data_2YIN
# 
_entry.id   2YIN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YIN         
PDBE  EBI-48298    
WWPDB D_1290048298 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2VRW unspecified 'CRITICAL STRUCTURAL ROLE FOR THE PH AND C1 DOMAINS OF THE VAV1 EXCHANGE FACTOR' 
PDB 1E96 unspecified 'STRUCTURE OF THE RAC/P67PHOX COMPLEX' 
PDB 1I4D unspecified 'CRYSTAL STRUCTURE ANALYSIS OF RAC1-GDP COMPLEXED WITHARFAPTIN (P21)' 
PDB 1FOE unspecified 'CRYSTAL STRUCTURE OF RAC1 IN COMPLEX WITH THE GUANINENUCLEOTIDE EXCHANGE REGION OF TIAM1' 
PDB 1MH1 unspecified 'SMALL G-PROTEIN' 
PDB 1I4L unspecified 'CRYSTAL STRUCTURE ANALYSIS OF RAC1-GDP IN COMPLEX WITHARFAPTIN (P41)' 
PDB 1HE1 unspecified 
'CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN THE GAP DOMAIN OF THE PSEUDOMONAS AERUGINOSA EXOS TOXIN AND HUMAN RAC' 
PDB 1RYF unspecified 'ALTERNATIVE SPLICING OF RAC1 GENERATES RAC1B, A SELF- ACTIVATING GTPASE' 
PDB 2WKQ unspecified 'STRUCTURE OF A PHOTOACTIVATABLE RAC1 CONTAINING THE LOV2 C450A MUTANT' 
PDB 1RYH unspecified 'ALTERNATIVE SPLICING OF RAC1 GENERATES RAC1B, A SELF- ACTIVATING GTPASE' 
PDB 1HH4 unspecified 'RAC1-RHOGDI COMPLEX INVOLVED IN NADPH OXIDASE ACTIVATION' 
PDB 2WKR unspecified 'STRUCTURE OF A PHOTOACTIVATABLE RAC1 CONTAINING THE LOV2 C450M MUTANT' 
PDB 2WKP unspecified 'STRUCTURE OF A PHOTOACTIVATABLE RAC1 CONTAINING LOV2 WILDTYPE' 
PDB 2FJU unspecified 'ACTIVATED RAC1 BOUND TO ITS EFFECTOR PHOSPHOLIPASE C BETA 2' 
PDB 1G4U unspecified 'CRYSTAL STRUCTURE OF THE SALMONELLA TYROSINE PHOSPHATASEAND GTPASE ACTIVATING PROTEIN SPTP BOUND TO RAC1' 
PDB 1I4T unspecified 'CRYSTAL STRUCTURE ANALYSIS OF RAC1-GMPPNP IN COMPLEX WITHARFAPTIN' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2YIN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kulkarni, K.A.' 1 
'Yang, J.'       2 
'Zhang, Z.'      3 
'Barford, D.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                25341 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21613211 
_citation.pdbx_database_id_DOI      10.1074/JBC.M111.236455 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kulkarni, K.' 1 ? 
primary 'Yang, J.'     2 ? 
primary 'Zhang, Z.'    3 ? 
primary 'Barford, D.'  4 ? 
# 
_cell.entry_id           2YIN 
_cell.length_a           68.510 
_cell.length_b           98.610 
_cell.length_c           130.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2YIN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DEDICATOR OF CYTOKINESIS PROTEIN 2'         51650.672 2  ? ? 'DHR2 DOMAIN, RESIDUES 1192-1622' 
'CIS PEPTIDE BETWEEN 1475 AND 1476 RESIDUES OF CHAIN A AND B.' 
2 polymer man 'RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1' 21861.152 2  ? ? 'RESIDUES 1-177'                  ? 
3 water   nat water                                        18.015    91 ? ? ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 DOCK2                                                                           
2 'RAC1, CELL MIGRATION-INDUCING GENE 5 PROTEIN, RAS-LIKE PROTEIN TC25, P21-RAC1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GECGDMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTG
QQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVG
YYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPV
PDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTAN
EKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKI
HEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
;
;GECGDMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTG
QQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVG
YYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPV
PDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTAN
EKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKI
HEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
;
A,B ? 
2 'polypeptide(L)' no no 
;MAHHHHHHSSGLEVLFQGTMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQ
EDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQ
GLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
;
;MAHHHHHHSSGLEVLFQGTMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQ
EDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQ
GLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLU n 
1 3   CYS n 
1 4   GLY n 
1 5   ASP n 
1 6   MET n 
1 7   THR n 
1 8   ASP n 
1 9   GLU n 
1 10  SER n 
1 11  LYS n 
1 12  ASP n 
1 13  ASN n 
1 14  ARG n 
1 15  MET n 
1 16  SER n 
1 17  CYS n 
1 18  THR n 
1 19  VAL n 
1 20  ASN n 
1 21  LEU n 
1 22  LEU n 
1 23  ASN n 
1 24  PHE n 
1 25  TYR n 
1 26  LYS n 
1 27  ASP n 
1 28  ASN n 
1 29  ASN n 
1 30  ARG n 
1 31  GLU n 
1 32  GLU n 
1 33  MET n 
1 34  TYR n 
1 35  ILE n 
1 36  ARG n 
1 37  TYR n 
1 38  LEU n 
1 39  TYR n 
1 40  LYS n 
1 41  LEU n 
1 42  ARG n 
1 43  ASP n 
1 44  LEU n 
1 45  HIS n 
1 46  LEU n 
1 47  ASP n 
1 48  CYS n 
1 49  ASP n 
1 50  ASN n 
1 51  TYR n 
1 52  THR n 
1 53  GLU n 
1 54  ALA n 
1 55  ALA n 
1 56  TYR n 
1 57  THR n 
1 58  LEU n 
1 59  LEU n 
1 60  LEU n 
1 61  HIS n 
1 62  THR n 
1 63  TRP n 
1 64  LEU n 
1 65  LEU n 
1 66  LYS n 
1 67  TRP n 
1 68  SER n 
1 69  ASP n 
1 70  GLU n 
1 71  GLN n 
1 72  CYS n 
1 73  ALA n 
1 74  SER n 
1 75  GLN n 
1 76  VAL n 
1 77  MET n 
1 78  GLN n 
1 79  THR n 
1 80  GLY n 
1 81  GLN n 
1 82  GLN n 
1 83  HIS n 
1 84  PRO n 
1 85  GLN n 
1 86  THR n 
1 87  HIS n 
1 88  ARG n 
1 89  GLN n 
1 90  LEU n 
1 91  LYS n 
1 92  GLU n 
1 93  THR n 
1 94  LEU n 
1 95  TYR n 
1 96  GLU n 
1 97  THR n 
1 98  ILE n 
1 99  ILE n 
1 100 GLY n 
1 101 TYR n 
1 102 PHE n 
1 103 ASP n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 MET n 
1 108 TRP n 
1 109 GLU n 
1 110 GLU n 
1 111 ALA n 
1 112 ILE n 
1 113 SER n 
1 114 LEU n 
1 115 CYS n 
1 116 LYS n 
1 117 GLU n 
1 118 LEU n 
1 119 ALA n 
1 120 GLU n 
1 121 GLN n 
1 122 TYR n 
1 123 GLU n 
1 124 MET n 
1 125 GLU n 
1 126 ILE n 
1 127 PHE n 
1 128 ASP n 
1 129 TYR n 
1 130 GLU n 
1 131 LEU n 
1 132 LEU n 
1 133 SER n 
1 134 GLN n 
1 135 ASN n 
1 136 LEU n 
1 137 ILE n 
1 138 GLN n 
1 139 GLN n 
1 140 ALA n 
1 141 LYS n 
1 142 PHE n 
1 143 TYR n 
1 144 GLU n 
1 145 SER n 
1 146 ILE n 
1 147 MET n 
1 148 LYS n 
1 149 ILE n 
1 150 LEU n 
1 151 ARG n 
1 152 PRO n 
1 153 LYS n 
1 154 PRO n 
1 155 ASP n 
1 156 TYR n 
1 157 PHE n 
1 158 ALA n 
1 159 VAL n 
1 160 GLY n 
1 161 TYR n 
1 162 TYR n 
1 163 GLY n 
1 164 GLN n 
1 165 GLY n 
1 166 PHE n 
1 167 PRO n 
1 168 SER n 
1 169 PHE n 
1 170 LEU n 
1 171 ARG n 
1 172 ASN n 
1 173 LYS n 
1 174 VAL n 
1 175 PHE n 
1 176 ILE n 
1 177 TYR n 
1 178 ARG n 
1 179 GLY n 
1 180 LYS n 
1 181 GLU n 
1 182 TYR n 
1 183 GLU n 
1 184 ARG n 
1 185 ARG n 
1 186 GLU n 
1 187 ASP n 
1 188 PHE n 
1 189 GLN n 
1 190 MET n 
1 191 GLN n 
1 192 LEU n 
1 193 MET n 
1 194 THR n 
1 195 GLN n 
1 196 PHE n 
1 197 PRO n 
1 198 ASN n 
1 199 ALA n 
1 200 GLU n 
1 201 LYS n 
1 202 MET n 
1 203 ASN n 
1 204 THR n 
1 205 THR n 
1 206 SER n 
1 207 ALA n 
1 208 PRO n 
1 209 GLY n 
1 210 ASP n 
1 211 ASP n 
1 212 VAL n 
1 213 LYS n 
1 214 ASN n 
1 215 ALA n 
1 216 PRO n 
1 217 GLY n 
1 218 GLN n 
1 219 TYR n 
1 220 ILE n 
1 221 GLN n 
1 222 CYS n 
1 223 PHE n 
1 224 THR n 
1 225 VAL n 
1 226 GLN n 
1 227 PRO n 
1 228 VAL n 
1 229 LEU n 
1 230 ASP n 
1 231 GLU n 
1 232 HIS n 
1 233 PRO n 
1 234 ARG n 
1 235 PHE n 
1 236 LYS n 
1 237 ASN n 
1 238 LYS n 
1 239 PRO n 
1 240 VAL n 
1 241 PRO n 
1 242 ASP n 
1 243 GLN n 
1 244 ILE n 
1 245 ILE n 
1 246 ASN n 
1 247 PHE n 
1 248 TYR n 
1 249 LYS n 
1 250 SER n 
1 251 ASN n 
1 252 TYR n 
1 253 VAL n 
1 254 GLN n 
1 255 ARG n 
1 256 PHE n 
1 257 HIS n 
1 258 TYR n 
1 259 SER n 
1 260 ARG n 
1 261 PRO n 
1 262 VAL n 
1 263 ARG n 
1 264 ARG n 
1 265 GLY n 
1 266 THR n 
1 267 VAL n 
1 268 ASP n 
1 269 PRO n 
1 270 GLU n 
1 271 ASN n 
1 272 GLU n 
1 273 PHE n 
1 274 ALA n 
1 275 SER n 
1 276 MET n 
1 277 TRP n 
1 278 ILE n 
1 279 GLU n 
1 280 ARG n 
1 281 THR n 
1 282 SER n 
1 283 PHE n 
1 284 VAL n 
1 285 THR n 
1 286 ALA n 
1 287 TYR n 
1 288 LYS n 
1 289 LEU n 
1 290 PRO n 
1 291 GLY n 
1 292 ILE n 
1 293 LEU n 
1 294 ARG n 
1 295 TRP n 
1 296 PHE n 
1 297 GLU n 
1 298 VAL n 
1 299 VAL n 
1 300 HIS n 
1 301 MET n 
1 302 SER n 
1 303 GLN n 
1 304 THR n 
1 305 THR n 
1 306 ILE n 
1 307 SER n 
1 308 PRO n 
1 309 LEU n 
1 310 GLU n 
1 311 ASN n 
1 312 ALA n 
1 313 ILE n 
1 314 GLU n 
1 315 THR n 
1 316 MET n 
1 317 SER n 
1 318 THR n 
1 319 ALA n 
1 320 ASN n 
1 321 GLU n 
1 322 LYS n 
1 323 ILE n 
1 324 LEU n 
1 325 MET n 
1 326 MET n 
1 327 ILE n 
1 328 ASN n 
1 329 GLN n 
1 330 TYR n 
1 331 GLN n 
1 332 SER n 
1 333 ASP n 
1 334 GLU n 
1 335 THR n 
1 336 LEU n 
1 337 PRO n 
1 338 ILE n 
1 339 ASN n 
1 340 PRO n 
1 341 LEU n 
1 342 SER n 
1 343 MET n 
1 344 LEU n 
1 345 LEU n 
1 346 ASN n 
1 347 GLY n 
1 348 ILE n 
1 349 VAL n 
1 350 ASP n 
1 351 PRO n 
1 352 ALA n 
1 353 VAL n 
1 354 MET n 
1 355 GLY n 
1 356 GLY n 
1 357 PHE n 
1 358 ALA n 
1 359 LYS n 
1 360 TYR n 
1 361 GLU n 
1 362 LYS n 
1 363 ALA n 
1 364 PHE n 
1 365 PHE n 
1 366 THR n 
1 367 GLU n 
1 368 GLU n 
1 369 TYR n 
1 370 VAL n 
1 371 ARG n 
1 372 ASP n 
1 373 HIS n 
1 374 PRO n 
1 375 GLU n 
1 376 ASP n 
1 377 GLN n 
1 378 ASP n 
1 379 LYS n 
1 380 LEU n 
1 381 THR n 
1 382 HIS n 
1 383 LEU n 
1 384 LYS n 
1 385 ASP n 
1 386 LEU n 
1 387 ILE n 
1 388 ALA n 
1 389 TRP n 
1 390 GLN n 
1 391 ILE n 
1 392 PRO n 
1 393 PHE n 
1 394 LEU n 
1 395 GLY n 
1 396 ALA n 
1 397 GLY n 
1 398 ILE n 
1 399 LYS n 
1 400 ILE n 
1 401 HIS n 
1 402 GLU n 
1 403 LYS n 
1 404 ARG n 
1 405 VAL n 
1 406 SER n 
1 407 ASP n 
1 408 ASN n 
1 409 LEU n 
1 410 ARG n 
1 411 PRO n 
1 412 PHE n 
1 413 HIS n 
1 414 ASP n 
1 415 ARG n 
1 416 MET n 
1 417 GLU n 
1 418 GLU n 
1 419 CYS n 
1 420 PHE n 
1 421 LYS n 
1 422 ASN n 
1 423 LEU n 
1 424 LYS n 
1 425 MET n 
1 426 LYS n 
1 427 VAL n 
1 428 GLU n 
1 429 LYS n 
1 430 GLU n 
1 431 TYR n 
1 432 GLY n 
1 433 VAL n 
1 434 ARG n 
1 435 GLU n 
1 436 MET n 
2 1   MET n 
2 2   ALA n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   SER n 
2 10  SER n 
2 11  GLY n 
2 12  LEU n 
2 13  GLU n 
2 14  VAL n 
2 15  LEU n 
2 16  PHE n 
2 17  GLN n 
2 18  GLY n 
2 19  THR n 
2 20  MET n 
2 21  GLN n 
2 22  ALA n 
2 23  ILE n 
2 24  LYS n 
2 25  CYS n 
2 26  VAL n 
2 27  VAL n 
2 28  VAL n 
2 29  GLY n 
2 30  ASP n 
2 31  GLY n 
2 32  ALA n 
2 33  VAL n 
2 34  GLY n 
2 35  LYS n 
2 36  THR n 
2 37  CYS n 
2 38  LEU n 
2 39  LEU n 
2 40  ILE n 
2 41  SER n 
2 42  TYR n 
2 43  THR n 
2 44  THR n 
2 45  ASN n 
2 46  ALA n 
2 47  PHE n 
2 48  PRO n 
2 49  GLY n 
2 50  GLU n 
2 51  TYR n 
2 52  ILE n 
2 53  PRO n 
2 54  THR n 
2 55  VAL n 
2 56  PHE n 
2 57  ASP n 
2 58  ASN n 
2 59  TYR n 
2 60  SER n 
2 61  ALA n 
2 62  ASN n 
2 63  VAL n 
2 64  MET n 
2 65  VAL n 
2 66  ASP n 
2 67  GLY n 
2 68  LYS n 
2 69  PRO n 
2 70  VAL n 
2 71  ASN n 
2 72  LEU n 
2 73  GLY n 
2 74  LEU n 
2 75  TRP n 
2 76  ASP n 
2 77  THR n 
2 78  ALA n 
2 79  GLY n 
2 80  GLN n 
2 81  GLU n 
2 82  ASP n 
2 83  TYR n 
2 84  ASP n 
2 85  ARG n 
2 86  LEU n 
2 87  ARG n 
2 88  PRO n 
2 89  LEU n 
2 90  SER n 
2 91  TYR n 
2 92  PRO n 
2 93  GLN n 
2 94  THR n 
2 95  ASP n 
2 96  VAL n 
2 97  PHE n 
2 98  LEU n 
2 99  ILE n 
2 100 CYS n 
2 101 PHE n 
2 102 SER n 
2 103 LEU n 
2 104 VAL n 
2 105 SER n 
2 106 PRO n 
2 107 ALA n 
2 108 SER n 
2 109 PHE n 
2 110 GLU n 
2 111 ASN n 
2 112 VAL n 
2 113 ARG n 
2 114 ALA n 
2 115 LYS n 
2 116 TRP n 
2 117 TYR n 
2 118 PRO n 
2 119 GLU n 
2 120 VAL n 
2 121 ARG n 
2 122 HIS n 
2 123 HIS n 
2 124 CYS n 
2 125 PRO n 
2 126 ASN n 
2 127 THR n 
2 128 PRO n 
2 129 ILE n 
2 130 ILE n 
2 131 LEU n 
2 132 VAL n 
2 133 GLY n 
2 134 THR n 
2 135 LYS n 
2 136 LEU n 
2 137 ASP n 
2 138 LEU n 
2 139 ARG n 
2 140 ASP n 
2 141 ASP n 
2 142 LYS n 
2 143 ASP n 
2 144 THR n 
2 145 ILE n 
2 146 GLU n 
2 147 LYS n 
2 148 LEU n 
2 149 LYS n 
2 150 GLU n 
2 151 LYS n 
2 152 LYS n 
2 153 LEU n 
2 154 THR n 
2 155 PRO n 
2 156 ILE n 
2 157 THR n 
2 158 TYR n 
2 159 PRO n 
2 160 GLN n 
2 161 GLY n 
2 162 LEU n 
2 163 ALA n 
2 164 MET n 
2 165 ALA n 
2 166 LYS n 
2 167 GLU n 
2 168 ILE n 
2 169 GLY n 
2 170 ALA n 
2 171 VAL n 
2 172 LYS n 
2 173 TYR n 
2 174 LEU n 
2 175 GLU n 
2 176 CYS n 
2 177 SER n 
2 178 ALA n 
2 179 LEU n 
2 180 THR n 
2 181 GLN n 
2 182 ARG n 
2 183 GLY n 
2 184 LEU n 
2 185 LYS n 
2 186 THR n 
2 187 VAL n 
2 188 PHE n 
2 189 ASP n 
2 190 GLU n 
2 191 ALA n 
2 192 ILE n 
2 193 ARG n 
2 194 ALA n 
2 195 VAL n 
2 196 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? B834 ? ? ? ? ? ? ? ? 
? ? ? POPIN ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? B834 ? ? ? ? ? ? ? ? 
? ? ? POPIN ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DOCK2_HUMAN 1 ? ? Q92608 ? 
2 UNP RAC1_HUMAN  2 ? ? P63000 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2YIN A 6  ? 436 ? Q92608 1192 ? 1622 ? 1192 1622 
2 1 2YIN B 6  ? 436 ? Q92608 1192 ? 1622 ? 1192 1622 
3 2 2YIN C 20 ? 196 ? P63000 1    ? 177  ? 1    177  
4 2 2YIN D 20 ? 196 ? P63000 1    ? 177  ? 1    177  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YIN GLY A 1  ? UNP Q92608 ? ? 'expression tag' 1187 1  
1 2YIN GLU A 2  ? UNP Q92608 ? ? 'expression tag' 1188 2  
1 2YIN CYS A 3  ? UNP Q92608 ? ? 'expression tag' 1189 3  
1 2YIN GLY A 4  ? UNP Q92608 ? ? 'expression tag' 1190 4  
1 2YIN ASP A 5  ? UNP Q92608 ? ? 'expression tag' 1191 5  
2 2YIN GLY B 1  ? UNP Q92608 ? ? 'expression tag' 1187 6  
2 2YIN GLU B 2  ? UNP Q92608 ? ? 'expression tag' 1188 7  
2 2YIN CYS B 3  ? UNP Q92608 ? ? 'expression tag' 1189 8  
2 2YIN GLY B 4  ? UNP Q92608 ? ? 'expression tag' 1190 9  
2 2YIN ASP B 5  ? UNP Q92608 ? ? 'expression tag' 1191 10 
3 2YIN MET C 1  ? UNP P63000 ? ? 'expression tag' -18  11 
3 2YIN ALA C 2  ? UNP P63000 ? ? 'expression tag' -17  12 
3 2YIN HIS C 3  ? UNP P63000 ? ? 'expression tag' -16  13 
3 2YIN HIS C 4  ? UNP P63000 ? ? 'expression tag' -15  14 
3 2YIN HIS C 5  ? UNP P63000 ? ? 'expression tag' -14  15 
3 2YIN HIS C 6  ? UNP P63000 ? ? 'expression tag' -13  16 
3 2YIN HIS C 7  ? UNP P63000 ? ? 'expression tag' -12  17 
3 2YIN HIS C 8  ? UNP P63000 ? ? 'expression tag' -11  18 
3 2YIN SER C 9  ? UNP P63000 ? ? 'expression tag' -10  19 
3 2YIN SER C 10 ? UNP P63000 ? ? 'expression tag' -9   20 
3 2YIN GLY C 11 ? UNP P63000 ? ? 'expression tag' -8   21 
3 2YIN LEU C 12 ? UNP P63000 ? ? 'expression tag' -7   22 
3 2YIN GLU C 13 ? UNP P63000 ? ? 'expression tag' -6   23 
3 2YIN VAL C 14 ? UNP P63000 ? ? 'expression tag' -5   24 
3 2YIN LEU C 15 ? UNP P63000 ? ? 'expression tag' -4   25 
3 2YIN PHE C 16 ? UNP P63000 ? ? 'expression tag' -3   26 
3 2YIN GLN C 17 ? UNP P63000 ? ? 'expression tag' -2   27 
3 2YIN GLY C 18 ? UNP P63000 ? ? 'expression tag' -1   28 
3 2YIN THR C 19 ? UNP P63000 ? ? 'expression tag' 0    29 
4 2YIN MET D 1  ? UNP P63000 ? ? 'expression tag' -18  30 
4 2YIN ALA D 2  ? UNP P63000 ? ? 'expression tag' -17  31 
4 2YIN HIS D 3  ? UNP P63000 ? ? 'expression tag' -16  32 
4 2YIN HIS D 4  ? UNP P63000 ? ? 'expression tag' -15  33 
4 2YIN HIS D 5  ? UNP P63000 ? ? 'expression tag' -14  34 
4 2YIN HIS D 6  ? UNP P63000 ? ? 'expression tag' -13  35 
4 2YIN HIS D 7  ? UNP P63000 ? ? 'expression tag' -12  36 
4 2YIN HIS D 8  ? UNP P63000 ? ? 'expression tag' -11  37 
4 2YIN SER D 9  ? UNP P63000 ? ? 'expression tag' -10  38 
4 2YIN SER D 10 ? UNP P63000 ? ? 'expression tag' -9   39 
4 2YIN GLY D 11 ? UNP P63000 ? ? 'expression tag' -8   40 
4 2YIN LEU D 12 ? UNP P63000 ? ? 'expression tag' -7   41 
4 2YIN GLU D 13 ? UNP P63000 ? ? 'expression tag' -6   42 
4 2YIN VAL D 14 ? UNP P63000 ? ? 'expression tag' -5   43 
4 2YIN LEU D 15 ? UNP P63000 ? ? 'expression tag' -4   44 
4 2YIN PHE D 16 ? UNP P63000 ? ? 'expression tag' -3   45 
4 2YIN GLN D 17 ? UNP P63000 ? ? 'expression tag' -2   46 
4 2YIN GLY D 18 ? UNP P63000 ? ? 'expression tag' -1   47 
4 2YIN THR D 19 ? UNP P63000 ? ? 'expression tag' 0    48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2YIN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.51 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES PH 6.5, 12% (W/V) PEG 3350, 10% (V/V) GLYCEROL AND 150 MM NACL. AT 20 C' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2010-01-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.90000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2YIN 
_reflns.observed_criterion_sigma_I   1.4 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             78.18 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   43702 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.70 
_reflns.B_iso_Wilson_estimate        63.41 
_reflns.pdbx_redundancy              2.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   90.1 
_reflns_shell.Rmerge_I_obs           0.61 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.50 
_reflns_shell.pdbx_redundancy        2.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2YIN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     43654 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             64.374 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    92.71 
_refine.ls_R_factor_obs                          0.2059 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2033 
_refine.ls_R_factor_R_free                       0.2548 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2217 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               68.9 
_refine.aniso_B[1][1]                            9.1660 
_refine.aniso_B[2][2]                            7.2882 
_refine.aniso_B[3][3]                            -16.4542 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            2.1660 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 54.961 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.72 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 1257-1270 ARE DISORDERED.' 
_refine.pdbx_starting_model                      'CHAIN A OF PDB ENTRY 1GAF AND CHAIN A OF PDB ENTRY 1MH1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.47 
_refine.pdbx_overall_phase_error                 28.86 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9525 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               9616 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        64.374 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 9762  'X-RAY DIFFRACTION' ? 
f_angle_d          1.439  ? ? 13247 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.101 ? ? 3604  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.101  ? ? 1441  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.010  ? ? 1709  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 3314 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 3314 0.567 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 C 1378 ?     ? POSITIONAL 2 3 'X-RAY DIFFRACTION' ? ? ? 
2 D 1378 0.405 ? POSITIONAL 2 4 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7000 2.7587  2481 0.3623 88.00 0.4495 . . 131 . . 
'X-RAY DIFFRACTION' . 2.7587 2.8229  2474 0.3475 91.00 0.4470 . . 152 . . 
'X-RAY DIFFRACTION' . 2.8229 2.8935  2516 0.3200 91.00 0.4022 . . 150 . . 
'X-RAY DIFFRACTION' . 2.8935 2.9717  2578 0.2838 92.00 0.3424 . . 145 . . 
'X-RAY DIFFRACTION' . 2.9717 3.0592  2573 0.2713 93.00 0.3166 . . 128 . . 
'X-RAY DIFFRACTION' . 3.0592 3.1579  2640 0.2612 94.00 0.3250 . . 126 . . 
'X-RAY DIFFRACTION' . 3.1579 3.2708  2625 0.2387 94.00 0.3208 . . 128 . . 
'X-RAY DIFFRACTION' . 3.2708 3.4017  2641 0.2175 95.00 0.2801 . . 141 . . 
'X-RAY DIFFRACTION' . 3.4017 3.5565  2619 0.2023 95.00 0.2706 . . 136 . . 
'X-RAY DIFFRACTION' . 3.5565 3.7440  2627 0.1938 94.00 0.2448 . . 141 . . 
'X-RAY DIFFRACTION' . 3.7440 3.9785  2607 0.1812 94.00 0.2314 . . 149 . . 
'X-RAY DIFFRACTION' . 3.9785 4.2857  2654 0.1669 94.00 0.2230 . . 135 . . 
'X-RAY DIFFRACTION' . 4.2857 4.7168  2585 0.1519 94.00 0.2047 . . 142 . . 
'X-RAY DIFFRACTION' . 4.7168 5.3991  2607 0.1678 93.00 0.2130 . . 146 . . 
'X-RAY DIFFRACTION' . 5.3991 6.8011  2601 0.2201 91.00 0.2942 . . 115 . . 
'X-RAY DIFFRACTION' . 6.8011 64.3927 2609 0.1807 91.00 0.1872 . . 152 . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN A AND (RESSEQ 1197:1256 OR RESSEQ 1271:1450 OR RESSEQ 1452:1620 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN B AND (RESSEQ 1197:1256 OR RESSEQ 1271:1450 OR RESSEQ 1452:1620 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN C AND (RESSEQ 1:177 )'                                             
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN D AND (RESSEQ 1:177 )'                                             
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2YIN 
_struct.title                     'STRUCTURE OF THE COMPLEX BETWEEN Dock2 AND Rac1.' 
_struct.pdbx_descriptor           'DEDICATOR OF CYTOKINESIS PROTEIN 2, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YIN 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'APOPTOSIS, DOCK, DOCK GUANINE NUCLEOTIDE EXCHANGE FACTORS, RHO GTPASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 10  ? ASN A 29  ? SER A 1196 ASN A 1215 1 ? 20 
HELX_P HELX_P2  2  ARG A 30  ? CYS A 48  ? ARG A 1216 CYS A 1234 1 ? 19 
HELX_P HELX_P3  3  ASN A 50  ? TRP A 63  ? ASN A 1236 TRP A 1249 1 ? 14 
HELX_P HELX_P4  4  THR A 86  ? LYS A 106 ? THR A 1272 LYS A 1292 1 ? 21 
HELX_P HELX_P5  5  MET A 107 ? GLU A 125 ? MET A 1293 GLU A 1311 1 ? 19 
HELX_P HELX_P6  6  ASP A 128 ? ILE A 149 ? ASP A 1314 ILE A 1335 1 ? 22 
HELX_P HELX_P7  7  ARG A 184 ? PHE A 196 ? ARG A 1370 PHE A 1382 1 ? 13 
HELX_P HELX_P8  8  GLY A 209 ? ALA A 215 ? GLY A 1395 ALA A 1401 1 ? 7  
HELX_P HELX_P9  9  HIS A 232 ? LYS A 236 ? HIS A 1418 LYS A 1422 5 ? 5  
HELX_P HELX_P10 10 PRO A 241 ? ASN A 251 ? PRO A 1427 ASN A 1437 1 ? 11 
HELX_P HELX_P11 11 ASN A 271 ? SER A 275 ? ASN A 1457 SER A 1461 1 ? 5  
HELX_P HELX_P12 12 SER A 307 ? ASP A 333 ? SER A 1493 ASP A 1519 1 ? 27 
HELX_P HELX_P13 13 ILE A 338 ? ASP A 350 ? ILE A 1524 ASP A 1536 1 ? 13 
HELX_P HELX_P14 14 PHE A 357 ? PHE A 365 ? PHE A 1543 PHE A 1551 1 ? 9  
HELX_P HELX_P15 15 THR A 366 ? HIS A 373 ? THR A 1552 HIS A 1559 1 ? 8  
HELX_P HELX_P16 16 ASP A 376 ? ARG A 404 ? ASP A 1562 ARG A 1590 1 ? 29 
HELX_P HELX_P17 17 SER A 406 ? ASN A 408 ? SER A 1592 ASN A 1594 5 ? 3  
HELX_P HELX_P18 18 LEU A 409 ? GLY A 432 ? LEU A 1595 GLY A 1618 1 ? 24 
HELX_P HELX_P19 19 LYS B 11  ? ASN B 28  ? LYS B 1197 ASN B 1214 1 ? 18 
HELX_P HELX_P20 20 ARG B 30  ? ASP B 49  ? ARG B 1216 ASP B 1235 1 ? 20 
HELX_P HELX_P21 21 ASN B 50  ? TRP B 63  ? ASN B 1236 TRP B 1249 1 ? 14 
HELX_P HELX_P22 22 THR B 86  ? LYS B 106 ? THR B 1272 LYS B 1292 1 ? 21 
HELX_P HELX_P23 23 MET B 107 ? GLU B 125 ? MET B 1293 GLU B 1311 1 ? 19 
HELX_P HELX_P24 24 ASP B 128 ? ILE B 149 ? ASP B 1314 ILE B 1335 1 ? 22 
HELX_P HELX_P25 25 ARG B 184 ? PHE B 196 ? ARG B 1370 PHE B 1382 1 ? 13 
HELX_P HELX_P26 26 GLY B 209 ? ASN B 214 ? GLY B 1395 ASN B 1400 1 ? 6  
HELX_P HELX_P27 27 PRO B 241 ? SER B 250 ? PRO B 1427 SER B 1436 1 ? 10 
HELX_P HELX_P28 28 ASN B 271 ? ALA B 274 ? ASN B 1457 ALA B 1460 5 ? 4  
HELX_P HELX_P29 29 SER B 307 ? ASP B 333 ? SER B 1493 ASP B 1519 1 ? 27 
HELX_P HELX_P30 30 ILE B 338 ? ASP B 350 ? ILE B 1524 ASP B 1536 1 ? 13 
HELX_P HELX_P31 31 PHE B 357 ? PHE B 365 ? PHE B 1543 PHE B 1551 1 ? 9  
HELX_P HELX_P32 32 THR B 366 ? HIS B 373 ? THR B 1552 HIS B 1559 1 ? 8  
HELX_P HELX_P33 33 ASP B 376 ? ARG B 404 ? ASP B 1562 ARG B 1590 1 ? 29 
HELX_P HELX_P34 34 SER B 406 ? ASN B 408 ? SER B 1592 ASN B 1594 5 ? 3  
HELX_P HELX_P35 35 LEU B 409 ? TYR B 431 ? LEU B 1595 TYR B 1617 1 ? 23 
HELX_P HELX_P36 36 ASP C 30  ? GLY C 34  ? ASP C 11   GLY C 15   5 ? 5  
HELX_P HELX_P37 37 LYS C 35  ? THR C 44  ? LYS C 16   THR C 25   1 ? 10 
HELX_P HELX_P38 38 GLU C 81  ? ARG C 85  ? GLU C 62   ARG C 66   5 ? 5  
HELX_P HELX_P39 39 LEU C 86  ? TYR C 91  ? LEU C 67   TYR C 72   5 ? 6  
HELX_P HELX_P40 40 SER C 105 ? LYS C 115 ? SER C 86   LYS C 96   1 ? 11 
HELX_P HELX_P41 41 LYS C 115 ? CYS C 124 ? LYS C 96   CYS C 105  1 ? 10 
HELX_P HELX_P42 42 ASP C 141 ? LYS C 151 ? ASP C 122  LYS C 132  1 ? 11 
HELX_P HELX_P43 43 THR C 157 ? GLY C 169 ? THR C 138  GLY C 150  1 ? 13 
HELX_P HELX_P44 44 GLY C 183 ? ALA C 194 ? GLY C 164  ALA C 175  1 ? 12 
HELX_P HELX_P45 45 ASP D 30  ? VAL D 33  ? ASP D 11   VAL D 14   5 ? 4  
HELX_P HELX_P46 46 GLY D 34  ? THR D 44  ? GLY D 15   THR D 25   1 ? 11 
HELX_P HELX_P47 47 GLN D 80  ? ARG D 85  ? GLN D 61   ARG D 66   5 ? 6  
HELX_P HELX_P48 48 LEU D 86  ? TYR D 91  ? LEU D 67   TYR D 72   5 ? 6  
HELX_P HELX_P49 49 SER D 105 ? LYS D 115 ? SER D 86   LYS D 96   1 ? 11 
HELX_P HELX_P50 50 LYS D 115 ? CYS D 124 ? LYS D 96   CYS D 105  1 ? 10 
HELX_P HELX_P51 51 ASP D 137 ? ASP D 140 ? ASP D 118  ASP D 121  5 ? 4  
HELX_P HELX_P52 52 ASP D 141 ? LYS D 151 ? ASP D 122  LYS D 132  1 ? 11 
HELX_P HELX_P53 53 THR D 157 ? GLY D 169 ? THR D 138  GLY D 150  1 ? 13 
HELX_P HELX_P54 54 GLY D 183 ? LEU D 196 ? GLY D 164  LEU D 177  1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 289 A . ? LEU 1475 A PRO 290 A ? PRO 1476 A 1 3.74 
2 LEU 289 B . ? LEU 1475 B PRO 290 B ? PRO 1476 B 1 7.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
BA ? 8 ? 
CA ? 6 ? 
DA ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? parallel      
CA 5 6 ? parallel      
DA 1 2 ? anti-parallel 
DA 2 3 ? parallel      
DA 3 4 ? parallel      
DA 4 5 ? parallel      
DA 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 156 ? TYR A 162 ? TYR A 1342 TYR A 1348 
AA 2 TYR A 219 ? VAL A 228 ? TYR A 1405 VAL A 1414 
AA 3 VAL A 253 ? ARG A 263 ? VAL A 1439 ARG A 1449 
AA 4 MET A 276 ? LEU A 289 ? MET A 1462 LEU A 1475 
AA 5 TRP A 295 ? ILE A 306 ? TRP A 1481 ILE A 1492 
AA 6 LYS A 173 ? ARG A 178 ? LYS A 1359 ARG A 1364 
AA 7 TYR A 156 ? TYR A 162 ? TYR A 1342 TYR A 1348 
BA 1 TYR B 156 ? TYR B 161 ? TYR B 1342 TYR B 1347 
BA 2 TYR B 219 ? PRO B 227 ? TYR B 1405 PRO B 1413 
BA 3 VAL B 253 ? ARG B 263 ? VAL B 1439 ARG B 1449 
BA 4 MET B 276 ? LEU B 289 ? MET B 1462 LEU B 1475 
BA 5 TRP B 295 ? ILE B 306 ? TRP B 1481 ILE B 1492 
BA 6 LYS B 173 ? ARG B 178 ? LYS B 1359 ARG B 1364 
BA 7 TYR B 156 ? TYR B 161 ? TYR B 1342 TYR B 1347 
CA 1 TYR C 59  ? VAL C 65  ? TYR C 40   VAL C 46   
CA 2 LYS C 68  ? ASP C 76  ? LYS C 49   ASP C 57   
CA 3 GLN C 21  ? VAL C 28  ? GLN C 2    VAL C 9    
CA 4 VAL C 96  ? SER C 102 ? VAL C 77   SER C 83   
CA 5 ILE C 129 ? THR C 134 ? ILE C 110  THR C 115  
CA 6 LYS C 172 ? GLU C 175 ? LYS C 153  GLU C 156  
DA 1 TYR D 59  ? VAL D 65  ? TYR D 40   VAL D 46   
DA 2 LYS D 68  ? ASP D 76  ? LYS D 49   ASP D 57   
DA 3 GLN D 21  ? VAL D 28  ? GLN D 2    VAL D 9    
DA 4 VAL D 96  ? SER D 102 ? VAL D 77   SER D 83   
DA 5 ILE D 129 ? THR D 134 ? ILE D 110  THR D 115  
DA 6 LYS D 172 ? GLU D 175 ? LYS D 153  GLU D 156  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 162 ? N TYR A 1348 O TYR A 219 ? O TYR A 1405 
AA 2 3 N VAL A 228 ? N VAL A 1414 O ARG A 255 ? O ARG A 1441 
AA 3 4 N VAL A 262 ? N VAL A 1448 O TRP A 277 ? O TRP A 1463 
AA 4 5 N ALA A 286 ? N ALA A 1472 O GLU A 297 ? O GLU A 1483 
AA 5 6 N VAL A 298 ? N VAL A 1484 O VAL A 174 ? O VAL A 1360 
BA 1 2 N GLY B 160 ? N GLY B 1346 O GLN B 221 ? O GLN B 1407 
BA 2 3 N GLN B 226 ? N GLN B 1412 O HIS B 257 ? O HIS B 1443 
BA 3 4 N VAL B 262 ? N VAL B 1448 O TRP B 277 ? O TRP B 1463 
BA 4 5 N ALA B 286 ? N ALA B 1472 O GLU B 297 ? O GLU B 1483 
BA 5 6 N VAL B 298 ? N VAL B 1484 O VAL B 174 ? O VAL B 1360 
CA 1 2 N VAL C 65  ? N VAL C 46   O LYS C 68  ? O LYS C 49   
CA 2 3 N ASN C 71  ? N ASN C 52   O GLN C 21  ? O GLN C 2    
CA 3 4 N VAL C 26  ? N VAL C 7    O VAL C 96  ? O VAL C 77   
CA 4 5 N ILE C 99  ? N ILE C 80   O ILE C 130 ? O ILE C 111  
CA 5 6 N LEU C 131 ? N LEU C 112  O LYS C 172 ? O LYS C 153  
DA 1 2 N VAL D 65  ? N VAL D 46   O LYS D 68  ? O LYS D 49   
DA 2 3 N ASN D 71  ? N ASN D 52   O GLN D 21  ? O GLN D 2    
DA 3 4 N VAL D 26  ? N VAL D 7    O VAL D 96  ? O VAL D 77   
DA 4 5 N ILE D 99  ? N ILE D 80   O ILE D 130 ? O ILE D 111  
DA 5 6 N LEU D 131 ? N LEU D 112  O LYS D 172 ? O LYS D 153  
# 
_database_PDB_matrix.entry_id          2YIN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2YIN 
_atom_sites.fract_transf_matrix[1][1]   0.014596 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002479 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010141 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007795 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 10  ? 10.675  62.138 162.384 1.00 68.15  ? 1196 SER A N   1 
ATOM   2    C CA  . SER A 1 10  ? 11.176  62.411 163.763 1.00 79.77  ? 1196 SER A CA  1 
ATOM   3    C C   . SER A 1 10  ? 10.216  61.840 164.817 1.00 90.54  ? 1196 SER A C   1 
ATOM   4    O O   . SER A 1 10  ? 10.653  61.499 165.917 1.00 102.86 ? 1196 SER A O   1 
ATOM   5    C CB  . SER A 1 10  ? 11.468  63.905 163.982 1.00 74.42  ? 1196 SER A CB  1 
ATOM   6    O OG  . SER A 1 10  ? 10.300  64.594 164.407 1.00 92.56  ? 1196 SER A OG  1 
ATOM   7    N N   . LYS A 1 11  ? 8.926   61.723 164.477 1.00 90.23  ? 1197 LYS A N   1 
ATOM   8    C CA  . LYS A 1 11  ? 8.008   60.819 165.193 1.00 97.16  ? 1197 LYS A CA  1 
ATOM   9    C C   . LYS A 1 11  ? 8.751   59.515 165.468 1.00 101.50 ? 1197 LYS A C   1 
ATOM   10   O O   . LYS A 1 11  ? 8.946   59.113 166.621 1.00 87.47  ? 1197 LYS A O   1 
ATOM   11   C CB  . LYS A 1 11  ? 6.748   60.530 164.353 1.00 98.44  ? 1197 LYS A CB  1 
ATOM   12   C CG  . LYS A 1 11  ? 5.936   59.258 164.766 1.00 147.38 ? 1197 LYS A CG  1 
ATOM   13   C CD  . LYS A 1 11  ? 5.293   58.531 163.545 1.00 91.27  ? 1197 LYS A CD  1 
ATOM   14   C CE  . LYS A 1 11  ? 4.199   57.495 163.924 1.00 86.35  ? 1197 LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 11  ? 4.693   56.139 164.368 1.00 74.76  ? 1197 LYS A NZ  1 
ATOM   16   N N   . ASP A 1 12  ? 9.194   58.881 164.388 1.00 102.60 ? 1198 ASP A N   1 
ATOM   17   C CA  . ASP A 1 12  ? 9.974   57.657 164.477 1.00 98.66  ? 1198 ASP A CA  1 
ATOM   18   C C   . ASP A 1 12  ? 11.328  57.863 165.152 1.00 87.94  ? 1198 ASP A C   1 
ATOM   19   O O   . ASP A 1 12  ? 11.811  56.992 165.851 1.00 84.13  ? 1198 ASP A O   1 
ATOM   20   C CB  . ASP A 1 12  ? 10.133  57.019 163.088 1.00 96.99  ? 1198 ASP A CB  1 
ATOM   21   C CG  . ASP A 1 12  ? 8.817   56.425 162.551 1.00 102.40 ? 1198 ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 12  ? 7.726   56.769 163.069 1.00 102.28 ? 1198 ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 12  ? 8.881   55.604 161.606 1.00 97.53  ? 1198 ASP A OD2 1 
ATOM   24   N N   . ASN A 1 13  ? 11.932  59.021 164.956 1.00 85.86  ? 1199 ASN A N   1 
ATOM   25   C CA  . ASN A 1 13  ? 13.217  59.274 165.572 1.00 85.16  ? 1199 ASN A CA  1 
ATOM   26   C C   . ASN A 1 13  ? 13.178  59.274 167.093 1.00 84.51  ? 1199 ASN A C   1 
ATOM   27   O O   . ASN A 1 13  ? 14.034  58.648 167.734 1.00 90.63  ? 1199 ASN A O   1 
ATOM   28   C CB  . ASN A 1 13  ? 13.827  60.572 165.047 1.00 89.94  ? 1199 ASN A CB  1 
ATOM   29   C CG  . ASN A 1 13  ? 14.721  60.348 163.828 1.00 108.67 ? 1199 ASN A CG  1 
ATOM   30   O OD1 . ASN A 1 13  ? 15.363  59.291 163.686 1.00 103.79 ? 1199 ASN A OD1 1 
ATOM   31   N ND2 . ASN A 1 13  ? 14.791  61.357 162.956 1.00 110.03 ? 1199 ASN A ND2 1 
ATOM   32   N N   . ARG A 1 14  ? 12.184  59.951 167.665 1.00 63.24  ? 1200 ARG A N   1 
ATOM   33   C CA  . ARG A 1 14  ? 12.126  60.133 169.105 1.00 55.82  ? 1200 ARG A CA  1 
ATOM   34   C C   . ARG A 1 14  ? 11.942  58.796 169.753 1.00 72.39  ? 1200 ARG A C   1 
ATOM   35   O O   . ARG A 1 14  ? 12.415  58.560 170.858 1.00 80.65  ? 1200 ARG A O   1 
ATOM   36   C CB  . ARG A 1 14  ? 10.994  61.064 169.496 1.00 60.53  ? 1200 ARG A CB  1 
ATOM   37   C CG  . ARG A 1 14  ? 11.289  62.548 169.281 1.00 62.12  ? 1200 ARG A CG  1 
ATOM   38   C CD  . ARG A 1 14  ? 9.998   63.409 169.222 1.00 104.44 ? 1200 ARG A CD  1 
ATOM   39   N NE  . ARG A 1 14  ? 9.422   63.709 170.545 1.00 108.35 ? 1200 ARG A NE  1 
ATOM   40   C CZ  . ARG A 1 14  ? 8.392   64.539 170.770 1.00 118.09 ? 1200 ARG A CZ  1 
ATOM   41   N NH1 . ARG A 1 14  ? 7.808   65.186 169.765 1.00 130.53 ? 1200 ARG A NH1 1 
ATOM   42   N NH2 . ARG A 1 14  ? 7.940   64.734 172.012 1.00 108.55 ? 1200 ARG A NH2 1 
ATOM   43   N N   . MET A 1 15  ? 11.295  57.897 169.029 1.00 62.19  ? 1201 MET A N   1 
ATOM   44   C CA  . MET A 1 15  ? 11.040  56.561 169.526 1.00 63.90  ? 1201 MET A CA  1 
ATOM   45   C C   . MET A 1 15  ? 12.254  55.653 169.507 1.00 66.92  ? 1201 MET A C   1 
ATOM   46   O O   . MET A 1 15  ? 12.573  55.021 170.501 1.00 75.83  ? 1201 MET A O   1 
ATOM   47   C CB  . MET A 1 15  ? 9.892   55.941 168.760 1.00 63.93  ? 1201 MET A CB  1 
ATOM   48   C CG  . MET A 1 15  ? 8.559   56.512 169.183 1.00 71.91  ? 1201 MET A CG  1 
ATOM   49   S SD  . MET A 1 15  ? 7.216   56.036 168.067 1.00 69.49  ? 1201 MET A SD  1 
ATOM   50   C CE  . MET A 1 15  ? 5.805   56.823 168.796 1.00 58.81  ? 1201 MET A CE  1 
ATOM   51   N N   . SER A 1 16  ? 12.930  55.599 168.377 1.00 52.99  ? 1202 SER A N   1 
ATOM   52   C CA  . SER A 1 16  ? 14.049  54.719 168.215 1.00 53.09  ? 1202 SER A CA  1 
ATOM   53   C C   . SER A 1 16  ? 15.054  55.106 169.257 1.00 62.90  ? 1202 SER A C   1 
ATOM   54   O O   . SER A 1 16  ? 15.689  54.248 169.882 1.00 62.83  ? 1202 SER A O   1 
ATOM   55   C CB  . SER A 1 16  ? 14.643  54.896 166.818 1.00 71.61  ? 1202 SER A CB  1 
ATOM   56   O OG  . SER A 1 16  ? 13.711  54.559 165.792 1.00 91.67  ? 1202 SER A OG  1 
ATOM   57   N N   . CYS A 1 17  ? 15.145  56.422 169.438 1.00 50.80  ? 1203 CYS A N   1 
ATOM   58   C CA  . CYS A 1 17  ? 16.047  57.059 170.361 1.00 62.70  ? 1203 CYS A CA  1 
ATOM   59   C C   . CYS A 1 17  ? 15.806  56.553 171.769 1.00 69.89  ? 1203 CYS A C   1 
ATOM   60   O O   . CYS A 1 17  ? 16.730  56.074 172.460 1.00 68.32  ? 1203 CYS A O   1 
ATOM   61   C CB  . CYS A 1 17  ? 15.822  58.561 170.297 1.00 53.58  ? 1203 CYS A CB  1 
ATOM   62   S SG  . CYS A 1 17  ? 16.923  59.588 171.286 1.00 66.89  ? 1203 CYS A SG  1 
ATOM   63   N N   . THR A 1 18  ? 14.546  56.638 172.173 1.00 48.39  ? 1204 THR A N   1 
ATOM   64   C CA  . THR A 1 18  ? 14.135  56.248 173.500 1.00 59.29  ? 1204 THR A CA  1 
ATOM   65   C C   . THR A 1 18  ? 14.432  54.791 173.778 1.00 58.80  ? 1204 THR A C   1 
ATOM   66   O O   . THR A 1 18  ? 14.819  54.459 174.892 1.00 61.12  ? 1204 THR A O   1 
ATOM   67   C CB  . THR A 1 18  ? 12.640  56.477 173.663 1.00 60.83  ? 1204 THR A CB  1 
ATOM   68   O OG1 . THR A 1 18  ? 12.280  57.692 173.004 1.00 51.23  ? 1204 THR A OG1 1 
ATOM   69   C CG2 . THR A 1 18  ? 12.245  56.556 175.109 1.00 54.90  ? 1204 THR A CG2 1 
ATOM   70   N N   . VAL A 1 19  ? 14.164  53.952 172.787 1.00 49.80  ? 1205 VAL A N   1 
ATOM   71   C CA  . VAL A 1 19  ? 14.368  52.522 172.893 1.00 49.69  ? 1205 VAL A CA  1 
ATOM   72   C C   . VAL A 1 19  ? 15.834  52.202 173.068 1.00 61.49  ? 1205 VAL A C   1 
ATOM   73   O O   . VAL A 1 19  ? 16.189  51.308 173.819 1.00 71.43  ? 1205 VAL A O   1 
ATOM   74   C CB  . VAL A 1 19  ? 13.811  51.781 171.678 1.00 45.29  ? 1205 VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 19  ? 14.124  50.308 171.775 1.00 35.45  ? 1205 VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 19  ? 12.319  51.997 171.583 1.00 44.12  ? 1205 VAL A CG2 1 
ATOM   77   N N   . ASN A 1 20  ? 16.688  52.927 172.359 1.00 59.62  ? 1206 ASN A N   1 
ATOM   78   C CA  . ASN A 1 20  ? 18.121  52.732 172.491 1.00 73.75  ? 1206 ASN A CA  1 
ATOM   79   C C   . ASN A 1 20  ? 18.590  53.094 173.895 1.00 70.45  ? 1206 ASN A C   1 
ATOM   80   O O   . ASN A 1 20  ? 19.379  52.376 174.507 1.00 83.60  ? 1206 ASN A O   1 
ATOM   81   C CB  . ASN A 1 20  ? 18.861  53.567 171.447 1.00 80.21  ? 1206 ASN A CB  1 
ATOM   82   C CG  . ASN A 1 20  ? 18.476  53.198 170.029 1.00 77.82  ? 1206 ASN A CG  1 
ATOM   83   O OD1 . ASN A 1 20  ? 18.155  52.049 169.743 1.00 75.23  ? 1206 ASN A OD1 1 
ATOM   84   N ND2 . ASN A 1 20  ? 18.514  54.172 169.132 1.00 65.49  ? 1206 ASN A ND2 1 
ATOM   85   N N   . LEU A 1 21  ? 18.104  54.222 174.397 1.00 56.77  ? 1207 LEU A N   1 
ATOM   86   C CA  . LEU A 1 21  ? 18.428  54.666 175.743 1.00 57.76  ? 1207 LEU A CA  1 
ATOM   87   C C   . LEU A 1 21  ? 17.890  53.670 176.751 1.00 75.46  ? 1207 LEU A C   1 
ATOM   88   O O   . LEU A 1 21  ? 18.537  53.357 177.746 1.00 83.18  ? 1207 LEU A O   1 
ATOM   89   C CB  . LEU A 1 21  ? 17.828  56.042 176.014 1.00 50.58  ? 1207 LEU A CB  1 
ATOM   90   C CG  . LEU A 1 21  ? 18.709  57.256 175.734 1.00 53.74  ? 1207 LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 21  ? 19.361  57.151 174.376 1.00 64.00  ? 1207 LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 21  ? 17.883  58.515 175.826 1.00 80.46  ? 1207 LEU A CD2 1 
ATOM   93   N N   . LEU A 1 22  ? 16.689  53.179 176.480 1.00 63.11  ? 1208 LEU A N   1 
ATOM   94   C CA  . LEU A 1 22  ? 16.030  52.222 177.347 1.00 45.75  ? 1208 LEU A CA  1 
ATOM   95   C C   . LEU A 1 22  ? 16.838  50.938 177.420 1.00 54.62  ? 1208 LEU A C   1 
ATOM   96   O O   . LEU A 1 22  ? 17.000  50.360 178.488 1.00 64.55  ? 1208 LEU A O   1 
ATOM   97   C CB  . LEU A 1 22  ? 14.640  51.928 176.797 1.00 41.53  ? 1208 LEU A CB  1 
ATOM   98   C CG  . LEU A 1 22  ? 13.650  51.202 177.697 1.00 68.42  ? 1208 LEU A CG  1 
ATOM   99   C CD1 . LEU A 1 22  ? 13.325  52.060 178.900 1.00 91.45  ? 1208 LEU A CD1 1 
ATOM   100  C CD2 . LEU A 1 22  ? 12.398  50.901 176.913 1.00 59.81  ? 1208 LEU A CD2 1 
ATOM   101  N N   . ASN A 1 23  ? 17.345  50.497 176.276 1.00 60.09  ? 1209 ASN A N   1 
ATOM   102  C CA  . ASN A 1 23  ? 18.170  49.299 176.209 1.00 66.81  ? 1209 ASN A CA  1 
ATOM   103  C C   . ASN A 1 23  ? 19.467  49.474 176.976 1.00 67.08  ? 1209 ASN A C   1 
ATOM   104  O O   . ASN A 1 23  ? 19.924  48.568 177.665 1.00 59.92  ? 1209 ASN A O   1 
ATOM   105  C CB  . ASN A 1 23  ? 18.482  48.947 174.758 1.00 67.25  ? 1209 ASN A CB  1 
ATOM   106  C CG  . ASN A 1 23  ? 17.248  48.586 173.971 1.00 71.59  ? 1209 ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 23  ? 16.205  48.285 174.540 1.00 69.53  ? 1209 ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 23  ? 17.361  48.611 172.652 1.00 65.42  ? 1209 ASN A ND2 1 
ATOM   109  N N   . PHE A 1 24  ? 20.054  50.656 176.843 1.00 70.68  ? 1210 PHE A N   1 
ATOM   110  C CA  . PHE A 1 24  ? 21.298  50.969 177.517 1.00 68.33  ? 1210 PHE A CA  1 
ATOM   111  C C   . PHE A 1 24  ? 21.119  50.934 179.023 1.00 76.71  ? 1210 PHE A C   1 
ATOM   112  O O   . PHE A 1 24  ? 21.961  50.406 179.740 1.00 84.50  ? 1210 PHE A O   1 
ATOM   113  C CB  . PHE A 1 24  ? 21.785  52.350 177.085 1.00 67.48  ? 1210 PHE A CB  1 
ATOM   114  C CG  . PHE A 1 24  ? 23.044  52.792 177.768 1.00 78.78  ? 1210 PHE A CG  1 
ATOM   115  C CD1 . PHE A 1 24  ? 22.998  53.383 179.015 1.00 86.39  ? 1210 PHE A CD1 1 
ATOM   116  C CD2 . PHE A 1 24  ? 24.272  52.621 177.161 1.00 68.89  ? 1210 PHE A CD2 1 
ATOM   117  C CE1 . PHE A 1 24  ? 24.152  53.791 179.641 1.00 70.09  ? 1210 PHE A CE1 1 
ATOM   118  C CE2 . PHE A 1 24  ? 25.426  53.027 177.784 1.00 63.45  ? 1210 PHE A CE2 1 
ATOM   119  C CZ  . PHE A 1 24  ? 25.366  53.613 179.024 1.00 57.77  ? 1210 PHE A CZ  1 
ATOM   120  N N   . TYR A 1 25  ? 20.031  51.518 179.508 1.00 67.22  ? 1211 TYR A N   1 
ATOM   121  C CA  . TYR A 1 25  ? 19.782  51.534 180.942 1.00 74.66  ? 1211 TYR A CA  1 
ATOM   122  C C   . TYR A 1 25  ? 19.567  50.142 181.520 1.00 84.37  ? 1211 TYR A C   1 
ATOM   123  O O   . TYR A 1 25  ? 20.080  49.826 182.586 1.00 98.39  ? 1211 TYR A O   1 
ATOM   124  C CB  . TYR A 1 25  ? 18.612  52.455 181.284 1.00 64.20  ? 1211 TYR A CB  1 
ATOM   125  C CG  . TYR A 1 25  ? 18.884  53.905 180.965 1.00 65.65  ? 1211 TYR A CG  1 
ATOM   126  C CD1 . TYR A 1 25  ? 20.036  54.526 181.417 1.00 63.16  ? 1211 TYR A CD1 1 
ATOM   127  C CD2 . TYR A 1 25  ? 17.990  54.652 180.217 1.00 69.42  ? 1211 TYR A CD2 1 
ATOM   128  C CE1 . TYR A 1 25  ? 20.291  55.845 181.129 1.00 67.93  ? 1211 TYR A CE1 1 
ATOM   129  C CE2 . TYR A 1 25  ? 18.238  55.974 179.927 1.00 53.87  ? 1211 TYR A CE2 1 
ATOM   130  C CZ  . TYR A 1 25  ? 19.390  56.564 180.385 1.00 63.15  ? 1211 TYR A CZ  1 
ATOM   131  O OH  . TYR A 1 25  ? 19.645  57.882 180.099 1.00 51.37  ? 1211 TYR A OH  1 
ATOM   132  N N   . LYS A 1 26  ? 18.810  49.309 180.817 1.00 75.31  ? 1212 LYS A N   1 
ATOM   133  C CA  . LYS A 1 26  ? 18.554  47.957 181.294 1.00 88.73  ? 1212 LYS A CA  1 
ATOM   134  C C   . LYS A 1 26  ? 19.845  47.154 181.337 1.00 81.81  ? 1212 LYS A C   1 
ATOM   135  O O   . LYS A 1 26  ? 20.082  46.386 182.265 1.00 89.74  ? 1212 LYS A O   1 
ATOM   136  C CB  . LYS A 1 26  ? 17.501  47.254 180.437 1.00 78.03  ? 1212 LYS A CB  1 
ATOM   137  C CG  . LYS A 1 26  ? 18.040  46.568 179.199 1.00 90.31  ? 1212 LYS A CG  1 
ATOM   138  C CD  . LYS A 1 26  ? 16.918  45.881 178.433 1.00 109.87 ? 1212 LYS A CD  1 
ATOM   139  C CE  . LYS A 1 26  ? 17.452  44.842 177.460 1.00 119.33 ? 1212 LYS A CE  1 
ATOM   140  N NZ  . LYS A 1 26  ? 18.349  45.430 176.431 1.00 114.85 ? 1212 LYS A NZ  1 
ATOM   141  N N   . ASP A 1 27  ? 20.676  47.342 180.321 1.00 62.43  ? 1213 ASP A N   1 
ATOM   142  C CA  . ASP A 1 27  ? 21.951  46.644 180.219 1.00 75.24  ? 1213 ASP A CA  1 
ATOM   143  C C   . ASP A 1 27  ? 22.886  47.000 181.362 1.00 80.16  ? 1213 ASP A C   1 
ATOM   144  O O   . ASP A 1 27  ? 23.605  46.148 181.879 1.00 95.34  ? 1213 ASP A O   1 
ATOM   145  C CB  . ASP A 1 27  ? 22.621  46.959 178.884 1.00 74.16  ? 1213 ASP A CB  1 
ATOM   146  C CG  . ASP A 1 27  ? 21.839  46.435 177.705 1.00 92.03  ? 1213 ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 27  ? 20.827  45.743 177.923 1.00 96.36  ? 1213 ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 27  ? 22.235  46.710 176.557 1.00 104.09 ? 1213 ASP A OD2 1 
ATOM   149  N N   . ASN A 1 28  ? 22.878  48.269 181.746 1.00 80.07  ? 1214 ASN A N   1 
ATOM   150  C CA  . ASN A 1 28  ? 23.727  48.752 182.824 1.00 82.79  ? 1214 ASN A CA  1 
ATOM   151  C C   . ASN A 1 28  ? 23.093  48.724 184.214 1.00 92.51  ? 1214 ASN A C   1 
ATOM   152  O O   . ASN A 1 28  ? 23.714  49.140 185.188 1.00 118.92 ? 1214 ASN A O   1 
ATOM   153  C CB  . ASN A 1 28  ? 24.281  50.134 182.487 1.00 75.78  ? 1214 ASN A CB  1 
ATOM   154  C CG  . ASN A 1 28  ? 25.143  50.117 181.244 1.00 77.61  ? 1214 ASN A CG  1 
ATOM   155  O OD1 . ASN A 1 28  ? 26.282  50.568 181.260 1.00 78.52  ? 1214 ASN A OD1 1 
ATOM   156  N ND2 . ASN A 1 28  ? 24.608  49.575 180.163 1.00 85.37  ? 1214 ASN A ND2 1 
ATOM   157  N N   . ASN A 1 29  ? 21.870  48.225 184.306 1.00 74.34  ? 1215 ASN A N   1 
ATOM   158  C CA  . ASN A 1 29  ? 21.195  48.138 185.592 1.00 98.75  ? 1215 ASN A CA  1 
ATOM   159  C C   . ASN A 1 29  ? 20.709  49.460 186.165 1.00 96.17  ? 1215 ASN A C   1 
ATOM   160  O O   . ASN A 1 29  ? 20.407  49.552 187.352 1.00 85.00  ? 1215 ASN A O   1 
ATOM   161  C CB  . ASN A 1 29  ? 22.085  47.417 186.601 1.00 98.88  ? 1215 ASN A CB  1 
ATOM   162  C CG  . ASN A 1 29  ? 22.345  45.978 186.214 1.00 114.14 ? 1215 ASN A CG  1 
ATOM   163  O OD1 . ASN A 1 29  ? 21.514  45.338 185.571 1.00 110.07 ? 1215 ASN A OD1 1 
ATOM   164  N ND2 . ASN A 1 29  ? 23.502  45.460 186.604 1.00 121.32 ? 1215 ASN A ND2 1 
ATOM   165  N N   . ARG A 1 30  ? 20.627  50.481 185.324 1.00 86.12  ? 1216 ARG A N   1 
ATOM   166  C CA  . ARG A 1 30  ? 20.157  51.774 185.780 1.00 72.88  ? 1216 ARG A CA  1 
ATOM   167  C C   . ARG A 1 30  ? 18.650  51.672 185.713 1.00 78.84  ? 1216 ARG A C   1 
ATOM   168  O O   . ARG A 1 30  ? 18.015  52.215 184.815 1.00 82.40  ? 1216 ARG A O   1 
ATOM   169  C CB  . ARG A 1 30  ? 20.645  52.884 184.863 1.00 50.23  ? 1216 ARG A CB  1 
ATOM   170  C CG  . ARG A 1 30  ? 20.290  54.263 185.366 1.00 106.70 ? 1216 ARG A CG  1 
ATOM   171  C CD  . ARG A 1 30  ? 20.933  54.515 186.710 1.00 103.05 ? 1216 ARG A CD  1 
ATOM   172  N NE  . ARG A 1 30  ? 22.386  54.453 186.617 1.00 87.57  ? 1216 ARG A NE  1 
ATOM   173  C CZ  . ARG A 1 30  ? 23.180  55.511 186.694 1.00 86.95  ? 1216 ARG A CZ  1 
ATOM   174  N NH1 . ARG A 1 30  ? 22.661  56.714 186.879 1.00 97.23  ? 1216 ARG A NH1 1 
ATOM   175  N NH2 . ARG A 1 30  ? 24.491  55.366 186.597 1.00 90.23  ? 1216 ARG A NH2 1 
ATOM   176  N N   . GLU A 1 31  ? 18.073  50.991 186.695 1.00 77.76  ? 1217 GLU A N   1 
ATOM   177  C CA  . GLU A 1 31  ? 16.631  50.787 186.758 1.00 85.52  ? 1217 GLU A CA  1 
ATOM   178  C C   . GLU A 1 31  ? 15.778  52.045 186.840 1.00 81.55  ? 1217 GLU A C   1 
ATOM   179  O O   . GLU A 1 31  ? 14.729  52.114 186.211 1.00 78.36  ? 1217 GLU A O   1 
ATOM   180  C CB  . GLU A 1 31  ? 16.283  49.879 187.938 1.00 83.51  ? 1217 GLU A CB  1 
ATOM   181  C CG  . GLU A 1 31  ? 14.802  49.582 188.062 1.00 80.75  ? 1217 GLU A CG  1 
ATOM   182  C CD  . GLU A 1 31  ? 14.386  49.264 189.481 1.00 91.91  ? 1217 GLU A CD  1 
ATOM   183  O OE1 . GLU A 1 31  ? 14.572  50.124 190.366 1.00 85.45  ? 1217 GLU A OE1 1 
ATOM   184  O OE2 . GLU A 1 31  ? 13.862  48.156 189.710 1.00 91.91  ? 1217 GLU A OE2 1 
ATOM   185  N N   . GLU A 1 32  ? 16.201  53.039 187.606 1.00 74.41  ? 1218 GLU A N   1 
ATOM   186  C CA  . GLU A 1 32  ? 15.396  54.247 187.703 1.00 64.62  ? 1218 GLU A CA  1 
ATOM   187  C C   . GLU A 1 32  ? 15.282  54.917 186.345 1.00 73.63  ? 1218 GLU A C   1 
ATOM   188  O O   . GLU A 1 32  ? 14.217  55.386 185.963 1.00 73.47  ? 1218 GLU A O   1 
ATOM   189  C CB  . GLU A 1 32  ? 15.976  55.214 188.730 1.00 76.63  ? 1218 GLU A CB  1 
ATOM   190  C CG  . GLU A 1 32  ? 15.004  56.301 189.140 1.00 100.82 ? 1218 GLU A CG  1 
ATOM   191  C CD  . GLU A 1 32  ? 15.484  57.093 190.331 1.00 111.08 ? 1218 GLU A CD  1 
ATOM   192  O OE1 . GLU A 1 32  ? 16.704  57.326 190.437 1.00 117.12 ? 1218 GLU A OE1 1 
ATOM   193  O OE2 . GLU A 1 32  ? 14.639  57.485 191.161 1.00 107.50 ? 1218 GLU A OE2 1 
ATOM   194  N N   . MET A 1 33  ? 16.391  54.963 185.621 1.00 78.32  ? 1219 MET A N   1 
ATOM   195  C CA  . MET A 1 33  ? 16.420  55.567 184.298 1.00 63.93  ? 1219 MET A CA  1 
ATOM   196  C C   . MET A 1 33  ? 15.565  54.794 183.307 1.00 67.76  ? 1219 MET A C   1 
ATOM   197  O O   . MET A 1 33  ? 14.861  55.374 182.490 1.00 55.06  ? 1219 MET A O   1 
ATOM   198  C CB  . MET A 1 33  ? 17.854  55.625 183.782 1.00 77.85  ? 1219 MET A CB  1 
ATOM   199  C CG  . MET A 1 33  ? 18.748  56.568 184.546 1.00 72.54  ? 1219 MET A CG  1 
ATOM   200  S SD  . MET A 1 33  ? 18.182  58.256 184.382 1.00 77.19  ? 1219 MET A SD  1 
ATOM   201  C CE  . MET A 1 33  ? 19.607  59.129 185.009 1.00 57.81  ? 1219 MET A CE  1 
ATOM   202  N N   . TYR A 1 34  ? 15.641  53.473 183.396 1.00 66.13  ? 1220 TYR A N   1 
ATOM   203  C CA  . TYR A 1 34  ? 14.903  52.584 182.515 1.00 52.45  ? 1220 TYR A CA  1 
ATOM   204  C C   . TYR A 1 34  ? 13.407  52.784 182.664 1.00 46.78  ? 1220 TYR A C   1 
ATOM   205  O O   . TYR A 1 34  ? 12.679  52.847 181.680 1.00 63.26  ? 1220 TYR A O   1 
ATOM   206  C CB  . TYR A 1 34  ? 15.285  51.147 182.868 1.00 31.68  ? 1220 TYR A CB  1 
ATOM   207  C CG  . TYR A 1 34  ? 14.516  50.061 182.159 1.00 58.38  ? 1220 TYR A CG  1 
ATOM   208  C CD1 . TYR A 1 34  ? 14.853  49.669 180.876 1.00 51.94  ? 1220 TYR A CD1 1 
ATOM   209  C CD2 . TYR A 1 34  ? 13.479  49.398 182.791 1.00 52.23  ? 1220 TYR A CD2 1 
ATOM   210  C CE1 . TYR A 1 34  ? 14.162  48.666 180.236 1.00 52.43  ? 1220 TYR A CE1 1 
ATOM   211  C CE2 . TYR A 1 34  ? 12.784  48.396 182.159 1.00 64.39  ? 1220 TYR A CE2 1 
ATOM   212  C CZ  . TYR A 1 34  ? 13.129  48.034 180.882 1.00 74.40  ? 1220 TYR A CZ  1 
ATOM   213  O OH  . TYR A 1 34  ? 12.437  47.033 180.250 1.00 48.93  ? 1220 TYR A OH  1 
ATOM   214  N N   . ILE A 1 35  ? 12.954  52.886 183.902 1.00 51.50  ? 1221 ILE A N   1 
ATOM   215  C CA  . ILE A 1 35  ? 11.546  53.089 184.193 1.00 55.17  ? 1221 ILE A CA  1 
ATOM   216  C C   . ILE A 1 35  ? 11.021  54.438 183.728 1.00 55.57  ? 1221 ILE A C   1 
ATOM   217  O O   . ILE A 1 35  ? 9.894   54.548 183.262 1.00 75.92  ? 1221 ILE A O   1 
ATOM   218  C CB  . ILE A 1 35  ? 11.248  52.932 185.685 1.00 64.20  ? 1221 ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 35  ? 11.412  51.475 186.102 1.00 53.76  ? 1221 ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 35  ? 9.843   53.404 185.989 1.00 43.97  ? 1221 ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 35  ? 11.055  51.218 187.532 1.00 54.22  ? 1221 ILE A CD1 1 
ATOM   222  N N   . ARG A 1 36  ? 11.842  55.467 183.873 1.00 47.01  ? 1222 ARG A N   1 
ATOM   223  C CA  . ARG A 1 36  ? 11.450  56.791 183.499 1.00 60.49  ? 1222 ARG A CA  1 
ATOM   224  C C   . ARG A 1 36  ? 11.256  56.782 182.013 1.00 63.85  ? 1222 ARG A C   1 
ATOM   225  O O   . ARG A 1 36  ? 10.314  57.353 181.483 1.00 64.11  ? 1222 ARG A O   1 
ATOM   226  C CB  . ARG A 1 36  ? 12.565  57.736 183.895 1.00 58.41  ? 1222 ARG A CB  1 
ATOM   227  C CG  . ARG A 1 36  ? 12.615  58.988 183.116 1.00 62.36  ? 1222 ARG A CG  1 
ATOM   228  C CD  . ARG A 1 36  ? 13.171  60.093 183.949 1.00 78.21  ? 1222 ARG A CD  1 
ATOM   229  N NE  . ARG A 1 36  ? 13.236  61.323 183.180 1.00 102.89 ? 1222 ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 36  ? 14.352  61.806 182.661 1.00 108.05 ? 1222 ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 36  ? 15.489  61.166 182.847 1.00 102.38 ? 1222 ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 36  ? 14.332  62.930 181.969 1.00 113.79 ? 1222 ARG A NH2 1 
ATOM   233  N N   . TYR A 1 37  ? 12.162  56.106 181.340 1.00 53.49  ? 1223 TYR A N   1 
ATOM   234  C CA  . TYR A 1 37  ? 12.088  55.956 179.906 1.00 55.02  ? 1223 TYR A CA  1 
ATOM   235  C C   . TYR A 1 37  ? 10.921  55.154 179.425 1.00 66.31  ? 1223 TYR A C   1 
ATOM   236  O O   . TYR A 1 37  ? 10.416  55.409 178.362 1.00 59.25  ? 1223 TYR A O   1 
ATOM   237  C CB  . TYR A 1 37  ? 13.400  55.523 179.298 1.00 39.77  ? 1223 TYR A CB  1 
ATOM   238  C CG  . TYR A 1 37  ? 14.258  56.718 179.072 1.00 57.48  ? 1223 TYR A CG  1 
ATOM   239  C CD1 . TYR A 1 37  ? 14.092  57.509 177.970 1.00 75.13  ? 1223 TYR A CD1 1 
ATOM   240  C CD2 . TYR A 1 37  ? 15.191  57.095 179.997 1.00 70.79  ? 1223 TYR A CD2 1 
ATOM   241  C CE1 . TYR A 1 37  ? 14.852  58.620 177.785 1.00 80.35  ? 1223 TYR A CE1 1 
ATOM   242  C CE2 . TYR A 1 37  ? 15.955  58.196 179.816 1.00 78.88  ? 1223 TYR A CE2 1 
ATOM   243  C CZ  . TYR A 1 37  ? 15.784  58.958 178.713 1.00 75.01  ? 1223 TYR A CZ  1 
ATOM   244  O OH  . TYR A 1 37  ? 16.557  60.062 178.535 1.00 63.85  ? 1223 TYR A OH  1 
ATOM   245  N N   . LEU A 1 38  ? 10.498  54.156 180.174 1.00 55.37  ? 1224 LEU A N   1 
ATOM   246  C CA  . LEU A 1 38  ? 9.359   53.427 179.707 1.00 49.05  ? 1224 LEU A CA  1 
ATOM   247  C C   . LEU A 1 38  ? 8.262   54.405 179.636 1.00 56.75  ? 1224 LEU A C   1 
ATOM   248  O O   . LEU A 1 38  ? 7.553   54.464 178.674 1.00 61.88  ? 1224 LEU A O   1 
ATOM   249  C CB  . LEU A 1 38  ? 8.870   52.464 180.749 1.00 47.71  ? 1224 LEU A CB  1 
ATOM   250  C CG  . LEU A 1 38  ? 9.733   51.450 181.427 1.00 71.55  ? 1224 LEU A CG  1 
ATOM   251  C CD1 . LEU A 1 38  ? 8.804   50.650 182.262 1.00 48.11  ? 1224 LEU A CD1 1 
ATOM   252  C CD2 . LEU A 1 38  ? 10.352  50.613 180.378 1.00 76.86  ? 1224 LEU A CD2 1 
ATOM   253  N N   . TYR A 1 39  ? 8.114   55.197 180.675 1.00 53.96  ? 1225 TYR A N   1 
ATOM   254  C CA  . TYR A 1 39  ? 7.013   56.133 180.655 1.00 61.40  ? 1225 TYR A CA  1 
ATOM   255  C C   . TYR A 1 39  ? 7.143   57.153 179.543 1.00 56.60  ? 1225 TYR A C   1 
ATOM   256  O O   . TYR A 1 39  ? 6.169   57.534 178.934 1.00 47.03  ? 1225 TYR A O   1 
ATOM   257  C CB  . TYR A 1 39  ? 6.765   56.742 182.025 1.00 41.74  ? 1225 TYR A CB  1 
ATOM   258  C CG  . TYR A 1 39  ? 6.139   55.752 182.945 1.00 40.67  ? 1225 TYR A CG  1 
ATOM   259  C CD1 . TYR A 1 39  ? 4.783   55.567 182.965 1.00 34.57  ? 1225 TYR A CD1 1 
ATOM   260  C CD2 . TYR A 1 39  ? 6.910   54.966 183.764 1.00 44.29  ? 1225 TYR A CD2 1 
ATOM   261  C CE1 . TYR A 1 39  ? 4.219   54.645 183.783 1.00 41.32  ? 1225 TYR A CE1 1 
ATOM   262  C CE2 . TYR A 1 39  ? 6.351   54.051 184.582 1.00 46.08  ? 1225 TYR A CE2 1 
ATOM   263  C CZ  . TYR A 1 39  ? 5.010   53.891 184.588 1.00 39.75  ? 1225 TYR A CZ  1 
ATOM   264  O OH  . TYR A 1 39  ? 4.457   52.967 185.410 1.00 61.84  ? 1225 TYR A OH  1 
ATOM   265  N N   . LYS A 1 40  ? 8.349   57.605 179.272 1.00 39.52  ? 1226 LYS A N   1 
ATOM   266  C CA  . LYS A 1 40  ? 8.508   58.551 178.196 1.00 58.68  ? 1226 LYS A CA  1 
ATOM   267  C C   . LYS A 1 40  ? 8.082   57.945 176.876 1.00 59.54  ? 1226 LYS A C   1 
ATOM   268  O O   . LYS A 1 40  ? 7.409   58.577 176.104 1.00 55.81  ? 1226 LYS A O   1 
ATOM   269  C CB  . LYS A 1 40  ? 9.958   58.982 178.086 1.00 57.46  ? 1226 LYS A CB  1 
ATOM   270  C CG  . LYS A 1 40  ? 10.376  59.998 179.096 1.00 66.63  ? 1226 LYS A CG  1 
ATOM   271  C CD  . LYS A 1 40  ? 11.819  60.370 178.926 1.00 74.79  ? 1226 LYS A CD  1 
ATOM   272  C CE  . LYS A 1 40  ? 11.981  61.858 178.746 1.00 89.07  ? 1226 LYS A CE  1 
ATOM   273  N NZ  . LYS A 1 40  ? 11.451  62.650 179.874 1.00 66.50  ? 1226 LYS A NZ  1 
ATOM   274  N N   . LEU A 1 41  ? 8.476   56.703 176.636 1.00 46.80  ? 1227 LEU A N   1 
ATOM   275  C CA  . LEU A 1 41  ? 8.118   56.023 175.402 1.00 55.22  ? 1227 LEU A CA  1 
ATOM   276  C C   . LEU A 1 41  ? 6.613   55.855 175.281 1.00 43.27  ? 1227 LEU A C   1 
ATOM   277  O O   . LEU A 1 41  ? 6.049   56.026 174.209 1.00 55.22  ? 1227 LEU A O   1 
ATOM   278  C CB  . LEU A 1 41  ? 8.794   54.658 175.328 1.00 45.74  ? 1227 LEU A CB  1 
ATOM   279  C CG  . LEU A 1 41  ? 8.379   53.784 174.147 1.00 41.48  ? 1227 LEU A CG  1 
ATOM   280  C CD1 . LEU A 1 41  ? 8.596   54.508 172.836 1.00 38.19  ? 1227 LEU A CD1 1 
ATOM   281  C CD2 . LEU A 1 41  ? 9.138   52.483 174.174 1.00 41.34  ? 1227 LEU A CD2 1 
ATOM   282  N N   . ARG A 1 42  ? 5.963   55.522 176.387 1.00 42.40  ? 1228 ARG A N   1 
ATOM   283  C CA  . ARG A 1 42  ? 4.523   55.336 176.378 1.00 49.43  ? 1228 ARG A CA  1 
ATOM   284  C C   . ARG A 1 42  ? 3.807   56.620 176.011 1.00 60.80  ? 1228 ARG A C   1 
ATOM   285  O O   . ARG A 1 42  ? 2.827   56.604 175.274 1.00 56.14  ? 1228 ARG A O   1 
ATOM   286  C CB  . ARG A 1 42  ? 4.026   54.859 177.737 1.00 59.36  ? 1228 ARG A CB  1 
ATOM   287  C CG  . ARG A 1 42  ? 2.518   54.791 177.819 1.00 59.75  ? 1228 ARG A CG  1 
ATOM   288  C CD  . ARG A 1 42  ? 2.065   54.626 179.238 1.00 70.56  ? 1228 ARG A CD  1 
ATOM   289  N NE  . ARG A 1 42  ? 2.483   55.752 180.058 1.00 82.99  ? 1228 ARG A NE  1 
ATOM   290  C CZ  . ARG A 1 42  ? 1.648   56.591 180.651 1.00 59.22  ? 1228 ARG A CZ  1 
ATOM   291  N NH1 . ARG A 1 42  ? 0.345   56.424 180.525 1.00 74.74  ? 1228 ARG A NH1 1 
ATOM   292  N NH2 . ARG A 1 42  ? 2.117   57.587 181.380 1.00 56.77  ? 1228 ARG A NH2 1 
ATOM   293  N N   . ASP A 1 43  ? 4.299   57.734 176.530 1.00 59.70  ? 1229 ASP A N   1 
ATOM   294  C CA  . ASP A 1 43  ? 3.695   59.023 176.248 1.00 61.86  ? 1229 ASP A CA  1 
ATOM   295  C C   . ASP A 1 43  ? 3.790   59.312 174.760 1.00 60.04  ? 1229 ASP A C   1 
ATOM   296  O O   . ASP A 1 43  ? 2.860   59.844 174.165 1.00 56.96  ? 1229 ASP A O   1 
ATOM   297  C CB  . ASP A 1 43  ? 4.368   60.125 177.062 1.00 58.26  ? 1229 ASP A CB  1 
ATOM   298  C CG  . ASP A 1 43  ? 3.973   60.090 178.521 1.00 75.50  ? 1229 ASP A CG  1 
ATOM   299  O OD1 . ASP A 1 43  ? 2.960   59.443 178.847 1.00 71.39  ? 1229 ASP A OD1 1 
ATOM   300  O OD2 . ASP A 1 43  ? 4.670   60.714 179.344 1.00 78.75  ? 1229 ASP A OD2 1 
ATOM   301  N N   . LEU A 1 44  ? 4.922   58.957 174.163 1.00 61.77  ? 1230 LEU A N   1 
ATOM   302  C CA  . LEU A 1 44  ? 5.130   59.175 172.740 1.00 66.85  ? 1230 LEU A CA  1 
ATOM   303  C C   . LEU A 1 44  ? 4.109   58.368 171.964 1.00 64.34  ? 1230 LEU A C   1 
ATOM   304  O O   . LEU A 1 44  ? 3.543   58.832 170.982 1.00 62.78  ? 1230 LEU A O   1 
ATOM   305  C CB  . LEU A 1 44  ? 6.537   58.746 172.335 1.00 58.61  ? 1230 LEU A CB  1 
ATOM   306  C CG  . LEU A 1 44  ? 7.679   59.675 172.732 1.00 59.81  ? 1230 LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 44  ? 9.016   59.005 172.485 1.00 38.97  ? 1230 LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 44  ? 7.578   60.972 171.962 1.00 37.29  ? 1230 LEU A CD2 1 
ATOM   309  N N   . HIS A 1 45  ? 3.881   57.147 172.423 1.00 53.87  ? 1231 HIS A N   1 
ATOM   310  C CA  . HIS A 1 45  ? 2.925   56.258 171.794 1.00 47.09  ? 1231 HIS A CA  1 
ATOM   311  C C   . HIS A 1 45  ? 1.525   56.825 171.892 1.00 63.15  ? 1231 HIS A C   1 
ATOM   312  O O   . HIS A 1 45  ? 0.730   56.690 170.969 1.00 54.21  ? 1231 HIS A O   1 
ATOM   313  C CB  . HIS A 1 45  ? 2.967   54.872 172.427 1.00 31.93  ? 1231 HIS A CB  1 
ATOM   314  C CG  . HIS A 1 45  ? 4.054   53.997 171.891 1.00 49.71  ? 1231 HIS A CG  1 
ATOM   315  N ND1 . HIS A 1 45  ? 5.047   53.472 172.686 1.00 68.94  ? 1231 HIS A ND1 1 
ATOM   316  C CD2 . HIS A 1 45  ? 4.306   53.559 170.637 1.00 30.01  ? 1231 HIS A CD2 1 
ATOM   317  C CE1 . HIS A 1 45  ? 5.862   52.744 171.946 1.00 55.66  ? 1231 HIS A CE1 1 
ATOM   318  N NE2 . HIS A 1 45  ? 5.434   52.780 170.699 1.00 52.22  ? 1231 HIS A NE2 1 
ATOM   319  N N   . LEU A 1 46  ? 1.219   57.451 173.022 1.00 62.01  ? 1232 LEU A N   1 
ATOM   320  C CA  . LEU A 1 46  ? -0.112  58.016 173.222 1.00 47.68  ? 1232 LEU A CA  1 
ATOM   321  C C   . LEU A 1 46  ? -0.322  59.251 172.394 1.00 63.98  ? 1232 LEU A C   1 
ATOM   322  O O   . LEU A 1 46  ? -1.433  59.500 171.934 1.00 70.13  ? 1232 LEU A O   1 
ATOM   323  C CB  . LEU A 1 46  ? -0.383  58.319 174.686 1.00 61.51  ? 1232 LEU A CB  1 
ATOM   324  C CG  . LEU A 1 46  ? -0.683  57.136 175.632 1.00 63.77  ? 1232 LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 46  ? -1.222  57.615 176.994 1.00 46.44  ? 1232 LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 46  ? -1.629  56.103 174.983 1.00 44.66  ? 1232 LEU A CD2 1 
ATOM   327  N N   . ASP A 1 47  ? 0.746   60.018 172.189 1.00 66.68  ? 1233 ASP A N   1 
ATOM   328  C CA  . ASP A 1 47  ? 0.678   61.156 171.281 1.00 69.38  ? 1233 ASP A CA  1 
ATOM   329  C C   . ASP A 1 47  ? 0.207   60.651 169.936 1.00 61.21  ? 1233 ASP A C   1 
ATOM   330  O O   . ASP A 1 47  ? -0.677  61.225 169.351 1.00 74.09  ? 1233 ASP A O   1 
ATOM   331  C CB  . ASP A 1 47  ? 2.035   61.879 171.146 1.00 91.09  ? 1233 ASP A CB  1 
ATOM   332  C CG  . ASP A 1 47  ? 2.480   62.600 172.443 1.00 109.78 ? 1233 ASP A CG  1 
ATOM   333  O OD1 . ASP A 1 47  ? 1.642   62.805 173.352 1.00 108.23 ? 1233 ASP A OD1 1 
ATOM   334  O OD2 . ASP A 1 47  ? 3.682   62.958 172.546 1.00 109.81 ? 1233 ASP A OD2 1 
ATOM   335  N N   . CYS A 1 48  ? 0.773   59.544 169.478 1.00 74.25  ? 1234 CYS A N   1 
ATOM   336  C CA  . CYS A 1 48  ? 0.410   58.968 168.194 1.00 63.90  ? 1234 CYS A CA  1 
ATOM   337  C C   . CYS A 1 48  ? -0.814  58.062 168.191 1.00 68.60  ? 1234 CYS A C   1 
ATOM   338  O O   . CYS A 1 48  ? -1.175  57.542 167.146 1.00 74.21  ? 1234 CYS A O   1 
ATOM   339  C CB  . CYS A 1 48  ? 1.580   58.184 167.664 1.00 57.00  ? 1234 CYS A CB  1 
ATOM   340  S SG  . CYS A 1 48  ? 2.891   59.275 167.212 1.00 89.97  ? 1234 CYS A SG  1 
ATOM   341  N N   . ASP A 1 49  ? -1.432  57.845 169.348 1.00 64.09  ? 1235 ASP A N   1 
ATOM   342  C CA  . ASP A 1 49  ? -2.545  56.890 169.476 1.00 54.98  ? 1235 ASP A CA  1 
ATOM   343  C C   . ASP A 1 49  ? -2.202  55.427 169.257 1.00 53.56  ? 1235 ASP A C   1 
ATOM   344  O O   . ASP A 1 49  ? -3.087  54.646 168.962 1.00 50.45  ? 1235 ASP A O   1 
ATOM   345  C CB  . ASP A 1 49  ? -3.710  57.261 168.552 1.00 62.92  ? 1235 ASP A CB  1 
ATOM   346  C CG  . ASP A 1 49  ? -4.412  58.549 168.984 1.00 98.00  ? 1235 ASP A CG  1 
ATOM   347  O OD1 . ASP A 1 49  ? -3.970  59.184 169.979 1.00 105.95 ? 1235 ASP A OD1 1 
ATOM   348  O OD2 . ASP A 1 49  ? -5.410  58.926 168.328 1.00 97.98  ? 1235 ASP A OD2 1 
ATOM   349  N N   . ASN A 1 50  ? -0.930  55.060 169.400 1.00 55.92  ? 1236 ASN A N   1 
ATOM   350  C CA  . ASN A 1 50  ? -0.512  53.671 169.359 1.00 57.25  ? 1236 ASN A CA  1 
ATOM   351  C C   . ASN A 1 50  ? -0.834  53.036 170.689 1.00 57.43  ? 1236 ASN A C   1 
ATOM   352  O O   . ASN A 1 50  ? -0.003  53.004 171.586 1.00 63.93  ? 1236 ASN A O   1 
ATOM   353  C CB  . ASN A 1 50  ? 0.990   53.575 169.151 1.00 71.89  ? 1236 ASN A CB  1 
ATOM   354  C CG  . ASN A 1 50  ? 1.463   54.278 167.927 1.00 58.25  ? 1236 ASN A CG  1 
ATOM   355  O OD1 . ASN A 1 50  ? 0.674   54.579 167.036 1.00 59.40  ? 1236 ASN A OD1 1 
ATOM   356  N ND2 . ASN A 1 50  ? 2.774   54.539 167.864 1.00 42.23  ? 1236 ASN A ND2 1 
ATOM   357  N N   . TYR A 1 51  ? -2.041  52.542 170.838 1.00 43.19  ? 1237 TYR A N   1 
ATOM   358  C CA  . TYR A 1 51  ? -2.443  52.044 172.122 1.00 52.34  ? 1237 TYR A CA  1 
ATOM   359  C C   . TYR A 1 51  ? -1.755  50.768 172.457 1.00 59.89  ? 1237 TYR A C   1 
ATOM   360  O O   . TYR A 1 51  ? -1.255  50.618 173.575 1.00 48.78  ? 1237 TYR A O   1 
ATOM   361  C CB  . TYR A 1 51  ? -3.939  51.867 172.180 1.00 56.71  ? 1237 TYR A CB  1 
ATOM   362  C CG  . TYR A 1 51  ? -4.610  53.208 172.173 1.00 61.30  ? 1237 TYR A CG  1 
ATOM   363  C CD1 . TYR A 1 51  ? -4.525  54.045 173.279 1.00 76.33  ? 1237 TYR A CD1 1 
ATOM   364  C CD2 . TYR A 1 51  ? -5.296  53.663 171.054 1.00 76.74  ? 1237 TYR A CD2 1 
ATOM   365  C CE1 . TYR A 1 51  ? -5.125  55.302 173.279 1.00 82.50  ? 1237 TYR A CE1 1 
ATOM   366  C CE2 . TYR A 1 51  ? -5.900  54.918 171.042 1.00 88.57  ? 1237 TYR A CE2 1 
ATOM   367  C CZ  . TYR A 1 51  ? -5.807  55.728 172.160 1.00 89.15  ? 1237 TYR A CZ  1 
ATOM   368  O OH  . TYR A 1 51  ? -6.397  56.965 172.182 1.00 110.05 ? 1237 TYR A OH  1 
ATOM   369  N N   . THR A 1 52  ? -1.687  49.861 171.487 1.00 54.82  ? 1238 THR A N   1 
ATOM   370  C CA  . THR A 1 52  ? -1.194  48.533 171.791 1.00 50.78  ? 1238 THR A CA  1 
ATOM   371  C C   . THR A 1 52  ? 0.322   48.558 172.030 1.00 45.88  ? 1238 THR A C   1 
ATOM   372  O O   . THR A 1 52  ? 0.863   47.841 172.880 1.00 39.38  ? 1238 THR A O   1 
ATOM   373  C CB  . THR A 1 52  ? -1.662  47.470 170.786 1.00 37.26  ? 1238 THR A CB  1 
ATOM   374  O OG1 . THR A 1 52  ? -0.538  46.855 170.151 1.00 51.91  ? 1238 THR A OG1 1 
ATOM   375  C CG2 . THR A 1 52  ? -2.598  48.050 169.772 1.00 49.83  ? 1238 THR A CG2 1 
ATOM   376  N N   . GLU A 1 53  ? 1.003   49.434 171.330 1.00 32.30  ? 1239 GLU A N   1 
ATOM   377  C CA  . GLU A 1 53  ? 2.409   49.535 171.582 1.00 47.10  ? 1239 GLU A CA  1 
ATOM   378  C C   . GLU A 1 53  ? 2.616   50.218 172.913 1.00 44.38  ? 1239 GLU A C   1 
ATOM   379  O O   . GLU A 1 53  ? 3.545   49.870 173.635 1.00 55.81  ? 1239 GLU A O   1 
ATOM   380  C CB  . GLU A 1 53  ? 3.144   50.206 170.432 1.00 28.68  ? 1239 GLU A CB  1 
ATOM   381  C CG  . GLU A 1 53  ? 2.208   50.802 169.428 1.00 51.66  ? 1239 GLU A CG  1 
ATOM   382  C CD  . GLU A 1 53  ? 1.619   49.789 168.444 1.00 57.43  ? 1239 GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 53  ? 2.365   48.913 167.947 1.00 55.89  ? 1239 GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 53  ? 0.406   49.897 168.146 1.00 66.38  ? 1239 GLU A OE2 1 
ATOM   385  N N   . ALA A 1 54  ? 1.721   51.133 173.275 1.00 50.31  ? 1240 ALA A N   1 
ATOM   386  C CA  . ALA A 1 54  ? 1.794   51.776 174.604 1.00 56.07  ? 1240 ALA A CA  1 
ATOM   387  C C   . ALA A 1 54  ? 1.616   50.756 175.744 1.00 57.37  ? 1240 ALA A C   1 
ATOM   388  O O   . ALA A 1 54  ? 2.382   50.761 176.733 1.00 44.56  ? 1240 ALA A O   1 
ATOM   389  C CB  . ALA A 1 54  ? 0.774   52.860 174.726 1.00 49.38  ? 1240 ALA A CB  1 
ATOM   390  N N   . ALA A 1 55  ? 0.612   49.889 175.575 1.00 42.64  ? 1241 ALA A N   1 
ATOM   391  C CA  . ALA A 1 55  ? 0.363   48.801 176.473 1.00 34.86  ? 1241 ALA A CA  1 
ATOM   392  C C   . ALA A 1 55  ? 1.560   47.836 176.635 1.00 54.66  ? 1241 ALA A C   1 
ATOM   393  O O   . ALA A 1 55  ? 1.906   47.425 177.736 1.00 50.50  ? 1241 ALA A O   1 
ATOM   394  C CB  . ALA A 1 55  ? -0.790  48.067 175.999 1.00 39.24  ? 1241 ALA A CB  1 
ATOM   395  N N   . TYR A 1 56  ? 2.179   47.432 175.547 1.00 48.83  ? 1242 TYR A N   1 
ATOM   396  C CA  . TYR A 1 56  ? 3.304   46.529 175.671 1.00 40.59  ? 1242 TYR A CA  1 
ATOM   397  C C   . TYR A 1 56  ? 4.457   47.153 176.427 1.00 54.65  ? 1242 TYR A C   1 
ATOM   398  O O   . TYR A 1 56  ? 5.288   46.436 177.024 1.00 43.64  ? 1242 TYR A O   1 
ATOM   399  C CB  . TYR A 1 56  ? 3.815   46.146 174.295 1.00 48.21  ? 1242 TYR A CB  1 
ATOM   400  C CG  . TYR A 1 56  ? 3.071   45.006 173.739 1.00 52.66  ? 1242 TYR A CG  1 
ATOM   401  C CD1 . TYR A 1 56  ? 3.156   43.736 174.333 1.00 44.43  ? 1242 TYR A CD1 1 
ATOM   402  C CD2 . TYR A 1 56  ? 2.232   45.185 172.641 1.00 53.49  ? 1242 TYR A CD2 1 
ATOM   403  C CE1 . TYR A 1 56  ? 2.431   42.667 173.818 1.00 44.72  ? 1242 TYR A CE1 1 
ATOM   404  C CE2 . TYR A 1 56  ? 1.509   44.123 172.113 1.00 45.21  ? 1242 TYR A CE2 1 
ATOM   405  C CZ  . TYR A 1 56  ? 1.615   42.877 172.694 1.00 52.94  ? 1242 TYR A CZ  1 
ATOM   406  O OH  . TYR A 1 56  ? 0.896   41.850 172.157 1.00 54.99  ? 1242 TYR A OH  1 
ATOM   407  N N   . THR A 1 57  ? 4.541   48.485 176.360 1.00 33.33  ? 1243 THR A N   1 
ATOM   408  C CA  . THR A 1 57  ? 5.687   49.141 176.966 1.00 52.87  ? 1243 THR A CA  1 
ATOM   409  C C   . THR A 1 57  ? 5.507   49.248 178.468 1.00 56.21  ? 1243 THR A C   1 
ATOM   410  O O   . THR A 1 57  ? 6.464   49.027 179.202 1.00 57.13  ? 1243 THR A O   1 
ATOM   411  C CB  . THR A 1 57  ? 6.131   50.501 176.318 1.00 46.60  ? 1243 THR A CB  1 
ATOM   412  O OG1 . THR A 1 57  ? 5.787   51.595 177.176 1.00 60.10  ? 1243 THR A OG1 1 
ATOM   413  C CG2 . THR A 1 57  ? 5.546   50.699 174.947 1.00 59.53  ? 1243 THR A CG2 1 
ATOM   414  N N   . LEU A 1 58  ? 4.301   49.546 178.924 1.00 38.38  ? 1244 LEU A N   1 
ATOM   415  C CA  . LEU A 1 58  ? 3.997   49.410 180.338 1.00 35.68  ? 1244 LEU A CA  1 
ATOM   416  C C   . LEU A 1 58  ? 4.252   47.992 180.927 1.00 50.96  ? 1244 LEU A C   1 
ATOM   417  O O   . LEU A 1 58  ? 4.615   47.855 182.085 1.00 42.04  ? 1244 LEU A O   1 
ATOM   418  C CB  . LEU A 1 58  ? 2.568   49.830 180.608 1.00 34.83  ? 1244 LEU A CB  1 
ATOM   419  C CG  . LEU A 1 58  ? 2.428   51.330 180.684 1.00 42.98  ? 1244 LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 58  ? 1.048   51.759 181.212 1.00 42.41  ? 1244 LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 58  ? 3.520   51.850 181.574 1.00 40.66  ? 1244 LEU A CD2 1 
ATOM   422  N N   . LEU A 1 59  ? 4.066   46.948 180.122 1.00 48.89  ? 1245 LEU A N   1 
ATOM   423  C CA  . LEU A 1 59  ? 4.300   45.581 180.539 1.00 43.50  ? 1245 LEU A CA  1 
ATOM   424  C C   . LEU A 1 59  ? 5.763   45.348 180.820 1.00 55.30  ? 1245 LEU A C   1 
ATOM   425  O O   . LEU A 1 59  ? 6.151   44.305 181.357 1.00 69.82  ? 1245 LEU A O   1 
ATOM   426  C CB  . LEU A 1 59  ? 3.862   44.601 179.456 1.00 37.16  ? 1245 LEU A CB  1 
ATOM   427  C CG  . LEU A 1 59  ? 2.419   44.163 179.450 1.00 36.11  ? 1245 LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 59  ? 2.303   43.045 178.523 1.00 36.68  ? 1245 LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 59  ? 2.085   43.650 180.797 1.00 51.47  ? 1245 LEU A CD2 1 
ATOM   430  N N   . LEU A 1 60  ? 6.588   46.300 180.436 1.00 52.21  ? 1246 LEU A N   1 
ATOM   431  C CA  . LEU A 1 60  ? 7.989   46.201 180.767 1.00 55.22  ? 1246 LEU A CA  1 
ATOM   432  C C   . LEU A 1 60  ? 8.216   46.564 182.234 1.00 65.05  ? 1246 LEU A C   1 
ATOM   433  O O   . LEU A 1 60  ? 9.138   46.011 182.871 1.00 70.96  ? 1246 LEU A O   1 
ATOM   434  C CB  . LEU A 1 60  ? 8.815   47.087 179.848 1.00 58.48  ? 1246 LEU A CB  1 
ATOM   435  C CG  . LEU A 1 60  ? 8.866   46.631 178.392 1.00 47.12  ? 1246 LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 60  ? 9.647   47.644 177.572 1.00 44.65  ? 1246 LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 60  ? 9.493   45.225 178.306 1.00 31.45  ? 1246 LEU A CD2 1 
ATOM   438  N N   . HIS A 1 61  ? 7.382   47.475 182.750 1.00 41.16  ? 1247 HIS A N   1 
ATOM   439  C CA  . HIS A 1 61  ? 7.362   47.817 184.169 1.00 53.67  ? 1247 HIS A CA  1 
ATOM   440  C C   . HIS A 1 61  ? 6.914   46.642 185.019 1.00 65.88  ? 1247 HIS A C   1 
ATOM   441  O O   . HIS A 1 61  ? 7.605   46.260 185.980 1.00 74.33  ? 1247 HIS A O   1 
ATOM   442  C CB  . HIS A 1 61  ? 6.404   48.980 184.453 1.00 48.29  ? 1247 HIS A CB  1 
ATOM   443  C CG  . HIS A 1 61  ? 6.684   49.698 185.742 1.00 57.38  ? 1247 HIS A CG  1 
ATOM   444  N ND1 . HIS A 1 61  ? 6.101   50.907 186.061 1.00 61.95  ? 1247 HIS A ND1 1 
ATOM   445  C CD2 . HIS A 1 61  ? 7.521   49.401 186.768 1.00 43.89  ? 1247 HIS A CD2 1 
ATOM   446  C CE1 . HIS A 1 61  ? 6.545   51.312 187.238 1.00 52.62  ? 1247 HIS A CE1 1 
ATOM   447  N NE2 . HIS A 1 61  ? 7.406   50.415 187.686 1.00 63.08  ? 1247 HIS A NE2 1 
ATOM   448  N N   . THR A 1 62  ? 5.768   46.066 184.666 1.00 51.41  ? 1248 THR A N   1 
ATOM   449  C CA  . THR A 1 62  ? 5.149   45.067 185.502 1.00 54.84  ? 1248 THR A CA  1 
ATOM   450  C C   . THR A 1 62  ? 6.014   43.827 185.580 1.00 56.43  ? 1248 THR A C   1 
ATOM   451  O O   . THR A 1 62  ? 5.861   43.021 186.488 1.00 65.00  ? 1248 THR A O   1 
ATOM   452  C CB  . THR A 1 62  ? 3.790   44.674 184.955 1.00 67.49  ? 1248 THR A CB  1 
ATOM   453  O OG1 . THR A 1 62  ? 3.969   43.950 183.727 1.00 48.69  ? 1248 THR A OG1 1 
ATOM   454  C CG2 . THR A 1 62  ? 2.936   45.904 184.723 1.00 43.77  ? 1248 THR A CG2 1 
ATOM   455  N N   . TRP A 1 63  ? 6.917   43.670 184.618 1.00 54.84  ? 1249 TRP A N   1 
ATOM   456  C CA  . TRP A 1 63  ? 7.863   42.565 184.629 1.00 67.96  ? 1249 TRP A CA  1 
ATOM   457  C C   . TRP A 1 63  ? 8.782   42.672 185.855 1.00 71.25  ? 1249 TRP A C   1 
ATOM   458  O O   . TRP A 1 63  ? 9.345   41.687 186.346 1.00 67.23  ? 1249 TRP A O   1 
ATOM   459  C CB  . TRP A 1 63  ? 8.670   42.568 183.344 1.00 55.53  ? 1249 TRP A CB  1 
ATOM   460  C CG  . TRP A 1 63  ? 9.441   41.334 183.186 1.00 90.49  ? 1249 TRP A CG  1 
ATOM   461  C CD1 . TRP A 1 63  ? 10.752  41.143 183.520 1.00 96.22  ? 1249 TRP A CD1 1 
ATOM   462  C CD2 . TRP A 1 63  ? 8.964   40.079 182.680 1.00 108.98 ? 1249 TRP A CD2 1 
ATOM   463  N NE1 . TRP A 1 63  ? 11.130  39.847 183.238 1.00 101.66 ? 1249 TRP A NE1 1 
ATOM   464  C CE2 . TRP A 1 63  ? 10.055  39.172 182.720 1.00 114.51 ? 1249 TRP A CE2 1 
ATOM   465  C CE3 . TRP A 1 63  ? 7.728   39.633 182.185 1.00 98.97  ? 1249 TRP A CE3 1 
ATOM   466  C CZ2 . TRP A 1 63  ? 9.946   37.845 182.285 1.00 116.74 ? 1249 TRP A CZ2 1 
ATOM   467  C CZ3 . TRP A 1 63  ? 7.617   38.318 181.751 1.00 97.88  ? 1249 TRP A CZ3 1 
ATOM   468  C CH2 . TRP A 1 63  ? 8.722   37.438 181.805 1.00 110.21 ? 1249 TRP A CH2 1 
ATOM   469  N N   . LEU A 1 64  ? 8.891   43.886 186.360 1.00 51.24  ? 1250 LEU A N   1 
ATOM   470  C CA  . LEU A 1 64  ? 9.690   44.158 187.531 1.00 56.54  ? 1250 LEU A CA  1 
ATOM   471  C C   . LEU A 1 64  ? 8.918   44.047 188.825 1.00 71.68  ? 1250 LEU A C   1 
ATOM   472  O O   . LEU A 1 64  ? 9.479   44.074 189.904 1.00 55.68  ? 1250 LEU A O   1 
ATOM   473  C CB  . LEU A 1 64  ? 10.240  45.565 187.437 1.00 48.18  ? 1250 LEU A CB  1 
ATOM   474  C CG  . LEU A 1 64  ? 11.195  45.719 186.264 1.00 61.18  ? 1250 LEU A CG  1 
ATOM   475  C CD1 . LEU A 1 64  ? 11.670  47.113 186.231 1.00 42.86  ? 1250 LEU A CD1 1 
ATOM   476  C CD2 . LEU A 1 64  ? 12.365  44.743 186.374 1.00 51.54  ? 1250 LEU A CD2 1 
ATOM   477  N N   . LEU A 1 65  ? 7.603   43.956 188.716 1.00 74.49  ? 1251 LEU A N   1 
ATOM   478  C CA  . LEU A 1 65  ? 6.756   43.869 189.894 1.00 58.58  ? 1251 LEU A CA  1 
ATOM   479  C C   . LEU A 1 65  ? 6.386   42.455 190.306 1.00 66.23  ? 1251 LEU A C   1 
ATOM   480  O O   . LEU A 1 65  ? 6.393   41.534 189.497 1.00 77.20  ? 1251 LEU A O   1 
ATOM   481  C CB  . LEU A 1 65  ? 5.503   44.723 189.706 1.00 76.54  ? 1251 LEU A CB  1 
ATOM   482  C CG  . LEU A 1 65  ? 5.786   46.210 189.494 1.00 60.79  ? 1251 LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 65  ? 4.550   46.949 189.041 1.00 57.83  ? 1251 LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 65  ? 6.348   46.823 190.754 1.00 59.93  ? 1251 LEU A CD2 1 
ATOM   485  N N   . LYS A 1 66  ? 6.059   42.306 191.584 1.00 75.78  ? 1252 LYS A N   1 
ATOM   486  C CA  . LYS A 1 66  ? 5.678   41.025 192.153 1.00 81.18  ? 1252 LYS A CA  1 
ATOM   487  C C   . LYS A 1 66  ? 4.364   41.176 192.890 1.00 79.84  ? 1252 LYS A C   1 
ATOM   488  O O   . LYS A 1 66  ? 4.040   42.252 193.384 1.00 67.53  ? 1252 LYS A O   1 
ATOM   489  C CB  . LYS A 1 66  ? 6.730   40.538 193.147 1.00 76.62  ? 1252 LYS A CB  1 
ATOM   490  C CG  . LYS A 1 66  ? 8.072   40.183 192.554 1.00 86.59  ? 1252 LYS A CG  1 
ATOM   491  C CD  . LYS A 1 66  ? 9.030   39.785 193.661 1.00 97.94  ? 1252 LYS A CD  1 
ATOM   492  C CE  . LYS A 1 66  ? 8.995   40.805 194.788 1.00 100.94 ? 1252 LYS A CE  1 
ATOM   493  N NZ  . LYS A 1 66  ? 9.826   40.409 195.954 1.00 104.68 ? 1252 LYS A NZ  1 
ATOM   494  N N   . TRP A 1 67  ? 3.607   40.091 192.963 1.00 71.85  ? 1253 TRP A N   1 
ATOM   495  C CA  . TRP A 1 67  ? 2.333   40.118 193.653 1.00 85.31  ? 1253 TRP A CA  1 
ATOM   496  C C   . TRP A 1 67  ? 2.586   39.881 195.133 1.00 85.61  ? 1253 TRP A C   1 
ATOM   497  O O   . TRP A 1 67  ? 2.301   38.808 195.658 1.00 88.39  ? 1253 TRP A O   1 
ATOM   498  C CB  . TRP A 1 67  ? 1.403   39.034 193.117 1.00 92.72  ? 1253 TRP A CB  1 
ATOM   499  C CG  . TRP A 1 67  ? 1.084   39.151 191.666 1.00 71.76  ? 1253 TRP A CG  1 
ATOM   500  C CD1 . TRP A 1 67  ? 1.555   38.366 190.663 1.00 56.29  ? 1253 TRP A CD1 1 
ATOM   501  C CD2 . TRP A 1 67  ? 0.208   40.101 191.054 1.00 70.59  ? 1253 TRP A CD2 1 
ATOM   502  N NE1 . TRP A 1 67  ? 1.033   38.766 189.463 1.00 58.27  ? 1253 TRP A NE1 1 
ATOM   503  C CE2 . TRP A 1 67  ? 0.202   39.833 189.676 1.00 60.58  ? 1253 TRP A CE2 1 
ATOM   504  C CE3 . TRP A 1 67  ? -0.570  41.155 191.539 1.00 85.16  ? 1253 TRP A CE3 1 
ATOM   505  C CZ2 . TRP A 1 67  ? -0.550  40.576 188.778 1.00 66.61  ? 1253 TRP A CZ2 1 
ATOM   506  C CZ3 . TRP A 1 67  ? -1.315  41.890 190.645 1.00 62.92  ? 1253 TRP A CZ3 1 
ATOM   507  C CH2 . TRP A 1 67  ? -1.300  41.599 189.281 1.00 60.38  ? 1253 TRP A CH2 1 
ATOM   508  N N   . SER A 1 68  ? 3.127   40.890 195.803 1.00 90.74  ? 1254 SER A N   1 
ATOM   509  C CA  . SER A 1 68  ? 3.418   40.794 197.225 1.00 92.05  ? 1254 SER A CA  1 
ATOM   510  C C   . SER A 1 68  ? 3.205   42.128 197.922 1.00 93.61  ? 1254 SER A C   1 
ATOM   511  O O   . SER A 1 68  ? 3.234   43.180 197.293 1.00 105.02 ? 1254 SER A O   1 
ATOM   512  C CB  . SER A 1 68  ? 4.841   40.284 197.461 1.00 102.85 ? 1254 SER A CB  1 
ATOM   513  O OG  . SER A 1 68  ? 5.799   41.158 196.896 1.00 100.15 ? 1254 SER A OG  1 
ATOM   514  N N   . ASP A 1 69  ? 3.030   42.097 199.229 1.00 88.40  ? 1255 ASP A N   1 
ATOM   515  C CA  . ASP A 1 69  ? 2.803   43.330 199.954 1.00 99.84  ? 1255 ASP A CA  1 
ATOM   516  C C   . ASP A 1 69  ? 4.047   44.201 200.053 1.00 117.97 ? 1255 ASP A C   1 
ATOM   517  O O   . ASP A 1 69  ? 3.955   45.390 200.327 1.00 137.34 ? 1255 ASP A O   1 
ATOM   518  C CB  . ASP A 1 69  ? 2.210   43.025 201.315 1.00 103.15 ? 1255 ASP A CB  1 
ATOM   519  C CG  . ASP A 1 69  ? 3.133   42.178 202.152 1.00 122.82 ? 1255 ASP A CG  1 
ATOM   520  O OD1 . ASP A 1 69  ? 4.195   41.765 201.651 1.00 138.32 ? 1255 ASP A OD1 1 
ATOM   521  O OD2 . ASP A 1 69  ? 2.790   41.931 203.325 1.00 102.66 ? 1255 ASP A OD2 1 
ATOM   522  N N   . GLU A 1 70  ? 5.208   43.614 199.801 1.00 103.42 ? 1256 GLU A N   1 
ATOM   523  C CA  . GLU A 1 70  ? 6.449   44.368 199.833 1.00 95.69  ? 1256 GLU A CA  1 
ATOM   524  C C   . GLU A 1 70  ? 6.195   45.837 199.534 1.00 96.20  ? 1256 GLU A C   1 
ATOM   525  O O   . GLU A 1 70  ? 7.127   46.593 199.272 1.00 81.92  ? 1256 GLU A O   1 
ATOM   526  C CB  . GLU A 1 70  ? 7.441   43.803 198.823 1.00 98.39  ? 1256 GLU A CB  1 
ATOM   527  C CG  . GLU A 1 70  ? 7.928   42.407 199.144 1.00 111.36 ? 1256 GLU A CG  1 
ATOM   528  C CD  . GLU A 1 70  ? 8.656   41.762 197.986 1.00 123.84 ? 1256 GLU A CD  1 
ATOM   529  O OE1 . GLU A 1 70  ? 9.652   42.339 197.508 1.00 117.99 ? 1256 GLU A OE1 1 
ATOM   530  O OE2 . GLU A 1 70  ? 8.232   40.674 197.553 1.00 130.86 ? 1256 GLU A OE2 1 
ATOM   531  N N   . GLN A 1 85  ? 2.856   52.573 198.156 1.00 108.30 ? 1271 GLN A N   1 
ATOM   532  C CA  . GLN A 1 85  ? 2.110   51.504 197.422 1.00 103.89 ? 1271 GLN A CA  1 
ATOM   533  C C   . GLN A 1 85  ? 2.936   50.228 197.329 1.00 92.33  ? 1271 GLN A C   1 
ATOM   534  O O   . GLN A 1 85  ? 4.000   50.212 196.688 1.00 113.82 ? 1271 GLN A O   1 
ATOM   535  C CB  . GLN A 1 85  ? 1.790   51.939 195.975 1.00 109.36 ? 1271 GLN A CB  1 
ATOM   536  C CG  . GLN A 1 85  ? 0.297   52.173 195.615 1.00 138.96 ? 1271 GLN A CG  1 
ATOM   537  C CD  . GLN A 1 85  ? 0.085   52.482 194.104 1.00 130.43 ? 1271 GLN A CD  1 
ATOM   538  O OE1 . GLN A 1 85  ? -0.953  52.138 193.492 1.00 120.14 ? 1271 GLN A OE1 1 
ATOM   539  N NE2 . GLN A 1 85  ? 1.081   53.137 193.506 1.00 129.48 ? 1271 GLN A NE2 1 
ATOM   540  N N   . THR A 1 86  ? 2.461   49.146 197.930 1.00 63.87  ? 1272 THR A N   1 
ATOM   541  C CA  . THR A 1 86  ? 3.191   47.873 197.829 1.00 80.88  ? 1272 THR A CA  1 
ATOM   542  C C   . THR A 1 86  ? 3.054   47.313 196.404 1.00 95.54  ? 1272 THR A C   1 
ATOM   543  O O   . THR A 1 86  ? 2.189   47.751 195.627 1.00 103.30 ? 1272 THR A O   1 
ATOM   544  C CB  . THR A 1 86  ? 2.726   46.822 198.892 1.00 115.17 ? 1272 THR A CB  1 
ATOM   545  O OG1 . THR A 1 86  ? 2.022   45.739 198.268 1.00 112.25 ? 1272 THR A OG1 1 
ATOM   546  C CG2 . THR A 1 86  ? 1.826   47.445 199.959 1.00 123.53 ? 1272 THR A CG2 1 
ATOM   547  N N   . HIS A 1 87  ? 3.902   46.345 196.070 1.00 78.44  ? 1273 HIS A N   1 
ATOM   548  C CA  . HIS A 1 87  ? 3.898   45.722 194.748 1.00 78.50  ? 1273 HIS A CA  1 
ATOM   549  C C   . HIS A 1 87  ? 2.520   45.426 194.160 1.00 85.42  ? 1273 HIS A C   1 
ATOM   550  O O   . HIS A 1 87  ? 2.131   46.030 193.160 1.00 87.15  ? 1273 HIS A O   1 
ATOM   551  C CB  . HIS A 1 87  ? 4.752   44.473 194.775 1.00 72.66  ? 1273 HIS A CB  1 
ATOM   552  C CG  . HIS A 1 87  ? 6.211   44.754 194.647 1.00 91.26  ? 1273 HIS A CG  1 
ATOM   553  N ND1 . HIS A 1 87  ? 7.109   43.827 194.161 1.00 87.55  ? 1273 HIS A ND1 1 
ATOM   554  C CD2 . HIS A 1 87  ? 6.926   45.872 194.912 1.00 91.41  ? 1273 HIS A CD2 1 
ATOM   555  C CE1 . HIS A 1 87  ? 8.321   44.354 194.155 1.00 81.32  ? 1273 HIS A CE1 1 
ATOM   556  N NE2 . HIS A 1 87  ? 8.235   45.595 194.602 1.00 83.94  ? 1273 HIS A NE2 1 
ATOM   557  N N   . ARG A 1 88  ? 1.788   44.506 194.789 1.00 88.62  ? 1274 ARG A N   1 
ATOM   558  C CA  . ARG A 1 88  ? 0.456   44.113 194.341 1.00 80.64  ? 1274 ARG A CA  1 
ATOM   559  C C   . ARG A 1 88  ? -0.478  45.275 193.952 1.00 75.48  ? 1274 ARG A C   1 
ATOM   560  O O   . ARG A 1 88  ? -1.105  45.220 192.902 1.00 77.61  ? 1274 ARG A O   1 
ATOM   561  C CB  . ARG A 1 88  ? -0.194  43.208 195.387 1.00 81.57  ? 1274 ARG A CB  1 
ATOM   562  C CG  . ARG A 1 88  ? -1.711  42.965 195.245 1.00 73.18  ? 1274 ARG A CG  1 
ATOM   563  C CD  . ARG A 1 88  ? -2.250  42.281 196.515 1.00 65.42  ? 1274 ARG A CD  1 
ATOM   564  N NE  . ARG A 1 88  ? -1.401  41.161 196.950 1.00 66.61  ? 1274 ARG A NE  1 
ATOM   565  C CZ  . ARG A 1 88  ? -1.301  39.988 196.311 1.00 75.07  ? 1274 ARG A CZ  1 
ATOM   566  N NH1 . ARG A 1 88  ? -1.998  39.784 195.189 1.00 72.89  ? 1274 ARG A NH1 1 
ATOM   567  N NH2 . ARG A 1 88  ? -0.504  39.017 196.779 1.00 64.17  ? 1274 ARG A NH2 1 
ATOM   568  N N   . GLN A 1 89  ? -0.600  46.317 194.761 1.00 83.98  ? 1275 GLN A N   1 
ATOM   569  C CA  . GLN A 1 89  ? -1.525  47.379 194.341 1.00 86.16  ? 1275 GLN A CA  1 
ATOM   570  C C   . GLN A 1 89  ? -0.979  48.128 193.144 1.00 82.08  ? 1275 GLN A C   1 
ATOM   571  O O   . GLN A 1 89  ? -1.754  48.588 192.294 1.00 79.11  ? 1275 GLN A O   1 
ATOM   572  C CB  . GLN A 1 89  ? -1.886  48.373 195.444 1.00 84.62  ? 1275 GLN A CB  1 
ATOM   573  C CG  . GLN A 1 89  ? -0.704  48.920 196.173 1.00 108.51 ? 1275 GLN A CG  1 
ATOM   574  C CD  . GLN A 1 89  ? -0.461  48.164 197.442 1.00 111.85 ? 1275 GLN A CD  1 
ATOM   575  O OE1 . GLN A 1 89  ? 0.220   47.137 197.443 1.00 113.10 ? 1275 GLN A OE1 1 
ATOM   576  N NE2 . GLN A 1 89  ? -1.055  48.639 198.534 1.00 86.92  ? 1275 GLN A NE2 1 
ATOM   577  N N   . LEU A 1 90  ? 0.332   48.326 193.107 1.00 71.26  ? 1276 LEU A N   1 
ATOM   578  C CA  . LEU A 1 90  ? 0.933   49.024 191.985 1.00 67.99  ? 1276 LEU A CA  1 
ATOM   579  C C   . LEU A 1 90  ? 0.770   48.215 190.712 1.00 55.94  ? 1276 LEU A C   1 
ATOM   580  O O   . LEU A 1 90  ? 0.410   48.744 189.668 1.00 55.05  ? 1276 LEU A O   1 
ATOM   581  C CB  . LEU A 1 90  ? 2.414   49.284 192.245 1.00 46.14  ? 1276 LEU A CB  1 
ATOM   582  C CG  . LEU A 1 90  ? 3.185   49.860 191.059 1.00 53.72  ? 1276 LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 90  ? 2.561   51.156 190.596 1.00 45.56  ? 1276 LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 90  ? 4.635   50.062 191.415 1.00 47.15  ? 1276 LEU A CD2 1 
ATOM   585  N N   . LYS A 1 91  ? 1.025   46.918 190.820 1.00 46.32  ? 1277 LYS A N   1 
ATOM   586  C CA  . LYS A 1 91  ? 0.918   46.014 189.686 1.00 48.91  ? 1277 LYS A CA  1 
ATOM   587  C C   . LYS A 1 91  ? -0.519  45.930 189.207 1.00 69.15  ? 1277 LYS A C   1 
ATOM   588  O O   . LYS A 1 91  ? -0.785  45.885 188.012 1.00 68.23  ? 1277 LYS A O   1 
ATOM   589  C CB  . LYS A 1 91  ? 1.454   44.629 190.047 1.00 46.39  ? 1277 LYS A CB  1 
ATOM   590  C CG  . LYS A 1 91  ? 1.883   43.802 188.851 1.00 48.11  ? 1277 LYS A CG  1 
ATOM   591  C CD  . LYS A 1 91  ? 2.653   42.570 189.279 1.00 44.30  ? 1277 LYS A CD  1 
ATOM   592  C CE  . LYS A 1 91  ? 3.092   41.752 188.086 1.00 49.30  ? 1277 LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 91  ? 3.904   40.579 188.487 1.00 51.15  ? 1277 LYS A NZ  1 
ATOM   594  N N   . GLU A 1 92  ? -1.442  45.905 190.159 1.00 62.68  ? 1278 GLU A N   1 
ATOM   595  C CA  . GLU A 1 92  ? -2.860  45.827 189.853 1.00 59.77  ? 1278 GLU A CA  1 
ATOM   596  C C   . GLU A 1 92  ? -3.306  47.054 189.078 1.00 59.99  ? 1278 GLU A C   1 
ATOM   597  O O   . GLU A 1 92  ? -4.064  46.953 188.122 1.00 48.79  ? 1278 GLU A O   1 
ATOM   598  C CB  . GLU A 1 92  ? -3.656  45.704 191.150 1.00 60.57  ? 1278 GLU A CB  1 
ATOM   599  C CG  . GLU A 1 92  ? -5.117  46.064 191.029 1.00 84.33  ? 1278 GLU A CG  1 
ATOM   600  C CD  . GLU A 1 92  ? -5.829  46.029 192.362 1.00 99.61  ? 1278 GLU A CD  1 
ATOM   601  O OE1 . GLU A 1 92  ? -5.551  45.113 193.159 1.00 90.20  ? 1278 GLU A OE1 1 
ATOM   602  O OE2 . GLU A 1 92  ? -6.666  46.917 192.614 1.00 113.61 ? 1278 GLU A OE2 1 
ATOM   603  N N   . THR A 1 93  ? -2.829  48.217 189.498 1.00 57.23  ? 1279 THR A N   1 
ATOM   604  C CA  . THR A 1 93  ? -3.158  49.461 188.824 1.00 62.30  ? 1279 THR A CA  1 
ATOM   605  C C   . THR A 1 93  ? -2.601  49.473 187.409 1.00 62.61  ? 1279 THR A C   1 
ATOM   606  O O   . THR A 1 93  ? -3.262  49.916 186.475 1.00 57.73  ? 1279 THR A O   1 
ATOM   607  C CB  . THR A 1 93  ? -2.615  50.668 189.592 1.00 62.96  ? 1279 THR A CB  1 
ATOM   608  O OG1 . THR A 1 93  ? -1.266  50.405 189.989 1.00 94.53  ? 1279 THR A OG1 1 
ATOM   609  C CG2 . THR A 1 93  ? -3.446  50.922 190.829 1.00 37.03  ? 1279 THR A CG2 1 
ATOM   610  N N   . LEU A 1 94  ? -1.372  48.990 187.260 1.00 64.18  ? 1280 LEU A N   1 
ATOM   611  C CA  . LEU A 1 94  ? -0.729  48.939 185.954 1.00 69.05  ? 1280 LEU A CA  1 
ATOM   612  C C   . LEU A 1 94  ? -1.470  48.010 185.012 1.00 66.51  ? 1280 LEU A C   1 
ATOM   613  O O   . LEU A 1 94  ? -1.702  48.343 183.856 1.00 41.23  ? 1280 LEU A O   1 
ATOM   614  C CB  . LEU A 1 94  ? 0.727   48.498 186.091 1.00 38.63  ? 1280 LEU A CB  1 
ATOM   615  C CG  . LEU A 1 94  ? 1.768   49.610 186.016 1.00 47.06  ? 1280 LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 94  ? 1.239   50.895 186.604 1.00 52.20  ? 1280 LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 94  ? 3.054   49.188 186.683 1.00 39.55  ? 1280 LEU A CD2 1 
ATOM   618  N N   . TYR A 1 95  ? -1.861  46.849 185.518 1.00 43.37  ? 1281 TYR A N   1 
ATOM   619  C CA  . TYR A 1 95  ? -2.619  45.911 184.710 1.00 47.03  ? 1281 TYR A CA  1 
ATOM   620  C C   . TYR A 1 95  ? -3.922  46.503 184.256 1.00 56.98  ? 1281 TYR A C   1 
ATOM   621  O O   . TYR A 1 95  ? -4.334  46.269 183.137 1.00 65.45  ? 1281 TYR A O   1 
ATOM   622  C CB  . TYR A 1 95  ? -2.915  44.626 185.464 1.00 49.17  ? 1281 TYR A CB  1 
ATOM   623  C CG  . TYR A 1 95  ? -1.899  43.513 185.225 1.00 61.26  ? 1281 TYR A CG  1 
ATOM   624  C CD1 . TYR A 1 95  ? -0.535  43.789 185.210 1.00 50.47  ? 1281 TYR A CD1 1 
ATOM   625  C CD2 . TYR A 1 95  ? -2.305  42.192 185.011 1.00 41.38  ? 1281 TYR A CD2 1 
ATOM   626  C CE1 . TYR A 1 95  ? 0.384   42.813 185.018 1.00 44.40  ? 1281 TYR A CE1 1 
ATOM   627  C CE2 . TYR A 1 95  ? -1.378  41.203 184.819 1.00 51.04  ? 1281 TYR A CE2 1 
ATOM   628  C CZ  . TYR A 1 95  ? -0.023  41.537 184.828 1.00 53.41  ? 1281 TYR A CZ  1 
ATOM   629  O OH  . TYR A 1 95  ? 0.975   40.608 184.614 1.00 50.89  ? 1281 TYR A OH  1 
ATOM   630  N N   . GLU A 1 96  ? -4.577  47.266 185.120 1.00 48.75  ? 1282 GLU A N   1 
ATOM   631  C CA  . GLU A 1 96  ? -5.829  47.888 184.751 1.00 44.35  ? 1282 GLU A CA  1 
ATOM   632  C C   . GLU A 1 96  ? -5.653  48.847 183.591 1.00 54.78  ? 1282 GLU A C   1 
ATOM   633  O O   . GLU A 1 96  ? -6.465  48.849 182.662 1.00 66.63  ? 1282 GLU A O   1 
ATOM   634  C CB  . GLU A 1 96  ? -6.435  48.618 185.930 1.00 35.37  ? 1282 GLU A CB  1 
ATOM   635  C CG  . GLU A 1 96  ? -7.145  47.687 186.856 1.00 49.47  ? 1282 GLU A CG  1 
ATOM   636  C CD  . GLU A 1 96  ? -7.679  48.371 188.105 1.00 97.04  ? 1282 GLU A CD  1 
ATOM   637  O OE1 . GLU A 1 96  ? -7.344  49.555 188.358 1.00 105.22 ? 1282 GLU A OE1 1 
ATOM   638  O OE2 . GLU A 1 96  ? -8.434  47.702 188.848 1.00 108.69 ? 1282 GLU A OE2 1 
ATOM   639  N N   . THR A 1 97  ? -4.597  49.655 183.647 1.00 48.13  ? 1283 THR A N   1 
ATOM   640  C CA  . THR A 1 97  ? -4.342  50.663 182.633 1.00 59.50  ? 1283 THR A CA  1 
ATOM   641  C C   . THR A 1 97  ? -3.987  49.975 181.325 1.00 68.10  ? 1283 THR A C   1 
ATOM   642  O O   . THR A 1 97  ? -4.605  50.262 180.296 1.00 56.18  ? 1283 THR A O   1 
ATOM   643  C CB  . THR A 1 97  ? -3.222  51.599 183.073 1.00 46.86  ? 1283 THR A CB  1 
ATOM   644  O OG1 . THR A 1 97  ? -3.170  51.597 184.500 1.00 67.27  ? 1283 THR A OG1 1 
ATOM   645  C CG2 . THR A 1 97  ? -3.483  53.009 182.603 1.00 55.66  ? 1283 THR A CG2 1 
ATOM   646  N N   . ILE A 1 98  ? -3.012  49.060 181.387 1.00 43.51  ? 1284 ILE A N   1 
ATOM   647  C CA  . ILE A 1 98  ? -2.596  48.241 180.254 1.00 40.06  ? 1284 ILE A CA  1 
ATOM   648  C C   . ILE A 1 98  ? -3.806  47.570 179.617 1.00 49.62  ? 1284 ILE A C   1 
ATOM   649  O O   . ILE A 1 98  ? -4.024  47.640 178.423 1.00 44.04  ? 1284 ILE A O   1 
ATOM   650  C CB  . ILE A 1 98  ? -1.575  47.143 180.680 1.00 38.94  ? 1284 ILE A CB  1 
ATOM   651  C CG1 . ILE A 1 98  ? -0.307  47.768 181.280 1.00 37.87  ? 1284 ILE A CG1 1 
ATOM   652  C CG2 . ILE A 1 98  ? -1.211  46.205 179.503 1.00 36.08  ? 1284 ILE A CG2 1 
ATOM   653  C CD1 . ILE A 1 98  ? 0.601   46.789 181.970 1.00 49.13  ? 1284 ILE A CD1 1 
ATOM   654  N N   . ILE A 1 99  ? -4.613  46.919 180.424 1.00 49.15  ? 1285 ILE A N   1 
ATOM   655  C CA  . ILE A 1 99  ? -5.771  46.242 179.886 1.00 35.54  ? 1285 ILE A CA  1 
ATOM   656  C C   . ILE A 1 99  ? -6.604  47.253 179.184 1.00 43.64  ? 1285 ILE A C   1 
ATOM   657  O O   . ILE A 1 99  ? -7.251  46.930 178.213 1.00 56.21  ? 1285 ILE A O   1 
ATOM   658  C CB  . ILE A 1 99  ? -6.604  45.557 180.974 1.00 43.40  ? 1285 ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 99  ? -5.811  44.382 181.544 1.00 38.04  ? 1285 ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 99  ? -7.961  45.095 180.415 1.00 33.40  ? 1285 ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 99  ? -6.466  43.739 182.693 1.00 35.51  ? 1285 ILE A CD1 1 
ATOM   662  N N   . GLY A 1 100 ? -6.584  48.480 179.669 1.00 36.74  ? 1286 GLY A N   1 
ATOM   663  C CA  . GLY A 1 100 ? -7.418  49.496 179.093 1.00 40.02  ? 1286 GLY A CA  1 
ATOM   664  C C   . GLY A 1 100 ? -6.878  49.787 177.713 1.00 59.02  ? 1286 GLY A C   1 
ATOM   665  O O   . GLY A 1 100 ? -7.634  49.979 176.770 1.00 49.96  ? 1286 GLY A O   1 
ATOM   666  N N   . TYR A 1 101 ? -5.557  49.790 177.581 1.00 61.05  ? 1287 TYR A N   1 
ATOM   667  C CA  . TYR A 1 101 ? -4.944  50.151 176.325 1.00 43.69  ? 1287 TYR A CA  1 
ATOM   668  C C   . TYR A 1 101 ? -5.274  49.080 175.296 1.00 52.41  ? 1287 TYR A C   1 
ATOM   669  O O   . TYR A 1 101 ? -5.740  49.372 174.198 1.00 44.92  ? 1287 TYR A O   1 
ATOM   670  C CB  . TYR A 1 101 ? -3.433  50.302 176.485 1.00 45.23  ? 1287 TYR A CB  1 
ATOM   671  C CG  . TYR A 1 101 ? -2.943  51.487 177.302 1.00 41.97  ? 1287 TYR A CG  1 
ATOM   672  C CD1 . TYR A 1 101 ? -3.756  52.587 177.570 1.00 35.65  ? 1287 TYR A CD1 1 
ATOM   673  C CD2 . TYR A 1 101 ? -1.628  51.514 177.760 1.00 42.75  ? 1287 TYR A CD2 1 
ATOM   674  C CE1 . TYR A 1 101 ? -3.272  53.668 178.289 1.00 33.21  ? 1287 TYR A CE1 1 
ATOM   675  C CE2 . TYR A 1 101 ? -1.127  52.574 178.490 1.00 42.68  ? 1287 TYR A CE2 1 
ATOM   676  C CZ  . TYR A 1 101 ? -1.942  53.646 178.749 1.00 51.86  ? 1287 TYR A CZ  1 
ATOM   677  O OH  . TYR A 1 101 ? -1.401  54.683 179.468 1.00 58.16  ? 1287 TYR A OH  1 
ATOM   678  N N   . PHE A 1 102 ? -5.057  47.829 175.665 1.00 34.94  ? 1288 PHE A N   1 
ATOM   679  C CA  . PHE A 1 102 ? -5.282  46.748 174.748 1.00 43.42  ? 1288 PHE A CA  1 
ATOM   680  C C   . PHE A 1 102 ? -6.687  46.764 174.246 1.00 45.02  ? 1288 PHE A C   1 
ATOM   681  O O   . PHE A 1 102 ? -6.925  46.402 173.112 1.00 54.31  ? 1288 PHE A O   1 
ATOM   682  C CB  . PHE A 1 102 ? -5.009  45.416 175.408 1.00 30.91  ? 1288 PHE A CB  1 
ATOM   683  C CG  . PHE A 1 102 ? -3.569  45.028 175.417 1.00 53.19  ? 1288 PHE A CG  1 
ATOM   684  C CD1 . PHE A 1 102 ? -2.728  45.360 174.372 1.00 39.65  ? 1288 PHE A CD1 1 
ATOM   685  C CD2 . PHE A 1 102 ? -3.044  44.313 176.479 1.00 48.77  ? 1288 PHE A CD2 1 
ATOM   686  C CE1 . PHE A 1 102 ? -1.368  44.991 174.388 1.00 46.36  ? 1288 PHE A CE1 1 
ATOM   687  C CE2 . PHE A 1 102 ? -1.687  43.924 176.502 1.00 46.84  ? 1288 PHE A CE2 1 
ATOM   688  C CZ  . PHE A 1 102 ? -0.850  44.269 175.448 1.00 47.06  ? 1288 PHE A CZ  1 
ATOM   689  N N   . ASP A 1 103 ? -7.617  47.164 175.102 1.00 43.90  ? 1289 ASP A N   1 
ATOM   690  C CA  . ASP A 1 103 ? -8.984  47.281 174.700 1.00 41.63  ? 1289 ASP A CA  1 
ATOM   691  C C   . ASP A 1 103 ? -9.106  48.274 173.547 1.00 48.56  ? 1289 ASP A C   1 
ATOM   692  O O   . ASP A 1 103 ? -9.659  47.935 172.513 1.00 55.20  ? 1289 ASP A O   1 
ATOM   693  C CB  . ASP A 1 103 ? -9.852  47.685 175.874 1.00 39.40  ? 1289 ASP A CB  1 
ATOM   694  C CG  . ASP A 1 103 ? -11.335 47.537 175.577 1.00 41.83  ? 1289 ASP A CG  1 
ATOM   695  O OD1 . ASP A 1 103 ? -11.783 46.532 174.994 1.00 41.45  ? 1289 ASP A OD1 1 
ATOM   696  O OD2 . ASP A 1 103 ? -12.069 48.457 175.921 1.00 57.20  ? 1289 ASP A OD2 1 
ATOM   697  N N   . LYS A 1 104 ? -8.572  49.482 173.702 1.00 47.59  ? 1290 LYS A N   1 
ATOM   698  C CA  . LYS A 1 104 ? -8.566  50.448 172.597 1.00 53.83  ? 1290 LYS A CA  1 
ATOM   699  C C   . LYS A 1 104 ? -7.865  49.896 171.364 1.00 47.56  ? 1290 LYS A C   1 
ATOM   700  O O   . LYS A 1 104 ? -8.333  50.088 170.257 1.00 53.92  ? 1290 LYS A O   1 
ATOM   701  C CB  . LYS A 1 104 ? -7.942  51.779 173.022 1.00 46.36  ? 1290 LYS A CB  1 
ATOM   702  C CG  . LYS A 1 104 ? -8.763  52.514 174.079 1.00 54.81  ? 1290 LYS A CG  1 
ATOM   703  C CD  . LYS A 1 104 ? -8.604  54.022 173.905 1.00 93.58  ? 1290 LYS A CD  1 
ATOM   704  C CE  . LYS A 1 104 ? -9.276  54.861 175.016 1.00 91.16  ? 1290 LYS A CE  1 
ATOM   705  N NZ  . LYS A 1 104 ? -9.649  56.243 174.515 1.00 85.41  ? 1290 LYS A NZ  1 
ATOM   706  N N   . GLY A 1 105 ? -6.768  49.174 171.577 1.00 52.23  ? 1291 GLY A N   1 
ATOM   707  C CA  . GLY A 1 105 ? -6.004  48.573 170.498 1.00 44.66  ? 1291 GLY A CA  1 
ATOM   708  C C   . GLY A 1 105 ? -6.701  47.386 169.901 1.00 51.10  ? 1291 GLY A C   1 
ATOM   709  O O   . GLY A 1 105 ? -6.296  46.875 168.871 1.00 54.99  ? 1291 GLY A O   1 
ATOM   710  N N   . LYS A 1 106 ? -7.760  46.937 170.553 1.00 55.58  ? 1292 LYS A N   1 
ATOM   711  C CA  . LYS A 1 106 ? -8.512  45.753 170.111 1.00 59.91  ? 1292 LYS A CA  1 
ATOM   712  C C   . LYS A 1 106 ? -7.687  44.462 170.138 1.00 64.36  ? 1292 LYS A C   1 
ATOM   713  O O   . LYS A 1 106 ? -7.972  43.492 169.411 1.00 53.27  ? 1292 LYS A O   1 
ATOM   714  C CB  . LYS A 1 106 ? -9.116  46.001 168.740 1.00 51.31  ? 1292 LYS A CB  1 
ATOM   715  C CG  . LYS A 1 106 ? -9.691  47.419 168.651 1.00 55.53  ? 1292 LYS A CG  1 
ATOM   716  C CD  . LYS A 1 106 ? -10.966 47.446 167.854 1.00 54.74  ? 1292 LYS A CD  1 
ATOM   717  C CE  . LYS A 1 106 ? -10.701 47.933 166.450 1.00 74.24  ? 1292 LYS A CE  1 
ATOM   718  N NZ  . LYS A 1 106 ? -10.737 49.426 166.336 1.00 78.01  ? 1292 LYS A NZ  1 
ATOM   719  N N   . MET A 1 107 ? -6.675  44.473 171.002 1.00 46.33  ? 1293 MET A N   1 
ATOM   720  C CA  . MET A 1 107 ? -5.932  43.298 171.371 1.00 48.52  ? 1293 MET A CA  1 
ATOM   721  C C   . MET A 1 107 ? -6.660  42.513 172.483 1.00 46.43  ? 1293 MET A C   1 
ATOM   722  O O   . MET A 1 107 ? -6.151  42.367 173.593 1.00 46.49  ? 1293 MET A O   1 
ATOM   723  C CB  . MET A 1 107 ? -4.558  43.745 171.839 1.00 40.52  ? 1293 MET A CB  1 
ATOM   724  C CG  . MET A 1 107 ? -3.719  44.389 170.735 1.00 60.46  ? 1293 MET A CG  1 
ATOM   725  S SD  . MET A 1 107 ? -3.413  43.314 169.273 1.00 55.05  ? 1293 MET A SD  1 
ATOM   726  C CE  . MET A 1 107 ? -4.580  44.107 168.168 1.00 52.23  ? 1293 MET A CE  1 
ATOM   727  N N   . TRP A 1 108 ? -7.864  42.051 172.189 1.00 37.43  ? 1294 TRP A N   1 
ATOM   728  C CA  . TRP A 1 108 ? -8.682  41.385 173.193 1.00 38.25  ? 1294 TRP A CA  1 
ATOM   729  C C   . TRP A 1 108 ? -8.091  40.110 173.766 1.00 42.18  ? 1294 TRP A C   1 
ATOM   730  O O   . TRP A 1 108 ? -8.231  39.848 174.951 1.00 59.45  ? 1294 TRP A O   1 
ATOM   731  C CB  . TRP A 1 108 ? -10.106 41.183 172.690 1.00 43.94  ? 1294 TRP A CB  1 
ATOM   732  C CG  . TRP A 1 108 ? -10.770 42.481 172.410 1.00 52.48  ? 1294 TRP A CG  1 
ATOM   733  C CD1 . TRP A 1 108 ? -10.780 43.578 173.211 1.00 46.80  ? 1294 TRP A CD1 1 
ATOM   734  C CD2 . TRP A 1 108 ? -11.515 42.829 171.243 1.00 55.74  ? 1294 TRP A CD2 1 
ATOM   735  N NE1 . TRP A 1 108 ? -11.485 44.590 172.620 1.00 43.66  ? 1294 TRP A NE1 1 
ATOM   736  C CE2 . TRP A 1 108 ? -11.949 44.154 171.408 1.00 54.19  ? 1294 TRP A CE2 1 
ATOM   737  C CE3 . TRP A 1 108 ? -11.859 42.148 170.076 1.00 45.05  ? 1294 TRP A CE3 1 
ATOM   738  C CZ2 . TRP A 1 108 ? -12.710 44.811 170.451 1.00 44.65  ? 1294 TRP A CZ2 1 
ATOM   739  C CZ3 . TRP A 1 108 ? -12.611 42.801 169.129 1.00 57.63  ? 1294 TRP A CZ3 1 
ATOM   740  C CH2 . TRP A 1 108 ? -13.029 44.118 169.319 1.00 54.53  ? 1294 TRP A CH2 1 
ATOM   741  N N   . GLU A 1 109 ? -7.439  39.311 172.939 1.00 50.10  ? 1295 GLU A N   1 
ATOM   742  C CA  . GLU A 1 109 ? -6.832  38.101 173.451 1.00 46.69  ? 1295 GLU A CA  1 
ATOM   743  C C   . GLU A 1 109 ? -5.763  38.463 174.473 1.00 26.69  ? 1295 GLU A C   1 
ATOM   744  O O   . GLU A 1 109 ? -5.665  37.833 175.517 1.00 55.71  ? 1295 GLU A O   1 
ATOM   745  C CB  . GLU A 1 109 ? -6.233  37.292 172.308 1.00 41.23  ? 1295 GLU A CB  1 
ATOM   746  C CG  . GLU A 1 109 ? -6.082  38.081 171.026 1.00 58.71  ? 1295 GLU A CG  1 
ATOM   747  C CD  . GLU A 1 109 ? -7.328  38.042 170.176 1.00 52.78  ? 1295 GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 109 ? -7.830  36.934 169.919 1.00 75.01  ? 1295 GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 109 ? -7.799  39.113 169.752 1.00 58.87  ? 1295 GLU A OE2 1 
ATOM   750  N N   . GLU A 1 110 ? -4.967  39.482 174.172 1.00 45.06  ? 1296 GLU A N   1 
ATOM   751  C CA  . GLU A 1 110 ? -3.925  39.937 175.086 1.00 55.12  ? 1296 GLU A CA  1 
ATOM   752  C C   . GLU A 1 110 ? -4.512  40.487 176.378 1.00 55.11  ? 1296 GLU A C   1 
ATOM   753  O O   . GLU A 1 110 ? -4.000  40.237 177.461 1.00 50.11  ? 1296 GLU A O   1 
ATOM   754  C CB  . GLU A 1 110 ? -3.049  40.999 174.424 1.00 41.71  ? 1296 GLU A CB  1 
ATOM   755  C CG  . GLU A 1 110 ? -1.954  40.450 173.535 1.00 44.83  ? 1296 GLU A CG  1 
ATOM   756  C CD  . GLU A 1 110 ? -0.825  39.815 174.318 1.00 55.65  ? 1296 GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 110 ? -1.056  39.391 175.463 1.00 61.86  ? 1296 GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 110 ? 0.300   39.744 173.791 1.00 38.31  ? 1296 GLU A OE2 1 
ATOM   759  N N   . ALA A 1 111 ? -5.588  41.250 176.249 1.00 40.83  ? 1297 ALA A N   1 
ATOM   760  C CA  . ALA A 1 111 ? -6.249  41.837 177.401 1.00 31.48  ? 1297 ALA A CA  1 
ATOM   761  C C   . ALA A 1 111 ? -6.820  40.766 178.311 1.00 52.79  ? 1297 ALA A C   1 
ATOM   762  O O   . ALA A 1 111 ? -6.727  40.858 179.528 1.00 54.02  ? 1297 ALA A O   1 
ATOM   763  C CB  . ALA A 1 111 ? -7.342  42.770 176.950 1.00 27.19  ? 1297 ALA A CB  1 
ATOM   764  N N   . ILE A 1 112 ? -7.403  39.737 177.716 1.00 49.72  ? 1298 ILE A N   1 
ATOM   765  C CA  . ILE A 1 112 ? -8.001  38.656 178.482 1.00 51.56  ? 1298 ILE A CA  1 
ATOM   766  C C   . ILE A 1 112 ? -6.974  37.926 179.324 1.00 44.59  ? 1298 ILE A C   1 
ATOM   767  O O   . ILE A 1 112 ? -7.242  37.566 180.463 1.00 61.58  ? 1298 ILE A O   1 
ATOM   768  C CB  . ILE A 1 112 ? -8.695  37.643 177.568 1.00 40.08  ? 1298 ILE A CB  1 
ATOM   769  C CG1 . ILE A 1 112 ? -9.947  38.261 176.954 1.00 32.09  ? 1298 ILE A CG1 1 
ATOM   770  C CG2 . ILE A 1 112 ? -9.047  36.393 178.342 1.00 29.39  ? 1298 ILE A CG2 1 
ATOM   771  C CD1 . ILE A 1 112 ? -10.539 37.443 175.852 1.00 36.16  ? 1298 ILE A CD1 1 
ATOM   772  N N   . SER A 1 113 ? -5.792  37.711 178.765 1.00 52.73  ? 1299 SER A N   1 
ATOM   773  C CA  . SER A 1 113 ? -4.753  37.008 179.491 1.00 48.91  ? 1299 SER A CA  1 
ATOM   774  C C   . SER A 1 113 ? -4.404  37.803 180.732 1.00 44.21  ? 1299 SER A C   1 
ATOM   775  O O   . SER A 1 113 ? -4.195  37.235 181.794 1.00 52.99  ? 1299 SER A O   1 
ATOM   776  C CB  . SER A 1 113 ? -3.518  36.820 178.619 1.00 34.04  ? 1299 SER A CB  1 
ATOM   777  O OG  . SER A 1 113 ? -2.845  38.047 178.433 1.00 64.08  ? 1299 SER A OG  1 
ATOM   778  N N   . LEU A 1 114 ? -4.342  39.121 180.599 1.00 41.84  ? 1300 LEU A N   1 
ATOM   779  C CA  . LEU A 1 114 ? -4.055  39.965 181.747 1.00 42.23  ? 1300 LEU A CA  1 
ATOM   780  C C   . LEU A 1 114 ? -5.172  39.824 182.769 1.00 57.48  ? 1300 LEU A C   1 
ATOM   781  O O   . LEU A 1 114 ? -4.916  39.712 183.959 1.00 38.61  ? 1300 LEU A O   1 
ATOM   782  C CB  . LEU A 1 114 ? -3.883  41.423 181.332 1.00 50.21  ? 1300 LEU A CB  1 
ATOM   783  C CG  . LEU A 1 114 ? -2.598  41.731 180.569 1.00 56.06  ? 1300 LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 114 ? -2.389  43.224 180.483 1.00 54.55  ? 1300 LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 114 ? -1.428  41.074 181.254 1.00 33.58  ? 1300 LEU A CD2 1 
ATOM   786  N N   . CYS A 1 115 ? -6.414  39.807 182.298 1.00 47.46  ? 1301 CYS A N   1 
ATOM   787  C CA  . CYS A 1 115 ? -7.537  39.608 183.195 1.00 40.58  ? 1301 CYS A CA  1 
ATOM   788  C C   . CYS A 1 115 ? -7.424  38.323 183.983 1.00 49.40  ? 1301 CYS A C   1 
ATOM   789  O O   . CYS A 1 115 ? -7.751  38.275 185.152 1.00 43.75  ? 1301 CYS A O   1 
ATOM   790  C CB  . CYS A 1 115 ? -8.830  39.619 182.429 1.00 27.34  ? 1301 CYS A CB  1 
ATOM   791  S SG  . CYS A 1 115 ? -9.238  41.263 182.036 1.00 53.36  ? 1301 CYS A SG  1 
ATOM   792  N N   . LYS A 1 116 ? -6.941  37.286 183.344 1.00 44.20  ? 1302 LYS A N   1 
ATOM   793  C CA  . LYS A 1 116 ? -6.854  35.996 184.000 1.00 51.12  ? 1302 LYS A CA  1 
ATOM   794  C C   . LYS A 1 116 ? -5.886  36.038 185.149 1.00 46.25  ? 1302 LYS A C   1 
ATOM   795  O O   . LYS A 1 116 ? -6.168  35.486 186.211 1.00 59.72  ? 1302 LYS A O   1 
ATOM   796  C CB  . LYS A 1 116 ? -6.475  34.890 183.027 1.00 31.35  ? 1302 LYS A CB  1 
ATOM   797  C CG  . LYS A 1 116 ? -7.551  34.571 182.012 1.00 29.60  ? 1302 LYS A CG  1 
ATOM   798  C CD  . LYS A 1 116 ? -6.895  33.530 181.147 1.00 46.73  ? 1302 LYS A CD  1 
ATOM   799  C CE  . LYS A 1 116 ? -7.767  32.416 180.520 1.00 38.85  ? 1302 LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 116 ? -9.118  32.242 181.113 1.00 66.58  ? 1302 LYS A NZ  1 
ATOM   801  N N   . GLU A 1 117 ? -4.774  36.726 184.961 1.00 43.53  ? 1303 GLU A N   1 
ATOM   802  C CA  . GLU A 1 117 ? -3.777  36.797 186.016 1.00 54.61  ? 1303 GLU A CA  1 
ATOM   803  C C   . GLU A 1 117 ? -4.309  37.494 187.240 1.00 55.79  ? 1303 GLU A C   1 
ATOM   804  O O   . GLU A 1 117 ? -4.048  37.048 188.368 1.00 62.72  ? 1303 GLU A O   1 
ATOM   805  C CB  . GLU A 1 117 ? -2.547  37.536 185.557 1.00 49.83  ? 1303 GLU A CB  1 
ATOM   806  C CG  . GLU A 1 117 ? -1.609  36.673 184.767 1.00 58.25  ? 1303 GLU A CG  1 
ATOM   807  C CD  . GLU A 1 117 ? -0.461  37.508 184.159 1.00 74.68  ? 1303 GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 117 ? 0.033   38.451 184.864 1.00 72.35  ? 1303 GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 117 ? -0.072  37.257 182.957 1.00 77.77  ? 1303 GLU A OE2 1 
ATOM   810  N N   . LEU A 1 118 ? -5.023  38.588 187.008 1.00 30.56  ? 1304 LEU A N   1 
ATOM   811  C CA  . LEU A 1 118 ? -5.697  39.292 188.058 1.00 34.14  ? 1304 LEU A CA  1 
ATOM   812  C C   . LEU A 1 118 ? -6.739  38.401 188.721 1.00 47.51  ? 1304 LEU A C   1 
ATOM   813  O O   . LEU A 1 118 ? -6.762  38.287 189.926 1.00 58.96  ? 1304 LEU A O   1 
ATOM   814  C CB  . LEU A 1 118 ? -6.345  40.542 187.485 1.00 38.48  ? 1304 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 118 ? -5.414  41.612 186.936 1.00 58.13  ? 1304 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 118 ? -6.162  42.740 186.264 1.00 59.80  ? 1304 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 118 ? -4.520  42.114 188.048 1.00 45.44  ? 1304 LEU A CD2 1 
ATOM   818  N N   . ALA A 1 119 ? -7.587  37.750 187.942 1.00 49.77  ? 1305 ALA A N   1 
ATOM   819  C CA  . ALA A 1 119 ? -8.640  36.951 188.517 1.00 38.08  ? 1305 ALA A CA  1 
ATOM   820  C C   . ALA A 1 119 ? -8.057  35.878 189.428 1.00 51.95  ? 1305 ALA A C   1 
ATOM   821  O O   . ALA A 1 119 ? -8.657  35.511 190.435 1.00 45.70  ? 1305 ALA A O   1 
ATOM   822  C CB  . ALA A 1 119 ? -9.463  36.332 187.458 1.00 28.53  ? 1305 ALA A CB  1 
ATOM   823  N N   . GLU A 1 120 ? -6.878  35.373 189.103 1.00 45.98  ? 1306 GLU A N   1 
ATOM   824  C CA  . GLU A 1 120 ? -6.292  34.367 189.981 1.00 48.70  ? 1306 GLU A CA  1 
ATOM   825  C C   . GLU A 1 120 ? -5.995  34.968 191.365 1.00 54.32  ? 1306 GLU A C   1 
ATOM   826  O O   . GLU A 1 120 ? -6.299  34.384 192.396 1.00 60.26  ? 1306 GLU A O   1 
ATOM   827  C CB  . GLU A 1 120 ? -5.037  33.772 189.372 1.00 49.89  ? 1306 GLU A CB  1 
ATOM   828  C CG  . GLU A 1 120 ? -4.650  32.447 189.979 1.00 59.70  ? 1306 GLU A CG  1 
ATOM   829  C CD  . GLU A 1 120 ? -3.315  31.906 189.457 1.00 94.28  ? 1306 GLU A CD  1 
ATOM   830  O OE1 . GLU A 1 120 ? -2.641  32.595 188.662 1.00 89.98  ? 1306 GLU A OE1 1 
ATOM   831  O OE2 . GLU A 1 120 ? -2.923  30.784 189.848 1.00 106.62 ? 1306 GLU A OE2 1 
ATOM   832  N N   . GLN A 1 121 ? -5.418  36.155 191.391 1.00 54.34  ? 1307 GLN A N   1 
ATOM   833  C CA  . GLN A 1 121 ? -5.161  36.795 192.651 1.00 56.96  ? 1307 GLN A CA  1 
ATOM   834  C C   . GLN A 1 121 ? -6.457  37.036 193.421 1.00 62.05  ? 1307 GLN A C   1 
ATOM   835  O O   . GLN A 1 121 ? -6.503  36.856 194.634 1.00 58.33  ? 1307 GLN A O   1 
ATOM   836  C CB  . GLN A 1 121 ? -4.426  38.111 192.430 1.00 49.08  ? 1307 GLN A CB  1 
ATOM   837  C CG  . GLN A 1 121 ? -3.095  37.942 191.725 1.00 56.46  ? 1307 GLN A CG  1 
ATOM   838  C CD  . GLN A 1 121 ? -2.041  37.192 192.526 1.00 58.91  ? 1307 GLN A CD  1 
ATOM   839  O OE1 . GLN A 1 121 ? -1.460  36.210 192.050 1.00 50.84  ? 1307 GLN A OE1 1 
ATOM   840  N NE2 . GLN A 1 121 ? -1.762  37.674 193.730 1.00 61.41  ? 1307 GLN A NE2 1 
ATOM   841  N N   . TYR A 1 122 ? -7.503  37.449 192.713 1.00 48.64  ? 1308 TYR A N   1 
ATOM   842  C CA  . TYR A 1 122 ? -8.754  37.817 193.361 1.00 56.50  ? 1308 TYR A CA  1 
ATOM   843  C C   . TYR A 1 122 ? -9.431  36.595 193.942 1.00 47.58  ? 1308 TYR A C   1 
ATOM   844  O O   . TYR A 1 122 ? -9.966  36.644 195.040 1.00 72.61  ? 1308 TYR A O   1 
ATOM   845  C CB  . TYR A 1 122 ? -9.707  38.536 192.391 1.00 38.37  ? 1308 TYR A CB  1 
ATOM   846  C CG  . TYR A 1 122 ? -9.244  39.894 191.949 1.00 47.20  ? 1308 TYR A CG  1 
ATOM   847  C CD1 . TYR A 1 122 ? -8.296  40.612 192.673 1.00 39.88  ? 1308 TYR A CD1 1 
ATOM   848  C CD2 . TYR A 1 122 ? -9.783  40.483 190.811 1.00 53.62  ? 1308 TYR A CD2 1 
ATOM   849  C CE1 . TYR A 1 122 ? -7.896  41.876 192.268 1.00 52.47  ? 1308 TYR A CE1 1 
ATOM   850  C CE2 . TYR A 1 122 ? -9.395  41.743 190.399 1.00 53.55  ? 1308 TYR A CE2 1 
ATOM   851  C CZ  . TYR A 1 122 ? -8.451  42.443 191.129 1.00 53.50  ? 1308 TYR A CZ  1 
ATOM   852  O OH  . TYR A 1 122 ? -8.055  43.699 190.705 1.00 55.02  ? 1308 TYR A OH  1 
ATOM   853  N N   . GLU A 1 123 ? -9.464  35.530 193.157 1.00 39.30  ? 1309 GLU A N   1 
ATOM   854  C CA  . GLU A 1 123 ? -10.085 34.284 193.565 1.00 41.94  ? 1309 GLU A CA  1 
ATOM   855  C C   . GLU A 1 123 ? -9.379  33.515 194.675 1.00 57.73  ? 1309 GLU A C   1 
ATOM   856  O O   . GLU A 1 123 ? -10.022 32.995 195.579 1.00 72.10  ? 1309 GLU A O   1 
ATOM   857  C CB  . GLU A 1 123 ? -10.259 33.375 192.351 1.00 45.13  ? 1309 GLU A CB  1 
ATOM   858  C CG  . GLU A 1 123 ? -10.998 32.094 192.646 1.00 52.88  ? 1309 GLU A CG  1 
ATOM   859  C CD  . GLU A 1 123 ? -10.817 31.069 191.559 1.00 71.06  ? 1309 GLU A CD  1 
ATOM   860  O OE1 . GLU A 1 123 ? -10.127 31.374 190.569 1.00 80.89  ? 1309 GLU A OE1 1 
ATOM   861  O OE2 . GLU A 1 123 ? -11.359 29.957 191.696 1.00 79.75  ? 1309 GLU A OE2 1 
ATOM   862  N N   . MET A 1 124 ? -8.057  33.429 194.600 1.00 57.98  ? 1310 MET A N   1 
ATOM   863  C CA  . MET A 1 124 ? -7.309  32.690 195.608 1.00 61.41  ? 1310 MET A CA  1 
ATOM   864  C C   . MET A 1 124 ? -6.186  33.373 196.367 1.00 67.63  ? 1310 MET A C   1 
ATOM   865  O O   . MET A 1 124 ? -5.589  32.757 197.242 1.00 67.63  ? 1310 MET A O   1 
ATOM   866  C CB  . MET A 1 124 ? -6.763  31.418 194.979 1.00 61.96  ? 1310 MET A CB  1 
ATOM   867  C CG  . MET A 1 124 ? -7.845  30.537 194.429 1.00 57.58  ? 1310 MET A CG  1 
ATOM   868  S SD  . MET A 1 124 ? -7.257  29.638 193.010 1.00 97.40  ? 1310 MET A SD  1 
ATOM   869  C CE  . MET A 1 124 ? -8.722  28.702 192.597 1.00 125.23 ? 1310 MET A CE  1 
ATOM   870  N N   . GLU A 1 125 ? -5.871  34.618 196.049 1.00 68.18  ? 1311 GLU A N   1 
ATOM   871  C CA  . GLU A 1 125 ? -4.786  35.254 196.776 1.00 58.31  ? 1311 GLU A CA  1 
ATOM   872  C C   . GLU A 1 125 ? -5.202  36.352 197.745 1.00 69.37  ? 1311 GLU A C   1 
ATOM   873  O O   . GLU A 1 125 ? -4.447  36.694 198.649 1.00 75.56  ? 1311 GLU A O   1 
ATOM   874  C CB  . GLU A 1 125 ? -3.724  35.770 195.808 1.00 65.06  ? 1311 GLU A CB  1 
ATOM   875  C CG  . GLU A 1 125 ? -2.314  35.406 196.213 1.00 75.99  ? 1311 GLU A CG  1 
ATOM   876  C CD  . GLU A 1 125 ? -2.041  33.922 196.081 1.00 87.26  ? 1311 GLU A CD  1 
ATOM   877  O OE1 . GLU A 1 125 ? -2.510  33.312 195.100 1.00 76.24  ? 1311 GLU A OE1 1 
ATOM   878  O OE2 . GLU A 1 125 ? -1.351  33.362 196.956 1.00 93.10  ? 1311 GLU A OE2 1 
ATOM   879  N N   . ILE A 1 126 ? -6.395  36.905 197.571 1.00 57.00  ? 1312 ILE A N   1 
ATOM   880  C CA  . ILE A 1 126 ? -6.837  37.967 198.470 1.00 50.36  ? 1312 ILE A CA  1 
ATOM   881  C C   . ILE A 1 126 ? -8.349  37.948 198.552 1.00 47.81  ? 1312 ILE A C   1 
ATOM   882  O O   . ILE A 1 126 ? -8.972  38.763 199.214 1.00 54.12  ? 1312 ILE A O   1 
ATOM   883  C CB  . ILE A 1 126 ? -6.353  39.357 197.995 1.00 57.83  ? 1312 ILE A CB  1 
ATOM   884  C CG1 . ILE A 1 126 ? -7.240  39.871 196.864 1.00 57.38  ? 1312 ILE A CG1 1 
ATOM   885  C CG2 . ILE A 1 126 ? -4.862  39.325 197.597 1.00 50.32  ? 1312 ILE A CG2 1 
ATOM   886  C CD1 . ILE A 1 126 ? -6.699  41.071 196.210 1.00 54.06  ? 1312 ILE A CD1 1 
ATOM   887  N N   . PHE A 1 127 ? -8.937  37.009 197.833 1.00 54.95  ? 1313 PHE A N   1 
ATOM   888  C CA  . PHE A 1 127 ? -10.363 36.764 197.886 1.00 53.02  ? 1313 PHE A CA  1 
ATOM   889  C C   . PHE A 1 127 ? -11.134 38.043 197.781 1.00 66.80  ? 1313 PHE A C   1 
ATOM   890  O O   . PHE A 1 127 ? -11.949 38.368 198.656 1.00 52.19  ? 1313 PHE A O   1 
ATOM   891  C CB  . PHE A 1 127 ? -10.691 35.961 199.137 1.00 41.87  ? 1313 PHE A CB  1 
ATOM   892  C CG  . PHE A 1 127 ? -9.910  34.714 199.210 1.00 45.75  ? 1313 PHE A CG  1 
ATOM   893  C CD1 . PHE A 1 127 ? -8.638  34.717 199.760 1.00 35.11  ? 1313 PHE A CD1 1 
ATOM   894  C CD2 . PHE A 1 127 ? -10.397 33.551 198.630 1.00 33.89  ? 1313 PHE A CD2 1 
ATOM   895  C CE1 . PHE A 1 127 ? -7.885  33.575 199.792 1.00 41.73  ? 1313 PHE A CE1 1 
ATOM   896  C CE2 . PHE A 1 127 ? -9.641  32.392 198.645 1.00 50.64  ? 1313 PHE A CE2 1 
ATOM   897  C CZ  . PHE A 1 127 ? -8.379  32.403 199.235 1.00 48.58  ? 1313 PHE A CZ  1 
ATOM   898  N N   . ASP A 1 128 ? -10.890 38.784 196.706 1.00 59.71  ? 1314 ASP A N   1 
ATOM   899  C CA  . ASP A 1 128 ? -11.772 39.901 196.449 1.00 52.83  ? 1314 ASP A CA  1 
ATOM   900  C C   . ASP A 1 128 ? -12.827 39.575 195.395 1.00 52.09  ? 1314 ASP A C   1 
ATOM   901  O O   . ASP A 1 128 ? -12.694 39.944 194.245 1.00 63.94  ? 1314 ASP A O   1 
ATOM   902  C CB  . ASP A 1 128 ? -11.011 41.159 196.116 1.00 40.55  ? 1314 ASP A CB  1 
ATOM   903  C CG  . ASP A 1 128 ? -11.862 42.388 196.327 1.00 61.53  ? 1314 ASP A CG  1 
ATOM   904  O OD1 . ASP A 1 128 ? -13.096 42.309 196.069 1.00 66.92  ? 1314 ASP A OD1 1 
ATOM   905  O OD2 . ASP A 1 128 ? -11.314 43.431 196.773 1.00 67.57  ? 1314 ASP A OD2 1 
ATOM   906  N N   . TYR A 1 129 ? -13.886 38.898 195.803 1.00 44.18  ? 1315 TYR A N   1 
ATOM   907  C CA  . TYR A 1 129 ? -14.901 38.475 194.862 1.00 51.63  ? 1315 TYR A CA  1 
ATOM   908  C C   . TYR A 1 129 ? -15.643 39.598 194.160 1.00 40.26  ? 1315 TYR A C   1 
ATOM   909  O O   . TYR A 1 129 ? -16.170 39.398 193.094 1.00 53.81  ? 1315 TYR A O   1 
ATOM   910  C CB  . TYR A 1 129 ? -15.948 37.602 195.553 1.00 46.27  ? 1315 TYR A CB  1 
ATOM   911  C CG  . TYR A 1 129 ? -15.495 36.229 195.948 1.00 40.10  ? 1315 TYR A CG  1 
ATOM   912  C CD1 . TYR A 1 129 ? -14.162 35.860 195.876 1.00 32.18  ? 1315 TYR A CD1 1 
ATOM   913  C CD2 . TYR A 1 129 ? -16.406 35.310 196.449 1.00 45.11  ? 1315 TYR A CD2 1 
ATOM   914  C CE1 . TYR A 1 129 ? -13.753 34.595 196.258 1.00 22.03  ? 1315 TYR A CE1 1 
ATOM   915  C CE2 . TYR A 1 129 ? -16.017 34.048 196.823 1.00 21.59  ? 1315 TYR A CE2 1 
ATOM   916  C CZ  . TYR A 1 129 ? -14.691 33.691 196.734 1.00 59.33  ? 1315 TYR A CZ  1 
ATOM   917  O OH  . TYR A 1 129 ? -14.302 32.411 197.118 1.00 39.90  ? 1315 TYR A OH  1 
ATOM   918  N N   . GLU A 1 130 ? -15.761 40.754 194.778 1.00 42.29  ? 1316 GLU A N   1 
ATOM   919  C CA  . GLU A 1 130 ? -16.497 41.838 194.142 1.00 58.66  ? 1316 GLU A CA  1 
ATOM   920  C C   . GLU A 1 130 ? -15.690 42.302 192.926 1.00 63.71  ? 1316 GLU A C   1 
ATOM   921  O O   . GLU A 1 130 ? -16.221 42.464 191.828 1.00 64.27  ? 1316 GLU A O   1 
ATOM   922  C CB  . GLU A 1 130 ? -16.766 43.000 195.112 1.00 56.19  ? 1316 GLU A CB  1 
ATOM   923  C CG  . GLU A 1 130 ? -17.378 42.615 196.508 1.00 146.06 ? 1316 GLU A CG  1 
ATOM   924  C CD  . GLU A 1 130 ? -16.366 42.699 197.702 1.00 122.34 ? 1316 GLU A CD  1 
ATOM   925  O OE1 . GLU A 1 130 ? -15.393 41.887 197.775 1.00 117.80 ? 1316 GLU A OE1 1 
ATOM   926  O OE2 . GLU A 1 130 ? -16.558 43.588 198.573 1.00 112.84 ? 1316 GLU A OE2 1 
ATOM   927  N N   . LEU A 1 131 ? -14.392 42.471 193.139 1.00 49.97  ? 1317 LEU A N   1 
ATOM   928  C CA  . LEU A 1 131 ? -13.437 42.728 192.068 1.00 56.03  ? 1317 LEU A CA  1 
ATOM   929  C C   . LEU A 1 131 ? -13.335 41.636 191.036 1.00 50.97  ? 1317 LEU A C   1 
ATOM   930  O O   . LEU A 1 131 ? -13.110 41.906 189.878 1.00 52.17  ? 1317 LEU A O   1 
ATOM   931  C CB  . LEU A 1 131 ? -12.047 42.949 192.644 1.00 41.91  ? 1317 LEU A CB  1 
ATOM   932  C CG  . LEU A 1 131 ? -11.514 44.359 192.499 1.00 35.20  ? 1317 LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 131 ? -12.620 45.391 192.688 1.00 35.25  ? 1317 LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 131 ? -10.448 44.555 193.491 1.00 41.84  ? 1317 LEU A CD2 1 
ATOM   935  N N   . LEU A 1 132 ? -13.474 40.403 191.502 1.00 58.84  ? 1318 LEU A N   1 
ATOM   936  C CA  . LEU A 1 132 ? -13.408 39.231 190.654 1.00 46.96  ? 1318 LEU A CA  1 
ATOM   937  C C   . LEU A 1 132 ? -14.560 39.214 189.672 1.00 51.97  ? 1318 LEU A C   1 
ATOM   938  O O   . LEU A 1 132 ? -14.389 38.878 188.511 1.00 54.08  ? 1318 LEU A O   1 
ATOM   939  C CB  . LEU A 1 132 ? -13.428 37.969 191.509 1.00 41.15  ? 1318 LEU A CB  1 
ATOM   940  C CG  . LEU A 1 132 ? -13.223 36.662 190.758 1.00 42.93  ? 1318 LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 132 ? -12.075 36.797 189.792 1.00 46.73  ? 1318 LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 132 ? -12.974 35.547 191.736 1.00 38.16  ? 1318 LEU A CD2 1 
ATOM   943  N N   . SER A 1 133 ? -15.741 39.577 190.154 1.00 48.34  ? 1319 SER A N   1 
ATOM   944  C CA  . SER A 1 133 ? -16.931 39.606 189.320 1.00 63.34  ? 1319 SER A CA  1 
ATOM   945  C C   . SER A 1 133 ? -16.777 40.634 188.217 1.00 52.75  ? 1319 SER A C   1 
ATOM   946  O O   . SER A 1 133 ? -17.156 40.396 187.077 1.00 57.10  ? 1319 SER A O   1 
ATOM   947  C CB  . SER A 1 133 ? -18.163 39.919 190.162 1.00 39.59  ? 1319 SER A CB  1 
ATOM   948  O OG  . SER A 1 133 ? -17.974 41.112 190.896 1.00 76.50  ? 1319 SER A OG  1 
ATOM   949  N N   . GLN A 1 134 ? -16.215 41.783 188.567 1.00 44.87  ? 1320 GLN A N   1 
ATOM   950  C CA  . GLN A 1 134 ? -16.004 42.847 187.603 1.00 54.16  ? 1320 GLN A CA  1 
ATOM   951  C C   . GLN A 1 134 ? -15.048 42.359 186.535 1.00 47.24  ? 1320 GLN A C   1 
ATOM   952  O O   . GLN A 1 134 ? -15.225 42.636 185.357 1.00 53.89  ? 1320 GLN A O   1 
ATOM   953  C CB  . GLN A 1 134 ? -15.438 44.086 188.287 1.00 53.69  ? 1320 GLN A CB  1 
ATOM   954  C CG  . GLN A 1 134 ? -16.441 44.815 189.152 1.00 69.90  ? 1320 GLN A CG  1 
ATOM   955  C CD  . GLN A 1 134 ? -17.773 44.986 188.460 1.00 81.18  ? 1320 GLN A CD  1 
ATOM   956  O OE1 . GLN A 1 134 ? -18.329 44.033 187.924 1.00 85.83  ? 1320 GLN A OE1 1 
ATOM   957  N NE2 . GLN A 1 134 ? -18.295 46.204 188.471 1.00 68.08  ? 1320 GLN A NE2 1 
ATOM   958  N N   . ASN A 1 135 ? -14.031 41.626 186.964 1.00 51.53  ? 1321 ASN A N   1 
ATOM   959  C CA  . ASN A 1 135 ? -13.035 41.081 186.064 1.00 39.78  ? 1321 ASN A CA  1 
ATOM   960  C C   . ASN A 1 135 ? -13.678 40.100 185.103 1.00 51.70  ? 1321 ASN A C   1 
ATOM   961  O O   . ASN A 1 135 ? -13.396 40.103 183.911 1.00 41.18  ? 1321 ASN A O   1 
ATOM   962  C CB  . ASN A 1 135 ? -11.979 40.355 186.890 1.00 45.67  ? 1321 ASN A CB  1 
ATOM   963  C CG  . ASN A 1 135 ? -10.802 39.909 186.071 1.00 38.99  ? 1321 ASN A CG  1 
ATOM   964  O OD1 . ASN A 1 135 ? -9.757  40.546 186.078 1.00 47.95  ? 1321 ASN A OD1 1 
ATOM   965  N ND2 . ASN A 1 135 ? -10.953 38.792 185.382 1.00 43.78  ? 1321 ASN A ND2 1 
ATOM   966  N N   . LEU A 1 136 ? -14.538 39.247 185.640 1.00 49.29  ? 1322 LEU A N   1 
ATOM   967  C CA  . LEU A 1 136 ? -15.232 38.250 184.843 1.00 31.24  ? 1322 LEU A CA  1 
ATOM   968  C C   . LEU A 1 136 ? -16.148 38.915 183.834 1.00 41.49  ? 1322 LEU A C   1 
ATOM   969  O O   . LEU A 1 136 ? -16.268 38.460 182.706 1.00 64.71  ? 1322 LEU A O   1 
ATOM   970  C CB  . LEU A 1 136 ? -15.991 37.277 185.735 1.00 40.84  ? 1322 LEU A CB  1 
ATOM   971  C CG  . LEU A 1 136 ? -15.044 36.432 186.580 1.00 36.35  ? 1322 LEU A CG  1 
ATOM   972  C CD1 . LEU A 1 136 ? -15.788 35.415 187.408 1.00 40.95  ? 1322 LEU A CD1 1 
ATOM   973  C CD2 . LEU A 1 136 ? -14.039 35.755 185.683 1.00 36.05  ? 1322 LEU A CD2 1 
ATOM   974  N N   . ILE A 1 137 ? -16.799 39.994 184.245 1.00 29.79  ? 1323 ILE A N   1 
ATOM   975  C CA  . ILE A 1 137 ? -17.695 40.711 183.353 1.00 51.58  ? 1323 ILE A CA  1 
ATOM   976  C C   . ILE A 1 137 ? -16.882 41.253 182.191 1.00 55.02  ? 1323 ILE A C   1 
ATOM   977  O O   . ILE A 1 137 ? -17.313 41.212 181.046 1.00 46.97  ? 1323 ILE A O   1 
ATOM   978  C CB  . ILE A 1 137 ? -18.377 41.887 184.063 1.00 67.90  ? 1323 ILE A CB  1 
ATOM   979  C CG1 . ILE A 1 137 ? -19.347 41.380 185.129 1.00 51.17  ? 1323 ILE A CG1 1 
ATOM   980  C CG2 . ILE A 1 137 ? -19.105 42.758 183.061 1.00 31.83  ? 1323 ILE A CG2 1 
ATOM   981  C CD1 . ILE A 1 137 ? -20.418 40.476 184.595 1.00 66.40  ? 1323 ILE A CD1 1 
ATOM   982  N N   . GLN A 1 138 ? -15.691 41.750 182.492 1.00 40.39  ? 1324 GLN A N   1 
ATOM   983  C CA  . GLN A 1 138 ? -14.798 42.281 181.477 1.00 42.82  ? 1324 GLN A CA  1 
ATOM   984  C C   . GLN A 1 138 ? -14.296 41.204 180.535 1.00 53.05  ? 1324 GLN A C   1 
ATOM   985  O O   . GLN A 1 138 ? -14.278 41.391 179.336 1.00 55.18  ? 1324 GLN A O   1 
ATOM   986  C CB  . GLN A 1 138 ? -13.612 42.980 182.125 1.00 45.93  ? 1324 GLN A CB  1 
ATOM   987  C CG  . GLN A 1 138 ? -13.809 44.454 182.353 1.00 50.06  ? 1324 GLN A CG  1 
ATOM   988  C CD  . GLN A 1 138 ? -14.194 45.185 181.093 1.00 79.83  ? 1324 GLN A CD  1 
ATOM   989  O OE1 . GLN A 1 138 ? -13.505 46.101 180.660 1.00 82.35  ? 1324 GLN A OE1 1 
ATOM   990  N NE2 . GLN A 1 138 ? -15.298 44.779 180.491 1.00 79.25  ? 1324 GLN A NE2 1 
ATOM   991  N N   . GLN A 1 139 ? -13.874 40.075 181.076 1.00 36.52  ? 1325 GLN A N   1 
ATOM   992  C CA  . GLN A 1 139 ? -13.390 38.997 180.237 1.00 40.38  ? 1325 GLN A CA  1 
ATOM   993  C C   . GLN A 1 139 ? -14.467 38.520 179.292 1.00 55.53  ? 1325 GLN A C   1 
ATOM   994  O O   . GLN A 1 139 ? -14.179 37.972 178.241 1.00 64.63  ? 1325 GLN A O   1 
ATOM   995  C CB  . GLN A 1 139 ? -12.941 37.815 181.079 1.00 30.85  ? 1325 GLN A CB  1 
ATOM   996  C CG  . GLN A 1 139 ? -11.719 38.049 181.897 1.00 29.76  ? 1325 GLN A CG  1 
ATOM   997  C CD  . GLN A 1 139 ? -11.196 36.774 182.465 1.00 46.21  ? 1325 GLN A CD  1 
ATOM   998  O OE1 . GLN A 1 139 ? -10.964 36.663 183.657 1.00 58.32  ? 1325 GLN A OE1 1 
ATOM   999  N NE2 . GLN A 1 139 ? -11.021 35.788 181.614 1.00 37.84  ? 1325 GLN A NE2 1 
ATOM   1000 N N   . ALA A 1 140 ? -15.717 38.710 179.679 1.00 45.41  ? 1326 ALA A N   1 
ATOM   1001 C CA  . ALA A 1 140 ? -16.831 38.243 178.878 1.00 39.19  ? 1326 ALA A CA  1 
ATOM   1002 C C   . ALA A 1 140 ? -17.105 39.186 177.730 1.00 46.35  ? 1326 ALA A C   1 
ATOM   1003 O O   . ALA A 1 140 ? -17.560 38.771 176.679 1.00 56.54  ? 1326 ALA A O   1 
ATOM   1004 C CB  . ALA A 1 140 ? -18.047 38.082 179.731 1.00 31.21  ? 1326 ALA A CB  1 
ATOM   1005 N N   . LYS A 1 141 ? -16.821 40.463 177.939 1.00 45.46  ? 1327 LYS A N   1 
ATOM   1006 C CA  . LYS A 1 141 ? -16.969 41.468 176.901 1.00 60.16  ? 1327 LYS A CA  1 
ATOM   1007 C C   . LYS A 1 141 ? -15.970 41.210 175.804 1.00 55.52  ? 1327 LYS A C   1 
ATOM   1008 O O   . LYS A 1 141 ? -16.267 41.328 174.628 1.00 47.75  ? 1327 LYS A O   1 
ATOM   1009 C CB  . LYS A 1 141 ? -16.663 42.847 177.461 1.00 46.83  ? 1327 LYS A CB  1 
ATOM   1010 C CG  . LYS A 1 141 ? -17.836 43.594 178.017 1.00 61.63  ? 1327 LYS A CG  1 
ATOM   1011 C CD  . LYS A 1 141 ? -17.401 44.988 178.389 1.00 87.41  ? 1327 LYS A CD  1 
ATOM   1012 C CE  . LYS A 1 141 ? -16.451 45.532 177.340 1.00 79.03  ? 1327 LYS A CE  1 
ATOM   1013 N NZ  . LYS A 1 141 ? -15.835 46.824 177.746 1.00 93.50  ? 1327 LYS A NZ  1 
ATOM   1014 N N   . PHE A 1 142 ? -14.759 40.878 176.208 1.00 60.11  ? 1328 PHE A N   1 
ATOM   1015 C CA  . PHE A 1 142 ? -13.702 40.676 175.279 1.00 50.66  ? 1328 PHE A CA  1 
ATOM   1016 C C   . PHE A 1 142 ? -14.002 39.477 174.415 1.00 53.82  ? 1328 PHE A C   1 
ATOM   1017 O O   . PHE A 1 142 ? -13.986 39.563 173.202 1.00 57.14  ? 1328 PHE A O   1 
ATOM   1018 C CB  . PHE A 1 142 ? -12.384 40.533 176.030 1.00 48.34  ? 1328 PHE A CB  1 
ATOM   1019 C CG  . PHE A 1 142 ? -11.960 41.796 176.756 1.00 54.81  ? 1328 PHE A CG  1 
ATOM   1020 C CD1 . PHE A 1 142 ? -12.399 43.038 176.330 1.00 48.14  ? 1328 PHE A CD1 1 
ATOM   1021 C CD2 . PHE A 1 142 ? -11.106 41.738 177.855 1.00 52.05  ? 1328 PHE A CD2 1 
ATOM   1022 C CE1 . PHE A 1 142 ? -12.023 44.198 176.996 1.00 52.89  ? 1328 PHE A CE1 1 
ATOM   1023 C CE2 . PHE A 1 142 ? -10.727 42.901 178.525 1.00 49.78  ? 1328 PHE A CE2 1 
ATOM   1024 C CZ  . PHE A 1 142 ? -11.190 44.135 178.088 1.00 54.83  ? 1328 PHE A CZ  1 
ATOM   1025 N N   . TYR A 1 143 ? -14.316 38.346 175.033 1.00 56.55  ? 1329 TYR A N   1 
ATOM   1026 C CA  . TYR A 1 143 ? -14.565 37.120 174.294 1.00 51.63  ? 1329 TYR A CA  1 
ATOM   1027 C C   . TYR A 1 143 ? -15.713 37.289 173.340 1.00 39.03  ? 1329 TYR A C   1 
ATOM   1028 O O   . TYR A 1 143 ? -15.756 36.630 172.328 1.00 49.19  ? 1329 TYR A O   1 
ATOM   1029 C CB  . TYR A 1 143 ? -14.927 35.988 175.245 1.00 55.87  ? 1329 TYR A CB  1 
ATOM   1030 C CG  . TYR A 1 143 ? -13.762 35.303 175.869 1.00 59.21  ? 1329 TYR A CG  1 
ATOM   1031 C CD1 . TYR A 1 143 ? -12.477 35.658 175.540 1.00 80.81  ? 1329 TYR A CD1 1 
ATOM   1032 C CD2 . TYR A 1 143 ? -13.946 34.267 176.774 1.00 79.46  ? 1329 TYR A CD2 1 
ATOM   1033 C CE1 . TYR A 1 143 ? -11.387 35.004 176.103 1.00 82.99  ? 1329 TYR A CE1 1 
ATOM   1034 C CE2 . TYR A 1 143 ? -12.866 33.614 177.353 1.00 76.32  ? 1329 TYR A CE2 1 
ATOM   1035 C CZ  . TYR A 1 143 ? -11.592 33.987 177.011 1.00 49.53  ? 1329 TYR A CZ  1 
ATOM   1036 O OH  . TYR A 1 143 ? -10.526 33.334 177.582 1.00 54.58  ? 1329 TYR A OH  1 
ATOM   1037 N N   . GLU A 1 144 ? -16.662 38.150 173.705 1.00 48.10  ? 1330 GLU A N   1 
ATOM   1038 C CA  . GLU A 1 144 ? -17.793 38.375 172.852 1.00 48.98  ? 1330 GLU A CA  1 
ATOM   1039 C C   . GLU A 1 144 ? -17.252 39.157 171.651 1.00 61.73  ? 1330 GLU A C   1 
ATOM   1040 O O   . GLU A 1 144 ? -17.373 38.701 170.504 1.00 57.65  ? 1330 GLU A O   1 
ATOM   1041 C CB  . GLU A 1 144 ? -18.904 39.132 173.620 1.00 64.62  ? 1330 GLU A CB  1 
ATOM   1042 C CG  . GLU A 1 144 ? -20.202 39.490 172.842 1.00 67.94  ? 1330 GLU A CG  1 
ATOM   1043 C CD  . GLU A 1 144 ? -21.101 38.282 172.518 1.00 97.52  ? 1330 GLU A CD  1 
ATOM   1044 O OE1 . GLU A 1 144 ? -20.613 37.128 172.576 1.00 109.98 ? 1330 GLU A OE1 1 
ATOM   1045 O OE2 . GLU A 1 144 ? -22.301 38.481 172.185 1.00 99.66  ? 1330 GLU A OE2 1 
ATOM   1046 N N   . SER A 1 145 ? -16.620 40.300 171.927 1.00 39.67  ? 1331 SER A N   1 
ATOM   1047 C CA  . SER A 1 145 ? -16.086 41.149 170.903 1.00 36.01  ? 1331 SER A CA  1 
ATOM   1048 C C   . SER A 1 145 ? -15.260 40.380 169.914 1.00 45.69  ? 1331 SER A C   1 
ATOM   1049 O O   . SER A 1 145 ? -15.294 40.666 168.738 1.00 48.72  ? 1331 SER A O   1 
ATOM   1050 C CB  . SER A 1 145 ? -15.175 42.171 171.509 1.00 51.38  ? 1331 SER A CB  1 
ATOM   1051 O OG  . SER A 1 145 ? -15.690 42.657 172.711 1.00 51.07  ? 1331 SER A OG  1 
ATOM   1052 N N   . ILE A 1 146 ? -14.490 39.419 170.397 1.00 40.65  ? 1332 ILE A N   1 
ATOM   1053 C CA  . ILE A 1 146 ? -13.644 38.640 169.536 1.00 37.61  ? 1332 ILE A CA  1 
ATOM   1054 C C   . ILE A 1 146 ? -14.482 38.003 168.489 1.00 47.06  ? 1332 ILE A C   1 
ATOM   1055 O O   . ILE A 1 146 ? -14.077 37.946 167.340 1.00 72.89  ? 1332 ILE A O   1 
ATOM   1056 C CB  . ILE A 1 146 ? -12.909 37.562 170.288 1.00 46.68  ? 1332 ILE A CB  1 
ATOM   1057 C CG1 . ILE A 1 146 ? -11.650 38.167 170.914 1.00 49.71  ? 1332 ILE A CG1 1 
ATOM   1058 C CG2 . ILE A 1 146 ? -12.548 36.416 169.350 1.00 34.17  ? 1332 ILE A CG2 1 
ATOM   1059 C CD1 . ILE A 1 146 ? -10.916 37.257 171.871 1.00 38.68  ? 1332 ILE A CD1 1 
ATOM   1060 N N   . MET A 1 147 ? -15.669 37.563 168.877 1.00 50.35  ? 1333 MET A N   1 
ATOM   1061 C CA  . MET A 1 147 ? -16.573 36.864 167.968 1.00 54.60  ? 1333 MET A CA  1 
ATOM   1062 C C   . MET A 1 147 ? -17.397 37.778 167.117 1.00 51.60  ? 1333 MET A C   1 
ATOM   1063 O O   . MET A 1 147 ? -17.683 37.422 165.985 1.00 61.10  ? 1333 MET A O   1 
ATOM   1064 C CB  . MET A 1 147 ? -17.537 35.959 168.730 1.00 49.56  ? 1333 MET A CB  1 
ATOM   1065 C CG  . MET A 1 147 ? -16.886 34.760 169.392 1.00 67.72  ? 1333 MET A CG  1 
ATOM   1066 S SD  . MET A 1 147 ? -15.792 33.892 168.279 1.00 73.35  ? 1333 MET A SD  1 
ATOM   1067 C CE  . MET A 1 147 ? -16.066 32.191 168.762 1.00 146.48 ? 1333 MET A CE  1 
ATOM   1068 N N   . LYS A 1 148 ? -17.789 38.931 167.658 1.00 51.61  ? 1334 LYS A N   1 
ATOM   1069 C CA  . LYS A 1 148 ? -18.822 39.766 167.031 1.00 54.96  ? 1334 LYS A CA  1 
ATOM   1070 C C   . LYS A 1 148 ? -18.334 41.096 166.461 1.00 64.15  ? 1334 LYS A C   1 
ATOM   1071 O O   . LYS A 1 148 ? -19.061 41.764 165.749 1.00 76.88  ? 1334 LYS A O   1 
ATOM   1072 C CB  . LYS A 1 148 ? -19.956 40.068 168.018 1.00 47.85  ? 1334 LYS A CB  1 
ATOM   1073 C CG  . LYS A 1 148 ? -20.698 38.866 168.490 1.00 56.87  ? 1334 LYS A CG  1 
ATOM   1074 C CD  . LYS A 1 148 ? -22.163 39.192 168.738 1.00 76.64  ? 1334 LYS A CD  1 
ATOM   1075 C CE  . LYS A 1 148 ? -23.042 38.007 168.327 1.00 100.75 ? 1334 LYS A CE  1 
ATOM   1076 N NZ  . LYS A 1 148 ? -22.343 36.687 168.568 1.00 121.54 ? 1334 LYS A NZ  1 
ATOM   1077 N N   . ILE A 1 149 ? -17.131 41.520 166.806 1.00 66.04  ? 1335 ILE A N   1 
ATOM   1078 C CA  . ILE A 1 149 ? -16.556 42.698 166.186 1.00 61.46  ? 1335 ILE A CA  1 
ATOM   1079 C C   . ILE A 1 149 ? -15.387 42.267 165.302 1.00 77.07  ? 1335 ILE A C   1 
ATOM   1080 O O   . ILE A 1 149 ? -14.401 41.683 165.801 1.00 80.46  ? 1335 ILE A O   1 
ATOM   1081 C CB  . ILE A 1 149 ? -16.105 43.710 167.232 1.00 67.65  ? 1335 ILE A CB  1 
ATOM   1082 C CG1 . ILE A 1 149 ? -17.349 44.327 167.887 1.00 64.17  ? 1335 ILE A CG1 1 
ATOM   1083 C CG2 . ILE A 1 149 ? -15.182 44.743 166.595 1.00 40.82  ? 1335 ILE A CG2 1 
ATOM   1084 C CD1 . ILE A 1 149 ? -17.070 45.360 169.000 1.00 59.62  ? 1335 ILE A CD1 1 
ATOM   1085 N N   . LEU A 1 150 ? -15.507 42.530 163.990 1.00 91.71  ? 1336 LEU A N   1 
ATOM   1086 C CA  . LEU A 1 150 ? -14.424 42.226 163.016 1.00 93.49  ? 1336 LEU A CA  1 
ATOM   1087 C C   . LEU A 1 150 ? -13.418 43.356 163.087 1.00 81.74  ? 1336 LEU A C   1 
ATOM   1088 O O   . LEU A 1 150 ? -13.796 44.554 163.090 1.00 75.91  ? 1336 LEU A O   1 
ATOM   1089 C CB  . LEU A 1 150 ? -14.963 42.067 161.587 1.00 97.59  ? 1336 LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 150 ? -16.047 40.994 161.258 1.00 103.65 ? 1336 LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 150 ? -15.579 40.008 160.186 1.00 72.99  ? 1336 LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 150 ? -16.684 40.229 162.484 1.00 78.36  ? 1336 LEU A CD2 1 
ATOM   1093 N N   . ARG A 1 151 ? -12.152 42.973 163.216 1.00 50.39  ? 1337 ARG A N   1 
ATOM   1094 C CA  . ARG A 1 151 ? -11.094 43.954 163.374 1.00 52.82  ? 1337 ARG A CA  1 
ATOM   1095 C C   . ARG A 1 151 ? -10.295 43.908 162.092 1.00 55.17  ? 1337 ARG A C   1 
ATOM   1096 O O   . ARG A 1 151 ? -9.844  42.843 161.678 1.00 55.63  ? 1337 ARG A O   1 
ATOM   1097 C CB  . ARG A 1 151 ? -10.205 43.596 164.569 1.00 43.68  ? 1337 ARG A CB  1 
ATOM   1098 C CG  . ARG A 1 151 ? -10.956 43.445 165.887 1.00 54.31  ? 1337 ARG A CG  1 
ATOM   1099 C CD  . ARG A 1 151 ? -10.119 42.769 166.944 1.00 41.03  ? 1337 ARG A CD  1 
ATOM   1100 N NE  . ARG A 1 151 ? -10.302 41.324 166.941 1.00 39.61  ? 1337 ARG A NE  1 
ATOM   1101 C CZ  . ARG A 1 151 ? -9.641  40.505 167.751 1.00 40.19  ? 1337 ARG A CZ  1 
ATOM   1102 N NH1 . ARG A 1 151 ? -8.775  41.029 168.624 1.00 33.01  ? 1337 ARG A NH1 1 
ATOM   1103 N NH2 . ARG A 1 151 ? -9.866  39.182 167.717 1.00 30.10  ? 1337 ARG A NH2 1 
ATOM   1104 N N   . PRO A 1 152 ? -10.109 45.054 161.456 1.00 42.14  ? 1338 PRO A N   1 
ATOM   1105 C CA  . PRO A 1 152 ? -9.495  45.085 160.142 1.00 42.91  ? 1338 PRO A CA  1 
ATOM   1106 C C   . PRO A 1 152 ? -8.102  44.503 160.213 1.00 46.20  ? 1338 PRO A C   1 
ATOM   1107 O O   . PRO A 1 152 ? -7.367  44.812 161.146 1.00 55.87  ? 1338 PRO A O   1 
ATOM   1108 C CB  . PRO A 1 152 ? -9.414  46.566 159.829 1.00 37.03  ? 1338 PRO A CB  1 
ATOM   1109 C CG  . PRO A 1 152 ? -10.365 47.221 160.770 1.00 55.38  ? 1338 PRO A CG  1 
ATOM   1110 C CD  . PRO A 1 152 ? -10.345 46.393 161.999 1.00 51.72  ? 1338 PRO A CD  1 
ATOM   1111 N N   . LYS A 1 153 ? -7.754  43.657 159.251 1.00 50.11  ? 1339 LYS A N   1 
ATOM   1112 C CA  . LYS A 1 153 ? -6.466  43.045 159.217 1.00 29.64  ? 1339 LYS A CA  1 
ATOM   1113 C C   . LYS A 1 153 ? -5.423  44.118 158.883 1.00 57.01  ? 1339 LYS A C   1 
ATOM   1114 O O   . LYS A 1 153 ? -5.599  44.907 157.952 1.00 45.85  ? 1339 LYS A O   1 
ATOM   1115 C CB  . LYS A 1 153 ? -6.519  41.907 158.223 1.00 46.30  ? 1339 LYS A CB  1 
ATOM   1116 C CG  . LYS A 1 153 ? -5.295  41.664 157.391 1.00 67.52  ? 1339 LYS A CG  1 
ATOM   1117 C CD  . LYS A 1 153 ? -5.676  40.928 156.058 1.00 74.53  ? 1339 LYS A CD  1 
ATOM   1118 C CE  . LYS A 1 153 ? -4.860  41.442 154.817 1.00 79.16  ? 1339 LYS A CE  1 
ATOM   1119 N NZ  . LYS A 1 153 ? -4.815  42.982 154.664 1.00 67.53  ? 1339 LYS A NZ  1 
ATOM   1120 N N   . PRO A 1 154 ? -4.354  44.208 159.682 1.00 34.14  ? 1340 PRO A N   1 
ATOM   1121 C CA  . PRO A 1 154 ? -3.327  45.171 159.356 1.00 43.32  ? 1340 PRO A CA  1 
ATOM   1122 C C   . PRO A 1 154 ? -2.389  44.661 158.222 1.00 55.78  ? 1340 PRO A C   1 
ATOM   1123 O O   . PRO A 1 154 ? -2.302  43.435 157.954 1.00 40.82  ? 1340 PRO A O   1 
ATOM   1124 C CB  . PRO A 1 154 ? -2.568  45.297 160.669 1.00 32.71  ? 1340 PRO A CB  1 
ATOM   1125 C CG  . PRO A 1 154 ? -2.641  43.928 161.251 1.00 37.41  ? 1340 PRO A CG  1 
ATOM   1126 C CD  . PRO A 1 154 ? -4.031  43.454 160.904 1.00 36.86  ? 1340 PRO A CD  1 
ATOM   1127 N N   . ASP A 1 155 ? -1.697  45.590 157.559 1.00 47.50  ? 1341 ASP A N   1 
ATOM   1128 C CA  . ASP A 1 155 ? -0.715  45.200 156.574 1.00 29.52  ? 1341 ASP A CA  1 
ATOM   1129 C C   . ASP A 1 155 ? 0.663   45.331 157.180 1.00 52.05  ? 1341 ASP A C   1 
ATOM   1130 O O   . ASP A 1 155 ? 0.891   46.139 158.097 1.00 48.25  ? 1341 ASP A O   1 
ATOM   1131 C CB  . ASP A 1 155 ? -0.804  46.072 155.313 1.00 59.94  ? 1341 ASP A CB  1 
ATOM   1132 C CG  . ASP A 1 155 ? -1.885  45.606 154.344 1.00 71.29  ? 1341 ASP A CG  1 
ATOM   1133 O OD1 . ASP A 1 155 ? -2.028  44.379 154.223 1.00 71.71  ? 1341 ASP A OD1 1 
ATOM   1134 O OD2 . ASP A 1 155 ? -2.589  46.445 153.706 1.00 76.88  ? 1341 ASP A OD2 1 
ATOM   1135 N N   . TYR A 1 156 ? 1.585   44.553 156.619 1.00 52.20  ? 1342 TYR A N   1 
ATOM   1136 C CA  . TYR A 1 156 ? 2.990   44.683 156.922 1.00 50.65  ? 1342 TYR A CA  1 
ATOM   1137 C C   . TYR A 1 156 ? 3.853   45.109 155.725 1.00 57.16  ? 1342 TYR A C   1 
ATOM   1138 O O   . TYR A 1 156 ? 3.680   44.621 154.617 1.00 54.69  ? 1342 TYR A O   1 
ATOM   1139 C CB  . TYR A 1 156 ? 3.471   43.401 157.497 1.00 48.10  ? 1342 TYR A CB  1 
ATOM   1140 C CG  . TYR A 1 156 ? 2.793   43.110 158.796 1.00 51.18  ? 1342 TYR A CG  1 
ATOM   1141 C CD1 . TYR A 1 156 ? 3.271   43.636 159.993 1.00 44.37  ? 1342 TYR A CD1 1 
ATOM   1142 C CD2 . TYR A 1 156 ? 1.662   42.308 158.837 1.00 50.53  ? 1342 TYR A CD2 1 
ATOM   1143 C CE1 . TYR A 1 156 ? 2.661   43.352 161.196 1.00 30.00  ? 1342 TYR A CE1 1 
ATOM   1144 C CE2 . TYR A 1 156 ? 1.036   42.034 160.032 1.00 40.91  ? 1342 TYR A CE2 1 
ATOM   1145 C CZ  . TYR A 1 156 ? 1.551   42.553 161.213 1.00 46.69  ? 1342 TYR A CZ  1 
ATOM   1146 O OH  . TYR A 1 156 ? 0.905   42.258 162.402 1.00 49.52  ? 1342 TYR A OH  1 
ATOM   1147 N N   . PHE A 1 157 ? 4.756   46.056 155.958 1.00 44.36  ? 1343 PHE A N   1 
ATOM   1148 C CA  . PHE A 1 157 ? 5.568   46.591 154.916 1.00 34.52  ? 1343 PHE A CA  1 
ATOM   1149 C C   . PHE A 1 157 ? 7.008   46.371 155.307 1.00 47.60  ? 1343 PHE A C   1 
ATOM   1150 O O   . PHE A 1 157 ? 7.443   46.700 156.401 1.00 48.75  ? 1343 PHE A O   1 
ATOM   1151 C CB  . PHE A 1 157 ? 5.305   48.083 154.729 1.00 29.88  ? 1343 PHE A CB  1 
ATOM   1152 C CG  . PHE A 1 157 ? 3.869   48.457 154.769 1.00 46.81  ? 1343 PHE A CG  1 
ATOM   1153 C CD1 . PHE A 1 157 ? 2.958   47.935 153.834 1.00 43.32  ? 1343 PHE A CD1 1 
ATOM   1154 C CD2 . PHE A 1 157 ? 3.401   49.329 155.743 1.00 43.39  ? 1343 PHE A CD2 1 
ATOM   1155 C CE1 . PHE A 1 157 ? 1.620   48.285 153.879 1.00 54.01  ? 1343 PHE A CE1 1 
ATOM   1156 C CE2 . PHE A 1 157 ? 2.046   49.675 155.798 1.00 37.50  ? 1343 PHE A CE2 1 
ATOM   1157 C CZ  . PHE A 1 157 ? 1.163   49.158 154.864 1.00 41.20  ? 1343 PHE A CZ  1 
ATOM   1158 N N   . ALA A 1 158 ? 7.781   45.852 154.368 1.00 53.93  ? 1344 ALA A N   1 
ATOM   1159 C CA  . ALA A 1 158 ? 9.190   45.656 154.610 1.00 50.73  ? 1344 ALA A CA  1 
ATOM   1160 C C   . ALA A 1 158 ? 9.901   46.825 153.960 1.00 37.43  ? 1344 ALA A C   1 
ATOM   1161 O O   . ALA A 1 158 ? 9.744   47.065 152.771 1.00 54.15  ? 1344 ALA A O   1 
ATOM   1162 C CB  . ALA A 1 158 ? 9.651   44.358 154.000 1.00 29.31  ? 1344 ALA A CB  1 
ATOM   1163 N N   . VAL A 1 159 ? 10.677  47.562 154.744 1.00 43.65  ? 1345 VAL A N   1 
ATOM   1164 C CA  . VAL A 1 159 ? 11.416  48.692 154.208 1.00 52.59  ? 1345 VAL A CA  1 
ATOM   1165 C C   . VAL A 1 159 ? 12.898  48.442 154.389 1.00 55.60  ? 1345 VAL A C   1 
ATOM   1166 O O   . VAL A 1 159 ? 13.358  48.135 155.482 1.00 42.59  ? 1345 VAL A O   1 
ATOM   1167 C CB  . VAL A 1 159 ? 11.048  50.013 154.893 1.00 48.43  ? 1345 VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 159 ? 9.557   50.090 155.129 1.00 57.68  ? 1345 VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 159 ? 11.799  50.154 156.189 1.00 66.60  ? 1345 VAL A CG2 1 
ATOM   1170 N N   . GLY A 1 160 ? 13.644  48.582 153.304 1.00 43.91  ? 1346 GLY A N   1 
ATOM   1171 C CA  . GLY A 1 160 ? 15.071  48.370 153.340 1.00 54.11  ? 1346 GLY A CA  1 
ATOM   1172 C C   . GLY A 1 160 ? 15.793  49.659 153.040 1.00 57.14  ? 1346 GLY A C   1 
ATOM   1173 O O   . GLY A 1 160 ? 15.474  50.347 152.080 1.00 47.50  ? 1346 GLY A O   1 
ATOM   1174 N N   . TYR A 1 161 ? 16.768  49.991 153.873 1.00 59.02  ? 1347 TYR A N   1 
ATOM   1175 C CA  . TYR A 1 161 ? 17.534  51.201 153.669 1.00 59.69  ? 1347 TYR A CA  1 
ATOM   1176 C C   . TYR A 1 161 ? 18.900  50.800 153.163 1.00 71.16  ? 1347 TYR A C   1 
ATOM   1177 O O   . TYR A 1 161 ? 19.624  50.067 153.828 1.00 78.41  ? 1347 TYR A O   1 
ATOM   1178 C CB  . TYR A 1 161 ? 17.679  51.961 154.982 1.00 62.53  ? 1347 TYR A CB  1 
ATOM   1179 C CG  . TYR A 1 161 ? 16.370  52.361 155.619 1.00 55.95  ? 1347 TYR A CG  1 
ATOM   1180 C CD1 . TYR A 1 161 ? 15.725  53.525 155.244 1.00 59.59  ? 1347 TYR A CD1 1 
ATOM   1181 C CD2 . TYR A 1 161 ? 15.789  51.581 156.604 1.00 54.71  ? 1347 TYR A CD2 1 
ATOM   1182 C CE1 . TYR A 1 161 ? 14.539  53.897 155.824 1.00 47.19  ? 1347 TYR A CE1 1 
ATOM   1183 C CE2 . TYR A 1 161 ? 14.601  51.947 157.190 1.00 51.23  ? 1347 TYR A CE2 1 
ATOM   1184 C CZ  . TYR A 1 161 ? 13.981  53.108 156.796 1.00 54.53  ? 1347 TYR A CZ  1 
ATOM   1185 O OH  . TYR A 1 161 ? 12.796  53.486 157.374 1.00 51.52  ? 1347 TYR A OH  1 
ATOM   1186 N N   . TYR A 1 162 ? 19.258  51.286 151.983 1.00 66.74  ? 1348 TYR A N   1 
ATOM   1187 C CA  . TYR A 1 162 ? 20.535  50.954 151.414 1.00 64.41  ? 1348 TYR A CA  1 
ATOM   1188 C C   . TYR A 1 162 ? 21.237  52.192 150.963 1.00 81.89  ? 1348 TYR A C   1 
ATOM   1189 O O   . TYR A 1 162 ? 20.617  53.133 150.502 1.00 99.09  ? 1348 TYR A O   1 
ATOM   1190 C CB  . TYR A 1 162 ? 20.352  50.015 150.249 1.00 54.81  ? 1348 TYR A CB  1 
ATOM   1191 C CG  . TYR A 1 162 ? 19.619  48.755 150.593 1.00 61.60  ? 1348 TYR A CG  1 
ATOM   1192 C CD1 . TYR A 1 162 ? 20.244  47.736 151.268 1.00 60.11  ? 1348 TYR A CD1 1 
ATOM   1193 C CD2 . TYR A 1 162 ? 18.304  48.584 150.236 1.00 54.99  ? 1348 TYR A CD2 1 
ATOM   1194 C CE1 . TYR A 1 162 ? 19.588  46.599 151.571 1.00 53.93  ? 1348 TYR A CE1 1 
ATOM   1195 C CE2 . TYR A 1 162 ? 17.645  47.451 150.535 1.00 46.85  ? 1348 TYR A CE2 1 
ATOM   1196 C CZ  . TYR A 1 162 ? 18.289  46.462 151.207 1.00 68.01  ? 1348 TYR A CZ  1 
ATOM   1197 O OH  . TYR A 1 162 ? 17.625  45.316 151.507 1.00 67.32  ? 1348 TYR A OH  1 
ATOM   1198 N N   . GLY A 1 163 ? 22.549  52.171 151.087 1.00 75.91  ? 1349 GLY A N   1 
ATOM   1199 C CA  . GLY A 1 163 ? 23.382  53.306 150.766 1.00 88.17  ? 1349 GLY A CA  1 
ATOM   1200 C C   . GLY A 1 163 ? 24.014  53.751 152.058 1.00 81.73  ? 1349 GLY A C   1 
ATOM   1201 O O   . GLY A 1 163 ? 23.519  53.452 153.126 1.00 86.53  ? 1349 GLY A O   1 
ATOM   1202 N N   . GLN A 1 164 ? 25.117  54.467 151.970 1.00 84.85  ? 1350 GLN A N   1 
ATOM   1203 C CA  . GLN A 1 164 ? 25.803  54.886 153.170 1.00 90.20  ? 1350 GLN A CA  1 
ATOM   1204 C C   . GLN A 1 164 ? 25.238  56.189 153.664 1.00 94.15  ? 1350 GLN A C   1 
ATOM   1205 O O   . GLN A 1 164 ? 25.682  56.731 154.658 1.00 95.56  ? 1350 GLN A O   1 
ATOM   1206 C CB  . GLN A 1 164 ? 27.302  54.998 152.943 1.00 87.34  ? 1350 GLN A CB  1 
ATOM   1207 C CG  . GLN A 1 164 ? 28.119  54.147 153.875 1.00 82.23  ? 1350 GLN A CG  1 
ATOM   1208 C CD  . GLN A 1 164 ? 28.318  52.780 153.326 1.00 95.43  ? 1350 GLN A CD  1 
ATOM   1209 O OE1 . GLN A 1 164 ? 28.017  52.530 152.171 1.00 85.74  ? 1350 GLN A OE1 1 
ATOM   1210 N NE2 . GLN A 1 164 ? 28.826  51.878 154.142 1.00 90.87  ? 1350 GLN A NE2 1 
ATOM   1211 N N   . GLY A 1 165 ? 24.245  56.696 152.965 1.00 89.12  ? 1351 GLY A N   1 
ATOM   1212 C CA  . GLY A 1 165 ? 23.641  57.935 153.381 1.00 97.64  ? 1351 GLY A CA  1 
ATOM   1213 C C   . GLY A 1 165 ? 23.069  57.721 154.756 1.00 99.04  ? 1351 GLY A C   1 
ATOM   1214 O O   . GLY A 1 165 ? 23.098  58.595 155.594 1.00 101.72 ? 1351 GLY A O   1 
ATOM   1215 N N   . PHE A 1 166 ? 22.527  56.539 154.974 1.00 96.28  ? 1352 PHE A N   1 
ATOM   1216 C CA  . PHE A 1 166 ? 21.907  56.189 156.238 1.00 91.82  ? 1352 PHE A CA  1 
ATOM   1217 C C   . PHE A 1 166 ? 22.818  56.016 157.438 1.00 81.18  ? 1352 PHE A C   1 
ATOM   1218 O O   . PHE A 1 166 ? 23.949  55.578 157.328 1.00 57.96  ? 1352 PHE A O   1 
ATOM   1219 C CB  . PHE A 1 166 ? 21.048  54.943 156.055 1.00 85.10  ? 1352 PHE A CB  1 
ATOM   1220 C CG  . PHE A 1 166 ? 20.038  55.076 154.975 1.00 70.61  ? 1352 PHE A CG  1 
ATOM   1221 C CD1 . PHE A 1 166 ? 19.072  56.040 155.040 1.00 62.70  ? 1352 PHE A CD1 1 
ATOM   1222 C CD2 . PHE A 1 166 ? 20.065  54.251 153.895 1.00 70.12  ? 1352 PHE A CD2 1 
ATOM   1223 C CE1 . PHE A 1 166 ? 18.157  56.165 154.060 1.00 67.77  ? 1352 PHE A CE1 1 
ATOM   1224 C CE2 . PHE A 1 166 ? 19.146  54.375 152.920 1.00 74.33  ? 1352 PHE A CE2 1 
ATOM   1225 C CZ  . PHE A 1 166 ? 18.194  55.332 153.002 1.00 81.56  ? 1352 PHE A CZ  1 
ATOM   1226 N N   . PRO A 1 167 ? 22.255  56.273 158.611 1.00 78.55  ? 1353 PRO A N   1 
ATOM   1227 C CA  . PRO A 1 167 ? 22.967  56.124 159.877 1.00 76.11  ? 1353 PRO A CA  1 
ATOM   1228 C C   . PRO A 1 167 ? 23.221  54.650 160.139 1.00 86.69  ? 1353 PRO A C   1 
ATOM   1229 O O   . PRO A 1 167 ? 22.579  53.805 159.524 1.00 95.70  ? 1353 PRO A O   1 
ATOM   1230 C CB  . PRO A 1 167 ? 21.981  56.683 160.908 1.00 82.64  ? 1353 PRO A CB  1 
ATOM   1231 C CG  . PRO A 1 167 ? 20.833  57.279 160.123 1.00 67.27  ? 1353 PRO A CG  1 
ATOM   1232 C CD  . PRO A 1 167 ? 21.227  57.318 158.689 1.00 63.47  ? 1353 PRO A CD  1 
ATOM   1233 N N   . SER A 1 168 ? 24.150  54.346 161.036 1.00 84.32  ? 1354 SER A N   1 
ATOM   1234 C CA  . SER A 1 168 ? 24.533  52.968 161.306 1.00 89.66  ? 1354 SER A CA  1 
ATOM   1235 C C   . SER A 1 168 ? 23.352  52.132 161.758 1.00 89.05  ? 1354 SER A C   1 
ATOM   1236 O O   . SER A 1 168 ? 23.244  50.965 161.395 1.00 95.05  ? 1354 SER A O   1 
ATOM   1237 C CB  . SER A 1 168 ? 25.635  52.919 162.363 1.00 89.04  ? 1354 SER A CB  1 
ATOM   1238 O OG  . SER A 1 168 ? 26.813  53.549 161.896 1.00 96.96  ? 1354 SER A OG  1 
ATOM   1239 N N   . PHE A 1 169 ? 22.469  52.717 162.553 1.00 82.72  ? 1355 PHE A N   1 
ATOM   1240 C CA  . PHE A 1 169 ? 21.297  51.987 163.018 1.00 85.55  ? 1355 PHE A CA  1 
ATOM   1241 C C   . PHE A 1 169 ? 20.387  51.566 161.857 1.00 77.48  ? 1355 PHE A C   1 
ATOM   1242 O O   . PHE A 1 169 ? 19.760  50.513 161.915 1.00 65.40  ? 1355 PHE A O   1 
ATOM   1243 C CB  . PHE A 1 169 ? 20.562  52.713 164.157 1.00 91.67  ? 1355 PHE A CB  1 
ATOM   1244 C CG  . PHE A 1 169 ? 19.660  53.822 163.710 1.00 105.97 ? 1355 PHE A CG  1 
ATOM   1245 C CD1 . PHE A 1 169 ? 20.147  54.880 162.970 1.00 109.90 ? 1355 PHE A CD1 1 
ATOM   1246 C CD2 . PHE A 1 169 ? 18.322  53.816 164.058 1.00 100.84 ? 1355 PHE A CD2 1 
ATOM   1247 C CE1 . PHE A 1 169 ? 19.312  55.901 162.570 1.00 100.60 ? 1355 PHE A CE1 1 
ATOM   1248 C CE2 . PHE A 1 169 ? 17.486  54.833 163.664 1.00 91.58  ? 1355 PHE A CE2 1 
ATOM   1249 C CZ  . PHE A 1 169 ? 17.980  55.877 162.919 1.00 88.83  ? 1355 PHE A CZ  1 
ATOM   1250 N N   . LEU A 1 170 ? 20.302  52.393 160.817 1.00 75.43  ? 1356 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 170 ? 19.463  52.073 159.649 1.00 68.39  ? 1356 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 170 ? 20.218  51.477 158.466 1.00 68.66  ? 1356 LEU A C   1 
ATOM   1253 O O   . LEU A 1 170 ? 19.610  50.853 157.609 1.00 71.26  ? 1356 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 170 ? 18.728  53.303 159.120 1.00 65.76  ? 1356 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 170 ? 17.618  53.993 159.902 1.00 69.41  ? 1356 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 170 ? 16.889  54.975 158.989 1.00 74.99  ? 1356 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 170 ? 16.646  53.025 160.533 1.00 73.25  ? 1356 LEU A CD2 1 
ATOM   1258 N N   . ARG A 1 171 ? 21.528  51.703 158.401 1.00 85.04  ? 1357 ARG A N   1 
ATOM   1259 C CA  . ARG A 1 171 ? 22.373  51.358 157.221 1.00 96.06  ? 1357 ARG A CA  1 
ATOM   1260 C C   . ARG A 1 171 ? 22.217  49.943 156.692 1.00 81.48  ? 1357 ARG A C   1 
ATOM   1261 O O   . ARG A 1 171 ? 22.504  48.986 157.409 1.00 75.46  ? 1357 ARG A O   1 
ATOM   1262 C CB  . ARG A 1 171 ? 23.871  51.551 157.547 1.00 107.43 ? 1357 ARG A CB  1 
ATOM   1263 C CG  . ARG A 1 171 ? 24.322  50.752 158.810 1.00 147.91 ? 1357 ARG A CG  1 
ATOM   1264 C CD  . ARG A 1 171 ? 25.806  50.464 158.864 1.00 149.73 ? 1357 ARG A CD  1 
ATOM   1265 N NE  . ARG A 1 171 ? 26.090  49.090 158.453 1.00 148.05 ? 1357 ARG A NE  1 
ATOM   1266 C CZ  . ARG A 1 171 ? 27.247  48.682 157.931 1.00 133.82 ? 1357 ARG A CZ  1 
ATOM   1267 N NH1 . ARG A 1 171 ? 28.241  49.549 157.759 1.00 130.81 ? 1357 ARG A NH1 1 
ATOM   1268 N NH2 . ARG A 1 171 ? 27.395  47.416 157.577 1.00 121.09 ? 1357 ARG A NH2 1 
ATOM   1269 N N   . ASN A 1 172 ? 21.820  49.817 155.426 1.00 78.29  ? 1358 ASN A N   1 
ATOM   1270 C CA  . ASN A 1 172 ? 21.700  48.505 154.761 1.00 78.89  ? 1358 ASN A CA  1 
ATOM   1271 C C   . ASN A 1 172 ? 20.921  47.488 155.577 1.00 67.48  ? 1358 ASN A C   1 
ATOM   1272 O O   . ASN A 1 172 ? 21.324  46.341 155.693 1.00 58.97  ? 1358 ASN A O   1 
ATOM   1273 C CB  . ASN A 1 172 ? 23.069  47.910 154.456 1.00 80.46  ? 1358 ASN A CB  1 
ATOM   1274 C CG  . ASN A 1 172 ? 23.825  48.689 153.430 1.00 85.99  ? 1358 ASN A CG  1 
ATOM   1275 O OD1 . ASN A 1 172 ? 23.929  49.915 153.492 1.00 103.29 ? 1358 ASN A OD1 1 
ATOM   1276 N ND2 . ASN A 1 172 ? 24.391  47.981 152.489 1.00 83.43  ? 1358 ASN A ND2 1 
ATOM   1277 N N   . LYS A 1 173 ? 19.810  47.926 156.147 1.00 66.43  ? 1359 LYS A N   1 
ATOM   1278 C CA  . LYS A 1 173 ? 18.988  47.086 156.971 1.00 48.18  ? 1359 LYS A CA  1 
ATOM   1279 C C   . LYS A 1 173 ? 17.549  47.099 156.479 1.00 52.22  ? 1359 LYS A C   1 
ATOM   1280 O O   . LYS A 1 173 ? 17.099  48.036 155.780 1.00 61.44  ? 1359 LYS A O   1 
ATOM   1281 C CB  . LYS A 1 173 ? 19.057  47.551 158.416 1.00 63.11  ? 1359 LYS A CB  1 
ATOM   1282 C CG  . LYS A 1 173 ? 20.217  46.984 159.170 1.00 70.20  ? 1359 LYS A CG  1 
ATOM   1283 C CD  . LYS A 1 173 ? 20.358  47.669 160.496 1.00 76.58  ? 1359 LYS A CD  1 
ATOM   1284 C CE  . LYS A 1 173 ? 21.564  47.135 161.229 1.00 81.46  ? 1359 LYS A CE  1 
ATOM   1285 N NZ  . LYS A 1 173 ? 21.412  47.395 162.687 1.00 85.13  ? 1359 LYS A NZ  1 
ATOM   1286 N N   . VAL A 1 174 ? 16.849  46.037 156.858 1.00 49.51  ? 1360 VAL A N   1 
ATOM   1287 C CA  . VAL A 1 174 ? 15.465  45.816 156.524 1.00 43.09  ? 1360 VAL A CA  1 
ATOM   1288 C C   . VAL A 1 174 ? 14.626  45.781 157.816 1.00 56.06  ? 1360 VAL A C   1 
ATOM   1289 O O   . VAL A 1 174 ? 14.956  45.104 158.794 1.00 53.19  ? 1360 VAL A O   1 
ATOM   1290 C CB  . VAL A 1 174 ? 15.297  44.458 155.787 1.00 42.08  ? 1360 VAL A CB  1 
ATOM   1291 C CG1 . VAL A 1 174 ? 13.970  44.407 155.045 1.00 49.57  ? 1360 VAL A CG1 1 
ATOM   1292 C CG2 . VAL A 1 174 ? 16.440  44.199 154.833 1.00 38.87  ? 1360 VAL A CG2 1 
ATOM   1293 N N   . PHE A 1 175 ? 13.526  46.508 157.804 1.00 48.43  ? 1361 PHE A N   1 
ATOM   1294 C CA  . PHE A 1 175 ? 12.611  46.499 158.906 1.00 51.32  ? 1361 PHE A CA  1 
ATOM   1295 C C   . PHE A 1 175 ? 11.232  46.115 158.399 1.00 50.03  ? 1361 PHE A C   1 
ATOM   1296 O O   . PHE A 1 175 ? 10.802  46.524 157.303 1.00 53.83  ? 1361 PHE A O   1 
ATOM   1297 C CB  . PHE A 1 175 ? 12.542  47.895 159.514 1.00 52.93  ? 1361 PHE A CB  1 
ATOM   1298 C CG  . PHE A 1 175 ? 13.801  48.329 160.159 1.00 51.90  ? 1361 PHE A CG  1 
ATOM   1299 C CD1 . PHE A 1 175 ? 14.868  48.821 159.402 1.00 56.41  ? 1361 PHE A CD1 1 
ATOM   1300 C CD2 . PHE A 1 175 ? 13.937  48.258 161.529 1.00 61.04  ? 1361 PHE A CD2 1 
ATOM   1301 C CE1 . PHE A 1 175 ? 16.083  49.225 160.015 1.00 70.08  ? 1361 PHE A CE1 1 
ATOM   1302 C CE2 . PHE A 1 175 ? 15.145  48.651 162.155 1.00 59.82  ? 1361 PHE A CE2 1 
ATOM   1303 C CZ  . PHE A 1 175 ? 16.223  49.142 161.394 1.00 51.80  ? 1361 PHE A CZ  1 
ATOM   1304 N N   . ILE A 1 176 ? 10.517  45.370 159.224 1.00 37.56  ? 1362 ILE A N   1 
ATOM   1305 C CA  . ILE A 1 176 ? 9.110   45.160 159.013 1.00 36.09  ? 1362 ILE A CA  1 
ATOM   1306 C C   . ILE A 1 176 ? 8.277   46.127 159.844 1.00 42.11  ? 1362 ILE A C   1 
ATOM   1307 O O   . ILE A 1 176 ? 8.467   46.269 161.051 1.00 50.61  ? 1362 ILE A O   1 
ATOM   1308 C CB  . ILE A 1 176 ? 8.750   43.758 159.366 1.00 35.29  ? 1362 ILE A CB  1 
ATOM   1309 C CG1 . ILE A 1 176 ? 9.671   42.801 158.638 1.00 41.96  ? 1362 ILE A CG1 1 
ATOM   1310 C CG2 . ILE A 1 176 ? 7.340   43.448 158.951 1.00 43.04  ? 1362 ILE A CG2 1 
ATOM   1311 C CD1 . ILE A 1 176 ? 9.536   42.773 157.128 1.00 44.74  ? 1362 ILE A CD1 1 
ATOM   1312 N N   . TYR A 1 177 ? 7.347   46.779 159.163 1.00 35.11  ? 1363 TYR A N   1 
ATOM   1313 C CA  . TYR A 1 177 ? 6.506   47.778 159.749 1.00 37.85  ? 1363 TYR A CA  1 
ATOM   1314 C C   . TYR A 1 177 ? 5.088   47.267 159.806 1.00 37.78  ? 1363 TYR A C   1 
ATOM   1315 O O   . TYR A 1 177 ? 4.604   46.670 158.872 1.00 44.87  ? 1363 TYR A O   1 
ATOM   1316 C CB  . TYR A 1 177 ? 6.569   49.068 158.937 1.00 45.83  ? 1363 TYR A CB  1 
ATOM   1317 C CG  . TYR A 1 177 ? 7.801   49.963 159.212 1.00 70.46  ? 1363 TYR A CG  1 
ATOM   1318 C CD1 . TYR A 1 177 ? 9.087   49.576 158.808 1.00 71.12  ? 1363 TYR A CD1 1 
ATOM   1319 C CD2 . TYR A 1 177 ? 7.669   51.215 159.840 1.00 60.18  ? 1363 TYR A CD2 1 
ATOM   1320 C CE1 . TYR A 1 177 ? 10.211  50.401 159.033 1.00 54.76  ? 1363 TYR A CE1 1 
ATOM   1321 C CE2 . TYR A 1 177 ? 8.792   52.039 160.050 1.00 58.21  ? 1363 TYR A CE2 1 
ATOM   1322 C CZ  . TYR A 1 177 ? 10.058  51.616 159.659 1.00 55.02  ? 1363 TYR A CZ  1 
ATOM   1323 O OH  . TYR A 1 177 ? 11.158  52.416 159.912 1.00 54.46  ? 1363 TYR A OH  1 
ATOM   1324 N N   . ARG A 1 178 ? 4.434   47.501 160.926 1.00 36.13  ? 1364 ARG A N   1 
ATOM   1325 C CA  . ARG A 1 178 ? 3.068   47.116 161.109 1.00 41.23  ? 1364 ARG A CA  1 
ATOM   1326 C C   . ARG A 1 178 ? 2.205   48.281 160.673 1.00 47.10  ? 1364 ARG A C   1 
ATOM   1327 O O   . ARG A 1 178 ? 2.342   49.399 161.169 1.00 62.38  ? 1364 ARG A O   1 
ATOM   1328 C CB  . ARG A 1 178 ? 2.832   46.768 162.585 1.00 38.53  ? 1364 ARG A CB  1 
ATOM   1329 C CG  . ARG A 1 178 ? 1.440   46.345 162.925 1.00 39.09  ? 1364 ARG A CG  1 
ATOM   1330 C CD  . ARG A 1 178 ? 1.386   45.728 164.278 1.00 45.42  ? 1364 ARG A CD  1 
ATOM   1331 N NE  . ARG A 1 178 ? 0.124   46.040 164.939 1.00 46.99  ? 1364 ARG A NE  1 
ATOM   1332 C CZ  . ARG A 1 178 ? -0.896  45.189 165.031 1.00 58.91  ? 1364 ARG A CZ  1 
ATOM   1333 N NH1 . ARG A 1 178 ? -0.792  43.961 164.512 1.00 43.22  ? 1364 ARG A NH1 1 
ATOM   1334 N NH2 . ARG A 1 178 ? -2.024  45.563 165.655 1.00 56.11  ? 1364 ARG A NH2 1 
ATOM   1335 N N   . GLY A 1 179 ? 1.311   48.039 159.727 1.00 40.37  ? 1365 GLY A N   1 
ATOM   1336 C CA  . GLY A 1 179 ? 0.470   49.119 159.253 1.00 51.77  ? 1365 GLY A CA  1 
ATOM   1337 C C   . GLY A 1 179 ? -0.579  49.525 160.250 1.00 45.11  ? 1365 GLY A C   1 
ATOM   1338 O O   . GLY A 1 179 ? -1.071  48.707 161.010 1.00 57.69  ? 1365 GLY A O   1 
ATOM   1339 N N   . LYS A 1 180 ? -0.952  50.790 160.233 1.00 44.27  ? 1366 LYS A N   1 
ATOM   1340 C CA  . LYS A 1 180 ? -2.082  51.232 161.012 1.00 49.14  ? 1366 LYS A CA  1 
ATOM   1341 C C   . LYS A 1 180 ? -3.330  50.684 160.359 1.00 39.01  ? 1366 LYS A C   1 
ATOM   1342 O O   . LYS A 1 180 ? -3.274  50.086 159.314 1.00 52.30  ? 1366 LYS A O   1 
ATOM   1343 C CB  . LYS A 1 180 ? -2.093  52.737 161.055 1.00 56.36  ? 1366 LYS A CB  1 
ATOM   1344 C CG  . LYS A 1 180 ? -2.091  53.293 162.444 1.00 69.28  ? 1366 LYS A CG  1 
ATOM   1345 C CD  . LYS A 1 180 ? -1.011  54.392 162.598 1.00 79.08  ? 1366 LYS A CD  1 
ATOM   1346 C CE  . LYS A 1 180 ? -1.067  55.172 163.948 1.00 98.26  ? 1366 LYS A CE  1 
ATOM   1347 N NZ  . LYS A 1 180 ? -1.921  54.616 165.071 1.00 70.44  ? 1366 LYS A NZ  1 
ATOM   1348 N N   . GLU A 1 181 ? -4.469  50.864 160.988 1.00 63.70  ? 1367 GLU A N   1 
ATOM   1349 C CA  . GLU A 1 181 ? -5.723  50.290 160.484 1.00 66.84  ? 1367 GLU A CA  1 
ATOM   1350 C C   . GLU A 1 181 ? -6.020  50.903 159.128 1.00 53.53  ? 1367 GLU A C   1 
ATOM   1351 O O   . GLU A 1 181 ? -6.011  52.127 158.999 1.00 67.10  ? 1367 GLU A O   1 
ATOM   1352 C CB  . GLU A 1 181 ? -6.853  50.630 161.465 1.00 74.51  ? 1367 GLU A CB  1 
ATOM   1353 C CG  . GLU A 1 181 ? -7.760  49.472 161.834 1.00 68.87  ? 1367 GLU A CG  1 
ATOM   1354 C CD  . GLU A 1 181 ? -8.821  49.852 162.882 1.00 92.79  ? 1367 GLU A CD  1 
ATOM   1355 O OE1 . GLU A 1 181 ? -9.318  51.006 162.848 1.00 94.98  ? 1367 GLU A OE1 1 
ATOM   1356 O OE2 . GLU A 1 181 ? -9.164  48.996 163.739 1.00 87.30  ? 1367 GLU A OE2 1 
ATOM   1357 N N   . TYR A 1 182 ? -6.252  50.057 158.124 1.00 50.73  ? 1368 TYR A N   1 
ATOM   1358 C CA  . TYR A 1 182 ? -6.516  50.505 156.754 1.00 37.28  ? 1368 TYR A CA  1 
ATOM   1359 C C   . TYR A 1 182 ? -5.416  51.329 156.159 1.00 32.12  ? 1368 TYR A C   1 
ATOM   1360 O O   . TYR A 1 182 ? -5.593  51.991 155.176 1.00 54.39  ? 1368 TYR A O   1 
ATOM   1361 C CB  . TYR A 1 182 ? -7.809  51.297 156.675 1.00 38.65  ? 1368 TYR A CB  1 
ATOM   1362 C CG  . TYR A 1 182 ? -9.010  50.458 156.986 1.00 56.34  ? 1368 TYR A CG  1 
ATOM   1363 C CD1 . TYR A 1 182 ? -9.407  49.469 156.114 1.00 40.36  ? 1368 TYR A CD1 1 
ATOM   1364 C CD2 . TYR A 1 182 ? -9.748  50.653 158.178 1.00 51.89  ? 1368 TYR A CD2 1 
ATOM   1365 C CE1 . TYR A 1 182 ? -10.485 48.694 156.386 1.00 61.43  ? 1368 TYR A CE1 1 
ATOM   1366 C CE2 . TYR A 1 182 ? -10.867 49.866 158.469 1.00 36.32  ? 1368 TYR A CE2 1 
ATOM   1367 C CZ  . TYR A 1 182 ? -11.216 48.885 157.564 1.00 62.88  ? 1368 TYR A CZ  1 
ATOM   1368 O OH  . TYR A 1 182 ? -12.299 48.078 157.803 1.00 62.75  ? 1368 TYR A OH  1 
ATOM   1369 N N   . GLU A 1 183 ? -4.260  51.309 156.767 1.00 54.78  ? 1369 GLU A N   1 
ATOM   1370 C CA  . GLU A 1 183 ? -3.124  51.921 156.142 1.00 42.43  ? 1369 GLU A CA  1 
ATOM   1371 C C   . GLU A 1 183 ? -2.616  51.078 154.981 1.00 46.64  ? 1369 GLU A C   1 
ATOM   1372 O O   . GLU A 1 183 ? -2.324  49.898 155.103 1.00 47.59  ? 1369 GLU A O   1 
ATOM   1373 C CB  . GLU A 1 183 ? -2.003  52.166 157.134 1.00 46.29  ? 1369 GLU A CB  1 
ATOM   1374 C CG  . GLU A 1 183 ? -1.029  53.193 156.635 1.00 41.84  ? 1369 GLU A CG  1 
ATOM   1375 C CD  . GLU A 1 183 ? 0.092   53.422 157.588 1.00 62.16  ? 1369 GLU A CD  1 
ATOM   1376 O OE1 . GLU A 1 183 ? 0.220   52.589 158.496 1.00 53.93  ? 1369 GLU A OE1 1 
ATOM   1377 O OE2 . GLU A 1 183 ? 0.855   54.403 157.430 1.00 61.34  ? 1369 GLU A OE2 1 
ATOM   1378 N N   . ARG A 1 184 ? -2.496  51.741 153.851 1.00 69.00  ? 1370 ARG A N   1 
ATOM   1379 C CA  . ARG A 1 184 ? -2.056  51.139 152.627 1.00 61.49  ? 1370 ARG A CA  1 
ATOM   1380 C C   . ARG A 1 184 ? -0.627  51.578 152.365 1.00 58.14  ? 1370 ARG A C   1 
ATOM   1381 O O   . ARG A 1 184 ? -0.225  52.657 152.827 1.00 52.95  ? 1370 ARG A O   1 
ATOM   1382 C CB  . ARG A 1 184 ? -2.956  51.670 151.526 1.00 70.00  ? 1370 ARG A CB  1 
ATOM   1383 C CG  . ARG A 1 184 ? -3.234  50.664 150.513 1.00 69.53  ? 1370 ARG A CG  1 
ATOM   1384 C CD  . ARG A 1 184 ? -4.417  51.031 149.708 1.00 74.34  ? 1370 ARG A CD  1 
ATOM   1385 N NE  . ARG A 1 184 ? -5.008  49.801 149.215 1.00 81.13  ? 1370 ARG A NE  1 
ATOM   1386 C CZ  . ARG A 1 184 ? -4.601  49.102 148.150 1.00 70.42  ? 1370 ARG A CZ  1 
ATOM   1387 N NH1 . ARG A 1 184 ? -3.582  49.473 147.384 1.00 55.50  ? 1370 ARG A NH1 1 
ATOM   1388 N NH2 . ARG A 1 184 ? -5.253  48.007 147.839 1.00 80.63  ? 1370 ARG A NH2 1 
ATOM   1389 N N   . ARG A 1 185 ? 0.117   50.792 151.598 1.00 49.98  ? 1371 ARG A N   1 
ATOM   1390 C CA  . ARG A 1 185 ? 1.511   51.094 151.284 1.00 41.46  ? 1371 ARG A CA  1 
ATOM   1391 C C   . ARG A 1 185 ? 1.763   52.423 150.580 1.00 45.40  ? 1371 ARG A C   1 
ATOM   1392 O O   . ARG A 1 185 ? 2.779   53.064 150.829 1.00 54.31  ? 1371 ARG A O   1 
ATOM   1393 C CB  . ARG A 1 185 ? 2.149   49.962 150.481 1.00 39.29  ? 1371 ARG A CB  1 
ATOM   1394 C CG  . ARG A 1 185 ? 3.596   50.227 150.110 1.00 52.83  ? 1371 ARG A CG  1 
ATOM   1395 C CD  . ARG A 1 185 ? 4.225   49.043 149.404 1.00 45.17  ? 1371 ARG A CD  1 
ATOM   1396 N NE  . ARG A 1 185 ? 3.478   48.652 148.217 1.00 65.58  ? 1371 ARG A NE  1 
ATOM   1397 C CZ  . ARG A 1 185 ? 3.633   49.208 147.021 1.00 93.08  ? 1371 ARG A CZ  1 
ATOM   1398 N NH1 . ARG A 1 185 ? 4.513   50.183 146.851 1.00 91.01  ? 1371 ARG A NH1 1 
ATOM   1399 N NH2 . ARG A 1 185 ? 2.908   48.792 145.995 1.00 91.41  ? 1371 ARG A NH2 1 
ATOM   1400 N N   . GLU A 1 186 ? 0.868   52.846 149.699 1.00 34.14  ? 1372 GLU A N   1 
ATOM   1401 C CA  . GLU A 1 186 ? 1.097   54.108 149.016 1.00 58.06  ? 1372 GLU A CA  1 
ATOM   1402 C C   . GLU A 1 186 ? 1.179   55.249 150.023 1.00 62.23  ? 1372 GLU A C   1 
ATOM   1403 O O   . GLU A 1 186 ? 2.045   56.112 149.920 1.00 70.01  ? 1372 GLU A O   1 
ATOM   1404 C CB  . GLU A 1 186 ? -0.027  54.389 148.018 1.00 66.48  ? 1372 GLU A CB  1 
ATOM   1405 C CG  . GLU A 1 186 ? -0.175  53.348 146.926 1.00 67.03  ? 1372 GLU A CG  1 
ATOM   1406 C CD  . GLU A 1 186 ? -1.093  52.219 147.323 1.00 77.32  ? 1372 GLU A CD  1 
ATOM   1407 O OE1 . GLU A 1 186 ? -1.947  52.436 148.201 1.00 105.09 ? 1372 GLU A OE1 1 
ATOM   1408 O OE2 . GLU A 1 186 ? -0.968  51.117 146.757 1.00 78.46  ? 1372 GLU A OE2 1 
ATOM   1409 N N   . ASP A 1 187 ? 0.274   55.249 150.995 1.00 64.63  ? 1373 ASP A N   1 
ATOM   1410 C CA  . ASP A 1 187 ? 0.241   56.277 152.031 1.00 55.99  ? 1373 ASP A CA  1 
ATOM   1411 C C   . ASP A 1 187 ? 1.446   56.250 152.959 1.00 56.80  ? 1373 ASP A C   1 
ATOM   1412 O O   . ASP A 1 187 ? 1.993   57.284 153.326 1.00 48.24  ? 1373 ASP A O   1 
ATOM   1413 C CB  . ASP A 1 187 ? -1.010  56.109 152.891 1.00 53.24  ? 1373 ASP A CB  1 
ATOM   1414 C CG  . ASP A 1 187 ? -2.281  56.162 152.086 1.00 78.50  ? 1373 ASP A CG  1 
ATOM   1415 O OD1 . ASP A 1 187 ? -2.354  56.972 151.143 1.00 71.51  ? 1373 ASP A OD1 1 
ATOM   1416 O OD2 . ASP A 1 187 ? -3.213  55.398 152.406 1.00 81.25  ? 1373 ASP A OD2 1 
ATOM   1417 N N   . PHE A 1 188 ? 1.841   55.042 153.334 1.00 40.18  ? 1374 PHE A N   1 
ATOM   1418 C CA  . PHE A 1 188 ? 2.926   54.810 154.221 1.00 49.29  ? 1374 PHE A CA  1 
ATOM   1419 C C   . PHE A 1 188 ? 4.184   55.245 153.567 1.00 54.19  ? 1374 PHE A C   1 
ATOM   1420 O O   . PHE A 1 188 ? 4.975   55.978 154.139 1.00 59.80  ? 1374 PHE A O   1 
ATOM   1421 C CB  . PHE A 1 188 ? 3.016   53.341 154.524 1.00 39.94  ? 1374 PHE A CB  1 
ATOM   1422 C CG  . PHE A 1 188 ? 4.235   52.954 155.312 1.00 56.95  ? 1374 PHE A CG  1 
ATOM   1423 C CD1 . PHE A 1 188 ? 4.219   52.948 156.714 1.00 51.51  ? 1374 PHE A CD1 1 
ATOM   1424 C CD2 . PHE A 1 188 ? 5.397   52.556 154.662 1.00 52.26  ? 1374 PHE A CD2 1 
ATOM   1425 C CE1 . PHE A 1 188 ? 5.353   52.547 157.435 1.00 39.82  ? 1374 PHE A CE1 1 
ATOM   1426 C CE2 . PHE A 1 188 ? 6.513   52.167 155.374 1.00 46.83  ? 1374 PHE A CE2 1 
ATOM   1427 C CZ  . PHE A 1 188 ? 6.494   52.164 156.754 1.00 35.24  ? 1374 PHE A CZ  1 
ATOM   1428 N N   . GLN A 1 189 ? 4.376   54.776 152.349 1.00 67.87  ? 1375 GLN A N   1 
ATOM   1429 C CA  . GLN A 1 189 ? 5.608   55.053 151.647 1.00 66.05  ? 1375 GLN A CA  1 
ATOM   1430 C C   . GLN A 1 189 ? 5.791   56.538 151.427 1.00 67.33  ? 1375 GLN A C   1 
ATOM   1431 O O   . GLN A 1 189 ? 6.902   57.035 151.482 1.00 73.57  ? 1375 GLN A O   1 
ATOM   1432 C CB  . GLN A 1 189 ? 5.627   54.343 150.317 1.00 55.31  ? 1375 GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 189 ? 6.817   54.719 149.489 1.00 74.87  ? 1375 GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 189 ? 7.325   53.550 148.694 1.00 86.18  ? 1375 GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 189 ? 6.542   52.714 148.233 1.00 75.76  ? 1375 GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 189 ? 8.645   53.470 148.529 1.00 96.42  ? 1375 GLN A NE2 1 
ATOM   1437 N N   . MET A 1 190 ? 4.683   57.226 151.183 1.00 69.37  ? 1376 MET A N   1 
ATOM   1438 C CA  . MET A 1 190 ? 4.692   58.633 150.866 1.00 67.93  ? 1376 MET A CA  1 
ATOM   1439 C C   . MET A 1 190 ? 5.156   59.408 152.071 1.00 80.84  ? 1376 MET A C   1 
ATOM   1440 O O   . MET A 1 190 ? 5.979   60.316 151.950 1.00 89.29  ? 1376 MET A O   1 
ATOM   1441 C CB  . MET A 1 190 ? 3.295   59.078 150.495 1.00 71.18  ? 1376 MET A CB  1 
ATOM   1442 C CG  . MET A 1 190 ? 3.237   60.305 149.623 1.00 67.95  ? 1376 MET A CG  1 
ATOM   1443 S SD  . MET A 1 190 ? 1.520   60.755 149.257 1.00 135.96 ? 1376 MET A SD  1 
ATOM   1444 C CE  . MET A 1 190 ? 0.691   59.196 148.839 1.00 98.30  ? 1376 MET A CE  1 
ATOM   1445 N N   . GLN A 1 191 ? 4.627   59.032 153.233 1.00 69.77  ? 1377 GLN A N   1 
ATOM   1446 C CA  . GLN A 1 191 ? 5.038   59.612 154.496 1.00 69.60  ? 1377 GLN A CA  1 
ATOM   1447 C C   . GLN A 1 191 ? 6.532   59.350 154.714 1.00 73.59  ? 1377 GLN A C   1 
ATOM   1448 O O   . GLN A 1 191 ? 7.283   60.243 155.118 1.00 77.12  ? 1377 GLN A O   1 
ATOM   1449 C CB  . GLN A 1 191 ? 4.211   59.010 155.630 1.00 82.48  ? 1377 GLN A CB  1 
ATOM   1450 C CG  . GLN A 1 191 ? 3.444   60.058 156.429 1.00 111.69 ? 1377 GLN A CG  1 
ATOM   1451 C CD  . GLN A 1 191 ? 3.035   59.565 157.813 1.00 114.28 ? 1377 GLN A CD  1 
ATOM   1452 O OE1 . GLN A 1 191 ? 2.446   58.489 157.961 1.00 103.38 ? 1377 GLN A OE1 1 
ATOM   1453 N NE2 . GLN A 1 191 ? 3.346   60.359 158.835 1.00 108.09 ? 1377 GLN A NE2 1 
ATOM   1454 N N   . LEU A 1 192 ? 6.951   58.125 154.419 1.00 65.81  ? 1378 LEU A N   1 
ATOM   1455 C CA  . LEU A 1 192 ? 8.334   57.715 154.566 1.00 64.90  ? 1378 LEU A CA  1 
ATOM   1456 C C   . LEU A 1 192 ? 9.297   58.443 153.605 1.00 67.22  ? 1378 LEU A C   1 
ATOM   1457 O O   . LEU A 1 192 ? 10.414  58.774 153.978 1.00 77.08  ? 1378 LEU A O   1 
ATOM   1458 C CB  . LEU A 1 192 ? 8.409   56.199 154.409 1.00 66.31  ? 1378 LEU A CB  1 
ATOM   1459 C CG  . LEU A 1 192 ? 9.698   55.395 154.208 1.00 60.42  ? 1378 LEU A CG  1 
ATOM   1460 C CD1 . LEU A 1 192 ? 10.547  55.278 155.458 1.00 49.63  ? 1378 LEU A CD1 1 
ATOM   1461 C CD2 . LEU A 1 192 ? 9.292   54.010 153.726 1.00 61.05  ? 1378 LEU A CD2 1 
ATOM   1462 N N   . MET A 1 193 ? 8.884   58.637 152.375 1.00 76.34  ? 1379 MET A N   1 
ATOM   1463 C CA  . MET A 1 193 ? 9.741   59.247 151.399 1.00 73.66  ? 1379 MET A CA  1 
ATOM   1464 C C   . MET A 1 193 ? 10.000  60.641 151.878 1.00 76.00  ? 1379 MET A C   1 
ATOM   1465 O O   . MET A 1 193 ? 10.975  61.266 151.556 1.00 74.18  ? 1379 MET A O   1 
ATOM   1466 C CB  . MET A 1 193 ? 9.027   59.274 150.065 1.00 74.31  ? 1379 MET A CB  1 
ATOM   1467 C CG  . MET A 1 193 ? 9.694   58.497 148.995 1.00 78.73  ? 1379 MET A CG  1 
ATOM   1468 S SD  . MET A 1 193 ? 10.486  57.094 149.679 1.00 79.56  ? 1379 MET A SD  1 
ATOM   1469 C CE  . MET A 1 193 ? 12.175  57.435 149.335 1.00 67.12  ? 1379 MET A CE  1 
ATOM   1470 N N   . THR A 1 194 ? 9.091   61.133 152.671 1.00 78.21  ? 1380 THR A N   1 
ATOM   1471 C CA  . THR A 1 194 ? 9.217   62.462 153.168 1.00 73.20  ? 1380 THR A CA  1 
ATOM   1472 C C   . THR A 1 194 ? 10.204  62.586 154.310 1.00 81.06  ? 1380 THR A C   1 
ATOM   1473 O O   . THR A 1 194 ? 10.765  63.620 154.514 1.00 76.13  ? 1380 THR A O   1 
ATOM   1474 C CB  . THR A 1 194 ? 7.901   62.939 153.624 1.00 73.54  ? 1380 THR A CB  1 
ATOM   1475 O OG1 . THR A 1 194 ? 7.201   63.448 152.503 1.00 55.54  ? 1380 THR A OG1 1 
ATOM   1476 C CG2 . THR A 1 194 ? 8.088   64.021 154.592 1.00 72.44  ? 1380 THR A CG2 1 
ATOM   1477 N N   . GLN A 1 195 ? 10.418  61.531 155.064 1.00 74.93  ? 1381 GLN A N   1 
ATOM   1478 C CA  . GLN A 1 195 ? 11.404  61.583 156.112 1.00 62.88  ? 1381 GLN A CA  1 
ATOM   1479 C C   . GLN A 1 195 ? 12.762  61.692 155.484 1.00 71.35  ? 1381 GLN A C   1 
ATOM   1480 O O   . GLN A 1 195 ? 13.694  62.160 156.093 1.00 85.06  ? 1381 GLN A O   1 
ATOM   1481 C CB  . GLN A 1 195 ? 11.332  60.336 156.980 1.00 79.85  ? 1381 GLN A CB  1 
ATOM   1482 C CG  . GLN A 1 195 ? 10.093  60.253 157.828 1.00 105.84 ? 1381 GLN A CG  1 
ATOM   1483 C CD  . GLN A 1 195 ? 9.977   58.969 158.620 1.00 118.57 ? 1381 GLN A CD  1 
ATOM   1484 O OE1 . GLN A 1 195 ? 8.904   58.612 159.072 1.00 124.72 ? 1381 GLN A OE1 1 
ATOM   1485 N NE2 . GLN A 1 195 ? 11.076  58.283 158.798 1.00 106.35 ? 1381 GLN A NE2 1 
ATOM   1486 N N   . PHE A 1 196 ? 12.863  61.249 154.246 1.00 82.78  ? 1382 PHE A N   1 
ATOM   1487 C CA  . PHE A 1 196 ? 14.088  61.329 153.481 1.00 84.37  ? 1382 PHE A CA  1 
ATOM   1488 C C   . PHE A 1 196 ? 13.778  61.814 152.098 1.00 89.83  ? 1382 PHE A C   1 
ATOM   1489 O O   . PHE A 1 196 ? 13.246  61.084 151.312 1.00 94.03  ? 1382 PHE A O   1 
ATOM   1490 C CB  . PHE A 1 196 ? 14.698  59.966 153.351 1.00 61.51  ? 1382 PHE A CB  1 
ATOM   1491 C CG  . PHE A 1 196 ? 14.699  59.205 154.599 1.00 75.57  ? 1382 PHE A CG  1 
ATOM   1492 C CD1 . PHE A 1 196 ? 15.662  59.399 155.530 1.00 82.28  ? 1382 PHE A CD1 1 
ATOM   1493 C CD2 . PHE A 1 196 ? 13.740  58.282 154.842 1.00 77.08  ? 1382 PHE A CD2 1 
ATOM   1494 C CE1 . PHE A 1 196 ? 15.659  58.695 156.663 1.00 70.97  ? 1382 PHE A CE1 1 
ATOM   1495 C CE2 . PHE A 1 196 ? 13.748  57.584 155.978 1.00 70.99  ? 1382 PHE A CE2 1 
ATOM   1496 C CZ  . PHE A 1 196 ? 14.707  57.793 156.886 1.00 69.21  ? 1382 PHE A CZ  1 
ATOM   1497 N N   . PRO A 1 197 ? 14.134  63.039 151.785 1.00 85.96  ? 1383 PRO A N   1 
ATOM   1498 C CA  . PRO A 1 197 ? 13.757  63.602 150.505 1.00 81.62  ? 1383 PRO A CA  1 
ATOM   1499 C C   . PRO A 1 197 ? 14.882  63.479 149.532 1.00 90.64  ? 1383 PRO A C   1 
ATOM   1500 O O   . PRO A 1 197 ? 14.726  63.791 148.376 1.00 83.82  ? 1383 PRO A O   1 
ATOM   1501 C CB  . PRO A 1 197 ? 13.521  65.062 150.836 1.00 79.43  ? 1383 PRO A CB  1 
ATOM   1502 C CG  . PRO A 1 197 ? 13.400  65.112 152.283 1.00 79.00  ? 1383 PRO A CG  1 
ATOM   1503 C CD  . PRO A 1 197 ? 14.291  64.084 152.789 1.00 72.89  ? 1383 PRO A CD  1 
ATOM   1504 N N   . ASN A 1 198 ? 16.018  63.017 150.004 1.00 97.96  ? 1384 ASN A N   1 
ATOM   1505 C CA  . ASN A 1 198 ? 17.134  62.791 149.129 1.00 100.69 ? 1384 ASN A CA  1 
ATOM   1506 C C   . ASN A 1 198 ? 17.195  61.327 148.814 1.00 87.21  ? 1384 ASN A C   1 
ATOM   1507 O O   . ASN A 1 198 ? 17.973  60.878 147.997 1.00 77.30  ? 1384 ASN A O   1 
ATOM   1508 C CB  . ASN A 1 198 ? 18.421  63.245 149.791 1.00 101.48 ? 1384 ASN A CB  1 
ATOM   1509 C CG  . ASN A 1 198 ? 18.773  64.655 149.445 1.00 108.63 ? 1384 ASN A CG  1 
ATOM   1510 O OD1 . ASN A 1 198 ? 19.797  65.161 149.859 1.00 124.13 ? 1384 ASN A OD1 1 
ATOM   1511 N ND2 . ASN A 1 198 ? 17.926  65.299 148.676 1.00 80.15  ? 1384 ASN A ND2 1 
ATOM   1512 N N   . ALA A 1 199 ? 16.356  60.574 149.484 1.00 69.74  ? 1385 ALA A N   1 
ATOM   1513 C CA  . ALA A 1 199 ? 16.303  59.165 149.218 1.00 70.70  ? 1385 ALA A CA  1 
ATOM   1514 C C   . ALA A 1 199 ? 15.672  58.937 147.852 1.00 77.28  ? 1385 ALA A C   1 
ATOM   1515 O O   . ALA A 1 199 ? 14.792  59.699 147.416 1.00 76.44  ? 1385 ALA A O   1 
ATOM   1516 C CB  . ALA A 1 199 ? 15.517  58.485 150.283 1.00 75.16  ? 1385 ALA A CB  1 
ATOM   1517 N N   . GLU A 1 200 ? 16.146  57.902 147.168 1.00 68.53  ? 1386 GLU A N   1 
ATOM   1518 C CA  . GLU A 1 200 ? 15.669  57.537 145.842 1.00 85.56  ? 1386 GLU A CA  1 
ATOM   1519 C C   . GLU A 1 200 ? 14.917  56.246 146.055 1.00 84.73  ? 1386 GLU A C   1 
ATOM   1520 O O   . GLU A 1 200 ? 15.432  55.340 146.700 1.00 95.47  ? 1386 GLU A O   1 
ATOM   1521 C CB  . GLU A 1 200 ? 16.858  57.332 144.902 1.00 86.34  ? 1386 GLU A CB  1 
ATOM   1522 C CG  . GLU A 1 200 ? 16.499  57.197 143.434 1.00 110.54 ? 1386 GLU A CG  1 
ATOM   1523 C CD  . GLU A 1 200 ? 16.495  55.759 142.965 1.00 130.29 ? 1386 GLU A CD  1 
ATOM   1524 O OE1 . GLU A 1 200 ? 17.195  54.934 143.586 1.00 147.69 ? 1386 GLU A OE1 1 
ATOM   1525 O OE2 . GLU A 1 200 ? 15.803  55.455 141.971 1.00 110.73 ? 1386 GLU A OE2 1 
ATOM   1526 N N   . LYS A 1 201 ? 13.698  56.142 145.540 1.00 64.97  ? 1387 LYS A N   1 
ATOM   1527 C CA  . LYS A 1 201 ? 12.961  54.888 145.785 1.00 76.15  ? 1387 LYS A CA  1 
ATOM   1528 C C   . LYS A 1 201 ? 13.241  53.790 144.774 1.00 64.35  ? 1387 LYS A C   1 
ATOM   1529 O O   . LYS A 1 201 ? 12.952  53.940 143.602 1.00 78.07  ? 1387 LYS A O   1 
ATOM   1530 C CB  . LYS A 1 201 ? 11.453  55.108 145.995 1.00 80.39  ? 1387 LYS A CB  1 
ATOM   1531 C CG  . LYS A 1 201 ? 10.596  55.348 144.790 1.00 83.70  ? 1387 LYS A CG  1 
ATOM   1532 C CD  . LYS A 1 201 ? 9.210   55.812 145.253 1.00 86.34  ? 1387 LYS A CD  1 
ATOM   1533 C CE  . LYS A 1 201 ? 8.089   55.133 144.472 1.00 101.94 ? 1387 LYS A CE  1 
ATOM   1534 N NZ  . LYS A 1 201 ? 8.355   55.097 142.996 1.00 113.95 ? 1387 LYS A NZ  1 
ATOM   1535 N N   . MET A 1 202 ? 13.813  52.688 145.241 1.00 55.68  ? 1388 MET A N   1 
ATOM   1536 C CA  . MET A 1 202 ? 14.174  51.586 144.362 1.00 58.47  ? 1388 MET A CA  1 
ATOM   1537 C C   . MET A 1 202 ? 12.989  51.072 143.555 1.00 66.14  ? 1388 MET A C   1 
ATOM   1538 O O   . MET A 1 202 ? 11.835  51.195 143.967 1.00 70.59  ? 1388 MET A O   1 
ATOM   1539 C CB  . MET A 1 202 ? 14.819  50.444 145.143 1.00 51.90  ? 1388 MET A CB  1 
ATOM   1540 C CG  . MET A 1 202 ? 16.233  50.766 145.573 1.00 60.04  ? 1388 MET A CG  1 
ATOM   1541 S SD  . MET A 1 202 ? 17.138  49.429 146.419 1.00 82.65  ? 1388 MET A SD  1 
ATOM   1542 C CE  . MET A 1 202 ? 17.195  48.157 145.182 1.00 68.86  ? 1388 MET A CE  1 
ATOM   1543 N N   . ASN A 1 203 ? 13.285  50.506 142.390 1.00 70.32  ? 1389 ASN A N   1 
ATOM   1544 C CA  . ASN A 1 203 ? 12.251  49.955 141.547 1.00 79.34  ? 1389 ASN A CA  1 
ATOM   1545 C C   . ASN A 1 203 ? 12.323  48.434 141.434 1.00 82.40  ? 1389 ASN A C   1 
ATOM   1546 O O   . ASN A 1 203 ? 11.744  47.846 140.532 1.00 85.02  ? 1389 ASN A O   1 
ATOM   1547 C CB  . ASN A 1 203 ? 12.252  50.624 140.171 1.00 97.35  ? 1389 ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 203 ? 10.867  50.632 139.530 1.00 128.59 ? 1389 ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 203 ? 10.245  49.580 139.342 1.00 137.76 ? 1389 ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 203 ? 10.373  51.822 139.202 1.00 133.41 ? 1389 ASN A ND2 1 
ATOM   1551 N N   . THR A 1 204 ? 13.014  47.786 142.357 1.00 81.52  ? 1390 THR A N   1 
ATOM   1552 C CA  . THR A 1 204 ? 12.947  46.323 142.440 1.00 81.60  ? 1390 THR A CA  1 
ATOM   1553 C C   . THR A 1 204 ? 12.738  45.891 143.862 1.00 74.65  ? 1390 THR A C   1 
ATOM   1554 O O   . THR A 1 204 ? 13.049  46.634 144.792 1.00 77.35  ? 1390 THR A O   1 
ATOM   1555 C CB  . THR A 1 204 ? 14.225  45.641 141.939 1.00 87.99  ? 1390 THR A CB  1 
ATOM   1556 O OG1 . THR A 1 204 ? 15.356  46.155 142.662 1.00 92.54  ? 1390 THR A OG1 1 
ATOM   1557 C CG2 . THR A 1 204 ? 14.415  45.866 140.412 1.00 112.83 ? 1390 THR A CG2 1 
ATOM   1558 N N   . THR A 1 205 ? 12.199  44.690 144.034 1.00 59.55  ? 1391 THR A N   1 
ATOM   1559 C CA  . THR A 1 205 ? 12.020  44.104 145.350 1.00 57.13  ? 1391 THR A CA  1 
ATOM   1560 C C   . THR A 1 205 ? 13.151  43.114 145.568 1.00 67.64  ? 1391 THR A C   1 
ATOM   1561 O O   . THR A 1 205 ? 13.259  42.495 146.621 1.00 78.01  ? 1391 THR A O   1 
ATOM   1562 C CB  . THR A 1 205 ? 10.688  43.368 145.468 1.00 61.53  ? 1391 THR A CB  1 
ATOM   1563 O OG1 . THR A 1 205 ? 10.592  42.388 144.431 1.00 71.24  ? 1391 THR A OG1 1 
ATOM   1564 C CG2 . THR A 1 205 ? 9.540   44.340 145.340 1.00 62.85  ? 1391 THR A CG2 1 
ATOM   1565 N N   . SER A 1 206 ? 13.989  42.970 144.547 1.00 83.71  ? 1392 SER A N   1 
ATOM   1566 C CA  . SER A 1 206 ? 15.123  42.056 144.579 1.00 62.35  ? 1392 SER A CA  1 
ATOM   1567 C C   . SER A 1 206 ? 16.201  42.557 145.523 1.00 70.55  ? 1392 SER A C   1 
ATOM   1568 O O   . SER A 1 206 ? 16.373  43.761 145.685 1.00 85.86  ? 1392 SER A O   1 
ATOM   1569 C CB  . SER A 1 206 ? 15.705  41.893 143.177 1.00 83.13  ? 1392 SER A CB  1 
ATOM   1570 O OG  . SER A 1 206 ? 14.691  41.588 142.239 1.00 79.19  ? 1392 SER A OG  1 
ATOM   1571 N N   . ALA A 1 207 ? 16.935  41.639 146.143 1.00 68.18  ? 1393 ALA A N   1 
ATOM   1572 C CA  . ALA A 1 207 ? 17.985  42.052 147.057 1.00 76.14  ? 1393 ALA A CA  1 
ATOM   1573 C C   . ALA A 1 207 ? 19.007  42.843 146.265 1.00 67.45  ? 1393 ALA A C   1 
ATOM   1574 O O   . ALA A 1 207 ? 19.438  42.424 145.198 1.00 77.72  ? 1393 ALA A O   1 
ATOM   1575 C CB  . ALA A 1 207 ? 18.632  40.848 147.699 1.00 82.45  ? 1393 ALA A CB  1 
ATOM   1576 N N   . PRO A 1 208 ? 19.360  44.003 146.798 1.00 83.42  ? 1394 PRO A N   1 
ATOM   1577 C CA  . PRO A 1 208 ? 20.290  44.926 146.155 1.00 68.58  ? 1394 PRO A CA  1 
ATOM   1578 C C   . PRO A 1 208 ? 21.721  44.423 146.108 1.00 83.79  ? 1394 PRO A C   1 
ATOM   1579 O O   . PRO A 1 208 ? 22.163  43.674 146.976 1.00 84.55  ? 1394 PRO A O   1 
ATOM   1580 C CB  . PRO A 1 208 ? 20.210  46.151 147.056 1.00 83.17  ? 1394 PRO A CB  1 
ATOM   1581 C CG  . PRO A 1 208 ? 19.954  45.582 148.412 1.00 89.12  ? 1394 PRO A CG  1 
ATOM   1582 C CD  . PRO A 1 208 ? 19.286  44.238 148.246 1.00 86.29  ? 1394 PRO A CD  1 
ATOM   1583 N N   . GLY A 1 209 ? 22.433  44.853 145.077 1.00 105.26 ? 1395 GLY A N   1 
ATOM   1584 C CA  . GLY A 1 209 ? 23.820  44.493 144.875 1.00 120.06 ? 1395 GLY A CA  1 
ATOM   1585 C C   . GLY A 1 209 ? 24.727  45.195 145.863 1.00 122.79 ? 1395 GLY A C   1 
ATOM   1586 O O   . GLY A 1 209 ? 24.350  46.195 146.469 1.00 110.85 ? 1395 GLY A O   1 
ATOM   1587 N N   . ASP A 1 210 ? 25.931  44.666 146.023 1.00 124.97 ? 1396 ASP A N   1 
ATOM   1588 C CA  . ASP A 1 210 ? 26.902  45.232 146.945 1.00 119.18 ? 1396 ASP A CA  1 
ATOM   1589 C C   . ASP A 1 210 ? 27.222  46.660 146.528 1.00 107.78 ? 1396 ASP A C   1 
ATOM   1590 O O   . ASP A 1 210 ? 27.461  47.522 147.370 1.00 91.17  ? 1396 ASP A O   1 
ATOM   1591 C CB  . ASP A 1 210 ? 28.170  44.383 146.995 1.00 116.92 ? 1396 ASP A CB  1 
ATOM   1592 C CG  . ASP A 1 210 ? 28.901  44.515 148.311 1.00 110.93 ? 1396 ASP A CG  1 
ATOM   1593 O OD1 . ASP A 1 210 ? 28.583  45.451 149.072 1.00 122.30 ? 1396 ASP A OD1 1 
ATOM   1594 O OD2 . ASP A 1 210 ? 29.787  43.683 148.590 1.00 93.61  ? 1396 ASP A OD2 1 
ATOM   1595 N N   . ASP A 1 211 ? 27.237  46.902 145.223 1.00 105.69 ? 1397 ASP A N   1 
ATOM   1596 C CA  . ASP A 1 211 ? 27.529  48.227 144.699 1.00 96.92  ? 1397 ASP A CA  1 
ATOM   1597 C C   . ASP A 1 211 ? 26.512  49.251 145.185 1.00 86.79  ? 1397 ASP A C   1 
ATOM   1598 O O   . ASP A 1 211 ? 26.878  50.358 145.563 1.00 80.84  ? 1397 ASP A O   1 
ATOM   1599 C CB  . ASP A 1 211 ? 27.492  48.184 143.176 1.00 104.38 ? 1397 ASP A CB  1 
ATOM   1600 C CG  . ASP A 1 211 ? 26.352  47.336 142.652 1.00 106.93 ? 1397 ASP A CG  1 
ATOM   1601 O OD1 . ASP A 1 211 ? 26.180  46.201 143.145 1.00 96.67  ? 1397 ASP A OD1 1 
ATOM   1602 O OD2 . ASP A 1 211 ? 25.630  47.800 141.746 1.00 107.94 ? 1397 ASP A OD2 1 
ATOM   1603 N N   . VAL A 1 212 ? 25.237  48.886 145.172 1.00 79.86  ? 1398 VAL A N   1 
ATOM   1604 C CA  . VAL A 1 212 ? 24.198  49.779 145.665 1.00 67.39  ? 1398 VAL A CA  1 
ATOM   1605 C C   . VAL A 1 212 ? 24.422  49.981 147.153 1.00 81.99  ? 1398 VAL A C   1 
ATOM   1606 O O   . VAL A 1 212 ? 24.307  51.082 147.683 1.00 77.07  ? 1398 VAL A O   1 
ATOM   1607 C CB  . VAL A 1 212 ? 22.801  49.184 145.457 1.00 74.92  ? 1398 VAL A CB  1 
ATOM   1608 C CG1 . VAL A 1 212 ? 21.741  50.139 145.963 1.00 73.42  ? 1398 VAL A CG1 1 
ATOM   1609 C CG2 . VAL A 1 212 ? 22.575  48.865 143.996 1.00 93.22  ? 1398 VAL A CG2 1 
ATOM   1610 N N   . LYS A 1 213 ? 24.753  48.878 147.807 1.00 77.87  ? 1399 LYS A N   1 
ATOM   1611 C CA  . LYS A 1 213 ? 25.010  48.818 149.245 1.00 68.00  ? 1399 LYS A CA  1 
ATOM   1612 C C   . LYS A 1 213 ? 26.120  49.734 149.730 1.00 76.11  ? 1399 LYS A C   1 
ATOM   1613 O O   . LYS A 1 213 ? 26.102  50.167 150.887 1.00 81.45  ? 1399 LYS A O   1 
ATOM   1614 C CB  . LYS A 1 213 ? 25.350  47.390 149.671 1.00 80.61  ? 1399 LYS A CB  1 
ATOM   1615 C CG  . LYS A 1 213 ? 24.182  46.410 149.596 1.00 97.65  ? 1399 LYS A CG  1 
ATOM   1616 C CD  . LYS A 1 213 ? 23.910  45.758 150.951 1.00 87.79  ? 1399 LYS A CD  1 
ATOM   1617 C CE  . LYS A 1 213 ? 24.435  44.370 151.071 1.00 69.86  ? 1399 LYS A CE  1 
ATOM   1618 N NZ  . LYS A 1 213 ? 23.399  43.479 150.531 1.00 70.71  ? 1399 LYS A NZ  1 
ATOM   1619 N N   . ASN A 1 214 ? 27.086  50.020 148.853 1.00 96.58  ? 1400 ASN A N   1 
ATOM   1620 C CA  . ASN A 1 214 ? 28.251  50.847 149.208 1.00 97.42  ? 1400 ASN A CA  1 
ATOM   1621 C C   . ASN A 1 214 ? 28.237  52.262 148.605 1.00 101.45 ? 1400 ASN A C   1 
ATOM   1622 O O   . ASN A 1 214 ? 29.075  53.095 148.953 1.00 117.54 ? 1400 ASN A O   1 
ATOM   1623 C CB  . ASN A 1 214 ? 29.565  50.089 148.952 1.00 90.61  ? 1400 ASN A CB  1 
ATOM   1624 C CG  . ASN A 1 214 ? 29.604  48.739 149.678 1.00 97.31  ? 1400 ASN A CG  1 
ATOM   1625 O OD1 . ASN A 1 214 ? 28.677  47.939 149.567 1.00 95.92  ? 1400 ASN A OD1 1 
ATOM   1626 N ND2 . ASN A 1 214 ? 30.668  48.490 150.429 1.00 101.11 ? 1400 ASN A ND2 1 
ATOM   1627 N N   . ALA A 1 215 ? 27.255  52.539 147.748 1.00 98.17  ? 1401 ALA A N   1 
ATOM   1628 C CA  . ALA A 1 215 ? 27.010  53.892 147.225 1.00 93.37  ? 1401 ALA A CA  1 
ATOM   1629 C C   . ALA A 1 215 ? 26.788  54.925 148.344 1.00 96.88  ? 1401 ALA A C   1 
ATOM   1630 O O   . ALA A 1 215 ? 26.356  54.561 149.427 1.00 97.37  ? 1401 ALA A O   1 
ATOM   1631 C CB  . ALA A 1 215 ? 25.811  53.877 146.272 1.00 82.80  ? 1401 ALA A CB  1 
ATOM   1632 N N   . PRO A 1 216 ? 27.074  56.220 148.078 1.00 107.60 ? 1402 PRO A N   1 
ATOM   1633 C CA  . PRO A 1 216 ? 26.924  57.272 149.108 1.00 117.68 ? 1402 PRO A CA  1 
ATOM   1634 C C   . PRO A 1 216 ? 25.481  57.792 149.352 1.00 105.63 ? 1402 PRO A C   1 
ATOM   1635 O O   . PRO A 1 216 ? 25.156  58.183 150.484 1.00 96.75  ? 1402 PRO A O   1 
ATOM   1636 C CB  . PRO A 1 216 ? 27.818  58.408 148.577 1.00 116.80 ? 1402 PRO A CB  1 
ATOM   1637 C CG  . PRO A 1 216 ? 27.773  58.264 147.094 1.00 102.62 ? 1402 PRO A CG  1 
ATOM   1638 C CD  . PRO A 1 216 ? 27.598  56.775 146.808 1.00 102.26 ? 1402 PRO A CD  1 
ATOM   1639 N N   . GLY A 1 217 ? 24.645  57.812 148.303 1.00 102.76 ? 1403 GLY A N   1 
ATOM   1640 C CA  . GLY A 1 217 ? 23.240  58.252 148.399 1.00 94.34  ? 1403 GLY A CA  1 
ATOM   1641 C C   . GLY A 1 217 ? 22.327  57.291 149.152 1.00 87.90  ? 1403 GLY A C   1 
ATOM   1642 O O   . GLY A 1 217 ? 22.741  56.207 149.569 1.00 84.50  ? 1403 GLY A O   1 
ATOM   1643 N N   . GLN A 1 218 ? 21.077  57.701 149.322 1.00 76.83  ? 1404 GLN A N   1 
ATOM   1644 C CA  . GLN A 1 218 ? 20.068  56.907 150.012 1.00 66.04  ? 1404 GLN A CA  1 
ATOM   1645 C C   . GLN A 1 218 ? 19.132  56.190 149.030 1.00 79.30  ? 1404 GLN A C   1 
ATOM   1646 O O   . GLN A 1 218 ? 18.414  56.828 148.231 1.00 81.11  ? 1404 GLN A O   1 
ATOM   1647 C CB  . GLN A 1 218 ? 19.231  57.810 150.905 1.00 49.06  ? 1404 GLN A CB  1 
ATOM   1648 C CG  . GLN A 1 218 ? 19.985  58.493 152.006 1.00 60.17  ? 1404 GLN A CG  1 
ATOM   1649 C CD  . GLN A 1 218 ? 19.137  59.535 152.720 1.00 81.42  ? 1404 GLN A CD  1 
ATOM   1650 O OE1 . GLN A 1 218 ? 18.236  60.155 152.129 1.00 93.57  ? 1404 GLN A OE1 1 
ATOM   1651 N NE2 . GLN A 1 218 ? 19.421  59.738 154.001 1.00 71.40  ? 1404 GLN A NE2 1 
ATOM   1652 N N   . TYR A 1 219 ? 19.123  54.864 149.097 1.00 80.13  ? 1405 TYR A N   1 
ATOM   1653 C CA  . TYR A 1 219 ? 18.157  54.099 148.312 1.00 83.33  ? 1405 TYR A CA  1 
ATOM   1654 C C   . TYR A 1 219 ? 17.213  53.298 149.210 1.00 74.21  ? 1405 TYR A C   1 
ATOM   1655 O O   . TYR A 1 219 ? 17.671  52.551 150.081 1.00 72.79  ? 1405 TYR A O   1 
ATOM   1656 C CB  . TYR A 1 219 ? 18.868  53.182 147.314 1.00 97.61  ? 1405 TYR A CB  1 
ATOM   1657 C CG  . TYR A 1 219 ? 20.007  53.846 146.576 1.00 102.09 ? 1405 TYR A CG  1 
ATOM   1658 C CD1 . TYR A 1 219 ? 21.207  54.125 147.236 1.00 111.01 ? 1405 TYR A CD1 1 
ATOM   1659 C CD2 . TYR A 1 219 ? 19.891  54.200 145.223 1.00 88.29  ? 1405 TYR A CD2 1 
ATOM   1660 C CE1 . TYR A 1 219 ? 22.258  54.743 146.581 1.00 124.56 ? 1405 TYR A CE1 1 
ATOM   1661 C CE2 . TYR A 1 219 ? 20.942  54.821 144.550 1.00 104.21 ? 1405 TYR A CE2 1 
ATOM   1662 C CZ  . TYR A 1 219 ? 22.124  55.089 145.238 1.00 125.30 ? 1405 TYR A CZ  1 
ATOM   1663 O OH  . TYR A 1 219 ? 23.188  55.699 144.605 1.00 126.16 ? 1405 TYR A OH  1 
ATOM   1664 N N   . ILE A 1 220 ? 15.907  53.472 148.978 1.00 67.47  ? 1406 ILE A N   1 
ATOM   1665 C CA  . ILE A 1 220 ? 14.852  52.872 149.783 1.00 43.15  ? 1406 ILE A CA  1 
ATOM   1666 C C   . ILE A 1 220 ? 13.978  51.873 149.000 1.00 60.05  ? 1406 ILE A C   1 
ATOM   1667 O O   . ILE A 1 220 ? 13.363  52.202 147.970 1.00 52.25  ? 1406 ILE A O   1 
ATOM   1668 C CB  . ILE A 1 220 ? 13.936  53.929 150.384 1.00 38.38  ? 1406 ILE A CB  1 
ATOM   1669 C CG1 . ILE A 1 220 ? 14.713  54.871 151.279 1.00 58.03  ? 1406 ILE A CG1 1 
ATOM   1670 C CG2 . ILE A 1 220 ? 12.911  53.291 151.235 1.00 32.62  ? 1406 ILE A CG2 1 
ATOM   1671 C CD1 . ILE A 1 220 ? 13.815  55.766 152.116 1.00 50.75  ? 1406 ILE A CD1 1 
ATOM   1672 N N   . GLN A 1 221 ? 13.914  50.660 149.538 1.00 53.91  ? 1407 GLN A N   1 
ATOM   1673 C CA  . GLN A 1 221 ? 13.084  49.578 149.046 1.00 40.91  ? 1407 GLN A CA  1 
ATOM   1674 C C   . GLN A 1 221 ? 11.875  49.376 149.963 1.00 60.46  ? 1407 GLN A C   1 
ATOM   1675 O O   . GLN A 1 221 ? 12.014  49.145 151.175 1.00 55.24  ? 1407 GLN A O   1 
ATOM   1676 C CB  . GLN A 1 221 ? 13.904  48.304 149.073 1.00 47.39  ? 1407 GLN A CB  1 
ATOM   1677 C CG  . GLN A 1 221 ? 13.563  47.281 148.029 1.00 59.46  ? 1407 GLN A CG  1 
ATOM   1678 C CD  . GLN A 1 221 ? 14.586  46.152 147.970 1.00 72.40  ? 1407 GLN A CD  1 
ATOM   1679 O OE1 . GLN A 1 221 ? 14.854  45.498 148.983 1.00 63.09  ? 1407 GLN A OE1 1 
ATOM   1680 N NE2 . GLN A 1 221 ? 15.166  45.919 146.784 1.00 73.81  ? 1407 GLN A NE2 1 
ATOM   1681 N N   . CYS A 1 222 ? 10.680  49.438 149.392 1.00 56.66  ? 1408 CYS A N   1 
ATOM   1682 C CA  . CYS A 1 222 ? 9.491   49.253 150.185 1.00 52.05  ? 1408 CYS A CA  1 
ATOM   1683 C C   . CYS A 1 222 ? 8.458   48.395 149.468 1.00 55.51  ? 1408 CYS A C   1 
ATOM   1684 O O   . CYS A 1 222 ? 8.057   48.686 148.332 1.00 61.40  ? 1408 CYS A O   1 
ATOM   1685 C CB  . CYS A 1 222 ? 8.894   50.606 150.549 1.00 54.36  ? 1408 CYS A CB  1 
ATOM   1686 S SG  . CYS A 1 222 ? 7.441   50.448 151.597 1.00 55.06  ? 1408 CYS A SG  1 
ATOM   1687 N N   . PHE A 1 223 ? 7.994   47.355 150.149 1.00 46.36  ? 1409 PHE A N   1 
ATOM   1688 C CA  . PHE A 1 223 ? 6.920   46.543 149.618 1.00 39.16  ? 1409 PHE A CA  1 
ATOM   1689 C C   . PHE A 1 223 ? 6.132   45.848 150.714 1.00 53.02  ? 1409 PHE A C   1 
ATOM   1690 O O   . PHE A 1 223 ? 6.687   45.558 151.780 1.00 53.10  ? 1409 PHE A O   1 
ATOM   1691 C CB  . PHE A 1 223 ? 7.487   45.493 148.693 1.00 44.45  ? 1409 PHE A CB  1 
ATOM   1692 C CG  . PHE A 1 223 ? 8.652   44.760 149.258 1.00 46.79  ? 1409 PHE A CG  1 
ATOM   1693 C CD1 . PHE A 1 223 ? 9.932   45.288 149.194 1.00 47.48  ? 1409 PHE A CD1 1 
ATOM   1694 C CD2 . PHE A 1 223 ? 8.489   43.518 149.838 1.00 52.35  ? 1409 PHE A CD2 1 
ATOM   1695 C CE1 . PHE A 1 223 ? 11.011  44.572 149.712 1.00 47.79  ? 1409 PHE A CE1 1 
ATOM   1696 C CE2 . PHE A 1 223 ? 9.583   42.798 150.355 1.00 32.20  ? 1409 PHE A CE2 1 
ATOM   1697 C CZ  . PHE A 1 223 ? 10.828  43.329 150.292 1.00 33.99  ? 1409 PHE A CZ  1 
ATOM   1698 N N   . THR A 1 224 ? 4.858   45.543 150.422 1.00 42.97  ? 1410 THR A N   1 
ATOM   1699 C CA  . THR A 1 224 ? 3.986   44.791 151.326 1.00 43.37  ? 1410 THR A CA  1 
ATOM   1700 C C   . THR A 1 224 ? 4.416   43.345 151.444 1.00 43.56  ? 1410 THR A C   1 
ATOM   1701 O O   . THR A 1 224 ? 4.667   42.690 150.458 1.00 37.45  ? 1410 THR A O   1 
ATOM   1702 C CB  . THR A 1 224 ? 2.524   44.799 150.858 1.00 35.26  ? 1410 THR A CB  1 
ATOM   1703 O OG1 . THR A 1 224 ? 2.085   46.140 150.602 1.00 44.39  ? 1410 THR A OG1 1 
ATOM   1704 C CG2 . THR A 1 224 ? 1.647   44.226 151.908 1.00 45.47  ? 1410 THR A CG2 1 
ATOM   1705 N N   . VAL A 1 225 ? 4.485   42.855 152.670 1.00 40.71  ? 1411 VAL A N   1 
ATOM   1706 C CA  . VAL A 1 225 ? 4.840   41.454 152.948 1.00 42.25  ? 1411 VAL A CA  1 
ATOM   1707 C C   . VAL A 1 225 ? 3.687   40.703 153.623 1.00 36.59  ? 1411 VAL A C   1 
ATOM   1708 O O   . VAL A 1 225 ? 2.837   41.312 154.236 1.00 50.24  ? 1411 VAL A O   1 
ATOM   1709 C CB  . VAL A 1 225 ? 6.123   41.339 153.803 1.00 38.17  ? 1411 VAL A CB  1 
ATOM   1710 C CG1 . VAL A 1 225 ? 7.315   41.779 153.008 1.00 38.60  ? 1411 VAL A CG1 1 
ATOM   1711 C CG2 . VAL A 1 225 ? 6.019   42.183 155.041 1.00 51.67  ? 1411 VAL A CG2 1 
ATOM   1712 N N   . GLN A 1 226 ? 3.646   39.387 153.501 1.00 40.08  ? 1412 GLN A N   1 
ATOM   1713 C CA  . GLN A 1 226 ? 2.530   38.629 154.033 1.00 45.12  ? 1412 GLN A CA  1 
ATOM   1714 C C   . GLN A 1 226 ? 2.869   37.938 155.377 1.00 49.01  ? 1412 GLN A C   1 
ATOM   1715 O O   . GLN A 1 226 ? 3.837   37.190 155.470 1.00 46.82  ? 1412 GLN A O   1 
ATOM   1716 C CB  . GLN A 1 226 ? 2.061   37.611 152.993 1.00 30.68  ? 1412 GLN A CB  1 
ATOM   1717 C CG  . GLN A 1 226 ? 0.590   37.598 152.823 1.00 45.72  ? 1412 GLN A CG  1 
ATOM   1718 C CD  . GLN A 1 226 ? 0.129   38.936 152.329 1.00 52.49  ? 1412 GLN A CD  1 
ATOM   1719 O OE1 . GLN A 1 226 ? 0.913   39.683 151.739 1.00 38.11  ? 1412 GLN A OE1 1 
ATOM   1720 N NE2 . GLN A 1 226 ? -1.131  39.260 152.561 1.00 42.19  ? 1412 GLN A NE2 1 
ATOM   1721 N N   . PRO A 1 227 ? 2.065   38.187 156.429 1.00 61.14  ? 1413 PRO A N   1 
ATOM   1722 C CA  . PRO A 1 227 ? 2.323   37.582 157.739 1.00 42.42  ? 1413 PRO A CA  1 
ATOM   1723 C C   . PRO A 1 227 ? 2.154   36.098 157.667 1.00 48.85  ? 1413 PRO A C   1 
ATOM   1724 O O   . PRO A 1 227 ? 1.330   35.620 156.875 1.00 56.60  ? 1413 PRO A O   1 
ATOM   1725 C CB  . PRO A 1 227 ? 1.191   38.120 158.627 1.00 36.28  ? 1413 PRO A CB  1 
ATOM   1726 C CG  . PRO A 1 227 ? 0.523   39.129 157.880 1.00 51.15  ? 1413 PRO A CG  1 
ATOM   1727 C CD  . PRO A 1 227 ? 0.843   39.010 156.432 1.00 46.92  ? 1413 PRO A CD  1 
ATOM   1728 N N   . VAL A 1 228 ? 2.899   35.384 158.504 1.00 32.22  ? 1414 VAL A N   1 
ATOM   1729 C CA  . VAL A 1 228 ? 2.798   33.946 158.583 1.00 41.05  ? 1414 VAL A CA  1 
ATOM   1730 C C   . VAL A 1 228 ? 2.306   33.515 159.941 1.00 56.72  ? 1414 VAL A C   1 
ATOM   1731 O O   . VAL A 1 228 ? 2.936   33.807 160.952 1.00 50.03  ? 1414 VAL A O   1 
ATOM   1732 C CB  . VAL A 1 228 ? 4.139   33.291 158.366 1.00 42.80  ? 1414 VAL A CB  1 
ATOM   1733 C CG1 . VAL A 1 228 ? 4.032   31.755 158.513 1.00 41.89  ? 1414 VAL A CG1 1 
ATOM   1734 C CG2 . VAL A 1 228 ? 4.681   33.696 157.003 1.00 50.34  ? 1414 VAL A CG2 1 
ATOM   1735 N N   . LEU A 1 229 ? 1.195   32.795 159.993 1.00 66.97  ? 1415 LEU A N   1 
ATOM   1736 C CA  . LEU A 1 229 ? 0.682   32.375 161.285 1.00 55.12  ? 1415 LEU A CA  1 
ATOM   1737 C C   . LEU A 1 229 ? 1.718   31.598 162.081 1.00 51.91  ? 1415 LEU A C   1 
ATOM   1738 O O   . LEU A 1 229 ? 2.339   30.664 161.585 1.00 61.63  ? 1415 LEU A O   1 
ATOM   1739 C CB  . LEU A 1 229 ? -0.563  31.513 161.094 1.00 48.34  ? 1415 LEU A CB  1 
ATOM   1740 C CG  . LEU A 1 229 ? -1.112  30.794 162.325 1.00 57.30  ? 1415 LEU A CG  1 
ATOM   1741 C CD1 . LEU A 1 229 ? -1.824  31.767 163.240 1.00 62.22  ? 1415 LEU A CD1 1 
ATOM   1742 C CD2 . LEU A 1 229 ? -2.054  29.694 161.899 1.00 47.84  ? 1415 LEU A CD2 1 
ATOM   1743 N N   . ASP A 1 230 ? 1.885   32.010 163.333 1.00 76.55  ? 1416 ASP A N   1 
ATOM   1744 C CA  . ASP A 1 230 ? 2.827   31.394 164.256 1.00 79.30  ? 1416 ASP A CA  1 
ATOM   1745 C C   . ASP A 1 230 ? 2.219   30.155 164.890 1.00 80.60  ? 1416 ASP A C   1 
ATOM   1746 O O   . ASP A 1 230 ? 1.003   30.018 164.950 1.00 81.66  ? 1416 ASP A O   1 
ATOM   1747 C CB  . ASP A 1 230 ? 3.257   32.389 165.328 1.00 83.13  ? 1416 ASP A CB  1 
ATOM   1748 C CG  . ASP A 1 230 ? 4.461   31.917 166.100 1.00 77.51  ? 1416 ASP A CG  1 
ATOM   1749 O OD1 . ASP A 1 230 ? 4.643   30.691 166.217 1.00 79.62  ? 1416 ASP A OD1 1 
ATOM   1750 O OD2 . ASP A 1 230 ? 5.225   32.770 166.589 1.00 71.78  ? 1416 ASP A OD2 1 
ATOM   1751 N N   . GLU A 1 231 ? 3.063   29.252 165.366 1.00 92.95  ? 1417 GLU A N   1 
ATOM   1752 C CA  . GLU A 1 231 ? 2.569   28.033 165.983 1.00 108.09 ? 1417 GLU A CA  1 
ATOM   1753 C C   . GLU A 1 231 ? 1.986   28.255 167.374 1.00 94.74  ? 1417 GLU A C   1 
ATOM   1754 O O   . GLU A 1 231 ? 2.637   28.812 168.256 1.00 67.44  ? 1417 GLU A O   1 
ATOM   1755 C CB  . GLU A 1 231 ? 3.700   27.006 166.049 1.00 120.61 ? 1417 GLU A CB  1 
ATOM   1756 C CG  . GLU A 1 231 ? 3.680   26.120 167.278 1.00 135.43 ? 1417 GLU A CG  1 
ATOM   1757 C CD  . GLU A 1 231 ? 5.001   25.406 167.496 1.00 144.96 ? 1417 GLU A CD  1 
ATOM   1758 O OE1 . GLU A 1 231 ? 5.649   25.025 166.497 1.00 124.84 ? 1417 GLU A OE1 1 
ATOM   1759 O OE2 . GLU A 1 231 ? 5.390   25.226 168.669 1.00 147.54 ? 1417 GLU A OE2 1 
ATOM   1760 N N   . HIS A 1 232 ? 0.749   27.804 167.556 1.00 89.80  ? 1418 HIS A N   1 
ATOM   1761 C CA  . HIS A 1 232 ? 0.055   27.925 168.829 1.00 85.63  ? 1418 HIS A CA  1 
ATOM   1762 C C   . HIS A 1 232 ? -0.449  26.547 169.228 1.00 104.46 ? 1418 HIS A C   1 
ATOM   1763 O O   . HIS A 1 232 ? -1.193  25.912 168.487 1.00 119.33 ? 1418 HIS A O   1 
ATOM   1764 C CB  . HIS A 1 232 ? -1.099  28.915 168.719 1.00 75.77  ? 1418 HIS A CB  1 
ATOM   1765 C CG  . HIS A 1 232 ? -0.658  30.328 168.505 1.00 74.19  ? 1418 HIS A CG  1 
ATOM   1766 N ND1 . HIS A 1 232 ? -0.330  30.824 167.263 1.00 82.50  ? 1418 HIS A ND1 1 
ATOM   1767 C CD2 . HIS A 1 232 ? -0.482  31.349 169.375 1.00 68.08  ? 1418 HIS A CD2 1 
ATOM   1768 C CE1 . HIS A 1 232 ? 0.024   32.091 167.376 1.00 79.77  ? 1418 HIS A CE1 1 
ATOM   1769 N NE2 . HIS A 1 232 ? -0.059  32.434 168.648 1.00 92.60  ? 1418 HIS A NE2 1 
ATOM   1770 N N   . PRO A 1 233 ? -0.039  26.093 170.403 1.00 87.15  ? 1419 PRO A N   1 
ATOM   1771 C CA  . PRO A 1 233 ? -0.429  24.777 170.917 1.00 89.73  ? 1419 PRO A CA  1 
ATOM   1772 C C   . PRO A 1 233 ? -1.909  24.568 171.214 1.00 86.58  ? 1419 PRO A C   1 
ATOM   1773 O O   . PRO A 1 233 ? -2.440  23.496 170.930 1.00 79.85  ? 1419 PRO A O   1 
ATOM   1774 C CB  . PRO A 1 233 ? 0.375   24.666 172.215 1.00 88.87  ? 1419 PRO A CB  1 
ATOM   1775 C CG  . PRO A 1 233 ? 1.548   25.548 172.003 1.00 86.76  ? 1419 PRO A CG  1 
ATOM   1776 C CD  . PRO A 1 233 ? 1.040   26.698 171.199 1.00 75.69  ? 1419 PRO A CD  1 
ATOM   1777 N N   . ARG A 1 234 ? -2.562  25.572 171.783 1.00 88.99  ? 1420 ARG A N   1 
ATOM   1778 C CA  . ARG A 1 234 ? -3.954  25.464 172.127 1.00 74.94  ? 1420 ARG A CA  1 
ATOM   1779 C C   . ARG A 1 234 ? -4.737  25.021 170.929 1.00 74.69  ? 1420 ARG A C   1 
ATOM   1780 O O   . ARG A 1 234 ? -5.705  24.309 171.074 1.00 69.02  ? 1420 ARG A O   1 
ATOM   1781 C CB  . ARG A 1 234 ? -4.490  26.796 172.655 1.00 57.25  ? 1420 ARG A CB  1 
ATOM   1782 N N   . PHE A 1 235 ? -4.339  25.440 169.741 1.00 65.66  ? 1421 PHE A N   1 
ATOM   1783 C CA  . PHE A 1 235 ? -5.081  25.045 168.562 1.00 77.60  ? 1421 PHE A CA  1 
ATOM   1784 C C   . PHE A 1 235 ? -4.418  23.940 167.767 1.00 78.08  ? 1421 PHE A C   1 
ATOM   1785 O O   . PHE A 1 235 ? -4.812  23.700 166.644 1.00 89.18  ? 1421 PHE A O   1 
ATOM   1786 C CB  . PHE A 1 235 ? -5.201  26.216 167.590 1.00 64.82  ? 1421 PHE A CB  1 
ATOM   1787 C CG  . PHE A 1 235 ? -5.490  27.542 168.229 1.00 83.40  ? 1421 PHE A CG  1 
ATOM   1788 C CD1 . PHE A 1 235 ? -6.407  27.667 169.231 1.00 90.06  ? 1421 PHE A CD1 1 
ATOM   1789 C CD2 . PHE A 1 235 ? -4.878  28.678 167.767 1.00 84.63  ? 1421 PHE A CD2 1 
ATOM   1790 C CE1 . PHE A 1 235 ? -6.672  28.882 169.780 1.00 70.16  ? 1421 PHE A CE1 1 
ATOM   1791 C CE2 . PHE A 1 235 ? -5.150  29.886 168.322 1.00 74.22  ? 1421 PHE A CE2 1 
ATOM   1792 C CZ  . PHE A 1 235 ? -6.046  29.984 169.328 1.00 54.84  ? 1421 PHE A CZ  1 
ATOM   1793 N N   . LYS A 1 236 ? -3.412  23.277 168.315 1.00 83.71  ? 1422 LYS A N   1 
ATOM   1794 C CA  . LYS A 1 236 ? -2.689  22.254 167.568 1.00 92.05  ? 1422 LYS A CA  1 
ATOM   1795 C C   . LYS A 1 236 ? -3.514  21.084 167.031 1.00 88.43  ? 1422 LYS A C   1 
ATOM   1796 O O   . LYS A 1 236 ? -3.337  20.690 165.882 1.00 101.22 ? 1422 LYS A O   1 
ATOM   1797 C CB  . LYS A 1 236 ? -1.536  21.713 168.415 1.00 83.28  ? 1422 LYS A CB  1 
ATOM   1798 N N   . ASN A 1 237 ? -4.406  20.524 167.836 1.00 66.00  ? 1423 ASN A N   1 
ATOM   1799 C CA  . ASN A 1 237 ? -5.237  19.425 167.351 1.00 99.32  ? 1423 ASN A CA  1 
ATOM   1800 C C   . ASN A 1 237 ? -6.721  19.762 167.335 1.00 98.29  ? 1423 ASN A C   1 
ATOM   1801 O O   . ASN A 1 237 ? -7.522  19.086 166.696 1.00 87.27  ? 1423 ASN A O   1 
ATOM   1802 C CB  . ASN A 1 237 ? -4.986  18.160 168.171 1.00 131.46 ? 1423 ASN A CB  1 
ATOM   1803 C CG  . ASN A 1 237 ? -3.589  17.607 167.970 1.00 152.08 ? 1423 ASN A CG  1 
ATOM   1804 O OD1 . ASN A 1 237 ? -2.975  17.810 166.923 1.00 163.13 ? 1423 ASN A OD1 1 
ATOM   1805 N ND2 . ASN A 1 237 ? -3.080  16.901 168.974 1.00 143.37 ? 1423 ASN A ND2 1 
ATOM   1806 N N   . LYS A 1 238 ? -7.068  20.824 168.047 1.00 106.96 ? 1424 LYS A N   1 
ATOM   1807 C CA  . LYS A 1 238 ? -8.448  21.256 168.208 1.00 98.07  ? 1424 LYS A CA  1 
ATOM   1808 C C   . LYS A 1 238 ? -9.016  21.911 166.959 1.00 99.73  ? 1424 LYS A C   1 
ATOM   1809 O O   . LYS A 1 238 ? -8.277  22.326 166.072 1.00 81.02  ? 1424 LYS A O   1 
ATOM   1810 C CB  . LYS A 1 238 ? -8.558  22.214 169.391 1.00 83.70  ? 1424 LYS A CB  1 
ATOM   1811 C CG  . LYS A 1 238 ? -7.782  21.768 170.616 1.00 78.31  ? 1424 LYS A CG  1 
ATOM   1812 C CD  . LYS A 1 238 ? -8.434  20.576 171.285 1.00 77.06  ? 1424 LYS A CD  1 
ATOM   1813 C CE  . LYS A 1 238 ? -7.732  20.234 172.584 1.00 65.02  ? 1424 LYS A CE  1 
ATOM   1814 N NZ  . LYS A 1 238 ? -7.752  18.776 172.864 1.00 95.97  ? 1424 LYS A NZ  1 
ATOM   1815 N N   . PRO A 1 239 ? -10.340 21.987 166.894 1.00 99.40  ? 1425 PRO A N   1 
ATOM   1816 C CA  . PRO A 1 239 ? -11.014 22.655 165.784 1.00 84.63  ? 1425 PRO A CA  1 
ATOM   1817 C C   . PRO A 1 239 ? -11.366 24.063 166.226 1.00 82.67  ? 1425 PRO A C   1 
ATOM   1818 O O   . PRO A 1 239 ? -12.096 24.230 167.198 1.00 91.22  ? 1425 PRO A O   1 
ATOM   1819 C CB  . PRO A 1 239 ? -12.289 21.837 165.635 1.00 85.64  ? 1425 PRO A CB  1 
ATOM   1820 C CG  . PRO A 1 239 ? -12.604 21.417 167.031 1.00 83.70  ? 1425 PRO A CG  1 
ATOM   1821 C CD  . PRO A 1 239 ? -11.288 21.255 167.749 1.00 84.03  ? 1425 PRO A CD  1 
ATOM   1822 N N   . VAL A 1 240 ? -10.856 25.060 165.513 1.00 69.35  ? 1426 VAL A N   1 
ATOM   1823 C CA  . VAL A 1 240 ? -11.028 26.454 165.896 1.00 48.17  ? 1426 VAL A CA  1 
ATOM   1824 C C   . VAL A 1 240 ? -11.779 27.251 164.845 1.00 47.93  ? 1426 VAL A C   1 
ATOM   1825 O O   . VAL A 1 240 ? -11.526 27.113 163.655 1.00 50.51  ? 1426 VAL A O   1 
ATOM   1826 C CB  . VAL A 1 240 ? -9.668  27.125 166.146 1.00 48.68  ? 1426 VAL A CB  1 
ATOM   1827 C CG1 . VAL A 1 240 ? -9.853  28.459 166.827 1.00 46.56  ? 1426 VAL A CG1 1 
ATOM   1828 C CG2 . VAL A 1 240 ? -8.786  26.227 166.982 1.00 71.36  ? 1426 VAL A CG2 1 
ATOM   1829 N N   . PRO A 1 241 ? -12.709 28.082 165.294 1.00 54.85  ? 1427 PRO A N   1 
ATOM   1830 C CA  . PRO A 1 241 ? -13.501 28.912 164.389 1.00 45.26  ? 1427 PRO A CA  1 
ATOM   1831 C C   . PRO A 1 241 ? -12.630 29.917 163.655 1.00 57.82  ? 1427 PRO A C   1 
ATOM   1832 O O   . PRO A 1 241 ? -11.655 30.415 164.203 1.00 53.26  ? 1427 PRO A O   1 
ATOM   1833 C CB  . PRO A 1 241 ? -14.453 29.631 165.335 1.00 50.21  ? 1427 PRO A CB  1 
ATOM   1834 C CG  . PRO A 1 241 ? -14.660 28.666 166.430 1.00 58.85  ? 1427 PRO A CG  1 
ATOM   1835 C CD  . PRO A 1 241 ? -13.377 27.903 166.593 1.00 41.92  ? 1427 PRO A CD  1 
ATOM   1836 N N   . ASP A 1 242 ? -13.015 30.248 162.433 1.00 64.15  ? 1428 ASP A N   1 
ATOM   1837 C CA  . ASP A 1 242 ? -12.262 31.186 161.621 1.00 65.42  ? 1428 ASP A CA  1 
ATOM   1838 C C   . ASP A 1 242 ? -12.115 32.515 162.327 1.00 52.31  ? 1428 ASP A C   1 
ATOM   1839 O O   . ASP A 1 242 ? -11.083 33.166 162.225 1.00 53.78  ? 1428 ASP A O   1 
ATOM   1840 C CB  . ASP A 1 242 ? -12.981 31.422 160.291 1.00 63.62  ? 1428 ASP A CB  1 
ATOM   1841 C CG  . ASP A 1 242 ? -13.052 30.182 159.435 1.00 73.81  ? 1428 ASP A CG  1 
ATOM   1842 O OD1 . ASP A 1 242 ? -12.029 29.483 159.316 1.00 82.60  ? 1428 ASP A OD1 1 
ATOM   1843 O OD2 . ASP A 1 242 ? -14.130 29.915 158.868 1.00 69.45  ? 1428 ASP A OD2 1 
ATOM   1844 N N   . GLN A 1 243 ? -13.137 32.923 163.063 1.00 45.70  ? 1429 GLN A N   1 
ATOM   1845 C CA  . GLN A 1 243 ? -13.052 34.198 163.751 1.00 53.38  ? 1429 GLN A CA  1 
ATOM   1846 C C   . GLN A 1 243 ? -11.917 34.278 164.766 1.00 61.36  ? 1429 GLN A C   1 
ATOM   1847 O O   . GLN A 1 243 ? -11.171 35.250 164.779 1.00 65.46  ? 1429 GLN A O   1 
ATOM   1848 C CB  . GLN A 1 243 ? -14.376 34.468 164.460 1.00 59.35  ? 1429 GLN A CB  1 
ATOM   1849 C CG  . GLN A 1 243 ? -14.469 35.824 165.116 1.00 88.44  ? 1429 GLN A CG  1 
ATOM   1850 C CD  . GLN A 1 243 ? -14.880 36.901 164.146 1.00 85.50  ? 1429 GLN A CD  1 
ATOM   1851 O OE1 . GLN A 1 243 ? -14.897 36.686 162.939 1.00 91.72  ? 1429 GLN A OE1 1 
ATOM   1852 N NE2 . GLN A 1 243 ? -15.218 38.071 164.668 1.00 103.06 ? 1429 GLN A NE2 1 
ATOM   1853 N N   . ILE A 1 244 ? -11.777 33.269 165.616 1.00 63.91  ? 1430 ILE A N   1 
ATOM   1854 C CA  . ILE A 1 244 ? -10.703 33.287 166.604 1.00 49.60  ? 1430 ILE A CA  1 
ATOM   1855 C C   . ILE A 1 244 ? -9.303  33.102 166.008 1.00 40.31  ? 1430 ILE A C   1 
ATOM   1856 O O   . ILE A 1 244 ? -8.359  33.782 166.387 1.00 71.00  ? 1430 ILE A O   1 
ATOM   1857 C CB  . ILE A 1 244 ? -10.950 32.288 167.756 1.00 48.19  ? 1430 ILE A CB  1 
ATOM   1858 C CG1 . ILE A 1 244 ? -10.396 30.911 167.418 1.00 79.98  ? 1430 ILE A CG1 1 
ATOM   1859 C CG2 . ILE A 1 244 ? -12.426 32.196 168.080 1.00 49.87  ? 1430 ILE A CG2 1 
ATOM   1860 C CD1 . ILE A 1 244 ? -10.643 29.901 168.501 1.00 101.34 ? 1430 ILE A CD1 1 
ATOM   1861 N N   . ILE A 1 245 ? -9.192  32.160 165.080 1.00 47.66  ? 1431 ILE A N   1 
ATOM   1862 C CA  . ILE A 1 245 ? -7.937  31.831 164.398 1.00 43.51  ? 1431 ILE A CA  1 
ATOM   1863 C C   . ILE A 1 245 ? -7.328  32.846 163.422 1.00 58.33  ? 1431 ILE A C   1 
ATOM   1864 O O   . ILE A 1 245 ? -6.119  33.041 163.392 1.00 61.42  ? 1431 ILE A O   1 
ATOM   1865 C CB  . ILE A 1 245 ? -8.056  30.483 163.667 1.00 55.16  ? 1431 ILE A CB  1 
ATOM   1866 C CG1 . ILE A 1 245 ? -6.673  29.947 163.313 1.00 52.28  ? 1431 ILE A CG1 1 
ATOM   1867 C CG2 . ILE A 1 245 ? -8.906  30.624 162.427 1.00 64.53  ? 1431 ILE A CG2 1 
ATOM   1868 C CD1 . ILE A 1 245 ? -5.822  29.643 164.515 1.00 55.24  ? 1431 ILE A CD1 1 
ATOM   1869 N N   . ASN A 1 246 ? -8.178  33.477 162.622 1.00 67.47  ? 1432 ASN A N   1 
ATOM   1870 C CA  . ASN A 1 246 ? -7.763  34.447 161.622 1.00 55.09  ? 1432 ASN A CA  1 
ATOM   1871 C C   . ASN A 1 246 ? -6.983  35.619 162.191 1.00 69.67  ? 1432 ASN A C   1 
ATOM   1872 O O   . ASN A 1 246 ? -6.039  36.099 161.572 1.00 83.51  ? 1432 ASN A O   1 
ATOM   1873 C CB  . ASN A 1 246 ? -8.973  34.955 160.843 1.00 44.96  ? 1432 ASN A CB  1 
ATOM   1874 C CG  . ASN A 1 246 ? -9.465  33.958 159.827 1.00 56.56  ? 1432 ASN A CG  1 
ATOM   1875 O OD1 . ASN A 1 246 ? -8.797  32.972 159.539 1.00 69.16  ? 1432 ASN A OD1 1 
ATOM   1876 N ND2 . ASN A 1 246 ? -10.638 34.213 159.270 1.00 70.13  ? 1432 ASN A ND2 1 
ATOM   1877 N N   . PHE A 1 247 ? -7.374  36.082 163.367 1.00 55.21  ? 1433 PHE A N   1 
ATOM   1878 C CA  . PHE A 1 247 ? -6.696  37.209 163.981 1.00 50.37  ? 1433 PHE A CA  1 
ATOM   1879 C C   . PHE A 1 247 ? -5.234  36.885 164.240 1.00 53.81  ? 1433 PHE A C   1 
ATOM   1880 O O   . PHE A 1 247 ? -4.362  37.728 164.077 1.00 54.00  ? 1433 PHE A O   1 
ATOM   1881 C CB  . PHE A 1 247 ? -7.374  37.599 165.286 1.00 48.26  ? 1433 PHE A CB  1 
ATOM   1882 C CG  . PHE A 1 247 ? -6.596  38.588 166.088 1.00 57.86  ? 1433 PHE A CG  1 
ATOM   1883 C CD1 . PHE A 1 247 ? -5.666  38.162 167.016 1.00 48.17  ? 1433 PHE A CD1 1 
ATOM   1884 C CD2 . PHE A 1 247 ? -6.782  39.945 165.909 1.00 47.35  ? 1433 PHE A CD2 1 
ATOM   1885 C CE1 . PHE A 1 247 ? -4.945  39.070 167.755 1.00 74.23  ? 1433 PHE A CE1 1 
ATOM   1886 C CE2 . PHE A 1 247 ? -6.063  40.855 166.645 1.00 42.07  ? 1433 PHE A CE2 1 
ATOM   1887 C CZ  . PHE A 1 247 ? -5.145  40.418 167.569 1.00 67.30  ? 1433 PHE A CZ  1 
ATOM   1888 N N   . TYR A 1 248 ? -4.975  35.653 164.647 1.00 48.40  ? 1434 TYR A N   1 
ATOM   1889 C CA  . TYR A 1 248 ? -3.621  35.202 164.933 1.00 62.38  ? 1434 TYR A CA  1 
ATOM   1890 C C   . TYR A 1 248 ? -2.719  35.247 163.707 1.00 47.78  ? 1434 TYR A C   1 
ATOM   1891 O O   . TYR A 1 248 ? -1.529  35.518 163.818 1.00 53.45  ? 1434 TYR A O   1 
ATOM   1892 C CB  . TYR A 1 248 ? -3.625  33.820 165.581 1.00 45.60  ? 1434 TYR A CB  1 
ATOM   1893 C CG  . TYR A 1 248 ? -3.845  33.889 167.071 1.00 57.71  ? 1434 TYR A CG  1 
ATOM   1894 C CD1 . TYR A 1 248 ? -2.830  34.304 167.919 1.00 55.80  ? 1434 TYR A CD1 1 
ATOM   1895 C CD2 . TYR A 1 248 ? -5.067  33.559 167.631 1.00 60.58  ? 1434 TYR A CD2 1 
ATOM   1896 C CE1 . TYR A 1 248 ? -3.023  34.378 169.279 1.00 64.40  ? 1434 TYR A CE1 1 
ATOM   1897 C CE2 . TYR A 1 248 ? -5.268  33.630 168.991 1.00 67.17  ? 1434 TYR A CE2 1 
ATOM   1898 C CZ  . TYR A 1 248 ? -4.243  34.041 169.810 1.00 69.91  ? 1434 TYR A CZ  1 
ATOM   1899 O OH  . TYR A 1 248 ? -4.437  34.113 171.166 1.00 60.54  ? 1434 TYR A OH  1 
ATOM   1900 N N   . LYS A 1 249 ? -3.289  34.958 162.546 1.00 47.30  ? 1435 LYS A N   1 
ATOM   1901 C CA  . LYS A 1 249 ? -2.535  34.968 161.302 1.00 50.23  ? 1435 LYS A CA  1 
ATOM   1902 C C   . LYS A 1 249 ? -1.973  36.351 160.993 1.00 46.65  ? 1435 LYS A C   1 
ATOM   1903 O O   . LYS A 1 249 ? -0.848  36.474 160.526 1.00 65.28  ? 1435 LYS A O   1 
ATOM   1904 C CB  . LYS A 1 249 ? -3.415  34.489 160.146 1.00 30.08  ? 1435 LYS A CB  1 
ATOM   1905 C CG  . LYS A 1 249 ? -4.003  33.106 160.358 1.00 53.73  ? 1435 LYS A CG  1 
ATOM   1906 C CD  . LYS A 1 249 ? -4.353  32.438 159.043 1.00 58.99  ? 1435 LYS A CD  1 
ATOM   1907 C CE  . LYS A 1 249 ? -5.752  32.788 158.582 1.00 80.73  ? 1435 LYS A CE  1 
ATOM   1908 N NZ  . LYS A 1 249 ? -6.779  31.919 159.212 1.00 85.39  ? 1435 LYS A NZ  1 
ATOM   1909 N N   . SER A 1 250 ? -2.760  37.390 161.240 1.00 53.06  ? 1436 SER A N   1 
ATOM   1910 C CA  . SER A 1 250 ? -2.321  38.758 160.985 1.00 51.70  ? 1436 SER A CA  1 
ATOM   1911 C C   . SER A 1 250 ? -1.665  39.466 162.175 1.00 44.49  ? 1436 SER A C   1 
ATOM   1912 O O   . SER A 1 250 ? -1.126  40.556 162.020 1.00 40.39  ? 1436 SER A O   1 
ATOM   1913 C CB  . SER A 1 250 ? -3.497  39.592 160.486 1.00 70.54  ? 1436 SER A CB  1 
ATOM   1914 O OG  . SER A 1 250 ? -4.265  38.862 159.550 1.00 71.30  ? 1436 SER A OG  1 
ATOM   1915 N N   . ASN A 1 251 ? -1.711  38.855 163.355 1.00 53.49  ? 1437 ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -1.137  39.458 164.559 1.00 46.35  ? 1437 ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -0.318  38.475 165.380 1.00 43.17  ? 1437 ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -0.533  37.272 165.298 1.00 37.77  ? 1437 ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -2.230  40.079 165.427 1.00 30.59  ? 1437 ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -3.080  41.067 164.669 1.00 41.35  ? 1437 ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -3.061  42.261 164.949 1.00 48.67  ? 1437 ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -3.828  40.575 163.696 1.00 45.41  ? 1437 ASN A ND2 1 
ATOM   1923 N N   . TYR A 1 252 ? 0.623   38.988 166.169 1.00 34.90  ? 1438 TYR A N   1 
ATOM   1924 C CA  . TYR A 1 252 ? 1.482   38.128 166.975 1.00 44.13  ? 1438 TYR A CA  1 
ATOM   1925 C C   . TYR A 1 252 ? 2.434   37.373 166.103 1.00 41.59  ? 1438 TYR A C   1 
ATOM   1926 O O   . TYR A 1 252 ? 2.803   36.243 166.400 1.00 53.57  ? 1438 TYR A O   1 
ATOM   1927 C CB  . TYR A 1 252 ? 0.675   37.086 167.646 1.00 42.55  ? 1438 TYR A CB  1 
ATOM   1928 C CG  . TYR A 1 252 ? -0.309  37.536 168.654 1.00 67.78  ? 1438 TYR A CG  1 
ATOM   1929 C CD1 . TYR A 1 252 ? 0.049   37.727 170.003 1.00 92.07  ? 1438 TYR A CD1 1 
ATOM   1930 C CD2 . TYR A 1 252 ? -1.598  37.895 168.223 1.00 87.25  ? 1438 TYR A CD2 1 
ATOM   1931 C CE1 . TYR A 1 252 ? -0.868  38.208 170.915 1.00 101.79 ? 1438 TYR A CE1 1 
ATOM   1932 C CE2 . TYR A 1 252 ? -2.533  38.389 169.107 1.00 96.90  ? 1438 TYR A CE2 1 
ATOM   1933 C CZ  . TYR A 1 252 ? -2.167  38.549 170.455 1.00 112.80 ? 1438 TYR A CZ  1 
ATOM   1934 O OH  . TYR A 1 252 ? -3.120  39.058 171.312 1.00 126.84 ? 1438 TYR A OH  1 
ATOM   1935 N N   . VAL A 1 253 ? 2.823   38.004 165.012 1.00 63.09  ? 1439 VAL A N   1 
ATOM   1936 C CA  . VAL A 1 253 ? 3.547   37.326 163.963 1.00 45.65  ? 1439 VAL A CA  1 
ATOM   1937 C C   . VAL A 1 253 ? 5.026   37.745 164.004 1.00 50.06  ? 1439 VAL A C   1 
ATOM   1938 O O   . VAL A 1 253 ? 5.374   38.870 164.393 1.00 47.91  ? 1439 VAL A O   1 
ATOM   1939 C CB  . VAL A 1 253 ? 2.859   37.596 162.621 1.00 41.74  ? 1439 VAL A CB  1 
ATOM   1940 C CG1 . VAL A 1 253 ? 1.561   36.800 162.552 1.00 37.14  ? 1439 VAL A CG1 1 
ATOM   1941 C CG2 . VAL A 1 253 ? 2.564   39.099 162.442 1.00 33.44  ? 1439 VAL A CG2 1 
ATOM   1942 N N   . GLN A 1 254 ? 5.897   36.807 163.654 1.00 56.55  ? 1440 GLN A N   1 
ATOM   1943 C CA  . GLN A 1 254 ? 7.318   37.100 163.623 1.00 41.73  ? 1440 GLN A CA  1 
ATOM   1944 C C   . GLN A 1 254 ? 7.930   36.724 162.271 1.00 52.06  ? 1440 GLN A C   1 
ATOM   1945 O O   . GLN A 1 254 ? 9.048   37.108 161.980 1.00 48.32  ? 1440 GLN A O   1 
ATOM   1946 C CB  . GLN A 1 254 ? 7.980   36.342 164.744 1.00 48.38  ? 1440 GLN A CB  1 
ATOM   1947 C CG  . GLN A 1 254 ? 9.313   36.933 165.103 1.00 77.42  ? 1440 GLN A CG  1 
ATOM   1948 C CD  . GLN A 1 254 ? 9.955   36.320 166.350 1.00 76.35  ? 1440 GLN A CD  1 
ATOM   1949 O OE1 . GLN A 1 254 ? 9.391   35.415 166.976 1.00 74.85  ? 1440 GLN A OE1 1 
ATOM   1950 N NE2 . GLN A 1 254 ? 11.132  36.832 166.722 1.00 69.90  ? 1440 GLN A NE2 1 
ATOM   1951 N N   . ARG A 1 255 ? 7.169   35.978 161.459 1.00 34.97  ? 1441 ARG A N   1 
ATOM   1952 C CA  . ARG A 1 255 ? 7.563   35.622 160.095 1.00 47.09  ? 1441 ARG A CA  1 
ATOM   1953 C C   . ARG A 1 255 ? 6.718   36.259 158.955 1.00 48.52  ? 1441 ARG A C   1 
ATOM   1954 O O   . ARG A 1 255 ? 5.502   36.323 159.045 1.00 43.05  ? 1441 ARG A O   1 
ATOM   1955 C CB  . ARG A 1 255 ? 7.569   34.106 159.952 1.00 45.55  ? 1441 ARG A CB  1 
ATOM   1956 C CG  . ARG A 1 255 ? 8.512   33.628 158.881 1.00 71.60  ? 1441 ARG A CG  1 
ATOM   1957 C CD  . ARG A 1 255 ? 8.341   32.146 158.604 1.00 79.74  ? 1441 ARG A CD  1 
ATOM   1958 N NE  . ARG A 1 255 ? 9.333   31.334 159.317 1.00 98.33  ? 1441 ARG A NE  1 
ATOM   1959 C CZ  . ARG A 1 255 ? 10.601  31.157 158.933 1.00 102.14 ? 1441 ARG A CZ  1 
ATOM   1960 N NH1 . ARG A 1 255 ? 11.080  31.738 157.833 1.00 99.82  ? 1441 ARG A NH1 1 
ATOM   1961 N NH2 . ARG A 1 255 ? 11.405  30.396 159.658 1.00 89.58  ? 1441 ARG A NH2 1 
ATOM   1962 N N   . PHE A 1 256 ? 7.388   36.696 157.885 1.00 41.78  ? 1442 PHE A N   1 
ATOM   1963 C CA  . PHE A 1 256 ? 6.715   37.201 156.717 1.00 39.06  ? 1442 PHE A CA  1 
ATOM   1964 C C   . PHE A 1 256 ? 7.234   36.696 155.388 1.00 43.82  ? 1442 PHE A C   1 
ATOM   1965 O O   . PHE A 1 256 ? 8.369   36.259 155.284 1.00 55.41  ? 1442 PHE A O   1 
ATOM   1966 C CB  . PHE A 1 256 ? 6.762   38.694 156.765 1.00 45.77  ? 1442 PHE A CB  1 
ATOM   1967 C CG  . PHE A 1 256 ? 6.418   39.239 158.110 1.00 44.11  ? 1442 PHE A CG  1 
ATOM   1968 C CD1 . PHE A 1 256 ? 7.390   39.261 159.132 1.00 53.11  ? 1442 PHE A CD1 1 
ATOM   1969 C CD2 . PHE A 1 256 ? 5.136   39.712 158.382 1.00 45.84  ? 1442 PHE A CD2 1 
ATOM   1970 C CE1 . PHE A 1 256 ? 7.101   39.773 160.378 1.00 51.04  ? 1442 PHE A CE1 1 
ATOM   1971 C CE2 . PHE A 1 256 ? 4.839   40.219 159.628 1.00 57.12  ? 1442 PHE A CE2 1 
ATOM   1972 C CZ  . PHE A 1 256 ? 5.810   40.250 160.625 1.00 43.56  ? 1442 PHE A CZ  1 
ATOM   1973 N N   . HIS A 1 257 ? 6.386   36.757 154.367 1.00 52.65  ? 1443 HIS A N   1 
ATOM   1974 C CA  . HIS A 1 257 ? 6.726   36.328 153.005 1.00 46.57  ? 1443 HIS A CA  1 
ATOM   1975 C C   . HIS A 1 257 ? 6.593   37.502 152.026 1.00 56.09  ? 1443 HIS A C   1 
ATOM   1976 O O   . HIS A 1 257 ? 5.723   38.376 152.189 1.00 53.86  ? 1443 HIS A O   1 
ATOM   1977 C CB  . HIS A 1 257 ? 5.723   35.272 152.510 1.00 42.08  ? 1443 HIS A CB  1 
ATOM   1978 C CG  . HIS A 1 257 ? 5.767   33.965 153.240 1.00 70.24  ? 1443 HIS A CG  1 
ATOM   1979 N ND1 . HIS A 1 257 ? 6.943   33.243 153.412 1.00 79.20  ? 1443 HIS A ND1 1 
ATOM   1980 C CD2 . HIS A 1 257 ? 4.774   33.213 153.793 1.00 79.80  ? 1443 HIS A CD2 1 
ATOM   1981 C CE1 . HIS A 1 257 ? 6.678   32.118 154.060 1.00 67.92  ? 1443 HIS A CE1 1 
ATOM   1982 N NE2 . HIS A 1 257 ? 5.370   32.080 154.312 1.00 83.39  ? 1443 HIS A NE2 1 
ATOM   1983 N N   . TYR A 1 258 ? 7.428   37.522 150.996 1.00 46.66  ? 1444 TYR A N   1 
ATOM   1984 C CA  . TYR A 1 258 ? 7.088   38.242 149.784 1.00 44.06  ? 1444 TYR A CA  1 
ATOM   1985 C C   . TYR A 1 258 ? 7.193   37.238 148.640 1.00 55.36  ? 1444 TYR A C   1 
ATOM   1986 O O   . TYR A 1 258 ? 8.159   36.470 148.559 1.00 43.67  ? 1444 TYR A O   1 
ATOM   1987 C CB  . TYR A 1 258 ? 8.004   39.435 149.526 1.00 39.31  ? 1444 TYR A CB  1 
ATOM   1988 C CG  . TYR A 1 258 ? 7.642   40.171 148.266 1.00 38.18  ? 1444 TYR A CG  1 
ATOM   1989 C CD1 . TYR A 1 258 ? 6.516   40.980 148.224 1.00 55.89  ? 1444 TYR A CD1 1 
ATOM   1990 C CD2 . TYR A 1 258 ? 8.375   40.019 147.110 1.00 48.92  ? 1444 TYR A CD2 1 
ATOM   1991 C CE1 . TYR A 1 258 ? 6.150   41.663 147.073 1.00 43.75  ? 1444 TYR A CE1 1 
ATOM   1992 C CE2 . TYR A 1 258 ? 8.012   40.696 145.929 1.00 44.07  ? 1444 TYR A CE2 1 
ATOM   1993 C CZ  . TYR A 1 258 ? 6.896   41.520 145.924 1.00 52.32  ? 1444 TYR A CZ  1 
ATOM   1994 O OH  . TYR A 1 258 ? 6.485   42.196 144.788 1.00 58.12  ? 1444 TYR A OH  1 
ATOM   1995 N N   . SER A 1 259 ? 6.194   37.233 147.762 1.00 56.36  ? 1445 SER A N   1 
ATOM   1996 C CA  . SER A 1 259 ? 6.257   36.391 146.589 1.00 45.17  ? 1445 SER A CA  1 
ATOM   1997 C C   . SER A 1 259 ? 6.290   37.245 145.330 1.00 59.72  ? 1445 SER A C   1 
ATOM   1998 O O   . SER A 1 259 ? 5.529   38.210 145.189 1.00 48.40  ? 1445 SER A O   1 
ATOM   1999 C CB  . SER A 1 259 ? 5.093   35.421 146.583 1.00 48.62  ? 1445 SER A CB  1 
ATOM   2000 O OG  . SER A 1 259 ? 5.084   34.681 147.792 1.00 55.94  ? 1445 SER A OG  1 
ATOM   2001 N N   . ARG A 1 260 ? 7.226   36.910 144.442 1.00 60.60  ? 1446 ARG A N   1 
ATOM   2002 C CA  . ARG A 1 260 ? 7.281   37.511 143.098 1.00 61.96  ? 1446 ARG A CA  1 
ATOM   2003 C C   . ARG A 1 260 ? 7.321   36.491 141.953 1.00 61.61  ? 1446 ARG A C   1 
ATOM   2004 O O   . ARG A 1 260 ? 7.957   35.422 142.063 1.00 44.22  ? 1446 ARG A O   1 
ATOM   2005 C CB  . ARG A 1 260 ? 8.427   38.522 142.959 1.00 64.64  ? 1446 ARG A CB  1 
ATOM   2006 C CG  . ARG A 1 260 ? 9.798   37.959 143.052 1.00 56.81  ? 1446 ARG A CG  1 
ATOM   2007 C CD  . ARG A 1 260 ? 10.795  39.095 143.036 1.00 78.08  ? 1446 ARG A CD  1 
ATOM   2008 N NE  . ARG A 1 260 ? 11.158  39.466 141.674 1.00 88.30  ? 1446 ARG A NE  1 
ATOM   2009 C CZ  . ARG A 1 260 ? 12.103  38.855 140.949 1.00 103.90 ? 1446 ARG A CZ  1 
ATOM   2010 N NH1 . ARG A 1 260 ? 12.803  37.824 141.441 1.00 92.09  ? 1446 ARG A NH1 1 
ATOM   2011 N NH2 . ARG A 1 260 ? 12.350  39.277 139.714 1.00 111.67 ? 1446 ARG A NH2 1 
ATOM   2012 N N   . PRO A 1 261 ? 6.665   36.821 140.868 1.00 68.50  ? 1447 PRO A N   1 
ATOM   2013 C CA  . PRO A 1 261 ? 6.627   35.933 139.729 1.00 71.81  ? 1447 PRO A CA  1 
ATOM   2014 C C   . PRO A 1 261 ? 7.830   36.126 138.846 1.00 70.94  ? 1447 PRO A C   1 
ATOM   2015 O O   . PRO A 1 261 ? 8.222   37.247 138.576 1.00 64.86  ? 1447 PRO A O   1 
ATOM   2016 C CB  . PRO A 1 261 ? 5.381   36.395 139.003 1.00 59.76  ? 1447 PRO A CB  1 
ATOM   2017 C CG  . PRO A 1 261 ? 5.333   37.798 139.281 1.00 65.29  ? 1447 PRO A CG  1 
ATOM   2018 C CD  . PRO A 1 261 ? 5.766   37.960 140.680 1.00 65.64  ? 1447 PRO A CD  1 
ATOM   2019 N N   . VAL A 1 262 ? 8.413   35.020 138.417 1.00 88.15  ? 1448 VAL A N   1 
ATOM   2020 C CA  . VAL A 1 262 ? 9.444   35.033 137.408 1.00 86.87  ? 1448 VAL A CA  1 
ATOM   2021 C C   . VAL A 1 262 ? 9.037   33.994 136.383 1.00 90.65  ? 1448 VAL A C   1 
ATOM   2022 O O   . VAL A 1 262 ? 8.444   32.981 136.721 1.00 84.45  ? 1448 VAL A O   1 
ATOM   2023 C CB  . VAL A 1 262 ? 10.807  34.707 137.959 1.00 68.05  ? 1448 VAL A CB  1 
ATOM   2024 C CG1 . VAL A 1 262 ? 10.761  34.659 139.434 1.00 67.53  ? 1448 VAL A CG1 1 
ATOM   2025 C CG2 . VAL A 1 262 ? 11.283  33.418 137.395 1.00 78.75  ? 1448 VAL A CG2 1 
ATOM   2026 N N   . ARG A 1 263 ? 9.341   34.264 135.124 1.00 99.32  ? 1449 ARG A N   1 
ATOM   2027 C CA  . ARG A 1 263 ? 8.986   33.365 134.047 1.00 97.29  ? 1449 ARG A CA  1 
ATOM   2028 C C   . ARG A 1 263 ? 10.245  32.675 133.599 1.00 98.05  ? 1449 ARG A C   1 
ATOM   2029 O O   . ARG A 1 263 ? 11.257  33.322 133.377 1.00 112.09 ? 1449 ARG A O   1 
ATOM   2030 C CB  . ARG A 1 263 ? 8.376   34.144 132.891 1.00 69.12  ? 1449 ARG A CB  1 
ATOM   2031 C CG  . ARG A 1 263 ? 7.269   33.406 132.187 1.00 69.49  ? 1449 ARG A CG  1 
ATOM   2032 C CD  . ARG A 1 263 ? 5.917   33.845 132.691 1.00 73.91  ? 1449 ARG A CD  1 
ATOM   2033 N N   . ARG A 1 264 ? 10.193  31.354 133.495 1.00 85.87  ? 1450 ARG A N   1 
ATOM   2034 C CA  . ARG A 1 264 ? 11.374  30.586 133.138 1.00 100.34 ? 1450 ARG A CA  1 
ATOM   2035 C C   . ARG A 1 264 ? 11.356  30.029 131.719 1.00 108.89 ? 1450 ARG A C   1 
ATOM   2036 O O   . ARG A 1 264 ? 12.006  30.555 130.821 1.00 85.59  ? 1450 ARG A O   1 
ATOM   2037 C CB  . ARG A 1 264 ? 11.542  29.441 134.124 1.00 80.54  ? 1450 ARG A CB  1 
ATOM   2038 C CG  . ARG A 1 264 ? 12.178  29.856 135.403 1.00 68.88  ? 1450 ARG A CG  1 
ATOM   2039 C CD  . ARG A 1 264 ? 12.564  31.306 135.334 1.00 76.16  ? 1450 ARG A CD  1 
ATOM   2040 N N   . GLY A 1 265 ? 10.584  28.973 131.528 1.00 102.83 ? 1451 GLY A N   1 
ATOM   2041 C CA  . GLY A 1 265 ? 10.482  28.320 130.245 1.00 108.95 ? 1451 GLY A CA  1 
ATOM   2042 C C   . GLY A 1 265 ? 9.736   29.266 129.352 1.00 137.40 ? 1451 GLY A C   1 
ATOM   2043 O O   . GLY A 1 265 ? 9.117   30.190 129.849 1.00 159.14 ? 1451 GLY A O   1 
ATOM   2044 N N   . THR A 1 266 ? 9.792   29.049 128.046 1.00 133.62 ? 1452 THR A N   1 
ATOM   2045 C CA  . THR A 1 266 ? 9.087   29.917 127.123 1.00 124.87 ? 1452 THR A CA  1 
ATOM   2046 C C   . THR A 1 266 ? 7.597   29.790 127.378 1.00 103.12 ? 1452 THR A C   1 
ATOM   2047 O O   . THR A 1 266 ? 7.105   28.720 127.697 1.00 83.53  ? 1452 THR A O   1 
ATOM   2048 C CB  . THR A 1 266 ? 9.422   29.566 125.662 1.00 105.81 ? 1452 THR A CB  1 
ATOM   2049 N N   . VAL A 1 267 ? 6.883   30.894 127.241 1.00 95.14  ? 1453 VAL A N   1 
ATOM   2050 C CA  . VAL A 1 267 ? 5.477   30.944 127.604 1.00 106.32 ? 1453 VAL A CA  1 
ATOM   2051 C C   . VAL A 1 267 ? 4.495   30.954 126.451 1.00 115.68 ? 1453 VAL A C   1 
ATOM   2052 O O   . VAL A 1 267 ? 4.639   31.739 125.533 1.00 133.94 ? 1453 VAL A O   1 
ATOM   2053 C CB  . VAL A 1 267 ? 5.203   32.228 128.396 1.00 101.29 ? 1453 VAL A CB  1 
ATOM   2054 C CG1 . VAL A 1 267 ? 3.729   32.374 128.685 1.00 102.89 ? 1453 VAL A CG1 1 
ATOM   2055 C CG2 . VAL A 1 267 ? 5.984   32.212 129.673 1.00 89.26  ? 1453 VAL A CG2 1 
ATOM   2056 N N   . ASP A 1 268 ? 3.482   30.097 126.514 1.00 101.43 ? 1454 ASP A N   1 
ATOM   2057 C CA  . ASP A 1 268 ? 2.402   30.145 125.552 1.00 94.67  ? 1454 ASP A CA  1 
ATOM   2058 C C   . ASP A 1 268 ? 1.713   31.433 125.810 1.00 94.94  ? 1454 ASP A C   1 
ATOM   2059 O O   . ASP A 1 268 ? 1.589   31.832 126.935 1.00 94.07  ? 1454 ASP A O   1 
ATOM   2060 C CB  . ASP A 1 268 ? 1.365   29.077 125.821 1.00 90.59  ? 1454 ASP A CB  1 
ATOM   2061 C CG  . ASP A 1 268 ? 1.932   27.714 125.834 1.00 105.09 ? 1454 ASP A CG  1 
ATOM   2062 O OD1 . ASP A 1 268 ? 3.161   27.593 125.810 1.00 104.07 ? 1454 ASP A OD1 1 
ATOM   2063 O OD2 . ASP A 1 268 ? 1.145   26.759 125.870 1.00 110.48 ? 1454 ASP A OD2 1 
ATOM   2064 N N   . PRO A 1 269 ? 1.224   32.091 124.787 1.00 114.04 ? 1455 PRO A N   1 
ATOM   2065 C CA  . PRO A 1 269 ? 0.453   33.293 125.050 1.00 110.32 ? 1455 PRO A CA  1 
ATOM   2066 C C   . PRO A 1 269 ? -0.756  32.878 125.841 1.00 101.55 ? 1455 PRO A C   1 
ATOM   2067 O O   . PRO A 1 269 ? -1.109  33.497 126.823 1.00 113.12 ? 1455 PRO A O   1 
ATOM   2068 C CB  . PRO A 1 269 ? -0.013  33.683 123.666 1.00 122.62 ? 1455 PRO A CB  1 
ATOM   2069 C CG  . PRO A 1 269 ? -0.258  32.375 123.019 1.00 130.84 ? 1455 PRO A CG  1 
ATOM   2070 C CD  . PRO A 1 269 ? 0.819   31.458 123.525 1.00 123.04 ? 1455 PRO A CD  1 
ATOM   2071 N N   . GLU A 1 270 ? -1.366  31.790 125.405 1.00 108.69 ? 1456 GLU A N   1 
ATOM   2072 C CA  . GLU A 1 270 ? -2.572  31.271 126.014 1.00 123.24 ? 1456 GLU A CA  1 
ATOM   2073 C C   . GLU A 1 270 ? -2.418  30.802 127.451 1.00 115.46 ? 1456 GLU A C   1 
ATOM   2074 O O   . GLU A 1 270 ? -3.317  30.988 128.244 1.00 120.44 ? 1456 GLU A O   1 
ATOM   2075 C CB  . GLU A 1 270 ? -3.197  30.184 125.138 1.00 136.21 ? 1456 GLU A CB  1 
ATOM   2076 C CG  . GLU A 1 270 ? -3.184  30.501 123.649 1.00 136.28 ? 1456 GLU A CG  1 
ATOM   2077 C CD  . GLU A 1 270 ? -4.272  31.452 123.228 1.00 131.38 ? 1456 GLU A CD  1 
ATOM   2078 O OE1 . GLU A 1 270 ? -5.415  31.014 122.999 1.00 106.80 ? 1456 GLU A OE1 1 
ATOM   2079 O OE2 . GLU A 1 270 ? -3.973  32.646 123.115 1.00 139.75 ? 1456 GLU A OE2 1 
ATOM   2080 N N   . ASN A 1 271 ? -1.307  30.172 127.794 1.00 104.31 ? 1457 ASN A N   1 
ATOM   2081 C CA  . ASN A 1 271 ? -1.155  29.708 129.162 1.00 95.96  ? 1457 ASN A CA  1 
ATOM   2082 C C   . ASN A 1 271 ? 0.093   30.140 129.912 1.00 94.50  ? 1457 ASN A C   1 
ATOM   2083 O O   . ASN A 1 271 ? 1.068   29.422 129.980 1.00 83.11  ? 1457 ASN A O   1 
ATOM   2084 C CB  . ASN A 1 271 ? -1.317  28.208 129.248 1.00 80.32  ? 1457 ASN A CB  1 
ATOM   2085 C CG  . ASN A 1 271 ? -1.371  27.741 130.644 1.00 77.42  ? 1457 ASN A CG  1 
ATOM   2086 O OD1 . ASN A 1 271 ? -0.726  28.307 131.492 1.00 89.71  ? 1457 ASN A OD1 1 
ATOM   2087 N ND2 . ASN A 1 271 ? -2.140  26.719 130.904 1.00 58.91  ? 1457 ASN A ND2 1 
ATOM   2088 N N   . GLU A 1 272 ? 0.035   31.321 130.499 1.00 97.44  ? 1458 GLU A N   1 
ATOM   2089 C CA  . GLU A 1 272 ? 1.147   31.853 131.251 1.00 87.76  ? 1458 GLU A CA  1 
ATOM   2090 C C   . GLU A 1 272 ? 1.462   30.970 132.434 1.00 79.43  ? 1458 GLU A C   1 
ATOM   2091 O O   . GLU A 1 272 ? 2.602   30.767 132.790 1.00 77.75  ? 1458 GLU A O   1 
ATOM   2092 C CB  . GLU A 1 272 ? 0.798   33.244 131.747 1.00 65.32  ? 1458 GLU A CB  1 
ATOM   2093 C CG  . GLU A 1 272 ? -0.679  33.515 131.747 1.00 90.84  ? 1458 GLU A CG  1 
ATOM   2094 C CD  . GLU A 1 272 ? -1.069  34.700 132.611 1.00 104.47 ? 1458 GLU A CD  1 
ATOM   2095 O OE1 . GLU A 1 272 ? -0.335  35.017 133.557 1.00 100.65 ? 1458 GLU A OE1 1 
ATOM   2096 O OE2 . GLU A 1 272 ? -2.115  35.318 132.349 1.00 96.02  ? 1458 GLU A OE2 1 
ATOM   2097 N N   . PHE A 1 273 ? 0.417   30.430 133.037 1.00 75.86  ? 1459 PHE A N   1 
ATOM   2098 C CA  . PHE A 1 273 ? 0.532   29.692 134.282 1.00 86.37  ? 1459 PHE A CA  1 
ATOM   2099 C C   . PHE A 1 273 ? 1.470   28.502 134.217 1.00 88.35  ? 1459 PHE A C   1 
ATOM   2100 O O   . PHE A 1 273 ? 2.168   28.216 135.183 1.00 84.95  ? 1459 PHE A O   1 
ATOM   2101 C CB  . PHE A 1 273 ? -0.854  29.286 134.776 1.00 79.73  ? 1459 PHE A CB  1 
ATOM   2102 C CG  . PHE A 1 273 ? -1.801  30.441 134.901 1.00 82.59  ? 1459 PHE A CG  1 
ATOM   2103 C CD1 . PHE A 1 273 ? -1.786  31.245 136.024 1.00 67.09  ? 1459 PHE A CD1 1 
ATOM   2104 C CD2 . PHE A 1 273 ? -2.690  30.736 133.888 1.00 66.54  ? 1459 PHE A CD2 1 
ATOM   2105 C CE1 . PHE A 1 273 ? -2.646  32.308 136.136 1.00 54.47  ? 1459 PHE A CE1 1 
ATOM   2106 C CE2 . PHE A 1 273 ? -3.552  31.799 134.000 1.00 65.14  ? 1459 PHE A CE2 1 
ATOM   2107 C CZ  . PHE A 1 273 ? -3.529  32.586 135.125 1.00 57.15  ? 1459 PHE A CZ  1 
ATOM   2108 N N   . ALA A 1 274 ? 1.495   27.808 133.090 1.00 84.44  ? 1460 ALA A N   1 
ATOM   2109 C CA  . ALA A 1 274 ? 2.387   26.671 132.958 1.00 77.01  ? 1460 ALA A CA  1 
ATOM   2110 C C   . ALA A 1 274 ? 3.843   27.112 133.103 1.00 73.78  ? 1460 ALA A C   1 
ATOM   2111 O O   . ALA A 1 274 ? 4.642   26.425 133.731 1.00 72.79  ? 1460 ALA A O   1 
ATOM   2112 C CB  . ALA A 1 274 ? 2.173   25.993 131.622 1.00 74.20  ? 1460 ALA A CB  1 
ATOM   2113 N N   . SER A 1 275 ? 4.188   28.252 132.515 1.00 68.02  ? 1461 SER A N   1 
ATOM   2114 C CA  . SER A 1 275 ? 5.558   28.759 132.578 1.00 77.37  ? 1461 SER A CA  1 
ATOM   2115 C C   . SER A 1 275 ? 5.911   29.581 133.818 1.00 83.34  ? 1461 SER A C   1 
ATOM   2116 O O   . SER A 1 275 ? 7.084   29.844 134.072 1.00 89.41  ? 1461 SER A O   1 
ATOM   2117 C CB  . SER A 1 275 ? 5.867   29.592 131.335 1.00 90.42  ? 1461 SER A CB  1 
ATOM   2118 O OG  . SER A 1 275 ? 5.364   30.906 131.475 1.00 95.71  ? 1461 SER A OG  1 
ATOM   2119 N N   . MET A 1 276 ? 4.908   30.000 134.579 1.00 87.70  ? 1462 MET A N   1 
ATOM   2120 C CA  . MET A 1 276 ? 5.157   30.832 135.756 1.00 89.39  ? 1462 MET A CA  1 
ATOM   2121 C C   . MET A 1 276 ? 5.821   30.136 136.945 1.00 85.07  ? 1462 MET A C   1 
ATOM   2122 O O   . MET A 1 276 ? 5.450   29.031 137.330 1.00 87.64  ? 1462 MET A O   1 
ATOM   2123 C CB  . MET A 1 276 ? 3.869   31.525 136.205 1.00 89.60  ? 1462 MET A CB  1 
ATOM   2124 C CG  . MET A 1 276 ? 4.040   32.415 137.422 1.00 80.48  ? 1462 MET A CG  1 
ATOM   2125 S SD  . MET A 1 276 ? 2.598   33.444 137.748 1.00 92.94  ? 1462 MET A SD  1 
ATOM   2126 C CE  . MET A 1 276 ? 2.677   34.573 136.366 1.00 80.97  ? 1462 MET A CE  1 
ATOM   2127 N N   . TRP A 1 277 ? 6.795   30.828 137.524 1.00 69.42  ? 1463 TRP A N   1 
ATOM   2128 C CA  . TRP A 1 277 ? 7.529   30.382 138.692 1.00 72.81  ? 1463 TRP A CA  1 
ATOM   2129 C C   . TRP A 1 277 ? 7.590   31.531 139.670 1.00 73.23  ? 1463 TRP A C   1 
ATOM   2130 O O   . TRP A 1 277 ? 7.736   32.682 139.271 1.00 87.39  ? 1463 TRP A O   1 
ATOM   2131 C CB  . TRP A 1 277 ? 8.962   30.023 138.304 1.00 81.30  ? 1463 TRP A CB  1 
ATOM   2132 C CG  . TRP A 1 277 ? 9.127   28.694 137.663 1.00 88.00  ? 1463 TRP A CG  1 
ATOM   2133 C CD1 . TRP A 1 277 ? 8.833   28.362 136.378 1.00 76.58  ? 1463 TRP A CD1 1 
ATOM   2134 C CD2 . TRP A 1 277 ? 9.654   27.514 138.272 1.00 91.41  ? 1463 TRP A CD2 1 
ATOM   2135 N NE1 . TRP A 1 277 ? 9.133   27.045 136.149 1.00 67.91  ? 1463 TRP A NE1 1 
ATOM   2136 C CE2 . TRP A 1 277 ? 9.639   26.502 137.299 1.00 83.28  ? 1463 TRP A CE2 1 
ATOM   2137 C CE3 . TRP A 1 277 ? 10.132  27.215 139.549 1.00 80.66  ? 1463 TRP A CE3 1 
ATOM   2138 C CZ2 . TRP A 1 277 ? 10.084  25.213 137.562 1.00 78.45  ? 1463 TRP A CZ2 1 
ATOM   2139 C CZ3 . TRP A 1 277 ? 10.571  25.936 139.808 1.00 68.67  ? 1463 TRP A CZ3 1 
ATOM   2140 C CH2 . TRP A 1 277 ? 10.545  24.950 138.820 1.00 71.55  ? 1463 TRP A CH2 1 
ATOM   2141 N N   . ILE A 1 278 ? 7.474   31.221 140.951 1.00 45.78  ? 1464 ILE A N   1 
ATOM   2142 C CA  . ILE A 1 278 ? 7.504   32.252 141.970 1.00 57.72  ? 1464 ILE A CA  1 
ATOM   2143 C C   . ILE A 1 278 ? 8.734   32.180 142.859 1.00 63.77  ? 1464 ILE A C   1 
ATOM   2144 O O   . ILE A 1 278 ? 9.082   31.123 143.368 1.00 62.50  ? 1464 ILE A O   1 
ATOM   2145 C CB  . ILE A 1 278 ? 6.260   32.176 142.862 1.00 59.15  ? 1464 ILE A CB  1 
ATOM   2146 C CG1 . ILE A 1 278 ? 5.041   32.709 142.113 1.00 59.85  ? 1464 ILE A CG1 1 
ATOM   2147 C CG2 . ILE A 1 278 ? 6.480   32.958 144.137 1.00 63.90  ? 1464 ILE A CG2 1 
ATOM   2148 C CD1 . ILE A 1 278 ? 3.804   32.786 142.958 1.00 75.07  ? 1464 ILE A CD1 1 
ATOM   2149 N N   . GLU A 1 279 ? 9.386   33.321 143.046 1.00 51.34  ? 1465 GLU A N   1 
ATOM   2150 C CA  . GLU A 1 279 ? 10.541  33.391 143.918 1.00 56.77  ? 1465 GLU A CA  1 
ATOM   2151 C C   . GLU A 1 279 ? 10.009  33.969 145.215 1.00 64.81  ? 1465 GLU A C   1 
ATOM   2152 O O   . GLU A 1 279 ? 9.492   35.080 145.243 1.00 50.95  ? 1465 GLU A O   1 
ATOM   2153 C CB  . GLU A 1 279 ? 11.610  34.302 143.325 1.00 57.94  ? 1465 GLU A CB  1 
ATOM   2154 C CG  . GLU A 1 279 ? 12.896  34.354 144.126 1.00 60.82  ? 1465 GLU A CG  1 
ATOM   2155 N N   . ARG A 1 280 ? 10.134  33.205 146.290 1.00 49.27  ? 1466 ARG A N   1 
ATOM   2156 C CA  . ARG A 1 280 ? 9.603   33.616 147.577 1.00 46.47  ? 1466 ARG A CA  1 
ATOM   2157 C C   . ARG A 1 280 ? 10.669  33.939 148.596 1.00 66.70  ? 1466 ARG A C   1 
ATOM   2158 O O   . ARG A 1 280 ? 11.572  33.146 148.835 1.00 83.07  ? 1466 ARG A O   1 
ATOM   2159 C CB  . ARG A 1 280 ? 8.696   32.518 148.128 1.00 42.95  ? 1466 ARG A CB  1 
ATOM   2160 C CG  . ARG A 1 280 ? 8.166   32.779 149.524 1.00 44.80  ? 1466 ARG A CG  1 
ATOM   2161 C CD  . ARG A 1 280 ? 7.104   31.764 149.892 1.00 38.87  ? 1466 ARG A CD  1 
ATOM   2162 N NE  . ARG A 1 280 ? 5.968   31.817 148.981 1.00 59.97  ? 1466 ARG A NE  1 
ATOM   2163 C CZ  . ARG A 1 280 ? 5.023   30.888 148.912 1.00 75.54  ? 1466 ARG A CZ  1 
ATOM   2164 N NH1 . ARG A 1 280 ? 5.077   29.828 149.701 1.00 83.84  ? 1466 ARG A NH1 1 
ATOM   2165 N NH2 . ARG A 1 280 ? 4.025   31.018 148.052 1.00 71.46  ? 1466 ARG A NH2 1 
ATOM   2166 N N   . THR A 1 281 ? 10.555  35.109 149.209 1.00 53.82  ? 1467 THR A N   1 
ATOM   2167 C CA  . THR A 1 281 ? 11.499  35.490 150.220 1.00 53.18  ? 1467 THR A CA  1 
ATOM   2168 C C   . THR A 1 281 ? 10.869  35.392 151.604 1.00 55.44  ? 1467 THR A C   1 
ATOM   2169 O O   . THR A 1 281 ? 9.687   35.733 151.806 1.00 68.20  ? 1467 THR A O   1 
ATOM   2170 C CB  . THR A 1 281 ? 11.933  36.884 149.940 1.00 50.66  ? 1467 THR A CB  1 
ATOM   2171 O OG1 . THR A 1 281 ? 12.222  36.962 148.538 1.00 61.26  ? 1467 THR A OG1 1 
ATOM   2172 C CG2 . THR A 1 281 ? 13.153  37.275 150.782 1.00 52.18  ? 1467 THR A CG2 1 
ATOM   2173 N N   . SER A 1 282 ? 11.647  34.915 152.569 1.00 53.43  ? 1468 SER A N   1 
ATOM   2174 C CA  . SER A 1 282 ? 11.184  34.901 153.950 1.00 57.93  ? 1468 SER A CA  1 
ATOM   2175 C C   . SER A 1 282 ? 11.950  35.888 154.799 1.00 56.30  ? 1468 SER A C   1 
ATOM   2176 O O   . SER A 1 282 ? 13.175  35.966 154.683 1.00 54.99  ? 1468 SER A O   1 
ATOM   2177 C CB  . SER A 1 282 ? 11.339  33.524 154.520 1.00 41.49  ? 1468 SER A CB  1 
ATOM   2178 O OG  . SER A 1 282 ? 10.418  32.669 153.876 1.00 75.96  ? 1468 SER A OG  1 
ATOM   2179 N N   . PHE A 1 283 ? 11.219  36.659 155.620 1.00 60.08  ? 1469 PHE A N   1 
ATOM   2180 C CA  . PHE A 1 283 ? 11.806  37.560 156.636 1.00 60.38  ? 1469 PHE A CA  1 
ATOM   2181 C C   . PHE A 1 283 ? 11.371  37.162 158.051 1.00 48.66  ? 1469 PHE A C   1 
ATOM   2182 O O   . PHE A 1 283 ? 10.196  36.898 158.316 1.00 59.87  ? 1469 PHE A O   1 
ATOM   2183 C CB  . PHE A 1 283 ? 11.437  39.015 156.381 1.00 49.18  ? 1469 PHE A CB  1 
ATOM   2184 C CG  . PHE A 1 283 ? 11.369  39.378 154.943 1.00 49.79  ? 1469 PHE A CG  1 
ATOM   2185 C CD1 . PHE A 1 283 ? 10.298  38.931 154.160 1.00 44.36  ? 1469 PHE A CD1 1 
ATOM   2186 C CD2 . PHE A 1 283 ? 12.352  40.177 154.373 1.00 37.17  ? 1469 PHE A CD2 1 
ATOM   2187 C CE1 . PHE A 1 283 ? 10.206  39.277 152.835 1.00 52.69  ? 1469 PHE A CE1 1 
ATOM   2188 C CE2 . PHE A 1 283 ? 12.292  40.536 153.048 1.00 39.47  ? 1469 PHE A CE2 1 
ATOM   2189 C CZ  . PHE A 1 283 ? 11.210  40.094 152.264 1.00 55.13  ? 1469 PHE A CZ  1 
ATOM   2190 N N   . VAL A 1 284 ? 12.344  37.093 158.952 1.00 49.17  ? 1470 VAL A N   1 
ATOM   2191 C CA  . VAL A 1 284 ? 12.078  36.870 160.381 1.00 45.54  ? 1470 VAL A CA  1 
ATOM   2192 C C   . VAL A 1 284 ? 12.570  38.061 161.168 1.00 43.87  ? 1470 VAL A C   1 
ATOM   2193 O O   . VAL A 1 284 ? 13.753  38.404 161.077 1.00 52.92  ? 1470 VAL A O   1 
ATOM   2194 C CB  . VAL A 1 284 ? 12.854  35.686 160.921 1.00 42.86  ? 1470 VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 284 ? 12.495  35.453 162.348 1.00 44.94  ? 1470 VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 284 ? 12.571  34.432 160.099 1.00 56.87  ? 1470 VAL A CG2 1 
ATOM   2197 N N   . THR A 1 285 ? 11.679  38.693 161.928 1.00 32.96  ? 1471 THR A N   1 
ATOM   2198 C CA  . THR A 1 285 ? 12.057  39.857 162.726 1.00 42.21  ? 1471 THR A CA  1 
ATOM   2199 C C   . THR A 1 285 ? 12.499  39.407 164.099 1.00 42.92  ? 1471 THR A C   1 
ATOM   2200 O O   . THR A 1 285 ? 12.102  38.351 164.591 1.00 46.73  ? 1471 THR A O   1 
ATOM   2201 C CB  . THR A 1 285 ? 10.909  40.822 162.944 1.00 34.40  ? 1471 THR A CB  1 
ATOM   2202 O OG1 . THR A 1 285 ? 9.873   40.126 163.621 1.00 42.79  ? 1471 THR A OG1 1 
ATOM   2203 C CG2 . THR A 1 285 ? 10.381  41.313 161.663 1.00 35.56  ? 1471 THR A CG2 1 
ATOM   2204 N N   . ALA A 1 286 ? 13.302  40.253 164.736 1.00 53.12  ? 1472 ALA A N   1 
ATOM   2205 C CA  . ALA A 1 286 ? 13.866  39.953 166.052 1.00 53.12  ? 1472 ALA A CA  1 
ATOM   2206 C C   . ALA A 1 286 ? 12.790  39.809 167.118 1.00 56.16  ? 1472 ALA A C   1 
ATOM   2207 O O   . ALA A 1 286 ? 12.950  39.000 168.025 1.00 51.86  ? 1472 ALA A O   1 
ATOM   2208 C CB  . ALA A 1 286 ? 14.857  41.025 166.449 1.00 39.13  ? 1472 ALA A CB  1 
ATOM   2209 N N   . TYR A 1 287 ? 11.717  40.594 167.014 1.00 44.95  ? 1473 TYR A N   1 
ATOM   2210 C CA  . TYR A 1 287 ? 10.575  40.461 167.921 1.00 47.64  ? 1473 TYR A CA  1 
ATOM   2211 C C   . TYR A 1 287 ? 9.257   40.339 167.166 1.00 55.12  ? 1473 TYR A C   1 
ATOM   2212 O O   . TYR A 1 287 ? 9.160   40.778 166.037 1.00 60.24  ? 1473 TYR A O   1 
ATOM   2213 C CB  . TYR A 1 287 ? 10.530  41.637 168.916 1.00 51.63  ? 1473 TYR A CB  1 
ATOM   2214 C CG  . TYR A 1 287 ? 11.830  41.758 169.665 1.00 58.01  ? 1473 TYR A CG  1 
ATOM   2215 C CD1 . TYR A 1 287 ? 12.098  40.927 170.762 1.00 56.76  ? 1473 TYR A CD1 1 
ATOM   2216 C CD2 . TYR A 1 287 ? 12.829  42.647 169.243 1.00 49.45  ? 1473 TYR A CD2 1 
ATOM   2217 C CE1 . TYR A 1 287 ? 13.295  41.001 171.438 1.00 53.85  ? 1473 TYR A CE1 1 
ATOM   2218 C CE2 . TYR A 1 287 ? 14.024  42.719 169.905 1.00 60.53  ? 1473 TYR A CE2 1 
ATOM   2219 C CZ  . TYR A 1 287 ? 14.250  41.888 171.004 1.00 63.54  ? 1473 TYR A CZ  1 
ATOM   2220 O OH  . TYR A 1 287 ? 15.436  41.934 171.682 1.00 66.40  ? 1473 TYR A OH  1 
ATOM   2221 N N   . LYS A 1 288 ? 8.270   39.739 167.803 1.00 49.79  ? 1474 LYS A N   1 
ATOM   2222 C CA  . LYS A 1 288 ? 6.927   39.682 167.258 1.00 42.75  ? 1474 LYS A CA  1 
ATOM   2223 C C   . LYS A 1 288 ? 6.308   41.061 167.090 1.00 45.00  ? 1474 LYS A C   1 
ATOM   2224 O O   . LYS A 1 288 ? 6.621   41.999 167.798 1.00 52.37  ? 1474 LYS A O   1 
ATOM   2225 C CB  . LYS A 1 288 ? 6.015   38.847 168.175 1.00 53.60  ? 1474 LYS A CB  1 
ATOM   2226 C CG  . LYS A 1 288 ? 6.008   37.363 167.872 1.00 71.03  ? 1474 LYS A CG  1 
ATOM   2227 C CD  . LYS A 1 288 ? 5.442   36.581 169.054 1.00 85.33  ? 1474 LYS A CD  1 
ATOM   2228 C CE  . LYS A 1 288 ? 4.986   35.164 168.635 1.00 106.81 ? 1474 LYS A CE  1 
ATOM   2229 N NZ  . LYS A 1 288 ? 5.036   34.990 167.123 1.00 130.30 ? 1474 LYS A NZ  1 
ATOM   2230 N N   . LEU A 1 289 ? 5.377   41.174 166.151 1.00 37.02  ? 1475 LEU A N   1 
ATOM   2231 C CA  . LEU A 1 289 ? 4.519   42.333 166.075 1.00 44.32  ? 1475 LEU A CA  1 
ATOM   2232 C C   . LEU A 1 289 ? 3.082   41.915 166.400 1.00 45.93  ? 1475 LEU A C   1 
ATOM   2233 O O   . LEU A 1 289 ? 2.645   40.888 165.895 1.00 41.35  ? 1475 LEU A O   1 
ATOM   2234 C CB  . LEU A 1 289 ? 4.569   42.917 164.676 1.00 38.99  ? 1475 LEU A CB  1 
ATOM   2235 C CG  . LEU A 1 289 ? 5.840   43.643 164.295 1.00 38.53  ? 1475 LEU A CG  1 
ATOM   2236 C CD1 . LEU A 1 289 ? 5.797   43.824 162.796 1.00 40.83  ? 1475 LEU A CD1 1 
ATOM   2237 C CD2 . LEU A 1 289 ? 5.982   45.005 164.994 1.00 26.48  ? 1475 LEU A CD2 1 
ATOM   2238 N N   . PRO A 1 290 ? 2.342   42.699 167.220 1.00 35.98  ? 1476 PRO A N   1 
ATOM   2239 C CA  . PRO A 1 290 ? 2.647   43.982 167.840 1.00 44.61  ? 1476 PRO A CA  1 
ATOM   2240 C C   . PRO A 1 290 ? 3.651   43.887 168.993 1.00 43.53  ? 1476 PRO A C   1 
ATOM   2241 O O   . PRO A 1 290 ? 3.862   42.818 169.565 1.00 54.95  ? 1476 PRO A O   1 
ATOM   2242 C CB  . PRO A 1 290 ? 1.287   44.420 168.394 1.00 35.90  ? 1476 PRO A CB  1 
ATOM   2243 C CG  . PRO A 1 290 ? 0.318   43.471 167.876 1.00 31.60  ? 1476 PRO A CG  1 
ATOM   2244 C CD  . PRO A 1 290 ? 1.046   42.235 167.699 1.00 39.44  ? 1476 PRO A CD  1 
ATOM   2245 N N   . GLY A 1 291 ? 4.251   45.007 169.336 1.00 39.43  ? 1477 GLY A N   1 
ATOM   2246 C CA  . GLY A 1 291 ? 5.236   45.041 170.393 1.00 32.78  ? 1477 GLY A CA  1 
ATOM   2247 C C   . GLY A 1 291 ? 5.417   46.458 170.822 1.00 27.34  ? 1477 GLY A C   1 
ATOM   2248 O O   . GLY A 1 291 ? 4.503   47.266 170.728 1.00 34.42  ? 1477 GLY A O   1 
ATOM   2249 N N   . ILE A 1 292 ? 6.625   46.749 171.248 1.00 53.81  ? 1478 ILE A N   1 
ATOM   2250 C CA  . ILE A 1 292 ? 7.029   48.005 171.910 1.00 52.94  ? 1478 ILE A CA  1 
ATOM   2251 C C   . ILE A 1 292 ? 7.199   49.114 170.873 1.00 48.57  ? 1478 ILE A C   1 
ATOM   2252 O O   . ILE A 1 292 ? 7.195   50.285 171.191 1.00 47.41  ? 1478 ILE A O   1 
ATOM   2253 C CB  . ILE A 1 292 ? 8.360   47.694 172.684 1.00 55.67  ? 1478 ILE A CB  1 
ATOM   2254 C CG1 . ILE A 1 292 ? 8.099   46.645 173.765 1.00 75.74  ? 1478 ILE A CG1 1 
ATOM   2255 C CG2 . ILE A 1 292 ? 8.989   48.848 173.270 1.00 53.35  ? 1478 ILE A CG2 1 
ATOM   2256 C CD1 . ILE A 1 292 ? 8.138   45.136 173.210 1.00 121.55 ? 1478 ILE A CD1 1 
ATOM   2257 N N   . LEU A 1 293 ? 7.366   48.712 169.615 1.00 51.07  ? 1479 LEU A N   1 
ATOM   2258 C CA  . LEU A 1 293 ? 7.377   49.618 168.463 1.00 32.62  ? 1479 LEU A CA  1 
ATOM   2259 C C   . LEU A 1 293 ? 6.531   49.070 167.310 1.00 47.30  ? 1479 LEU A C   1 
ATOM   2260 O O   . LEU A 1 293 ? 6.086   47.903 167.320 1.00 42.22  ? 1479 LEU A O   1 
ATOM   2261 C CB  . LEU A 1 293 ? 8.799   49.874 167.979 1.00 38.16  ? 1479 LEU A CB  1 
ATOM   2262 C CG  . LEU A 1 293 ? 9.706   50.667 168.920 1.00 47.36  ? 1479 LEU A CG  1 
ATOM   2263 C CD1 . LEU A 1 293 ? 11.096  50.586 168.435 1.00 27.80  ? 1479 LEU A CD1 1 
ATOM   2264 C CD2 . LEU A 1 293 ? 9.289   52.080 169.018 1.00 55.62  ? 1479 LEU A CD2 1 
ATOM   2265 N N   . ARG A 1 294 ? 6.291   49.932 166.320 1.00 47.52  ? 1480 ARG A N   1 
ATOM   2266 C CA  . ARG A 1 294 ? 5.601   49.522 165.081 1.00 41.48  ? 1480 ARG A CA  1 
ATOM   2267 C C   . ARG A 1 294 ? 6.528   48.805 164.073 1.00 52.70  ? 1480 ARG A C   1 
ATOM   2268 O O   . ARG A 1 294 ? 6.099   48.320 163.038 1.00 28.86  ? 1480 ARG A O   1 
ATOM   2269 C CB  . ARG A 1 294 ? 4.891   50.706 164.406 1.00 42.09  ? 1480 ARG A CB  1 
ATOM   2270 C CG  . ARG A 1 294 ? 3.556   51.095 164.981 1.00 41.39  ? 1480 ARG A CG  1 
ATOM   2271 C CD  . ARG A 1 294 ? 2.558   51.546 163.894 1.00 42.57  ? 1480 ARG A CD  1 
ATOM   2272 N NE  . ARG A 1 294 ? 1.228   51.814 164.469 1.00 81.49  ? 1480 ARG A NE  1 
ATOM   2273 C CZ  . ARG A 1 294 ? 0.262   50.909 164.701 1.00 89.93  ? 1480 ARG A CZ  1 
ATOM   2274 N NH1 . ARG A 1 294 ? 0.417   49.624 164.407 1.00 74.53  ? 1480 ARG A NH1 1 
ATOM   2275 N NH2 . ARG A 1 294 ? -0.885  51.290 165.247 1.00 76.11  ? 1480 ARG A NH2 1 
ATOM   2276 N N   . TRP A 1 295 ? 7.815   48.753 164.384 1.00 46.48  ? 1481 TRP A N   1 
ATOM   2277 C CA  . TRP A 1 295 ? 8.755   48.116 163.484 1.00 57.79  ? 1481 TRP A CA  1 
ATOM   2278 C C   . TRP A 1 295 ? 9.808   47.301 164.201 1.00 46.20  ? 1481 TRP A C   1 
ATOM   2279 O O   . TRP A 1 295 ? 10.200  47.625 165.295 1.00 52.37  ? 1481 TRP A O   1 
ATOM   2280 C CB  . TRP A 1 295 ? 9.422   49.173 162.626 1.00 55.90  ? 1481 TRP A CB  1 
ATOM   2281 C CG  . TRP A 1 295 ? 10.183  50.182 163.390 1.00 46.54  ? 1481 TRP A CG  1 
ATOM   2282 C CD1 . TRP A 1 295 ? 11.506  50.132 163.714 1.00 50.17  ? 1481 TRP A CD1 1 
ATOM   2283 C CD2 . TRP A 1 295 ? 9.688   51.414 163.904 1.00 52.58  ? 1481 TRP A CD2 1 
ATOM   2284 N NE1 . TRP A 1 295 ? 11.866  51.258 164.402 1.00 56.24  ? 1481 TRP A NE1 1 
ATOM   2285 C CE2 . TRP A 1 295 ? 10.771  52.069 164.529 1.00 55.20  ? 1481 TRP A CE2 1 
ATOM   2286 C CE3 . TRP A 1 295 ? 8.425   52.036 163.902 1.00 50.35  ? 1481 TRP A CE3 1 
ATOM   2287 C CZ2 . TRP A 1 295 ? 10.635  53.307 165.160 1.00 54.38  ? 1481 TRP A CZ2 1 
ATOM   2288 C CZ3 . TRP A 1 295 ? 8.286   53.286 164.516 1.00 53.18  ? 1481 TRP A CZ3 1 
ATOM   2289 C CH2 . TRP A 1 295 ? 9.393   53.902 165.140 1.00 58.65  ? 1481 TRP A CH2 1 
ATOM   2290 N N   . PHE A 1 296 ? 10.260  46.236 163.572 1.00 45.87  ? 1482 PHE A N   1 
ATOM   2291 C CA  . PHE A 1 296 ? 11.413  45.532 164.075 1.00 46.02  ? 1482 PHE A CA  1 
ATOM   2292 C C   . PHE A 1 296 ? 12.333  45.088 162.937 1.00 44.62  ? 1482 PHE A C   1 
ATOM   2293 O O   . PHE A 1 296 ? 11.884  44.722 161.858 1.00 53.16  ? 1482 PHE A O   1 
ATOM   2294 C CB  . PHE A 1 296 ? 10.985  44.338 164.910 1.00 44.37  ? 1482 PHE A CB  1 
ATOM   2295 C CG  . PHE A 1 296 ? 10.346  44.703 166.230 1.00 52.39  ? 1482 PHE A CG  1 
ATOM   2296 C CD1 . PHE A 1 296 ? 11.067  45.381 167.216 1.00 48.70  ? 1482 PHE A CD1 1 
ATOM   2297 C CD2 . PHE A 1 296 ? 9.030   44.308 166.510 1.00 63.83  ? 1482 PHE A CD2 1 
ATOM   2298 C CE1 . PHE A 1 296 ? 10.480  45.694 168.428 1.00 27.72  ? 1482 PHE A CE1 1 
ATOM   2299 C CE2 . PHE A 1 296 ? 8.440   44.609 167.724 1.00 42.78  ? 1482 PHE A CE2 1 
ATOM   2300 C CZ  . PHE A 1 296 ? 9.182   45.313 168.680 1.00 46.45  ? 1482 PHE A CZ  1 
ATOM   2301 N N   . GLU A 1 297 ? 13.627  45.127 163.191 1.00 57.29  ? 1483 GLU A N   1 
ATOM   2302 C CA  . GLU A 1 297 ? 14.613  44.838 162.179 1.00 43.03  ? 1483 GLU A CA  1 
ATOM   2303 C C   . GLU A 1 297 ? 14.527  43.392 161.731 1.00 58.81  ? 1483 GLU A C   1 
ATOM   2304 O O   . GLU A 1 297 ? 14.358  42.491 162.576 1.00 49.75  ? 1483 GLU A O   1 
ATOM   2305 C CB  . GLU A 1 297 ? 16.002  45.104 162.748 1.00 51.06  ? 1483 GLU A CB  1 
ATOM   2306 C CG  . GLU A 1 297 ? 17.138  44.687 161.814 1.00 77.39  ? 1483 GLU A CG  1 
ATOM   2307 C CD  . GLU A 1 297 ? 18.540  45.074 162.331 1.00 79.15  ? 1483 GLU A CD  1 
ATOM   2308 O OE1 . GLU A 1 297 ? 18.638  45.808 163.352 1.00 76.36  ? 1483 GLU A OE1 1 
ATOM   2309 O OE2 . GLU A 1 297 ? 19.548  44.642 161.712 1.00 62.86  ? 1483 GLU A OE2 1 
ATOM   2310 N N   . VAL A 1 298 ? 14.659  43.156 160.416 1.00 67.72  ? 1484 VAL A N   1 
ATOM   2311 C CA  . VAL A 1 298 ? 14.707  41.771 159.891 1.00 52.55  ? 1484 VAL A CA  1 
ATOM   2312 C C   . VAL A 1 298 ? 16.053  41.196 160.247 1.00 52.97  ? 1484 VAL A C   1 
ATOM   2313 O O   . VAL A 1 298 ? 17.083  41.818 159.990 1.00 57.56  ? 1484 VAL A O   1 
ATOM   2314 C CB  . VAL A 1 298 ? 14.571  41.652 158.373 1.00 47.25  ? 1484 VAL A CB  1 
ATOM   2315 C CG1 . VAL A 1 298 ? 14.757  40.208 157.973 1.00 45.41  ? 1484 VAL A CG1 1 
ATOM   2316 C CG2 . VAL A 1 298 ? 13.229  42.089 157.928 1.00 48.48  ? 1484 VAL A CG2 1 
ATOM   2317 N N   . VAL A 1 299 ? 16.051  40.021 160.843 1.00 50.00  ? 1485 VAL A N   1 
ATOM   2318 C CA  . VAL A 1 299 ? 17.287  39.455 161.342 1.00 50.50  ? 1485 VAL A CA  1 
ATOM   2319 C C   . VAL A 1 299 ? 17.729  38.217 160.544 1.00 53.97  ? 1485 VAL A C   1 
ATOM   2320 O O   . VAL A 1 299 ? 18.928  37.892 160.477 1.00 57.29  ? 1485 VAL A O   1 
ATOM   2321 C CB  . VAL A 1 299 ? 17.139  39.139 162.824 1.00 46.93  ? 1485 VAL A CB  1 
ATOM   2322 C CG1 . VAL A 1 299 ? 17.932  37.908 163.191 1.00 60.44  ? 1485 VAL A CG1 1 
ATOM   2323 C CG2 . VAL A 1 299 ? 17.579  40.321 163.611 1.00 58.39  ? 1485 VAL A CG2 1 
ATOM   2324 N N   . HIS A 1 300 ? 16.763  37.527 159.951 1.00 55.43  ? 1486 HIS A N   1 
ATOM   2325 C CA  . HIS A 1 300 ? 17.060  36.353 159.148 1.00 59.31  ? 1486 HIS A CA  1 
ATOM   2326 C C   . HIS A 1 300 ? 16.274  36.365 157.844 1.00 70.01  ? 1486 HIS A C   1 
ATOM   2327 O O   . HIS A 1 300 ? 15.084  36.655 157.836 1.00 72.36  ? 1486 HIS A O   1 
ATOM   2328 C CB  . HIS A 1 300 ? 16.805  35.057 159.904 1.00 58.20  ? 1486 HIS A CB  1 
ATOM   2329 C CG  . HIS A 1 300 ? 17.285  33.847 159.170 1.00 78.45  ? 1486 HIS A CG  1 
ATOM   2330 N ND1 . HIS A 1 300 ? 16.434  32.997 158.498 1.00 81.01  ? 1486 HIS A ND1 1 
ATOM   2331 C CD2 . HIS A 1 300 ? 18.533  33.365 158.972 1.00 82.99  ? 1486 HIS A CD2 1 
ATOM   2332 C CE1 . HIS A 1 300 ? 17.136  32.032 157.934 1.00 79.18  ? 1486 HIS A CE1 1 
ATOM   2333 N NE2 . HIS A 1 300 ? 18.412  32.232 158.205 1.00 96.93  ? 1486 HIS A NE2 1 
ATOM   2334 N N   . MET A 1 301 ? 16.945  36.046 156.744 1.00 65.12  ? 1487 MET A N   1 
ATOM   2335 C CA  . MET A 1 301 ? 16.301  36.019 155.437 1.00 58.74  ? 1487 MET A CA  1 
ATOM   2336 C C   . MET A 1 301 ? 16.569  34.713 154.705 1.00 68.85  ? 1487 MET A C   1 
ATOM   2337 O O   . MET A 1 301 ? 17.674  34.185 154.748 1.00 85.54  ? 1487 MET A O   1 
ATOM   2338 C CB  . MET A 1 301 ? 16.753  37.200 154.583 1.00 41.99  ? 1487 MET A CB  1 
ATOM   2339 C CG  . MET A 1 301 ? 16.049  38.496 154.910 1.00 67.13  ? 1487 MET A CG  1 
ATOM   2340 S SD  . MET A 1 301 ? 16.487  39.815 153.777 1.00 66.84  ? 1487 MET A SD  1 
ATOM   2341 C CE  . MET A 1 301 ? 16.140  39.039 152.210 1.00 107.18 ? 1487 MET A CE  1 
ATOM   2342 N N   . SER A 1 302 ? 15.537  34.193 154.058 1.00 67.82  ? 1488 SER A N   1 
ATOM   2343 C CA  . SER A 1 302 ? 15.640  32.952 153.319 1.00 55.88  ? 1488 SER A CA  1 
ATOM   2344 C C   . SER A 1 302 ? 14.916  33.075 151.995 1.00 63.12  ? 1488 SER A C   1 
ATOM   2345 O O   . SER A 1 302 ? 13.867  33.702 151.917 1.00 68.81  ? 1488 SER A O   1 
ATOM   2346 C CB  . SER A 1 302 ? 15.027  31.815 154.131 1.00 71.27  ? 1488 SER A CB  1 
ATOM   2347 O OG  . SER A 1 302 ? 14.560  30.782 153.286 1.00 83.69  ? 1488 SER A OG  1 
ATOM   2348 N N   . GLN A 1 303 ? 15.470  32.474 150.952 1.00 81.16  ? 1489 GLN A N   1 
ATOM   2349 C CA  . GLN A 1 303 ? 14.834  32.532 149.648 1.00 67.22  ? 1489 GLN A CA  1 
ATOM   2350 C C   . GLN A 1 303 ? 14.532  31.136 149.137 1.00 51.35  ? 1489 GLN A C   1 
ATOM   2351 O O   . GLN A 1 303 ? 15.394  30.267 149.124 1.00 70.70  ? 1489 GLN A O   1 
ATOM   2352 C CB  . GLN A 1 303 ? 15.682  33.296 148.640 1.00 56.27  ? 1489 GLN A CB  1 
ATOM   2353 C CG  . GLN A 1 303 ? 15.125  33.225 147.235 1.00 94.42  ? 1489 GLN A CG  1 
ATOM   2354 C CD  . GLN A 1 303 ? 15.312  34.512 146.473 1.00 118.00 ? 1489 GLN A CD  1 
ATOM   2355 O OE1 . GLN A 1 303 ? 15.290  35.594 147.053 1.00 133.50 ? 1489 GLN A OE1 1 
ATOM   2356 N NE2 . GLN A 1 303 ? 15.492  34.405 145.163 1.00 107.90 ? 1489 GLN A NE2 1 
ATOM   2357 N N   . THR A 1 304 ? 13.295  30.930 148.717 1.00 65.10  ? 1490 THR A N   1 
ATOM   2358 C CA  . THR A 1 304 ? 12.872  29.641 148.207 1.00 61.74  ? 1490 THR A CA  1 
ATOM   2359 C C   . THR A 1 304 ? 12.137  29.812 146.897 1.00 68.32  ? 1490 THR A C   1 
ATOM   2360 O O   . THR A 1 304 ? 11.440  30.801 146.700 1.00 78.96  ? 1490 THR A O   1 
ATOM   2361 C CB  . THR A 1 304 ? 11.936  28.950 149.197 1.00 51.57  ? 1490 THR A CB  1 
ATOM   2362 O OG1 . THR A 1 304 ? 12.710  28.360 150.246 1.00 82.65  ? 1490 THR A OG1 1 
ATOM   2363 C CG2 . THR A 1 304 ? 11.137  27.871 148.504 1.00 66.23  ? 1490 THR A CG2 1 
ATOM   2364 N N   . THR A 1 305 ? 12.290  28.849 145.996 1.00 79.94  ? 1491 THR A N   1 
ATOM   2365 C CA  . THR A 1 305 ? 11.597  28.939 144.696 1.00 74.16  ? 1491 THR A CA  1 
ATOM   2366 C C   . THR A 1 305 ? 10.432  27.973 144.620 1.00 64.46  ? 1491 THR A C   1 
ATOM   2367 O O   . THR A 1 305 ? 10.530  26.857 145.113 1.00 67.95  ? 1491 THR A O   1 
ATOM   2368 C CB  . THR A 1 305 ? 12.576  28.719 143.547 1.00 67.58  ? 1491 THR A CB  1 
ATOM   2369 O OG1 . THR A 1 305 ? 13.622  29.687 143.668 1.00 87.45  ? 1491 THR A OG1 1 
ATOM   2370 C CG2 . THR A 1 305 ? 11.905  28.921 142.199 1.00 78.12  ? 1491 THR A CG2 1 
ATOM   2371 N N   . ILE A 1 306 ? 9.318   28.418 144.036 1.00 63.84  ? 1492 ILE A N   1 
ATOM   2372 C CA  . ILE A 1 306 ? 8.137   27.546 143.870 1.00 67.69  ? 1492 ILE A CA  1 
ATOM   2373 C C   . ILE A 1 306 ? 7.687   27.381 142.400 1.00 66.32  ? 1492 ILE A C   1 
ATOM   2374 O O   . ILE A 1 306 ? 7.618   28.342 141.622 1.00 59.10  ? 1492 ILE A O   1 
ATOM   2375 C CB  . ILE A 1 306 ? 6.975   27.851 144.909 1.00 63.07  ? 1492 ILE A CB  1 
ATOM   2376 C CG1 . ILE A 1 306 ? 5.618   27.910 144.229 1.00 61.93  ? 1492 ILE A CG1 1 
ATOM   2377 C CG2 . ILE A 1 306 ? 7.209   29.159 145.676 1.00 72.50  ? 1492 ILE A CG2 1 
ATOM   2378 C CD1 . ILE A 1 306 ? 4.510   28.217 145.154 1.00 67.33  ? 1492 ILE A CD1 1 
ATOM   2379 N N   . SER A 1 307 ? 7.413   26.134 142.041 1.00 67.99  ? 1493 SER A N   1 
ATOM   2380 C CA  . SER A 1 307 ? 7.104   25.760 140.666 1.00 75.37  ? 1493 SER A CA  1 
ATOM   2381 C C   . SER A 1 307 ? 5.663   26.057 140.293 1.00 62.63  ? 1493 SER A C   1 
ATOM   2382 O O   . SER A 1 307 ? 4.805   26.120 141.168 1.00 68.75  ? 1493 SER A O   1 
ATOM   2383 C CB  . SER A 1 307 ? 7.390   24.266 140.458 1.00 79.18  ? 1493 SER A CB  1 
ATOM   2384 O OG  . SER A 1 307 ? 6.476   23.462 141.187 1.00 75.39  ? 1493 SER A OG  1 
ATOM   2385 N N   . PRO A 1 308 ? 5.389   26.202 138.983 1.00 70.29  ? 1494 PRO A N   1 
ATOM   2386 C CA  . PRO A 1 308 ? 4.017   26.390 138.517 1.00 71.50  ? 1494 PRO A CA  1 
ATOM   2387 C C   . PRO A 1 308 ? 3.057   25.394 139.143 1.00 71.28  ? 1494 PRO A C   1 
ATOM   2388 O O   . PRO A 1 308 ? 1.934   25.754 139.526 1.00 66.77  ? 1494 PRO A O   1 
ATOM   2389 C CB  . PRO A 1 308 ? 4.136   26.156 137.011 1.00 52.30  ? 1494 PRO A CB  1 
ATOM   2390 C CG  . PRO A 1 308 ? 5.467   26.729 136.688 1.00 54.36  ? 1494 PRO A CG  1 
ATOM   2391 C CD  . PRO A 1 308 ? 6.347   26.307 137.865 1.00 69.39  ? 1494 PRO A CD  1 
ATOM   2392 N N   . LEU A 1 309 ? 3.499   24.158 139.276 1.00 69.46  ? 1495 LEU A N   1 
ATOM   2393 C CA  . LEU A 1 309 ? 2.634   23.189 139.874 1.00 71.30  ? 1495 LEU A CA  1 
ATOM   2394 C C   . LEU A 1 309 ? 2.320   23.588 141.301 1.00 74.86  ? 1495 LEU A C   1 
ATOM   2395 O O   . LEU A 1 309 ? 1.144   23.633 141.688 1.00 68.49  ? 1495 LEU A O   1 
ATOM   2396 C CB  . LEU A 1 309 ? 3.250   21.793 139.833 1.00 68.46  ? 1495 LEU A CB  1 
ATOM   2397 C CG  . LEU A 1 309 ? 2.335   20.675 140.365 1.00 72.19  ? 1495 LEU A CG  1 
ATOM   2398 C CD1 . LEU A 1 309 ? 1.062   20.544 139.526 1.00 71.76  ? 1495 LEU A CD1 1 
ATOM   2399 C CD2 . LEU A 1 309 ? 3.075   19.346 140.434 1.00 67.18  ? 1495 LEU A CD2 1 
ATOM   2400 N N   . GLU A 1 310 ? 3.369   23.893 142.072 1.00 77.59  ? 1496 GLU A N   1 
ATOM   2401 C CA  . GLU A 1 310 ? 3.236   24.144 143.524 1.00 63.90  ? 1496 GLU A CA  1 
ATOM   2402 C C   . GLU A 1 310 ? 2.359   25.352 143.762 1.00 66.82  ? 1496 GLU A C   1 
ATOM   2403 O O   . GLU A 1 310 ? 1.572   25.404 144.707 1.00 68.39  ? 1496 GLU A O   1 
ATOM   2404 C CB  . GLU A 1 310 ? 4.601   24.337 144.172 1.00 59.29  ? 1496 GLU A CB  1 
ATOM   2405 C CG  . GLU A 1 310 ? 5.389   23.059 144.342 1.00 60.83  ? 1496 GLU A CG  1 
ATOM   2406 C CD  . GLU A 1 310 ? 6.865   23.332 144.537 1.00 83.73  ? 1496 GLU A CD  1 
ATOM   2407 O OE1 . GLU A 1 310 ? 7.420   24.191 143.817 1.00 88.55  ? 1496 GLU A OE1 1 
ATOM   2408 O OE2 . GLU A 1 310 ? 7.484   22.696 145.413 1.00 91.73  ? 1496 GLU A OE2 1 
ATOM   2409 N N   . ASN A 1 311 ? 2.506   26.301 142.851 1.00 53.26  ? 1497 ASN A N   1 
ATOM   2410 C CA  . ASN A 1 311 ? 1.742   27.529 142.811 1.00 66.46  ? 1497 ASN A CA  1 
ATOM   2411 C C   . ASN A 1 311 ? 0.272   27.362 142.484 1.00 68.72  ? 1497 ASN A C   1 
ATOM   2412 O O   . ASN A 1 311 ? -0.585  28.024 143.058 1.00 57.50  ? 1497 ASN A O   1 
ATOM   2413 C CB  . ASN A 1 311 ? 2.322   28.393 141.731 1.00 55.51  ? 1497 ASN A CB  1 
ATOM   2414 C CG  . ASN A 1 311 ? 2.297   29.800 142.096 1.00 81.39  ? 1497 ASN A CG  1 
ATOM   2415 O OD1 . ASN A 1 311 ? 1.278   30.327 142.540 1.00 80.55  ? 1497 ASN A OD1 1 
ATOM   2416 N ND2 . ASN A 1 311 ? 3.442   30.438 141.974 1.00 101.99 ? 1497 ASN A ND2 1 
ATOM   2417 N N   . ALA A 1 312 ? 0.002   26.502 141.514 1.00 58.74  ? 1498 ALA A N   1 
ATOM   2418 C CA  . ALA A 1 312 ? -1.345  26.151 141.173 1.00 62.35  ? 1498 ALA A CA  1 
ATOM   2419 C C   . ALA A 1 312 ? -1.986  25.590 142.398 1.00 67.88  ? 1498 ALA A C   1 
ATOM   2420 O O   . ALA A 1 312 ? -3.130  25.902 142.686 1.00 71.15  ? 1498 ALA A O   1 
ATOM   2421 C CB  . ALA A 1 312 ? -1.342  25.135 140.086 1.00 72.66  ? 1498 ALA A CB  1 
ATOM   2422 N N   . ILE A 1 313 ? -1.250  24.774 143.136 1.00 57.40  ? 1499 ILE A N   1 
ATOM   2423 C CA  . ILE A 1 313 ? -1.826  24.152 144.313 1.00 64.96  ? 1499 ILE A CA  1 
ATOM   2424 C C   . ILE A 1 313 ? -2.263  25.202 145.355 1.00 68.40  ? 1499 ILE A C   1 
ATOM   2425 O O   . ILE A 1 313 ? -3.417  25.186 145.870 1.00 54.13  ? 1499 ILE A O   1 
ATOM   2426 C CB  . ILE A 1 313 ? -0.872  23.099 144.905 1.00 62.49  ? 1499 ILE A CB  1 
ATOM   2427 C CG1 . ILE A 1 313 ? -0.621  22.019 143.849 1.00 47.55  ? 1499 ILE A CG1 1 
ATOM   2428 C CG2 . ILE A 1 313 ? -1.424  22.550 146.244 1.00 72.29  ? 1499 ILE A CG2 1 
ATOM   2429 C CD1 . ILE A 1 313 ? -0.245  20.671 144.366 1.00 63.19  ? 1499 ILE A CD1 1 
ATOM   2430 N N   . GLU A 1 314 ? -1.355  26.132 145.636 1.00 49.71  ? 1500 GLU A N   1 
ATOM   2431 C CA  . GLU A 1 314 ? -1.666  27.210 146.558 1.00 68.46  ? 1500 GLU A CA  1 
ATOM   2432 C C   . GLU A 1 314 ? -2.931  27.929 146.094 1.00 70.17  ? 1500 GLU A C   1 
ATOM   2433 O O   . GLU A 1 314 ? -3.841  28.183 146.892 1.00 68.47  ? 1500 GLU A O   1 
ATOM   2434 C CB  . GLU A 1 314 ? -0.518  28.211 146.642 1.00 59.49  ? 1500 GLU A CB  1 
ATOM   2435 C CG  . GLU A 1 314 ? 0.692   27.724 147.373 1.00 63.32  ? 1500 GLU A CG  1 
ATOM   2436 C CD  . GLU A 1 314 ? 1.832   28.711 147.251 1.00 75.25  ? 1500 GLU A CD  1 
ATOM   2437 O OE1 . GLU A 1 314 ? 1.720   29.655 146.427 1.00 69.53  ? 1500 GLU A OE1 1 
ATOM   2438 O OE2 . GLU A 1 314 ? 2.845   28.542 147.971 1.00 84.49  ? 1500 GLU A OE2 1 
ATOM   2439 N N   . THR A 1 315 ? -2.981  28.244 144.806 1.00 46.47  ? 1501 THR A N   1 
ATOM   2440 C CA  . THR A 1 315 ? -4.058  29.031 144.264 1.00 36.11  ? 1501 THR A CA  1 
ATOM   2441 C C   . THR A 1 315 ? -5.362  28.310 144.457 1.00 50.46  ? 1501 THR A C   1 
ATOM   2442 O O   . THR A 1 315 ? -6.373  28.915 144.783 1.00 59.51  ? 1501 THR A O   1 
ATOM   2443 C CB  . THR A 1 315 ? -3.831  29.317 142.793 1.00 52.31  ? 1501 THR A CB  1 
ATOM   2444 O OG1 . THR A 1 315 ? -2.580  29.991 142.653 1.00 39.01  ? 1501 THR A OG1 1 
ATOM   2445 C CG2 . THR A 1 315 ? -4.921  30.214 142.230 1.00 40.03  ? 1501 THR A CG2 1 
ATOM   2446 N N   . MET A 1 316 ? -5.332  27.005 144.290 1.00 57.82  ? 1502 MET A N   1 
ATOM   2447 C CA  . MET A 1 316 ? -6.532  26.226 144.418 1.00 55.32  ? 1502 MET A CA  1 
ATOM   2448 C C   . MET A 1 316 ? -6.935  26.119 145.911 1.00 65.64  ? 1502 MET A C   1 
ATOM   2449 O O   . MET A 1 316 ? -8.117  26.315 146.249 1.00 54.39  ? 1502 MET A O   1 
ATOM   2450 C CB  . MET A 1 316 ? -6.324  24.863 143.712 1.00 60.67  ? 1502 MET A CB  1 
ATOM   2451 C CG  . MET A 1 316 ? -7.580  24.246 143.059 1.00 65.71  ? 1502 MET A CG  1 
ATOM   2452 S SD  . MET A 1 316 ? -8.306  25.149 141.658 1.00 55.38  ? 1502 MET A SD  1 
ATOM   2453 C CE  . MET A 1 316 ? -6.849  25.614 140.830 1.00 41.04  ? 1502 MET A CE  1 
ATOM   2454 N N   . SER A 1 317 ? -5.961  25.862 146.794 1.00 44.54  ? 1503 SER A N   1 
ATOM   2455 C CA  . SER A 1 317 ? -6.244  25.840 148.247 1.00 60.93  ? 1503 SER A CA  1 
ATOM   2456 C C   . SER A 1 317 ? -6.883  27.131 148.715 1.00 50.38  ? 1503 SER A C   1 
ATOM   2457 O O   . SER A 1 317 ? -7.827  27.113 149.489 1.00 49.86  ? 1503 SER A O   1 
ATOM   2458 C CB  . SER A 1 317 ? -4.985  25.618 149.093 1.00 42.59  ? 1503 SER A CB  1 
ATOM   2459 O OG  . SER A 1 317 ? -4.195  24.570 148.586 1.00 69.96  ? 1503 SER A OG  1 
ATOM   2460 N N   . THR A 1 318 ? -6.352  28.256 148.260 1.00 48.53  ? 1504 THR A N   1 
ATOM   2461 C CA  . THR A 1 318 ? -6.833  29.546 148.717 1.00 56.79  ? 1504 THR A CA  1 
ATOM   2462 C C   . THR A 1 318 ? -8.268  29.749 148.292 1.00 61.55  ? 1504 THR A C   1 
ATOM   2463 O O   . THR A 1 318 ? -9.101  30.257 149.049 1.00 66.56  ? 1504 THR A O   1 
ATOM   2464 C CB  . THR A 1 318 ? -5.989  30.681 148.169 1.00 62.86  ? 1504 THR A CB  1 
ATOM   2465 O OG1 . THR A 1 318 ? -4.620  30.441 148.490 1.00 62.44  ? 1504 THR A OG1 1 
ATOM   2466 C CG2 . THR A 1 318 ? -6.413  32.013 148.785 1.00 41.79  ? 1504 THR A CG2 1 
ATOM   2467 N N   . ALA A 1 319 ? -8.551  29.327 147.077 1.00 63.97  ? 1505 ALA A N   1 
ATOM   2468 C CA  . ALA A 1 319 ? -9.841  29.525 146.499 1.00 50.67  ? 1505 ALA A CA  1 
ATOM   2469 C C   . ALA A 1 319 ? -10.847 28.718 147.290 1.00 64.43  ? 1505 ALA A C   1 
ATOM   2470 O O   . ALA A 1 319 ? -11.932 29.225 147.633 1.00 55.57  ? 1505 ALA A O   1 
ATOM   2471 C CB  . ALA A 1 319 ? -9.805  29.096 145.085 1.00 47.64  ? 1505 ALA A CB  1 
ATOM   2472 N N   . ASN A 1 320 ? -10.478 27.478 147.619 1.00 54.89  ? 1506 ASN A N   1 
ATOM   2473 C CA  . ASN A 1 320 ? -11.363 26.627 148.426 1.00 62.45  ? 1506 ASN A CA  1 
ATOM   2474 C C   . ASN A 1 320 ? -11.530 27.122 149.866 1.00 59.88  ? 1506 ASN A C   1 
ATOM   2475 O O   . ASN A 1 320 ? -12.662 27.184 150.374 1.00 71.81  ? 1506 ASN A O   1 
ATOM   2476 C CB  . ASN A 1 320 ? -10.909 25.174 148.387 1.00 66.94  ? 1506 ASN A CB  1 
ATOM   2477 C CG  . ASN A 1 320 ? -10.892 24.606 146.967 1.00 67.02  ? 1506 ASN A CG  1 
ATOM   2478 O OD1 . ASN A 1 320 ? -10.280 23.557 146.718 1.00 66.22  ? 1506 ASN A OD1 1 
ATOM   2479 N ND2 . ASN A 1 320 ? -11.567 25.289 146.034 1.00 47.41  ? 1506 ASN A ND2 1 
ATOM   2480 N N   . GLU A 1 321 ? -10.415 27.504 150.492 1.00 47.06  ? 1507 GLU A N   1 
ATOM   2481 C CA  . GLU A 1 321 ? -10.445 28.142 151.797 1.00 62.78  ? 1507 GLU A CA  1 
ATOM   2482 C C   . GLU A 1 321 ? -11.416 29.323 151.833 1.00 65.61  ? 1507 GLU A C   1 
ATOM   2483 O O   . GLU A 1 321 ? -12.225 29.450 152.779 1.00 65.75  ? 1507 GLU A O   1 
ATOM   2484 C CB  . GLU A 1 321 ? -9.054  28.603 152.203 1.00 49.31  ? 1507 GLU A CB  1 
ATOM   2485 C CG  . GLU A 1 321 ? -8.204  27.509 152.827 1.00 82.62  ? 1507 GLU A CG  1 
ATOM   2486 C CD  . GLU A 1 321 ? -6.723  27.873 152.885 1.00 109.42 ? 1507 GLU A CD  1 
ATOM   2487 O OE1 . GLU A 1 321 ? -6.387  29.082 152.977 1.00 107.47 ? 1507 GLU A OE1 1 
ATOM   2488 O OE2 . GLU A 1 321 ? -5.888  26.939 152.829 1.00 110.16 ? 1507 GLU A OE2 1 
ATOM   2489 N N   . LYS A 1 322 ? -11.339 30.166 150.801 1.00 52.71  ? 1508 LYS A N   1 
ATOM   2490 C CA  . LYS A 1 322 ? -12.185 31.337 150.687 1.00 54.79  ? 1508 LYS A CA  1 
ATOM   2491 C C   . LYS A 1 322 ? -13.649 30.987 150.536 1.00 67.92  ? 1508 LYS A C   1 
ATOM   2492 O O   . LYS A 1 322 ? -14.516 31.673 151.096 1.00 65.32  ? 1508 LYS A O   1 
ATOM   2493 C CB  . LYS A 1 322 ? -11.767 32.175 149.505 1.00 39.38  ? 1508 LYS A CB  1 
ATOM   2494 C CG  . LYS A 1 322 ? -11.079 33.438 149.875 1.00 55.47  ? 1508 LYS A CG  1 
ATOM   2495 C CD  . LYS A 1 322 ? -10.770 34.254 148.627 1.00 74.72  ? 1508 LYS A CD  1 
ATOM   2496 C CE  . LYS A 1 322 ? -9.273  34.644 148.523 1.00 74.74  ? 1508 LYS A CE  1 
ATOM   2497 N NZ  . LYS A 1 322 ? -8.915  35.181 147.158 1.00 70.70  ? 1508 LYS A NZ  1 
ATOM   2498 N N   . ILE A 1 323 ? -13.933 29.931 149.770 1.00 68.88  ? 1509 ILE A N   1 
ATOM   2499 C CA  . ILE A 1 323 ? -15.319 29.540 149.548 1.00 72.71  ? 1509 ILE A CA  1 
ATOM   2500 C C   . ILE A 1 323 ? -15.873 29.070 150.869 1.00 73.80  ? 1509 ILE A C   1 
ATOM   2501 O O   . ILE A 1 323 ? -16.890 29.591 151.337 1.00 78.56  ? 1509 ILE A O   1 
ATOM   2502 C CB  . ILE A 1 323 ? -15.464 28.423 148.506 1.00 69.05  ? 1509 ILE A CB  1 
ATOM   2503 C CG1 . ILE A 1 323 ? -14.883 28.864 147.168 1.00 41.83  ? 1509 ILE A CG1 1 
ATOM   2504 C CG2 . ILE A 1 323 ? -16.942 28.049 148.332 1.00 48.79  ? 1509 ILE A CG2 1 
ATOM   2505 C CD1 . ILE A 1 323 ? -14.640 27.720 146.242 1.00 55.63  ? 1509 ILE A CD1 1 
ATOM   2506 N N   . LEU A 1 324 ? -15.177 28.109 151.478 1.00 72.62  ? 1510 LEU A N   1 
ATOM   2507 C CA  . LEU A 1 324 ? -15.562 27.591 152.786 1.00 65.01  ? 1510 LEU A CA  1 
ATOM   2508 C C   . LEU A 1 324 ? -15.801 28.728 153.796 1.00 70.46  ? 1510 LEU A C   1 
ATOM   2509 O O   . LEU A 1 324 ? -16.909 28.855 154.338 1.00 73.72  ? 1510 LEU A O   1 
ATOM   2510 C CB  . LEU A 1 324 ? -14.527 26.584 153.295 1.00 59.29  ? 1510 LEU A CB  1 
ATOM   2511 C CG  . LEU A 1 324 ? -15.136 25.340 153.949 1.00 63.20  ? 1510 LEU A CG  1 
ATOM   2512 C CD1 . LEU A 1 324 ? -14.049 24.440 154.537 1.00 66.35  ? 1510 LEU A CD1 1 
ATOM   2513 C CD2 . LEU A 1 324 ? -16.142 25.733 155.036 1.00 63.44  ? 1510 LEU A CD2 1 
ATOM   2514 N N   . MET A 1 325 ? -14.819 29.585 154.009 1.00 67.67  ? 1511 MET A N   1 
ATOM   2515 C CA  . MET A 1 325 ? -15.017 30.647 154.974 1.00 60.17  ? 1511 MET A CA  1 
ATOM   2516 C C   . MET A 1 325 ? -16.268 31.419 154.616 1.00 62.47  ? 1511 MET A C   1 
ATOM   2517 O O   . MET A 1 325 ? -17.022 31.815 155.496 1.00 76.02  ? 1511 MET A O   1 
ATOM   2518 C CB  . MET A 1 325 ? -13.798 31.562 155.012 1.00 56.84  ? 1511 MET A CB  1 
ATOM   2519 C CG  . MET A 1 325 ? -12.521 30.825 155.369 1.00 86.43  ? 1511 MET A CG  1 
ATOM   2520 S SD  . MET A 1 325 ? -11.092 31.895 155.581 1.00 131.98 ? 1511 MET A SD  1 
ATOM   2521 C CE  . MET A 1 325 ? -9.867  30.708 156.116 1.00 96.76  ? 1511 MET A CE  1 
ATOM   2522 N N   . MET A 1 326 ? -16.501 31.636 153.333 1.00 78.80  ? 1512 MET A N   1 
ATOM   2523 C CA  . MET A 1 326 ? -17.698 32.355 152.933 1.00 67.09  ? 1512 MET A CA  1 
ATOM   2524 C C   . MET A 1 326 ? -19.002 31.608 153.268 1.00 66.66  ? 1512 MET A C   1 
ATOM   2525 O O   . MET A 1 326 ? -19.968 32.233 153.693 1.00 72.59  ? 1512 MET A O   1 
ATOM   2526 C CB  . MET A 1 326 ? -17.636 32.775 151.467 1.00 65.95  ? 1512 MET A CB  1 
ATOM   2527 C CG  . MET A 1 326 ? -18.597 33.897 151.133 1.00 74.52  ? 1512 MET A CG  1 
ATOM   2528 S SD  . MET A 1 326 ? -17.832 35.211 150.181 1.00 76.59  ? 1512 MET A SD  1 
ATOM   2529 C CE  . MET A 1 326 ? -16.782 35.956 151.416 1.00 82.69  ? 1512 MET A CE  1 
ATOM   2530 N N   . ILE A 1 327 ? -19.042 30.286 153.085 1.00 62.05  ? 1513 ILE A N   1 
ATOM   2531 C CA  . ILE A 1 327 ? -20.271 29.547 153.396 1.00 71.21  ? 1513 ILE A CA  1 
ATOM   2532 C C   . ILE A 1 327 ? -20.542 29.713 154.880 1.00 72.60  ? 1513 ILE A C   1 
ATOM   2533 O O   . ILE A 1 327 ? -21.656 30.023 155.290 1.00 85.71  ? 1513 ILE A O   1 
ATOM   2534 C CB  . ILE A 1 327 ? -20.154 28.054 153.065 1.00 70.78  ? 1513 ILE A CB  1 
ATOM   2535 C CG1 . ILE A 1 327 ? -19.230 27.357 154.059 1.00 89.14  ? 1513 ILE A CG1 1 
ATOM   2536 C CG2 . ILE A 1 327 ? -19.661 27.854 151.645 1.00 66.51  ? 1513 ILE A CG2 1 
ATOM   2537 C CD1 . ILE A 1 327 ? -19.062 25.888 153.784 1.00 90.75  ? 1513 ILE A CD1 1 
ATOM   2538 N N   . ASN A 1 328 ? -19.501 29.532 155.680 1.00 61.13  ? 1514 ASN A N   1 
ATOM   2539 C CA  . ASN A 1 328 ? -19.593 29.716 157.110 1.00 76.44  ? 1514 ASN A CA  1 
ATOM   2540 C C   . ASN A 1 328 ? -20.150 31.060 157.545 1.00 75.70  ? 1514 ASN A C   1 
ATOM   2541 O O   . ASN A 1 328 ? -21.090 31.094 158.331 1.00 86.35  ? 1514 ASN A O   1 
ATOM   2542 C CB  . ASN A 1 328 ? -18.264 29.401 157.766 1.00 75.95  ? 1514 ASN A CB  1 
ATOM   2543 C CG  . ASN A 1 328 ? -17.975 27.918 157.761 1.00 86.20  ? 1514 ASN A CG  1 
ATOM   2544 O OD1 . ASN A 1 328 ? -18.909 27.092 157.786 1.00 83.18  ? 1514 ASN A OD1 1 
ATOM   2545 N ND2 . ASN A 1 328 ? -16.689 27.558 157.725 1.00 79.65  ? 1514 ASN A ND2 1 
ATOM   2546 N N   . GLN A 1 329 ? -19.618 32.159 157.019 1.00 70.02  ? 1515 GLN A N   1 
ATOM   2547 C CA  . GLN A 1 329 ? -20.097 33.482 157.431 1.00 62.46  ? 1515 GLN A CA  1 
ATOM   2548 C C   . GLN A 1 329 ? -21.556 33.656 157.069 1.00 73.70  ? 1515 GLN A C   1 
ATOM   2549 O O   . GLN A 1 329 ? -22.316 34.278 157.791 1.00 71.61  ? 1515 GLN A O   1 
ATOM   2550 C CB  . GLN A 1 329 ? -19.316 34.612 156.769 1.00 68.71  ? 1515 GLN A CB  1 
ATOM   2551 C CG  . GLN A 1 329 ? -17.786 34.460 156.726 1.00 95.24  ? 1515 GLN A CG  1 
ATOM   2552 C CD  . GLN A 1 329 ? -17.164 35.153 155.487 1.00 110.69 ? 1515 GLN A CD  1 
ATOM   2553 O OE1 . GLN A 1 329 ? -17.695 36.166 154.986 1.00 98.95  ? 1515 GLN A OE1 1 
ATOM   2554 N NE2 . GLN A 1 329 ? -16.043 34.603 154.987 1.00 105.94 ? 1515 GLN A NE2 1 
ATOM   2555 N N   . TYR A 1 330 ? -21.944 33.101 155.935 1.00 71.52  ? 1516 TYR A N   1 
ATOM   2556 C CA  . TYR A 1 330 ? -23.284 33.331 155.429 1.00 80.15  ? 1516 TYR A CA  1 
ATOM   2557 C C   . TYR A 1 330 ? -24.299 32.409 156.082 1.00 90.70  ? 1516 TYR A C   1 
ATOM   2558 O O   . TYR A 1 330 ? -25.437 32.814 156.307 1.00 97.97  ? 1516 TYR A O   1 
ATOM   2559 C CB  . TYR A 1 330 ? -23.315 33.235 153.896 1.00 74.69  ? 1516 TYR A CB  1 
ATOM   2560 C CG  . TYR A 1 330 ? -22.928 34.536 153.223 1.00 60.07  ? 1516 TYR A CG  1 
ATOM   2561 C CD1 . TYR A 1 330 ? -23.893 35.513 152.956 1.00 44.92  ? 1516 TYR A CD1 1 
ATOM   2562 C CD2 . TYR A 1 330 ? -21.590 34.804 152.873 1.00 58.23  ? 1516 TYR A CD2 1 
ATOM   2563 C CE1 . TYR A 1 330 ? -23.550 36.720 152.353 1.00 50.38  ? 1516 TYR A CE1 1 
ATOM   2564 C CE2 . TYR A 1 330 ? -21.232 36.003 152.264 1.00 49.63  ? 1516 TYR A CE2 1 
ATOM   2565 C CZ  . TYR A 1 330 ? -22.219 36.960 152.014 1.00 66.52  ? 1516 TYR A CZ  1 
ATOM   2566 O OH  . TYR A 1 330 ? -21.900 38.156 151.409 1.00 58.40  ? 1516 TYR A OH  1 
ATOM   2567 N N   . GLN A 1 331 ? -23.884 31.177 156.377 1.00 91.55  ? 1517 GLN A N   1 
ATOM   2568 C CA  . GLN A 1 331 ? -24.662 30.255 157.222 1.00 94.27  ? 1517 GLN A CA  1 
ATOM   2569 C C   . GLN A 1 331 ? -24.961 30.864 158.604 1.00 108.00 ? 1517 GLN A C   1 
ATOM   2570 O O   . GLN A 1 331 ? -26.083 30.810 159.119 1.00 111.48 ? 1517 GLN A O   1 
ATOM   2571 C CB  . GLN A 1 331 ? -23.874 28.975 157.441 1.00 72.94  ? 1517 GLN A CB  1 
ATOM   2572 C CG  . GLN A 1 331 ? -23.907 28.052 156.292 1.00 74.65  ? 1517 GLN A CG  1 
ATOM   2573 C CD  . GLN A 1 331 ? -23.284 26.726 156.623 1.00 88.78  ? 1517 GLN A CD  1 
ATOM   2574 O OE1 . GLN A 1 331 ? -23.739 25.691 156.139 1.00 84.55  ? 1517 GLN A OE1 1 
ATOM   2575 N NE2 . GLN A 1 331 ? -22.235 26.739 157.461 1.00 72.79  ? 1517 GLN A NE2 1 
ATOM   2576 N N   . SER A 1 332 ? -23.919 31.443 159.178 1.00 101.45 ? 1518 SER A N   1 
ATOM   2577 C CA  . SER A 1 332 ? -23.905 31.994 160.505 1.00 82.40  ? 1518 SER A CA  1 
ATOM   2578 C C   . SER A 1 332 ? -24.730 33.297 160.603 1.00 102.44 ? 1518 SER A C   1 
ATOM   2579 O O   . SER A 1 332 ? -25.430 33.508 161.600 1.00 127.77 ? 1518 SER A O   1 
ATOM   2580 C CB  . SER A 1 332 ? -22.417 32.133 160.836 1.00 71.83  ? 1518 SER A CB  1 
ATOM   2581 O OG  . SER A 1 332 ? -22.078 32.939 161.905 1.00 81.97  ? 1518 SER A OG  1 
ATOM   2582 N N   . ASP A 1 333 ? -24.697 34.128 159.556 1.00 98.88  ? 1519 ASP A N   1 
ATOM   2583 C CA  . ASP A 1 333 ? -25.400 35.419 159.562 1.00 83.55  ? 1519 ASP A CA  1 
ATOM   2584 C C   . ASP A 1 333 ? -26.248 35.616 158.290 1.00 90.03  ? 1519 ASP A C   1 
ATOM   2585 O O   . ASP A 1 333 ? -25.741 35.443 157.172 1.00 107.90 ? 1519 ASP A O   1 
ATOM   2586 C CB  . ASP A 1 333 ? -24.388 36.560 159.761 1.00 64.93  ? 1519 ASP A CB  1 
ATOM   2587 C CG  . ASP A 1 333 ? -25.024 37.942 159.670 1.00 81.42  ? 1519 ASP A CG  1 
ATOM   2588 O OD1 . ASP A 1 333 ? -26.240 38.014 159.374 1.00 82.14  ? 1519 ASP A OD1 1 
ATOM   2589 O OD2 . ASP A 1 333 ? -24.312 38.965 159.880 1.00 68.41  ? 1519 ASP A OD2 1 
ATOM   2590 N N   . GLU A 1 334 ? -27.523 35.982 158.454 1.00 67.30  ? 1520 GLU A N   1 
ATOM   2591 C CA  . GLU A 1 334 ? -28.413 36.228 157.306 1.00 82.31  ? 1520 GLU A CA  1 
ATOM   2592 C C   . GLU A 1 334 ? -28.713 37.722 157.019 1.00 85.74  ? 1520 GLU A C   1 
ATOM   2593 O O   . GLU A 1 334 ? -29.490 38.057 156.105 1.00 84.96  ? 1520 GLU A O   1 
ATOM   2594 C CB  . GLU A 1 334 ? -29.723 35.472 157.477 1.00 89.62  ? 1520 GLU A CB  1 
ATOM   2595 C CG  . GLU A 1 334 ? -29.578 34.108 158.142 1.00 109.76 ? 1520 GLU A CG  1 
ATOM   2596 C CD  . GLU A 1 334 ? -30.982 33.415 158.311 1.00 115.32 ? 1520 GLU A CD  1 
ATOM   2597 O OE1 . GLU A 1 334 ? -31.640 33.062 157.289 1.00 105.43 ? 1520 GLU A OE1 1 
ATOM   2598 O OE2 . GLU A 1 334 ? -31.500 33.250 159.467 1.00 107.86 ? 1520 GLU A OE2 1 
ATOM   2599 N N   . THR A 1 335 ? -28.123 38.611 157.814 1.00 79.38  ? 1521 THR A N   1 
ATOM   2600 C CA  . THR A 1 335 ? -28.163 40.042 157.523 1.00 89.87  ? 1521 THR A CA  1 
ATOM   2601 C C   . THR A 1 335 ? -27.094 40.394 156.465 1.00 95.34  ? 1521 THR A C   1 
ATOM   2602 O O   . THR A 1 335 ? -27.084 41.513 155.900 1.00 102.96 ? 1521 THR A O   1 
ATOM   2603 C CB  . THR A 1 335 ? -27.946 40.904 158.812 1.00 86.81  ? 1521 THR A CB  1 
ATOM   2604 O OG1 . THR A 1 335 ? -27.740 42.281 158.457 1.00 105.55 ? 1521 THR A OG1 1 
ATOM   2605 C CG2 . THR A 1 335 ? -26.699 40.445 159.608 1.00 67.32  ? 1521 THR A CG2 1 
ATOM   2606 N N   . LEU A 1 336 ? -26.182 39.455 156.213 1.00 76.67  ? 1522 LEU A N   1 
ATOM   2607 C CA  . LEU A 1 336 ? -25.103 39.700 155.251 1.00 83.36  ? 1522 LEU A CA  1 
ATOM   2608 C C   . LEU A 1 336 ? -25.602 39.991 153.810 1.00 86.25  ? 1522 LEU A C   1 
ATOM   2609 O O   . LEU A 1 336 ? -26.481 39.259 153.284 1.00 61.37  ? 1522 LEU A O   1 
ATOM   2610 C CB  . LEU A 1 336 ? -24.074 38.558 155.269 1.00 74.88  ? 1522 LEU A CB  1 
ATOM   2611 C CG  . LEU A 1 336 ? -23.000 38.621 156.353 1.00 63.92  ? 1522 LEU A CG  1 
ATOM   2612 C CD1 . LEU A 1 336 ? -22.247 37.306 156.443 1.00 63.47  ? 1522 LEU A CD1 1 
ATOM   2613 C CD2 . LEU A 1 336 ? -22.047 39.746 156.063 1.00 59.32  ? 1522 LEU A CD2 1 
ATOM   2614 N N   . PRO A 1 337 ? -25.050 41.070 153.185 1.00 80.03  ? 1523 PRO A N   1 
ATOM   2615 C CA  . PRO A 1 337 ? -25.286 41.389 151.769 1.00 95.77  ? 1523 PRO A CA  1 
ATOM   2616 C C   . PRO A 1 337 ? -24.737 40.275 150.889 1.00 92.50  ? 1523 PRO A C   1 
ATOM   2617 O O   . PRO A 1 337 ? -23.655 39.733 151.166 1.00 90.09  ? 1523 PRO A O   1 
ATOM   2618 C CB  . PRO A 1 337 ? -24.467 42.668 151.544 1.00 83.04  ? 1523 PRO A CB  1 
ATOM   2619 C CG  . PRO A 1 337 ? -24.191 43.209 152.902 1.00 77.76  ? 1523 PRO A CG  1 
ATOM   2620 C CD  . PRO A 1 337 ? -24.099 42.016 153.795 1.00 67.88  ? 1523 PRO A CD  1 
ATOM   2621 N N   . ILE A 1 338 ? -25.467 39.931 149.837 1.00 69.14  ? 1524 ILE A N   1 
ATOM   2622 C CA  . ILE A 1 338 ? -25.035 38.826 148.986 1.00 73.64  ? 1524 ILE A CA  1 
ATOM   2623 C C   . ILE A 1 338 ? -24.045 39.191 147.881 1.00 64.40  ? 1524 ILE A C   1 
ATOM   2624 O O   . ILE A 1 338 ? -23.318 38.324 147.410 1.00 67.15  ? 1524 ILE A O   1 
ATOM   2625 C CB  . ILE A 1 338 ? -26.219 38.069 148.410 1.00 74.10  ? 1524 ILE A CB  1 
ATOM   2626 C CG1 . ILE A 1 338 ? -26.812 38.794 147.175 1.00 80.26  ? 1524 ILE A CG1 1 
ATOM   2627 C CG2 . ILE A 1 338 ? -27.220 37.843 149.514 1.00 68.78  ? 1524 ILE A CG2 1 
ATOM   2628 C CD1 . ILE A 1 338 ? -27.388 40.235 147.400 1.00 158.31 ? 1524 ILE A CD1 1 
ATOM   2629 N N   . ASN A 1 339 ? -23.995 40.458 147.481 1.00 49.83  ? 1525 ASN A N   1 
ATOM   2630 C CA  . ASN A 1 339 ? -23.036 40.857 146.464 1.00 54.39  ? 1525 ASN A CA  1 
ATOM   2631 C C   . ASN A 1 339 ? -21.667 40.225 146.644 1.00 66.28  ? 1525 ASN A C   1 
ATOM   2632 O O   . ASN A 1 339 ? -21.187 39.609 145.705 1.00 79.03  ? 1525 ASN A O   1 
ATOM   2633 C CB  . ASN A 1 339 ? -22.961 42.365 146.266 1.00 57.75  ? 1525 ASN A CB  1 
ATOM   2634 C CG  . ASN A 1 339 ? -24.183 42.927 145.508 1.00 84.68  ? 1525 ASN A CG  1 
ATOM   2635 O OD1 . ASN A 1 339 ? -24.902 42.191 144.813 1.00 81.06  ? 1525 ASN A OD1 1 
ATOM   2636 N ND2 . ASN A 1 339 ? -24.408 44.232 145.631 1.00 70.82  ? 1525 ASN A ND2 1 
ATOM   2637 N N   . PRO A 1 340 ? -21.045 40.324 147.843 1.00 61.20  ? 1526 PRO A N   1 
ATOM   2638 C CA  . PRO A 1 340 ? -19.744 39.666 148.055 1.00 63.57  ? 1526 PRO A CA  1 
ATOM   2639 C C   . PRO A 1 340 ? -19.696 38.180 147.782 1.00 71.34  ? 1526 PRO A C   1 
ATOM   2640 O O   . PRO A 1 340 ? -18.622 37.644 147.470 1.00 67.20  ? 1526 PRO A O   1 
ATOM   2641 C CB  . PRO A 1 340 ? -19.468 39.926 149.525 1.00 52.43  ? 1526 PRO A CB  1 
ATOM   2642 C CG  . PRO A 1 340 ? -20.022 41.276 149.735 1.00 48.29  ? 1526 PRO A CG  1 
ATOM   2643 C CD  . PRO A 1 340 ? -21.295 41.316 148.906 1.00 62.91  ? 1526 PRO A CD  1 
ATOM   2644 N N   . LEU A 1 341 ? -20.851 37.526 147.889 1.00 70.27  ? 1527 LEU A N   1 
ATOM   2645 C CA  . LEU A 1 341 ? -20.953 36.084 147.671 1.00 68.32  ? 1527 LEU A CA  1 
ATOM   2646 C C   . LEU A 1 341 ? -21.147 35.780 146.192 1.00 65.06  ? 1527 LEU A C   1 
ATOM   2647 O O   . LEU A 1 341 ? -20.475 34.915 145.630 1.00 66.88  ? 1527 LEU A O   1 
ATOM   2648 C CB  . LEU A 1 341 ? -22.108 35.527 148.483 1.00 64.44  ? 1527 LEU A CB  1 
ATOM   2649 C CG  . LEU A 1 341 ? -22.280 34.022 148.386 1.00 68.11  ? 1527 LEU A CG  1 
ATOM   2650 C CD1 . LEU A 1 341 ? -21.047 33.252 148.896 1.00 39.21  ? 1527 LEU A CD1 1 
ATOM   2651 C CD2 . LEU A 1 341 ? -23.573 33.599 149.103 1.00 59.00  ? 1527 LEU A CD2 1 
ATOM   2652 N N   . SER A 1 342 ? -22.062 36.515 145.565 1.00 55.76  ? 1528 SER A N   1 
ATOM   2653 C CA  . SER A 1 342 ? -22.267 36.444 144.131 1.00 52.34  ? 1528 SER A CA  1 
ATOM   2654 C C   . SER A 1 342 ? -20.904 36.524 143.492 1.00 60.65  ? 1528 SER A C   1 
ATOM   2655 O O   . SER A 1 342 ? -20.478 35.609 142.776 1.00 58.85  ? 1528 SER A O   1 
ATOM   2656 C CB  . SER A 1 342 ? -23.084 37.648 143.632 1.00 50.95  ? 1528 SER A CB  1 
ATOM   2657 O OG  . SER A 1 342 ? -24.169 37.975 144.473 1.00 52.65  ? 1528 SER A OG  1 
ATOM   2658 N N   . MET A 1 343 ? -20.221 37.621 143.786 1.00 36.94  ? 1529 MET A N   1 
ATOM   2659 C CA  . MET A 1 343 ? -18.993 37.929 143.132 1.00 51.31  ? 1529 MET A CA  1 
ATOM   2660 C C   . MET A 1 343 ? -17.971 36.792 143.221 1.00 64.30  ? 1529 MET A C   1 
ATOM   2661 O O   . MET A 1 343 ? -17.334 36.429 142.211 1.00 62.26  ? 1529 MET A O   1 
ATOM   2662 C CB  . MET A 1 343 ? -18.424 39.196 143.717 1.00 43.98  ? 1529 MET A CB  1 
ATOM   2663 C CG  . MET A 1 343 ? -17.555 39.926 142.757 1.00 49.04  ? 1529 MET A CG  1 
ATOM   2664 S SD  . MET A 1 343 ? -16.434 41.118 143.503 1.00 56.74  ? 1529 MET A SD  1 
ATOM   2665 C CE  . MET A 1 343 ? -15.285 39.965 144.278 1.00 46.57  ? 1529 MET A CE  1 
ATOM   2666 N N   . LEU A 1 344 ? -17.811 36.227 144.421 1.00 59.50  ? 1530 LEU A N   1 
ATOM   2667 C CA  . LEU A 1 344 ? -16.818 35.179 144.613 1.00 56.53  ? 1530 LEU A CA  1 
ATOM   2668 C C   . LEU A 1 344 ? -17.212 33.934 143.818 1.00 50.72  ? 1530 LEU A C   1 
ATOM   2669 O O   . LEU A 1 344 ? -16.402 33.379 143.056 1.00 61.01  ? 1530 LEU A O   1 
ATOM   2670 C CB  . LEU A 1 344 ? -16.662 34.841 146.093 1.00 47.38  ? 1530 LEU A CB  1 
ATOM   2671 C CG  . LEU A 1 344 ? -15.714 33.670 146.321 1.00 59.27  ? 1530 LEU A CG  1 
ATOM   2672 C CD1 . LEU A 1 344 ? -14.377 34.142 146.813 1.00 51.89  ? 1530 LEU A CD1 1 
ATOM   2673 C CD2 . LEU A 1 344 ? -16.329 32.716 147.308 1.00 72.31  ? 1530 LEU A CD2 1 
ATOM   2674 N N   . LEU A 1 345 ? -18.462 33.513 143.988 1.00 57.03  ? 1531 LEU A N   1 
ATOM   2675 C CA  . LEU A 1 345 ? -18.915 32.270 143.374 1.00 59.30  ? 1531 LEU A CA  1 
ATOM   2676 C C   . LEU A 1 345 ? -18.803 32.350 141.881 1.00 62.03  ? 1531 LEU A C   1 
ATOM   2677 O O   . LEU A 1 345 ? -18.211 31.468 141.249 1.00 67.34  ? 1531 LEU A O   1 
ATOM   2678 C CB  . LEU A 1 345 ? -20.342 31.938 143.778 1.00 56.59  ? 1531 LEU A CB  1 
ATOM   2679 C CG  . LEU A 1 345 ? -20.529 31.712 145.273 1.00 59.57  ? 1531 LEU A CG  1 
ATOM   2680 C CD1 . LEU A 1 345 ? -21.991 31.558 145.530 1.00 67.91  ? 1531 LEU A CD1 1 
ATOM   2681 C CD2 . LEU A 1 345 ? -19.754 30.507 145.775 1.00 47.91  ? 1531 LEU A CD2 1 
ATOM   2682 N N   . ASN A 1 346 ? -19.321 33.439 141.329 1.00 46.86  ? 1532 ASN A N   1 
ATOM   2683 C CA  . ASN A 1 346 ? -19.380 33.551 139.903 1.00 74.24  ? 1532 ASN A CA  1 
ATOM   2684 C C   . ASN A 1 346 ? -18.032 33.494 139.245 1.00 70.84  ? 1532 ASN A C   1 
ATOM   2685 O O   . ASN A 1 346 ? -17.857 32.756 138.275 1.00 73.64  ? 1532 ASN A O   1 
ATOM   2686 C CB  . ASN A 1 346 ? -20.114 34.794 139.460 1.00 87.95  ? 1532 ASN A CB  1 
ATOM   2687 C CG  . ASN A 1 346 ? -20.434 34.760 137.971 1.00 92.04  ? 1532 ASN A CG  1 
ATOM   2688 O OD1 . ASN A 1 346 ? -21.083 33.812 137.471 1.00 86.86  ? 1532 ASN A OD1 1 
ATOM   2689 N ND2 . ASN A 1 346 ? -19.951 35.776 137.245 1.00 71.12  ? 1532 ASN A ND2 1 
ATOM   2690 N N   . GLY A 1 347 ? -17.090 34.264 139.782 1.00 57.65  ? 1533 GLY A N   1 
ATOM   2691 C CA  . GLY A 1 347 ? -15.731 34.315 139.261 1.00 58.02  ? 1533 GLY A CA  1 
ATOM   2692 C C   . GLY A 1 347 ? -14.971 33.012 139.380 1.00 62.20  ? 1533 GLY A C   1 
ATOM   2693 O O   . GLY A 1 347 ? -13.910 32.853 138.771 1.00 64.07  ? 1533 GLY A O   1 
ATOM   2694 N N   . ILE A 1 348 ? -15.494 32.084 140.183 1.00 60.31  ? 1534 ILE A N   1 
ATOM   2695 C CA  . ILE A 1 348 ? -14.879 30.766 140.274 1.00 62.17  ? 1534 ILE A CA  1 
ATOM   2696 C C   . ILE A 1 348 ? -15.610 29.764 139.399 1.00 63.99  ? 1534 ILE A C   1 
ATOM   2697 O O   . ILE A 1 348 ? -15.010 28.799 138.879 1.00 70.09  ? 1534 ILE A O   1 
ATOM   2698 C CB  . ILE A 1 348 ? -14.792 30.258 141.733 1.00 55.23  ? 1534 ILE A CB  1 
ATOM   2699 C CG1 . ILE A 1 348 ? -13.720 31.053 142.489 1.00 60.38  ? 1534 ILE A CG1 1 
ATOM   2700 C CG2 . ILE A 1 348 ? -14.469 28.762 141.755 1.00 52.18  ? 1534 ILE A CG2 1 
ATOM   2701 C CD1 . ILE A 1 348 ? -13.804 30.972 143.992 1.00 63.34  ? 1534 ILE A CD1 1 
ATOM   2702 N N   . VAL A 1 349 ? -16.910 29.988 139.253 1.00 53.47  ? 1535 VAL A N   1 
ATOM   2703 C CA  . VAL A 1 349 ? -17.749 29.073 138.506 1.00 62.17  ? 1535 VAL A CA  1 
ATOM   2704 C C   . VAL A 1 349 ? -17.610 29.361 137.017 1.00 66.66  ? 1535 VAL A C   1 
ATOM   2705 O O   . VAL A 1 349 ? -17.575 28.447 136.197 1.00 52.99  ? 1535 VAL A O   1 
ATOM   2706 C CB  . VAL A 1 349 ? -19.210 29.155 138.970 1.00 60.84  ? 1535 VAL A CB  1 
ATOM   2707 C CG1 . VAL A 1 349 ? -20.137 28.861 137.847 1.00 72.02  ? 1535 VAL A CG1 1 
ATOM   2708 C CG2 . VAL A 1 349 ? -19.451 28.185 140.096 1.00 55.72  ? 1535 VAL A CG2 1 
ATOM   2709 N N   . ASP A 1 350 ? -17.505 30.640 136.678 1.00 64.30  ? 1536 ASP A N   1 
ATOM   2710 C CA  . ASP A 1 350 ? -17.399 31.049 135.281 1.00 64.41  ? 1536 ASP A CA  1 
ATOM   2711 C C   . ASP A 1 350 ? -16.258 32.073 135.058 1.00 59.48  ? 1536 ASP A C   1 
ATOM   2712 O O   . ASP A 1 350 ? -16.492 33.254 134.826 1.00 45.97  ? 1536 ASP A O   1 
ATOM   2713 C CB  . ASP A 1 350 ? -18.764 31.522 134.748 1.00 65.76  ? 1536 ASP A CB  1 
ATOM   2714 C CG  . ASP A 1 350 ? -18.733 31.859 133.261 1.00 83.29  ? 1536 ASP A CG  1 
ATOM   2715 O OD1 . ASP A 1 350 ? -17.815 31.383 132.546 1.00 83.86  ? 1536 ASP A OD1 1 
ATOM   2716 O OD2 . ASP A 1 350 ? -19.619 32.611 132.792 1.00 91.45  ? 1536 ASP A OD2 1 
ATOM   2717 N N   . PRO A 1 351 ? -15.010 31.600 135.140 1.00 53.97  ? 1537 PRO A N   1 
ATOM   2718 C CA  . PRO A 1 351 ? -13.861 32.454 134.986 1.00 51.94  ? 1537 PRO A CA  1 
ATOM   2719 C C   . PRO A 1 351 ? -13.591 32.798 133.521 1.00 56.68  ? 1537 PRO A C   1 
ATOM   2720 O O   . PRO A 1 351 ? -12.585 32.354 132.929 1.00 53.67  ? 1537 PRO A O   1 
ATOM   2721 C CB  . PRO A 1 351 ? -12.722 31.628 135.599 1.00 49.41  ? 1537 PRO A CB  1 
ATOM   2722 C CG  . PRO A 1 351 ? -13.125 30.263 135.470 1.00 51.32  ? 1537 PRO A CG  1 
ATOM   2723 C CD  . PRO A 1 351 ? -14.622 30.227 135.496 1.00 54.40  ? 1537 PRO A CD  1 
ATOM   2724 N N   . ALA A 1 352 ? -14.493 33.599 132.954 1.00 53.69  ? 1538 ALA A N   1 
ATOM   2725 C CA  . ALA A 1 352 ? -14.415 34.026 131.550 1.00 57.37  ? 1538 ALA A CA  1 
ATOM   2726 C C   . ALA A 1 352 ? -13.115 34.731 131.162 1.00 59.43  ? 1538 ALA A C   1 
ATOM   2727 O O   . ALA A 1 352 ? -12.534 34.467 130.111 1.00 68.73  ? 1538 ALA A O   1 
ATOM   2728 C CB  . ALA A 1 352 ? -15.590 34.892 131.197 1.00 37.34  ? 1538 ALA A CB  1 
ATOM   2729 N N   . VAL A 1 353 ? -12.667 35.637 132.004 1.00 39.58  ? 1539 VAL A N   1 
ATOM   2730 C CA  . VAL A 1 353 ? -11.538 36.488 131.683 1.00 44.60  ? 1539 VAL A CA  1 
ATOM   2731 C C   . VAL A 1 353 ? -10.234 35.735 131.893 1.00 45.14  ? 1539 VAL A C   1 
ATOM   2732 O O   . VAL A 1 353 ? -9.420  35.617 131.000 1.00 58.75  ? 1539 VAL A O   1 
ATOM   2733 C CB  . VAL A 1 353 ? -11.600 37.800 132.528 1.00 35.86  ? 1539 VAL A CB  1 
ATOM   2734 C CG1 . VAL A 1 353 ? -10.328 38.609 132.425 1.00 36.82  ? 1539 VAL A CG1 1 
ATOM   2735 C CG2 . VAL A 1 353 ? -12.821 38.640 132.118 1.00 38.17  ? 1539 VAL A CG2 1 
ATOM   2736 N N   . MET A 1 354 ? -10.035 35.236 133.098 1.00 66.51  ? 1540 MET A N   1 
ATOM   2737 C CA  . MET A 1 354 ? -8.848  34.466 133.358 1.00 57.71  ? 1540 MET A CA  1 
ATOM   2738 C C   . MET A 1 354 ? -9.219  33.049 132.992 1.00 55.87  ? 1540 MET A C   1 
ATOM   2739 O O   . MET A 1 354 ? -10.392 32.719 132.887 1.00 65.46  ? 1540 MET A O   1 
ATOM   2740 C CB  . MET A 1 354 ? -8.413  34.593 134.812 1.00 75.59  ? 1540 MET A CB  1 
ATOM   2741 C CG  . MET A 1 354 ? -8.084  36.013 135.246 1.00 60.12  ? 1540 MET A CG  1 
ATOM   2742 S SD  . MET A 1 354 ? -6.830  36.833 134.263 1.00 63.26  ? 1540 MET A SD  1 
ATOM   2743 C CE  . MET A 1 354 ? -5.444  35.754 134.508 1.00 45.50  ? 1540 MET A CE  1 
ATOM   2744 N N   . GLY A 1 355 ? -8.224  32.212 132.773 1.00 52.87  ? 1541 GLY A N   1 
ATOM   2745 C CA  . GLY A 1 355 ? -8.483  30.853 132.355 1.00 81.10  ? 1541 GLY A CA  1 
ATOM   2746 C C   . GLY A 1 355 ? -9.561  30.088 133.092 1.00 66.38  ? 1541 GLY A C   1 
ATOM   2747 O O   . GLY A 1 355 ? -10.645 29.862 132.576 1.00 73.20  ? 1541 GLY A O   1 
ATOM   2748 N N   . GLY A 1 356 ? -9.228  29.712 134.319 1.00 63.83  ? 1542 GLY A N   1 
ATOM   2749 C CA  . GLY A 1 356 ? -10.065 28.893 135.170 1.00 53.16  ? 1542 GLY A CA  1 
ATOM   2750 C C   . GLY A 1 356 ? -9.105  27.783 135.528 1.00 64.65  ? 1542 GLY A C   1 
ATOM   2751 O O   . GLY A 1 356 ? -7.929  27.876 135.179 1.00 61.89  ? 1542 GLY A O   1 
ATOM   2752 N N   . PHE A 1 357 ? -9.556  26.735 136.203 1.00 64.85  ? 1543 PHE A N   1 
ATOM   2753 C CA  . PHE A 1 357 ? -8.610  25.680 136.510 1.00 70.00  ? 1543 PHE A CA  1 
ATOM   2754 C C   . PHE A 1 357 ? -8.322  24.840 135.278 1.00 82.25  ? 1543 PHE A C   1 
ATOM   2755 O O   . PHE A 1 357 ? -7.422  24.009 135.288 1.00 68.90  ? 1543 PHE A O   1 
ATOM   2756 C CB  . PHE A 1 357 ? -9.063  24.822 137.683 1.00 55.67  ? 1543 PHE A CB  1 
ATOM   2757 C CG  . PHE A 1 357 ? -10.181 23.901 137.360 1.00 84.22  ? 1543 PHE A CG  1 
ATOM   2758 C CD1 . PHE A 1 357 ? -10.032 22.932 136.396 1.00 104.58 ? 1543 PHE A CD1 1 
ATOM   2759 C CD2 . PHE A 1 357 ? -11.376 23.987 138.036 1.00 89.29  ? 1543 PHE A CD2 1 
ATOM   2760 C CE1 . PHE A 1 357 ? -11.059 22.078 136.104 1.00 113.58 ? 1543 PHE A CE1 1 
ATOM   2761 C CE2 . PHE A 1 357 ? -12.401 23.135 137.749 1.00 92.83  ? 1543 PHE A CE2 1 
ATOM   2762 C CZ  . PHE A 1 357 ? -12.245 22.180 136.782 1.00 103.54 ? 1543 PHE A CZ  1 
ATOM   2763 N N   . ALA A 1 358 ? -9.075  25.066 134.206 1.00 85.50  ? 1544 ALA A N   1 
ATOM   2764 C CA  . ALA A 1 358 ? -8.812  24.337 132.971 1.00 80.22  ? 1544 ALA A CA  1 
ATOM   2765 C C   . ALA A 1 358 ? -7.356  24.490 132.566 1.00 66.27  ? 1544 ALA A C   1 
ATOM   2766 O O   . ALA A 1 358 ? -6.750  23.561 132.044 1.00 59.57  ? 1544 ALA A O   1 
ATOM   2767 C CB  . ALA A 1 358 ? -9.716  24.834 131.867 1.00 40.75  ? 1544 ALA A CB  1 
ATOM   2768 N N   . LYS A 1 359 ? -6.796  25.666 132.803 1.00 66.26  ? 1545 LYS A N   1 
ATOM   2769 C CA  . LYS A 1 359 ? -5.407  25.922 132.455 1.00 69.32  ? 1545 LYS A CA  1 
ATOM   2770 C C   . LYS A 1 359 ? -4.467  24.987 133.199 1.00 68.23  ? 1545 LYS A C   1 
ATOM   2771 O O   . LYS A 1 359 ? -3.477  24.532 132.640 1.00 66.75  ? 1545 LYS A O   1 
ATOM   2772 C CB  . LYS A 1 359 ? -5.048  27.381 132.711 1.00 54.42  ? 1545 LYS A CB  1 
ATOM   2773 C CG  . LYS A 1 359 ? -5.770  28.324 131.779 1.00 55.27  ? 1545 LYS A CG  1 
ATOM   2774 C CD  . LYS A 1 359 ? -5.044  29.634 131.630 1.00 78.86  ? 1545 LYS A CD  1 
ATOM   2775 C CE  . LYS A 1 359 ? -5.324  30.229 130.269 1.00 85.22  ? 1545 LYS A CE  1 
ATOM   2776 N NZ  . LYS A 1 359 ? -6.746  30.035 129.885 1.00 90.88  ? 1545 LYS A NZ  1 
ATOM   2777 N N   . TYR A 1 360 ? -4.770  24.701 134.459 1.00 60.93  ? 1546 TYR A N   1 
ATOM   2778 C CA  . TYR A 1 360 ? -3.924  23.807 135.237 1.00 62.59  ? 1546 TYR A CA  1 
ATOM   2779 C C   . TYR A 1 360 ? -3.924  22.420 134.592 1.00 74.07  ? 1546 TYR A C   1 
ATOM   2780 O O   . TYR A 1 360 ? -2.886  21.774 134.498 1.00 74.94  ? 1546 TYR A O   1 
ATOM   2781 C CB  . TYR A 1 360 ? -4.355  23.785 136.699 1.00 64.56  ? 1546 TYR A CB  1 
ATOM   2782 C CG  . TYR A 1 360 ? -4.119  25.113 137.386 1.00 69.72  ? 1546 TYR A CG  1 
ATOM   2783 C CD1 . TYR A 1 360 ? -3.001  25.875 137.086 1.00 61.42  ? 1546 TYR A CD1 1 
ATOM   2784 C CD2 . TYR A 1 360 ? -5.005  25.600 138.334 1.00 62.12  ? 1546 TYR A CD2 1 
ATOM   2785 C CE1 . TYR A 1 360 ? -2.775  27.085 137.703 1.00 73.27  ? 1546 TYR A CE1 1 
ATOM   2786 C CE2 . TYR A 1 360 ? -4.784  26.811 138.958 1.00 57.00  ? 1546 TYR A CE2 1 
ATOM   2787 C CZ  . TYR A 1 360 ? -3.667  27.548 138.638 1.00 78.33  ? 1546 TYR A CZ  1 
ATOM   2788 O OH  . TYR A 1 360 ? -3.436  28.753 139.252 1.00 52.32  ? 1546 TYR A OH  1 
ATOM   2789 N N   . GLU A 1 361 ? -5.094  21.978 134.142 1.00 77.65  ? 1547 GLU A N   1 
ATOM   2790 C CA  . GLU A 1 361 ? -5.244  20.666 133.461 1.00 72.51  ? 1547 GLU A CA  1 
ATOM   2791 C C   . GLU A 1 361 ? -4.405  20.580 132.207 1.00 70.46  ? 1547 GLU A C   1 
ATOM   2792 O O   . GLU A 1 361 ? -3.656  19.623 132.008 1.00 71.79  ? 1547 GLU A O   1 
ATOM   2793 C CB  . GLU A 1 361 ? -6.676  20.431 133.029 1.00 63.66  ? 1547 GLU A CB  1 
ATOM   2794 C CG  . GLU A 1 361 ? -7.644  20.044 134.112 1.00 70.53  ? 1547 GLU A CG  1 
ATOM   2795 C CD  . GLU A 1 361 ? -9.057  20.395 133.699 1.00 84.06  ? 1547 GLU A CD  1 
ATOM   2796 O OE1 . GLU A 1 361 ? -9.210  21.251 132.804 1.00 85.00  ? 1547 GLU A OE1 1 
ATOM   2797 O OE2 . GLU A 1 361 ? -10.026 19.829 134.243 1.00 86.75  ? 1547 GLU A OE2 1 
ATOM   2798 N N   . LYS A 1 362 ? -4.569  21.592 131.361 1.00 68.72  ? 1548 LYS A N   1 
ATOM   2799 C CA  . LYS A 1 362 ? -3.809  21.735 130.145 1.00 70.82  ? 1548 LYS A CA  1 
ATOM   2800 C C   . LYS A 1 362 ? -2.313  21.829 130.432 1.00 83.71  ? 1548 LYS A C   1 
ATOM   2801 O O   . LYS A 1 362 ? -1.515  21.304 129.656 1.00 94.22  ? 1548 LYS A O   1 
ATOM   2802 C CB  . LYS A 1 362 ? -4.286  22.951 129.345 1.00 53.03  ? 1548 LYS A CB  1 
ATOM   2803 N N   . ALA A 1 363 ? -1.918  22.457 131.540 1.00 84.49  ? 1549 ALA A N   1 
ATOM   2804 C CA  . ALA A 1 363 ? -0.487  22.672 131.789 1.00 76.71  ? 1549 ALA A CA  1 
ATOM   2805 C C   . ALA A 1 363 ? 0.270   21.490 132.400 1.00 80.30  ? 1549 ALA A C   1 
ATOM   2806 O O   . ALA A 1 363 ? 1.438   21.281 132.073 1.00 77.91  ? 1549 ALA A O   1 
ATOM   2807 C CB  . ALA A 1 363 ? -0.262  23.919 132.608 1.00 80.11  ? 1549 ALA A CB  1 
ATOM   2808 N N   . PHE A 1 364 ? -0.374  20.720 133.276 1.00 84.40  ? 1550 PHE A N   1 
ATOM   2809 C CA  . PHE A 1 364 ? 0.343   19.646 133.991 1.00 90.60  ? 1550 PHE A CA  1 
ATOM   2810 C C   . PHE A 1 364 ? -0.181  18.224 133.791 1.00 92.63  ? 1550 PHE A C   1 
ATOM   2811 O O   . PHE A 1 364 ? 0.490   17.252 134.171 1.00 100.01 ? 1550 PHE A O   1 
ATOM   2812 C CB  . PHE A 1 364 ? 0.414   19.937 135.495 1.00 90.92  ? 1550 PHE A CB  1 
ATOM   2813 C CG  . PHE A 1 364 ? 0.607   21.396 135.831 1.00 77.36  ? 1550 PHE A CG  1 
ATOM   2814 C CD1 . PHE A 1 364 ? 1.835   22.037 135.602 1.00 68.86  ? 1550 PHE A CD1 1 
ATOM   2815 C CD2 . PHE A 1 364 ? -0.438  22.126 136.386 1.00 74.31  ? 1550 PHE A CD2 1 
ATOM   2816 C CE1 . PHE A 1 364 ? 2.014   23.385 135.910 1.00 60.91  ? 1550 PHE A CE1 1 
ATOM   2817 C CE2 . PHE A 1 364 ? -0.265  23.460 136.697 1.00 75.22  ? 1550 PHE A CE2 1 
ATOM   2818 C CZ  . PHE A 1 364 ? 0.981   24.092 136.457 1.00 70.02  ? 1550 PHE A CZ  1 
ATOM   2819 N N   . PHE A 1 365 ? -1.370  18.096 133.208 1.00 83.95  ? 1551 PHE A N   1 
ATOM   2820 C CA  . PHE A 1 365 ? -1.993  16.776 133.071 1.00 91.86  ? 1551 PHE A CA  1 
ATOM   2821 C C   . PHE A 1 365 ? -1.695  16.018 131.751 1.00 103.59 ? 1551 PHE A C   1 
ATOM   2822 O O   . PHE A 1 365 ? -2.158  14.888 131.547 1.00 102.21 ? 1551 PHE A O   1 
ATOM   2823 C CB  . PHE A 1 365 ? -3.491  16.866 133.381 1.00 88.59  ? 1551 PHE A CB  1 
ATOM   2824 C CG  . PHE A 1 365 ? -3.801  17.220 134.830 1.00 85.57  ? 1551 PHE A CG  1 
ATOM   2825 C CD1 . PHE A 1 365 ? -2.834  17.076 135.835 1.00 78.10  ? 1551 PHE A CD1 1 
ATOM   2826 C CD2 . PHE A 1 365 ? -5.070  17.690 135.187 1.00 77.26  ? 1551 PHE A CD2 1 
ATOM   2827 C CE1 . PHE A 1 365 ? -3.128  17.400 137.167 1.00 75.55  ? 1551 PHE A CE1 1 
ATOM   2828 C CE2 . PHE A 1 365 ? -5.375  18.017 136.515 1.00 64.99  ? 1551 PHE A CE2 1 
ATOM   2829 C CZ  . PHE A 1 365 ? -4.409  17.874 137.505 1.00 66.18  ? 1551 PHE A CZ  1 
ATOM   2830 N N   . THR A 1 366 ? -0.896  16.638 130.885 1.00 94.51  ? 1552 THR A N   1 
ATOM   2831 C CA  . THR A 1 366 ? -0.351  15.984 129.702 1.00 98.65  ? 1552 THR A CA  1 
ATOM   2832 C C   . THR A 1 366 ? 0.389   14.698 130.084 1.00 107.19 ? 1552 THR A C   1 
ATOM   2833 O O   . THR A 1 366 ? 0.948   14.593 131.192 1.00 90.27  ? 1552 THR A O   1 
ATOM   2834 C CB  . THR A 1 366 ? 0.669   16.903 128.963 1.00 107.84 ? 1552 THR A CB  1 
ATOM   2835 O OG1 . THR A 1 366 ? 1.881   17.014 129.726 1.00 99.14  ? 1552 THR A OG1 1 
ATOM   2836 C CG2 . THR A 1 366 ? 0.086   18.290 128.713 1.00 94.92  ? 1552 THR A CG2 1 
ATOM   2837 N N   . GLU A 1 367 ? 0.414   13.733 129.164 1.00 104.49 ? 1553 GLU A N   1 
ATOM   2838 C CA  . GLU A 1 367 ? 1.274   12.563 129.353 1.00 107.00 ? 1553 GLU A CA  1 
ATOM   2839 C C   . GLU A 1 367 ? 2.769   12.922 129.399 1.00 105.21 ? 1553 GLU A C   1 
ATOM   2840 O O   . GLU A 1 367 ? 3.538   12.217 130.064 1.00 106.65 ? 1553 GLU A O   1 
ATOM   2841 C CB  . GLU A 1 367 ? 1.006   11.496 128.289 1.00 108.25 ? 1553 GLU A CB  1 
ATOM   2842 C CG  . GLU A 1 367 ? 0.720   12.073 126.851 1.00 130.05 ? 1553 GLU A CG  1 
ATOM   2843 C CD  . GLU A 1 367 ? 0.280   10.978 125.825 1.00 111.05 ? 1553 GLU A CD  1 
ATOM   2844 O OE1 . GLU A 1 367 ? -0.613  10.123 126.169 1.00 112.88 ? 1553 GLU A OE1 1 
ATOM   2845 O OE2 . GLU A 1 367 ? 0.822   10.985 124.676 1.00 93.30  ? 1553 GLU A OE2 1 
ATOM   2846 N N   . GLU A 1 368 ? 3.189   14.001 128.722 1.00 95.51  ? 1554 GLU A N   1 
ATOM   2847 C CA  . GLU A 1 368 ? 4.615   14.389 128.829 1.00 97.57  ? 1554 GLU A CA  1 
ATOM   2848 C C   . GLU A 1 368 ? 4.932   15.003 130.135 1.00 110.53 ? 1554 GLU A C   1 
ATOM   2849 O O   . GLU A 1 368 ? 6.001   14.730 130.689 1.00 122.80 ? 1554 GLU A O   1 
ATOM   2850 C CB  . GLU A 1 368 ? 5.118   15.457 127.883 1.00 94.31  ? 1554 GLU A CB  1 
ATOM   2851 C CG  . GLU A 1 368 ? 4.263   15.775 126.934 1.00 104.28 ? 1554 GLU A CG  1 
ATOM   2852 C CD  . GLU A 1 368 ? 4.603   17.019 126.155 1.00 116.41 ? 1554 GLU A CD  1 
ATOM   2853 O OE1 . GLU A 1 368 ? 5.514   17.901 126.402 1.00 97.26  ? 1554 GLU A OE1 1 
ATOM   2854 O OE2 . GLU A 1 368 ? 3.670   17.038 125.192 1.00 112.51 ? 1554 GLU A OE2 1 
ATOM   2855 N N   . TYR A 1 369 ? 4.054   15.831 130.674 1.00 111.73 ? 1555 TYR A N   1 
ATOM   2856 C CA  . TYR A 1 369 ? 4.402   16.435 131.943 1.00 113.51 ? 1555 TYR A CA  1 
ATOM   2857 C C   . TYR A 1 369 ? 4.630   15.358 132.980 1.00 103.48 ? 1555 TYR A C   1 
ATOM   2858 O O   . TYR A 1 369 ? 5.564   15.444 133.772 1.00 99.76  ? 1555 TYR A O   1 
ATOM   2859 C CB  . TYR A 1 369 ? 3.334   17.411 132.424 1.00 109.81 ? 1555 TYR A CB  1 
ATOM   2860 C CG  . TYR A 1 369 ? 3.721   18.063 133.726 1.00 96.71  ? 1555 TYR A CG  1 
ATOM   2861 C CD1 . TYR A 1 369 ? 4.569   19.159 133.748 1.00 78.67  ? 1555 TYR A CD1 1 
ATOM   2862 C CD2 . TYR A 1 369 ? 3.269   17.562 134.935 1.00 88.79  ? 1555 TYR A CD2 1 
ATOM   2863 C CE1 . TYR A 1 369 ? 4.937   19.746 134.934 1.00 59.36  ? 1555 TYR A CE1 1 
ATOM   2864 C CE2 . TYR A 1 369 ? 3.633   18.145 136.125 1.00 83.92  ? 1555 TYR A CE2 1 
ATOM   2865 C CZ  . TYR A 1 369 ? 4.466   19.236 136.118 1.00 82.11  ? 1555 TYR A CZ  1 
ATOM   2866 O OH  . TYR A 1 369 ? 4.833   19.818 137.305 1.00 94.19  ? 1555 TYR A OH  1 
ATOM   2867 N N   . VAL A 1 370 ? 3.789   14.337 132.976 1.00 82.72  ? 1556 VAL A N   1 
ATOM   2868 C CA  . VAL A 1 370 ? 3.951   13.271 133.942 1.00 88.02  ? 1556 VAL A CA  1 
ATOM   2869 C C   . VAL A 1 370 ? 5.286   12.567 133.741 1.00 113.47 ? 1556 VAL A C   1 
ATOM   2870 O O   . VAL A 1 370 ? 5.989   12.277 134.706 1.00 121.89 ? 1556 VAL A O   1 
ATOM   2871 C CB  . VAL A 1 370 ? 2.820   12.246 133.820 1.00 99.28  ? 1556 VAL A CB  1 
ATOM   2872 C CG1 . VAL A 1 370 ? 2.788   11.347 135.042 1.00 84.27  ? 1556 VAL A CG1 1 
ATOM   2873 C CG2 . VAL A 1 370 ? 1.493   12.956 133.645 1.00 110.00 ? 1556 VAL A CG2 1 
ATOM   2874 N N   . ARG A 1 371 ? 5.635   12.295 132.487 1.00 123.59 ? 1557 ARG A N   1 
ATOM   2875 C CA  . ARG A 1 371 ? 6.896   11.621 132.185 1.00 123.33 ? 1557 ARG A CA  1 
ATOM   2876 C C   . ARG A 1 371 ? 8.148   12.424 132.532 1.00 120.46 ? 1557 ARG A C   1 
ATOM   2877 O O   . ARG A 1 371 ? 9.111   11.878 133.063 1.00 128.29 ? 1557 ARG A O   1 
ATOM   2878 C CB  . ARG A 1 371 ? 6.939   11.138 130.730 1.00 121.39 ? 1557 ARG A CB  1 
ATOM   2879 C CG  . ARG A 1 371 ? 7.090   12.222 129.676 1.00 131.31 ? 1557 ARG A CG  1 
ATOM   2880 C CD  . ARG A 1 371 ? 7.427   11.586 128.333 1.00 126.96 ? 1557 ARG A CD  1 
ATOM   2881 N NE  . ARG A 1 371 ? 7.247   12.490 127.203 1.00 117.27 ? 1557 ARG A NE  1 
ATOM   2882 C CZ  . ARG A 1 371 ? 8.224   13.193 126.640 1.00 113.17 ? 1557 ARG A CZ  1 
ATOM   2883 N NH1 . ARG A 1 371 ? 9.460   13.106 127.105 1.00 119.11 ? 1557 ARG A NH1 1 
ATOM   2884 N NH2 . ARG A 1 371 ? 7.963   13.986 125.612 1.00 98.36  ? 1557 ARG A NH2 1 
ATOM   2885 N N   . ASP A 1 372 ? 8.133   13.717 132.231 1.00 110.86 ? 1558 ASP A N   1 
ATOM   2886 C CA  . ASP A 1 372 ? 9.277   14.577 132.517 1.00 115.04 ? 1558 ASP A CA  1 
ATOM   2887 C C   . ASP A 1 372 ? 9.542   14.691 134.014 1.00 113.69 ? 1558 ASP A C   1 
ATOM   2888 O O   . ASP A 1 372 ? 10.687  14.667 134.459 1.00 106.62 ? 1558 ASP A O   1 
ATOM   2889 C CB  . ASP A 1 372 ? 9.063   15.957 131.900 1.00 115.92 ? 1558 ASP A CB  1 
ATOM   2890 C CG  . ASP A 1 372 ? 8.724   15.881 130.429 1.00 127.83 ? 1558 ASP A CG  1 
ATOM   2891 O OD1 . ASP A 1 372 ? 8.458   14.764 129.945 1.00 135.77 ? 1558 ASP A OD1 1 
ATOM   2892 O OD2 . ASP A 1 372 ? 8.722   16.931 129.757 1.00 130.17 ? 1558 ASP A OD2 1 
ATOM   2893 N N   . HIS A 1 373 ? 8.461   14.811 134.776 1.00 115.80 ? 1559 HIS A N   1 
ATOM   2894 C CA  . HIS A 1 373 ? 8.503   14.928 136.244 1.00 108.84 ? 1559 HIS A CA  1 
ATOM   2895 C C   . HIS A 1 373 ? 7.699   13.803 136.901 1.00 113.50 ? 1559 HIS A C   1 
ATOM   2896 O O   . HIS A 1 373 ? 6.468   13.876 136.949 1.00 106.41 ? 1559 HIS A O   1 
ATOM   2897 C CB  . HIS A 1 373 ? 7.946   16.276 136.705 1.00 95.80  ? 1559 HIS A CB  1 
ATOM   2898 C CG  . HIS A 1 373 ? 8.288   17.415 135.797 1.00 104.94 ? 1559 HIS A CG  1 
ATOM   2899 N ND1 . HIS A 1 373 ? 9.457   18.138 135.906 1.00 115.71 ? 1559 HIS A ND1 1 
ATOM   2900 C CD2 . HIS A 1 373 ? 7.620   17.940 134.744 1.00 108.42 ? 1559 HIS A CD2 1 
ATOM   2901 C CE1 . HIS A 1 373 ? 9.485   19.073 134.972 1.00 109.46 ? 1559 HIS A CE1 1 
ATOM   2902 N NE2 . HIS A 1 373 ? 8.380   18.976 134.255 1.00 108.10 ? 1559 HIS A NE2 1 
ATOM   2903 N N   . PRO A 1 374 ? 8.387   12.740 137.374 1.00 124.83 ? 1560 PRO A N   1 
ATOM   2904 C CA  . PRO A 1 374 ? 7.730   11.716 138.214 1.00 126.90 ? 1560 PRO A CA  1 
ATOM   2905 C C   . PRO A 1 374 ? 7.858   11.960 139.746 1.00 104.34 ? 1560 PRO A C   1 
ATOM   2906 O O   . PRO A 1 374 ? 7.093   11.394 140.532 1.00 91.41  ? 1560 PRO A O   1 
ATOM   2907 C CB  . PRO A 1 374 ? 8.427   10.402 137.791 1.00 127.69 ? 1560 PRO A CB  1 
ATOM   2908 C CG  . PRO A 1 374 ? 9.504   10.800 136.742 1.00 127.23 ? 1560 PRO A CG  1 
ATOM   2909 C CD  . PRO A 1 374 ? 9.708   12.281 136.897 1.00 125.46 ? 1560 PRO A CD  1 
ATOM   2910 N N   . GLU A 1 375 ? 8.811   12.796 140.158 1.00 92.56  ? 1561 GLU A N   1 
ATOM   2911 C CA  . GLU A 1 375 ? 8.971   13.204 141.562 1.00 98.48  ? 1561 GLU A CA  1 
ATOM   2912 C C   . GLU A 1 375 ? 7.690   13.843 142.118 1.00 107.86 ? 1561 GLU A C   1 
ATOM   2913 O O   . GLU A 1 375 ? 7.390   13.699 143.310 1.00 107.14 ? 1561 GLU A O   1 
ATOM   2914 C CB  . GLU A 1 375 ? 10.166  14.160 141.718 1.00 96.87  ? 1561 GLU A CB  1 
ATOM   2915 C CG  . GLU A 1 375 ? 10.085  15.480 140.907 1.00 104.81 ? 1561 GLU A CG  1 
ATOM   2916 C CD  . GLU A 1 375 ? 10.514  15.343 139.448 1.00 113.74 ? 1561 GLU A CD  1 
ATOM   2917 O OE1 . GLU A 1 375 ? 10.502  14.217 138.919 1.00 109.68 ? 1561 GLU A OE1 1 
ATOM   2918 O OE2 . GLU A 1 375 ? 10.877  16.362 138.818 1.00 114.38 ? 1561 GLU A OE2 1 
ATOM   2919 N N   . ASP A 1 376 ? 6.947   14.527 141.233 1.00 106.09 ? 1562 ASP A N   1 
ATOM   2920 C CA  . ASP A 1 376 ? 5.692   15.231 141.568 1.00 107.96 ? 1562 ASP A CA  1 
ATOM   2921 C C   . ASP A 1 376 ? 4.416   14.384 141.506 1.00 113.45 ? 1562 ASP A C   1 
ATOM   2922 O O   . ASP A 1 376 ? 3.338   14.915 141.763 1.00 123.77 ? 1562 ASP A O   1 
ATOM   2923 C CB  . ASP A 1 376 ? 5.438   16.442 140.644 1.00 103.32 ? 1562 ASP A CB  1 
ATOM   2924 C CG  . ASP A 1 376 ? 6.602   17.420 140.576 1.00 94.51  ? 1562 ASP A CG  1 
ATOM   2925 O OD1 . ASP A 1 376 ? 7.503   17.398 141.442 1.00 94.03  ? 1562 ASP A OD1 1 
ATOM   2926 O OD2 . ASP A 1 376 ? 6.592   18.234 139.626 1.00 85.84  ? 1562 ASP A OD2 1 
ATOM   2927 N N   . GLN A 1 377 ? 4.531   13.084 141.283 1.00 112.87 ? 1563 GLN A N   1 
ATOM   2928 C CA  . GLN A 1 377 ? 3.343   12.262 141.128 1.00 102.56 ? 1563 GLN A CA  1 
ATOM   2929 C C   . GLN A 1 377 ? 2.472   12.433 142.353 1.00 106.09 ? 1563 GLN A C   1 
ATOM   2930 O O   . GLN A 1 377 ? 1.250   12.495 142.246 1.00 94.19  ? 1563 GLN A O   1 
ATOM   2931 C CB  . GLN A 1 377 ? 3.724   10.787 141.003 1.00 93.35  ? 1563 GLN A CB  1 
ATOM   2932 C CG  . GLN A 1 377 ? 5.024   10.520 140.269 1.00 139.77 ? 1563 GLN A CG  1 
ATOM   2933 C CD  . GLN A 1 377 ? 5.471   9.076  140.403 1.00 162.00 ? 1563 GLN A CD  1 
ATOM   2934 O OE1 . GLN A 1 377 ? 4.759   8.243  140.964 1.00 161.21 ? 1563 GLN A OE1 1 
ATOM   2935 N NE2 . GLN A 1 377 ? 6.656   8.773  139.888 1.00 165.25 ? 1563 GLN A NE2 1 
ATOM   2936 N N   . ASP A 1 378 ? 3.098   12.519 143.516 1.00 113.39 ? 1564 ASP A N   1 
ATOM   2937 C CA  . ASP A 1 378 ? 2.356   12.699 144.749 1.00 112.46 ? 1564 ASP A CA  1 
ATOM   2938 C C   . ASP A 1 378 ? 1.600   14.026 144.684 1.00 101.79 ? 1564 ASP A C   1 
ATOM   2939 O O   . ASP A 1 378 ? 0.453   14.119 145.113 1.00 87.90  ? 1564 ASP A O   1 
ATOM   2940 C CB  . ASP A 1 378 ? 3.321   12.697 145.933 1.00 120.22 ? 1564 ASP A CB  1 
ATOM   2941 C CG  . ASP A 1 378 ? 2.786   11.927 147.118 1.00 126.48 ? 1564 ASP A CG  1 
ATOM   2942 O OD1 . ASP A 1 378 ? 1.810   11.171 146.941 1.00 124.97 ? 1564 ASP A OD1 1 
ATOM   2943 O OD2 . ASP A 1 378 ? 3.348   12.071 148.224 1.00 116.48 ? 1564 ASP A OD2 1 
ATOM   2944 N N   . LYS A 1 379 ? 2.261   15.050 144.152 1.00 100.84 ? 1565 LYS A N   1 
ATOM   2945 C CA  . LYS A 1 379 ? 1.680   16.387 144.009 1.00 85.61  ? 1565 LYS A CA  1 
ATOM   2946 C C   . LYS A 1 379 ? 0.488   16.509 143.057 1.00 92.64  ? 1565 LYS A C   1 
ATOM   2947 O O   . LYS A 1 379 ? -0.472  17.216 143.350 1.00 88.56  ? 1565 LYS A O   1 
ATOM   2948 C CB  . LYS A 1 379 ? 2.757   17.398 143.612 1.00 76.18  ? 1565 LYS A CB  1 
ATOM   2949 C CG  . LYS A 1 379 ? 3.728   17.725 144.725 1.00 70.42  ? 1565 LYS A CG  1 
ATOM   2950 C CD  . LYS A 1 379 ? 4.710   18.795 144.301 1.00 76.03  ? 1565 LYS A CD  1 
ATOM   2951 C CE  . LYS A 1 379 ? 5.743   19.034 145.380 1.00 81.00  ? 1565 LYS A CE  1 
ATOM   2952 N NZ  . LYS A 1 379 ? 6.447   17.776 145.739 1.00 89.30  ? 1565 LYS A NZ  1 
ATOM   2953 N N   . LEU A 1 380 ? 0.552   15.822 141.921 1.00 90.09  ? 1566 LEU A N   1 
ATOM   2954 C CA  . LEU A 1 380 ? -0.508  15.901 140.920 1.00 81.38  ? 1566 LEU A CA  1 
ATOM   2955 C C   . LEU A 1 380 ? -1.834  15.410 141.473 1.00 86.98  ? 1566 LEU A C   1 
ATOM   2956 O O   . LEU A 1 380 ? -2.885  15.979 141.190 1.00 89.41  ? 1566 LEU A O   1 
ATOM   2957 C CB  . LEU A 1 380 ? -0.137  15.094 139.679 1.00 81.60  ? 1566 LEU A CB  1 
ATOM   2958 C CG  . LEU A 1 380 ? 1.043   15.602 138.857 1.00 87.52  ? 1566 LEU A CG  1 
ATOM   2959 C CD1 . LEU A 1 380 ? 0.701   16.914 138.189 1.00 91.85  ? 1566 LEU A CD1 1 
ATOM   2960 C CD2 . LEU A 1 380 ? 2.268   15.744 139.737 1.00 112.27 ? 1566 LEU A CD2 1 
ATOM   2961 N N   . THR A 1 381 ? -1.782  14.347 142.260 1.00 82.85  ? 1567 THR A N   1 
ATOM   2962 C CA  . THR A 1 381 ? -2.988  13.807 142.857 1.00 106.08 ? 1567 THR A CA  1 
ATOM   2963 C C   . THR A 1 381 ? -3.582  14.867 143.770 1.00 106.82 ? 1567 THR A C   1 
ATOM   2964 O O   . THR A 1 381 ? -4.797  15.044 143.831 1.00 110.61 ? 1567 THR A O   1 
ATOM   2965 C CB  . THR A 1 381 ? -2.694  12.532 143.657 1.00 103.26 ? 1567 THR A CB  1 
ATOM   2966 O OG1 . THR A 1 381 ? -1.638  12.786 144.589 1.00 120.23 ? 1567 THR A OG1 1 
ATOM   2967 C CG2 . THR A 1 381 ? -2.270  11.416 142.725 1.00 98.24  ? 1567 THR A CG2 1 
ATOM   2968 N N   . HIS A 1 382 ? -2.709  15.574 144.479 1.00 91.68  ? 1568 HIS A N   1 
ATOM   2969 C CA  . HIS A 1 382 ? -3.130  16.619 145.391 1.00 84.87  ? 1568 HIS A CA  1 
ATOM   2970 C C   . HIS A 1 382 ? -3.921  17.693 144.643 1.00 89.81  ? 1568 HIS A C   1 
ATOM   2971 O O   . HIS A 1 382 ? -4.975  18.142 145.113 1.00 82.51  ? 1568 HIS A O   1 
ATOM   2972 C CB  . HIS A 1 382 ? -1.910  17.219 146.075 1.00 77.41  ? 1568 HIS A CB  1 
ATOM   2973 C CG  . HIS A 1 382 ? -2.242  18.140 147.204 1.00 74.41  ? 1568 HIS A CG  1 
ATOM   2974 N ND1 . HIS A 1 382 ? -1.296  18.930 147.816 1.00 75.66  ? 1568 HIS A ND1 1 
ATOM   2975 C CD2 . HIS A 1 382 ? -3.415  18.400 147.830 1.00 65.17  ? 1568 HIS A CD2 1 
ATOM   2976 C CE1 . HIS A 1 382 ? -1.871  19.628 148.780 1.00 78.31  ? 1568 HIS A CE1 1 
ATOM   2977 N NE2 . HIS A 1 382 ? -3.157  19.328 148.805 1.00 74.43  ? 1568 HIS A NE2 1 
ATOM   2978 N N   . LEU A 1 383 ? -3.421  18.094 143.475 1.00 85.49  ? 1569 LEU A N   1 
ATOM   2979 C CA  . LEU A 1 383 ? -4.115  19.073 142.640 1.00 74.21  ? 1569 LEU A CA  1 
ATOM   2980 C C   . LEU A 1 383 ? -5.453  18.524 142.133 1.00 82.19  ? 1569 LEU A C   1 
ATOM   2981 O O   . LEU A 1 383 ? -6.464  19.217 142.178 1.00 68.39  ? 1569 LEU A O   1 
ATOM   2982 C CB  . LEU A 1 383 ? -3.235  19.512 141.473 1.00 73.47  ? 1569 LEU A CB  1 
ATOM   2983 C CG  . LEU A 1 383 ? -3.550  20.898 140.909 1.00 69.91  ? 1569 LEU A CG  1 
ATOM   2984 C CD1 . LEU A 1 383 ? -2.697  21.192 139.693 1.00 67.08  ? 1569 LEU A CD1 1 
ATOM   2985 C CD2 . LEU A 1 383 ? -5.023  21.016 140.575 1.00 66.75  ? 1569 LEU A CD2 1 
ATOM   2986 N N   . LYS A 1 384 ? -5.461  17.274 141.673 1.00 89.75  ? 1570 LYS A N   1 
ATOM   2987 C CA  . LYS A 1 384 ? -6.697  16.625 141.270 1.00 98.18  ? 1570 LYS A CA  1 
ATOM   2988 C C   . LYS A 1 384 ? -7.717  16.695 142.425 1.00 89.95  ? 1570 LYS A C   1 
ATOM   2989 O O   . LYS A 1 384 ? -8.873  17.102 142.228 1.00 78.86  ? 1570 LYS A O   1 
ATOM   2990 C CB  . LYS A 1 384 ? -6.444  15.172 140.865 1.00 86.49  ? 1570 LYS A CB  1 
ATOM   2991 N N   . ASP A 1 385 ? -7.254  16.347 143.629 1.00 83.87  ? 1571 ASP A N   1 
ATOM   2992 C CA  . ASP A 1 385 ? -8.082  16.343 144.841 1.00 95.56  ? 1571 ASP A CA  1 
ATOM   2993 C C   . ASP A 1 385 ? -8.843  17.644 145.017 1.00 86.37  ? 1571 ASP A C   1 
ATOM   2994 O O   . ASP A 1 385 ? -10.051 17.641 145.231 1.00 87.65  ? 1571 ASP A O   1 
ATOM   2995 C CB  . ASP A 1 385 ? -7.225  16.097 146.100 1.00 102.93 ? 1571 ASP A CB  1 
ATOM   2996 C CG  . ASP A 1 385 ? -6.935  14.620 146.355 1.00 117.88 ? 1571 ASP A CG  1 
ATOM   2997 O OD1 . ASP A 1 385 ? -7.886  13.805 146.306 1.00 131.10 ? 1571 ASP A OD1 1 
ATOM   2998 O OD2 . ASP A 1 385 ? -5.752  14.289 146.630 1.00 114.91 ? 1571 ASP A OD2 1 
ATOM   2999 N N   . LEU A 1 386 ? -8.118  18.753 144.929 1.00 82.96  ? 1572 LEU A N   1 
ATOM   3000 C CA  . LEU A 1 386 ? -8.681  20.085 145.124 1.00 70.69  ? 1572 LEU A CA  1 
ATOM   3001 C C   . LEU A 1 386 ? -9.764  20.440 144.122 1.00 75.94  ? 1572 LEU A C   1 
ATOM   3002 O O   . LEU A 1 386 ? -10.761 21.058 144.482 1.00 72.50  ? 1572 LEU A O   1 
ATOM   3003 C CB  . LEU A 1 386 ? -7.575  21.140 145.081 1.00 78.50  ? 1572 LEU A CB  1 
ATOM   3004 C CG  . LEU A 1 386 ? -6.487  21.062 146.153 1.00 76.09  ? 1572 LEU A CG  1 
ATOM   3005 C CD1 . LEU A 1 386 ? -5.277  21.872 145.743 1.00 75.43  ? 1572 LEU A CD1 1 
ATOM   3006 C CD2 . LEU A 1 386 ? -7.014  21.526 147.496 1.00 57.11  ? 1572 LEU A CD2 1 
ATOM   3007 N N   . ILE A 1 387 ? -9.575  20.057 142.867 1.00 69.57  ? 1573 ILE A N   1 
ATOM   3008 C CA  . ILE A 1 387 ? -10.572 20.359 141.856 1.00 79.41  ? 1573 ILE A CA  1 
ATOM   3009 C C   . ILE A 1 387 ? -11.874 19.665 142.229 1.00 80.51  ? 1573 ILE A C   1 
ATOM   3010 O O   . ILE A 1 387 ? -12.950 20.247 142.114 1.00 77.06  ? 1573 ILE A O   1 
ATOM   3011 C CB  . ILE A 1 387 ? -10.117 19.905 140.464 1.00 79.59  ? 1573 ILE A CB  1 
ATOM   3012 C CG1 . ILE A 1 387 ? -8.785  20.562 140.106 1.00 61.62  ? 1573 ILE A CG1 1 
ATOM   3013 C CG2 . ILE A 1 387 ? -11.172 20.239 139.427 1.00 61.16  ? 1573 ILE A CG2 1 
ATOM   3014 C CD1 . ILE A 1 387 ? -8.317  20.264 138.712 1.00 67.88  ? 1573 ILE A CD1 1 
ATOM   3015 N N   . ALA A 1 388 ? -11.771 18.419 142.678 1.00 58.22  ? 1574 ALA A N   1 
ATOM   3016 C CA  . ALA A 1 388 ? -12.939 17.664 143.104 1.00 63.96  ? 1574 ALA A CA  1 
ATOM   3017 C C   . ALA A 1 388 ? -13.548 18.321 144.335 1.00 72.67  ? 1574 ALA A C   1 
ATOM   3018 O O   . ALA A 1 388 ? -14.760 18.460 144.456 1.00 79.11  ? 1574 ALA A O   1 
ATOM   3019 C CB  . ALA A 1 388 ? -12.549 16.240 143.412 1.00 70.60  ? 1574 ALA A CB  1 
ATOM   3020 N N   . TRP A 1 389 ? -12.670 18.728 145.242 1.00 80.68  ? 1575 TRP A N   1 
ATOM   3021 C CA  . TRP A 1 389 ? -13.036 19.378 146.485 1.00 78.90  ? 1575 TRP A CA  1 
ATOM   3022 C C   . TRP A 1 389 ? -13.751 20.691 146.222 1.00 85.38  ? 1575 TRP A C   1 
ATOM   3023 O O   . TRP A 1 389 ? -14.682 21.049 146.935 1.00 98.15  ? 1575 TRP A O   1 
ATOM   3024 C CB  . TRP A 1 389 ? -11.752 19.630 147.275 1.00 79.92  ? 1575 TRP A CB  1 
ATOM   3025 C CG  . TRP A 1 389 ? -11.921 19.872 148.734 1.00 88.95  ? 1575 TRP A CG  1 
ATOM   3026 C CD1 . TRP A 1 389 ? -11.310 20.837 149.476 1.00 83.79  ? 1575 TRP A CD1 1 
ATOM   3027 C CD2 . TRP A 1 389 ? -12.740 19.128 149.640 1.00 102.72 ? 1575 TRP A CD2 1 
ATOM   3028 N NE1 . TRP A 1 389 ? -11.700 20.746 150.786 1.00 86.51  ? 1575 TRP A NE1 1 
ATOM   3029 C CE2 . TRP A 1 389 ? -12.580 19.704 150.914 1.00 97.03  ? 1575 TRP A CE2 1 
ATOM   3030 C CE3 . TRP A 1 389 ? -13.597 18.036 149.498 1.00 102.97 ? 1575 TRP A CE3 1 
ATOM   3031 C CZ2 . TRP A 1 389 ? -13.243 19.225 152.036 1.00 88.51  ? 1575 TRP A CZ2 1 
ATOM   3032 C CZ3 . TRP A 1 389 ? -14.254 17.563 150.612 1.00 89.02  ? 1575 TRP A CZ3 1 
ATOM   3033 C CH2 . TRP A 1 389 ? -14.075 18.157 151.865 1.00 87.57  ? 1575 TRP A CH2 1 
ATOM   3034 N N   . GLN A 1 390 ? -13.320 21.410 145.197 1.00 79.72  ? 1576 GLN A N   1 
ATOM   3035 C CA  . GLN A 1 390 ? -13.918 22.696 144.867 1.00 70.48  ? 1576 GLN A CA  1 
ATOM   3036 C C   . GLN A 1 390 ? -15.395 22.628 144.497 1.00 73.02  ? 1576 GLN A C   1 
ATOM   3037 O O   . GLN A 1 390 ? -16.171 23.495 144.887 1.00 87.54  ? 1576 GLN A O   1 
ATOM   3038 C CB  . GLN A 1 390 ? -13.139 23.361 143.735 1.00 65.06  ? 1576 GLN A CB  1 
ATOM   3039 C CG  . GLN A 1 390 ? -13.697 24.702 143.314 1.00 66.31  ? 1576 GLN A CG  1 
ATOM   3040 C CD  . GLN A 1 390 ? -12.670 25.560 142.614 1.00 65.74  ? 1576 GLN A CD  1 
ATOM   3041 O OE1 . GLN A 1 390 ? -11.469 25.380 142.794 1.00 79.62  ? 1576 GLN A OE1 1 
ATOM   3042 N NE2 . GLN A 1 390 ? -13.137 26.505 141.814 1.00 84.18  ? 1576 GLN A NE2 1 
ATOM   3043 N N   . ILE A 1 391 ? -15.789 21.605 143.751 1.00 70.79  ? 1577 ILE A N   1 
ATOM   3044 C CA  . ILE A 1 391 ? -17.176 21.487 143.307 1.00 67.09  ? 1577 ILE A CA  1 
ATOM   3045 C C   . ILE A 1 391 ? -18.183 21.373 144.444 1.00 63.23  ? 1577 ILE A C   1 
ATOM   3046 O O   . ILE A 1 391 ? -19.248 21.981 144.392 1.00 57.55  ? 1577 ILE A O   1 
ATOM   3047 C CB  . ILE A 1 391 ? -17.369 20.298 142.355 1.00 64.98  ? 1577 ILE A CB  1 
ATOM   3048 C CG1 . ILE A 1 391 ? -17.185 20.747 140.907 1.00 73.28  ? 1577 ILE A CG1 1 
ATOM   3049 C CG2 . ILE A 1 391 ? -18.753 19.726 142.517 1.00 69.20  ? 1577 ILE A CG2 1 
ATOM   3050 C CD1 . ILE A 1 391 ? -15.927 21.541 140.667 1.00 77.63  ? 1577 ILE A CD1 1 
ATOM   3051 N N   . PRO A 1 392 ? -17.852 20.607 145.472 1.00 73.47  ? 1578 PRO A N   1 
ATOM   3052 C CA  . PRO A 1 392 ? -18.768 20.461 146.602 1.00 77.55  ? 1578 PRO A CA  1 
ATOM   3053 C C   . PRO A 1 392 ? -18.972 21.813 147.257 1.00 88.81  ? 1578 PRO A C   1 
ATOM   3054 O O   . PRO A 1 392 ? -20.088 22.167 147.627 1.00 73.81  ? 1578 PRO A O   1 
ATOM   3055 C CB  . PRO A 1 392 ? -18.001 19.540 147.545 1.00 72.93  ? 1578 PRO A CB  1 
ATOM   3056 C CG  . PRO A 1 392 ? -17.147 18.732 146.655 1.00 88.12  ? 1578 PRO A CG  1 
ATOM   3057 C CD  . PRO A 1 392 ? -16.754 19.629 145.523 1.00 80.81  ? 1578 PRO A CD  1 
ATOM   3058 N N   . PHE A 1 393 ? -17.882 22.560 147.396 1.00 88.26  ? 1579 PHE A N   1 
ATOM   3059 C CA  . PHE A 1 393 ? -17.922 23.889 147.984 1.00 77.71  ? 1579 PHE A CA  1 
ATOM   3060 C C   . PHE A 1 393 ? -18.736 24.859 147.143 1.00 82.78  ? 1579 PHE A C   1 
ATOM   3061 O O   . PHE A 1 393 ? -19.502 25.658 147.673 1.00 81.34  ? 1579 PHE A O   1 
ATOM   3062 C CB  . PHE A 1 393 ? -16.506 24.430 148.148 1.00 79.89  ? 1579 PHE A CB  1 
ATOM   3063 C CG  . PHE A 1 393 ? -15.643 23.598 149.042 1.00 91.56  ? 1579 PHE A CG  1 
ATOM   3064 C CD1 . PHE A 1 393 ? -15.396 22.273 148.746 1.00 103.55 ? 1579 PHE A CD1 1 
ATOM   3065 C CD2 . PHE A 1 393 ? -15.083 24.137 150.183 1.00 81.76  ? 1579 PHE A CD2 1 
ATOM   3066 C CE1 . PHE A 1 393 ? -14.605 21.505 149.566 1.00 82.56  ? 1579 PHE A CE1 1 
ATOM   3067 C CE2 . PHE A 1 393 ? -14.291 23.372 151.005 1.00 75.71  ? 1579 PHE A CE2 1 
ATOM   3068 C CZ  . PHE A 1 393 ? -14.052 22.054 150.696 1.00 78.33  ? 1579 PHE A CZ  1 
ATOM   3069 N N   . LEU A 1 394 ? -18.564 24.794 145.828 1.00 63.83  ? 1580 LEU A N   1 
ATOM   3070 C CA  . LEU A 1 394 ? -19.284 25.698 144.947 1.00 70.90  ? 1580 LEU A CA  1 
ATOM   3071 C C   . LEU A 1 394 ? -20.782 25.472 145.044 1.00 76.86  ? 1580 LEU A C   1 
ATOM   3072 O O   . LEU A 1 394 ? -21.555 26.419 145.142 1.00 72.58  ? 1580 LEU A O   1 
ATOM   3073 C CB  . LEU A 1 394 ? -18.811 25.527 143.505 1.00 67.15  ? 1580 LEU A CB  1 
ATOM   3074 C CG  . LEU A 1 394 ? -17.407 26.049 143.207 1.00 69.84  ? 1580 LEU A CG  1 
ATOM   3075 C CD1 . LEU A 1 394 ? -17.018 25.746 141.774 1.00 55.22  ? 1580 LEU A CD1 1 
ATOM   3076 C CD2 . LEU A 1 394 ? -17.326 27.536 143.481 1.00 49.41  ? 1580 LEU A CD2 1 
ATOM   3077 N N   . GLY A 1 395 ? -21.188 24.211 145.049 1.00 45.95  ? 1581 GLY A N   1 
ATOM   3078 C CA  . GLY A 1 395 ? -22.576 23.891 145.183 1.00 63.11  ? 1581 GLY A CA  1 
ATOM   3079 C C   . GLY A 1 395 ? -23.091 24.408 146.500 1.00 78.23  ? 1581 GLY A C   1 
ATOM   3080 O O   . GLY A 1 395 ? -24.121 25.104 146.550 1.00 78.64  ? 1581 GLY A O   1 
ATOM   3081 N N   . ALA A 1 396 ? -22.361 24.082 147.564 1.00 62.99  ? 1582 ALA A N   1 
ATOM   3082 C CA  . ALA A 1 396 ? -22.751 24.485 148.908 1.00 69.99  ? 1582 ALA A CA  1 
ATOM   3083 C C   . ALA A 1 396 ? -23.051 25.989 148.963 1.00 74.39  ? 1582 ALA A C   1 
ATOM   3084 O O   . ALA A 1 396 ? -24.105 26.417 149.460 1.00 70.68  ? 1582 ALA A O   1 
ATOM   3085 C CB  . ALA A 1 396 ? -21.663 24.084 149.922 1.00 60.46  ? 1582 ALA A CB  1 
ATOM   3086 N N   . GLY A 1 397 ? -22.132 26.775 148.403 1.00 58.32  ? 1583 GLY A N   1 
ATOM   3087 C CA  . GLY A 1 397 ? -22.305 28.213 148.300 1.00 50.76  ? 1583 GLY A CA  1 
ATOM   3088 C C   . GLY A 1 397 ? -23.438 28.592 147.367 1.00 68.93  ? 1583 GLY A C   1 
ATOM   3089 O O   . GLY A 1 397 ? -24.083 29.647 147.554 1.00 63.90  ? 1583 GLY A O   1 
ATOM   3090 N N   . ILE A 1 398 ? -23.692 27.747 146.356 1.00 56.17  ? 1584 ILE A N   1 
ATOM   3091 C CA  . ILE A 1 398 ? -24.746 28.056 145.376 1.00 52.58  ? 1584 ILE A CA  1 
ATOM   3092 C C   . ILE A 1 398 ? -26.109 27.841 145.977 1.00 64.15  ? 1584 ILE A C   1 
ATOM   3093 O O   . ILE A 1 398 ? -27.017 28.653 145.773 1.00 54.23  ? 1584 ILE A O   1 
ATOM   3094 C CB  . ILE A 1 398 ? -24.604 27.298 144.064 1.00 68.62  ? 1584 ILE A CB  1 
ATOM   3095 C CG1 . ILE A 1 398 ? -23.260 27.654 143.428 1.00 66.10  ? 1584 ILE A CG1 1 
ATOM   3096 C CG2 . ILE A 1 398 ? -25.763 27.668 143.128 1.00 54.02  ? 1584 ILE A CG2 1 
ATOM   3097 C CD1 . ILE A 1 398 ? -23.089 27.200 142.007 1.00 57.55  ? 1584 ILE A CD1 1 
ATOM   3098 N N   . LYS A 1 399 ? -26.218 26.751 146.732 1.00 73.25  ? 1585 LYS A N   1 
ATOM   3099 C CA  . LYS A 1 399 ? -27.360 26.491 147.607 1.00 78.23  ? 1585 LYS A CA  1 
ATOM   3100 C C   . LYS A 1 399 ? -27.793 27.759 148.376 1.00 76.91  ? 1585 LYS A C   1 
ATOM   3101 O O   . LYS A 1 399 ? -28.966 28.170 148.290 1.00 82.29  ? 1585 LYS A O   1 
ATOM   3102 C CB  . LYS A 1 399 ? -27.029 25.335 148.569 1.00 65.46  ? 1585 LYS A CB  1 
ATOM   3103 C CG  . LYS A 1 399 ? -28.193 24.774 149.394 1.00 59.49  ? 1585 LYS A CG  1 
ATOM   3104 C CD  . LYS A 1 399 ? -27.778 23.466 150.085 1.00 59.39  ? 1585 LYS A CD  1 
ATOM   3105 N N   . ILE A 1 400 ? -26.843 28.381 149.091 1.00 64.86  ? 1586 ILE A N   1 
ATOM   3106 C CA  . ILE A 1 400 ? -27.113 29.582 149.904 1.00 71.59  ? 1586 ILE A CA  1 
ATOM   3107 C C   . ILE A 1 400 ? -27.477 30.776 149.048 1.00 71.94  ? 1586 ILE A C   1 
ATOM   3108 O O   . ILE A 1 400 ? -28.350 31.570 149.409 1.00 66.23  ? 1586 ILE A O   1 
ATOM   3109 C CB  . ILE A 1 400 ? -25.890 30.001 150.764 1.00 69.28  ? 1586 ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 400 ? -25.423 28.850 151.666 1.00 61.94  ? 1586 ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 400 ? -26.193 31.298 151.558 1.00 57.01  ? 1586 ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 400 ? -24.143 29.181 152.437 1.00 69.46  ? 1586 ILE A CD1 1 
ATOM   3113 N N   . HIS A 1 401 ? -26.780 30.913 147.932 1.00 63.74  ? 1587 HIS A N   1 
ATOM   3114 C CA  . HIS A 1 401 ? -27.040 32.003 147.040 1.00 57.26  ? 1587 HIS A CA  1 
ATOM   3115 C C   . HIS A 1 401 ? -28.483 31.916 146.549 1.00 72.91  ? 1587 HIS A C   1 
ATOM   3116 O O   . HIS A 1 401 ? -29.194 32.934 146.519 1.00 65.92  ? 1587 HIS A O   1 
ATOM   3117 C CB  . HIS A 1 401 ? -26.066 31.965 145.868 1.00 69.62  ? 1587 HIS A CB  1 
ATOM   3118 C CG  . HIS A 1 401 ? -26.057 33.224 145.052 1.00 65.27  ? 1587 HIS A CG  1 
ATOM   3119 N ND1 . HIS A 1 401 ? -25.087 34.190 145.192 1.00 65.10  ? 1587 HIS A ND1 1 
ATOM   3120 C CD2 . HIS A 1 401 ? -26.897 33.679 144.090 1.00 63.82  ? 1587 HIS A CD2 1 
ATOM   3121 C CE1 . HIS A 1 401 ? -25.332 35.189 144.359 1.00 50.72  ? 1587 HIS A CE1 1 
ATOM   3122 N NE2 . HIS A 1 401 ? -26.422 34.901 143.674 1.00 57.41  ? 1587 HIS A NE2 1 
ATOM   3123 N N   . GLU A 1 402 ? -28.908 30.694 146.201 1.00 66.24  ? 1588 GLU A N   1 
ATOM   3124 C CA  . GLU A 1 402 ? -30.267 30.432 145.721 1.00 87.51  ? 1588 GLU A CA  1 
ATOM   3125 C C   . GLU A 1 402 ? -31.351 30.892 146.686 1.00 89.49  ? 1588 GLU A C   1 
ATOM   3126 O O   . GLU A 1 402 ? -32.336 31.520 146.260 1.00 75.90  ? 1588 GLU A O   1 
ATOM   3127 C CB  . GLU A 1 402 ? -30.477 28.950 145.407 1.00 102.53 ? 1588 GLU A CB  1 
ATOM   3128 C CG  . GLU A 1 402 ? -31.944 28.619 145.067 1.00 124.91 ? 1588 GLU A CG  1 
ATOM   3129 C CD  . GLU A 1 402 ? -32.270 27.140 145.210 1.00 140.60 ? 1588 GLU A CD  1 
ATOM   3130 O OE1 . GLU A 1 402 ? -31.615 26.452 146.049 1.00 146.90 ? 1588 GLU A OE1 1 
ATOM   3131 O OE2 . GLU A 1 402 ? -33.193 26.674 144.486 1.00 134.88 ? 1588 GLU A OE2 1 
ATOM   3132 N N   . LYS A 1 403 ? -31.176 30.565 147.970 1.00 76.29  ? 1589 LYS A N   1 
ATOM   3133 C CA  . LYS A 1 403 ? -32.140 30.980 149.002 1.00 91.71  ? 1589 LYS A CA  1 
ATOM   3134 C C   . LYS A 1 403 ? -32.192 32.512 149.233 1.00 90.13  ? 1589 LYS A C   1 
ATOM   3135 O O   . LYS A 1 403 ? -33.272 33.082 149.362 1.00 91.18  ? 1589 LYS A O   1 
ATOM   3136 C CB  . LYS A 1 403 ? -31.817 30.279 150.322 1.00 70.93  ? 1589 LYS A CB  1 
ATOM   3137 C CG  . LYS A 1 403 ? -32.005 28.771 150.288 1.00 82.84  ? 1589 LYS A CG  1 
ATOM   3138 N N   . ARG A 1 404 ? -31.056 33.198 149.247 1.00 85.13  ? 1590 ARG A N   1 
ATOM   3139 C CA  . ARG A 1 404 ? -31.106 34.609 149.626 1.00 87.18  ? 1590 ARG A CA  1 
ATOM   3140 C C   . ARG A 1 404 ? -30.694 35.576 148.523 1.00 82.93  ? 1590 ARG A C   1 
ATOM   3141 O O   . ARG A 1 404 ? -29.885 36.459 148.771 1.00 91.45  ? 1590 ARG A O   1 
ATOM   3142 C CB  . ARG A 1 404 ? -30.223 34.842 150.854 1.00 79.97  ? 1590 ARG A CB  1 
ATOM   3143 N N   . VAL A 1 405 ? -31.247 35.435 147.320 1.00 77.06  ? 1591 VAL A N   1 
ATOM   3144 C CA  . VAL A 1 405 ? -30.846 36.289 146.198 1.00 84.86  ? 1591 VAL A CA  1 
ATOM   3145 C C   . VAL A 1 405 ? -31.999 37.198 145.826 1.00 92.43  ? 1591 VAL A C   1 
ATOM   3146 O O   . VAL A 1 405 ? -33.118 36.723 145.650 1.00 100.62 ? 1591 VAL A O   1 
ATOM   3147 C CB  . VAL A 1 405 ? -30.328 35.449 144.956 1.00 68.73  ? 1591 VAL A CB  1 
ATOM   3148 C CG1 . VAL A 1 405 ? -31.413 34.549 144.361 1.00 47.96  ? 1591 VAL A CG1 1 
ATOM   3149 C CG2 . VAL A 1 405 ? -29.723 36.332 143.873 1.00 50.71  ? 1591 VAL A CG2 1 
ATOM   3150 N N   . SER A 1 406 ? -31.733 38.482 145.636 1.00 96.39  ? 1592 SER A N   1 
ATOM   3151 C CA  . SER A 1 406 ? -32.799 39.388 145.254 1.00 92.20  ? 1592 SER A CA  1 
ATOM   3152 C C   . SER A 1 406 ? -33.321 38.856 143.927 1.00 88.22  ? 1592 SER A C   1 
ATOM   3153 O O   . SER A 1 406 ? -32.566 38.304 143.137 1.00 101.49 ? 1592 SER A O   1 
ATOM   3154 C CB  . SER A 1 406 ? -32.273 40.807 145.086 1.00 85.57  ? 1592 SER A CB  1 
ATOM   3155 O OG  . SER A 1 406 ? -31.290 40.861 144.072 1.00 92.00  ? 1592 SER A OG  1 
ATOM   3156 N N   . ASP A 1 407 ? -34.617 39.019 143.694 1.00 80.58  ? 1593 ASP A N   1 
ATOM   3157 C CA  . ASP A 1 407 ? -35.267 38.540 142.474 1.00 86.00  ? 1593 ASP A CA  1 
ATOM   3158 C C   . ASP A 1 407 ? -34.741 39.116 141.164 1.00 87.76  ? 1593 ASP A C   1 
ATOM   3159 O O   . ASP A 1 407 ? -34.712 38.421 140.152 1.00 85.23  ? 1593 ASP A O   1 
ATOM   3160 C CB  . ASP A 1 407 ? -36.786 38.686 142.566 1.00 94.09  ? 1593 ASP A CB  1 
ATOM   3161 C CG  . ASP A 1 407 ? -37.445 37.466 143.174 1.00 111.37 ? 1593 ASP A CG  1 
ATOM   3162 O OD1 . ASP A 1 407 ? -36.713 36.565 143.634 1.00 95.14  ? 1593 ASP A OD1 1 
ATOM   3163 O OD2 . ASP A 1 407 ? -38.691 37.402 143.187 1.00 109.79 ? 1593 ASP A OD2 1 
ATOM   3164 N N   . ASN A 1 408 ? -34.329 40.375 141.172 1.00 92.35  ? 1594 ASN A N   1 
ATOM   3165 C CA  . ASN A 1 408 ? -33.817 40.987 139.956 1.00 80.89  ? 1594 ASN A CA  1 
ATOM   3166 C C   . ASN A 1 408 ? -32.617 40.201 139.449 1.00 75.57  ? 1594 ASN A C   1 
ATOM   3167 O O   . ASN A 1 408 ? -32.395 40.100 138.248 1.00 82.20  ? 1594 ASN A O   1 
ATOM   3168 C CB  . ASN A 1 408 ? -33.454 42.455 140.176 1.00 70.72  ? 1594 ASN A CB  1 
ATOM   3169 C CG  . ASN A 1 408 ? -32.819 42.703 141.522 1.00 100.87 ? 1594 ASN A CG  1 
ATOM   3170 O OD1 . ASN A 1 408 ? -32.961 41.902 142.444 1.00 105.77 ? 1594 ASN A OD1 1 
ATOM   3171 N ND2 . ASN A 1 408 ? -32.121 43.822 141.647 1.00 111.68 ? 1594 ASN A ND2 1 
ATOM   3172 N N   . LEU A 1 409 ? -31.843 39.652 140.375 1.00 77.53  ? 1595 LEU A N   1 
ATOM   3173 C CA  . LEU A 1 409 ? -30.660 38.871 140.033 1.00 81.47  ? 1595 LEU A CA  1 
ATOM   3174 C C   . LEU A 1 409 ? -30.904 37.378 139.762 1.00 81.42  ? 1595 LEU A C   1 
ATOM   3175 O O   . LEU A 1 409 ? -29.966 36.660 139.429 1.00 84.46  ? 1595 LEU A O   1 
ATOM   3176 C CB  . LEU A 1 409 ? -29.588 39.039 141.110 1.00 71.40  ? 1595 LEU A CB  1 
ATOM   3177 C CG  . LEU A 1 409 ? -28.969 40.435 141.206 1.00 77.65  ? 1595 LEU A CG  1 
ATOM   3178 C CD1 . LEU A 1 409 ? -28.190 40.599 142.492 1.00 60.01  ? 1595 LEU A CD1 1 
ATOM   3179 C CD2 . LEU A 1 409 ? -28.094 40.723 140.006 1.00 69.70  ? 1595 LEU A CD2 1 
ATOM   3180 N N   . ARG A 1 410 ? -32.140 36.900 139.904 1.00 82.60  ? 1596 ARG A N   1 
ATOM   3181 C CA  . ARG A 1 410 ? -32.414 35.472 139.659 1.00 84.59  ? 1596 ARG A CA  1 
ATOM   3182 C C   . ARG A 1 410 ? -31.948 35.000 138.249 1.00 88.27  ? 1596 ARG A C   1 
ATOM   3183 O O   . ARG A 1 410 ? -31.361 33.907 138.154 1.00 77.21  ? 1596 ARG A O   1 
ATOM   3184 C CB  . ARG A 1 410 ? -33.908 35.188 139.829 1.00 67.61  ? 1596 ARG A CB  1 
ATOM   3185 N N   . PRO A 1 411 ? -32.145 35.826 137.165 1.00 77.64  ? 1597 PRO A N   1 
ATOM   3186 C CA  . PRO A 1 411 ? -31.600 35.355 135.882 1.00 72.93  ? 1597 PRO A CA  1 
ATOM   3187 C C   . PRO A 1 411 ? -30.109 35.019 135.995 1.00 82.34  ? 1597 PRO A C   1 
ATOM   3188 O O   . PRO A 1 411 ? -29.688 33.942 135.535 1.00 79.63  ? 1597 PRO A O   1 
ATOM   3189 C CB  . PRO A 1 411 ? -31.804 36.545 134.949 1.00 56.85  ? 1597 PRO A CB  1 
ATOM   3190 C CG  . PRO A 1 411 ? -32.830 37.384 135.571 1.00 56.24  ? 1597 PRO A CG  1 
ATOM   3191 C CD  . PRO A 1 411 ? -32.752 37.172 137.034 1.00 71.80  ? 1597 PRO A CD  1 
ATOM   3192 N N   . PHE A 1 412 ? -29.350 35.934 136.630 1.00 77.71  ? 1598 PHE A N   1 
ATOM   3193 C CA  . PHE A 1 412 ? -27.910 35.796 136.907 1.00 70.26  ? 1598 PHE A CA  1 
ATOM   3194 C C   . PHE A 1 412 ? -27.590 34.546 137.705 1.00 71.12  ? 1598 PHE A C   1 
ATOM   3195 O O   . PHE A 1 412 ? -26.662 33.796 137.380 1.00 63.90  ? 1598 PHE A O   1 
ATOM   3196 C CB  . PHE A 1 412 ? -27.379 37.034 137.651 1.00 65.38  ? 1598 PHE A CB  1 
ATOM   3197 C CG  . PHE A 1 412 ? -26.021 36.820 138.306 1.00 73.95  ? 1598 PHE A CG  1 
ATOM   3198 C CD1 . PHE A 1 412 ? -24.839 37.021 137.599 1.00 62.87  ? 1598 PHE A CD1 1 
ATOM   3199 C CD2 . PHE A 1 412 ? -25.929 36.400 139.629 1.00 70.40  ? 1598 PHE A CD2 1 
ATOM   3200 C CE1 . PHE A 1 412 ? -23.607 36.807 138.205 1.00 65.02  ? 1598 PHE A CE1 1 
ATOM   3201 C CE2 . PHE A 1 412 ? -24.699 36.195 140.222 1.00 64.75  ? 1598 PHE A CE2 1 
ATOM   3202 C CZ  . PHE A 1 412 ? -23.542 36.390 139.509 1.00 55.60  ? 1598 PHE A CZ  1 
ATOM   3203 N N   . HIS A 1 413 ? -28.355 34.331 138.763 1.00 59.59  ? 1599 HIS A N   1 
ATOM   3204 C CA  . HIS A 1 413 ? -28.166 33.159 139.577 1.00 63.81  ? 1599 HIS A CA  1 
ATOM   3205 C C   . HIS A 1 413 ? -28.432 31.896 138.747 1.00 73.89  ? 1599 HIS A C   1 
ATOM   3206 O O   . HIS A 1 413 ? -27.676 30.917 138.833 1.00 62.04  ? 1599 HIS A O   1 
ATOM   3207 C CB  . HIS A 1 413 ? -29.036 33.209 140.847 1.00 61.56  ? 1599 HIS A CB  1 
ATOM   3208 C CG  . HIS A 1 413 ? -28.953 31.956 141.649 1.00 56.45  ? 1599 HIS A CG  1 
ATOM   3209 N ND1 . HIS A 1 413 ? -29.828 30.906 141.477 1.00 60.78  ? 1599 HIS A ND1 1 
ATOM   3210 C CD2 . HIS A 1 413 ? -28.033 31.533 142.545 1.00 68.35  ? 1599 HIS A CD2 1 
ATOM   3211 C CE1 . HIS A 1 413 ? -29.466 29.898 142.249 1.00 64.48  ? 1599 HIS A CE1 1 
ATOM   3212 N NE2 . HIS A 1 413 ? -28.384 30.258 142.916 1.00 82.53  ? 1599 HIS A NE2 1 
ATOM   3213 N N   . ASP A 1 414 ? -29.491 31.927 137.933 1.00 68.32  ? 1600 ASP A N   1 
ATOM   3214 C CA  . ASP A 1 414 ? -29.938 30.731 137.220 1.00 84.36  ? 1600 ASP A CA  1 
ATOM   3215 C C   . ASP A 1 414 ? -28.850 30.236 136.280 1.00 82.54  ? 1600 ASP A C   1 
ATOM   3216 O O   . ASP A 1 414 ? -28.558 29.033 136.187 1.00 70.25  ? 1600 ASP A O   1 
ATOM   3217 C CB  . ASP A 1 414 ? -31.237 31.035 136.467 1.00 88.38  ? 1600 ASP A CB  1 
ATOM   3218 C CG  . ASP A 1 414 ? -32.458 31.067 137.394 1.00 94.18  ? 1600 ASP A CG  1 
ATOM   3219 O OD1 . ASP A 1 414 ? -32.711 30.056 138.074 1.00 93.36  ? 1600 ASP A OD1 1 
ATOM   3220 O OD2 . ASP A 1 414 ? -33.171 32.094 137.439 1.00 95.20  ? 1600 ASP A OD2 1 
ATOM   3221 N N   . ARG A 1 415 ? -28.247 31.216 135.618 1.00 74.97  ? 1601 ARG A N   1 
ATOM   3222 C CA  . ARG A 1 415 ? -27.161 31.024 134.681 1.00 78.68  ? 1601 ARG A CA  1 
ATOM   3223 C C   . ARG A 1 415 ? -25.913 30.451 135.371 1.00 71.81  ? 1601 ARG A C   1 
ATOM   3224 O O   . ARG A 1 415 ? -25.242 29.577 134.827 1.00 58.68  ? 1601 ARG A O   1 
ATOM   3225 C CB  . ARG A 1 415 ? -26.912 32.358 133.955 1.00 68.30  ? 1601 ARG A CB  1 
ATOM   3226 C CG  . ARG A 1 415 ? -25.502 32.614 133.505 1.00 73.61  ? 1601 ARG A CG  1 
ATOM   3227 C CD  . ARG A 1 415 ? -25.083 31.655 132.442 1.00 67.93  ? 1601 ARG A CD  1 
ATOM   3228 N NE  . ARG A 1 415 ? -23.656 31.768 132.198 1.00 75.94  ? 1601 ARG A NE  1 
ATOM   3229 C CZ  . ARG A 1 415 ? -22.961 30.896 131.479 1.00 96.76  ? 1601 ARG A CZ  1 
ATOM   3230 N NH1 . ARG A 1 415 ? -23.573 29.839 130.940 1.00 101.80 ? 1601 ARG A NH1 1 
ATOM   3231 N NH2 . ARG A 1 415 ? -21.653 31.080 131.311 1.00 101.05 ? 1601 ARG A NH2 1 
ATOM   3232 N N   . MET A 1 416 ? -25.635 30.931 136.578 1.00 58.85  ? 1602 MET A N   1 
ATOM   3233 C CA  . MET A 1 416 ? -24.517 30.461 137.382 1.00 62.26  ? 1602 MET A CA  1 
ATOM   3234 C C   . MET A 1 416 ? -24.691 29.001 137.774 1.00 65.00  ? 1602 MET A C   1 
ATOM   3235 O O   . MET A 1 416 ? -23.716 28.250 137.837 1.00 62.94  ? 1602 MET A O   1 
ATOM   3236 C CB  . MET A 1 416 ? -24.415 31.313 138.629 1.00 59.77  ? 1602 MET A CB  1 
ATOM   3237 C CG  . MET A 1 416 ? -23.063 31.305 139.305 1.00 67.42  ? 1602 MET A CG  1 
ATOM   3238 S SD  . MET A 1 416 ? -23.239 31.676 141.063 1.00 79.27  ? 1602 MET A SD  1 
ATOM   3239 C CE  . MET A 1 416 ? -23.951 33.292 141.024 1.00 79.85  ? 1602 MET A CE  1 
ATOM   3240 N N   . GLU A 1 417 ? -25.938 28.610 138.035 1.00 59.24  ? 1603 GLU A N   1 
ATOM   3241 C CA  . GLU A 1 417 ? -26.273 27.210 138.293 1.00 74.31  ? 1603 GLU A CA  1 
ATOM   3242 C C   . GLU A 1 417 ? -25.989 26.316 137.093 1.00 88.96  ? 1603 GLU A C   1 
ATOM   3243 O O   . GLU A 1 417 ? -25.416 25.232 137.237 1.00 102.90 ? 1603 GLU A O   1 
ATOM   3244 C CB  . GLU A 1 417 ? -27.734 27.065 138.670 1.00 73.55  ? 1603 GLU A CB  1 
ATOM   3245 C CG  . GLU A 1 417 ? -28.050 27.520 140.072 1.00 93.93  ? 1603 GLU A CG  1 
ATOM   3246 C CD  . GLU A 1 417 ? -29.017 26.588 140.768 1.00 97.25  ? 1603 GLU A CD  1 
ATOM   3247 O OE1 . GLU A 1 417 ? -28.719 25.376 140.860 1.00 87.13  ? 1603 GLU A OE1 1 
ATOM   3248 O OE2 . GLU A 1 417 ? -30.074 27.068 141.219 1.00 96.62  ? 1603 GLU A OE2 1 
ATOM   3249 N N   . GLU A 1 418 ? -26.391 26.773 135.912 1.00 56.50  ? 1604 GLU A N   1 
ATOM   3250 C CA  . GLU A 1 418 ? -26.173 26.010 134.711 1.00 56.40  ? 1604 GLU A CA  1 
ATOM   3251 C C   . GLU A 1 418 ? -24.713 25.692 134.525 1.00 60.91  ? 1604 GLU A C   1 
ATOM   3252 O O   . GLU A 1 418 ? -24.364 24.526 134.331 1.00 75.27  ? 1604 GLU A O   1 
ATOM   3253 C CB  . GLU A 1 418 ? -26.738 26.729 133.507 1.00 72.75  ? 1604 GLU A CB  1 
ATOM   3254 C CG  . GLU A 1 418 ? -28.230 26.473 133.321 1.00 105.23 ? 1604 GLU A CG  1 
ATOM   3255 C CD  . GLU A 1 418 ? -28.869 27.365 132.252 1.00 114.66 ? 1604 GLU A CD  1 
ATOM   3256 O OE1 . GLU A 1 418 ? -28.181 27.717 131.269 1.00 115.86 ? 1604 GLU A OE1 1 
ATOM   3257 O OE2 . GLU A 1 418 ? -30.063 27.713 132.389 1.00 100.52 ? 1604 GLU A OE2 1 
ATOM   3258 N N   . CYS A 1 419 ? -23.863 26.715 134.610 1.00 56.49  ? 1605 CYS A N   1 
ATOM   3259 C CA  . CYS A 1 419 ? -22.420 26.501 134.543 1.00 67.29  ? 1605 CYS A CA  1 
ATOM   3260 C C   . CYS A 1 419 ? -21.978 25.518 135.607 1.00 79.30  ? 1605 CYS A C   1 
ATOM   3261 O O   . CYS A 1 419 ? -21.244 24.560 135.334 1.00 97.24  ? 1605 CYS A O   1 
ATOM   3262 C CB  . CYS A 1 419 ? -21.662 27.788 134.780 1.00 60.89  ? 1605 CYS A CB  1 
ATOM   3263 S SG  . CYS A 1 419 ? -21.725 28.935 133.464 1.00 78.11  ? 1605 CYS A SG  1 
ATOM   3264 N N   . PHE A 1 420 ? -22.413 25.763 136.833 1.00 58.34  ? 1606 PHE A N   1 
ATOM   3265 C CA  . PHE A 1 420 ? -22.024 24.887 137.880 1.00 76.90  ? 1606 PHE A CA  1 
ATOM   3266 C C   . PHE A 1 420 ? -22.406 23.471 137.487 1.00 72.41  ? 1606 PHE A C   1 
ATOM   3267 O O   . PHE A 1 420 ? -21.591 22.551 137.596 1.00 65.34  ? 1606 PHE A O   1 
ATOM   3268 C CB  . PHE A 1 420 ? -22.669 25.273 139.205 1.00 71.20  ? 1606 PHE A CB  1 
ATOM   3269 C CG  . PHE A 1 420 ? -22.362 24.309 140.283 1.00 74.45  ? 1606 PHE A CG  1 
ATOM   3270 C CD1 . PHE A 1 420 ? -21.034 24.086 140.674 1.00 89.03  ? 1606 PHE A CD1 1 
ATOM   3271 C CD2 . PHE A 1 420 ? -23.360 23.558 140.859 1.00 78.44  ? 1606 PHE A CD2 1 
ATOM   3272 C CE1 . PHE A 1 420 ? -20.716 23.146 141.651 1.00 82.37  ? 1606 PHE A CE1 1 
ATOM   3273 C CE2 . PHE A 1 420 ? -23.056 22.613 141.839 1.00 69.84  ? 1606 PHE A CE2 1 
ATOM   3274 C CZ  . PHE A 1 420 ? -21.734 22.408 142.231 1.00 67.48  ? 1606 PHE A CZ  1 
ATOM   3275 N N   . LYS A 1 421 ? -23.642 23.320 137.004 1.00 65.54  ? 1607 LYS A N   1 
ATOM   3276 C CA  . LYS A 1 421 ? -24.212 22.010 136.705 1.00 81.21  ? 1607 LYS A CA  1 
ATOM   3277 C C   . LYS A 1 421 ? -23.363 21.318 135.641 1.00 82.02  ? 1607 LYS A C   1 
ATOM   3278 O O   . LYS A 1 421 ? -22.994 20.151 135.786 1.00 73.19  ? 1607 LYS A O   1 
ATOM   3279 C CB  . LYS A 1 421 ? -25.662 22.139 136.235 1.00 72.20  ? 1607 LYS A CB  1 
ATOM   3280 N N   . ASN A 1 422 ? -23.031 22.063 134.596 1.00 76.00  ? 1608 ASN A N   1 
ATOM   3281 C CA  . ASN A 1 422 ? -22.056 21.643 133.609 1.00 80.48  ? 1608 ASN A CA  1 
ATOM   3282 C C   . ASN A 1 422 ? -20.752 21.227 134.262 1.00 92.99  ? 1608 ASN A C   1 
ATOM   3283 O O   . ASN A 1 422 ? -20.196 20.156 133.968 1.00 94.65  ? 1608 ASN A O   1 
ATOM   3284 C CB  . ASN A 1 422 ? -21.755 22.797 132.656 1.00 85.16  ? 1608 ASN A CB  1 
ATOM   3285 C CG  . ASN A 1 422 ? -22.167 22.505 131.257 1.00 101.67 ? 1608 ASN A CG  1 
ATOM   3286 O OD1 . ASN A 1 422 ? -21.332 22.334 130.376 1.00 105.73 ? 1608 ASN A OD1 1 
ATOM   3287 N ND2 . ASN A 1 422 ? -23.466 22.423 131.036 1.00 104.43 ? 1608 ASN A ND2 1 
ATOM   3288 N N   . LEU A 1 423 ? -20.250 22.098 135.128 1.00 95.03  ? 1609 LEU A N   1 
ATOM   3289 C CA  . LEU A 1 423 ? -18.992 21.873 135.825 1.00 89.21  ? 1609 LEU A CA  1 
ATOM   3290 C C   . LEU A 1 423 ? -18.972 20.665 136.748 1.00 93.95  ? 1609 LEU A C   1 
ATOM   3291 O O   . LEU A 1 423 ? -17.995 19.920 136.780 1.00 100.62 ? 1609 LEU A O   1 
ATOM   3292 C CB  . LEU A 1 423 ? -18.615 23.132 136.605 1.00 83.18  ? 1609 LEU A CB  1 
ATOM   3293 C CG  . LEU A 1 423 ? -17.150 23.305 136.992 1.00 69.63  ? 1609 LEU A CG  1 
ATOM   3294 C CD1 . LEU A 1 423 ? -16.250 22.896 135.847 1.00 67.44  ? 1609 LEU A CD1 1 
ATOM   3295 C CD2 . LEU A 1 423 ? -16.891 24.742 137.393 1.00 65.61  ? 1609 LEU A CD2 1 
ATOM   3296 N N   . LYS A 1 424 ? -20.045 20.463 137.497 1.00 80.49  ? 1610 LYS A N   1 
ATOM   3297 C CA  . LYS A 1 424 ? -20.090 19.333 138.402 1.00 75.77  ? 1610 LYS A CA  1 
ATOM   3298 C C   . LYS A 1 424 ? -20.009 18.034 137.620 1.00 96.81  ? 1610 LYS A C   1 
ATOM   3299 O O   . LYS A 1 424 ? -19.291 17.114 138.003 1.00 109.75 ? 1610 LYS A O   1 
ATOM   3300 C CB  . LYS A 1 424 ? -21.385 19.366 139.212 1.00 74.90  ? 1610 LYS A CB  1 
ATOM   3301 C CG  . LYS A 1 424 ? -21.408 18.439 140.412 1.00 81.25  ? 1610 LYS A CG  1 
ATOM   3302 C CD  . LYS A 1 424 ? -22.776 18.450 141.072 1.00 89.57  ? 1610 LYS A CD  1 
ATOM   3303 C CE  . LYS A 1 424 ? -22.727 17.913 142.493 1.00 110.90 ? 1610 LYS A CE  1 
ATOM   3304 N NZ  . LYS A 1 424 ? -22.071 18.863 143.437 1.00 111.61 ? 1610 LYS A NZ  1 
ATOM   3305 N N   . MET A 1 425 ? -20.750 17.965 136.520 1.00 90.01  ? 1611 MET A N   1 
ATOM   3306 C CA  . MET A 1 425 ? -20.764 16.773 135.684 1.00 92.00  ? 1611 MET A CA  1 
ATOM   3307 C C   . MET A 1 425 ? -19.433 16.450 135.020 1.00 98.24  ? 1611 MET A C   1 
ATOM   3308 O O   . MET A 1 425 ? -18.979 15.311 135.038 1.00 101.47 ? 1611 MET A O   1 
ATOM   3309 C CB  . MET A 1 425 ? -21.823 16.945 134.600 1.00 88.98  ? 1611 MET A CB  1 
ATOM   3310 C CG  . MET A 1 425 ? -21.643 16.035 133.410 1.00 76.04  ? 1611 MET A CG  1 
ATOM   3311 S SD  . MET A 1 425 ? -22.537 16.655 131.982 1.00 163.37 ? 1611 MET A SD  1 
ATOM   3312 C CE  . MET A 1 425 ? -21.362 17.825 131.315 1.00 108.86 ? 1611 MET A CE  1 
ATOM   3313 N N   . LYS A 1 426 ? -18.811 17.465 134.438 1.00 93.43  ? 1612 LYS A N   1 
ATOM   3314 C CA  . LYS A 1 426 ? -17.531 17.303 133.765 1.00 78.34  ? 1612 LYS A CA  1 
ATOM   3315 C C   . LYS A 1 426 ? -16.454 16.939 134.769 1.00 94.93  ? 1612 LYS A C   1 
ATOM   3316 O O   . LYS A 1 426 ? -15.568 16.132 134.504 1.00 104.92 ? 1612 LYS A O   1 
ATOM   3317 C CB  . LYS A 1 426 ? -17.168 18.577 133.009 1.00 73.20  ? 1612 LYS A CB  1 
ATOM   3318 C CG  . LYS A 1 426 ? -18.329 19.150 132.214 1.00 82.85  ? 1612 LYS A CG  1 
ATOM   3319 C CD  . LYS A 1 426 ? -17.878 20.201 131.220 1.00 81.25  ? 1612 LYS A CD  1 
ATOM   3320 C CE  . LYS A 1 426 ? -19.062 20.756 130.449 1.00 89.04  ? 1612 LYS A CE  1 
ATOM   3321 N NZ  . LYS A 1 426 ? -18.643 21.753 129.431 1.00 97.42  ? 1612 LYS A NZ  1 
ATOM   3322 N N   . VAL A 1 427 ? -16.554 17.567 135.930 1.00 86.64  ? 1613 VAL A N   1 
ATOM   3323 C CA  . VAL A 1 427 ? -15.608 17.375 137.052 1.00 91.43  ? 1613 VAL A CA  1 
ATOM   3324 C C   . VAL A 1 427 ? -15.808 16.091 137.880 1.00 94.26  ? 1613 VAL A C   1 
ATOM   3325 O O   . VAL A 1 427 ? -14.823 15.496 138.361 1.00 100.15 ? 1613 VAL A O   1 
ATOM   3326 C CB  . VAL A 1 427 ? -15.490 18.614 137.995 1.00 79.65  ? 1613 VAL A CB  1 
ATOM   3327 C CG1 . VAL A 1 427 ? -15.089 18.190 139.416 1.00 66.47  ? 1613 VAL A CG1 1 
ATOM   3328 C CG2 . VAL A 1 427 ? -14.465 19.581 137.448 1.00 62.88  ? 1613 VAL A CG2 1 
ATOM   3329 N N   . GLU A 1 428 ? -17.051 15.685 138.069 1.00 110.51 ? 1614 GLU A N   1 
ATOM   3330 C CA  . GLU A 1 428 ? -17.286 14.496 138.849 1.00 103.10 ? 1614 GLU A CA  1 
ATOM   3331 C C   . GLU A 1 428 ? -16.763 13.310 138.093 1.00 99.86  ? 1614 GLU A C   1 
ATOM   3332 O O   . GLU A 1 428 ? -16.143 12.428 138.659 1.00 113.60 ? 1614 GLU A O   1 
ATOM   3333 C CB  . GLU A 1 428 ? -18.763 14.327 139.156 1.00 91.11  ? 1614 GLU A CB  1 
ATOM   3334 C CG  . GLU A 1 428 ? -19.354 15.486 139.903 1.00 105.71 ? 1614 GLU A CG  1 
ATOM   3335 C CD  . GLU A 1 428 ? -20.305 15.044 140.977 1.00 114.88 ? 1614 GLU A CD  1 
ATOM   3336 O OE1 . GLU A 1 428 ? -20.595 13.846 141.043 1.00 112.87 ? 1614 GLU A OE1 1 
ATOM   3337 O OE2 . GLU A 1 428 ? -20.753 15.885 141.769 1.00 112.49 ? 1614 GLU A OE2 1 
ATOM   3338 N N   . LYS A 1 429 ? -17.018 13.283 136.799 1.00 99.65  ? 1615 LYS A N   1 
ATOM   3339 C CA  . LYS A 1 429 ? -16.551 12.165 136.023 1.00 107.90 ? 1615 LYS A CA  1 
ATOM   3340 C C   . LYS A 1 429 ? -15.060 12.052 135.974 1.00 107.80 ? 1615 LYS A C   1 
ATOM   3341 O O   . LYS A 1 429 ? -14.510 10.988 136.207 1.00 109.69 ? 1615 LYS A O   1 
ATOM   3342 C CB  . LYS A 1 429 ? -17.053 12.294 134.586 1.00 86.86  ? 1615 LYS A CB  1 
ATOM   3343 N N   . GLU A 1 430 ? -14.388 13.148 135.681 1.00 102.90 ? 1616 GLU A N   1 
ATOM   3344 C CA  . GLU A 1 430 ? -12.945 13.083 135.611 1.00 112.28 ? 1616 GLU A CA  1 
ATOM   3345 C C   . GLU A 1 430 ? -12.230 12.845 136.912 1.00 101.37 ? 1616 GLU A C   1 
ATOM   3346 O O   . GLU A 1 430 ? -11.315 12.048 136.993 1.00 106.61 ? 1616 GLU A O   1 
ATOM   3347 C CB  . GLU A 1 430 ? -12.378 14.321 134.942 1.00 119.60 ? 1616 GLU A CB  1 
ATOM   3348 C CG  . GLU A 1 430 ? -10.891 14.319 134.974 1.00 120.39 ? 1616 GLU A CG  1 
ATOM   3349 C CD  . GLU A 1 430 ? -10.346 12.932 135.106 1.00 121.40 ? 1616 GLU A CD  1 
ATOM   3350 O OE1 . GLU A 1 430 ? -10.860 12.037 134.426 1.00 116.70 ? 1616 GLU A OE1 1 
ATOM   3351 O OE2 . GLU A 1 430 ? -9.413  12.725 135.896 1.00 126.46 ? 1616 GLU A OE2 1 
ATOM   3352 N N   . TYR A 1 431 ? -12.655 13.548 137.939 1.00 100.61 ? 1617 TYR A N   1 
ATOM   3353 C CA  . TYR A 1 431 ? -12.027 13.415 139.230 1.00 97.16  ? 1617 TYR A CA  1 
ATOM   3354 C C   . TYR A 1 431 ? -12.888 12.717 140.233 1.00 101.73 ? 1617 TYR A C   1 
ATOM   3355 O O   . TYR A 1 431 ? -12.556 12.658 141.403 1.00 106.98 ? 1617 TYR A O   1 
ATOM   3356 C CB  . TYR A 1 431 ? -11.597 14.788 139.716 1.00 79.41  ? 1617 TYR A CB  1 
ATOM   3357 C CG  . TYR A 1 431 ? -10.771 15.487 138.679 1.00 81.09  ? 1617 TYR A CG  1 
ATOM   3358 C CD1 . TYR A 1 431 ? -9.488  15.076 138.415 1.00 82.40  ? 1617 TYR A CD1 1 
ATOM   3359 C CD2 . TYR A 1 431 ? -11.286 16.520 137.936 1.00 86.29  ? 1617 TYR A CD2 1 
ATOM   3360 C CE1 . TYR A 1 431 ? -8.742  15.682 137.469 1.00 83.32  ? 1617 TYR A CE1 1 
ATOM   3361 C CE2 . TYR A 1 431 ? -10.538 17.133 136.982 1.00 88.51  ? 1617 TYR A CE2 1 
ATOM   3362 C CZ  . TYR A 1 431 ? -9.267  16.707 136.754 1.00 90.52  ? 1617 TYR A CZ  1 
ATOM   3363 O OH  . TYR A 1 431 ? -8.502  17.309 135.800 1.00 79.86  ? 1617 TYR A OH  1 
ATOM   3364 N N   . GLY A 1 432 ? -14.003 12.181 139.771 1.00 111.13 ? 1618 GLY A N   1 
ATOM   3365 C CA  . GLY A 1 432 ? -14.889 11.490 140.672 1.00 127.52 ? 1618 GLY A CA  1 
ATOM   3366 C C   . GLY A 1 432 ? -15.486 12.572 141.518 1.00 119.25 ? 1618 GLY A C   1 
ATOM   3367 O O   . GLY A 1 432 ? -15.515 13.717 141.102 1.00 120.91 ? 1618 GLY A O   1 
ATOM   3368 N N   . VAL A 1 433 ? -15.955 12.220 142.702 1.00 95.56  ? 1619 VAL A N   1 
ATOM   3369 C CA  . VAL A 1 433 ? -16.547 13.196 143.580 1.00 101.42 ? 1619 VAL A CA  1 
ATOM   3370 C C   . VAL A 1 433 ? -15.878 13.156 144.928 1.00 108.33 ? 1619 VAL A C   1 
ATOM   3371 O O   . VAL A 1 433 ? -15.291 12.153 145.299 1.00 116.15 ? 1619 VAL A O   1 
ATOM   3372 C CB  . VAL A 1 433 ? -17.999 12.905 143.778 1.00 97.08  ? 1619 VAL A CB  1 
ATOM   3373 C CG1 . VAL A 1 433 ? -18.323 11.576 143.207 1.00 75.96  ? 1619 VAL A CG1 1 
ATOM   3374 C CG2 . VAL A 1 433 ? -18.330 12.966 145.233 1.00 99.93  ? 1619 VAL A CG2 1 
ATOM   3375 N N   . ARG A 1 434 ? -15.956 14.255 145.662 1.00 98.43  ? 1620 ARG A N   1 
ATOM   3376 C CA  . ARG A 1 434 ? -15.346 14.319 146.975 1.00 95.55  ? 1620 ARG A CA  1 
ATOM   3377 C C   . ARG A 1 434 ? -16.366 14.789 147.988 1.00 95.64  ? 1620 ARG A C   1 
ATOM   3378 O O   . ARG A 1 434 ? -17.525 14.977 147.650 1.00 87.41  ? 1620 ARG A O   1 
ATOM   3379 C CB  . ARG A 1 434 ? -14.131 15.249 146.967 1.00 72.06  ? 1620 ARG A CB  1 
ATOM   3380 N N   . LYS B 1 11  ? -19.492 12.098 73.679  1.00 93.35  ? 1197 LYS B N   1 
ATOM   3381 C CA  . LYS B 1 11  ? -19.444 10.654 73.761  1.00 100.82 ? 1197 LYS B CA  1 
ATOM   3382 C C   . LYS B 1 11  ? -18.052 10.210 74.136  1.00 104.47 ? 1197 LYS B C   1 
ATOM   3383 O O   . LYS B 1 11  ? -17.321 9.725  73.299  1.00 93.54  ? 1197 LYS B O   1 
ATOM   3384 C CB  . LYS B 1 11  ? -19.819 10.056 72.416  1.00 97.09  ? 1197 LYS B CB  1 
ATOM   3385 N N   . ASP B 1 12  ? -17.684 10.355 75.399  1.00 103.83 ? 1198 ASP B N   1 
ATOM   3386 C CA  . ASP B 1 12  ? -16.356 9.958  75.815  1.00 101.39 ? 1198 ASP B CA  1 
ATOM   3387 C C   . ASP B 1 12  ? -16.172 8.510  75.538  1.00 94.65  ? 1198 ASP B C   1 
ATOM   3388 O O   . ASP B 1 12  ? -15.136 8.097  75.083  1.00 85.33  ? 1198 ASP B O   1 
ATOM   3389 C CB  . ASP B 1 12  ? -16.193 10.125 77.311  1.00 96.87  ? 1198 ASP B CB  1 
ATOM   3390 C CG  . ASP B 1 12  ? -16.269 11.540 77.743  1.00 105.88 ? 1198 ASP B CG  1 
ATOM   3391 O OD1 . ASP B 1 12  ? -16.240 12.428 76.878  1.00 102.68 ? 1198 ASP B OD1 1 
ATOM   3392 O OD2 . ASP B 1 12  ? -16.352 11.764 78.958  1.00 102.56 ? 1198 ASP B OD2 1 
ATOM   3393 N N   . ASN B 1 13  ? -17.192 7.726  75.818  1.00 88.79  ? 1199 ASN B N   1 
ATOM   3394 C CA  . ASN B 1 13  ? -17.102 6.311  75.594  1.00 86.98  ? 1199 ASN B CA  1 
ATOM   3395 C C   . ASN B 1 13  ? -16.891 5.999  74.131  1.00 92.17  ? 1199 ASN B C   1 
ATOM   3396 O O   . ASN B 1 13  ? -16.041 5.205  73.780  1.00 93.94  ? 1199 ASN B O   1 
ATOM   3397 C CB  . ASN B 1 13  ? -18.394 5.699  76.075  1.00 86.61  ? 1199 ASN B CB  1 
ATOM   3398 C CG  . ASN B 1 13  ? -19.020 6.509  77.179  1.00 113.59 ? 1199 ASN B CG  1 
ATOM   3399 O OD1 . ASN B 1 13  ? -18.476 6.598  78.275  1.00 109.29 ? 1199 ASN B OD1 1 
ATOM   3400 N ND2 . ASN B 1 13  ? -20.159 7.126  76.894  1.00 109.44 ? 1199 ASN B ND2 1 
ATOM   3401 N N   . ARG B 1 14  ? -17.641 6.645  73.263  1.00 70.35  ? 1200 ARG B N   1 
ATOM   3402 C CA  . ARG B 1 14  ? -17.476 6.379  71.856  1.00 66.80  ? 1200 ARG B CA  1 
ATOM   3403 C C   . ARG B 1 14  ? -16.085 6.752  71.408  1.00 80.15  ? 1200 ARG B C   1 
ATOM   3404 O O   . ARG B 1 14  ? -15.467 6.028  70.643  1.00 80.80  ? 1200 ARG B O   1 
ATOM   3405 C CB  . ARG B 1 14  ? -18.519 7.141  71.036  1.00 66.17  ? 1200 ARG B CB  1 
ATOM   3406 N N   . MET B 1 15  ? -15.586 7.884  71.880  1.00 76.25  ? 1201 MET B N   1 
ATOM   3407 C CA  . MET B 1 15  ? -14.256 8.316  71.494  1.00 70.20  ? 1201 MET B CA  1 
ATOM   3408 C C   . MET B 1 15  ? -13.183 7.391  71.994  1.00 75.01  ? 1201 MET B C   1 
ATOM   3409 O O   . MET B 1 15  ? -12.237 7.094  71.297  1.00 77.83  ? 1201 MET B O   1 
ATOM   3410 C CB  . MET B 1 15  ? -13.983 9.722  71.996  1.00 68.34  ? 1201 MET B CB  1 
ATOM   3411 C CG  . MET B 1 15  ? -14.688 10.789 71.232  1.00 74.12  ? 1201 MET B CG  1 
ATOM   3412 S SD  . MET B 1 15  ? -14.599 12.315 72.117  1.00 65.05  ? 1201 MET B SD  1 
ATOM   3413 C CE  . MET B 1 15  ? -15.526 13.389 71.068  1.00 74.30  ? 1201 MET B CE  1 
ATOM   3414 N N   . SER B 1 16  ? -13.339 6.939  73.222  1.00 61.50  ? 1202 SER B N   1 
ATOM   3415 C CA  . SER B 1 16  ? -12.378 6.062  73.833  1.00 59.50  ? 1202 SER B CA  1 
ATOM   3416 C C   . SER B 1 16  ? -12.369 4.805  73.039  1.00 71.68  ? 1202 SER B C   1 
ATOM   3417 O O   . SER B 1 16  ? -11.342 4.201  72.816  1.00 69.10  ? 1202 SER B O   1 
ATOM   3418 C CB  . SER B 1 16  ? -12.782 5.796  75.266  1.00 68.88  ? 1202 SER B CB  1 
ATOM   3419 O OG  . SER B 1 16  ? -13.287 6.974  75.857  1.00 90.55  ? 1202 SER B OG  1 
ATOM   3420 N N   . CYS B 1 17  ? -13.557 4.421  72.619  1.00 65.15  ? 1203 CYS B N   1 
ATOM   3421 C CA  . CYS B 1 17  ? -13.773 3.237  71.833  1.00 66.90  ? 1203 CYS B CA  1 
ATOM   3422 C C   . CYS B 1 17  ? -13.145 3.449  70.495  1.00 72.24  ? 1203 CYS B C   1 
ATOM   3423 O O   . CYS B 1 17  ? -12.350 2.640  70.061  1.00 60.39  ? 1203 CYS B O   1 
ATOM   3424 C CB  . CYS B 1 17  ? -15.261 2.994  71.653  1.00 64.59  ? 1203 CYS B CB  1 
ATOM   3425 S SG  . CYS B 1 17  ? -15.654 1.659  70.508  1.00 99.84  ? 1203 CYS B SG  1 
ATOM   3426 N N   . THR B 1 18  ? -13.498 4.542  69.828  1.00 52.55  ? 1204 THR B N   1 
ATOM   3427 C CA  . THR B 1 18  ? -12.903 4.765  68.528  1.00 57.20  ? 1204 THR B CA  1 
ATOM   3428 C C   . THR B 1 18  ? -11.370 4.713  68.591  1.00 59.09  ? 1204 THR B C   1 
ATOM   3429 O O   . THR B 1 18  ? -10.729 4.177  67.708  1.00 54.89  ? 1204 THR B O   1 
ATOM   3430 C CB  . THR B 1 18  ? -13.337 6.125  67.984  1.00 68.35  ? 1204 THR B CB  1 
ATOM   3431 O OG1 . THR B 1 18  ? -14.688 6.385  68.387  1.00 68.30  ? 1204 THR B OG1 1 
ATOM   3432 C CG2 . THR B 1 18  ? -13.221 6.182  66.468  1.00 61.96  ? 1204 THR B CG2 1 
ATOM   3433 N N   . VAL B 1 19  ? -10.788 5.274  69.642  1.00 57.43  ? 1205 VAL B N   1 
ATOM   3434 C CA  . VAL B 1 19  ? -9.343  5.341  69.755  1.00 56.46  ? 1205 VAL B CA  1 
ATOM   3435 C C   . VAL B 1 19  ? -8.807  3.957  70.052  1.00 64.19  ? 1205 VAL B C   1 
ATOM   3436 O O   . VAL B 1 19  ? -7.761  3.571  69.556  1.00 70.92  ? 1205 VAL B O   1 
ATOM   3437 C CB  . VAL B 1 19  ? -8.915  6.326  70.851  1.00 62.85  ? 1205 VAL B CB  1 
ATOM   3438 C CG1 . VAL B 1 19  ? -7.405  6.284  71.078  1.00 38.45  ? 1205 VAL B CG1 1 
ATOM   3439 C CG2 . VAL B 1 19  ? -9.356  7.730  70.488  1.00 48.11  ? 1205 VAL B CG2 1 
ATOM   3440 N N   . ASN B 1 20  ? -9.536  3.196  70.858  1.00 63.36  ? 1206 ASN B N   1 
ATOM   3441 C CA  . ASN B 1 20  ? -9.146  1.812  71.112  1.00 77.20  ? 1206 ASN B CA  1 
ATOM   3442 C C   . ASN B 1 20  ? -9.150  1.020  69.797  1.00 84.19  ? 1206 ASN B C   1 
ATOM   3443 O O   . ASN B 1 20  ? -8.176  0.320  69.486  1.00 81.95  ? 1206 ASN B O   1 
ATOM   3444 C CB  . ASN B 1 20  ? -10.046 1.157  72.176  1.00 80.81  ? 1206 ASN B CB  1 
ATOM   3445 C CG  . ASN B 1 20  ? -9.928  1.836  73.551  1.00 87.21  ? 1206 ASN B CG  1 
ATOM   3446 O OD1 . ASN B 1 20  ? -8.819  2.120  74.011  1.00 88.48  ? 1206 ASN B OD1 1 
ATOM   3447 N ND2 . ASN B 1 20  ? -11.072 2.113  74.199  1.00 82.89  ? 1206 ASN B ND2 1 
ATOM   3448 N N   . LEU B 1 21  ? -10.230 1.161  69.016  1.00 73.73  ? 1207 LEU B N   1 
ATOM   3449 C CA  . LEU B 1 21  ? -10.276 0.587  67.659  1.00 70.84  ? 1207 LEU B CA  1 
ATOM   3450 C C   . LEU B 1 21  ? -9.097  1.106  66.840  1.00 75.24  ? 1207 LEU B C   1 
ATOM   3451 O O   . LEU B 1 21  ? -8.360  0.348  66.230  1.00 80.21  ? 1207 LEU B O   1 
ATOM   3452 C CB  . LEU B 1 21  ? -11.602 0.928  66.950  1.00 67.58  ? 1207 LEU B CB  1 
ATOM   3453 C CG  . LEU B 1 21  ? -12.694 -0.145 66.951  1.00 62.63  ? 1207 LEU B CG  1 
ATOM   3454 C CD1 . LEU B 1 21  ? -12.436 -1.186 68.035  1.00 65.86  ? 1207 LEU B CD1 1 
ATOM   3455 C CD2 . LEU B 1 21  ? -14.109 0.500  67.126  1.00 91.03  ? 1207 LEU B CD2 1 
ATOM   3456 N N   . LEU B 1 22  ? -8.906  2.408  66.868  1.00 62.04  ? 1208 LEU B N   1 
ATOM   3457 C CA  . LEU B 1 22  ? -7.959  3.049  65.998  1.00 60.49  ? 1208 LEU B CA  1 
ATOM   3458 C C   . LEU B 1 22  ? -6.566  2.556  66.288  1.00 62.37  ? 1208 LEU B C   1 
ATOM   3459 O O   . LEU B 1 22  ? -5.740  2.406  65.389  1.00 66.78  ? 1208 LEU B O   1 
ATOM   3460 C CB  . LEU B 1 22  ? -8.048  4.537  66.238  1.00 53.58  ? 1208 LEU B CB  1 
ATOM   3461 C CG  . LEU B 1 22  ? -7.303  5.471  65.338  1.00 64.11  ? 1208 LEU B CG  1 
ATOM   3462 C CD1 . LEU B 1 22  ? -8.312  6.523  65.018  1.00 88.58  ? 1208 LEU B CD1 1 
ATOM   3463 C CD2 . LEU B 1 22  ? -6.153  6.018  66.125  1.00 59.84  ? 1208 LEU B CD2 1 
ATOM   3464 N N   . ASN B 1 23  ? -6.283  2.337  67.558  1.00 70.20  ? 1209 ASN B N   1 
ATOM   3465 C CA  . ASN B 1 23  ? -4.984  1.841  67.970  1.00 73.66  ? 1209 ASN B CA  1 
ATOM   3466 C C   . ASN B 1 23  ? -4.698  0.441  67.503  1.00 77.60  ? 1209 ASN B C   1 
ATOM   3467 O O   . ASN B 1 23  ? -3.616  0.137  67.039  1.00 71.99  ? 1209 ASN B O   1 
ATOM   3468 C CB  . ASN B 1 23  ? -4.897  1.856  69.481  1.00 70.77  ? 1209 ASN B CB  1 
ATOM   3469 C CG  . ASN B 1 23  ? -4.568  3.204  70.021  1.00 79.43  ? 1209 ASN B CG  1 
ATOM   3470 O OD1 . ASN B 1 23  ? -4.867  3.503  71.162  1.00 75.75  ? 1209 ASN B OD1 1 
ATOM   3471 N ND2 . ASN B 1 23  ? -3.953  4.034  69.204  1.00 69.96  ? 1209 ASN B ND2 1 
ATOM   3472 N N   . PHE B 1 24  ? -5.699  -0.410 67.623  1.00 81.67  ? 1210 PHE B N   1 
ATOM   3473 C CA  . PHE B 1 24  ? -5.566  -1.801 67.257  1.00 76.47  ? 1210 PHE B CA  1 
ATOM   3474 C C   . PHE B 1 24  ? -5.250  -1.916 65.791  1.00 83.58  ? 1210 PHE B C   1 
ATOM   3475 O O   . PHE B 1 24  ? -4.415  -2.709 65.381  1.00 79.23  ? 1210 PHE B O   1 
ATOM   3476 C CB  . PHE B 1 24  ? -6.867  -2.529 67.551  1.00 68.96  ? 1210 PHE B CB  1 
ATOM   3477 C CG  . PHE B 1 24  ? -6.935  -3.894 66.959  1.00 85.94  ? 1210 PHE B CG  1 
ATOM   3478 C CD1 . PHE B 1 24  ? -6.124  -4.900 67.422  1.00 77.31  ? 1210 PHE B CD1 1 
ATOM   3479 C CD2 . PHE B 1 24  ? -7.811  -4.173 65.939  1.00 93.89  ? 1210 PHE B CD2 1 
ATOM   3480 C CE1 . PHE B 1 24  ? -6.181  -6.144 66.874  1.00 73.63  ? 1210 PHE B CE1 1 
ATOM   3481 C CE2 . PHE B 1 24  ? -7.868  -5.419 65.397  1.00 80.99  ? 1210 PHE B CE2 1 
ATOM   3482 C CZ  . PHE B 1 24  ? -7.052  -6.403 65.863  1.00 69.31  ? 1210 PHE B CZ  1 
ATOM   3483 N N   . TYR B 1 25  ? -5.919  -1.096 65.003  1.00 77.46  ? 1211 TYR B N   1 
ATOM   3484 C CA  . TYR B 1 25  ? -5.714  -1.081 63.578  1.00 78.83  ? 1211 TYR B CA  1 
ATOM   3485 C C   . TYR B 1 25  ? -4.297  -0.682 63.281  1.00 85.48  ? 1211 TYR B C   1 
ATOM   3486 O O   . TYR B 1 25  ? -3.710  -1.147 62.341  1.00 85.62  ? 1211 TYR B O   1 
ATOM   3487 C CB  . TYR B 1 25  ? -6.700  -0.151 62.912  1.00 74.00  ? 1211 TYR B CB  1 
ATOM   3488 C CG  . TYR B 1 25  ? -8.084  -0.723 62.897  1.00 69.00  ? 1211 TYR B CG  1 
ATOM   3489 C CD1 . TYR B 1 25  ? -8.281  -2.067 62.749  1.00 65.33  ? 1211 TYR B CD1 1 
ATOM   3490 C CD2 . TYR B 1 25  ? -9.190  0.078  63.049  1.00 71.92  ? 1211 TYR B CD2 1 
ATOM   3491 C CE1 . TYR B 1 25  ? -9.524  -2.593 62.743  1.00 73.47  ? 1211 TYR B CE1 1 
ATOM   3492 C CE2 . TYR B 1 25  ? -10.437 -0.445 63.040  1.00 66.06  ? 1211 TYR B CE2 1 
ATOM   3493 C CZ  . TYR B 1 25  ? -10.596 -1.782 62.887  1.00 71.45  ? 1211 TYR B CZ  1 
ATOM   3494 O OH  . TYR B 1 25  ? -11.845 -2.322 62.876  1.00 68.76  ? 1211 TYR B OH  1 
ATOM   3495 N N   . LYS B 1 26  ? -3.743  0.228  64.051  1.00 89.36  ? 1212 LYS B N   1 
ATOM   3496 C CA  . LYS B 1 26  ? -2.366  0.598  63.803  1.00 97.43  ? 1212 LYS B CA  1 
ATOM   3497 C C   . LYS B 1 26  ? -1.438  -0.565 64.067  1.00 89.74  ? 1212 LYS B C   1 
ATOM   3498 O O   . LYS B 1 26  ? -0.507  -0.807 63.321  1.00 86.64  ? 1212 LYS B O   1 
ATOM   3499 C CB  . LYS B 1 26  ? -1.964  1.774  64.669  1.00 78.29  ? 1212 LYS B CB  1 
ATOM   3500 C CG  . LYS B 1 26  ? -0.881  2.614  64.061  1.00 82.55  ? 1212 LYS B CG  1 
ATOM   3501 N N   . ASP B 1 27  ? -1.710  -1.285 65.144  1.00 64.42  ? 1213 ASP B N   1 
ATOM   3502 C CA  . ASP B 1 27  ? -0.872  -2.390 65.561  1.00 77.03  ? 1213 ASP B CA  1 
ATOM   3503 C C   . ASP B 1 27  ? -0.832  -3.488 64.529  1.00 86.93  ? 1213 ASP B C   1 
ATOM   3504 O O   . ASP B 1 27  ? 0.221   -4.027 64.231  1.00 99.08  ? 1213 ASP B O   1 
ATOM   3505 C CB  . ASP B 1 27  ? -1.381  -2.944 66.884  1.00 82.16  ? 1213 ASP B CB  1 
ATOM   3506 C CG  . ASP B 1 27  ? -1.585  -1.871 67.928  1.00 100.21 ? 1213 ASP B CG  1 
ATOM   3507 O OD1 . ASP B 1 27  ? -0.581  -1.321 68.411  1.00 102.75 ? 1213 ASP B OD1 1 
ATOM   3508 O OD2 . ASP B 1 27  ? -2.743  -1.588 68.280  1.00 104.61 ? 1213 ASP B OD2 1 
ATOM   3509 N N   . ASN B 1 28  ? -1.987  -3.802 63.968  1.00 86.10  ? 1214 ASN B N   1 
ATOM   3510 C CA  . ASN B 1 28  ? -2.077  -4.791 62.917  1.00 85.22  ? 1214 ASN B CA  1 
ATOM   3511 C C   . ASN B 1 28  ? -2.217  -3.944 61.675  1.00 93.45  ? 1214 ASN B C   1 
ATOM   3512 O O   . ASN B 1 28  ? -3.170  -3.222 61.533  1.00 120.12 ? 1214 ASN B O   1 
ATOM   3513 C CB  . ASN B 1 28  ? -3.312  -5.639 63.143  1.00 78.45  ? 1214 ASN B CB  1 
ATOM   3514 C CG  . ASN B 1 28  ? -3.319  -6.299 64.500  1.00 88.74  ? 1214 ASN B CG  1 
ATOM   3515 O OD1 . ASN B 1 28  ? -2.285  -6.714 65.003  1.00 91.39  ? 1214 ASN B OD1 1 
ATOM   3516 N ND2 . ASN B 1 28  ? -4.490  -6.411 65.094  1.00 92.33  ? 1214 ASN B ND2 1 
ATOM   3517 N N   . ASN B 1 29  ? -1.284  -4.014 60.754  1.00 75.63  ? 1215 ASN B N   1 
ATOM   3518 C CA  . ASN B 1 29  ? -1.315  -3.051 59.684  1.00 99.28  ? 1215 ASN B CA  1 
ATOM   3519 C C   . ASN B 1 29  ? -2.549  -3.143 58.848  1.00 96.21  ? 1215 ASN B C   1 
ATOM   3520 O O   . ASN B 1 29  ? -2.651  -3.935 57.935  1.00 91.34  ? 1215 ASN B O   1 
ATOM   3521 C CB  . ASN B 1 29  ? -0.101  -3.205 58.800  1.00 99.81  ? 1215 ASN B CB  1 
ATOM   3522 C CG  . ASN B 1 29  ? 1.154   -2.883 59.520  1.00 115.54 ? 1215 ASN B CG  1 
ATOM   3523 O OD1 . ASN B 1 29  ? 1.882   -1.972 59.148  1.00 110.27 ? 1215 ASN B OD1 1 
ATOM   3524 N ND2 . ASN B 1 29  ? 1.419   -3.625 60.576  1.00 122.98 ? 1215 ASN B ND2 1 
ATOM   3525 N N   . ARG B 1 30  ? -3.482  -2.274 59.181  1.00 86.42  ? 1216 ARG B N   1 
ATOM   3526 C CA  . ARG B 1 30  ? -4.738  -2.171 58.498  1.00 76.71  ? 1216 ARG B CA  1 
ATOM   3527 C C   . ARG B 1 30  ? -4.904  -0.709 58.218  1.00 78.35  ? 1216 ARG B C   1 
ATOM   3528 O O   . ARG B 1 30  ? -5.662  -0.032 58.874  1.00 88.50  ? 1216 ARG B O   1 
ATOM   3529 C CB  . ARG B 1 30  ? -5.896  -2.725 59.332  1.00 56.55  ? 1216 ARG B CB  1 
ATOM   3530 N N   . GLU B 1 31  ? -4.184  -0.221 57.230  1.00 78.56  ? 1217 GLU B N   1 
ATOM   3531 C CA  . GLU B 1 31  ? -4.202  1.182  56.891  1.00 85.21  ? 1217 GLU B CA  1 
ATOM   3532 C C   . GLU B 1 31  ? -5.566  1.676  56.483  1.00 82.95  ? 1217 GLU B C   1 
ATOM   3533 O O   . GLU B 1 31  ? -5.939  2.784  56.783  1.00 80.62  ? 1217 GLU B O   1 
ATOM   3534 C CB  . GLU B 1 31  ? -3.229  1.433  55.757  1.00 88.41  ? 1217 GLU B CB  1 
ATOM   3535 C CG  . GLU B 1 31  ? -2.483  2.726  55.856  1.00 76.83  ? 1217 GLU B CG  1 
ATOM   3536 C CD  . GLU B 1 31  ? -1.686  2.987  54.629  1.00 91.15  ? 1217 GLU B CD  1 
ATOM   3537 O OE1 . GLU B 1 31  ? -2.123  2.544  53.562  1.00 90.10  ? 1217 GLU B OE1 1 
ATOM   3538 O OE2 . GLU B 1 31  ? -0.623  3.616  54.719  1.00 94.52  ? 1217 GLU B OE2 1 
ATOM   3539 N N   . GLU B 1 32  ? -6.295  0.870  55.724  1.00 75.39  ? 1218 GLU B N   1 
ATOM   3540 C CA  . GLU B 1 32  ? -7.607  1.296  55.266  1.00 72.12  ? 1218 GLU B CA  1 
ATOM   3541 C C   . GLU B 1 32  ? -8.557  1.491  56.435  1.00 81.92  ? 1218 GLU B C   1 
ATOM   3542 O O   . GLU B 1 32  ? -9.302  2.465  56.495  1.00 78.05  ? 1218 GLU B O   1 
ATOM   3543 C CB  . GLU B 1 32  ? -8.189  0.271  54.298  1.00 73.32  ? 1218 GLU B CB  1 
ATOM   3544 C CG  . GLU B 1 32  ? -9.187  0.856  53.324  1.00 97.71  ? 1218 GLU B CG  1 
ATOM   3545 C CD  . GLU B 1 32  ? -10.209 -0.154 52.871  1.00 108.42 ? 1218 GLU B CD  1 
ATOM   3546 O OE1 . GLU B 1 32  ? -9.854  -1.037 52.066  1.00 108.16 ? 1218 GLU B OE1 1 
ATOM   3547 O OE2 . GLU B 1 32  ? -11.370 -0.057 53.310  1.00 115.93 ? 1218 GLU B OE2 1 
ATOM   3548 N N   . MET B 1 33  ? -8.527  0.539  57.358  1.00 73.12  ? 1219 MET B N   1 
ATOM   3549 C CA  . MET B 1 33  ? -9.354  0.584  58.552  1.00 72.25  ? 1219 MET B CA  1 
ATOM   3550 C C   . MET B 1 33  ? -8.965  1.726  59.472  1.00 71.26  ? 1219 MET B C   1 
ATOM   3551 O O   . MET B 1 33  ? -9.815  2.406  60.036  1.00 62.10  ? 1219 MET B O   1 
ATOM   3552 C CB  . MET B 1 33  ? -9.255  -0.741 59.299  1.00 75.74  ? 1219 MET B CB  1 
ATOM   3553 C CG  . MET B 1 33  ? -9.980  -1.881 58.628  1.00 71.84  ? 1219 MET B CG  1 
ATOM   3554 S SD  . MET B 1 33  ? -11.760 -1.712 58.774  1.00 82.58  ? 1219 MET B SD  1 
ATOM   3555 C CE  . MET B 1 33  ? -12.057 -0.322 57.694  1.00 53.60  ? 1219 MET B CE  1 
ATOM   3556 N N   . TYR B 1 34  ? -7.661  1.921  59.613  1.00 76.81  ? 1220 TYR B N   1 
ATOM   3557 C CA  . TYR B 1 34  ? -7.110  2.943  60.485  1.00 58.37  ? 1220 TYR B CA  1 
ATOM   3558 C C   . TYR B 1 34  ? -7.537  4.327  60.030  1.00 50.39  ? 1220 TYR B C   1 
ATOM   3559 O O   . TYR B 1 34  ? -7.913  5.169  60.838  1.00 68.40  ? 1220 TYR B O   1 
ATOM   3560 C CB  . TYR B 1 34  ? -5.586  2.819  60.473  1.00 45.73  ? 1220 TYR B CB  1 
ATOM   3561 C CG  . TYR B 1 34  ? -4.845  3.841  61.294  1.00 66.10  ? 1220 TYR B CG  1 
ATOM   3562 C CD1 . TYR B 1 34  ? -4.695  3.682  62.660  1.00 59.46  ? 1220 TYR B CD1 1 
ATOM   3563 C CD2 . TYR B 1 34  ? -4.272  4.950  60.698  1.00 51.66  ? 1220 TYR B CD2 1 
ATOM   3564 C CE1 . TYR B 1 34  ? -4.010  4.607  63.410  1.00 55.48  ? 1220 TYR B CE1 1 
ATOM   3565 C CE2 . TYR B 1 34  ? -3.584  5.879  61.441  1.00 66.80  ? 1220 TYR B CE2 1 
ATOM   3566 C CZ  . TYR B 1 34  ? -3.456  5.704  62.797  1.00 80.85  ? 1220 TYR B CZ  1 
ATOM   3567 O OH  . TYR B 1 34  ? -2.769  6.629  63.544  1.00 54.71  ? 1220 TYR B OH  1 
ATOM   3568 N N   . ILE B 1 35  ? -7.486  4.552  58.726  1.00 44.67  ? 1221 ILE B N   1 
ATOM   3569 C CA  . ILE B 1 35  ? -7.901  5.821  58.150  1.00 54.72  ? 1221 ILE B CA  1 
ATOM   3570 C C   . ILE B 1 35  ? -9.389  6.057  58.354  1.00 55.75  ? 1221 ILE B C   1 
ATOM   3571 O O   . ILE B 1 35  ? -9.819  7.175  58.611  1.00 70.04  ? 1221 ILE B O   1 
ATOM   3572 C CB  . ILE B 1 35  ? -7.539  5.919  56.665  1.00 66.53  ? 1221 ILE B CB  1 
ATOM   3573 C CG1 . ILE B 1 35  ? -6.021  5.958  56.505  1.00 59.36  ? 1221 ILE B CG1 1 
ATOM   3574 C CG2 . ILE B 1 35  ? -8.155  7.156  56.055  1.00 53.53  ? 1221 ILE B CG2 1 
ATOM   3575 C CD1 . ILE B 1 35  ? -5.562  6.028  55.080  1.00 59.99  ? 1221 ILE B CD1 1 
ATOM   3576 N N   . ARG B 1 36  ? -10.172 4.993  58.233  1.00 52.42  ? 1222 ARG B N   1 
ATOM   3577 C CA  . ARG B 1 36  ? -11.614 5.089  58.392  1.00 66.35  ? 1222 ARG B CA  1 
ATOM   3578 C C   . ARG B 1 36  ? -11.927 5.564  59.798  1.00 73.20  ? 1222 ARG B C   1 
ATOM   3579 O O   . ARG B 1 36  ? -12.818 6.381  60.005  1.00 72.91  ? 1222 ARG B O   1 
ATOM   3580 C CB  . ARG B 1 36  ? -12.272 3.735  58.128  1.00 58.91  ? 1222 ARG B CB  1 
ATOM   3581 C CG  . ARG B 1 36  ? -13.789 3.780  58.106  1.00 69.83  ? 1222 ARG B CG  1 
ATOM   3582 C CD  . ARG B 1 36  ? -14.374 2.468  57.620  1.00 73.16  ? 1222 ARG B CD  1 
ATOM   3583 N N   . TYR B 1 37  ? -11.179 5.047  60.762  1.00 64.70  ? 1223 TYR B N   1 
ATOM   3584 C CA  . TYR B 1 37  ? -11.330 5.444  62.143  1.00 63.74  ? 1223 TYR B CA  1 
ATOM   3585 C C   . TYR B 1 37  ? -10.817 6.836  62.454  1.00 73.81  ? 1223 TYR B C   1 
ATOM   3586 O O   . TYR B 1 37  ? -11.339 7.495  63.326  1.00 64.95  ? 1223 TYR B O   1 
ATOM   3587 C CB  . TYR B 1 37  ? -10.912 4.352  63.106  1.00 44.67  ? 1223 TYR B CB  1 
ATOM   3588 C CG  . TYR B 1 37  ? -12.021 3.346  63.200  1.00 71.74  ? 1223 TYR B CG  1 
ATOM   3589 C CD1 . TYR B 1 37  ? -13.283 3.735  63.590  1.00 87.00  ? 1223 TYR B CD1 1 
ATOM   3590 C CD2 . TYR B 1 37  ? -11.839 2.036  62.825  1.00 75.76  ? 1223 TYR B CD2 1 
ATOM   3591 C CE1 . TYR B 1 37  ? -14.315 2.847  63.648  1.00 86.04  ? 1223 TYR B CE1 1 
ATOM   3592 C CE2 . TYR B 1 37  ? -12.867 1.142  62.881  1.00 86.39  ? 1223 TYR B CE2 1 
ATOM   3593 C CZ  . TYR B 1 37  ? -14.103 1.551  63.296  1.00 85.50  ? 1223 TYR B CZ  1 
ATOM   3594 O OH  . TYR B 1 37  ? -15.139 0.660  63.360  1.00 77.09  ? 1223 TYR B OH  1 
ATOM   3595 N N   . LEU B 1 38  ? -9.802  7.292  61.741  1.00 63.46  ? 1224 LEU B N   1 
ATOM   3596 C CA  . LEU B 1 38  ? -9.330  8.630  61.990  1.00 54.12  ? 1224 LEU B CA  1 
ATOM   3597 C C   . LEU B 1 38  ? -10.469 9.539  61.701  1.00 57.09  ? 1224 LEU B C   1 
ATOM   3598 O O   . LEU B 1 38  ? -10.742 10.448 62.447  1.00 55.41  ? 1224 LEU B O   1 
ATOM   3599 C CB  . LEU B 1 38  ? -8.257  9.014  60.995  1.00 51.76  ? 1224 LEU B CB  1 
ATOM   3600 C CG  . LEU B 1 38  ? -6.841  8.511  61.091  1.00 74.59  ? 1224 LEU B CG  1 
ATOM   3601 C CD1 . LEU B 1 38  ? -6.012  9.304  60.140  1.00 49.11  ? 1224 LEU B CD1 1 
ATOM   3602 C CD2 . LEU B 1 38  ? -6.347  8.647  62.480  1.00 74.67  ? 1224 LEU B CD2 1 
ATOM   3603 N N   . TYR B 1 39  ? -11.140 9.307  60.594  1.00 63.79  ? 1225 TYR B N   1 
ATOM   3604 C CA  . TYR B 1 39  ? -12.242 10.185 60.254  1.00 61.03  ? 1225 TYR B CA  1 
ATOM   3605 C C   . TYR B 1 39  ? -13.410 10.057 61.172  1.00 56.18  ? 1225 TYR B C   1 
ATOM   3606 O O   . TYR B 1 39  ? -14.089 11.020 61.446  1.00 56.82  ? 1225 TYR B O   1 
ATOM   3607 C CB  . TYR B 1 39  ? -12.603 10.120 58.782  1.00 53.04  ? 1225 TYR B CB  1 
ATOM   3608 C CG  . TYR B 1 39  ? -11.520 10.728 57.958  1.00 46.38  ? 1225 TYR B CG  1 
ATOM   3609 C CD1 . TYR B 1 39  ? -10.468 9.975  57.529  1.00 37.28  ? 1225 TYR B CD1 1 
ATOM   3610 C CD2 . TYR B 1 39  ? -11.525 12.063 57.657  1.00 45.56  ? 1225 TYR B CD2 1 
ATOM   3611 C CE1 . TYR B 1 39  ? -9.485  10.517 56.817  1.00 43.98  ? 1225 TYR B CE1 1 
ATOM   3612 C CE2 . TYR B 1 39  ? -10.538 12.605 56.938  1.00 39.54  ? 1225 TYR B CE2 1 
ATOM   3613 C CZ  . TYR B 1 39  ? -9.524  11.826 56.520  1.00 40.16  ? 1225 TYR B CZ  1 
ATOM   3614 O OH  . TYR B 1 39  ? -8.516  12.353 55.796  1.00 67.73  ? 1225 TYR B OH  1 
ATOM   3615 N N   . LYS B 1 40  ? -13.663 8.852  61.640  1.00 41.41  ? 1226 LYS B N   1 
ATOM   3616 C CA  . LYS B 1 40  ? -14.772 8.696  62.540  1.00 55.77  ? 1226 LYS B CA  1 
ATOM   3617 C C   . LYS B 1 40  ? -14.484 9.548  63.747  1.00 60.50  ? 1226 LYS B C   1 
ATOM   3618 O O   . LYS B 1 40  ? -15.338 10.256 64.230  1.00 60.22  ? 1226 LYS B O   1 
ATOM   3619 C CB  . LYS B 1 40  ? -14.874 7.252  62.979  1.00 56.19  ? 1226 LYS B CB  1 
ATOM   3620 C CG  . LYS B 1 40  ? -15.719 6.391  62.094  1.00 77.81  ? 1226 LYS B CG  1 
ATOM   3621 C CD  . LYS B 1 40  ? -15.592 4.927  62.479  1.00 82.28  ? 1226 LYS B CD  1 
ATOM   3622 N N   . LEU B 1 41  ? -13.250 9.495  64.210  1.00 61.66  ? 1227 LEU B N   1 
ATOM   3623 C CA  . LEU B 1 41  ? -12.828 10.261 65.366  1.00 57.57  ? 1227 LEU B CA  1 
ATOM   3624 C C   . LEU B 1 41  ? -12.894 11.756 65.143  1.00 51.42  ? 1227 LEU B C   1 
ATOM   3625 O O   . LEU B 1 41  ? -13.290 12.494 66.005  1.00 52.90  ? 1227 LEU B O   1 
ATOM   3626 C CB  . LEU B 1 41  ? -11.422 9.846  65.766  1.00 46.22  ? 1227 LEU B CB  1 
ATOM   3627 C CG  . LEU B 1 41  ? -10.749 10.490 66.962  1.00 46.57  ? 1227 LEU B CG  1 
ATOM   3628 C CD1 . LEU B 1 41  ? -11.669 10.566 68.096  1.00 40.35  ? 1227 LEU B CD1 1 
ATOM   3629 C CD2 . LEU B 1 41  ? -9.576  9.684  67.335  1.00 41.00  ? 1227 LEU B CD2 1 
ATOM   3630 N N   . ARG B 1 42  ? -12.506 12.198 63.971  1.00 42.49  ? 1228 ARG B N   1 
ATOM   3631 C CA  . ARG B 1 42  ? -12.522 13.602 63.666  1.00 48.99  ? 1228 ARG B CA  1 
ATOM   3632 C C   . ARG B 1 42  ? -13.914 14.176 63.701  1.00 62.39  ? 1228 ARG B C   1 
ATOM   3633 O O   . ARG B 1 42  ? -14.133 15.260 64.184  1.00 53.26  ? 1228 ARG B O   1 
ATOM   3634 C CB  . ARG B 1 42  ? -11.939 13.810 62.281  1.00 48.91  ? 1228 ARG B CB  1 
ATOM   3635 C CG  . ARG B 1 42  ? -11.845 15.233 61.860  1.00 61.75  ? 1228 ARG B CG  1 
ATOM   3636 C CD  . ARG B 1 42  ? -13.089 15.686 61.143  1.00 79.02  ? 1228 ARG B CD  1 
ATOM   3637 N NE  . ARG B 1 42  ? -12.825 15.854 59.731  1.00 70.78  ? 1228 ARG B NE  1 
ATOM   3638 C CZ  . ARG B 1 42  ? -13.453 15.195 58.779  1.00 62.14  ? 1228 ARG B CZ  1 
ATOM   3639 N NH1 . ARG B 1 42  ? -14.411 14.338 59.073  1.00 77.54  ? 1228 ARG B NH1 1 
ATOM   3640 N NH2 . ARG B 1 42  ? -13.125 15.407 57.528  1.00 70.93  ? 1228 ARG B NH2 1 
ATOM   3641 N N   . ASP B 1 43  ? -14.863 13.436 63.172  1.00 61.04  ? 1229 ASP B N   1 
ATOM   3642 C CA  . ASP B 1 43  ? -16.244 13.904 63.076  1.00 63.22  ? 1229 ASP B CA  1 
ATOM   3643 C C   . ASP B 1 43  ? -16.834 14.098 64.447  1.00 67.28  ? 1229 ASP B C   1 
ATOM   3644 O O   . ASP B 1 43  ? -17.568 15.067 64.674  1.00 71.36  ? 1229 ASP B O   1 
ATOM   3645 C CB  . ASP B 1 43  ? -17.115 13.001 62.201  1.00 60.10  ? 1229 ASP B CB  1 
ATOM   3646 C CG  . ASP B 1 43  ? -16.781 13.130 60.709  1.00 77.89  ? 1229 ASP B CG  1 
ATOM   3647 O OD1 . ASP B 1 43  ? -16.375 14.242 60.287  1.00 75.53  ? 1229 ASP B OD1 1 
ATOM   3648 O OD2 . ASP B 1 43  ? -16.911 12.117 59.964  1.00 74.47  ? 1229 ASP B OD2 1 
ATOM   3649 N N   . LEU B 1 44  ? -16.463 13.206 65.362  1.00 55.51  ? 1230 LEU B N   1 
ATOM   3650 C CA  . LEU B 1 44  ? -16.886 13.300 66.755  1.00 63.23  ? 1230 LEU B CA  1 
ATOM   3651 C C   . LEU B 1 44  ? -16.428 14.565 67.463  1.00 66.30  ? 1230 LEU B C   1 
ATOM   3652 O O   . LEU B 1 44  ? -17.249 15.224 68.118  1.00 69.64  ? 1230 LEU B O   1 
ATOM   3653 C CB  . LEU B 1 44  ? -16.438 12.070 67.531  1.00 63.73  ? 1230 LEU B CB  1 
ATOM   3654 C CG  . LEU B 1 44  ? -17.212 10.774 67.249  1.00 65.96  ? 1230 LEU B CG  1 
ATOM   3655 C CD1 . LEU B 1 44  ? -16.592 9.581  67.958  1.00 40.12  ? 1230 LEU B CD1 1 
ATOM   3656 C CD2 . LEU B 1 44  ? -18.692 10.922 67.624  1.00 50.22  ? 1230 LEU B CD2 1 
ATOM   3657 N N   . HIS B 1 45  ? -15.149 14.913 67.313  1.00 47.66  ? 1231 HIS B N   1 
ATOM   3658 C CA  . HIS B 1 45  ? -14.647 16.186 67.810  1.00 46.81  ? 1231 HIS B CA  1 
ATOM   3659 C C   . HIS B 1 45  ? -15.361 17.385 67.255  1.00 61.60  ? 1231 HIS B C   1 
ATOM   3660 O O   . HIS B 1 45  ? -15.546 18.379 67.973  1.00 55.23  ? 1231 HIS B O   1 
ATOM   3661 C CB  . HIS B 1 45  ? -13.169 16.339 67.549  1.00 43.41  ? 1231 HIS B CB  1 
ATOM   3662 C CG  . HIS B 1 45  ? -12.343 15.514 68.461  1.00 47.60  ? 1231 HIS B CG  1 
ATOM   3663 N ND1 . HIS B 1 45  ? -11.464 14.558 68.011  1.00 55.11  ? 1231 HIS B ND1 1 
ATOM   3664 C CD2 . HIS B 1 45  ? -12.325 15.438 69.810  1.00 44.05  ? 1231 HIS B CD2 1 
ATOM   3665 C CE1 . HIS B 1 45  ? -10.909 13.946 69.040  1.00 53.86  ? 1231 HIS B CE1 1 
ATOM   3666 N NE2 . HIS B 1 45  ? -11.419 14.457 70.146  1.00 57.34  ? 1231 HIS B NE2 1 
ATOM   3667 N N   . LEU B 1 46  ? -15.765 17.304 65.992  1.00 55.79  ? 1232 LEU B N   1 
ATOM   3668 C CA  . LEU B 1 46  ? -16.439 18.429 65.368  1.00 57.17  ? 1232 LEU B CA  1 
ATOM   3669 C C   . LEU B 1 46  ? -17.842 18.655 65.918  1.00 69.24  ? 1232 LEU B C   1 
ATOM   3670 O O   . LEU B 1 46  ? -18.310 19.802 66.010  1.00 70.89  ? 1232 LEU B O   1 
ATOM   3671 C CB  . LEU B 1 46  ? -16.456 18.290 63.850  1.00 56.71  ? 1232 LEU B CB  1 
ATOM   3672 C CG  . LEU B 1 46  ? -15.129 18.634 63.168  1.00 61.30  ? 1232 LEU B CG  1 
ATOM   3673 C CD1 . LEU B 1 46  ? -15.390 18.828 61.697  1.00 57.04  ? 1232 LEU B CD1 1 
ATOM   3674 C CD2 . LEU B 1 46  ? -14.407 19.862 63.765  1.00 48.15  ? 1232 LEU B CD2 1 
ATOM   3675 N N   . ASP B 1 47  ? -18.496 17.563 66.297  1.00 64.39  ? 1233 ASP B N   1 
ATOM   3676 C CA  . ASP B 1 47  ? -19.776 17.654 66.964  1.00 71.72  ? 1233 ASP B CA  1 
ATOM   3677 C C   . ASP B 1 47  ? -19.610 18.417 68.254  1.00 66.57  ? 1233 ASP B C   1 
ATOM   3678 O O   . ASP B 1 47  ? -20.432 19.253 68.604  1.00 81.61  ? 1233 ASP B O   1 
ATOM   3679 C CB  . ASP B 1 47  ? -20.329 16.268 67.248  1.00 87.39  ? 1233 ASP B CB  1 
ATOM   3680 C CG  . ASP B 1 47  ? -20.654 15.498 65.974  1.00 105.85 ? 1233 ASP B CG  1 
ATOM   3681 O OD1 . ASP B 1 47  ? -20.776 16.118 64.887  1.00 106.93 ? 1233 ASP B OD1 1 
ATOM   3682 O OD2 . ASP B 1 47  ? -20.776 14.259 66.060  1.00 107.30 ? 1233 ASP B OD2 1 
ATOM   3683 N N   . CYS B 1 48  ? -18.513 18.147 68.941  1.00 73.27  ? 1234 CYS B N   1 
ATOM   3684 C CA  . CYS B 1 48  ? -18.203 18.825 70.188  1.00 67.73  ? 1234 CYS B CA  1 
ATOM   3685 C C   . CYS B 1 48  ? -17.517 20.174 70.060  1.00 72.17  ? 1234 CYS B C   1 
ATOM   3686 O O   . CYS B 1 48  ? -17.328 20.852 71.081  1.00 89.74  ? 1234 CYS B O   1 
ATOM   3687 C CB  . CYS B 1 48  ? -17.334 17.930 71.064  1.00 58.09  ? 1234 CYS B CB  1 
ATOM   3688 S SG  . CYS B 1 48  ? -18.235 16.555 71.715  1.00 92.46  ? 1234 CYS B SG  1 
ATOM   3689 N N   . ASP B 1 49  ? -17.136 20.572 68.843  1.00 64.17  ? 1235 ASP B N   1 
ATOM   3690 C CA  . ASP B 1 49  ? -16.346 21.803 68.637  1.00 63.33  ? 1235 ASP B CA  1 
ATOM   3691 C C   . ASP B 1 49  ? -14.940 21.712 69.201  1.00 57.02  ? 1235 ASP B C   1 
ATOM   3692 O O   . ASP B 1 49  ? -14.346 22.737 69.519  1.00 59.86  ? 1235 ASP B O   1 
ATOM   3693 C CB  . ASP B 1 49  ? -17.035 23.042 69.241  1.00 66.52  ? 1235 ASP B CB  1 
ATOM   3694 C CG  . ASP B 1 49  ? -18.220 23.507 68.425  1.00 97.89  ? 1235 ASP B CG  1 
ATOM   3695 O OD1 . ASP B 1 49  ? -18.607 22.778 67.476  1.00 108.37 ? 1235 ASP B OD1 1 
ATOM   3696 O OD2 . ASP B 1 49  ? -18.767 24.597 68.728  1.00 100.34 ? 1235 ASP B OD2 1 
ATOM   3697 N N   . ASN B 1 50  ? -14.424 20.496 69.355  1.00 49.54  ? 1236 ASN B N   1 
ATOM   3698 C CA  . ASN B 1 50  ? -13.032 20.298 69.734  1.00 58.87  ? 1236 ASN B CA  1 
ATOM   3699 C C   . ASN B 1 50  ? -12.137 20.445 68.523  1.00 60.82  ? 1236 ASN B C   1 
ATOM   3700 O O   . ASN B 1 50  ? -11.713 19.458 67.898  1.00 52.40  ? 1236 ASN B O   1 
ATOM   3701 C CB  . ASN B 1 50  ? -12.818 18.911 70.297  1.00 67.39  ? 1236 ASN B CB  1 
ATOM   3702 C CG  . ASN B 1 50  ? -13.676 18.623 71.468  1.00 64.57  ? 1236 ASN B CG  1 
ATOM   3703 O OD1 . ASN B 1 50  ? -14.284 19.519 72.082  1.00 64.77  ? 1236 ASN B OD1 1 
ATOM   3704 N ND2 . ASN B 1 50  ? -13.743 17.352 71.802  1.00 49.62  ? 1236 ASN B ND2 1 
ATOM   3705 N N   . TYR B 1 51  ? -11.833 21.681 68.185  1.00 47.77  ? 1237 TYR B N   1 
ATOM   3706 C CA  . TYR B 1 51  ? -11.099 21.887 66.991  1.00 49.63  ? 1237 TYR B CA  1 
ATOM   3707 C C   . TYR B 1 51  ? -9.691  21.339 67.129  1.00 56.86  ? 1237 TYR B C   1 
ATOM   3708 O O   . TYR B 1 51  ? -9.206  20.610 66.242  1.00 49.23  ? 1237 TYR B O   1 
ATOM   3709 C CB  . TYR B 1 51  ? -11.127 23.344 66.641  1.00 55.30  ? 1237 TYR B CB  1 
ATOM   3710 C CG  . TYR B 1 51  ? -12.512 23.776 66.290  1.00 55.31  ? 1237 TYR B CG  1 
ATOM   3711 C CD1 . TYR B 1 51  ? -13.110 23.330 65.116  1.00 72.83  ? 1237 TYR B CD1 1 
ATOM   3712 C CD2 . TYR B 1 51  ? -13.233 24.620 67.127  1.00 75.97  ? 1237 TYR B CD2 1 
ATOM   3713 C CE1 . TYR B 1 51  ? -14.391 23.718 64.769  1.00 79.88  ? 1237 TYR B CE1 1 
ATOM   3714 C CE2 . TYR B 1 51  ? -14.522 25.020 66.797  1.00 90.08  ? 1237 TYR B CE2 1 
ATOM   3715 C CZ  . TYR B 1 51  ? -15.094 24.558 65.612  1.00 92.45  ? 1237 TYR B CZ  1 
ATOM   3716 O OH  . TYR B 1 51  ? -16.365 24.937 65.256  1.00 113.37 ? 1237 TYR B OH  1 
ATOM   3717 N N   . THR B 1 52  ? -9.052  21.628 68.251  1.00 38.29  ? 1238 THR B N   1 
ATOM   3718 C CA  . THR B 1 52  ? -7.658  21.339 68.283  1.00 50.39  ? 1238 THR B CA  1 
ATOM   3719 C C   . THR B 1 52  ? -7.437  19.834 68.264  1.00 43.99  ? 1238 THR B C   1 
ATOM   3720 O O   . THR B 1 52  ? -6.569  19.301 67.574  1.00 37.69  ? 1238 THR B O   1 
ATOM   3721 C CB  . THR B 1 52  ? -6.882  22.124 69.380  1.00 32.88  ? 1238 THR B CB  1 
ATOM   3722 O OG1 . THR B 1 52  ? -6.329  21.235 70.335  1.00 44.84  ? 1238 THR B OG1 1 
ATOM   3723 C CG2 . THR B 1 52  ? -7.741  23.133 70.065  1.00 56.87  ? 1238 THR B CG2 1 
ATOM   3724 N N   . GLU B 1 53  ? -8.285  19.139 68.975  1.00 38.93  ? 1239 GLU B N   1 
ATOM   3725 C CA  . GLU B 1 53  ? -8.174  17.689 68.997  1.00 53.74  ? 1239 GLU B CA  1 
ATOM   3726 C C   . GLU B 1 53  ? -8.564  17.134 67.623  1.00 50.20  ? 1239 GLU B C   1 
ATOM   3727 O O   . GLU B 1 53  ? -7.899  16.228 67.123  1.00 52.16  ? 1239 GLU B O   1 
ATOM   3728 C CB  . GLU B 1 53  ? -8.954  17.080 70.170  1.00 33.13  ? 1239 GLU B CB  1 
ATOM   3729 C CG  . GLU B 1 53  ? -9.887  18.092 70.836  1.00 52.45  ? 1239 GLU B CG  1 
ATOM   3730 C CD  . GLU B 1 53  ? -9.204  19.050 71.791  1.00 51.48  ? 1239 GLU B CD  1 
ATOM   3731 O OE1 . GLU B 1 53  ? -8.284  18.618 72.514  1.00 56.03  ? 1239 GLU B OE1 1 
ATOM   3732 O OE2 . GLU B 1 53  ? -9.603  20.234 71.835  1.00 63.45  ? 1239 GLU B OE2 1 
ATOM   3733 N N   . ALA B 1 54  ? -9.559  17.733 66.964  1.00 49.76  ? 1240 ALA B N   1 
ATOM   3734 C CA  . ALA B 1 54  ? -9.836  17.360 65.565  1.00 54.42  ? 1240 ALA B CA  1 
ATOM   3735 C C   . ALA B 1 54  ? -8.628  17.538 64.644  1.00 52.62  ? 1240 ALA B C   1 
ATOM   3736 O O   . ALA B 1 54  ? -8.303  16.662 63.832  1.00 47.82  ? 1240 ALA B O   1 
ATOM   3737 C CB  . ALA B 1 54  ? -10.990 18.124 65.032  1.00 58.28  ? 1240 ALA B CB  1 
ATOM   3738 N N   . ALA B 1 55  ? -7.958  18.676 64.773  1.00 43.77  ? 1241 ALA B N   1 
ATOM   3739 C CA  . ALA B 1 55  ? -6.747  18.924 64.026  1.00 31.44  ? 1241 ALA B CA  1 
ATOM   3740 C C   . ALA B 1 55  ? -5.644  17.918 64.301  1.00 47.16  ? 1241 ALA B C   1 
ATOM   3741 O O   . ALA B 1 55  ? -4.952  17.498 63.383  1.00 52.60  ? 1241 ALA B O   1 
ATOM   3742 C CB  . ALA B 1 55  ? -6.262  20.276 64.331  1.00 48.19  ? 1241 ALA B CB  1 
ATOM   3743 N N   . TYR B 1 56  ? -5.442  17.538 65.554  1.00 39.28  ? 1242 TYR B N   1 
ATOM   3744 C CA  . TYR B 1 56  ? -4.372  16.602 65.838  1.00 38.77  ? 1242 TYR B CA  1 
ATOM   3745 C C   . TYR B 1 56  ? -4.684  15.254 65.281  1.00 49.51  ? 1242 TYR B C   1 
ATOM   3746 O O   . TYR B 1 56  ? -3.754  14.468 65.011  1.00 47.73  ? 1242 TYR B O   1 
ATOM   3747 C CB  . TYR B 1 56  ? -4.135  16.456 67.322  1.00 49.34  ? 1242 TYR B CB  1 
ATOM   3748 C CG  . TYR B 1 56  ? -3.233  17.507 67.878  1.00 43.07  ? 1242 TYR B CG  1 
ATOM   3749 C CD1 . TYR B 1 56  ? -1.918  17.597 67.469  1.00 43.55  ? 1242 TYR B CD1 1 
ATOM   3750 C CD2 . TYR B 1 56  ? -3.706  18.438 68.790  1.00 45.58  ? 1242 TYR B CD2 1 
ATOM   3751 C CE1 . TYR B 1 56  ? -1.093  18.559 67.966  1.00 38.99  ? 1242 TYR B CE1 1 
ATOM   3752 C CE2 . TYR B 1 56  ? -2.899  19.415 69.292  1.00 36.72  ? 1242 TYR B CE2 1 
ATOM   3753 C CZ  . TYR B 1 56  ? -1.587  19.470 68.894  1.00 46.63  ? 1242 TYR B CZ  1 
ATOM   3754 O OH  . TYR B 1 56  ? -0.757  20.457 69.407  1.00 44.39  ? 1242 TYR B OH  1 
ATOM   3755 N N   . THR B 1 57  ? -5.978  14.959 65.117  1.00 32.38  ? 1243 THR B N   1 
ATOM   3756 C CA  . THR B 1 57  ? -6.316  13.618 64.674  1.00 52.74  ? 1243 THR B CA  1 
ATOM   3757 C C   . THR B 1 57  ? -6.053  13.481 63.187  1.00 56.38  ? 1243 THR B C   1 
ATOM   3758 O O   . THR B 1 57  ? -5.458  12.485 62.750  1.00 53.18  ? 1243 THR B O   1 
ATOM   3759 C CB  . THR B 1 57  ? -7.707  13.081 65.165  1.00 47.44  ? 1243 THR B CB  1 
ATOM   3760 O OG1 . THR B 1 57  ? -8.660  13.046 64.109  1.00 66.62  ? 1243 THR B OG1 1 
ATOM   3761 C CG2 . THR B 1 57  ? -8.248  13.900 66.284  1.00 54.32  ? 1243 THR B CG2 1 
ATOM   3762 N N   . LEU B 1 58  ? -6.424  14.517 62.426  1.00 41.58  ? 1244 LEU B N   1 
ATOM   3763 C CA  . LEU B 1 58  ? -6.066  14.563 61.009  1.00 39.56  ? 1244 LEU B CA  1 
ATOM   3764 C C   . LEU B 1 58  ? -4.567  14.416 60.778  1.00 52.49  ? 1244 LEU B C   1 
ATOM   3765 O O   . LEU B 1 58  ? -4.143  13.812 59.798  1.00 56.02  ? 1244 LEU B O   1 
ATOM   3766 C CB  . LEU B 1 58  ? -6.635  15.788 60.306  1.00 32.84  ? 1244 LEU B CB  1 
ATOM   3767 C CG  . LEU B 1 58  ? -8.113  15.585 59.939  1.00 51.66  ? 1244 LEU B CG  1 
ATOM   3768 C CD1 . LEU B 1 58  ? -8.689  16.716 59.127  1.00 48.06  ? 1244 LEU B CD1 1 
ATOM   3769 C CD2 . LEU B 1 58  ? -8.310  14.276 59.223  1.00 34.16  ? 1244 LEU B CD2 1 
ATOM   3770 N N   . LEU B 1 59  ? -3.756  14.955 61.678  1.00 46.96  ? 1245 LEU B N   1 
ATOM   3771 C CA  . LEU B 1 59  ? -2.303  14.833 61.551  1.00 46.75  ? 1245 LEU B CA  1 
ATOM   3772 C C   . LEU B 1 59  ? -1.865  13.390 61.484  1.00 59.81  ? 1245 LEU B C   1 
ATOM   3773 O O   . LEU B 1 59  ? -0.735  13.099 61.046  1.00 66.64  ? 1245 LEU B O   1 
ATOM   3774 C CB  . LEU B 1 59  ? -1.581  15.506 62.716  1.00 35.79  ? 1245 LEU B CB  1 
ATOM   3775 C CG  . LEU B 1 59  ? -1.306  16.973 62.465  1.00 46.31  ? 1245 LEU B CG  1 
ATOM   3776 C CD1 . LEU B 1 59  ? -0.501  17.529 63.613  1.00 42.14  ? 1245 LEU B CD1 1 
ATOM   3777 C CD2 . LEU B 1 59  ? -0.560  17.167 61.161  1.00 41.15  ? 1245 LEU B CD2 1 
ATOM   3778 N N   . LEU B 1 60  ? -2.744  12.488 61.927  1.00 52.71  ? 1246 LEU B N   1 
ATOM   3779 C CA  . LEU B 1 60  ? -2.396  11.073 61.912  1.00 53.81  ? 1246 LEU B CA  1 
ATOM   3780 C C   . LEU B 1 60  ? -2.420  10.527 60.494  1.00 61.30  ? 1246 LEU B C   1 
ATOM   3781 O O   . LEU B 1 60  ? -1.593  9.683  60.129  1.00 62.51  ? 1246 LEU B O   1 
ATOM   3782 C CB  . LEU B 1 60  ? -3.306  10.266 62.828  1.00 56.98  ? 1246 LEU B CB  1 
ATOM   3783 C CG  . LEU B 1 60  ? -3.153  10.592 64.307  1.00 50.83  ? 1246 LEU B CG  1 
ATOM   3784 C CD1 . LEU B 1 60  ? -4.144  9.778  65.147  1.00 55.95  ? 1246 LEU B CD1 1 
ATOM   3785 C CD2 . LEU B 1 60  ? -1.699  10.381 64.754  1.00 43.31  ? 1246 LEU B CD2 1 
ATOM   3786 N N   . HIS B 1 61  ? -3.362  11.040 59.708  1.00 49.77  ? 1247 HIS B N   1 
ATOM   3787 C CA  . HIS B 1 61  ? -3.408  10.808 58.276  1.00 49.16  ? 1247 HIS B CA  1 
ATOM   3788 C C   . HIS B 1 61  ? -2.172  11.309 57.543  1.00 54.25  ? 1247 HIS B C   1 
ATOM   3789 O O   . HIS B 1 61  ? -1.550  10.545 56.803  1.00 67.89  ? 1247 HIS B O   1 
ATOM   3790 C CB  . HIS B 1 61  ? -4.619  11.479 57.644  1.00 44.16  ? 1247 HIS B CB  1 
ATOM   3791 C CG  . HIS B 1 61  ? -4.996  10.915 56.308  1.00 61.76  ? 1247 HIS B CG  1 
ATOM   3792 N ND1 . HIS B 1 61  ? -6.181  11.233 55.672  1.00 67.17  ? 1247 HIS B ND1 1 
ATOM   3793 C CD2 . HIS B 1 61  ? -4.358  10.035 55.498  1.00 45.73  ? 1247 HIS B CD2 1 
ATOM   3794 C CE1 . HIS B 1 61  ? -6.253  10.585 54.524  1.00 56.30  ? 1247 HIS B CE1 1 
ATOM   3795 N NE2 . HIS B 1 61  ? -5.160  9.846  54.397  1.00 63.58  ? 1247 HIS B NE2 1 
ATOM   3796 N N   . THR B 1 62  ? -1.817  12.578 57.710  1.00 45.11  ? 1248 THR B N   1 
ATOM   3797 C CA  . THR B 1 62  ? -0.714  13.127 56.942  1.00 52.16  ? 1248 THR B CA  1 
ATOM   3798 C C   . THR B 1 62  ? 0.626   12.514 57.335  1.00 55.11  ? 1248 THR B C   1 
ATOM   3799 O O   . THR B 1 62  ? 1.576   12.577 56.582  1.00 56.63  ? 1248 THR B O   1 
ATOM   3800 C CB  . THR B 1 62  ? -0.593  14.592 57.161  1.00 65.77  ? 1248 THR B CB  1 
ATOM   3801 O OG1 . THR B 1 62  ? -0.047  14.799 58.466  1.00 48.38  ? 1248 THR B OG1 1 
ATOM   3802 C CG2 . THR B 1 62  ? -1.947  15.277 57.049  1.00 47.20  ? 1248 THR B CG2 1 
ATOM   3803 N N   . TRP B 1 63  ? 0.719   11.948 58.527  1.00 56.50  ? 1249 TRP B N   1 
ATOM   3804 C CA  . TRP B 1 63  ? 1.902   11.199 58.914  1.00 58.01  ? 1249 TRP B CA  1 
ATOM   3805 C C   . TRP B 1 63  ? 2.166   10.065 57.928  1.00 62.95  ? 1249 TRP B C   1 
ATOM   3806 O O   . TRP B 1 63  ? 3.293   9.608  57.787  1.00 77.02  ? 1249 TRP B O   1 
ATOM   3807 C CB  . TRP B 1 63  ? 1.707   10.611 60.303  1.00 65.32  ? 1249 TRP B CB  1 
ATOM   3808 C CG  . TRP B 1 63  ? 2.951   10.028 60.851  1.00 95.40  ? 1249 TRP B CG  1 
ATOM   3809 C CD1 . TRP B 1 63  ? 3.317   8.698  60.868  1.00 101.03 ? 1249 TRP B CD1 1 
ATOM   3810 C CD2 . TRP B 1 63  ? 4.030   10.753 61.448  1.00 112.84 ? 1249 TRP B CD2 1 
ATOM   3811 N NE1 . TRP B 1 63  ? 4.561   8.556  61.453  1.00 103.21 ? 1249 TRP B NE1 1 
ATOM   3812 C CE2 . TRP B 1 63  ? 5.027   9.798  61.816  1.00 117.69 ? 1249 TRP B CE2 1 
ATOM   3813 C CE3 . TRP B 1 63  ? 4.256   12.117 61.715  1.00 103.15 ? 1249 TRP B CE3 1 
ATOM   3814 C CZ2 . TRP B 1 63  ? 6.240   10.170 62.440  1.00 117.79 ? 1249 TRP B CZ2 1 
ATOM   3815 C CZ3 . TRP B 1 63  ? 5.460   12.486 62.338  1.00 103.71 ? 1249 TRP B CZ3 1 
ATOM   3816 C CH2 . TRP B 1 63  ? 6.434   11.510 62.697  1.00 111.61 ? 1249 TRP B CH2 1 
ATOM   3817 N N   . LEU B 1 64  ? 1.115   9.607  57.256  1.00 62.25  ? 1250 LEU B N   1 
ATOM   3818 C CA  . LEU B 1 64  ? 1.198   8.528  56.285  1.00 55.42  ? 1250 LEU B CA  1 
ATOM   3819 C C   . LEU B 1 64  ? 1.523   9.051  54.900  1.00 73.49  ? 1250 LEU B C   1 
ATOM   3820 O O   . LEU B 1 64  ? 1.959   8.313  54.031  1.00 70.11  ? 1250 LEU B O   1 
ATOM   3821 C CB  . LEU B 1 64  ? -0.139  7.818  56.224  1.00 44.81  ? 1250 LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 64  ? -0.492  7.123  57.516  1.00 60.88  ? 1250 LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 64  ? -1.836  6.460  57.316  1.00 50.62  ? 1250 LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 64  ? 0.604   6.113  57.842  1.00 55.01  ? 1250 LEU B CD2 1 
ATOM   3825 N N   . LEU B 1 65  ? 1.273   10.330 54.674  1.00 75.51  ? 1251 LEU B N   1 
ATOM   3826 C CA  . LEU B 1 65  ? 1.512   10.897 53.358  1.00 68.17  ? 1251 LEU B CA  1 
ATOM   3827 C C   . LEU B 1 65  ? 2.914   11.457 53.218  1.00 72.57  ? 1251 LEU B C   1 
ATOM   3828 O O   . LEU B 1 65  ? 3.623   11.644 54.203  1.00 82.64  ? 1251 LEU B O   1 
ATOM   3829 C CB  . LEU B 1 65  ? 0.470   11.968 53.049  1.00 72.32  ? 1251 LEU B CB  1 
ATOM   3830 C CG  . LEU B 1 65  ? -0.972  11.473 53.119  1.00 62.47  ? 1251 LEU B CG  1 
ATOM   3831 C CD1 . LEU B 1 65  ? -1.948  12.615 52.970  1.00 56.43  ? 1251 LEU B CD1 1 
ATOM   3832 C CD2 . LEU B 1 65  ? -1.215  10.416 52.070  1.00 45.41  ? 1251 LEU B CD2 1 
ATOM   3833 N N   . LYS B 1 66  ? 3.310   11.717 51.981  1.00 79.76  ? 1252 LYS B N   1 
ATOM   3834 C CA  . LYS B 1 66  ? 4.624   12.270 51.713  1.00 86.55  ? 1252 LYS B CA  1 
ATOM   3835 C C   . LYS B 1 66  ? 4.539   13.256 50.564  1.00 86.46  ? 1252 LYS B C   1 
ATOM   3836 O O   . LYS B 1 66  ? 3.601   13.221 49.772  1.00 74.45  ? 1252 LYS B O   1 
ATOM   3837 C CB  . LYS B 1 66  ? 5.629   11.169 51.392  1.00 80.62  ? 1252 LYS B CB  1 
ATOM   3838 C CG  . LYS B 1 66  ? 7.051   11.554 51.731  1.00 92.48  ? 1252 LYS B CG  1 
ATOM   3839 C CD  . LYS B 1 66  ? 7.313   13.003 51.368  1.00 98.42  ? 1252 LYS B CD  1 
ATOM   3840 C CE  . LYS B 1 66  ? 8.461   13.569 52.177  1.00 97.79  ? 1252 LYS B CE  1 
ATOM   3841 N NZ  . LYS B 1 66  ? 8.137   13.589 53.628  1.00 102.87 ? 1252 LYS B NZ  1 
ATOM   3842 N N   . TRP B 1 67  ? 5.522   14.140 50.481  1.00 71.34  ? 1253 TRP B N   1 
ATOM   3843 C CA  . TRP B 1 67  ? 5.545   15.144 49.435  1.00 83.51  ? 1253 TRP B CA  1 
ATOM   3844 C C   . TRP B 1 67  ? 6.080   14.574 48.129  1.00 85.04  ? 1253 TRP B C   1 
ATOM   3845 O O   . TRP B 1 67  ? 7.189   14.893 47.710  1.00 89.09  ? 1253 TRP B O   1 
ATOM   3846 C CB  . TRP B 1 67  ? 6.384   16.341 49.875  1.00 87.66  ? 1253 TRP B CB  1 
ATOM   3847 C CG  . TRP B 1 67  ? 5.987   16.903 51.208  1.00 75.41  ? 1253 TRP B CG  1 
ATOM   3848 C CD1 . TRP B 1 67  ? 6.654   16.763 52.386  1.00 69.27  ? 1253 TRP B CD1 1 
ATOM   3849 C CD2 . TRP B 1 67  ? 4.833   17.700 51.495  1.00 71.96  ? 1253 TRP B CD2 1 
ATOM   3850 N NE1 . TRP B 1 67  ? 5.991   17.423 53.389  1.00 55.86  ? 1253 TRP B NE1 1 
ATOM   3851 C CE2 . TRP B 1 67  ? 4.869   18.005 52.867  1.00 60.87  ? 1253 TRP B CE2 1 
ATOM   3852 C CE3 . TRP B 1 67  ? 3.774   18.184 50.724  1.00 81.65  ? 1253 TRP B CE3 1 
ATOM   3853 C CZ2 . TRP B 1 67  ? 3.888   18.770 53.483  1.00 63.60  ? 1253 TRP B CZ2 1 
ATOM   3854 C CZ3 . TRP B 1 67  ? 2.803   18.943 51.339  1.00 56.74  ? 1253 TRP B CZ3 1 
ATOM   3855 C CH2 . TRP B 1 67  ? 2.866   19.229 52.704  1.00 64.47  ? 1253 TRP B CH2 1 
ATOM   3856 N N   . SER B 1 68  ? 5.280   13.726 47.492  1.00 94.65  ? 1254 SER B N   1 
ATOM   3857 C CA  . SER B 1 68  ? 5.651   13.112 46.227  1.00 92.11  ? 1254 SER B CA  1 
ATOM   3858 C C   . SER B 1 68  ? 4.510   13.281 45.235  1.00 89.66  ? 1254 SER B C   1 
ATOM   3859 O O   . SER B 1 68  ? 3.439   13.766 45.587  1.00 100.53 ? 1254 SER B O   1 
ATOM   3860 C CB  . SER B 1 68  ? 5.976   11.631 46.413  1.00 102.75 ? 1254 SER B CB  1 
ATOM   3861 O OG  . SER B 1 68  ? 7.205   11.459 47.092  1.00 96.68  ? 1254 SER B OG  1 
ATOM   3862 N N   . ASP B 1 69  ? 4.746   12.884 43.993  1.00 90.83  ? 1255 ASP B N   1 
ATOM   3863 C CA  . ASP B 1 69  ? 3.728   12.992 42.957  1.00 105.22 ? 1255 ASP B CA  1 
ATOM   3864 C C   . ASP B 1 69  ? 2.927   11.701 42.806  1.00 121.55 ? 1255 ASP B C   1 
ATOM   3865 O O   . ASP B 1 69  ? 2.025   11.612 41.976  1.00 138.84 ? 1255 ASP B O   1 
ATOM   3866 C CB  . ASP B 1 69  ? 4.358   13.410 41.630  1.00 105.40 ? 1255 ASP B CB  1 
ATOM   3867 C CG  . ASP B 1 69  ? 4.964   14.794 41.694  1.00 122.15 ? 1255 ASP B CG  1 
ATOM   3868 O OD1 . ASP B 1 69  ? 5.043   15.349 42.808  1.00 104.01 ? 1255 ASP B OD1 1 
ATOM   3869 O OD2 . ASP B 1 69  ? 5.357   15.329 40.638  1.00 138.86 ? 1255 ASP B OD2 1 
ATOM   3870 N N   . GLU B 1 70  ? 3.267   10.704 43.614  1.00 103.82 ? 1256 GLU B N   1 
ATOM   3871 C CA  . GLU B 1 70  ? 2.588   9.416  43.579  1.00 92.99  ? 1256 GLU B CA  1 
ATOM   3872 C C   . GLU B 1 70  ? 1.128   9.541  43.989  1.00 95.87  ? 1256 GLU B C   1 
ATOM   3873 O O   . GLU B 1 70  ? 0.516   8.573  44.439  1.00 81.02  ? 1256 GLU B O   1 
ATOM   3874 C CB  . GLU B 1 70  ? 3.298   8.430  44.501  1.00 98.74  ? 1256 GLU B CB  1 
ATOM   3875 C CG  . GLU B 1 70  ? 4.802   8.410  44.318  1.00 114.82 ? 1256 GLU B CG  1 
ATOM   3876 C CD  . GLU B 1 70  ? 5.506   7.585  45.373  1.00 128.11 ? 1256 GLU B CD  1 
ATOM   3877 O OE1 . GLU B 1 70  ? 4.815   7.016  46.243  1.00 117.82 ? 1256 GLU B OE1 1 
ATOM   3878 O OE2 . GLU B 1 70  ? 6.752   7.508  45.332  1.00 133.45 ? 1256 GLU B OE2 1 
ATOM   3879 N N   . GLN B 1 85  ? -5.789  12.423 43.127  1.00 112.35 ? 1271 GLN B N   1 
ATOM   3880 C CA  . GLN B 1 85  ? -5.072  13.529 43.705  1.00 110.73 ? 1271 GLN B CA  1 
ATOM   3881 C C   . GLN B 1 85  ? -3.862  12.833 44.250  1.00 96.89  ? 1271 GLN B C   1 
ATOM   3882 O O   . GLN B 1 85  ? -3.992  11.843 44.937  1.00 111.55 ? 1271 GLN B O   1 
ATOM   3883 C CB  . GLN B 1 85  ? -5.870  14.266 44.784  1.00 115.15 ? 1271 GLN B CB  1 
ATOM   3884 C CG  . GLN B 1 85  ? -7.026  15.093 44.246  1.00 139.20 ? 1271 GLN B CG  1 
ATOM   3885 C CD  . GLN B 1 85  ? -7.835  15.748 45.346  1.00 134.50 ? 1271 GLN B CD  1 
ATOM   3886 O OE1 . GLN B 1 85  ? -7.859  15.267 46.479  1.00 122.06 ? 1271 GLN B OE1 1 
ATOM   3887 N NE2 . GLN B 1 85  ? -8.502  16.850 45.016  1.00 134.37 ? 1271 GLN B NE2 1 
ATOM   3888 N N   . THR B 1 86  ? -2.677  13.308 43.922  1.00 74.81  ? 1272 THR B N   1 
ATOM   3889 C CA  . THR B 1 86  ? -1.481  12.615 44.349  1.00 85.13  ? 1272 THR B CA  1 
ATOM   3890 C C   . THR B 1 86  ? -1.127  12.996 45.759  1.00 94.77  ? 1272 THR B C   1 
ATOM   3891 O O   . THR B 1 86  ? -1.798  13.810 46.353  1.00 99.06  ? 1272 THR B O   1 
ATOM   3892 C CB  . THR B 1 86  ? -0.334  12.820 43.396  1.00 111.62 ? 1272 THR B CB  1 
ATOM   3893 O OG1 . THR B 1 86  ? 0.632   13.672 43.991  1.00 111.63 ? 1272 THR B OG1 1 
ATOM   3894 C CG2 . THR B 1 86  ? -0.820  13.505 42.195  1.00 117.32 ? 1272 THR B CG2 1 
ATOM   3895 N N   . HIS B 1 87  ? -0.069  12.411 46.295  1.00 83.61  ? 1273 HIS B N   1 
ATOM   3896 C CA  . HIS B 1 87  ? 0.259   12.590 47.695  1.00 76.42  ? 1273 HIS B CA  1 
ATOM   3897 C C   . HIS B 1 87  ? 0.459   14.017 48.140  1.00 83.86  ? 1273 HIS B C   1 
ATOM   3898 O O   . HIS B 1 87  ? -0.059  14.446 49.167  1.00 85.18  ? 1273 HIS B O   1 
ATOM   3899 C CB  . HIS B 1 87  ? 1.592   11.908 47.980  1.00 67.47  ? 1273 HIS B CB  1 
ATOM   3900 C CG  . HIS B 1 87  ? 1.478   10.486 48.417  1.00 89.76  ? 1273 HIS B CG  1 
ATOM   3901 N ND1 . HIS B 1 87  ? 2.387   9.885  49.250  1.00 87.95  ? 1273 HIS B ND1 1 
ATOM   3902 C CD2 . HIS B 1 87  ? 0.561   9.540  48.123  1.00 89.68  ? 1273 HIS B CD2 1 
ATOM   3903 C CE1 . HIS B 1 87  ? 2.037   8.631  49.461  1.00 81.67  ? 1273 HIS B CE1 1 
ATOM   3904 N NE2 . HIS B 1 87  ? 0.926   8.400  48.779  1.00 82.22  ? 1273 HIS B NE2 1 
ATOM   3905 N N   . ARG B 1 88  ? 1.213   14.765 47.367  1.00 91.81  ? 1274 ARG B N   1 
ATOM   3906 C CA  . ARG B 1 88  ? 1.472   16.142 47.703  1.00 80.67  ? 1274 ARG B CA  1 
ATOM   3907 C C   . ARG B 1 88  ? 0.209   16.980 47.699  1.00 72.75  ? 1274 ARG B C   1 
ATOM   3908 O O   . ARG B 1 88  ? 0.018   17.806 48.553  1.00 73.45  ? 1274 ARG B O   1 
ATOM   3909 C CB  . ARG B 1 88  ? 2.500   16.724 46.755  1.00 76.82  ? 1274 ARG B CB  1 
ATOM   3910 C CG  . ARG B 1 88  ? 2.506   18.227 46.715  1.00 68.56  ? 1274 ARG B CG  1 
ATOM   3911 C CD  . ARG B 1 88  ? 3.351   18.729 45.580  1.00 64.88  ? 1274 ARG B CD  1 
ATOM   3912 N NE  . ARG B 1 88  ? 4.625   18.035 45.498  1.00 69.92  ? 1274 ARG B NE  1 
ATOM   3913 C CZ  . ARG B 1 88  ? 5.675   18.330 46.242  1.00 73.35  ? 1274 ARG B CZ  1 
ATOM   3914 N NH1 . ARG B 1 88  ? 5.597   19.294 47.131  1.00 72.14  ? 1274 ARG B NH1 1 
ATOM   3915 N NH2 . ARG B 1 88  ? 6.796   17.655 46.105  1.00 60.84  ? 1274 ARG B NH2 1 
ATOM   3916 N N   . GLN B 1 89  ? -0.675  16.783 46.733  1.00 79.44  ? 1275 GLN B N   1 
ATOM   3917 C CA  . GLN B 1 89  ? -1.891  17.592 46.738  1.00 84.13  ? 1275 GLN B CA  1 
ATOM   3918 C C   . GLN B 1 89  ? -2.782  17.202 47.891  1.00 79.01  ? 1275 GLN B C   1 
ATOM   3919 O O   . GLN B 1 89  ? -3.490  18.061 48.427  1.00 71.82  ? 1275 GLN B O   1 
ATOM   3920 C CB  . GLN B 1 89  ? -2.687  17.580 45.418  1.00 83.79  ? 1275 GLN B CB  1 
ATOM   3921 C CG  . GLN B 1 89  ? -2.975  16.201 44.810  1.00 112.94 ? 1275 GLN B CG  1 
ATOM   3922 C CD  . GLN B 1 89  ? -1.926  15.822 43.763  1.00 114.88 ? 1275 GLN B CD  1 
ATOM   3923 O OE1 . GLN B 1 89  ? -0.848  15.301 44.091  1.00 115.83 ? 1275 GLN B OE1 1 
ATOM   3924 N NE2 . GLN B 1 89  ? -2.230  16.116 42.494  1.00 82.13  ? 1275 GLN B NE2 1 
ATOM   3925 N N   . LEU B 1 90  ? -2.761  15.921 48.268  1.00 69.17  ? 1276 LEU B N   1 
ATOM   3926 C CA  . LEU B 1 90  ? -3.653  15.450 49.321  1.00 61.13  ? 1276 LEU B CA  1 
ATOM   3927 C C   . LEU B 1 90  ? -3.118  15.938 50.634  1.00 58.98  ? 1276 LEU B C   1 
ATOM   3928 O O   . LEU B 1 90  ? -3.860  16.505 51.431  1.00 53.44  ? 1276 LEU B O   1 
ATOM   3929 C CB  . LEU B 1 90  ? -3.821  13.930 49.346  1.00 46.81  ? 1276 LEU B CB  1 
ATOM   3930 C CG  . LEU B 1 90  ? -4.717  13.447 50.509  1.00 58.14  ? 1276 LEU B CG  1 
ATOM   3931 C CD1 . LEU B 1 90  ? -6.098  14.130 50.526  1.00 51.03  ? 1276 LEU B CD1 1 
ATOM   3932 C CD2 . LEU B 1 90  ? -4.862  11.934 50.587  1.00 41.73  ? 1276 LEU B CD2 1 
ATOM   3933 N N   . LYS B 1 91  ? -1.825  15.729 50.852  1.00 56.23  ? 1277 LYS B N   1 
ATOM   3934 C CA  . LYS B 1 91  ? -1.200  16.220 52.050  1.00 53.47  ? 1277 LYS B CA  1 
ATOM   3935 C C   . LYS B 1 91  ? -1.413  17.708 52.152  1.00 63.84  ? 1277 LYS B C   1 
ATOM   3936 O O   . LYS B 1 91  ? -1.585  18.233 53.258  1.00 68.66  ? 1277 LYS B O   1 
ATOM   3937 C CB  . LYS B 1 91  ? 0.270   15.912 52.044  1.00 50.79  ? 1277 LYS B CB  1 
ATOM   3938 C CG  . LYS B 1 91  ? 0.928   16.024 53.384  1.00 47.05  ? 1277 LYS B CG  1 
ATOM   3939 C CD  . LYS B 1 91  ? 2.263   15.282 53.333  1.00 53.68  ? 1277 LYS B CD  1 
ATOM   3940 C CE  . LYS B 1 91  ? 2.893   15.226 54.702  1.00 58.44  ? 1277 LYS B CE  1 
ATOM   3941 N NZ  . LYS B 1 91  ? 4.191   14.516 54.729  1.00 62.34  ? 1277 LYS B NZ  1 
ATOM   3942 N N   . GLU B 1 92  ? -1.440  18.384 51.005  1.00 57.18  ? 1278 GLU B N   1 
ATOM   3943 C CA  . GLU B 1 92  ? -1.643  19.827 50.970  1.00 61.51  ? 1278 GLU B CA  1 
ATOM   3944 C C   . GLU B 1 92  ? -3.050  20.216 51.365  1.00 58.58  ? 1278 GLU B C   1 
ATOM   3945 O O   . GLU B 1 92  ? -3.254  21.140 52.137  1.00 46.53  ? 1278 GLU B O   1 
ATOM   3946 C CB  . GLU B 1 92  ? -1.343  20.377 49.585  1.00 69.35  ? 1278 GLU B CB  1 
ATOM   3947 C CG  . GLU B 1 92  ? -1.862  21.804 49.376  1.00 88.93  ? 1278 GLU B CG  1 
ATOM   3948 C CD  . GLU B 1 92  ? -1.678  22.304 47.958  1.00 100.33 ? 1278 GLU B CD  1 
ATOM   3949 O OE1 . GLU B 1 92  ? -0.522  22.309 47.462  1.00 89.33  ? 1278 GLU B OE1 1 
ATOM   3950 O OE2 . GLU B 1 92  ? -2.703  22.701 47.358  1.00 112.41 ? 1278 GLU B OE2 1 
ATOM   3951 N N   . THR B 1 93  ? -4.026  19.514 50.822  1.00 59.03  ? 1279 THR B N   1 
ATOM   3952 C CA  . THR B 1 93  ? -5.400  19.848 51.113  1.00 66.55  ? 1279 THR B CA  1 
ATOM   3953 C C   . THR B 1 93  ? -5.662  19.625 52.570  1.00 59.20  ? 1279 THR B C   1 
ATOM   3954 O O   . THR B 1 93  ? -6.337  20.433 53.214  1.00 56.04  ? 1279 THR B O   1 
ATOM   3955 C CB  . THR B 1 93  ? -6.365  19.018 50.304  1.00 68.60  ? 1279 THR B CB  1 
ATOM   3956 O OG1 . THR B 1 93  ? -5.706  17.810 49.920  1.00 89.10  ? 1279 THR B OG1 1 
ATOM   3957 C CG2 . THR B 1 93  ? -6.790  19.801 49.051  1.00 46.59  ? 1279 THR B CG2 1 
ATOM   3958 N N   . LEU B 1 94  ? -5.088  18.535 53.077  1.00 63.55  ? 1280 LEU B N   1 
ATOM   3959 C CA  . LEU B 1 94  ? -5.125  18.178 54.500  1.00 64.58  ? 1280 LEU B CA  1 
ATOM   3960 C C   . LEU B 1 94  ? -4.489  19.209 55.440  1.00 71.25  ? 1280 LEU B C   1 
ATOM   3961 O O   . LEU B 1 94  ? -5.175  19.694 56.353  1.00 58.16  ? 1280 LEU B O   1 
ATOM   3962 C CB  . LEU B 1 94  ? -4.480  16.827 54.701  1.00 38.43  ? 1280 LEU B CB  1 
ATOM   3963 C CG  . LEU B 1 94  ? -5.208  15.661 54.047  1.00 55.00  ? 1280 LEU B CG  1 
ATOM   3964 C CD1 . LEU B 1 94  ? -4.468  14.330 54.138  1.00 60.94  ? 1280 LEU B CD1 1 
ATOM   3965 C CD2 . LEU B 1 94  ? -6.605  15.563 54.642  1.00 39.59  ? 1280 LEU B CD2 1 
ATOM   3966 N N   . TYR B 1 95  ? -3.208  19.555 55.214  1.00 45.50  ? 1281 TYR B N   1 
ATOM   3967 C CA  . TYR B 1 95  ? -2.564  20.650 55.958  1.00 50.47  ? 1281 TYR B CA  1 
ATOM   3968 C C   . TYR B 1 95  ? -3.415  21.921 56.011  1.00 57.80  ? 1281 TYR B C   1 
ATOM   3969 O O   . TYR B 1 95  ? -3.501  22.568 57.055  1.00 61.30  ? 1281 TYR B O   1 
ATOM   3970 C CB  . TYR B 1 95  ? -1.200  20.989 55.383  1.00 43.99  ? 1281 TYR B CB  1 
ATOM   3971 C CG  . TYR B 1 95  ? -0.051  20.244 56.007  1.00 50.99  ? 1281 TYR B CG  1 
ATOM   3972 C CD1 . TYR B 1 95  ? -0.159  18.895 56.322  1.00 50.65  ? 1281 TYR B CD1 1 
ATOM   3973 C CD2 . TYR B 1 95  ? 1.153   20.887 56.280  1.00 40.06  ? 1281 TYR B CD2 1 
ATOM   3974 C CE1 . TYR B 1 95  ? 0.909   18.190 56.906  1.00 51.49  ? 1281 TYR B CE1 1 
ATOM   3975 C CE2 . TYR B 1 95  ? 2.225   20.192 56.854  1.00 51.99  ? 1281 TYR B CE2 1 
ATOM   3976 C CZ  . TYR B 1 95  ? 2.091   18.850 57.169  1.00 50.57  ? 1281 TYR B CZ  1 
ATOM   3977 O OH  . TYR B 1 95  ? 3.133   18.181 57.745  1.00 42.89  ? 1281 TYR B OH  1 
ATOM   3978 N N   . GLU B 1 96  ? -4.047  22.276 54.892  1.00 42.91  ? 1282 GLU B N   1 
ATOM   3979 C CA  . GLU B 1 96  ? -4.878  23.474 54.877  1.00 51.51  ? 1282 GLU B CA  1 
ATOM   3980 C C   . GLU B 1 96  ? -6.007  23.349 55.870  1.00 48.62  ? 1282 GLU B C   1 
ATOM   3981 O O   . GLU B 1 96  ? -6.264  24.279 56.617  1.00 61.26  ? 1282 GLU B O   1 
ATOM   3982 C CB  . GLU B 1 96  ? -5.424  23.774 53.496  1.00 33.52  ? 1282 GLU B CB  1 
ATOM   3983 C CG  . GLU B 1 96  ? -4.466  24.580 52.671  1.00 43.22  ? 1282 GLU B CG  1 
ATOM   3984 C CD  . GLU B 1 96  ? -4.824  24.604 51.201  1.00 94.71  ? 1282 GLU B CD  1 
ATOM   3985 O OE1 . GLU B 1 96  ? -5.849  23.989 50.800  1.00 104.21 ? 1282 GLU B OE1 1 
ATOM   3986 O OE2 . GLU B 1 96  ? -4.066  25.242 50.444  1.00 103.39 ? 1282 GLU B OE2 1 
ATOM   3987 N N   . THR B 1 97  ? -6.656  22.188 55.890  1.00 46.62  ? 1283 THR B N   1 
ATOM   3988 C CA  . THR B 1 97  ? -7.820  21.989 56.732  1.00 58.38  ? 1283 THR B CA  1 
ATOM   3989 C C   . THR B 1 97  ? -7.380  21.957 58.214  1.00 70.91  ? 1283 THR B C   1 
ATOM   3990 O O   . THR B 1 97  ? -7.965  22.675 59.068  1.00 64.45  ? 1283 THR B O   1 
ATOM   3991 C CB  . THR B 1 97  ? -8.604  20.696 56.360  1.00 53.70  ? 1283 THR B CB  1 
ATOM   3992 O OG1 . THR B 1 97  ? -8.317  20.317 55.014  1.00 63.20  ? 1283 THR B OG1 1 
ATOM   3993 C CG2 . THR B 1 97  ? -10.099 20.913 56.496  1.00 63.55  ? 1283 THR B CG2 1 
ATOM   3994 N N   . ILE B 1 98  ? -6.355  21.142 58.508  1.00 42.78  ? 1284 ILE B N   1 
ATOM   3995 C CA  . ILE B 1 98  ? -5.744  21.110 59.826  1.00 43.68  ? 1284 ILE B CA  1 
ATOM   3996 C C   . ILE B 1 98  ? -5.353  22.508 60.320  1.00 51.67  ? 1284 ILE B C   1 
ATOM   3997 O O   . ILE B 1 98  ? -5.676  22.883 61.435  1.00 49.85  ? 1284 ILE B O   1 
ATOM   3998 C CB  . ILE B 1 98  ? -4.506  20.276 59.811  1.00 41.78  ? 1284 ILE B CB  1 
ATOM   3999 C CG1 . ILE B 1 98  ? -4.851  18.880 59.349  1.00 43.36  ? 1284 ILE B CG1 1 
ATOM   4000 C CG2 . ILE B 1 98  ? -3.836  20.269 61.191  1.00 46.15  ? 1284 ILE B CG2 1 
ATOM   4001 C CD1 . ILE B 1 98  ? -3.630  18.041 59.014  1.00 58.98  ? 1284 ILE B CD1 1 
ATOM   4002 N N   . ILE B 1 99  ? -4.667  23.277 59.481  1.00 47.59  ? 1285 ILE B N   1 
ATOM   4003 C CA  . ILE B 1 99  ? -4.284  24.613 59.841  1.00 33.36  ? 1285 ILE B CA  1 
ATOM   4004 C C   . ILE B 1 99  ? -5.496  25.437 60.146  1.00 48.35  ? 1285 ILE B C   1 
ATOM   4005 O O   . ILE B 1 99  ? -5.461  26.314 61.023  1.00 58.58  ? 1285 ILE B O   1 
ATOM   4006 C CB  . ILE B 1 99  ? -3.518  25.309 58.743  1.00 45.85  ? 1285 ILE B CB  1 
ATOM   4007 C CG1 . ILE B 1 99  ? -2.159  24.628 58.565  1.00 42.48  ? 1285 ILE B CG1 1 
ATOM   4008 C CG2 . ILE B 1 99  ? -3.346  26.785 59.117  1.00 30.67  ? 1285 ILE B CG2 1 
ATOM   4009 C CD1 . ILE B 1 99  ? -1.371  25.174 57.414  1.00 40.97  ? 1285 ILE B CD1 1 
ATOM   4010 N N   . GLY B 1 100 ? -6.580  25.164 59.427  1.00 43.08  ? 1286 GLY B N   1 
ATOM   4011 C CA  . GLY B 1 100 ? -7.830  25.861 59.665  1.00 41.16  ? 1286 GLY B CA  1 
ATOM   4012 C C   . GLY B 1 100 ? -8.347  25.566 61.046  1.00 51.55  ? 1286 GLY B C   1 
ATOM   4013 O O   . GLY B 1 100 ? -8.828  26.458 61.727  1.00 50.20  ? 1286 GLY B O   1 
ATOM   4014 N N   . TYR B 1 101 ? -8.234  24.297 61.455  1.00 62.37  ? 1287 TYR B N   1 
ATOM   4015 C CA  . TYR B 1 101 ? -8.711  23.842 62.772  1.00 48.01  ? 1287 TYR B CA  1 
ATOM   4016 C C   . TYR B 1 101 ? -7.911  24.484 63.903  1.00 58.82  ? 1287 TYR B C   1 
ATOM   4017 O O   . TYR B 1 101 ? -8.460  24.946 64.906  1.00 49.13  ? 1287 TYR B O   1 
ATOM   4018 C CB  . TYR B 1 101 ? -8.625  22.322 62.902  1.00 47.72  ? 1287 TYR B CB  1 
ATOM   4019 C CG  . TYR B 1 101 ? -9.577  21.495 62.038  1.00 41.05  ? 1287 TYR B CG  1 
ATOM   4020 C CD1 . TYR B 1 101 ? -10.739 22.056 61.474  1.00 46.97  ? 1287 TYR B CD1 1 
ATOM   4021 C CD2 . TYR B 1 101 ? -9.341  20.141 61.833  1.00 39.51  ? 1287 TYR B CD2 1 
ATOM   4022 C CE1 . TYR B 1 101 ? -11.607 21.282 60.687  1.00 45.07  ? 1287 TYR B CE1 1 
ATOM   4023 C CE2 . TYR B 1 101 ? -10.173 19.373 61.066  1.00 49.38  ? 1287 TYR B CE2 1 
ATOM   4024 C CZ  . TYR B 1 101 ? -11.304 19.942 60.494  1.00 52.20  ? 1287 TYR B CZ  1 
ATOM   4025 O OH  . TYR B 1 101 ? -12.140 19.163 59.746  1.00 54.30  ? 1287 TYR B OH  1 
ATOM   4026 N N   . PHE B 1 102 ? -6.604  24.532 63.735  1.00 42.91  ? 1288 PHE B N   1 
ATOM   4027 C CA  . PHE B 1 102 ? -5.774  25.043 64.787  1.00 47.01  ? 1288 PHE B CA  1 
ATOM   4028 C C   . PHE B 1 102 ? -6.052  26.509 64.988  1.00 49.15  ? 1288 PHE B C   1 
ATOM   4029 O O   . PHE B 1 102 ? -5.938  27.027 66.095  1.00 58.16  ? 1288 PHE B O   1 
ATOM   4030 C CB  . PHE B 1 102 ? -4.317  24.829 64.433  1.00 29.80  ? 1288 PHE B CB  1 
ATOM   4031 C CG  . PHE B 1 102 ? -3.790  23.483 64.801  1.00 45.23  ? 1288 PHE B CG  1 
ATOM   4032 C CD1 . PHE B 1 102 ? -4.146  22.888 65.999  1.00 34.32  ? 1288 PHE B CD1 1 
ATOM   4033 C CD2 . PHE B 1 102 ? -2.880  22.842 63.964  1.00 43.44  ? 1288 PHE B CD2 1 
ATOM   4034 C CE1 . PHE B 1 102 ? -3.613  21.671 66.357  1.00 52.08  ? 1288 PHE B CE1 1 
ATOM   4035 C CE2 . PHE B 1 102 ? -2.325  21.604 64.297  1.00 43.68  ? 1288 PHE B CE2 1 
ATOM   4036 C CZ  . PHE B 1 102 ? -2.679  21.007 65.492  1.00 52.24  ? 1288 PHE B CZ  1 
ATOM   4037 N N   . ASP B 1 103 ? -6.402  27.180 63.896  1.00 52.66  ? 1289 ASP B N   1 
ATOM   4038 C CA  . ASP B 1 103 ? -6.736  28.593 63.949  1.00 42.63  ? 1289 ASP B CA  1 
ATOM   4039 C C   . ASP B 1 103 ? -7.947  28.806 64.823  1.00 45.58  ? 1289 ASP B C   1 
ATOM   4040 O O   . ASP B 1 103 ? -7.936  29.705 65.639  1.00 53.37  ? 1289 ASP B O   1 
ATOM   4041 C CB  . ASP B 1 103 ? -7.020  29.136 62.568  1.00 39.09  ? 1289 ASP B CB  1 
ATOM   4042 C CG  . ASP B 1 103 ? -7.096  30.615 62.562  1.00 45.16  ? 1289 ASP B CG  1 
ATOM   4043 O OD1 . ASP B 1 103 ? -6.252  31.253 63.219  1.00 55.03  ? 1289 ASP B OD1 1 
ATOM   4044 O OD2 . ASP B 1 103 ? -7.986  31.166 61.898  1.00 60.95  ? 1289 ASP B OD2 1 
ATOM   4045 N N   . LYS B 1 104 ? -8.983  27.994 64.646  1.00 37.32  ? 1290 LYS B N   1 
ATOM   4046 C CA  . LYS B 1 104 ? -10.170 28.060 65.489  1.00 54.74  ? 1290 LYS B CA  1 
ATOM   4047 C C   . LYS B 1 104 ? -9.793  27.666 66.912  1.00 50.69  ? 1290 LYS B C   1 
ATOM   4048 O O   . LYS B 1 104 ? -10.281 28.232 67.884  1.00 55.51  ? 1290 LYS B O   1 
ATOM   4049 C CB  . LYS B 1 104 ? -11.273 27.158 64.950  1.00 40.75  ? 1290 LYS B CB  1 
ATOM   4050 C CG  . LYS B 1 104 ? -11.793 27.589 63.597  1.00 65.38  ? 1290 LYS B CG  1 
ATOM   4051 C CD  . LYS B 1 104 ? -13.132 26.951 63.286  1.00 92.32  ? 1290 LYS B CD  1 
ATOM   4052 N N   . GLY B 1 105 ? -8.920  26.672 67.005  1.00 49.80  ? 1291 GLY B N   1 
ATOM   4053 C CA  . GLY B 1 105 ? -8.403  26.169 68.261  1.00 38.65  ? 1291 GLY B CA  1 
ATOM   4054 C C   . GLY B 1 105 ? -7.613  27.233 68.990  1.00 54.82  ? 1291 GLY B C   1 
ATOM   4055 O O   . GLY B 1 105 ? -7.619  27.302 70.214  1.00 46.63  ? 1291 GLY B O   1 
ATOM   4056 N N   . LYS B 1 106 ? -6.911  28.062 68.233  1.00 52.82  ? 1292 LYS B N   1 
ATOM   4057 C CA  . LYS B 1 106 ? -6.098  29.115 68.816  1.00 50.36  ? 1292 LYS B CA  1 
ATOM   4058 C C   . LYS B 1 106 ? -4.835  28.425 69.305  1.00 60.05  ? 1292 LYS B C   1 
ATOM   4059 O O   . LYS B 1 106 ? -4.304  28.750 70.361  1.00 63.25  ? 1292 LYS B O   1 
ATOM   4060 C CB  . LYS B 1 106 ? -6.750  29.673 70.075  1.00 42.73  ? 1292 LYS B CB  1 
ATOM   4061 C CG  . LYS B 1 106 ? -7.949  30.551 69.781  1.00 50.09  ? 1292 LYS B CG  1 
ATOM   4062 C CD  . LYS B 1 106 ? -8.543  31.132 71.044  1.00 56.31  ? 1292 LYS B CD  1 
ATOM   4063 C CE  . LYS B 1 106 ? -9.852  31.831 70.751  1.00 69.26  ? 1292 LYS B CE  1 
ATOM   4064 N NZ  . LYS B 1 106 ? -10.570 32.205 71.997  1.00 77.94  ? 1292 LYS B NZ  1 
ATOM   4065 N N   . MET B 1 107 ? -4.360  27.470 68.516  1.00 38.90  ? 1293 MET B N   1 
ATOM   4066 C CA  . MET B 1 107 ? -3.037  26.894 68.646  1.00 36.86  ? 1293 MET B CA  1 
ATOM   4067 C C   . MET B 1 107 ? -2.288  27.485 67.479  1.00 52.12  ? 1293 MET B C   1 
ATOM   4068 O O   . MET B 1 107 ? -1.947  26.789 66.531  1.00 48.26  ? 1293 MET B O   1 
ATOM   4069 C CB  . MET B 1 107 ? -3.092  25.379 68.495  1.00 31.84  ? 1293 MET B CB  1 
ATOM   4070 C CG  . MET B 1 107 ? -4.014  24.671 69.463  1.00 63.94  ? 1293 MET B CG  1 
ATOM   4071 S SD  . MET B 1 107 ? -3.373  24.601 71.138  1.00 55.44  ? 1293 MET B SD  1 
ATOM   4072 C CE  . MET B 1 107 ? -4.170  26.017 71.872  1.00 39.41  ? 1293 MET B CE  1 
ATOM   4073 N N   . TRP B 1 108 ? -2.050  28.786 67.542  1.00 37.47  ? 1294 TRP B N   1 
ATOM   4074 C CA  . TRP B 1 108 ? -1.400  29.493 66.448  1.00 42.35  ? 1294 TRP B CA  1 
ATOM   4075 C C   . TRP B 1 108 ? 0.017   29.014 66.155  1.00 47.58  ? 1294 TRP B C   1 
ATOM   4076 O O   . TRP B 1 108 ? 0.409   28.901 65.000  1.00 61.32  ? 1294 TRP B O   1 
ATOM   4077 C CB  . TRP B 1 108 ? -1.489  31.000 66.661  1.00 41.13  ? 1294 TRP B CB  1 
ATOM   4078 C CG  . TRP B 1 108 ? -2.912  31.449 66.711  1.00 52.51  ? 1294 TRP B CG  1 
ATOM   4079 C CD1 . TRP B 1 108 ? -3.922  31.041 65.894  1.00 44.70  ? 1294 TRP B CD1 1 
ATOM   4080 C CD2 . TRP B 1 108 ? -3.490  32.383 67.626  1.00 63.54  ? 1294 TRP B CD2 1 
ATOM   4081 N NE1 . TRP B 1 108 ? -5.092  31.661 66.242  1.00 38.03  ? 1294 TRP B NE1 1 
ATOM   4082 C CE2 . TRP B 1 108 ? -4.853  32.493 67.302  1.00 53.89  ? 1294 TRP B CE2 1 
ATOM   4083 C CE3 . TRP B 1 108 ? -2.988  33.139 68.684  1.00 51.28  ? 1294 TRP B CE3 1 
ATOM   4084 C CZ2 . TRP B 1 108 ? -5.717  33.326 67.998  1.00 35.31  ? 1294 TRP B CZ2 1 
ATOM   4085 C CZ3 . TRP B 1 108 ? -3.846  33.963 69.372  1.00 50.53  ? 1294 TRP B CZ3 1 
ATOM   4086 C CH2 . TRP B 1 108 ? -5.194  34.051 69.028  1.00 54.43  ? 1294 TRP B CH2 1 
ATOM   4087 N N   . GLU B 1 109 ? 0.775   28.727 67.204  1.00 46.11  ? 1295 GLU B N   1 
ATOM   4088 C CA  . GLU B 1 109 ? 2.103   28.193 67.062  1.00 42.75  ? 1295 GLU B CA  1 
ATOM   4089 C C   . GLU B 1 109 ? 2.058   26.835 66.391  1.00 25.58  ? 1295 GLU B C   1 
ATOM   4090 O O   . GLU B 1 109 ? 2.900   26.531 65.564  1.00 44.02  ? 1295 GLU B O   1 
ATOM   4091 C CB  . GLU B 1 109 ? 2.802   28.161 68.423  1.00 36.98  ? 1295 GLU B CB  1 
ATOM   4092 C CG  . GLU B 1 109 ? 1.826   28.080 69.578  1.00 51.31  ? 1295 GLU B CG  1 
ATOM   4093 C CD  . GLU B 1 109 ? 1.509   29.417 70.192  1.00 45.97  ? 1295 GLU B CD  1 
ATOM   4094 O OE1 . GLU B 1 109 ? 2.448   30.172 70.464  1.00 73.28  ? 1295 GLU B OE1 1 
ATOM   4095 O OE2 . GLU B 1 109 ? 0.335   29.701 70.464  1.00 50.34  ? 1295 GLU B OE2 1 
ATOM   4096 N N   . GLU B 1 110 ? 1.073   26.009 66.702  1.00 52.42  ? 1296 GLU B N   1 
ATOM   4097 C CA  . GLU B 1 110 ? 0.948   24.746 65.946  1.00 58.19  ? 1296 GLU B CA  1 
ATOM   4098 C C   . GLU B 1 110 ? 0.636   25.024 64.481  1.00 53.53  ? 1296 GLU B C   1 
ATOM   4099 O O   . GLU B 1 110 ? 1.216   24.393 63.603  1.00 55.23  ? 1296 GLU B O   1 
ATOM   4100 C CB  . GLU B 1 110 ? -0.098  23.796 66.519  1.00 49.80  ? 1296 GLU B CB  1 
ATOM   4101 C CG  . GLU B 1 110 ? 0.369   22.937 67.703  1.00 49.50  ? 1296 GLU B CG  1 
ATOM   4102 C CD  . GLU B 1 110 ? 1.418   21.875 67.319  1.00 58.02  ? 1296 GLU B CD  1 
ATOM   4103 O OE1 . GLU B 1 110 ? 2.018   21.999 66.223  1.00 61.19  ? 1296 GLU B OE1 1 
ATOM   4104 O OE2 . GLU B 1 110 ? 1.643   20.920 68.123  1.00 48.61  ? 1296 GLU B OE2 1 
ATOM   4105 N N   . ALA B 1 111 ? -0.247  25.983 64.215  1.00 41.73  ? 1297 ALA B N   1 
ATOM   4106 C CA  . ALA B 1 111 ? -0.598  26.373 62.841  1.00 44.94  ? 1297 ALA B CA  1 
ATOM   4107 C C   . ALA B 1 111 ? 0.610   26.868 62.063  1.00 51.09  ? 1297 ALA B C   1 
ATOM   4108 O O   . ALA B 1 111 ? 0.881   26.418 60.951  1.00 49.62  ? 1297 ALA B O   1 
ATOM   4109 C CB  . ALA B 1 111 ? -1.644  27.443 62.866  1.00 36.40  ? 1297 ALA B CB  1 
ATOM   4110 N N   . ILE B 1 112 ? 1.322   27.816 62.654  1.00 46.80  ? 1298 ILE B N   1 
ATOM   4111 C CA  . ILE B 1 112 ? 2.560   28.316 62.087  1.00 45.92  ? 1298 ILE B CA  1 
ATOM   4112 C C   . ILE B 1 112 ? 3.469   27.169 61.723  1.00 49.96  ? 1298 ILE B C   1 
ATOM   4113 O O   . ILE B 1 112 ? 4.034   27.155 60.645  1.00 69.44  ? 1298 ILE B O   1 
ATOM   4114 C CB  . ILE B 1 112 ? 3.286   29.287 63.066  1.00 36.65  ? 1298 ILE B CB  1 
ATOM   4115 C CG1 . ILE B 1 112 ? 2.536   30.620 63.117  1.00 28.53  ? 1298 ILE B CG1 1 
ATOM   4116 C CG2 . ILE B 1 112 ? 4.715   29.546 62.653  1.00 27.77  ? 1298 ILE B CG2 1 
ATOM   4117 C CD1 . ILE B 1 112 ? 2.785   31.427 64.328  1.00 37.95  ? 1298 ILE B CD1 1 
ATOM   4118 N N   . SER B 1 113 ? 3.618   26.184 62.585  1.00 45.85  ? 1299 SER B N   1 
ATOM   4119 C CA  . SER B 1 113 ? 4.589   25.180 62.283  1.00 43.85  ? 1299 SER B CA  1 
ATOM   4120 C C   . SER B 1 113 ? 4.206   24.355 61.042  1.00 48.59  ? 1299 SER B C   1 
ATOM   4121 O O   . SER B 1 113 ? 5.081   23.861 60.317  1.00 50.30  ? 1299 SER B O   1 
ATOM   4122 C CB  . SER B 1 113 ? 4.852   24.355 63.537  1.00 34.25  ? 1299 SER B CB  1 
ATOM   4123 O OG  . SER B 1 113 ? 5.012   22.996 63.261  1.00 49.41  ? 1299 SER B OG  1 
ATOM   4124 N N   . LEU B 1 114 ? 2.911   24.211 60.780  1.00 42.60  ? 1300 LEU B N   1 
ATOM   4125 C CA  . LEU B 1 114 ? 2.487   23.548 59.566  1.00 36.31  ? 1300 LEU B CA  1 
ATOM   4126 C C   . LEU B 1 114 ? 2.681   24.457 58.365  1.00 56.12  ? 1300 LEU B C   1 
ATOM   4127 O O   . LEU B 1 114 ? 3.069   24.001 57.275  1.00 38.68  ? 1300 LEU B O   1 
ATOM   4128 C CB  . LEU B 1 114 ? 1.036   23.104 59.628  1.00 40.70  ? 1300 LEU B CB  1 
ATOM   4129 C CG  . LEU B 1 114 ? 0.701   21.954 60.570  1.00 45.25  ? 1300 LEU B CG  1 
ATOM   4130 C CD1 . LEU B 1 114 ? -0.641  21.458 60.229  1.00 48.76  ? 1300 LEU B CD1 1 
ATOM   4131 C CD2 . LEU B 1 114 ? 1.678   20.853 60.424  1.00 45.22  ? 1300 LEU B CD2 1 
ATOM   4132 N N   . CYS B 1 115 ? 2.445   25.747 58.551  1.00 37.29  ? 1301 CYS B N   1 
ATOM   4133 C CA  . CYS B 1 115 ? 2.696   26.670 57.472  1.00 42.70  ? 1301 CYS B CA  1 
ATOM   4134 C C   . CYS B 1 115 ? 4.121   26.581 57.008  1.00 45.70  ? 1301 CYS B C   1 
ATOM   4135 O O   . CYS B 1 115 ? 4.386   26.634 55.823  1.00 59.41  ? 1301 CYS B O   1 
ATOM   4136 C CB  . CYS B 1 115 ? 2.341   28.102 57.843  1.00 41.99  ? 1301 CYS B CB  1 
ATOM   4137 S SG  . CYS B 1 115 ? 0.492   28.371 57.806  1.00 54.21  ? 1301 CYS B SG  1 
ATOM   4138 N N   . LYS B 1 116 ? 5.062   26.408 57.909  1.00 36.53  ? 1302 LYS B N   1 
ATOM   4139 C CA  . LYS B 1 116 ? 6.435   26.443 57.447  1.00 49.42  ? 1302 LYS B CA  1 
ATOM   4140 C C   . LYS B 1 116 ? 6.743   25.275 56.522  1.00 49.18  ? 1302 LYS B C   1 
ATOM   4141 O O   . LYS B 1 116 ? 7.434   25.443 55.520  1.00 55.56  ? 1302 LYS B O   1 
ATOM   4142 C CB  . LYS B 1 116 ? 7.428   26.563 58.592  1.00 23.66  ? 1302 LYS B CB  1 
ATOM   4143 C CG  . LYS B 1 116 ? 7.255   27.851 59.394  1.00 30.39  ? 1302 LYS B CG  1 
ATOM   4144 C CD  . LYS B 1 116 ? 7.880   27.652 60.843  1.00 54.13  ? 1302 LYS B CD  1 
ATOM   4145 C CE  . LYS B 1 116 ? 9.290   28.264 61.002  1.00 42.45  ? 1302 LYS B CE  1 
ATOM   4146 N NZ  . LYS B 1 116 ? 9.246   29.688 60.465  1.00 68.22  ? 1302 LYS B NZ  1 
ATOM   4147 N N   . GLU B 1 117 ? 6.217   24.099 56.834  1.00 49.07  ? 1303 GLU B N   1 
ATOM   4148 C CA  . GLU B 1 117 ? 6.437   22.934 55.977  1.00 57.36  ? 1303 GLU B CA  1 
ATOM   4149 C C   . GLU B 1 117 ? 5.898   23.203 54.578  1.00 54.26  ? 1303 GLU B C   1 
ATOM   4150 O O   . GLU B 1 117 ? 6.569   22.932 53.588  1.00 51.71  ? 1303 GLU B O   1 
ATOM   4151 C CB  . GLU B 1 117 ? 5.720   21.713 56.525  1.00 43.39  ? 1303 GLU B CB  1 
ATOM   4152 C CG  . GLU B 1 117 ? 6.098   21.423 57.933  1.00 66.13  ? 1303 GLU B CG  1 
ATOM   4153 C CD  . GLU B 1 117 ? 5.680   20.038 58.360  1.00 71.65  ? 1303 GLU B CD  1 
ATOM   4154 O OE1 . GLU B 1 117 ? 5.509   19.221 57.420  1.00 66.82  ? 1303 GLU B OE1 1 
ATOM   4155 O OE2 . GLU B 1 117 ? 5.529   19.776 59.603  1.00 76.97  ? 1303 GLU B OE2 1 
ATOM   4156 N N   . LEU B 1 118 ? 4.690   23.729 54.507  1.00 27.60  ? 1304 LEU B N   1 
ATOM   4157 C CA  . LEU B 1 118 ? 4.146   24.060 53.240  1.00 40.31  ? 1304 LEU B CA  1 
ATOM   4158 C C   . LEU B 1 118 ? 4.974   25.099 52.508  1.00 46.46  ? 1304 LEU B C   1 
ATOM   4159 O O   . LEU B 1 118 ? 5.161   25.041 51.315  1.00 53.57  ? 1304 LEU B O   1 
ATOM   4160 C CB  . LEU B 1 118 ? 2.737   24.554 53.418  1.00 45.58  ? 1304 LEU B CB  1 
ATOM   4161 C CG  . LEU B 1 118 ? 1.625   23.743 52.755  1.00 50.80  ? 1304 LEU B CG  1 
ATOM   4162 C CD1 . LEU B 1 118 ? 1.943   22.296 52.714  1.00 61.99  ? 1304 LEU B CD1 1 
ATOM   4163 C CD2 . LEU B 1 118 ? 0.328   23.971 53.470  1.00 44.14  ? 1304 LEU B CD2 1 
ATOM   4164 N N   . ALA B 1 119 ? 5.499   26.053 53.229  1.00 51.52  ? 1305 ALA B N   1 
ATOM   4165 C CA  . ALA B 1 119 ? 6.175   27.121 52.579  1.00 38.47  ? 1305 ALA B CA  1 
ATOM   4166 C C   . ALA B 1 119 ? 7.458   26.583 52.017  1.00 50.25  ? 1305 ALA B C   1 
ATOM   4167 O O   . ALA B 1 119 ? 7.972   27.129 51.055  1.00 42.62  ? 1305 ALA B O   1 
ATOM   4168 C CB  . ALA B 1 119 ? 6.429   28.250 53.564  1.00 34.39  ? 1305 ALA B CB  1 
ATOM   4169 N N   . GLU B 1 120 ? 7.981   25.517 52.609  1.00 49.23  ? 1306 GLU B N   1 
ATOM   4170 C CA  . GLU B 1 120 ? 9.264   25.018 52.154  1.00 53.06  ? 1306 GLU B CA  1 
ATOM   4171 C C   . GLU B 1 120 ? 9.053   24.408 50.788  1.00 48.50  ? 1306 GLU B C   1 
ATOM   4172 O O   . GLU B 1 120 ? 9.860   24.566 49.893  1.00 50.03  ? 1306 GLU B O   1 
ATOM   4173 C CB  . GLU B 1 120 ? 9.878   24.005 53.115  1.00 45.77  ? 1306 GLU B CB  1 
ATOM   4174 C CG  . GLU B 1 120 ? 11.351  23.732 52.842  1.00 56.10  ? 1306 GLU B CG  1 
ATOM   4175 C CD  . GLU B 1 120 ? 11.920  22.619 53.704  1.00 92.59  ? 1306 GLU B CD  1 
ATOM   4176 O OE1 . GLU B 1 120 ? 11.157  21.917 54.408  1.00 92.65  ? 1306 GLU B OE1 1 
ATOM   4177 O OE2 . GLU B 1 120 ? 13.147  22.426 53.676  1.00 105.78 ? 1306 GLU B OE2 1 
ATOM   4178 N N   . GLN B 1 121 ? 7.927   23.735 50.638  1.00 49.18  ? 1307 GLN B N   1 
ATOM   4179 C CA  . GLN B 1 121 ? 7.595   23.067 49.411  1.00 49.09  ? 1307 GLN B CA  1 
ATOM   4180 C C   . GLN B 1 121 ? 7.332   24.097 48.345  1.00 62.88  ? 1307 GLN B C   1 
ATOM   4181 O O   . GLN B 1 121 ? 7.768   23.948 47.200  1.00 64.13  ? 1307 GLN B O   1 
ATOM   4182 C CB  . GLN B 1 121 ? 6.368   22.186 49.623  1.00 56.98  ? 1307 GLN B CB  1 
ATOM   4183 C CG  . GLN B 1 121 ? 6.605   21.011 50.604  1.00 64.38  ? 1307 GLN B CG  1 
ATOM   4184 C CD  . GLN B 1 121 ? 7.622   19.964 50.087  1.00 67.69  ? 1307 GLN B CD  1 
ATOM   4185 O OE1 . GLN B 1 121 ? 8.600   19.624 50.772  1.00 54.15  ? 1307 GLN B OE1 1 
ATOM   4186 N NE2 . GLN B 1 121 ? 7.381   19.451 48.876  1.00 68.50  ? 1307 GLN B NE2 1 
ATOM   4187 N N   . TYR B 1 122 ? 6.629   25.151 48.715  1.00 43.72  ? 1308 TYR B N   1 
ATOM   4188 C CA  . TYR B 1 122 ? 6.324   26.177 47.752  1.00 51.70  ? 1308 TYR B CA  1 
ATOM   4189 C C   . TYR B 1 122 ? 7.585   26.888 47.295  1.00 58.74  ? 1308 TYR B C   1 
ATOM   4190 O O   . TYR B 1 122 ? 7.744   27.176 46.118  1.00 79.07  ? 1308 TYR B O   1 
ATOM   4191 C CB  . TYR B 1 122 ? 5.362   27.195 48.333  1.00 41.01  ? 1308 TYR B CB  1 
ATOM   4192 C CG  . TYR B 1 122 ? 4.005   26.649 48.626  1.00 55.83  ? 1308 TYR B CG  1 
ATOM   4193 C CD1 . TYR B 1 122 ? 3.552   25.472 48.017  1.00 48.09  ? 1308 TYR B CD1 1 
ATOM   4194 C CD2 . TYR B 1 122 ? 3.132   27.324 49.496  1.00 61.16  ? 1308 TYR B CD2 1 
ATOM   4195 C CE1 . TYR B 1 122 ? 2.257   24.980 48.280  1.00 58.83  ? 1308 TYR B CE1 1 
ATOM   4196 C CE2 . TYR B 1 122 ? 1.822   26.836 49.764  1.00 56.21  ? 1308 TYR B CE2 1 
ATOM   4197 C CZ  . TYR B 1 122 ? 1.406   25.665 49.151  1.00 53.16  ? 1308 TYR B CZ  1 
ATOM   4198 O OH  . TYR B 1 122 ? 0.145   25.165 49.396  1.00 59.55  ? 1308 TYR B OH  1 
ATOM   4199 N N   . GLU B 1 123 ? 8.421   27.243 48.258  1.00 50.87  ? 1309 GLU B N   1 
ATOM   4200 C CA  . GLU B 1 123 ? 9.662   27.946 47.993  1.00 47.05  ? 1309 GLU B CA  1 
ATOM   4201 C C   . GLU B 1 123 ? 10.758  27.163 47.285  1.00 57.50  ? 1309 GLU B C   1 
ATOM   4202 O O   . GLU B 1 123 ? 11.411  27.682 46.387  1.00 64.66  ? 1309 GLU B O   1 
ATOM   4203 C CB  . GLU B 1 123 ? 10.207  28.522 49.297  1.00 33.25  ? 1309 GLU B CB  1 
ATOM   4204 C CG  . GLU B 1 123 ? 11.441  29.363 49.124  1.00 46.76  ? 1309 GLU B CG  1 
ATOM   4205 C CD  . GLU B 1 123 ? 12.125  29.641 50.433  1.00 70.87  ? 1309 GLU B CD  1 
ATOM   4206 O OE1 . GLU B 1 123 ? 11.563  29.269 51.479  1.00 87.90  ? 1309 GLU B OE1 1 
ATOM   4207 O OE2 . GLU B 1 123 ? 13.223  30.226 50.418  1.00 73.49  ? 1309 GLU B OE2 1 
ATOM   4208 N N   . MET B 1 124 ? 10.984  25.930 47.738  1.00 55.37  ? 1310 MET B N   1 
ATOM   4209 C CA  . MET B 1 124 ? 12.032  25.073 47.184  1.00 60.73  ? 1310 MET B CA  1 
ATOM   4210 C C   . MET B 1 124 ? 11.678  23.808 46.404  1.00 70.82  ? 1310 MET B C   1 
ATOM   4211 O O   . MET B 1 124 ? 12.552  23.248 45.751  1.00 74.83  ? 1310 MET B O   1 
ATOM   4212 C CB  . MET B 1 124 ? 12.970  24.645 48.316  1.00 54.18  ? 1310 MET B CB  1 
ATOM   4213 C CG  . MET B 1 124 ? 13.194  25.688 49.384  1.00 47.52  ? 1310 MET B CG  1 
ATOM   4214 S SD  . MET B 1 124 ? 14.305  26.985 48.843  1.00 95.31  ? 1310 MET B SD  1 
ATOM   4215 C CE  . MET B 1 124 ? 15.823  26.069 48.635  1.00 125.46 ? 1310 MET B CE  1 
ATOM   4216 N N   . GLU B 1 125 ? 10.438  23.336 46.460  1.00 73.22  ? 1311 GLU B N   1 
ATOM   4217 C CA  . GLU B 1 125 ? 10.105  22.116 45.732  1.00 65.00  ? 1311 GLU B CA  1 
ATOM   4218 C C   . GLU B 1 125 ? 9.194   22.200 44.508  1.00 70.26  ? 1311 GLU B C   1 
ATOM   4219 O O   . GLU B 1 125 ? 9.258   21.343 43.634  1.00 79.26  ? 1311 GLU B O   1 
ATOM   4220 C CB  . GLU B 1 125 ? 9.549   21.081 46.712  1.00 64.06  ? 1311 GLU B CB  1 
ATOM   4221 C CG  . GLU B 1 125 ? 10.281  19.762 46.674  1.00 73.89  ? 1311 GLU B CG  1 
ATOM   4222 C CD  . GLU B 1 125 ? 11.720  19.902 47.110  1.00 80.71  ? 1311 GLU B CD  1 
ATOM   4223 O OE1 . GLU B 1 125 ? 11.977  20.660 48.064  1.00 64.94  ? 1311 GLU B OE1 1 
ATOM   4224 O OE2 . GLU B 1 125 ? 12.595  19.256 46.502  1.00 91.91  ? 1311 GLU B OE2 1 
ATOM   4225 N N   . ILE B 1 126 ? 8.353   23.219 44.437  1.00 65.85  ? 1312 ILE B N   1 
ATOM   4226 C CA  . ILE B 1 126 ? 7.448   23.350 43.310  1.00 58.91  ? 1312 ILE B CA  1 
ATOM   4227 C C   . ILE B 1 126 ? 7.291   24.822 42.898  1.00 60.48  ? 1312 ILE B C   1 
ATOM   4228 O O   . ILE B 1 126 ? 6.466   25.180 42.047  1.00 65.33  ? 1312 ILE B O   1 
ATOM   4229 C CB  . ILE B 1 126 ? 6.091   22.767 43.680  1.00 60.33  ? 1312 ILE B CB  1 
ATOM   4230 C CG1 . ILE B 1 126 ? 5.311   23.758 44.532  1.00 55.36  ? 1312 ILE B CG1 1 
ATOM   4231 C CG2 . ILE B 1 126 ? 6.281   21.453 44.442  1.00 52.51  ? 1312 ILE B CG2 1 
ATOM   4232 C CD1 . ILE B 1 126 ? 3.984   23.213 45.037  1.00 53.54  ? 1312 ILE B CD1 1 
ATOM   4233 N N   . PHE B 1 127 ? 8.072   25.678 43.532  1.00 53.27  ? 1313 PHE B N   1 
ATOM   4234 C CA  . PHE B 1 127 ? 8.130   27.091 43.182  1.00 56.17  ? 1313 PHE B CA  1 
ATOM   4235 C C   . PHE B 1 127 ? 6.796   27.707 42.898  1.00 66.42  ? 1313 PHE B C   1 
ATOM   4236 O O   . PHE B 1 127 ? 6.627   28.350 41.872  1.00 64.30  ? 1313 PHE B O   1 
ATOM   4237 C CB  . PHE B 1 127 ? 9.137   27.323 42.063  1.00 43.50  ? 1313 PHE B CB  1 
ATOM   4238 C CG  . PHE B 1 127 ? 10.466  26.757 42.391  1.00 39.69  ? 1313 PHE B CG  1 
ATOM   4239 C CD1 . PHE B 1 127 ? 10.734  25.417 42.145  1.00 37.51  ? 1313 PHE B CD1 1 
ATOM   4240 C CD2 . PHE B 1 127 ? 11.405  27.512 43.045  1.00 30.79  ? 1313 PHE B CD2 1 
ATOM   4241 C CE1 . PHE B 1 127 ? 11.952  24.844 42.490  1.00 50.04  ? 1313 PHE B CE1 1 
ATOM   4242 C CE2 . PHE B 1 127 ? 12.626  26.946 43.413  1.00 48.36  ? 1313 PHE B CE2 1 
ATOM   4243 C CZ  . PHE B 1 127 ? 12.902  25.614 43.131  1.00 46.37  ? 1313 PHE B CZ  1 
ATOM   4244 N N   . ASP B 1 128 ? 5.852   27.531 43.809  1.00 51.71  ? 1314 ASP B N   1 
ATOM   4245 C CA  . ASP B 1 128 ? 4.628   28.266 43.681  1.00 47.74  ? 1314 ASP B CA  1 
ATOM   4246 C C   . ASP B 1 128 ? 4.642   29.496 44.589  1.00 51.03  ? 1314 ASP B C   1 
ATOM   4247 O O   . ASP B 1 128 ? 4.220   29.447 45.755  1.00 69.71  ? 1314 ASP B O   1 
ATOM   4248 C CB  . ASP B 1 128 ? 3.417   27.373 43.922  1.00 42.95  ? 1314 ASP B CB  1 
ATOM   4249 C CG  . ASP B 1 128 ? 2.130   28.019 43.435  1.00 62.78  ? 1314 ASP B CG  1 
ATOM   4250 O OD1 . ASP B 1 128 ? 2.118   29.275 43.349  1.00 68.42  ? 1314 ASP B OD1 1 
ATOM   4251 O OD2 . ASP B 1 128 ? 1.138   27.296 43.138  1.00 63.14  ? 1314 ASP B OD2 1 
ATOM   4252 N N   . TYR B 1 129 ? 5.125   30.606 44.058  1.00 43.83  ? 1315 TYR B N   1 
ATOM   4253 C CA  . TYR B 1 129 ? 5.307   31.832 44.843  1.00 48.15  ? 1315 TYR B CA  1 
ATOM   4254 C C   . TYR B 1 129 ? 4.000   32.507 45.180  1.00 48.75  ? 1315 TYR B C   1 
ATOM   4255 O O   . TYR B 1 129 ? 3.898   33.224 46.171  1.00 52.73  ? 1315 TYR B O   1 
ATOM   4256 C CB  . TYR B 1 129 ? 6.157   32.829 44.060  1.00 59.08  ? 1315 TYR B CB  1 
ATOM   4257 C CG  . TYR B 1 129 ? 7.629   32.547 44.065  1.00 49.23  ? 1315 TYR B CG  1 
ATOM   4258 C CD1 . TYR B 1 129 ? 8.127   31.332 44.545  1.00 28.09  ? 1315 TYR B CD1 1 
ATOM   4259 C CD2 . TYR B 1 129 ? 8.519   33.491 43.562  1.00 38.55  ? 1315 TYR B CD2 1 
ATOM   4260 C CE1 . TYR B 1 129 ? 9.470   31.078 44.548  1.00 28.19  ? 1315 TYR B CE1 1 
ATOM   4261 C CE2 . TYR B 1 129 ? 9.848   33.251 43.559  1.00 22.95  ? 1315 TYR B CE2 1 
ATOM   4262 C CZ  . TYR B 1 129 ? 10.327  32.050 44.050  1.00 55.20  ? 1315 TYR B CZ  1 
ATOM   4263 O OH  . TYR B 1 129 ? 11.673  31.835 44.035  1.00 42.53  ? 1315 TYR B OH  1 
ATOM   4264 N N   . GLU B 1 130 ? 3.000   32.323 44.338  1.00 55.05  ? 1316 GLU B N   1 
ATOM   4265 C CA  . GLU B 1 130 ? 1.723   32.988 44.586  1.00 61.76  ? 1316 GLU B CA  1 
ATOM   4266 C C   . GLU B 1 130 ? 1.143   32.356 45.837  1.00 60.37  ? 1316 GLU B C   1 
ATOM   4267 O O   . GLU B 1 130 ? 0.720   33.055 46.771  1.00 73.64  ? 1316 GLU B O   1 
ATOM   4268 C CB  . GLU B 1 130 ? 0.747   32.835 43.406  1.00 65.27  ? 1316 GLU B CB  1 
ATOM   4269 C CG  . GLU B 1 130 ? 1.327   33.199 41.989  1.00 148.47 ? 1316 GLU B CG  1 
ATOM   4270 C CD  . GLU B 1 130 ? 1.605   31.966 41.071  1.00 123.69 ? 1316 GLU B CD  1 
ATOM   4271 O OE1 . GLU B 1 130 ? 2.517   31.141 41.371  1.00 115.61 ? 1316 GLU B OE1 1 
ATOM   4272 O OE2 . GLU B 1 130 ? 0.897   31.836 40.038  1.00 114.71 ? 1316 GLU B OE2 1 
ATOM   4273 N N   . LEU B 1 131 ? 1.130   31.032 45.883  1.00 44.10  ? 1317 LEU B N   1 
ATOM   4274 C CA  . LEU B 1 131 ? 0.613   30.340 47.051  1.00 60.29  ? 1317 LEU B CA  1 
ATOM   4275 C C   . LEU B 1 131 ? 1.497   30.631 48.250  1.00 60.37  ? 1317 LEU B C   1 
ATOM   4276 O O   . LEU B 1 131 ? 1.031   30.670 49.382  1.00 60.92  ? 1317 LEU B O   1 
ATOM   4277 C CB  . LEU B 1 131 ? 0.546   28.835 46.809  1.00 46.75  ? 1317 LEU B CB  1 
ATOM   4278 C CG  . LEU B 1 131 ? -0.841  28.261 46.542  1.00 27.77  ? 1317 LEU B CG  1 
ATOM   4279 C CD1 . LEU B 1 131 ? -1.667  29.209 45.710  1.00 40.67  ? 1317 LEU B CD1 1 
ATOM   4280 C CD2 . LEU B 1 131 ? -0.741  26.906 45.890  1.00 31.60  ? 1317 LEU B CD2 1 
ATOM   4281 N N   . LEU B 1 132 ? 2.781   30.837 47.988  1.00 66.13  ? 1318 LEU B N   1 
ATOM   4282 C CA  . LEU B 1 132 ? 3.745   31.123 49.042  1.00 48.49  ? 1318 LEU B CA  1 
ATOM   4283 C C   . LEU B 1 132 ? 3.444   32.440 49.740  1.00 53.87  ? 1318 LEU B C   1 
ATOM   4284 O O   . LEU B 1 132 ? 3.455   32.517 50.961  1.00 43.46  ? 1318 LEU B O   1 
ATOM   4285 C CB  . LEU B 1 132 ? 5.160   31.139 48.475  1.00 50.21  ? 1318 LEU B CB  1 
ATOM   4286 C CG  . LEU B 1 132 ? 6.292   31.217 49.495  1.00 50.97  ? 1318 LEU B CG  1 
ATOM   4287 C CD1 . LEU B 1 132 ? 6.092   30.190 50.586  1.00 51.77  ? 1318 LEU B CD1 1 
ATOM   4288 C CD2 . LEU B 1 132 ? 7.625   31.019 48.811  1.00 39.67  ? 1318 LEU B CD2 1 
ATOM   4289 N N   . SER B 1 133 ? 3.175   33.479 48.961  1.00 54.11  ? 1319 SER B N   1 
ATOM   4290 C CA  . SER B 1 133 ? 2.867   34.778 49.532  1.00 60.75  ? 1319 SER B CA  1 
ATOM   4291 C C   . SER B 1 133 ? 1.624   34.665 50.400  1.00 55.45  ? 1319 SER B C   1 
ATOM   4292 O O   . SER B 1 133 ? 1.501   35.348 51.409  1.00 65.88  ? 1319 SER B O   1 
ATOM   4293 C CB  . SER B 1 133 ? 2.668   35.821 48.436  1.00 44.12  ? 1319 SER B CB  1 
ATOM   4294 O OG  . SER B 1 133 ? 1.614   35.451 47.571  1.00 74.07  ? 1319 SER B OG  1 
ATOM   4295 N N   . GLN B 1 134 ? 0.702   33.794 50.004  1.00 48.49  ? 1320 GLN B N   1 
ATOM   4296 C CA  . GLN B 1 134 ? -0.520  33.591 50.766  1.00 57.52  ? 1320 GLN B CA  1 
ATOM   4297 C C   . GLN B 1 134 ? -0.175  32.959 52.102  1.00 50.06  ? 1320 GLN B C   1 
ATOM   4298 O O   . GLN B 1 134 ? -0.728  33.320 53.134  1.00 51.35  ? 1320 GLN B O   1 
ATOM   4299 C CB  . GLN B 1 134 ? -1.486  32.685 50.005  1.00 69.03  ? 1320 GLN B CB  1 
ATOM   4300 C CG  . GLN B 1 134 ? -2.301  33.393 48.950  1.00 68.85  ? 1320 GLN B CG  1 
ATOM   4301 C CD  . GLN B 1 134 ? -2.835  34.718 49.438  1.00 83.58  ? 1320 GLN B CD  1 
ATOM   4302 O OE1 . GLN B 1 134 ? -2.071  35.608 49.804  1.00 81.85  ? 1320 GLN B OE1 1 
ATOM   4303 N NE2 . GLN B 1 134 ? -4.154  34.861 49.441  1.00 76.15  ? 1320 GLN B NE2 1 
ATOM   4304 N N   . ASN B 1 135 ? 0.749   32.009 52.064  1.00 49.53  ? 1321 ASN B N   1 
ATOM   4305 C CA  . ASN B 1 135 ? 1.198   31.306 53.253  1.00 39.07  ? 1321 ASN B CA  1 
ATOM   4306 C C   . ASN B 1 135 ? 1.869   32.243 54.245  1.00 55.21  ? 1321 ASN B C   1 
ATOM   4307 O O   . ASN B 1 135 ? 1.640   32.160 55.445  1.00 43.88  ? 1321 ASN B O   1 
ATOM   4308 C CB  . ASN B 1 135 ? 2.187   30.215 52.842  1.00 45.12  ? 1321 ASN B CB  1 
ATOM   4309 C CG  . ASN B 1 135 ? 2.530   29.276 53.970  1.00 44.02  ? 1321 ASN B CG  1 
ATOM   4310 O OD1 . ASN B 1 135 ? 1.939   28.211 54.101  1.00 55.97  ? 1321 ASN B OD1 1 
ATOM   4311 N ND2 . ASN B 1 135 ? 3.508   29.653 54.777  1.00 45.02  ? 1321 ASN B ND2 1 
ATOM   4312 N N   . LEU B 1 136 ? 2.713   33.130 53.731  1.00 49.28  ? 1322 LEU B N   1 
ATOM   4313 C CA  . LEU B 1 136 ? 3.438   34.082 54.561  1.00 32.00  ? 1322 LEU B CA  1 
ATOM   4314 C C   . LEU B 1 136 ? 2.509   35.043 55.274  1.00 48.41  ? 1322 LEU B C   1 
ATOM   4315 O O   . LEU B 1 136 ? 2.728   35.390 56.428  1.00 60.24  ? 1322 LEU B O   1 
ATOM   4316 C CB  . LEU B 1 136 ? 4.437   34.866 53.719  1.00 44.53  ? 1322 LEU B CB  1 
ATOM   4317 C CG  . LEU B 1 136 ? 5.624   34.073 53.184  1.00 45.60  ? 1322 LEU B CG  1 
ATOM   4318 C CD1 . LEU B 1 136 ? 6.587   34.995 52.476  1.00 38.93  ? 1322 LEU B CD1 1 
ATOM   4319 C CD2 . LEU B 1 136 ? 6.313   33.354 54.321  1.00 36.00  ? 1322 LEU B CD2 1 
ATOM   4320 N N   . ILE B 1 137 ? 1.469   35.473 54.578  1.00 31.73  ? 1323 ILE B N   1 
ATOM   4321 C CA  . ILE B 1 137 ? 0.505   36.390 55.155  1.00 56.58  ? 1323 ILE B CA  1 
ATOM   4322 C C   . ILE B 1 137 ? -0.249  35.690 56.271  1.00 57.24  ? 1323 ILE B C   1 
ATOM   4323 O O   . ILE B 1 137 ? -0.580  36.290 57.288  1.00 45.69  ? 1323 ILE B O   1 
ATOM   4324 C CB  . ILE B 1 137 ? -0.483  36.888 54.101  1.00 62.69  ? 1323 ILE B CB  1 
ATOM   4325 C CG1 . ILE B 1 137 ? 0.196   37.919 53.203  1.00 43.64  ? 1323 ILE B CG1 1 
ATOM   4326 C CG2 . ILE B 1 137 ? -1.702  37.485 54.765  1.00 40.28  ? 1323 ILE B CG2 1 
ATOM   4327 C CD1 . ILE B 1 137 ? -0.635  38.341 52.028  1.00 68.70  ? 1323 ILE B CD1 1 
ATOM   4328 N N   . GLN B 1 138 ? -0.512  34.408 56.069  1.00 47.71  ? 1324 GLN B N   1 
ATOM   4329 C CA  . GLN B 1 138 ? -1.218  33.614 57.053  1.00 41.74  ? 1324 GLN B CA  1 
ATOM   4330 C C   . GLN B 1 138 ? -0.363  33.495 58.303  1.00 58.43  ? 1324 GLN B C   1 
ATOM   4331 O O   . GLN B 1 138 ? -0.879  33.461 59.413  1.00 61.02  ? 1324 GLN B O   1 
ATOM   4332 C CB  . GLN B 1 138 ? -1.529  32.234 56.483  1.00 46.05  ? 1324 GLN B CB  1 
ATOM   4333 C CG  . GLN B 1 138 ? -2.609  31.488 57.229  1.00 59.13  ? 1324 GLN B CG  1 
ATOM   4334 C CD  . GLN B 1 138 ? -3.861  32.312 57.399  1.00 81.85  ? 1324 GLN B CD  1 
ATOM   4335 O OE1 . GLN B 1 138 ? -3.803  33.536 57.474  1.00 81.80  ? 1324 GLN B OE1 1 
ATOM   4336 N NE2 . GLN B 1 138 ? -5.005  31.644 57.467  1.00 79.61  ? 1324 GLN B NE2 1 
ATOM   4337 N N   . GLN B 1 139 ? 0.950   33.439 58.117  1.00 42.74  ? 1325 GLN B N   1 
ATOM   4338 C CA  . GLN B 1 139 ? 1.874   33.332 59.236  1.00 43.78  ? 1325 GLN B CA  1 
ATOM   4339 C C   . GLN B 1 139 ? 1.996   34.663 59.954  1.00 52.56  ? 1325 GLN B C   1 
ATOM   4340 O O   . GLN B 1 139 ? 2.168   34.710 61.164  1.00 57.73  ? 1325 GLN B O   1 
ATOM   4341 C CB  . GLN B 1 139 ? 3.253   32.886 58.764  1.00 22.17  ? 1325 GLN B CB  1 
ATOM   4342 C CG  . GLN B 1 139 ? 3.298   31.493 58.188  1.00 27.88  ? 1325 GLN B CG  1 
ATOM   4343 C CD  . GLN B 1 139 ? 4.709   31.007 57.976  1.00 43.44  ? 1325 GLN B CD  1 
ATOM   4344 O OE1 . GLN B 1 139 ? 5.083   30.615 56.876  1.00 57.94  ? 1325 GLN B OE1 1 
ATOM   4345 N NE2 . GLN B 1 139 ? 5.507   31.041 59.028  1.00 41.47  ? 1325 GLN B NE2 1 
ATOM   4346 N N   . ALA B 1 140 ? 1.911   35.749 59.198  1.00 50.28  ? 1326 ALA B N   1 
ATOM   4347 C CA  . ALA B 1 140 ? 2.010   37.076 59.776  1.00 43.30  ? 1326 ALA B CA  1 
ATOM   4348 C C   . ALA B 1 140 ? 0.835   37.276 60.713  1.00 53.16  ? 1326 ALA B C   1 
ATOM   4349 O O   . ALA B 1 140 ? 0.951   37.925 61.745  1.00 55.06  ? 1326 ALA B O   1 
ATOM   4350 C CB  . ALA B 1 140 ? 2.008   38.123 58.689  1.00 29.95  ? 1326 ALA B CB  1 
ATOM   4351 N N   . LYS B 1 141 ? -0.300  36.705 60.338  1.00 36.63  ? 1327 LYS B N   1 
ATOM   4352 C CA  . LYS B 1 141 ? -1.513  36.793 61.133  1.00 57.53  ? 1327 LYS B CA  1 
ATOM   4353 C C   . LYS B 1 141 ? -1.417  36.016 62.438  1.00 55.88  ? 1327 LYS B C   1 
ATOM   4354 O O   . LYS B 1 141 ? -1.924  36.453 63.465  1.00 45.01  ? 1327 LYS B O   1 
ATOM   4355 C CB  . LYS B 1 141 ? -2.723  36.314 60.334  1.00 48.72  ? 1327 LYS B CB  1 
ATOM   4356 C CG  . LYS B 1 141 ? -3.234  37.322 59.326  1.00 60.85  ? 1327 LYS B CG  1 
ATOM   4357 C CD  . LYS B 1 141 ? -4.540  36.866 58.711  1.00 81.84  ? 1327 LYS B CD  1 
ATOM   4358 C CE  . LYS B 1 141 ? -5.052  37.868 57.695  1.00 77.23  ? 1327 LYS B CE  1 
ATOM   4359 N NZ  . LYS B 1 141 ? -6.326  37.419 57.074  1.00 89.95  ? 1327 LYS B NZ  1 
ATOM   4360 N N   . PHE B 1 142 ? -0.784  34.851 62.392  1.00 58.46  ? 1328 PHE B N   1 
ATOM   4361 C CA  . PHE B 1 142 ? -0.678  34.025 63.569  1.00 47.27  ? 1328 PHE B CA  1 
ATOM   4362 C C   . PHE B 1 142 ? 0.350   34.569 64.528  1.00 48.91  ? 1328 PHE B C   1 
ATOM   4363 O O   . PHE B 1 142 ? 0.123   34.596 65.716  1.00 56.49  ? 1328 PHE B O   1 
ATOM   4364 C CB  . PHE B 1 142 ? -0.365  32.595 63.180  1.00 52.67  ? 1328 PHE B CB  1 
ATOM   4365 C CG  . PHE B 1 142 ? -1.458  31.930 62.414  1.00 57.25  ? 1328 PHE B CG  1 
ATOM   4366 C CD1 . PHE B 1 142 ? -2.768  32.218 62.681  1.00 53.01  ? 1328 PHE B CD1 1 
ATOM   4367 C CD2 . PHE B 1 142 ? -1.178  30.999 61.448  1.00 49.89  ? 1328 PHE B CD2 1 
ATOM   4368 C CE1 . PHE B 1 142 ? -3.762  31.609 61.997  1.00 50.07  ? 1328 PHE B CE1 1 
ATOM   4369 C CE2 . PHE B 1 142 ? -2.182  30.387 60.767  1.00 38.74  ? 1328 PHE B CE2 1 
ATOM   4370 C CZ  . PHE B 1 142 ? -3.468  30.694 61.042  1.00 53.38  ? 1328 PHE B CZ  1 
ATOM   4371 N N   . TYR B 1 143 ? 1.485   35.008 64.014  1.00 41.79  ? 1329 TYR B N   1 
ATOM   4372 C CA  . TYR B 1 143 ? 2.487   35.631 64.851  1.00 46.44  ? 1329 TYR B CA  1 
ATOM   4373 C C   . TYR B 1 143 ? 1.939   36.877 65.559  1.00 43.20  ? 1329 TYR B C   1 
ATOM   4374 O O   . TYR B 1 143 ? 2.302   37.167 66.703  1.00 52.61  ? 1329 TYR B O   1 
ATOM   4375 C CB  . TYR B 1 143 ? 3.726   36.010 64.035  1.00 44.77  ? 1329 TYR B CB  1 
ATOM   4376 C CG  . TYR B 1 143 ? 4.657   34.859 63.813  1.00 55.76  ? 1329 TYR B CG  1 
ATOM   4377 C CD1 . TYR B 1 143 ? 4.337   33.576 64.286  1.00 82.56  ? 1329 TYR B CD1 1 
ATOM   4378 C CD2 . TYR B 1 143 ? 5.855   35.029 63.136  1.00 80.25  ? 1329 TYR B CD2 1 
ATOM   4379 C CE1 . TYR B 1 143 ? 5.171   32.499 64.088  1.00 86.70  ? 1329 TYR B CE1 1 
ATOM   4380 C CE2 . TYR B 1 143 ? 6.706   33.953 62.926  1.00 75.08  ? 1329 TYR B CE2 1 
ATOM   4381 C CZ  . TYR B 1 143 ? 6.356   32.696 63.409  1.00 47.19  ? 1329 TYR B CZ  1 
ATOM   4382 O OH  . TYR B 1 143 ? 7.201   31.636 63.218  1.00 48.55  ? 1329 TYR B OH  1 
ATOM   4383 N N   . GLU B 1 144 ? 1.074   37.608 64.864  1.00 49.27  ? 1330 GLU B N   1 
ATOM   4384 C CA  . GLU B 1 144 ? 0.552   38.851 65.374  1.00 44.23  ? 1330 GLU B CA  1 
ATOM   4385 C C   . GLU B 1 144 ? -0.418  38.519 66.480  1.00 57.24  ? 1330 GLU B C   1 
ATOM   4386 O O   . GLU B 1 144 ? -0.289  39.038 67.582  1.00 46.09  ? 1330 GLU B O   1 
ATOM   4387 C CB  . GLU B 1 144 ? -0.122  39.643 64.243  1.00 58.52  ? 1330 GLU B CB  1 
ATOM   4388 C CG  . GLU B 1 144 ? -0.780  41.009 64.609  1.00 70.45  ? 1330 GLU B CG  1 
ATOM   4389 C CD  . GLU B 1 144 ? 0.218   42.139 64.923  1.00 97.90  ? 1330 GLU B CD  1 
ATOM   4390 O OE1 . GLU B 1 144 ? 1.445   41.878 65.097  1.00 106.16 ? 1330 GLU B OE1 1 
ATOM   4391 O OE2 . GLU B 1 144 ? -0.243  43.306 65.012  1.00 98.28  ? 1330 GLU B OE2 1 
ATOM   4392 N N   . SER B 1 145 ? -1.385  37.651 66.169  1.00 46.46  ? 1331 SER B N   1 
ATOM   4393 C CA  . SER B 1 145 ? -2.330  37.121 67.144  1.00 40.63  ? 1331 SER B CA  1 
ATOM   4394 C C   . SER B 1 145 ? -1.664  36.602 68.433  1.00 47.35  ? 1331 SER B C   1 
ATOM   4395 O O   . SER B 1 145 ? -2.096  36.919 69.525  1.00 42.97  ? 1331 SER B O   1 
ATOM   4396 C CB  . SER B 1 145 ? -3.130  35.978 66.547  1.00 49.90  ? 1331 SER B CB  1 
ATOM   4397 O OG  . SER B 1 145 ? -3.468  36.197 65.217  1.00 49.36  ? 1331 SER B OG  1 
ATOM   4398 N N   . ILE B 1 146 ? -0.631  35.778 68.305  1.00 46.36  ? 1332 ILE B N   1 
ATOM   4399 C CA  . ILE B 1 146 ? 0.089   35.319 69.472  1.00 32.86  ? 1332 ILE B CA  1 
ATOM   4400 C C   . ILE B 1 146 ? 0.343   36.478 70.413  1.00 43.56  ? 1332 ILE B C   1 
ATOM   4401 O O   . ILE B 1 146 ? 0.024   36.377 71.584  1.00 71.24  ? 1332 ILE B O   1 
ATOM   4402 C CB  . ILE B 1 146 ? 1.391   34.594 69.100  1.00 46.61  ? 1332 ILE B CB  1 
ATOM   4403 C CG1 . ILE B 1 146 ? 1.051   33.176 68.674  1.00 48.65  ? 1332 ILE B CG1 1 
ATOM   4404 C CG2 . ILE B 1 146 ? 2.354   34.538 70.260  1.00 36.68  ? 1332 ILE B CG2 1 
ATOM   4405 C CD1 . ILE B 1 146 ? 2.173   32.439 68.038  1.00 38.52  ? 1332 ILE B CD1 1 
ATOM   4406 N N   . MET B 1 147 ? 0.870   37.589 69.897  1.00 50.24  ? 1333 MET B N   1 
ATOM   4407 C CA  . MET B 1 147 ? 1.225   38.748 70.700  1.00 52.70  ? 1333 MET B CA  1 
ATOM   4408 C C   . MET B 1 147 ? 0.046   39.594 71.122  1.00 47.01  ? 1333 MET B C   1 
ATOM   4409 O O   . MET B 1 147 ? 0.099   40.209 72.175  1.00 64.45  ? 1333 MET B O   1 
ATOM   4410 C CB  . MET B 1 147 ? 2.175   39.659 69.933  1.00 47.35  ? 1333 MET B CB  1 
ATOM   4411 C CG  . MET B 1 147 ? 3.535   39.086 69.674  1.00 70.86  ? 1333 MET B CG  1 
ATOM   4412 S SD  . MET B 1 147 ? 4.383   38.576 71.187  1.00 68.75  ? 1333 MET B SD  1 
ATOM   4413 C CE  . MET B 1 147 ? 6.106   38.953 70.800  1.00 147.13 ? 1333 MET B CE  1 
ATOM   4414 N N   . LYS B 1 148 ? -0.997  39.667 70.302  1.00 55.53  ? 1334 LYS B N   1 
ATOM   4415 C CA  . LYS B 1 148 ? -2.048  40.689 70.504  1.00 54.46  ? 1334 LYS B CA  1 
ATOM   4416 C C   . LYS B 1 148 ? -3.406  40.134 70.906  1.00 55.15  ? 1334 LYS B C   1 
ATOM   4417 O O   . LYS B 1 148 ? -4.237  40.853 71.392  1.00 73.57  ? 1334 LYS B O   1 
ATOM   4418 C CB  . LYS B 1 148 ? -2.228  41.605 69.276  1.00 48.48  ? 1334 LYS B CB  1 
ATOM   4419 C CG  . LYS B 1 148 ? -1.034  42.421 68.920  1.00 59.15  ? 1334 LYS B CG  1 
ATOM   4420 C CD  . LYS B 1 148 ? -1.427  43.733 68.276  1.00 80.52  ? 1334 LYS B CD  1 
ATOM   4421 C CE  . LYS B 1 148 ? -0.443  44.822 68.696  1.00 99.88  ? 1334 LYS B CE  1 
ATOM   4422 N NZ  . LYS B 1 148 ? 0.977   44.312 68.750  1.00 119.04 ? 1334 LYS B NZ  1 
ATOM   4423 N N   . ILE B 1 149 ? -3.631  38.847 70.695  1.00 64.24  ? 1335 ILE B N   1 
ATOM   4424 C CA  . ILE B 1 149 ? -4.907  38.261 71.079  1.00 67.62  ? 1335 ILE B CA  1 
ATOM   4425 C C   . ILE B 1 149 ? -4.671  37.304 72.233  1.00 79.05  ? 1335 ILE B C   1 
ATOM   4426 O O   . ILE B 1 149 ? -4.154  36.207 72.045  1.00 74.58  ? 1335 ILE B O   1 
ATOM   4427 C CB  . ILE B 1 149 ? -5.594  37.530 69.922  1.00 63.30  ? 1335 ILE B CB  1 
ATOM   4428 C CG1 . ILE B 1 149 ? -6.012  38.524 68.843  1.00 59.56  ? 1335 ILE B CG1 1 
ATOM   4429 C CG2 . ILE B 1 149 ? -6.813  36.793 70.422  1.00 44.49  ? 1335 ILE B CG2 1 
ATOM   4430 C CD1 . ILE B 1 149 ? -6.824  37.905 67.741  1.00 51.04  ? 1335 ILE B CD1 1 
ATOM   4431 N N   . LEU B 1 150 ? -5.045  37.735 73.433  1.00 89.65  ? 1336 LEU B N   1 
ATOM   4432 C CA  . LEU B 1 150 ? -4.861  36.918 74.623  1.00 97.04  ? 1336 LEU B CA  1 
ATOM   4433 C C   . LEU B 1 150 ? -5.806  35.728 74.657  1.00 77.71  ? 1336 LEU B C   1 
ATOM   4434 O O   . LEU B 1 150 ? -7.011  35.869 74.470  1.00 65.34  ? 1336 LEU B O   1 
ATOM   4435 C CB  . LEU B 1 150 ? -5.009  37.762 75.890  1.00 100.79 ? 1336 LEU B CB  1 
ATOM   4436 C CG  . LEU B 1 150 ? -4.051  38.949 76.007  1.00 99.65  ? 1336 LEU B CG  1 
ATOM   4437 C CD1 . LEU B 1 150 ? -3.817  39.289 77.467  1.00 69.72  ? 1336 LEU B CD1 1 
ATOM   4438 C CD2 . LEU B 1 150 ? -2.733  38.650 75.320  1.00 77.20  ? 1336 LEU B CD2 1 
ATOM   4439 N N   . ARG B 1 151 ? -5.235  34.555 74.899  1.00 42.46  ? 1337 ARG B N   1 
ATOM   4440 C CA  . ARG B 1 151 ? -5.988  33.315 74.961  1.00 47.78  ? 1337 ARG B CA  1 
ATOM   4441 C C   . ARG B 1 151 ? -6.132  32.875 76.407  1.00 58.45  ? 1337 ARG B C   1 
ATOM   4442 O O   . ARG B 1 151 ? -5.151  32.813 77.138  1.00 59.59  ? 1337 ARG B O   1 
ATOM   4443 C CB  . ARG B 1 151 ? -5.265  32.240 74.154  1.00 40.47  ? 1337 ARG B CB  1 
ATOM   4444 C CG  . ARG B 1 151 ? -5.036  32.616 72.705  1.00 51.11  ? 1337 ARG B CG  1 
ATOM   4445 C CD  . ARG B 1 151 ? -4.064  31.676 72.020  1.00 45.27  ? 1337 ARG B CD  1 
ATOM   4446 N NE  . ARG B 1 151 ? -2.676  32.039 72.278  1.00 40.35  ? 1337 ARG B NE  1 
ATOM   4447 C CZ  . ARG B 1 151 ? -1.636  31.474 71.678  1.00 36.48  ? 1337 ARG B CZ  1 
ATOM   4448 N NH1 . ARG B 1 151 ? -1.826  30.520 70.785  1.00 43.67  ? 1337 ARG B NH1 1 
ATOM   4449 N NH2 . ARG B 1 151 ? -0.408  31.861 71.970  1.00 27.67  ? 1337 ARG B NH2 1 
ATOM   4450 N N   . PRO B 1 152 ? -7.356  32.573 76.822  1.00 54.06  ? 1338 PRO B N   1 
ATOM   4451 C CA  . PRO B 1 152 ? -7.608  32.148 78.199  1.00 48.10  ? 1338 PRO B CA  1 
ATOM   4452 C C   . PRO B 1 152 ? -6.875  30.870 78.527  1.00 42.42  ? 1338 PRO B C   1 
ATOM   4453 O O   . PRO B 1 152 ? -6.895  29.921 77.751  1.00 55.70  ? 1338 PRO B O   1 
ATOM   4454 C CB  . PRO B 1 152 ? -9.097  31.853 78.213  1.00 42.07  ? 1338 PRO B CB  1 
ATOM   4455 C CG  . PRO B 1 152 ? -9.651  32.526 76.984  1.00 56.76  ? 1338 PRO B CG  1 
ATOM   4456 C CD  . PRO B 1 152 ? -8.566  32.532 75.986  1.00 54.43  ? 1338 PRO B CD  1 
ATOM   4457 N N   . LYS B 1 153 ? -6.243  30.849 79.691  1.00 54.43  ? 1339 LYS B N   1 
ATOM   4458 C CA  . LYS B 1 153 ? -5.459  29.704 80.149  1.00 39.19  ? 1339 LYS B CA  1 
ATOM   4459 C C   . LYS B 1 153 ? -6.439  28.575 80.462  1.00 51.89  ? 1339 LYS B C   1 
ATOM   4460 O O   . LYS B 1 153 ? -7.430  28.779 81.141  1.00 53.71  ? 1339 LYS B O   1 
ATOM   4461 C CB  . LYS B 1 153 ? -4.589  30.156 81.346  1.00 48.49  ? 1339 LYS B CB  1 
ATOM   4462 C CG  . LYS B 1 153 ? -4.187  29.133 82.405  1.00 61.73  ? 1339 LYS B CG  1 
ATOM   4463 C CD  . LYS B 1 153 ? -3.854  29.887 83.726  1.00 69.56  ? 1339 LYS B CD  1 
ATOM   4464 C CE  . LYS B 1 153 ? -4.506  29.247 84.977  1.00 76.22  ? 1339 LYS B CE  1 
ATOM   4465 N NZ  . LYS B 1 153 ? -5.954  28.821 84.831  1.00 61.48  ? 1339 LYS B NZ  1 
ATOM   4466 N N   . PRO B 1 154 ? -6.209  27.385 79.924  1.00 42.28  ? 1340 PRO B N   1 
ATOM   4467 C CA  . PRO B 1 154 ? -7.141  26.318 80.257  1.00 50.22  ? 1340 PRO B CA  1 
ATOM   4468 C C   . PRO B 1 154 ? -6.807  25.711 81.611  1.00 53.06  ? 1340 PRO B C   1 
ATOM   4469 O O   . PRO B 1 154 ? -5.726  25.937 82.143  1.00 43.45  ? 1340 PRO B O   1 
ATOM   4470 C CB  . PRO B 1 154 ? -6.907  25.310 79.145  1.00 29.37  ? 1340 PRO B CB  1 
ATOM   4471 C CG  . PRO B 1 154 ? -5.466  25.478 78.832  1.00 44.79  ? 1340 PRO B CG  1 
ATOM   4472 C CD  . PRO B 1 154 ? -5.223  26.959 78.923  1.00 44.50  ? 1340 PRO B CD  1 
ATOM   4473 N N   . ASP B 1 155 ? -7.751  24.973 82.176  1.00 38.84  ? 1341 ASP B N   1 
ATOM   4474 C CA  . ASP B 1 155 ? -7.521  24.335 83.439  1.00 32.86  ? 1341 ASP B CA  1 
ATOM   4475 C C   . ASP B 1 155 ? -7.382  22.868 83.211  1.00 48.06  ? 1341 ASP B C   1 
ATOM   4476 O O   . ASP B 1 155 ? -7.998  22.324 82.323  1.00 46.39  ? 1341 ASP B O   1 
ATOM   4477 C CB  . ASP B 1 155 ? -8.671  24.585 84.404  1.00 44.90  ? 1341 ASP B CB  1 
ATOM   4478 C CG  . ASP B 1 155 ? -8.466  25.815 85.283  1.00 61.66  ? 1341 ASP B CG  1 
ATOM   4479 O OD1 . ASP B 1 155 ? -7.310  26.224 85.596  1.00 64.43  ? 1341 ASP B OD1 1 
ATOM   4480 O OD2 . ASP B 1 155 ? -9.512  26.362 85.689  1.00 74.54  ? 1341 ASP B OD2 1 
ATOM   4481 N N   . TYR B 1 156 ? -6.577  22.223 84.042  1.00 49.74  ? 1342 TYR B N   1 
ATOM   4482 C CA  . TYR B 1 156 ? -6.474  20.797 83.998  1.00 42.07  ? 1342 TYR B CA  1 
ATOM   4483 C C   . TYR B 1 156 ? -7.088  20.180 85.251  1.00 55.52  ? 1342 TYR B C   1 
ATOM   4484 O O   . TYR B 1 156 ? -6.898  20.695 86.381  1.00 54.93  ? 1342 TYR B O   1 
ATOM   4485 C CB  . TYR B 1 156 ? -5.031  20.437 83.829  1.00 40.41  ? 1342 TYR B CB  1 
ATOM   4486 C CG  . TYR B 1 156 ? -4.535  20.891 82.500  1.00 51.27  ? 1342 TYR B CG  1 
ATOM   4487 C CD1 . TYR B 1 156 ? -4.753  20.116 81.367  1.00 36.96  ? 1342 TYR B CD1 1 
ATOM   4488 C CD2 . TYR B 1 156 ? -3.891  22.122 82.355  1.00 43.76  ? 1342 TYR B CD2 1 
ATOM   4489 C CE1 . TYR B 1 156 ? -4.316  20.534 80.146  1.00 35.42  ? 1342 TYR B CE1 1 
ATOM   4490 C CE2 . TYR B 1 156 ? -3.450  22.552 81.138  1.00 30.25  ? 1342 TYR B CE2 1 
ATOM   4491 C CZ  . TYR B 1 156 ? -3.656  21.751 80.038  1.00 46.78  ? 1342 TYR B CZ  1 
ATOM   4492 O OH  . TYR B 1 156 ? -3.234  22.145 78.803  1.00 47.14  ? 1342 TYR B OH  1 
ATOM   4493 N N   . PHE B 1 157 ? -7.847  19.101 85.048  1.00 39.37  ? 1343 PHE B N   1 
ATOM   4494 C CA  . PHE B 1 157 ? -8.467  18.397 86.137  1.00 32.25  ? 1343 PHE B CA  1 
ATOM   4495 C C   . PHE B 1 157 ? -8.060  16.960 86.149  1.00 42.71  ? 1343 PHE B C   1 
ATOM   4496 O O   . PHE B 1 157 ? -8.146  16.290 85.154  1.00 53.61  ? 1343 PHE B O   1 
ATOM   4497 C CB  . PHE B 1 157 ? -9.961  18.442 85.976  1.00 34.02  ? 1343 PHE B CB  1 
ATOM   4498 C CG  . PHE B 1 157 ? -10.488 19.777 85.603  1.00 46.79  ? 1343 PHE B CG  1 
ATOM   4499 C CD1 . PHE B 1 157 ? -10.317 20.882 86.431  1.00 49.34  ? 1343 PHE B CD1 1 
ATOM   4500 C CD2 . PHE B 1 157 ? -11.210 19.925 84.433  1.00 48.47  ? 1343 PHE B CD2 1 
ATOM   4501 C CE1 . PHE B 1 157 ? -10.847 22.126 86.077  1.00 58.12  ? 1343 PHE B CE1 1 
ATOM   4502 C CE2 . PHE B 1 157 ? -11.748 21.162 84.072  1.00 46.34  ? 1343 PHE B CE2 1 
ATOM   4503 C CZ  . PHE B 1 157 ? -11.565 22.265 84.891  1.00 49.60  ? 1343 PHE B CZ  1 
ATOM   4504 N N   . ALA B 1 158 ? -7.648  16.470 87.300  1.00 47.61  ? 1344 ALA B N   1 
ATOM   4505 C CA  . ALA B 1 158 ? -7.324  15.065 87.450  1.00 46.78  ? 1344 ALA B CA  1 
ATOM   4506 C C   . ALA B 1 158 ? -8.603  14.418 87.852  1.00 36.87  ? 1344 ALA B C   1 
ATOM   4507 O O   . ALA B 1 158 ? -9.286  14.938 88.713  1.00 52.09  ? 1344 ALA B O   1 
ATOM   4508 C CB  . ALA B 1 158 ? -6.306  14.898 88.557  1.00 36.06  ? 1344 ALA B CB  1 
ATOM   4509 N N   . VAL B 1 159 ? -8.958  13.304 87.233  1.00 36.89  ? 1345 VAL B N   1 
ATOM   4510 C CA  . VAL B 1 159 ? -10.025 12.495 87.817  1.00 50.24  ? 1345 VAL B CA  1 
ATOM   4511 C C   . VAL B 1 159 ? -9.497  11.097 88.114  1.00 54.12  ? 1345 VAL B C   1 
ATOM   4512 O O   . VAL B 1 159 ? -8.784  10.513 87.301  1.00 52.42  ? 1345 VAL B O   1 
ATOM   4513 C CB  . VAL B 1 159 ? -11.349 12.447 86.973  1.00 55.68  ? 1345 VAL B CB  1 
ATOM   4514 C CG1 . VAL B 1 159 ? -11.638 13.770 86.320  1.00 53.72  ? 1345 VAL B CG1 1 
ATOM   4515 C CG2 . VAL B 1 159 ? -11.273 11.396 85.933  1.00 65.45  ? 1345 VAL B CG2 1 
ATOM   4516 N N   . GLY B 1 160 ? -9.820  10.584 89.295  1.00 43.35  ? 1346 GLY B N   1 
ATOM   4517 C CA  . GLY B 1 160 ? -9.500  9.204  89.634  1.00 53.76  ? 1346 GLY B CA  1 
ATOM   4518 C C   . GLY B 1 160 ? -10.786 8.415  89.707  1.00 50.19  ? 1346 GLY B C   1 
ATOM   4519 O O   . GLY B 1 160 ? -11.747 8.896  90.245  1.00 50.18  ? 1346 GLY B O   1 
ATOM   4520 N N   . TYR B 1 161 ? -10.807 7.224  89.130  1.00 50.76  ? 1347 TYR B N   1 
ATOM   4521 C CA  . TYR B 1 161 ? -11.976 6.332  89.167  1.00 57.07  ? 1347 TYR B CA  1 
ATOM   4522 C C   . TYR B 1 161 ? -11.636 5.125  89.998  1.00 72.70  ? 1347 TYR B C   1 
ATOM   4523 O O   . TYR B 1 161 ? -10.917 4.242  89.526  1.00 81.09  ? 1347 TYR B O   1 
ATOM   4524 C CB  . TYR B 1 161 ? -12.299 5.815  87.781  1.00 56.88  ? 1347 TYR B CB  1 
ATOM   4525 C CG  . TYR B 1 161 ? -12.681 6.874  86.810  1.00 54.09  ? 1347 TYR B CG  1 
ATOM   4526 C CD1 . TYR B 1 161 ? -13.948 7.436  86.839  1.00 62.42  ? 1347 TYR B CD1 1 
ATOM   4527 C CD2 . TYR B 1 161 ? -11.782 7.312  85.854  1.00 57.44  ? 1347 TYR B CD2 1 
ATOM   4528 C CE1 . TYR B 1 161 ? -14.312 8.411  85.952  1.00 46.86  ? 1347 TYR B CE1 1 
ATOM   4529 C CE2 . TYR B 1 161 ? -12.132 8.282  84.955  1.00 56.33  ? 1347 TYR B CE2 1 
ATOM   4530 C CZ  . TYR B 1 161 ? -13.403 8.831  85.011  1.00 57.18  ? 1347 TYR B CZ  1 
ATOM   4531 O OH  . TYR B 1 161 ? -13.759 9.814  84.132  1.00 46.28  ? 1347 TYR B OH  1 
ATOM   4532 N N   . TYR B 1 162 ? -12.147 5.054  91.215  1.00 62.69  ? 1348 TYR B N   1 
ATOM   4533 C CA  . TYR B 1 162 ? -11.588 4.093  92.120  1.00 63.42  ? 1348 TYR B CA  1 
ATOM   4534 C C   . TYR B 1 162 ? -12.464 2.932  92.519  1.00 85.22  ? 1348 TYR B C   1 
ATOM   4535 O O   . TYR B 1 162 ? -11.955 1.931  93.036  1.00 108.16 ? 1348 TYR B O   1 
ATOM   4536 C CB  . TYR B 1 162 ? -11.033 4.786  93.340  1.00 57.97  ? 1348 TYR B CB  1 
ATOM   4537 C CG  . TYR B 1 162 ? -9.808  5.607  93.050  1.00 59.15  ? 1348 TYR B CG  1 
ATOM   4538 C CD1 . TYR B 1 162 ? -8.564  5.008  92.852  1.00 60.15  ? 1348 TYR B CD1 1 
ATOM   4539 C CD2 . TYR B 1 162 ? -9.891  6.978  92.994  1.00 52.91  ? 1348 TYR B CD2 1 
ATOM   4540 C CE1 . TYR B 1 162 ? -7.433  5.774  92.601  1.00 59.86  ? 1348 TYR B CE1 1 
ATOM   4541 C CE2 . TYR B 1 162 ? -8.791  7.750  92.754  1.00 51.86  ? 1348 TYR B CE2 1 
ATOM   4542 C CZ  . TYR B 1 162 ? -7.559  7.156  92.559  1.00 67.29  ? 1348 TYR B CZ  1 
ATOM   4543 O OH  . TYR B 1 162 ? -6.477  7.970  92.322  1.00 68.14  ? 1348 TYR B OH  1 
ATOM   4544 N N   . GLY B 1 163 ? -13.763 3.012  92.288  1.00 73.05  ? 1349 GLY B N   1 
ATOM   4545 C CA  . GLY B 1 163 ? -14.565 1.816  92.538  1.00 91.57  ? 1349 GLY B CA  1 
ATOM   4546 C C   . GLY B 1 163 ? -14.186 0.572  91.730  1.00 76.38  ? 1349 GLY B C   1 
ATOM   4547 O O   . GLY B 1 163 ? -13.576 0.665  90.675  1.00 80.21  ? 1349 GLY B O   1 
ATOM   4548 N N   . GLN B 1 164 ? -14.554 -0.600 92.225  1.00 77.70  ? 1350 GLN B N   1 
ATOM   4549 C CA  . GLN B 1 164 ? -14.510 -1.803 91.404  1.00 90.78  ? 1350 GLN B CA  1 
ATOM   4550 C C   . GLN B 1 164 ? -15.674 -1.792 90.399  1.00 95.72  ? 1350 GLN B C   1 
ATOM   4551 O O   . GLN B 1 164 ? -15.675 -2.552 89.419  1.00 96.37  ? 1350 GLN B O   1 
ATOM   4552 C CB  . GLN B 1 164 ? -14.569 -3.057 92.281  1.00 86.76  ? 1350 GLN B CB  1 
ATOM   4553 C CG  . GLN B 1 164 ? -13.888 -4.284 91.687  1.00 86.15  ? 1350 GLN B CG  1 
ATOM   4554 C CD  . GLN B 1 164 ? -12.362 -4.211 91.722  1.00 94.89  ? 1350 GLN B CD  1 
ATOM   4555 O OE1 . GLN B 1 164 ? -11.692 -4.798 90.869  1.00 81.17  ? 1350 GLN B OE1 1 
ATOM   4556 N NE2 . GLN B 1 164 ? -11.808 -3.499 92.710  1.00 86.48  ? 1350 GLN B NE2 1 
ATOM   4557 N N   . GLY B 1 165 ? -16.653 -0.918 90.653  1.00 81.19  ? 1351 GLY B N   1 
ATOM   4558 C CA  . GLY B 1 165 ? -17.792 -0.707 89.762  1.00 93.34  ? 1351 GLY B CA  1 
ATOM   4559 C C   . GLY B 1 165 ? -17.437 -0.272 88.344  1.00 102.88 ? 1351 GLY B C   1 
ATOM   4560 O O   . GLY B 1 165 ? -18.223 -0.474 87.410  1.00 97.48  ? 1351 GLY B O   1 
ATOM   4561 N N   . PHE B 1 166 ? -16.250 0.315  88.178  1.00 101.17 ? 1352 PHE B N   1 
ATOM   4562 C CA  . PHE B 1 166 ? -15.791 0.793  86.865  1.00 92.76  ? 1352 PHE B CA  1 
ATOM   4563 C C   . PHE B 1 166 ? -15.311 -0.312 85.919  1.00 83.80  ? 1352 PHE B C   1 
ATOM   4564 O O   . PHE B 1 166 ? -14.672 -1.282 86.363  1.00 74.59  ? 1352 PHE B O   1 
ATOM   4565 C CB  . PHE B 1 166 ? -14.690 1.845  87.022  1.00 84.24  ? 1352 PHE B CB  1 
ATOM   4566 C CG  . PHE B 1 166 ? -15.134 3.067  87.729  1.00 64.40  ? 1352 PHE B CG  1 
ATOM   4567 C CD1 . PHE B 1 166 ? -16.014 3.934  87.121  1.00 46.80  ? 1352 PHE B CD1 1 
ATOM   4568 C CD2 . PHE B 1 166 ? -14.667 3.346  89.012  1.00 72.86  ? 1352 PHE B CD2 1 
ATOM   4569 C CE1 . PHE B 1 166 ? -16.433 5.063  87.775  1.00 64.79  ? 1352 PHE B CE1 1 
ATOM   4570 C CE2 . PHE B 1 166 ? -15.076 4.488  89.700  1.00 77.33  ? 1352 PHE B CE2 1 
ATOM   4571 C CZ  . PHE B 1 166 ? -15.956 5.352  89.081  1.00 81.88  ? 1352 PHE B CZ  1 
ATOM   4572 N N   . PRO B 1 167 ? -15.624 -0.158 84.613  1.00 75.12  ? 1353 PRO B N   1 
ATOM   4573 C CA  . PRO B 1 167 ? -15.077 -0.988 83.555  1.00 78.80  ? 1353 PRO B CA  1 
ATOM   4574 C C   . PRO B 1 167 ? -13.566 -0.981 83.617  1.00 93.12  ? 1353 PRO B C   1 
ATOM   4575 O O   . PRO B 1 167 ? -12.955 -0.089 84.225  1.00 99.92  ? 1353 PRO B O   1 
ATOM   4576 C CB  . PRO B 1 167 ? -15.525 -0.287 82.269  1.00 82.85  ? 1353 PRO B CB  1 
ATOM   4577 C CG  . PRO B 1 167 ? -16.430 0.821  82.681  1.00 68.74  ? 1353 PRO B CG  1 
ATOM   4578 C CD  . PRO B 1 167 ? -16.697 0.721  84.125  1.00 55.50  ? 1353 PRO B CD  1 
ATOM   4579 N N   . SER B 1 168 ? -12.980 -1.964 82.956  1.00 88.22  ? 1354 SER B N   1 
ATOM   4580 C CA  . SER B 1 168 ? -11.570 -2.245 83.062  1.00 86.56  ? 1354 SER B CA  1 
ATOM   4581 C C   . SER B 1 168 ? -10.634 -1.157 82.423  1.00 94.03  ? 1354 SER B C   1 
ATOM   4582 O O   . SER B 1 168 ? -9.459  -1.012 82.814  1.00 101.03 ? 1354 SER B O   1 
ATOM   4583 C CB  . SER B 1 168 ? -11.418 -3.695 82.598  1.00 86.90  ? 1354 SER B CB  1 
ATOM   4584 O OG  . SER B 1 168 ? -10.292 -4.000 81.865  1.00 94.17  ? 1354 SER B OG  1 
ATOM   4585 N N   . PHE B 1 169 ? -11.173 -0.340 81.516  1.00 81.14  ? 1355 PHE B N   1 
ATOM   4586 C CA  . PHE B 1 169 ? -10.367 0.719  80.911  1.00 86.71  ? 1355 PHE B CA  1 
ATOM   4587 C C   . PHE B 1 169 ? -10.351 1.982  81.781  1.00 80.87  ? 1355 PHE B C   1 
ATOM   4588 O O   . PHE B 1 169 ? -9.500  2.849  81.602  1.00 66.16  ? 1355 PHE B O   1 
ATOM   4589 C CB  . PHE B 1 169 ? -10.812 1.004  79.471  1.00 95.21  ? 1355 PHE B CB  1 
ATOM   4590 C CG  . PHE B 1 169 ? -12.023 1.883  79.367  1.00 107.98 ? 1355 PHE B CG  1 
ATOM   4591 C CD1 . PHE B 1 169 ? -13.209 1.558  80.036  1.00 107.01 ? 1355 PHE B CD1 1 
ATOM   4592 C CD2 . PHE B 1 169 ? -11.981 3.048  78.599  1.00 105.81 ? 1355 PHE B CD2 1 
ATOM   4593 C CE1 . PHE B 1 169 ? -14.346 2.389  79.936  1.00 96.29  ? 1355 PHE B CE1 1 
ATOM   4594 C CE2 . PHE B 1 169 ? -13.114 3.892  78.495  1.00 96.87  ? 1355 PHE B CE2 1 
ATOM   4595 C CZ  . PHE B 1 169 ? -14.295 3.558  79.161  1.00 90.16  ? 1355 PHE B CZ  1 
ATOM   4596 N N   . LEU B 1 170 ? -11.281 2.065  82.731  1.00 77.54  ? 1356 LEU B N   1 
ATOM   4597 C CA  . LEU B 1 170 ? -11.306 3.154  83.723  1.00 75.53  ? 1356 LEU B CA  1 
ATOM   4598 C C   . LEU B 1 170 ? -10.837 2.765  85.143  1.00 73.23  ? 1356 LEU B C   1 
ATOM   4599 O O   . LEU B 1 170 ? -10.411 3.618  85.914  1.00 72.13  ? 1356 LEU B O   1 
ATOM   4600 C CB  . LEU B 1 170 ? -12.714 3.742  83.839  1.00 63.41  ? 1356 LEU B CB  1 
ATOM   4601 C CG  . LEU B 1 170 ? -13.384 4.459  82.675  1.00 65.31  ? 1356 LEU B CG  1 
ATOM   4602 C CD1 . LEU B 1 170 ? -14.560 5.217  83.236  1.00 70.45  ? 1356 LEU B CD1 1 
ATOM   4603 C CD2 . LEU B 1 170 ? -12.467 5.406  81.932  1.00 75.43  ? 1356 LEU B CD2 1 
ATOM   4604 N N   . ARG B 1 171 ? -10.949 1.480  85.471  1.00 82.93  ? 1357 ARG B N   1 
ATOM   4605 C CA  . ARG B 1 171 ? -10.727 0.920  86.818  1.00 89.91  ? 1357 ARG B CA  1 
ATOM   4606 C C   . ARG B 1 171 ? -9.462  1.382  87.544  1.00 82.33  ? 1357 ARG B C   1 
ATOM   4607 O O   . ARG B 1 171 ? -8.347  1.092  87.108  1.00 83.65  ? 1357 ARG B O   1 
ATOM   4608 C CB  . ARG B 1 171 ? -10.663 -0.610 86.719  1.00 108.28 ? 1357 ARG B CB  1 
ATOM   4609 C CG  . ARG B 1 171 ? -9.502  -1.117 85.784  1.00 149.97 ? 1357 ARG B CG  1 
ATOM   4610 C CD  . ARG B 1 171 ? -9.009  -2.545 86.085  1.00 151.89 ? 1357 ARG B CD  1 
ATOM   4611 N NE  . ARG B 1 171 ? -7.694  -2.568 86.760  1.00 147.67 ? 1357 ARG B NE  1 
ATOM   4612 C CZ  . ARG B 1 171 ? -7.297  -3.543 87.591  1.00 136.06 ? 1357 ARG B CZ  1 
ATOM   4613 N NH1 . ARG B 1 171 ? -8.082  -4.598 87.884  1.00 131.98 ? 1357 ARG B NH1 1 
ATOM   4614 N NH2 . ARG B 1 171 ? -6.088  -3.478 88.156  1.00 127.15 ? 1357 ARG B NH2 1 
ATOM   4615 N N   . ASN B 1 172 ? -9.636  2.055  88.676  1.00 78.43  ? 1358 ASN B N   1 
ATOM   4616 C CA  . ASN B 1 172 ? -8.512  2.443  89.543  1.00 77.03  ? 1358 ASN B CA  1 
ATOM   4617 C C   . ASN B 1 172 ? -7.451  3.214  88.794  1.00 66.40  ? 1358 ASN B C   1 
ATOM   4618 O O   . ASN B 1 172 ? -6.260  3.000  88.987  1.00 54.24  ? 1358 ASN B O   1 
ATOM   4619 C CB  . ASN B 1 172 ? -7.877  1.211  90.213  1.00 83.06  ? 1358 ASN B CB  1 
ATOM   4620 C CG  . ASN B 1 172 ? -8.794  0.559  91.246  1.00 84.68  ? 1358 ASN B CG  1 
ATOM   4621 O OD1 . ASN B 1 172 ? -9.903  0.141  90.936  1.00 95.86  ? 1358 ASN B OD1 1 
ATOM   4622 N ND2 . ASN B 1 172 ? -8.318  0.452  92.469  1.00 79.23  ? 1358 ASN B ND2 1 
ATOM   4623 N N   . LYS B 1 173 ? -7.909  4.105  87.925  1.00 70.38  ? 1359 LYS B N   1 
ATOM   4624 C CA  . LYS B 1 173 ? -7.032  4.862  87.038  1.00 57.04  ? 1359 LYS B CA  1 
ATOM   4625 C C   . LYS B 1 173 ? -7.222  6.362  87.188  1.00 56.13  ? 1359 LYS B C   1 
ATOM   4626 O O   . LYS B 1 173 ? -8.295  6.831  87.582  1.00 64.26  ? 1359 LYS B O   1 
ATOM   4627 C CB  . LYS B 1 173 ? -7.257  4.432  85.593  1.00 61.35  ? 1359 LYS B CB  1 
ATOM   4628 C CG  . LYS B 1 173 ? -6.512  3.173  85.254  1.00 70.07  ? 1359 LYS B CG  1 
ATOM   4629 C CD  . LYS B 1 173 ? -6.700  2.793  83.823  1.00 78.61  ? 1359 LYS B CD  1 
ATOM   4630 C CE  . LYS B 1 173 ? -5.917  1.534  83.497  1.00 86.50  ? 1359 LYS B CE  1 
ATOM   4631 N NZ  . LYS B 1 173 ? -5.881  1.323  82.024  1.00 85.57  ? 1359 LYS B NZ  1 
ATOM   4632 N N   . VAL B 1 174 ? -6.170  7.113  86.888  1.00 60.93  ? 1360 VAL B N   1 
ATOM   4633 C CA  . VAL B 1 174 ? -6.239  8.564  86.958  1.00 51.67  ? 1360 VAL B CA  1 
ATOM   4634 C C   . VAL B 1 174 ? -6.075  9.098  85.554  1.00 57.94  ? 1360 VAL B C   1 
ATOM   4635 O O   . VAL B 1 174 ? -5.233  8.602  84.784  1.00 57.62  ? 1360 VAL B O   1 
ATOM   4636 C CB  . VAL B 1 174 ? -5.150  9.156  87.861  1.00 42.23  ? 1360 VAL B CB  1 
ATOM   4637 C CG1 . VAL B 1 174 ? -5.499  10.560 88.219  1.00 47.30  ? 1360 VAL B CG1 1 
ATOM   4638 C CG2 . VAL B 1 174 ? -5.015  8.365  89.117  1.00 44.75  ? 1360 VAL B CG2 1 
ATOM   4639 N N   . PHE B 1 175 ? -6.890  10.089 85.218  1.00 41.89  ? 1361 PHE B N   1 
ATOM   4640 C CA  . PHE B 1 175 ? -6.782  10.741 83.937  1.00 46.76  ? 1361 PHE B CA  1 
ATOM   4641 C C   . PHE B 1 175 ? -6.675  12.213 84.143  1.00 47.02  ? 1361 PHE B C   1 
ATOM   4642 O O   . PHE B 1 175 ? -7.273  12.739 85.086  1.00 57.39  ? 1361 PHE B O   1 
ATOM   4643 C CB  . PHE B 1 175 ? -8.010  10.454 83.102  1.00 54.66  ? 1361 PHE B CB  1 
ATOM   4644 C CG  . PHE B 1 175 ? -8.105  9.048  82.668  1.00 59.59  ? 1361 PHE B CG  1 
ATOM   4645 C CD1 . PHE B 1 175 ? -8.613  8.079  83.525  1.00 56.64  ? 1361 PHE B CD1 1 
ATOM   4646 C CD2 . PHE B 1 175 ? -7.681  8.671  81.410  1.00 53.41  ? 1361 PHE B CD2 1 
ATOM   4647 C CE1 . PHE B 1 175 ? -8.713  6.751  83.122  1.00 68.35  ? 1361 PHE B CE1 1 
ATOM   4648 C CE2 . PHE B 1 175 ? -7.761  7.353  81.011  1.00 52.31  ? 1361 PHE B CE2 1 
ATOM   4649 C CZ  . PHE B 1 175 ? -8.276  6.391  81.867  1.00 53.58  ? 1361 PHE B CZ  1 
ATOM   4650 N N   . ILE B 1 176 ? -5.933  12.878 83.261  1.00 35.08  ? 1362 ILE B N   1 
ATOM   4651 C CA  . ILE B 1 176 ? -5.881  14.315 83.263  1.00 34.80  ? 1362 ILE B CA  1 
ATOM   4652 C C   . ILE B 1 176 ? -6.720  14.811 82.113  1.00 43.95  ? 1362 ILE B C   1 
ATOM   4653 O O   . ILE B 1 176 ? -6.590  14.325 81.010  1.00 48.53  ? 1362 ILE B O   1 
ATOM   4654 C CB  . ILE B 1 176 ? -4.443  14.856 83.145  1.00 36.42  ? 1362 ILE B CB  1 
ATOM   4655 C CG1 . ILE B 1 176 ? -3.515  14.202 84.172  1.00 36.36  ? 1362 ILE B CG1 1 
ATOM   4656 C CG2 . ILE B 1 176 ? -4.440  16.360 83.346  1.00 34.27  ? 1362 ILE B CG2 1 
ATOM   4657 C CD1 . ILE B 1 176 ? -3.883  14.514 85.631  1.00 44.23  ? 1362 ILE B CD1 1 
ATOM   4658 N N   . TYR B 1 177 ? -7.578  15.784 82.383  1.00 38.71  ? 1363 TYR B N   1 
ATOM   4659 C CA  . TYR B 1 177 ? -8.511  16.305 81.410  1.00 37.26  ? 1363 TYR B CA  1 
ATOM   4660 C C   . TYR B 1 177 ? -8.174  17.730 81.186  1.00 45.10  ? 1363 TYR B C   1 
ATOM   4661 O O   . TYR B 1 177 ? -7.912  18.469 82.131  1.00 52.25  ? 1363 TYR B O   1 
ATOM   4662 C CB  . TYR B 1 177 ? -9.924  16.269 81.931  1.00 39.08  ? 1363 TYR B CB  1 
ATOM   4663 C CG  . TYR B 1 177 ? -10.567 14.900 81.876  1.00 66.05  ? 1363 TYR B CG  1 
ATOM   4664 C CD1 . TYR B 1 177 ? -10.142 13.845 82.716  1.00 67.97  ? 1363 TYR B CD1 1 
ATOM   4665 C CD2 . TYR B 1 177 ? -11.631 14.652 81.008  1.00 56.84  ? 1363 TYR B CD2 1 
ATOM   4666 C CE1 . TYR B 1 177 ? -10.754 12.596 82.650  1.00 59.82  ? 1363 TYR B CE1 1 
ATOM   4667 C CE2 . TYR B 1 177 ? -12.242 13.403 80.959  1.00 56.22  ? 1363 TYR B CE2 1 
ATOM   4668 C CZ  . TYR B 1 177 ? -11.806 12.397 81.772  1.00 51.41  ? 1363 TYR B CZ  1 
ATOM   4669 O OH  . TYR B 1 177 ? -12.409 11.174 81.700  1.00 57.52  ? 1363 TYR B OH  1 
ATOM   4670 N N   . ARG B 1 178 ? -8.197  18.125 79.924  1.00 46.83  ? 1364 ARG B N   1 
ATOM   4671 C CA  . ARG B 1 178 ? -7.934  19.483 79.558  1.00 42.33  ? 1364 ARG B CA  1 
ATOM   4672 C C   . ARG B 1 178 ? -9.253  20.226 79.595  1.00 52.51  ? 1364 ARG B C   1 
ATOM   4673 O O   . ARG B 1 178 ? -10.244 19.801 78.994  1.00 64.81  ? 1364 ARG B O   1 
ATOM   4674 C CB  . ARG B 1 178 ? -7.350  19.499 78.157  1.00 40.01  ? 1364 ARG B CB  1 
ATOM   4675 C CG  . ARG B 1 178 ? -7.075  20.875 77.636  1.00 35.94  ? 1364 ARG B CG  1 
ATOM   4676 C CD  . ARG B 1 178 ? -6.172  20.802 76.464  1.00 41.59  ? 1364 ARG B CD  1 
ATOM   4677 N NE  . ARG B 1 178 ? -6.434  21.887 75.527  1.00 50.62  ? 1364 ARG B NE  1 
ATOM   4678 C CZ  . ARG B 1 178 ? -5.666  22.970 75.390  1.00 59.12  ? 1364 ARG B CZ  1 
ATOM   4679 N NH1 . ARG B 1 178 ? -4.568  23.134 76.127  1.00 43.72  ? 1364 ARG B NH1 1 
ATOM   4680 N NH2 . ARG B 1 178 ? -5.994  23.893 74.502  1.00 51.52  ? 1364 ARG B NH2 1 
ATOM   4681 N N   . GLY B 1 179 ? -9.284  21.328 80.321  1.00 55.20  ? 1365 GLY B N   1 
ATOM   4682 C CA  . GLY B 1 179 ? -10.511 22.087 80.456  1.00 55.21  ? 1365 GLY B CA  1 
ATOM   4683 C C   . GLY B 1 179 ? -10.800 22.850 79.194  1.00 49.96  ? 1365 GLY B C   1 
ATOM   4684 O O   . GLY B 1 179 ? -9.889  23.267 78.495  1.00 48.77  ? 1365 GLY B O   1 
ATOM   4685 N N   . LYS B 1 180 ? -12.082 23.025 78.907  1.00 50.25  ? 1366 LYS B N   1 
ATOM   4686 C CA  . LYS B 1 180 ? -12.532 23.898 77.830  1.00 55.24  ? 1366 LYS B CA  1 
ATOM   4687 C C   . LYS B 1 180 ? -12.323 25.327 78.287  1.00 42.51  ? 1366 LYS B C   1 
ATOM   4688 O O   . LYS B 1 180 ? -12.065 25.554 79.453  1.00 56.11  ? 1366 LYS B O   1 
ATOM   4689 C CB  . LYS B 1 180 ? -14.007 23.649 77.546  1.00 53.64  ? 1366 LYS B CB  1 
ATOM   4690 C CG  . LYS B 1 180 ? -14.279 23.338 76.107  1.00 70.06  ? 1366 LYS B CG  1 
ATOM   4691 C CD  . LYS B 1 180 ? -15.336 22.226 75.994  1.00 79.55  ? 1366 LYS B CD  1 
ATOM   4692 C CE  . LYS B 1 180 ? -15.437 21.623 74.563  1.00 98.96  ? 1366 LYS B CE  1 
ATOM   4693 N NZ  . LYS B 1 180 ? -14.936 22.487 73.413  1.00 73.34  ? 1366 LYS B NZ  1 
ATOM   4694 N N   . GLU B 1 181 ? -12.452 26.288 77.385  1.00 61.54  ? 1367 GLU B N   1 
ATOM   4695 C CA  . GLU B 1 181 ? -12.210 27.700 77.717  1.00 68.54  ? 1367 GLU B CA  1 
ATOM   4696 C C   . GLU B 1 181 ? -13.108 28.143 78.860  1.00 62.85  ? 1367 GLU B C   1 
ATOM   4697 O O   . GLU B 1 181 ? -14.328 27.936 78.784  1.00 75.80  ? 1367 GLU B O   1 
ATOM   4698 C CB  . GLU B 1 181 ? -12.509 28.573 76.509  1.00 70.39  ? 1367 GLU B CB  1 
ATOM   4699 C CG  . GLU B 1 181 ? -11.386 29.521 76.142  1.00 72.03  ? 1367 GLU B CG  1 
ATOM   4700 C CD  . GLU B 1 181 ? -11.694 30.353 74.889  1.00 92.81  ? 1367 GLU B CD  1 
ATOM   4701 O OE1 . GLU B 1 181 ? -12.885 30.634 74.601  1.00 92.85  ? 1367 GLU B OE1 1 
ATOM   4702 O OE2 . GLU B 1 181 ? -10.737 30.733 74.189  1.00 86.20  ? 1367 GLU B OE2 1 
ATOM   4703 N N   . TYR B 1 182 ? -12.515 28.728 79.910  1.00 47.85  ? 1368 TYR B N   1 
ATOM   4704 C CA  . TYR B 1 182 ? -13.267 29.167 81.092  1.00 39.42  ? 1368 TYR B CA  1 
ATOM   4705 C C   . TYR B 1 182 ? -14.030 28.051 81.796  1.00 34.93  ? 1368 TYR B C   1 
ATOM   4706 O O   . TYR B 1 182 ? -14.899 28.295 82.602  1.00 41.81  ? 1368 TYR B O   1 
ATOM   4707 C CB  . TYR B 1 182 ? -14.231 30.314 80.739  1.00 36.90  ? 1368 TYR B CB  1 
ATOM   4708 C CG  . TYR B 1 182 ? -13.521 31.569 80.362  1.00 55.89  ? 1368 TYR B CG  1 
ATOM   4709 C CD1 . TYR B 1 182 ? -12.820 32.292 81.311  1.00 46.91  ? 1368 TYR B CD1 1 
ATOM   4710 C CD2 . TYR B 1 182 ? -13.508 32.023 79.051  1.00 53.43  ? 1368 TYR B CD2 1 
ATOM   4711 C CE1 . TYR B 1 182 ? -12.121 33.438 80.980  1.00 59.31  ? 1368 TYR B CE1 1 
ATOM   4712 C CE2 . TYR B 1 182 ? -12.802 33.183 78.698  1.00 43.35  ? 1368 TYR B CE2 1 
ATOM   4713 C CZ  . TYR B 1 182 ? -12.125 33.885 79.679  1.00 59.75  ? 1368 TYR B CZ  1 
ATOM   4714 O OH  . TYR B 1 182 ? -11.422 35.025 79.387  1.00 61.07  ? 1368 TYR B OH  1 
ATOM   4715 N N   . GLU B 1 183 ? -13.721 26.812 81.490  1.00 50.64  ? 1369 GLU B N   1 
ATOM   4716 C CA  . GLU B 1 183 ? -14.388 25.746 82.194  1.00 44.26  ? 1369 GLU B CA  1 
ATOM   4717 C C   . GLU B 1 183 ? -13.780 25.573 83.555  1.00 50.51  ? 1369 GLU B C   1 
ATOM   4718 O O   . GLU B 1 183 ? -12.572 25.514 83.700  1.00 60.95  ? 1369 GLU B O   1 
ATOM   4719 C CB  . GLU B 1 183 ? -14.285 24.444 81.461  1.00 47.86  ? 1369 GLU B CB  1 
ATOM   4720 C CG  . GLU B 1 183 ? -15.178 23.424 82.057  1.00 46.59  ? 1369 GLU B CG  1 
ATOM   4721 C CD  . GLU B 1 183 ? -15.153 22.151 81.272  1.00 66.00  ? 1369 GLU B CD  1 
ATOM   4722 O OE1 . GLU B 1 183 ? -14.146 21.902 80.544  1.00 59.51  ? 1369 GLU B OE1 1 
ATOM   4723 O OE2 . GLU B 1 183 ? -16.143 21.396 81.385  1.00 62.08  ? 1369 GLU B OE2 1 
ATOM   4724 N N   . ARG B 1 184 ? -14.643 25.462 84.550  1.00 65.58  ? 1370 ARG B N   1 
ATOM   4725 C CA  . ARG B 1 184 ? -14.220 25.449 85.926  1.00 58.03  ? 1370 ARG B CA  1 
ATOM   4726 C C   . ARG B 1 184 ? -14.565 24.096 86.459  1.00 53.58  ? 1370 ARG B C   1 
ATOM   4727 O O   . ARG B 1 184 ? -15.512 23.453 85.981  1.00 49.21  ? 1370 ARG B O   1 
ATOM   4728 C CB  . ARG B 1 184 ? -15.003 26.519 86.664  1.00 71.62  ? 1370 ARG B CB  1 
ATOM   4729 C CG  . ARG B 1 184 ? -14.260 27.080 87.792  1.00 71.46  ? 1370 ARG B CG  1 
ATOM   4730 C CD  . ARG B 1 184 ? -14.903 28.308 88.281  1.00 68.90  ? 1370 ARG B CD  1 
ATOM   4731 N NE  . ARG B 1 184 ? -13.845 29.185 88.766  1.00 79.70  ? 1370 ARG B NE  1 
ATOM   4732 C CZ  . ARG B 1 184 ? -13.341 29.176 90.001  1.00 79.44  ? 1370 ARG B CZ  1 
ATOM   4733 N NH1 . ARG B 1 184 ? -13.804 28.341 90.942  1.00 73.04  ? 1370 ARG B NH1 1 
ATOM   4734 N NH2 . ARG B 1 184 ? -12.368 30.029 90.295  1.00 86.72  ? 1370 ARG B NH2 1 
ATOM   4735 N N   . ARG B 1 185 ? -13.866 23.664 87.496  1.00 50.75  ? 1371 ARG B N   1 
ATOM   4736 C CA  . ARG B 1 185 ? -14.078 22.334 88.048  1.00 41.83  ? 1371 ARG B CA  1 
ATOM   4737 C C   . ARG B 1 185 ? -15.505 22.076 88.491  1.00 40.25  ? 1371 ARG B C   1 
ATOM   4738 O O   . ARG B 1 185 ? -15.993 20.963 88.354  1.00 49.44  ? 1371 ARG B O   1 
ATOM   4739 C CB  . ARG B 1 185 ? -13.114 22.052 89.198  1.00 43.87  ? 1371 ARG B CB  1 
ATOM   4740 C CG  . ARG B 1 185 ? -13.332 20.696 89.841  1.00 55.30  ? 1371 ARG B CG  1 
ATOM   4741 C CD  . ARG B 1 185 ? -12.202 20.325 90.772  1.00 50.43  ? 1371 ARG B CD  1 
ATOM   4742 N NE  . ARG B 1 185 ? -11.858 21.416 91.672  1.00 61.19  ? 1371 ARG B NE  1 
ATOM   4743 C CZ  . ARG B 1 185 ? -12.533 21.716 92.774  1.00 85.43  ? 1371 ARG B CZ  1 
ATOM   4744 N NH1 . ARG B 1 185 ? -13.600 21.009 93.111  1.00 78.96  ? 1371 ARG B NH1 1 
ATOM   4745 N NH2 . ARG B 1 185 ? -12.145 22.726 93.535  1.00 93.48  ? 1371 ARG B NH2 1 
ATOM   4746 N N   . GLU B 1 186 ? -16.180 23.083 89.022  1.00 46.08  ? 1372 GLU B N   1 
ATOM   4747 C CA  . GLU B 1 186 ? -17.547 22.870 89.459  1.00 58.61  ? 1372 GLU B CA  1 
ATOM   4748 C C   . GLU B 1 186 ? -18.404 22.433 88.277  1.00 65.38  ? 1372 GLU B C   1 
ATOM   4749 O O   . GLU B 1 186 ? -19.221 21.529 88.404  1.00 71.37  ? 1372 GLU B O   1 
ATOM   4750 C CB  . GLU B 1 186 ? -18.124 24.155 90.049  1.00 68.50  ? 1372 GLU B CB  1 
ATOM   4751 C CG  . GLU B 1 186 ? -17.358 24.713 91.234  1.00 68.64  ? 1372 GLU B CG  1 
ATOM   4752 C CD  . GLU B 1 186 ? -16.131 25.490 90.823  1.00 79.72  ? 1372 GLU B CD  1 
ATOM   4753 O OE1 . GLU B 1 186 ? -15.541 25.158 89.781  1.00 104.74 ? 1372 GLU B OE1 1 
ATOM   4754 O OE2 . GLU B 1 186 ? -15.755 26.433 91.544  1.00 73.06  ? 1372 GLU B OE2 1 
ATOM   4755 N N   . ASP B 1 187 ? -18.220 23.081 87.133  1.00 59.03  ? 1373 ASP B N   1 
ATOM   4756 C CA  . ASP B 1 187 ? -18.965 22.743 85.922  1.00 53.67  ? 1373 ASP B CA  1 
ATOM   4757 C C   . ASP B 1 187 ? -18.642 21.362 85.359  1.00 61.47  ? 1373 ASP B C   1 
ATOM   4758 O O   . ASP B 1 187 ? -19.526 20.628 84.928  1.00 55.55  ? 1373 ASP B O   1 
ATOM   4759 C CB  . ASP B 1 187 ? -18.720 23.790 84.834  1.00 63.55  ? 1373 ASP B CB  1 
ATOM   4760 C CG  . ASP B 1 187 ? -18.854 25.205 85.345  1.00 80.38  ? 1373 ASP B CG  1 
ATOM   4761 O OD1 . ASP B 1 187 ? -19.993 25.632 85.609  1.00 79.94  ? 1373 ASP B OD1 1 
ATOM   4762 O OD2 . ASP B 1 187 ? -17.824 25.897 85.463  1.00 72.21  ? 1373 ASP B OD2 1 
ATOM   4763 N N   . PHE B 1 188 ? -17.358 21.028 85.364  1.00 36.24  ? 1374 PHE B N   1 
ATOM   4764 C CA  . PHE B 1 188 ? -16.852 19.776 84.830  1.00 51.22  ? 1374 PHE B CA  1 
ATOM   4765 C C   . PHE B 1 188 ? -17.318 18.569 85.632  1.00 65.78  ? 1374 PHE B C   1 
ATOM   4766 O O   . PHE B 1 188 ? -17.925 17.626 85.104  1.00 77.04  ? 1374 PHE B O   1 
ATOM   4767 C CB  . PHE B 1 188 ? -15.333 19.839 84.826  1.00 43.45  ? 1374 PHE B CB  1 
ATOM   4768 C CG  . PHE B 1 188 ? -14.674 18.602 84.339  1.00 48.48  ? 1374 PHE B CG  1 
ATOM   4769 C CD1 . PHE B 1 188 ? -14.432 18.421 83.002  1.00 39.90  ? 1374 PHE B CD1 1 
ATOM   4770 C CD2 . PHE B 1 188 ? -14.276 17.630 85.219  1.00 51.13  ? 1374 PHE B CD2 1 
ATOM   4771 C CE1 . PHE B 1 188 ? -13.822 17.291 82.556  1.00 46.68  ? 1374 PHE B CE1 1 
ATOM   4772 C CE2 . PHE B 1 188 ? -13.660 16.496 84.773  1.00 51.01  ? 1374 PHE B CE2 1 
ATOM   4773 C CZ  . PHE B 1 188 ? -13.434 16.327 83.443  1.00 46.12  ? 1374 PHE B CZ  1 
ATOM   4774 N N   . GLN B 1 189 ? -17.026 18.601 86.922  1.00 67.39  ? 1375 GLN B N   1 
ATOM   4775 C CA  . GLN B 1 189 ? -17.389 17.507 87.792  1.00 65.34  ? 1375 GLN B CA  1 
ATOM   4776 C C   . GLN B 1 189 ? -18.871 17.255 87.761  1.00 62.97  ? 1375 GLN B C   1 
ATOM   4777 O O   . GLN B 1 189 ? -19.311 16.144 87.985  1.00 72.89  ? 1375 GLN B O   1 
ATOM   4778 C CB  . GLN B 1 189 ? -16.942 17.778 89.219  1.00 62.25  ? 1375 GLN B CB  1 
ATOM   4779 C CG  . GLN B 1 189 ? -17.197 16.618 90.144  1.00 73.62  ? 1375 GLN B CG  1 
ATOM   4780 C CD  . GLN B 1 189 ? -16.359 16.683 91.384  1.00 86.82  ? 1375 GLN B CD  1 
ATOM   4781 O OE1 . GLN B 1 189 ? -16.034 17.761 91.864  1.00 78.89  ? 1375 GLN B OE1 1 
ATOM   4782 N NE2 . GLN B 1 189 ? -15.997 15.525 91.913  1.00 97.93  ? 1375 GLN B NE2 1 
ATOM   4783 N N   . MET B 1 190 ? -19.649 18.287 87.486  1.00 63.17  ? 1376 MET B N   1 
ATOM   4784 C CA  . MET B 1 190 ? -21.089 18.124 87.448  1.00 68.63  ? 1376 MET B CA  1 
ATOM   4785 C C   . MET B 1 190 ? -21.464 17.188 86.313  1.00 79.40  ? 1376 MET B C   1 
ATOM   4786 O O   . MET B 1 190 ? -22.201 16.223 86.505  1.00 87.72  ? 1376 MET B O   1 
ATOM   4787 C CB  . MET B 1 190 ? -21.771 19.474 87.298  1.00 73.02  ? 1376 MET B CB  1 
ATOM   4788 C CG  . MET B 1 190 ? -23.034 19.601 88.114  1.00 65.32  ? 1376 MET B CG  1 
ATOM   4789 S SD  . MET B 1 190 ? -23.659 21.280 88.142  1.00 132.79 ? 1376 MET B SD  1 
ATOM   4790 C CE  . MET B 1 190 ? -22.497 22.067 89.241  1.00 100.44 ? 1376 MET B CE  1 
ATOM   4791 N N   . GLN B 1 191 ? -20.938 17.468 85.130  1.00 66.81  ? 1377 GLN B N   1 
ATOM   4792 C CA  . GLN B 1 191 ? -21.188 16.625 83.981  1.00 63.32  ? 1377 GLN B CA  1 
ATOM   4793 C C   . GLN B 1 191 ? -20.677 15.228 84.248  1.00 73.11  ? 1377 GLN B C   1 
ATOM   4794 O O   . GLN B 1 191 ? -21.264 14.246 83.809  1.00 77.82  ? 1377 GLN B O   1 
ATOM   4795 C CB  . GLN B 1 191 ? -20.486 17.181 82.754  1.00 80.99  ? 1377 GLN B CB  1 
ATOM   4796 C CG  . GLN B 1 191 ? -21.352 18.059 81.890  1.00 113.42 ? 1377 GLN B CG  1 
ATOM   4797 C CD  . GLN B 1 191 ? -20.776 18.235 80.508  1.00 113.51 ? 1377 GLN B CD  1 
ATOM   4798 O OE1 . GLN B 1 191 ? -19.584 18.480 80.350  1.00 109.92 ? 1377 GLN B OE1 1 
ATOM   4799 N NE2 . GLN B 1 191 ? -21.621 18.109 79.496  1.00 103.71 ? 1377 GLN B NE2 1 
ATOM   4800 N N   . LEU B 1 192 ? -19.569 15.140 84.968  1.00 72.94  ? 1378 LEU B N   1 
ATOM   4801 C CA  . LEU B 1 192 ? -18.977 13.845 85.278  1.00 68.09  ? 1378 LEU B CA  1 
ATOM   4802 C C   . LEU B 1 192 ? -19.885 12.989 86.170  1.00 64.27  ? 1378 LEU B C   1 
ATOM   4803 O O   . LEU B 1 192 ? -20.058 11.776 85.965  1.00 80.35  ? 1378 LEU B O   1 
ATOM   4804 C CB  . LEU B 1 192 ? -17.625 14.077 85.947  1.00 70.06  ? 1378 LEU B CB  1 
ATOM   4805 C CG  . LEU B 1 192 ? -16.581 12.968 85.982  1.00 62.10  ? 1378 LEU B CG  1 
ATOM   4806 C CD1 . LEU B 1 192 ? -16.191 12.552 84.588  1.00 57.70  ? 1378 LEU B CD1 1 
ATOM   4807 C CD2 . LEU B 1 192 ? -15.385 13.472 86.729  1.00 66.99  ? 1378 LEU B CD2 1 
ATOM   4808 N N   . MET B 1 193 ? -20.465 13.627 87.172  1.00 66.01  ? 1379 MET B N   1 
ATOM   4809 C CA  . MET B 1 193 ? -21.338 12.934 88.093  1.00 76.00  ? 1379 MET B CA  1 
ATOM   4810 C C   . MET B 1 193 ? -22.597 12.565 87.349  1.00 81.69  ? 1379 MET B C   1 
ATOM   4811 O O   . MET B 1 193 ? -23.245 11.577 87.653  1.00 89.85  ? 1379 MET B O   1 
ATOM   4812 C CB  . MET B 1 193 ? -21.649 13.813 89.296  1.00 72.62  ? 1379 MET B CB  1 
ATOM   4813 C CG  . MET B 1 193 ? -20.408 14.362 89.978  1.00 82.16  ? 1379 MET B CG  1 
ATOM   4814 S SD  . MET B 1 193 ? -19.133 13.125 90.264  1.00 79.01  ? 1379 MET B SD  1 
ATOM   4815 C CE  . MET B 1 193 ? -19.951 12.045 91.412  1.00 60.33  ? 1379 MET B CE  1 
ATOM   4816 N N   . THR B 1 194 ? -22.934 13.374 86.357  1.00 87.96  ? 1380 THR B N   1 
ATOM   4817 C CA  . THR B 1 194 ? -24.094 13.107 85.533  1.00 75.63  ? 1380 THR B CA  1 
ATOM   4818 C C   . THR B 1 194 ? -23.841 11.815 84.784  1.00 78.37  ? 1380 THR B C   1 
ATOM   4819 O O   . THR B 1 194 ? -24.701 10.952 84.716  1.00 80.40  ? 1380 THR B O   1 
ATOM   4820 C CB  . THR B 1 194 ? -24.330 14.240 84.554  1.00 75.77  ? 1380 THR B CB  1 
ATOM   4821 O OG1 . THR B 1 194 ? -24.884 15.349 85.262  1.00 65.73  ? 1380 THR B OG1 1 
ATOM   4822 C CG2 . THR B 1 194 ? -25.288 13.815 83.476  1.00 75.79  ? 1380 THR B CG2 1 
ATOM   4823 N N   . GLN B 1 195 ? -22.646 11.688 84.228  1.00 69.18  ? 1381 GLN B N   1 
ATOM   4824 C CA  . GLN B 1 195 ? -22.250 10.472 83.534  1.00 68.35  ? 1381 GLN B CA  1 
ATOM   4825 C C   . GLN B 1 195 ? -22.351 9.264  84.451  1.00 75.65  ? 1381 GLN B C   1 
ATOM   4826 O O   . GLN B 1 195 ? -22.785 8.204  84.023  1.00 87.58  ? 1381 GLN B O   1 
ATOM   4827 C CB  . GLN B 1 195 ? -20.830 10.582 82.994  1.00 82.28  ? 1381 GLN B CB  1 
ATOM   4828 C CG  . GLN B 1 195 ? -20.719 11.355 81.706  1.00 105.17 ? 1381 GLN B CG  1 
ATOM   4829 C CD  . GLN B 1 195 ? -19.411 11.101 80.998  1.00 121.40 ? 1381 GLN B CD  1 
ATOM   4830 O OE1 . GLN B 1 195 ? -19.153 11.648 79.929  1.00 129.14 ? 1381 GLN B OE1 1 
ATOM   4831 N NE2 . GLN B 1 195 ? -18.575 10.263 81.591  1.00 110.95 ? 1381 GLN B NE2 1 
ATOM   4832 N N   . PHE B 1 196 ? -21.948 9.411  85.709  1.00 79.24  ? 1382 PHE B N   1 
ATOM   4833 C CA  . PHE B 1 196 ? -22.074 8.284  86.644  1.00 74.80  ? 1382 PHE B CA  1 
ATOM   4834 C C   . PHE B 1 196 ? -22.969 8.722  87.784  1.00 91.27  ? 1382 PHE B C   1 
ATOM   4835 O O   . PHE B 1 196 ? -22.562 9.577  88.559  1.00 99.62  ? 1382 PHE B O   1 
ATOM   4836 C CB  . PHE B 1 196 ? -20.711 7.890  87.183  1.00 55.75  ? 1382 PHE B CB  1 
ATOM   4837 C CG  . PHE B 1 196 ? -19.686 7.673  86.117  1.00 78.07  ? 1382 PHE B CG  1 
ATOM   4838 C CD1 . PHE B 1 196 ? -19.629 6.483  85.431  1.00 85.56  ? 1382 PHE B CD1 1 
ATOM   4839 C CD2 . PHE B 1 196 ? -18.783 8.661  85.798  1.00 77.33  ? 1382 PHE B CD2 1 
ATOM   4840 C CE1 . PHE B 1 196 ? -18.694 6.284  84.454  1.00 69.05  ? 1382 PHE B CE1 1 
ATOM   4841 C CE2 . PHE B 1 196 ? -17.848 8.460  84.822  1.00 75.67  ? 1382 PHE B CE2 1 
ATOM   4842 C CZ  . PHE B 1 196 ? -17.805 7.270  84.151  1.00 73.63  ? 1382 PHE B CZ  1 
ATOM   4843 N N   . PRO B 1 197 ? -24.181 8.178  87.914  1.00 90.69  ? 1383 PRO B N   1 
ATOM   4844 C CA  . PRO B 1 197 ? -25.030 8.733  88.968  1.00 84.61  ? 1383 PRO B CA  1 
ATOM   4845 C C   . PRO B 1 197 ? -24.931 7.946  90.268  1.00 92.47  ? 1383 PRO B C   1 
ATOM   4846 O O   . PRO B 1 197 ? -25.367 8.429  91.306  1.00 91.15  ? 1383 PRO B O   1 
ATOM   4847 C CB  . PRO B 1 197 ? -26.437 8.665  88.370  1.00 77.49  ? 1383 PRO B CB  1 
ATOM   4848 C CG  . PRO B 1 197 ? -26.241 8.242  86.912  1.00 72.47  ? 1383 PRO B CG  1 
ATOM   4849 C CD  . PRO B 1 197 ? -24.965 7.507  86.863  1.00 72.29  ? 1383 PRO B CD  1 
ATOM   4850 N N   . ASN B 1 198 ? -24.342 6.759  90.229  1.00 95.02  ? 1384 ASN B N   1 
ATOM   4851 C CA  . ASN B 1 198 ? -24.183 6.008  91.458  1.00 96.32  ? 1384 ASN B CA  1 
ATOM   4852 C C   . ASN B 1 198 ? -22.813 6.183  92.086  1.00 87.42  ? 1384 ASN B C   1 
ATOM   4853 O O   . ASN B 1 198 ? -22.566 5.714  93.208  1.00 81.52  ? 1384 ASN B O   1 
ATOM   4854 C CB  . ASN B 1 198 ? -24.509 4.544  91.219  1.00 101.12 ? 1384 ASN B CB  1 
ATOM   4855 C CG  . ASN B 1 198 ? -25.982 4.321  91.022  1.00 105.53 ? 1384 ASN B CG  1 
ATOM   4856 O OD1 . ASN B 1 198 ? -26.393 3.316  90.460  1.00 126.71 ? 1384 ASN B OD1 1 
ATOM   4857 N ND2 . ASN B 1 198 ? -26.790 5.268  91.476  1.00 73.85  ? 1384 ASN B ND2 1 
ATOM   4858 N N   . ALA B 1 199 ? -21.922 6.847  91.365  1.00 69.63  ? 1385 ALA B N   1 
ATOM   4859 C CA  . ALA B 1 199 ? -20.580 7.075  91.859  1.00 69.44  ? 1385 ALA B CA  1 
ATOM   4860 C C   . ALA B 1 199 ? -20.621 8.068  93.002  1.00 76.44  ? 1385 ALA B C   1 
ATOM   4861 O O   . ALA B 1 199 ? -21.427 8.992  93.003  1.00 73.14  ? 1385 ALA B O   1 
ATOM   4862 C CB  . ALA B 1 199 ? -19.694 7.588  90.748  1.00 78.09  ? 1385 ALA B CB  1 
ATOM   4863 N N   . GLU B 1 200 ? -19.748 7.870  93.979  1.00 69.95  ? 1386 GLU B N   1 
ATOM   4864 C CA  . GLU B 1 200 ? -19.682 8.761  95.121  1.00 81.92  ? 1386 GLU B CA  1 
ATOM   4865 C C   . GLU B 1 200 ? -18.473 9.650  94.937  1.00 81.20  ? 1386 GLU B C   1 
ATOM   4866 O O   . GLU B 1 200 ? -17.412 9.176  94.547  1.00 94.43  ? 1386 GLU B O   1 
ATOM   4867 C CB  . GLU B 1 200 ? -19.532 7.968  96.413  1.00 85.18  ? 1386 GLU B CB  1 
ATOM   4868 C CG  . GLU B 1 200 ? -19.270 8.842  97.623  1.00 110.62 ? 1386 GLU B CG  1 
ATOM   4869 C CD  . GLU B 1 200 ? -18.383 8.169  98.643  1.00 125.79 ? 1386 GLU B CD  1 
ATOM   4870 O OE1 . GLU B 1 200 ? -18.250 6.931  98.588  1.00 143.78 ? 1386 GLU B OE1 1 
ATOM   4871 O OE2 . GLU B 1 200 ? -17.814 8.879  99.497  1.00 105.76 ? 1386 GLU B OE2 1 
ATOM   4872 N N   . LYS B 1 201 ? -18.622 10.938 95.213  1.00 63.05  ? 1387 LYS B N   1 
ATOM   4873 C CA  . LYS B 1 201 ? -17.498 11.845 95.058  1.00 78.52  ? 1387 LYS B CA  1 
ATOM   4874 C C   . LYS B 1 201 ? -16.657 11.872 96.329  1.00 67.02  ? 1387 LYS B C   1 
ATOM   4875 O O   . LYS B 1 201 ? -17.106 12.323 97.377  1.00 74.60  ? 1387 LYS B O   1 
ATOM   4876 C CB  . LYS B 1 201 ? -17.963 13.247 94.660  1.00 74.39  ? 1387 LYS B CB  1 
ATOM   4877 C CG  . LYS B 1 201 ? -18.390 14.132 95.810  1.00 92.60  ? 1387 LYS B CG  1 
ATOM   4878 C CD  . LYS B 1 201 ? -18.724 15.530 95.312  1.00 94.14  ? 1387 LYS B CD  1 
ATOM   4879 C CE  . LYS B 1 201 ? -18.873 16.509 96.463  1.00 106.26 ? 1387 LYS B CE  1 
ATOM   4880 N NZ  . LYS B 1 201 ? -19.949 16.106 97.406  1.00 108.16 ? 1387 LYS B NZ  1 
ATOM   4881 N N   . MET B 1 202 ? -15.432 11.373 96.216  1.00 52.60  ? 1388 MET B N   1 
ATOM   4882 C CA  . MET B 1 202 ? -14.497 11.317 97.327  1.00 55.85  ? 1388 MET B CA  1 
ATOM   4883 C C   . MET B 1 202 ? -14.207 12.681 97.893  1.00 63.68  ? 1388 MET B C   1 
ATOM   4884 O O   . MET B 1 202 ? -14.229 13.663 97.182  1.00 65.42  ? 1388 MET B O   1 
ATOM   4885 C CB  . MET B 1 202 ? -13.200 10.622 96.908  1.00 50.99  ? 1388 MET B CB  1 
ATOM   4886 C CG  . MET B 1 202 ? -13.366 9.132  96.665  1.00 45.28  ? 1388 MET B CG  1 
ATOM   4887 S SD  . MET B 1 202 ? -11.873 8.263  96.204  1.00 75.88  ? 1388 MET B SD  1 
ATOM   4888 C CE  . MET B 1 202 ? -10.787 8.650  97.619  1.00 74.81  ? 1388 MET B CE  1 
ATOM   4889 N N   . ASN B 1 203 ? -13.933 12.734 99.188  1.00 74.43  ? 1389 ASN B N   1 
ATOM   4890 C CA  . ASN B 1 203 ? -13.659 13.998 99.865  1.00 81.36  ? 1389 ASN B CA  1 
ATOM   4891 C C   . ASN B 1 203 ? -12.190 14.180 100.232 1.00 87.08  ? 1389 ASN B C   1 
ATOM   4892 O O   . ASN B 1 203 ? -11.839 15.019 101.063 1.00 91.80  ? 1389 ASN B O   1 
ATOM   4893 C CB  . ASN B 1 203 ? -14.549 14.168 101.101 1.00 97.39  ? 1389 ASN B CB  1 
ATOM   4894 C CG  . ASN B 1 203 ? -14.806 15.631 101.430 1.00 126.58 ? 1389 ASN B CG  1 
ATOM   4895 O OD1 . ASN B 1 203 ? -13.878 16.400 101.713 1.00 133.40 ? 1389 ASN B OD1 1 
ATOM   4896 N ND2 . ASN B 1 203 ? -16.075 16.027 101.388 1.00 135.18 ? 1389 ASN B ND2 1 
ATOM   4897 N N   . THR B 1 204 ? -11.330 13.388 99.609  1.00 84.57  ? 1390 THR B N   1 
ATOM   4898 C CA  . THR B 1 204 ? -9.890  13.590 99.739  1.00 88.33  ? 1390 THR B CA  1 
ATOM   4899 C C   . THR B 1 204 ? -9.239  13.623 98.345  1.00 77.56  ? 1390 THR B C   1 
ATOM   4900 O O   . THR B 1 204 ? -9.744  13.055 97.371  1.00 70.30  ? 1390 THR B O   1 
ATOM   4901 C CB  . THR B 1 204 ? -9.213  12.509 100.652 1.00 91.15  ? 1390 THR B CB  1 
ATOM   4902 O OG1 . THR B 1 204 ? -9.586  11.195 100.195 1.00 90.47  ? 1390 THR B OG1 1 
ATOM   4903 C CG2 . THR B 1 204 ? -9.614  12.680 102.131 1.00 107.66 ? 1390 THR B CG2 1 
ATOM   4904 N N   . THR B 1 205 ? -8.120  14.309 98.257  1.00 59.31  ? 1391 THR B N   1 
ATOM   4905 C CA  . THR B 1 205 ? -7.337  14.257 97.061  1.00 54.08  ? 1391 THR B CA  1 
ATOM   4906 C C   . THR B 1 205 ? -6.257  13.227 97.259  1.00 66.22  ? 1391 THR B C   1 
ATOM   4907 O O   . THR B 1 205 ? -5.503  12.939 96.328  1.00 79.69  ? 1391 THR B O   1 
ATOM   4908 C CB  . THR B 1 205 ? -6.660  15.574 96.824  1.00 65.94  ? 1391 THR B CB  1 
ATOM   4909 O OG1 . THR B 1 205 ? -5.913  15.920 98.001  1.00 73.33  ? 1391 THR B OG1 1 
ATOM   4910 C CG2 . THR B 1 205 ? -7.688  16.657 96.539  1.00 66.37  ? 1391 THR B CG2 1 
ATOM   4911 N N   . SER B 1 206 ? -6.184  12.675 98.473  1.00 83.02  ? 1392 SER B N   1 
ATOM   4912 C CA  . SER B 1 206 ? -5.111  11.761 98.861  1.00 63.18  ? 1392 SER B CA  1 
ATOM   4913 C C   . SER B 1 206 ? -5.301  10.429 98.160  1.00 68.71  ? 1392 SER B C   1 
ATOM   4914 O O   . SER B 1 206 ? -6.413  9.944  98.014  1.00 78.62  ? 1392 SER B O   1 
ATOM   4915 C CB  . SER B 1 206 ? -5.062  11.585 100.389 1.00 87.43  ? 1392 SER B CB  1 
ATOM   4916 O OG  . SER B 1 206 ? -5.507  12.753 101.092 1.00 77.56  ? 1392 SER B OG  1 
ATOM   4917 N N   . ALA B 1 207 ? -4.201  9.860  97.698  1.00 68.60  ? 1393 ALA B N   1 
ATOM   4918 C CA  . ALA B 1 207 ? -4.205  8.540  97.078  1.00 73.66  ? 1393 ALA B CA  1 
ATOM   4919 C C   . ALA B 1 207 ? -4.978  7.530  97.941  1.00 80.69  ? 1393 ALA B C   1 
ATOM   4920 O O   . ALA B 1 207 ? -4.667  7.344  99.123  1.00 82.90  ? 1393 ALA B O   1 
ATOM   4921 C CB  . ALA B 1 207 ? -2.763  8.068  96.870  1.00 89.13  ? 1393 ALA B CB  1 
ATOM   4922 N N   . PRO B 1 208 ? -6.004  6.923  97.356  1.00 87.62  ? 1394 PRO B N   1 
ATOM   4923 C CA  . PRO B 1 208 ? -6.864  5.978  98.071  1.00 66.29  ? 1394 PRO B CA  1 
ATOM   4924 C C   . PRO B 1 208 ? -6.199  4.652  98.390  1.00 83.70  ? 1394 PRO B C   1 
ATOM   4925 O O   . PRO B 1 208 ? -5.304  4.216  97.682  1.00 82.63  ? 1394 PRO B O   1 
ATOM   4926 C CB  . PRO B 1 208 ? -8.024  5.768  97.101  1.00 75.32  ? 1394 PRO B CB  1 
ATOM   4927 C CG  . PRO B 1 208 ? -7.468  6.073  95.784  1.00 82.28  ? 1394 PRO B CG  1 
ATOM   4928 C CD  . PRO B 1 208 ? -6.488  7.174  95.993  1.00 84.14  ? 1394 PRO B CD  1 
ATOM   4929 N N   . GLY B 1 209 ? -6.652  4.019  99.463  1.00 108.09 ? 1395 GLY B N   1 
ATOM   4930 C CA  . GLY B 1 209 ? -6.109  2.747  99.888  1.00 120.17 ? 1395 GLY B CA  1 
ATOM   4931 C C   . GLY B 1 209 ? -6.659  1.602  99.077  1.00 119.72 ? 1395 GLY B C   1 
ATOM   4932 O O   . GLY B 1 209 ? -7.514  1.800  98.229  1.00 108.03 ? 1395 GLY B O   1 
ATOM   4933 N N   . ASP B 1 210 ? -6.162  0.400  99.336  1.00 125.41 ? 1396 ASP B N   1 
ATOM   4934 C CA  . ASP B 1 210 ? -6.608  -0.780 98.611  1.00 120.30 ? 1396 ASP B CA  1 
ATOM   4935 C C   . ASP B 1 210 ? -7.981  -1.196 99.107  1.00 106.49 ? 1396 ASP B C   1 
ATOM   4936 O O   . ASP B 1 210 ? -8.631  -2.054 98.522  1.00 86.17  ? 1396 ASP B O   1 
ATOM   4937 C CB  . ASP B 1 210 ? -5.608  -1.921 98.788  1.00 118.96 ? 1396 ASP B CB  1 
ATOM   4938 C CG  . ASP B 1 210 ? -5.411  -2.728 97.522  1.00 112.93 ? 1396 ASP B CG  1 
ATOM   4939 O OD1 . ASP B 1 210 ? -6.134  -2.481 96.540  1.00 119.65 ? 1396 ASP B OD1 1 
ATOM   4940 O OD2 . ASP B 1 210 ? -4.524  -3.605 97.506  1.00 96.64  ? 1396 ASP B OD2 1 
ATOM   4941 N N   . ASP B 1 211 ? -8.413  -0.573 100.194 1.00 105.32 ? 1397 ASP B N   1 
ATOM   4942 C CA  . ASP B 1 211 ? -9.712  -0.856 100.778 1.00 95.35  ? 1397 ASP B CA  1 
ATOM   4943 C C   . ASP B 1 211 ? -10.799 -0.326 99.868  1.00 90.11  ? 1397 ASP B C   1 
ATOM   4944 O O   . ASP B 1 211 ? -11.852 -0.932 99.727  1.00 88.21  ? 1397 ASP B O   1 
ATOM   4945 C CB  . ASP B 1 211 ? -9.825  -0.170 102.129 1.00 99.74  ? 1397 ASP B CB  1 
ATOM   4946 C CG  . ASP B 1 211 ? -9.585  1.308  102.034 1.00 104.57 ? 1397 ASP B CG  1 
ATOM   4947 O OD1 . ASP B 1 211 ? -8.936  1.729  101.061 1.00 105.50 ? 1397 ASP B OD1 1 
ATOM   4948 O OD2 . ASP B 1 211 ? -10.038 2.050  102.923 1.00 99.53  ? 1397 ASP B OD2 1 
ATOM   4949 N N   . VAL B 1 212 ? -10.532 0.819  99.256  1.00 85.57  ? 1398 VAL B N   1 
ATOM   4950 C CA  . VAL B 1 212 ? -11.470 1.456  98.351  1.00 72.61  ? 1398 VAL B CA  1 
ATOM   4951 C C   . VAL B 1 212 ? -11.287 0.921  96.947  1.00 79.10  ? 1398 VAL B C   1 
ATOM   4952 O O   . VAL B 1 212 ? -12.241 0.770  96.197  1.00 77.54  ? 1398 VAL B O   1 
ATOM   4953 C CB  . VAL B 1 212 ? -11.236 2.959  98.298  1.00 79.66  ? 1398 VAL B CB  1 
ATOM   4954 C CG1 . VAL B 1 212 ? -12.242 3.610  97.387  1.00 74.46  ? 1398 VAL B CG1 1 
ATOM   4955 C CG2 . VAL B 1 212 ? -11.304 3.550  99.682  1.00 89.92  ? 1398 VAL B CG2 1 
ATOM   4956 N N   . LYS B 1 213 ? -10.043 0.640  96.597  1.00 71.07  ? 1399 LYS B N   1 
ATOM   4957 C CA  . LYS B 1 213 ? -9.717  0.132  95.279  1.00 73.68  ? 1399 LYS B CA  1 
ATOM   4958 C C   . LYS B 1 213 ? -10.415 -1.183 94.981  1.00 77.87  ? 1399 LYS B C   1 
ATOM   4959 O O   . LYS B 1 213 ? -10.866 -1.411 93.867  1.00 79.48  ? 1399 LYS B O   1 
ATOM   4960 C CB  . LYS B 1 213 ? -8.210  -0.047 95.160  1.00 81.87  ? 1399 LYS B CB  1 
ATOM   4961 C CG  . LYS B 1 213 ? -7.425  1.160  95.616  1.00 94.24  ? 1399 LYS B CG  1 
ATOM   4962 C CD  . LYS B 1 213 ? -7.101  2.074  94.460  1.00 89.21  ? 1399 LYS B CD  1 
ATOM   4963 C CE  . LYS B 1 213 ? -5.809  1.666  93.792  1.00 75.75  ? 1399 LYS B CE  1 
ATOM   4964 N NZ  . LYS B 1 213 ? -4.672  1.745  94.733  1.00 79.87  ? 1399 LYS B NZ  1 
ATOM   4965 N N   . ASN B 1 214 ? -10.498 -2.054 95.977  1.00 97.91  ? 1400 ASN B N   1 
ATOM   4966 C CA  . ASN B 1 214 ? -11.137 -3.347 95.786  1.00 97.39  ? 1400 ASN B CA  1 
ATOM   4967 C C   . ASN B 1 214 ? -12.581 -3.371 96.245  1.00 100.44 ? 1400 ASN B C   1 
ATOM   4968 O O   . ASN B 1 214 ? -13.099 -4.417 96.610  1.00 118.78 ? 1400 ASN B O   1 
ATOM   4969 C CB  . ASN B 1 214 ? -10.353 -4.446 96.494  1.00 92.11  ? 1400 ASN B CB  1 
ATOM   4970 C CG  . ASN B 1 214 ? -8.872  -4.327 96.276  1.00 96.31  ? 1400 ASN B CG  1 
ATOM   4971 O OD1 . ASN B 1 214 ? -8.267  -3.328 96.642  1.00 98.61  ? 1400 ASN B OD1 1 
ATOM   4972 N ND2 . ASN B 1 214 ? -8.275  -5.346 95.681  1.00 94.63  ? 1400 ASN B ND2 1 
ATOM   4973 N N   . ALA B 1 215 ? -13.228 -2.214 96.226  1.00 99.40  ? 1401 ALA B N   1 
ATOM   4974 C CA  . ALA B 1 215 ? -14.620 -2.118 96.627  1.00 89.08  ? 1401 ALA B CA  1 
ATOM   4975 C C   . ALA B 1 215 ? -15.541 -2.284 95.429  1.00 96.17  ? 1401 ALA B C   1 
ATOM   4976 O O   . ALA B 1 215 ? -15.108 -2.181 94.286  1.00 94.07  ? 1401 ALA B O   1 
ATOM   4977 C CB  . ALA B 1 215 ? -14.921 -0.741 97.152  1.00 81.41  ? 1401 ALA B CB  1 
ATOM   4978 N N   . PRO B 1 216 ? -16.813 -2.544 95.692  1.00 106.39 ? 1402 PRO B N   1 
ATOM   4979 C CA  . PRO B 1 216 ? -17.771 -2.870 94.633  1.00 113.05 ? 1402 PRO B CA  1 
ATOM   4980 C C   . PRO B 1 216 ? -18.392 -1.624 94.024  1.00 101.03 ? 1402 PRO B C   1 
ATOM   4981 O O   . PRO B 1 216 ? -18.757 -1.631 92.852  1.00 94.44  ? 1402 PRO B O   1 
ATOM   4982 C CB  . PRO B 1 216 ? -18.832 -3.690 95.364  1.00 113.55 ? 1402 PRO B CB  1 
ATOM   4983 C CG  . PRO B 1 216 ? -18.759 -3.231 96.767  1.00 105.76 ? 1402 PRO B CG  1 
ATOM   4984 C CD  . PRO B 1 216 ? -17.332 -2.870 97.030  1.00 105.32 ? 1402 PRO B CD  1 
ATOM   4985 N N   . GLY B 1 217 ? -18.500 -0.568 94.820  1.00 88.21  ? 1403 GLY B N   1 
ATOM   4986 C CA  . GLY B 1 217 ? -19.071 0.709  94.362  1.00 93.67  ? 1403 GLY B CA  1 
ATOM   4987 C C   . GLY B 1 217 ? -18.104 1.605  93.596  1.00 90.79  ? 1403 GLY B C   1 
ATOM   4988 O O   . GLY B 1 217 ? -16.915 1.327  93.544  1.00 86.33  ? 1403 GLY B O   1 
ATOM   4989 N N   . GLN B 1 218 ? -18.615 2.686  93.012  1.00 77.79  ? 1404 GLN B N   1 
ATOM   4990 C CA  . GLN B 1 218 ? -17.809 3.623  92.248  1.00 60.34  ? 1404 GLN B CA  1 
ATOM   4991 C C   . GLN B 1 218 ? -17.451 4.834  93.081  1.00 76.26  ? 1404 GLN B C   1 
ATOM   4992 O O   . GLN B 1 218 ? -18.331 5.540  93.584  1.00 74.75  ? 1404 GLN B O   1 
ATOM   4993 C CB  . GLN B 1 218 ? -18.604 4.115  91.063  1.00 50.02  ? 1404 GLN B CB  1 
ATOM   4994 C CG  . GLN B 1 218 ? -19.004 3.065  90.071  1.00 54.24  ? 1404 GLN B CG  1 
ATOM   4995 C CD  . GLN B 1 218 ? -19.877 3.651  88.986  1.00 78.16  ? 1404 GLN B CD  1 
ATOM   4996 O OE1 . GLN B 1 218 ? -20.664 4.564  89.238  1.00 96.49  ? 1404 GLN B OE1 1 
ATOM   4997 N NE2 . GLN B 1 218 ? -19.739 3.141  87.768  1.00 74.70  ? 1404 GLN B NE2 1 
ATOM   4998 N N   . TYR B 1 219 ? -16.160 5.096  93.227  1.00 79.49  ? 1405 TYR B N   1 
ATOM   4999 C CA  . TYR B 1 219 ? -15.741 6.312  93.936  1.00 84.13  ? 1405 TYR B CA  1 
ATOM   5000 C C   . TYR B 1 219 ? -14.878 7.161  93.002  1.00 76.50  ? 1405 TYR B C   1 
ATOM   5001 O O   . TYR B 1 219 ? -13.980 6.630  92.328  1.00 76.88  ? 1405 TYR B O   1 
ATOM   5002 C CB  . TYR B 1 219 ? -15.008 5.985  95.249  1.00 95.42  ? 1405 TYR B CB  1 
ATOM   5003 C CG  . TYR B 1 219 ? -15.659 4.902  96.091  1.00 95.50  ? 1405 TYR B CG  1 
ATOM   5004 C CD1 . TYR B 1 219 ? -15.631 3.567  95.678  1.00 108.79 ? 1405 TYR B CD1 1 
ATOM   5005 C CD2 . TYR B 1 219 ? -16.285 5.209  97.294  1.00 88.74  ? 1405 TYR B CD2 1 
ATOM   5006 C CE1 . TYR B 1 219 ? -16.222 2.571  96.428  1.00 122.93 ? 1405 TYR B CE1 1 
ATOM   5007 C CE2 . TYR B 1 219 ? -16.877 4.218  98.060  1.00 105.52 ? 1405 TYR B CE2 1 
ATOM   5008 C CZ  . TYR B 1 219 ? -16.842 2.898  97.619  1.00 123.95 ? 1405 TYR B CZ  1 
ATOM   5009 O OH  . TYR B 1 219 ? -17.424 1.898  98.362  1.00 124.31 ? 1405 TYR B OH  1 
ATOM   5010 N N   . ILE B 1 220 ? -15.175 8.463  92.960  1.00 69.23  ? 1406 ILE B N   1 
ATOM   5011 C CA  . ILE B 1 220 ? -14.558 9.399  92.022  1.00 38.92  ? 1406 ILE B CA  1 
ATOM   5012 C C   . ILE B 1 220 ? -13.835 10.532 92.720  1.00 58.37  ? 1406 ILE B C   1 
ATOM   5013 O O   . ILE B 1 220 ? -14.426 11.281 93.494  1.00 61.27  ? 1406 ILE B O   1 
ATOM   5014 C CB  . ILE B 1 220 ? -15.598 10.003 91.076  1.00 40.36  ? 1406 ILE B CB  1 
ATOM   5015 C CG1 . ILE B 1 220 ? -16.210 8.897  90.228  1.00 60.37  ? 1406 ILE B CG1 1 
ATOM   5016 C CG2 . ILE B 1 220 ? -14.979 11.059 90.157  1.00 37.44  ? 1406 ILE B CG2 1 
ATOM   5017 C CD1 . ILE B 1 220 ? -16.898 9.404  88.964  1.00 59.02  ? 1406 ILE B CD1 1 
ATOM   5018 N N   . GLN B 1 221 ? -12.554 10.664 92.416  1.00 50.70  ? 1407 GLN B N   1 
ATOM   5019 C CA  . GLN B 1 221 ? -11.739 11.749 92.935  1.00 50.27  ? 1407 GLN B CA  1 
ATOM   5020 C C   . GLN B 1 221 ? -11.627 12.741 91.803  1.00 62.07  ? 1407 GLN B C   1 
ATOM   5021 O O   . GLN B 1 221 ? -11.410 12.359 90.630  1.00 58.93  ? 1407 GLN B O   1 
ATOM   5022 C CB  . GLN B 1 221 ? -10.355 11.207 93.297  1.00 52.49  ? 1407 GLN B CB  1 
ATOM   5023 C CG  . GLN B 1 221 ? -9.686  11.811 94.474  1.00 51.63  ? 1407 GLN B CG  1 
ATOM   5024 C CD  . GLN B 1 221 ? -8.526  10.955 94.890  1.00 71.74  ? 1407 GLN B CD  1 
ATOM   5025 O OE1 . GLN B 1 221 ? -7.732  10.496 94.059  1.00 67.72  ? 1407 GLN B OE1 1 
ATOM   5026 N NE2 . GLN B 1 221 ? -8.427  10.701 96.181  1.00 81.26  ? 1407 GLN B NE2 1 
ATOM   5027 N N   . CYS B 1 222 ? -11.781 14.012 92.147  1.00 52.71  ? 1408 CYS B N   1 
ATOM   5028 C CA  . CYS B 1 222 ? -11.647 15.059 91.158  1.00 50.64  ? 1408 CYS B CA  1 
ATOM   5029 C C   . CYS B 1 222 ? -11.066 16.353 91.724  1.00 53.72  ? 1408 CYS B C   1 
ATOM   5030 O O   . CYS B 1 222 ? -11.632 16.924 92.632  1.00 63.87  ? 1408 CYS B O   1 
ATOM   5031 C CB  . CYS B 1 222 ? -12.995 15.309 90.479  1.00 47.98  ? 1408 CYS B CB  1 
ATOM   5032 S SG  . CYS B 1 222 ? -12.905 16.492 89.135  1.00 64.24  ? 1408 CYS B SG  1 
ATOM   5033 N N   . PHE B 1 223 ? -9.956  16.817 91.165  1.00 51.23  ? 1409 PHE B N   1 
ATOM   5034 C CA  . PHE B 1 223 ? -9.373  18.092 91.558  1.00 45.42  ? 1409 PHE B CA  1 
ATOM   5035 C C   . PHE B 1 223 ? -8.621  18.780 90.409  1.00 55.28  ? 1409 PHE B C   1 
ATOM   5036 O O   . PHE B 1 223 ? -8.269  18.158 89.422  1.00 49.79  ? 1409 PHE B O   1 
ATOM   5037 C CB  . PHE B 1 223 ? -8.468  17.920 92.780  1.00 37.72  ? 1409 PHE B CB  1 
ATOM   5038 C CG  . PHE B 1 223 ? -7.522  16.788 92.664  1.00 47.54  ? 1409 PHE B CG  1 
ATOM   5039 C CD1 . PHE B 1 223 ? -7.962  15.459 92.786  1.00 50.06  ? 1409 PHE B CD1 1 
ATOM   5040 C CD2 . PHE B 1 223 ? -6.178  17.035 92.434  1.00 53.16  ? 1409 PHE B CD2 1 
ATOM   5041 C CE1 . PHE B 1 223 ? -7.053  14.384 92.669  1.00 54.61  ? 1409 PHE B CE1 1 
ATOM   5042 C CE2 . PHE B 1 223 ? -5.261  15.982 92.341  1.00 39.58  ? 1409 PHE B CE2 1 
ATOM   5043 C CZ  . PHE B 1 223 ? -5.693  14.663 92.450  1.00 45.58  ? 1409 PHE B CZ  1 
ATOM   5044 N N   . THR B 1 224 ? -8.403  20.074 90.551  1.00 39.32  ? 1410 THR B N   1 
ATOM   5045 C CA  . THR B 1 224 ? -7.664  20.840 89.601  1.00 38.42  ? 1410 THR B CA  1 
ATOM   5046 C C   . THR B 1 224 ? -6.176  20.622 89.859  1.00 53.01  ? 1410 THR B C   1 
ATOM   5047 O O   . THR B 1 224 ? -5.748  20.646 91.009  1.00 47.43  ? 1410 THR B O   1 
ATOM   5048 C CB  . THR B 1 224 ? -7.969  22.322 89.791  1.00 36.94  ? 1410 THR B CB  1 
ATOM   5049 O OG1 . THR B 1 224 ? -9.375  22.549 89.642  1.00 38.54  ? 1410 THR B OG1 1 
ATOM   5050 C CG2 . THR B 1 224 ? -7.214  23.151 88.784  1.00 45.35  ? 1410 THR B CG2 1 
ATOM   5051 N N   . VAL B 1 225 ? -5.391  20.451 88.790  1.00 45.88  ? 1411 VAL B N   1 
ATOM   5052 C CA  . VAL B 1 225 ? -3.953  20.270 88.904  1.00 36.58  ? 1411 VAL B CA  1 
ATOM   5053 C C   . VAL B 1 225 ? -3.270  21.365 88.130  1.00 33.88  ? 1411 VAL B C   1 
ATOM   5054 O O   . VAL B 1 225 ? -3.860  21.948 87.254  1.00 41.02  ? 1411 VAL B O   1 
ATOM   5055 C CB  . VAL B 1 225 ? -3.514  18.902 88.400  1.00 40.64  ? 1411 VAL B CB  1 
ATOM   5056 C CG1 . VAL B 1 225 ? -3.928  17.806 89.374  1.00 39.86  ? 1411 VAL B CG1 1 
ATOM   5057 C CG2 . VAL B 1 225 ? -4.115  18.646 87.036  1.00 46.33  ? 1411 VAL B CG2 1 
ATOM   5058 N N   . GLN B 1 226 ? -2.023  21.650 88.490  1.00 44.49  ? 1412 GLN B N   1 
ATOM   5059 C CA  . GLN B 1 226 ? -1.231  22.700 87.862  1.00 45.54  ? 1412 GLN B CA  1 
ATOM   5060 C C   . GLN B 1 226 ? -0.254  22.183 86.766  1.00 52.30  ? 1412 GLN B C   1 
ATOM   5061 O O   . GLN B 1 226 ? 0.553   21.275 87.029  1.00 51.83  ? 1412 GLN B O   1 
ATOM   5062 C CB  . GLN B 1 226 ? -0.489  23.447 88.956  1.00 32.72  ? 1412 GLN B CB  1 
ATOM   5063 C CG  . GLN B 1 226 ? -0.729  24.912 88.870  1.00 53.14  ? 1412 GLN B CG  1 
ATOM   5064 C CD  . GLN B 1 226 ? -2.223  25.222 88.948  1.00 54.77  ? 1412 GLN B CD  1 
ATOM   5065 O OE1 . GLN B 1 226 ? -2.958  24.459 89.558  1.00 38.30  ? 1412 GLN B OE1 1 
ATOM   5066 N NE2 . GLN B 1 226 ? -2.674  26.313 88.312  1.00 36.72  ? 1412 GLN B NE2 1 
ATOM   5067 N N   . PRO B 1 227 ? -0.341  22.735 85.528  1.00 52.65  ? 1413 PRO B N   1 
ATOM   5068 C CA  . PRO B 1 227 ? 0.538   22.262 84.457  1.00 42.07  ? 1413 PRO B CA  1 
ATOM   5069 C C   . PRO B 1 227 ? 1.961   22.706 84.743  1.00 53.11  ? 1413 PRO B C   1 
ATOM   5070 O O   . PRO B 1 227 ? 2.178   23.720 85.424  1.00 50.42  ? 1413 PRO B O   1 
ATOM   5071 C CB  . PRO B 1 227 ? 0.021   22.993 83.222  1.00 37.56  ? 1413 PRO B CB  1 
ATOM   5072 C CG  . PRO B 1 227 ? -1.118  23.736 83.623  1.00 48.40  ? 1413 PRO B CG  1 
ATOM   5073 C CD  . PRO B 1 227 ? -1.192  23.843 85.079  1.00 46.92  ? 1413 PRO B CD  1 
ATOM   5074 N N   . VAL B 1 228 ? 2.923   21.956 84.229  1.00 40.45  ? 1414 VAL B N   1 
ATOM   5075 C CA  . VAL B 1 228 ? 4.315   22.331 84.364  1.00 45.74  ? 1414 VAL B CA  1 
ATOM   5076 C C   . VAL B 1 228 ? 4.917   22.660 83.000  1.00 52.92  ? 1414 VAL B C   1 
ATOM   5077 O O   . VAL B 1 228 ? 4.820   21.877 82.038  1.00 56.63  ? 1414 VAL B O   1 
ATOM   5078 C CB  . VAL B 1 228 ? 5.110   21.204 85.059  1.00 45.36  ? 1414 VAL B CB  1 
ATOM   5079 C CG1 . VAL B 1 228 ? 6.550   21.596 85.270  1.00 41.26  ? 1414 VAL B CG1 1 
ATOM   5080 C CG2 . VAL B 1 228 ? 4.464   20.864 86.373  1.00 42.50  ? 1414 VAL B CG2 1 
ATOM   5081 N N   . LEU B 1 229 ? 5.595   23.790 82.923  1.00 57.44  ? 1415 LEU B N   1 
ATOM   5082 C CA  . LEU B 1 229 ? 6.235   24.180 81.692  1.00 50.24  ? 1415 LEU B CA  1 
ATOM   5083 C C   . LEU B 1 229 ? 7.238   23.124 81.277  1.00 55.25  ? 1415 LEU B C   1 
ATOM   5084 O O   . LEU B 1 229 ? 8.171   22.832 81.995  1.00 57.48  ? 1415 LEU B O   1 
ATOM   5085 C CB  . LEU B 1 229 ? 6.946   25.505 81.866  1.00 43.56  ? 1415 LEU B CB  1 
ATOM   5086 C CG  . LEU B 1 229 ? 7.890   25.898 80.746  1.00 53.28  ? 1415 LEU B CG  1 
ATOM   5087 C CD1 . LEU B 1 229 ? 7.148   26.379 79.553  1.00 55.55  ? 1415 LEU B CD1 1 
ATOM   5088 C CD2 . LEU B 1 229 ? 8.802   26.956 81.232  1.00 46.06  ? 1415 LEU B CD2 1 
ATOM   5089 N N   . ASP B 1 230 ? 7.033   22.582 80.090  1.00 78.64  ? 1416 ASP B N   1 
ATOM   5090 C CA  . ASP B 1 230 ? 7.902   21.581 79.528  1.00 79.86  ? 1416 ASP B CA  1 
ATOM   5091 C C   . ASP B 1 230 ? 9.070   22.381 79.033  1.00 75.81  ? 1416 ASP B C   1 
ATOM   5092 O O   . ASP B 1 230 ? 8.931   23.539 78.705  1.00 75.89  ? 1416 ASP B O   1 
ATOM   5093 C CB  . ASP B 1 230 ? 7.211   20.896 78.355  1.00 77.69  ? 1416 ASP B CB  1 
ATOM   5094 C CG  . ASP B 1 230 ? 7.792   19.557 78.039  1.00 68.92  ? 1416 ASP B CG  1 
ATOM   5095 O OD1 . ASP B 1 230 ? 9.015   19.462 77.903  1.00 65.51  ? 1416 ASP B OD1 1 
ATOM   5096 O OD2 . ASP B 1 230 ? 7.024   18.602 77.901  1.00 64.26  ? 1416 ASP B OD2 1 
ATOM   5097 N N   . GLU B 1 231 ? 10.234  21.771 78.978  1.00 92.15  ? 1417 GLU B N   1 
ATOM   5098 C CA  . GLU B 1 231 ? 11.404  22.491 78.526  1.00 108.76 ? 1417 GLU B CA  1 
ATOM   5099 C C   . GLU B 1 231 ? 11.598  22.442 77.025  1.00 94.46  ? 1417 GLU B C   1 
ATOM   5100 O O   . GLU B 1 231 ? 11.661  21.386 76.428  1.00 67.71  ? 1417 GLU B O   1 
ATOM   5101 C CB  . GLU B 1 231 ? 12.644  21.978 79.246  1.00 120.07 ? 1417 GLU B CB  1 
ATOM   5102 C CG  . GLU B 1 231 ? 12.434  21.716 80.727  1.00 128.43 ? 1417 GLU B CG  1 
ATOM   5103 N N   . HIS B 1 232 ? 11.688  23.618 76.431  1.00 90.64  ? 1418 HIS B N   1 
ATOM   5104 C CA  . HIS B 1 232 ? 11.880  23.765 75.012  1.00 85.20  ? 1418 HIS B CA  1 
ATOM   5105 C C   . HIS B 1 232 ? 13.244  24.369 74.873  1.00 104.53 ? 1418 HIS B C   1 
ATOM   5106 O O   . HIS B 1 232 ? 13.601  25.235 75.645  1.00 122.33 ? 1418 HIS B O   1 
ATOM   5107 C CB  . HIS B 1 232 ? 10.844  24.718 74.434  1.00 70.83  ? 1418 HIS B CB  1 
ATOM   5108 C CG  . HIS B 1 232 ? 9.436   24.258 74.618  1.00 78.13  ? 1418 HIS B CG  1 
ATOM   5109 N ND1 . HIS B 1 232 ? 8.785   24.327 75.827  1.00 87.54  ? 1418 HIS B ND1 1 
ATOM   5110 C CD2 . HIS B 1 232 ? 8.560   23.709 73.752  1.00 72.36  ? 1418 HIS B CD2 1 
ATOM   5111 C CE1 . HIS B 1 232 ? 7.568   23.839 75.698  1.00 77.12  ? 1418 HIS B CE1 1 
ATOM   5112 N NE2 . HIS B 1 232 ? 7.408   23.455 74.448  1.00 92.97  ? 1418 HIS B NE2 1 
ATOM   5113 N N   . PRO B 1 233 ? 14.014  23.914 73.898  1.00 91.08  ? 1419 PRO B N   1 
ATOM   5114 C CA  . PRO B 1 233 ? 15.354  24.450 73.700  1.00 89.12  ? 1419 PRO B CA  1 
ATOM   5115 C C   . PRO B 1 233 ? 15.587  25.679 72.855  1.00 82.24  ? 1419 PRO B C   1 
ATOM   5116 O O   . PRO B 1 233 ? 16.621  26.328 72.926  1.00 85.88  ? 1419 PRO B O   1 
ATOM   5117 C CB  . PRO B 1 233 ? 15.919  23.538 72.625  1.00 88.22  ? 1419 PRO B CB  1 
ATOM   5118 C CG  . PRO B 1 233 ? 15.145  22.306 72.743  1.00 79.64  ? 1419 PRO B CG  1 
ATOM   5119 C CD  . PRO B 1 233 ? 13.791  22.718 73.081  1.00 72.76  ? 1419 PRO B CD  1 
ATOM   5120 N N   . ARG B 1 234 ? 14.595  25.994 72.047  1.00 84.08  ? 1420 ARG B N   1 
ATOM   5121 C CA  . ARG B 1 234 ? 14.435  27.277 71.429  1.00 79.78  ? 1420 ARG B CA  1 
ATOM   5122 C C   . ARG B 1 234 ? 14.570  28.377 72.452  1.00 73.45  ? 1420 ARG B C   1 
ATOM   5123 O O   . ARG B 1 234 ? 15.332  29.297 72.265  1.00 68.60  ? 1420 ARG B O   1 
ATOM   5124 C CB  . ARG B 1 234 ? 13.080  27.372 70.724  1.00 57.08  ? 1420 ARG B CB  1 
ATOM   5125 N N   . PHE B 1 235 ? 13.828  28.284 73.539  1.00 67.76  ? 1421 PHE B N   1 
ATOM   5126 C CA  . PHE B 1 235 ? 13.876  29.307 74.565  1.00 78.27  ? 1421 PHE B CA  1 
ATOM   5127 C C   . PHE B 1 235 ? 14.850  29.029 75.664  1.00 76.02  ? 1421 PHE B C   1 
ATOM   5128 O O   . PHE B 1 235 ? 14.803  29.683 76.682  1.00 85.54  ? 1421 PHE B O   1 
ATOM   5129 C CB  . PHE B 1 235 ? 12.531  29.378 75.271  1.00 63.77  ? 1421 PHE B CB  1 
ATOM   5130 C CG  . PHE B 1 235 ? 11.360  29.464 74.363  1.00 79.97  ? 1421 PHE B CG  1 
ATOM   5131 C CD1 . PHE B 1 235 ? 11.287  30.429 73.401  1.00 83.72  ? 1421 PHE B CD1 1 
ATOM   5132 C CD2 . PHE B 1 235 ? 10.298  28.610 74.513  1.00 80.24  ? 1421 PHE B CD2 1 
ATOM   5133 C CE1 . PHE B 1 235 ? 10.201  30.512 72.585  1.00 64.26  ? 1421 PHE B CE1 1 
ATOM   5134 C CE2 . PHE B 1 235 ? 9.213   28.702 73.699  1.00 68.64  ? 1421 PHE B CE2 1 
ATOM   5135 C CZ  . PHE B 1 235 ? 9.167   29.649 72.736  1.00 61.89  ? 1421 PHE B CZ  1 
ATOM   5136 N N   . LYS B 1 236 ? 15.731  28.065 75.490  1.00 86.76  ? 1422 LYS B N   1 
ATOM   5137 C CA  . LYS B 1 236 ? 16.636  27.743 76.566  1.00 92.73  ? 1422 LYS B CA  1 
ATOM   5138 C C   . LYS B 1 236 ? 17.460  28.856 77.197  1.00 89.46  ? 1422 LYS B C   1 
ATOM   5139 O O   . LYS B 1 236 ? 17.475  28.947 78.410  1.00 99.04  ? 1422 LYS B O   1 
ATOM   5140 C CB  . LYS B 1 236 ? 17.602  26.663 76.075  1.00 79.47  ? 1422 LYS B CB  1 
ATOM   5141 N N   . ASN B 1 237 ? 18.119  29.728 76.474  1.00 64.35  ? 1423 ASN B N   1 
ATOM   5142 C CA  . ASN B 1 237 ? 18.810  30.754 77.244  1.00 99.18  ? 1423 ASN B CA  1 
ATOM   5143 C C   . ASN B 1 237 ? 18.474  32.165 76.856  1.00 101.50 ? 1423 ASN B C   1 
ATOM   5144 O O   . ASN B 1 237 ? 18.908  33.117 77.474  1.00 92.09  ? 1423 ASN B O   1 
ATOM   5145 C CB  . ASN B 1 237 ? 20.315  30.554 77.230  1.00 132.50 ? 1423 ASN B CB  1 
ATOM   5146 C CG  . ASN B 1 237 ? 21.003  31.329 78.320  1.00 150.04 ? 1423 ASN B CG  1 
ATOM   5147 O OD1 . ASN B 1 237 ? 20.400  32.185 78.952  1.00 160.28 ? 1423 ASN B OD1 1 
ATOM   5148 N ND2 . ASN B 1 237 ? 22.274  31.036 78.548  1.00 142.90 ? 1423 ASN B ND2 1 
ATOM   5149 N N   . LYS B 1 238 ? 17.693  32.278 75.804  1.00 107.36 ? 1424 LYS B N   1 
ATOM   5150 C CA  . LYS B 1 238 ? 17.316  33.553 75.252  1.00 96.87  ? 1424 LYS B CA  1 
ATOM   5151 C C   . LYS B 1 238 ? 16.293  34.249 76.107  1.00 95.47  ? 1424 LYS B C   1 
ATOM   5152 O O   . LYS B 1 238 ? 15.702  33.655 76.990  1.00 78.34  ? 1424 LYS B O   1 
ATOM   5153 C CB  . LYS B 1 238 ? 16.796  33.349 73.840  1.00 85.26  ? 1424 LYS B CB  1 
ATOM   5154 C CG  . LYS B 1 238 ? 17.512  32.247 73.090  1.00 77.28  ? 1424 LYS B CG  1 
ATOM   5155 C CD  . LYS B 1 238 ? 18.600  32.815 72.230  1.00 77.40  ? 1424 LYS B CD  1 
ATOM   5156 C CE  . LYS B 1 238 ? 19.113  31.792 71.291  1.00 62.09  ? 1424 LYS B CE  1 
ATOM   5157 N NZ  . LYS B 1 238 ? 18.659  30.493 71.773  1.00 87.52  ? 1424 LYS B NZ  1 
ATOM   5158 N N   . PRO B 1 239 ? 16.115  35.529 75.857  1.00 88.29  ? 1425 PRO B N   1 
ATOM   5159 C CA  . PRO B 1 239 ? 15.146  36.313 76.595  1.00 82.81  ? 1425 PRO B CA  1 
ATOM   5160 C C   . PRO B 1 239 ? 13.847  36.279 75.844  1.00 79.50  ? 1425 PRO B C   1 
ATOM   5161 O O   . PRO B 1 239 ? 13.721  36.963 74.853  1.00 83.15  ? 1425 PRO B O   1 
ATOM   5162 C CB  . PRO B 1 239 ? 15.721  37.706 76.469  1.00 86.67  ? 1425 PRO B CB  1 
ATOM   5163 C CG  . PRO B 1 239 ? 16.299  37.716 75.113  1.00 81.84  ? 1425 PRO B CG  1 
ATOM   5164 C CD  . PRO B 1 239 ? 16.767  36.329 74.817  1.00 80.36  ? 1425 PRO B CD  1 
ATOM   5165 N N   . VAL B 1 240 ? 12.881  35.526 76.333  1.00 67.23  ? 1426 VAL B N   1 
ATOM   5166 C CA  . VAL B 1 240 ? 11.613  35.394 75.661  1.00 56.18  ? 1426 VAL B CA  1 
ATOM   5167 C C   . VAL B 1 240 ? 10.560  36.166 76.381  1.00 55.55  ? 1426 VAL B C   1 
ATOM   5168 O O   . VAL B 1 240 ? 10.498  36.164 77.583  1.00 50.42  ? 1426 VAL B O   1 
ATOM   5169 C CB  . VAL B 1 240 ? 11.172  33.950 75.607  1.00 57.68  ? 1426 VAL B CB  1 
ATOM   5170 C CG1 . VAL B 1 240 ? 10.023  33.796 74.692  1.00 54.00  ? 1426 VAL B CG1 1 
ATOM   5171 C CG2 . VAL B 1 240 ? 12.284  33.098 75.155  1.00 73.76  ? 1426 VAL B CG2 1 
ATOM   5172 N N   . PRO B 1 241 ? 9.739   36.849 75.617  1.00 53.19  ? 1427 PRO B N   1 
ATOM   5173 C CA  . PRO B 1 241 ? 8.649   37.641 76.156  1.00 47.89  ? 1427 PRO B CA  1 
ATOM   5174 C C   . PRO B 1 241 ? 7.576   36.821 76.827  1.00 54.75  ? 1427 PRO B C   1 
ATOM   5175 O O   . PRO B 1 241 ? 7.165   35.805 76.327  1.00 45.78  ? 1427 PRO B O   1 
ATOM   5176 C CB  . PRO B 1 241 ? 8.074   38.300 74.909  1.00 46.95  ? 1427 PRO B CB  1 
ATOM   5177 C CG  . PRO B 1 241 ? 9.076   38.104 73.843  1.00 47.04  ? 1427 PRO B CG  1 
ATOM   5178 C CD  . PRO B 1 241 ? 10.258  37.436 74.386  1.00 37.49  ? 1427 PRO B CD  1 
ATOM   5179 N N   . ASP B 1 242 ? 7.109   37.300 77.959  1.00 62.45  ? 1428 ASP B N   1 
ATOM   5180 C CA  . ASP B 1 242 ? 6.055   36.630 78.719  1.00 68.85  ? 1428 ASP B CA  1 
ATOM   5181 C C   . ASP B 1 242 ? 5.005   36.120 77.781  1.00 59.72  ? 1428 ASP B C   1 
ATOM   5182 O O   . ASP B 1 242 ? 4.697   34.935 77.726  1.00 51.96  ? 1428 ASP B O   1 
ATOM   5183 C CB  . ASP B 1 242 ? 5.389   37.614 79.679  1.00 61.46  ? 1428 ASP B CB  1 
ATOM   5184 C CG  . ASP B 1 242 ? 6.341   38.107 80.750  1.00 80.53  ? 1428 ASP B CG  1 
ATOM   5185 O OD1 . ASP B 1 242 ? 7.315   37.351 81.035  1.00 87.10  ? 1428 ASP B OD1 1 
ATOM   5186 O OD2 . ASP B 1 242 ? 6.129   39.245 81.289  1.00 75.44  ? 1428 ASP B OD2 1 
ATOM   5187 N N   . GLN B 1 243 ? 4.477   37.068 77.027  1.00 56.74  ? 1429 GLN B N   1 
ATOM   5188 C CA  . GLN B 1 243 ? 3.464   36.838 76.043  1.00 51.69  ? 1429 GLN B CA  1 
ATOM   5189 C C   . GLN B 1 243 ? 3.645   35.510 75.285  1.00 56.15  ? 1429 GLN B C   1 
ATOM   5190 O O   . GLN B 1 243 ? 2.693   34.799 75.074  1.00 58.72  ? 1429 GLN B O   1 
ATOM   5191 C CB  . GLN B 1 243 ? 3.498   38.023 75.088  1.00 60.58  ? 1429 GLN B CB  1 
ATOM   5192 C CG  . GLN B 1 243 ? 2.433   38.011 74.066  1.00 82.42  ? 1429 GLN B CG  1 
ATOM   5193 C CD  . GLN B 1 243 ? 1.081   38.126 74.698  1.00 82.51  ? 1429 GLN B CD  1 
ATOM   5194 O OE1 . GLN B 1 243 ? 0.774   39.104 75.384  1.00 97.02  ? 1429 GLN B OE1 1 
ATOM   5195 N NE2 . GLN B 1 243 ? 0.255   37.121 74.485  1.00 103.67 ? 1429 GLN B NE2 1 
ATOM   5196 N N   . ILE B 1 244 ? 4.848   35.135 74.896  1.00 56.96  ? 1430 ILE B N   1 
ATOM   5197 C CA  . ILE B 1 244 ? 4.953   33.943 74.082  1.00 44.24  ? 1430 ILE B CA  1 
ATOM   5198 C C   . ILE B 1 244 ? 5.491   32.768 74.867  1.00 44.06  ? 1430 ILE B C   1 
ATOM   5199 O O   . ILE B 1 244 ? 5.611   31.676 74.337  1.00 73.24  ? 1430 ILE B O   1 
ATOM   5200 C CB  . ILE B 1 244 ? 5.768   34.178 72.759  1.00 49.85  ? 1430 ILE B CB  1 
ATOM   5201 C CG1 . ILE B 1 244 ? 7.194   34.607 73.011  1.00 78.70  ? 1430 ILE B CG1 1 
ATOM   5202 C CG2 . ILE B 1 244 ? 5.112   35.239 71.828  1.00 74.57  ? 1430 ILE B CG2 1 
ATOM   5203 C CD1 . ILE B 1 244 ? 7.992   34.602 71.700  1.00 95.06  ? 1430 ILE B CD1 1 
ATOM   5204 N N   . ILE B 1 245 ? 5.818   32.974 76.131  1.00 52.99  ? 1431 ILE B N   1 
ATOM   5205 C CA  . ILE B 1 245 ? 6.357   31.888 76.952  1.00 47.42  ? 1431 ILE B CA  1 
ATOM   5206 C C   . ILE B 1 245 ? 5.257   31.335 77.843  1.00 54.94  ? 1431 ILE B C   1 
ATOM   5207 O O   . ILE B 1 245 ? 5.203   30.152 78.145  1.00 58.35  ? 1431 ILE B O   1 
ATOM   5208 C CB  . ILE B 1 245 ? 7.588   32.358 77.810  1.00 56.80  ? 1431 ILE B CB  1 
ATOM   5209 C CG1 . ILE B 1 245 ? 8.208   31.221 78.596  1.00 52.13  ? 1431 ILE B CG1 1 
ATOM   5210 C CG2 . ILE B 1 245 ? 7.197   33.390 78.823  1.00 60.12  ? 1431 ILE B CG2 1 
ATOM   5211 C CD1 . ILE B 1 245 ? 8.875   30.204 77.738  1.00 53.67  ? 1431 ILE B CD1 1 
ATOM   5212 N N   . ASN B 1 246 ? 4.366   32.218 78.258  1.00 65.41  ? 1432 ASN B N   1 
ATOM   5213 C CA  . ASN B 1 246 ? 3.274   31.831 79.123  1.00 45.58  ? 1432 ASN B CA  1 
ATOM   5214 C C   . ASN B 1 246 ? 2.415   30.784 78.488  1.00 67.24  ? 1432 ASN B C   1 
ATOM   5215 O O   . ASN B 1 246 ? 1.948   29.869 79.161  1.00 84.11  ? 1432 ASN B O   1 
ATOM   5216 C CB  . ASN B 1 246 ? 2.389   33.018 79.472  1.00 48.77  ? 1432 ASN B CB  1 
ATOM   5217 C CG  . ASN B 1 246 ? 3.025   33.949 80.484  1.00 54.12  ? 1432 ASN B CG  1 
ATOM   5218 O OD1 . ASN B 1 246 ? 4.047   33.635 81.110  1.00 62.12  ? 1432 ASN B OD1 1 
ATOM   5219 N ND2 . ASN B 1 246 ? 2.439   35.117 80.622  1.00 65.34  ? 1432 ASN B ND2 1 
ATOM   5220 N N   . PHE B 1 247 ? 2.191   30.914 77.190  1.00 58.26  ? 1433 PHE B N   1 
ATOM   5221 C CA  . PHE B 1 247 ? 1.376   29.961 76.490  1.00 40.72  ? 1433 PHE B CA  1 
ATOM   5222 C C   . PHE B 1 247 ? 1.869   28.551 76.699  1.00 49.56  ? 1433 PHE B C   1 
ATOM   5223 O O   . PHE B 1 247 ? 1.062   27.625 76.746  1.00 50.39  ? 1433 PHE B O   1 
ATOM   5224 C CB  . PHE B 1 247 ? 1.341   30.253 75.013  1.00 45.33  ? 1433 PHE B CB  1 
ATOM   5225 C CG  . PHE B 1 247 ? 0.667   29.190 74.237  1.00 51.83  ? 1433 PHE B CG  1 
ATOM   5226 C CD1 . PHE B 1 247 ? -0.732  29.148 74.171  1.00 52.62  ? 1433 PHE B CD1 1 
ATOM   5227 C CD2 . PHE B 1 247 ? 1.416   28.187 73.611  1.00 36.00  ? 1433 PHE B CD2 1 
ATOM   5228 C CE1 . PHE B 1 247 ? -1.391  28.143 73.490  1.00 42.39  ? 1433 PHE B CE1 1 
ATOM   5229 C CE2 . PHE B 1 247 ? 0.772   27.159 72.911  1.00 64.29  ? 1433 PHE B CE2 1 
ATOM   5230 C CZ  . PHE B 1 247 ? -0.658  27.149 72.850  1.00 59.35  ? 1433 PHE B CZ  1 
ATOM   5231 N N   . TYR B 1 248 ? 3.179   28.363 76.811  1.00 42.84  ? 1434 TYR B N   1 
ATOM   5232 C CA  . TYR B 1 248 ? 3.720   26.992 76.912  1.00 54.35  ? 1434 TYR B CA  1 
ATOM   5233 C C   . TYR B 1 248 ? 3.578   26.444 78.312  1.00 47.19  ? 1434 TYR B C   1 
ATOM   5234 O O   . TYR B 1 248 ? 3.733   25.247 78.513  1.00 49.15  ? 1434 TYR B O   1 
ATOM   5235 C CB  . TYR B 1 248 ? 5.173   26.877 76.429  1.00 40.18  ? 1434 TYR B CB  1 
ATOM   5236 C CG  . TYR B 1 248 ? 5.315   26.908 74.933  1.00 51.82  ? 1434 TYR B CG  1 
ATOM   5237 C CD1 . TYR B 1 248 ? 5.127   25.760 74.183  1.00 55.22  ? 1434 TYR B CD1 1 
ATOM   5238 C CD2 . TYR B 1 248 ? 5.613   28.107 74.251  1.00 66.62  ? 1434 TYR B CD2 1 
ATOM   5239 C CE1 . TYR B 1 248 ? 5.246   25.781 72.799  1.00 63.19  ? 1434 TYR B CE1 1 
ATOM   5240 C CE2 . TYR B 1 248 ? 5.736   28.141 72.851  1.00 68.74  ? 1434 TYR B CE2 1 
ATOM   5241 C CZ  . TYR B 1 248 ? 5.549   26.974 72.137  1.00 73.32  ? 1434 TYR B CZ  1 
ATOM   5242 O OH  . TYR B 1 248 ? 5.659   26.992 70.771  1.00 66.48  ? 1434 TYR B OH  1 
ATOM   5243 N N   . LYS B 1 249 ? 3.315   27.327 79.261  1.00 41.06  ? 1435 LYS B N   1 
ATOM   5244 C CA  . LYS B 1 249 ? 3.116   26.935 80.639  1.00 34.65  ? 1435 LYS B CA  1 
ATOM   5245 C C   . LYS B 1 249 ? 1.844   26.106 80.798  1.00 49.55  ? 1435 LYS B C   1 
ATOM   5246 O O   . LYS B 1 249 ? 1.808   25.158 81.570  1.00 65.71  ? 1435 LYS B O   1 
ATOM   5247 C CB  . LYS B 1 249 ? 3.130   28.159 81.549  1.00 31.66  ? 1435 LYS B CB  1 
ATOM   5248 C CG  . LYS B 1 249 ? 4.445   28.919 81.479  1.00 55.49  ? 1435 LYS B CG  1 
ATOM   5249 C CD  . LYS B 1 249 ? 4.858   29.483 82.826  1.00 54.48  ? 1435 LYS B CD  1 
ATOM   5250 C CE  . LYS B 1 249 ? 4.494   30.944 82.967  1.00 69.31  ? 1435 LYS B CE  1 
ATOM   5251 N NZ  . LYS B 1 249 ? 5.352   31.803 82.115  1.00 82.78  ? 1435 LYS B NZ  1 
ATOM   5252 N N   . SER B 1 250 ? 0.796   26.484 80.073  1.00 47.62  ? 1436 SER B N   1 
ATOM   5253 C CA  . SER B 1 250 ? -0.488  25.789 80.137  1.00 41.35  ? 1436 SER B CA  1 
ATOM   5254 C C   . SER B 1 250 ? -0.889  24.928 78.929  1.00 43.80  ? 1436 SER B C   1 
ATOM   5255 O O   . SER B 1 250 ? -2.008  24.436 78.884  1.00 49.48  ? 1436 SER B O   1 
ATOM   5256 C CB  . SER B 1 250 ? -1.598  26.804 80.404  1.00 59.46  ? 1436 SER B CB  1 
ATOM   5257 O OG  . SER B 1 250 ? -1.136  27.848 81.240  1.00 57.93  ? 1436 SER B OG  1 
ATOM   5258 N N   . ASN B 1 251 ? -0.005  24.748 77.955  1.00 42.33  ? 1437 ASN B N   1 
ATOM   5259 C CA  . ASN B 1 251 ? -0.343  23.966 76.752  1.00 46.01  ? 1437 ASN B CA  1 
ATOM   5260 C C   . ASN B 1 251 ? 0.880   23.180 76.301  1.00 46.37  ? 1437 ASN B C   1 
ATOM   5261 O O   . ASN B 1 251 ? 2.019   23.596 76.532  1.00 45.25  ? 1437 ASN B O   1 
ATOM   5262 C CB  . ASN B 1 251 ? -0.731  24.881 75.579  1.00 37.84  ? 1437 ASN B CB  1 
ATOM   5263 C CG  . ASN B 1 251 ? -2.073  25.549 75.750  1.00 49.26  ? 1437 ASN B CG  1 
ATOM   5264 O OD1 . ASN B 1 251 ? -3.117  24.967 75.434  1.00 53.13  ? 1437 ASN B OD1 1 
ATOM   5265 N ND2 . ASN B 1 251 ? -2.054  26.795 76.239  1.00 45.41  ? 1437 ASN B ND2 1 
ATOM   5266 N N   . TYR B 1 252 ? 0.678   22.054 75.636  1.00 40.91  ? 1438 TYR B N   1 
ATOM   5267 C CA  . TYR B 1 252 ? 1.813   21.251 75.253  1.00 40.53  ? 1438 TYR B CA  1 
ATOM   5268 C C   . TYR B 1 252 ? 2.444   20.636 76.474  1.00 41.80  ? 1438 TYR B C   1 
ATOM   5269 O O   . TYR B 1 252 ? 3.640   20.453 76.529  1.00 50.62  ? 1438 TYR B O   1 
ATOM   5270 C CB  . TYR B 1 252 ? 2.880   22.140 74.679  1.00 45.38  ? 1438 TYR B CB  1 
ATOM   5271 C CG  . TYR B 1 252 ? 2.750   22.523 73.242  1.00 72.97  ? 1438 TYR B CG  1 
ATOM   5272 C CD1 . TYR B 1 252 ? 1.716   23.376 72.805  1.00 89.05  ? 1438 TYR B CD1 1 
ATOM   5273 C CD2 . TYR B 1 252 ? 3.705   22.082 72.317  1.00 90.28  ? 1438 TYR B CD2 1 
ATOM   5274 C CE1 . TYR B 1 252 ? 1.614   23.747 71.469  1.00 97.21  ? 1438 TYR B CE1 1 
ATOM   5275 C CE2 . TYR B 1 252 ? 3.631   22.451 70.987  1.00 106.02 ? 1438 TYR B CE2 1 
ATOM   5276 C CZ  . TYR B 1 252 ? 2.583   23.281 70.565  1.00 114.30 ? 1438 TYR B CZ  1 
ATOM   5277 O OH  . TYR B 1 252 ? 2.534   23.641 69.239  1.00 124.45 ? 1438 TYR B OH  1 
ATOM   5278 N N   . VAL B 1 253 ? 1.647   20.329 77.478  1.00 57.76  ? 1439 VAL B N   1 
ATOM   5279 C CA  . VAL B 1 253 ? 2.188   19.914 78.749  1.00 43.34  ? 1439 VAL B CA  1 
ATOM   5280 C C   . VAL B 1 253 ? 1.847   18.476 78.976  1.00 41.96  ? 1439 VAL B C   1 
ATOM   5281 O O   . VAL B 1 253 ? 0.845   17.991 78.477  1.00 39.33  ? 1439 VAL B O   1 
ATOM   5282 C CB  . VAL B 1 253 ? 1.640   20.751 79.854  1.00 43.04  ? 1439 VAL B CB  1 
ATOM   5283 C CG1 . VAL B 1 253 ? 2.310   22.144 79.853  1.00 35.10  ? 1439 VAL B CG1 1 
ATOM   5284 C CG2 . VAL B 1 253 ? 0.115   20.842 79.711  1.00 37.11  ? 1439 VAL B CG2 1 
ATOM   5285 N N   . GLN B 1 254 ? 2.731   17.804 79.707  1.00 51.27  ? 1440 GLN B N   1 
ATOM   5286 C CA  . GLN B 1 254 ? 2.660   16.390 79.987  1.00 33.54  ? 1440 GLN B CA  1 
ATOM   5287 C C   . GLN B 1 254 ? 2.795   16.150 81.492  1.00 55.52  ? 1440 GLN B C   1 
ATOM   5288 O O   . GLN B 1 254 ? 2.425   15.076 81.985  1.00 38.64  ? 1440 GLN B O   1 
ATOM   5289 C CB  . GLN B 1 254 ? 3.795   15.695 79.267  1.00 45.47  ? 1440 GLN B CB  1 
ATOM   5290 C CG  . GLN B 1 254 ? 3.623   14.227 79.155  1.00 66.89  ? 1440 GLN B CG  1 
ATOM   5291 C CD  . GLN B 1 254 ? 4.622   13.566 78.223  1.00 69.26  ? 1440 GLN B CD  1 
ATOM   5292 O OE1 . GLN B 1 254 ? 5.530   14.199 77.717  1.00 65.30  ? 1440 GLN B OE1 1 
ATOM   5293 N NE2 . GLN B 1 254 ? 4.434   12.279 77.985  1.00 77.74  ? 1440 GLN B NE2 1 
ATOM   5294 N N   . ARG B 1 255 ? 3.329   17.138 82.227  1.00 43.95  ? 1441 ARG B N   1 
ATOM   5295 C CA  . ARG B 1 255 ? 3.501   17.004 83.666  1.00 39.37  ? 1441 ARG B CA  1 
ATOM   5296 C C   . ARG B 1 255 ? 2.610   17.940 84.477  1.00 48.07  ? 1441 ARG B C   1 
ATOM   5297 O O   . ARG B 1 255 ? 2.416   19.110 84.093  1.00 49.79  ? 1441 ARG B O   1 
ATOM   5298 C CB  . ARG B 1 255 ? 4.961   17.222 84.034  1.00 46.00  ? 1441 ARG B CB  1 
ATOM   5299 C CG  . ARG B 1 255 ? 5.310   16.698 85.431  1.00 69.58  ? 1441 ARG B CG  1 
ATOM   5300 C CD  . ARG B 1 255 ? 6.667   17.179 85.971  1.00 79.41  ? 1441 ARG B CD  1 
ATOM   5301 N NE  . ARG B 1 255 ? 7.754   16.245 85.667  1.00 101.35 ? 1441 ARG B NE  1 
ATOM   5302 C CZ  . ARG B 1 255 ? 8.038   15.145 86.370  1.00 102.32 ? 1441 ARG B CZ  1 
ATOM   5303 N NH1 . ARG B 1 255 ? 7.304   14.818 87.431  1.00 97.77  ? 1441 ARG B NH1 1 
ATOM   5304 N NH2 . ARG B 1 255 ? 9.064   14.364 86.012  1.00 90.72  ? 1441 ARG B NH2 1 
ATOM   5305 N N   . PHE B 1 256 ? 2.054   17.434 85.584  1.00 40.24  ? 1442 PHE B N   1 
ATOM   5306 C CA  . PHE B 1 256 ? 1.164   18.242 86.432  1.00 45.30  ? 1442 PHE B CA  1 
ATOM   5307 C C   . PHE B 1 256 ? 1.375   18.103 87.946  1.00 45.86  ? 1442 PHE B C   1 
ATOM   5308 O O   . PHE B 1 256 ? 1.817   17.064 88.403  1.00 49.73  ? 1442 PHE B O   1 
ATOM   5309 C CB  . PHE B 1 256 ? -0.301  17.967 86.096  1.00 46.92  ? 1442 PHE B CB  1 
ATOM   5310 C CG  . PHE B 1 256 ? -0.587  17.968 84.655  1.00 45.69  ? 1442 PHE B CG  1 
ATOM   5311 C CD1 . PHE B 1 256 ? -0.251  16.869 83.881  1.00 49.64  ? 1442 PHE B CD1 1 
ATOM   5312 C CD2 . PHE B 1 256 ? -1.174  19.063 84.050  1.00 46.69  ? 1442 PHE B CD2 1 
ATOM   5313 C CE1 . PHE B 1 256 ? -0.483  16.858 82.520  1.00 52.88  ? 1442 PHE B CE1 1 
ATOM   5314 C CE2 . PHE B 1 256 ? -1.429  19.051 82.686  1.00 52.38  ? 1442 PHE B CE2 1 
ATOM   5315 C CZ  . PHE B 1 256 ? -1.085  17.954 81.927  1.00 38.40  ? 1442 PHE B CZ  1 
ATOM   5316 N N   . HIS B 1 257 ? 1.024   19.154 88.694  1.00 48.43  ? 1443 HIS B N   1 
ATOM   5317 C CA  . HIS B 1 257 ? 1.227   19.246 90.139  1.00 38.87  ? 1443 HIS B CA  1 
ATOM   5318 C C   . HIS B 1 257 ? -0.090  19.421 90.858  1.00 52.41  ? 1443 HIS B C   1 
ATOM   5319 O O   . HIS B 1 257 ? -0.980  20.152 90.401  1.00 51.03  ? 1443 HIS B O   1 
ATOM   5320 C CB  . HIS B 1 257 ? 2.050   20.482 90.531  1.00 43.03  ? 1443 HIS B CB  1 
ATOM   5321 C CG  . HIS B 1 257 ? 3.496   20.420 90.163  1.00 69.29  ? 1443 HIS B CG  1 
ATOM   5322 N ND1 . HIS B 1 257 ? 4.306   19.330 90.457  1.00 73.67  ? 1443 HIS B ND1 1 
ATOM   5323 C CD2 . HIS B 1 257 ? 4.293   21.351 89.574  1.00 80.14  ? 1443 HIS B CD2 1 
ATOM   5324 C CE1 . HIS B 1 257 ? 5.533   19.576 90.033  1.00 71.68  ? 1443 HIS B CE1 1 
ATOM   5325 N NE2 . HIS B 1 257 ? 5.551   20.798 89.494  1.00 87.43  ? 1443 HIS B NE2 1 
ATOM   5326 N N   . TYR B 1 258 ? -0.215  18.779 92.013  1.00 51.92  ? 1444 TYR B N   1 
ATOM   5327 C CA  . TYR B 1 258 ? -1.240  19.188 92.997  1.00 51.56  ? 1444 TYR B CA  1 
ATOM   5328 C C   . TYR B 1 258 ? -0.588  19.440 94.330  1.00 48.42  ? 1444 TYR B C   1 
ATOM   5329 O O   . TYR B 1 258 ? 0.115   18.586 94.840  1.00 44.82  ? 1444 TYR B O   1 
ATOM   5330 C CB  . TYR B 1 258 ? -2.320  18.135 93.202  1.00 29.85  ? 1444 TYR B CB  1 
ATOM   5331 C CG  . TYR B 1 258 ? -3.325  18.606 94.211  1.00 45.27  ? 1444 TYR B CG  1 
ATOM   5332 C CD1 . TYR B 1 258 ? -4.247  19.564 93.873  1.00 53.95  ? 1444 TYR B CD1 1 
ATOM   5333 C CD2 . TYR B 1 258 ? -3.333  18.121 95.528  1.00 55.43  ? 1444 TYR B CD2 1 
ATOM   5334 C CE1 . TYR B 1 258 ? -5.167  20.008 94.777  1.00 44.14  ? 1444 TYR B CE1 1 
ATOM   5335 C CE2 . TYR B 1 258 ? -4.254  18.578 96.467  1.00 37.84  ? 1444 TYR B CE2 1 
ATOM   5336 C CZ  . TYR B 1 258 ? -5.159  19.522 96.072  1.00 52.92  ? 1444 TYR B CZ  1 
ATOM   5337 O OH  . TYR B 1 258 ? -6.085  20.027 96.938  1.00 53.23  ? 1444 TYR B OH  1 
ATOM   5338 N N   . SER B 1 259 ? -0.815  20.596 94.904  1.00 42.34  ? 1445 SER B N   1 
ATOM   5339 C CA  . SER B 1 259 ? -0.178  20.874 96.170  1.00 46.45  ? 1445 SER B CA  1 
ATOM   5340 C C   . SER B 1 259 ? -1.205  20.926 97.298  1.00 53.39  ? 1445 SER B C   1 
ATOM   5341 O O   . SER B 1 259 ? -2.222  21.558 97.164  1.00 47.04  ? 1445 SER B O   1 
ATOM   5342 C CB  . SER B 1 259 ? 0.675   22.141 96.079  1.00 42.58  ? 1445 SER B CB  1 
ATOM   5343 O OG  . SER B 1 259 ? 1.609   22.014 95.010  1.00 48.47  ? 1445 SER B OG  1 
ATOM   5344 N N   . ARG B 1 260 ? -0.921  20.270 98.413  1.00 53.85  ? 1446 ARG B N   1 
ATOM   5345 C CA  . ARG B 1 260 ? -1.832  20.307 99.546  1.00 56.76  ? 1446 ARG B CA  1 
ATOM   5346 C C   . ARG B 1 260 ? -1.057  20.743 100.776 1.00 63.59  ? 1446 ARG B C   1 
ATOM   5347 O O   . ARG B 1 260 ? 0.100   20.378 100.947 1.00 53.69  ? 1446 ARG B O   1 
ATOM   5348 C CB  . ARG B 1 260 ? -2.520  18.965 99.770  1.00 53.18  ? 1446 ARG B CB  1 
ATOM   5349 C CG  . ARG B 1 260 ? -1.592  17.828 100.093 1.00 67.08  ? 1446 ARG B CG  1 
ATOM   5350 C CD  . ARG B 1 260 ? -2.376  16.543 100.254 1.00 83.75  ? 1446 ARG B CD  1 
ATOM   5351 N NE  . ARG B 1 260 ? -3.265  16.590 101.408 1.00 89.09  ? 1446 ARG B NE  1 
ATOM   5352 C CZ  . ARG B 1 260 ? -2.962  16.089 102.599 1.00 98.79  ? 1446 ARG B CZ  1 
ATOM   5353 N NH1 . ARG B 1 260 ? -1.792  15.501 102.792 1.00 83.63  ? 1446 ARG B NH1 1 
ATOM   5354 N NH2 . ARG B 1 260 ? -3.830  16.173 103.596 1.00 112.86 ? 1446 ARG B NH2 1 
ATOM   5355 N N   . PRO B 1 261 ? -1.693  21.533 101.628 1.00 63.38  ? 1447 PRO B N   1 
ATOM   5356 C CA  . PRO B 1 261 ? -1.026  22.031 102.826 1.00 67.17  ? 1447 PRO B CA  1 
ATOM   5357 C C   . PRO B 1 261 ? -1.311  21.173 104.039 1.00 66.99  ? 1447 PRO B C   1 
ATOM   5358 O O   . PRO B 1 261 ? -2.466  20.908 104.355 1.00 65.94  ? 1447 PRO B O   1 
ATOM   5359 C CB  . PRO B 1 261 ? -1.674  23.395 103.019 1.00 52.11  ? 1447 PRO B CB  1 
ATOM   5360 C CG  . PRO B 1 261 ? -3.058  23.196 102.540 1.00 59.67  ? 1447 PRO B CG  1 
ATOM   5361 C CD  . PRO B 1 261 ? -2.995  22.186 101.423 1.00 60.47  ? 1447 PRO B CD  1 
ATOM   5362 N N   . VAL B 1 262 ? -0.251  20.739 104.708 1.00 86.32  ? 1448 VAL B N   1 
ATOM   5363 C CA  . VAL B 1 262 ? -0.386  19.932 105.903 1.00 81.28  ? 1448 VAL B CA  1 
ATOM   5364 C C   . VAL B 1 262 ? 0.389   20.583 107.036 1.00 88.52  ? 1448 VAL B C   1 
ATOM   5365 O O   . VAL B 1 262 ? 1.562   20.907 106.882 1.00 88.16  ? 1448 VAL B O   1 
ATOM   5366 C CB  . VAL B 1 262 ? 0.167   18.527 105.687 1.00 69.09  ? 1448 VAL B CB  1 
ATOM   5367 C CG1 . VAL B 1 262 ? -0.130  18.067 104.277 1.00 77.13  ? 1448 VAL B CG1 1 
ATOM   5368 C CG2 . VAL B 1 262 ? 1.657   18.510 105.940 1.00 80.86  ? 1448 VAL B CG2 1 
ATOM   5369 N N   . ARG B 1 263 ? -0.264  20.769 108.175 1.00 97.65  ? 1449 ARG B N   1 
ATOM   5370 C CA  . ARG B 1 263 ? 0.405   21.364 109.334 1.00 95.71  ? 1449 ARG B CA  1 
ATOM   5371 C C   . ARG B 1 263 ? 1.123   20.232 110.089 1.00 93.37  ? 1449 ARG B C   1 
ATOM   5372 O O   . ARG B 1 263 ? 0.540   19.149 110.274 1.00 107.17 ? 1449 ARG B O   1 
ATOM   5373 C CB  . ARG B 1 263 ? -0.590  22.087 110.244 1.00 71.74  ? 1449 ARG B CB  1 
ATOM   5374 N N   . ARG B 1 264 ? 2.379   20.461 110.497 1.00 79.31  ? 1450 ARG B N   1 
ATOM   5375 C CA  . ARG B 1 264 ? 3.156   19.402 111.180 1.00 95.55  ? 1450 ARG B CA  1 
ATOM   5376 C C   . ARG B 1 264 ? 3.072   19.356 112.733 1.00 114.48 ? 1450 ARG B C   1 
ATOM   5377 O O   . ARG B 1 264 ? 2.989   18.252 113.332 1.00 98.22  ? 1450 ARG B O   1 
ATOM   5378 C CB  . ARG B 1 264 ? 4.603   19.315 110.674 1.00 76.96  ? 1450 ARG B CB  1 
ATOM   5379 C CG  . ARG B 1 264 ? 4.731   18.555 109.360 1.00 74.79  ? 1450 ARG B CG  1 
ATOM   5380 C CD  . ARG B 1 264 ? 4.139   17.152 109.459 1.00 77.60  ? 1450 ARG B CD  1 
ATOM   5381 N N   . GLY B 1 265 ? 3.065   20.527 113.371 1.00 106.09 ? 1451 GLY B N   1 
ATOM   5382 C CA  . GLY B 1 265 ? 2.812   20.600 114.808 1.00 88.41  ? 1451 GLY B CA  1 
ATOM   5383 C C   . GLY B 1 265 ? 3.442   21.855 115.354 1.00 130.54 ? 1451 GLY B C   1 
ATOM   5384 O O   . GLY B 1 265 ? 4.134   22.564 114.607 1.00 162.30 ? 1451 GLY B O   1 
ATOM   5385 N N   . THR B 1 266 ? 3.227   22.133 116.646 1.00 135.60 ? 1452 THR B N   1 
ATOM   5386 C CA  . THR B 1 266 ? 3.579   23.456 117.250 1.00 134.35 ? 1452 THR B CA  1 
ATOM   5387 C C   . THR B 1 266 ? 2.966   24.701 116.506 1.00 100.25 ? 1452 THR B C   1 
ATOM   5388 O O   . THR B 1 266 ? 3.660   25.723 116.326 1.00 83.05  ? 1452 THR B O   1 
ATOM   5389 C CB  . THR B 1 266 ? 5.152   23.632 117.564 1.00 104.32 ? 1452 THR B CB  1 
ATOM   5390 O OG1 . THR B 1 266 ? 5.957   23.203 116.452 1.00 86.58  ? 1452 THR B OG1 1 
ATOM   5391 C CG2 . THR B 1 266 ? 5.574   22.852 118.835 1.00 64.56  ? 1452 THR B CG2 1 
ATOM   5392 N N   . VAL B 1 267 ? 1.710   24.570 116.098 1.00 88.23  ? 1453 VAL B N   1 
ATOM   5393 C CA  . VAL B 1 267 ? 1.010   25.626 115.396 1.00 100.88 ? 1453 VAL B CA  1 
ATOM   5394 C C   . VAL B 1 267 ? 1.011   26.901 116.213 1.00 113.78 ? 1453 VAL B C   1 
ATOM   5395 O O   . VAL B 1 267 ? 0.854   26.871 117.431 1.00 133.17 ? 1453 VAL B O   1 
ATOM   5396 C CB  . VAL B 1 267 ? -0.447  25.234 115.125 1.00 100.52 ? 1453 VAL B CB  1 
ATOM   5397 C CG1 . VAL B 1 267 ? -1.149  26.319 114.328 1.00 96.14  ? 1453 VAL B CG1 1 
ATOM   5398 C CG2 . VAL B 1 267 ? -0.509  23.903 114.404 1.00 91.55  ? 1453 VAL B CG2 1 
ATOM   5399 N N   . ASP B 1 268 ? 1.187   28.026 115.534 1.00 98.33  ? 1454 ASP B N   1 
ATOM   5400 C CA  . ASP B 1 268 ? 1.195   29.312 116.201 1.00 95.07  ? 1454 ASP B CA  1 
ATOM   5401 C C   . ASP B 1 268 ? -0.005  30.115 115.736 1.00 100.38 ? 1454 ASP B C   1 
ATOM   5402 O O   . ASP B 1 268 ? -0.259  30.231 114.540 1.00 95.13  ? 1454 ASP B O   1 
ATOM   5403 C CB  . ASP B 1 268 ? 2.478   30.074 115.893 1.00 88.52  ? 1454 ASP B CB  1 
ATOM   5404 C CG  . ASP B 1 268 ? 2.577   31.367 116.664 1.00 101.11 ? 1454 ASP B CG  1 
ATOM   5405 O OD1 . ASP B 1 268 ? 1.878   32.333 116.300 1.00 110.39 ? 1454 ASP B OD1 1 
ATOM   5406 O OD2 . ASP B 1 268 ? 3.357   31.421 117.632 1.00 98.37  ? 1454 ASP B OD2 1 
ATOM   5407 N N   . PRO B 1 269 ? -0.746  30.667 116.685 1.00 116.66 ? 1455 PRO B N   1 
ATOM   5408 C CA  . PRO B 1 269 ? -1.926  31.463 116.354 1.00 111.92 ? 1455 PRO B CA  1 
ATOM   5409 C C   . PRO B 1 269 ? -1.514  32.750 115.663 1.00 99.22  ? 1455 PRO B C   1 
ATOM   5410 O O   . PRO B 1 269 ? -2.351  33.446 115.095 1.00 115.78 ? 1455 PRO B O   1 
ATOM   5411 C CB  . PRO B 1 269 ? -2.526  31.770 117.724 1.00 123.97 ? 1455 PRO B CB  1 
ATOM   5412 C CG  . PRO B 1 269 ? -1.359  31.792 118.639 1.00 131.05 ? 1455 PRO B CG  1 
ATOM   5413 C CD  . PRO B 1 269 ? -0.358  30.808 118.098 1.00 121.38 ? 1455 PRO B CD  1 
ATOM   5414 N N   . GLU B 1 270 ? -0.224  33.058 115.714 1.00 101.40 ? 1456 GLU B N   1 
ATOM   5415 C CA  . GLU B 1 270 ? 0.294   34.268 115.093 1.00 123.41 ? 1456 GLU B CA  1 
ATOM   5416 C C   . GLU B 1 270 ? 0.658   34.055 113.632 1.00 114.02 ? 1456 GLU B C   1 
ATOM   5417 O O   . GLU B 1 270 ? 0.176   34.776 112.764 1.00 114.28 ? 1456 GLU B O   1 
ATOM   5418 C CB  . GLU B 1 270 ? 1.480   34.812 115.883 1.00 135.70 ? 1456 GLU B CB  1 
ATOM   5419 C CG  . GLU B 1 270 ? 1.101   35.242 117.283 1.00 138.21 ? 1456 GLU B CG  1 
ATOM   5420 C CD  . GLU B 1 270 ? -0.292  35.836 117.334 1.00 133.71 ? 1456 GLU B CD  1 
ATOM   5421 O OE1 . GLU B 1 270 ? -0.978  35.824 116.292 1.00 110.25 ? 1456 GLU B OE1 1 
ATOM   5422 O OE2 . GLU B 1 270 ? -0.705  36.309 118.412 1.00 140.25 ? 1456 GLU B OE2 1 
ATOM   5423 N N   . ASN B 1 271 ? 1.504   33.071 113.351 1.00 101.65 ? 1457 ASN B N   1 
ATOM   5424 C CA  . ASN B 1 271 ? 1.879   32.810 111.966 1.00 96.81  ? 1457 ASN B CA  1 
ATOM   5425 C C   . ASN B 1 271 ? 1.893   31.332 111.577 1.00 94.67  ? 1457 ASN B C   1 
ATOM   5426 O O   . ASN B 1 271 ? 2.833   30.595 111.851 1.00 85.48  ? 1457 ASN B O   1 
ATOM   5427 C CB  . ASN B 1 271 ? 3.171   33.537 111.569 1.00 83.41  ? 1457 ASN B CB  1 
ATOM   5428 C CG  . ASN B 1 271 ? 4.416   32.789 111.968 1.00 81.17  ? 1457 ASN B CG  1 
ATOM   5429 O OD1 . ASN B 1 271 ? 4.393   31.947 112.861 1.00 91.35  ? 1457 ASN B OD1 1 
ATOM   5430 N ND2 . ASN B 1 271 ? 5.522   33.104 111.308 1.00 52.93  ? 1457 ASN B ND2 1 
ATOM   5431 N N   . GLU B 1 272 ? 0.808   30.931 110.931 1.00 96.66  ? 1458 GLU B N   1 
ATOM   5432 C CA  . GLU B 1 272 ? 0.582   29.593 110.456 1.00 85.20  ? 1458 GLU B CA  1 
ATOM   5433 C C   . GLU B 1 272 ? 1.659   29.136 109.526 1.00 73.88  ? 1458 GLU B C   1 
ATOM   5434 O O   . GLU B 1 272 ? 1.909   27.963 109.368 1.00 76.16  ? 1458 GLU B O   1 
ATOM   5435 C CB  . GLU B 1 272 ? -0.753  29.555 109.736 1.00 74.35  ? 1458 GLU B CB  1 
ATOM   5436 C CG  . GLU B 1 272 ? -1.124  30.852 109.071 1.00 88.68  ? 1458 GLU B CG  1 
ATOM   5437 C CD  . GLU B 1 272 ? -2.306  30.692 108.162 1.00 101.89 ? 1458 GLU B CD  1 
ATOM   5438 O OE1 . GLU B 1 272 ? -2.486  29.587 107.646 1.00 102.23 ? 1458 GLU B OE1 1 
ATOM   5439 O OE2 . GLU B 1 272 ? -3.058  31.657 107.958 1.00 94.98  ? 1458 GLU B OE2 1 
ATOM   5440 N N   . PHE B 1 273 ? 2.290   30.093 108.893 1.00 75.60  ? 1459 PHE B N   1 
ATOM   5441 C CA  . PHE B 1 273 ? 3.328   29.815 107.933 1.00 87.67  ? 1459 PHE B CA  1 
ATOM   5442 C C   . PHE B 1 273 ? 4.529   29.064 108.459 1.00 85.60  ? 1459 PHE B C   1 
ATOM   5443 O O   . PHE B 1 273 ? 5.085   28.238 107.762 1.00 80.54  ? 1459 PHE B O   1 
ATOM   5444 C CB  . PHE B 1 273 ? 3.732   31.119 107.263 1.00 72.71  ? 1459 PHE B CB  1 
ATOM   5445 C CG  . PHE B 1 273 ? 2.567   31.908 106.789 1.00 77.70  ? 1459 PHE B CG  1 
ATOM   5446 C CD1 . PHE B 1 273 ? 1.870   31.523 105.673 1.00 66.68  ? 1459 PHE B CD1 1 
ATOM   5447 C CD2 . PHE B 1 273 ? 2.137   33.003 107.477 1.00 66.87  ? 1459 PHE B CD2 1 
ATOM   5448 C CE1 . PHE B 1 273 ? 0.798   32.226 105.252 1.00 55.78  ? 1459 PHE B CE1 1 
ATOM   5449 C CE2 . PHE B 1 273 ? 1.058   33.702 107.047 1.00 68.62  ? 1459 PHE B CE2 1 
ATOM   5450 C CZ  . PHE B 1 273 ? 0.394   33.314 105.938 1.00 59.99  ? 1459 PHE B CZ  1 
ATOM   5451 N N   . ALA B 1 274 ? 4.936   29.350 109.679 1.00 84.20  ? 1460 ALA B N   1 
ATOM   5452 C CA  . ALA B 1 274 ? 6.095   28.681 110.244 1.00 77.75  ? 1460 ALA B CA  1 
ATOM   5453 C C   . ALA B 1 274 ? 5.886   27.171 110.261 1.00 72.78  ? 1460 ALA B C   1 
ATOM   5454 O O   . ALA B 1 274 ? 6.811   26.405 110.012 1.00 69.02  ? 1460 ALA B O   1 
ATOM   5455 C CB  . ALA B 1 274 ? 6.359   29.189 111.641 1.00 64.60  ? 1460 ALA B CB  1 
ATOM   5456 N N   . SER B 1 275 ? 4.665   26.754 110.570 1.00 62.82  ? 1461 SER B N   1 
ATOM   5457 C CA  . SER B 1 275 ? 4.322   25.339 110.655 1.00 68.32  ? 1461 SER B CA  1 
ATOM   5458 C C   . SER B 1 275 ? 3.661   24.724 109.424 1.00 79.37  ? 1461 SER B C   1 
ATOM   5459 O O   . SER B 1 275 ? 3.248   23.571 109.470 1.00 87.43  ? 1461 SER B O   1 
ATOM   5460 C CB  . SER B 1 275 ? 3.409   25.103 111.853 1.00 85.01  ? 1461 SER B CB  1 
ATOM   5461 O OG  . SER B 1 275 ? 2.095   25.538 111.562 1.00 86.83  ? 1461 SER B OG  1 
ATOM   5462 N N   . MET B 1 276 ? 3.541   25.468 108.332 1.00 85.53  ? 1462 MET B N   1 
ATOM   5463 C CA  . MET B 1 276 ? 2.878   24.909 107.158 1.00 85.88  ? 1462 MET B CA  1 
ATOM   5464 C C   . MET B 1 276 ? 3.800   24.257 106.137 1.00 82.61  ? 1462 MET B C   1 
ATOM   5465 O O   . MET B 1 276 ? 4.676   24.898 105.568 1.00 81.52  ? 1462 MET B O   1 
ATOM   5466 C CB  . MET B 1 276 ? 2.037   25.976 106.458 1.00 88.66  ? 1462 MET B CB  1 
ATOM   5467 C CG  . MET B 1 276 ? 1.158   25.424 105.350 1.00 80.25  ? 1462 MET B CG  1 
ATOM   5468 S SD  . MET B 1 276 ? 0.557   26.689 104.225 1.00 84.74  ? 1462 MET B SD  1 
ATOM   5469 C CE  . MET B 1 276 ? -0.032  27.914 105.381 1.00 81.52  ? 1462 MET B CE  1 
ATOM   5470 N N   . TRP B 1 277 ? 3.561   22.971 105.904 1.00 75.41  ? 1463 TRP B N   1 
ATOM   5471 C CA  . TRP B 1 277 ? 4.317   22.169 104.934 1.00 72.50  ? 1463 TRP B CA  1 
ATOM   5472 C C   . TRP B 1 277 ? 3.438   21.889 103.727 1.00 69.66  ? 1463 TRP B C   1 
ATOM   5473 O O   . TRP B 1 277 ? 2.226   21.939 103.823 1.00 82.23  ? 1463 TRP B O   1 
ATOM   5474 C CB  . TRP B 1 277 ? 4.718   20.838 105.584 1.00 74.61  ? 1463 TRP B CB  1 
ATOM   5475 C CG  . TRP B 1 277 ? 5.833   20.962 106.597 1.00 84.88  ? 1463 TRP B CG  1 
ATOM   5476 C CD1 . TRP B 1 277 ? 5.781   21.566 107.830 1.00 75.18  ? 1463 TRP B CD1 1 
ATOM   5477 C CD2 . TRP B 1 277 ? 7.170   20.471 106.450 1.00 88.42  ? 1463 TRP B CD2 1 
ATOM   5478 N NE1 . TRP B 1 277 ? 7.008   21.487 108.452 1.00 65.91  ? 1463 TRP B NE1 1 
ATOM   5479 C CE2 . TRP B 1 277 ? 7.880   20.821 107.630 1.00 81.25  ? 1463 TRP B CE2 1 
ATOM   5480 C CE3 . TRP B 1 277 ? 7.841   19.778 105.433 1.00 77.03  ? 1463 TRP B CE3 1 
ATOM   5481 C CZ2 . TRP B 1 277 ? 9.228   20.498 107.817 1.00 71.25  ? 1463 TRP B CZ2 1 
ATOM   5482 C CZ3 . TRP B 1 277 ? 9.179   19.462 105.617 1.00 68.03  ? 1463 TRP B CZ3 1 
ATOM   5483 C CH2 . TRP B 1 277 ? 9.860   19.822 106.803 1.00 67.38  ? 1463 TRP B CH2 1 
ATOM   5484 N N   . ILE B 1 278 ? 4.028   21.606 102.583 1.00 55.91  ? 1464 ILE B N   1 
ATOM   5485 C CA  . ILE B 1 278 ? 3.212   21.204 101.454 1.00 48.31  ? 1464 ILE B CA  1 
ATOM   5486 C C   . ILE B 1 278 ? 3.541   19.811 100.969 1.00 51.38  ? 1464 ILE B C   1 
ATOM   5487 O O   . ILE B 1 278 ? 4.700   19.507 100.678 1.00 46.27  ? 1464 ILE B O   1 
ATOM   5488 C CB  . ILE B 1 278 ? 3.272   22.200 100.258 1.00 54.05  ? 1464 ILE B CB  1 
ATOM   5489 C CG1 . ILE B 1 278 ? 2.055   23.099 100.237 1.00 57.61  ? 1464 ILE B CG1 1 
ATOM   5490 C CG2 . ILE B 1 278 ? 3.104   21.470 98.953  1.00 67.17  ? 1464 ILE B CG2 1 
ATOM   5491 C CD1 . ILE B 1 278 ? 2.224   24.378 100.912 1.00 68.45  ? 1464 ILE B CD1 1 
ATOM   5492 N N   . GLU B 1 279 ? 2.511   18.973 100.869 1.00 42.34  ? 1465 GLU B N   1 
ATOM   5493 C CA  . GLU B 1 279 ? 2.643   17.719 100.148 1.00 50.22  ? 1465 GLU B CA  1 
ATOM   5494 C C   . GLU B 1 279 ? 2.314   17.998 98.693  1.00 62.73  ? 1465 GLU B C   1 
ATOM   5495 O O   . GLU B 1 279 ? 1.230   18.503 98.392  1.00 51.53  ? 1465 GLU B O   1 
ATOM   5496 C CB  . GLU B 1 279 ? 1.699   16.662 100.711 1.00 48.65  ? 1465 GLU B CB  1 
ATOM   5497 C CG  . GLU B 1 279 ? 2.396   15.373 101.121 1.00 58.89  ? 1465 GLU B CG  1 
ATOM   5498 N N   . ARG B 1 280 ? 3.243   17.693 97.794  1.00 53.59  ? 1466 ARG B N   1 
ATOM   5499 C CA  . ARG B 1 280 ? 3.019   17.949 96.377  1.00 42.57  ? 1466 ARG B CA  1 
ATOM   5500 C C   . ARG B 1 280 ? 3.074   16.685 95.592  1.00 56.97  ? 1466 ARG B C   1 
ATOM   5501 O O   . ARG B 1 280 ? 4.078   15.972 95.638  1.00 66.97  ? 1466 ARG B O   1 
ATOM   5502 C CB  . ARG B 1 280 ? 4.058   18.911 95.832  1.00 42.63  ? 1466 ARG B CB  1 
ATOM   5503 C CG  . ARG B 1 280 ? 3.921   19.158 94.340  1.00 51.54  ? 1466 ARG B CG  1 
ATOM   5504 C CD  . ARG B 1 280 ? 4.810   20.265 93.868  1.00 42.15  ? 1466 ARG B CD  1 
ATOM   5505 N NE  . ARG B 1 280 ? 4.427   21.514 94.503  1.00 55.49  ? 1466 ARG B NE  1 
ATOM   5506 C CZ  . ARG B 1 280 ? 5.273   22.496 94.813  1.00 73.17  ? 1466 ARG B CZ  1 
ATOM   5507 N NH1 . ARG B 1 280 ? 6.572   22.382 94.566  1.00 78.17  ? 1466 ARG B NH1 1 
ATOM   5508 N NH2 . ARG B 1 280 ? 4.819   23.594 95.388  1.00 62.53  ? 1466 ARG B NH2 1 
ATOM   5509 N N   . THR B 1 281 ? 2.007   16.424 94.849  1.00 47.35  ? 1467 THR B N   1 
ATOM   5510 C CA  . THR B 1 281 ? 1.913   15.244 94.001  1.00 42.14  ? 1467 THR B CA  1 
ATOM   5511 C C   . THR B 1 281 ? 2.190   15.621 92.581  1.00 44.14  ? 1467 THR B C   1 
ATOM   5512 O O   . THR B 1 281 ? 1.802   16.696 92.163  1.00 45.30  ? 1467 THR B O   1 
ATOM   5513 C CB  . THR B 1 281 ? 0.525   14.709 94.045  1.00 37.43  ? 1467 THR B CB  1 
ATOM   5514 O OG1 . THR B 1 281 ? 0.087   14.742 95.392  1.00 63.51  ? 1467 THR B OG1 1 
ATOM   5515 C CG2 . THR B 1 281 ? 0.455   13.304 93.561  1.00 46.36  ? 1467 THR B CG2 1 
ATOM   5516 N N   . SER B 1 282 ? 2.866   14.730 91.855  1.00 56.26  ? 1468 SER B N   1 
ATOM   5517 C CA  . SER B 1 282 ? 3.192   14.926 90.460  1.00 49.42  ? 1468 SER B CA  1 
ATOM   5518 C C   . SER B 1 282 ? 2.475   13.876 89.672  1.00 48.05  ? 1468 SER B C   1 
ATOM   5519 O O   . SER B 1 282 ? 2.431   12.753 90.082  1.00 50.94  ? 1468 SER B O   1 
ATOM   5520 C CB  . SER B 1 282 ? 4.700   14.807 90.238  1.00 43.47  ? 1468 SER B CB  1 
ATOM   5521 O OG  . SER B 1 282 ? 5.397   15.874 90.882  1.00 80.74  ? 1468 SER B OG  1 
ATOM   5522 N N   . PHE B 1 283 ? 1.893   14.261 88.540  1.00 56.84  ? 1469 PHE B N   1 
ATOM   5523 C CA  . PHE B 1 283 ? 1.284   13.305 87.588  1.00 57.68  ? 1469 PHE B CA  1 
ATOM   5524 C C   . PHE B 1 283 ? 1.909   13.521 86.255  1.00 52.75  ? 1469 PHE B C   1 
ATOM   5525 O O   . PHE B 1 283 ? 2.051   14.677 85.846  1.00 65.11  ? 1469 PHE B O   1 
ATOM   5526 C CB  . PHE B 1 283 ? -0.209  13.543 87.426  1.00 46.14  ? 1469 PHE B CB  1 
ATOM   5527 C CG  . PHE B 1 283 ? -0.894  13.887 88.697  1.00 48.59  ? 1469 PHE B CG  1 
ATOM   5528 C CD1 . PHE B 1 283 ? -0.628  15.095 89.348  1.00 51.10  ? 1469 PHE B CD1 1 
ATOM   5529 C CD2 . PHE B 1 283 ? -1.798  13.006 89.264  1.00 42.86  ? 1469 PHE B CD2 1 
ATOM   5530 C CE1 . PHE B 1 283 ? -1.254  15.399 90.538  1.00 41.10  ? 1469 PHE B CE1 1 
ATOM   5531 C CE2 . PHE B 1 283 ? -2.429  13.315 90.473  1.00 38.25  ? 1469 PHE B CE2 1 
ATOM   5532 C CZ  . PHE B 1 283 ? -2.165  14.496 91.095  1.00 33.93  ? 1469 PHE B CZ  1 
ATOM   5533 N N   . VAL B 1 284 ? 2.291   12.426 85.588  1.00 50.87  ? 1470 VAL B N   1 
ATOM   5534 C CA  . VAL B 1 284 ? 2.833   12.483 84.240  1.00 44.14  ? 1470 VAL B CA  1 
ATOM   5535 C C   . VAL B 1 284 ? 1.928   11.670 83.356  1.00 50.39  ? 1470 VAL B C   1 
ATOM   5536 O O   . VAL B 1 284 ? 1.680   10.494 83.673  1.00 46.00  ? 1470 VAL B O   1 
ATOM   5537 C CB  . VAL B 1 284 ? 4.190   11.861 84.175  1.00 43.72  ? 1470 VAL B CB  1 
ATOM   5538 C CG1 . VAL B 1 284 ? 4.731   12.007 82.782  1.00 53.25  ? 1470 VAL B CG1 1 
ATOM   5539 C CG2 . VAL B 1 284 ? 5.125   12.520 85.151  1.00 51.46  ? 1470 VAL B CG2 1 
ATOM   5540 N N   . THR B 1 285 ? 1.414   12.282 82.276  1.00 38.23  ? 1471 THR B N   1 
ATOM   5541 C CA  . THR B 1 285 ? 0.528   11.566 81.356  1.00 34.75  ? 1471 THR B CA  1 
ATOM   5542 C C   . THR B 1 285 ? 1.384   10.917 80.311  1.00 43.79  ? 1471 THR B C   1 
ATOM   5543 O O   . THR B 1 285 ? 2.539   11.273 80.152  1.00 42.49  ? 1471 THR B O   1 
ATOM   5544 C CB  . THR B 1 285 ? -0.474  12.466 80.658  1.00 33.63  ? 1471 THR B CB  1 
ATOM   5545 O OG1 . THR B 1 285 ? 0.232   13.388 79.827  1.00 42.46  ? 1471 THR B OG1 1 
ATOM   5546 C CG2 . THR B 1 285 ? -1.286  13.237 81.680  1.00 51.03  ? 1471 THR B CG2 1 
ATOM   5547 N N   . ALA B 1 286 ? 0.824   9.950  79.602  1.00 55.58  ? 1472 ALA B N   1 
ATOM   5548 C CA  . ALA B 1 286 ? 1.582   9.240  78.590  1.00 46.22  ? 1472 ALA B CA  1 
ATOM   5549 C C   . ALA B 1 286 ? 1.782   10.095 77.348  1.00 52.60  ? 1472 ALA B C   1 
ATOM   5550 O O   . ALA B 1 286 ? 2.750   9.912  76.650  1.00 40.57  ? 1472 ALA B O   1 
ATOM   5551 C CB  . ALA B 1 286 ? 0.890   7.974  78.239  1.00 42.18  ? 1472 ALA B CB  1 
ATOM   5552 N N   . TYR B 1 287 ? 0.859   11.016 77.073  1.00 48.67  ? 1473 TYR B N   1 
ATOM   5553 C CA  . TYR B 1 287 ? 1.003   11.933 75.958  1.00 42.25  ? 1473 TYR B CA  1 
ATOM   5554 C C   . TYR B 1 287 ? 0.764   13.345 76.431  1.00 61.13  ? 1473 TYR B C   1 
ATOM   5555 O O   . TYR B 1 287 ? 0.090   13.540 77.443  1.00 69.18  ? 1473 TYR B O   1 
ATOM   5556 C CB  . TYR B 1 287 ? 0.019   11.561 74.870  1.00 55.19  ? 1473 TYR B CB  1 
ATOM   5557 C CG  . TYR B 1 287 ? 0.177   10.145 74.436  1.00 51.12  ? 1473 TYR B CG  1 
ATOM   5558 C CD1 . TYR B 1 287 ? 1.198   9.792  73.590  1.00 47.94  ? 1473 TYR B CD1 1 
ATOM   5559 C CD2 . TYR B 1 287 ? -0.684  9.164  74.887  1.00 41.51  ? 1473 TYR B CD2 1 
ATOM   5560 C CE1 . TYR B 1 287 ? 1.365   8.508  73.195  1.00 59.06  ? 1473 TYR B CE1 1 
ATOM   5561 C CE2 . TYR B 1 287 ? -0.528  7.867  74.505  1.00 59.11  ? 1473 TYR B CE2 1 
ATOM   5562 C CZ  . TYR B 1 287 ? 0.503   7.547  73.655  1.00 66.03  ? 1473 TYR B CZ  1 
ATOM   5563 O OH  . TYR B 1 287 ? 0.673   6.253  73.259  1.00 65.06  ? 1473 TYR B OH  1 
ATOM   5564 N N   . LYS B 1 288 ? 1.332   14.322 75.723  1.00 44.23  ? 1474 LYS B N   1 
ATOM   5565 C CA  . LYS B 1 288 ? 1.090   15.734 75.988  1.00 30.21  ? 1474 LYS B CA  1 
ATOM   5566 C C   . LYS B 1 288 ? -0.330  16.133 75.684  1.00 40.81  ? 1474 LYS B C   1 
ATOM   5567 O O   . LYS B 1 288 ? -1.002  15.497 74.877  1.00 45.75  ? 1474 LYS B O   1 
ATOM   5568 C CB  . LYS B 1 288 ? 1.988   16.572 75.113  1.00 45.24  ? 1474 LYS B CB  1 
ATOM   5569 C CG  . LYS B 1 288 ? 3.353   16.819 75.677  1.00 64.79  ? 1474 LYS B CG  1 
ATOM   5570 C CD  . LYS B 1 288 ? 4.306   17.200 74.565  1.00 88.34  ? 1474 LYS B CD  1 
ATOM   5571 C CE  . LYS B 1 288 ? 5.529   17.936 75.097  1.00 105.83 ? 1474 LYS B CE  1 
ATOM   5572 N NZ  . LYS B 1 288 ? 5.947   19.012 74.127  1.00 125.06 ? 1474 LYS B NZ  1 
ATOM   5573 N N   . LEU B 1 289 ? -0.771  17.196 76.342  1.00 34.50  ? 1475 LEU B N   1 
ATOM   5574 C CA  . LEU B 1 289 ? -2.033  17.866 76.014  1.00 36.49  ? 1475 LEU B CA  1 
ATOM   5575 C C   . LEU B 1 289 ? -1.727  19.239 75.486  1.00 43.79  ? 1475 LEU B C   1 
ATOM   5576 O O   . LEU B 1 289 ? -0.889  19.944 76.062  1.00 33.14  ? 1475 LEU B O   1 
ATOM   5577 C CB  . LEU B 1 289 ? -2.912  17.995 77.243  1.00 42.57  ? 1475 LEU B CB  1 
ATOM   5578 C CG  . LEU B 1 289 ? -3.536  16.727 77.791  1.00 33.67  ? 1475 LEU B CG  1 
ATOM   5579 C CD1 . LEU B 1 289 ? -4.067  17.060 79.121  1.00 48.50  ? 1475 LEU B CD1 1 
ATOM   5580 C CD2 . LEU B 1 289 ? -4.657  16.245 76.918  1.00 28.62  ? 1475 LEU B CD2 1 
ATOM   5581 N N   . PRO B 1 290 ? -2.404  19.648 74.401  1.00 40.73  ? 1476 PRO B N   1 
ATOM   5582 C CA  . PRO B 1 290 ? -3.506  19.025 73.710  1.00 43.55  ? 1476 PRO B CA  1 
ATOM   5583 C C   . PRO B 1 290 ? -3.045  17.892 72.793  1.00 48.84  ? 1476 PRO B C   1 
ATOM   5584 O O   . PRO B 1 290 ? -1.910  17.855 72.345  1.00 52.55  ? 1476 PRO B O   1 
ATOM   5585 C CB  . PRO B 1 290 ? -4.061  20.172 72.835  1.00 34.56  ? 1476 PRO B CB  1 
ATOM   5586 C CG  . PRO B 1 290 ? -3.320  21.370 73.209  1.00 42.38  ? 1476 PRO B CG  1 
ATOM   5587 C CD  . PRO B 1 290 ? -2.008  20.872 73.697  1.00 37.83  ? 1476 PRO B CD  1 
ATOM   5588 N N   . GLY B 1 291 ? -3.951  16.982 72.494  1.00 41.30  ? 1477 GLY B N   1 
ATOM   5589 C CA  . GLY B 1 291 ? -3.679  15.958 71.512  1.00 30.57  ? 1477 GLY B CA  1 
ATOM   5590 C C   . GLY B 1 291 ? -4.968  15.454 70.915  1.00 31.78  ? 1477 GLY B C   1 
ATOM   5591 O O   . GLY B 1 291 ? -5.914  16.194 70.693  1.00 46.05  ? 1477 GLY B O   1 
ATOM   5592 N N   . ILE B 1 292 ? -4.982  14.167 70.677  1.00 51.72  ? 1478 ILE B N   1 
ATOM   5593 C CA  . ILE B 1 292 ? -6.052  13.484 69.980  1.00 57.57  ? 1478 ILE B CA  1 
ATOM   5594 C C   . ILE B 1 292 ? -7.308  13.340 70.873  1.00 59.37  ? 1478 ILE B C   1 
ATOM   5595 O O   . ILE B 1 292 ? -8.415  13.039 70.355  1.00 55.30  ? 1478 ILE B O   1 
ATOM   5596 C CB  . ILE B 1 292 ? -5.521  12.074 69.552  1.00 62.55  ? 1478 ILE B CB  1 
ATOM   5597 C CG1 . ILE B 1 292 ? -4.247  12.211 68.722  1.00 76.70  ? 1478 ILE B CG1 1 
ATOM   5598 C CG2 . ILE B 1 292 ? -6.497  11.344 68.736  1.00 65.06  ? 1478 ILE B CG2 1 
ATOM   5599 C CD1 . ILE B 1 292 ? -2.971  12.604 69.560  1.00 116.31 ? 1478 ILE B CD1 1 
ATOM   5600 N N   . LEU B 1 293 ? -7.135  13.513 72.194  1.00 50.12  ? 1479 LEU B N   1 
ATOM   5601 C CA  . LEU B 1 293 ? -8.248  13.491 73.111  1.00 31.12  ? 1479 LEU B CA  1 
ATOM   5602 C C   . LEU B 1 293 ? -8.126  14.595 74.115  1.00 53.50  ? 1479 LEU B C   1 
ATOM   5603 O O   . LEU B 1 293 ? -7.108  15.257 74.189  1.00 53.05  ? 1479 LEU B O   1 
ATOM   5604 C CB  . LEU B 1 293 ? -8.353  12.165 73.815  1.00 38.46  ? 1479 LEU B CB  1 
ATOM   5605 C CG  . LEU B 1 293 ? -8.836  11.006 72.936  1.00 53.50  ? 1479 LEU B CG  1 
ATOM   5606 C CD1 . LEU B 1 293 ? -8.535  9.679  73.607  1.00 31.55  ? 1479 LEU B CD1 1 
ATOM   5607 C CD2 . LEU B 1 293 ? -10.339 11.116 72.583  1.00 61.71  ? 1479 LEU B CD2 1 
ATOM   5608 N N   . ARG B 1 294 ? -9.183  14.839 74.880  1.00 53.67  ? 1480 ARG B N   1 
ATOM   5609 C CA  . ARG B 1 294 ? -9.139  15.887 75.899  1.00 39.41  ? 1480 ARG B CA  1 
ATOM   5610 C C   . ARG B 1 294 ? -8.542  15.308 77.182  1.00 54.07  ? 1480 ARG B C   1 
ATOM   5611 O O   . ARG B 1 294 ? -8.361  16.038 78.159  1.00 44.05  ? 1480 ARG B O   1 
ATOM   5612 C CB  . ARG B 1 294 ? -10.534 16.485 76.182  1.00 35.14  ? 1480 ARG B CB  1 
ATOM   5613 C CG  . ARG B 1 294 ? -10.959 17.608 75.292  1.00 42.26  ? 1480 ARG B CG  1 
ATOM   5614 C CD  . ARG B 1 294 ? -11.712 18.740 76.045  1.00 47.43  ? 1480 ARG B CD  1 
ATOM   5615 N NE  . ARG B 1 294 ? -11.969 19.873 75.128  1.00 89.18  ? 1480 ARG B NE  1 
ATOM   5616 C CZ  . ARG B 1 294 ? -11.134 20.902 74.848  1.00 96.56  ? 1480 ARG B CZ  1 
ATOM   5617 N NH1 . ARG B 1 294 ? -9.918  21.031 75.422  1.00 78.12  ? 1480 ARG B NH1 1 
ATOM   5618 N NH2 . ARG B 1 294 ? -11.528 21.832 73.960  1.00 77.46  ? 1480 ARG B NH2 1 
ATOM   5619 N N   . TRP B 1 295 ? -8.251  14.010 77.202  1.00 35.32  ? 1481 TRP B N   1 
ATOM   5620 C CA  . TRP B 1 295 ? -7.734  13.364 78.413  1.00 58.38  ? 1481 TRP B CA  1 
ATOM   5621 C C   . TRP B 1 295 ? -6.743  12.269 78.092  1.00 43.49  ? 1481 TRP B C   1 
ATOM   5622 O O   . TRP B 1 295 ? -6.875  11.545 77.088  1.00 50.98  ? 1481 TRP B O   1 
ATOM   5623 C CB  . TRP B 1 295 ? -8.860  12.759 79.248  1.00 60.86  ? 1481 TRP B CB  1 
ATOM   5624 C CG  . TRP B 1 295 ? -9.630  11.695 78.466  1.00 60.13  ? 1481 TRP B CG  1 
ATOM   5625 C CD1 . TRP B 1 295 ? -9.338  10.339 78.378  1.00 59.15  ? 1481 TRP B CD1 1 
ATOM   5626 C CD2 . TRP B 1 295 ? -10.778 11.910 77.644  1.00 56.40  ? 1481 TRP B CD2 1 
ATOM   5627 N NE1 . TRP B 1 295 ? -10.238 9.720  77.553  1.00 57.26  ? 1481 TRP B NE1 1 
ATOM   5628 C CE2 . TRP B 1 295 ? -11.125 10.655 77.079  1.00 59.24  ? 1481 TRP B CE2 1 
ATOM   5629 C CE3 . TRP B 1 295 ? -11.535 13.044 77.311  1.00 52.69  ? 1481 TRP B CE3 1 
ATOM   5630 C CZ2 . TRP B 1 295 ? -12.206 10.502 76.204  1.00 62.02  ? 1481 TRP B CZ2 1 
ATOM   5631 C CZ3 . TRP B 1 295 ? -12.611 12.894 76.437  1.00 56.40  ? 1481 TRP B CZ3 1 
ATOM   5632 C CH2 . TRP B 1 295 ? -12.939 11.629 75.896  1.00 57.51  ? 1481 TRP B CH2 1 
ATOM   5633 N N   . PHE B 1 296 ? -5.745  12.140 78.955  1.00 47.25  ? 1482 PHE B N   1 
ATOM   5634 C CA  . PHE B 1 296 ? -4.793  11.048 78.860  1.00 47.10  ? 1482 PHE B CA  1 
ATOM   5635 C C   . PHE B 1 296 ? -4.560  10.469 80.228  1.00 37.93  ? 1482 PHE B C   1 
ATOM   5636 O O   . PHE B 1 296 ? -4.594  11.163 81.211  1.00 57.55  ? 1482 PHE B O   1 
ATOM   5637 C CB  . PHE B 1 296 ? -3.496  11.513 78.230  1.00 46.24  ? 1482 PHE B CB  1 
ATOM   5638 C CG  . PHE B 1 296 ? -3.605  11.820 76.756  1.00 44.92  ? 1482 PHE B CG  1 
ATOM   5639 C CD1 . PHE B 1 296 ? -4.048  10.852 75.853  1.00 50.32  ? 1482 PHE B CD1 1 
ATOM   5640 C CD2 . PHE B 1 296 ? -3.218  13.067 76.262  1.00 49.86  ? 1482 PHE B CD2 1 
ATOM   5641 C CE1 . PHE B 1 296 ? -4.109  11.126 74.488  1.00 36.65  ? 1482 PHE B CE1 1 
ATOM   5642 C CE2 . PHE B 1 296 ? -3.300  13.370 74.912  1.00 42.59  ? 1482 PHE B CE2 1 
ATOM   5643 C CZ  . PHE B 1 296 ? -3.740  12.395 74.017  1.00 49.09  ? 1482 PHE B CZ  1 
ATOM   5644 N N   . GLU B 1 297 ? -4.360  9.175  80.294  1.00 49.71  ? 1483 GLU B N   1 
ATOM   5645 C CA  . GLU B 1 297 ? -4.224  8.481  81.567  1.00 46.54  ? 1483 GLU B CA  1 
ATOM   5646 C C   . GLU B 1 297 ? -2.914  8.816  82.210  1.00 55.67  ? 1483 GLU B C   1 
ATOM   5647 O O   . GLU B 1 297 ? -1.905  8.905  81.537  1.00 61.98  ? 1483 GLU B O   1 
ATOM   5648 C CB  . GLU B 1 297 ? -4.277  6.986  81.313  1.00 52.70  ? 1483 GLU B CB  1 
ATOM   5649 C CG  . GLU B 1 297 ? -3.867  6.103  82.477  1.00 71.70  ? 1483 GLU B CG  1 
ATOM   5650 C CD  . GLU B 1 297 ? -3.978  4.609  82.154  1.00 76.03  ? 1483 GLU B CD  1 
ATOM   5651 O OE1 . GLU B 1 297 ? -4.392  4.259  81.027  1.00 75.52  ? 1483 GLU B OE1 1 
ATOM   5652 O OE2 . GLU B 1 297 ? -3.650  3.784  83.026  1.00 69.14  ? 1483 GLU B OE2 1 
ATOM   5653 N N   . VAL B 1 298 ? -2.922  8.998  83.519  1.00 60.49  ? 1484 VAL B N   1 
ATOM   5654 C CA  . VAL B 1 298 ? -1.674  9.269  84.240  1.00 52.43  ? 1484 VAL B CA  1 
ATOM   5655 C C   . VAL B 1 298 ? -0.874  7.990  84.259  1.00 49.61  ? 1484 VAL B C   1 
ATOM   5656 O O   . VAL B 1 298 ? -1.402  6.938  84.567  1.00 51.50  ? 1484 VAL B O   1 
ATOM   5657 C CB  . VAL B 1 298 ? -1.931  9.710  85.690  1.00 46.86  ? 1484 VAL B CB  1 
ATOM   5658 C CG1 . VAL B 1 298 ? -0.616  9.753  86.471  1.00 43.70  ? 1484 VAL B CG1 1 
ATOM   5659 C CG2 . VAL B 1 298 ? -2.606  11.066 85.706  1.00 39.70  ? 1484 VAL B CG2 1 
ATOM   5660 N N   . VAL B 1 299 ? 0.397   8.060  83.931  1.00 50.15  ? 1485 VAL B N   1 
ATOM   5661 C CA  . VAL B 1 299 ? 1.167   6.833  83.889  1.00 55.17  ? 1485 VAL B CA  1 
ATOM   5662 C C   . VAL B 1 299 ? 2.200   6.735  85.029  1.00 53.93  ? 1485 VAL B C   1 
ATOM   5663 O O   . VAL B 1 299 ? 2.742   5.672  85.331  1.00 52.26  ? 1485 VAL B O   1 
ATOM   5664 C CB  . VAL B 1 299 ? 1.799   6.686  82.517  1.00 45.87  ? 1485 VAL B CB  1 
ATOM   5665 C CG1 . VAL B 1 299 ? 3.038   5.853  82.585  1.00 56.36  ? 1485 VAL B CG1 1 
ATOM   5666 C CG2 . VAL B 1 299 ? 0.840   6.066  81.590  1.00 56.70  ? 1485 VAL B CG2 1 
ATOM   5667 N N   . HIS B 1 300 ? 2.464   7.866  85.657  1.00 52.71  ? 1486 HIS B N   1 
ATOM   5668 C CA  . HIS B 1 300 ? 3.388   7.940  86.768  1.00 55.28  ? 1486 HIS B CA  1 
ATOM   5669 C C   . HIS B 1 300 ? 2.978   9.028  87.751  1.00 65.21  ? 1486 HIS B C   1 
ATOM   5670 O O   . HIS B 1 300 ? 2.579   10.136 87.387  1.00 69.11  ? 1486 HIS B O   1 
ATOM   5671 C CB  . HIS B 1 300 ? 4.824   8.187  86.307  1.00 66.91  ? 1486 HIS B CB  1 
ATOM   5672 C CG  . HIS B 1 300 ? 5.798   8.199  87.435  1.00 76.94  ? 1486 HIS B CG  1 
ATOM   5673 N ND1 . HIS B 1 300 ? 6.309   9.359  87.973  1.00 68.98  ? 1486 HIS B ND1 1 
ATOM   5674 C CD2 . HIS B 1 300 ? 6.307   7.187  88.172  1.00 79.53  ? 1486 HIS B CD2 1 
ATOM   5675 C CE1 . HIS B 1 300 ? 7.118   9.061  88.972  1.00 62.23  ? 1486 HIS B CE1 1 
ATOM   5676 N NE2 . HIS B 1 300 ? 7.135   7.749  89.111  1.00 91.00  ? 1486 HIS B NE2 1 
ATOM   5677 N N   . MET B 1 301 ? 3.041   8.676  89.030  1.00 69.45  ? 1487 MET B N   1 
ATOM   5678 C CA  . MET B 1 301 ? 2.693   9.581  90.118  1.00 59.37  ? 1487 MET B CA  1 
ATOM   5679 C C   . MET B 1 301 ? 3.798   9.638  91.157  1.00 55.61  ? 1487 MET B C   1 
ATOM   5680 O O   . MET B 1 301 ? 4.305   8.610  91.584  1.00 77.19  ? 1487 MET B O   1 
ATOM   5681 C CB  . MET B 1 301 ? 1.403   9.132  90.794  1.00 48.48  ? 1487 MET B CB  1 
ATOM   5682 C CG  . MET B 1 301 ? 0.157   9.796  90.268  1.00 71.07  ? 1487 MET B CG  1 
ATOM   5683 S SD  . MET B 1 301 ? -1.298  9.232  91.147  1.00 63.18  ? 1487 MET B SD  1 
ATOM   5684 C CE  . MET B 1 301 ? -2.385  10.622 90.904  1.00 111.96 ? 1487 MET B CE  1 
ATOM   5685 N N   . SER B 1 302 ? 4.165   10.841 91.571  1.00 56.38  ? 1488 SER B N   1 
ATOM   5686 C CA  . SER B 1 302 ? 5.202   11.004 92.573  1.00 52.41  ? 1488 SER B CA  1 
ATOM   5687 C C   . SER B 1 302 ? 4.799   12.069 93.571  1.00 63.07  ? 1488 SER B C   1 
ATOM   5688 O O   . SER B 1 302 ? 4.033   12.969 93.252  1.00 62.41  ? 1488 SER B O   1 
ATOM   5689 C CB  . SER B 1 302 ? 6.528   11.386 91.923  1.00 69.11  ? 1488 SER B CB  1 
ATOM   5690 O OG  . SER B 1 302 ? 6.558   12.765 91.607  1.00 76.42  ? 1488 SER B OG  1 
ATOM   5691 N N   . GLN B 1 303 ? 5.314   11.955 94.786  1.00 81.26  ? 1489 GLN B N   1 
ATOM   5692 C CA  . GLN B 1 303 ? 5.021   12.922 95.829  1.00 68.84  ? 1489 GLN B CA  1 
ATOM   5693 C C   . GLN B 1 303 ? 6.303   13.426 96.467  1.00 46.68  ? 1489 GLN B C   1 
ATOM   5694 O O   . GLN B 1 303 ? 7.191   12.644 96.787  1.00 60.70  ? 1489 GLN B O   1 
ATOM   5695 C CB  . GLN B 1 303 ? 4.117   12.310 96.892  1.00 58.19  ? 1489 GLN B CB  1 
ATOM   5696 C CG  . GLN B 1 303 ? 3.746   13.269 97.995  1.00 92.87  ? 1489 GLN B CG  1 
ATOM   5697 C CD  . GLN B 1 303 ? 2.975   12.599 99.101  1.00 114.42 ? 1489 GLN B CD  1 
ATOM   5698 O OE1 . GLN B 1 303 ? 2.580   13.239 100.071 1.00 134.84 ? 1489 GLN B OE1 1 
ATOM   5699 N NE2 . GLN B 1 303 ? 2.758   11.299 98.964  1.00 98.62  ? 1489 GLN B NE2 1 
ATOM   5700 N N   . THR B 1 304 ? 6.395   14.736 96.649  1.00 64.27  ? 1490 THR B N   1 
ATOM   5701 C CA  . THR B 1 304 ? 7.532   15.326 97.255  1.00 61.06  ? 1490 THR B CA  1 
ATOM   5702 C C   . THR B 1 304 ? 6.998   16.273 98.271  1.00 59.29  ? 1490 THR B C   1 
ATOM   5703 O O   . THR B 1 304 ? 5.958   16.841 98.119  1.00 57.17  ? 1490 THR B O   1 
ATOM   5704 C CB  . THR B 1 304 ? 8.316   16.068 96.238  1.00 54.64  ? 1490 THR B CB  1 
ATOM   5705 O OG1 . THR B 1 304 ? 8.526   17.386 96.701  1.00 78.98  ? 1490 THR B OG1 1 
ATOM   5706 C CG2 . THR B 1 304 ? 7.532   16.144 94.983  1.00 69.98  ? 1490 THR B CG2 1 
ATOM   5707 N N   . THR B 1 305 ? 7.739   16.457 99.356  1.00 77.49  ? 1491 THR B N   1 
ATOM   5708 C CA  . THR B 1 305 ? 7.314   17.356 100.428 1.00 72.71  ? 1491 THR B CA  1 
ATOM   5709 C C   . THR B 1 305 ? 8.173   18.610 100.523 1.00 59.12  ? 1491 THR B C   1 
ATOM   5710 O O   . THR B 1 305 ? 9.396   18.535 100.499 1.00 64.06  ? 1491 THR B O   1 
ATOM   5711 C CB  . THR B 1 305 ? 7.328   16.644 101.792 1.00 71.20  ? 1491 THR B CB  1 
ATOM   5712 O OG1 . THR B 1 305 ? 6.540   15.451 101.720 1.00 83.88  ? 1491 THR B OG1 1 
ATOM   5713 C CG2 . THR B 1 305 ? 6.763   17.544 102.869 1.00 82.51  ? 1491 THR B CG2 1 
ATOM   5714 N N   . ILE B 1 306 ? 7.521   19.764 100.629 1.00 50.95  ? 1492 ILE B N   1 
ATOM   5715 C CA  . ILE B 1 306 ? 8.228   21.038 100.724 1.00 64.19  ? 1492 ILE B CA  1 
ATOM   5716 C C   . ILE B 1 306 ? 8.039   21.746 102.067 1.00 60.36  ? 1492 ILE B C   1 
ATOM   5717 O O   . ILE B 1 306 ? 6.921   21.930 102.535 1.00 56.51  ? 1492 ILE B O   1 
ATOM   5718 C CB  . ILE B 1 306 ? 7.842   21.974 99.565  1.00 65.36  ? 1492 ILE B CB  1 
ATOM   5719 C CG1 . ILE B 1 306 ? 7.851   23.426 100.029 1.00 57.41  ? 1492 ILE B CG1 1 
ATOM   5720 C CG2 . ILE B 1 306 ? 6.477   21.612 99.020  1.00 65.32  ? 1492 ILE B CG2 1 
ATOM   5721 C CD1 . ILE B 1 306 ? 7.285   24.377 99.017  1.00 64.60  ? 1492 ILE B CD1 1 
ATOM   5722 N N   . SER B 1 307 ? 9.156   22.133 102.675 1.00 66.44  ? 1493 SER B N   1 
ATOM   5723 C CA  . SER B 1 307 ? 9.176   22.819 103.968 1.00 71.71  ? 1493 SER B CA  1 
ATOM   5724 C C   . SER B 1 307 ? 8.710   24.270 103.948 1.00 58.12  ? 1493 SER B C   1 
ATOM   5725 O O   . SER B 1 307 ? 8.857   24.964 102.950 1.00 67.92  ? 1493 SER B O   1 
ATOM   5726 C CB  . SER B 1 307 ? 10.579  22.752 104.569 1.00 76.80  ? 1493 SER B CB  1 
ATOM   5727 O OG  . SER B 1 307 ? 11.532  23.318 103.691 1.00 72.75  ? 1493 SER B OG  1 
ATOM   5728 N N   . PRO B 1 308 ? 8.150   24.726 105.063 1.00 72.54  ? 1494 PRO B N   1 
ATOM   5729 C CA  . PRO B 1 308 ? 7.681   26.089 105.153 1.00 64.65  ? 1494 PRO B CA  1 
ATOM   5730 C C   . PRO B 1 308 ? 8.671   27.046 104.538 1.00 65.74  ? 1494 PRO B C   1 
ATOM   5731 O O   . PRO B 1 308 ? 8.241   28.010 103.904 1.00 64.12  ? 1494 PRO B O   1 
ATOM   5732 C CB  . PRO B 1 308 ? 7.579   26.326 106.664 1.00 61.99  ? 1494 PRO B CB  1 
ATOM   5733 C CG  . PRO B 1 308 ? 7.245   25.012 107.222 1.00 51.18  ? 1494 PRO B CG  1 
ATOM   5734 C CD  . PRO B 1 308 ? 8.015   24.027 106.359 1.00 68.42  ? 1494 PRO B CD  1 
ATOM   5735 N N   . LEU B 1 309 ? 9.970   26.785 104.702 1.00 69.74  ? 1495 LEU B N   1 
ATOM   5736 C CA  . LEU B 1 309 ? 10.980  27.662 104.119 1.00 70.86  ? 1495 LEU B CA  1 
ATOM   5737 C C   . LEU B 1 309 ? 10.899  27.658 102.590 1.00 78.60  ? 1495 LEU B C   1 
ATOM   5738 O O   . LEU B 1 309 ? 10.842  28.719 101.952 1.00 65.57  ? 1495 LEU B O   1 
ATOM   5739 C CB  . LEU B 1 309 ? 12.392  27.289 104.578 1.00 58.74  ? 1495 LEU B CB  1 
ATOM   5740 C CG  . LEU B 1 309 ? 13.488  28.225 104.070 1.00 65.53  ? 1495 LEU B CG  1 
ATOM   5741 C CD1 . LEU B 1 309 ? 13.271  29.615 104.605 1.00 69.96  ? 1495 LEU B CD1 1 
ATOM   5742 C CD2 . LEU B 1 309 ? 14.835  27.725 104.474 1.00 53.02  ? 1495 LEU B CD2 1 
ATOM   5743 N N   . GLU B 1 310 ? 10.877  26.451 102.023 1.00 79.75  ? 1496 GLU B N   1 
ATOM   5744 C CA  . GLU B 1 310 ? 10.870  26.245 100.584 1.00 52.59  ? 1496 GLU B CA  1 
ATOM   5745 C C   . GLU B 1 310 ? 9.622   26.848 100.010 1.00 62.99  ? 1496 GLU B C   1 
ATOM   5746 O O   . GLU B 1 310 ? 9.635   27.401 98.911  1.00 65.42  ? 1496 GLU B O   1 
ATOM   5747 C CB  . GLU B 1 310 ? 10.923  24.763 100.272 1.00 55.47  ? 1496 GLU B CB  1 
ATOM   5748 C CG  . GLU B 1 310 ? 12.283  24.157 100.509 1.00 61.77  ? 1496 GLU B CG  1 
ATOM   5749 C CD  . GLU B 1 310 ? 12.243  22.653 100.566 1.00 81.78  ? 1496 GLU B CD  1 
ATOM   5750 O OE1 . GLU B 1 310 ? 11.267  22.104 101.128 1.00 84.29  ? 1496 GLU B OE1 1 
ATOM   5751 O OE2 . GLU B 1 310 ? 13.194  22.023 100.057 1.00 82.67  ? 1496 GLU B OE2 1 
ATOM   5752 N N   . ASN B 1 311 ? 8.552   26.758 100.788 1.00 47.01  ? 1497 ASN B N   1 
ATOM   5753 C CA  . ASN B 1 311 ? 7.267   27.323 100.450 1.00 58.69  ? 1497 ASN B CA  1 
ATOM   5754 C C   . ASN B 1 311 ? 7.226   28.827 100.455 1.00 61.13  ? 1497 ASN B C   1 
ATOM   5755 O O   . ASN B 1 311 ? 6.638   29.462 99.595  1.00 52.13  ? 1497 ASN B O   1 
ATOM   5756 C CB  . ASN B 1 311 ? 6.269   26.866 101.462 1.00 52.95  ? 1497 ASN B CB  1 
ATOM   5757 C CG  . ASN B 1 311 ? 4.970   26.593 100.848 1.00 78.58  ? 1497 ASN B CG  1 
ATOM   5758 O OD1 . ASN B 1 311 ? 4.422   27.416 100.108 1.00 65.26  ? 1497 ASN B OD1 1 
ATOM   5759 N ND2 . ASN B 1 311 ? 4.457   25.398 101.104 1.00 100.44 ? 1497 ASN B ND2 1 
ATOM   5760 N N   . ALA B 1 312 ? 7.827   29.400 101.472 1.00 58.50  ? 1498 ALA B N   1 
ATOM   5761 C CA  . ALA B 1 312 ? 7.959   30.834 101.538 1.00 63.47  ? 1498 ALA B CA  1 
ATOM   5762 C C   . ALA B 1 312 ? 8.653   31.311 100.272 1.00 67.54  ? 1498 ALA B C   1 
ATOM   5763 O O   . ALA B 1 312 ? 8.256   32.313 99.687  1.00 59.86  ? 1498 ALA B O   1 
ATOM   5764 C CB  . ALA B 1 312 ? 8.766   31.223 102.754 1.00 60.64  ? 1498 ALA B CB  1 
ATOM   5765 N N   . ILE B 1 313 ? 9.676   30.576 99.844  1.00 59.89  ? 1499 ILE B N   1 
ATOM   5766 C CA  . ILE B 1 313 ? 10.460  30.981 98.685  1.00 66.02  ? 1499 ILE B CA  1 
ATOM   5767 C C   . ILE B 1 313 ? 9.660   30.994 97.387  1.00 64.98  ? 1499 ILE B C   1 
ATOM   5768 O O   . ILE B 1 313 ? 9.741   31.947 96.608  1.00 54.74  ? 1499 ILE B O   1 
ATOM   5769 C CB  . ILE B 1 313 ? 11.710  30.118 98.516  1.00 66.53  ? 1499 ILE B CB  1 
ATOM   5770 C CG1 . ILE B 1 313 ? 12.616  30.288 99.745  1.00 54.01  ? 1499 ILE B CG1 1 
ATOM   5771 C CG2 . ILE B 1 313 ? 12.431  30.485 97.221  1.00 65.80  ? 1499 ILE B CG2 1 
ATOM   5772 C CD1 . ILE B 1 313 ? 14.060  29.897 99.522  1.00 61.56  ? 1499 ILE B CD1 1 
ATOM   5773 N N   . GLU B 1 314 ? 8.860   29.965 97.170  1.00 56.22  ? 1500 GLU B N   1 
ATOM   5774 C CA  . GLU B 1 314 ? 8.030   29.909 95.996  1.00 58.20  ? 1500 GLU B CA  1 
ATOM   5775 C C   . GLU B 1 314 ? 7.084   31.063 96.056  1.00 62.43  ? 1500 GLU B C   1 
ATOM   5776 O O   . GLU B 1 314 ? 6.845   31.732 95.085  1.00 60.07  ? 1500 GLU B O   1 
ATOM   5777 C CB  . GLU B 1 314 ? 7.189   28.658 96.027  1.00 49.52  ? 1500 GLU B CB  1 
ATOM   5778 C CG  . GLU B 1 314 ? 7.918   27.405 95.752  1.00 61.65  ? 1500 GLU B CG  1 
ATOM   5779 C CD  . GLU B 1 314 ? 7.031   26.212 95.899  1.00 80.12  ? 1500 GLU B CD  1 
ATOM   5780 O OE1 . GLU B 1 314 ? 5.964   26.349 96.517  1.00 81.59  ? 1500 GLU B OE1 1 
ATOM   5781 O OE2 . GLU B 1 314 ? 7.395   25.137 95.403  1.00 84.70  ? 1500 GLU B OE2 1 
ATOM   5782 N N   . THR B 1 315 ? 6.555   31.302 97.235  1.00 43.76  ? 1501 THR B N   1 
ATOM   5783 C CA  . THR B 1 315 ? 5.592   32.354 97.432  1.00 42.95  ? 1501 THR B CA  1 
ATOM   5784 C C   . THR B 1 315 ? 6.194   33.693 97.101  1.00 51.05  ? 1501 THR B C   1 
ATOM   5785 O O   . THR B 1 315 ? 5.567   34.512 96.489  1.00 52.89  ? 1501 THR B O   1 
ATOM   5786 C CB  . THR B 1 315 ? 5.126   32.355 98.878  1.00 50.68  ? 1501 THR B CB  1 
ATOM   5787 O OG1 . THR B 1 315 ? 4.678   31.050 99.222  1.00 39.10  ? 1501 THR B OG1 1 
ATOM   5788 C CG2 . THR B 1 315 ? 4.004   33.301 99.072  1.00 33.90  ? 1501 THR B CG2 1 
ATOM   5789 N N   . MET B 1 316 ? 7.421   33.917 97.524  1.00 57.40  ? 1502 MET B N   1 
ATOM   5790 C CA  . MET B 1 316 ? 8.109   35.150 97.233  1.00 51.16  ? 1502 MET B CA  1 
ATOM   5791 C C   . MET B 1 316 ? 8.384   35.307 95.751  1.00 62.89  ? 1502 MET B C   1 
ATOM   5792 O O   . MET B 1 316 ? 8.255   36.378 95.207  1.00 47.90  ? 1502 MET B O   1 
ATOM   5793 C CB  . MET B 1 316 ? 9.403   35.203 98.023  1.00 57.64  ? 1502 MET B CB  1 
ATOM   5794 C CG  . MET B 1 316 ? 9.773   36.562 98.546  1.00 67.97  ? 1502 MET B CG  1 
ATOM   5795 S SD  . MET B 1 316 ? 8.590   37.235 99.687  1.00 61.70  ? 1502 MET B SD  1 
ATOM   5796 C CE  . MET B 1 316 ? 9.002   38.943 99.576  1.00 51.73  ? 1502 MET B CE  1 
ATOM   5797 N N   . SER B 1 317 ? 8.792   34.237 95.096  1.00 44.61  ? 1503 SER B N   1 
ATOM   5798 C CA  . SER B 1 317 ? 9.063   34.315 93.681  1.00 55.22  ? 1503 SER B CA  1 
ATOM   5799 C C   . SER B 1 317 ? 7.832   34.587 92.865  1.00 57.38  ? 1503 SER B C   1 
ATOM   5800 O O   . SER B 1 317 ? 7.831   35.428 91.995  1.00 43.63  ? 1503 SER B O   1 
ATOM   5801 C CB  . SER B 1 317 ? 9.699   33.032 93.212  1.00 36.05  ? 1503 SER B CB  1 
ATOM   5802 O OG  . SER B 1 317 ? 10.564  32.546 94.196  1.00 65.74  ? 1503 SER B OG  1 
ATOM   5803 N N   . THR B 1 318 ? 6.758   33.892 93.164  1.00 49.58  ? 1504 THR B N   1 
ATOM   5804 C CA  . THR B 1 318 ? 5.538   34.128 92.435  1.00 53.26  ? 1504 THR B CA  1 
ATOM   5805 C C   . THR B 1 318 ? 5.148   35.583 92.482  1.00 57.64  ? 1504 THR B C   1 
ATOM   5806 O O   . THR B 1 318 ? 4.764   36.151 91.462  1.00 59.81  ? 1504 THR B O   1 
ATOM   5807 C CB  . THR B 1 318 ? 4.447   33.299 92.985  1.00 60.08  ? 1504 THR B CB  1 
ATOM   5808 O OG1 . THR B 1 318 ? 4.819   31.949 92.766  1.00 55.77  ? 1504 THR B OG1 1 
ATOM   5809 C CG2 . THR B 1 318 ? 3.142   33.588 92.275  1.00 35.82  ? 1504 THR B CG2 1 
ATOM   5810 N N   . ALA B 1 319 ? 5.270   36.166 93.674  1.00 56.47  ? 1505 ALA B N   1 
ATOM   5811 C CA  . ALA B 1 319 ? 4.894   37.530 93.942  1.00 41.42  ? 1505 ALA B CA  1 
ATOM   5812 C C   . ALA B 1 319 ? 5.753   38.455 93.117  1.00 60.55  ? 1505 ALA B C   1 
ATOM   5813 O O   . ALA B 1 319 ? 5.254   39.376 92.479  1.00 60.17  ? 1505 ALA B O   1 
ATOM   5814 C CB  . ALA B 1 319 ? 5.065   37.827 95.376  1.00 44.73  ? 1505 ALA B CB  1 
ATOM   5815 N N   . ASN B 1 320 ? 7.049   38.206 93.092  1.00 55.83  ? 1506 ASN B N   1 
ATOM   5816 C CA  . ASN B 1 320 ? 7.910   39.037 92.269  1.00 60.94  ? 1506 ASN B CA  1 
ATOM   5817 C C   . ASN B 1 320 ? 7.675   38.842 90.769  1.00 56.71  ? 1506 ASN B C   1 
ATOM   5818 O O   . ASN B 1 320 ? 7.540   39.811 90.048  1.00 70.87  ? 1506 ASN B O   1 
ATOM   5819 C CB  . ASN B 1 320 ? 9.366   38.807 92.636  1.00 64.22  ? 1506 ASN B CB  1 
ATOM   5820 C CG  . ASN B 1 320 ? 9.666   39.152 94.084  1.00 61.13  ? 1506 ASN B CG  1 
ATOM   5821 O OD1 . ASN B 1 320 ? 10.728  38.812 94.590  1.00 52.89  ? 1506 ASN B OD1 1 
ATOM   5822 N ND2 . ASN B 1 320 ? 8.734   39.837 94.754  1.00 49.73  ? 1506 ASN B ND2 1 
ATOM   5823 N N   . GLU B 1 321 ? 7.595   37.598 90.308  1.00 43.10  ? 1507 GLU B N   1 
ATOM   5824 C CA  . GLU B 1 321 ? 7.211   37.323 88.919  1.00 57.32  ? 1507 GLU B CA  1 
ATOM   5825 C C   . GLU B 1 321 ? 5.951   38.063 88.492  1.00 62.15  ? 1507 GLU B C   1 
ATOM   5826 O O   . GLU B 1 321 ? 5.909   38.626 87.410  1.00 59.03  ? 1507 GLU B O   1 
ATOM   5827 C CB  . GLU B 1 321 ? 6.988   35.836 88.702  1.00 33.85  ? 1507 GLU B CB  1 
ATOM   5828 C CG  . GLU B 1 321 ? 8.244   35.055 88.521  1.00 71.59  ? 1507 GLU B CG  1 
ATOM   5829 C CD  . GLU B 1 321 ? 8.027   33.562 88.741  1.00 107.29 ? 1507 GLU B CD  1 
ATOM   5830 O OE1 . GLU B 1 321 ? 6.888   33.090 88.505  1.00 111.18 ? 1507 GLU B OE1 1 
ATOM   5831 O OE2 . GLU B 1 321 ? 8.984   32.856 89.153  1.00 107.80 ? 1507 GLU B OE2 1 
ATOM   5832 N N   . LYS B 1 322 ? 4.928   38.053 89.336  1.00 59.01  ? 1508 LYS B N   1 
ATOM   5833 C CA  . LYS B 1 322 ? 3.675   38.727 89.015  1.00 62.11  ? 1508 LYS B CA  1 
ATOM   5834 C C   . LYS B 1 322 ? 3.822   40.239 88.923  1.00 60.83  ? 1508 LYS B C   1 
ATOM   5835 O O   . LYS B 1 322 ? 3.241   40.875 88.045  1.00 56.30  ? 1508 LYS B O   1 
ATOM   5836 C CB  . LYS B 1 322 ? 2.586   38.358 90.023  1.00 42.99  ? 1508 LYS B CB  1 
ATOM   5837 C CG  . LYS B 1 322 ? 1.892   37.052 89.707  1.00 62.61  ? 1508 LYS B CG  1 
ATOM   5838 C CD  . LYS B 1 322 ? 0.572   36.916 90.441  1.00 72.94  ? 1508 LYS B CD  1 
ATOM   5839 C CE  . LYS B 1 322 ? 0.751   36.272 91.798  1.00 80.83  ? 1508 LYS B CE  1 
ATOM   5840 N NZ  . LYS B 1 322 ? -0.552  35.865 92.384  1.00 70.25  ? 1508 LYS B NZ  1 
ATOM   5841 N N   . ILE B 1 323 ? 4.579   40.819 89.845  1.00 52.83  ? 1509 ILE B N   1 
ATOM   5842 C CA  . ILE B 1 323 ? 4.776   42.258 89.834  1.00 61.96  ? 1509 ILE B CA  1 
ATOM   5843 C C   . ILE B 1 323 ? 5.532   42.689 88.590  1.00 73.33  ? 1509 ILE B C   1 
ATOM   5844 O O   . ILE B 1 323 ? 5.181   43.672 87.948  1.00 77.70  ? 1509 ILE B O   1 
ATOM   5845 C CB  . ILE B 1 323 ? 5.563   42.733 91.059  1.00 66.73  ? 1509 ILE B CB  1 
ATOM   5846 C CG1 . ILE B 1 323 ? 4.939   42.192 92.342  1.00 50.11  ? 1509 ILE B CG1 1 
ATOM   5847 C CG2 . ILE B 1 323 ? 5.614   44.246 91.095  1.00 48.10  ? 1509 ILE B CG2 1 
ATOM   5848 C CD1 . ILE B 1 323 ? 5.712   42.556 93.583  1.00 58.13  ? 1509 ILE B CD1 1 
ATOM   5849 N N   . LEU B 1 324 ? 6.575   41.942 88.253  1.00 73.47  ? 1510 LEU B N   1 
ATOM   5850 C CA  . LEU B 1 324 ? 7.380   42.251 87.083  1.00 61.93  ? 1510 LEU B CA  1 
ATOM   5851 C C   . LEU B 1 324 ? 6.567   42.107 85.810  1.00 61.28  ? 1510 LEU B C   1 
ATOM   5852 O O   . LEU B 1 324 ? 6.659   42.927 84.906  1.00 76.35  ? 1510 LEU B O   1 
ATOM   5853 C CB  . LEU B 1 324 ? 8.606   41.346 87.025  1.00 59.45  ? 1510 LEU B CB  1 
ATOM   5854 C CG  . LEU B 1 324 ? 9.780   41.901 86.225  1.00 56.27  ? 1510 LEU B CG  1 
ATOM   5855 C CD1 . LEU B 1 324 ? 10.799  40.815 85.967  1.00 53.32  ? 1510 LEU B CD1 1 
ATOM   5856 C CD2 . LEU B 1 324 ? 9.287   42.490 84.925  1.00 58.83  ? 1510 LEU B CD2 1 
ATOM   5857 N N   . MET B 1 325 ? 5.768   41.053 85.750  1.00 58.59  ? 1511 MET B N   1 
ATOM   5858 C CA  . MET B 1 325 ? 4.933   40.792 84.591  1.00 55.86  ? 1511 MET B CA  1 
ATOM   5859 C C   . MET B 1 325 ? 3.919   41.902 84.420  1.00 60.80  ? 1511 MET B C   1 
ATOM   5860 O O   . MET B 1 325 ? 3.615   42.314 83.308  1.00 76.92  ? 1511 MET B O   1 
ATOM   5861 C CB  . MET B 1 325 ? 4.224   39.448 84.728  1.00 54.39  ? 1511 MET B CB  1 
ATOM   5862 C CG  . MET B 1 325 ? 5.167   38.264 84.784  1.00 90.32  ? 1511 MET B CG  1 
ATOM   5863 S SD  . MET B 1 325 ? 4.318   36.683 84.663  1.00 130.34 ? 1511 MET B SD  1 
ATOM   5864 C CE  . MET B 1 325 ? 5.709   35.565 84.580  1.00 95.13  ? 1511 MET B CE  1 
ATOM   5865 N N   . MET B 1 326 ? 3.392   42.379 85.538  1.00 74.05  ? 1512 MET B N   1 
ATOM   5866 C CA  . MET B 1 326 ? 2.401   43.442 85.520  1.00 67.67  ? 1512 MET B CA  1 
ATOM   5867 C C   . MET B 1 326 ? 2.990   44.779 85.089  1.00 66.08  ? 1512 MET B C   1 
ATOM   5868 O O   . MET B 1 326 ? 2.383   45.500 84.304  1.00 73.47  ? 1512 MET B O   1 
ATOM   5869 C CB  . MET B 1 326 ? 1.700   43.560 86.871  1.00 67.54  ? 1512 MET B CB  1 
ATOM   5870 C CG  . MET B 1 326 ? 0.462   44.425 86.826  1.00 71.05  ? 1512 MET B CG  1 
ATOM   5871 S SD  . MET B 1 326 ? -0.905  43.708 87.733  1.00 72.99  ? 1512 MET B SD  1 
ATOM   5872 C CE  . MET B 1 326 ? -1.036  42.122 86.927  1.00 71.30  ? 1512 MET B CE  1 
ATOM   5873 N N   . ILE B 1 327 ? 4.171   45.111 85.597  1.00 59.61  ? 1513 ILE B N   1 
ATOM   5874 C CA  . ILE B 1 327 ? 4.811   46.365 85.233  1.00 69.20  ? 1513 ILE B CA  1 
ATOM   5875 C C   . ILE B 1 327 ? 5.137   46.343 83.752  1.00 67.97  ? 1513 ILE B C   1 
ATOM   5876 O O   . ILE B 1 327 ? 5.159   47.380 83.098  1.00 76.87  ? 1513 ILE B O   1 
ATOM   5877 C CB  . ILE B 1 327 ? 6.100   46.620 86.028  1.00 68.11  ? 1513 ILE B CB  1 
ATOM   5878 C CG1 . ILE B 1 327 ? 7.234   45.747 85.503  1.00 91.81  ? 1513 ILE B CG1 1 
ATOM   5879 C CG2 . ILE B 1 327 ? 5.879   46.373 87.505  1.00 69.22  ? 1513 ILE B CG2 1 
ATOM   5880 C CD1 . ILE B 1 327 ? 8.526   45.930 86.257  1.00 95.01  ? 1513 ILE B CD1 1 
ATOM   5881 N N   . ASN B 1 328 ? 5.389   45.154 83.221  1.00 63.36  ? 1514 ASN B N   1 
ATOM   5882 C CA  . ASN B 1 328 ? 5.702   45.031 81.806  1.00 76.82  ? 1514 ASN B CA  1 
ATOM   5883 C C   . ASN B 1 328 ? 4.463   45.180 80.932  1.00 79.29  ? 1514 ASN B C   1 
ATOM   5884 O O   . ASN B 1 328 ? 4.523   45.775 79.860  1.00 79.62  ? 1514 ASN B O   1 
ATOM   5885 C CB  . ASN B 1 328 ? 6.418   43.715 81.514  1.00 74.03  ? 1514 ASN B CB  1 
ATOM   5886 C CG  . ASN B 1 328 ? 7.907   43.804 81.752  1.00 81.45  ? 1514 ASN B CG  1 
ATOM   5887 O OD1 . ASN B 1 328 ? 8.499   44.873 81.630  1.00 75.43  ? 1514 ASN B OD1 1 
ATOM   5888 N ND2 . ASN B 1 328 ? 8.523   42.681 82.088  1.00 69.96  ? 1514 ASN B ND2 1 
ATOM   5889 N N   . GLN B 1 329 ? 3.338   44.644 81.393  1.00 75.53  ? 1515 GLN B N   1 
ATOM   5890 C CA  . GLN B 1 329 ? 2.097   44.742 80.634  1.00 62.77  ? 1515 GLN B CA  1 
ATOM   5891 C C   . GLN B 1 329 ? 1.679   46.199 80.551  1.00 77.08  ? 1515 GLN B C   1 
ATOM   5892 O O   . GLN B 1 329 ? 1.151   46.656 79.541  1.00 65.51  ? 1515 GLN B O   1 
ATOM   5893 C CB  . GLN B 1 329 ? 0.982   43.960 81.321  1.00 66.88  ? 1515 GLN B CB  1 
ATOM   5894 C CG  . GLN B 1 329 ? 1.372   42.592 81.828  1.00 94.01  ? 1515 GLN B CG  1 
ATOM   5895 C CD  . GLN B 1 329 ? 0.283   41.971 82.677  1.00 110.26 ? 1515 GLN B CD  1 
ATOM   5896 O OE1 . GLN B 1 329 ? -0.832  42.485 82.744  1.00 94.20  ? 1515 GLN B OE1 1 
ATOM   5897 N NE2 . GLN B 1 329 ? 0.600   40.863 83.333  1.00 109.27 ? 1515 GLN B NE2 1 
ATOM   5898 N N   . TYR B 1 330 ? 1.921   46.917 81.639  1.00 70.95  ? 1516 TYR B N   1 
ATOM   5899 C CA  . TYR B 1 330 ? 1.582   48.329 81.753  1.00 75.89  ? 1516 TYR B CA  1 
ATOM   5900 C C   . TYR B 1 330 ? 2.553   49.275 81.058  1.00 90.75  ? 1516 TYR B C   1 
ATOM   5901 O O   . TYR B 1 330 ? 2.162   50.345 80.603  1.00 96.10  ? 1516 TYR B O   1 
ATOM   5902 C CB  . TYR B 1 330 ? 1.361   48.712 83.214  1.00 68.22  ? 1516 TYR B CB  1 
ATOM   5903 C CG  . TYR B 1 330 ? 0.039   48.219 83.740  1.00 60.58  ? 1516 TYR B CG  1 
ATOM   5904 C CD1 . TYR B 1 330 ? -0.074  46.973 84.317  1.00 54.88  ? 1516 TYR B CD1 1 
ATOM   5905 C CD2 . TYR B 1 330 ? -1.101  48.992 83.639  1.00 42.02  ? 1516 TYR B CD2 1 
ATOM   5906 C CE1 . TYR B 1 330 ? -1.281  46.518 84.786  1.00 50.66  ? 1516 TYR B CE1 1 
ATOM   5907 C CE2 . TYR B 1 330 ? -2.307  48.544 84.104  1.00 46.84  ? 1516 TYR B CE2 1 
ATOM   5908 C CZ  . TYR B 1 330 ? -2.391  47.307 84.678  1.00 63.07  ? 1516 TYR B CZ  1 
ATOM   5909 O OH  . TYR B 1 330 ? -3.591  46.849 85.148  1.00 57.59  ? 1516 TYR B OH  1 
ATOM   5910 N N   . GLN B 1 331 ? 3.816   48.889 80.961  1.00 91.83  ? 1517 GLN B N   1 
ATOM   5911 C CA  . GLN B 1 331 ? 4.770   49.734 80.274  1.00 88.52  ? 1517 GLN B CA  1 
ATOM   5912 C C   . GLN B 1 331 ? 4.412   49.715 78.802  1.00 106.14 ? 1517 GLN B C   1 
ATOM   5913 O O   . GLN B 1 331 ? 4.633   50.682 78.085  1.00 110.26 ? 1517 GLN B O   1 
ATOM   5914 C CB  . GLN B 1 331 ? 6.191   49.223 80.456  1.00 72.96  ? 1517 GLN B CB  1 
ATOM   5915 C CG  . GLN B 1 331 ? 6.620   49.077 81.888  1.00 82.28  ? 1517 GLN B CG  1 
ATOM   5916 C CD  . GLN B 1 331 ? 8.103   49.295 82.064  1.00 90.82  ? 1517 GLN B CD  1 
ATOM   5917 O OE1 . GLN B 1 331 ? 8.530   50.330 82.564  1.00 81.11  ? 1517 GLN B OE1 1 
ATOM   5918 N NE2 . GLN B 1 331 ? 8.898   48.315 81.662  1.00 76.73  ? 1517 GLN B NE2 1 
ATOM   5919 N N   . SER B 1 332 ? 3.853   48.596 78.359  1.00 100.37 ? 1518 SER B N   1 
ATOM   5920 C CA  . SER B 1 332 ? 3.461   48.419 76.973  1.00 70.73  ? 1518 SER B CA  1 
ATOM   5921 C C   . SER B 1 332 ? 2.176   49.151 76.671  1.00 99.44  ? 1518 SER B C   1 
ATOM   5922 O O   . SER B 1 332 ? 2.183   50.197 76.035  1.00 127.26 ? 1518 SER B O   1 
ATOM   5923 C CB  . SER B 1 332 ? 3.260   46.943 76.672  1.00 67.94  ? 1518 SER B CB  1 
ATOM   5924 O OG  . SER B 1 332 ? 4.322   46.180 77.199  1.00 89.25  ? 1518 SER B OG  1 
ATOM   5925 N N   . ASP B 1 333 ? 1.068   48.585 77.128  1.00 101.75 ? 1519 ASP B N   1 
ATOM   5926 C CA  . ASP B 1 333 ? -0.240  49.168 76.889  1.00 85.07  ? 1519 ASP B CA  1 
ATOM   5927 C C   . ASP B 1 333 ? -0.632  50.191 77.941  1.00 86.93  ? 1519 ASP B C   1 
ATOM   5928 O O   . ASP B 1 333 ? -0.335  50.032 79.116  1.00 102.05 ? 1519 ASP B O   1 
ATOM   5929 C CB  . ASP B 1 333 ? -1.291  48.070 76.809  1.00 71.73  ? 1519 ASP B CB  1 
ATOM   5930 C CG  . ASP B 1 333 ? -2.635  48.599 76.419  1.00 83.21  ? 1519 ASP B CG  1 
ATOM   5931 O OD1 . ASP B 1 333 ? -2.813  49.823 76.506  1.00 89.28  ? 1519 ASP B OD1 1 
ATOM   5932 O OD2 . ASP B 1 333 ? -3.508  47.801 76.032  1.00 69.75  ? 1519 ASP B OD2 1 
ATOM   5933 N N   . GLU B 1 334 ? -1.305  51.244 77.503  1.00 70.66  ? 1520 GLU B N   1 
ATOM   5934 C CA  . GLU B 1 334 ? -1.747  52.302 78.393  1.00 76.93  ? 1520 GLU B CA  1 
ATOM   5935 C C   . GLU B 1 334 ? -3.264  52.417 78.359  1.00 78.35  ? 1520 GLU B C   1 
ATOM   5936 O O   . GLU B 1 334 ? -3.842  53.337 78.914  1.00 81.98  ? 1520 GLU B O   1 
ATOM   5937 C CB  . GLU B 1 334 ? -1.077  53.620 78.018  1.00 90.82  ? 1520 GLU B CB  1 
ATOM   5938 C CG  . GLU B 1 334 ? 0.413   53.467 77.759  1.00 111.53 ? 1520 GLU B CG  1 
ATOM   5939 C CD  . GLU B 1 334 ? 1.157   54.784 77.767  1.00 115.50 ? 1520 GLU B CD  1 
ATOM   5940 O OE1 . GLU B 1 334 ? 0.530   55.820 78.058  1.00 106.75 ? 1520 GLU B OE1 1 
ATOM   5941 O OE2 . GLU B 1 334 ? 2.371   54.782 77.489  1.00 107.71 ? 1520 GLU B OE2 1 
ATOM   5942 N N   . THR B 1 335 ? -3.900  51.457 77.704  1.00 80.24  ? 1521 THR B N   1 
ATOM   5943 C CA  . THR B 1 335 ? -5.346  51.408 77.621  1.00 91.29  ? 1521 THR B CA  1 
ATOM   5944 C C   . THR B 1 335 ? -5.824  50.420 78.657  1.00 93.00  ? 1521 THR B C   1 
ATOM   5945 O O   . THR B 1 335 ? -7.001  50.082 78.715  1.00 97.54  ? 1521 THR B O   1 
ATOM   5946 C CB  . THR B 1 335 ? -5.821  50.889 76.266  1.00 89.57  ? 1521 THR B CB  1 
ATOM   5947 O OG1 . THR B 1 335 ? -7.187  50.480 76.378  1.00 109.59 ? 1521 THR B OG1 1 
ATOM   5948 C CG2 . THR B 1 335 ? -5.008  49.687 75.845  1.00 64.92  ? 1521 THR B CG2 1 
ATOM   5949 N N   . LEU B 1 336 ? -4.887  49.952 79.469  1.00 80.39  ? 1522 LEU B N   1 
ATOM   5950 C CA  . LEU B 1 336 ? -5.175  48.976 80.500  1.00 80.60  ? 1522 LEU B CA  1 
ATOM   5951 C C   . LEU B 1 336 ? -5.740  49.620 81.744  1.00 83.15  ? 1522 LEU B C   1 
ATOM   5952 O O   . LEU B 1 336 ? -5.175  50.572 82.263  1.00 69.87  ? 1522 LEU B O   1 
ATOM   5953 C CB  . LEU B 1 336 ? -3.907  48.214 80.867  1.00 67.05  ? 1522 LEU B CB  1 
ATOM   5954 C CG  . LEU B 1 336 ? -3.436  47.145 79.895  1.00 66.68  ? 1522 LEU B CG  1 
ATOM   5955 C CD1 . LEU B 1 336 ? -2.200  46.482 80.424  1.00 61.67  ? 1522 LEU B CD1 1 
ATOM   5956 C CD2 . LEU B 1 336 ? -4.523  46.134 79.682  1.00 59.17  ? 1522 LEU B CD2 1 
ATOM   5957 N N   . PRO B 1 337 ? -6.855  49.087 82.222  1.00 81.68  ? 1523 PRO B N   1 
ATOM   5958 C CA  . PRO B 1 337 ? -7.486  49.602 83.432  1.00 97.02  ? 1523 PRO B CA  1 
ATOM   5959 C C   . PRO B 1 337 ? -6.483  49.498 84.552  1.00 95.64  ? 1523 PRO B C   1 
ATOM   5960 O O   . PRO B 1 337 ? -5.702  48.557 84.557  1.00 91.74  ? 1523 PRO B O   1 
ATOM   5961 C CB  . PRO B 1 337 ? -8.628  48.617 83.672  1.00 81.16  ? 1523 PRO B CB  1 
ATOM   5962 C CG  . PRO B 1 337 ? -8.896  48.021 82.359  1.00 81.61  ? 1523 PRO B CG  1 
ATOM   5963 C CD  . PRO B 1 337 ? -7.575  47.923 81.689  1.00 69.74  ? 1523 PRO B CD  1 
ATOM   5964 N N   . ILE B 1 338 ? -6.485  50.436 85.485  1.00 68.75  ? 1524 ILE B N   1 
ATOM   5965 C CA  . ILE B 1 338 ? -5.519  50.364 86.567  1.00 66.60  ? 1524 ILE B CA  1 
ATOM   5966 C C   . ILE B 1 338 ? -5.973  49.547 87.758  1.00 61.66  ? 1524 ILE B C   1 
ATOM   5967 O O   . ILE B 1 338 ? -5.140  49.015 88.487  1.00 72.87  ? 1524 ILE B O   1 
ATOM   5968 C CB  . ILE B 1 338 ? -5.012  51.750 86.977  1.00 72.10  ? 1524 ILE B CB  1 
ATOM   5969 C CG1 . ILE B 1 338 ? -5.976  52.472 87.942  1.00 81.17  ? 1524 ILE B CG1 1 
ATOM   5970 C CG2 . ILE B 1 338 ? -4.694  52.550 85.724  1.00 59.17  ? 1524 ILE B CG2 1 
ATOM   5971 C CD1 . ILE B 1 338 ? -7.393  52.830 87.373  1.00 159.17 ? 1524 ILE B CD1 1 
ATOM   5972 N N   . ASN B 1 339 ? -7.279  49.402 87.946  1.00 54.74  ? 1525 ASN B N   1 
ATOM   5973 C CA  . ASN B 1 339 ? -7.752  48.593 89.074  1.00 65.04  ? 1525 ASN B CA  1 
ATOM   5974 C C   . ASN B 1 339 ? -6.923  47.318 89.346  1.00 61.74  ? 1525 ASN B C   1 
ATOM   5975 O O   . ASN B 1 339 ? -6.483  47.113 90.464  1.00 69.40  ? 1525 ASN B O   1 
ATOM   5976 C CB  . ASN B 1 339 ? -9.265  48.349 89.011  1.00 61.37  ? 1525 ASN B CB  1 
ATOM   5977 C CG  . ASN B 1 339 ? -10.068 49.592 89.414  1.00 80.39  ? 1525 ASN B CG  1 
ATOM   5978 O OD1 . ASN B 1 339 ? -9.533  50.534 90.007  1.00 73.98  ? 1525 ASN B OD1 1 
ATOM   5979 N ND2 . ASN B 1 339 ? -11.354 49.589 89.108  1.00 71.38  ? 1525 ASN B ND2 1 
ATOM   5980 N N   . PRO B 1 340 ? -6.666  46.484 88.321  1.00 62.12  ? 1526 PRO B N   1 
ATOM   5981 C CA  . PRO B 1 340 ? -5.875  45.273 88.557  1.00 65.91  ? 1526 PRO B CA  1 
ATOM   5982 C C   . PRO B 1 340 ? -4.463  45.505 89.055  1.00 69.43  ? 1526 PRO B C   1 
ATOM   5983 O O   . PRO B 1 340 ? -3.844  44.597 89.618  1.00 64.76  ? 1526 PRO B O   1 
ATOM   5984 C CB  . PRO B 1 340 ? -5.819  44.641 87.174  1.00 51.89  ? 1526 PRO B CB  1 
ATOM   5985 C CG  . PRO B 1 340 ? -7.138  44.997 86.592  1.00 47.47  ? 1526 PRO B CG  1 
ATOM   5986 C CD  . PRO B 1 340 ? -7.339  46.417 87.008  1.00 58.98  ? 1526 PRO B CD  1 
ATOM   5987 N N   . LEU B 1 341 ? -3.957  46.707 88.823  1.00 71.80  ? 1527 LEU B N   1 
ATOM   5988 C CA  . LEU B 1 341 ? -2.618  47.063 89.251  1.00 69.43  ? 1527 LEU B CA  1 
ATOM   5989 C C   . LEU B 1 341 ? -2.641  47.550 90.704  1.00 67.48  ? 1527 LEU B C   1 
ATOM   5990 O O   . LEU B 1 341 ? -1.859  47.075 91.545  1.00 69.57  ? 1527 LEU B O   1 
ATOM   5991 C CB  . LEU B 1 341 ? -2.027  48.120 88.327  1.00 64.81  ? 1527 LEU B CB  1 
ATOM   5992 C CG  . LEU B 1 341 ? -0.604  48.568 88.687  1.00 65.73  ? 1527 LEU B CG  1 
ATOM   5993 C CD1 . LEU B 1 341 ? 0.470   47.476 88.675  1.00 36.89  ? 1527 LEU B CD1 1 
ATOM   5994 C CD2 . LEU B 1 341 ? -0.217  49.684 87.767  1.00 51.32  ? 1527 LEU B CD2 1 
ATOM   5995 N N   . SER B 1 342 ? -3.537  48.491 90.992  1.00 52.85  ? 1528 SER B N   1 
ATOM   5996 C CA  . SER B 1 342 ? -3.734  48.970 92.340  1.00 48.25  ? 1528 SER B CA  1 
ATOM   5997 C C   . SER B 1 342 ? -3.813  47.755 93.254  1.00 55.24  ? 1528 SER B C   1 
ATOM   5998 O O   . SER B 1 342 ? -3.023  47.599 94.182  1.00 54.00  ? 1528 SER B O   1 
ATOM   5999 C CB  . SER B 1 342 ? -5.046  49.755 92.416  1.00 53.14  ? 1528 SER B CB  1 
ATOM   6000 O OG  . SER B 1 342 ? -5.178  50.698 91.371  1.00 52.33  ? 1528 SER B OG  1 
ATOM   6001 N N   . MET B 1 343 ? -4.764  46.880 92.947  1.00 46.03  ? 1529 MET B N   1 
ATOM   6002 C CA  . MET B 1 343 ? -5.044  45.726 93.758  1.00 52.64  ? 1529 MET B CA  1 
ATOM   6003 C C   . MET B 1 343 ? -3.792  44.931 94.085  1.00 52.12  ? 1529 MET B C   1 
ATOM   6004 O O   . MET B 1 343 ? -3.561  44.581 95.223  1.00 59.08  ? 1529 MET B O   1 
ATOM   6005 C CB  . MET B 1 343 ? -6.051  44.829 93.076  1.00 45.97  ? 1529 MET B CB  1 
ATOM   6006 C CG  . MET B 1 343 ? -6.841  44.069 94.068  1.00 49.89  ? 1529 MET B CG  1 
ATOM   6007 S SD  . MET B 1 343 ? -7.721  42.684 93.398  1.00 52.79  ? 1529 MET B SD  1 
ATOM   6008 C CE  . MET B 1 343 ? -6.305  41.648 93.155  1.00 46.68  ? 1529 MET B CE  1 
ATOM   6009 N N   . LEU B 1 344 ? -2.971  44.655 93.086  1.00 59.14  ? 1530 LEU B N   1 
ATOM   6010 C CA  . LEU B 1 344 ? -1.867  43.758 93.282  1.00 53.87  ? 1530 LEU B CA  1 
ATOM   6011 C C   . LEU B 1 344 ? -0.837  44.437 94.142  1.00 48.19  ? 1530 LEU B C   1 
ATOM   6012 O O   . LEU B 1 344 ? -0.328  43.837 95.077  1.00 59.11  ? 1530 LEU B O   1 
ATOM   6013 C CB  . LEU B 1 344 ? -1.250  43.378 91.951  1.00 51.08  ? 1530 LEU B CB  1 
ATOM   6014 C CG  . LEU B 1 344 ? 0.005   42.524 92.123  1.00 63.64  ? 1530 LEU B CG  1 
ATOM   6015 C CD1 . LEU B 1 344 ? -0.303  41.060 91.867  1.00 55.25  ? 1530 LEU B CD1 1 
ATOM   6016 C CD2 . LEU B 1 344 ? 1.138   43.018 91.212  1.00 77.53  ? 1530 LEU B CD2 1 
ATOM   6017 N N   . LEU B 1 345 ? -0.536  45.689 93.819  1.00 50.25  ? 1531 LEU B N   1 
ATOM   6018 C CA  . LEU B 1 345 ? 0.516   46.411 94.499  1.00 43.61  ? 1531 LEU B CA  1 
ATOM   6019 C C   . LEU B 1 345 ? 0.164   46.607 95.956  1.00 65.61  ? 1531 LEU B C   1 
ATOM   6020 O O   . LEU B 1 345 ? 0.965   46.302 96.849  1.00 59.63  ? 1531 LEU B O   1 
ATOM   6021 C CB  . LEU B 1 345 ? 0.710   47.765 93.850  1.00 52.50  ? 1531 LEU B CB  1 
ATOM   6022 C CG  . LEU B 1 345 ? 1.193   47.777 92.415  1.00 62.49  ? 1531 LEU B CG  1 
ATOM   6023 C CD1 . LEU B 1 345 ? 1.218   49.210 91.937  1.00 62.23  ? 1531 LEU B CD1 1 
ATOM   6024 C CD2 . LEU B 1 345 ? 2.571   47.153 92.325  1.00 52.74  ? 1531 LEU B CD2 1 
ATOM   6025 N N   . ASN B 1 346 ? -1.046  47.106 96.188  1.00 55.73  ? 1532 ASN B N   1 
ATOM   6026 C CA  . ASN B 1 346 ? -1.480  47.382 97.537  1.00 77.56  ? 1532 ASN B CA  1 
ATOM   6027 C C   . ASN B 1 346 ? -1.454  46.147 98.434  1.00 69.42  ? 1532 ASN B C   1 
ATOM   6028 O O   . ASN B 1 346 ? -0.912  46.198 99.528  1.00 77.87  ? 1532 ASN B O   1 
ATOM   6029 C CB  . ASN B 1 346 ? -2.865  48.038 97.558  1.00 93.34  ? 1532 ASN B CB  1 
ATOM   6030 C CG  . ASN B 1 346 ? -3.225  48.601 98.934  1.00 88.33  ? 1532 ASN B CG  1 
ATOM   6031 O OD1 . ASN B 1 346 ? -2.515  49.448 99.493  1.00 78.15  ? 1532 ASN B OD1 1 
ATOM   6032 N ND2 . ASN B 1 346 ? -4.336  48.127 99.480  1.00 74.59  ? 1532 ASN B ND2 1 
ATOM   6033 N N   . GLY B 1 347 ? -2.032  45.047 97.971  1.00 60.54  ? 1533 GLY B N   1 
ATOM   6034 C CA  . GLY B 1 347 ? -2.012  43.804 98.707  1.00 55.07  ? 1533 GLY B CA  1 
ATOM   6035 C C   . GLY B 1 347 ? -0.627  43.275 99.021  1.00 58.85  ? 1533 GLY B C   1 
ATOM   6036 O O   . GLY B 1 347 ? -0.474  42.404 99.878  1.00 67.99  ? 1533 GLY B O   1 
ATOM   6037 N N   . ILE B 1 348 ? 0.396   43.776 98.343  1.00 53.76  ? 1534 ILE B N   1 
ATOM   6038 C CA  . ILE B 1 348 ? 1.754   43.341 98.651  1.00 64.78  ? 1534 ILE B CA  1 
ATOM   6039 C C   . ILE B 1 348 ? 2.475   44.403 99.465  1.00 62.53  ? 1534 ILE B C   1 
ATOM   6040 O O   . ILE B 1 348 ? 3.362   44.106 100.266 1.00 61.03  ? 1534 ILE B O   1 
ATOM   6041 C CB  . ILE B 1 348 ? 2.563   42.997 97.372  1.00 63.53  ? 1534 ILE B CB  1 
ATOM   6042 C CG1 . ILE B 1 348 ? 2.131   41.646 96.809  1.00 57.84  ? 1534 ILE B CG1 1 
ATOM   6043 C CG2 . ILE B 1 348 ? 4.054   42.936 97.650  1.00 55.04  ? 1534 ILE B CG2 1 
ATOM   6044 C CD1 . ILE B 1 348 ? 2.627   41.382 95.370  1.00 67.18  ? 1534 ILE B CD1 1 
ATOM   6045 N N   . VAL B 1 349 ? 2.099   45.647 99.245  1.00 58.49  ? 1535 VAL B N   1 
ATOM   6046 C CA  . VAL B 1 349 ? 2.734   46.741 99.954  1.00 64.60  ? 1535 VAL B CA  1 
ATOM   6047 C C   . VAL B 1 349 ? 2.196   46.853 101.394 1.00 67.55  ? 1535 VAL B C   1 
ATOM   6048 O O   . VAL B 1 349 ? 2.955   47.088 102.346 1.00 62.46  ? 1535 VAL B O   1 
ATOM   6049 C CB  . VAL B 1 349 ? 2.590   48.062 99.154  1.00 66.86  ? 1535 VAL B CB  1 
ATOM   6050 C CG1 . VAL B 1 349 ? 2.491   49.283 100.068 1.00 77.60  ? 1535 VAL B CG1 1 
ATOM   6051 C CG2 . VAL B 1 349 ? 3.755   48.216 98.216  1.00 61.28  ? 1535 VAL B CG2 1 
ATOM   6052 N N   . ASP B 1 350 ? 0.889   46.661 101.538 1.00 66.75  ? 1536 ASP B N   1 
ATOM   6053 C CA  . ASP B 1 350 ? 0.244   46.783 102.816 1.00 62.08  ? 1536 ASP B CA  1 
ATOM   6054 C C   . ASP B 1 350 ? -0.671  45.585 102.980 1.00 51.05  ? 1536 ASP B C   1 
ATOM   6055 O O   . ASP B 1 350 ? -1.890  45.695 102.789 1.00 54.33  ? 1536 ASP B O   1 
ATOM   6056 C CB  . ASP B 1 350 ? -0.495  48.138 102.934 1.00 72.64  ? 1536 ASP B CB  1 
ATOM   6057 C CG  . ASP B 1 350 ? -1.108  48.364 104.326 1.00 82.34  ? 1536 ASP B CG  1 
ATOM   6058 O OD1 . ASP B 1 350 ? -0.584  47.753 105.282 1.00 86.11  ? 1536 ASP B OD1 1 
ATOM   6059 O OD2 . ASP B 1 350 ? -2.105  49.129 104.478 1.00 83.34  ? 1536 ASP B OD2 1 
ATOM   6060 N N   . PRO B 1 351 ? -0.077  44.430 103.317 1.00 41.68  ? 1537 PRO B N   1 
ATOM   6061 C CA  . PRO B 1 351 ? -0.822  43.209 103.597 1.00 52.94  ? 1537 PRO B CA  1 
ATOM   6062 C C   . PRO B 1 351 ? -1.406  43.186 105.015 1.00 55.97  ? 1537 PRO B C   1 
ATOM   6063 O O   . PRO B 1 351 ? -0.927  42.449 105.866 1.00 58.76  ? 1537 PRO B O   1 
ATOM   6064 C CB  . PRO B 1 351 ? 0.230   42.112 103.438 1.00 51.80  ? 1537 PRO B CB  1 
ATOM   6065 C CG  . PRO B 1 351 ? 1.517   42.781 103.772 1.00 54.01  ? 1537 PRO B CG  1 
ATOM   6066 C CD  . PRO B 1 351 ? 1.370   44.254 103.517 1.00 47.28  ? 1537 PRO B CD  1 
ATOM   6067 N N   . ALA B 1 352 ? -2.442  43.981 105.244 1.00 49.91  ? 1538 ALA B N   1 
ATOM   6068 C CA  . ALA B 1 352 ? -3.068  44.086 106.536 1.00 53.99  ? 1538 ALA B CA  1 
ATOM   6069 C C   . ALA B 1 352 ? -3.655  42.764 107.042 1.00 57.38  ? 1538 ALA B C   1 
ATOM   6070 O O   . ALA B 1 352 ? -3.480  42.413 108.211 1.00 64.05  ? 1538 ALA B O   1 
ATOM   6071 C CB  . ALA B 1 352 ? -4.145  45.199 106.520 1.00 36.28  ? 1538 ALA B CB  1 
ATOM   6072 N N   . VAL B 1 353 ? -4.343  42.033 106.172 1.00 45.32  ? 1539 VAL B N   1 
ATOM   6073 C CA  . VAL B 1 353 ? -5.132  40.901 106.599 1.00 39.36  ? 1539 VAL B CA  1 
ATOM   6074 C C   . VAL B 1 353 ? -4.211  39.698 106.820 1.00 45.05  ? 1539 VAL B C   1 
ATOM   6075 O O   . VAL B 1 353 ? -4.170  39.088 107.884 1.00 57.08  ? 1539 VAL B O   1 
ATOM   6076 C CB  . VAL B 1 353 ? -6.235  40.620 105.560 1.00 35.51  ? 1539 VAL B CB  1 
ATOM   6077 C CG1 . VAL B 1 353 ? -6.894  39.262 105.768 1.00 35.62  ? 1539 VAL B CG1 1 
ATOM   6078 C CG2 . VAL B 1 353 ? -7.248  41.741 105.551 1.00 40.84  ? 1539 VAL B CG2 1 
ATOM   6079 N N   . MET B 1 354 ? -3.456  39.348 105.801 1.00 71.48  ? 1540 MET B N   1 
ATOM   6080 C CA  . MET B 1 354 ? -2.525  38.247 105.941 1.00 58.35  ? 1540 MET B CA  1 
ATOM   6081 C C   . MET B 1 354 ? -1.264  38.882 106.436 1.00 62.47  ? 1540 MET B C   1 
ATOM   6082 O O   . MET B 1 354 ? -1.181  40.111 106.519 1.00 77.98  ? 1540 MET B O   1 
ATOM   6083 C CB  . MET B 1 354 ? -2.290  37.551 104.609 1.00 69.25  ? 1540 MET B CB  1 
ATOM   6084 C CG  . MET B 1 354 ? -3.516  36.857 104.037 1.00 55.52  ? 1540 MET B CG  1 
ATOM   6085 S SD  . MET B 1 354 ? -4.346  35.809 105.261 1.00 69.16  ? 1540 MET B SD  1 
ATOM   6086 C CE  . MET B 1 354 ? -3.125  34.523 105.551 1.00 43.07  ? 1540 MET B CE  1 
ATOM   6087 N N   . GLY B 1 355 ? -0.264  38.082 106.775 1.00 60.72  ? 1541 GLY B N   1 
ATOM   6088 C CA  . GLY B 1 355 ? 0.919   38.664 107.422 1.00 72.84  ? 1541 GLY B CA  1 
ATOM   6089 C C   . GLY B 1 355 ? 1.685   39.749 106.678 1.00 62.02  ? 1541 GLY B C   1 
ATOM   6090 O O   . GLY B 1 355 ? 1.808   40.864 107.152 1.00 75.59  ? 1541 GLY B O   1 
ATOM   6091 N N   . GLY B 1 356 ? 2.189   39.415 105.498 1.00 59.19  ? 1542 GLY B N   1 
ATOM   6092 C CA  . GLY B 1 356 ? 3.350   40.090 104.937 1.00 50.74  ? 1542 GLY B CA  1 
ATOM   6093 C C   . GLY B 1 356 ? 4.492   39.127 105.214 1.00 65.65  ? 1542 GLY B C   1 
ATOM   6094 O O   . GLY B 1 356 ? 4.301   38.111 105.894 1.00 59.57  ? 1542 GLY B O   1 
ATOM   6095 N N   . PHE B 1 357 ? 5.678   39.425 104.690 1.00 63.15  ? 1543 PHE B N   1 
ATOM   6096 C CA  . PHE B 1 357 ? 6.862   38.572 104.894 1.00 74.37  ? 1543 PHE B CA  1 
ATOM   6097 C C   . PHE B 1 357 ? 7.520   38.719 106.265 1.00 81.73  ? 1543 PHE B C   1 
ATOM   6098 O O   . PHE B 1 357 ? 8.458   38.007 106.592 1.00 64.96  ? 1543 PHE B O   1 
ATOM   6099 C CB  . PHE B 1 357 ? 7.908   38.818 103.816 1.00 60.31  ? 1543 PHE B CB  1 
ATOM   6100 C CG  . PHE B 1 357 ? 8.397   40.236 103.748 1.00 89.34  ? 1543 PHE B CG  1 
ATOM   6101 C CD1 . PHE B 1 357 ? 9.465   40.636 104.530 1.00 102.70 ? 1543 PHE B CD1 1 
ATOM   6102 C CD2 . PHE B 1 357 ? 7.818   41.165 102.883 1.00 95.50  ? 1543 PHE B CD2 1 
ATOM   6103 C CE1 . PHE B 1 357 ? 9.928   41.932 104.482 1.00 108.85 ? 1543 PHE B CE1 1 
ATOM   6104 C CE2 . PHE B 1 357 ? 8.285   42.466 102.815 1.00 97.87  ? 1543 PHE B CE2 1 
ATOM   6105 C CZ  . PHE B 1 357 ? 9.338   42.848 103.624 1.00 100.70 ? 1543 PHE B CZ  1 
ATOM   6106 N N   . ALA B 1 358 ? 7.047   39.675 107.054 1.00 82.22  ? 1544 ALA B N   1 
ATOM   6107 C CA  . ALA B 1 358 ? 7.403   39.747 108.456 1.00 71.99  ? 1544 ALA B CA  1 
ATOM   6108 C C   . ALA B 1 358 ? 7.244   38.354 109.036 1.00 66.61  ? 1544 ALA B C   1 
ATOM   6109 O O   . ALA B 1 358 ? 8.087   37.903 109.776 1.00 63.79  ? 1544 ALA B O   1 
ATOM   6110 C CB  . ALA B 1 358 ? 6.498   40.729 109.173 1.00 43.61  ? 1544 ALA B CB  1 
ATOM   6111 N N   . LYS B 1 359 ? 6.164   37.677 108.652 1.00 60.72  ? 1545 LYS B N   1 
ATOM   6112 C CA  . LYS B 1 359 ? 5.873   36.328 109.100 1.00 69.74  ? 1545 LYS B CA  1 
ATOM   6113 C C   . LYS B 1 359 ? 6.967   35.373 108.711 1.00 69.24  ? 1545 LYS B C   1 
ATOM   6114 O O   . LYS B 1 359 ? 7.259   34.428 109.437 1.00 65.51  ? 1545 LYS B O   1 
ATOM   6115 C CB  . LYS B 1 359 ? 4.538   35.842 108.547 1.00 54.95  ? 1545 LYS B CB  1 
ATOM   6116 C CG  . LYS B 1 359 ? 3.401   36.658 109.065 1.00 53.49  ? 1545 LYS B CG  1 
ATOM   6117 C CD  . LYS B 1 359 ? 2.189   35.806 109.403 1.00 78.25  ? 1545 LYS B CD  1 
ATOM   6118 C CE  . LYS B 1 359 ? 1.400   36.370 110.586 1.00 84.97  ? 1545 LYS B CE  1 
ATOM   6119 N NZ  . LYS B 1 359 ? -0.088  36.283 110.403 1.00 92.83  ? 1545 LYS B NZ  1 
ATOM   6120 N N   . TYR B 1 360 ? 7.571   35.612 107.563 1.00 53.65  ? 1546 TYR B N   1 
ATOM   6121 C CA  . TYR B 1 360 ? 8.653   34.763 107.143 1.00 62.59  ? 1546 TYR B CA  1 
ATOM   6122 C C   . TYR B 1 360 ? 9.905   35.089 107.951 1.00 77.77  ? 1546 TYR B C   1 
ATOM   6123 O O   . TYR B 1 360 ? 10.645  34.184 108.329 1.00 74.68  ? 1546 TYR B O   1 
ATOM   6124 C CB  . TYR B 1 360 ? 8.887   34.884 105.642 1.00 57.07  ? 1546 TYR B CB  1 
ATOM   6125 C CG  . TYR B 1 360 ? 7.784   34.285 104.786 1.00 63.83  ? 1546 TYR B CG  1 
ATOM   6126 C CD1 . TYR B 1 360 ? 7.079   33.167 105.202 1.00 64.54  ? 1546 TYR B CD1 1 
ATOM   6127 C CD2 . TYR B 1 360 ? 7.469   34.817 103.541 1.00 58.22  ? 1546 TYR B CD2 1 
ATOM   6128 C CE1 . TYR B 1 360 ? 6.066   32.615 104.404 1.00 80.49  ? 1546 TYR B CE1 1 
ATOM   6129 C CE2 . TYR B 1 360 ? 6.466   34.261 102.739 1.00 53.36  ? 1546 TYR B CE2 1 
ATOM   6130 C CZ  . TYR B 1 360 ? 5.774   33.166 103.168 1.00 75.48  ? 1546 TYR B CZ  1 
ATOM   6131 O OH  . TYR B 1 360 ? 4.790   32.613 102.377 1.00 63.19  ? 1546 TYR B OH  1 
ATOM   6132 N N   . GLU B 1 361 ? 10.115  36.379 108.241 1.00 79.82  ? 1547 GLU B N   1 
ATOM   6133 C CA  . GLU B 1 361 ? 11.248  36.843 109.068 1.00 67.91  ? 1547 GLU B CA  1 
ATOM   6134 C C   . GLU B 1 361 ? 11.122  36.292 110.458 1.00 67.53  ? 1547 GLU B C   1 
ATOM   6135 O O   . GLU B 1 361 ? 12.074  35.757 111.010 1.00 75.26  ? 1547 GLU B O   1 
ATOM   6136 C CB  . GLU B 1 361 ? 11.275  38.359 109.213 1.00 65.13  ? 1547 GLU B CB  1 
ATOM   6137 C CG  . GLU B 1 361 ? 11.815  39.151 108.048 1.00 66.77  ? 1547 GLU B CG  1 
ATOM   6138 C CD  . GLU B 1 361 ? 11.257  40.561 108.062 1.00 79.92  ? 1547 GLU B CD  1 
ATOM   6139 O OE1 . GLU B 1 361 ? 10.199  40.757 108.718 1.00 85.07  ? 1547 GLU B OE1 1 
ATOM   6140 O OE2 . GLU B 1 361 ? 11.861  41.468 107.442 1.00 80.47  ? 1547 GLU B OE2 1 
ATOM   6141 N N   . LYS B 1 362 ? 9.944   36.451 111.036 1.00 67.49  ? 1548 LYS B N   1 
ATOM   6142 C CA  . LYS B 1 362 ? 9.714   35.984 112.377 1.00 68.41  ? 1548 LYS B CA  1 
ATOM   6143 C C   . LYS B 1 362 ? 9.881   34.480 112.418 1.00 80.56  ? 1548 LYS B C   1 
ATOM   6144 O O   . LYS B 1 362 ? 10.278  33.951 113.444 1.00 90.35  ? 1548 LYS B O   1 
ATOM   6145 C CB  . LYS B 1 362 ? 8.325   36.391 112.872 1.00 50.62  ? 1548 LYS B CB  1 
ATOM   6146 N N   . ALA B 1 363 ? 9.616   33.791 111.305 1.00 83.20  ? 1549 ALA B N   1 
ATOM   6147 C CA  . ALA B 1 363 ? 9.553   32.323 111.330 1.00 76.29  ? 1549 ALA B CA  1 
ATOM   6148 C C   . ALA B 1 363 ? 10.891  31.631 111.120 1.00 72.08  ? 1549 ALA B C   1 
ATOM   6149 O O   . ALA B 1 363 ? 11.148  30.600 111.732 1.00 74.25  ? 1549 ALA B O   1 
ATOM   6150 C CB  . ALA B 1 363 ? 8.520   31.800 110.355 1.00 82.97  ? 1549 ALA B CB  1 
ATOM   6151 N N   . PHE B 1 364 ? 11.747  32.184 110.269 1.00 79.65  ? 1550 PHE B N   1 
ATOM   6152 C CA  . PHE B 1 364 ? 13.000  31.500 109.928 1.00 88.61  ? 1550 PHE B CA  1 
ATOM   6153 C C   . PHE B 1 364 ? 14.284  32.270 110.282 1.00 93.63  ? 1550 PHE B C   1 
ATOM   6154 O O   . PHE B 1 364 ? 15.374  31.692 110.275 1.00 103.75 ? 1550 PHE B O   1 
ATOM   6155 C CB  . PHE B 1 364 ? 13.045  31.109 108.439 1.00 88.90  ? 1550 PHE B CB  1 
ATOM   6156 C CG  . PHE B 1 364 ? 11.735  30.621 107.883 1.00 75.67  ? 1550 PHE B CG  1 
ATOM   6157 C CD1 . PHE B 1 364 ? 11.234  29.363 108.213 1.00 67.11  ? 1550 PHE B CD1 1 
ATOM   6158 C CD2 . PHE B 1 364 ? 11.008  31.419 107.009 1.00 75.99  ? 1550 PHE B CD2 1 
ATOM   6159 C CE1 . PHE B 1 364 ? 10.010  28.916 107.690 1.00 61.83  ? 1550 PHE B CE1 1 
ATOM   6160 C CE2 . PHE B 1 364 ? 9.792   30.989 106.482 1.00 72.40  ? 1550 PHE B CE2 1 
ATOM   6161 C CZ  . PHE B 1 364 ? 9.292   29.735 106.822 1.00 70.20  ? 1550 PHE B CZ  1 
ATOM   6162 N N   . PHE B 1 365 ? 14.173  33.554 110.589 1.00 85.78  ? 1551 PHE B N   1 
ATOM   6163 C CA  . PHE B 1 365 ? 15.371  34.362 110.803 1.00 90.36  ? 1551 PHE B CA  1 
ATOM   6164 C C   . PHE B 1 365 ? 15.859  34.437 112.261 1.00 99.85  ? 1551 PHE B C   1 
ATOM   6165 O O   . PHE B 1 365 ? 16.832  35.122 112.562 1.00 98.17  ? 1551 PHE B O   1 
ATOM   6166 C CB  . PHE B 1 365 ? 15.178  35.746 110.196 1.00 84.41  ? 1551 PHE B CB  1 
ATOM   6167 C CG  . PHE B 1 365 ? 15.085  35.735 108.713 1.00 73.02  ? 1551 PHE B CG  1 
ATOM   6168 C CD1 . PHE B 1 365 ? 15.565  34.652 107.986 1.00 74.34  ? 1551 PHE B CD1 1 
ATOM   6169 C CD2 . PHE B 1 365 ? 14.521  36.804 108.040 1.00 72.75  ? 1551 PHE B CD2 1 
ATOM   6170 C CE1 . PHE B 1 365 ? 15.491  34.634 106.596 1.00 76.62  ? 1551 PHE B CE1 1 
ATOM   6171 C CE2 . PHE B 1 365 ? 14.448  36.812 106.657 1.00 64.39  ? 1551 PHE B CE2 1 
ATOM   6172 C CZ  . PHE B 1 365 ? 14.938  35.718 105.923 1.00 65.55  ? 1551 PHE B CZ  1 
ATOM   6173 N N   . THR B 1 366 ? 15.182  33.714 113.151 1.00 99.08  ? 1552 THR B N   1 
ATOM   6174 C CA  . THR B 1 366 ? 15.596  33.546 114.552 1.00 102.46 ? 1552 THR B CA  1 
ATOM   6175 C C   . THR B 1 366 ? 16.977  32.914 114.603 1.00 107.16 ? 1552 THR B C   1 
ATOM   6176 O O   . THR B 1 366 ? 17.320  32.132 113.711 1.00 93.08  ? 1552 THR B O   1 
ATOM   6177 C CB  . THR B 1 366 ? 14.649  32.574 115.301 1.00 107.70 ? 1552 THR B CB  1 
ATOM   6178 O OG1 . THR B 1 366 ? 14.813  31.242 114.789 1.00 98.06  ? 1552 THR B OG1 1 
ATOM   6179 C CG2 . THR B 1 366 ? 13.190  32.979 115.149 1.00 97.88  ? 1552 THR B CG2 1 
ATOM   6180 N N   . GLU B 1 367 ? 17.756  33.210 115.646 1.00 105.94 ? 1553 GLU B N   1 
ATOM   6181 C CA  . GLU B 1 367 ? 19.089  32.575 115.790 1.00 108.14 ? 1553 GLU B CA  1 
ATOM   6182 C C   . GLU B 1 367 ? 18.948  31.079 115.942 1.00 100.31 ? 1553 GLU B C   1 
ATOM   6183 O O   . GLU B 1 367 ? 19.832  30.298 115.599 1.00 98.58  ? 1553 GLU B O   1 
ATOM   6184 C CB  . GLU B 1 367 ? 19.894  33.142 116.968 1.00 106.54 ? 1553 GLU B CB  1 
ATOM   6185 C CG  . GLU B 1 367 ? 19.064  33.537 118.199 1.00 124.64 ? 1553 GLU B CG  1 
ATOM   6186 C CD  . GLU B 1 367 ? 19.868  34.442 119.155 1.00 113.88 ? 1553 GLU B CD  1 
ATOM   6187 O OE1 . GLU B 1 367 ? 20.868  35.064 118.689 1.00 112.59 ? 1553 GLU B OE1 1 
ATOM   6188 O OE2 . GLU B 1 367 ? 19.522  34.549 120.362 1.00 94.04  ? 1553 GLU B OE2 1 
ATOM   6189 N N   . GLU B 1 368 ? 17.819  30.715 116.520 1.00 96.19  ? 1554 GLU B N   1 
ATOM   6190 C CA  . GLU B 1 368 ? 17.436  29.339 116.757 1.00 97.61  ? 1554 GLU B CA  1 
ATOM   6191 C C   . GLU B 1 368 ? 17.112  28.507 115.532 1.00 110.98 ? 1554 GLU B C   1 
ATOM   6192 O O   . GLU B 1 368 ? 17.524  27.362 115.434 1.00 121.10 ? 1554 GLU B O   1 
ATOM   6193 C CB  . GLU B 1 368 ? 16.245  29.313 117.701 1.00 93.75  ? 1554 GLU B CB  1 
ATOM   6194 C CG  . GLU B 1 368 ? 15.411  28.085 117.591 1.00 104.02 ? 1554 GLU B CG  1 
ATOM   6195 C CD  . GLU B 1 368 ? 14.576  27.867 118.816 1.00 114.63 ? 1554 GLU B CD  1 
ATOM   6196 O OE1 . GLU B 1 368 ? 13.543  28.539 118.955 1.00 101.43 ? 1554 GLU B OE1 1 
ATOM   6197 O OE2 . GLU B 1 368 ? 14.951  27.023 119.647 1.00 110.37 ? 1554 GLU B OE2 1 
ATOM   6198 N N   . TYR B 1 369 ? 16.349  29.063 114.601 1.00 113.11 ? 1555 TYR B N   1 
ATOM   6199 C CA  . TYR B 1 369 ? 16.007  28.293 113.417 1.00 114.26 ? 1555 TYR B CA  1 
ATOM   6200 C C   . TYR B 1 369 ? 17.268  27.956 112.645 1.00 101.05 ? 1555 TYR B C   1 
ATOM   6201 O O   . TYR B 1 369 ? 17.426  26.846 112.150 1.00 93.21  ? 1555 TYR B O   1 
ATOM   6202 C CB  . TYR B 1 369 ? 15.035  29.043 112.510 1.00 110.65 ? 1555 TYR B CB  1 
ATOM   6203 C CG  . TYR B 1 369 ? 14.828  28.336 111.193 1.00 95.47  ? 1555 TYR B CG  1 
ATOM   6204 C CD1 . TYR B 1 369 ? 15.647  28.597 110.108 1.00 76.50  ? 1555 TYR B CD1 1 
ATOM   6205 C CD2 . TYR B 1 369 ? 13.832  27.385 111.044 1.00 86.92  ? 1555 TYR B CD2 1 
ATOM   6206 C CE1 . TYR B 1 369 ? 15.470  27.945 108.910 1.00 56.64  ? 1555 TYR B CE1 1 
ATOM   6207 C CE2 . TYR B 1 369 ? 13.650  26.730 109.848 1.00 80.09  ? 1555 TYR B CE2 1 
ATOM   6208 C CZ  . TYR B 1 369 ? 14.471  27.013 108.786 1.00 72.15  ? 1555 TYR B CZ  1 
ATOM   6209 O OH  . TYR B 1 369 ? 14.291  26.359 107.594 1.00 91.09  ? 1555 TYR B OH  1 
ATOM   6210 N N   . VAL B 1 370 ? 18.170  28.921 112.547 1.00 79.60  ? 1556 VAL B N   1 
ATOM   6211 C CA  . VAL B 1 370 ? 19.408  28.709 111.821 1.00 86.36  ? 1556 VAL B CA  1 
ATOM   6212 C C   . VAL B 1 370 ? 20.234  27.617 112.482 1.00 111.29 ? 1556 VAL B C   1 
ATOM   6213 O O   . VAL B 1 370 ? 20.814  26.771 111.806 1.00 120.99 ? 1556 VAL B O   1 
ATOM   6214 C CB  . VAL B 1 370 ? 20.243  29.994 111.752 1.00 97.87  ? 1556 VAL B CB  1 
ATOM   6215 C CG1 . VAL B 1 370 ? 21.446  29.792 110.851 1.00 80.63  ? 1556 VAL B CG1 1 
ATOM   6216 C CG2 . VAL B 1 370 ? 19.394  31.146 111.254 1.00 111.68 ? 1556 VAL B CG2 1 
ATOM   6217 N N   . ARG B 1 371 ? 20.276  27.635 113.809 1.00 122.26 ? 1557 ARG B N   1 
ATOM   6218 C CA  . ARG B 1 371 ? 21.063  26.661 114.549 1.00 123.56 ? 1557 ARG B CA  1 
ATOM   6219 C C   . ARG B 1 371 ? 20.562  25.242 114.318 1.00 121.50 ? 1557 ARG B C   1 
ATOM   6220 O O   . ARG B 1 371 ? 21.352  24.318 114.138 1.00 127.55 ? 1557 ARG B O   1 
ATOM   6221 C CB  . ARG B 1 371 ? 21.043  26.985 116.044 1.00 118.11 ? 1557 ARG B CB  1 
ATOM   6222 N N   . ASP B 1 372 ? 19.246  25.074 114.322 1.00 110.90 ? 1558 ASP B N   1 
ATOM   6223 C CA  . ASP B 1 372 ? 18.646  23.767 114.099 1.00 112.84 ? 1558 ASP B CA  1 
ATOM   6224 C C   . ASP B 1 372 ? 18.934  23.239 112.700 1.00 109.49 ? 1558 ASP B C   1 
ATOM   6225 O O   . ASP B 1 372 ? 19.205  22.054 112.519 1.00 101.19 ? 1558 ASP B O   1 
ATOM   6226 C CB  . ASP B 1 372 ? 17.145  23.825 114.355 1.00 114.05 ? 1558 ASP B CB  1 
ATOM   6227 C CG  . ASP B 1 372 ? 16.821  23.978 115.820 1.00 127.24 ? 1558 ASP B CG  1 
ATOM   6228 O OD1 . ASP B 1 372 ? 17.725  23.756 116.650 1.00 138.63 ? 1558 ASP B OD1 1 
ATOM   6229 O OD2 . ASP B 1 372 ? 15.666  24.320 116.142 1.00 132.03 ? 1558 ASP B OD2 1 
ATOM   6230 N N   . HIS B 1 373 ? 18.868  24.120 111.708 1.00 110.92 ? 1559 HIS B N   1 
ATOM   6231 C CA  . HIS B 1 373 ? 19.150  23.726 110.338 1.00 107.01 ? 1559 HIS B CA  1 
ATOM   6232 C C   . HIS B 1 373 ? 20.312  24.532 109.779 1.00 113.22 ? 1559 HIS B C   1 
ATOM   6233 O O   . HIS B 1 373 ? 20.260  25.759 109.743 1.00 109.45 ? 1559 HIS B O   1 
ATOM   6234 C CB  . HIS B 1 373 ? 17.917  23.958 109.468 1.00 97.52  ? 1559 HIS B CB  1 
ATOM   6235 C CG  . HIS B 1 373 ? 16.623  23.818 110.205 1.00 103.19 ? 1559 HIS B CG  1 
ATOM   6236 N ND1 . HIS B 1 373 ? 15.783  22.740 110.037 1.00 113.85 ? 1559 HIS B ND1 1 
ATOM   6237 C CD2 . HIS B 1 373 ? 16.024  24.623 111.113 1.00 107.74 ? 1559 HIS B CD2 1 
ATOM   6238 C CE1 . HIS B 1 373 ? 14.722  22.886 110.810 1.00 106.31 ? 1559 HIS B CE1 1 
ATOM   6239 N NE2 . HIS B 1 373 ? 14.844  24.020 111.474 1.00 101.89 ? 1559 HIS B NE2 1 
ATOM   6240 N N   . PRO B 1 374 ? 21.358  23.841 109.335 1.00 120.20 ? 1560 PRO B N   1 
ATOM   6241 C CA  . PRO B 1 374 ? 22.496  24.509 108.698 1.00 121.65 ? 1560 PRO B CA  1 
ATOM   6242 C C   . PRO B 1 374 ? 22.426  24.338 107.189 1.00 101.01 ? 1560 PRO B C   1 
ATOM   6243 O O   . PRO B 1 374 ? 23.092  25.046 106.440 1.00 90.68  ? 1560 PRO B O   1 
ATOM   6244 C CB  . PRO B 1 374 ? 23.699  23.760 109.268 1.00 129.14 ? 1560 PRO B CB  1 
ATOM   6245 C CG  . PRO B 1 374 ? 23.224  23.236 110.578 1.00 126.45 ? 1560 PRO B CG  1 
ATOM   6246 C CD  . PRO B 1 374 ? 21.791  22.868 110.353 1.00 123.76 ? 1560 PRO B CD  1 
ATOM   6247 N N   . GLU B 1 375 ? 21.606  23.386 106.762 1.00 87.02  ? 1561 GLU B N   1 
ATOM   6248 C CA  . GLU B 1 375 ? 21.370  23.104 105.355 1.00 97.57  ? 1561 GLU B CA  1 
ATOM   6249 C C   . GLU B 1 375 ? 20.703  24.292 104.677 1.00 107.86 ? 1561 GLU B C   1 
ATOM   6250 O O   . GLU B 1 375 ? 20.986  24.620 103.528 1.00 109.52 ? 1561 GLU B O   1 
ATOM   6251 C CB  . GLU B 1 375 ? 20.469  21.882 105.231 1.00 97.24  ? 1561 GLU B CB  1 
ATOM   6252 C CG  . GLU B 1 375 ? 20.717  20.839 106.299 1.00 102.98 ? 1561 GLU B CG  1 
ATOM   6253 C CD  . GLU B 1 375 ? 19.452  20.115 106.706 1.00 117.11 ? 1561 GLU B CD  1 
ATOM   6254 O OE1 . GLU B 1 375 ? 18.417  20.785 106.901 1.00 114.03 ? 1561 GLU B OE1 1 
ATOM   6255 O OE2 . GLU B 1 375 ? 19.493  18.875 106.839 1.00 117.99 ? 1561 GLU B OE2 1 
ATOM   6256 N N   . ASP B 1 376 ? 19.800  24.920 105.416 1.00 102.11 ? 1562 ASP B N   1 
ATOM   6257 C CA  . ASP B 1 376 ? 18.968  26.012 104.933 1.00 103.79 ? 1562 ASP B CA  1 
ATOM   6258 C C   . ASP B 1 376 ? 19.713  27.327 104.741 1.00 111.21 ? 1562 ASP B C   1 
ATOM   6259 O O   . ASP B 1 376 ? 19.157  28.288 104.213 1.00 125.12 ? 1562 ASP B O   1 
ATOM   6260 C CB  . ASP B 1 376 ? 17.775  26.210 105.862 1.00 102.15 ? 1562 ASP B CB  1 
ATOM   6261 C CG  . ASP B 1 376 ? 16.979  24.944 106.048 1.00 91.18  ? 1562 ASP B CG  1 
ATOM   6262 O OD1 . ASP B 1 376 ? 17.501  23.868 105.699 1.00 89.78  ? 1562 ASP B OD1 1 
ATOM   6263 O OD2 . ASP B 1 376 ? 15.835  25.022 106.539 1.00 88.68  ? 1562 ASP B OD2 1 
ATOM   6264 N N   . GLN B 1 377 ? 20.963  27.379 105.178 1.00 106.22 ? 1563 GLN B N   1 
ATOM   6265 C CA  . GLN B 1 377 ? 21.716  28.620 105.117 1.00 98.75  ? 1563 GLN B CA  1 
ATOM   6266 C C   . GLN B 1 377 ? 21.792  29.102 103.678 1.00 99.18  ? 1563 GLN B C   1 
ATOM   6267 O O   . GLN B 1 377 ? 21.679  30.295 103.412 1.00 87.70  ? 1563 GLN B O   1 
ATOM   6268 C CB  . GLN B 1 377 ? 23.120  28.435 105.697 1.00 80.92  ? 1563 GLN B CB  1 
ATOM   6269 N N   . ASP B 1 378 ? 21.975  28.176 102.747 1.00 107.62 ? 1564 ASP B N   1 
ATOM   6270 C CA  . ASP B 1 378 ? 22.008  28.534 101.338 1.00 109.19 ? 1564 ASP B CA  1 
ATOM   6271 C C   . ASP B 1 378 ? 20.650  29.111 100.941 1.00 99.24  ? 1564 ASP B C   1 
ATOM   6272 O O   . ASP B 1 378 ? 20.567  30.082 100.194 1.00 82.93  ? 1564 ASP B O   1 
ATOM   6273 C CB  . ASP B 1 378 ? 22.345  27.311 100.487 1.00 118.92 ? 1564 ASP B CB  1 
ATOM   6274 C CG  . ASP B 1 378 ? 23.166  27.662 99.263  1.00 125.74 ? 1564 ASP B CG  1 
ATOM   6275 O OD1 . ASP B 1 378 ? 23.750  28.764 99.234  1.00 123.43 ? 1564 ASP B OD1 1 
ATOM   6276 O OD2 . ASP B 1 378 ? 23.234  26.831 98.334  1.00 116.62 ? 1564 ASP B OD2 1 
ATOM   6277 N N   . LYS B 1 379 ? 19.591  28.500 101.460 1.00 98.13  ? 1565 LYS B N   1 
ATOM   6278 C CA  . LYS B 1 379 ? 18.218  28.931 101.214 1.00 83.44  ? 1565 LYS B CA  1 
ATOM   6279 C C   . LYS B 1 379 ? 17.852  30.253 101.846 1.00 90.28  ? 1565 LYS B C   1 
ATOM   6280 O O   . LYS B 1 379 ? 17.142  31.041 101.262 1.00 89.11  ? 1565 LYS B O   1 
ATOM   6281 C CB  . LYS B 1 379 ? 17.228  27.883 101.693 1.00 73.98  ? 1565 LYS B CB  1 
ATOM   6282 C CG  . LYS B 1 379 ? 17.035  26.739 100.754 1.00 68.03  ? 1565 LYS B CG  1 
ATOM   6283 C CD  . LYS B 1 379 ? 16.099  25.737 101.357 1.00 76.50  ? 1565 LYS B CD  1 
ATOM   6284 C CE  . LYS B 1 379 ? 16.429  24.353 100.893 1.00 82.99  ? 1565 LYS B CE  1 
ATOM   6285 N NZ  . LYS B 1 379 ? 17.508  24.381 99.880  1.00 88.72  ? 1565 LYS B NZ  1 
ATOM   6286 N N   . LEU B 1 380 ? 18.324  30.489 103.053 1.00 85.72  ? 1566 LEU B N   1 
ATOM   6287 C CA  . LEU B 1 380 ? 17.969  31.703 103.744 1.00 77.93  ? 1566 LEU B CA  1 
ATOM   6288 C C   . LEU B 1 380 ? 18.437  32.911 102.976 1.00 86.73  ? 1566 LEU B C   1 
ATOM   6289 O O   . LEU B 1 380 ? 17.736  33.896 102.883 1.00 94.72  ? 1566 LEU B O   1 
ATOM   6290 C CB  . LEU B 1 380 ? 18.584  31.717 105.130 1.00 82.30  ? 1566 LEU B CB  1 
ATOM   6291 C CG  . LEU B 1 380 ? 18.119  30.675 106.135 1.00 87.58  ? 1566 LEU B CG  1 
ATOM   6292 C CD1 . LEU B 1 380 ? 18.930  30.757 107.372 1.00 94.73  ? 1566 LEU B CD1 1 
ATOM   6293 C CD2 . LEU B 1 380 ? 16.668  30.826 106.451 1.00 103.70 ? 1566 LEU B CD2 1 
ATOM   6294 N N   . THR B 1 381 ? 19.634  32.825 102.416 1.00 87.82  ? 1567 THR B N   1 
ATOM   6295 C CA  . THR B 1 381 ? 20.176  33.927 101.643 1.00 104.17 ? 1567 THR B CA  1 
ATOM   6296 C C   . THR B 1 381 ? 19.279  34.160 100.441 1.00 101.43 ? 1567 THR B C   1 
ATOM   6297 O O   . THR B 1 381 ? 19.006  35.297 100.067 1.00 106.05 ? 1567 THR B O   1 
ATOM   6298 C CB  . THR B 1 381 ? 21.596  33.624 101.161 1.00 101.02 ? 1567 THR B CB  1 
ATOM   6299 O OG1 . THR B 1 381 ? 21.617  32.341 100.526 1.00 118.25 ? 1567 THR B OG1 1 
ATOM   6300 C CG2 . THR B 1 381 ? 22.557  33.608 102.333 1.00 92.95  ? 1567 THR B CG2 1 
ATOM   6301 N N   . HIS B 1 382 ? 18.818  33.069 99.842  1.00 90.67  ? 1568 HIS B N   1 
ATOM   6302 C CA  . HIS B 1 382 ? 17.950  33.147 98.679  1.00 84.40  ? 1568 HIS B CA  1 
ATOM   6303 C C   . HIS B 1 382 ? 16.649  33.844 99.037  1.00 88.33  ? 1568 HIS B C   1 
ATOM   6304 O O   . HIS B 1 382 ? 16.150  34.672 98.283  1.00 79.09  ? 1568 HIS B O   1 
ATOM   6305 C CB  . HIS B 1 382 ? 17.676  31.744 98.144  1.00 74.93  ? 1568 HIS B CB  1 
ATOM   6306 C CG  . HIS B 1 382 ? 16.880  31.722 96.878  1.00 73.53  ? 1568 HIS B CG  1 
ATOM   6307 N ND1 . HIS B 1 382 ? 16.066  30.666 96.531  1.00 70.89  ? 1568 HIS B ND1 1 
ATOM   6308 C CD2 . HIS B 1 382 ? 16.768  32.627 95.878  1.00 66.50  ? 1568 HIS B CD2 1 
ATOM   6309 C CE1 . HIS B 1 382 ? 15.491  30.919 95.370  1.00 72.88  ? 1568 HIS B CE1 1 
ATOM   6310 N NE2 . HIS B 1 382 ? 15.900  32.102 94.952  1.00 73.08  ? 1568 HIS B NE2 1 
ATOM   6311 N N   . LEU B 1 383 ? 16.105  33.510 100.199 1.00 84.55  ? 1569 LEU B N   1 
ATOM   6312 C CA  . LEU B 1 383 ? 14.872  34.129 100.654 1.00 73.77  ? 1569 LEU B CA  1 
ATOM   6313 C C   . LEU B 1 383 ? 15.102  35.616 100.874 1.00 86.22  ? 1569 LEU B C   1 
ATOM   6314 O O   . LEU B 1 383 ? 14.254  36.445 100.557 1.00 75.54  ? 1569 LEU B O   1 
ATOM   6315 C CB  . LEU B 1 383 ? 14.383  33.477 101.942 1.00 71.50  ? 1569 LEU B CB  1 
ATOM   6316 C CG  . LEU B 1 383 ? 12.950  33.844 102.318 1.00 66.40  ? 1569 LEU B CG  1 
ATOM   6317 C CD1 . LEU B 1 383 ? 12.631  33.364 103.715 1.00 64.06  ? 1569 LEU B CD1 1 
ATOM   6318 C CD2 . LEU B 1 383 ? 12.749  35.341 102.205 1.00 68.37  ? 1569 LEU B CD2 1 
ATOM   6319 N N   . LYS B 1 384 ? 16.264  35.941 101.426 1.00 89.86  ? 1570 LYS B N   1 
ATOM   6320 C CA  . LYS B 1 384 ? 16.629  37.322 101.702 1.00 95.78  ? 1570 LYS B CA  1 
ATOM   6321 C C   . LYS B 1 384 ? 16.710  38.127 100.414 1.00 85.13  ? 1570 LYS B C   1 
ATOM   6322 O O   . LYS B 1 384 ? 16.302  39.283 100.371 1.00 71.11  ? 1570 LYS B O   1 
ATOM   6323 C CB  . LYS B 1 384 ? 17.962  37.381 102.447 1.00 83.04  ? 1570 LYS B CB  1 
ATOM   6324 N N   . ASP B 1 385 ? 17.250  37.510 99.371  1.00 76.99  ? 1571 ASP B N   1 
ATOM   6325 C CA  . ASP B 1 385 ? 17.414  38.173 98.084  1.00 92.94  ? 1571 ASP B CA  1 
ATOM   6326 C C   . ASP B 1 385 ? 16.084  38.581 97.483  1.00 85.35  ? 1571 ASP B C   1 
ATOM   6327 O O   . ASP B 1 385 ? 15.964  39.649 96.890  1.00 79.15  ? 1571 ASP B O   1 
ATOM   6328 C CB  . ASP B 1 385 ? 18.167  37.272 97.108  1.00 100.03 ? 1571 ASP B CB  1 
ATOM   6329 C CG  . ASP B 1 385 ? 19.623  37.122 97.467  1.00 114.24 ? 1571 ASP B CG  1 
ATOM   6330 O OD1 . ASP B 1 385 ? 20.112  37.924 98.286  1.00 131.23 ? 1571 ASP B OD1 1 
ATOM   6331 O OD2 . ASP B 1 385 ? 20.279  36.204 96.939  1.00 107.70 ? 1571 ASP B OD2 1 
ATOM   6332 N N   . LEU B 1 386 ? 15.087  37.721 97.630  1.00 80.26  ? 1572 LEU B N   1 
ATOM   6333 C CA  . LEU B 1 386 ? 13.769  38.002 97.091  1.00 68.75  ? 1572 LEU B CA  1 
ATOM   6334 C C   . LEU B 1 386 ? 13.176  39.242 97.739  1.00 74.06  ? 1572 LEU B C   1 
ATOM   6335 O O   . LEU B 1 386 ? 12.568  40.067 97.067  1.00 71.53  ? 1572 LEU B O   1 
ATOM   6336 C CB  . LEU B 1 386 ? 12.848  36.800 97.291  1.00 78.99  ? 1572 LEU B CB  1 
ATOM   6337 C CG  . LEU B 1 386 ? 13.292  35.513 96.594  1.00 75.19  ? 1572 LEU B CG  1 
ATOM   6338 C CD1 . LEU B 1 386 ? 12.444  34.337 97.027  1.00 70.94  ? 1572 LEU B CD1 1 
ATOM   6339 C CD2 . LEU B 1 386 ? 13.261  35.675 95.088  1.00 54.95  ? 1572 LEU B CD2 1 
ATOM   6340 N N   . ILE B 1 387 ? 13.355  39.379 99.047  1.00 70.33  ? 1573 ILE B N   1 
ATOM   6341 C CA  . ILE B 1 387 ? 12.825  40.539 99.747  1.00 76.00  ? 1573 ILE B CA  1 
ATOM   6342 C C   . ILE B 1 387 ? 13.470  41.824 99.243  1.00 80.44  ? 1573 ILE B C   1 
ATOM   6343 O O   . ILE B 1 387 ? 12.787  42.819 99.025  1.00 79.19  ? 1573 ILE B O   1 
ATOM   6344 C CB  . ILE B 1 387 ? 13.041  40.431 101.259 1.00 67.64  ? 1573 ILE B CB  1 
ATOM   6345 C CG1 . ILE B 1 387 ? 12.527  39.088 101.771 1.00 65.76  ? 1573 ILE B CG1 1 
ATOM   6346 C CG2 . ILE B 1 387 ? 12.344  41.567 101.971 1.00 59.02  ? 1573 ILE B CG2 1 
ATOM   6347 C CD1 . ILE B 1 387 ? 12.417  39.015 103.269 1.00 73.52  ? 1573 ILE B CD1 1 
ATOM   6348 N N   . ALA B 1 388 ? 14.785  41.799 99.056  1.00 59.74  ? 1574 ALA B N   1 
ATOM   6349 C CA  . ALA B 1 388 ? 15.500  42.961 98.550  1.00 69.19  ? 1574 ALA B CA  1 
ATOM   6350 C C   . ALA B 1 388 ? 15.005  43.216 97.140  1.00 76.82  ? 1574 ALA B C   1 
ATOM   6351 O O   . ALA B 1 388 ? 14.781  44.350 96.728  1.00 81.61  ? 1574 ALA B O   1 
ATOM   6352 C CB  . ALA B 1 388 ? 16.989  42.707 98.552  1.00 69.24  ? 1574 ALA B CB  1 
ATOM   6353 N N   . TRP B 1 389 ? 14.833  42.123 96.412  1.00 75.14  ? 1575 TRP B N   1 
ATOM   6354 C CA  . TRP B 1 389 ? 14.344  42.142 95.049  1.00 73.67  ? 1575 TRP B CA  1 
ATOM   6355 C C   . TRP B 1 389 ? 12.961  42.780 94.968  1.00 85.90  ? 1575 TRP B C   1 
ATOM   6356 O O   . TRP B 1 389 ? 12.649  43.484 94.008  1.00 94.41  ? 1575 TRP B O   1 
ATOM   6357 C CB  . TRP B 1 389 ? 14.283  40.703 94.565  1.00 81.73  ? 1575 TRP B CB  1 
ATOM   6358 C CG  . TRP B 1 389 ? 14.484  40.458 93.127  1.00 80.96  ? 1575 TRP B CG  1 
ATOM   6359 C CD1 . TRP B 1 389 ? 13.964  39.426 92.409  1.00 79.61  ? 1575 TRP B CD1 1 
ATOM   6360 C CD2 . TRP B 1 389 ? 15.277  41.223 92.219  1.00 97.51  ? 1575 TRP B CD2 1 
ATOM   6361 N NE1 . TRP B 1 389 ? 14.373  39.502 91.107  1.00 88.22  ? 1575 TRP B NE1 1 
ATOM   6362 C CE2 . TRP B 1 389 ? 15.183  40.598 90.960  1.00 97.85  ? 1575 TRP B CE2 1 
ATOM   6363 C CE3 . TRP B 1 389 ? 16.056  42.380 92.341  1.00 103.16 ? 1575 TRP B CE3 1 
ATOM   6364 C CZ2 . TRP B 1 389 ? 15.836  41.096 89.822  1.00 89.21  ? 1575 TRP B CZ2 1 
ATOM   6365 C CZ3 . TRP B 1 389 ? 16.708  42.878 91.207  1.00 89.64  ? 1575 TRP B CZ3 1 
ATOM   6366 C CH2 . TRP B 1 389 ? 16.590  42.234 89.969  1.00 86.34  ? 1575 TRP B CH2 1 
ATOM   6367 N N   . GLN B 1 390 ? 12.143  42.559 95.993  1.00 79.73  ? 1576 GLN B N   1 
ATOM   6368 C CA  . GLN B 1 390 ? 10.765  43.015 95.960  1.00 71.02  ? 1576 GLN B CA  1 
ATOM   6369 C C   . GLN B 1 390 ? 10.624  44.531 95.782  1.00 67.98  ? 1576 GLN B C   1 
ATOM   6370 O O   . GLN B 1 390 ? 9.805   45.012 94.987  1.00 85.66  ? 1576 GLN B O   1 
ATOM   6371 C CB  . GLN B 1 390 ? 10.040  42.528 97.208  1.00 59.87  ? 1576 GLN B CB  1 
ATOM   6372 C CG  . GLN B 1 390 ? 8.540   42.669 97.144  1.00 64.96  ? 1576 GLN B CG  1 
ATOM   6373 C CD  . GLN B 1 390 ? 7.836   41.426 97.588  1.00 57.17  ? 1576 GLN B CD  1 
ATOM   6374 O OE1 . GLN B 1 390 ? 8.109   40.905 98.657  1.00 80.31  ? 1576 GLN B OE1 1 
ATOM   6375 N NE2 . GLN B 1 390 ? 6.936   40.929 96.765  1.00 73.42  ? 1576 GLN B NE2 1 
ATOM   6376 N N   . ILE B 1 391 ? 11.449  45.266 96.516  1.00 68.30  ? 1577 ILE B N   1 
ATOM   6377 C CA  . ILE B 1 391 ? 11.296  46.710 96.654  1.00 61.03  ? 1577 ILE B CA  1 
ATOM   6378 C C   . ILE B 1 391 ? 11.390  47.467 95.316  1.00 68.08  ? 1577 ILE B C   1 
ATOM   6379 O O   . ILE B 1 391 ? 10.479  48.229 94.987  1.00 61.62  ? 1577 ILE B O   1 
ATOM   6380 C CB  . ILE B 1 391 ? 12.230  47.243 97.759  1.00 56.08  ? 1577 ILE B CB  1 
ATOM   6381 C CG1 . ILE B 1 391 ? 11.534  47.161 99.121  1.00 76.16  ? 1577 ILE B CG1 1 
ATOM   6382 C CG2 . ILE B 1 391 ? 12.586  48.692 97.540  1.00 69.25  ? 1577 ILE B CG2 1 
ATOM   6383 C CD1 . ILE B 1 391 ? 11.164  45.782 99.589  1.00 69.89  ? 1577 ILE B CD1 1 
ATOM   6384 N N   . PRO B 1 392 ? 12.462  47.228 94.534  1.00 69.06  ? 1578 PRO B N   1 
ATOM   6385 C CA  . PRO B 1 392 ? 12.613  47.803 93.214  1.00 72.66  ? 1578 PRO B CA  1 
ATOM   6386 C C   . PRO B 1 392 ? 11.386  47.588 92.380  1.00 83.04  ? 1578 PRO B C   1 
ATOM   6387 O O   . PRO B 1 392 ? 10.889  48.530 91.784  1.00 76.15  ? 1578 PRO B O   1 
ATOM   6388 C CB  . PRO B 1 392 ? 13.742  46.988 92.604  1.00 72.48  ? 1578 PRO B CB  1 
ATOM   6389 C CG  . PRO B 1 392 ? 14.554  46.559 93.745  1.00 84.01  ? 1578 PRO B CG  1 
ATOM   6390 C CD  . PRO B 1 392 ? 13.616  46.384 94.890  1.00 76.02  ? 1578 PRO B CD  1 
ATOM   6391 N N   . PHE B 1 393 ? 10.898  46.354 92.345  1.00 79.31  ? 1579 PHE B N   1 
ATOM   6392 C CA  . PHE B 1 393 ? 9.754   46.019 91.519  1.00 75.06  ? 1579 PHE B CA  1 
ATOM   6393 C C   . PHE B 1 393 ? 8.572   46.804 92.006  1.00 83.43  ? 1579 PHE B C   1 
ATOM   6394 O O   . PHE B 1 393 ? 7.837   47.392 91.210  1.00 84.57  ? 1579 PHE B O   1 
ATOM   6395 C CB  . PHE B 1 393 ? 9.413   44.545 91.611  1.00 75.51  ? 1579 PHE B CB  1 
ATOM   6396 C CG  . PHE B 1 393 ? 10.454  43.633 91.055  1.00 82.63  ? 1579 PHE B CG  1 
ATOM   6397 C CD1 . PHE B 1 393 ? 11.797  43.951 91.132  1.00 94.44  ? 1579 PHE B CD1 1 
ATOM   6398 C CD2 . PHE B 1 393 ? 10.086  42.427 90.470  1.00 77.13  ? 1579 PHE B CD2 1 
ATOM   6399 C CE1 . PHE B 1 393 ? 12.752  43.092 90.639  1.00 80.41  ? 1579 PHE B CE1 1 
ATOM   6400 C CE2 . PHE B 1 393 ? 11.037  41.560 89.972  1.00 74.29  ? 1579 PHE B CE2 1 
ATOM   6401 C CZ  . PHE B 1 393 ? 12.367  41.892 90.055  1.00 79.73  ? 1579 PHE B CZ  1 
ATOM   6402 N N   . LEU B 1 394 ? 8.395   46.817 93.325  1.00 70.92  ? 1580 LEU B N   1 
ATOM   6403 C CA  . LEU B 1 394 ? 7.283   47.530 93.929  1.00 74.52  ? 1580 LEU B CA  1 
ATOM   6404 C C   . LEU B 1 394 ? 7.312   48.997 93.534  1.00 73.41  ? 1580 LEU B C   1 
ATOM   6405 O O   . LEU B 1 394 ? 6.337   49.530 93.021  1.00 62.92  ? 1580 LEU B O   1 
ATOM   6406 C CB  . LEU B 1 394 ? 7.283   47.354 95.443  1.00 61.25  ? 1580 LEU B CB  1 
ATOM   6407 C CG  . LEU B 1 394 ? 6.590   46.079 95.914  1.00 63.95  ? 1580 LEU B CG  1 
ATOM   6408 C CD1 . LEU B 1 394 ? 6.760   46.016 97.402  1.00 57.44  ? 1580 LEU B CD1 1 
ATOM   6409 C CD2 . LEU B 1 394 ? 5.102   46.009 95.534  1.00 43.46  ? 1580 LEU B CD2 1 
ATOM   6410 N N   . GLY B 1 395 ? 8.450   49.637 93.731  1.00 49.80  ? 1581 GLY B N   1 
ATOM   6411 C CA  . GLY B 1 395 ? 8.573   51.041 93.383  1.00 61.26  ? 1581 GLY B CA  1 
ATOM   6412 C C   . GLY B 1 395 ? 8.364   51.275 91.902  1.00 77.77  ? 1581 GLY B C   1 
ATOM   6413 O O   . GLY B 1 395 ? 7.615   52.179 91.508  1.00 73.08  ? 1581 GLY B O   1 
ATOM   6414 N N   . ALA B 1 396 ? 9.024   50.453 91.086  1.00 65.33  ? 1582 ALA B N   1 
ATOM   6415 C CA  . ALA B 1 396 ? 8.816   50.468 89.651  1.00 63.45  ? 1582 ALA B CA  1 
ATOM   6416 C C   . ALA B 1 396 ? 7.322   50.493 89.342  1.00 69.28  ? 1582 ALA B C   1 
ATOM   6417 O O   . ALA B 1 396 ? 6.861   51.354 88.584  1.00 69.33  ? 1582 ALA B O   1 
ATOM   6418 C CB  . ALA B 1 396 ? 9.491   49.272 88.988  1.00 53.85  ? 1582 ALA B CB  1 
ATOM   6419 N N   . GLY B 1 397 ? 6.565   49.573 89.942  1.00 45.70  ? 1583 GLY B N   1 
ATOM   6420 C CA  . GLY B 1 397 ? 5.131   49.526 89.723  1.00 45.63  ? 1583 GLY B CA  1 
ATOM   6421 C C   . GLY B 1 397 ? 4.424   50.729 90.304  1.00 64.75  ? 1583 GLY B C   1 
ATOM   6422 O O   . GLY B 1 397 ? 3.350   51.131 89.828  1.00 66.91  ? 1583 GLY B O   1 
ATOM   6423 N N   . ILE B 1 398 ? 5.011   51.302 91.352  1.00 49.66  ? 1584 ILE B N   1 
ATOM   6424 C CA  . ILE B 1 398 ? 4.361   52.422 92.012  1.00 49.76  ? 1584 ILE B CA  1 
ATOM   6425 C C   . ILE B 1 398 ? 4.479   53.662 91.127  1.00 67.22  ? 1584 ILE B C   1 
ATOM   6426 O O   . ILE B 1 398 ? 3.484   54.389 90.926  1.00 59.71  ? 1584 ILE B O   1 
ATOM   6427 C CB  . ILE B 1 398 ? 4.856   52.631 93.462  1.00 70.04  ? 1584 ILE B CB  1 
ATOM   6428 C CG1 . ILE B 1 398 ? 4.533   51.373 94.284  1.00 63.73  ? 1584 ILE B CG1 1 
ATOM   6429 C CG2 . ILE B 1 398 ? 4.224   53.894 94.067  1.00 55.19  ? 1584 ILE B CG2 1 
ATOM   6430 C CD1 . ILE B 1 398 ? 4.639   51.486 95.771  1.00 54.30  ? 1584 ILE B CD1 1 
ATOM   6431 N N   . LYS B 1 399 ? 5.688   53.863 90.574  1.00 75.82  ? 1585 LYS B N   1 
ATOM   6432 C CA  . LYS B 1 399 ? 5.929   54.893 89.555  1.00 74.25  ? 1585 LYS B CA  1 
ATOM   6433 C C   . LYS B 1 399 ? 4.814   54.863 88.497  1.00 78.56  ? 1585 LYS B C   1 
ATOM   6434 O O   . LYS B 1 399 ? 4.112   55.876 88.309  1.00 85.06  ? 1585 LYS B O   1 
ATOM   6435 C CB  . LYS B 1 399 ? 7.294   54.693 88.895  1.00 60.47  ? 1585 LYS B CB  1 
ATOM   6436 N N   . ILE B 1 400 ? 4.612   53.710 87.854  1.00 63.15  ? 1586 ILE B N   1 
ATOM   6437 C CA  . ILE B 1 400 ? 3.512   53.567 86.899  1.00 66.42  ? 1586 ILE B CA  1 
ATOM   6438 C C   . ILE B 1 400 ? 2.141   53.970 87.477  1.00 73.61  ? 1586 ILE B C   1 
ATOM   6439 O O   . ILE B 1 400 ? 1.369   54.680 86.833  1.00 67.54  ? 1586 ILE B O   1 
ATOM   6440 C CB  . ILE B 1 400 ? 3.418   52.133 86.357  1.00 65.46  ? 1586 ILE B CB  1 
ATOM   6441 C CG1 . ILE B 1 400 ? 4.753   51.696 85.753  1.00 62.14  ? 1586 ILE B CG1 1 
ATOM   6442 C CG2 . ILE B 1 400 ? 2.239   51.975 85.359  1.00 64.61  ? 1586 ILE B CG2 1 
ATOM   6443 C CD1 . ILE B 1 400 ? 4.740   50.258 85.253  1.00 64.72  ? 1586 ILE B CD1 1 
ATOM   6444 N N   . HIS B 1 401 ? 1.843   53.506 88.682  1.00 64.89  ? 1587 HIS B N   1 
ATOM   6445 C CA  . HIS B 1 401 ? 0.544   53.748 89.282  1.00 54.38  ? 1587 HIS B CA  1 
ATOM   6446 C C   . HIS B 1 401 ? 0.366   55.248 89.447  1.00 66.03  ? 1587 HIS B C   1 
ATOM   6447 O O   . HIS B 1 401 ? -0.699  55.799 89.131  1.00 68.21  ? 1587 HIS B O   1 
ATOM   6448 C CB  . HIS B 1 401 ? 0.453   53.021 90.641  1.00 71.97  ? 1587 HIS B CB  1 
ATOM   6449 C CG  . HIS B 1 401 ? -0.932  52.943 91.213  1.00 64.99  ? 1587 HIS B CG  1 
ATOM   6450 N ND1 . HIS B 1 401 ? -1.704  51.804 91.141  1.00 61.28  ? 1587 HIS B ND1 1 
ATOM   6451 C CD2 . HIS B 1 401 ? -1.676  53.854 91.878  1.00 61.64  ? 1587 HIS B CD2 1 
ATOM   6452 C CE1 . HIS B 1 401 ? -2.873  52.026 91.710  1.00 52.94  ? 1587 HIS B CE1 1 
ATOM   6453 N NE2 . HIS B 1 401 ? -2.881  53.263 92.168  1.00 65.11  ? 1587 HIS B NE2 1 
ATOM   6454 N N   . GLU B 1 402 ? 1.426   55.901 89.927  1.00 59.49  ? 1588 GLU B N   1 
ATOM   6455 C CA  . GLU B 1 402 ? 1.407   57.349 90.152  1.00 83.36  ? 1588 GLU B CA  1 
ATOM   6456 C C   . GLU B 1 402 ? 0.993   58.116 88.896  1.00 92.81  ? 1588 GLU B C   1 
ATOM   6457 O O   . GLU B 1 402 ? 0.085   58.947 88.935  1.00 80.96  ? 1588 GLU B O   1 
ATOM   6458 C CB  . GLU B 1 402 ? 2.772   57.858 90.635  1.00 101.50 ? 1588 GLU B CB  1 
ATOM   6459 C CG  . GLU B 1 402 ? 2.901   59.413 90.613  1.00 124.76 ? 1588 GLU B CG  1 
ATOM   6460 C CD  . GLU B 1 402 ? 4.352   59.918 90.700  1.00 137.87 ? 1588 GLU B CD  1 
ATOM   6461 O OE1 . GLU B 1 402 ? 5.272   59.240 90.181  1.00 146.23 ? 1588 GLU B OE1 1 
ATOM   6462 O OE2 . GLU B 1 402 ? 4.570   61.005 91.287  1.00 131.40 ? 1588 GLU B OE2 1 
ATOM   6463 N N   . LYS B 1 403 ? 1.668   57.817 87.792  1.00 80.09  ? 1589 LYS B N   1 
ATOM   6464 C CA  . LYS B 1 403 ? 1.388   58.459 86.537  1.00 89.81  ? 1589 LYS B CA  1 
ATOM   6465 C C   . LYS B 1 403 ? -0.065  58.239 86.136  1.00 88.06  ? 1589 LYS B C   1 
ATOM   6466 O O   . LYS B 1 403 ? -0.727  59.154 85.661  1.00 92.27  ? 1589 LYS B O   1 
ATOM   6467 C CB  . LYS B 1 403 ? 2.361   57.992 85.434  1.00 72.45  ? 1589 LYS B CB  1 
ATOM   6468 C CG  . LYS B 1 403 ? 3.900   58.110 85.761  1.00 86.61  ? 1589 LYS B CG  1 
ATOM   6469 C CD  . LYS B 1 403 ? 4.357   59.466 86.443  1.00 151.03 ? 1589 LYS B CD  1 
ATOM   6470 C CE  . LYS B 1 403 ? 4.604   60.649 85.459  1.00 68.21  ? 1589 LYS B CE  1 
ATOM   6471 N N   . ARG B 1 404 ? -0.608  57.055 86.334  1.00 81.52  ? 1590 ARG B N   1 
ATOM   6472 C CA  . ARG B 1 404 ? -1.874  56.873 85.675  1.00 85.74  ? 1590 ARG B CA  1 
ATOM   6473 C C   . ARG B 1 404 ? -3.074  56.526 86.520  1.00 81.71  ? 1590 ARG B C   1 
ATOM   6474 O O   . ARG B 1 404 ? -3.910  55.706 86.144  1.00 86.89  ? 1590 ARG B O   1 
ATOM   6475 C CB  . ARG B 1 404 ? -1.730  55.962 84.478  1.00 81.13  ? 1590 ARG B CB  1 
ATOM   6476 C CG  . ARG B 1 404 ? -1.681  54.510 84.778  1.00 76.13  ? 1590 ARG B CG  1 
ATOM   6477 C CD  . ARG B 1 404 ? -1.626  53.837 83.434  1.00 79.70  ? 1590 ARG B CD  1 
ATOM   6478 N NE  . ARG B 1 404 ? -0.238  53.831 83.000  1.00 70.45  ? 1590 ARG B NE  1 
ATOM   6479 C CZ  . ARG B 1 404 ? 0.261   52.936 82.157  1.00 88.48  ? 1590 ARG B CZ  1 
ATOM   6480 N NH1 . ARG B 1 404 ? -0.556  52.002 81.646  1.00 93.99  ? 1590 ARG B NH1 1 
ATOM   6481 N NH2 . ARG B 1 404 ? 1.568   52.969 81.840  1.00 82.37  ? 1590 ARG B NH2 1 
ATOM   6482 N N   . VAL B 1 405 ? -3.201  57.218 87.635  1.00 80.14  ? 1591 VAL B N   1 
ATOM   6483 C CA  . VAL B 1 405 ? -4.252  56.885 88.569  1.00 84.25  ? 1591 VAL B CA  1 
ATOM   6484 C C   . VAL B 1 405 ? -5.318  57.967 88.559  1.00 96.05  ? 1591 VAL B C   1 
ATOM   6485 O O   . VAL B 1 405 ? -4.999  59.153 88.711  1.00 100.39 ? 1591 VAL B O   1 
ATOM   6486 C CB  . VAL B 1 405 ? -3.657  56.653 89.967  1.00 69.79  ? 1591 VAL B CB  1 
ATOM   6487 C CG1 . VAL B 1 405 ? -2.860  57.873 90.433  1.00 56.57  ? 1591 VAL B CG1 1 
ATOM   6488 C CG2 . VAL B 1 405 ? -4.736  56.247 90.939  1.00 50.36  ? 1591 VAL B CG2 1 
ATOM   6489 N N   . SER B 1 406 ? -6.575  57.562 88.361  1.00 99.42  ? 1592 SER B N   1 
ATOM   6490 C CA  . SER B 1 406 ? -7.705  58.504 88.407  1.00 93.53  ? 1592 SER B CA  1 
ATOM   6491 C C   . SER B 1 406 ? -7.613  59.319 89.691  1.00 88.59  ? 1592 SER B C   1 
ATOM   6492 O O   . SER B 1 406 ? -7.095  58.831 90.691  1.00 97.09  ? 1592 SER B O   1 
ATOM   6493 C CB  . SER B 1 406 ? -9.037  57.767 88.352  1.00 87.99  ? 1592 SER B CB  1 
ATOM   6494 O OG  . SER B 1 406 ? -9.265  57.071 89.564  1.00 89.18  ? 1592 SER B OG  1 
ATOM   6495 N N   . ASP B 1 407 ? -8.054  60.569 89.649  1.00 83.52  ? 1593 ASP B N   1 
ATOM   6496 C CA  . ASP B 1 407 ? -7.953  61.455 90.809  1.00 87.06  ? 1593 ASP B CA  1 
ATOM   6497 C C   . ASP B 1 407 ? -8.792  61.136 92.043  1.00 88.46  ? 1593 ASP B C   1 
ATOM   6498 O O   . ASP B 1 407 ? -8.521  61.659 93.120  1.00 85.73  ? 1593 ASP B O   1 
ATOM   6499 C CB  . ASP B 1 407 ? -8.130  62.914 90.383  1.00 93.31  ? 1593 ASP B CB  1 
ATOM   6500 C CG  . ASP B 1 407 ? -6.930  63.441 89.617  1.00 111.52 ? 1593 ASP B CG  1 
ATOM   6501 O OD1 . ASP B 1 407 ? -5.826  62.886 89.789  1.00 88.97  ? 1593 ASP B OD1 1 
ATOM   6502 O OD2 . ASP B 1 407 ? -7.088  64.408 88.844  1.00 114.09 ? 1593 ASP B OD2 1 
ATOM   6503 N N   . ASN B 1 408 ? -9.798  60.286 91.904  1.00 95.86  ? 1594 ASN B N   1 
ATOM   6504 C CA  . ASN B 1 408 ? -10.617 59.948 93.057  1.00 80.20  ? 1594 ASN B CA  1 
ATOM   6505 C C   . ASN B 1 408 ? -9.897  58.956 93.963  1.00 79.70  ? 1594 ASN B C   1 
ATOM   6506 O O   . ASN B 1 408 ? -10.304 58.731 95.098  1.00 76.88  ? 1594 ASN B O   1 
ATOM   6507 C CB  . ASN B 1 408 ? -11.984 59.416 92.628  1.00 64.05  ? 1594 ASN B CB  1 
ATOM   6508 C CG  . ASN B 1 408 ? -11.889 58.355 91.560  1.00 98.55  ? 1594 ASN B CG  1 
ATOM   6509 O OD1 . ASN B 1 408 ? -12.878 57.711 91.216  1.00 101.41 ? 1594 ASN B OD1 1 
ATOM   6510 N ND2 . ASN B 1 408 ? -10.690 58.164 91.027  1.00 115.19 ? 1594 ASN B ND2 1 
ATOM   6511 N N   . LEU B 1 409 ? -8.820  58.371 93.450  1.00 79.56  ? 1595 LEU B N   1 
ATOM   6512 C CA  . LEU B 1 409 ? -8.031  57.401 94.200  1.00 82.24  ? 1595 LEU B CA  1 
ATOM   6513 C C   . LEU B 1 409 ? -6.656  57.945 94.556  1.00 76.63  ? 1595 LEU B C   1 
ATOM   6514 O O   . LEU B 1 409 ? -5.787  57.207 95.005  1.00 73.56  ? 1595 LEU B O   1 
ATOM   6515 C CB  . LEU B 1 409 ? -7.877  56.108 93.400  1.00 74.70  ? 1595 LEU B CB  1 
ATOM   6516 C CG  . LEU B 1 409 ? -9.105  55.206 93.300  1.00 83.42  ? 1595 LEU B CG  1 
ATOM   6517 C CD1 . LEU B 1 409 ? -8.868  54.101 92.294  1.00 57.20  ? 1595 LEU B CD1 1 
ATOM   6518 C CD2 . LEU B 1 409 ? -9.446  54.626 94.658  1.00 74.56  ? 1595 LEU B CD2 1 
ATOM   6519 N N   . ARG B 1 410 ? -6.461  59.239 94.349  1.00 77.23  ? 1596 ARG B N   1 
ATOM   6520 C CA  . ARG B 1 410 ? -5.192  59.873 94.651  1.00 85.39  ? 1596 ARG B CA  1 
ATOM   6521 C C   . ARG B 1 410 ? -4.814  59.675 96.134  1.00 86.50  ? 1596 ARG B C   1 
ATOM   6522 O O   . ARG B 1 410 ? -3.701  59.267 96.437  1.00 81.51  ? 1596 ARG B O   1 
ATOM   6523 C CB  . ARG B 1 410 ? -5.240  61.366 94.264  1.00 69.59  ? 1596 ARG B CB  1 
ATOM   6524 C CG  . ARG B 1 410 ? -3.900  62.078 94.256  1.00 71.08  ? 1596 ARG B CG  1 
ATOM   6525 C CD  . ARG B 1 410 ? -3.014  61.535 93.168  1.00 93.01  ? 1596 ARG B CD  1 
ATOM   6526 N NE  . ARG B 1 410 ? -1.604  61.708 93.504  1.00 91.95  ? 1596 ARG B NE  1 
ATOM   6527 C CZ  . ARG B 1 410 ? -0.621  61.697 92.603  1.00 93.76  ? 1596 ARG B CZ  1 
ATOM   6528 N NH1 . ARG B 1 410 ? -0.916  61.524 91.301  1.00 67.35  ? 1596 ARG B NH1 1 
ATOM   6529 N NH2 . ARG B 1 410 ? 0.646   61.863 93.007  1.00 89.65  ? 1596 ARG B NH2 1 
ATOM   6530 N N   . PRO B 1 411 ? -5.750  59.942 97.057  1.00 72.52  ? 1597 PRO B N   1 
ATOM   6531 C CA  . PRO B 1 411 ? -5.473  59.713 98.478  1.00 77.47  ? 1597 PRO B CA  1 
ATOM   6532 C C   . PRO B 1 411 ? -4.966  58.290 98.757  1.00 78.29  ? 1597 PRO B C   1 
ATOM   6533 O O   . PRO B 1 411 ? -3.999  58.118 99.509  1.00 67.72  ? 1597 PRO B O   1 
ATOM   6534 C CB  . PRO B 1 411 ? -6.851  59.916 99.146  1.00 62.90  ? 1597 PRO B CB  1 
ATOM   6535 C CG  . PRO B 1 411 ? -7.649  60.722 98.196  1.00 64.96  ? 1597 PRO B CG  1 
ATOM   6536 C CD  . PRO B 1 411 ? -7.145  60.371 96.826  1.00 78.38  ? 1597 PRO B CD  1 
ATOM   6537 N N   . PHE B 1 412 ? -5.641  57.304 98.149  1.00 76.19  ? 1598 PHE B N   1 
ATOM   6538 C CA  . PHE B 1 412 ? -5.288  55.880 98.214  1.00 65.62  ? 1598 PHE B CA  1 
ATOM   6539 C C   . PHE B 1 412 ? -3.867  55.615 97.725  1.00 73.71  ? 1598 PHE B C   1 
ATOM   6540 O O   . PHE B 1 412 ? -3.109  54.887 98.371  1.00 56.90  ? 1598 PHE B O   1 
ATOM   6541 C CB  . PHE B 1 412 ? -6.267  55.038 97.398  1.00 61.12  ? 1598 PHE B CB  1 
ATOM   6542 C CG  . PHE B 1 412 ? -5.757  53.668 97.070  1.00 64.74  ? 1598 PHE B CG  1 
ATOM   6543 C CD1 . PHE B 1 412 ? -5.949  52.616 97.950  1.00 62.24  ? 1598 PHE B CD1 1 
ATOM   6544 C CD2 . PHE B 1 412 ? -5.076  53.420 95.879  1.00 68.00  ? 1598 PHE B CD2 1 
ATOM   6545 C CE1 . PHE B 1 412 ? -5.470  51.322 97.655  1.00 67.60  ? 1598 PHE B CE1 1 
ATOM   6546 C CE2 . PHE B 1 412 ? -4.594  52.135 95.571  1.00 67.56  ? 1598 PHE B CE2 1 
ATOM   6547 C CZ  . PHE B 1 412 ? -4.790  51.085 96.463  1.00 59.93  ? 1598 PHE B CZ  1 
ATOM   6548 N N   . HIS B 1 413 ? -3.518  56.195 96.577  1.00 68.43  ? 1599 HIS B N   1 
ATOM   6549 C CA  . HIS B 1 413 ? -2.176  56.065 96.049  1.00 60.07  ? 1599 HIS B CA  1 
ATOM   6550 C C   . HIS B 1 413 ? -1.134  56.702 96.990  1.00 66.56  ? 1599 HIS B C   1 
ATOM   6551 O O   . HIS B 1 413 ? -0.046  56.155 97.205  1.00 56.59  ? 1599 HIS B O   1 
ATOM   6552 C CB  . HIS B 1 413 ? -2.069  56.633 94.620  1.00 65.94  ? 1599 HIS B CB  1 
ATOM   6553 C CG  . HIS B 1 413 ? -0.676  56.591 94.078  1.00 56.38  ? 1599 HIS B CG  1 
ATOM   6554 N ND1 . HIS B 1 413 ? 0.232   57.600 94.298  1.00 50.77  ? 1599 HIS B ND1 1 
ATOM   6555 C CD2 . HIS B 1 413 ? -0.007  55.625 93.409  1.00 60.36  ? 1599 HIS B CD2 1 
ATOM   6556 C CE1 . HIS B 1 413 ? 1.388   57.273 93.757  1.00 59.67  ? 1599 HIS B CE1 1 
ATOM   6557 N NE2 . HIS B 1 413 ? 1.272   56.078 93.215  1.00 68.89  ? 1599 HIS B NE2 1 
ATOM   6558 N N   . ASP B 1 414 ? -1.470  57.848 97.560  1.00 70.63  ? 1600 ASP B N   1 
ATOM   6559 C CA  . ASP B 1 414 ? -0.538  58.553 98.443  1.00 87.79  ? 1600 ASP B CA  1 
ATOM   6560 C C   . ASP B 1 414 ? -0.158  57.709 99.707  1.00 86.92  ? 1600 ASP B C   1 
ATOM   6561 O O   . ASP B 1 414 ? 1.036   57.629 100.091 1.00 69.91  ? 1600 ASP B O   1 
ATOM   6562 C CB  . ASP B 1 414 ? -1.069  59.967 98.808  1.00 81.68  ? 1600 ASP B CB  1 
ATOM   6563 C CG  . ASP B 1 414 ? -1.065  60.948 97.613  1.00 92.70  ? 1600 ASP B CG  1 
ATOM   6564 O OD1 . ASP B 1 414 ? 0.020   61.264 97.078  1.00 93.60  ? 1600 ASP B OD1 1 
ATOM   6565 O OD2 . ASP B 1 414 ? -2.155  61.423 97.227  1.00 97.52  ? 1600 ASP B OD2 1 
ATOM   6566 N N   . ARG B 1 415 ? -1.154  57.061 100.329 1.00 67.08  ? 1601 ARG B N   1 
ATOM   6567 C CA  . ARG B 1 415 ? -0.886  56.168 101.470 1.00 77.63  ? 1601 ARG B CA  1 
ATOM   6568 C C   . ARG B 1 415 ? 0.035   55.044 101.052 1.00 72.64  ? 1601 ARG B C   1 
ATOM   6569 O O   . ARG B 1 415 ? 1.001   54.733 101.735 1.00 50.29  ? 1601 ARG B O   1 
ATOM   6570 C CB  . ARG B 1 415 ? -2.191  55.604 102.034 1.00 63.96  ? 1601 ARG B CB  1 
ATOM   6571 N N   . MET B 1 416 ? -0.285  54.451 99.906  1.00 63.03  ? 1602 MET B N   1 
ATOM   6572 C CA  . MET B 1 416 ? 0.419   53.286 99.392  1.00 63.25  ? 1602 MET B CA  1 
ATOM   6573 C C   . MET B 1 416 ? 1.909   53.578 99.224  1.00 68.73  ? 1602 MET B C   1 
ATOM   6574 O O   . MET B 1 416 ? 2.761   52.727 99.498  1.00 62.95  ? 1602 MET B O   1 
ATOM   6575 C CB  . MET B 1 416 ? -0.191  52.871 98.060  1.00 61.80  ? 1602 MET B CB  1 
ATOM   6576 C CG  . MET B 1 416 ? 0.065   51.419 97.673  1.00 67.78  ? 1602 MET B CG  1 
ATOM   6577 S SD  . MET B 1 416 ? -0.014  51.109 95.881  1.00 82.03  ? 1602 MET B SD  1 
ATOM   6578 C CE  . MET B 1 416 ? -1.712  51.571 95.541  1.00 78.56  ? 1602 MET B CE  1 
ATOM   6579 N N   . GLU B 1 417 ? 2.203   54.792 98.771  1.00 64.01  ? 1603 GLU B N   1 
ATOM   6580 C CA  . GLU B 1 417 ? 3.566   55.280 98.685  1.00 75.69  ? 1603 GLU B CA  1 
ATOM   6581 C C   . GLU B 1 417 ? 4.230   55.373 100.060 1.00 87.04  ? 1603 GLU B C   1 
ATOM   6582 O O   . GLU B 1 417 ? 5.370   54.952 100.216 1.00 95.39  ? 1603 GLU B O   1 
ATOM   6583 C CB  . GLU B 1 417 ? 3.591   56.660 98.021  1.00 78.03  ? 1603 GLU B CB  1 
ATOM   6584 C CG  . GLU B 1 417 ? 3.393   56.655 96.524  1.00 90.02  ? 1603 GLU B CG  1 
ATOM   6585 C CD  . GLU B 1 417 ? 4.356   57.597 95.825  1.00 97.73  ? 1603 GLU B CD  1 
ATOM   6586 O OE1 . GLU B 1 417 ? 5.587   57.447 96.032  1.00 82.27  ? 1603 GLU B OE1 1 
ATOM   6587 O OE2 . GLU B 1 417 ? 3.880   58.488 95.081  1.00 99.87  ? 1603 GLU B OE2 1 
ATOM   6588 N N   . GLU B 1 418 ? 3.521   55.936 101.043 1.00 63.94  ? 1604 GLU B N   1 
ATOM   6589 C CA  . GLU B 1 418 ? 4.065   56.080 102.401 1.00 56.92  ? 1604 GLU B CA  1 
ATOM   6590 C C   . GLU B 1 418 ? 4.484   54.742 102.979 1.00 65.46  ? 1604 GLU B C   1 
ATOM   6591 O O   . GLU B 1 418 ? 5.600   54.620 103.475 1.00 73.09  ? 1604 GLU B O   1 
ATOM   6592 C CB  . GLU B 1 418 ? 3.081   56.764 103.341 1.00 71.34  ? 1604 GLU B CB  1 
ATOM   6593 C CG  . GLU B 1 418 ? 3.106   58.274 103.250 1.00 104.24 ? 1604 GLU B CG  1 
ATOM   6594 C CD  . GLU B 1 418 ? 1.882   58.940 103.892 1.00 115.35 ? 1604 GLU B CD  1 
ATOM   6595 O OE1 . GLU B 1 418 ? 1.356   58.395 104.896 1.00 116.37 ? 1604 GLU B OE1 1 
ATOM   6596 O OE2 . GLU B 1 418 ? 1.450   60.009 103.386 1.00 106.74 ? 1604 GLU B OE2 1 
ATOM   6597 N N   . CYS B 1 419 ? 3.609   53.738 102.897 1.00 49.20  ? 1605 CYS B N   1 
ATOM   6598 C CA  . CYS B 1 419 ? 3.966   52.403 103.335 1.00 57.92  ? 1605 CYS B CA  1 
ATOM   6599 C C   . CYS B 1 419 ? 5.163   51.928 102.567 1.00 72.75  ? 1605 CYS B C   1 
ATOM   6600 O O   . CYS B 1 419 ? 6.095   51.392 103.146 1.00 87.51  ? 1605 CYS B O   1 
ATOM   6601 C CB  . CYS B 1 419 ? 2.858   51.417 103.078 1.00 61.87  ? 1605 CYS B CB  1 
ATOM   6602 S SG  . CYS B 1 419 ? 1.317   51.831 103.804 1.00 69.82  ? 1605 CYS B SG  1 
ATOM   6603 N N   . PHE B 1 420 ? 5.131   52.102 101.255 1.00 67.78  ? 1606 PHE B N   1 
ATOM   6604 C CA  . PHE B 1 420 ? 6.236   51.675 100.449 1.00 76.10  ? 1606 PHE B CA  1 
ATOM   6605 C C   . PHE B 1 420 ? 7.538   52.321 100.899 1.00 76.27  ? 1606 PHE B C   1 
ATOM   6606 O O   . PHE B 1 420 ? 8.532   51.630 101.117 1.00 60.52  ? 1606 PHE B O   1 
ATOM   6607 C CB  . PHE B 1 420 ? 6.016   51.980 98.977  1.00 73.08  ? 1606 PHE B CB  1 
ATOM   6608 C CG  . PHE B 1 420 ? 7.207   51.631 98.144  1.00 76.80  ? 1606 PHE B CG  1 
ATOM   6609 C CD1 . PHE B 1 420 ? 7.648   50.316 98.071  1.00 90.25  ? 1606 PHE B CD1 1 
ATOM   6610 C CD2 . PHE B 1 420 ? 7.930   52.606 97.500  1.00 76.80  ? 1606 PHE B CD2 1 
ATOM   6611 C CE1 . PHE B 1 420 ? 8.761   49.980 97.344  1.00 79.16  ? 1606 PHE B CE1 1 
ATOM   6612 C CE2 . PHE B 1 420 ? 9.052   52.275 96.775  1.00 66.14  ? 1606 PHE B CE2 1 
ATOM   6613 C CZ  . PHE B 1 420 ? 9.464   50.961 96.702  1.00 64.20  ? 1606 PHE B CZ  1 
ATOM   6614 N N   . LYS B 1 421 ? 7.536   53.650 101.001 1.00 72.04  ? 1607 LYS B N   1 
ATOM   6615 C CA  . LYS B 1 421 ? 8.684   54.402 101.514 1.00 80.65  ? 1607 LYS B CA  1 
ATOM   6616 C C   . LYS B 1 421 ? 9.186   53.763 102.814 1.00 79.25  ? 1607 LYS B C   1 
ATOM   6617 O O   . LYS B 1 421 ? 10.348  53.351 102.914 1.00 65.34  ? 1607 LYS B O   1 
ATOM   6618 C CB  . LYS B 1 421 ? 8.291   55.859 101.788 1.00 74.98  ? 1607 LYS B CB  1 
ATOM   6619 C CG  . LYS B 1 421 ? 7.650   56.620 100.636 1.00 102.42 ? 1607 LYS B CG  1 
ATOM   6620 C CD  . LYS B 1 421 ? 8.609   57.614 99.969  1.00 109.15 ? 1607 LYS B CD  1 
ATOM   6621 C CE  . LYS B 1 421 ? 7.811   58.635 99.130  1.00 126.62 ? 1607 LYS B CE  1 
ATOM   6622 N NZ  . LYS B 1 421 ? 8.684   59.636 98.420  1.00 132.34 ? 1607 LYS B NZ  1 
ATOM   6623 N N   . ASN B 1 422 ? 8.275   53.681 103.787 1.00 70.17  ? 1608 ASN B N   1 
ATOM   6624 C CA  . ASN B 1 422 ? 8.529   53.035 105.064 1.00 81.07  ? 1608 ASN B CA  1 
ATOM   6625 C C   . ASN B 1 422 ? 9.189   51.708 104.827 1.00 89.46  ? 1608 ASN B C   1 
ATOM   6626 O O   . ASN B 1 422 ? 10.204  51.391 105.439 1.00 88.39  ? 1608 ASN B O   1 
ATOM   6627 C CB  . ASN B 1 422 ? 7.217   52.777 105.810 1.00 88.24  ? 1608 ASN B CB  1 
ATOM   6628 C CG  . ASN B 1 422 ? 7.201   53.403 107.185 1.00 103.41 ? 1608 ASN B CG  1 
ATOM   6629 O OD1 . ASN B 1 422 ? 7.154   52.714 108.213 1.00 102.27 ? 1608 ASN B OD1 1 
ATOM   6630 N ND2 . ASN B 1 422 ? 7.238   54.731 107.212 1.00 109.00 ? 1608 ASN B ND2 1 
ATOM   6631 N N   . LEU B 1 423 ? 8.586   50.940 103.926 1.00 92.85  ? 1609 LEU B N   1 
ATOM   6632 C CA  . LEU B 1 423 ? 9.025   49.588 103.617 1.00 89.32  ? 1609 LEU B CA  1 
ATOM   6633 C C   . LEU B 1 423 ? 10.393  49.579 102.940 1.00 91.60  ? 1609 LEU B C   1 
ATOM   6634 O O   . LEU B 1 423 ? 11.308  48.897 103.407 1.00 95.56  ? 1609 LEU B O   1 
ATOM   6635 C CB  . LEU B 1 423 ? 7.970   48.881 102.758 1.00 88.69  ? 1609 LEU B CB  1 
ATOM   6636 C CG  . LEU B 1 423 ? 8.088   47.397 102.395 1.00 67.66  ? 1609 LEU B CG  1 
ATOM   6637 C CD1 . LEU B 1 423 ? 9.125   46.677 103.166 1.00 72.30  ? 1609 LEU B CD1 1 
ATOM   6638 C CD2 . LEU B 1 423 ? 6.747   46.730 102.631 1.00 75.86  ? 1609 LEU B CD2 1 
ATOM   6639 N N   . LYS B 1 424 ? 10.530  50.347 101.856 1.00 86.94  ? 1610 LYS B N   1 
ATOM   6640 C CA  . LYS B 1 424 ? 11.812  50.479 101.161 1.00 77.43  ? 1610 LYS B CA  1 
ATOM   6641 C C   . LYS B 1 424 ? 12.893  50.618 102.202 1.00 91.30  ? 1610 LYS B C   1 
ATOM   6642 O O   . LYS B 1 424 ? 13.887  49.898 102.211 1.00 100.31 ? 1610 LYS B O   1 
ATOM   6643 C CB  . LYS B 1 424 ? 11.813  51.714 100.259 1.00 77.70  ? 1610 LYS B CB  1 
ATOM   6644 C CG  . LYS B 1 424 ? 13.219  52.183 99.856  1.00 83.69  ? 1610 LYS B CG  1 
ATOM   6645 C CD  . LYS B 1 424 ? 13.388  52.332 98.346  1.00 85.90  ? 1610 LYS B CD  1 
ATOM   6646 N N   . MET B 1 425 ? 12.620  51.543 103.106 1.00 91.25  ? 1611 MET B N   1 
ATOM   6647 C CA  . MET B 1 425 ? 13.523  51.982 104.129 1.00 89.34  ? 1611 MET B CA  1 
ATOM   6648 C C   . MET B 1 425 ? 14.010  50.884 105.076 1.00 92.09  ? 1611 MET B C   1 
ATOM   6649 O O   . MET B 1 425 ? 15.219  50.636 105.161 1.00 95.47  ? 1611 MET B O   1 
ATOM   6650 C CB  . MET B 1 425 ? 12.821  53.082 104.892 1.00 86.32  ? 1611 MET B CB  1 
ATOM   6651 C CG  . MET B 1 425 ? 13.749  53.991 105.580 1.00 71.76  ? 1611 MET B CG  1 
ATOM   6652 S SD  . MET B 1 425 ? 13.139  54.110 107.271 1.00 166.81 ? 1611 MET B SD  1 
ATOM   6653 C CE  . MET B 1 425 ? 12.588  55.772 107.121 1.00 105.57 ? 1611 MET B CE  1 
ATOM   6654 N N   . LYS B 1 426 ? 13.074  50.223 105.768 1.00 91.18  ? 1612 LYS B N   1 
ATOM   6655 C CA  . LYS B 1 426 ? 13.402  49.146 106.711 1.00 78.93  ? 1612 LYS B CA  1 
ATOM   6656 C C   . LYS B 1 426 ? 14.143  48.027 106.008 1.00 90.33  ? 1612 LYS B C   1 
ATOM   6657 O O   . LYS B 1 426 ? 15.042  47.428 106.581 1.00 101.94 ? 1612 LYS B O   1 
ATOM   6658 C CB  . LYS B 1 426 ? 12.134  48.606 107.374 1.00 67.81  ? 1612 LYS B CB  1 
ATOM   6659 C CG  . LYS B 1 426 ? 11.447  49.596 108.301 1.00 77.80  ? 1612 LYS B CG  1 
ATOM   6660 N N   . VAL B 1 427 ? 13.784  47.776 104.753 1.00 83.54  ? 1613 VAL B N   1 
ATOM   6661 C CA  . VAL B 1 427 ? 14.392  46.702 103.983 1.00 86.03  ? 1613 VAL B CA  1 
ATOM   6662 C C   . VAL B 1 427 ? 15.779  47.066 103.487 1.00 87.73  ? 1613 VAL B C   1 
ATOM   6663 O O   . VAL B 1 427 ? 16.675  46.222 103.474 1.00 88.87  ? 1613 VAL B O   1 
ATOM   6664 C CB  . VAL B 1 427 ? 13.498  46.263 102.801 1.00 80.34  ? 1613 VAL B CB  1 
ATOM   6665 C CG1 . VAL B 1 427 ? 14.257  45.336 101.827 1.00 57.00  ? 1613 VAL B CG1 1 
ATOM   6666 C CG2 . VAL B 1 427 ? 12.265  45.572 103.328 1.00 67.89  ? 1613 VAL B CG2 1 
ATOM   6667 N N   . GLU B 1 428 ? 15.970  48.300 103.071 1.00 98.82  ? 1614 GLU B N   1 
ATOM   6668 C CA  . GLU B 1 428 ? 17.254  48.653 102.523 1.00 98.58  ? 1614 GLU B CA  1 
ATOM   6669 C C   . GLU B 1 428 ? 18.342  48.454 103.544 1.00 104.88 ? 1614 GLU B C   1 
ATOM   6670 O O   . GLU B 1 428 ? 19.399  47.934 103.227 1.00 116.20 ? 1614 GLU B O   1 
ATOM   6671 C CB  . GLU B 1 428 ? 17.240  50.096 102.063 1.00 93.29  ? 1614 GLU B CB  1 
ATOM   6672 C CG  . GLU B 1 428 ? 16.102  50.412 101.153 1.00 104.47 ? 1614 GLU B CG  1 
ATOM   6673 C CD  . GLU B 1 428 ? 16.497  51.370 100.069 1.00 115.61 ? 1614 GLU B CD  1 
ATOM   6674 O OE1 . GLU B 1 428 ? 16.476  52.586 100.315 1.00 116.47 ? 1614 GLU B OE1 1 
ATOM   6675 O OE2 . GLU B 1 428 ? 16.835  50.912 98.969  1.00 111.96 ? 1614 GLU B OE2 1 
ATOM   6676 N N   . LYS B 1 429 ? 18.074  48.853 104.775 1.00 104.53 ? 1615 LYS B N   1 
ATOM   6677 C CA  . LYS B 1 429 ? 19.038  48.708 105.846 1.00 103.23 ? 1615 LYS B CA  1 
ATOM   6678 C C   . LYS B 1 429 ? 19.337  47.256 106.131 1.00 104.66 ? 1615 LYS B C   1 
ATOM   6679 O O   . LYS B 1 429 ? 20.474  46.819 106.066 1.00 105.54 ? 1615 LYS B O   1 
ATOM   6680 C CB  . LYS B 1 429 ? 18.532  49.396 107.115 1.00 78.34  ? 1615 LYS B CB  1 
ATOM   6681 N N   . GLU B 1 430 ? 18.295  46.505 106.433 1.00 105.66 ? 1616 GLU B N   1 
ATOM   6682 C CA  . GLU B 1 430 ? 18.429  45.110 106.788 1.00 113.34 ? 1616 GLU B CA  1 
ATOM   6683 C C   . GLU B 1 430 ? 19.049  44.341 105.657 1.00 101.80 ? 1616 GLU B C   1 
ATOM   6684 O O   . GLU B 1 430 ? 19.902  43.497 105.866 1.00 98.90  ? 1616 GLU B O   1 
ATOM   6685 C CB  . GLU B 1 430 ? 17.047  44.545 107.070 1.00 121.87 ? 1616 GLU B CB  1 
ATOM   6686 C CG  . GLU B 1 430 ? 16.916  43.919 108.419 1.00 118.97 ? 1616 GLU B CG  1 
ATOM   6687 C CD  . GLU B 1 430 ? 18.189  43.289 108.837 1.00 116.65 ? 1616 GLU B CD  1 
ATOM   6688 O OE1 . GLU B 1 430 ? 19.045  43.082 107.959 1.00 123.81 ? 1616 GLU B OE1 1 
ATOM   6689 O OE2 . GLU B 1 430 ? 18.334  43.015 110.036 1.00 115.35 ? 1616 GLU B OE2 1 
ATOM   6690 N N   . TYR B 1 431 ? 18.620  44.650 104.449 1.00 102.14 ? 1617 TYR B N   1 
ATOM   6691 C CA  . TYR B 1 431 ? 19.164  44.012 103.287 1.00 99.38  ? 1617 TYR B CA  1 
ATOM   6692 C C   . TYR B 1 431 ? 19.608  45.044 102.262 1.00 103.45 ? 1617 TYR B C   1 
ATOM   6693 O O   . TYR B 1 431 ? 18.914  46.007 101.984 1.00 112.58 ? 1617 TYR B O   1 
ATOM   6694 C CB  . TYR B 1 431 ? 18.099  43.185 102.564 1.00 82.73  ? 1617 TYR B CB  1 
ATOM   6695 C CG  . TYR B 1 431 ? 17.232  42.416 103.514 1.00 86.61  ? 1617 TYR B CG  1 
ATOM   6696 C CD1 . TYR B 1 431 ? 17.733  41.352 104.221 1.00 91.16  ? 1617 TYR B CD1 1 
ATOM   6697 C CD2 . TYR B 1 431 ? 15.918  42.764 103.716 1.00 87.42  ? 1617 TYR B CD2 1 
ATOM   6698 C CE1 . TYR B 1 431 ? 16.951  40.654 105.094 1.00 85.86  ? 1617 TYR B CE1 1 
ATOM   6699 C CE2 . TYR B 1 431 ? 15.134  42.073 104.586 1.00 85.94  ? 1617 TYR B CE2 1 
ATOM   6700 C CZ  . TYR B 1 431 ? 15.657  41.020 105.268 1.00 88.11  ? 1617 TYR B CZ  1 
ATOM   6701 O OH  . TYR B 1 431 ? 14.885  40.321 106.137 1.00 78.20  ? 1617 TYR B OH  1 
ATOM   6702 N N   . GLY B 1 432 ? 20.791  44.850 101.736 1.00 108.66 ? 1618 GLY B N   1 
ATOM   6703 C CA  . GLY B 1 432 ? 21.390  45.851 100.888 1.00 129.68 ? 1618 GLY B CA  1 
ATOM   6704 C C   . GLY B 1 432 ? 20.497  46.170 99.705  1.00 118.19 ? 1618 GLY B C   1 
ATOM   6705 O O   . GLY B 1 432 ? 19.716  45.349 99.282  1.00 115.67 ? 1618 GLY B O   1 
ATOM   6706 N N   . VAL B 1 433 ? 20.608  47.382 99.200  1.00 99.67  ? 1619 VAL B N   1 
ATOM   6707 C CA  . VAL B 1 433 ? 19.820  47.794 98.067  1.00 104.26 ? 1619 VAL B CA  1 
ATOM   6708 C C   . VAL B 1 433 ? 20.182  46.924 96.885  1.00 106.42 ? 1619 VAL B C   1 
ATOM   6709 O O   . VAL B 1 433 ? 21.339  46.618 96.678  1.00 112.47 ? 1619 VAL B O   1 
ATOM   6710 C CB  . VAL B 1 433 ? 20.188  49.193 97.676  1.00 96.87  ? 1619 VAL B CB  1 
ATOM   6711 C CG1 . VAL B 1 433 ? 20.837  49.170 96.332  1.00 70.80  ? 1619 VAL B CG1 1 
ATOM   6712 C CG2 . VAL B 1 433 ? 18.977  50.078 97.683  1.00 98.87  ? 1619 VAL B CG2 1 
ATOM   6713 N N   . ARG B 1 434 ? 19.188  46.528 96.105  1.00 98.02  ? 1620 ARG B N   1 
ATOM   6714 C CA  . ARG B 1 434 ? 19.424  45.690 94.943  1.00 93.28  ? 1620 ARG B CA  1 
ATOM   6715 C C   . ARG B 1 434 ? 18.874  46.370 93.710  1.00 93.70  ? 1620 ARG B C   1 
ATOM   6716 O O   . ARG B 1 434 ? 18.312  47.452 93.804  1.00 87.56  ? 1620 ARG B O   1 
ATOM   6717 C CB  . ARG B 1 434 ? 18.787  44.311 95.125  1.00 58.32  ? 1620 ARG B CB  1 
ATOM   6718 N N   . GLN C 2 17  ? -18.209 49.658 167.054 1.00 75.00  ? -2   GLN C N   1 
ATOM   6719 C CA  . GLN C 2 17  ? -16.908 49.620 166.400 1.00 73.10  ? -2   GLN C CA  1 
ATOM   6720 C C   . GLN C 2 17  ? -17.004 49.974 164.920 1.00 65.96  ? -2   GLN C C   1 
ATOM   6721 O O   . GLN C 2 17  ? -15.992 50.095 164.237 1.00 74.55  ? -2   GLN C O   1 
ATOM   6722 C CB  . GLN C 2 17  ? -16.271 48.239 166.566 1.00 63.70  ? -2   GLN C CB  1 
ATOM   6723 N N   . GLY C 2 18  ? -18.227 50.143 164.433 1.00 69.47  ? -1   GLY C N   1 
ATOM   6724 C CA  . GLY C 2 18  ? -18.460 50.477 163.041 1.00 68.28  ? -1   GLY C CA  1 
ATOM   6725 C C   . GLY C 2 18  ? -18.742 49.253 162.194 1.00 76.16  ? -1   GLY C C   1 
ATOM   6726 O O   . GLY C 2 18  ? -18.441 48.132 162.592 1.00 91.25  ? -1   GLY C O   1 
ATOM   6727 N N   . THR C 2 19  ? -19.322 49.476 161.020 1.00 86.90  ? 0    THR C N   1 
ATOM   6728 C CA  . THR C 2 19  ? -19.662 48.399 160.094 1.00 97.95  ? 0    THR C CA  1 
ATOM   6729 C C   . THR C 2 19  ? -19.198 48.724 158.681 1.00 93.14  ? 0    THR C C   1 
ATOM   6730 O O   . THR C 2 19  ? -18.926 49.878 158.362 1.00 78.75  ? 0    THR C O   1 
ATOM   6731 C CB  . THR C 2 19  ? -21.164 48.095 160.085 1.00 108.26 ? 0    THR C CB  1 
ATOM   6732 O OG1 . THR C 2 19  ? -21.537 47.514 161.337 1.00 126.68 ? 0    THR C OG1 1 
ATOM   6733 C CG2 . THR C 2 19  ? -21.494 47.118 158.975 1.00 96.64  ? 0    THR C CG2 1 
ATOM   6734 N N   . MET C 2 20  ? -19.097 47.700 157.841 1.00 82.85  ? 1    MET C N   1 
ATOM   6735 C CA  . MET C 2 20  ? -18.646 47.897 156.468 1.00 63.51  ? 1    MET C CA  1 
ATOM   6736 C C   . MET C 2 20  ? -19.667 47.888 155.334 1.00 70.36  ? 1    MET C C   1 
ATOM   6737 O O   . MET C 2 20  ? -20.420 46.936 155.152 1.00 72.60  ? 1    MET C O   1 
ATOM   6738 C CB  . MET C 2 20  ? -17.571 46.870 156.120 1.00 47.12  ? 1    MET C CB  1 
ATOM   6739 C CG  . MET C 2 20  ? -16.204 47.183 156.656 1.00 58.97  ? 1    MET C CG  1 
ATOM   6740 S SD  . MET C 2 20  ? -14.989 46.177 155.812 1.00 85.08  ? 1    MET C SD  1 
ATOM   6741 C CE  . MET C 2 20  ? -15.838 44.607 155.776 1.00 75.57  ? 1    MET C CE  1 
ATOM   6742 N N   . GLN C 2 21  ? -19.655 48.973 154.572 1.00 52.05  ? 2    GLN C N   1 
ATOM   6743 C CA  . GLN C 2 21  ? -20.489 49.164 153.421 1.00 58.78  ? 2    GLN C CA  1 
ATOM   6744 C C   . GLN C 2 21  ? -19.949 48.354 152.283 1.00 76.15  ? 2    GLN C C   1 
ATOM   6745 O O   . GLN C 2 21  ? -18.771 48.418 151.975 1.00 70.59  ? 2    GLN C O   1 
ATOM   6746 C CB  . GLN C 2 21  ? -20.567 50.617 153.023 1.00 54.40  ? 2    GLN C CB  1 
ATOM   6747 C CG  . GLN C 2 21  ? -21.979 50.967 152.585 1.00 86.53  ? 2    GLN C CG  1 
ATOM   6748 C CD  . GLN C 2 21  ? -21.998 51.899 151.403 1.00 91.77  ? 2    GLN C CD  1 
ATOM   6749 O OE1 . GLN C 2 21  ? -21.557 53.055 151.494 1.00 88.81  ? 2    GLN C OE1 1 
ATOM   6750 N NE2 . GLN C 2 21  ? -22.515 51.408 150.276 1.00 88.15  ? 2    GLN C NE2 1 
ATOM   6751 N N   . ALA C 2 22  ? -20.820 47.561 151.674 1.00 76.37  ? 3    ALA C N   1 
ATOM   6752 C CA  . ALA C 2 22  ? -20.414 46.731 150.558 1.00 63.97  ? 3    ALA C CA  1 
ATOM   6753 C C   . ALA C 2 22  ? -20.662 47.532 149.300 1.00 69.45  ? 3    ALA C C   1 
ATOM   6754 O O   . ALA C 2 22  ? -21.788 47.969 149.057 1.00 82.92  ? 3    ALA C O   1 
ATOM   6755 C CB  . ALA C 2 22  ? -21.183 45.427 150.547 1.00 47.36  ? 3    ALA C CB  1 
ATOM   6756 N N   . ILE C 2 23  ? -19.602 47.760 148.527 1.00 57.49  ? 4    ILE C N   1 
ATOM   6757 C CA  . ILE C 2 23  ? -19.717 48.455 147.253 1.00 60.47  ? 4    ILE C CA  1 
ATOM   6758 C C   . ILE C 2 23  ? -19.389 47.528 146.073 1.00 44.81  ? 4    ILE C C   1 
ATOM   6759 O O   . ILE C 2 23  ? -18.333 46.903 146.020 1.00 35.22  ? 4    ILE C O   1 
ATOM   6760 C CB  . ILE C 2 23  ? -18.837 49.695 147.233 1.00 56.72  ? 4    ILE C CB  1 
ATOM   6761 C CG1 . ILE C 2 23  ? -19.245 50.619 148.376 1.00 42.02  ? 4    ILE C CG1 1 
ATOM   6762 C CG2 . ILE C 2 23  ? -18.914 50.397 145.868 1.00 48.80  ? 4    ILE C CG2 1 
ATOM   6763 C CD1 . ILE C 2 23  ? -18.665 51.978 148.275 1.00 40.49  ? 4    ILE C CD1 1 
ATOM   6764 N N   . LYS C 2 24  ? -20.323 47.413 145.140 1.00 42.02  ? 5    LYS C N   1 
ATOM   6765 C CA  . LYS C 2 24  ? -20.137 46.569 143.972 1.00 46.04  ? 5    LYS C CA  1 
ATOM   6766 C C   . LYS C 2 24  ? -19.819 47.465 142.818 1.00 64.12  ? 5    LYS C C   1 
ATOM   6767 O O   . LYS C 2 24  ? -20.650 48.288 142.417 1.00 48.32  ? 5    LYS C O   1 
ATOM   6768 C CB  . LYS C 2 24  ? -21.384 45.780 143.670 1.00 49.00  ? 5    LYS C CB  1 
ATOM   6769 C CG  . LYS C 2 24  ? -21.545 45.371 142.216 1.00 49.54  ? 5    LYS C CG  1 
ATOM   6770 C CD  . LYS C 2 24  ? -22.308 44.063 142.115 1.00 55.02  ? 5    LYS C CD  1 
ATOM   6771 C CE  . LYS C 2 24  ? -23.291 44.078 140.987 1.00 52.36  ? 5    LYS C CE  1 
ATOM   6772 N NZ  . LYS C 2 24  ? -24.008 42.793 140.946 1.00 57.72  ? 5    LYS C NZ  1 
ATOM   6773 N N   . CYS C 2 25  ? -18.589 47.314 142.322 1.00 50.55  ? 6    CYS C N   1 
ATOM   6774 C CA  . CYS C 2 25  ? -18.043 48.097 141.218 1.00 59.35  ? 6    CYS C CA  1 
ATOM   6775 C C   . CYS C 2 25  ? -17.791 47.199 139.985 1.00 45.61  ? 6    CYS C C   1 
ATOM   6776 O O   . CYS C 2 25  ? -17.078 46.190 140.044 1.00 49.05  ? 6    CYS C O   1 
ATOM   6777 C CB  . CYS C 2 25  ? -16.769 48.778 141.669 1.00 47.89  ? 6    CYS C CB  1 
ATOM   6778 S SG  . CYS C 2 25  ? -15.961 49.659 140.362 1.00 59.22  ? 6    CYS C SG  1 
ATOM   6779 N N   . VAL C 2 26  ? -18.408 47.542 138.871 1.00 50.07  ? 7    VAL C N   1 
ATOM   6780 C CA  . VAL C 2 26  ? -18.290 46.689 137.697 1.00 54.47  ? 7    VAL C CA  1 
ATOM   6781 C C   . VAL C 2 26  ? -17.419 47.378 136.663 1.00 57.20  ? 7    VAL C C   1 
ATOM   6782 O O   . VAL C 2 26  ? -17.643 48.559 136.333 1.00 42.80  ? 7    VAL C O   1 
ATOM   6783 C CB  . VAL C 2 26  ? -19.685 46.241 137.138 1.00 55.95  ? 7    VAL C CB  1 
ATOM   6784 C CG1 . VAL C 2 26  ? -19.544 45.526 135.793 1.00 33.01  ? 7    VAL C CG1 1 
ATOM   6785 C CG2 . VAL C 2 26  ? -20.442 45.367 138.182 1.00 33.29  ? 7    VAL C CG2 1 
ATOM   6786 N N   . VAL C 2 27  ? -16.422 46.620 136.196 1.00 45.41  ? 8    VAL C N   1 
ATOM   6787 C CA  . VAL C 2 27  ? -15.400 47.112 135.286 1.00 65.44  ? 8    VAL C CA  1 
ATOM   6788 C C   . VAL C 2 27  ? -15.608 46.570 133.860 1.00 58.77  ? 8    VAL C C   1 
ATOM   6789 O O   . VAL C 2 27  ? -15.599 45.364 133.635 1.00 52.77  ? 8    VAL C O   1 
ATOM   6790 C CB  . VAL C 2 27  ? -13.964 46.769 135.779 1.00 42.03  ? 8    VAL C CB  1 
ATOM   6791 C CG1 . VAL C 2 27  ? -12.920 47.693 135.109 1.00 45.42  ? 8    VAL C CG1 1 
ATOM   6792 C CG2 . VAL C 2 27  ? -13.897 46.892 137.264 1.00 41.88  ? 8    VAL C CG2 1 
ATOM   6793 N N   . VAL C 2 28  ? -15.762 47.497 132.916 1.00 41.74  ? 9    VAL C N   1 
ATOM   6794 C CA  . VAL C 2 28  ? -16.037 47.194 131.520 1.00 53.50  ? 9    VAL C CA  1 
ATOM   6795 C C   . VAL C 2 28  ? -15.068 47.905 130.588 1.00 65.64  ? 9    VAL C C   1 
ATOM   6796 O O   . VAL C 2 28  ? -14.547 48.982 130.904 1.00 57.44  ? 9    VAL C O   1 
ATOM   6797 C CB  . VAL C 2 28  ? -17.477 47.583 131.122 1.00 55.25  ? 9    VAL C CB  1 
ATOM   6798 C CG1 . VAL C 2 28  ? -18.482 46.861 132.010 1.00 53.14  ? 9    VAL C CG1 1 
ATOM   6799 C CG2 . VAL C 2 28  ? -17.685 49.099 131.177 1.00 39.62  ? 9    VAL C CG2 1 
ATOM   6800 N N   . GLY C 2 29  ? -14.864 47.294 129.418 1.00 65.76  ? 10   GLY C N   1 
ATOM   6801 C CA  . GLY C 2 29  ? -13.939 47.799 128.402 1.00 56.51  ? 10   GLY C CA  1 
ATOM   6802 C C   . GLY C 2 29  ? -13.422 46.655 127.577 1.00 53.85  ? 10   GLY C C   1 
ATOM   6803 O O   . GLY C 2 29  ? -13.692 45.506 127.885 1.00 64.49  ? 10   GLY C O   1 
ATOM   6804 N N   . ASP C 2 30  ? -12.674 46.978 126.530 1.00 59.22  ? 11   ASP C N   1 
ATOM   6805 C CA  . ASP C 2 30  ? -12.127 45.972 125.620 1.00 59.85  ? 11   ASP C CA  1 
ATOM   6806 C C   . ASP C 2 30  ? -11.062 45.131 126.319 1.00 58.45  ? 11   ASP C C   1 
ATOM   6807 O O   . ASP C 2 30  ? -10.428 45.565 127.293 1.00 56.62  ? 11   ASP C O   1 
ATOM   6808 C CB  . ASP C 2 30  ? -11.539 46.620 124.354 1.00 58.27  ? 11   ASP C CB  1 
ATOM   6809 C CG  . ASP C 2 30  ? -12.573 47.445 123.543 1.00 71.81  ? 11   ASP C CG  1 
ATOM   6810 O OD1 . ASP C 2 30  ? -13.800 47.296 123.721 1.00 72.54  ? 11   ASP C OD1 1 
ATOM   6811 O OD2 . ASP C 2 30  ? -12.148 48.251 122.688 1.00 64.70  ? 11   ASP C OD2 1 
ATOM   6812 N N   . GLY C 2 31  ? -10.884 43.914 125.825 1.00 57.71  ? 12   GLY C N   1 
ATOM   6813 C CA  . GLY C 2 31  ? -9.855  43.013 126.332 1.00 59.61  ? 12   GLY C CA  1 
ATOM   6814 C C   . GLY C 2 31  ? -8.458  43.601 126.248 1.00 71.26  ? 12   GLY C C   1 
ATOM   6815 O O   . GLY C 2 31  ? -7.594  43.273 127.062 1.00 91.01  ? 12   GLY C O   1 
ATOM   6816 N N   . ALA C 2 32  ? -8.232  44.488 125.281 1.00 62.83  ? 13   ALA C N   1 
ATOM   6817 C CA  . ALA C 2 32  ? -6.879  45.004 125.010 1.00 69.76  ? 13   ALA C CA  1 
ATOM   6818 C C   . ALA C 2 32  ? -6.459  46.096 126.002 1.00 76.59  ? 13   ALA C C   1 
ATOM   6819 O O   . ALA C 2 32  ? -5.261  46.354 126.203 1.00 68.57  ? 13   ALA C O   1 
ATOM   6820 C CB  . ALA C 2 32  ? -6.786  45.517 123.571 1.00 81.47  ? 13   ALA C CB  1 
ATOM   6821 N N   . VAL C 2 33  ? -7.464  46.703 126.620 1.00 61.83  ? 14   VAL C N   1 
ATOM   6822 C CA  . VAL C 2 33  ? -7.285  47.750 127.609 1.00 44.95  ? 14   VAL C CA  1 
ATOM   6823 C C   . VAL C 2 33  ? -6.328  47.330 128.711 1.00 72.36  ? 14   VAL C C   1 
ATOM   6824 O O   . VAL C 2 33  ? -5.507  48.120 129.164 1.00 63.83  ? 14   VAL C O   1 
ATOM   6825 C CB  . VAL C 2 33  ? -8.623  48.090 128.262 1.00 59.75  ? 14   VAL C CB  1 
ATOM   6826 C CG1 . VAL C 2 33  ? -8.434  49.095 129.372 1.00 82.24  ? 14   VAL C CG1 1 
ATOM   6827 C CG2 . VAL C 2 33  ? -9.598  48.592 127.227 1.00 62.23  ? 14   VAL C CG2 1 
ATOM   6828 N N   . GLY C 2 34  ? -6.444  46.082 129.148 1.00 67.65  ? 15   GLY C N   1 
ATOM   6829 C CA  . GLY C 2 34  ? -5.600  45.568 130.209 1.00 63.00  ? 15   GLY C CA  1 
ATOM   6830 C C   . GLY C 2 34  ? -6.094  46.038 131.559 1.00 68.16  ? 15   GLY C C   1 
ATOM   6831 O O   . GLY C 2 34  ? -5.329  46.544 132.373 1.00 67.96  ? 15   GLY C O   1 
ATOM   6832 N N   . LYS C 2 35  ? -7.390  45.870 131.790 1.00 48.54  ? 16   LYS C N   1 
ATOM   6833 C CA  . LYS C 2 35  ? -8.015  46.291 133.034 1.00 48.20  ? 16   LYS C CA  1 
ATOM   6834 C C   . LYS C 2 35  ? -7.795  45.297 134.165 1.00 48.06  ? 16   LYS C C   1 
ATOM   6835 O O   . LYS C 2 35  ? -7.719  45.682 135.323 1.00 62.44  ? 16   LYS C O   1 
ATOM   6836 C CB  . LYS C 2 35  ? -9.507  46.527 132.819 1.00 32.57  ? 16   LYS C CB  1 
ATOM   6837 C CG  . LYS C 2 35  ? -10.120 45.624 131.771 1.00 64.32  ? 16   LYS C CG  1 
ATOM   6838 C CD  . LYS C 2 35  ? -11.609 45.462 131.970 1.00 48.13  ? 16   LYS C CD  1 
ATOM   6839 C CE  . LYS C 2 35  ? -12.109 44.245 131.224 1.00 72.18  ? 16   LYS C CE  1 
ATOM   6840 N NZ  . LYS C 2 35  ? -13.427 43.790 131.721 1.00 69.99  ? 16   LYS C NZ  1 
ATOM   6841 N N   . THR C 2 36  ? -7.692  44.019 133.829 1.00 38.37  ? 17   THR C N   1 
ATOM   6842 C CA  . THR C 2 36  ? -7.470  42.997 134.839 1.00 48.23  ? 17   THR C CA  1 
ATOM   6843 C C   . THR C 2 36  ? -6.243  43.342 135.666 1.00 43.72  ? 17   THR C C   1 
ATOM   6844 O O   . THR C 2 36  ? -6.237  43.169 136.880 1.00 48.73  ? 17   THR C O   1 
ATOM   6845 C CB  . THR C 2 36  ? -7.289  41.615 134.214 1.00 51.54  ? 17   THR C CB  1 
ATOM   6846 O OG1 . THR C 2 36  ? -8.498  41.231 133.553 1.00 54.26  ? 17   THR C OG1 1 
ATOM   6847 C CG2 . THR C 2 36  ? -6.966  40.599 135.285 1.00 41.78  ? 17   THR C CG2 1 
ATOM   6848 N N   . CYS C 2 37  ? -5.202  43.834 135.005 1.00 43.36  ? 18   CYS C N   1 
ATOM   6849 C CA  . CYS C 2 37  ? -3.987  44.234 135.714 1.00 56.48  ? 18   CYS C CA  1 
ATOM   6850 C C   . CYS C 2 37  ? -4.238  45.356 136.718 1.00 50.89  ? 18   CYS C C   1 
ATOM   6851 O O   . CYS C 2 37  ? -3.586  45.430 137.741 1.00 49.01  ? 18   CYS C O   1 
ATOM   6852 C CB  . CYS C 2 37  ? -2.873  44.667 134.755 1.00 38.09  ? 18   CYS C CB  1 
ATOM   6853 S SG  . CYS C 2 37  ? -2.648  43.512 133.426 1.00 89.26  ? 18   CYS C SG  1 
ATOM   6854 N N   . LEU C 2 38  ? -5.167  46.245 136.419 1.00 50.06  ? 19   LEU C N   1 
ATOM   6855 C CA  . LEU C 2 38  ? -5.484  47.276 137.362 1.00 38.44  ? 19   LEU C CA  1 
ATOM   6856 C C   . LEU C 2 38  ? -6.016  46.635 138.619 1.00 57.05  ? 19   LEU C C   1 
ATOM   6857 O O   . LEU C 2 38  ? -5.537  46.916 139.702 1.00 60.08  ? 19   LEU C O   1 
ATOM   6858 C CB  . LEU C 2 38  ? -6.537  48.222 136.803 1.00 41.35  ? 19   LEU C CB  1 
ATOM   6859 C CG  . LEU C 2 38  ? -6.188  49.113 135.599 1.00 63.24  ? 19   LEU C CG  1 
ATOM   6860 C CD1 . LEU C 2 38  ? -7.164  50.321 135.570 1.00 50.71  ? 19   LEU C CD1 1 
ATOM   6861 C CD2 . LEU C 2 38  ? -4.721  49.607 135.580 1.00 66.64  ? 19   LEU C CD2 1 
ATOM   6862 N N   . LEU C 2 39  ? -7.000  45.759 138.465 1.00 51.26  ? 20   LEU C N   1 
ATOM   6863 C CA  . LEU C 2 39  ? -7.690  45.216 139.592 1.00 46.84  ? 20   LEU C CA  1 
ATOM   6864 C C   . LEU C 2 39  ? -6.757  44.405 140.477 1.00 56.05  ? 20   LEU C C   1 
ATOM   6865 O O   . LEU C 2 39  ? -6.772  44.558 141.695 1.00 38.46  ? 20   LEU C O   1 
ATOM   6866 C CB  . LEU C 2 39  ? -8.877  44.380 139.128 1.00 43.45  ? 20   LEU C CB  1 
ATOM   6867 C CG  . LEU C 2 39  ? -9.879  44.974 138.125 1.00 32.60  ? 20   LEU C CG  1 
ATOM   6868 C CD1 . LEU C 2 39  ? -11.069 44.035 137.862 1.00 34.23  ? 20   LEU C CD1 1 
ATOM   6869 C CD2 . LEU C 2 39  ? -10.365 46.361 138.560 1.00 31.77  ? 20   LEU C CD2 1 
ATOM   6870 N N   . ILE C 2 40  ? -5.937  43.560 139.875 1.00 42.68  ? 21   ILE C N   1 
ATOM   6871 C CA  . ILE C 2 40  ? -5.054  42.713 140.659 1.00 50.37  ? 21   ILE C CA  1 
ATOM   6872 C C   . ILE C 2 40  ? -3.984  43.506 141.348 1.00 46.26  ? 21   ILE C C   1 
ATOM   6873 O O   . ILE C 2 40  ? -3.587  43.170 142.450 1.00 58.39  ? 21   ILE C O   1 
ATOM   6874 C CB  . ILE C 2 40  ? -4.331  41.664 139.810 1.00 56.90  ? 21   ILE C CB  1 
ATOM   6875 C CG1 . ILE C 2 40  ? -5.289  41.038 138.818 1.00 57.35  ? 21   ILE C CG1 1 
ATOM   6876 C CG2 . ILE C 2 40  ? -3.797  40.560 140.678 1.00 68.50  ? 21   ILE C CG2 1 
ATOM   6877 C CD1 . ILE C 2 40  ? -4.770  39.763 138.230 1.00 54.17  ? 21   ILE C CD1 1 
ATOM   6878 N N   . SER C 2 41  ? -3.491  44.546 140.705 1.00 47.53  ? 22   SER C N   1 
ATOM   6879 C CA  . SER C 2 41  ? -2.412  45.300 141.321 1.00 64.24  ? 22   SER C CA  1 
ATOM   6880 C C   . SER C 2 41  ? -2.939  45.988 142.539 1.00 52.88  ? 22   SER C C   1 
ATOM   6881 O O   . SER C 2 41  ? -2.268  46.063 143.546 1.00 58.43  ? 22   SER C O   1 
ATOM   6882 C CB  . SER C 2 41  ? -1.811  46.344 140.380 1.00 48.05  ? 22   SER C CB  1 
ATOM   6883 O OG  . SER C 2 41  ? -1.518  45.772 139.119 1.00 74.84  ? 22   SER C OG  1 
ATOM   6884 N N   . TYR C 2 42  ? -4.143  46.502 142.441 1.00 41.07  ? 23   TYR C N   1 
ATOM   6885 C CA  . TYR C 2 42  ? -4.615  47.339 143.472 1.00 44.14  ? 23   TYR C CA  1 
ATOM   6886 C C   . TYR C 2 42  ? -5.005  46.481 144.619 1.00 51.84  ? 23   TYR C C   1 
ATOM   6887 O O   . TYR C 2 42  ? -4.701  46.830 145.733 1.00 46.77  ? 23   TYR C O   1 
ATOM   6888 C CB  . TYR C 2 42  ? -5.791  48.147 143.005 1.00 40.49  ? 23   TYR C CB  1 
ATOM   6889 C CG  . TYR C 2 42  ? -6.463  48.929 144.096 1.00 44.86  ? 23   TYR C CG  1 
ATOM   6890 C CD1 . TYR C 2 42  ? -5.872  50.038 144.638 1.00 48.98  ? 23   TYR C CD1 1 
ATOM   6891 C CD2 . TYR C 2 42  ? -7.712  48.567 144.570 1.00 62.39  ? 23   TYR C CD2 1 
ATOM   6892 C CE1 . TYR C 2 42  ? -6.503  50.759 145.626 1.00 62.74  ? 23   TYR C CE1 1 
ATOM   6893 C CE2 . TYR C 2 42  ? -8.343  49.291 145.565 1.00 48.38  ? 23   TYR C CE2 1 
ATOM   6894 C CZ  . TYR C 2 42  ? -7.733  50.379 146.082 1.00 42.65  ? 23   TYR C CZ  1 
ATOM   6895 O OH  . TYR C 2 42  ? -8.382  51.119 147.044 1.00 49.11  ? 23   TYR C OH  1 
ATOM   6896 N N   . THR C 2 43  ? -5.669  45.359 144.349 1.00 46.60  ? 24   THR C N   1 
ATOM   6897 C CA  . THR C 2 43  ? -6.288  44.571 145.416 1.00 51.05  ? 24   THR C CA  1 
ATOM   6898 C C   . THR C 2 43  ? -5.315  43.733 146.177 1.00 47.08  ? 24   THR C C   1 
ATOM   6899 O O   . THR C 2 43  ? -5.570  43.401 147.303 1.00 48.63  ? 24   THR C O   1 
ATOM   6900 C CB  . THR C 2 43  ? -7.450  43.672 144.954 1.00 36.79  ? 24   THR C CB  1 
ATOM   6901 O OG1 . THR C 2 43  ? -6.973  42.628 144.095 1.00 51.72  ? 24   THR C OG1 1 
ATOM   6902 C CG2 . THR C 2 43  ? -8.500  44.476 144.296 1.00 37.26  ? 24   THR C CG2 1 
ATOM   6903 N N   . THR C 2 44  ? -4.206  43.379 145.548 1.00 49.60  ? 25   THR C N   1 
ATOM   6904 C CA  . THR C 2 44  ? -3.121  42.627 146.194 1.00 49.42  ? 25   THR C CA  1 
ATOM   6905 C C   . THR C 2 44  ? -2.026  43.600 146.646 1.00 53.99  ? 25   THR C C   1 
ATOM   6906 O O   . THR C 2 44  ? -0.973  43.194 147.107 1.00 62.43  ? 25   THR C O   1 
ATOM   6907 C CB  . THR C 2 44  ? -2.510  41.544 145.250 1.00 60.62  ? 25   THR C CB  1 
ATOM   6908 O OG1 . THR C 2 44  ? -1.954  42.164 144.081 1.00 43.14  ? 25   THR C OG1 1 
ATOM   6909 C CG2 . THR C 2 44  ? -3.551  40.529 144.828 1.00 39.66  ? 25   THR C CG2 1 
ATOM   6910 N N   . ASN C 2 45  ? -2.286  44.891 146.528 1.00 54.51  ? 26   ASN C N   1 
ATOM   6911 C CA  . ASN C 2 45  ? -1.292  45.906 146.851 1.00 74.43  ? 26   ASN C CA  1 
ATOM   6912 C C   . ASN C 2 45  ? 0.114   45.501 146.386 1.00 66.38  ? 26   ASN C C   1 
ATOM   6913 O O   . ASN C 2 45  ? 1.082   45.521 147.132 1.00 65.19  ? 26   ASN C O   1 
ATOM   6914 C CB  . ASN C 2 45  ? -1.336  46.251 148.339 1.00 68.06  ? 26   ASN C CB  1 
ATOM   6915 C CG  . ASN C 2 45  ? -0.702  47.585 148.635 1.00 73.40  ? 26   ASN C CG  1 
ATOM   6916 O OD1 . ASN C 2 45  ? -0.788  48.508 147.840 1.00 83.56  ? 26   ASN C OD1 1 
ATOM   6917 N ND2 . ASN C 2 45  ? -0.070  47.700 149.791 1.00 87.82  ? 26   ASN C ND2 1 
ATOM   6918 N N   . ALA C 2 46  ? 0.192   45.144 145.116 1.00 54.16  ? 27   ALA C N   1 
ATOM   6919 C CA  . ALA C 2 46  ? 1.373   44.542 144.565 1.00 55.24  ? 27   ALA C CA  1 
ATOM   6920 C C   . ALA C 2 46  ? 2.451   45.573 144.370 1.00 53.58  ? 27   ALA C C   1 
ATOM   6921 O O   . ALA C 2 46  ? 2.192   46.748 144.305 1.00 54.12  ? 27   ALA C O   1 
ATOM   6922 C CB  . ALA C 2 46  ? 1.036   43.891 143.275 1.00 42.19  ? 27   ALA C CB  1 
ATOM   6923 N N   . PHE C 2 47  ? 3.681   45.122 144.276 1.00 56.44  ? 28   PHE C N   1 
ATOM   6924 C CA  . PHE C 2 47  ? 4.739   46.015 143.857 1.00 62.64  ? 28   PHE C CA  1 
ATOM   6925 C C   . PHE C 2 47  ? 4.494   46.409 142.407 1.00 55.28  ? 28   PHE C C   1 
ATOM   6926 O O   . PHE C 2 47  ? 3.921   45.618 141.667 1.00 58.80  ? 28   PHE C O   1 
ATOM   6927 C CB  . PHE C 2 47  ? 6.068   45.306 143.985 1.00 56.14  ? 28   PHE C CB  1 
ATOM   6928 C CG  . PHE C 2 47  ? 7.204   46.219 144.021 1.00 66.44  ? 28   PHE C CG  1 
ATOM   6929 C CD1 . PHE C 2 47  ? 7.365   47.072 145.086 1.00 53.54  ? 28   PHE C CD1 1 
ATOM   6930 C CD2 . PHE C 2 47  ? 8.108   46.260 142.983 1.00 71.94  ? 28   PHE C CD2 1 
ATOM   6931 C CE1 . PHE C 2 47  ? 8.419   47.963 145.136 1.00 57.71  ? 28   PHE C CE1 1 
ATOM   6932 C CE2 . PHE C 2 47  ? 9.187   47.145 143.032 1.00 75.08  ? 28   PHE C CE2 1 
ATOM   6933 C CZ  . PHE C 2 47  ? 9.335   48.001 144.120 1.00 52.11  ? 28   PHE C CZ  1 
ATOM   6934 N N   . PRO C 2 48  ? 4.909   47.615 141.993 1.00 51.28  ? 29   PRO C N   1 
ATOM   6935 C CA  . PRO C 2 48  ? 4.531   48.056 140.645 1.00 69.39  ? 29   PRO C CA  1 
ATOM   6936 C C   . PRO C 2 48  ? 4.796   47.068 139.487 1.00 78.04  ? 29   PRO C C   1 
ATOM   6937 O O   . PRO C 2 48  ? 3.883   46.802 138.668 1.00 87.34  ? 29   PRO C O   1 
ATOM   6938 C CB  . PRO C 2 48  ? 5.306   49.347 140.487 1.00 52.11  ? 29   PRO C CB  1 
ATOM   6939 C CG  . PRO C 2 48  ? 5.232   49.924 141.874 1.00 63.26  ? 29   PRO C CG  1 
ATOM   6940 C CD  . PRO C 2 48  ? 5.388   48.747 142.803 1.00 55.22  ? 29   PRO C CD  1 
ATOM   6941 N N   . GLY C 2 49  ? 5.994   46.501 139.417 1.00 61.49  ? 30   GLY C N   1 
ATOM   6942 C CA  . GLY C 2 49  ? 6.254   45.555 138.335 1.00 78.43  ? 30   GLY C CA  1 
ATOM   6943 C C   . GLY C 2 49  ? 5.481   44.261 138.479 1.00 74.71  ? 30   GLY C C   1 
ATOM   6944 O O   . GLY C 2 49  ? 4.741   43.852 137.593 1.00 74.44  ? 30   GLY C O   1 
ATOM   6945 N N   . GLU C 2 50  ? 5.607   43.668 139.653 1.00 82.44  ? 31   GLU C N   1 
ATOM   6946 C CA  . GLU C 2 50  ? 5.431   42.239 139.841 1.00 79.61  ? 31   GLU C CA  1 
ATOM   6947 C C   . GLU C 2 50  ? 4.174   41.815 140.557 1.00 65.41  ? 31   GLU C C   1 
ATOM   6948 O O   . GLU C 2 50  ? 4.092   41.821 141.769 1.00 83.56  ? 31   GLU C O   1 
ATOM   6949 C CB  . GLU C 2 50  ? 6.645   41.696 140.603 1.00 79.71  ? 31   GLU C CB  1 
ATOM   6950 C CG  . GLU C 2 50  ? 7.276   42.691 141.566 1.00 62.74  ? 31   GLU C CG  1 
ATOM   6951 C CD  . GLU C 2 50  ? 8.772   42.516 141.625 1.00 80.06  ? 31   GLU C CD  1 
ATOM   6952 O OE1 . GLU C 2 50  ? 9.487   42.985 140.706 1.00 87.81  ? 31   GLU C OE1 1 
ATOM   6953 O OE2 . GLU C 2 50  ? 9.240   41.880 142.587 1.00 80.87  ? 31   GLU C OE2 1 
ATOM   6954 N N   . TYR C 2 51  ? 3.204   41.387 139.797 1.00 69.45  ? 32   TYR C N   1 
ATOM   6955 C CA  . TYR C 2 51  ? 2.025   40.850 140.417 1.00 66.73  ? 32   TYR C CA  1 
ATOM   6956 C C   . TYR C 2 51  ? 1.758   39.421 139.967 1.00 77.66  ? 32   TYR C C   1 
ATOM   6957 O O   . TYR C 2 51  ? 2.109   39.045 138.836 1.00 58.81  ? 32   TYR C O   1 
ATOM   6958 C CB  . TYR C 2 51  ? 0.836   41.737 140.105 1.00 72.93  ? 32   TYR C CB  1 
ATOM   6959 C CG  . TYR C 2 51  ? 0.515   41.862 138.638 1.00 107.78 ? 32   TYR C CG  1 
ATOM   6960 C CD1 . TYR C 2 51  ? 0.174   40.735 137.878 1.00 112.37 ? 32   TYR C CD1 1 
ATOM   6961 C CD2 . TYR C 2 51  ? 0.517   43.115 138.007 1.00 110.93 ? 32   TYR C CD2 1 
ATOM   6962 C CE1 . TYR C 2 51  ? -0.146  40.836 136.531 1.00 111.62 ? 32   TYR C CE1 1 
ATOM   6963 C CE2 . TYR C 2 51  ? 0.185   43.233 136.646 1.00 118.82 ? 32   TYR C CE2 1 
ATOM   6964 C CZ  . TYR C 2 51  ? -0.144  42.084 135.921 1.00 117.60 ? 32   TYR C CZ  1 
ATOM   6965 O OH  . TYR C 2 51  ? -0.468  42.181 134.589 1.00 116.12 ? 32   TYR C OH  1 
ATOM   6966 N N   . ILE C 2 52  ? 1.131   38.639 140.854 1.00 57.25  ? 33   ILE C N   1 
ATOM   6967 C CA  . ILE C 2 52  ? 0.757   37.281 140.529 1.00 61.75  ? 33   ILE C CA  1 
ATOM   6968 C C   . ILE C 2 52  ? -0.664  37.216 140.026 1.00 65.64  ? 33   ILE C C   1 
ATOM   6969 O O   . ILE C 2 52  ? -1.576  37.692 140.698 1.00 67.25  ? 33   ILE C O   1 
ATOM   6970 C CB  . ILE C 2 52  ? 0.863   36.377 141.700 1.00 53.62  ? 33   ILE C CB  1 
ATOM   6971 C CG1 . ILE C 2 52  ? 2.326   36.102 141.999 1.00 67.75  ? 33   ILE C CG1 1 
ATOM   6972 C CG2 . ILE C 2 52  ? 0.210   35.059 141.377 1.00 49.22  ? 33   ILE C CG2 1 
ATOM   6973 C CD1 . ILE C 2 52  ? 2.958   37.152 142.799 1.00 68.61  ? 33   ILE C CD1 1 
ATOM   6974 N N   . PRO C 2 53  ? -0.851  36.669 138.813 1.00 61.13  ? 34   PRO C N   1 
ATOM   6975 C CA  . PRO C 2 53  ? -2.162  36.393 138.292 1.00 53.97  ? 34   PRO C CA  1 
ATOM   6976 C C   . PRO C 2 53  ? -2.716  35.173 138.965 1.00 60.93  ? 34   PRO C C   1 
ATOM   6977 O O   . PRO C 2 53  ? -1.973  34.325 139.485 1.00 48.08  ? 34   PRO C O   1 
ATOM   6978 C CB  . PRO C 2 53  ? -1.899  36.072 136.835 1.00 53.24  ? 34   PRO C CB  1 
ATOM   6979 C CG  . PRO C 2 53  ? -0.669  36.785 136.527 1.00 72.48  ? 34   PRO C CG  1 
ATOM   6980 C CD  . PRO C 2 53  ? 0.158   36.643 137.747 1.00 65.38  ? 34   PRO C CD  1 
ATOM   6981 N N   . THR C 2 54  ? -4.034  35.106 138.936 1.00 63.07  ? 35   THR C N   1 
ATOM   6982 C CA  . THR C 2 54  ? -4.782  34.021 139.501 1.00 58.15  ? 35   THR C CA  1 
ATOM   6983 C C   . THR C 2 54  ? -5.560  33.509 138.315 1.00 66.43  ? 35   THR C C   1 
ATOM   6984 O O   . THR C 2 54  ? -5.648  34.182 137.278 1.00 64.43  ? 35   THR C O   1 
ATOM   6985 C CB  . THR C 2 54  ? -5.769  34.575 140.547 1.00 67.42  ? 35   THR C CB  1 
ATOM   6986 O OG1 . THR C 2 54  ? -6.665  33.547 140.984 1.00 57.13  ? 35   THR C OG1 1 
ATOM   6987 C CG2 . THR C 2 54  ? -6.589  35.767 139.940 1.00 63.04  ? 35   THR C CG2 1 
ATOM   6988 N N   . VAL C 2 55  ? -6.158  32.345 138.476 1.00 70.49  ? 36   VAL C N   1 
ATOM   6989 C CA  . VAL C 2 55  ? -6.907  31.719 137.409 1.00 55.44  ? 36   VAL C CA  1 
ATOM   6990 C C   . VAL C 2 55  ? -8.364  32.132 137.477 1.00 55.88  ? 36   VAL C C   1 
ATOM   6991 O O   . VAL C 2 55  ? -9.123  31.836 136.561 1.00 46.71  ? 36   VAL C O   1 
ATOM   6992 C CB  . VAL C 2 55  ? -6.708  30.190 137.514 1.00 49.76  ? 36   VAL C CB  1 
ATOM   6993 C CG1 . VAL C 2 55  ? -8.013  29.439 137.555 1.00 54.41  ? 36   VAL C CG1 1 
ATOM   6994 C CG2 . VAL C 2 55  ? -5.763  29.709 136.435 1.00 53.81  ? 36   VAL C CG2 1 
ATOM   6995 N N   . PHE C 2 56  ? -8.753  32.840 138.539 1.00 59.97  ? 37   PHE C N   1 
ATOM   6996 C CA  . PHE C 2 56  ? -10.137 33.306 138.735 1.00 46.69  ? 37   PHE C CA  1 
ATOM   6997 C C   . PHE C 2 56  ? -10.299 34.836 138.623 1.00 48.02  ? 37   PHE C C   1 
ATOM   6998 O O   . PHE C 2 56  ? -9.447  35.593 139.070 1.00 63.44  ? 37   PHE C O   1 
ATOM   6999 C CB  . PHE C 2 56  ? -10.703 32.760 140.043 1.00 69.06  ? 37   PHE C CB  1 
ATOM   7000 C CG  . PHE C 2 56  ? -10.514 31.278 140.203 1.00 68.91  ? 37   PHE C CG  1 
ATOM   7001 C CD1 . PHE C 2 56  ? -11.261 30.388 139.457 1.00 68.24  ? 37   PHE C CD1 1 
ATOM   7002 C CD2 . PHE C 2 56  ? -9.580  30.776 141.088 1.00 61.80  ? 37   PHE C CD2 1 
ATOM   7003 C CE1 . PHE C 2 56  ? -11.086 29.030 139.596 1.00 46.68  ? 37   PHE C CE1 1 
ATOM   7004 C CE2 . PHE C 2 56  ? -9.404  29.417 141.229 1.00 63.88  ? 37   PHE C CE2 1 
ATOM   7005 C CZ  . PHE C 2 56  ? -10.158 28.545 140.482 1.00 61.16  ? 37   PHE C CZ  1 
ATOM   7006 N N   . ASP C 2 57  ? -11.399 35.261 138.003 1.00 61.56  ? 38   ASP C N   1 
ATOM   7007 C CA  . ASP C 2 57  ? -11.734 36.676 137.725 1.00 81.72  ? 38   ASP C CA  1 
ATOM   7008 C C   . ASP C 2 57  ? -12.006 37.853 138.697 1.00 115.89 ? 38   ASP C C   1 
ATOM   7009 O O   . ASP C 2 57  ? -11.489 38.943 138.458 1.00 155.68 ? 38   ASP C O   1 
ATOM   7010 C CB  . ASP C 2 57  ? -12.921 36.683 136.757 1.00 56.30  ? 38   ASP C CB  1 
ATOM   7011 C CG  . ASP C 2 57  ? -12.609 36.009 135.458 1.00 72.98  ? 38   ASP C CG  1 
ATOM   7012 O OD1 . ASP C 2 57  ? -11.424 35.958 135.086 1.00 51.65  ? 38   ASP C OD1 1 
ATOM   7013 O OD2 . ASP C 2 57  ? -13.552 35.534 134.805 1.00 80.68  ? 38   ASP C OD2 1 
ATOM   7014 N N   . ASN C 2 58  ? -12.798 37.690 139.750 1.00 52.48  ? 39   ASN C N   1 
ATOM   7015 C CA  . ASN C 2 58  ? -13.079 38.840 140.634 1.00 60.18  ? 39   ASN C CA  1 
ATOM   7016 C C   . ASN C 2 58  ? -12.089 39.265 141.730 1.00 52.73  ? 39   ASN C C   1 
ATOM   7017 O O   . ASN C 2 58  ? -11.302 38.449 142.196 1.00 65.88  ? 39   ASN C O   1 
ATOM   7018 C CB  . ASN C 2 58  ? -14.514 38.774 141.149 1.00 79.25  ? 39   ASN C CB  1 
ATOM   7019 C CG  . ASN C 2 58  ? -15.523 38.731 140.021 1.00 68.49  ? 39   ASN C CG  1 
ATOM   7020 O OD1 . ASN C 2 58  ? -16.286 37.779 139.888 1.00 68.74  ? 39   ASN C OD1 1 
ATOM   7021 N ND2 . ASN C 2 58  ? -15.529 39.768 139.200 1.00 67.93  ? 39   ASN C ND2 1 
ATOM   7022 N N   . TYR C 2 59  ? -12.130 40.539 142.140 1.00 43.88  ? 40   TYR C N   1 
ATOM   7023 C CA  . TYR C 2 59  ? -11.207 40.989 143.171 1.00 52.15  ? 40   TYR C CA  1 
ATOM   7024 C C   . TYR C 2 59  ? -11.880 41.837 144.215 1.00 53.15  ? 40   TYR C C   1 
ATOM   7025 O O   . TYR C 2 59  ? -12.713 42.666 143.899 1.00 61.37  ? 40   TYR C O   1 
ATOM   7026 C CB  . TYR C 2 59  ? -10.016 41.688 142.536 1.00 38.74  ? 40   TYR C CB  1 
ATOM   7027 C CG  . TYR C 2 59  ? -9.474  40.905 141.382 1.00 58.33  ? 40   TYR C CG  1 
ATOM   7028 C CD1 . TYR C 2 59  ? -8.546  39.883 141.593 1.00 59.69  ? 40   TYR C CD1 1 
ATOM   7029 C CD2 . TYR C 2 59  ? -9.919  41.156 140.084 1.00 49.64  ? 40   TYR C CD2 1 
ATOM   7030 C CE1 . TYR C 2 59  ? -8.056  39.147 140.537 1.00 67.22  ? 40   TYR C CE1 1 
ATOM   7031 C CE2 . TYR C 2 59  ? -9.457  40.429 139.029 1.00 52.97  ? 40   TYR C CE2 1 
ATOM   7032 C CZ  . TYR C 2 59  ? -8.517  39.422 139.252 1.00 59.89  ? 40   TYR C CZ  1 
ATOM   7033 O OH  . TYR C 2 59  ? -8.035  38.660 138.196 1.00 67.23  ? 40   TYR C OH  1 
ATOM   7034 N N   . SER C 2 60  ? -11.531 41.591 145.471 1.00 46.39  ? 41   SER C N   1 
ATOM   7035 C CA  . SER C 2 60  ? -12.098 42.351 146.584 1.00 51.28  ? 41   SER C CA  1 
ATOM   7036 C C   . SER C 2 60  ? -11.031 42.980 147.466 1.00 43.03  ? 41   SER C C   1 
ATOM   7037 O O   . SER C 2 60  ? -9.962  42.399 147.696 1.00 50.40  ? 41   SER C O   1 
ATOM   7038 C CB  . SER C 2 60  ? -13.023 41.479 147.415 1.00 34.50  ? 41   SER C CB  1 
ATOM   7039 O OG  . SER C 2 60  ? -12.302 40.406 147.929 1.00 69.49  ? 41   SER C OG  1 
ATOM   7040 N N   . ALA C 2 61  ? -11.342 44.177 147.943 1.00 35.54  ? 42   ALA C N   1 
ATOM   7041 C CA  . ALA C 2 61  ? -10.456 44.899 148.825 1.00 49.81  ? 42   ALA C CA  1 
ATOM   7042 C C   . ALA C 2 61  ? -11.223 45.567 149.963 1.00 53.30  ? 42   ALA C C   1 
ATOM   7043 O O   . ALA C 2 61  ? -12.326 46.046 149.772 1.00 40.90  ? 42   ALA C O   1 
ATOM   7044 C CB  . ALA C 2 61  ? -9.657  45.905 148.046 1.00 36.31  ? 42   ALA C CB  1 
ATOM   7045 N N   . ASN C 2 62  ? -10.631 45.567 151.152 1.00 56.71  ? 43   ASN C N   1 
ATOM   7046 C CA  . ASN C 2 62  ? -11.202 46.257 152.297 1.00 45.36  ? 43   ASN C CA  1 
ATOM   7047 C C   . ASN C 2 62  ? -10.489 47.546 152.525 1.00 55.59  ? 43   ASN C C   1 
ATOM   7048 O O   . ASN C 2 62  ? -9.381  47.555 153.057 1.00 49.60  ? 43   ASN C O   1 
ATOM   7049 C CB  . ASN C 2 62  ? -10.992 45.442 153.536 1.00 49.84  ? 43   ASN C CB  1 
ATOM   7050 C CG  . ASN C 2 62  ? -11.881 44.259 153.591 1.00 64.46  ? 43   ASN C CG  1 
ATOM   7051 O OD1 . ASN C 2 62  ? -13.076 44.318 153.214 1.00 62.39  ? 43   ASN C OD1 1 
ATOM   7052 N ND2 . ASN C 2 62  ? -11.325 43.150 154.069 1.00 39.00  ? 43   ASN C ND2 1 
ATOM   7053 N N   . VAL C 2 63  ? -11.105 48.647 152.158 1.00 49.52  ? 44   VAL C N   1 
ATOM   7054 C CA  . VAL C 2 63  ? -10.341 49.869 152.139 1.00 44.95  ? 44   VAL C CA  1 
ATOM   7055 C C   . VAL C 2 63  ? -11.031 50.964 152.916 1.00 52.87  ? 44   VAL C C   1 
ATOM   7056 O O   . VAL C 2 63  ? -12.246 50.863 153.171 1.00 58.80  ? 44   VAL C O   1 
ATOM   7057 C CB  . VAL C 2 63  ? -10.008 50.326 150.684 1.00 54.26  ? 44   VAL C CB  1 
ATOM   7058 C CG1 . VAL C 2 63  ? -9.016  49.353 150.050 1.00 37.03  ? 44   VAL C CG1 1 
ATOM   7059 C CG2 . VAL C 2 63  ? -11.279 50.517 149.841 1.00 37.37  ? 44   VAL C CG2 1 
ATOM   7060 N N   . MET C 2 64  ? -10.259 51.977 153.313 1.00 42.47  ? 45   MET C N   1 
ATOM   7061 C CA  . MET C 2 64  ? -10.845 53.132 153.933 1.00 49.61  ? 45   MET C CA  1 
ATOM   7062 C C   . MET C 2 64  ? -10.616 54.331 153.069 1.00 54.50  ? 45   MET C C   1 
ATOM   7063 O O   . MET C 2 64  ? -9.492  54.679 152.776 1.00 66.64  ? 45   MET C O   1 
ATOM   7064 C CB  . MET C 2 64  ? -10.285 53.384 155.321 1.00 51.90  ? 45   MET C CB  1 
ATOM   7065 C CG  . MET C 2 64  ? -10.342 54.847 155.727 1.00 54.56  ? 45   MET C CG  1 
ATOM   7066 S SD  . MET C 2 64  ? -10.356 55.135 157.493 1.00 67.02  ? 45   MET C SD  1 
ATOM   7067 C CE  . MET C 2 64  ? -11.655 54.056 158.087 1.00 49.49  ? 45   MET C CE  1 
ATOM   7068 N N   . VAL C 2 65  ? -11.700 54.970 152.669 1.00 69.24  ? 46   VAL C N   1 
ATOM   7069 C CA  . VAL C 2 65  ? -11.594 56.236 151.965 1.00 79.27  ? 46   VAL C CA  1 
ATOM   7070 C C   . VAL C 2 65  ? -12.475 57.282 152.662 1.00 77.26  ? 46   VAL C C   1 
ATOM   7071 O O   . VAL C 2 65  ? -13.667 57.010 152.944 1.00 57.50  ? 46   VAL C O   1 
ATOM   7072 C CB  . VAL C 2 65  ? -11.896 56.097 150.430 1.00 59.90  ? 46   VAL C CB  1 
ATOM   7073 C CG1 . VAL C 2 65  ? -12.935 55.056 150.195 1.00 70.71  ? 46   VAL C CG1 1 
ATOM   7074 C CG2 . VAL C 2 65  ? -12.339 57.432 149.819 1.00 73.47  ? 46   VAL C CG2 1 
ATOM   7075 N N   . ASP C 2 66  ? -11.869 58.454 152.943 1.00 75.21  ? 47   ASP C N   1 
ATOM   7076 C CA  . ASP C 2 66  ? -12.540 59.565 153.646 1.00 78.02  ? 47   ASP C CA  1 
ATOM   7077 C C   . ASP C 2 66  ? -13.025 59.148 155.026 1.00 81.51  ? 47   ASP C C   1 
ATOM   7078 O O   . ASP C 2 66  ? -14.178 59.422 155.407 1.00 73.27  ? 47   ASP C O   1 
ATOM   7079 C CB  . ASP C 2 66  ? -13.755 60.078 152.856 1.00 78.00  ? 47   ASP C CB  1 
ATOM   7080 C CG  . ASP C 2 66  ? -13.372 60.890 151.646 1.00 85.08  ? 47   ASP C CG  1 
ATOM   7081 O OD1 . ASP C 2 66  ? -12.171 61.270 151.491 1.00 68.96  ? 47   ASP C OD1 1 
ATOM   7082 O OD2 . ASP C 2 66  ? -14.303 61.142 150.852 1.00 71.55  ? 47   ASP C OD2 1 
ATOM   7083 N N   . GLY C 2 67  ? -12.158 58.456 155.757 1.00 75.17  ? 48   GLY C N   1 
ATOM   7084 C CA  . GLY C 2 67  ? -12.515 57.970 157.070 1.00 71.60  ? 48   GLY C CA  1 
ATOM   7085 C C   . GLY C 2 67  ? -13.619 56.933 157.101 1.00 66.52  ? 48   GLY C C   1 
ATOM   7086 O O   . GLY C 2 67  ? -14.046 56.543 158.177 1.00 69.07  ? 48   GLY C O   1 
ATOM   7087 N N   . LYS C 2 68  ? -14.089 56.479 155.944 1.00 69.20  ? 49   LYS C N   1 
ATOM   7088 C CA  . LYS C 2 68  ? -15.104 55.417 155.900 1.00 59.50  ? 49   LYS C CA  1 
ATOM   7089 C C   . LYS C 2 68  ? -14.539 54.088 155.371 1.00 69.78  ? 49   LYS C C   1 
ATOM   7090 O O   . LYS C 2 68  ? -13.870 54.058 154.339 1.00 85.13  ? 49   LYS C O   1 
ATOM   7091 C CB  . LYS C 2 68  ? -16.332 55.885 155.115 1.00 72.36  ? 49   LYS C CB  1 
ATOM   7092 C CG  . LYS C 2 68  ? -17.065 57.049 155.822 1.00 110.74 ? 49   LYS C CG  1 
ATOM   7093 C CD  . LYS C 2 68  ? -17.506 58.159 154.873 1.00 113.74 ? 49   LYS C CD  1 
ATOM   7094 C CE  . LYS C 2 68  ? -17.667 59.497 155.596 1.00 102.19 ? 49   LYS C CE  1 
ATOM   7095 N NZ  . LYS C 2 68  ? -17.419 60.635 154.656 1.00 87.59  ? 49   LYS C NZ  1 
ATOM   7096 N N   . PRO C 2 69  ? -14.774 52.991 156.102 1.00 56.50  ? 50   PRO C N   1 
ATOM   7097 C CA  . PRO C 2 69  ? -14.286 51.698 155.674 1.00 59.20  ? 50   PRO C CA  1 
ATOM   7098 C C   . PRO C 2 69  ? -15.282 50.979 154.753 1.00 62.25  ? 50   PRO C C   1 
ATOM   7099 O O   . PRO C 2 69  ? -16.492 50.956 154.999 1.00 66.41  ? 50   PRO C O   1 
ATOM   7100 C CB  . PRO C 2 69  ? -14.102 50.938 156.992 1.00 52.61  ? 50   PRO C CB  1 
ATOM   7101 C CG  . PRO C 2 69  ? -15.024 51.587 157.956 1.00 40.86  ? 50   PRO C CG  1 
ATOM   7102 C CD  . PRO C 2 69  ? -15.416 52.929 157.426 1.00 62.65  ? 50   PRO C CD  1 
ATOM   7103 N N   . VAL C 2 70  ? -14.755 50.379 153.697 1.00 59.18  ? 51   VAL C N   1 
ATOM   7104 C CA  . VAL C 2 70  ? -15.595 49.731 152.718 1.00 57.54  ? 51   VAL C CA  1 
ATOM   7105 C C   . VAL C 2 70  ? -15.047 48.427 152.210 1.00 54.99  ? 51   VAL C C   1 
ATOM   7106 O O   . VAL C 2 70  ? -13.844 48.277 152.023 1.00 61.97  ? 51   VAL C O   1 
ATOM   7107 C CB  . VAL C 2 70  ? -15.894 50.645 151.529 1.00 58.66  ? 51   VAL C CB  1 
ATOM   7108 C CG1 . VAL C 2 70  ? -17.327 51.054 151.581 1.00 85.56  ? 51   VAL C CG1 1 
ATOM   7109 C CG2 . VAL C 2 70  ? -15.032 51.891 151.567 1.00 46.90  ? 51   VAL C CG2 1 
ATOM   7110 N N   . ASN C 2 71  ? -15.951 47.476 152.016 1.00 54.51  ? 52   ASN C N   1 
ATOM   7111 C CA  . ASN C 2 71  ? -15.627 46.252 151.327 1.00 52.49  ? 52   ASN C CA  1 
ATOM   7112 C C   . ASN C 2 71  ? -15.927 46.442 149.857 1.00 56.21  ? 52   ASN C C   1 
ATOM   7113 O O   . ASN C 2 71  ? -17.084 46.414 149.453 1.00 49.99  ? 52   ASN C O   1 
ATOM   7114 C CB  . ASN C 2 71  ? -16.442 45.081 151.843 1.00 51.47  ? 52   ASN C CB  1 
ATOM   7115 C CG  . ASN C 2 71  ? -16.270 43.845 150.979 1.00 60.88  ? 52   ASN C CG  1 
ATOM   7116 O OD1 . ASN C 2 71  ? -15.412 43.822 150.087 1.00 57.83  ? 52   ASN C OD1 1 
ATOM   7117 N ND2 . ASN C 2 71  ? -17.084 42.809 151.233 1.00 48.34  ? 52   ASN C ND2 1 
ATOM   7118 N N   . LEU C 2 72  ? -14.875 46.636 149.072 1.00 56.23  ? 53   LEU C N   1 
ATOM   7119 C CA  . LEU C 2 72  ? -15.011 46.901 147.659 1.00 51.47  ? 53   LEU C CA  1 
ATOM   7120 C C   . LEU C 2 72  ? -14.874 45.654 146.821 1.00 52.60  ? 53   LEU C C   1 
ATOM   7121 O O   . LEU C 2 72  ? -13.815 45.054 146.787 1.00 53.76  ? 53   LEU C O   1 
ATOM   7122 C CB  . LEU C 2 72  ? -13.964 47.886 147.218 1.00 45.12  ? 53   LEU C CB  1 
ATOM   7123 C CG  . LEU C 2 72  ? -13.910 48.194 145.725 1.00 47.77  ? 53   LEU C CG  1 
ATOM   7124 C CD1 . LEU C 2 72  ? -15.001 49.163 145.288 1.00 44.60  ? 53   LEU C CD1 1 
ATOM   7125 C CD2 . LEU C 2 72  ? -12.585 48.849 145.500 1.00 54.39  ? 53   LEU C CD2 1 
ATOM   7126 N N   . GLY C 2 73  ? -15.963 45.270 146.162 1.00 58.88  ? 54   GLY C N   1 
ATOM   7127 C CA  . GLY C 2 73  ? -15.960 44.217 145.147 1.00 63.43  ? 54   GLY C CA  1 
ATOM   7128 C C   . GLY C 2 73  ? -15.693 44.778 143.745 1.00 66.69  ? 54   GLY C C   1 
ATOM   7129 O O   . GLY C 2 73  ? -16.345 45.734 143.303 1.00 53.60  ? 54   GLY C O   1 
ATOM   7130 N N   . LEU C 2 74  ? -14.717 44.188 143.056 1.00 53.95  ? 55   LEU C N   1 
ATOM   7131 C CA  . LEU C 2 74  ? -14.352 44.573 141.681 1.00 51.07  ? 55   LEU C CA  1 
ATOM   7132 C C   . LEU C 2 74  ? -14.640 43.468 140.691 1.00 49.33  ? 55   LEU C C   1 
ATOM   7133 O O   . LEU C 2 74  ? -13.962 42.452 140.671 1.00 47.46  ? 55   LEU C O   1 
ATOM   7134 C CB  . LEU C 2 74  ? -12.878 44.960 141.623 1.00 48.25  ? 55   LEU C CB  1 
ATOM   7135 C CG  . LEU C 2 74  ? -12.575 46.178 142.497 1.00 41.76  ? 55   LEU C CG  1 
ATOM   7136 C CD1 . LEU C 2 74  ? -11.097 46.385 142.544 1.00 38.14  ? 55   LEU C CD1 1 
ATOM   7137 C CD2 . LEU C 2 74  ? -13.318 47.409 142.000 1.00 38.57  ? 55   LEU C CD2 1 
ATOM   7138 N N   . TRP C 2 75  ? -15.680 43.679 139.897 1.00 44.72  ? 56   TRP C N   1 
ATOM   7139 C CA  . TRP C 2 75  ? -16.124 42.691 138.926 1.00 48.26  ? 56   TRP C CA  1 
ATOM   7140 C C   . TRP C 2 75  ? -15.466 42.919 137.585 1.00 52.54  ? 56   TRP C C   1 
ATOM   7141 O O   . TRP C 2 75  ? -15.651 43.949 136.950 1.00 41.62  ? 56   TRP C O   1 
ATOM   7142 C CB  . TRP C 2 75  ? -17.608 42.792 138.722 1.00 53.21  ? 56   TRP C CB  1 
ATOM   7143 C CG  . TRP C 2 75  ? -18.424 42.466 139.905 1.00 65.74  ? 56   TRP C CG  1 
ATOM   7144 C CD1 . TRP C 2 75  ? -18.463 43.130 141.106 1.00 74.52  ? 56   TRP C CD1 1 
ATOM   7145 C CD2 . TRP C 2 75  ? -19.389 41.423 139.996 1.00 45.68  ? 56   TRP C CD2 1 
ATOM   7146 N NE1 . TRP C 2 75  ? -19.376 42.535 141.942 1.00 60.28  ? 56   TRP C NE1 1 
ATOM   7147 C CE2 . TRP C 2 75  ? -19.969 41.497 141.277 1.00 62.44  ? 56   TRP C CE2 1 
ATOM   7148 C CE3 . TRP C 2 75  ? -19.807 40.421 139.121 1.00 43.82  ? 56   TRP C CE3 1 
ATOM   7149 C CZ2 . TRP C 2 75  ? -20.933 40.611 141.703 1.00 57.59  ? 56   TRP C CZ2 1 
ATOM   7150 C CZ3 . TRP C 2 75  ? -20.768 39.541 139.545 1.00 53.53  ? 56   TRP C CZ3 1 
ATOM   7151 C CH2 . TRP C 2 75  ? -21.326 39.644 140.830 1.00 63.85  ? 56   TRP C CH2 1 
ATOM   7152 N N   . ASP C 2 76  ? -14.700 41.919 137.182 1.00 62.33  ? 57   ASP C N   1 
ATOM   7153 C CA  . ASP C 2 76  ? -13.943 41.895 135.945 1.00 52.91  ? 57   ASP C CA  1 
ATOM   7154 C C   . ASP C 2 76  ? -14.820 41.242 134.885 1.00 52.26  ? 57   ASP C C   1 
ATOM   7155 O O   . ASP C 2 76  ? -14.951 40.021 134.826 1.00 59.50  ? 57   ASP C O   1 
ATOM   7156 C CB  . ASP C 2 76  ? -12.702 41.054 136.199 1.00 54.51  ? 57   ASP C CB  1 
ATOM   7157 C CG  . ASP C 2 76  ? -11.642 41.289 135.204 1.00 55.66  ? 57   ASP C CG  1 
ATOM   7158 O OD1 . ASP C 2 76  ? -11.736 42.262 134.438 1.00 63.32  ? 57   ASP C OD1 1 
ATOM   7159 O OD2 . ASP C 2 76  ? -10.693 40.496 135.187 1.00 55.98  ? 57   ASP C OD2 1 
ATOM   7160 N N   . THR C 2 77  ? -15.473 42.053 134.068 1.00 54.11  ? 58   THR C N   1 
ATOM   7161 C CA  . THR C 2 77  ? -16.399 41.491 133.091 1.00 38.68  ? 58   THR C CA  1 
ATOM   7162 C C   . THR C 2 77  ? -15.661 41.050 131.838 1.00 62.89  ? 58   THR C C   1 
ATOM   7163 O O   . THR C 2 77  ? -14.538 41.482 131.564 1.00 38.25  ? 58   THR C O   1 
ATOM   7164 C CB  . THR C 2 77  ? -17.495 42.456 132.736 1.00 46.98  ? 58   THR C CB  1 
ATOM   7165 O OG1 . THR C 2 77  ? -16.920 43.667 132.256 1.00 56.09  ? 58   THR C OG1 1 
ATOM   7166 C CG2 . THR C 2 77  ? -18.326 42.764 133.959 1.00 46.57  ? 58   THR C CG2 1 
ATOM   7167 N N   . ALA C 2 78  ? -16.303 40.195 131.053 1.00 53.04  ? 59   ALA C N   1 
ATOM   7168 C CA  . ALA C 2 78  ? -15.713 39.722 129.812 1.00 46.30  ? 59   ALA C CA  1 
ATOM   7169 C C   . ALA C 2 78  ? -15.963 40.745 128.715 1.00 63.59  ? 59   ALA C C   1 
ATOM   7170 O O   . ALA C 2 78  ? -17.102 41.111 128.448 1.00 64.43  ? 59   ALA C O   1 
ATOM   7171 C CB  . ALA C 2 78  ? -16.291 38.383 129.429 1.00 49.03  ? 59   ALA C CB  1 
ATOM   7172 N N   . GLY C 2 79  ? -14.893 41.210 128.085 1.00 54.05  ? 60   GLY C N   1 
ATOM   7173 C CA  . GLY C 2 79  ? -15.008 42.201 127.034 1.00 70.02  ? 60   GLY C CA  1 
ATOM   7174 C C   . GLY C 2 79  ? -15.366 41.623 125.682 1.00 64.17  ? 60   GLY C C   1 
ATOM   7175 O O   . GLY C 2 79  ? -15.669 42.360 124.752 1.00 75.20  ? 60   GLY C O   1 
ATOM   7176 N N   . GLN C 2 80  ? -15.317 40.302 125.576 1.00 62.52  ? 61   GLN C N   1 
ATOM   7177 C CA  . GLN C 2 80  ? -15.630 39.627 124.329 1.00 57.06  ? 61   GLN C CA  1 
ATOM   7178 C C   . GLN C 2 80  ? -17.042 39.953 123.873 1.00 68.26  ? 61   GLN C C   1 
ATOM   7179 O O   . GLN C 2 80  ? -17.812 40.560 124.607 1.00 64.46  ? 61   GLN C O   1 
ATOM   7180 C CB  . GLN C 2 80  ? -15.448 38.119 124.480 1.00 75.69  ? 61   GLN C CB  1 
ATOM   7181 C CG  . GLN C 2 80  ? -14.002 37.689 124.605 1.00 87.03  ? 61   GLN C CG  1 
ATOM   7182 C CD  . GLN C 2 80  ? -13.334 38.234 125.849 1.00 104.46 ? 61   GLN C CD  1 
ATOM   7183 O OE1 . GLN C 2 80  ? -13.783 37.989 126.966 1.00 94.92  ? 61   GLN C OE1 1 
ATOM   7184 N NE2 . GLN C 2 80  ? -12.246 38.968 125.662 1.00 93.01  ? 61   GLN C NE2 1 
ATOM   7185 N N   . GLU C 2 81  ? -17.373 39.549 122.652 1.00 93.02  ? 62   GLU C N   1 
ATOM   7186 C CA  . GLU C 2 81  ? -18.689 39.809 122.081 1.00 94.08  ? 62   GLU C CA  1 
ATOM   7187 C C   . GLU C 2 81  ? -19.654 38.656 122.316 1.00 77.42  ? 62   GLU C C   1 
ATOM   7188 O O   . GLU C 2 81  ? -20.868 38.840 122.295 1.00 76.60  ? 62   GLU C O   1 
ATOM   7189 C CB  . GLU C 2 81  ? -18.574 40.084 120.582 1.00 97.68  ? 62   GLU C CB  1 
ATOM   7190 C CG  . GLU C 2 81  ? -17.553 41.142 120.216 1.00 115.77 ? 62   GLU C CG  1 
ATOM   7191 C CD  . GLU C 2 81  ? -17.539 41.439 118.732 1.00 130.10 ? 62   GLU C CD  1 
ATOM   7192 O OE1 . GLU C 2 81  ? -18.497 41.041 118.041 1.00 129.76 ? 62   GLU C OE1 1 
ATOM   7193 O OE2 . GLU C 2 81  ? -16.574 42.068 118.254 1.00 130.88 ? 62   GLU C OE2 1 
ATOM   7194 N N   . ASP C 2 82  ? -19.110 37.466 122.536 1.00 57.07  ? 63   ASP C N   1 
ATOM   7195 C CA  . ASP C 2 82  ? -19.929 36.290 122.775 1.00 65.93  ? 63   ASP C CA  1 
ATOM   7196 C C   . ASP C 2 82  ? -20.729 36.461 124.053 1.00 80.32  ? 63   ASP C C   1 
ATOM   7197 O O   . ASP C 2 82  ? -21.801 35.885 124.212 1.00 76.06  ? 63   ASP C O   1 
ATOM   7198 C CB  . ASP C 2 82  ? -19.044 35.054 122.906 1.00 87.00  ? 63   ASP C CB  1 
ATOM   7199 C CG  . ASP C 2 82  ? -17.767 35.169 122.110 1.00 102.50 ? 63   ASP C CG  1 
ATOM   7200 O OD1 . ASP C 2 82  ? -17.621 36.160 121.368 1.00 122.76 ? 63   ASP C OD1 1 
ATOM   7201 O OD2 . ASP C 2 82  ? -16.908 34.273 122.229 1.00 90.01  ? 63   ASP C OD2 1 
ATOM   7202 N N   . TYR C 2 83  ? -20.192 37.256 124.968 1.00 65.82  ? 64   TYR C N   1 
ATOM   7203 C CA  . TYR C 2 83  ? -20.829 37.483 126.254 1.00 57.76  ? 64   TYR C CA  1 
ATOM   7204 C C   . TYR C 2 83  ? -21.755 38.685 126.265 1.00 71.90  ? 64   TYR C C   1 
ATOM   7205 O O   . TYR C 2 83  ? -22.182 39.126 127.326 1.00 67.25  ? 64   TYR C O   1 
ATOM   7206 C CB  . TYR C 2 83  ? -19.767 37.638 127.340 1.00 47.74  ? 64   TYR C CB  1 
ATOM   7207 C CG  . TYR C 2 83  ? -19.033 36.357 127.641 1.00 53.77  ? 64   TYR C CG  1 
ATOM   7208 C CD1 . TYR C 2 83  ? -17.911 35.992 126.917 1.00 53.66  ? 64   TYR C CD1 1 
ATOM   7209 C CD2 . TYR C 2 83  ? -19.468 35.508 128.644 1.00 57.61  ? 64   TYR C CD2 1 
ATOM   7210 C CE1 . TYR C 2 83  ? -17.242 34.820 127.188 1.00 64.51  ? 64   TYR C CE1 1 
ATOM   7211 C CE2 . TYR C 2 83  ? -18.805 34.335 128.921 1.00 64.24  ? 64   TYR C CE2 1 
ATOM   7212 C CZ  . TYR C 2 83  ? -17.694 33.996 128.191 1.00 73.55  ? 64   TYR C CZ  1 
ATOM   7213 O OH  . TYR C 2 83  ? -17.032 32.825 128.468 1.00 73.68  ? 64   TYR C OH  1 
ATOM   7214 N N   . ASP C 2 84  ? -22.075 39.217 125.092 1.00 82.34  ? 65   ASP C N   1 
ATOM   7215 C CA  . ASP C 2 84  ? -22.970 40.403 125.042 1.00 72.76  ? 65   ASP C CA  1 
ATOM   7216 C C   . ASP C 2 84  ? -24.300 40.093 125.676 1.00 64.47  ? 65   ASP C C   1 
ATOM   7217 O O   . ASP C 2 84  ? -24.964 40.975 126.192 1.00 70.92  ? 65   ASP C O   1 
ATOM   7218 C CB  . ASP C 2 84  ? -23.220 40.892 123.610 1.00 71.71  ? 65   ASP C CB  1 
ATOM   7219 C CG  . ASP C 2 84  ? -21.989 41.447 122.953 1.00 87.93  ? 65   ASP C CG  1 
ATOM   7220 O OD1 . ASP C 2 84  ? -21.076 41.949 123.655 1.00 86.45  ? 65   ASP C OD1 1 
ATOM   7221 O OD2 . ASP C 2 84  ? -21.944 41.378 121.712 1.00 91.48  ? 65   ASP C OD2 1 
ATOM   7222 N N   . ARG C 2 85  ? -24.680 38.822 125.615 1.00 67.85  ? 66   ARG C N   1 
ATOM   7223 C CA  . ARG C 2 85  ? -25.934 38.349 126.192 1.00 81.56  ? 66   ARG C CA  1 
ATOM   7224 C C   . ARG C 2 85  ? -25.791 37.991 127.690 1.00 80.59  ? 66   ARG C C   1 
ATOM   7225 O O   . ARG C 2 85  ? -26.661 38.314 128.508 1.00 77.52  ? 66   ARG C O   1 
ATOM   7226 C CB  . ARG C 2 85  ? -26.476 37.172 125.362 1.00 63.65  ? 66   ARG C CB  1 
ATOM   7227 C CG  . ARG C 2 85  ? -26.994 37.616 124.004 1.00 81.22  ? 66   ARG C CG  1 
ATOM   7228 C CD  . ARG C 2 85  ? -28.471 37.937 124.057 1.00 103.41 ? 66   ARG C CD  1 
ATOM   7229 N NE  . ARG C 2 85  ? -29.259 36.708 124.217 1.00 121.95 ? 66   ARG C NE  1 
ATOM   7230 C CZ  . ARG C 2 85  ? -30.468 36.635 124.772 1.00 109.28 ? 66   ARG C CZ  1 
ATOM   7231 N NH1 . ARG C 2 85  ? -31.056 37.729 125.255 1.00 118.71 ? 66   ARG C NH1 1 
ATOM   7232 N NH2 . ARG C 2 85  ? -31.084 35.458 124.856 1.00 81.36  ? 66   ARG C NH2 1 
ATOM   7233 N N   . LEU C 2 86  ? -24.671 37.358 128.027 1.00 68.06  ? 67   LEU C N   1 
ATOM   7234 C CA  . LEU C 2 86  ? -24.355 36.955 129.389 1.00 63.30  ? 67   LEU C CA  1 
ATOM   7235 C C   . LEU C 2 86  ? -23.844 38.026 130.361 1.00 73.46  ? 67   LEU C C   1 
ATOM   7236 O O   . LEU C 2 86  ? -24.084 37.947 131.552 1.00 67.92  ? 67   LEU C O   1 
ATOM   7237 C CB  . LEU C 2 86  ? -23.331 35.842 129.325 1.00 61.11  ? 67   LEU C CB  1 
ATOM   7238 C CG  . LEU C 2 86  ? -23.928 34.452 129.473 1.00 63.14  ? 67   LEU C CG  1 
ATOM   7239 C CD1 . LEU C 2 86  ? -25.360 34.396 128.923 1.00 62.80  ? 67   LEU C CD1 1 
ATOM   7240 C CD2 . LEU C 2 86  ? -23.006 33.413 128.840 1.00 50.30  ? 67   LEU C CD2 1 
ATOM   7241 N N   . ARG C 2 87  ? -23.118 39.009 129.858 1.00 69.07  ? 68   ARG C N   1 
ATOM   7242 C CA  . ARG C 2 87  ? -22.422 39.970 130.709 1.00 66.78  ? 68   ARG C CA  1 
ATOM   7243 C C   . ARG C 2 87  ? -23.382 40.859 131.545 1.00 71.25  ? 68   ARG C C   1 
ATOM   7244 O O   . ARG C 2 87  ? -23.198 40.989 132.755 1.00 70.17  ? 68   ARG C O   1 
ATOM   7245 C CB  . ARG C 2 87  ? -21.429 40.792 129.866 1.00 53.27  ? 68   ARG C CB  1 
ATOM   7246 C CG  . ARG C 2 87  ? -20.656 41.863 130.602 1.00 48.04  ? 68   ARG C CG  1 
ATOM   7247 C CD  . ARG C 2 87  ? -19.662 42.601 129.678 1.00 63.34  ? 68   ARG C CD  1 
ATOM   7248 N NE  . ARG C 2 87  ? -20.299 43.206 128.501 1.00 67.71  ? 68   ARG C NE  1 
ATOM   7249 C CZ  . ARG C 2 87  ? -20.215 42.717 127.268 1.00 58.31  ? 68   ARG C CZ  1 
ATOM   7250 N NH1 . ARG C 2 87  ? -19.507 41.625 127.022 1.00 60.59  ? 68   ARG C NH1 1 
ATOM   7251 N NH2 . ARG C 2 87  ? -20.840 43.323 126.282 1.00 65.19  ? 68   ARG C NH2 1 
ATOM   7252 N N   . PRO C 2 88  ? -24.416 41.458 130.913 1.00 71.17  ? 69   PRO C N   1 
ATOM   7253 C CA  . PRO C 2 88  ? -25.235 42.401 131.681 1.00 59.82  ? 69   PRO C CA  1 
ATOM   7254 C C   . PRO C 2 88  ? -26.078 41.757 132.790 1.00 66.99  ? 69   PRO C C   1 
ATOM   7255 O O   . PRO C 2 88  ? -26.733 42.472 133.569 1.00 59.16  ? 69   PRO C O   1 
ATOM   7256 C CB  . PRO C 2 88  ? -26.125 43.028 130.602 1.00 50.33  ? 69   PRO C CB  1 
ATOM   7257 C CG  . PRO C 2 88  ? -25.353 42.868 129.374 1.00 59.54  ? 69   PRO C CG  1 
ATOM   7258 C CD  . PRO C 2 88  ? -24.777 41.511 129.485 1.00 55.56  ? 69   PRO C CD  1 
ATOM   7259 N N   . LEU C 2 89  ? -26.041 40.424 132.860 1.00 70.67  ? 70   LEU C N   1 
ATOM   7260 C CA  . LEU C 2 89  ? -26.751 39.675 133.891 1.00 58.13  ? 70   LEU C CA  1 
ATOM   7261 C C   . LEU C 2 89  ? -26.354 40.100 135.271 1.00 71.54  ? 70   LEU C C   1 
ATOM   7262 O O   . LEU C 2 89  ? -27.178 40.070 136.176 1.00 94.89  ? 70   LEU C O   1 
ATOM   7263 C CB  . LEU C 2 89  ? -26.493 38.182 133.781 1.00 47.53  ? 70   LEU C CB  1 
ATOM   7264 C CG  . LEU C 2 89  ? -27.197 37.493 132.622 1.00 72.05  ? 70   LEU C CG  1 
ATOM   7265 C CD1 . LEU C 2 89  ? -27.174 35.976 132.846 1.00 80.48  ? 70   LEU C CD1 1 
ATOM   7266 C CD2 . LEU C 2 89  ? -28.632 38.023 132.430 1.00 58.18  ? 70   LEU C CD2 1 
ATOM   7267 N N   . SER C 2 90  ? -25.098 40.479 135.441 1.00 65.29  ? 71   SER C N   1 
ATOM   7268 C CA  . SER C 2 90  ? -24.620 40.898 136.741 1.00 61.77  ? 71   SER C CA  1 
ATOM   7269 C C   . SER C 2 90  ? -24.594 42.410 136.932 1.00 59.46  ? 71   SER C C   1 
ATOM   7270 O O   . SER C 2 90  ? -23.933 42.900 137.843 1.00 68.93  ? 71   SER C O   1 
ATOM   7271 C CB  . SER C 2 90  ? -23.245 40.326 136.966 1.00 62.91  ? 71   SER C CB  1 
ATOM   7272 O OG  . SER C 2 90  ? -22.481 40.517 135.802 1.00 63.77  ? 71   SER C OG  1 
ATOM   7273 N N   . TYR C 2 91  ? -25.268 43.128 136.059 1.00 68.87  ? 72   TYR C N   1 
ATOM   7274 C CA  . TYR C 2 91  ? -25.359 44.579 136.119 1.00 74.34  ? 72   TYR C CA  1 
ATOM   7275 C C   . TYR C 2 91  ? -26.240 45.212 137.202 1.00 75.51  ? 72   TYR C C   1 
ATOM   7276 O O   . TYR C 2 91  ? -26.017 46.333 137.615 1.00 72.31  ? 72   TYR C O   1 
ATOM   7277 C CB  . TYR C 2 91  ? -25.756 45.120 134.751 1.00 49.38  ? 72   TYR C CB  1 
ATOM   7278 C CG  . TYR C 2 91  ? -24.619 45.221 133.782 1.00 64.02  ? 72   TYR C CG  1 
ATOM   7279 C CD1 . TYR C 2 91  ? -23.401 44.665 134.063 1.00 64.71  ? 72   TYR C CD1 1 
ATOM   7280 C CD2 . TYR C 2 91  ? -24.770 45.874 132.585 1.00 77.06  ? 72   TYR C CD2 1 
ATOM   7281 C CE1 . TYR C 2 91  ? -22.380 44.753 133.183 1.00 79.53  ? 72   TYR C CE1 1 
ATOM   7282 C CE2 . TYR C 2 91  ? -23.754 45.962 131.705 1.00 76.77  ? 72   TYR C CE2 1 
ATOM   7283 C CZ  . TYR C 2 91  ? -22.559 45.403 132.006 1.00 76.69  ? 72   TYR C CZ  1 
ATOM   7284 O OH  . TYR C 2 91  ? -21.528 45.499 131.121 1.00 55.41  ? 72   TYR C OH  1 
ATOM   7285 N N   . PRO C 2 92  ? -27.245 44.491 137.651 1.00 75.16  ? 73   PRO C N   1 
ATOM   7286 C CA  . PRO C 2 92  ? -28.280 45.042 138.508 1.00 80.06  ? 73   PRO C CA  1 
ATOM   7287 C C   . PRO C 2 92  ? -27.944 45.655 139.844 1.00 83.20  ? 73   PRO C C   1 
ATOM   7288 O O   . PRO C 2 92  ? -28.487 46.707 140.135 1.00 92.56  ? 73   PRO C O   1 
ATOM   7289 C CB  . PRO C 2 92  ? -29.162 43.837 138.745 1.00 68.94  ? 73   PRO C CB  1 
ATOM   7290 C CG  . PRO C 2 92  ? -29.097 43.112 137.487 1.00 69.17  ? 73   PRO C CG  1 
ATOM   7291 C CD  . PRO C 2 92  ? -27.731 43.318 136.922 1.00 66.66  ? 73   PRO C CD  1 
ATOM   7292 N N   . GLN C 2 93  ? -27.084 45.077 140.643 1.00 69.06  ? 74   GLN C N   1 
ATOM   7293 C CA  . GLN C 2 93  ? -26.853 45.695 141.928 1.00 75.73  ? 74   GLN C CA  1 
ATOM   7294 C C   . GLN C 2 93  ? -25.682 46.644 141.954 1.00 74.71  ? 74   GLN C C   1 
ATOM   7295 O O   . GLN C 2 93  ? -25.256 47.064 143.002 1.00 80.19  ? 74   GLN C O   1 
ATOM   7296 C CB  . GLN C 2 93  ? -26.696 44.634 142.994 1.00 93.12  ? 74   GLN C CB  1 
ATOM   7297 C CG  . GLN C 2 93  ? -27.556 44.861 144.196 1.00 101.06 ? 74   GLN C CG  1 
ATOM   7298 C CD  . GLN C 2 93  ? -28.979 44.521 143.945 1.00 95.28  ? 74   GLN C CD  1 
ATOM   7299 O OE1 . GLN C 2 93  ? -29.767 45.374 143.559 1.00 85.69  ? 74   GLN C OE1 1 
ATOM   7300 N NE2 . GLN C 2 93  ? -29.331 43.273 144.170 1.00 77.82  ? 74   GLN C NE2 1 
ATOM   7301 N N   . THR C 2 94  ? -25.150 46.970 140.795 1.00 74.58  ? 75   THR C N   1 
ATOM   7302 C CA  . THR C 2 94  ? -23.980 47.814 140.723 1.00 70.52  ? 75   THR C CA  1 
ATOM   7303 C C   . THR C 2 94  ? -24.137 49.177 141.348 1.00 58.98  ? 75   THR C C   1 
ATOM   7304 O O   . THR C 2 94  ? -25.109 49.864 141.134 1.00 68.75  ? 75   THR C O   1 
ATOM   7305 C CB  . THR C 2 94  ? -23.616 48.041 139.283 1.00 53.67  ? 75   THR C CB  1 
ATOM   7306 O OG1 . THR C 2 94  ? -23.717 46.804 138.588 1.00 56.33  ? 75   THR C OG1 1 
ATOM   7307 C CG2 . THR C 2 94  ? -22.219 48.557 139.181 1.00 41.49  ? 75   THR C CG2 1 
ATOM   7308 N N   . ASP C 2 95  ? -23.141 49.556 142.129 1.00 49.96  ? 76   ASP C N   1 
ATOM   7309 C CA  . ASP C 2 95  ? -23.128 50.833 142.795 1.00 61.45  ? 76   ASP C CA  1 
ATOM   7310 C C   . ASP C 2 95  ? -22.425 51.878 141.971 1.00 64.35  ? 76   ASP C C   1 
ATOM   7311 O O   . ASP C 2 95  ? -22.762 53.037 142.010 1.00 80.02  ? 76   ASP C O   1 
ATOM   7312 C CB  . ASP C 2 95  ? -22.450 50.693 144.144 1.00 68.23  ? 76   ASP C CB  1 
ATOM   7313 C CG  . ASP C 2 95  ? -23.281 49.932 145.126 1.00 84.90  ? 76   ASP C CG  1 
ATOM   7314 O OD1 . ASP C 2 95  ? -24.387 50.376 145.440 1.00 91.78  ? 76   ASP C OD1 1 
ATOM   7315 O OD2 . ASP C 2 95  ? -22.840 48.883 145.588 1.00 73.55  ? 76   ASP C OD2 1 
ATOM   7316 N N   . VAL C 2 96  ? -21.439 51.444 141.219 1.00 53.02  ? 77   VAL C N   1 
ATOM   7317 C CA  . VAL C 2 96  ? -20.659 52.319 140.362 1.00 63.02  ? 77   VAL C CA  1 
ATOM   7318 C C   . VAL C 2 96  ? -20.052 51.488 139.231 1.00 64.36  ? 77   VAL C C   1 
ATOM   7319 O O   . VAL C 2 96  ? -19.826 50.286 139.382 1.00 54.47  ? 77   VAL C O   1 
ATOM   7320 C CB  . VAL C 2 96  ? -19.555 53.067 141.151 1.00 46.41  ? 77   VAL C CB  1 
ATOM   7321 C CG1 . VAL C 2 96  ? -18.754 52.095 141.983 1.00 40.17  ? 77   VAL C CG1 1 
ATOM   7322 C CG2 . VAL C 2 96  ? -18.611 53.818 140.219 1.00 52.32  ? 77   VAL C CG2 1 
ATOM   7323 N N   . PHE C 2 97  ? -19.822 52.147 138.098 1.00 50.98  ? 78   PHE C N   1 
ATOM   7324 C CA  . PHE C 2 97  ? -19.279 51.517 136.915 1.00 51.25  ? 78   PHE C CA  1 
ATOM   7325 C C   . PHE C 2 97  ? -17.963 52.144 136.560 1.00 58.12  ? 78   PHE C C   1 
ATOM   7326 O O   . PHE C 2 97  ? -17.787 53.363 136.666 1.00 63.05  ? 78   PHE C O   1 
ATOM   7327 C CB  . PHE C 2 97  ? -20.225 51.690 135.751 1.00 36.91  ? 78   PHE C CB  1 
ATOM   7328 C CG  . PHE C 2 97  ? -21.255 50.637 135.665 1.00 48.65  ? 78   PHE C CG  1 
ATOM   7329 C CD1 . PHE C 2 97  ? -20.918 49.379 135.180 1.00 48.09  ? 78   PHE C CD1 1 
ATOM   7330 C CD2 . PHE C 2 97  ? -22.566 50.882 136.055 1.00 56.44  ? 78   PHE C CD2 1 
ATOM   7331 C CE1 . PHE C 2 97  ? -21.854 48.353 135.071 1.00 56.63  ? 78   PHE C CE1 1 
ATOM   7332 C CE2 . PHE C 2 97  ? -23.542 49.862 135.946 1.00 61.54  ? 78   PHE C CE2 1 
ATOM   7333 C CZ  . PHE C 2 97  ? -23.170 48.583 135.456 1.00 61.21  ? 78   PHE C CZ  1 
ATOM   7334 N N   . LEU C 2 98  ? -17.031 51.297 136.151 1.00 53.04  ? 79   LEU C N   1 
ATOM   7335 C CA  . LEU C 2 98  ? -15.765 51.761 135.633 1.00 58.41  ? 79   LEU C CA  1 
ATOM   7336 C C   . LEU C 2 98  ? -15.736 51.407 134.176 1.00 51.49  ? 79   LEU C C   1 
ATOM   7337 O O   . LEU C 2 98  ? -15.802 50.233 133.818 1.00 52.16  ? 79   LEU C O   1 
ATOM   7338 C CB  . LEU C 2 98  ? -14.600 51.073 136.336 1.00 48.83  ? 79   LEU C CB  1 
ATOM   7339 C CG  . LEU C 2 98  ? -14.303 51.533 137.751 1.00 59.68  ? 79   LEU C CG  1 
ATOM   7340 C CD1 . LEU C 2 98  ? -12.982 50.978 138.177 1.00 71.28  ? 79   LEU C CD1 1 
ATOM   7341 C CD2 . LEU C 2 98  ? -14.261 53.054 137.813 1.00 53.64  ? 79   LEU C CD2 1 
ATOM   7342 N N   . ILE C 2 99  ? -15.647 52.430 133.344 1.00 48.20  ? 80   ILE C N   1 
ATOM   7343 C CA  . ILE C 2 99  ? -15.430 52.252 131.924 1.00 45.43  ? 80   ILE C CA  1 
ATOM   7344 C C   . ILE C 2 99  ? -13.975 52.574 131.555 1.00 50.94  ? 80   ILE C C   1 
ATOM   7345 O O   . ILE C 2 99  ? -13.453 53.652 131.857 1.00 45.93  ? 80   ILE C O   1 
ATOM   7346 C CB  . ILE C 2 99  ? -16.408 53.140 131.129 1.00 60.80  ? 80   ILE C CB  1 
ATOM   7347 C CG1 . ILE C 2 99  ? -17.676 52.369 130.812 1.00 57.91  ? 80   ILE C CG1 1 
ATOM   7348 C CG2 . ILE C 2 99  ? -15.802 53.604 129.811 1.00 75.46  ? 80   ILE C CG2 1 
ATOM   7349 C CD1 . ILE C 2 99  ? -18.904 53.239 130.721 1.00 45.97  ? 80   ILE C CD1 1 
ATOM   7350 N N   . CYS C 2 100 ? -13.312 51.645 130.893 1.00 49.28  ? 81   CYS C N   1 
ATOM   7351 C CA  . CYS C 2 100 ? -11.929 51.899 130.570 1.00 67.34  ? 81   CYS C CA  1 
ATOM   7352 C C   . CYS C 2 100 ? -11.595 51.690 129.115 1.00 57.61  ? 81   CYS C C   1 
ATOM   7353 O O   . CYS C 2 100 ? -12.271 50.963 128.385 1.00 48.70  ? 81   CYS C O   1 
ATOM   7354 C CB  . CYS C 2 100 ? -10.959 51.065 131.423 1.00 66.53  ? 81   CYS C CB  1 
ATOM   7355 S SG  . CYS C 2 100 ? -10.965 51.427 133.157 1.00 82.43  ? 81   CYS C SG  1 
ATOM   7356 N N   . PHE C 2 101 ? -10.504 52.338 128.730 1.00 56.13  ? 82   PHE C N   1 
ATOM   7357 C CA  . PHE C 2 101 ? -9.991  52.277 127.395 1.00 48.97  ? 82   PHE C CA  1 
ATOM   7358 C C   . PHE C 2 101 ? -8.528  52.545 127.540 1.00 45.91  ? 82   PHE C C   1 
ATOM   7359 O O   . PHE C 2 101 ? -8.101  53.211 128.476 1.00 47.37  ? 82   PHE C O   1 
ATOM   7360 C CB  . PHE C 2 101 ? -10.604 53.389 126.542 1.00 55.96  ? 82   PHE C CB  1 
ATOM   7361 C CG  . PHE C 2 101 ? -10.118 54.756 126.910 1.00 53.26  ? 82   PHE C CG  1 
ATOM   7362 C CD1 . PHE C 2 101 ? -8.932  55.253 126.373 1.00 59.55  ? 82   PHE C CD1 1 
ATOM   7363 C CD2 . PHE C 2 101 ? -10.825 55.539 127.820 1.00 55.54  ? 82   PHE C CD2 1 
ATOM   7364 C CE1 . PHE C 2 101 ? -8.465  56.521 126.729 1.00 64.07  ? 82   PHE C CE1 1 
ATOM   7365 C CE2 . PHE C 2 101 ? -10.357 56.804 128.189 1.00 60.88  ? 82   PHE C CE2 1 
ATOM   7366 C CZ  . PHE C 2 101 ? -9.181  57.296 127.637 1.00 61.21  ? 82   PHE C CZ  1 
ATOM   7367 N N   . SER C 2 102 ? -7.768  52.016 126.599 1.00 62.48  ? 83   SER C N   1 
ATOM   7368 C CA  . SER C 2 102 ? -6.334  52.233 126.518 1.00 55.08  ? 83   SER C CA  1 
ATOM   7369 C C   . SER C 2 102 ? -6.047  53.595 125.915 1.00 65.90  ? 83   SER C C   1 
ATOM   7370 O O   . SER C 2 102 ? -6.564  53.948 124.836 1.00 78.73  ? 83   SER C O   1 
ATOM   7371 C CB  . SER C 2 102 ? -5.717  51.193 125.600 1.00 55.99  ? 83   SER C CB  1 
ATOM   7372 O OG  . SER C 2 102 ? -4.323  51.372 125.582 1.00 53.55  ? 83   SER C OG  1 
ATOM   7373 N N   . LEU C 2 103 ? -5.202  54.365 126.578 1.00 66.33  ? 84   LEU C N   1 
ATOM   7374 C CA  . LEU C 2 103 ? -4.808  55.657 126.007 1.00 70.25  ? 84   LEU C CA  1 
ATOM   7375 C C   . LEU C 2 103 ? -4.041  55.490 124.689 1.00 71.54  ? 84   LEU C C   1 
ATOM   7376 O O   . LEU C 2 103 ? -3.979  56.429 123.907 1.00 71.17  ? 84   LEU C O   1 
ATOM   7377 C CB  . LEU C 2 103 ? -3.965  56.464 126.998 1.00 58.05  ? 84   LEU C CB  1 
ATOM   7378 C CG  . LEU C 2 103 ? -4.663  56.920 128.282 1.00 59.08  ? 84   LEU C CG  1 
ATOM   7379 C CD1 . LEU C 2 103 ? -3.591  57.330 129.319 1.00 57.84  ? 84   LEU C CD1 1 
ATOM   7380 C CD2 . LEU C 2 103 ? -5.636  58.056 127.988 1.00 46.33  ? 84   LEU C CD2 1 
ATOM   7381 N N   . VAL C 2 104 ? -3.475  54.298 124.460 1.00 61.24  ? 85   VAL C N   1 
ATOM   7382 C CA  . VAL C 2 104 ? -2.736  53.993 123.249 1.00 44.59  ? 85   VAL C CA  1 
ATOM   7383 C C   . VAL C 2 104 ? -3.545  53.118 122.321 1.00 51.40  ? 85   VAL C C   1 
ATOM   7384 O O   . VAL C 2 104 ? -2.974  52.519 121.405 1.00 59.72  ? 85   VAL C O   1 
ATOM   7385 C CB  . VAL C 2 104 ? -1.390  53.297 123.516 1.00 54.74  ? 85   VAL C CB  1 
ATOM   7386 C CG1 . VAL C 2 104 ? -0.478  54.176 124.415 1.00 54.56  ? 85   VAL C CG1 1 
ATOM   7387 C CG2 . VAL C 2 104 ? -1.601  51.907 124.086 1.00 36.44  ? 85   VAL C CG2 1 
ATOM   7388 N N   . SER C 2 105 ? -4.861  53.048 122.544 1.00 56.24  ? 86   SER C N   1 
ATOM   7389 C CA  . SER C 2 105 ? -5.732  52.406 121.574 1.00 62.58  ? 86   SER C CA  1 
ATOM   7390 C C   . SER C 2 105 ? -6.984  53.201 121.211 1.00 56.94  ? 86   SER C C   1 
ATOM   7391 O O   . SER C 2 105 ? -8.045  53.002 121.800 1.00 56.18  ? 86   SER C O   1 
ATOM   7392 C CB  . SER C 2 105 ? -6.099  50.991 121.998 1.00 50.07  ? 86   SER C CB  1 
ATOM   7393 O OG  . SER C 2 105 ? -7.197  50.533 121.221 1.00 70.75  ? 86   SER C OG  1 
ATOM   7394 N N   . PRO C 2 106 ? -6.877  54.074 120.193 1.00 60.63  ? 87   PRO C N   1 
ATOM   7395 C CA  . PRO C 2 106 ? -8.056  54.875 119.822 1.00 62.76  ? 87   PRO C CA  1 
ATOM   7396 C C   . PRO C 2 106 ? -9.296  54.028 119.561 1.00 70.40  ? 87   PRO C C   1 
ATOM   7397 O O   . PRO C 2 106 ? -10.419 54.496 119.783 1.00 66.01  ? 87   PRO C O   1 
ATOM   7398 C CB  . PRO C 2 106 ? -7.603  55.617 118.570 1.00 40.66  ? 87   PRO C CB  1 
ATOM   7399 C CG  . PRO C 2 106 ? -6.113  55.762 118.765 1.00 63.36  ? 87   PRO C CG  1 
ATOM   7400 C CD  . PRO C 2 106 ? -5.655  54.523 119.492 1.00 45.47  ? 87   PRO C CD  1 
ATOM   7401 N N   . ALA C 2 107 ? -9.108  52.790 119.116 1.00 69.76  ? 88   ALA C N   1 
ATOM   7402 C CA  . ALA C 2 107 ? -10.250 51.936 118.840 1.00 68.40  ? 88   ALA C CA  1 
ATOM   7403 C C   . ALA C 2 107 ? -11.040 51.769 120.138 1.00 70.03  ? 88   ALA C C   1 
ATOM   7404 O O   . ALA C 2 107 ? -12.274 52.030 120.174 1.00 71.07  ? 88   ALA C O   1 
ATOM   7405 C CB  . ALA C 2 107 ? -9.801  50.599 118.310 1.00 56.89  ? 88   ALA C CB  1 
ATOM   7406 N N   . SER C 2 108 ? -10.327 51.388 121.207 1.00 47.98  ? 89   SER C N   1 
ATOM   7407 C CA  . SER C 2 108 ? -10.972 51.137 122.509 1.00 60.44  ? 89   SER C CA  1 
ATOM   7408 C C   . SER C 2 108 ? -11.674 52.391 122.970 1.00 53.35  ? 89   SER C C   1 
ATOM   7409 O O   . SER C 2 108 ? -12.775 52.344 123.495 1.00 62.31  ? 89   SER C O   1 
ATOM   7410 C CB  . SER C 2 108 ? -9.953  50.726 123.559 1.00 39.43  ? 89   SER C CB  1 
ATOM   7411 O OG  . SER C 2 108 ? -9.092  51.817 123.844 1.00 52.15  ? 89   SER C OG  1 
ATOM   7412 N N   . PHE C 2 109 ? -11.007 53.513 122.756 1.00 46.70  ? 90   PHE C N   1 
ATOM   7413 C CA  . PHE C 2 109 ? -11.574 54.806 123.053 1.00 66.63  ? 90   PHE C CA  1 
ATOM   7414 C C   . PHE C 2 109 ? -12.903 55.004 122.300 1.00 65.35  ? 90   PHE C C   1 
ATOM   7415 O O   . PHE C 2 109 ? -13.897 55.438 122.885 1.00 52.85  ? 90   PHE C O   1 
ATOM   7416 C CB  . PHE C 2 109 ? -10.550 55.924 122.742 1.00 57.65  ? 90   PHE C CB  1 
ATOM   7417 C CG  . PHE C 2 109 ? -10.970 57.285 123.210 1.00 60.52  ? 90   PHE C CG  1 
ATOM   7418 C CD1 . PHE C 2 109 ? -11.777 58.086 122.416 1.00 58.92  ? 90   PHE C CD1 1 
ATOM   7419 C CD2 . PHE C 2 109 ? -10.569 57.758 124.448 1.00 65.63  ? 90   PHE C CD2 1 
ATOM   7420 C CE1 . PHE C 2 109 ? -12.171 59.340 122.843 1.00 71.44  ? 90   PHE C CE1 1 
ATOM   7421 C CE2 . PHE C 2 109 ? -10.960 59.009 124.902 1.00 63.87  ? 90   PHE C CE2 1 
ATOM   7422 C CZ  . PHE C 2 109 ? -11.753 59.813 124.096 1.00 74.72  ? 90   PHE C CZ  1 
ATOM   7423 N N   . GLU C 2 110 ? -12.917 54.666 121.016 1.00 57.43  ? 91   GLU C N   1 
ATOM   7424 C CA  . GLU C 2 110 ? -14.090 54.899 120.221 1.00 50.86  ? 91   GLU C CA  1 
ATOM   7425 C C   . GLU C 2 110 ? -15.217 53.986 120.698 1.00 60.53  ? 91   GLU C C   1 
ATOM   7426 O O   . GLU C 2 110 ? -16.383 54.375 120.688 1.00 61.59  ? 91   GLU C O   1 
ATOM   7427 C CB  . GLU C 2 110 ? -13.779 54.721 118.730 1.00 64.77  ? 91   GLU C CB  1 
ATOM   7428 C CG  . GLU C 2 110 ? -14.991 54.938 117.765 1.00 93.76  ? 91   GLU C CG  1 
ATOM   7429 C CD  . GLU C 2 110 ? -15.728 56.285 117.949 1.00 96.61  ? 91   GLU C CD  1 
ATOM   7430 O OE1 . GLU C 2 110 ? -15.064 57.268 118.350 1.00 97.73  ? 91   GLU C OE1 1 
ATOM   7431 O OE2 . GLU C 2 110 ? -16.961 56.351 117.688 1.00 74.17  ? 91   GLU C OE2 1 
ATOM   7432 N N   . ASN C 2 111 ? -14.866 52.788 121.149 1.00 48.00  ? 92   ASN C N   1 
ATOM   7433 C CA  . ASN C 2 111 ? -15.867 51.846 121.656 1.00 70.38  ? 92   ASN C CA  1 
ATOM   7434 C C   . ASN C 2 111 ? -16.551 52.260 122.959 1.00 73.65  ? 92   ASN C C   1 
ATOM   7435 O O   . ASN C 2 111 ? -17.596 51.718 123.330 1.00 63.14  ? 92   ASN C O   1 
ATOM   7436 C CB  . ASN C 2 111 ? -15.255 50.467 121.830 1.00 70.19  ? 92   ASN C CB  1 
ATOM   7437 C CG  . ASN C 2 111 ? -15.291 49.667 120.572 1.00 71.41  ? 92   ASN C CG  1 
ATOM   7438 O OD1 . ASN C 2 111 ? -14.335 48.994 120.240 1.00 70.96  ? 92   ASN C OD1 1 
ATOM   7439 N ND2 . ASN C 2 111 ? -16.396 49.734 119.862 1.00 65.94  ? 92   ASN C ND2 1 
ATOM   7440 N N   . VAL C 2 112 ? -15.946 53.210 123.658 1.00 64.98  ? 93   VAL C N   1 
ATOM   7441 C CA  . VAL C 2 112 ? -16.547 53.760 124.849 1.00 50.46  ? 93   VAL C CA  1 
ATOM   7442 C C   . VAL C 2 112 ? -17.870 54.364 124.471 1.00 69.50  ? 93   VAL C C   1 
ATOM   7443 O O   . VAL C 2 112 ? -18.891 54.072 125.093 1.00 72.80  ? 93   VAL C O   1 
ATOM   7444 C CB  . VAL C 2 112 ? -15.716 54.875 125.432 1.00 56.22  ? 93   VAL C CB  1 
ATOM   7445 C CG1 . VAL C 2 112 ? -16.469 55.515 126.582 1.00 52.75  ? 93   VAL C CG1 1 
ATOM   7446 C CG2 . VAL C 2 112 ? -14.358 54.359 125.887 1.00 51.93  ? 93   VAL C CG2 1 
ATOM   7447 N N   . ARG C 2 113 ? -17.826 55.221 123.449 1.00 76.20  ? 94   ARG C N   1 
ATOM   7448 C CA  . ARG C 2 113 ? -18.981 55.953 122.943 1.00 70.08  ? 94   ARG C CA  1 
ATOM   7449 C C   . ARG C 2 113 ? -19.877 55.022 122.134 1.00 65.78  ? 94   ARG C C   1 
ATOM   7450 O O   . ARG C 2 113 ? -21.092 55.033 122.275 1.00 64.20  ? 94   ARG C O   1 
ATOM   7451 C CB  . ARG C 2 113 ? -18.510 57.113 122.071 1.00 78.07  ? 94   ARG C CB  1 
ATOM   7452 C CG  . ARG C 2 113 ? -19.629 57.734 121.242 1.00 95.82  ? 94   ARG C CG  1 
ATOM   7453 C CD  . ARG C 2 113 ? -19.139 58.403 119.958 1.00 87.12  ? 94   ARG C CD  1 
ATOM   7454 N NE  . ARG C 2 113 ? -18.569 59.707 120.240 1.00 85.45  ? 94   ARG C NE  1 
ATOM   7455 C CZ  . ARG C 2 113 ? -17.271 59.982 120.190 1.00 83.90  ? 94   ARG C CZ  1 
ATOM   7456 N NH1 . ARG C 2 113 ? -16.413 59.041 119.844 1.00 82.37  ? 94   ARG C NH1 1 
ATOM   7457 N NH2 . ARG C 2 113 ? -16.825 61.204 120.469 1.00 72.78  ? 94   ARG C NH2 1 
ATOM   7458 N N   . ALA C 2 114 ? -19.260 54.191 121.309 1.00 62.70  ? 95   ALA C N   1 
ATOM   7459 C CA  . ALA C 2 114 ? -19.997 53.271 120.455 1.00 67.16  ? 95   ALA C CA  1 
ATOM   7460 C C   . ALA C 2 114 ? -20.640 52.062 121.136 1.00 70.28  ? 95   ALA C C   1 
ATOM   7461 O O   . ALA C 2 114 ? -21.769 51.705 120.810 1.00 69.96  ? 95   ALA C O   1 
ATOM   7462 C CB  . ALA C 2 114 ? -19.111 52.810 119.316 1.00 52.44  ? 95   ALA C CB  1 
ATOM   7463 N N   . LYS C 2 115 ? -19.932 51.421 122.061 1.00 74.30  ? 96   LYS C N   1 
ATOM   7464 C CA  . LYS C 2 115 ? -20.457 50.207 122.685 1.00 74.78  ? 96   LYS C CA  1 
ATOM   7465 C C   . LYS C 2 115 ? -20.712 50.193 124.194 1.00 75.37  ? 96   LYS C C   1 
ATOM   7466 O O   . LYS C 2 115 ? -21.820 49.902 124.634 1.00 65.95  ? 96   LYS C O   1 
ATOM   7467 C CB  . LYS C 2 115 ? -19.558 49.021 122.329 1.00 63.58  ? 96   LYS C CB  1 
ATOM   7468 C CG  . LYS C 2 115 ? -19.889 47.756 123.092 1.00 64.65  ? 96   LYS C CG  1 
ATOM   7469 C CD  . LYS C 2 115 ? -19.081 46.577 122.591 1.00 69.36  ? 96   LYS C CD  1 
ATOM   7470 C CE  . LYS C 2 115 ? -19.625 45.275 123.148 1.00 83.65  ? 96   LYS C CE  1 
ATOM   7471 N NZ  . LYS C 2 115 ? -18.899 44.096 122.615 1.00 95.85  ? 96   LYS C NZ  1 
ATOM   7472 N N   . TRP C 2 116 ? -19.685 50.475 124.983 1.00 74.88  ? 97   TRP C N   1 
ATOM   7473 C CA  . TRP C 2 116 ? -19.801 50.410 126.439 1.00 76.92  ? 97   TRP C CA  1 
ATOM   7474 C C   . TRP C 2 116 ? -20.836 51.330 127.088 1.00 75.80  ? 97   TRP C C   1 
ATOM   7475 O O   . TRP C 2 116 ? -21.790 50.856 127.695 1.00 77.02  ? 97   TRP C O   1 
ATOM   7476 C CB  . TRP C 2 116 ? -18.425 50.568 127.087 1.00 51.92  ? 97   TRP C CB  1 
ATOM   7477 C CG  . TRP C 2 116 ? -17.448 49.578 126.553 1.00 62.96  ? 97   TRP C CG  1 
ATOM   7478 C CD1 . TRP C 2 116 ? -16.300 49.844 125.878 1.00 76.33  ? 97   TRP C CD1 1 
ATOM   7479 C CD2 . TRP C 2 116 ? -17.555 48.153 126.615 1.00 67.94  ? 97   TRP C CD2 1 
ATOM   7480 N NE1 . TRP C 2 116 ? -15.674 48.676 125.528 1.00 72.58  ? 97   TRP C NE1 1 
ATOM   7481 C CE2 . TRP C 2 116 ? -16.428 47.622 125.970 1.00 60.39  ? 97   TRP C CE2 1 
ATOM   7482 C CE3 . TRP C 2 116 ? -18.494 47.275 127.161 1.00 64.74  ? 97   TRP C CE3 1 
ATOM   7483 C CZ2 . TRP C 2 116 ? -16.211 46.256 125.856 1.00 60.88  ? 97   TRP C CZ2 1 
ATOM   7484 C CZ3 . TRP C 2 116 ? -18.277 45.922 127.047 1.00 44.13  ? 97   TRP C CZ3 1 
ATOM   7485 C CH2 . TRP C 2 116 ? -17.146 45.424 126.401 1.00 60.48  ? 97   TRP C CH2 1 
ATOM   7486 N N   . TYR C 2 117 ? -20.649 52.636 126.965 1.00 70.48  ? 98   TYR C N   1 
ATOM   7487 C CA  . TYR C 2 117 ? -21.568 53.585 127.555 1.00 63.16  ? 98   TYR C CA  1 
ATOM   7488 C C   . TYR C 2 117 ? -23.025 53.200 127.243 1.00 68.38  ? 98   TYR C C   1 
ATOM   7489 O O   . TYR C 2 117 ? -23.804 53.019 128.160 1.00 80.15  ? 98   TYR C O   1 
ATOM   7490 C CB  . TYR C 2 117 ? -21.220 55.040 127.168 1.00 70.46  ? 98   TYR C CB  1 
ATOM   7491 C CG  . TYR C 2 117 ? -22.286 56.046 127.540 1.00 77.50  ? 98   TYR C CG  1 
ATOM   7492 C CD1 . TYR C 2 117 ? -22.885 56.019 128.801 1.00 77.42  ? 98   TYR C CD1 1 
ATOM   7493 C CD2 . TYR C 2 117 ? -22.707 57.016 126.634 1.00 85.99  ? 98   TYR C CD2 1 
ATOM   7494 C CE1 . TYR C 2 117 ? -23.867 56.917 129.149 1.00 78.44  ? 98   TYR C CE1 1 
ATOM   7495 C CE2 . TYR C 2 117 ? -23.698 57.937 126.980 1.00 98.36  ? 98   TYR C CE2 1 
ATOM   7496 C CZ  . TYR C 2 117 ? -24.273 57.874 128.245 1.00 102.66 ? 98   TYR C CZ  1 
ATOM   7497 O OH  . TYR C 2 117 ? -25.259 58.765 128.617 1.00 116.52 ? 98   TYR C OH  1 
ATOM   7498 N N   . PRO C 2 118 ? -23.386 53.035 125.959 1.00 74.30  ? 99   PRO C N   1 
ATOM   7499 C CA  . PRO C 2 118 ? -24.741 52.610 125.620 1.00 66.14  ? 99   PRO C CA  1 
ATOM   7500 C C   . PRO C 2 118 ? -25.230 51.405 126.383 1.00 63.27  ? 99   PRO C C   1 
ATOM   7501 O O   . PRO C 2 118 ? -26.348 51.413 126.896 1.00 66.43  ? 99   PRO C O   1 
ATOM   7502 C CB  . PRO C 2 118 ? -24.613 52.263 124.149 1.00 57.82  ? 99   PRO C CB  1 
ATOM   7503 C CG  . PRO C 2 118 ? -23.658 53.291 123.664 1.00 79.49  ? 99   PRO C CG  1 
ATOM   7504 C CD  . PRO C 2 118 ? -22.644 53.447 124.754 1.00 71.09  ? 99   PRO C CD  1 
ATOM   7505 N N   . GLU C 2 119 ? -24.412 50.364 126.463 1.00 62.33  ? 100  GLU C N   1 
ATOM   7506 C CA  . GLU C 2 119 ? -24.806 49.149 127.164 1.00 68.28  ? 100  GLU C CA  1 
ATOM   7507 C C   . GLU C 2 119 ? -25.109 49.403 128.632 1.00 71.22  ? 100  GLU C C   1 
ATOM   7508 O O   . GLU C 2 119 ? -26.139 48.975 129.145 1.00 75.62  ? 100  GLU C O   1 
ATOM   7509 C CB  . GLU C 2 119 ? -23.720 48.084 127.049 1.00 34.59  ? 100  GLU C CB  1 
ATOM   7510 C CG  . GLU C 2 119 ? -24.195 46.700 127.430 1.00 40.60  ? 100  GLU C CG  1 
ATOM   7511 C CD  . GLU C 2 119 ? -23.076 45.692 127.462 1.00 57.00  ? 100  GLU C CD  1 
ATOM   7512 O OE1 . GLU C 2 119 ? -22.211 45.797 128.350 1.00 61.44  ? 100  GLU C OE1 1 
ATOM   7513 O OE2 . GLU C 2 119 ? -23.054 44.796 126.598 1.00 67.49  ? 100  GLU C OE2 1 
ATOM   7514 N N   . VAL C 2 120 ? -24.201 50.096 129.304 1.00 53.64  ? 101  VAL C N   1 
ATOM   7515 C CA  . VAL C 2 120 ? -24.366 50.399 130.717 1.00 61.89  ? 101  VAL C CA  1 
ATOM   7516 C C   . VAL C 2 120 ? -25.620 51.215 130.968 1.00 69.35  ? 101  VAL C C   1 
ATOM   7517 O O   . VAL C 2 120 ? -26.506 50.796 131.708 1.00 74.42  ? 101  VAL C O   1 
ATOM   7518 C CB  . VAL C 2 120 ? -23.160 51.171 131.263 1.00 68.14  ? 101  VAL C CB  1 
ATOM   7519 C CG1 . VAL C 2 120 ? -23.489 51.786 132.606 1.00 60.77  ? 101  VAL C CG1 1 
ATOM   7520 C CG2 . VAL C 2 120 ? -21.957 50.261 131.364 1.00 46.68  ? 101  VAL C CG2 1 
ATOM   7521 N N   . ARG C 2 121 ? -25.687 52.387 130.347 1.00 67.17  ? 102  ARG C N   1 
ATOM   7522 C CA  . ARG C 2 121 ? -26.826 53.279 130.509 1.00 55.39  ? 102  ARG C CA  1 
ATOM   7523 C C   . ARG C 2 121 ? -28.143 52.590 130.206 1.00 58.34  ? 102  ARG C C   1 
ATOM   7524 O O   . ARG C 2 121 ? -29.144 52.834 130.872 1.00 82.41  ? 102  ARG C O   1 
ATOM   7525 C CB  . ARG C 2 121 ? -26.667 54.521 129.639 1.00 62.40  ? 102  ARG C CB  1 
ATOM   7526 C CG  . ARG C 2 121 ? -25.660 55.509 130.178 1.00 85.87  ? 102  ARG C CG  1 
ATOM   7527 C CD  . ARG C 2 121 ? -25.827 55.675 131.677 1.00 94.51  ? 102  ARG C CD  1 
ATOM   7528 N NE  . ARG C 2 121 ? -25.136 56.857 132.178 1.00 105.56 ? 102  ARG C NE  1 
ATOM   7529 C CZ  . ARG C 2 121 ? -25.001 57.151 133.464 1.00 108.70 ? 102  ARG C CZ  1 
ATOM   7530 N NH1 . ARG C 2 121 ? -25.503 56.342 134.384 1.00 98.02  ? 102  ARG C NH1 1 
ATOM   7531 N NH2 . ARG C 2 121 ? -24.358 58.250 133.830 1.00 116.59 ? 102  ARG C NH2 1 
ATOM   7532 N N   . HIS C 2 122 ? -28.144 51.728 129.201 1.00 51.26  ? 103  HIS C N   1 
ATOM   7533 C CA  . HIS C 2 122 ? -29.355 51.014 128.842 1.00 74.94  ? 103  HIS C CA  1 
ATOM   7534 C C   . HIS C 2 122 ? -29.807 50.116 129.978 1.00 84.02  ? 103  HIS C C   1 
ATOM   7535 O O   . HIS C 2 122 ? -30.998 49.996 130.250 1.00 89.14  ? 103  HIS C O   1 
ATOM   7536 C CB  . HIS C 2 122 ? -29.137 50.163 127.596 1.00 70.78  ? 103  HIS C CB  1 
ATOM   7537 C CG  . HIS C 2 122 ? -30.194 49.124 127.392 1.00 91.86  ? 103  HIS C CG  1 
ATOM   7538 N ND1 . HIS C 2 122 ? -31.228 49.279 126.495 1.00 98.99  ? 103  HIS C ND1 1 
ATOM   7539 C CD2 . HIS C 2 122 ? -30.386 47.922 127.983 1.00 95.44  ? 103  HIS C CD2 1 
ATOM   7540 C CE1 . HIS C 2 122 ? -32.006 48.213 126.535 1.00 91.51  ? 103  HIS C CE1 1 
ATOM   7541 N NE2 . HIS C 2 122 ? -31.517 47.374 127.430 1.00 87.15  ? 103  HIS C NE2 1 
ATOM   7542 N N   . HIS C 2 123 ? -28.849 49.479 130.638 1.00 77.91  ? 104  HIS C N   1 
ATOM   7543 C CA  . HIS C 2 123 ? -29.167 48.564 131.726 1.00 78.06  ? 104  HIS C CA  1 
ATOM   7544 C C   . HIS C 2 123 ? -29.282 49.254 133.081 1.00 80.81  ? 104  HIS C C   1 
ATOM   7545 O O   . HIS C 2 123 ? -30.084 48.845 133.921 1.00 74.43  ? 104  HIS C O   1 
ATOM   7546 C CB  . HIS C 2 123 ? -28.120 47.448 131.777 1.00 71.27  ? 104  HIS C CB  1 
ATOM   7547 C CG  . HIS C 2 123 ? -28.268 46.438 130.680 1.00 85.34  ? 104  HIS C CG  1 
ATOM   7548 N ND1 . HIS C 2 123 ? -29.019 45.287 130.821 1.00 79.38  ? 104  HIS C ND1 1 
ATOM   7549 C CD2 . HIS C 2 123 ? -27.781 46.414 129.416 1.00 88.71  ? 104  HIS C CD2 1 
ATOM   7550 C CE1 . HIS C 2 123 ? -28.984 44.595 129.696 1.00 67.91  ? 104  HIS C CE1 1 
ATOM   7551 N NE2 . HIS C 2 123 ? -28.242 45.258 128.826 1.00 77.43  ? 104  HIS C NE2 1 
ATOM   7552 N N   . CYS C 2 124 ? -28.478 50.297 133.284 1.00 75.82  ? 105  CYS C N   1 
ATOM   7553 C CA  . CYS C 2 124 ? -28.418 50.999 134.560 1.00 72.43  ? 105  CYS C CA  1 
ATOM   7554 C C   . CYS C 2 124 ? -28.363 52.507 134.308 1.00 76.78  ? 105  CYS C C   1 
ATOM   7555 O O   . CYS C 2 124 ? -27.278 53.112 134.267 1.00 78.75  ? 105  CYS C O   1 
ATOM   7556 C CB  . CYS C 2 124 ? -27.210 50.523 135.382 1.00 67.74  ? 105  CYS C CB  1 
ATOM   7557 S SG  . CYS C 2 124 ? -27.176 48.754 135.743 1.00 73.31  ? 105  CYS C SG  1 
ATOM   7558 N N   . PRO C 2 125 ? -29.540 53.120 134.130 1.00 72.29  ? 106  PRO C N   1 
ATOM   7559 C CA  . PRO C 2 125 ? -29.633 54.518 133.753 1.00 69.07  ? 106  PRO C CA  1 
ATOM   7560 C C   . PRO C 2 125 ? -28.981 55.451 134.754 1.00 78.66  ? 106  PRO C C   1 
ATOM   7561 O O   . PRO C 2 125 ? -28.309 56.385 134.338 1.00 88.16  ? 106  PRO C O   1 
ATOM   7562 C CB  . PRO C 2 125 ? -31.138 54.762 133.715 1.00 64.04  ? 106  PRO C CB  1 
ATOM   7563 C CG  . PRO C 2 125 ? -31.724 53.441 133.459 1.00 63.24  ? 106  PRO C CG  1 
ATOM   7564 C CD  . PRO C 2 125 ? -30.869 52.496 134.216 1.00 74.11  ? 106  PRO C CD  1 
ATOM   7565 N N   . ASN C 2 126 ? -29.149 55.187 136.053 1.00 76.95  ? 107  ASN C N   1 
ATOM   7566 C CA  . ASN C 2 126 ? -28.709 56.132 137.094 1.00 83.16  ? 107  ASN C CA  1 
ATOM   7567 C C   . ASN C 2 126 ? -27.423 55.819 137.864 1.00 89.59  ? 107  ASN C C   1 
ATOM   7568 O O   . ASN C 2 126 ? -26.974 56.653 138.654 1.00 94.64  ? 107  ASN C O   1 
ATOM   7569 C CB  . ASN C 2 126 ? -29.845 56.410 138.085 1.00 73.30  ? 107  ASN C CB  1 
ATOM   7570 C CG  . ASN C 2 126 ? -31.168 56.621 137.395 1.00 80.59  ? 107  ASN C CG  1 
ATOM   7571 O OD1 . ASN C 2 126 ? -32.148 55.956 137.716 1.00 85.69  ? 107  ASN C OD1 1 
ATOM   7572 N ND2 . ASN C 2 126 ? -31.202 57.529 136.426 1.00 60.62  ? 107  ASN C ND2 1 
ATOM   7573 N N   . THR C 2 127 ? -26.837 54.640 137.649 1.00 76.49  ? 108  THR C N   1 
ATOM   7574 C CA  . THR C 2 127 ? -25.578 54.292 138.301 1.00 74.95  ? 108  THR C CA  1 
ATOM   7575 C C   . THR C 2 127 ? -24.447 55.187 137.784 1.00 72.46  ? 108  THR C C   1 
ATOM   7576 O O   . THR C 2 127 ? -24.317 55.398 136.570 1.00 62.06  ? 108  THR C O   1 
ATOM   7577 C CB  . THR C 2 127 ? -25.239 52.839 138.079 1.00 64.07  ? 108  THR C CB  1 
ATOM   7578 O OG1 . THR C 2 127 ? -26.392 52.054 138.366 1.00 75.48  ? 108  THR C OG1 1 
ATOM   7579 C CG2 . THR C 2 127 ? -24.150 52.404 138.990 1.00 71.76  ? 108  THR C CG2 1 
ATOM   7580 N N   . PRO C 2 128 ? -23.628 55.732 138.709 1.00 76.17  ? 109  PRO C N   1 
ATOM   7581 C CA  . PRO C 2 128 ? -22.544 56.610 138.301 1.00 67.78  ? 109  PRO C CA  1 
ATOM   7582 C C   . PRO C 2 128 ? -21.504 55.894 137.427 1.00 69.24  ? 109  PRO C C   1 
ATOM   7583 O O   . PRO C 2 128 ? -21.337 54.683 137.495 1.00 51.73  ? 109  PRO C O   1 
ATOM   7584 C CB  . PRO C 2 128 ? -21.899 57.022 139.634 1.00 56.61  ? 109  PRO C CB  1 
ATOM   7585 C CG  . PRO C 2 128 ? -22.866 56.647 140.691 1.00 52.58  ? 109  PRO C CG  1 
ATOM   7586 C CD  . PRO C 2 128 ? -23.596 55.473 140.161 1.00 56.43  ? 109  PRO C CD  1 
ATOM   7587 N N   . ILE C 2 129 ? -20.800 56.672 136.618 1.00 83.80  ? 110  ILE C N   1 
ATOM   7588 C CA  . ILE C 2 129 ? -19.777 56.136 135.747 1.00 71.41  ? 110  ILE C CA  1 
ATOM   7589 C C   . ILE C 2 129 ? -18.465 56.874 135.918 1.00 60.61  ? 110  ILE C C   1 
ATOM   7590 O O   . ILE C 2 129 ? -18.449 58.090 136.011 1.00 58.91  ? 110  ILE C O   1 
ATOM   7591 C CB  . ILE C 2 129 ? -20.213 56.238 134.268 1.00 73.20  ? 110  ILE C CB  1 
ATOM   7592 C CG1 . ILE C 2 129 ? -21.312 55.226 133.960 1.00 64.82  ? 110  ILE C CG1 1 
ATOM   7593 C CG2 . ILE C 2 129 ? -19.024 56.037 133.326 1.00 61.49  ? 110  ILE C CG2 1 
ATOM   7594 C CD1 . ILE C 2 129 ? -21.787 55.325 132.555 1.00 65.17  ? 110  ILE C CD1 1 
ATOM   7595 N N   . ILE C 2 130 ? -17.365 56.130 135.946 1.00 72.14  ? 111  ILE C N   1 
ATOM   7596 C CA  . ILE C 2 130 ? -16.035 56.723 135.823 1.00 67.37  ? 111  ILE C CA  1 
ATOM   7597 C C   . ILE C 2 130 ? -15.313 56.223 134.566 1.00 68.78  ? 111  ILE C C   1 
ATOM   7598 O O   . ILE C 2 130 ? -15.310 55.040 134.245 1.00 69.02  ? 111  ILE C O   1 
ATOM   7599 C CB  . ILE C 2 130 ? -15.183 56.448 137.050 1.00 50.68  ? 111  ILE C CB  1 
ATOM   7600 C CG1 . ILE C 2 130 ? -15.925 56.887 138.298 1.00 66.76  ? 111  ILE C CG1 1 
ATOM   7601 C CG2 . ILE C 2 130 ? -13.865 57.171 136.981 1.00 54.62  ? 111  ILE C CG2 1 
ATOM   7602 C CD1 . ILE C 2 130 ? -15.022 56.979 139.497 1.00 62.30  ? 111  ILE C CD1 1 
ATOM   7603 N N   . LEU C 2 131 ? -14.697 57.159 133.873 1.00 52.74  ? 112  LEU C N   1 
ATOM   7604 C CA  . LEU C 2 131 ? -13.994 56.884 132.665 1.00 55.27  ? 112  LEU C CA  1 
ATOM   7605 C C   . LEU C 2 131 ? -12.536 56.705 132.998 1.00 60.55  ? 112  LEU C C   1 
ATOM   7606 O O   . LEU C 2 131 ? -11.894 57.592 133.578 1.00 56.84  ? 112  LEU C O   1 
ATOM   7607 C CB  . LEU C 2 131 ? -14.185 58.068 131.722 1.00 65.74  ? 112  LEU C CB  1 
ATOM   7608 C CG  . LEU C 2 131 ? -14.152 57.830 130.214 1.00 60.07  ? 112  LEU C CG  1 
ATOM   7609 C CD1 . LEU C 2 131 ? -12.746 58.058 129.709 1.00 64.44  ? 112  LEU C CD1 1 
ATOM   7610 C CD2 . LEU C 2 131 ? -14.673 56.449 129.817 1.00 45.38  ? 112  LEU C CD2 1 
ATOM   7611 N N   . VAL C 2 132 ? -11.996 55.556 132.637 1.00 45.99  ? 113  VAL C N   1 
ATOM   7612 C CA  . VAL C 2 132 ? -10.608 55.289 132.973 1.00 44.14  ? 113  VAL C CA  1 
ATOM   7613 C C   . VAL C 2 132 ? -9.703  55.052 131.749 1.00 54.72  ? 113  VAL C C   1 
ATOM   7614 O O   . VAL C 2 132 ? -9.980  54.207 130.898 1.00 54.07  ? 113  VAL C O   1 
ATOM   7615 C CB  . VAL C 2 132 ? -10.497 54.147 134.035 1.00 56.70  ? 113  VAL C CB  1 
ATOM   7616 C CG1 . VAL C 2 132 ? -9.065  54.054 134.604 1.00 36.62  ? 113  VAL C CG1 1 
ATOM   7617 C CG2 . VAL C 2 132 ? -11.499 54.378 135.147 1.00 36.80  ? 113  VAL C CG2 1 
ATOM   7618 N N   . GLY C 2 133 ? -8.623  55.824 131.687 1.00 51.03  ? 114  GLY C N   1 
ATOM   7619 C CA  . GLY C 2 133 ? -7.629  55.702 130.649 1.00 55.60  ? 114  GLY C CA  1 
ATOM   7620 C C   . GLY C 2 133 ? -6.435  54.938 131.187 1.00 63.81  ? 114  GLY C C   1 
ATOM   7621 O O   . GLY C 2 133 ? -5.740  55.385 132.116 1.00 63.33  ? 114  GLY C O   1 
ATOM   7622 N N   . THR C 2 134 ? -6.215  53.780 130.579 1.00 61.93  ? 115  THR C N   1 
ATOM   7623 C CA  . THR C 2 134 ? -5.195  52.825 130.942 1.00 39.78  ? 115  THR C CA  1 
ATOM   7624 C C   . THR C 2 134 ? -3.905  53.133 130.224 1.00 44.81  ? 115  THR C C   1 
ATOM   7625 O O   . THR C 2 134 ? -3.866  53.986 129.341 1.00 68.72  ? 115  THR C O   1 
ATOM   7626 C CB  . THR C 2 134 ? -5.666  51.453 130.461 1.00 60.46  ? 115  THR C CB  1 
ATOM   7627 O OG1 . THR C 2 134 ? -7.011  51.259 130.885 1.00 70.43  ? 115  THR C OG1 1 
ATOM   7628 C CG2 . THR C 2 134 ? -4.847  50.357 131.057 1.00 79.59  ? 115  THR C CG2 1 
ATOM   7629 N N   . LYS C 2 135 ? -2.867  52.369 130.542 1.00 56.57  ? 116  LYS C N   1 
ATOM   7630 C CA  . LYS C 2 135 ? -1.582  52.466 129.862 1.00 49.99  ? 116  LYS C CA  1 
ATOM   7631 C C   . LYS C 2 135 ? -1.033  53.876 129.769 1.00 56.98  ? 116  LYS C C   1 
ATOM   7632 O O   . LYS C 2 135 ? -0.544  54.284 128.723 1.00 53.13  ? 116  LYS C O   1 
ATOM   7633 C CB  . LYS C 2 135 ? -1.703  51.896 128.447 1.00 56.39  ? 116  LYS C CB  1 
ATOM   7634 C CG  . LYS C 2 135 ? -2.283  50.497 128.368 1.00 39.80  ? 116  LYS C CG  1 
ATOM   7635 C CD  . LYS C 2 135 ? -1.224  49.445 128.609 1.00 56.52  ? 116  LYS C CD  1 
ATOM   7636 C CE  . LYS C 2 135 ? -1.812  48.047 128.565 1.00 70.61  ? 116  LYS C CE  1 
ATOM   7637 N NZ  . LYS C 2 135 ? -2.294  47.678 127.211 1.00 69.48  ? 116  LYS C NZ  1 
ATOM   7638 N N   . LEU C 2 136 ? -1.104  54.618 130.862 1.00 51.00  ? 117  LEU C N   1 
ATOM   7639 C CA  . LEU C 2 136 ? -0.597  55.978 130.872 1.00 45.77  ? 117  LEU C CA  1 
ATOM   7640 C C   . LEU C 2 136 ? 0.904   55.985 130.610 1.00 59.50  ? 117  LEU C C   1 
ATOM   7641 O O   . LEU C 2 136 ? 1.449   56.960 130.104 1.00 68.47  ? 117  LEU C O   1 
ATOM   7642 C CB  . LEU C 2 136 ? -0.906  56.640 132.212 1.00 58.67  ? 117  LEU C CB  1 
ATOM   7643 C CG  . LEU C 2 136 ? -0.507  58.101 132.395 1.00 59.52  ? 117  LEU C CG  1 
ATOM   7644 C CD1 . LEU C 2 136 ? -1.192  58.972 131.371 1.00 62.37  ? 117  LEU C CD1 1 
ATOM   7645 C CD2 . LEU C 2 136 ? -0.853  58.555 133.793 1.00 53.94  ? 117  LEU C CD2 1 
ATOM   7646 N N   . ASP C 2 137 ? 1.567   54.888 130.951 1.00 55.78  ? 118  ASP C N   1 
ATOM   7647 C CA  . ASP C 2 137 ? 3.011   54.780 130.775 1.00 61.30  ? 118  ASP C CA  1 
ATOM   7648 C C   . ASP C 2 137 ? 3.453   54.651 129.322 1.00 70.66  ? 118  ASP C C   1 
ATOM   7649 O O   . ASP C 2 137 ? 4.601   54.937 128.991 1.00 81.26  ? 118  ASP C O   1 
ATOM   7650 C CB  . ASP C 2 137 ? 3.571   53.615 131.598 1.00 45.53  ? 118  ASP C CB  1 
ATOM   7651 C CG  . ASP C 2 137 ? 2.993   52.275 131.193 1.00 60.57  ? 118  ASP C CG  1 
ATOM   7652 O OD1 . ASP C 2 137 ? 2.099   52.244 130.325 1.00 69.97  ? 118  ASP C OD1 1 
ATOM   7653 O OD2 . ASP C 2 137 ? 3.416   51.252 131.760 1.00 50.05  ? 118  ASP C OD2 1 
ATOM   7654 N N   . LEU C 2 138 ? 2.546   54.219 128.457 1.00 61.40  ? 119  LEU C N   1 
ATOM   7655 C CA  . LEU C 2 138 ? 2.868   54.040 127.055 1.00 62.53  ? 119  LEU C CA  1 
ATOM   7656 C C   . LEU C 2 138 ? 2.594   55.261 126.164 1.00 58.05  ? 119  LEU C C   1 
ATOM   7657 O O   . LEU C 2 138 ? 3.115   55.340 125.051 1.00 73.61  ? 119  LEU C O   1 
ATOM   7658 C CB  . LEU C 2 138 ? 2.194   52.777 126.501 1.00 52.84  ? 119  LEU C CB  1 
ATOM   7659 C CG  . LEU C 2 138 ? 2.754   51.448 127.026 1.00 54.38  ? 119  LEU C CG  1 
ATOM   7660 C CD1 . LEU C 2 138 ? 2.063   50.307 126.373 1.00 53.71  ? 119  LEU C CD1 1 
ATOM   7661 C CD2 . LEU C 2 138 ? 4.255   51.288 126.837 1.00 43.05  ? 119  LEU C CD2 1 
ATOM   7662 N N   . ARG C 2 139 ? 1.802   56.215 126.643 1.00 54.86  ? 120  ARG C N   1 
ATOM   7663 C CA  . ARG C 2 139 ? 1.507   57.417 125.851 1.00 53.27  ? 120  ARG C CA  1 
ATOM   7664 C C   . ARG C 2 139 ? 2.752   58.212 125.434 1.00 60.74  ? 120  ARG C C   1 
ATOM   7665 O O   . ARG C 2 139 ? 2.671   59.082 124.564 1.00 84.59  ? 120  ARG C O   1 
ATOM   7666 C CB  . ARG C 2 139 ? 0.519   58.331 126.575 1.00 44.12  ? 120  ARG C CB  1 
ATOM   7667 C CG  . ARG C 2 139 ? 0.198   59.592 125.809 1.00 51.79  ? 120  ARG C CG  1 
ATOM   7668 C CD  . ARG C 2 139 ? -1.095  60.223 126.239 1.00 59.22  ? 120  ARG C CD  1 
ATOM   7669 N NE  . ARG C 2 139 ? -0.966  60.913 127.512 1.00 62.71  ? 120  ARG C NE  1 
ATOM   7670 C CZ  . ARG C 2 139 ? -1.993  61.228 128.294 1.00 63.48  ? 120  ARG C CZ  1 
ATOM   7671 N NH1 . ARG C 2 139 ? -3.230  60.917 127.958 1.00 68.71  ? 120  ARG C NH1 1 
ATOM   7672 N NH2 . ARG C 2 139 ? -1.786  61.859 129.426 1.00 73.29  ? 120  ARG C NH2 1 
ATOM   7673 N N   . ASP C 2 140 ? 3.890   57.915 126.052 1.00 69.61  ? 121  ASP C N   1 
ATOM   7674 C CA  . ASP C 2 140 ? 5.114   58.615 125.755 1.00 72.81  ? 121  ASP C CA  1 
ATOM   7675 C C   . ASP C 2 140 ? 6.136   57.685 125.180 1.00 74.44  ? 121  ASP C C   1 
ATOM   7676 O O   . ASP C 2 140 ? 7.215   58.131 124.841 1.00 87.54  ? 121  ASP C O   1 
ATOM   7677 C CB  . ASP C 2 140 ? 5.700   59.231 127.021 1.00 92.61  ? 121  ASP C CB  1 
ATOM   7678 C CG  . ASP C 2 140 ? 4.949   60.454 127.476 1.00 105.41 ? 121  ASP C CG  1 
ATOM   7679 O OD1 . ASP C 2 140 ? 3.938   60.830 126.833 1.00 75.06  ? 121  ASP C OD1 1 
ATOM   7680 O OD2 . ASP C 2 140 ? 5.377   61.035 128.496 1.00 125.57 ? 121  ASP C OD2 1 
ATOM   7681 N N   . ASP C 2 141 ? 5.831   56.397 125.088 1.00 79.34  ? 122  ASP C N   1 
ATOM   7682 C CA  . ASP C 2 141 ? 6.832   55.443 124.597 1.00 88.56  ? 122  ASP C CA  1 
ATOM   7683 C C   . ASP C 2 141 ? 7.060   55.561 123.092 1.00 90.45  ? 122  ASP C C   1 
ATOM   7684 O O   . ASP C 2 141 ? 6.125   55.446 122.316 1.00 74.50  ? 122  ASP C O   1 
ATOM   7685 C CB  . ASP C 2 141 ? 6.473   54.005 124.948 1.00 72.13  ? 122  ASP C CB  1 
ATOM   7686 C CG  . ASP C 2 141 ? 7.579   53.035 124.583 1.00 84.94  ? 122  ASP C CG  1 
ATOM   7687 O OD1 . ASP C 2 141 ? 8.707   53.191 125.096 1.00 85.25  ? 122  ASP C OD1 1 
ATOM   7688 O OD2 . ASP C 2 141 ? 7.318   52.116 123.782 1.00 86.07  ? 122  ASP C OD2 1 
ATOM   7689 N N   . LYS C 2 142 ? 8.313   55.764 122.696 1.00 92.66  ? 123  LYS C N   1 
ATOM   7690 C CA  . LYS C 2 142 ? 8.666   56.047 121.306 1.00 87.29  ? 123  LYS C CA  1 
ATOM   7691 C C   . LYS C 2 142 ? 8.167   54.975 120.357 1.00 84.29  ? 123  LYS C C   1 
ATOM   7692 O O   . LYS C 2 142 ? 7.456   55.285 119.398 1.00 76.47  ? 123  LYS C O   1 
ATOM   7693 C CB  . LYS C 2 142 ? 10.186  56.201 121.142 1.00 91.14  ? 123  LYS C CB  1 
ATOM   7694 C CG  . LYS C 2 142 ? 10.811  57.389 121.883 1.00 114.17 ? 123  LYS C CG  1 
ATOM   7695 C CD  . LYS C 2 142 ? 10.624  58.732 121.134 1.00 115.21 ? 123  LYS C CD  1 
ATOM   7696 C CE  . LYS C 2 142 ? 11.445  59.879 121.782 1.00 107.99 ? 123  LYS C CE  1 
ATOM   7697 N NZ  . LYS C 2 142 ? 10.979  60.231 123.200 1.00 106.58 ? 123  LYS C NZ  1 
ATOM   7698 N N   . ASP C 2 143 ? 8.536   53.721 120.638 1.00 84.02  ? 124  ASP C N   1 
ATOM   7699 C CA  . ASP C 2 143 ? 8.153   52.576 119.803 1.00 75.28  ? 124  ASP C CA  1 
ATOM   7700 C C   . ASP C 2 143 ? 6.648   52.555 119.623 1.00 75.88  ? 124  ASP C C   1 
ATOM   7701 O O   . ASP C 2 143 ? 6.161   52.289 118.524 1.00 87.15  ? 124  ASP C O   1 
ATOM   7702 C CB  . ASP C 2 143 ? 8.626   51.245 120.413 1.00 87.80  ? 124  ASP C CB  1 
ATOM   7703 C CG  . ASP C 2 143 ? 10.110  51.239 120.721 1.00 104.63 ? 124  ASP C CG  1 
ATOM   7704 O OD1 . ASP C 2 143 ? 10.686  52.326 120.887 1.00 116.28 ? 124  ASP C OD1 1 
ATOM   7705 O OD2 . ASP C 2 143 ? 10.708  50.154 120.804 1.00 98.66  ? 124  ASP C OD2 1 
ATOM   7706 N N   . THR C 2 144 ? 5.931   52.874 120.701 1.00 71.38  ? 125  THR C N   1 
ATOM   7707 C CA  . THR C 2 144 ? 4.468   52.863 120.728 1.00 66.69  ? 125  THR C CA  1 
ATOM   7708 C C   . THR C 2 144 ? 3.847   53.998 119.886 1.00 63.62  ? 125  THR C C   1 
ATOM   7709 O O   . THR C 2 144 ? 2.881   53.794 119.155 1.00 58.17  ? 125  THR C O   1 
ATOM   7710 C CB  . THR C 2 144 ? 3.962   52.912 122.193 1.00 56.67  ? 125  THR C CB  1 
ATOM   7711 O OG1 . THR C 2 144 ? 4.568   51.852 122.941 1.00 62.33  ? 125  THR C OG1 1 
ATOM   7712 C CG2 . THR C 2 144 ? 2.456   52.770 122.253 1.00 44.93  ? 125  THR C CG2 1 
ATOM   7713 N N   . ILE C 2 145 ? 4.403   55.197 120.006 1.00 59.17  ? 126  ILE C N   1 
ATOM   7714 C CA  . ILE C 2 145 ? 3.975   56.328 119.181 1.00 70.47  ? 126  ILE C CA  1 
ATOM   7715 C C   . ILE C 2 145 ? 4.160   55.998 117.692 1.00 78.62  ? 126  ILE C C   1 
ATOM   7716 O O   . ILE C 2 145 ? 3.288   56.333 116.885 1.00 58.37  ? 126  ILE C O   1 
ATOM   7717 C CB  . ILE C 2 145 ? 4.803   57.631 119.466 1.00 75.11  ? 126  ILE C CB  1 
ATOM   7718 C CG1 . ILE C 2 145 ? 5.031   57.857 120.973 1.00 61.36  ? 126  ILE C CG1 1 
ATOM   7719 C CG2 . ILE C 2 145 ? 4.148   58.850 118.758 1.00 51.22  ? 126  ILE C CG2 1 
ATOM   7720 C CD1 . ILE C 2 145 ? 4.109   58.916 121.626 1.00 65.55  ? 126  ILE C CD1 1 
ATOM   7721 N N   . GLU C 2 146 ? 5.302   55.360 117.364 1.00 74.49  ? 127  GLU C N   1 
ATOM   7722 C CA  . GLU C 2 146 ? 5.708   55.042 115.990 1.00 84.77  ? 127  GLU C CA  1 
ATOM   7723 C C   . GLU C 2 146 ? 4.708   54.120 115.330 1.00 85.75  ? 127  GLU C C   1 
ATOM   7724 O O   . GLU C 2 146 ? 4.231   54.388 114.226 1.00 81.51  ? 127  GLU C O   1 
ATOM   7725 C CB  . GLU C 2 146 ? 7.070   54.347 115.959 1.00 93.37  ? 127  GLU C CB  1 
ATOM   7726 C CG  . GLU C 2 146 ? 8.280   55.256 116.030 1.00 114.89 ? 127  GLU C CG  1 
ATOM   7727 C CD  . GLU C 2 146 ? 9.574   54.500 116.393 1.00 132.38 ? 127  GLU C CD  1 
ATOM   7728 O OE1 . GLU C 2 146 ? 9.579   53.248 116.415 1.00 129.04 ? 127  GLU C OE1 1 
ATOM   7729 O OE2 . GLU C 2 146 ? 10.599  55.163 116.667 1.00 139.24 ? 127  GLU C OE2 1 
ATOM   7730 N N   . LYS C 2 147 ? 4.406   53.021 116.008 1.00 74.78  ? 128  LYS C N   1 
ATOM   7731 C CA  . LYS C 2 147 ? 3.505   52.033 115.460 1.00 69.89  ? 128  LYS C CA  1 
ATOM   7732 C C   . LYS C 2 147 ? 2.126   52.643 115.282 1.00 60.18  ? 128  LYS C C   1 
ATOM   7733 O O   . LYS C 2 147 ? 1.411   52.319 114.361 1.00 76.14  ? 128  LYS C O   1 
ATOM   7734 C CB  . LYS C 2 147 ? 3.468   50.784 116.345 1.00 72.03  ? 128  LYS C CB  1 
ATOM   7735 C CG  . LYS C 2 147 ? 4.812   50.047 116.416 1.00 66.31  ? 128  LYS C CG  1 
ATOM   7736 C CD  . LYS C 2 147 ? 4.675   48.583 116.906 1.00 83.39  ? 128  LYS C CD  1 
ATOM   7737 C CE  . LYS C 2 147 ? 5.166   48.353 118.361 1.00 109.47 ? 128  LYS C CE  1 
ATOM   7738 N NZ  . LYS C 2 147 ? 4.157   48.663 119.428 1.00 89.56  ? 128  LYS C NZ  1 
ATOM   7739 N N   . LEU C 2 148 ? 1.760   53.560 116.145 1.00 58.69  ? 129  LEU C N   1 
ATOM   7740 C CA  . LEU C 2 148 ? 0.454   54.188 116.016 1.00 63.02  ? 129  LEU C CA  1 
ATOM   7741 C C   . LEU C 2 148 ? 0.377   55.051 114.779 1.00 62.39  ? 129  LEU C C   1 
ATOM   7742 O O   . LEU C 2 148 ? -0.658  55.083 114.108 1.00 62.38  ? 129  LEU C O   1 
ATOM   7743 C CB  . LEU C 2 148 ? 0.135   55.056 117.243 1.00 72.08  ? 129  LEU C CB  1 
ATOM   7744 C CG  . LEU C 2 148 ? -0.418  54.404 118.518 1.00 59.15  ? 129  LEU C CG  1 
ATOM   7745 C CD1 . LEU C 2 148 ? -0.940  55.520 119.428 1.00 69.33  ? 129  LEU C CD1 1 
ATOM   7746 C CD2 . LEU C 2 148 ? -1.526  53.376 118.246 1.00 53.19  ? 129  LEU C CD2 1 
ATOM   7747 N N   . LYS C 2 149 ? 1.456   55.759 114.494 1.00 58.43  ? 130  LYS C N   1 
ATOM   7748 C CA  . LYS C 2 149 ? 1.507   56.638 113.348 1.00 69.28  ? 130  LYS C CA  1 
ATOM   7749 C C   . LYS C 2 149 ? 1.407   55.826 112.083 1.00 82.43  ? 130  LYS C C   1 
ATOM   7750 O O   . LYS C 2 149 ? 0.673   56.164 111.172 1.00 63.17  ? 130  LYS C O   1 
ATOM   7751 C CB  . LYS C 2 149 ? 2.810   57.426 113.344 1.00 56.58  ? 130  LYS C CB  1 
ATOM   7752 C CG  . LYS C 2 149 ? 4.039   56.555 113.320 1.00 101.07 ? 130  LYS C CG  1 
ATOM   7753 C CD  . LYS C 2 149 ? 5.202   57.264 112.657 1.00 129.42 ? 130  LYS C CD  1 
ATOM   7754 C CE  . LYS C 2 149 ? 6.359   56.306 112.423 1.00 124.97 ? 130  LYS C CE  1 
ATOM   7755 N NZ  . LYS C 2 149 ? 7.204   56.693 111.263 1.00 108.59 ? 130  LYS C NZ  1 
ATOM   7756 N N   . GLU C 2 150 ? 2.158   54.743 112.028 1.00 65.78  ? 131  GLU C N   1 
ATOM   7757 C CA  . GLU C 2 150 ? 2.127   53.892 110.863 1.00 67.00  ? 131  GLU C CA  1 
ATOM   7758 C C   . GLU C 2 150 ? 0.710   53.693 110.371 1.00 75.93  ? 131  GLU C C   1 
ATOM   7759 O O   . GLU C 2 150 ? 0.482   53.472 109.194 1.00 82.79  ? 131  GLU C O   1 
ATOM   7760 C CB  . GLU C 2 150 ? 2.755   52.554 111.191 1.00 70.50  ? 131  GLU C CB  1 
ATOM   7761 C CG  . GLU C 2 150 ? 4.222   52.659 111.468 1.00 84.17  ? 131  GLU C CG  1 
ATOM   7762 C CD  . GLU C 2 150 ? 4.810   51.350 111.874 1.00 110.35 ? 131  GLU C CD  1 
ATOM   7763 O OE1 . GLU C 2 150 ? 4.034   50.413 112.105 1.00 112.20 ? 131  GLU C OE1 1 
ATOM   7764 O OE2 . GLU C 2 150 ? 6.043   51.252 111.961 1.00 114.16 ? 131  GLU C OE2 1 
ATOM   7765 N N   . LYS C 2 151 ? -0.244  53.771 111.283 1.00 79.21  ? 132  LYS C N   1 
ATOM   7766 C CA  . LYS C 2 151 ? -1.638  53.563 110.944 1.00 58.92  ? 132  LYS C CA  1 
ATOM   7767 C C   . LYS C 2 151 ? -2.368  54.876 110.939 1.00 64.45  ? 132  LYS C C   1 
ATOM   7768 O O   . LYS C 2 151 ? -3.574  54.923 110.764 1.00 56.76  ? 132  LYS C O   1 
ATOM   7769 C CB  . LYS C 2 151 ? -2.284  52.617 111.941 1.00 69.37  ? 132  LYS C CB  1 
ATOM   7770 C CG  . LYS C 2 151 ? -1.834  51.194 111.786 1.00 87.87  ? 132  LYS C CG  1 
ATOM   7771 C CD  . LYS C 2 151 ? -2.247  50.348 112.953 1.00 97.87  ? 132  LYS C CD  1 
ATOM   7772 C CE  . LYS C 2 151 ? -1.489  49.043 112.948 1.00 105.17 ? 132  LYS C CE  1 
ATOM   7773 N NZ  . LYS C 2 151 ? -0.024  49.251 113.103 1.00 123.25 ? 132  LYS C NZ  1 
ATOM   7774 N N   . LYS C 2 152 ? -1.612  55.944 111.133 1.00 72.00  ? 133  LYS C N   1 
ATOM   7775 C CA  . LYS C 2 152 ? -2.147  57.293 111.146 1.00 80.35  ? 133  LYS C CA  1 
ATOM   7776 C C   . LYS C 2 152 ? -3.040  57.521 112.336 1.00 67.17  ? 133  LYS C C   1 
ATOM   7777 O O   . LYS C 2 152 ? -4.086  58.140 112.231 1.00 55.62  ? 133  LYS C O   1 
ATOM   7778 C CB  . LYS C 2 152 ? -2.871  57.606 109.843 1.00 88.67  ? 133  LYS C CB  1 
ATOM   7779 C CG  . LYS C 2 152 ? -1.921  57.961 108.720 1.00 83.12  ? 133  LYS C CG  1 
ATOM   7780 C CD  . LYS C 2 152 ? -2.633  58.141 107.415 1.00 87.28  ? 133  LYS C CD  1 
ATOM   7781 C CE  . LYS C 2 152 ? -1.650  58.482 106.325 1.00 75.07  ? 133  LYS C CE  1 
ATOM   7782 N NZ  . LYS C 2 152 ? -0.877  59.691 106.676 1.00 84.15  ? 133  LYS C NZ  1 
ATOM   7783 N N   . LEU C 2 153 ? -2.601  57.015 113.476 1.00 64.45  ? 134  LEU C N   1 
ATOM   7784 C CA  . LEU C 2 153 ? -3.332  57.163 114.714 1.00 72.99  ? 134  LEU C CA  1 
ATOM   7785 C C   . LEU C 2 153 ? -2.409  57.726 115.764 1.00 78.32  ? 134  LEU C C   1 
ATOM   7786 O O   . LEU C 2 153 ? -1.228  57.417 115.783 1.00 79.75  ? 134  LEU C O   1 
ATOM   7787 C CB  . LEU C 2 153 ? -3.822  55.806 115.200 1.00 80.13  ? 134  LEU C CB  1 
ATOM   7788 C CG  . LEU C 2 153 ? -4.839  55.021 114.392 1.00 57.83  ? 134  LEU C CG  1 
ATOM   7789 C CD1 . LEU C 2 153 ? -4.875  53.610 114.869 1.00 48.69  ? 134  LEU C CD1 1 
ATOM   7790 C CD2 . LEU C 2 153 ? -6.190  55.648 114.517 1.00 62.24  ? 134  LEU C CD2 1 
ATOM   7791 N N   . THR C 2 154 ? -2.951  58.541 116.652 1.00 76.12  ? 135  THR C N   1 
ATOM   7792 C CA  . THR C 2 154 ? -2.170  59.031 117.780 1.00 82.03  ? 135  THR C CA  1 
ATOM   7793 C C   . THR C 2 154 ? -2.804  58.640 119.122 1.00 74.50  ? 135  THR C C   1 
ATOM   7794 O O   . THR C 2 154 ? -4.018  58.367 119.189 1.00 69.64  ? 135  THR C O   1 
ATOM   7795 C CB  . THR C 2 154 ? -1.965  60.556 117.730 1.00 80.11  ? 135  THR C CB  1 
ATOM   7796 O OG1 . THR C 2 154 ? -3.246  61.197 117.677 1.00 95.94  ? 135  THR C OG1 1 
ATOM   7797 C CG2 . THR C 2 154 ? -1.100  60.951 116.530 1.00 81.02  ? 135  THR C CG2 1 
ATOM   7798 N N   . PRO C 2 155 ? -1.986  58.627 120.197 1.00 65.52  ? 136  PRO C N   1 
ATOM   7799 C CA  . PRO C 2 155 ? -2.498  58.325 121.520 1.00 59.87  ? 136  PRO C CA  1 
ATOM   7800 C C   . PRO C 2 155 ? -3.586  59.296 121.886 1.00 57.04  ? 136  PRO C C   1 
ATOM   7801 O O   . PRO C 2 155 ? -3.568  60.419 121.405 1.00 65.91  ? 136  PRO C O   1 
ATOM   7802 C CB  . PRO C 2 155 ? -1.297  58.584 122.416 1.00 53.29  ? 136  PRO C CB  1 
ATOM   7803 C CG  . PRO C 2 155 ? -0.121  58.466 121.524 1.00 63.67  ? 136  PRO C CG  1 
ATOM   7804 C CD  . PRO C 2 155 ? -0.576  59.044 120.251 1.00 54.08  ? 136  PRO C CD  1 
ATOM   7805 N N   . ILE C 2 156 ? -4.530  58.861 122.715 1.00 60.20  ? 137  ILE C N   1 
ATOM   7806 C CA  . ILE C 2 156 ? -5.558  59.735 123.248 1.00 63.28  ? 137  ILE C CA  1 
ATOM   7807 C C   . ILE C 2 156 ? -4.943  60.746 124.231 1.00 73.80  ? 137  ILE C C   1 
ATOM   7808 O O   . ILE C 2 156 ? -4.116  60.383 125.060 1.00 90.72  ? 137  ILE C O   1 
ATOM   7809 C CB  . ILE C 2 156 ? -6.649  58.929 123.927 1.00 55.62  ? 137  ILE C CB  1 
ATOM   7810 C CG1 . ILE C 2 156 ? -7.140  57.818 123.000 1.00 55.34  ? 137  ILE C CG1 1 
ATOM   7811 C CG2 . ILE C 2 156 ? -7.801  59.835 124.356 1.00 67.62  ? 137  ILE C CG2 1 
ATOM   7812 C CD1 . ILE C 2 156 ? -7.817  58.288 121.721 1.00 55.16  ? 137  ILE C CD1 1 
ATOM   7813 N N   . THR C 2 157 ? -5.319  62.016 124.114 1.00 63.46  ? 138  THR C N   1 
ATOM   7814 C CA  . THR C 2 157 ? -4.784  63.052 124.983 1.00 74.42  ? 138  THR C CA  1 
ATOM   7815 C C   . THR C 2 157 ? -5.705  63.309 126.158 1.00 75.41  ? 138  THR C C   1 
ATOM   7816 O O   . THR C 2 157 ? -6.912  63.020 126.079 1.00 66.85  ? 138  THR C O   1 
ATOM   7817 C CB  . THR C 2 157 ? -4.631  64.397 124.245 1.00 66.86  ? 138  THR C CB  1 
ATOM   7818 O OG1 . THR C 2 157 ? -5.879  64.763 123.645 1.00 61.53  ? 138  THR C OG1 1 
ATOM   7819 C CG2 . THR C 2 157 ? -3.548  64.319 123.195 1.00 57.14  ? 138  THR C CG2 1 
ATOM   7820 N N   . TYR C 2 158 ? -5.143  63.890 127.226 1.00 79.40  ? 139  TYR C N   1 
ATOM   7821 C CA  . TYR C 2 158 ? -5.934  64.255 128.408 1.00 79.46  ? 139  TYR C CA  1 
ATOM   7822 C C   . TYR C 2 158 ? -7.198  65.040 128.031 1.00 75.28  ? 139  TYR C C   1 
ATOM   7823 O O   . TYR C 2 158 ? -8.319  64.632 128.384 1.00 71.43  ? 139  TYR C O   1 
ATOM   7824 C CB  . TYR C 2 158 ? -5.108  65.021 129.455 1.00 75.40  ? 139  TYR C CB  1 
ATOM   7825 C CG  . TYR C 2 158 ? -5.872  65.160 130.753 1.00 71.62  ? 139  TYR C CG  1 
ATOM   7826 C CD1 . TYR C 2 158 ? -6.909  66.103 130.879 1.00 59.78  ? 139  TYR C CD1 1 
ATOM   7827 C CD2 . TYR C 2 158 ? -5.597  64.326 131.843 1.00 63.89  ? 139  TYR C CD2 1 
ATOM   7828 C CE1 . TYR C 2 158 ? -7.631  66.219 132.048 1.00 71.52  ? 139  TYR C CE1 1 
ATOM   7829 C CE2 . TYR C 2 158 ? -6.319  64.435 133.019 1.00 77.74  ? 139  TYR C CE2 1 
ATOM   7830 C CZ  . TYR C 2 158 ? -7.338  65.384 133.111 1.00 86.22  ? 139  TYR C CZ  1 
ATOM   7831 O OH  . TYR C 2 158 ? -8.065  65.510 134.267 1.00 78.89  ? 139  TYR C OH  1 
ATOM   7832 N N   . PRO C 2 159 ? -7.028  66.159 127.305 1.00 73.95  ? 140  PRO C N   1 
ATOM   7833 C CA  . PRO C 2 159 ? -8.188  66.940 126.924 1.00 66.43  ? 140  PRO C CA  1 
ATOM   7834 C C   . PRO C 2 159 ? -9.214  66.115 126.209 1.00 64.32  ? 140  PRO C C   1 
ATOM   7835 O O   . PRO C 2 159 ? -10.400 66.351 126.433 1.00 64.60  ? 140  PRO C O   1 
ATOM   7836 C CB  . PRO C 2 159 ? -7.606  67.998 126.009 1.00 64.15  ? 140  PRO C CB  1 
ATOM   7837 C CG  . PRO C 2 159 ? -6.240  68.220 126.581 1.00 69.82  ? 140  PRO C CG  1 
ATOM   7838 C CD  . PRO C 2 159 ? -5.770  66.860 126.983 1.00 69.62  ? 140  PRO C CD  1 
ATOM   7839 N N   . GLN C 2 160 ? -8.777  65.141 125.400 1.00 57.67  ? 141  GLN C N   1 
ATOM   7840 C CA  . GLN C 2 160 ? -9.720  64.267 124.670 1.00 67.38  ? 141  GLN C CA  1 
ATOM   7841 C C   . GLN C 2 160 ? -10.532 63.354 125.588 1.00 79.40  ? 141  GLN C C   1 
ATOM   7842 O O   . GLN C 2 160 ? -11.751 63.192 125.396 1.00 77.52  ? 141  GLN C O   1 
ATOM   7843 C CB  . GLN C 2 160 ? -9.022  63.388 123.632 1.00 78.73  ? 141  GLN C CB  1 
ATOM   7844 C CG  . GLN C 2 160 ? -8.080  64.075 122.688 1.00 81.47  ? 141  GLN C CG  1 
ATOM   7845 C CD  . GLN C 2 160 ? -7.736  63.189 121.508 1.00 77.31  ? 141  GLN C CD  1 
ATOM   7846 O OE1 . GLN C 2 160 ? -8.504  63.112 120.551 1.00 85.66  ? 141  GLN C OE1 1 
ATOM   7847 N NE2 . GLN C 2 160 ? -6.588  62.518 121.565 1.00 70.95  ? 141  GLN C NE2 1 
ATOM   7848 N N   . GLY C 2 161 ? -9.850  62.744 126.563 1.00 58.50  ? 142  GLY C N   1 
ATOM   7849 C CA  . GLY C 2 161 ? -10.511 61.840 127.503 1.00 54.68  ? 142  GLY C CA  1 
ATOM   7850 C C   . GLY C 2 161 ? -11.550 62.585 128.313 1.00 74.60  ? 142  GLY C C   1 
ATOM   7851 O O   . GLY C 2 161 ? -12.699 62.142 128.499 1.00 60.21  ? 142  GLY C O   1 
ATOM   7852 N N   . LEU C 2 162 ? -11.116 63.754 128.767 1.00 75.41  ? 143  LEU C N   1 
ATOM   7853 C CA  . LEU C 2 162 ? -11.946 64.667 129.508 1.00 67.81  ? 143  LEU C CA  1 
ATOM   7854 C C   . LEU C 2 162 ? -13.244 64.954 128.748 1.00 78.56  ? 143  LEU C C   1 
ATOM   7855 O O   . LEU C 2 162 ? -14.351 64.849 129.306 1.00 82.04  ? 143  LEU C O   1 
ATOM   7856 C CB  . LEU C 2 162 ? -11.167 65.952 129.732 1.00 73.07  ? 143  LEU C CB  1 
ATOM   7857 C CG  . LEU C 2 162 ? -11.097 66.466 131.176 1.00 68.18  ? 143  LEU C CG  1 
ATOM   7858 C CD1 . LEU C 2 162 ? -10.300 67.768 131.229 1.00 68.08  ? 143  LEU C CD1 1 
ATOM   7859 C CD2 . LEU C 2 162 ? -12.495 66.645 131.792 1.00 59.37  ? 143  LEU C CD2 1 
ATOM   7860 N N   . ALA C 2 163 ? -13.089 65.299 127.469 1.00 79.50  ? 144  ALA C N   1 
ATOM   7861 C CA  . ALA C 2 163 ? -14.207 65.630 126.594 1.00 65.25  ? 144  ALA C CA  1 
ATOM   7862 C C   . ALA C 2 163 ? -15.186 64.470 126.488 1.00 69.74  ? 144  ALA C C   1 
ATOM   7863 O O   . ALA C 2 163 ? -16.408 64.658 126.585 1.00 79.39  ? 144  ALA C O   1 
ATOM   7864 C CB  . ALA C 2 163 ? -13.677 66.007 125.219 1.00 61.89  ? 144  ALA C CB  1 
ATOM   7865 N N   . MET C 2 164 ? -14.617 63.274 126.309 1.00 64.33  ? 145  MET C N   1 
ATOM   7866 C CA  . MET C 2 164 ? -15.357 62.027 126.195 1.00 64.96  ? 145  MET C CA  1 
ATOM   7867 C C   . MET C 2 164 ? -16.137 61.736 127.486 1.00 74.06  ? 145  MET C C   1 
ATOM   7868 O O   . MET C 2 164 ? -17.285 61.271 127.450 1.00 73.21  ? 145  MET C O   1 
ATOM   7869 C CB  . MET C 2 164 ? -14.371 60.910 125.833 1.00 52.72  ? 145  MET C CB  1 
ATOM   7870 C CG  . MET C 2 164 ? -14.907 59.510 125.901 1.00 58.27  ? 145  MET C CG  1 
ATOM   7871 S SD  . MET C 2 164 ? -16.333 59.285 124.872 1.00 80.56  ? 145  MET C SD  1 
ATOM   7872 C CE  . MET C 2 164 ? -15.628 58.378 123.487 1.00 71.20  ? 145  MET C CE  1 
ATOM   7873 N N   . ALA C 2 165 ? -15.508 62.052 128.616 1.00 68.77  ? 146  ALA C N   1 
ATOM   7874 C CA  . ALA C 2 165 ? -16.140 61.943 129.931 1.00 77.76  ? 146  ALA C CA  1 
ATOM   7875 C C   . ALA C 2 165 ? -17.361 62.846 130.052 1.00 80.22  ? 146  ALA C C   1 
ATOM   7876 O O   . ALA C 2 165 ? -18.452 62.412 130.475 1.00 72.70  ? 146  ALA C O   1 
ATOM   7877 C CB  . ALA C 2 165 ? -15.143 62.287 131.015 1.00 61.00  ? 146  ALA C CB  1 
ATOM   7878 N N   . LYS C 2 166 ? -17.152 64.111 129.687 1.00 76.85  ? 147  LYS C N   1 
ATOM   7879 C CA  . LYS C 2 166 ? -18.193 65.103 129.756 1.00 79.11  ? 147  LYS C CA  1 
ATOM   7880 C C   . LYS C 2 166 ? -19.335 64.626 128.897 1.00 76.96  ? 147  LYS C C   1 
ATOM   7881 O O   . LYS C 2 166 ? -20.488 64.670 129.309 1.00 78.37  ? 147  LYS C O   1 
ATOM   7882 C CB  . LYS C 2 166 ? -17.681 66.440 129.261 1.00 83.99  ? 147  LYS C CB  1 
ATOM   7883 C CG  . LYS C 2 166 ? -18.622 67.569 129.612 1.00 104.72 ? 147  LYS C CG  1 
ATOM   7884 C CD  . LYS C 2 166 ? -18.719 68.592 128.491 1.00 125.65 ? 147  LYS C CD  1 
ATOM   7885 C CE  . LYS C 2 166 ? -20.143 69.161 128.415 1.00 131.33 ? 147  LYS C CE  1 
ATOM   7886 N NZ  . LYS C 2 166 ? -20.247 70.199 127.365 1.00 126.81 ? 147  LYS C NZ  1 
ATOM   7887 N N   . GLU C 2 167 ? -18.981 64.109 127.726 1.00 64.14  ? 148  GLU C N   1 
ATOM   7888 C CA  . GLU C 2 167 ? -19.947 63.608 126.767 1.00 75.16  ? 148  GLU C CA  1 
ATOM   7889 C C   . GLU C 2 167 ? -20.864 62.493 127.276 1.00 74.73  ? 148  GLU C C   1 
ATOM   7890 O O   . GLU C 2 167 ? -22.077 62.526 127.087 1.00 72.70  ? 148  GLU C O   1 
ATOM   7891 C CB  . GLU C 2 167 ? -19.227 63.141 125.504 1.00 83.44  ? 148  GLU C CB  1 
ATOM   7892 C CG  . GLU C 2 167 ? -20.173 62.416 124.553 1.00 82.91  ? 148  GLU C CG  1 
ATOM   7893 C CD  . GLU C 2 167 ? -19.497 61.843 123.329 1.00 88.70  ? 148  GLU C CD  1 
ATOM   7894 O OE1 . GLU C 2 167 ? -18.412 62.339 122.935 1.00 77.32  ? 148  GLU C OE1 1 
ATOM   7895 O OE2 . GLU C 2 167 ? -20.082 60.893 122.756 1.00 91.52  ? 148  GLU C OE2 1 
ATOM   7896 N N   . ILE C 2 168 ? -20.269 61.494 127.901 1.00 71.41  ? 149  ILE C N   1 
ATOM   7897 C CA  . ILE C 2 168 ? -21.031 60.344 128.361 1.00 74.00  ? 149  ILE C CA  1 
ATOM   7898 C C   . ILE C 2 168 ? -21.686 60.589 129.718 1.00 86.24  ? 149  ILE C C   1 
ATOM   7899 O O   . ILE C 2 168 ? -22.490 59.775 130.174 1.00 78.13  ? 149  ILE C O   1 
ATOM   7900 C CB  . ILE C 2 168 ? -20.152 59.077 128.419 1.00 72.69  ? 149  ILE C CB  1 
ATOM   7901 C CG1 . ILE C 2 168 ? -18.812 59.374 129.084 1.00 71.74  ? 149  ILE C CG1 1 
ATOM   7902 C CG2 . ILE C 2 168 ? -19.894 58.547 127.020 1.00 75.65  ? 149  ILE C CG2 1 
ATOM   7903 C CD1 . ILE C 2 168 ? -18.239 58.186 129.761 1.00 72.32  ? 149  ILE C CD1 1 
ATOM   7904 N N   . GLY C 2 169 ? -21.331 61.712 130.354 1.00 91.07  ? 150  GLY C N   1 
ATOM   7905 C CA  . GLY C 2 169 ? -21.807 62.055 131.700 1.00 89.75  ? 150  GLY C CA  1 
ATOM   7906 C C   . GLY C 2 169 ? -21.149 61.249 132.814 1.00 82.87  ? 150  GLY C C   1 
ATOM   7907 O O   . GLY C 2 169 ? -21.825 60.726 133.710 1.00 77.27  ? 150  GLY C O   1 
ATOM   7908 N N   . ALA C 2 170 ? -19.829 61.129 132.744 1.00 70.76  ? 151  ALA C N   1 
ATOM   7909 C CA  . ALA C 2 170 ? -19.095 60.394 133.747 1.00 67.08  ? 151  ALA C CA  1 
ATOM   7910 C C   . ALA C 2 170 ? -18.710 61.327 134.869 1.00 68.66  ? 151  ALA C C   1 
ATOM   7911 O O   . ALA C 2 170 ? -18.156 62.388 134.622 1.00 76.23  ? 151  ALA C O   1 
ATOM   7912 C CB  . ALA C 2 170 ? -17.847 59.785 133.143 1.00 80.27  ? 151  ALA C CB  1 
ATOM   7913 N N   . VAL C 2 171 ? -18.983 60.920 136.102 1.00 61.12  ? 152  VAL C N   1 
ATOM   7914 C CA  . VAL C 2 171 ? -18.546 61.660 137.291 1.00 60.54  ? 152  VAL C CA  1 
ATOM   7915 C C   . VAL C 2 171 ? -17.068 62.121 137.301 1.00 66.34  ? 152  VAL C C   1 
ATOM   7916 O O   . VAL C 2 171 ? -16.760 63.217 137.743 1.00 56.83  ? 152  VAL C O   1 
ATOM   7917 C CB  . VAL C 2 171 ? -18.810 60.853 138.564 1.00 51.08  ? 152  VAL C CB  1 
ATOM   7918 C CG1 . VAL C 2 171 ? -18.470 61.684 139.823 1.00 59.21  ? 152  VAL C CG1 1 
ATOM   7919 C CG2 . VAL C 2 171 ? -20.250 60.399 138.587 1.00 55.60  ? 152  VAL C CG2 1 
ATOM   7920 N N   . LYS C 2 172 ? -16.163 61.278 136.825 1.00 72.71  ? 153  LYS C N   1 
ATOM   7921 C CA  . LYS C 2 172 ? -14.734 61.611 136.787 1.00 71.04  ? 153  LYS C CA  1 
ATOM   7922 C C   . LYS C 2 172 ? -14.041 60.957 135.572 1.00 72.23  ? 153  LYS C C   1 
ATOM   7923 O O   . LYS C 2 172 ? -14.489 59.904 135.070 1.00 72.53  ? 153  LYS C O   1 
ATOM   7924 C CB  . LYS C 2 172 ? -14.052 61.181 138.098 1.00 73.45  ? 153  LYS C CB  1 
ATOM   7925 C CG  . LYS C 2 172 ? -14.022 62.222 139.211 1.00 70.37  ? 153  LYS C CG  1 
ATOM   7926 C CD  . LYS C 2 172 ? -12.646 62.896 139.289 1.00 83.00  ? 153  LYS C CD  1 
ATOM   7927 C CE  . LYS C 2 172 ? -12.581 63.965 140.392 1.00 86.32  ? 153  LYS C CE  1 
ATOM   7928 N NZ  . LYS C 2 172 ? -11.170 64.417 140.611 1.00 76.85  ? 153  LYS C NZ  1 
ATOM   7929 N N   . TYR C 2 173 ? -12.981 61.606 135.087 1.00 58.34  ? 154  TYR C N   1 
ATOM   7930 C CA  . TYR C 2 173 ? -12.096 61.036 134.092 1.00 45.46  ? 154  TYR C CA  1 
ATOM   7931 C C   . TYR C 2 173 ? -10.728 60.914 134.734 1.00 56.46  ? 154  TYR C C   1 
ATOM   7932 O O   . TYR C 2 173 ? -10.205 61.877 135.286 1.00 61.86  ? 154  TYR C O   1 
ATOM   7933 C CB  . TYR C 2 173 ? -12.017 61.902 132.823 1.00 52.09  ? 154  TYR C CB  1 
ATOM   7934 C CG  . TYR C 2 173 ? -10.867 61.486 131.905 1.00 60.70  ? 154  TYR C CG  1 
ATOM   7935 C CD1 . TYR C 2 173 ? -10.891 60.283 131.222 1.00 53.27  ? 154  TYR C CD1 1 
ATOM   7936 C CD2 . TYR C 2 173 ? -9.738  62.283 131.762 1.00 59.22  ? 154  TYR C CD2 1 
ATOM   7937 C CE1 . TYR C 2 173 ? -9.835  59.897 130.411 1.00 59.40  ? 154  TYR C CE1 1 
ATOM   7938 C CE2 . TYR C 2 173 ? -8.683  61.905 130.966 1.00 55.07  ? 154  TYR C CE2 1 
ATOM   7939 C CZ  . TYR C 2 173 ? -8.741  60.712 130.289 1.00 65.37  ? 154  TYR C CZ  1 
ATOM   7940 O OH  . TYR C 2 173 ? -7.706  60.312 129.483 1.00 59.89  ? 154  TYR C OH  1 
ATOM   7941 N N   . LEU C 2 174 ? -10.133 59.738 134.663 1.00 45.51  ? 155  LEU C N   1 
ATOM   7942 C CA  . LEU C 2 174 ? -8.889  59.534 135.352 1.00 52.38  ? 155  LEU C CA  1 
ATOM   7943 C C   . LEU C 2 174 ? -8.011  58.723 134.480 1.00 57.84  ? 155  LEU C C   1 
ATOM   7944 O O   . LEU C 2 174 ? -8.512  57.868 133.750 1.00 63.63  ? 155  LEU C O   1 
ATOM   7945 C CB  . LEU C 2 174 ? -9.156  58.742 136.625 1.00 65.48  ? 155  LEU C CB  1 
ATOM   7946 C CG  . LEU C 2 174 ? -9.899  59.477 137.731 1.00 66.01  ? 155  LEU C CG  1 
ATOM   7947 C CD1 . LEU C 2 174 ? -10.514 58.494 138.707 1.00 53.51  ? 155  LEU C CD1 1 
ATOM   7948 C CD2 . LEU C 2 174 ? -8.928  60.476 138.415 1.00 66.91  ? 155  LEU C CD2 1 
ATOM   7949 N N   . GLU C 2 175 ? -6.706  58.955 134.574 1.00 48.49  ? 156  GLU C N   1 
ATOM   7950 C CA  . GLU C 2 175 ? -5.727  58.173 133.811 1.00 42.22  ? 156  GLU C CA  1 
ATOM   7951 C C   . GLU C 2 175 ? -4.778  57.485 134.770 1.00 51.30  ? 156  GLU C C   1 
ATOM   7952 O O   . GLU C 2 175 ? -4.435  58.061 135.801 1.00 64.70  ? 156  GLU C O   1 
ATOM   7953 C CB  . GLU C 2 175 ? -4.918  59.076 132.896 1.00 56.27  ? 156  GLU C CB  1 
ATOM   7954 C CG  . GLU C 2 175 ? -5.750  59.956 131.997 1.00 57.04  ? 156  GLU C CG  1 
ATOM   7955 C CD  . GLU C 2 175 ? -4.890  60.792 131.061 1.00 73.70  ? 156  GLU C CD  1 
ATOM   7956 O OE1 . GLU C 2 175 ? -3.806  61.285 131.506 1.00 69.42  ? 156  GLU C OE1 1 
ATOM   7957 O OE2 . GLU C 2 175 ? -5.302  60.953 129.881 1.00 68.21  ? 156  GLU C OE2 1 
ATOM   7958 N N   . CYS C 2 176 ? -4.355  56.267 134.440 1.00 40.77  ? 157  CYS C N   1 
ATOM   7959 C CA  . CYS C 2 176 ? -3.484  55.491 135.326 1.00 58.06  ? 157  CYS C CA  1 
ATOM   7960 C C   . CYS C 2 176 ? -2.655  54.500 134.546 1.00 64.75  ? 157  CYS C C   1 
ATOM   7961 O O   . CYS C 2 176 ? -2.888  54.275 133.347 1.00 52.97  ? 157  CYS C O   1 
ATOM   7962 C CB  . CYS C 2 176 ? -4.290  54.710 136.367 1.00 36.89  ? 157  CYS C CB  1 
ATOM   7963 S SG  . CYS C 2 176 ? -5.475  53.529 135.666 1.00 56.16  ? 157  CYS C SG  1 
ATOM   7964 N N   . SER C 2 177 ? -1.636  53.954 135.198 1.00 57.33  ? 158  SER C N   1 
ATOM   7965 C CA  . SER C 2 177 ? -0.791  52.949 134.577 1.00 41.37  ? 158  SER C CA  1 
ATOM   7966 C C   . SER C 2 177 ? -0.611  51.775 135.525 1.00 55.44  ? 158  SER C C   1 
ATOM   7967 O O   . SER C 2 177 ? -0.143  51.945 136.646 1.00 54.86  ? 158  SER C O   1 
ATOM   7968 C CB  . SER C 2 177 ? 0.557   53.543 134.200 1.00 44.21  ? 158  SER C CB  1 
ATOM   7969 O OG  . SER C 2 177 ? 1.415   52.545 133.688 1.00 74.36  ? 158  SER C OG  1 
ATOM   7970 N N   . ALA C 2 178 ? -0.976  50.582 135.079 1.00 63.95  ? 159  ALA C N   1 
ATOM   7971 C CA  . ALA C 2 178 ? -0.838  49.407 135.924 1.00 47.80  ? 159  ALA C CA  1 
ATOM   7972 C C   . ALA C 2 178 ? 0.615   49.090 136.247 1.00 55.55  ? 159  ALA C C   1 
ATOM   7973 O O   . ALA C 2 178 ? 0.943   48.758 137.381 1.00 64.40  ? 159  ALA C O   1 
ATOM   7974 C CB  . ALA C 2 178 ? -1.510  48.214 135.280 1.00 54.69  ? 159  ALA C CB  1 
ATOM   7975 N N   . LEU C 2 179 ? 1.485   49.170 135.246 1.00 66.87  ? 160  LEU C N   1 
ATOM   7976 C CA  . LEU C 2 179 ? 2.892   48.887 135.475 1.00 61.40  ? 160  LEU C CA  1 
ATOM   7977 C C   . LEU C 2 179 ? 3.537   49.918 136.386 1.00 52.53  ? 160  LEU C C   1 
ATOM   7978 O O   . LEU C 2 179 ? 4.230   49.573 137.336 1.00 68.91  ? 160  LEU C O   1 
ATOM   7979 C CB  . LEU C 2 179 ? 3.633   48.843 134.141 1.00 70.57  ? 160  LEU C CB  1 
ATOM   7980 C CG  . LEU C 2 179 ? 5.120   48.517 134.204 1.00 74.58  ? 160  LEU C CG  1 
ATOM   7981 C CD1 . LEU C 2 179 ? 5.323   47.132 134.782 1.00 61.87  ? 160  LEU C CD1 1 
ATOM   7982 C CD2 . LEU C 2 179 ? 5.733   48.621 132.825 1.00 46.12  ? 160  LEU C CD2 1 
ATOM   7983 N N   . THR C 2 180 ? 3.297   51.190 136.088 1.00 54.47  ? 161  THR C N   1 
ATOM   7984 C CA  . THR C 2 180 ? 3.803   52.283 136.904 1.00 61.02  ? 161  THR C CA  1 
ATOM   7985 C C   . THR C 2 180 ? 3.090   52.315 138.242 1.00 70.75  ? 161  THR C C   1 
ATOM   7986 O O   . THR C 2 180 ? 3.686   52.573 139.284 1.00 54.19  ? 161  THR C O   1 
ATOM   7987 C CB  . THR C 2 180 ? 3.682   53.634 136.194 1.00 67.62  ? 161  THR C CB  1 
ATOM   7988 O OG1 . THR C 2 180 ? 2.413   53.715 135.542 1.00 94.21  ? 161  THR C OG1 1 
ATOM   7989 C CG2 . THR C 2 180 ? 4.774   53.778 135.157 1.00 62.08  ? 161  THR C CG2 1 
ATOM   7990 N N   . GLN C 2 181 ? 1.789   52.064 138.186 1.00 72.49  ? 162  GLN C N   1 
ATOM   7991 C CA  . GLN C 2 181 ? 0.952   52.057 139.368 1.00 68.35  ? 162  GLN C CA  1 
ATOM   7992 C C   . GLN C 2 181 ? 0.593   53.483 139.753 1.00 59.21  ? 162  GLN C C   1 
ATOM   7993 O O   . GLN C 2 181 ? -0.035  53.717 140.778 1.00 68.43  ? 162  GLN C O   1 
ATOM   7994 C CB  . GLN C 2 181 ? 1.659   51.341 140.514 1.00 69.10  ? 162  GLN C CB  1 
ATOM   7995 C CG  . GLN C 2 181 ? 0.758   50.992 141.675 1.00 75.15  ? 162  GLN C CG  1 
ATOM   7996 C CD  . GLN C 2 181 ? 1.198   49.732 142.381 1.00 85.39  ? 162  GLN C CD  1 
ATOM   7997 O OE1 . GLN C 2 181 ? 1.475   48.719 141.745 1.00 75.24  ? 162  GLN C OE1 1 
ATOM   7998 N NE2 . GLN C 2 181 ? 1.256   49.784 143.704 1.00 98.51  ? 162  GLN C NE2 1 
ATOM   7999 N N   . ARG C 2 182 ? 0.992   54.433 138.917 1.00 48.20  ? 163  ARG C N   1 
ATOM   8000 C CA  . ARG C 2 182 ? 0.695   55.836 139.169 1.00 72.26  ? 163  ARG C CA  1 
ATOM   8001 C C   . ARG C 2 182 ? -0.715  56.168 138.704 1.00 74.85  ? 163  ARG C C   1 
ATOM   8002 O O   . ARG C 2 182 ? -1.140  55.760 137.627 1.00 54.42  ? 163  ARG C O   1 
ATOM   8003 C CB  . ARG C 2 182 ? 1.732   56.761 138.535 1.00 78.19  ? 163  ARG C CB  1 
ATOM   8004 C CG  . ARG C 2 182 ? 1.549   57.020 137.063 1.00 68.02  ? 163  ARG C CG  1 
ATOM   8005 C CD  . ARG C 2 182 ? 2.638   57.946 136.563 1.00 79.33  ? 163  ARG C CD  1 
ATOM   8006 N NE  . ARG C 2 182 ? 2.707   57.978 135.109 1.00 106.94 ? 163  ARG C NE  1 
ATOM   8007 C CZ  . ARG C 2 182 ? 3.186   56.987 134.366 1.00 85.49  ? 163  ARG C CZ  1 
ATOM   8008 N NH1 . ARG C 2 182 ? 3.629   55.881 134.940 1.00 53.33  ? 163  ARG C NH1 1 
ATOM   8009 N NH2 . ARG C 2 182 ? 3.216   57.102 133.049 1.00 87.86  ? 163  ARG C NH2 1 
ATOM   8010 N N   . GLY C 2 183 ? -1.441  56.883 139.557 1.00 62.50  ? 164  GLY C N   1 
ATOM   8011 C CA  . GLY C 2 183 ? -2.814  57.256 139.290 1.00 58.18  ? 164  GLY C CA  1 
ATOM   8012 C C   . GLY C 2 183 ? -3.758  56.100 139.543 1.00 61.86  ? 164  GLY C C   1 
ATOM   8013 O O   . GLY C 2 183 ? -4.956  56.204 139.314 1.00 58.26  ? 164  GLY C O   1 
ATOM   8014 N N   . LEU C 2 184 ? -3.208  54.992 140.024 1.00 36.57  ? 165  LEU C N   1 
ATOM   8015 C CA  . LEU C 2 184 ? -3.990  53.788 140.275 1.00 53.09  ? 165  LEU C CA  1 
ATOM   8016 C C   . LEU C 2 184 ? -4.861  53.842 141.525 1.00 48.14  ? 165  LEU C C   1 
ATOM   8017 O O   . LEU C 2 184 ? -6.033  53.488 141.477 1.00 51.72  ? 165  LEU C O   1 
ATOM   8018 C CB  . LEU C 2 184 ? -3.075  52.565 140.325 1.00 46.49  ? 165  LEU C CB  1 
ATOM   8019 C CG  . LEU C 2 184 ? -3.776  51.214 140.428 1.00 48.40  ? 165  LEU C CG  1 
ATOM   8020 C CD1 . LEU C 2 184 ? -4.803  51.071 139.328 1.00 41.62  ? 165  LEU C CD1 1 
ATOM   8021 C CD2 . LEU C 2 184 ? -2.774  50.083 140.381 1.00 45.77  ? 165  LEU C CD2 1 
ATOM   8022 N N   . LYS C 2 185 ? -4.292  54.274 142.643 1.00 44.08  ? 166  LYS C N   1 
ATOM   8023 C CA  . LYS C 2 185 ? -5.053  54.356 143.882 1.00 52.42  ? 166  LYS C CA  1 
ATOM   8024 C C   . LYS C 2 185 ? -6.236  55.291 143.685 1.00 59.94  ? 166  LYS C C   1 
ATOM   8025 O O   . LYS C 2 185 ? -7.372  54.951 143.995 1.00 43.60  ? 166  LYS C O   1 
ATOM   8026 C CB  . LYS C 2 185 ? -4.169  54.829 145.031 1.00 48.82  ? 166  LYS C CB  1 
ATOM   8027 C CG  . LYS C 2 185 ? -4.819  54.694 146.389 1.00 52.47  ? 166  LYS C CG  1 
ATOM   8028 C CD  . LYS C 2 185 ? -3.931  55.231 147.486 1.00 75.34  ? 166  LYS C CD  1 
ATOM   8029 C CE  . LYS C 2 185 ? -4.739  55.539 148.727 1.00 67.09  ? 166  LYS C CE  1 
ATOM   8030 N NZ  . LYS C 2 185 ? -5.648  56.691 148.499 1.00 66.12  ? 166  LYS C NZ  1 
ATOM   8031 N N   . THR C 2 186 ? -5.954  56.474 143.157 1.00 50.18  ? 167  THR C N   1 
ATOM   8032 C CA  . THR C 2 186 ? -6.982  57.453 142.846 1.00 56.51  ? 167  THR C CA  1 
ATOM   8033 C C   . THR C 2 186 ? -8.254  56.896 142.220 1.00 63.06  ? 167  THR C C   1 
ATOM   8034 O O   . THR C 2 186 ? -9.337  57.319 142.608 1.00 54.20  ? 167  THR C O   1 
ATOM   8035 C CB  . THR C 2 186 ? -6.431  58.569 141.962 1.00 47.68  ? 167  THR C CB  1 
ATOM   8036 O OG1 . THR C 2 186 ? -5.153  58.962 142.456 1.00 49.06  ? 167  THR C OG1 1 
ATOM   8037 C CG2 . THR C 2 186 ? -7.339  59.767 141.986 1.00 43.11  ? 167  THR C CG2 1 
ATOM   8038 N N   . VAL C 2 187 ? -8.111  55.963 141.273 1.00 58.00  ? 168  VAL C N   1 
ATOM   8039 C CA  . VAL C 2 187 ? -9.218  55.421 140.498 1.00 36.47  ? 168  VAL C CA  1 
ATOM   8040 C C   . VAL C 2 187 ? -10.225 54.802 141.432 1.00 47.35  ? 168  VAL C C   1 
ATOM   8041 O O   . VAL C 2 187 ? -11.445 55.003 141.341 1.00 54.33  ? 168  VAL C O   1 
ATOM   8042 C CB  . VAL C 2 187 ? -8.732  54.341 139.506 1.00 50.20  ? 168  VAL C CB  1 
ATOM   8043 C CG1 . VAL C 2 187 ? -9.895  53.481 138.985 1.00 35.38  ? 168  VAL C CG1 1 
ATOM   8044 C CG2 . VAL C 2 187 ? -7.980  54.966 138.354 1.00 45.69  ? 168  VAL C CG2 1 
ATOM   8045 N N   . PHE C 2 188 ? -9.707  54.051 142.370 1.00 45.00  ? 169  PHE C N   1 
ATOM   8046 C CA  . PHE C 2 188 ? -10.577 53.332 143.257 1.00 55.76  ? 169  PHE C CA  1 
ATOM   8047 C C   . PHE C 2 188 ? -11.069 54.198 144.383 1.00 58.43  ? 169  PHE C C   1 
ATOM   8048 O O   . PHE C 2 188 ? -12.244 54.090 144.742 1.00 56.07  ? 169  PHE C O   1 
ATOM   8049 C CB  . PHE C 2 188 ? -9.872  52.079 143.706 1.00 51.47  ? 169  PHE C CB  1 
ATOM   8050 C CG  . PHE C 2 188 ? -9.548  51.192 142.564 1.00 62.07  ? 169  PHE C CG  1 
ATOM   8051 C CD1 . PHE C 2 188 ? -10.574 50.535 141.902 1.00 65.56  ? 169  PHE C CD1 1 
ATOM   8052 C CD2 . PHE C 2 188 ? -8.248  51.080 142.080 1.00 69.02  ? 169  PHE C CD2 1 
ATOM   8053 C CE1 . PHE C 2 188 ? -10.315 49.733 140.816 1.00 54.41  ? 169  PHE C CE1 1 
ATOM   8054 C CE2 . PHE C 2 188 ? -7.978  50.270 140.975 1.00 71.52  ? 169  PHE C CE2 1 
ATOM   8055 C CZ  . PHE C 2 188 ? -9.015  49.605 140.343 1.00 52.59  ? 169  PHE C CZ  1 
ATOM   8056 N N   . ASP C 2 189 ? -10.248 55.129 144.840 1.00 43.36  ? 170  ASP C N   1 
ATOM   8057 C CA  . ASP C 2 189 ? -10.675 56.060 145.856 1.00 54.16  ? 170  ASP C CA  1 
ATOM   8058 C C   . ASP C 2 189 ? -11.840 56.858 145.321 1.00 60.72  ? 170  ASP C C   1 
ATOM   8059 O O   . ASP C 2 189 ? -12.803 57.095 146.032 1.00 54.80  ? 170  ASP C O   1 
ATOM   8060 C CB  . ASP C 2 189 ? -9.559  57.050 146.181 1.00 49.58  ? 170  ASP C CB  1 
ATOM   8061 C CG  . ASP C 2 189 ? -8.456  56.447 146.999 1.00 65.14  ? 170  ASP C CG  1 
ATOM   8062 O OD1 . ASP C 2 189 ? -8.650  55.346 147.526 1.00 73.93  ? 170  ASP C OD1 1 
ATOM   8063 O OD2 . ASP C 2 189 ? -7.391  57.075 147.117 1.00 61.37  ? 170  ASP C OD2 1 
ATOM   8064 N N   . GLU C 2 190 ? -11.755 57.274 144.062 1.00 47.43  ? 171  GLU C N   1 
ATOM   8065 C CA  . GLU C 2 190 ? -12.784 58.124 143.477 1.00 52.83  ? 171  GLU C CA  1 
ATOM   8066 C C   . GLU C 2 190 ? -14.024 57.350 143.108 1.00 54.21  ? 171  GLU C C   1 
ATOM   8067 O O   . GLU C 2 190 ? -15.150 57.863 143.185 1.00 58.23  ? 171  GLU C O   1 
ATOM   8068 C CB  . GLU C 2 190 ? -12.265 58.877 142.266 1.00 51.84  ? 171  GLU C CB  1 
ATOM   8069 C CG  . GLU C 2 190 ? -11.301 60.022 142.612 1.00 79.93  ? 171  GLU C CG  1 
ATOM   8070 C CD  . GLU C 2 190 ? -11.973 61.190 143.352 1.00 92.83  ? 171  GLU C CD  1 
ATOM   8071 O OE1 . GLU C 2 190 ? -13.232 61.208 143.448 1.00 83.71  ? 171  GLU C OE1 1 
ATOM   8072 O OE2 . GLU C 2 190 ? -11.228 62.086 143.824 1.00 104.95 ? 171  GLU C OE2 1 
ATOM   8073 N N   . ALA C 2 191 ? -13.829 56.107 142.714 1.00 38.97  ? 172  ALA C N   1 
ATOM   8074 C CA  . ALA C 2 191 ? -14.956 55.262 142.458 1.00 57.10  ? 172  ALA C CA  1 
ATOM   8075 C C   . ALA C 2 191 ? -15.813 55.135 143.733 1.00 61.21  ? 172  ALA C C   1 
ATOM   8076 O O   . ALA C 2 191 ? -17.026 55.059 143.685 1.00 64.81  ? 172  ALA C O   1 
ATOM   8077 C CB  . ALA C 2 191 ? -14.467 53.921 141.986 1.00 38.17  ? 172  ALA C CB  1 
ATOM   8078 N N   . ILE C 2 192 ? -15.161 55.104 144.883 1.00 52.35  ? 173  ILE C N   1 
ATOM   8079 C CA  . ILE C 2 192 ? -15.874 54.973 146.143 1.00 57.24  ? 173  ILE C CA  1 
ATOM   8080 C C   . ILE C 2 192 ? -16.528 56.288 146.560 1.00 61.79  ? 173  ILE C C   1 
ATOM   8081 O O   . ILE C 2 192 ? -17.648 56.289 147.056 1.00 64.95  ? 173  ILE C O   1 
ATOM   8082 C CB  . ILE C 2 192 ? -14.943 54.426 147.229 1.00 53.25  ? 173  ILE C CB  1 
ATOM   8083 C CG1 . ILE C 2 192 ? -14.400 53.074 146.773 1.00 59.61  ? 173  ILE C CG1 1 
ATOM   8084 C CG2 . ILE C 2 192 ? -15.671 54.279 148.518 1.00 46.60  ? 173  ILE C CG2 1 
ATOM   8085 C CD1 . ILE C 2 192 ? -13.488 52.402 147.749 1.00 56.77  ? 173  ILE C CD1 1 
ATOM   8086 N N   . ARG C 2 193 ? -15.834 57.402 146.345 1.00 49.70  ? 174  ARG C N   1 
ATOM   8087 C CA  . ARG C 2 193 ? -16.378 58.709 146.647 1.00 61.17  ? 174  ARG C CA  1 
ATOM   8088 C C   . ARG C 2 193 ? -17.693 58.919 145.900 1.00 50.96  ? 174  ARG C C   1 
ATOM   8089 O O   . ARG C 2 193 ? -18.611 59.552 146.401 1.00 72.78  ? 174  ARG C O   1 
ATOM   8090 C CB  . ARG C 2 193 ? -15.365 59.790 146.302 1.00 62.92  ? 174  ARG C CB  1 
ATOM   8091 C CG  . ARG C 2 193 ? -14.089 59.709 147.136 1.00 61.00  ? 174  ARG C CG  1 
ATOM   8092 C CD  . ARG C 2 193 ? -13.230 60.931 146.943 1.00 56.05  ? 174  ARG C CD  1 
ATOM   8093 N NE  . ARG C 2 193 ? -12.228 61.067 147.995 1.00 65.96  ? 174  ARG C NE  1 
ATOM   8094 C CZ  . ARG C 2 193 ? -10.914 60.875 147.838 1.00 80.02  ? 174  ARG C CZ  1 
ATOM   8095 N NH1 . ARG C 2 193 ? -10.413 60.524 146.661 1.00 80.68  ? 174  ARG C NH1 1 
ATOM   8096 N NH2 . ARG C 2 193 ? -10.089 61.044 148.862 1.00 62.53  ? 174  ARG C NH2 1 
ATOM   8097 N N   . ALA C 2 194 ? -17.783 58.348 144.711 1.00 54.37  ? 175  ALA C N   1 
ATOM   8098 C CA  . ALA C 2 194 ? -18.963 58.447 143.886 1.00 60.29  ? 175  ALA C CA  1 
ATOM   8099 C C   . ALA C 2 194 ? -20.171 57.673 144.432 1.00 61.40  ? 175  ALA C C   1 
ATOM   8100 O O   . ALA C 2 194 ? -21.303 58.018 144.113 1.00 79.25  ? 175  ALA C O   1 
ATOM   8101 C CB  . ALA C 2 194 ? -18.639 58.008 142.486 1.00 45.95  ? 175  ALA C CB  1 
ATOM   8102 N N   . VAL C 2 195 ? -19.954 56.635 145.233 1.00 59.20  ? 176  VAL C N   1 
ATOM   8103 C CA  . VAL C 2 195 ? -21.066 55.863 145.813 1.00 60.19  ? 176  VAL C CA  1 
ATOM   8104 C C   . VAL C 2 195 ? -21.466 56.400 147.186 1.00 76.64  ? 176  VAL C C   1 
ATOM   8105 O O   . VAL C 2 195 ? -22.623 56.316 147.580 1.00 78.23  ? 176  VAL C O   1 
ATOM   8106 C CB  . VAL C 2 195 ? -20.708 54.386 145.939 1.00 66.29  ? 176  VAL C CB  1 
ATOM   8107 C CG1 . VAL C 2 195 ? -21.695 53.637 146.840 1.00 65.27  ? 176  VAL C CG1 1 
ATOM   8108 C CG2 . VAL C 2 195 ? -20.665 53.767 144.587 1.00 52.65  ? 176  VAL C CG2 1 
ATOM   8109 N N   . LEU C 2 196 ? -20.487 56.907 147.929 1.00 78.35  ? 177  LEU C N   1 
ATOM   8110 C CA  . LEU C 2 196 ? -20.741 57.722 149.103 1.00 87.59  ? 177  LEU C CA  1 
ATOM   8111 C C   . LEU C 2 196 ? -21.418 58.970 148.549 1.00 95.86  ? 177  LEU C C   1 
ATOM   8112 O O   . LEU C 2 196 ? -21.886 59.838 149.288 1.00 85.07  ? 177  LEU C O   1 
ATOM   8113 C CB  . LEU C 2 196 ? -19.414 58.116 149.749 1.00 88.28  ? 177  LEU C CB  1 
ATOM   8114 C CG  . LEU C 2 196 ? -18.731 57.229 150.795 1.00 80.35  ? 177  LEU C CG  1 
ATOM   8115 C CD1 . LEU C 2 196 ? -19.079 55.741 150.682 1.00 63.90  ? 177  LEU C CD1 1 
ATOM   8116 C CD2 . LEU C 2 196 ? -17.213 57.461 150.734 1.00 64.52  ? 177  LEU C CD2 1 
ATOM   8117 N N   . PHE D 2 16  ? -9.255  43.609 68.513  1.00 77.14  ? -3   PHE D N   1 
ATOM   8118 C CA  . PHE D 2 16  ? -10.611 43.110 68.297  1.00 89.97  ? -3   PHE D CA  1 
ATOM   8119 C C   . PHE D 2 16  ? -11.349 42.778 69.586  1.00 103.41 ? -3   PHE D C   1 
ATOM   8120 O O   . PHE D 2 16  ? -10.998 41.831 70.269  1.00 116.56 ? -3   PHE D O   1 
ATOM   8121 C CB  . PHE D 2 16  ? -10.571 41.872 67.399  1.00 86.68  ? -3   PHE D CB  1 
ATOM   8122 C CG  . PHE D 2 16  ? -10.037 42.140 66.021  1.00 125.65 ? -3   PHE D CG  1 
ATOM   8123 C CD1 . PHE D 2 16  ? -10.861 42.644 65.028  1.00 121.77 ? -3   PHE D CD1 1 
ATOM   8124 C CD2 . PHE D 2 16  ? -8.709  41.889 65.718  1.00 135.51 ? -3   PHE D CD2 1 
ATOM   8125 C CE1 . PHE D 2 16  ? -10.370 42.893 63.761  1.00 101.81 ? -3   PHE D CE1 1 
ATOM   8126 C CE2 . PHE D 2 16  ? -8.214  42.134 64.451  1.00 118.33 ? -3   PHE D CE2 1 
ATOM   8127 C CZ  . PHE D 2 16  ? -9.045  42.638 63.471  1.00 99.60  ? -3   PHE D CZ  1 
ATOM   8128 N N   . GLN D 2 17  ? -12.392 43.540 69.891  1.00 79.22  ? -2   GLN D N   1 
ATOM   8129 C CA  . GLN D 2 17  ? -13.190 43.325 71.088  1.00 76.87  ? -2   GLN D CA  1 
ATOM   8130 C C   . GLN D 2 17  ? -12.685 44.038 72.340  1.00 98.01  ? -2   GLN D C   1 
ATOM   8131 O O   . GLN D 2 17  ? -13.208 43.844 73.423  1.00 118.92 ? -2   GLN D O   1 
ATOM   8132 C CB  . GLN D 2 17  ? -13.334 41.835 71.352  1.00 84.45  ? -2   GLN D CB  1 
ATOM   8133 C CG  . GLN D 2 17  ? -14.265 41.127 70.396  1.00 78.38  ? -2   GLN D CG  1 
ATOM   8134 C CD  . GLN D 2 17  ? -14.584 39.731 70.835  1.00 101.42 ? -2   GLN D CD  1 
ATOM   8135 O OE1 . GLN D 2 17  ? -14.517 38.792 70.057  1.00 104.81 ? -2   GLN D OE1 1 
ATOM   8136 N NE2 . GLN D 2 17  ? -14.929 39.583 72.091  1.00 108.45 ? -2   GLN D NE2 1 
ATOM   8137 N N   . GLY D 2 18  ? -11.671 44.873 72.178  1.00 107.76 ? -1   GLY D N   1 
ATOM   8138 C CA  . GLY D 2 18  ? -11.091 45.642 73.262  1.00 108.76 ? -1   GLY D CA  1 
ATOM   8139 C C   . GLY D 2 18  ? -10.475 44.903 74.424  1.00 106.55 ? -1   GLY D C   1 
ATOM   8140 O O   . GLY D 2 18  ? -9.708  43.973 74.232  1.00 103.77 ? -1   GLY D O   1 
ATOM   8141 N N   . THR D 2 19  ? -10.798 45.319 75.642  1.00 103.94 ? 0    THR D N   1 
ATOM   8142 C CA  . THR D 2 19  ? -10.240 44.675 76.824  1.00 97.51  ? 0    THR D CA  1 
ATOM   8143 C C   . THR D 2 19  ? -11.307 44.066 77.719  1.00 88.58  ? 0    THR D C   1 
ATOM   8144 O O   . THR D 2 19  ? -12.437 44.544 77.761  1.00 105.70 ? 0    THR D O   1 
ATOM   8145 C CB  . THR D 2 19  ? -9.415  45.668 77.657  1.00 95.88  ? 0    THR D CB  1 
ATOM   8146 O OG1 . THR D 2 19  ? -10.238 46.781 78.023  1.00 88.11  ? 0    THR D OG1 1 
ATOM   8147 C CG2 . THR D 2 19  ? -8.226  46.170 76.859  1.00 99.48  ? 0    THR D CG2 1 
ATOM   8148 N N   . MET D 2 20  ? -10.940 43.008 78.436  1.00 70.98  ? 1    MET D N   1 
ATOM   8149 C CA  . MET D 2 20  ? -11.869 42.344 79.336  1.00 65.50  ? 1    MET D CA  1 
ATOM   8150 C C   . MET D 2 20  ? -12.384 43.346 80.347  1.00 79.90  ? 1    MET D C   1 
ATOM   8151 O O   . MET D 2 20  ? -11.645 44.220 80.791  1.00 66.48  ? 1    MET D O   1 
ATOM   8152 C CB  . MET D 2 20  ? -11.176 41.220 80.099  1.00 59.10  ? 1    MET D CB  1 
ATOM   8153 C CG  . MET D 2 20  ? -10.885 39.979 79.303  1.00 63.65  ? 1    MET D CG  1 
ATOM   8154 S SD  . MET D 2 20  ? -10.120 38.761 80.372  1.00 75.74  ? 1    MET D SD  1 
ATOM   8155 C CE  . MET D 2 20  ? -11.353 38.652 81.654  1.00 77.42  ? 1    MET D CE  1 
ATOM   8156 N N   . GLN D 2 21  ? -13.649 43.222 80.722  1.00 56.86  ? 2    GLN D N   1 
ATOM   8157 C CA  . GLN D 2 21  ? -14.200 44.141 81.695  1.00 63.17  ? 2    GLN D CA  1 
ATOM   8158 C C   . GLN D 2 21  ? -13.571 43.850 83.045  1.00 86.19  ? 2    GLN D C   1 
ATOM   8159 O O   . GLN D 2 21  ? -13.649 42.733 83.543  1.00 80.06  ? 2    GLN D O   1 
ATOM   8160 C CB  . GLN D 2 21  ? -15.719 44.018 81.784  1.00 59.18  ? 2    GLN D CB  1 
ATOM   8161 C CG  . GLN D 2 21  ? -16.329 44.990 82.779  1.00 87.54  ? 2    GLN D CG  1 
ATOM   8162 C CD  . GLN D 2 21  ? -17.838 44.996 82.752  1.00 93.62  ? 2    GLN D CD  1 
ATOM   8163 O OE1 . GLN D 2 21  ? -18.461 44.274 81.976  1.00 95.73  ? 2    GLN D OE1 1 
ATOM   8164 N NE2 . GLN D 2 21  ? -18.438 45.818 83.602  1.00 86.92  ? 2    GLN D NE2 1 
ATOM   8165 N N   . ALA D 2 22  ? -12.941 44.859 83.632  1.00 78.63  ? 3    ALA D N   1 
ATOM   8166 C CA  . ALA D 2 22  ? -12.307 44.701 84.928  1.00 65.27  ? 3    ALA D CA  1 
ATOM   8167 C C   . ALA D 2 22  ? -13.310 45.062 86.005  1.00 69.27  ? 3    ALA D C   1 
ATOM   8168 O O   . ALA D 2 22  ? -13.822 46.176 86.033  1.00 79.51  ? 3    ALA D O   1 
ATOM   8169 C CB  . ALA D 2 22  ? -11.082 45.580 85.028  1.00 48.45  ? 3    ALA D CB  1 
ATOM   8170 N N   . ILE D 2 23  ? -13.593 44.116 86.891  1.00 63.12  ? 4    ILE D N   1 
ATOM   8171 C CA  . ILE D 2 23  ? -14.541 44.349 87.959  1.00 62.29  ? 4    ILE D CA  1 
ATOM   8172 C C   . ILE D 2 23  ? -13.853 44.380 89.312  1.00 43.68  ? 4    ILE D C   1 
ATOM   8173 O O   . ILE D 2 23  ? -13.219 43.422 89.709  1.00 35.53  ? 4    ILE D O   1 
ATOM   8174 C CB  . ILE D 2 23  ? -15.643 43.307 87.948  1.00 56.07  ? 4    ILE D CB  1 
ATOM   8175 C CG1 . ILE D 2 23  ? -16.373 43.372 86.606  1.00 40.68  ? 4    ILE D CG1 1 
ATOM   8176 C CG2 . ILE D 2 23  ? -16.577 43.543 89.130  1.00 48.17  ? 4    ILE D CG2 1 
ATOM   8177 C CD1 . ILE D 2 23  ? -17.726 42.722 86.608  1.00 39.63  ? 4    ILE D CD1 1 
ATOM   8178 N N   . LYS D 2 24  ? -13.982 45.503 90.005  1.00 44.41  ? 5    LYS D N   1 
ATOM   8179 C CA  . LYS D 2 24  ? -13.406 45.647 91.327  1.00 55.82  ? 5    LYS D CA  1 
ATOM   8180 C C   . LYS D 2 24  ? -14.471 45.352 92.368  1.00 64.84  ? 5    LYS D C   1 
ATOM   8181 O O   . LYS D 2 24  ? -15.485 46.050 92.433  1.00 45.87  ? 5    LYS D O   1 
ATOM   8182 C CB  . LYS D 2 24  ? -12.847 47.044 91.502  1.00 48.73  ? 5    LYS D CB  1 
ATOM   8183 C CG  . LYS D 2 24  ? -12.629 47.477 92.911  1.00 50.63  ? 5    LYS D CG  1 
ATOM   8184 C CD  . LYS D 2 24  ? -11.490 48.457 92.959  1.00 54.23  ? 5    LYS D CD  1 
ATOM   8185 C CE  . LYS D 2 24  ? -11.765 49.564 93.966  1.00 63.01  ? 5    LYS D CE  1 
ATOM   8186 N NZ  . LYS D 2 24  ? -10.544 50.397 94.196  1.00 61.51  ? 5    LYS D NZ  1 
ATOM   8187 N N   . CYS D 2 25  ? -14.225 44.299 93.157  1.00 48.54  ? 6    CYS D N   1 
ATOM   8188 C CA  . CYS D 2 25  ? -15.147 43.852 94.195  1.00 62.23  ? 6    CYS D CA  1 
ATOM   8189 C C   . CYS D 2 25  ? -14.483 43.902 95.579  1.00 47.30  ? 6    CYS D C   1 
ATOM   8190 O O   . CYS D 2 25  ? -13.397 43.364 95.792  1.00 44.09  ? 6    CYS D O   1 
ATOM   8191 C CB  . CYS D 2 25  ? -15.636 42.455 93.881  1.00 54.51  ? 6    CYS D CB  1 
ATOM   8192 S SG  . CYS D 2 25  ? -16.629 41.794 95.198  1.00 69.51  ? 6    CYS D SG  1 
ATOM   8193 N N   . VAL D 2 26  ? -15.120 44.593 96.507  1.00 56.60  ? 7    VAL D N   1 
ATOM   8194 C CA  . VAL D 2 26  ? -14.473 44.861 97.778  1.00 52.52  ? 7    VAL D CA  1 
ATOM   8195 C C   . VAL D 2 26  ? -15.244 44.110 98.814  1.00 55.06  ? 7    VAL D C   1 
ATOM   8196 O O   . VAL D 2 26  ? -16.485 44.217 98.883  1.00 46.87  ? 7    VAL D O   1 
ATOM   8197 C CB  . VAL D 2 26  ? -14.385 46.367 98.114  1.00 50.14  ? 7    VAL D CB  1 
ATOM   8198 C CG1 . VAL D 2 26  ? -13.912 46.562 99.528  1.00 35.32  ? 7    VAL D CG1 1 
ATOM   8199 C CG2 . VAL D 2 26  ? -13.447 47.076 97.138  1.00 38.05  ? 7    VAL D CG2 1 
ATOM   8200 N N   . VAL D 2 27  ? -14.493 43.328 99.597  1.00 54.73  ? 8    VAL D N   1 
ATOM   8201 C CA  . VAL D 2 27  ? -15.069 42.453 100.630 1.00 68.40  ? 8    VAL D CA  1 
ATOM   8202 C C   . VAL D 2 27  ? -14.833 43.007 102.048 1.00 59.01  ? 8    VAL D C   1 
ATOM   8203 O O   . VAL D 2 27  ? -13.701 43.292 102.454 1.00 53.99  ? 8    VAL D O   1 
ATOM   8204 C CB  . VAL D 2 27  ? -14.564 41.012 100.479 1.00 48.74  ? 8    VAL D CB  1 
ATOM   8205 C CG1 . VAL D 2 27  ? -15.551 40.055 101.070 1.00 48.80  ? 8    VAL D CG1 1 
ATOM   8206 C CG2 . VAL D 2 27  ? -14.429 40.700 99.028  1.00 42.74  ? 8    VAL D CG2 1 
ATOM   8207 N N   . VAL D 2 28  ? -15.933 43.190 102.765 1.00 49.92  ? 9    VAL D N   1 
ATOM   8208 C CA  . VAL D 2 28  ? -15.908 43.704 104.125 1.00 53.96  ? 9    VAL D CA  1 
ATOM   8209 C C   . VAL D 2 28  ? -16.632 42.734 105.067 1.00 59.25  ? 9    VAL D C   1 
ATOM   8210 O O   . VAL D 2 28  ? -17.477 41.916 104.629 1.00 50.10  ? 9    VAL D O   1 
ATOM   8211 C CB  . VAL D 2 28  ? -16.538 45.099 104.204 1.00 52.40  ? 9    VAL D CB  1 
ATOM   8212 C CG1 . VAL D 2 28  ? -15.834 46.052 103.239 1.00 50.16  ? 9    VAL D CG1 1 
ATOM   8213 C CG2 . VAL D 2 28  ? -18.031 45.038 103.901 1.00 45.08  ? 9    VAL D CG2 1 
ATOM   8214 N N   . GLY D 2 29  ? -16.276 42.828 106.350 1.00 63.28  ? 10   GLY D N   1 
ATOM   8215 C CA  . GLY D 2 29  ? -16.848 42.000 107.405 1.00 55.39  ? 10   GLY D CA  1 
ATOM   8216 C C   . GLY D 2 29  ? -15.859 41.882 108.535 1.00 58.44  ? 10   GLY D C   1 
ATOM   8217 O O   . GLY D 2 29  ? -14.720 42.323 108.415 1.00 62.08  ? 10   GLY D O   1 
ATOM   8218 N N   . ASP D 2 30  ? -16.283 41.281 109.636 1.00 63.07  ? 11   ASP D N   1 
ATOM   8219 C CA  . ASP D 2 30  ? -15.403 41.100 110.787 1.00 57.32  ? 11   ASP D CA  1 
ATOM   8220 C C   . ASP D 2 30  ? -14.320 40.088 110.468 1.00 52.43  ? 11   ASP D C   1 
ATOM   8221 O O   . ASP D 2 30  ? -14.500 39.229 109.617 1.00 47.93  ? 11   ASP D O   1 
ATOM   8222 C CB  . ASP D 2 30  ? -16.190 40.607 112.008 1.00 64.00  ? 11   ASP D CB  1 
ATOM   8223 C CG  . ASP D 2 30  ? -17.229 41.609 112.509 1.00 72.40  ? 11   ASP D CG  1 
ATOM   8224 O OD1 . ASP D 2 30  ? -17.166 42.812 112.158 1.00 74.36  ? 11   ASP D OD1 1 
ATOM   8225 O OD2 . ASP D 2 30  ? -18.122 41.172 113.274 1.00 63.10  ? 11   ASP D OD2 1 
ATOM   8226 N N   . GLY D 2 31  ? -13.197 40.196 111.164 1.00 55.36  ? 12   GLY D N   1 
ATOM   8227 C CA  . GLY D 2 31  ? -12.109 39.215 111.077 1.00 62.12  ? 12   GLY D CA  1 
ATOM   8228 C C   . GLY D 2 31  ? -12.546 37.771 111.303 1.00 73.60  ? 12   GLY D C   1 
ATOM   8229 O O   . GLY D 2 31  ? -12.020 36.861 110.671 1.00 90.20  ? 12   GLY D O   1 
ATOM   8230 N N   . ALA D 2 32  ? -13.526 37.561 112.180 1.00 69.46  ? 13   ALA D N   1 
ATOM   8231 C CA  . ALA D 2 32  ? -13.978 36.212 112.560 1.00 74.51  ? 13   ALA D CA  1 
ATOM   8232 C C   . ALA D 2 32  ? -14.824 35.525 111.486 1.00 72.62  ? 13   ALA D C   1 
ATOM   8233 O O   . ALA D 2 32  ? -15.022 34.307 111.521 1.00 58.80  ? 13   ALA D O   1 
ATOM   8234 C CB  . ALA D 2 32  ? -14.777 36.287 113.882 1.00 82.70  ? 13   ALA D CB  1 
ATOM   8235 N N   . VAL D 2 33  ? -15.327 36.325 110.555 1.00 56.92  ? 14   VAL D N   1 
ATOM   8236 C CA  . VAL D 2 33  ? -16.170 35.845 109.470 1.00 50.26  ? 14   VAL D CA  1 
ATOM   8237 C C   . VAL D 2 33  ? -15.469 34.865 108.540 1.00 67.69  ? 14   VAL D C   1 
ATOM   8238 O O   . VAL D 2 33  ? -16.117 34.041 107.902 1.00 45.62  ? 14   VAL D O   1 
ATOM   8239 C CB  . VAL D 2 33  ? -16.703 37.020 108.641 1.00 65.33  ? 14   VAL D CB  1 
ATOM   8240 C CG1 . VAL D 2 33  ? -17.406 36.518 107.404 1.00 80.94  ? 14   VAL D CG1 1 
ATOM   8241 C CG2 . VAL D 2 33  ? -17.625 37.877 109.480 1.00 55.25  ? 14   VAL D CG2 1 
ATOM   8242 N N   . GLY D 2 34  ? -14.148 34.960 108.462 1.00 62.37  ? 15   GLY D N   1 
ATOM   8243 C CA  . GLY D 2 34  ? -13.373 34.082 107.606 1.00 63.33  ? 15   GLY D CA  1 
ATOM   8244 C C   . GLY D 2 34  ? -13.636 34.343 106.138 1.00 69.09  ? 15   GLY D C   1 
ATOM   8245 O O   . GLY D 2 34  ? -13.753 33.417 105.342 1.00 57.99  ? 15   GLY D O   1 
ATOM   8246 N N   . LYS D 2 35  ? -13.729 35.617 105.783 1.00 52.07  ? 16   LYS D N   1 
ATOM   8247 C CA  . LYS D 2 35  ? -13.984 36.015 104.409 1.00 49.17  ? 16   LYS D CA  1 
ATOM   8248 C C   . LYS D 2 35  ? -12.799 35.736 103.496 1.00 53.15  ? 16   LYS D C   1 
ATOM   8249 O O   . LYS D 2 35  ? -12.970 35.529 102.302 1.00 61.01  ? 16   LYS D O   1 
ATOM   8250 C CB  . LYS D 2 35  ? -14.349 37.495 104.352 1.00 34.57  ? 16   LYS D CB  1 
ATOM   8251 C CG  . LYS D 2 35  ? -13.451 38.367 105.195 1.00 68.98  ? 16   LYS D CG  1 
ATOM   8252 C CD  . LYS D 2 35  ? -13.590 39.827 104.839 1.00 47.28  ? 16   LYS D CD  1 
ATOM   8253 C CE  . LYS D 2 35  ? -12.432 40.614 105.405 1.00 67.93  ? 16   LYS D CE  1 
ATOM   8254 N NZ  . LYS D 2 35  ? -12.538 42.059 105.109 1.00 71.78  ? 16   LYS D NZ  1 
ATOM   8255 N N   . THR D 2 36  ? -11.599 35.732 104.059 1.00 45.40  ? 17   THR D N   1 
ATOM   8256 C CA  . THR D 2 36  ? -10.397 35.477 103.276 1.00 47.72  ? 17   THR D CA  1 
ATOM   8257 C C   . THR D 2 36  ? -10.420 34.077 102.688 1.00 44.48  ? 17   THR D C   1 
ATOM   8258 O O   . THR D 2 36  ? -10.019 33.867 101.550 1.00 55.09  ? 17   THR D O   1 
ATOM   8259 C CB  . THR D 2 36  ? -9.129  35.666 104.112 1.00 51.00  ? 17   THR D CB  1 
ATOM   8260 O OG1 . THR D 2 36  ? -8.996  37.045 104.469 1.00 53.25  ? 17   THR D OG1 1 
ATOM   8261 C CG2 . THR D 2 36  ? -7.914  35.246 103.323 1.00 44.63  ? 17   THR D CG2 1 
ATOM   8262 N N   . CYS D 2 37  ? -10.892 33.119 103.472 1.00 50.11  ? 18   CYS D N   1 
ATOM   8263 C CA  . CYS D 2 37  ? -10.979 31.726 103.016 1.00 62.10  ? 18   CYS D CA  1 
ATOM   8264 C C   . CYS D 2 37  ? -11.871 31.595 101.822 1.00 53.56  ? 18   CYS D C   1 
ATOM   8265 O O   . CYS D 2 37  ? -11.586 30.760 100.963 1.00 59.74  ? 18   CYS D O   1 
ATOM   8266 C CB  . CYS D 2 37  ? -11.392 30.762 104.126 1.00 46.60  ? 18   CYS D CB  1 
ATOM   8267 S SG  . CYS D 2 37  ? -10.522 31.247 105.681 1.00 96.31  ? 18   CYS D SG  1 
ATOM   8268 N N   . LEU D 2 38  ? -12.909 32.426 101.743 1.00 42.02  ? 19   LEU D N   1 
ATOM   8269 C CA  . LEU D 2 38  ? -13.771 32.420 100.572 1.00 44.90  ? 19   LEU D CA  1 
ATOM   8270 C C   . LEU D 2 38  ? -12.982 32.815 99.325  1.00 56.54  ? 19   LEU D C   1 
ATOM   8271 O O   . LEU D 2 38  ? -13.006 32.108 98.320  1.00 60.99  ? 19   LEU D O   1 
ATOM   8272 C CB  . LEU D 2 38  ? -14.938 33.383 100.736 1.00 46.49  ? 19   LEU D CB  1 
ATOM   8273 C CG  . LEU D 2 38  ? -15.973 33.182 101.815 1.00 56.52  ? 19   LEU D CG  1 
ATOM   8274 C CD1 . LEU D 2 38  ? -17.187 33.945 101.377 1.00 37.00  ? 19   LEU D CD1 1 
ATOM   8275 C CD2 . LEU D 2 38  ? -16.289 31.693 101.966 1.00 71.77  ? 19   LEU D CD2 1 
ATOM   8276 N N   . LEU D 2 39  ? -12.268 33.934 99.394  1.00 54.84  ? 20   LEU D N   1 
ATOM   8277 C CA  . LEU D 2 39  ? -11.585 34.463 98.229  1.00 41.15  ? 20   LEU D CA  1 
ATOM   8278 C C   . LEU D 2 39  ? -10.515 33.505 97.720  1.00 58.79  ? 20   LEU D C   1 
ATOM   8279 O O   . LEU D 2 39  ? -10.390 33.311 96.518  1.00 41.17  ? 20   LEU D O   1 
ATOM   8280 C CB  . LEU D 2 39  ? -10.988 35.817 98.540  1.00 37.64  ? 20   LEU D CB  1 
ATOM   8281 C CG  . LEU D 2 39  ? -11.862 36.791 99.337  1.00 37.73  ? 20   LEU D CG  1 
ATOM   8282 C CD1 . LEU D 2 39  ? -11.092 38.073 99.625  1.00 42.92  ? 20   LEU D CD1 1 
ATOM   8283 C CD2 . LEU D 2 39  ? -13.141 37.118 98.645  1.00 34.56  ? 20   LEU D CD2 1 
ATOM   8284 N N   . ILE D 2 40  ? -9.756  32.877 98.623  1.00 53.22  ? 21   ILE D N   1 
ATOM   8285 C CA  . ILE D 2 40  ? -8.654  32.020 98.176  1.00 52.47  ? 21   ILE D CA  1 
ATOM   8286 C C   . ILE D 2 40  ? -9.211  30.796 97.545  1.00 47.48  ? 21   ILE D C   1 
ATOM   8287 O O   . ILE D 2 40  ? -8.707  30.345 96.538  1.00 58.68  ? 21   ILE D O   1 
ATOM   8288 C CB  . ILE D 2 40  ? -7.735  31.547 99.290  1.00 58.77  ? 21   ILE D CB  1 
ATOM   8289 C CG1 . ILE D 2 40  ? -7.449  32.687 100.256 1.00 58.23  ? 21   ILE D CG1 1 
ATOM   8290 C CG2 . ILE D 2 40  ? -6.444  31.033 98.685  1.00 62.84  ? 21   ILE D CG2 1 
ATOM   8291 C CD1 . ILE D 2 40  ? -6.269  32.456 101.123 1.00 52.49  ? 21   ILE D CD1 1 
ATOM   8292 N N   . SER D 2 41  ? -10.249 30.225 98.133  1.00 47.65  ? 22   SER D N   1 
ATOM   8293 C CA  . SER D 2 41  ? -10.789 28.993 97.589  1.00 65.13  ? 22   SER D CA  1 
ATOM   8294 C C   . SER D 2 41  ? -11.330 29.174 96.178  1.00 53.16  ? 22   SER D C   1 
ATOM   8295 O O   . SER D 2 41  ? -11.084 28.350 95.307  1.00 53.97  ? 22   SER D O   1 
ATOM   8296 C CB  . SER D 2 41  ? -11.897 28.467 98.498  1.00 51.10  ? 22   SER D CB  1 
ATOM   8297 O OG  . SER D 2 41  ? -11.522 28.579 99.857  1.00 71.45  ? 22   SER D OG  1 
ATOM   8298 N N   . TYR D 2 42  ? -12.079 30.248 95.960  1.00 43.30  ? 23   TYR D N   1 
ATOM   8299 C CA  . TYR D 2 42  ? -12.633 30.526 94.642  1.00 43.38  ? 23   TYR D CA  1 
ATOM   8300 C C   . TYR D 2 42  ? -11.604 30.879 93.573  1.00 48.92  ? 23   TYR D C   1 
ATOM   8301 O O   . TYR D 2 42  ? -11.657 30.375 92.457  1.00 50.60  ? 23   TYR D O   1 
ATOM   8302 C CB  . TYR D 2 42  ? -13.671 31.643 94.739  1.00 40.83  ? 23   TYR D CB  1 
ATOM   8303 C CG  . TYR D 2 42  ? -14.348 31.959 93.428  1.00 53.38  ? 23   TYR D CG  1 
ATOM   8304 C CD1 . TYR D 2 42  ? -15.367 31.157 92.944  1.00 54.71  ? 23   TYR D CD1 1 
ATOM   8305 C CD2 . TYR D 2 42  ? -13.969 33.058 92.675  1.00 57.53  ? 23   TYR D CD2 1 
ATOM   8306 C CE1 . TYR D 2 42  ? -15.985 31.439 91.750  1.00 66.78  ? 23   TYR D CE1 1 
ATOM   8307 C CE2 . TYR D 2 42  ? -14.584 33.347 91.480  1.00 48.32  ? 23   TYR D CE2 1 
ATOM   8308 C CZ  . TYR D 2 42  ? -15.591 32.534 91.023  1.00 52.02  ? 23   TYR D CZ  1 
ATOM   8309 O OH  . TYR D 2 42  ? -16.211 32.816 89.832  1.00 45.71  ? 23   TYR D OH  1 
ATOM   8310 N N   . THR D 2 43  ? -10.666 31.748 93.926  1.00 46.18  ? 24   THR D N   1 
ATOM   8311 C CA  . THR D 2 43  ? -9.669  32.226 92.974  1.00 57.51  ? 24   THR D CA  1 
ATOM   8312 C C   . THR D 2 43  ? -8.713  31.154 92.476  1.00 57.06  ? 24   THR D C   1 
ATOM   8313 O O   . THR D 2 43  ? -8.367  31.119 91.300  1.00 59.93  ? 24   THR D O   1 
ATOM   8314 C CB  . THR D 2 43  ? -8.872  33.407 93.533  1.00 49.12  ? 24   THR D CB  1 
ATOM   8315 O OG1 . THR D 2 43  ? -7.949  32.940 94.520  1.00 58.06  ? 24   THR D OG1 1 
ATOM   8316 C CG2 . THR D 2 43  ? -9.807  34.416 94.156  1.00 46.48  ? 24   THR D CG2 1 
ATOM   8317 N N   . THR D 2 44  ? -8.284  30.289 93.385  1.00 36.23  ? 25   THR D N   1 
ATOM   8318 C CA  . THR D 2 44  ? -7.349  29.223 93.061  1.00 45.37  ? 25   THR D CA  1 
ATOM   8319 C C   . THR D 2 44  ? -8.094  27.963 92.664  1.00 49.10  ? 25   THR D C   1 
ATOM   8320 O O   . THR D 2 44  ? -7.492  26.937 92.373  1.00 59.87  ? 25   THR D O   1 
ATOM   8321 C CB  . THR D 2 44  ? -6.432  28.915 94.248  1.00 53.53  ? 25   THR D CB  1 
ATOM   8322 O OG1 . THR D 2 44  ? -7.214  28.830 95.442  1.00 52.74  ? 25   THR D OG1 1 
ATOM   8323 C CG2 . THR D 2 44  ? -5.405  30.012 94.415  1.00 38.46  ? 25   THR D CG2 1 
ATOM   8324 N N   . ASN D 2 45  ? -9.415  28.051 92.669  1.00 54.81  ? 26   ASN D N   1 
ATOM   8325 C CA  . ASN D 2 45  ? -10.274 26.889 92.392  1.00 72.23  ? 26   ASN D CA  1 
ATOM   8326 C C   . ASN D 2 45  ? -9.795  25.641 93.172  1.00 65.84  ? 26   ASN D C   1 
ATOM   8327 O O   . ASN D 2 45  ? -9.454  24.599 92.604  1.00 71.02  ? 26   ASN D O   1 
ATOM   8328 C CB  . ASN D 2 45  ? -10.377 26.650 90.874  1.00 71.56  ? 26   ASN D CB  1 
ATOM   8329 C CG  . ASN D 2 45  ? -11.543 25.715 90.496  1.00 80.77  ? 26   ASN D CG  1 
ATOM   8330 O OD1 . ASN D 2 45  ? -12.586 25.670 91.179  1.00 83.88  ? 26   ASN D OD1 1 
ATOM   8331 N ND2 . ASN D 2 45  ? -11.380 24.983 89.394  1.00 93.57  ? 26   ASN D ND2 1 
ATOM   8332 N N   . ALA D 2 46  ? -9.752  25.774 94.490  1.00 57.97  ? 27   ALA D N   1 
ATOM   8333 C CA  . ALA D 2 46  ? -9.022  24.832 95.307  1.00 62.32  ? 27   ALA D CA  1 
ATOM   8334 C C   . ALA D 2 46  ? -9.950  23.699 95.591  1.00 57.53  ? 27   ALA D C   1 
ATOM   8335 O O   . ALA D 2 46  ? -11.153 23.841 95.393  1.00 50.12  ? 27   ALA D O   1 
ATOM   8336 C CB  . ALA D 2 46  ? -8.591  25.497 96.599  1.00 55.05  ? 27   ALA D CB  1 
ATOM   8337 N N   . PHE D 2 47  ? -9.421  22.600 96.110  1.00 48.17  ? 28   PHE D N   1 
ATOM   8338 C CA  . PHE D 2 47  ? -10.268 21.493 96.499  1.00 59.75  ? 28   PHE D CA  1 
ATOM   8339 C C   . PHE D 2 47  ? -10.966 22.064 97.720  1.00 61.18  ? 28   PHE D C   1 
ATOM   8340 O O   . PHE D 2 47  ? -10.434 22.967 98.358  1.00 55.99  ? 28   PHE D O   1 
ATOM   8341 C CB  . PHE D 2 47  ? -9.450  20.265 96.860  1.00 66.35  ? 28   PHE D CB  1 
ATOM   8342 C CG  . PHE D 2 47  ? -10.268 19.021 96.997  1.00 73.73  ? 28   PHE D CG  1 
ATOM   8343 C CD1 . PHE D 2 47  ? -10.801 18.406 95.883  1.00 51.94  ? 28   PHE D CD1 1 
ATOM   8344 C CD2 . PHE D 2 47  ? -10.514 18.473 98.239  1.00 71.00  ? 28   PHE D CD2 1 
ATOM   8345 C CE1 . PHE D 2 47  ? -11.552 17.268 96.004  1.00 49.90  ? 28   PHE D CE1 1 
ATOM   8346 C CE2 . PHE D 2 47  ? -11.268 17.333 98.363  1.00 77.21  ? 28   PHE D CE2 1 
ATOM   8347 C CZ  . PHE D 2 47  ? -11.786 16.729 97.244  1.00 59.86  ? 28   PHE D CZ  1 
ATOM   8348 N N   . PRO D 2 48  ? -12.143 21.562 98.065  1.00 56.28  ? 29   PRO D N   1 
ATOM   8349 C CA  . PRO D 2 48  ? -12.856 22.142 99.203  1.00 74.38  ? 29   PRO D CA  1 
ATOM   8350 C C   . PRO D 2 48  ? -12.098 22.041 100.516 1.00 76.10  ? 29   PRO D C   1 
ATOM   8351 O O   . PRO D 2 48  ? -12.013 23.022 101.246 1.00 81.82  ? 29   PRO D O   1 
ATOM   8352 C CB  . PRO D 2 48  ? -14.119 21.285 99.285  1.00 55.34  ? 29   PRO D CB  1 
ATOM   8353 C CG  . PRO D 2 48  ? -14.323 20.787 97.916  1.00 53.69  ? 29   PRO D CG  1 
ATOM   8354 C CD  . PRO D 2 48  ? -12.963 20.572 97.350  1.00 56.99  ? 29   PRO D CD  1 
ATOM   8355 N N   . GLY D 2 49  ? -11.546 20.877 100.810 1.00 54.27  ? 30   GLY D N   1 
ATOM   8356 C CA  . GLY D 2 49  ? -10.805 20.701 102.040 1.00 79.26  ? 30   GLY D CA  1 
ATOM   8357 C C   . GLY D 2 49  ? -9.504  21.463 102.194 1.00 80.45  ? 30   GLY D C   1 
ATOM   8358 O O   . GLY D 2 49  ? -9.204  21.995 103.258 1.00 69.27  ? 30   GLY D O   1 
ATOM   8359 N N   . GLU D 2 50  ? -8.720  21.506 101.124 1.00 90.44  ? 31   GLU D N   1 
ATOM   8360 C CA  . GLU D 2 50  ? -7.412  22.135 101.179 1.00 78.82  ? 31   GLU D CA  1 
ATOM   8361 C C   . GLU D 2 50  ? -7.111  23.262 100.200 1.00 68.65  ? 31   GLU D C   1 
ATOM   8362 O O   . GLU D 2 50  ? -7.270  23.115 98.995  1.00 90.19  ? 31   GLU D O   1 
ATOM   8363 C CB  . GLU D 2 50  ? -6.371  21.036 100.992 1.00 81.61  ? 31   GLU D CB  1 
ATOM   8364 C CG  . GLU D 2 50  ? -6.640  20.183 99.765  1.00 71.30  ? 31   GLU D CG  1 
ATOM   8365 C CD  . GLU D 2 50  ? -6.656  18.702 100.071 1.00 83.46  ? 31   GLU D CD  1 
ATOM   8366 O OE1 . GLU D 2 50  ? -6.918  18.341 101.233 1.00 88.00  ? 31   GLU D OE1 1 
ATOM   8367 O OE2 . GLU D 2 50  ? -6.420  17.898 99.149  1.00 83.55  ? 31   GLU D OE2 1 
ATOM   8368 N N   . TYR D 2 51  ? -6.646  24.380 100.743 1.00 60.00  ? 32   TYR D N   1 
ATOM   8369 C CA  . TYR D 2 51  ? -6.255  25.540 99.959  1.00 68.79  ? 32   TYR D CA  1 
ATOM   8370 C C   . TYR D 2 51  ? -4.990  26.073 100.615 1.00 81.19  ? 32   TYR D C   1 
ATOM   8371 O O   . TYR D 2 51  ? -4.791  25.863 101.809 1.00 61.45  ? 32   TYR D O   1 
ATOM   8372 C CB  . TYR D 2 51  ? -7.360  26.592 99.930  1.00 75.70  ? 32   TYR D CB  1 
ATOM   8373 C CG  . TYR D 2 51  ? -7.666  27.219 101.265 1.00 104.53 ? 32   TYR D CG  1 
ATOM   8374 C CD1 . TYR D 2 51  ? -6.720  27.984 101.926 1.00 112.16 ? 32   TYR D CD1 1 
ATOM   8375 C CD2 . TYR D 2 51  ? -8.904  27.052 101.860 1.00 110.97 ? 32   TYR D CD2 1 
ATOM   8376 C CE1 . TYR D 2 51  ? -6.998  28.563 103.143 1.00 115.19 ? 32   TYR D CE1 1 
ATOM   8377 C CE2 . TYR D 2 51  ? -9.191  27.626 103.076 1.00 120.87 ? 32   TYR D CE2 1 
ATOM   8378 C CZ  . TYR D 2 51  ? -8.235  28.381 103.714 1.00 119.69 ? 32   TYR D CZ  1 
ATOM   8379 O OH  . TYR D 2 51  ? -8.519  28.956 104.928 1.00 112.86 ? 32   TYR D OH  1 
ATOM   8380 N N   . ILE D 2 52  ? -4.124  26.746 99.861  1.00 62.78  ? 33   ILE D N   1 
ATOM   8381 C CA  . ILE D 2 52  ? -2.895  27.224 100.470 1.00 51.43  ? 33   ILE D CA  1 
ATOM   8382 C C   . ILE D 2 52  ? -2.908  28.726 100.645 1.00 62.04  ? 33   ILE D C   1 
ATOM   8383 O O   . ILE D 2 52  ? -3.115  29.471 99.692  1.00 65.47  ? 33   ILE D O   1 
ATOM   8384 C CB  . ILE D 2 52  ? -1.664  26.859 99.627  1.00 51.72  ? 33   ILE D CB  1 
ATOM   8385 C CG1 . ILE D 2 52  ? -1.495  25.345 99.536  1.00 65.44  ? 33   ILE D CG1 1 
ATOM   8386 C CG2 . ILE D 2 52  ? -0.422  27.486 100.213 1.00 44.39  ? 33   ILE D CG2 1 
ATOM   8387 C CD1 . ILE D 2 52  ? -2.362  24.700 98.494  1.00 71.71  ? 33   ILE D CD1 1 
ATOM   8388 N N   . PRO D 2 53  ? -2.677  29.167 101.874 1.00 66.17  ? 34   PRO D N   1 
ATOM   8389 C CA  . PRO D 2 53  ? -2.639  30.569 102.160 1.00 48.40  ? 34   PRO D CA  1 
ATOM   8390 C C   . PRO D 2 53  ? -1.394  31.163 101.627 1.00 53.68  ? 34   PRO D C   1 
ATOM   8391 O O   . PRO D 2 53  ? -0.386  30.505 101.444 1.00 53.29  ? 34   PRO D O   1 
ATOM   8392 C CB  . PRO D 2 53  ? -2.566  30.605 103.679 1.00 53.36  ? 34   PRO D CB  1 
ATOM   8393 C CG  . PRO D 2 53  ? -3.228  29.373 104.094 1.00 74.78  ? 34   PRO D CG  1 
ATOM   8394 C CD  . PRO D 2 53  ? -2.753  28.370 103.107 1.00 64.74  ? 34   PRO D CD  1 
ATOM   8395 N N   . THR D 2 54  ? -1.465  32.443 101.410 1.00 54.57  ? 35   THR D N   1 
ATOM   8396 C CA  . THR D 2 54  ? -0.354  33.167 100.902 1.00 59.60  ? 35   THR D CA  1 
ATOM   8397 C C   . THR D 2 54  ? -0.099  34.207 101.974 1.00 65.02  ? 35   THR D C   1 
ATOM   8398 O O   . THR D 2 54  ? -0.912  34.395 102.868 1.00 62.71  ? 35   THR D O   1 
ATOM   8399 C CB  . THR D 2 54  ? -0.750  33.834 99.577  1.00 64.22  ? 35   THR D CB  1 
ATOM   8400 O OG1 . THR D 2 54  ? 0.314   34.681 99.133  1.00 51.08  ? 35   THR D OG1 1 
ATOM   8401 C CG2 . THR D 2 54  ? -2.087  34.658 99.744  1.00 61.57  ? 35   THR D CG2 1 
ATOM   8402 N N   . VAL D 2 55  ? 1.005   34.930 101.848 1.00 70.96  ? 36   VAL D N   1 
ATOM   8403 C CA  . VAL D 2 55  ? 1.334   35.985 102.794 1.00 54.79  ? 36   VAL D CA  1 
ATOM   8404 C C   . VAL D 2 55  ? 0.830   37.338 102.283 1.00 55.72  ? 36   VAL D C   1 
ATOM   8405 O O   . VAL D 2 55  ? 1.042   38.361 102.921 1.00 53.66  ? 36   VAL D O   1 
ATOM   8406 C CB  . VAL D 2 55  ? 2.846   36.080 103.038 1.00 58.79  ? 36   VAL D CB  1 
ATOM   8407 C CG1 . VAL D 2 55  ? 3.194   37.407 103.673 1.00 66.67  ? 36   VAL D CG1 1 
ATOM   8408 C CG2 . VAL D 2 55  ? 3.316   34.934 103.907 1.00 61.97  ? 36   VAL D CG2 1 
ATOM   8409 N N   . PHE D 2 56  ? 0.167   37.335 101.128 1.00 57.23  ? 37   PHE D N   1 
ATOM   8410 C CA  . PHE D 2 56  ? -0.351  38.567 100.519 1.00 46.53  ? 37   PHE D CA  1 
ATOM   8411 C C   . PHE D 2 56  ? -1.879  38.661 100.404 1.00 50.08  ? 37   PHE D C   1 
ATOM   8412 O O   . PHE D 2 56  ? -2.564  37.680 100.143 1.00 62.56  ? 37   PHE D O   1 
ATOM   8413 C CB  . PHE D 2 56  ? 0.364   38.843 99.200  1.00 75.91  ? 37   PHE D CB  1 
ATOM   8414 C CG  . PHE D 2 56  ? 1.857   38.862 99.335  1.00 65.37  ? 37   PHE D CG  1 
ATOM   8415 C CD1 . PHE D 2 56  ? 2.476   39.812 100.124 1.00 59.79  ? 37   PHE D CD1 1 
ATOM   8416 C CD2 . PHE D 2 56  ? 2.639   37.918 98.701  1.00 61.54  ? 37   PHE D CD2 1 
ATOM   8417 C CE1 . PHE D 2 56  ? 3.843   39.827 100.267 1.00 43.79  ? 37   PHE D CE1 1 
ATOM   8418 C CE2 . PHE D 2 56  ? 4.010   37.932 98.841  1.00 63.28  ? 37   PHE D CE2 1 
ATOM   8419 C CZ  . PHE D 2 56  ? 4.610   38.888 99.626  1.00 61.59  ? 37   PHE D CZ  1 
ATOM   8420 N N   . ASP D 2 57  ? -2.378  39.875 100.609 1.00 57.77  ? 38   ASP D N   1 
ATOM   8421 C CA  . ASP D 2 57  ? -3.806  40.228 100.612 1.00 81.60  ? 38   ASP D CA  1 
ATOM   8422 C C   . ASP D 2 57  ? -4.808  40.138 99.445  1.00 107.04 ? 38   ASP D C   1 
ATOM   8423 O O   . ASP D 2 57  ? -5.956  39.775 99.680  1.00 153.58 ? 38   ASP D O   1 
ATOM   8424 C CB  . ASP D 2 57  ? -3.970  41.599 101.269 1.00 58.48  ? 38   ASP D CB  1 
ATOM   8425 C CG  . ASP D 2 57  ? -3.926  41.524 102.769 1.00 76.38  ? 38   ASP D CG  1 
ATOM   8426 O OD1 . ASP D 2 57  ? -3.767  40.407 103.295 1.00 54.93  ? 38   ASP D OD1 1 
ATOM   8427 O OD2 . ASP D 2 57  ? -4.055  42.574 103.424 1.00 76.75  ? 38   ASP D OD2 1 
ATOM   8428 N N   . ASN D 2 58  ? -4.439  40.472 98.218  1.00 48.27  ? 39   ASN D N   1 
ATOM   8429 C CA  . ASN D 2 58  ? -5.442  40.415 97.145  1.00 63.24  ? 39   ASN D CA  1 
ATOM   8430 C C   . ASN D 2 58  ? -5.489  39.238 96.160  1.00 51.90  ? 39   ASN D C   1 
ATOM   8431 O O   . ASN D 2 58  ? -4.464  38.697 95.761  1.00 64.93  ? 39   ASN D O   1 
ATOM   8432 C CB  . ASN D 2 58  ? -5.502  41.759 96.423  1.00 79.69  ? 39   ASN D CB  1 
ATOM   8433 C CG  . ASN D 2 58  ? -5.828  42.897 97.363  1.00 60.44  ? 39   ASN D CG  1 
ATOM   8434 O OD1 . ASN D 2 58  ? -6.552  42.718 98.336  1.00 54.60  ? 39   ASN D OD1 1 
ATOM   8435 N ND2 . ASN D 2 58  ? -5.285  44.071 97.084  1.00 68.81  ? 39   ASN D ND2 1 
ATOM   8436 N N   . TYR D 2 59  ? -6.713  38.862 95.787  1.00 40.18  ? 40   TYR D N   1 
ATOM   8437 C CA  . TYR D 2 59  ? -6.979  37.754 94.867  1.00 50.95  ? 40   TYR D CA  1 
ATOM   8438 C C   . TYR D 2 59  ? -7.744  38.178 93.609  1.00 54.95  ? 40   TYR D C   1 
ATOM   8439 O O   . TYR D 2 59  ? -8.632  39.018 93.667  1.00 62.31  ? 40   TYR D O   1 
ATOM   8440 C CB  . TYR D 2 59  ? -7.708  36.645 95.617  1.00 29.83  ? 40   TYR D CB  1 
ATOM   8441 C CG  . TYR D 2 59  ? -7.102  36.431 96.977  1.00 59.42  ? 40   TYR D CG  1 
ATOM   8442 C CD1 . TYR D 2 59  ? -6.039  35.564 97.153  1.00 52.41  ? 40   TYR D CD1 1 
ATOM   8443 C CD2 . TYR D 2 59  ? -7.560  37.136 98.077  1.00 52.52  ? 40   TYR D CD2 1 
ATOM   8444 C CE1 . TYR D 2 59  ? -5.468  35.386 98.391  1.00 63.03  ? 40   TYR D CE1 1 
ATOM   8445 C CE2 . TYR D 2 59  ? -6.994  36.963 99.317  1.00 51.90  ? 40   TYR D CE2 1 
ATOM   8446 C CZ  . TYR D 2 59  ? -5.949  36.088 99.468  1.00 55.80  ? 40   TYR D CZ  1 
ATOM   8447 O OH  . TYR D 2 59  ? -5.382  35.913 100.702 1.00 59.87  ? 40   TYR D OH  1 
ATOM   8448 N N   . SER D 2 60  ? -7.376  37.589 92.476  1.00 51.31  ? 41   SER D N   1 
ATOM   8449 C CA  . SER D 2 60  ? -7.972  37.891 91.181  1.00 49.86  ? 41   SER D CA  1 
ATOM   8450 C C   . SER D 2 60  ? -8.317  36.615 90.441  1.00 47.37  ? 41   SER D C   1 
ATOM   8451 O O   . SER D 2 60  ? -7.608  35.631 90.545  1.00 51.58  ? 41   SER D O   1 
ATOM   8452 C CB  . SER D 2 60  ? -6.991  38.736 90.375  1.00 44.61  ? 41   SER D CB  1 
ATOM   8453 O OG  . SER D 2 60  ? -5.805  37.988 90.149  1.00 70.94  ? 41   SER D OG  1 
ATOM   8454 N N   . ALA D 2 61  ? -9.416  36.629 89.700  1.00 40.27  ? 42   ALA D N   1 
ATOM   8455 C CA  . ALA D 2 61  ? -9.789  35.491 88.840  1.00 41.79  ? 42   ALA D CA  1 
ATOM   8456 C C   . ALA D 2 61  ? -10.280 35.949 87.453  1.00 60.26  ? 42   ALA D C   1 
ATOM   8457 O O   . ALA D 2 61  ? -10.967 36.980 87.321  1.00 54.70  ? 42   ALA D O   1 
ATOM   8458 C CB  . ALA D 2 61  ? -10.827 34.689 89.498  1.00 29.22  ? 42   ALA D CB  1 
ATOM   8459 N N   . ASN D 2 62  ? -9.928  35.206 86.405  1.00 58.12  ? 43   ASN D N   1 
ATOM   8460 C CA  . ASN D 2 62  ? -10.532 35.460 85.103  1.00 44.62  ? 43   ASN D CA  1 
ATOM   8461 C C   . ASN D 2 62  ? -11.683 34.508 84.892  1.00 56.17  ? 43   ASN D C   1 
ATOM   8462 O O   . ASN D 2 62  ? -11.488 33.314 84.751  1.00 43.76  ? 43   ASN D O   1 
ATOM   8463 C CB  . ASN D 2 62  ? -9.542  35.244 84.005  1.00 45.81  ? 43   ASN D CB  1 
ATOM   8464 C CG  . ASN D 2 62  ? -8.448  36.231 84.022  1.00 54.37  ? 43   ASN D CG  1 
ATOM   8465 O OD1 . ASN D 2 62  ? -8.655  37.444 84.043  1.00 56.65  ? 43   ASN D OD1 1 
ATOM   8466 N ND2 . ASN D 2 62  ? -7.249  35.724 83.987  1.00 47.35  ? 43   ASN D ND2 1 
ATOM   8467 N N   . VAL D 2 63  ? -12.899 35.027 84.883  1.00 55.40  ? 44   VAL D N   1 
ATOM   8468 C CA  . VAL D 2 63  ? -14.042 34.133 84.867  1.00 50.58  ? 44   VAL D CA  1 
ATOM   8469 C C   . VAL D 2 63  ? -15.068 34.564 83.840  1.00 51.48  ? 44   VAL D C   1 
ATOM   8470 O O   . VAL D 2 63  ? -15.136 35.731 83.474  1.00 52.96  ? 44   VAL D O   1 
ATOM   8471 C CB  . VAL D 2 63  ? -14.712 34.038 86.270  1.00 54.86  ? 44   VAL D CB  1 
ATOM   8472 C CG1 . VAL D 2 63  ? -13.813 33.267 87.263  1.00 43.29  ? 44   VAL D CG1 1 
ATOM   8473 C CG2 . VAL D 2 63  ? -15.059 35.422 86.785  1.00 33.26  ? 44   VAL D CG2 1 
ATOM   8474 N N   . MET D 2 64  ? -15.902 33.627 83.406  1.00 44.84  ? 45   MET D N   1 
ATOM   8475 C CA  . MET D 2 64  ? -16.958 33.945 82.461  1.00 47.56  ? 45   MET D CA  1 
ATOM   8476 C C   . MET D 2 64  ? -18.330 33.707 83.077  1.00 52.58  ? 45   MET D C   1 
ATOM   8477 O O   . MET D 2 64  ? -18.626 32.612 83.543  1.00 58.94  ? 45   MET D O   1 
ATOM   8478 C CB  . MET D 2 64  ? -16.823 33.105 81.195  1.00 56.52  ? 45   MET D CB  1 
ATOM   8479 C CG  . MET D 2 64  ? -18.104 33.034 80.390  1.00 59.44  ? 45   MET D CG  1 
ATOM   8480 S SD  . MET D 2 64  ? -17.877 32.379 78.737  1.00 63.94  ? 45   MET D SD  1 
ATOM   8481 C CE  . MET D 2 64  ? -16.649 33.507 78.103  1.00 61.76  ? 45   MET D CE  1 
ATOM   8482 N N   . VAL D 2 65  ? -19.166 34.739 83.070  1.00 74.77  ? 46   VAL D N   1 
ATOM   8483 C CA  . VAL D 2 65  ? -20.521 34.637 83.603  1.00 77.24  ? 46   VAL D CA  1 
ATOM   8484 C C   . VAL D 2 65  ? -21.517 35.089 82.543  1.00 72.99  ? 46   VAL D C   1 
ATOM   8485 O O   . VAL D 2 65  ? -21.377 36.170 81.977  1.00 50.72  ? 46   VAL D O   1 
ATOM   8486 C CB  . VAL D 2 65  ? -20.703 35.488 84.867  1.00 54.40  ? 46   VAL D CB  1 
ATOM   8487 C CG1 . VAL D 2 65  ? -20.653 36.957 84.520  1.00 72.09  ? 46   VAL D CG1 1 
ATOM   8488 C CG2 . VAL D 2 65  ? -22.017 35.157 85.535  1.00 71.71  ? 46   VAL D CG2 1 
ATOM   8489 N N   . ASP D 2 66  ? -22.524 34.268 82.276  1.00 73.40  ? 47   ASP D N   1 
ATOM   8490 C CA  . ASP D 2 66  ? -23.517 34.617 81.273  1.00 76.67  ? 47   ASP D CA  1 
ATOM   8491 C C   . ASP D 2 66  ? -22.831 34.888 79.946  1.00 82.18  ? 47   ASP D C   1 
ATOM   8492 O O   . ASP D 2 66  ? -23.188 35.817 79.230  1.00 74.27  ? 47   ASP D O   1 
ATOM   8493 C CB  . ASP D 2 66  ? -24.309 35.843 81.707  1.00 80.39  ? 47   ASP D CB  1 
ATOM   8494 C CG  . ASP D 2 66  ? -25.216 35.559 82.877  1.00 89.81  ? 47   ASP D CG  1 
ATOM   8495 O OD1 . ASP D 2 66  ? -25.482 34.371 83.148  1.00 72.05  ? 47   ASP D OD1 1 
ATOM   8496 O OD2 . ASP D 2 66  ? -25.664 36.525 83.524  1.00 86.99  ? 47   ASP D OD2 1 
ATOM   8497 N N   . GLY D 2 67  ? -21.836 34.070 79.631  1.00 77.60  ? 48   GLY D N   1 
ATOM   8498 C CA  . GLY D 2 67  ? -21.081 34.209 78.394  1.00 72.52  ? 48   GLY D CA  1 
ATOM   8499 C C   . GLY D 2 67  ? -20.218 35.451 78.296  1.00 67.48  ? 48   GLY D C   1 
ATOM   8500 O O   . GLY D 2 67  ? -19.658 35.732 77.248  1.00 61.26  ? 48   GLY D O   1 
ATOM   8501 N N   . LYS D 2 68  ? -20.107 36.212 79.373  1.00 69.45  ? 49   LYS D N   1 
ATOM   8502 C CA  . LYS D 2 68  ? -19.237 37.379 79.365  1.00 60.26  ? 49   LYS D CA  1 
ATOM   8503 C C   . LYS D 2 68  ? -17.990 37.142 80.207  1.00 66.12  ? 49   LYS D C   1 
ATOM   8504 O O   . LYS D 2 68  ? -18.081 36.763 81.366  1.00 81.70  ? 49   LYS D O   1 
ATOM   8505 C CB  . LYS D 2 68  ? -20.017 38.603 79.822  1.00 70.54  ? 49   LYS D CB  1 
ATOM   8506 C CG  . LYS D 2 68  ? -21.105 39.001 78.791  1.00 120.15 ? 49   LYS D CG  1 
ATOM   8507 C CD  . LYS D 2 68  ? -22.420 39.515 79.435  1.00 118.42 ? 49   LYS D CD  1 
ATOM   8508 C CE  . LYS D 2 68  ? -23.615 39.432 78.480  1.00 101.03 ? 49   LYS D CE  1 
ATOM   8509 N NZ  . LYS D 2 68  ? -24.845 39.175 79.262  1.00 85.42  ? 49   LYS D NZ  1 
ATOM   8510 N N   . PRO D 2 69  ? -16.823 37.351 79.612  1.00 57.32  ? 50   PRO D N   1 
ATOM   8511 C CA  . PRO D 2 69  ? -15.557 37.148 80.318  1.00 60.97  ? 50   PRO D CA  1 
ATOM   8512 C C   . PRO D 2 69  ? -15.081 38.421 80.996  1.00 55.24  ? 50   PRO D C   1 
ATOM   8513 O O   . PRO D 2 69  ? -15.120 39.486 80.390  1.00 65.97  ? 50   PRO D O   1 
ATOM   8514 C CB  . PRO D 2 69  ? -14.591 36.756 79.198  1.00 56.75  ? 50   PRO D CB  1 
ATOM   8515 C CG  . PRO D 2 69  ? -15.239 37.209 77.945  1.00 50.71  ? 50   PRO D CG  1 
ATOM   8516 C CD  . PRO D 2 69  ? -16.699 37.072 78.176  1.00 67.71  ? 50   PRO D CD  1 
ATOM   8517 N N   . VAL D 2 70  ? -14.636 38.307 82.240  1.00 58.25  ? 51   VAL D N   1 
ATOM   8518 C CA  . VAL D 2 70  ? -14.164 39.469 82.975  1.00 60.04  ? 51   VAL D CA  1 
ATOM   8519 C C   . VAL D 2 70  ? -13.002 39.165 83.907  1.00 58.58  ? 51   VAL D C   1 
ATOM   8520 O O   . VAL D 2 70  ? -12.732 38.015 84.235  1.00 56.13  ? 51   VAL D O   1 
ATOM   8521 C CB  . VAL D 2 70  ? -15.291 40.087 83.809  1.00 51.74  ? 51   VAL D CB  1 
ATOM   8522 C CG1 . VAL D 2 70  ? -16.228 40.871 82.925  1.00 85.98  ? 51   VAL D CG1 1 
ATOM   8523 C CG2 . VAL D 2 70  ? -16.038 39.012 84.563  1.00 36.87  ? 51   VAL D CG2 1 
ATOM   8524 N N   . ASN D 2 71  ? -12.323 40.224 84.329  1.00 62.93  ? 52   ASN D N   1 
ATOM   8525 C CA  . ASN D 2 71  ? -11.195 40.120 85.234  1.00 44.12  ? 52   ASN D CA  1 
ATOM   8526 C C   . ASN D 2 71  ? -11.656 40.591 86.597  1.00 60.00  ? 52   ASN D C   1 
ATOM   8527 O O   . ASN D 2 71  ? -11.695 41.785 86.867  1.00 58.01  ? 52   ASN D O   1 
ATOM   8528 C CB  . ASN D 2 71  ? -10.039 40.983 84.746  1.00 52.68  ? 52   ASN D CB  1 
ATOM   8529 C CG  . ASN D 2 71  ? -8.886  41.008 85.717  1.00 63.67  ? 52   ASN D CG  1 
ATOM   8530 O OD1 . ASN D 2 71  ? -8.886  40.289 86.710  1.00 65.02  ? 52   ASN D OD1 1 
ATOM   8531 N ND2 . ASN D 2 71  ? -7.893  41.837 85.436  1.00 56.15  ? 52   ASN D ND2 1 
ATOM   8532 N N   . LEU D 2 72  ? -12.014 39.642 87.451  1.00 56.97  ? 53   LEU D N   1 
ATOM   8533 C CA  . LEU D 2 72  ? -12.501 39.948 88.800  1.00 52.09  ? 53   LEU D CA  1 
ATOM   8534 C C   . LEU D 2 72  ? -11.395 40.118 89.822  1.00 48.79  ? 53   LEU D C   1 
ATOM   8535 O O   . LEU D 2 72  ? -10.657 39.182 90.126  1.00 45.58  ? 53   LEU D O   1 
ATOM   8536 C CB  . LEU D 2 72  ? -13.433 38.836 89.270  1.00 51.75  ? 53   LEU D CB  1 
ATOM   8537 C CG  . LEU D 2 72  ? -14.078 38.924 90.657  1.00 42.78  ? 53   LEU D CG  1 
ATOM   8538 C CD1 . LEU D 2 72  ? -15.195 39.945 90.781  1.00 34.35  ? 53   LEU D CD1 1 
ATOM   8539 C CD2 . LEU D 2 72  ? -14.671 37.594 90.917  1.00 50.82  ? 53   LEU D CD2 1 
ATOM   8540 N N   . GLY D 2 73  ? -11.324 41.320 90.371  1.00 47.52  ? 54   GLY D N   1 
ATOM   8541 C CA  . GLY D 2 73  ? -10.404 41.660 91.451  1.00 55.86  ? 54   GLY D CA  1 
ATOM   8542 C C   . GLY D 2 73  ? -11.123 41.633 92.785  1.00 66.75  ? 54   GLY D C   1 
ATOM   8543 O O   . GLY D 2 73  ? -12.107 42.372 92.981  1.00 50.32  ? 54   GLY D O   1 
ATOM   8544 N N   . LEU D 2 74  ? -10.642 40.761 93.685  1.00 50.52  ? 55   LEU D N   1 
ATOM   8545 C CA  . LEU D 2 74  ? -11.179 40.616 95.056  1.00 46.31  ? 55   LEU D CA  1 
ATOM   8546 C C   . LEU D 2 74  ? -10.316 41.289 96.154  1.00 56.08  ? 55   LEU D C   1 
ATOM   8547 O O   . LEU D 2 74  ? -9.226  40.817 96.514  1.00 40.91  ? 55   LEU D O   1 
ATOM   8548 C CB  . LEU D 2 74  ? -11.417 39.151 95.378  1.00 35.95  ? 55   LEU D CB  1 
ATOM   8549 C CG  . LEU D 2 74  ? -12.410 38.556 94.389  1.00 46.40  ? 55   LEU D CG  1 
ATOM   8550 C CD1 . LEU D 2 74  ? -12.552 37.064 94.552  1.00 34.02  ? 55   LEU D CD1 1 
ATOM   8551 C CD2 . LEU D 2 74  ? -13.771 39.207 94.562  1.00 44.48  ? 55   LEU D CD2 1 
ATOM   8552 N N   . TRP D 2 75  ? -10.828 42.400 96.675  1.00 44.96  ? 56   TRP D N   1 
ATOM   8553 C CA  . TRP D 2 75  ? -10.136 43.130 97.700  1.00 44.01  ? 56   TRP D CA  1 
ATOM   8554 C C   . TRP D 2 75  ? -10.536 42.645 99.063  1.00 49.65  ? 56   TRP D C   1 
ATOM   8555 O O   . TRP D 2 75  ? -11.713 42.755 99.473  1.00 51.93  ? 56   TRP D O   1 
ATOM   8556 C CB  . TRP D 2 75  ? -10.472 44.590 97.598  1.00 46.75  ? 56   TRP D CB  1 
ATOM   8557 C CG  . TRP D 2 75  ? -9.987  45.214 96.351  1.00 71.14  ? 56   TRP D CG  1 
ATOM   8558 C CD1 . TRP D 2 75  ? -10.369 44.907 95.054  1.00 77.60  ? 56   TRP D CD1 1 
ATOM   8559 C CD2 . TRP D 2 75  ? -9.069  46.297 96.254  1.00 52.22  ? 56   TRP D CD2 1 
ATOM   8560 N NE1 . TRP D 2 75  ? -9.724  45.742 94.170  1.00 66.21  ? 56   TRP D NE1 1 
ATOM   8561 C CE2 . TRP D 2 75  ? -8.924  46.603 94.880  1.00 63.57  ? 56   TRP D CE2 1 
ATOM   8562 C CE3 . TRP D 2 75  ? -8.359  47.045 97.193  1.00 47.59  ? 56   TRP D CE3 1 
ATOM   8563 C CZ2 . TRP D 2 75  ? -8.075  47.618 94.428  1.00 62.51  ? 56   TRP D CZ2 1 
ATOM   8564 C CZ3 . TRP D 2 75  ? -7.525  48.052 96.744  1.00 48.56  ? 56   TRP D CZ3 1 
ATOM   8565 C CH2 . TRP D 2 75  ? -7.390  48.329 95.373  1.00 62.79  ? 56   TRP D CH2 1 
ATOM   8566 N N   . ASP D 2 76  ? -9.535  42.130 99.765  1.00 57.98  ? 57   ASP D N   1 
ATOM   8567 C CA  . ASP D 2 76  ? -9.662  41.632 101.116 1.00 53.76  ? 57   ASP D CA  1 
ATOM   8568 C C   . ASP D 2 76  ? -9.349  42.777 102.080 1.00 55.80  ? 57   ASP D C   1 
ATOM   8569 O O   . ASP D 2 76  ? -8.177  43.069 102.361 1.00 62.38  ? 57   ASP D O   1 
ATOM   8570 C CB  . ASP D 2 76  ? -8.645  40.527 101.278 1.00 55.10  ? 57   ASP D CB  1 
ATOM   8571 C CG  . ASP D 2 76  ? -8.953  39.627 102.426 1.00 60.47  ? 57   ASP D CG  1 
ATOM   8572 O OD1 . ASP D 2 76  ? -10.072 39.779 102.982 1.00 67.35  ? 57   ASP D OD1 1 
ATOM   8573 O OD2 . ASP D 2 76  ? -8.074  38.777 102.763 1.00 58.90  ? 57   ASP D OD2 1 
ATOM   8574 N N   . THR D 2 77  ? -10.389 43.438 102.566 1.00 45.90  ? 58   THR D N   1 
ATOM   8575 C CA  . THR D 2 77  ? -10.208 44.551 103.479 1.00 32.63  ? 58   THR D CA  1 
ATOM   8576 C C   . THR D 2 77  ? -9.939  44.072 104.894 1.00 64.85  ? 58   THR D C   1 
ATOM   8577 O O   . THR D 2 77  ? -10.202 42.923 105.233 1.00 41.51  ? 58   THR D O   1 
ATOM   8578 C CB  . THR D 2 77  ? -11.427 45.481 103.469 1.00 44.24  ? 58   THR D CB  1 
ATOM   8579 O OG1 . THR D 2 77  ? -12.593 44.743 103.845 1.00 54.54  ? 58   THR D OG1 1 
ATOM   8580 C CG2 . THR D 2 77  ? -11.635 46.051 102.088 1.00 45.39  ? 58   THR D CG2 1 
ATOM   8581 N N   . ALA D 2 78  ? -9.409  44.967 105.718 1.00 53.60  ? 59   ALA D N   1 
ATOM   8582 C CA  . ALA D 2 78  ? -9.103  44.645 107.100 1.00 59.69  ? 59   ALA D CA  1 
ATOM   8583 C C   . ALA D 2 78  ? -10.282 44.992 107.992 1.00 70.05  ? 59   ALA D C   1 
ATOM   8584 O O   . ALA D 2 78  ? -10.803 46.101 107.937 1.00 64.91  ? 59   ALA D O   1 
ATOM   8585 C CB  . ALA D 2 78  ? -7.863  45.385 107.550 1.00 46.95  ? 59   ALA D CB  1 
ATOM   8586 N N   . GLY D 2 79  ? -10.698 44.037 108.814 1.00 61.52  ? 60   GLY D N   1 
ATOM   8587 C CA  . GLY D 2 79  ? -11.812 44.243 109.718 1.00 71.90  ? 60   GLY D CA  1 
ATOM   8588 C C   . GLY D 2 79  ? -11.410 45.065 110.924 1.00 66.31  ? 60   GLY D C   1 
ATOM   8589 O O   . GLY D 2 79  ? -12.193 45.861 111.429 1.00 73.10  ? 60   GLY D O   1 
ATOM   8590 N N   . GLN D 2 80  ? -10.181 44.871 111.385 1.00 65.78  ? 61   GLN D N   1 
ATOM   8591 C CA  . GLN D 2 80  ? -9.676  45.600 112.536 1.00 53.56  ? 61   GLN D CA  1 
ATOM   8592 C C   . GLN D 2 80  ? -10.019 47.077 112.577 1.00 76.21  ? 61   GLN D C   1 
ATOM   8593 O O   . GLN D 2 80  ? -10.062 47.739 111.546 1.00 69.34  ? 61   GLN D O   1 
ATOM   8594 C CB  . GLN D 2 80  ? -8.154  45.655 112.504 1.00 73.65  ? 61   GLN D CB  1 
ATOM   8595 C CG  . GLN D 2 80  ? -7.502  44.309 112.688 1.00 91.93  ? 61   GLN D CG  1 
ATOM   8596 C CD  . GLN D 2 80  ? -7.902  43.325 111.614 1.00 108.86 ? 61   GLN D CD  1 
ATOM   8597 O OE1 . GLN D 2 80  ? -7.555  43.491 110.445 1.00 92.89  ? 61   GLN D OE1 1 
ATOM   8598 N NE2 . GLN D 2 80  ? -8.629  42.286 112.005 1.00 94.18  ? 61   GLN D NE2 1 
ATOM   8599 N N   . GLU D 2 81  ? -10.264 47.586 113.778 1.00 94.41  ? 62   GLU D N   1 
ATOM   8600 C CA  . GLU D 2 81  ? -10.779 48.934 113.966 1.00 88.05  ? 62   GLU D CA  1 
ATOM   8601 C C   . GLU D 2 81  ? -9.689  49.958 113.703 1.00 71.77  ? 62   GLU D C   1 
ATOM   8602 O O   . GLU D 2 81  ? -9.970  51.096 113.346 1.00 80.87  ? 62   GLU D O   1 
ATOM   8603 C CB  . GLU D 2 81  ? -11.353 49.100 115.372 1.00 102.84 ? 62   GLU D CB  1 
ATOM   8604 C CG  . GLU D 2 81  ? -12.354 48.020 115.754 1.00 118.39 ? 62   GLU D CG  1 
ATOM   8605 C CD  . GLU D 2 81  ? -13.162 48.381 116.980 1.00 131.86 ? 62   GLU D CD  1 
ATOM   8606 O OE1 . GLU D 2 81  ? -13.896 49.391 116.933 1.00 131.61 ? 62   GLU D OE1 1 
ATOM   8607 O OE2 . GLU D 2 81  ? -13.058 47.659 117.993 1.00 129.65 ? 62   GLU D OE2 1 
ATOM   8608 N N   . ASP D 2 82  ? -8.442  49.543 113.881 1.00 62.06  ? 63   ASP D N   1 
ATOM   8609 C CA  . ASP D 2 82  ? -7.304  50.423 113.641 1.00 77.69  ? 63   ASP D CA  1 
ATOM   8610 C C   . ASP D 2 82  ? -7.336  50.970 112.218 1.00 79.06  ? 63   ASP D C   1 
ATOM   8611 O O   . ASP D 2 82  ? -6.801  52.063 111.905 1.00 71.68  ? 63   ASP D O   1 
ATOM   8612 C CB  . ASP D 2 82  ? -6.010  49.650 113.801 1.00 93.46  ? 63   ASP D CB  1 
ATOM   8613 C CG  . ASP D 2 82  ? -6.040  48.700 114.954 1.00 103.73 ? 63   ASP D CG  1 
ATOM   8614 O OD1 . ASP D 2 82  ? -7.129  48.132 115.237 1.00 92.94  ? 63   ASP D OD1 1 
ATOM   8615 O OD2 . ASP D 2 82  ? -4.963  48.516 115.560 1.00 121.02 ? 63   ASP D OD2 1 
ATOM   8616 N N   . TYR D 2 83  ? -7.973  50.188 111.358 1.00 63.99  ? 64   TYR D N   1 
ATOM   8617 C CA  . TYR D 2 83  ? -8.006  50.479 109.952 1.00 62.30  ? 64   TYR D CA  1 
ATOM   8618 C C   . TYR D 2 83  ? -9.236  51.281 109.536 1.00 72.74  ? 64   TYR D C   1 
ATOM   8619 O O   . TYR D 2 83  ? -9.467  51.479 108.341 1.00 64.81  ? 64   TYR D O   1 
ATOM   8620 C CB  . TYR D 2 83  ? -7.880  49.174 109.180 1.00 52.75  ? 64   TYR D CB  1 
ATOM   8621 C CG  . TYR D 2 83  ? -6.482  48.651 109.196 1.00 53.12  ? 64   TYR D CG  1 
ATOM   8622 C CD1 . TYR D 2 83  ? -5.564  49.075 108.255 1.00 59.77  ? 64   TYR D CD1 1 
ATOM   8623 C CD2 . TYR D 2 83  ? -6.064  47.756 110.162 1.00 58.38  ? 64   TYR D CD2 1 
ATOM   8624 C CE1 . TYR D 2 83  ? -4.244  48.601 108.253 1.00 63.80  ? 64   TYR D CE1 1 
ATOM   8625 C CE2 . TYR D 2 83  ? -4.747  47.265 110.176 1.00 64.30  ? 64   TYR D CE2 1 
ATOM   8626 C CZ  . TYR D 2 83  ? -3.850  47.702 109.215 1.00 70.27  ? 64   TYR D CZ  1 
ATOM   8627 O OH  . TYR D 2 83  ? -2.559  47.268 109.207 1.00 73.41  ? 64   TYR D OH  1 
ATOM   8628 N N   . ASP D 2 84  ? -10.014 51.760 110.504 1.00 74.67  ? 65   ASP D N   1 
ATOM   8629 C CA  . ASP D 2 84  ? -11.233 52.490 110.157 1.00 67.79  ? 65   ASP D CA  1 
ATOM   8630 C C   . ASP D 2 84  ? -10.914 53.739 109.339 1.00 67.39  ? 65   ASP D C   1 
ATOM   8631 O O   . ASP D 2 84  ? -11.743 54.211 108.555 1.00 74.03  ? 65   ASP D O   1 
ATOM   8632 C CB  . ASP D 2 84  ? -12.014 52.890 111.402 1.00 76.87  ? 65   ASP D CB  1 
ATOM   8633 C CG  . ASP D 2 84  ? -12.567 51.702 112.158 1.00 93.28  ? 65   ASP D CG  1 
ATOM   8634 O OD1 . ASP D 2 84  ? -12.791 50.635 111.540 1.00 87.19  ? 65   ASP D OD1 1 
ATOM   8635 O OD2 . ASP D 2 84  ? -12.789 51.849 113.383 1.00 89.11  ? 65   ASP D OD2 1 
ATOM   8636 N N   . ARG D 2 85  ? -9.727  54.301 109.528 1.00 61.18  ? 66   ARG D N   1 
ATOM   8637 C CA  . ARG D 2 85  ? -9.359  55.486 108.769 1.00 77.93  ? 66   ARG D CA  1 
ATOM   8638 C C   . ARG D 2 85  ? -8.813  55.101 107.394 1.00 82.67  ? 66   ARG D C   1 
ATOM   8639 O O   . ARG D 2 85  ? -9.201  55.652 106.367 1.00 82.75  ? 66   ARG D O   1 
ATOM   8640 C CB  . ARG D 2 85  ? -8.308  56.288 109.537 1.00 65.46  ? 66   ARG D CB  1 
ATOM   8641 C CG  . ARG D 2 85  ? -8.839  56.996 110.770 1.00 83.12  ? 66   ARG D CG  1 
ATOM   8642 C CD  . ARG D 2 85  ? -9.409  58.356 110.417 1.00 105.86 ? 66   ARG D CD  1 
ATOM   8643 N NE  . ARG D 2 85  ? -8.367  59.279 109.976 1.00 125.88 ? 66   ARG D NE  1 
ATOM   8644 C CZ  . ARG D 2 85  ? -8.600  60.477 109.451 1.00 110.76 ? 66   ARG D CZ  1 
ATOM   8645 N NH1 . ARG D 2 85  ? -9.845  60.903 109.294 1.00 118.34 ? 66   ARG D NH1 1 
ATOM   8646 N NH2 . ARG D 2 85  ? -7.588  61.247 109.079 1.00 79.16  ? 66   ARG D NH2 1 
ATOM   8647 N N   . LEU D 2 86  ? -7.898  54.138 107.415 1.00 67.42  ? 67   LEU D N   1 
ATOM   8648 C CA  . LEU D 2 86  ? -7.216  53.590 106.241 1.00 65.78  ? 67   LEU D CA  1 
ATOM   8649 C C   . LEU D 2 86  ? -8.000  52.756 105.224 1.00 72.13  ? 67   LEU D C   1 
ATOM   8650 O O   . LEU D 2 86  ? -7.758  52.836 104.024 1.00 56.99  ? 67   LEU D O   1 
ATOM   8651 C CB  . LEU D 2 86  ? -5.979  52.804 106.683 1.00 59.45  ? 67   LEU D CB  1 
ATOM   8652 C CG  . LEU D 2 86  ? -4.912  53.593 107.437 1.00 60.95  ? 67   LEU D CG  1 
ATOM   8653 C CD1 . LEU D 2 86  ? -3.680  52.740 107.651 1.00 60.14  ? 67   LEU D CD1 1 
ATOM   8654 C CD2 . LEU D 2 86  ? -4.559  54.856 106.684 1.00 45.61  ? 67   LEU D CD2 1 
ATOM   8655 N N   . ARG D 2 87  ? -8.928  51.946 105.713 1.00 71.03  ? 68   ARG D N   1 
ATOM   8656 C CA  . ARG D 2 87  ? -9.717  51.067 104.855 1.00 58.91  ? 68   ARG D CA  1 
ATOM   8657 C C   . ARG D 2 87  ? -10.589 51.673 103.756 1.00 69.46  ? 68   ARG D C   1 
ATOM   8658 O O   . ARG D 2 87  ? -10.625 51.138 102.654 1.00 74.56  ? 68   ARG D O   1 
ATOM   8659 C CB  . ARG D 2 87  ? -10.566 50.138 105.725 1.00 49.85  ? 68   ARG D CB  1 
ATOM   8660 C CG  . ARG D 2 87  ? -11.381 49.138 104.944 1.00 53.70  ? 68   ARG D CG  1 
ATOM   8661 C CD  . ARG D 2 87  ? -12.145 48.215 105.868 1.00 67.56  ? 68   ARG D CD  1 
ATOM   8662 N NE  . ARG D 2 87  ? -12.948 48.954 106.835 1.00 62.26  ? 68   ARG D NE  1 
ATOM   8663 C CZ  . ARG D 2 87  ? -12.634 49.088 108.116 1.00 60.40  ? 68   ARG D CZ  1 
ATOM   8664 N NH1 . ARG D 2 87  ? -11.535 48.528 108.593 1.00 71.66  ? 68   ARG D NH1 1 
ATOM   8665 N NH2 . ARG D 2 87  ? -13.423 49.777 108.922 1.00 72.28  ? 68   ARG D NH2 1 
ATOM   8666 N N   . PRO D 2 88  ? -11.288 52.766 104.022 1.00 67.08  ? 69   PRO D N   1 
ATOM   8667 C CA  . PRO D 2 88  ? -12.128 53.344 102.972 1.00 54.15  ? 69   PRO D CA  1 
ATOM   8668 C C   . PRO D 2 88  ? -11.383 54.064 101.854 1.00 62.57  ? 69   PRO D C   1 
ATOM   8669 O O   . PRO D 2 88  ? -11.999 54.442 100.875 1.00 59.41  ? 69   PRO D O   1 
ATOM   8670 C CB  . PRO D 2 88  ? -13.006 54.332 103.738 1.00 54.31  ? 69   PRO D CB  1 
ATOM   8671 C CG  . PRO D 2 88  ? -13.038 53.796 105.085 1.00 53.20  ? 69   PRO D CG  1 
ATOM   8672 C CD  . PRO D 2 88  ? -11.622 53.378 105.312 1.00 53.39  ? 69   PRO D CD  1 
ATOM   8673 N N   . LEU D 2 89  ? -10.066 54.147 101.933 1.00 69.13  ? 70   LEU D N   1 
ATOM   8674 C CA  . LEU D 2 89  ? -9.295  54.796 100.881 1.00 58.25  ? 70   LEU D CA  1 
ATOM   8675 C C   . LEU D 2 89  ? -9.483  54.114 99.525  1.00 76.61  ? 70   LEU D C   1 
ATOM   8676 O O   . LEU D 2 89  ? -9.514  54.778 98.494  1.00 95.27  ? 70   LEU D O   1 
ATOM   8677 C CB  . LEU D 2 89  ? -7.812  54.816 101.240 1.00 46.95  ? 70   LEU D CB  1 
ATOM   8678 C CG  . LEU D 2 89  ? -7.408  55.689 102.424 1.00 65.69  ? 70   LEU D CG  1 
ATOM   8679 C CD1 . LEU D 2 89  ? -5.917  55.601 102.652 1.00 70.67  ? 70   LEU D CD1 1 
ATOM   8680 C CD2 . LEU D 2 89  ? -7.829  57.122 102.189 1.00 45.78  ? 70   LEU D CD2 1 
ATOM   8681 N N   . SER D 2 90  ? -9.611  52.795 99.545  1.00 69.23  ? 71   SER D N   1 
ATOM   8682 C CA  . SER D 2 90  ? -9.769  52.002 98.334  1.00 58.13  ? 71   SER D CA  1 
ATOM   8683 C C   . SER D 2 90  ? -11.219 51.792 97.918  1.00 66.74  ? 71   SER D C   1 
ATOM   8684 O O   . SER D 2 90  ? -11.494 51.117 96.932  1.00 79.49  ? 71   SER D O   1 
ATOM   8685 C CB  . SER D 2 90  ? -9.080  50.653 98.509  1.00 61.19  ? 71   SER D CB  1 
ATOM   8686 O OG  . SER D 2 90  ? -9.369  50.107 99.780  1.00 56.61  ? 71   SER D OG  1 
ATOM   8687 N N   . TYR D 2 91  ? -12.143 52.362 98.678  1.00 64.81  ? 72   TYR D N   1 
ATOM   8688 C CA  . TYR D 2 91  ? -13.565 52.221 98.395  1.00 71.30  ? 72   TYR D CA  1 
ATOM   8689 C C   . TYR D 2 91  ? -13.992 52.803 97.052  1.00 73.51  ? 72   TYR D C   1 
ATOM   8690 O O   . TYR D 2 91  ? -14.827 52.227 96.361  1.00 70.34  ? 72   TYR D O   1 
ATOM   8691 C CB  . TYR D 2 91  ? -14.389 52.839 99.521  1.00 45.55  ? 72   TYR D CB  1 
ATOM   8692 C CG  . TYR D 2 91  ? -14.533 51.938 100.719 1.00 63.27  ? 72   TYR D CG  1 
ATOM   8693 C CD1 . TYR D 2 91  ? -13.587 50.965 100.993 1.00 63.12  ? 72   TYR D CD1 1 
ATOM   8694 C CD2 . TYR D 2 91  ? -15.605 52.068 101.585 1.00 81.14  ? 72   TYR D CD2 1 
ATOM   8695 C CE1 . TYR D 2 91  ? -13.710 50.142 102.088 1.00 78.50  ? 72   TYR D CE1 1 
ATOM   8696 C CE2 . TYR D 2 91  ? -15.735 51.250 102.683 1.00 80.91  ? 72   TYR D CE2 1 
ATOM   8697 C CZ  . TYR D 2 91  ? -14.784 50.288 102.930 1.00 72.18  ? 72   TYR D CZ  1 
ATOM   8698 O OH  . TYR D 2 91  ? -14.910 49.469 104.025 1.00 60.28  ? 72   TYR D OH  1 
ATOM   8699 N N   . PRO D 2 92  ? -13.411 53.933 96.676  1.00 75.91  ? 73   PRO D N   1 
ATOM   8700 C CA  . PRO D 2 92  ? -13.764 54.582 95.411  1.00 83.48  ? 73   PRO D CA  1 
ATOM   8701 C C   . PRO D 2 92  ? -13.435 53.727 94.195  1.00 77.19  ? 73   PRO D C   1 
ATOM   8702 O O   . PRO D 2 92  ? -12.401 53.070 94.154  1.00 76.19  ? 73   PRO D O   1 
ATOM   8703 C CB  . PRO D 2 92  ? -12.895 55.837 95.417  1.00 67.57  ? 73   PRO D CB  1 
ATOM   8704 C CG  . PRO D 2 92  ? -11.725 55.473 96.226  1.00 70.24  ? 73   PRO D CG  1 
ATOM   8705 C CD  . PRO D 2 92  ? -12.206 54.523 97.279  1.00 62.12  ? 73   PRO D CD  1 
ATOM   8706 N N   . GLN D 2 93  ? -14.321 53.750 93.208  1.00 77.86  ? 74   GLN D N   1 
ATOM   8707 C CA  . GLN D 2 93  ? -14.136 52.983 91.984  1.00 79.90  ? 74   GLN D CA  1 
ATOM   8708 C C   . GLN D 2 93  ? -14.658 51.555 92.083  1.00 74.07  ? 74   GLN D C   1 
ATOM   8709 O O   . GLN D 2 93  ? -14.568 50.794 91.126  1.00 86.33  ? 74   GLN D O   1 
ATOM   8710 C CB  . GLN D 2 93  ? -12.658 52.962 91.599  1.00 88.70  ? 74   GLN D CB  1 
ATOM   8711 C CG  . GLN D 2 93  ? -12.099 54.320 91.226  1.00 101.36 ? 74   GLN D CG  1 
ATOM   8712 C CD  . GLN D 2 93  ? -12.513 54.762 89.840  1.00 96.89  ? 74   GLN D CD  1 
ATOM   8713 O OE1 . GLN D 2 93  ? -11.893 54.388 88.849  1.00 84.67  ? 74   GLN D OE1 1 
ATOM   8714 N NE2 . GLN D 2 93  ? -13.559 55.574 89.766  1.00 81.43  ? 74   GLN D NE2 1 
ATOM   8715 N N   . THR D 2 94  ? -15.210 51.192 93.233  1.00 70.52  ? 75   THR D N   1 
ATOM   8716 C CA  . THR D 2 94  ? -15.739 49.847 93.413  1.00 70.37  ? 75   THR D CA  1 
ATOM   8717 C C   . THR D 2 94  ? -16.951 49.610 92.523  1.00 57.35  ? 75   THR D C   1 
ATOM   8718 O O   . THR D 2 94  ? -17.790 50.489 92.359  1.00 71.84  ? 75   THR D O   1 
ATOM   8719 C CB  . THR D 2 94  ? -16.132 49.583 94.871  1.00 66.57  ? 75   THR D CB  1 
ATOM   8720 O OG1 . THR D 2 94  ? -15.046 49.941 95.731  1.00 60.29  ? 75   THR D OG1 1 
ATOM   8721 C CG2 . THR D 2 94  ? -16.464 48.122 95.073  1.00 40.06  ? 75   THR D CG2 1 
ATOM   8722 N N   . ASP D 2 95  ? -17.040 48.413 91.957  1.00 54.29  ? 76   ASP D N   1 
ATOM   8723 C CA  . ASP D 2 95  ? -18.146 48.053 91.096  1.00 59.32  ? 76   ASP D CA  1 
ATOM   8724 C C   . ASP D 2 95  ? -19.237 47.395 91.912  1.00 67.80  ? 76   ASP D C   1 
ATOM   8725 O O   . ASP D 2 95  ? -20.424 47.558 91.617  1.00 74.77  ? 76   ASP D O   1 
ATOM   8726 C CB  . ASP D 2 95  ? -17.674 47.098 90.001  1.00 65.38  ? 76   ASP D CB  1 
ATOM   8727 C CG  . ASP D 2 95  ? -16.747 47.771 88.997  1.00 84.50  ? 76   ASP D CG  1 
ATOM   8728 O OD1 . ASP D 2 95  ? -17.241 48.675 88.264  1.00 91.08  ? 76   ASP D OD1 1 
ATOM   8729 O OD2 . ASP D 2 95  ? -15.529 47.409 88.942  1.00 76.16  ? 76   ASP D OD2 1 
ATOM   8730 N N   . VAL D 2 96  ? -18.840 46.649 92.940  1.00 59.97  ? 77   VAL D N   1 
ATOM   8731 C CA  . VAL D 2 96  ? -19.780 45.929 93.800  1.00 58.35  ? 77   VAL D CA  1 
ATOM   8732 C C   . VAL D 2 96  ? -19.130 45.649 95.158  1.00 66.86  ? 77   VAL D C   1 
ATOM   8733 O O   . VAL D 2 96  ? -17.899 45.499 95.249  1.00 59.57  ? 77   VAL D O   1 
ATOM   8734 C CB  . VAL D 2 96  ? -20.225 44.609 93.173  1.00 45.51  ? 77   VAL D CB  1 
ATOM   8735 C CG1 . VAL D 2 96  ? -19.040 43.854 92.644  1.00 40.01  ? 77   VAL D CG1 1 
ATOM   8736 C CG2 . VAL D 2 96  ? -20.962 43.754 94.187  1.00 44.11  ? 77   VAL D CG2 1 
ATOM   8737 N N   . PHE D 2 97  ? -19.969 45.583 96.198  1.00 58.02  ? 78   PHE D N   1 
ATOM   8738 C CA  . PHE D 2 97  ? -19.555 45.275 97.565  1.00 46.39  ? 78   PHE D CA  1 
ATOM   8739 C C   . PHE D 2 97  ? -20.073 43.931 98.080  1.00 63.00  ? 78   PHE D C   1 
ATOM   8740 O O   . PHE D 2 97  ? -21.273 43.609 97.987  1.00 58.57  ? 78   PHE D O   1 
ATOM   8741 C CB  . PHE D 2 97  ? -19.975 46.383 98.525  1.00 40.57  ? 78   PHE D CB  1 
ATOM   8742 C CG  . PHE D 2 97  ? -19.033 47.542 98.554  1.00 56.61  ? 78   PHE D CG  1 
ATOM   8743 C CD1 . PHE D 2 97  ? -17.828 47.446 99.226  1.00 61.07  ? 78   PHE D CD1 1 
ATOM   8744 C CD2 . PHE D 2 97  ? -19.341 48.736 97.916  1.00 54.99  ? 78   PHE D CD2 1 
ATOM   8745 C CE1 . PHE D 2 97  ? -16.936 48.535 99.276  1.00 57.75  ? 78   PHE D CE1 1 
ATOM   8746 C CE2 . PHE D 2 97  ? -18.440 49.818 97.958  1.00 61.37  ? 78   PHE D CE2 1 
ATOM   8747 C CZ  . PHE D 2 97  ? -17.239 49.706 98.651  1.00 58.93  ? 78   PHE D CZ  1 
ATOM   8748 N N   . LEU D 2 98  ? -19.177 43.173 98.692  1.00 56.11  ? 79   LEU D N   1 
ATOM   8749 C CA  . LEU D 2 98  ? -19.568 41.922 99.293  1.00 57.27  ? 79   LEU D CA  1 
ATOM   8750 C C   . LEU D 2 98  ? -19.530 42.167 100.785 1.00 49.44  ? 79   LEU D C   1 
ATOM   8751 O O   . LEU D 2 98  ? -18.494 42.512 101.332 1.00 51.95  ? 79   LEU D O   1 
ATOM   8752 C CB  . LEU D 2 98  ? -18.592 40.813 98.929  1.00 52.27  ? 79   LEU D CB  1 
ATOM   8753 C CG  . LEU D 2 98  ? -18.798 40.164 97.567  1.00 59.02  ? 79   LEU D CG  1 
ATOM   8754 C CD1 . LEU D 2 98  ? -17.908 38.948 97.450  1.00 68.97  ? 79   LEU D CD1 1 
ATOM   8755 C CD2 . LEU D 2 98  ? -20.247 39.769 97.409  1.00 60.78  ? 79   LEU D CD2 1 
ATOM   8756 N N   . ILE D 2 99  ? -20.663 41.986 101.446 1.00 57.82  ? 80   ILE D N   1 
ATOM   8757 C CA  . ILE D 2 99  ? -20.725 42.175 102.883 1.00 47.25  ? 80   ILE D CA  1 
ATOM   8758 C C   . ILE D 2 99  ? -20.951 40.805 103.474 1.00 45.18  ? 80   ILE D C   1 
ATOM   8759 O O   . ILE D 2 99  ? -21.891 40.112 103.104 1.00 55.45  ? 80   ILE D O   1 
ATOM   8760 C CB  . ILE D 2 99  ? -21.846 43.131 103.288 1.00 59.22  ? 80   ILE D CB  1 
ATOM   8761 C CG1 . ILE D 2 99  ? -21.406 44.577 103.050 1.00 61.66  ? 80   ILE D CG1 1 
ATOM   8762 C CG2 . ILE D 2 99  ? -22.201 42.932 104.740 1.00 69.86  ? 80   ILE D CG2 1 
ATOM   8763 C CD1 . ILE D 2 99  ? -22.332 45.607 103.626 1.00 41.04  ? 80   ILE D CD1 1 
ATOM   8764 N N   . CYS D 2 100 ? -20.080 40.411 104.391 1.00 49.29  ? 81   CYS D N   1 
ATOM   8765 C CA  . CYS D 2 100 ? -20.169 39.090 104.980 1.00 64.92  ? 81   CYS D CA  1 
ATOM   8766 C C   . CYS D 2 100 ? -20.216 39.076 106.491 1.00 58.73  ? 81   CYS D C   1 
ATOM   8767 O O   . CYS D 2 100 ? -19.635 39.919 107.161 1.00 48.50  ? 81   CYS D O   1 
ATOM   8768 C CB  . CYS D 2 100 ? -18.973 38.246 104.539 1.00 61.54  ? 81   CYS D CB  1 
ATOM   8769 S SG  . CYS D 2 100 ? -18.263 38.699 102.961 1.00 64.46  ? 81   CYS D SG  1 
ATOM   8770 N N   . PHE D 2 101 ? -20.921 38.085 107.012 1.00 55.99  ? 82   PHE D N   1 
ATOM   8771 C CA  . PHE D 2 101 ? -21.039 37.880 108.433 1.00 40.11  ? 82   PHE D CA  1 
ATOM   8772 C C   . PHE D 2 101 ? -21.070 36.377 108.591 1.00 47.57  ? 82   PHE D C   1 
ATOM   8773 O O   . PHE D 2 101 ? -21.372 35.666 107.632 1.00 52.08  ? 82   PHE D O   1 
ATOM   8774 C CB  . PHE D 2 101 ? -22.342 38.493 108.953 1.00 54.11  ? 82   PHE D CB  1 
ATOM   8775 C CG  . PHE D 2 101 ? -23.558 37.771 108.481 1.00 57.20  ? 82   PHE D CG  1 
ATOM   8776 C CD1 . PHE D 2 101 ? -23.985 36.623 109.127 1.00 58.76  ? 82   PHE D CD1 1 
ATOM   8777 C CD2 . PHE D 2 101 ? -24.245 38.210 107.367 1.00 54.08  ? 82   PHE D CD2 1 
ATOM   8778 C CE1 . PHE D 2 101 ? -25.083 35.933 108.674 1.00 68.93  ? 82   PHE D CE1 1 
ATOM   8779 C CE2 . PHE D 2 101 ? -25.346 37.522 106.900 1.00 53.11  ? 82   PHE D CE2 1 
ATOM   8780 C CZ  . PHE D 2 101 ? -25.778 36.387 107.548 1.00 61.25  ? 82   PHE D CZ  1 
ATOM   8781 N N   . SER D 2 102 ? -20.748 35.896 109.791 1.00 60.19  ? 83   SER D N   1 
ATOM   8782 C CA  . SER D 2 102 ? -20.752 34.463 110.078 1.00 54.77  ? 83   SER D CA  1 
ATOM   8783 C C   . SER D 2 102 ? -22.149 34.066 110.450 1.00 60.96  ? 83   SER D C   1 
ATOM   8784 O O   . SER D 2 102 ? -22.774 34.731 111.238 1.00 70.91  ? 83   SER D O   1 
ATOM   8785 C CB  . SER D 2 102 ? -19.819 34.149 111.239 1.00 56.99  ? 83   SER D CB  1 
ATOM   8786 O OG  . SER D 2 102 ? -19.823 32.763 111.508 1.00 56.47  ? 83   SER D OG  1 
ATOM   8787 N N   . LEU D 2 103 ? -22.654 32.989 109.887 1.00 66.03  ? 84   LEU D N   1 
ATOM   8788 C CA  . LEU D 2 103 ? -23.981 32.563 110.254 1.00 65.07  ? 84   LEU D CA  1 
ATOM   8789 C C   . LEU D 2 103 ? -23.984 32.073 111.687 1.00 67.91  ? 84   LEU D C   1 
ATOM   8790 O O   . LEU D 2 103 ? -25.023 32.042 112.314 1.00 72.35  ? 84   LEU D O   1 
ATOM   8791 C CB  . LEU D 2 103 ? -24.502 31.474 109.330 1.00 54.63  ? 84   LEU D CB  1 
ATOM   8792 C CG  . LEU D 2 103 ? -24.822 31.853 107.897 1.00 48.52  ? 84   LEU D CG  1 
ATOM   8793 C CD1 . LEU D 2 103 ? -24.845 30.568 107.068 1.00 55.78  ? 84   LEU D CD1 1 
ATOM   8794 C CD2 . LEU D 2 103 ? -26.146 32.601 107.820 1.00 38.60  ? 84   LEU D CD2 1 
ATOM   8795 N N   . VAL D 2 104 ? -22.820 31.705 112.204 1.00 62.52  ? 85   VAL D N   1 
ATOM   8796 C CA  . VAL D 2 104 ? -22.706 31.262 113.584 1.00 47.63  ? 85   VAL D CA  1 
ATOM   8797 C C   . VAL D 2 104 ? -22.143 32.329 114.537 1.00 54.68  ? 85   VAL D C   1 
ATOM   8798 O O   . VAL D 2 104 ? -21.689 32.002 115.635 1.00 61.40  ? 85   VAL D O   1 
ATOM   8799 C CB  . VAL D 2 104 ? -21.869 30.001 113.688 1.00 54.59  ? 85   VAL D CB  1 
ATOM   8800 C CG1 . VAL D 2 104 ? -22.474 28.882 112.834 1.00 57.89  ? 85   VAL D CG1 1 
ATOM   8801 C CG2 . VAL D 2 104 ? -20.453 30.274 113.284 1.00 37.99  ? 85   VAL D CG2 1 
ATOM   8802 N N   . SER D 2 105 ? -22.170 33.596 114.125 1.00 54.74  ? 86   SER D N   1 
ATOM   8803 C CA  . SER D 2 105 ? -21.790 34.693 115.013 1.00 53.37  ? 86   SER D CA  1 
ATOM   8804 C C   . SER D 2 105 ? -22.778 35.862 114.937 1.00 57.88  ? 86   SER D C   1 
ATOM   8805 O O   . SER D 2 105 ? -22.632 36.759 114.100 1.00 64.63  ? 86   SER D O   1 
ATOM   8806 C CB  . SER D 2 105 ? -20.375 35.186 114.731 1.00 44.58  ? 86   SER D CB  1 
ATOM   8807 O OG  . SER D 2 105 ? -20.182 36.488 115.276 1.00 66.89  ? 86   SER D OG  1 
ATOM   8808 N N   . PRO D 2 106 ? -23.789 35.872 115.817 1.00 53.32  ? 87   PRO D N   1 
ATOM   8809 C CA  . PRO D 2 106 ? -24.788 36.943 115.752 1.00 59.58  ? 87   PRO D CA  1 
ATOM   8810 C C   . PRO D 2 106 ? -24.185 38.338 115.921 1.00 67.10  ? 87   PRO D C   1 
ATOM   8811 O O   . PRO D 2 106 ? -24.789 39.337 115.495 1.00 58.63  ? 87   PRO D O   1 
ATOM   8812 C CB  . PRO D 2 106 ? -25.720 36.622 116.907 1.00 40.62  ? 87   PRO D CB  1 
ATOM   8813 C CG  . PRO D 2 106 ? -25.596 35.147 117.084 1.00 62.75  ? 87   PRO D CG  1 
ATOM   8814 C CD  . PRO D 2 106 ? -24.180 34.794 116.737 1.00 40.00  ? 87   PRO D CD  1 
ATOM   8815 N N   . ALA D 2 107 ? -22.999 38.410 116.523 1.00 63.17  ? 88   ALA D N   1 
ATOM   8816 C CA  . ALA D 2 107 ? -22.331 39.691 116.698 1.00 58.94  ? 88   ALA D CA  1 
ATOM   8817 C C   . ALA D 2 107 ? -21.911 40.291 115.351 1.00 69.14  ? 88   ALA D C   1 
ATOM   8818 O O   . ALA D 2 107 ? -22.109 41.489 115.085 1.00 60.03  ? 88   ALA D O   1 
ATOM   8819 C CB  . ALA D 2 107 ? -21.134 39.511 117.580 1.00 56.69  ? 88   ALA D CB  1 
ATOM   8820 N N   . SER D 2 108 ? -21.313 39.439 114.513 1.00 53.42  ? 89   SER D N   1 
ATOM   8821 C CA  . SER D 2 108 ? -20.855 39.828 113.196 1.00 45.37  ? 89   SER D CA  1 
ATOM   8822 C C   . SER D 2 108 ? -22.065 40.153 112.357 1.00 51.90  ? 89   SER D C   1 
ATOM   8823 O O   . SER D 2 108 ? -22.031 41.092 111.584 1.00 65.36  ? 89   SER D O   1 
ATOM   8824 C CB  . SER D 2 108 ? -20.107 38.688 112.559 1.00 42.60  ? 89   SER D CB  1 
ATOM   8825 O OG  . SER D 2 108 ? -21.016 37.645 112.255 1.00 53.74  ? 89   SER D OG  1 
ATOM   8826 N N   . PHE D 2 109 ? -23.137 39.386 112.519 1.00 48.79  ? 90   PHE D N   1 
ATOM   8827 C CA  . PHE D 2 109 ? -24.414 39.753 111.931 1.00 65.26  ? 90   PHE D CA  1 
ATOM   8828 C C   . PHE D 2 109 ? -24.896 41.148 112.343 1.00 57.99  ? 90   PHE D C   1 
ATOM   8829 O O   . PHE D 2 109 ? -25.255 41.951 111.491 1.00 46.33  ? 90   PHE D O   1 
ATOM   8830 C CB  . PHE D 2 109 ? -25.472 38.706 112.243 1.00 64.83  ? 90   PHE D CB  1 
ATOM   8831 C CG  . PHE D 2 109 ? -26.759 38.880 111.461 1.00 72.60  ? 90   PHE D CG  1 
ATOM   8832 C CD1 . PHE D 2 109 ? -27.768 39.743 111.908 1.00 63.89  ? 90   PHE D CD1 1 
ATOM   8833 C CD2 . PHE D 2 109 ? -26.986 38.158 110.298 1.00 67.18  ? 90   PHE D CD2 1 
ATOM   8834 C CE1 . PHE D 2 109 ? -28.979 39.889 111.195 1.00 68.14  ? 90   PHE D CE1 1 
ATOM   8835 C CE2 . PHE D 2 109 ? -28.193 38.307 109.578 1.00 57.25  ? 90   PHE D CE2 1 
ATOM   8836 C CZ  . PHE D 2 109 ? -29.188 39.165 110.032 1.00 63.53  ? 90   PHE D CZ  1 
ATOM   8837 N N   . GLU D 2 110 ? -24.886 41.439 113.639 1.00 52.34  ? 91   GLU D N   1 
ATOM   8838 C CA  . GLU D 2 110 ? -25.373 42.716 114.111 1.00 43.10  ? 91   GLU D CA  1 
ATOM   8839 C C   . GLU D 2 110 ? -24.476 43.833 113.619 1.00 60.63  ? 91   GLU D C   1 
ATOM   8840 O O   . GLU D 2 110 ? -24.948 44.941 113.345 1.00 66.44  ? 91   GLU D O   1 
ATOM   8841 C CB  . GLU D 2 110 ? -25.490 42.722 115.633 1.00 64.99  ? 91   GLU D CB  1 
ATOM   8842 C CG  . GLU D 2 110 ? -26.003 44.056 116.292 1.00 95.10  ? 91   GLU D CG  1 
ATOM   8843 C CD  . GLU D 2 110 ? -27.363 44.578 115.744 1.00 98.34  ? 91   GLU D CD  1 
ATOM   8844 O OE1 . GLU D 2 110 ? -28.172 43.775 115.224 1.00 98.89  ? 91   GLU D OE1 1 
ATOM   8845 O OE2 . GLU D 2 110 ? -27.619 45.806 115.835 1.00 78.73  ? 91   GLU D OE2 1 
ATOM   8846 N N   . ASN D 2 111 ? -23.192 43.545 113.462 1.00 44.40  ? 92   ASN D N   1 
ATOM   8847 C CA  . ASN D 2 111 ? -22.291 44.543 112.906 1.00 68.71  ? 92   ASN D CA  1 
ATOM   8848 C C   . ASN D 2 111 ? -22.553 44.944 111.462 1.00 71.49  ? 92   ASN D C   1 
ATOM   8849 O O   . ASN D 2 111 ? -22.116 46.015 111.019 1.00 64.14  ? 92   ASN D O   1 
ATOM   8850 C CB  . ASN D 2 111 ? -20.849 44.107 113.048 1.00 72.21  ? 92   ASN D CB  1 
ATOM   8851 C CG  . ASN D 2 111 ? -20.262 44.541 114.341 1.00 77.75  ? 92   ASN D CG  1 
ATOM   8852 O OD1 . ASN D 2 111 ? -19.647 43.738 115.053 1.00 76.79  ? 92   ASN D OD1 1 
ATOM   8853 N ND2 . ASN D 2 111 ? -20.461 45.817 114.683 1.00 64.57  ? 92   ASN D ND2 1 
ATOM   8854 N N   . VAL D 2 112 ? -23.243 44.081 110.726 1.00 67.13  ? 93   VAL D N   1 
ATOM   8855 C CA  . VAL D 2 112 ? -23.610 44.404 109.371 1.00 61.01  ? 93   VAL D CA  1 
ATOM   8856 C C   . VAL D 2 112 ? -24.435 45.665 109.354 1.00 69.05  ? 93   VAL D C   1 
ATOM   8857 O O   . VAL D 2 112 ? -24.155 46.568 108.569 1.00 70.78  ? 93   VAL D O   1 
ATOM   8858 C CB  . VAL D 2 112 ? -24.483 43.340 108.768 1.00 60.24  ? 93   VAL D CB  1 
ATOM   8859 C CG1 . VAL D 2 112 ? -25.054 43.845 107.434 1.00 47.06  ? 93   VAL D CG1 1 
ATOM   8860 C CG2 . VAL D 2 112 ? -23.694 42.049 108.597 1.00 49.86  ? 93   VAL D CG2 1 
ATOM   8861 N N   . ARG D 2 113 ? -25.462 45.693 110.214 1.00 75.67  ? 94   ARG D N   1 
ATOM   8862 C CA  . ARG D 2 113 ? -26.362 46.849 110.389 1.00 77.53  ? 94   ARG D CA  1 
ATOM   8863 C C   . ARG D 2 113 ? -25.677 47.966 111.161 1.00 65.23  ? 94   ARG D C   1 
ATOM   8864 O O   . ARG D 2 113 ? -25.813 49.140 110.823 1.00 67.31  ? 94   ARG D O   1 
ATOM   8865 C CB  . ARG D 2 113 ? -27.654 46.438 111.117 1.00 79.32  ? 94   ARG D CB  1 
ATOM   8866 C CG  . ARG D 2 113 ? -28.573 47.610 111.485 1.00 92.58  ? 94   ARG D CG  1 
ATOM   8867 C CD  . ARG D 2 113 ? -29.455 47.301 112.701 1.00 89.68  ? 94   ARG D CD  1 
ATOM   8868 N NE  . ARG D 2 113 ? -30.612 46.482 112.366 1.00 84.88  ? 94   ARG D NE  1 
ATOM   8869 C CZ  . ARG D 2 113 ? -30.732 45.197 112.683 1.00 86.84  ? 94   ARG D CZ  1 
ATOM   8870 N NH1 . ARG D 2 113 ? -29.768 44.574 113.359 1.00 80.36  ? 94   ARG D NH1 1 
ATOM   8871 N NH2 . ARG D 2 113 ? -31.820 44.534 112.318 1.00 81.13  ? 94   ARG D NH2 1 
ATOM   8872 N N   . ALA D 2 114 ? -24.941 47.585 112.195 1.00 63.47  ? 95   ALA D N   1 
ATOM   8873 C CA  . ALA D 2 114 ? -24.282 48.575 113.055 1.00 73.89  ? 95   ALA D CA  1 
ATOM   8874 C C   . ALA D 2 114 ? -23.141 49.351 112.399 1.00 71.49  ? 95   ALA D C   1 
ATOM   8875 O O   . ALA D 2 114 ? -23.098 50.577 112.518 1.00 67.29  ? 95   ALA D O   1 
ATOM   8876 C CB  . ALA D 2 114 ? -23.798 47.940 114.353 1.00 49.45  ? 95   ALA D CB  1 
ATOM   8877 N N   . LYS D 2 115 ? -22.223 48.655 111.717 1.00 67.79  ? 96   LYS D N   1 
ATOM   8878 C CA  . LYS D 2 115 ? -21.009 49.328 111.203 1.00 73.19  ? 96   LYS D CA  1 
ATOM   8879 C C   . LYS D 2 115 ? -20.737 49.253 109.698 1.00 74.57  ? 96   LYS D C   1 
ATOM   8880 O O   . LYS D 2 115 ? -20.445 50.285 109.093 1.00 66.09  ? 96   LYS D O   1 
ATOM   8881 C CB  . LYS D 2 115 ? -19.745 48.967 112.016 1.00 62.86  ? 96   LYS D CB  1 
ATOM   8882 C CG  . LYS D 2 115 ? -18.736 48.048 111.330 1.00 62.25  ? 96   LYS D CG  1 
ATOM   8883 C CD  . LYS D 2 115 ? -17.400 48.089 112.006 1.00 66.41  ? 96   LYS D CD  1 
ATOM   8884 C CE  . LYS D 2 115 ? -16.623 49.306 111.594 1.00 82.04  ? 96   LYS D CE  1 
ATOM   8885 N NZ  . LYS D 2 115 ? -15.208 49.147 112.022 1.00 90.78  ? 96   LYS D NZ  1 
ATOM   8886 N N   . TRP D 2 116 ? -20.834 48.055 109.107 1.00 72.57  ? 97   TRP D N   1 
ATOM   8887 C CA  . TRP D 2 116 ? -20.384 47.827 107.718 1.00 75.03  ? 97   TRP D CA  1 
ATOM   8888 C C   . TRP D 2 116 ? -21.249 48.543 106.692 1.00 74.03  ? 97   TRP D C   1 
ATOM   8889 O O   . TRP D 2 116 ? -20.732 49.341 105.903 1.00 73.79  ? 97   TRP D O   1 
ATOM   8890 C CB  . TRP D 2 116 ? -20.232 46.337 107.388 1.00 57.35  ? 97   TRP D CB  1 
ATOM   8891 C CG  . TRP D 2 116 ? -19.188 45.633 108.230 1.00 67.96  ? 97   TRP D CG  1 
ATOM   8892 C CD1 . TRP D 2 116 ? -19.374 44.516 109.010 1.00 76.20  ? 97   TRP D CD1 1 
ATOM   8893 C CD2 . TRP D 2 116 ? -17.806 45.999 108.389 1.00 68.32  ? 97   TRP D CD2 1 
ATOM   8894 N NE1 . TRP D 2 116 ? -18.192 44.160 109.637 1.00 73.49  ? 97   TRP D NE1 1 
ATOM   8895 C CE2 . TRP D 2 116 ? -17.216 45.050 109.271 1.00 63.56  ? 97   TRP D CE2 1 
ATOM   8896 C CE3 . TRP D 2 116 ? -17.006 47.031 107.875 1.00 64.65  ? 97   TRP D CE3 1 
ATOM   8897 C CZ2 . TRP D 2 116 ? -15.873 45.111 109.646 1.00 65.75  ? 97   TRP D CZ2 1 
ATOM   8898 C CZ3 . TRP D 2 116 ? -15.652 47.086 108.250 1.00 45.95  ? 97   TRP D CZ3 1 
ATOM   8899 C CH2 . TRP D 2 116 ? -15.109 46.131 109.117 1.00 61.93  ? 97   TRP D CH2 1 
ATOM   8900 N N   . TYR D 2 117 ? -22.554 48.288 106.722 1.00 68.72  ? 98   TYR D N   1 
ATOM   8901 C CA  . TYR D 2 117 ? -23.469 48.939 105.792 1.00 59.53  ? 98   TYR D CA  1 
ATOM   8902 C C   . TYR D 2 117 ? -23.364 50.452 105.844 1.00 63.76  ? 98   TYR D C   1 
ATOM   8903 O O   . TYR D 2 117 ? -23.157 51.079 104.822 1.00 80.18  ? 98   TYR D O   1 
ATOM   8904 C CB  . TYR D 2 117 ? -24.909 48.488 106.000 1.00 68.41  ? 98   TYR D CB  1 
ATOM   8905 C CG  . TYR D 2 117 ? -25.921 49.329 105.272 1.00 77.23  ? 98   TYR D CG  1 
ATOM   8906 C CD1 . TYR D 2 117 ? -25.721 49.699 103.946 1.00 82.01  ? 98   TYR D CD1 1 
ATOM   8907 C CD2 . TYR D 2 117 ? -27.095 49.730 105.893 1.00 87.42  ? 98   TYR D CD2 1 
ATOM   8908 C CE1 . TYR D 2 117 ? -26.645 50.451 103.270 1.00 81.12  ? 98   TYR D CE1 1 
ATOM   8909 C CE2 . TYR D 2 117 ? -28.038 50.485 105.213 1.00 99.90  ? 98   TYR D CE2 1 
ATOM   8910 C CZ  . TYR D 2 117 ? -27.799 50.845 103.904 1.00 101.08 ? 98   TYR D CZ  1 
ATOM   8911 O OH  . TYR D 2 117 ? -28.710 51.603 103.217 1.00 113.11 ? 98   TYR D OH  1 
ATOM   8912 N N   . PRO D 2 118 ? -23.494 51.045 107.031 1.00 69.15  ? 99   PRO D N   1 
ATOM   8913 C CA  . PRO D 2 118 ? -23.280 52.498 107.165 1.00 69.88  ? 99   PRO D CA  1 
ATOM   8914 C C   . PRO D 2 118 ? -21.966 53.013 106.556 1.00 66.95  ? 99   PRO D C   1 
ATOM   8915 O O   . PRO D 2 118 ? -21.959 54.023 105.851 1.00 70.05  ? 99   PRO D O   1 
ATOM   8916 C CB  . PRO D 2 118 ? -23.250 52.692 108.681 1.00 66.13  ? 99   PRO D CB  1 
ATOM   8917 C CG  . PRO D 2 118 ? -24.179 51.613 109.200 1.00 78.83  ? 99   PRO D CG  1 
ATOM   8918 C CD  . PRO D 2 118 ? -24.005 50.440 108.281 1.00 74.20  ? 99   PRO D CD  1 
ATOM   8919 N N   . GLU D 2 119 ? -20.868 52.328 106.848 1.00 52.78  ? 100  GLU D N   1 
ATOM   8920 C CA  . GLU D 2 119 ? -19.576 52.733 106.333 1.00 65.84  ? 100  GLU D CA  1 
ATOM   8921 C C   . GLU D 2 119 ? -19.600 52.716 104.798 1.00 69.93  ? 100  GLU D C   1 
ATOM   8922 O O   . GLU D 2 119 ? -19.216 53.687 104.125 1.00 66.72  ? 100  GLU D O   1 
ATOM   8923 C CB  . GLU D 2 119 ? -18.468 51.805 106.853 1.00 41.93  ? 100  GLU D CB  1 
ATOM   8924 C CG  . GLU D 2 119 ? -17.111 52.134 106.279 1.00 44.61  ? 100  GLU D CG  1 
ATOM   8925 C CD  . GLU D 2 119 ? -15.977 51.238 106.789 1.00 66.70  ? 100  GLU D CD  1 
ATOM   8926 O OE1 . GLU D 2 119 ? -15.698 50.183 106.162 1.00 57.06  ? 100  GLU D OE1 1 
ATOM   8927 O OE2 . GLU D 2 119 ? -15.321 51.611 107.794 1.00 81.84  ? 100  GLU D OE2 1 
ATOM   8928 N N   . VAL D 2 120 ? -20.052 51.592 104.253 1.00 61.81  ? 101  VAL D N   1 
ATOM   8929 C CA  . VAL D 2 120 ? -20.067 51.417 102.815 1.00 65.95  ? 101  VAL D CA  1 
ATOM   8930 C C   . VAL D 2 120 ? -20.962 52.479 102.208 1.00 73.91  ? 101  VAL D C   1 
ATOM   8931 O O   . VAL D 2 120 ? -20.552 53.168 101.265 1.00 80.56  ? 101  VAL D O   1 
ATOM   8932 C CB  . VAL D 2 120 ? -20.553 50.012 102.397 1.00 64.17  ? 101  VAL D CB  1 
ATOM   8933 C CG1 . VAL D 2 120 ? -21.114 50.039 100.968 1.00 59.17  ? 101  VAL D CG1 1 
ATOM   8934 C CG2 . VAL D 2 120 ? -19.424 48.968 102.551 1.00 43.55  ? 101  VAL D CG2 1 
ATOM   8935 N N   . ARG D 2 121 ? -22.187 52.572 102.714 1.00 67.09  ? 102  ARG D N   1 
ATOM   8936 C CA  . ARG D 2 121 ? -23.157 53.528 102.206 1.00 53.46  ? 102  ARG D CA  1 
ATOM   8937 C C   . ARG D 2 121 ? -22.655 54.939 102.323 1.00 56.05  ? 102  ARG D C   1 
ATOM   8938 O O   . ARG D 2 121 ? -22.874 55.757 101.438 1.00 83.58  ? 102  ARG D O   1 
ATOM   8939 C CB  . ARG D 2 121 ? -24.493 53.386 102.924 1.00 67.16  ? 102  ARG D CB  1 
ATOM   8940 C CG  . ARG D 2 121 ? -25.321 52.236 102.411 1.00 91.89  ? 102  ARG D CG  1 
ATOM   8941 C CD  . ARG D 2 121 ? -25.236 52.160 100.900 1.00 93.14  ? 102  ARG D CD  1 
ATOM   8942 N NE  . ARG D 2 121 ? -26.219 51.239 100.343 1.00 107.98 ? 102  ARG D NE  1 
ATOM   8943 C CZ  . ARG D 2 121 ? -26.228 50.836 99.080  1.00 109.48 ? 102  ARG D CZ  1 
ATOM   8944 N NH1 . ARG D 2 121 ? -25.298 51.269 98.241  1.00 95.47  ? 102  ARG D NH1 1 
ATOM   8945 N NH2 . ARG D 2 121 ? -27.161 49.997 98.656  1.00 117.96 ? 102  ARG D NH2 1 
ATOM   8946 N N   . HIS D 2 122 ? -21.978 55.236 103.419 1.00 54.64  ? 103  HIS D N   1 
ATOM   8947 C CA  . HIS D 2 122 ? -21.465 56.576 103.578 1.00 80.98  ? 103  HIS D CA  1 
ATOM   8948 C C   . HIS D 2 122 ? -20.576 56.881 102.381 1.00 83.56  ? 103  HIS D C   1 
ATOM   8949 O O   . HIS D 2 122 ? -20.740 57.923 101.723 1.00 91.74  ? 103  HIS D O   1 
ATOM   8950 C CB  . HIS D 2 122 ? -20.700 56.753 104.894 1.00 66.17  ? 103  HIS D CB  1 
ATOM   8951 C CG  . HIS D 2 122 ? -19.938 58.046 104.992 1.00 89.49  ? 103  HIS D CG  1 
ATOM   8952 N ND1 . HIS D 2 122 ? -19.912 58.813 106.138 1.00 95.83  ? 103  HIS D ND1 1 
ATOM   8953 C CD2 . HIS D 2 122 ? -19.167 58.703 104.089 1.00 102.26 ? 103  HIS D CD2 1 
ATOM   8954 C CE1 . HIS D 2 122 ? -19.150 59.877 105.943 1.00 89.29  ? 103  HIS D CE1 1 
ATOM   8955 N NE2 . HIS D 2 122 ? -18.691 59.839 104.705 1.00 97.23  ? 103  HIS D NE2 1 
ATOM   8956 N N   . HIS D 2 123 ? -19.662 55.962 102.087 1.00 67.31  ? 104  HIS D N   1 
ATOM   8957 C CA  . HIS D 2 123 ? -18.618 56.228 101.111 1.00 76.38  ? 104  HIS D CA  1 
ATOM   8958 C C   . HIS D 2 123 ? -19.035 56.019 99.659  1.00 82.77  ? 104  HIS D C   1 
ATOM   8959 O O   . HIS D 2 123 ? -18.549 56.706 98.760  1.00 77.84  ? 104  HIS D O   1 
ATOM   8960 C CB  . HIS D 2 123 ? -17.390 55.400 101.436 1.00 75.18  ? 104  HIS D CB  1 
ATOM   8961 C CG  . HIS D 2 123 ? -16.621 55.908 102.613 1.00 88.18  ? 104  HIS D CG  1 
ATOM   8962 N ND1 . HIS D 2 123 ? -15.478 56.673 102.486 1.00 76.89  ? 104  HIS D ND1 1 
ATOM   8963 C CD2 . HIS D 2 123 ? -16.829 55.758 103.941 1.00 85.79  ? 104  HIS D CD2 1 
ATOM   8964 C CE1 . HIS D 2 123 ? -15.012 56.967 103.685 1.00 66.01  ? 104  HIS D CE1 1 
ATOM   8965 N NE2 . HIS D 2 123 ? -15.815 56.424 104.586 1.00 81.38  ? 104  HIS D NE2 1 
ATOM   8966 N N   . CYS D 2 124 ? -19.919 55.057 99.429  1.00 77.46  ? 105  CYS D N   1 
ATOM   8967 C CA  . CYS D 2 124 ? -20.361 54.745 98.084  1.00 74.39  ? 105  CYS D CA  1 
ATOM   8968 C C   . CYS D 2 124 ? -21.852 54.485 98.092  1.00 81.46  ? 105  CYS D C   1 
ATOM   8969 O O   . CYS D 2 124 ? -22.278 53.337 98.275  1.00 82.43  ? 105  CYS D O   1 
ATOM   8970 C CB  . CYS D 2 124 ? -19.627 53.527 97.566  1.00 67.80  ? 105  CYS D CB  1 
ATOM   8971 S SG  . CYS D 2 124 ? -17.855 53.730 97.582  1.00 82.90  ? 105  CYS D SG  1 
ATOM   8972 N N   . PRO D 2 125 ? -22.654 55.555 97.914  1.00 78.82  ? 106  PRO D N   1 
ATOM   8973 C CA  . PRO D 2 125 ? -24.114 55.518 98.014  1.00 68.24  ? 106  PRO D CA  1 
ATOM   8974 C C   . PRO D 2 125 ? -24.778 54.611 97.001  1.00 76.13  ? 106  PRO D C   1 
ATOM   8975 O O   . PRO D 2 125 ? -25.770 53.966 97.331  1.00 81.19  ? 106  PRO D O   1 
ATOM   8976 C CB  . PRO D 2 125 ? -24.521 56.962 97.741  1.00 64.60  ? 106  PRO D CB  1 
ATOM   8977 C CG  . PRO D 2 125 ? -23.334 57.769 98.126  1.00 73.52  ? 106  PRO D CG  1 
ATOM   8978 C CD  . PRO D 2 125 ? -22.152 56.933 97.755  1.00 77.86  ? 106  PRO D CD  1 
ATOM   8979 N N   . ASN D 2 126 ? -24.240 54.547 95.784  1.00 70.06  ? 107  ASN D N   1 
ATOM   8980 C CA  . ASN D 2 126 ? -24.937 53.825 94.693  1.00 81.00  ? 107  ASN D CA  1 
ATOM   8981 C C   . ASN D 2 126 ? -24.345 52.493 94.232  1.00 88.03  ? 107  ASN D C   1 
ATOM   8982 O O   . ASN D 2 126 ? -24.990 51.783 93.460  1.00 94.87  ? 107  ASN D O   1 
ATOM   8983 C CB  . ASN D 2 126 ? -25.159 54.728 93.479  1.00 72.71  ? 107  ASN D CB  1 
ATOM   8984 C CG  . ASN D 2 126 ? -25.622 56.106 93.870  1.00 81.82  ? 107  ASN D CG  1 
ATOM   8985 O OD1 . ASN D 2 126 ? -24.969 57.106 93.561  1.00 84.51  ? 107  ASN D OD1 1 
ATOM   8986 N ND2 . ASN D 2 126 ? -26.739 56.170 94.593  1.00 70.09  ? 107  ASN D ND2 1 
ATOM   8987 N N   . THR D 2 127 ? -23.133 52.166 94.690  1.00 79.67  ? 108  THR D N   1 
ATOM   8988 C CA  . THR D 2 127 ? -22.526 50.859 94.441  1.00 73.06  ? 108  THR D CA  1 
ATOM   8989 C C   . THR D 2 127 ? -23.349 49.742 95.062  1.00 71.88  ? 108  THR D C   1 
ATOM   8990 O O   . THR D 2 127 ? -23.665 49.811 96.249  1.00 70.51  ? 108  THR D O   1 
ATOM   8991 C CB  . THR D 2 127 ? -21.147 50.780 95.046  1.00 69.51  ? 108  THR D CB  1 
ATOM   8992 O OG1 . THR D 2 127 ? -20.416 51.959 94.708  1.00 80.74  ? 108  THR D OG1 1 
ATOM   8993 C CG2 . THR D 2 127 ? -20.417 49.596 94.496  1.00 72.55  ? 108  THR D CG2 1 
ATOM   8994 N N   . PRO D 2 128 ? -23.691 48.705 94.269  1.00 69.26  ? 109  PRO D N   1 
ATOM   8995 C CA  . PRO D 2 128 ? -24.544 47.619 94.750  1.00 69.00  ? 109  PRO D CA  1 
ATOM   8996 C C   . PRO D 2 128 ? -23.915 46.852 95.923  1.00 70.98  ? 109  PRO D C   1 
ATOM   8997 O O   . PRO D 2 128 ? -22.706 46.956 96.168  1.00 64.82  ? 109  PRO D O   1 
ATOM   8998 C CB  . PRO D 2 128 ? -24.676 46.711 93.524  1.00 51.67  ? 109  PRO D CB  1 
ATOM   8999 C CG  . PRO D 2 128 ? -24.269 47.541 92.387  1.00 51.48  ? 109  PRO D CG  1 
ATOM   9000 C CD  . PRO D 2 128 ? -23.252 48.464 92.885  1.00 54.16  ? 109  PRO D CD  1 
ATOM   9001 N N   . ILE D 2 129 ? -24.736 46.096 96.643  1.00 77.93  ? 110  ILE D N   1 
ATOM   9002 C CA  . ILE D 2 129 ? -24.264 45.339 97.792  1.00 70.83  ? 110  ILE D CA  1 
ATOM   9003 C C   . ILE D 2 129 ? -24.833 43.927 97.790  1.00 58.54  ? 110  ILE D C   1 
ATOM   9004 O O   . ILE D 2 129 ? -26.000 43.717 97.507  1.00 55.82  ? 110  ILE D O   1 
ATOM   9005 C CB  . ILE D 2 129 ? -24.650 46.034 99.132  1.00 73.72  ? 110  ILE D CB  1 
ATOM   9006 C CG1 . ILE D 2 129 ? -23.768 47.261 99.416  1.00 64.70  ? 110  ILE D CG1 1 
ATOM   9007 C CG2 . ILE D 2 129 ? -24.599 45.056 100.306 1.00 64.49  ? 110  ILE D CG2 1 
ATOM   9008 C CD1 . ILE D 2 129 ? -24.149 47.974 100.718 1.00 58.20  ? 110  ILE D CD1 1 
ATOM   9009 N N   . ILE D 2 130 ? -23.995 42.966 98.143  1.00 71.95  ? 111  ILE D N   1 
ATOM   9010 C CA  . ILE D 2 130 ? -24.422 41.584 98.213  1.00 64.55  ? 111  ILE D CA  1 
ATOM   9011 C C   . ILE D 2 130 ? -24.164 41.161 99.645  1.00 67.78  ? 111  ILE D C   1 
ATOM   9012 O O   . ILE D 2 130 ? -23.077 41.376 100.170 1.00 69.06  ? 111  ILE D O   1 
ATOM   9013 C CB  . ILE D 2 130 ? -23.653 40.682 97.249  1.00 63.20  ? 111  ILE D CB  1 
ATOM   9014 C CG1 . ILE D 2 130 ? -23.980 41.058 95.807  1.00 65.33  ? 111  ILE D CG1 1 
ATOM   9015 C CG2 . ILE D 2 130 ? -24.011 39.231 97.491  1.00 56.74  ? 111  ILE D CG2 1 
ATOM   9016 C CD1 . ILE D 2 130 ? -23.575 40.017 94.811  1.00 59.86  ? 111  ILE D CD1 1 
ATOM   9017 N N   . LEU D 2 131 ? -25.159 40.562 100.284 1.00 55.64  ? 112  LEU D N   1 
ATOM   9018 C CA  . LEU D 2 131 ? -24.990 40.131 101.661 1.00 58.68  ? 112  LEU D CA  1 
ATOM   9019 C C   . LEU D 2 131 ? -24.583 38.676 101.670 1.00 60.92  ? 112  LEU D C   1 
ATOM   9020 O O   . LEU D 2 131 ? -25.230 37.839 101.050 1.00 51.54  ? 112  LEU D O   1 
ATOM   9021 C CB  . LEU D 2 131 ? -26.279 40.318 102.455 1.00 62.63  ? 112  LEU D CB  1 
ATOM   9022 C CG  . LEU D 2 131 ? -26.100 40.201 103.966 1.00 59.79  ? 112  LEU D CG  1 
ATOM   9023 C CD1 . LEU D 2 131 ? -25.315 41.384 104.482 1.00 67.05  ? 112  LEU D CD1 1 
ATOM   9024 C CD2 . LEU D 2 131 ? -27.435 40.105 104.661 1.00 54.60  ? 112  LEU D CD2 1 
ATOM   9025 N N   . VAL D 2 132 ? -23.500 38.373 102.371 1.00 53.84  ? 113  VAL D N   1 
ATOM   9026 C CA  . VAL D 2 132 ? -23.031 37.004 102.428 1.00 51.50  ? 113  VAL D CA  1 
ATOM   9027 C C   . VAL D 2 132 ? -22.946 36.399 103.821 1.00 54.23  ? 113  VAL D C   1 
ATOM   9028 O O   . VAL D 2 132 ? -22.391 36.984 104.741 1.00 54.81  ? 113  VAL D O   1 
ATOM   9029 C CB  . VAL D 2 132 ? -21.662 36.857 101.746 1.00 46.66  ? 113  VAL D CB  1 
ATOM   9030 C CG1 . VAL D 2 132 ? -21.265 35.402 101.687 1.00 36.86  ? 113  VAL D CG1 1 
ATOM   9031 C CG2 . VAL D 2 132 ? -21.704 37.447 100.355 1.00 42.95  ? 113  VAL D CG2 1 
ATOM   9032 N N   . GLY D 2 133 ? -23.511 35.207 103.940 1.00 52.79  ? 114  GLY D N   1 
ATOM   9033 C CA  . GLY D 2 133 ? -23.530 34.433 105.169 1.00 54.36  ? 114  GLY D CA  1 
ATOM   9034 C C   . GLY D 2 133 ? -22.516 33.313 105.102 1.00 62.82  ? 114  GLY D C   1 
ATOM   9035 O O   . GLY D 2 133 ? -22.633 32.411 104.274 1.00 51.43  ? 114  GLY D O   1 
ATOM   9036 N N   . THR D 2 134 ? -21.519 33.382 105.982 1.00 60.61  ? 115  THR D N   1 
ATOM   9037 C CA  . THR D 2 134 ? -20.367 32.499 105.965 1.00 47.14  ? 115  THR D CA  1 
ATOM   9038 C C   . THR D 2 134 ? -20.640 31.318 106.824 1.00 43.54  ? 115  THR D C   1 
ATOM   9039 O O   . THR D 2 134 ? -21.658 31.274 107.451 1.00 68.95  ? 115  THR D O   1 
ATOM   9040 C CB  . THR D 2 134 ? -19.199 33.233 106.552 1.00 59.28  ? 115  THR D CB  1 
ATOM   9041 O OG1 . THR D 2 134 ? -19.073 34.461 105.849 1.00 66.91  ? 115  THR D OG1 1 
ATOM   9042 C CG2 . THR D 2 134 ? -17.927 32.461 106.340 1.00 74.95  ? 115  THR D CG2 1 
ATOM   9043 N N   . LYS D 2 135 ? -19.699 30.386 106.900 1.00 51.79  ? 116  LYS D N   1 
ATOM   9044 C CA  . LYS D 2 135 ? -19.836 29.206 107.749 1.00 52.79  ? 116  LYS D CA  1 
ATOM   9045 C C   . LYS D 2 135 ? -21.194 28.531 107.693 1.00 58.37  ? 116  LYS D C   1 
ATOM   9046 O O   . LYS D 2 135 ? -21.727 28.129 108.720 1.00 50.46  ? 116  LYS D O   1 
ATOM   9047 C CB  . LYS D 2 135 ? -19.556 29.588 109.204 1.00 44.74  ? 116  LYS D CB  1 
ATOM   9048 C CG  . LYS D 2 135 ? -18.282 30.385 109.421 1.00 40.69  ? 116  LYS D CG  1 
ATOM   9049 C CD  . LYS D 2 135 ? -17.070 29.483 109.524 1.00 64.00  ? 116  LYS D CD  1 
ATOM   9050 C CE  . LYS D 2 135 ? -15.789 30.286 109.663 1.00 79.19  ? 116  LYS D CE  1 
ATOM   9051 N NZ  . LYS D 2 135 ? -15.773 31.128 110.887 1.00 72.19  ? 116  LYS D NZ  1 
ATOM   9052 N N   . LEU D 2 136 ? -21.753 28.402 106.500 1.00 52.97  ? 117  LEU D N   1 
ATOM   9053 C CA  . LEU D 2 136 ? -23.051 27.772 106.343 1.00 37.87  ? 117  LEU D CA  1 
ATOM   9054 C C   . LEU D 2 136 ? -23.036 26.317 106.788 1.00 57.07  ? 117  LEU D C   1 
ATOM   9055 O O   . LEU D 2 136 ? -24.084 25.730 107.037 1.00 68.99  ? 117  LEU D O   1 
ATOM   9056 C CB  . LEU D 2 136 ? -23.505 27.860 104.890 1.00 59.10  ? 117  LEU D CB  1 
ATOM   9057 C CG  . LEU D 2 136 ? -24.694 26.984 104.511 1.00 61.53  ? 117  LEU D CG  1 
ATOM   9058 C CD1 . LEU D 2 136 ? -25.894 27.345 105.349 1.00 64.40  ? 117  LEU D CD1 1 
ATOM   9059 C CD2 . LEU D 2 136 ? -25.009 27.115 103.039 1.00 46.88  ? 117  LEU D CD2 1 
ATOM   9060 N N   . ASP D 2 137 ? -21.847 25.737 106.885 1.00 49.72  ? 118  ASP D N   1 
ATOM   9061 C CA  . ASP D 2 137 ? -21.715 24.343 107.290 1.00 59.13  ? 118  ASP D CA  1 
ATOM   9062 C C   . ASP D 2 137 ? -21.782 24.129 108.794 1.00 66.11  ? 118  ASP D C   1 
ATOM   9063 O O   . ASP D 2 137 ? -22.154 23.056 109.257 1.00 73.18  ? 118  ASP D O   1 
ATOM   9064 C CB  . ASP D 2 137 ? -20.415 23.748 106.744 1.00 53.57  ? 118  ASP D CB  1 
ATOM   9065 C CG  . ASP D 2 137 ? -19.190 24.531 107.163 1.00 57.64  ? 118  ASP D CG  1 
ATOM   9066 O OD1 . ASP D 2 137 ? -19.070 25.705 106.771 1.00 65.87  ? 118  ASP D OD1 1 
ATOM   9067 O OD2 . ASP D 2 137 ? -18.337 23.968 107.872 1.00 44.31  ? 118  ASP D OD2 1 
ATOM   9068 N N   . LEU D 2 138 ? -21.417 25.150 109.554 1.00 62.42  ? 119  LEU D N   1 
ATOM   9069 C CA  . LEU D 2 138 ? -21.432 25.051 111.005 1.00 59.54  ? 119  LEU D CA  1 
ATOM   9070 C C   . LEU D 2 138 ? -22.826 25.212 111.588 1.00 57.31  ? 119  LEU D C   1 
ATOM   9071 O O   . LEU D 2 138 ? -23.121 24.674 112.650 1.00 75.13  ? 119  LEU D O   1 
ATOM   9072 C CB  . LEU D 2 138 ? -20.477 26.071 111.617 1.00 48.08  ? 119  LEU D CB  1 
ATOM   9073 C CG  . LEU D 2 138 ? -18.999 25.784 111.373 1.00 56.01  ? 119  LEU D CG  1 
ATOM   9074 C CD1 . LEU D 2 138 ? -18.139 26.858 111.999 1.00 58.01  ? 119  LEU D CD1 1 
ATOM   9075 C CD2 . LEU D 2 138 ? -18.629 24.423 111.918 1.00 33.11  ? 119  LEU D CD2 1 
ATOM   9076 N N   . ARG D 2 139 ? -23.684 25.950 110.894 1.00 52.04  ? 120  ARG D N   1 
ATOM   9077 C CA  . ARG D 2 139 ? -25.066 26.164 111.382 1.00 44.18  ? 120  ARG D CA  1 
ATOM   9078 C C   . ARG D 2 139 ? -25.805 24.889 111.833 1.00 49.09  ? 120  ARG D C   1 
ATOM   9079 O O   . ARG D 2 139 ? -26.841 24.968 112.482 1.00 81.65  ? 120  ARG D O   1 
ATOM   9080 C CB  . ARG D 2 139 ? -25.917 26.930 110.366 1.00 37.73  ? 120  ARG D CB  1 
ATOM   9081 C CG  . ARG D 2 139 ? -27.346 27.151 110.822 1.00 39.32  ? 120  ARG D CG  1 
ATOM   9082 C CD  . ARG D 2 139 ? -28.081 28.253 110.065 1.00 56.29  ? 120  ARG D CD  1 
ATOM   9083 N NE  . ARG D 2 139 ? -28.529 27.812 108.748 1.00 67.49  ? 120  ARG D NE  1 
ATOM   9084 C CZ  . ARG D 2 139 ? -28.771 28.622 107.727 1.00 64.54  ? 120  ARG D CZ  1 
ATOM   9085 N NH1 . ARG D 2 139 ? -28.635 29.932 107.864 1.00 62.34  ? 120  ARG D NH1 1 
ATOM   9086 N NH2 . ARG D 2 139 ? -29.139 28.113 106.564 1.00 70.53  ? 120  ARG D NH2 1 
ATOM   9087 N N   . ASP D 2 140 ? -25.264 23.720 111.509 1.00 65.95  ? 121  ASP D N   1 
ATOM   9088 C CA  . ASP D 2 140 ? -25.857 22.450 111.919 1.00 70.16  ? 121  ASP D CA  1 
ATOM   9089 C C   . ASP D 2 140 ? -24.917 21.653 112.793 1.00 75.05  ? 121  ASP D C   1 
ATOM   9090 O O   . ASP D 2 140 ? -25.264 20.556 113.220 1.00 84.95  ? 121  ASP D O   1 
ATOM   9091 C CB  . ASP D 2 140 ? -26.230 21.597 110.700 1.00 95.32  ? 121  ASP D CB  1 
ATOM   9092 C CG  . ASP D 2 140 ? -27.452 22.131 109.946 1.00 106.30 ? 121  ASP D CG  1 
ATOM   9093 O OD1 . ASP D 2 140 ? -28.157 23.060 110.418 1.00 68.54  ? 121  ASP D OD1 1 
ATOM   9094 O OD2 . ASP D 2 140 ? -27.709 21.599 108.852 1.00 123.30 ? 121  ASP D OD2 1 
ATOM   9095 N N   . ASP D 2 141 ? -23.725 22.178 113.054 1.00 81.62  ? 122  ASP D N   1 
ATOM   9096 C CA  . ASP D 2 141 ? -22.789 21.460 113.903 1.00 85.47  ? 122  ASP D CA  1 
ATOM   9097 C C   . ASP D 2 141 ? -23.206 21.529 115.377 1.00 90.19  ? 122  ASP D C   1 
ATOM   9098 O O   . ASP D 2 141 ? -23.360 22.616 115.938 1.00 66.53  ? 122  ASP D O   1 
ATOM   9099 C CB  . ASP D 2 141 ? -21.369 21.974 113.723 1.00 72.15  ? 122  ASP D CB  1 
ATOM   9100 C CG  . ASP D 2 141 ? -20.352 21.110 114.445 1.00 84.33  ? 122  ASP D CG  1 
ATOM   9101 O OD1 . ASP D 2 141 ? -20.333 19.886 114.201 1.00 87.78  ? 122  ASP D OD1 1 
ATOM   9102 O OD2 . ASP D 2 141 ? -19.586 21.645 115.275 1.00 83.22  ? 122  ASP D OD2 1 
ATOM   9103 N N   . LYS D 2 142 ? -23.377 20.356 115.987 1.00 95.60  ? 123  LYS D N   1 
ATOM   9104 C CA  . LYS D 2 142 ? -23.882 20.242 117.355 1.00 79.91  ? 123  LYS D CA  1 
ATOM   9105 C C   . LYS D 2 142 ? -23.026 21.012 118.326 1.00 76.78  ? 123  LYS D C   1 
ATOM   9106 O O   . LYS D 2 142 ? -23.539 21.845 119.060 1.00 76.77  ? 123  LYS D O   1 
ATOM   9107 C CB  . LYS D 2 142 ? -23.977 18.782 117.802 1.00 87.07  ? 123  LYS D CB  1 
ATOM   9108 C CG  . LYS D 2 142 ? -24.950 17.935 116.984 1.00 114.00 ? 123  LYS D CG  1 
ATOM   9109 C CD  . LYS D 2 142 ? -26.415 18.081 117.434 1.00 113.76 ? 123  LYS D CD  1 
ATOM   9110 C CE  . LYS D 2 142 ? -27.318 17.054 116.745 1.00 108.64 ? 123  LYS D CE  1 
ATOM   9111 N NZ  . LYS D 2 142 ? -27.417 17.259 115.274 1.00 100.91 ? 123  LYS D NZ  1 
ATOM   9112 N N   . ASP D 2 143 ? -21.724 20.782 118.296 1.00 80.36  ? 124  ASP D N   1 
ATOM   9113 C CA  . ASP D 2 143 ? -20.835 21.441 119.226 1.00 74.77  ? 124  ASP D CA  1 
ATOM   9114 C C   . ASP D 2 143 ? -20.983 22.938 119.059 1.00 66.73  ? 124  ASP D C   1 
ATOM   9115 O O   . ASP D 2 143 ? -20.996 23.674 120.031 1.00 84.17  ? 124  ASP D O   1 
ATOM   9116 C CB  . ASP D 2 143 ? -19.387 21.021 118.962 1.00 89.12  ? 124  ASP D CB  1 
ATOM   9117 C CG  . ASP D 2 143 ? -19.197 19.518 118.990 1.00 105.12 ? 124  ASP D CG  1 
ATOM   9118 O OD1 . ASP D 2 143 ? -20.193 18.783 118.877 1.00 109.63 ? 124  ASP D OD1 1 
ATOM   9119 O OD2 . ASP D 2 143 ? -18.042 19.073 119.134 1.00 103.85 ? 124  ASP D OD2 1 
ATOM   9120 N N   . THR D 2 144 ? -21.098 23.390 117.822 1.00 63.03  ? 125  THR D N   1 
ATOM   9121 C CA  . THR D 2 144 ? -21.268 24.807 117.562 1.00 60.16  ? 125  THR D CA  1 
ATOM   9122 C C   . THR D 2 144 ? -22.578 25.349 118.132 1.00 59.22  ? 125  THR D C   1 
ATOM   9123 O O   . THR D 2 144 ? -22.616 26.449 118.678 1.00 63.39  ? 125  THR D O   1 
ATOM   9124 C CB  . THR D 2 144 ? -21.200 25.088 116.070 1.00 62.26  ? 125  THR D CB  1 
ATOM   9125 O OG1 . THR D 2 144 ? -19.995 24.518 115.549 1.00 59.05  ? 125  THR D OG1 1 
ATOM   9126 C CG2 . THR D 2 144 ? -21.213 26.568 115.811 1.00 40.39  ? 125  THR D CG2 1 
ATOM   9127 N N   . ILE D 2 145 ? -23.650 24.580 117.991 1.00 60.21  ? 126  ILE D N   1 
ATOM   9128 C CA  . ILE D 2 145 ? -24.952 24.987 118.501 1.00 70.02  ? 126  ILE D CA  1 
ATOM   9129 C C   . ILE D 2 145 ? -24.951 25.106 120.022 1.00 72.78  ? 126  ILE D C   1 
ATOM   9130 O O   . ILE D 2 145 ? -25.537 26.025 120.583 1.00 64.96  ? 126  ILE D O   1 
ATOM   9131 C CB  . ILE D 2 145 ? -26.049 24.000 118.080 1.00 72.40  ? 126  ILE D CB  1 
ATOM   9132 C CG1 . ILE D 2 145 ? -25.929 23.670 116.593 1.00 58.63  ? 126  ILE D CG1 1 
ATOM   9133 C CG2 . ILE D 2 145 ? -27.416 24.577 118.379 1.00 46.95  ? 126  ILE D CG2 1 
ATOM   9134 C CD1 . ILE D 2 145 ? -26.349 24.796 115.689 1.00 66.42  ? 126  ILE D CD1 1 
ATOM   9135 N N   . GLU D 2 146 ? -24.287 24.162 120.677 1.00 72.22  ? 127  GLU D N   1 
ATOM   9136 C CA  . GLU D 2 146 ? -24.194 24.122 122.128 1.00 83.37  ? 127  GLU D CA  1 
ATOM   9137 C C   . GLU D 2 146 ? -23.458 25.305 122.725 1.00 76.48  ? 127  GLU D C   1 
ATOM   9138 O O   . GLU D 2 146 ? -23.894 25.890 123.708 1.00 78.79  ? 127  GLU D O   1 
ATOM   9139 C CB  . GLU D 2 146 ? -23.423 22.873 122.548 1.00 90.33  ? 127  GLU D CB  1 
ATOM   9140 C CG  . GLU D 2 146 ? -24.172 21.571 122.457 1.00 110.93 ? 127  GLU D CG  1 
ATOM   9141 C CD  . GLU D 2 146 ? -23.239 20.382 122.581 1.00 133.47 ? 127  GLU D CD  1 
ATOM   9142 O OE1 . GLU D 2 146 ? -22.019 20.601 122.736 1.00 130.56 ? 127  GLU D OE1 1 
ATOM   9143 O OE2 . GLU D 2 146 ? -23.718 19.232 122.519 1.00 144.51 ? 127  GLU D OE2 1 
ATOM   9144 N N   . LYS D 2 147 ? -22.334 25.650 122.120 1.00 65.97  ? 128  LYS D N   1 
ATOM   9145 C CA  . LYS D 2 147 ? -21.522 26.753 122.590 1.00 65.70  ? 128  LYS D CA  1 
ATOM   9146 C C   . LYS D 2 147 ? -22.300 28.039 122.454 1.00 61.68  ? 128  LYS D C   1 
ATOM   9147 O O   . LYS D 2 147 ? -22.219 28.917 123.298 1.00 72.16  ? 128  LYS D O   1 
ATOM   9148 C CB  . LYS D 2 147 ? -20.179 26.775 121.864 1.00 67.44  ? 128  LYS D CB  1 
ATOM   9149 C CG  . LYS D 2 147 ? -19.332 25.551 122.212 1.00 62.25  ? 128  LYS D CG  1 
ATOM   9150 C CD  . LYS D 2 147 ? -17.848 25.771 121.982 1.00 87.18  ? 128  LYS D CD  1 
ATOM   9151 C CE  . LYS D 2 147 ? -17.387 25.105 120.698 1.00 104.77 ? 128  LYS D CE  1 
ATOM   9152 N NZ  . LYS D 2 147 ? -17.700 25.917 119.492 1.00 85.24  ? 128  LYS D NZ  1 
ATOM   9153 N N   . LEU D 2 148 ? -23.062 28.140 121.381 1.00 57.68  ? 129  LEU D N   1 
ATOM   9154 C CA  . LEU D 2 148 ? -23.863 29.334 121.161 1.00 61.61  ? 129  LEU D CA  1 
ATOM   9155 C C   . LEU D 2 148 ? -24.954 29.487 122.196 1.00 62.50  ? 129  LEU D C   1 
ATOM   9156 O O   . LEU D 2 148 ? -25.212 30.590 122.670 1.00 62.98  ? 129  LEU D O   1 
ATOM   9157 C CB  . LEU D 2 148 ? -24.507 29.294 119.789 1.00 65.95  ? 129  LEU D CB  1 
ATOM   9158 C CG  . LEU D 2 148 ? -23.661 29.656 118.591 1.00 61.24  ? 129  LEU D CG  1 
ATOM   9159 C CD1 . LEU D 2 148 ? -24.583 29.782 117.398 1.00 68.32  ? 129  LEU D CD1 1 
ATOM   9160 C CD2 . LEU D 2 148 ? -22.941 30.942 118.849 1.00 55.45  ? 129  LEU D CD2 1 
ATOM   9161 N N   . LYS D 2 149 ? -25.606 28.366 122.509 1.00 54.82  ? 130  LYS D N   1 
ATOM   9162 C CA  . LYS D 2 149 ? -26.687 28.324 123.493 1.00 71.62  ? 130  LYS D CA  1 
ATOM   9163 C C   . LYS D 2 149 ? -26.138 28.724 124.866 1.00 76.85  ? 130  LYS D C   1 
ATOM   9164 O O   . LYS D 2 149 ? -26.732 29.557 125.537 1.00 68.66  ? 130  LYS D O   1 
ATOM   9165 C CB  . LYS D 2 149 ? -27.371 26.946 123.540 1.00 40.58  ? 130  LYS D CB  1 
ATOM   9166 C CG  . LYS D 2 149 ? -28.536 26.907 124.499 1.00 96.36  ? 130  LYS D CG  1 
ATOM   9167 C CD  . LYS D 2 149 ? -29.269 25.530 124.519 1.00 128.99 ? 130  LYS D CD  1 
ATOM   9168 C CE  . LYS D 2 149 ? -30.423 25.590 125.547 1.00 121.22 ? 130  LYS D CE  1 
ATOM   9169 N N   . GLU D 2 150 ? -24.982 28.199 125.241 1.00 57.94  ? 131  GLU D N   1 
ATOM   9170 C CA  . GLU D 2 150 ? -24.400 28.521 126.532 1.00 64.38  ? 131  GLU D CA  1 
ATOM   9171 C C   . GLU D 2 150 ? -24.285 30.028 126.636 1.00 78.66  ? 131  GLU D C   1 
ATOM   9172 O O   . GLU D 2 150 ? -24.424 30.593 127.715 1.00 82.66  ? 131  GLU D O   1 
ATOM   9173 C CB  . GLU D 2 150 ? -23.020 27.888 126.667 1.00 64.66  ? 131  GLU D CB  1 
ATOM   9174 C CG  . GLU D 2 150 ? -23.000 26.390 126.479 1.00 73.97  ? 131  GLU D CG  1 
ATOM   9175 C CD  . GLU D 2 150 ? -21.611 25.812 126.627 1.00 107.45 ? 131  GLU D CD  1 
ATOM   9176 O OE1 . GLU D 2 150 ? -20.642 26.596 126.643 1.00 111.88 ? 131  GLU D OE1 1 
ATOM   9177 O OE2 . GLU D 2 150 ? -21.485 24.575 126.725 1.00 112.50 ? 131  GLU D OE2 1 
ATOM   9178 N N   . LYS D 2 151 ? -24.031 30.676 125.511 1.00 78.37  ? 132  LYS D N   1 
ATOM   9179 C CA  . LYS D 2 151 ? -23.907 32.123 125.471 1.00 63.83  ? 132  LYS D CA  1 
ATOM   9180 C C   . LYS D 2 151 ? -25.279 32.740 125.216 1.00 65.24  ? 132  LYS D C   1 
ATOM   9181 O O   . LYS D 2 151 ? -25.406 33.946 125.031 1.00 57.12  ? 132  LYS D O   1 
ATOM   9182 C CB  . LYS D 2 151 ? -22.909 32.548 124.402 1.00 73.58  ? 132  LYS D CB  1 
ATOM   9183 C CG  . LYS D 2 151 ? -21.623 31.759 124.457 1.00 85.73  ? 132  LYS D CG  1 
ATOM   9184 C CD  . LYS D 2 151 ? -20.447 32.575 123.984 1.00 94.22  ? 132  LYS D CD  1 
ATOM   9185 C CE  . LYS D 2 151 ? -19.162 31.871 124.345 1.00 102.86 ? 132  LYS D CE  1 
ATOM   9186 N NZ  . LYS D 2 151 ? -18.026 32.474 123.603 1.00 124.22 ? 132  LYS D NZ  1 
ATOM   9187 N N   . LYS D 2 152 ? -26.306 31.894 125.212 1.00 67.23  ? 133  LYS D N   1 
ATOM   9188 C CA  . LYS D 2 152 ? -27.676 32.339 124.980 1.00 77.92  ? 133  LYS D CA  1 
ATOM   9189 C C   . LYS D 2 152 ? -27.874 32.957 123.605 1.00 69.34  ? 133  LYS D C   1 
ATOM   9190 O O   . LYS D 2 152 ? -28.589 33.943 123.451 1.00 66.29  ? 133  LYS D O   1 
ATOM   9191 C CB  . LYS D 2 152 ? -28.090 33.342 126.058 1.00 89.79  ? 133  LYS D CB  1 
ATOM   9192 N N   . LEU D 2 153 ? -27.227 32.362 122.612 1.00 62.47  ? 134  LEU D N   1 
ATOM   9193 C CA  . LEU D 2 153 ? -27.298 32.825 121.227 1.00 70.33  ? 134  LEU D CA  1 
ATOM   9194 C C   . LEU D 2 153 ? -27.618 31.652 120.313 1.00 79.37  ? 134  LEU D C   1 
ATOM   9195 O O   . LEU D 2 153 ? -27.264 30.502 120.604 1.00 76.96  ? 134  LEU D O   1 
ATOM   9196 C CB  . LEU D 2 153 ? -25.975 33.465 120.785 1.00 82.39  ? 134  LEU D CB  1 
ATOM   9197 C CG  . LEU D 2 153 ? -25.261 34.529 121.641 1.00 65.80  ? 134  LEU D CG  1 
ATOM   9198 C CD1 . LEU D 2 153 ? -23.764 34.397 121.557 1.00 41.21  ? 134  LEU D CD1 1 
ATOM   9199 C CD2 . LEU D 2 153 ? -25.684 35.943 121.256 1.00 70.63  ? 134  LEU D CD2 1 
ATOM   9200 N N   . THR D 2 154 ? -28.293 31.949 119.205 1.00 77.86  ? 135  THR D N   1 
ATOM   9201 C CA  . THR D 2 154 ? -28.562 30.944 118.184 1.00 75.84  ? 135  THR D CA  1 
ATOM   9202 C C   . THR D 2 154 ? -28.048 31.398 116.807 1.00 71.43  ? 135  THR D C   1 
ATOM   9203 O O   . THR D 2 154 ? -27.923 32.610 116.543 1.00 64.25  ? 135  THR D O   1 
ATOM   9204 C CB  . THR D 2 154 ? -30.076 30.569 118.100 1.00 86.03  ? 135  THR D CB  1 
ATOM   9205 O OG1 . THR D 2 154 ? -30.862 31.741 117.822 1.00 96.15  ? 135  THR D OG1 1 
ATOM   9206 C CG2 . THR D 2 154 ? -30.572 29.863 119.398 1.00 75.71  ? 135  THR D CG2 1 
ATOM   9207 N N   . PRO D 2 155 ? -27.746 30.425 115.918 1.00 64.00  ? 136  PRO D N   1 
ATOM   9208 C CA  . PRO D 2 155 ? -27.184 30.790 114.628 1.00 54.74  ? 136  PRO D CA  1 
ATOM   9209 C C   . PRO D 2 155 ? -28.215 31.606 113.922 1.00 59.13  ? 136  PRO D C   1 
ATOM   9210 O O   . PRO D 2 155 ? -29.394 31.501 114.246 1.00 75.63  ? 136  PRO D O   1 
ATOM   9211 C CB  . PRO D 2 155 ? -27.003 29.448 113.907 1.00 49.85  ? 136  PRO D CB  1 
ATOM   9212 C CG  . PRO D 2 155 ? -27.034 28.398 114.986 1.00 67.86  ? 136  PRO D CG  1 
ATOM   9213 C CD  . PRO D 2 155 ? -28.004 28.974 116.004 1.00 55.67  ? 136  PRO D CD  1 
ATOM   9214 N N   . ILE D 2 156 ? -27.762 32.432 112.992 1.00 66.33  ? 137  ILE D N   1 
ATOM   9215 C CA  . ILE D 2 156 ? -28.630 33.217 112.143 1.00 69.28  ? 137  ILE D CA  1 
ATOM   9216 C C   . ILE D 2 156 ? -29.320 32.274 111.155 1.00 71.05  ? 137  ILE D C   1 
ATOM   9217 O O   . ILE D 2 156 ? -28.690 31.346 110.634 1.00 84.47  ? 137  ILE D O   1 
ATOM   9218 C CB  . ILE D 2 156 ? -27.821 34.293 111.373 1.00 62.85  ? 137  ILE D CB  1 
ATOM   9219 C CG1 . ILE D 2 156 ? -26.846 35.066 112.296 1.00 63.69  ? 137  ILE D CG1 1 
ATOM   9220 C CG2 . ILE D 2 156 ? -28.759 35.210 110.584 1.00 65.59  ? 137  ILE D CG2 1 
ATOM   9221 C CD1 . ILE D 2 156 ? -27.479 36.028 113.316 1.00 57.15  ? 137  ILE D CD1 1 
ATOM   9222 N N   . THR D 2 157 ? -30.608 32.501 110.911 1.00 60.06  ? 138  THR D N   1 
ATOM   9223 C CA  . THR D 2 157 ? -31.375 31.639 110.014 1.00 75.73  ? 138  THR D CA  1 
ATOM   9224 C C   . THR D 2 157 ? -31.486 32.288 108.655 1.00 72.19  ? 138  THR D C   1 
ATOM   9225 O O   . THR D 2 157 ? -31.301 33.507 108.546 1.00 61.91  ? 138  THR D O   1 
ATOM   9226 C CB  . THR D 2 157 ? -32.783 31.438 110.543 1.00 64.62  ? 138  THR D CB  1 
ATOM   9227 O OG1 . THR D 2 157 ? -33.352 32.728 110.834 1.00 57.88  ? 138  THR D OG1 1 
ATOM   9228 C CG2 . THR D 2 157 ? -32.738 30.587 111.785 1.00 49.03  ? 138  THR D CG2 1 
ATOM   9229 N N   . TYR D 2 158 ? -31.810 31.483 107.641 1.00 70.05  ? 139  TYR D N   1 
ATOM   9230 C CA  . TYR D 2 158 ? -32.058 32.010 106.307 1.00 75.91  ? 139  TYR D CA  1 
ATOM   9231 C C   . TYR D 2 158 ? -33.045 33.189 106.300 1.00 75.04  ? 139  TYR D C   1 
ATOM   9232 O O   . TYR D 2 158 ? -32.756 34.241 105.703 1.00 69.03  ? 139  TYR D O   1 
ATOM   9233 C CB  . TYR D 2 158 ? -32.561 30.927 105.346 1.00 79.24  ? 139  TYR D CB  1 
ATOM   9234 C CG  . TYR D 2 158 ? -32.549 31.420 103.912 1.00 72.79  ? 139  TYR D CG  1 
ATOM   9235 C CD1 . TYR D 2 158 ? -33.545 32.293 103.436 1.00 55.78  ? 139  TYR D CD1 1 
ATOM   9236 C CD2 . TYR D 2 158 ? -31.505 31.062 103.049 1.00 67.64  ? 139  TYR D CD2 1 
ATOM   9237 C CE1 . TYR D 2 158 ? -33.511 32.777 102.147 1.00 69.82  ? 139  TYR D CE1 1 
ATOM   9238 C CE2 . TYR D 2 158 ? -31.460 31.543 101.743 1.00 78.90  ? 139  TYR D CE2 1 
ATOM   9239 C CZ  . TYR D 2 158 ? -32.468 32.399 101.298 1.00 85.23  ? 139  TYR D CZ  1 
ATOM   9240 O OH  . TYR D 2 158 ? -32.420 32.857 99.998  1.00 82.82  ? 139  TYR D OH  1 
ATOM   9241 N N   . PRO D 2 159 ? -34.223 33.018 106.940 1.00 76.13  ? 140  PRO D N   1 
ATOM   9242 C CA  . PRO D 2 159 ? -35.205 34.116 106.969 1.00 69.92  ? 140  PRO D CA  1 
ATOM   9243 C C   . PRO D 2 159 ? -34.662 35.388 107.590 1.00 63.42  ? 140  PRO D C   1 
ATOM   9244 O O   . PRO D 2 159 ? -34.989 36.478 107.130 1.00 63.20  ? 140  PRO D O   1 
ATOM   9245 C CB  . PRO D 2 159 ? -36.332 33.546 107.816 1.00 61.85  ? 140  PRO D CB  1 
ATOM   9246 C CG  . PRO D 2 159 ? -36.270 32.083 107.554 1.00 66.80  ? 140  PRO D CG  1 
ATOM   9247 C CD  . PRO D 2 159 ? -34.806 31.764 107.453 1.00 65.86  ? 140  PRO D CD  1 
ATOM   9248 N N   . GLN D 2 160 ? -33.818 35.247 108.606 1.00 57.45  ? 141  GLN D N   1 
ATOM   9249 C CA  . GLN D 2 160 ? -33.171 36.417 109.217 1.00 70.77  ? 141  GLN D CA  1 
ATOM   9250 C C   . GLN D 2 160 ? -32.148 37.123 108.309 1.00 81.02  ? 141  GLN D C   1 
ATOM   9251 O O   . GLN D 2 160 ? -32.068 38.377 108.281 1.00 81.56  ? 141  GLN D O   1 
ATOM   9252 C CB  . GLN D 2 160 ? -32.449 36.062 110.502 1.00 82.42  ? 141  GLN D CB  1 
ATOM   9253 C CG  . GLN D 2 160 ? -33.162 35.156 111.448 1.00 82.23  ? 141  GLN D CG  1 
ATOM   9254 C CD  . GLN D 2 160 ? -32.473 35.173 112.790 1.00 77.23  ? 141  GLN D CD  1 
ATOM   9255 O OE1 . GLN D 2 160 ? -32.594 36.144 113.524 1.00 82.82  ? 141  GLN D OE1 1 
ATOM   9256 N NE2 . GLN D 2 160 ? -31.724 34.115 113.112 1.00 75.19  ? 141  GLN D NE2 1 
ATOM   9257 N N   . GLY D 2 161 ? -31.351 36.348 107.589 1.00 61.73  ? 142  GLY D N   1 
ATOM   9258 C CA  . GLY D 2 161 ? -30.366 36.941 106.713 1.00 58.02  ? 142  GLY D CA  1 
ATOM   9259 C C   . GLY D 2 161 ? -31.044 37.726 105.612 1.00 74.85  ? 142  GLY D C   1 
ATOM   9260 O O   . GLY D 2 161 ? -30.622 38.820 105.250 1.00 64.54  ? 142  GLY D O   1 
ATOM   9261 N N   . LEU D 2 162 ? -32.113 37.149 105.081 1.00 73.85  ? 143  LEU D N   1 
ATOM   9262 C CA  . LEU D 2 162 ? -32.875 37.765 104.009 1.00 67.24  ? 143  LEU D CA  1 
ATOM   9263 C C   . LEU D 2 162 ? -33.506 39.078 104.440 1.00 70.16  ? 143  LEU D C   1 
ATOM   9264 O O   . LEU D 2 162 ? -33.502 40.051 103.694 1.00 74.69  ? 143  LEU D O   1 
ATOM   9265 C CB  . LEU D 2 162 ? -33.952 36.797 103.527 1.00 73.04  ? 143  LEU D CB  1 
ATOM   9266 C CG  . LEU D 2 162 ? -34.605 37.076 102.178 1.00 62.66  ? 143  LEU D CG  1 
ATOM   9267 C CD1 . LEU D 2 162 ? -33.556 37.176 101.096 1.00 67.29  ? 143  LEU D CD1 1 
ATOM   9268 C CD2 . LEU D 2 162 ? -35.595 35.979 101.857 1.00 56.79  ? 143  LEU D CD2 1 
ATOM   9269 N N   . ALA D 2 163 ? -34.048 39.100 105.649 1.00 75.94  ? 144  ALA D N   1 
ATOM   9270 C CA  . ALA D 2 163 ? -34.681 40.298 106.174 1.00 61.12  ? 144  ALA D CA  1 
ATOM   9271 C C   . ALA D 2 163 ? -33.649 41.397 106.310 1.00 67.24  ? 144  ALA D C   1 
ATOM   9272 O O   . ALA D 2 163 ? -33.916 42.561 106.026 1.00 75.83  ? 144  ALA D O   1 
ATOM   9273 C CB  . ALA D 2 163 ? -35.319 40.007 107.512 1.00 50.67  ? 144  ALA D CB  1 
ATOM   9274 N N   . MET D 2 164 ? -32.464 41.005 106.754 1.00 70.89  ? 145  MET D N   1 
ATOM   9275 C CA  . MET D 2 164 ? -31.354 41.927 106.951 1.00 68.07  ? 145  MET D CA  1 
ATOM   9276 C C   . MET D 2 164 ? -30.965 42.551 105.609 1.00 74.18  ? 145  MET D C   1 
ATOM   9277 O O   . MET D 2 164 ? -30.711 43.766 105.532 1.00 66.62  ? 145  MET D O   1 
ATOM   9278 C CB  . MET D 2 164 ? -30.182 41.194 107.634 1.00 53.68  ? 145  MET D CB  1 
ATOM   9279 C CG  . MET D 2 164 ? -28.867 41.970 107.726 1.00 58.73  ? 145  MET D CG  1 
ATOM   9280 S SD  . MET D 2 164 ? -28.992 43.609 108.478 1.00 79.29  ? 145  MET D SD  1 
ATOM   9281 C CE  . MET D 2 164 ? -28.331 43.303 110.125 1.00 78.66  ? 145  MET D CE  1 
ATOM   9282 N N   . ALA D 2 165 ? -30.950 41.719 104.559 1.00 74.87  ? 146  ALA D N   1 
ATOM   9283 C CA  . ALA D 2 165 ? -30.591 42.158 103.207 1.00 72.57  ? 146  ALA D CA  1 
ATOM   9284 C C   . ALA D 2 165 ? -31.609 43.171 102.737 1.00 77.73  ? 146  ALA D C   1 
ATOM   9285 O O   . ALA D 2 165 ? -31.255 44.280 102.289 1.00 73.93  ? 146  ALA D O   1 
ATOM   9286 C CB  . ALA D 2 165 ? -30.538 40.983 102.259 1.00 52.72  ? 146  ALA D CB  1 
ATOM   9287 N N   . LYS D 2 166 ? -32.879 42.797 102.876 1.00 69.52  ? 147  LYS D N   1 
ATOM   9288 C CA  . LYS D 2 166 ? -33.968 43.662 102.479 1.00 76.48  ? 147  LYS D CA  1 
ATOM   9289 C C   . LYS D 2 166 ? -33.812 45.017 103.172 1.00 74.56  ? 147  LYS D C   1 
ATOM   9290 O O   . LYS D 2 166 ? -33.951 46.078 102.549 1.00 74.89  ? 147  LYS D O   1 
ATOM   9291 C CB  . LYS D 2 166 ? -35.318 43.021 102.808 1.00 78.53  ? 147  LYS D CB  1 
ATOM   9292 C CG  . LYS D 2 166 ? -36.475 43.711 102.080 1.00 102.35 ? 147  LYS D CG  1 
ATOM   9293 C CD  . LYS D 2 166 ? -37.707 43.856 102.962 1.00 124.53 ? 147  LYS D CD  1 
ATOM   9294 C CE  . LYS D 2 166 ? -38.417 45.190 102.706 1.00 127.49 ? 147  LYS D CE  1 
ATOM   9295 N NZ  . LYS D 2 166 ? -39.651 45.324 103.539 1.00 119.95 ? 147  LYS D NZ  1 
ATOM   9296 N N   . GLU D 2 167 ? -33.484 44.958 104.456 1.00 64.40  ? 148  GLU D N   1 
ATOM   9297 C CA  . GLU D 2 167 ? -33.298 46.147 105.255 1.00 77.44  ? 148  GLU D CA  1 
ATOM   9298 C C   . GLU D 2 167 ? -32.181 47.039 104.707 1.00 73.85  ? 148  GLU D C   1 
ATOM   9299 O O   . GLU D 2 167 ? -32.362 48.240 104.544 1.00 73.48  ? 148  GLU D O   1 
ATOM   9300 C CB  . GLU D 2 167 ? -33.027 45.764 106.715 1.00 83.86  ? 148  GLU D CB  1 
ATOM   9301 C CG  . GLU D 2 167 ? -32.763 46.970 107.642 1.00 81.75  ? 148  GLU D CG  1 
ATOM   9302 C CD  . GLU D 2 167 ? -32.196 46.592 109.009 1.00 88.56  ? 148  GLU D CD  1 
ATOM   9303 O OE1 . GLU D 2 167 ? -32.571 45.536 109.579 1.00 76.63  ? 148  GLU D OE1 1 
ATOM   9304 O OE2 . GLU D 2 167 ? -31.373 47.380 109.517 1.00 86.18  ? 148  GLU D OE2 1 
ATOM   9305 N N   . ILE D 2 168 ? -31.028 46.464 104.411 1.00 61.56  ? 149  ILE D N   1 
ATOM   9306 C CA  . ILE D 2 168 ? -29.889 47.298 104.038 1.00 72.93  ? 149  ILE D CA  1 
ATOM   9307 C C   . ILE D 2 168 ? -29.941 47.678 102.559 1.00 86.62  ? 149  ILE D C   1 
ATOM   9308 O O   . ILE D 2 168 ? -29.150 48.508 102.086 1.00 73.00  ? 149  ILE D O   1 
ATOM   9309 C CB  . ILE D 2 168 ? -28.525 46.631 104.400 1.00 71.08  ? 149  ILE D CB  1 
ATOM   9310 C CG1 . ILE D 2 168 ? -28.513 45.162 103.982 1.00 73.44  ? 149  ILE D CG1 1 
ATOM   9311 C CG2 . ILE D 2 168 ? -28.259 46.721 105.892 1.00 70.58  ? 149  ILE D CG2 1 
ATOM   9312 C CD1 . ILE D 2 168 ? -27.155 44.655 103.603 1.00 72.39  ? 149  ILE D CD1 1 
ATOM   9313 N N   . GLY D 2 169 ? -30.878 47.060 101.837 1.00 91.07  ? 150  GLY D N   1 
ATOM   9314 C CA  . GLY D 2 169 ? -31.011 47.272 100.394 1.00 89.86  ? 150  GLY D CA  1 
ATOM   9315 C C   . GLY D 2 169 ? -29.929 46.569 99.587  1.00 81.64  ? 150  GLY D C   1 
ATOM   9316 O O   . GLY D 2 169 ? -29.335 47.151 98.667  1.00 73.22  ? 150  GLY D O   1 
ATOM   9317 N N   . ALA D 2 170 ? -29.658 45.319 99.955  1.00 71.47  ? 151  ALA D N   1 
ATOM   9318 C CA  . ALA D 2 170 ? -28.702 44.507 99.229  1.00 72.59  ? 151  ALA D CA  1 
ATOM   9319 C C   . ALA D 2 170 ? -29.413 43.799 98.059  1.00 74.35  ? 151  ALA D C   1 
ATOM   9320 O O   . ALA D 2 170 ? -30.519 43.242 98.233  1.00 73.73  ? 151  ALA D O   1 
ATOM   9321 C CB  . ALA D 2 170 ? -28.049 43.485 100.162 1.00 82.68  ? 151  ALA D CB  1 
ATOM   9322 N N   . VAL D 2 171 ? -28.768 43.825 96.885  1.00 62.65  ? 152  VAL D N   1 
ATOM   9323 C CA  . VAL D 2 171 ? -29.255 43.144 95.700  1.00 57.28  ? 152  VAL D CA  1 
ATOM   9324 C C   . VAL D 2 171 ? -29.556 41.681 95.990  1.00 67.00  ? 152  VAL D C   1 
ATOM   9325 O O   . VAL D 2 171 ? -30.623 41.182 95.634  1.00 59.47  ? 152  VAL D O   1 
ATOM   9326 C CB  . VAL D 2 171 ? -28.251 43.267 94.550  1.00 49.91  ? 152  VAL D CB  1 
ATOM   9327 C CG1 . VAL D 2 171 ? -28.800 42.598 93.280  1.00 61.60  ? 152  VAL D CG1 1 
ATOM   9328 C CG2 . VAL D 2 171 ? -27.905 44.740 94.306  1.00 54.37  ? 152  VAL D CG2 1 
ATOM   9329 N N   . LYS D 2 172 ? -28.623 40.995 96.654  1.00 69.42  ? 153  LYS D N   1 
ATOM   9330 C CA  . LYS D 2 172 ? -28.792 39.548 96.931  1.00 73.87  ? 153  LYS D CA  1 
ATOM   9331 C C   . LYS D 2 172 ? -28.346 39.157 98.350  1.00 71.77  ? 153  LYS D C   1 
ATOM   9332 O O   . LYS D 2 172 ? -27.464 39.807 98.927  1.00 76.65  ? 153  LYS D O   1 
ATOM   9333 C CB  . LYS D 2 172 ? -28.061 38.689 95.865  1.00 77.81  ? 153  LYS D CB  1 
ATOM   9334 C CG  . LYS D 2 172 ? -28.898 38.323 94.620  1.00 68.71  ? 153  LYS D CG  1 
ATOM   9335 C CD  . LYS D 2 172 ? -29.398 36.885 94.669  1.00 82.17  ? 153  LYS D CD  1 
ATOM   9336 C CE  . LYS D 2 172 ? -30.263 36.546 93.433  1.00 86.22  ? 153  LYS D CE  1 
ATOM   9337 N NZ  . LYS D 2 172 ? -30.486 35.068 93.300  1.00 73.02  ? 153  LYS D NZ  1 
ATOM   9338 N N   . TYR D 2 173 ? -28.971 38.121 98.909  1.00 49.72  ? 154  TYR D N   1 
ATOM   9339 C CA  . TYR D 2 173 ? -28.492 37.536 100.139 1.00 37.56  ? 154  TYR D CA  1 
ATOM   9340 C C   . TYR D 2 173 ? -28.160 36.102 99.815  1.00 52.11  ? 154  TYR D C   1 
ATOM   9341 O O   . TYR D 2 173 ? -28.964 35.420 99.202  1.00 61.59  ? 154  TYR D O   1 
ATOM   9342 C CB  . TYR D 2 173 ? -29.536 37.616 101.275 1.00 58.94  ? 154  TYR D CB  1 
ATOM   9343 C CG  . TYR D 2 173 ? -29.242 36.672 102.441 1.00 61.67  ? 154  TYR D CG  1 
ATOM   9344 C CD1 . TYR D 2 173 ? -28.178 36.921 103.293 1.00 46.06  ? 154  TYR D CD1 1 
ATOM   9345 C CD2 . TYR D 2 173 ? -30.004 35.509 102.648 1.00 59.21  ? 154  TYR D CD2 1 
ATOM   9346 C CE1 . TYR D 2 173 ? -27.870 36.068 104.316 1.00 52.59  ? 154  TYR D CE1 1 
ATOM   9347 C CE2 . TYR D 2 173 ? -29.711 34.630 103.685 1.00 56.07  ? 154  TYR D CE2 1 
ATOM   9348 C CZ  . TYR D 2 173 ? -28.642 34.925 104.523 1.00 67.44  ? 154  TYR D CZ  1 
ATOM   9349 O OH  . TYR D 2 173 ? -28.323 34.066 105.567 1.00 67.41  ? 154  TYR D OH  1 
ATOM   9350 N N   . LEU D 2 174 ? -26.982 35.641 100.221 1.00 48.37  ? 155  LEU D N   1 
ATOM   9351 C CA  . LEU D 2 174 ? -26.512 34.330 99.805  1.00 54.47  ? 155  LEU D CA  1 
ATOM   9352 C C   . LEU D 2 174 ? -25.737 33.733 100.916 1.00 50.66  ? 155  LEU D C   1 
ATOM   9353 O O   . LEU D 2 174 ? -24.985 34.444 101.562 1.00 66.97  ? 155  LEU D O   1 
ATOM   9354 C CB  . LEU D 2 174 ? -25.566 34.473 98.609  1.00 61.76  ? 155  LEU D CB  1 
ATOM   9355 C CG  . LEU D 2 174 ? -26.190 34.914 97.285  1.00 62.99  ? 155  LEU D CG  1 
ATOM   9356 C CD1 . LEU D 2 174 ? -25.105 35.459 96.387  1.00 57.49  ? 155  LEU D CD1 1 
ATOM   9357 C CD2 . LEU D 2 174 ? -26.964 33.760 96.641  1.00 63.42  ? 155  LEU D CD2 1 
ATOM   9358 N N   . GLU D 2 175 ? -25.878 32.432 101.106 1.00 35.64  ? 156  GLU D N   1 
ATOM   9359 C CA  . GLU D 2 175 ? -25.135 31.730 102.123 1.00 45.33  ? 156  GLU D CA  1 
ATOM   9360 C C   . GLU D 2 175 ? -24.202 30.717 101.516 1.00 50.11  ? 156  GLU D C   1 
ATOM   9361 O O   . GLU D 2 175 ? -24.603 29.958 100.611 1.00 56.96  ? 156  GLU D O   1 
ATOM   9362 C CB  . GLU D 2 175 ? -26.092 30.977 103.040 1.00 54.80  ? 156  GLU D CB  1 
ATOM   9363 C CG  . GLU D 2 175 ? -27.180 31.812 103.642 1.00 56.59  ? 156  GLU D CG  1 
ATOM   9364 C CD  . GLU D 2 175 ? -28.140 30.994 104.481 1.00 75.97  ? 156  GLU D CD  1 
ATOM   9365 O OE1 . GLU D 2 175 ? -28.513 29.862 104.056 1.00 59.77  ? 156  GLU D OE1 1 
ATOM   9366 O OE2 . GLU D 2 175 ? -28.536 31.517 105.561 1.00 68.85  ? 156  GLU D OE2 1 
ATOM   9367 N N   . CYS D 2 176 ? -22.977 30.658 102.043 1.00 48.69  ? 157  CYS D N   1 
ATOM   9368 C CA  . CYS D 2 176 ? -21.958 29.707 101.557 1.00 59.63  ? 157  CYS D CA  1 
ATOM   9369 C C   . CYS D 2 176 ? -21.060 29.185 102.664 1.00 68.24  ? 157  CYS D C   1 
ATOM   9370 O O   . CYS D 2 176 ? -21.072 29.683 103.807 1.00 48.62  ? 157  CYS D O   1 
ATOM   9371 C CB  . CYS D 2 176 ? -21.060 30.382 100.559 1.00 32.17  ? 157  CYS D CB  1 
ATOM   9372 S SG  . CYS D 2 176 ? -20.275 31.795 101.333 1.00 59.87  ? 157  CYS D SG  1 
ATOM   9373 N N   . SER D 2 177 ? -20.243 28.203 102.288 1.00 59.25  ? 158  SER D N   1 
ATOM   9374 C CA  . SER D 2 177 ? -19.286 27.624 103.183 1.00 42.64  ? 158  SER D CA  1 
ATOM   9375 C C   . SER D 2 177 ? -17.994 27.402 102.451 1.00 54.75  ? 158  SER D C   1 
ATOM   9376 O O   . SER D 2 177 ? -17.932 26.568 101.549 1.00 48.24  ? 158  SER D O   1 
ATOM   9377 C CB  . SER D 2 177 ? -19.812 26.290 103.690 1.00 46.15  ? 158  SER D CB  1 
ATOM   9378 O OG  . SER D 2 177 ? -18.733 25.476 104.135 1.00 71.80  ? 158  SER D OG  1 
ATOM   9379 N N   . ALA D 2 178 ? -16.954 28.119 102.866 1.00 53.56  ? 159  ALA D N   1 
ATOM   9380 C CA  . ALA D 2 178 ? -15.600 27.896 102.336 1.00 42.33  ? 159  ALA D CA  1 
ATOM   9381 C C   . ALA D 2 178 ? -15.118 26.454 102.454 1.00 52.20  ? 159  ALA D C   1 
ATOM   9382 O O   . ALA D 2 178 ? -14.402 25.980 101.580 1.00 66.38  ? 159  ALA D O   1 
ATOM   9383 C CB  . ALA D 2 178 ? -14.614 28.820 102.981 1.00 39.40  ? 159  ALA D CB  1 
ATOM   9384 N N   . LEU D 2 179 ? -15.522 25.758 103.515 1.00 61.90  ? 160  LEU D N   1 
ATOM   9385 C CA  . LEU D 2 179 ? -15.033 24.421 103.739 1.00 56.17  ? 160  LEU D CA  1 
ATOM   9386 C C   . LEU D 2 179 ? -15.689 23.415 102.809 1.00 60.33  ? 160  LEU D C   1 
ATOM   9387 O O   . LEU D 2 179 ? -14.993 22.603 102.187 1.00 84.37  ? 160  LEU D O   1 
ATOM   9388 C CB  . LEU D 2 179 ? -15.202 23.979 105.196 1.00 69.04  ? 160  LEU D CB  1 
ATOM   9389 C CG  . LEU D 2 179 ? -14.666 22.562 105.491 1.00 66.35  ? 160  LEU D CG  1 
ATOM   9390 C CD1 . LEU D 2 179 ? -13.122 22.525 105.414 1.00 63.01  ? 160  LEU D CD1 1 
ATOM   9391 C CD2 . LEU D 2 179 ? -15.165 22.049 106.814 1.00 43.17  ? 160  LEU D CD2 1 
ATOM   9392 N N   . THR D 2 180 ? -17.010 23.436 102.707 1.00 55.48  ? 161  THR D N   1 
ATOM   9393 C CA  . THR D 2 180 ? -17.660 22.467 101.827 1.00 58.50  ? 161  THR D CA  1 
ATOM   9394 C C   . THR D 2 180 ? -17.715 23.001 100.415 1.00 74.09  ? 161  THR D C   1 
ATOM   9395 O O   . THR D 2 180 ? -17.892 22.250 99.451  1.00 57.22  ? 161  THR D O   1 
ATOM   9396 C CB  . THR D 2 180 ? -19.046 22.230 102.243 1.00 63.30  ? 161  THR D CB  1 
ATOM   9397 O OG1 . THR D 2 180 ? -19.640 23.505 102.508 1.00 85.95  ? 161  THR D OG1 1 
ATOM   9398 C CG2 . THR D 2 180 ? -19.061 21.366 103.499 1.00 63.54  ? 161  THR D CG2 1 
ATOM   9399 N N   . GLN D 2 181 ? -17.570 24.318 100.305 1.00 77.35  ? 162  GLN D N   1 
ATOM   9400 C CA  . GLN D 2 181 ? -17.509 24.997 99.017  1.00 69.54  ? 162  GLN D CA  1 
ATOM   9401 C C   . GLN D 2 181 ? -18.904 25.190 98.466  1.00 57.12  ? 162  GLN D C   1 
ATOM   9402 O O   . GLN D 2 181 ? -19.070 25.850 97.454  1.00 64.19  ? 162  GLN D O   1 
ATOM   9403 C CB  . GLN D 2 181 ? -16.611 24.235 98.032  1.00 67.18  ? 162  GLN D CB  1 
ATOM   9404 C CG  . GLN D 2 181 ? -15.890 25.099 97.033  1.00 77.24  ? 162  GLN D CG  1 
ATOM   9405 C CD  . GLN D 2 181 ? -14.420 24.751 96.959  1.00 86.77  ? 162  GLN D CD  1 
ATOM   9406 O OE1 . GLN D 2 181 ? -13.597 25.241 97.749  1.00 82.26  ? 162  GLN D OE1 1 
ATOM   9407 N NE2 . GLN D 2 181 ? -14.077 23.902 96.006  1.00 96.32  ? 162  GLN D NE2 1 
ATOM   9408 N N   . ARG D 2 182 ? -19.908 24.604 99.102  1.00 58.70  ? 163  ARG D N   1 
ATOM   9409 C CA  . ARG D 2 182 ? -21.271 24.736 98.595  1.00 76.27  ? 163  ARG D CA  1 
ATOM   9410 C C   . ARG D 2 182 ? -21.867 26.132 98.724  1.00 67.69  ? 163  ARG D C   1 
ATOM   9411 O O   . ARG D 2 182 ? -21.919 26.701 99.807  1.00 56.05  ? 163  ARG D O   1 
ATOM   9412 C CB  . ARG D 2 182 ? -22.196 23.689 99.214  1.00 79.25  ? 163  ARG D CB  1 
ATOM   9413 C CG  . ARG D 2 182 ? -22.698 24.028 100.592 1.00 63.07  ? 163  ARG D CG  1 
ATOM   9414 C CD  . ARG D 2 182 ? -23.420 22.842 101.199 1.00 84.74  ? 163  ARG D CD  1 
ATOM   9415 N NE  . ARG D 2 182 ? -23.893 23.130 102.547 1.00 111.99 ? 163  ARG D NE  1 
ATOM   9416 C CZ  . ARG D 2 182 ? -23.101 23.238 103.607 1.00 87.71  ? 163  ARG D CZ  1 
ATOM   9417 N NH1 . ARG D 2 182 ? -21.792 23.090 103.478 1.00 59.17  ? 163  ARG D NH1 1 
ATOM   9418 N NH2 . ARG D 2 182 ? -23.621 23.500 104.794 1.00 84.51  ? 163  ARG D NH2 1 
ATOM   9419 N N   . GLY D 2 183 ? -22.316 26.667 97.594  1.00 54.65  ? 164  GLY D N   1 
ATOM   9420 C CA  . GLY D 2 183 ? -22.914 27.985 97.541  1.00 51.68  ? 164  GLY D CA  1 
ATOM   9421 C C   . GLY D 2 183 ? -21.892 29.073 97.311  1.00 58.88  ? 164  GLY D C   1 
ATOM   9422 O O   . GLY D 2 183 ? -22.231 30.250 97.274  1.00 54.63  ? 164  GLY D O   1 
ATOM   9423 N N   . LEU D 2 184 ? -20.638 28.672 97.153  1.00 42.08  ? 165  LEU D N   1 
ATOM   9424 C CA  . LEU D 2 184 ? -19.546 29.611 96.935  1.00 58.77  ? 165  LEU D CA  1 
ATOM   9425 C C   . LEU D 2 184 ? -19.530 30.225 95.537  1.00 52.18  ? 165  LEU D C   1 
ATOM   9426 O O   . LEU D 2 184 ? -19.594 31.439 95.389  1.00 50.73  ? 165  LEU D O   1 
ATOM   9427 C CB  . LEU D 2 184 ? -18.207 28.937 97.239  1.00 52.79  ? 165  LEU D CB  1 
ATOM   9428 C CG  . LEU D 2 184 ? -16.989 29.847 97.376  1.00 49.39  ? 165  LEU D CG  1 
ATOM   9429 C CD1 . LEU D 2 184 ? -17.235 30.906 98.423  1.00 44.26  ? 165  LEU D CD1 1 
ATOM   9430 C CD2 . LEU D 2 184 ? -15.759 29.039 97.716  1.00 47.98  ? 165  LEU D CD2 1 
ATOM   9431 N N   . LYS D 2 185 ? -19.439 29.386 94.513  1.00 51.06  ? 166  LYS D N   1 
ATOM   9432 C CA  . LYS D 2 185 ? -19.412 29.870 93.138  1.00 49.47  ? 166  LYS D CA  1 
ATOM   9433 C C   . LYS D 2 185 ? -20.482 30.927 92.924  1.00 58.88  ? 166  LYS D C   1 
ATOM   9434 O O   . LYS D 2 185 ? -20.210 32.010 92.421  1.00 54.40  ? 166  LYS D O   1 
ATOM   9435 C CB  . LYS D 2 185 ? -19.608 28.714 92.162  1.00 51.15  ? 166  LYS D CB  1 
ATOM   9436 C CG  . LYS D 2 185 ? -19.536 29.108 90.700  1.00 59.07  ? 166  LYS D CG  1 
ATOM   9437 C CD  . LYS D 2 185 ? -19.389 27.884 89.816  1.00 80.41  ? 166  LYS D CD  1 
ATOM   9438 C CE  . LYS D 2 185 ? -19.581 28.219 88.350  1.00 61.83  ? 166  LYS D CE  1 
ATOM   9439 N NZ  . LYS D 2 185 ? -21.015 28.399 88.007  1.00 62.46  ? 166  LYS D NZ  1 
ATOM   9440 N N   . THR D 2 186 ? -21.703 30.594 93.313  1.00 49.55  ? 167  THR D N   1 
ATOM   9441 C CA  . THR D 2 186 ? -22.846 31.492 93.188  1.00 60.99  ? 167  THR D CA  1 
ATOM   9442 C C   . THR D 2 186 ? -22.605 32.930 93.701  1.00 65.27  ? 167  THR D C   1 
ATOM   9443 O O   . THR D 2 186 ? -23.018 33.895 93.043  1.00 53.08  ? 167  THR D O   1 
ATOM   9444 C CB  . THR D 2 186 ? -24.085 30.865 93.854  1.00 53.84  ? 167  THR D CB  1 
ATOM   9445 O OG1 . THR D 2 186 ? -24.255 29.527 93.367  1.00 46.36  ? 167  THR D OG1 1 
ATOM   9446 C CG2 . THR D 2 186 ? -25.324 31.660 93.558  1.00 40.65  ? 167  THR D CG2 1 
ATOM   9447 N N   . VAL D 2 187 ? -21.940 33.060 94.857  1.00 59.58  ? 168  VAL D N   1 
ATOM   9448 C CA  . VAL D 2 187 ? -21.647 34.373 95.462  1.00 41.44  ? 168  VAL D CA  1 
ATOM   9449 C C   . VAL D 2 187 ? -20.927 35.221 94.448  1.00 51.48  ? 168  VAL D C   1 
ATOM   9450 O O   . VAL D 2 187 ? -21.210 36.395 94.312  1.00 54.86  ? 168  VAL D O   1 
ATOM   9451 C CB  . VAL D 2 187 ? -20.703 34.277 96.693  1.00 45.65  ? 168  VAL D CB  1 
ATOM   9452 C CG1 . VAL D 2 187 ? -20.207 35.671 97.110  1.00 42.42  ? 168  VAL D CG1 1 
ATOM   9453 C CG2 . VAL D 2 187 ? -21.345 33.580 97.865  1.00 43.53  ? 168  VAL D CG2 1 
ATOM   9454 N N   . PHE D 2 188 ? -19.993 34.617 93.728  1.00 40.49  ? 169  PHE D N   1 
ATOM   9455 C CA  . PHE D 2 188 ? -19.149 35.382 92.840  1.00 57.12  ? 169  PHE D CA  1 
ATOM   9456 C C   . PHE D 2 188 ? -19.796 35.598 91.491  1.00 62.70  ? 169  PHE D C   1 
ATOM   9457 O O   . PHE D 2 188 ? -19.672 36.684 90.900  1.00 49.79  ? 169  PHE D O   1 
ATOM   9458 C CB  . PHE D 2 188 ? -17.777 34.742 92.766  1.00 50.64  ? 169  PHE D CB  1 
ATOM   9459 C CG  . PHE D 2 188 ? -17.061 34.800 94.072  1.00 66.30  ? 169  PHE D CG  1 
ATOM   9460 C CD1 . PHE D 2 188 ? -16.579 36.038 94.560  1.00 66.02  ? 169  PHE D CD1 1 
ATOM   9461 C CD2 . PHE D 2 188 ? -16.939 33.667 94.865  1.00 66.17  ? 169  PHE D CD2 1 
ATOM   9462 C CE1 . PHE D 2 188 ? -15.927 36.129 95.809  1.00 56.29  ? 169  PHE D CE1 1 
ATOM   9463 C CE2 . PHE D 2 188 ? -16.294 33.741 96.113  1.00 74.32  ? 169  PHE D CE2 1 
ATOM   9464 C CZ  . PHE D 2 188 ? -15.778 34.973 96.589  1.00 55.07  ? 169  PHE D CZ  1 
ATOM   9465 N N   . ASP D 2 189 ? -20.524 34.583 91.025  1.00 51.67  ? 170  ASP D N   1 
ATOM   9466 C CA  . ASP D 2 189 ? -21.333 34.741 89.834  1.00 54.08  ? 170  ASP D CA  1 
ATOM   9467 C C   . ASP D 2 189 ? -22.251 35.936 90.042  1.00 53.03  ? 170  ASP D C   1 
ATOM   9468 O O   . ASP D 2 189 ? -22.318 36.850 89.222  1.00 53.76  ? 170  ASP D O   1 
ATOM   9469 C CB  . ASP D 2 189 ? -22.172 33.495 89.579  1.00 54.46  ? 170  ASP D CB  1 
ATOM   9470 C CG  . ASP D 2 189 ? -21.362 32.338 88.992  1.00 69.75  ? 170  ASP D CG  1 
ATOM   9471 O OD1 . ASP D 2 189 ? -20.202 32.564 88.582  1.00 73.43  ? 170  ASP D OD1 1 
ATOM   9472 O OD2 . ASP D 2 189 ? -21.898 31.198 88.940  1.00 66.12  ? 170  ASP D OD2 1 
ATOM   9473 N N   . GLU D 2 190 ? -22.933 35.941 91.175  1.00 52.39  ? 171  GLU D N   1 
ATOM   9474 C CA  . GLU D 2 190 ? -23.967 36.914 91.411  1.00 56.97  ? 171  GLU D CA  1 
ATOM   9475 C C   . GLU D 2 190 ? -23.396 38.301 91.656  1.00 59.35  ? 171  GLU D C   1 
ATOM   9476 O O   . GLU D 2 190 ? -24.023 39.331 91.339  1.00 69.10  ? 171  GLU D O   1 
ATOM   9477 C CB  . GLU D 2 190 ? -24.853 36.456 92.560  1.00 54.06  ? 171  GLU D CB  1 
ATOM   9478 C CG  . GLU D 2 190 ? -25.826 35.330 92.186  1.00 75.78  ? 171  GLU D CG  1 
ATOM   9479 C CD  . GLU D 2 190 ? -26.918 35.783 91.219  1.00 89.73  ? 171  GLU D CD  1 
ATOM   9480 O OE1 . GLU D 2 190 ? -27.098 37.018 90.997  1.00 70.98  ? 171  GLU D OE1 1 
ATOM   9481 O OE2 . GLU D 2 190 ? -27.601 34.876 90.686  1.00 104.65 ? 171  GLU D OE2 1 
ATOM   9482 N N   . ALA D 2 191 ? -22.195 38.327 92.198  1.00 41.42  ? 172  ALA D N   1 
ATOM   9483 C CA  . ALA D 2 191 ? -21.486 39.563 92.376  1.00 53.02  ? 172  ALA D CA  1 
ATOM   9484 C C   . ALA D 2 191 ? -21.293 40.227 91.038  1.00 59.92  ? 172  ALA D C   1 
ATOM   9485 O O   . ALA D 2 191 ? -21.326 41.455 90.919  1.00 65.15  ? 172  ALA D O   1 
ATOM   9486 C CB  . ALA D 2 191 ? -20.146 39.286 93.000  1.00 37.85  ? 172  ALA D CB  1 
ATOM   9487 N N   . ILE D 2 192 ? -21.080 39.392 90.028  1.00 46.82  ? 173  ILE D N   1 
ATOM   9488 C CA  . ILE D 2 192 ? -20.779 39.869 88.696  1.00 61.19  ? 173  ILE D CA  1 
ATOM   9489 C C   . ILE D 2 192 ? -22.053 40.250 87.931  1.00 60.79  ? 173  ILE D C   1 
ATOM   9490 O O   . ILE D 2 192 ? -22.087 41.267 87.240  1.00 57.00  ? 173  ILE D O   1 
ATOM   9491 C CB  . ILE D 2 192 ? -19.904 38.869 87.936  1.00 61.85  ? 173  ILE D CB  1 
ATOM   9492 C CG1 . ILE D 2 192 ? -18.666 38.510 88.772  1.00 66.32  ? 173  ILE D CG1 1 
ATOM   9493 C CG2 . ILE D 2 192 ? -19.456 39.467 86.619  1.00 47.94  ? 173  ILE D CG2 1 
ATOM   9494 C CD1 . ILE D 2 192 ? -17.678 37.612 88.073  1.00 53.44  ? 173  ILE D CD1 1 
ATOM   9495 N N   . ARG D 2 193 ? -23.102 39.452 88.077  1.00 56.16  ? 174  ARG D N   1 
ATOM   9496 C CA  . ARG D 2 193 ? -24.393 39.802 87.513  1.00 56.77  ? 174  ARG D CA  1 
ATOM   9497 C C   . ARG D 2 193 ? -24.851 41.161 88.029  1.00 56.29  ? 174  ARG D C   1 
ATOM   9498 O O   . ARG D 2 193 ? -25.493 41.945 87.315  1.00 74.16  ? 174  ARG D O   1 
ATOM   9499 C CB  . ARG D 2 193 ? -25.424 38.742 87.844  1.00 57.17  ? 174  ARG D CB  1 
ATOM   9500 C CG  . ARG D 2 193 ? -25.039 37.371 87.321  1.00 66.37  ? 174  ARG D CG  1 
ATOM   9501 C CD  . ARG D 2 193 ? -26.139 36.364 87.548  1.00 60.89  ? 174  ARG D CD  1 
ATOM   9502 N NE  . ARG D 2 193 ? -26.000 35.223 86.658  1.00 65.00  ? 174  ARG D NE  1 
ATOM   9503 C CZ  . ARG D 2 193 ? -25.675 33.999 87.049  1.00 77.80  ? 174  ARG D CZ  1 
ATOM   9504 N NH1 . ARG D 2 193 ? -25.450 33.739 88.330  1.00 80.02  ? 174  ARG D NH1 1 
ATOM   9505 N NH2 . ARG D 2 193 ? -25.588 33.031 86.155  1.00 68.95  ? 174  ARG D NH2 1 
ATOM   9506 N N   . ALA D 2 194 ? -24.499 41.454 89.265  1.00 47.86  ? 175  ALA D N   1 
ATOM   9507 C CA  . ALA D 2 194 ? -24.773 42.758 89.821  1.00 63.37  ? 175  ALA D CA  1 
ATOM   9508 C C   . ALA D 2 194 ? -24.076 43.929 89.101  1.00 64.96  ? 175  ALA D C   1 
ATOM   9509 O O   . ALA D 2 194 ? -24.616 45.033 89.054  1.00 80.90  ? 175  ALA D O   1 
ATOM   9510 C CB  . ALA D 2 194 ? -24.426 42.765 91.307  1.00 55.55  ? 175  ALA D CB  1 
ATOM   9511 N N   . VAL D 2 195 ? -22.895 43.683 88.552  1.00 58.58  ? 176  VAL D N   1 
ATOM   9512 C CA  . VAL D 2 195 ? -22.162 44.727 87.852  1.00 60.79  ? 176  VAL D CA  1 
ATOM   9513 C C   . VAL D 2 195 ? -22.604 44.847 86.401  1.00 81.41  ? 176  VAL D C   1 
ATOM   9514 O O   . VAL D 2 195 ? -22.707 45.947 85.867  1.00 88.04  ? 176  VAL D O   1 
ATOM   9515 C CB  . VAL D 2 195 ? -20.654 44.481 87.900  1.00 66.99  ? 176  VAL D CB  1 
ATOM   9516 C CG1 . VAL D 2 195 ? -19.941 45.405 86.941  1.00 62.22  ? 176  VAL D CG1 1 
ATOM   9517 C CG2 . VAL D 2 195 ? -20.142 44.670 89.307  1.00 55.62  ? 176  VAL D CG2 1 
ATOM   9518 N N   . LEU D 2 196 ? -22.865 43.711 85.767  1.00 84.08  ? 177  LEU D N   1 
ATOM   9519 C CA  . LEU D 2 196 ? -23.298 43.701 84.378  1.00 92.65  ? 177  LEU D CA  1 
ATOM   9520 C C   . LEU D 2 196 ? -24.671 44.346 84.246  1.00 99.95  ? 177  LEU D C   1 
ATOM   9521 O O   . LEU D 2 196 ? -25.660 43.831 84.764  1.00 91.62  ? 177  LEU D O   1 
ATOM   9522 C CB  . LEU D 2 196 ? -23.343 42.274 83.832  1.00 89.27  ? 177  LEU D CB  1 
ATOM   9523 C CG  . LEU D 2 196 ? -22.078 41.422 83.927  1.00 77.72  ? 177  LEU D CG  1 
ATOM   9524 C CD1 . LEU D 2 196 ? -22.308 40.087 83.248  1.00 62.95  ? 177  LEU D CD1 1 
ATOM   9525 C CD2 . LEU D 2 196 ? -20.891 42.135 83.312  1.00 65.03  ? 177  LEU D CD2 1 
HETATM 9526 O O   . HOH E 3 .   ? 13.551  55.417 162.510 1.00 45.73  ? 2001 HOH A O   1 
HETATM 9527 O O   . HOH E 3 .   ? 16.777  47.390 184.747 1.00 67.36  ? 2002 HOH A O   1 
HETATM 9528 O O   . HOH E 3 .   ? 25.051  59.398 187.463 1.00 67.19  ? 2003 HOH A O   1 
HETATM 9529 O O   . HOH E 3 .   ? 5.860   41.485 181.447 1.00 47.83  ? 2004 HOH A O   1 
HETATM 9530 O O   . HOH E 3 .   ? -0.562  44.065 198.902 1.00 47.82  ? 2005 HOH A O   1 
HETATM 9531 O O   . HOH E 3 .   ? -4.981  48.209 167.046 1.00 47.38  ? 2006 HOH A O   1 
HETATM 9532 O O   . HOH E 3 .   ? -2.457  35.055 182.478 1.00 50.88  ? 2007 HOH A O   1 
HETATM 9533 O O   . HOH E 3 .   ? -9.750  31.387 183.277 1.00 59.80  ? 2008 HOH A O   1 
HETATM 9534 O O   . HOH E 3 .   ? 2.925   36.935 182.855 1.00 53.95  ? 2009 HOH A O   1 
HETATM 9535 O O   . HOH E 3 .   ? -10.057 43.978 185.418 1.00 32.76  ? 2010 HOH A O   1 
HETATM 9536 O O   . HOH E 3 .   ? -12.102 30.515 129.168 1.00 66.42  ? 2011 HOH A O   1 
HETATM 9537 O O   . HOH E 3 .   ? -12.639 39.802 165.915 1.00 62.73  ? 2012 HOH A O   1 
HETATM 9538 O O   . HOH E 3 .   ? -14.815 45.828 160.510 1.00 52.15  ? 2013 HOH A O   1 
HETATM 9539 O O   . HOH E 3 .   ? -10.939 41.966 159.459 1.00 56.19  ? 2014 HOH A O   1 
HETATM 9540 O O   . HOH E 3 .   ? -1.373  41.007 156.766 1.00 49.43  ? 2015 HOH A O   1 
HETATM 9541 O O   . HOH E 3 .   ? 0.673   42.443 154.883 1.00 57.26  ? 2016 HOH A O   1 
HETATM 9542 O O   . HOH E 3 .   ? 26.709  54.198 157.369 1.00 46.62  ? 2017 HOH A O   1 
HETATM 9543 O O   . HOH E 3 .   ? -7.569  51.850 152.809 1.00 51.52  ? 2018 HOH A O   1 
HETATM 9544 O O   . HOH E 3 .   ? 10.317  50.650 147.202 1.00 58.87  ? 2019 HOH A O   1 
HETATM 9545 O O   . HOH E 3 .   ? 19.360  63.750 146.556 1.00 50.45  ? 2020 HOH A O   1 
HETATM 9546 O O   . HOH E 3 .   ? 3.954   44.173 147.592 1.00 38.31  ? 2021 HOH A O   1 
HETATM 9547 O O   . HOH E 3 .   ? -1.555  38.425 148.127 1.00 59.45  ? 2022 HOH A O   1 
HETATM 9548 O O   . HOH E 3 .   ? 3.621   29.849 170.564 1.00 57.73  ? 2023 HOH A O   1 
HETATM 9549 O O   . HOH E 3 .   ? -11.476 38.761 163.984 1.00 56.39  ? 2024 HOH A O   1 
HETATM 9550 O O   . HOH E 3 .   ? -1.950  35.866 172.791 1.00 60.41  ? 2025 HOH A O   1 
HETATM 9551 O O   . HOH E 3 .   ? 12.770  34.573 169.977 1.00 66.74  ? 2026 HOH A O   1 
HETATM 9552 O O   . HOH E 3 .   ? 0.743   30.782 151.537 1.00 60.29  ? 2027 HOH A O   1 
HETATM 9553 O O   . HOH E 3 .   ? 6.805   42.306 170.456 1.00 49.35  ? 2028 HOH A O   1 
HETATM 9554 O O   . HOH E 3 .   ? 4.928   41.605 172.084 1.00 45.45  ? 2029 HOH A O   1 
HETATM 9555 O O   . HOH E 3 .   ? -0.230  24.170 149.700 1.00 48.59  ? 2030 HOH A O   1 
HETATM 9556 O O   . HOH E 3 .   ? -9.140  32.740 144.795 1.00 64.81  ? 2031 HOH A O   1 
HETATM 9557 O O   . HOH E 3 .   ? -14.397 29.868 130.973 1.00 52.98  ? 2032 HOH A O   1 
HETATM 9558 O O   . HOH E 3 .   ? -12.582 26.306 135.395 1.00 55.13  ? 2033 HOH A O   1 
HETATM 9559 O O   . HOH E 3 .   ? -8.187  32.956 128.744 1.00 56.34  ? 2034 HOH A O   1 
HETATM 9560 O O   . HOH E 3 .   ? -35.052 35.177 148.914 1.00 67.27  ? 2035 HOH A O   1 
HETATM 9561 O O   . HOH F 3 .   ? -14.290 8.766  79.460  1.00 77.52  ? 2001 HOH B O   1 
HETATM 9562 O O   . HOH F 3 .   ? -15.358 -3.071 66.232  1.00 39.88  ? 2002 HOH B O   1 
HETATM 9563 O O   . HOH F 3 .   ? -11.097 14.273 73.472  1.00 58.44  ? 2003 HOH B O   1 
HETATM 9564 O O   . HOH F 3 .   ? -21.450 21.350 65.244  1.00 54.76  ? 2004 HOH B O   1 
HETATM 9565 O O   . HOH F 3 .   ? -22.149 20.505 67.626  1.00 77.46  ? 2005 HOH B O   1 
HETATM 9566 O O   . HOH F 3 .   ? -22.319 16.875 72.141  1.00 50.13  ? 2006 HOH B O   1 
HETATM 9567 O O   . HOH F 3 .   ? 4.544   23.667 67.640  1.00 71.08  ? 2007 HOH B O   1 
HETATM 9568 O O   . HOH F 3 .   ? 3.674   19.786 63.328  1.00 69.54  ? 2008 HOH B O   1 
HETATM 9569 O O   . HOH F 3 .   ? 11.869  18.800 51.270  1.00 56.98  ? 2009 HOH B O   1 
HETATM 9570 O O   . HOH F 3 .   ? 3.022   28.044 39.304  1.00 59.02  ? 2010 HOH B O   1 
HETATM 9571 O O   . HOH F 3 .   ? -1.827  34.631 76.371  1.00 40.67  ? 2011 HOH B O   1 
HETATM 9572 O O   . HOH F 3 .   ? -7.669  28.998 88.140  1.00 48.41  ? 2012 HOH B O   1 
HETATM 9573 O O   . HOH F 3 .   ? -4.996  24.209 85.724  1.00 41.64  ? 2013 HOH B O   1 
HETATM 9574 O O   . HOH F 3 .   ? -13.018 25.947 93.779  1.00 42.66  ? 2014 HOH B O   1 
HETATM 9575 O O   . HOH F 3 .   ? -19.860 22.017 81.214  1.00 59.97  ? 2015 HOH B O   1 
HETATM 9576 O O   . HOH F 3 .   ? -21.058 11.649 96.619  1.00 65.95  ? 2016 HOH B O   1 
HETATM 9577 O O   . HOH F 3 .   ? -21.678 1.127  91.661  1.00 45.97  ? 2017 HOH B O   1 
HETATM 9578 O O   . HOH F 3 .   ? 4.846   22.849 77.695  1.00 51.50  ? 2018 HOH B O   1 
HETATM 9579 O O   . HOH F 3 .   ? 8.241   39.688 82.453  1.00 43.02  ? 2019 HOH B O   1 
HETATM 9580 O O   . HOH F 3 .   ? -3.027  19.385 108.297 1.00 65.84  ? 2020 HOH B O   1 
HETATM 9581 O O   . HOH F 3 .   ? -1.312  34.245 120.371 1.00 69.11  ? 2021 HOH B O   1 
HETATM 9582 O O   . HOH F 3 .   ? 4.275   34.274 88.561  1.00 66.68  ? 2022 HOH B O   1 
HETATM 9583 O O   . HOH F 3 .   ? 1.600   45.141 107.345 1.00 49.09  ? 2023 HOH B O   1 
HETATM 9584 O O   . HOH F 3 .   ? 5.689   43.035 105.197 1.00 44.77  ? 2024 HOH B O   1 
HETATM 9585 O O   . HOH F 3 .   ? 27.613  31.545 99.411  1.00 69.50  ? 2025 HOH B O   1 
HETATM 9586 O O   . HOH F 3 .   ? -8.239  56.824 97.501  1.00 90.87  ? 2026 HOH B O   1 
HETATM 9587 O O   . HOH F 3 .   ? -1.128  53.780 105.545 1.00 42.98  ? 2027 HOH B O   1 
HETATM 9588 O O   . HOH G 3 .   ? -8.238  44.560 129.228 1.00 54.29  ? 2001 HOH C O   1 
HETATM 9589 O O   . HOH G 3 .   ? 0.879   43.657 133.096 1.00 66.02  ? 2002 HOH C O   1 
HETATM 9590 O O   . HOH G 3 .   ? -3.329  39.648 133.408 1.00 67.52  ? 2003 HOH C O   1 
HETATM 9591 O O   . HOH G 3 .   ? -9.914  38.342 136.904 1.00 54.03  ? 2004 HOH C O   1 
HETATM 9592 O O   . HOH G 3 .   ? -9.490  57.977 154.805 1.00 51.01  ? 2005 HOH C O   1 
HETATM 9593 O O   . HOH G 3 .   ? -29.355 48.966 139.288 1.00 73.52  ? 2006 HOH C O   1 
HETATM 9594 O O   . HOH G 3 .   ? -9.891  54.335 115.360 1.00 47.69  ? 2007 HOH C O   1 
HETATM 9595 O O   . HOH G 3 .   ? -15.544 51.546 117.077 1.00 58.89  ? 2008 HOH C O   1 
HETATM 9596 O O   . HOH G 3 .   ? -25.457 59.647 137.002 1.00 55.32  ? 2009 HOH C O   1 
HETATM 9597 O O   . HOH G 3 .   ? 11.589  49.141 116.541 1.00 63.15  ? 2010 HOH C O   1 
HETATM 9598 O O   . HOH G 3 .   ? -5.576  58.579 115.918 1.00 71.55  ? 2011 HOH C O   1 
HETATM 9599 O O   . HOH G 3 .   ? -5.496  69.113 134.059 1.00 67.50  ? 2012 HOH C O   1 
HETATM 9600 O O   . HOH G 3 .   ? -9.726  66.257 139.760 1.00 70.63  ? 2013 HOH C O   1 
HETATM 9601 O O   . HOH H 3 .   ? -13.674 42.461 76.187  1.00 66.42  ? 2001 HOH D O   1 
HETATM 9602 O O   . HOH H 3 .   ? -7.539  31.510 105.618 1.00 58.45  ? 2002 HOH D O   1 
HETATM 9603 O O   . HOH H 3 .   ? -9.042  27.952 109.618 1.00 68.71  ? 2003 HOH D O   1 
HETATM 9604 O O   . HOH H 3 .   ? -1.774  29.705 97.425  1.00 54.44  ? 2004 HOH D O   1 
HETATM 9605 O O   . HOH H 3 .   ? -4.586  35.970 92.688  1.00 51.66  ? 2005 HOH D O   1 
HETATM 9606 O O   . HOH H 3 .   ? -3.805  40.047 91.863  1.00 54.03  ? 2006 HOH D O   1 
HETATM 9607 O O   . HOH H 3 .   ? -26.316 35.113 78.519  1.00 55.90  ? 2007 HOH D O   1 
HETATM 9608 O O   . HOH H 3 .   ? -8.983  40.960 109.293 1.00 61.47  ? 2008 HOH D O   1 
HETATM 9609 O O   . HOH H 3 .   ? -17.629 54.593 93.527  1.00 67.75  ? 2009 HOH D O   1 
HETATM 9610 O O   . HOH H 3 .   ? -24.148 56.145 105.503 1.00 57.86  ? 2010 HOH D O   1 
HETATM 9611 O O   . HOH H 3 .   ? -17.320 29.480 105.539 1.00 39.58  ? 2011 HOH D O   1 
HETATM 9612 O O   . HOH H 3 .   ? -26.145 24.209 107.317 1.00 52.71  ? 2012 HOH D O   1 
HETATM 9613 O O   . HOH H 3 .   ? -28.461 25.133 107.622 1.00 50.46  ? 2013 HOH D O   1 
HETATM 9614 O O   . HOH H 3 .   ? -30.799 34.004 98.793  1.00 47.10  ? 2014 HOH D O   1 
HETATM 9615 O O   . HOH H 3 .   ? -31.707 36.568 97.832  1.00 51.19  ? 2015 HOH D O   1 
HETATM 9616 O O   . HOH H 3 .   ? -24.402 30.274 90.010  1.00 68.60  ? 2016 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 10  ? 0.9870 0.7447 0.8577 -0.0635 -0.0619 0.0090  1196 SER A N   
2    C CA  . SER A 10  ? 1.1261 0.8982 1.0065 -0.0516 -0.0525 0.0030  1196 SER A CA  
3    C C   . SER A 10  ? 1.2458 1.0443 1.1500 -0.0416 -0.0522 0.0102  1196 SER A C   
4    O O   . SER A 10  ? 1.3944 1.2070 1.3068 -0.0364 -0.0447 0.0064  1196 SER A O   
5    C CB  . SER A 10  ? 1.0648 0.8264 0.9362 -0.0453 -0.0503 -0.0021 1196 SER A CB  
6    O OG  . SER A 10  ? 1.2864 1.0578 1.1727 -0.0347 -0.0545 0.0055  1196 SER A OG  
7    N N   . LYS A 11  ? 1.2363 1.0410 1.1509 -0.0400 -0.0606 0.0201  1197 LYS A N   
8    C CA  . LYS A 11  ? 1.3098 1.1375 1.2444 -0.0349 -0.0607 0.0262  1197 LYS A CA  
9    C C   . LYS A 11  ? 1.3628 1.1970 1.2967 -0.0405 -0.0546 0.0231  1197 LYS A C   
10   O O   . LYS A 11  ? 1.1768 1.0261 1.1204 -0.0349 -0.0484 0.0209  1197 LYS A O   
11   C CB  . LYS A 11  ? 1.3234 1.1527 1.2643 -0.0380 -0.0713 0.0365  1197 LYS A CB  
12   C CG  . LYS A 11  ? 1.9313 1.7812 1.8874 -0.0374 -0.0710 0.0418  1197 LYS A CG  
13   C CD  . LYS A 11  ? 1.2235 1.0692 1.1753 -0.0480 -0.0793 0.0498  1197 LYS A CD  
14   C CE  . LYS A 11  ? 1.1487 1.0155 1.1168 -0.0458 -0.0800 0.0557  1197 LYS A CE  
15   N NZ  . LYS A 11  ? 0.9989 0.8749 0.9668 -0.0498 -0.0717 0.0531  1197 LYS A NZ  
16   N N   . ASP A 12  ? 1.3850 1.2063 1.3073 -0.0528 -0.0564 0.0227  1198 ASP A N   
17   C CA  . ASP A 12  ? 1.3337 1.1582 1.2568 -0.0594 -0.0505 0.0192  1198 ASP A CA  
18   C C   . ASP A 12  ? 1.2000 1.0216 1.1198 -0.0573 -0.0425 0.0092  1198 ASP A C   
19   O O   . ASP A 12  ? 1.1452 0.9775 1.0738 -0.0564 -0.0378 0.0076  1198 ASP A O   
20   C CB  . ASP A 12  ? 1.3213 1.1309 1.2331 -0.0750 -0.0527 0.0200  1198 ASP A CB  
21   C CG  . ASP A 12  ? 1.3853 1.2026 1.3027 -0.0783 -0.0596 0.0308  1198 ASP A CG  
22   O OD1 . ASP A 12  ? 1.3756 1.2063 1.3045 -0.0682 -0.0644 0.0372  1198 ASP A OD1 
23   O OD2 . ASP A 12  ? 1.3281 1.1383 1.2391 -0.0920 -0.0594 0.0321  1198 ASP A OD2 
24   N N   . ASN A 13  ? 1.1826 0.9899 1.0898 -0.0567 -0.0414 0.0027  1199 ASN A N   
25   C CA  . ASN A 13  ? 1.1757 0.9807 1.0794 -0.0551 -0.0338 -0.0073 1199 ASN A CA  
26   C C   . ASN A 13  ? 1.1564 0.9815 1.0731 -0.0441 -0.0298 -0.0064 1199 ASN A C   
27   O O   . ASN A 13  ? 1.2302 1.0616 1.1519 -0.0445 -0.0253 -0.0103 1199 ASN A O   
28   C CB  . ASN A 13  ? 1.2490 1.0340 1.1343 -0.0570 -0.0328 -0.0151 1199 ASN A CB  
29   C CG  . ASN A 13  ? 1.4988 1.2617 1.3685 -0.0716 -0.0316 -0.0231 1199 ASN A CG  
30   O OD1 . ASN A 13  ? 1.4349 1.1988 1.3100 -0.0788 -0.0278 -0.0267 1199 ASN A OD1 
31   N ND2 . ASN A 13  ? 1.5295 1.2712 1.3799 -0.0768 -0.0343 -0.0265 1199 ASN A ND2 
32   N N   . ARG A 14  ? 0.8818 0.7163 0.8048 -0.0355 -0.0315 -0.0014 1200 ARG A N   
33   C CA  . ARG A 14  ? 0.7790 0.6303 0.7117 -0.0273 -0.0266 -0.0017 1200 ARG A CA  
34   C C   . ARG A 14  ? 0.9795 0.8466 0.9243 -0.0281 -0.0267 0.0027  1200 ARG A C   
35   O O   . ARG A 14  ? 1.0792 0.9568 1.0283 -0.0259 -0.0226 0.0011  1200 ARG A O   
36   C CB  . ARG A 14  ? 0.8341 0.6918 0.7740 -0.0196 -0.0275 0.0020  1200 ARG A CB  
37   C CG  . ARG A 14  ? 0.8620 0.7066 0.7917 -0.0167 -0.0250 -0.0032 1200 ARG A CG  
38   C CD  . ARG A 14  ? 1.3939 1.2407 1.3337 -0.0102 -0.0285 0.0020  1200 ARG A CD  
39   N NE  . ARG A 14  ? 1.4323 1.2968 1.3875 -0.0034 -0.0221 0.0019  1200 ARG A NE  
40   C CZ  . ARG A 14  ? 1.5498 1.4185 1.5185 0.0028  -0.0221 0.0041  1200 ARG A CZ  
41   N NH1 . ARG A 14  ? 1.7112 1.5680 1.6804 0.0044  -0.0298 0.0080  1200 ARG A NH1 
42   N NH2 . ARG A 14  ? 1.4192 1.3036 1.4017 0.0065  -0.0143 0.0023  1200 ARG A NH2 
43   N N   . MET A 15  ? 0.8489 0.7165 0.7976 -0.0323 -0.0315 0.0086  1201 MET A N   
44   C CA  . MET A 15  ? 0.8626 0.7437 0.8216 -0.0336 -0.0316 0.0132  1201 MET A CA  
45   C C   . MET A 15  ? 0.9021 0.7798 0.8609 -0.0393 -0.0289 0.0095  1201 MET A C   
46   O O   . MET A 15  ? 1.0088 0.8975 0.9749 -0.0375 -0.0272 0.0104  1201 MET A O   
47   C CB  . MET A 15  ? 0.8607 0.7443 0.8239 -0.0365 -0.0367 0.0205  1201 MET A CB  
48   C CG  . MET A 15  ? 0.9556 0.8497 0.9272 -0.0294 -0.0392 0.0249  1201 MET A CG  
49   S SD  . MET A 15  ? 0.9233 0.8182 0.8987 -0.0330 -0.0468 0.0331  1201 MET A SD  
50   C CE  . MET A 15  ? 0.7785 0.6870 0.7689 -0.0231 -0.0487 0.0358  1201 MET A CE  
51   N N   . SER A 16  ? 0.7335 0.5954 0.6846 -0.0470 -0.0287 0.0052  1202 SER A N   
52   C CA  . SER A 16  ? 0.7351 0.5926 0.6896 -0.0533 -0.0256 0.0007  1202 SER A CA  
53   C C   . SER A 16  ? 0.8573 0.7189 0.8136 -0.0485 -0.0224 -0.0048 1202 SER A C   
54   O O   . SER A 16  ? 0.8507 0.7194 0.8172 -0.0489 -0.0215 -0.0046 1202 SER A O   
55   C CB  . SER A 16  ? 0.9799 0.8170 0.9238 -0.0638 -0.0244 -0.0059 1202 SER A CB  
56   O OG  . SER A 16  ? 1.2367 1.0692 1.1770 -0.0705 -0.0278 -0.0002 1202 SER A OG  
57   N N   . CYS A 17  ? 0.7089 0.5659 0.6553 -0.0442 -0.0210 -0.0089 1203 CYS A N   
58   C CA  . CYS A 17  ? 0.8594 0.7192 0.8036 -0.0402 -0.0172 -0.0147 1203 CYS A CA  
59   C C   . CYS A 17  ? 0.9408 0.8193 0.8954 -0.0356 -0.0177 -0.0089 1203 CYS A C   
60   O O   . CYS A 17  ? 0.9174 0.8008 0.8776 -0.0364 -0.0171 -0.0105 1203 CYS A O   
61   C CB  . CYS A 17  ? 0.7502 0.6033 0.6821 -0.0362 -0.0152 -0.0184 1203 CYS A CB  
62   S SG  . CYS A 17  ? 0.9207 0.7751 0.8456 -0.0326 -0.0085 -0.0269 1203 CYS A SG  
63   N N   . THR A 18  ? 0.6642 0.5526 0.6218 -0.0317 -0.0193 -0.0022 1204 THR A N   
64   C CA  . THR A 18  ? 0.7945 0.6991 0.7591 -0.0291 -0.0193 0.0028  1204 THR A CA  
65   C C   . THR A 18  ? 0.7833 0.6939 0.7571 -0.0325 -0.0224 0.0072  1204 THR A C   
66   O O   . THR A 18  ? 0.8087 0.7281 0.7856 -0.0326 -0.0228 0.0090  1204 THR A O   
67   C CB  . THR A 18  ? 0.8102 0.7226 0.7783 -0.0257 -0.0201 0.0078  1204 THR A CB  
68   O OG1 . THR A 18  ? 0.6935 0.5971 0.6558 -0.0228 -0.0191 0.0048  1204 THR A OG1 
69   C CG2 . THR A 18  ? 0.7293 0.6557 0.7008 -0.0242 -0.0176 0.0095  1204 THR A CG2 
70   N N   . VAL A 19  ? 0.6696 0.5753 0.6472 -0.0360 -0.0246 0.0096  1205 VAL A N   
71   C CA  . VAL A 19  ? 0.6635 0.5735 0.6509 -0.0394 -0.0266 0.0139  1205 VAL A CA  
72   C C   . VAL A 19  ? 0.8126 0.7184 0.8054 -0.0418 -0.0262 0.0095  1205 VAL A C   
73   O O   . VAL A 19  ? 0.9331 0.8460 0.9349 -0.0424 -0.0287 0.0135  1205 VAL A O   
74   C CB  . VAL A 19  ? 0.6088 0.5135 0.5984 -0.0441 -0.0271 0.0164  1205 VAL A CB  
75   C CG1 . VAL A 19  ? 0.4793 0.3875 0.4800 -0.0480 -0.0277 0.0200  1205 VAL A CG1 
76   C CG2 . VAL A 19  ? 0.5928 0.5038 0.5797 -0.0415 -0.0287 0.0215  1205 VAL A CG2 
77   N N   . ASN A 20  ? 0.7947 0.6882 0.7823 -0.0436 -0.0234 0.0010  1206 ASN A N   
78   C CA  . ASN A 20  ? 0.9729 0.8622 0.9671 -0.0458 -0.0226 -0.0051 1206 ASN A CA  
79   C C   . ASN A 20  ? 0.9276 0.8272 0.9219 -0.0418 -0.0241 -0.0038 1206 ASN A C   
80   O O   . ASN A 20  ? 1.0889 0.9932 1.0945 -0.0429 -0.0271 -0.0021 1206 ASN A O   
81   C CB  . ASN A 20  ? 1.0630 0.9360 1.0486 -0.0493 -0.0183 -0.0162 1206 ASN A CB  
82   C CG  . ASN A 20  ? 1.0375 0.8984 1.0210 -0.0563 -0.0168 -0.0177 1206 ASN A CG  
83   O OD1 . ASN A 20  ? 1.0003 0.8640 0.9942 -0.0600 -0.0177 -0.0127 1206 ASN A OD1 
84   N ND2 . ASN A 20  ? 0.8911 0.7376 0.8598 -0.0593 -0.0144 -0.0245 1206 ASN A ND2 
85   N N   . LEU A 21  ? 0.7573 0.6603 0.7396 -0.0382 -0.0219 -0.0044 1207 LEU A N   
86   C CA  . LEU A 21  ? 0.7674 0.6802 0.7469 -0.0365 -0.0220 -0.0033 1207 LEU A CA  
87   C C   . LEU A 21  ? 0.9851 0.9104 0.9716 -0.0375 -0.0269 0.0066  1207 LEU A C   
88   O O   . LEU A 21  ? 1.0796 1.0113 1.0695 -0.0394 -0.0303 0.0093  1207 LEU A O   
89   C CB  . LEU A 21  ? 0.6807 0.5942 0.6471 -0.0335 -0.0168 -0.0060 1207 LEU A CB  
90   C CG  . LEU A 21  ? 0.7271 0.6317 0.6830 -0.0328 -0.0114 -0.0160 1207 LEU A CG  
91   C CD1 . LEU A 21  ? 0.8623 0.7514 0.8179 -0.0351 -0.0110 -0.0231 1207 LEU A CD1 
92   C CD2 . LEU A 21  ? 1.0692 0.9734 1.0146 -0.0294 -0.0061 -0.0176 1207 LEU A CD2 
93   N N   . LEU A 22  ? 0.8274 0.7554 0.8152 -0.0370 -0.0278 0.0119  1208 LEU A N   
94   C CA  . LEU A 22  ? 0.6027 0.5409 0.5946 -0.0386 -0.0317 0.0203  1208 LEU A CA  
95   C C   . LEU A 22  ? 0.7111 0.6490 0.7152 -0.0414 -0.0371 0.0242  1208 LEU A C   
96   O O   . LEU A 22  ? 0.8338 0.7786 0.8402 -0.0436 -0.0419 0.0300  1208 LEU A O   
97   C CB  . LEU A 22  ? 0.5488 0.4887 0.5404 -0.0376 -0.0309 0.0235  1208 LEU A CB  
98   C CG  . LEU A 22  ? 0.8857 0.8361 0.8778 -0.0392 -0.0329 0.0301  1208 LEU A CG  
99   C CD1 . LEU A 22  ? 1.1776 1.1350 1.1619 -0.0401 -0.0303 0.0290  1208 LEU A CD1 
100  C CD2 . LEU A 22  ? 0.7760 0.7271 0.7694 -0.0380 -0.0318 0.0319  1208 LEU A CD2 
101  N N   . ASN A 23  ? 0.7805 0.7095 0.7929 -0.0421 -0.0362 0.0208  1209 ASN A N   
102  C CA  . ASN A 23  ? 0.8610 0.7885 0.8892 -0.0447 -0.0400 0.0232  1209 ASN A CA  
103  C C   . ASN A 23  ? 0.8619 0.7908 0.8961 -0.0449 -0.0437 0.0215  1209 ASN A C   
104  O O   . ASN A 23  ? 0.7660 0.6992 0.8115 -0.0463 -0.0501 0.0277  1209 ASN A O   
105  C CB  . ASN A 23  ? 0.8676 0.7840 0.9035 -0.0473 -0.0360 0.0175  1209 ASN A CB  
106  C CG  . ASN A 23  ? 0.9243 0.8399 0.9557 -0.0486 -0.0334 0.0206  1209 ASN A CG  
107  O OD1 . ASN A 23  ? 0.8968 0.8212 0.9239 -0.0471 -0.0353 0.0275  1209 ASN A OD1 
108  N ND2 . ASN A 23  ? 0.8497 0.7544 0.8815 -0.0527 -0.0289 0.0150  1209 ASN A ND2 
109  N N   . PHE A 24  ? 0.9114 0.8363 0.9377 -0.0437 -0.0399 0.0132  1210 PHE A N   
110  C CA  . PHE A 24  ? 0.8798 0.8064 0.9102 -0.0442 -0.0425 0.0104  1210 PHE A CA  
111  C C   . PHE A 24  ? 0.9839 0.9219 1.0089 -0.0455 -0.0481 0.0190  1210 PHE A C   
112  O O   . PHE A 24  ? 1.0779 1.0197 1.1129 -0.0475 -0.0552 0.0231  1210 PHE A O   
113  C CB  . PHE A 24  ? 0.8752 0.7952 0.8937 -0.0429 -0.0357 -0.0007 1210 PHE A CB  
114  C CG  . PHE A 24  ? 1.0166 0.9392 1.0373 -0.0436 -0.0373 -0.0048 1210 PHE A CG  
115  C CD1 . PHE A 24  ? 1.1134 1.0456 1.1233 -0.0444 -0.0386 -0.0008 1210 PHE A CD1 
116  C CD2 . PHE A 24  ? 0.8894 0.8047 0.9233 -0.0447 -0.0368 -0.0133 1210 PHE A CD2 
117  C CE1 . PHE A 24  ? 0.9056 0.8408 0.9167 -0.0459 -0.0402 -0.0041 1210 PHE A CE1 
118  C CE2 . PHE A 24  ? 0.8184 0.7370 0.8554 -0.0453 -0.0386 -0.0173 1210 PHE A CE2 
119  C CZ  . PHE A 24  ? 0.7471 0.6760 0.7720 -0.0458 -0.0406 -0.0122 1210 PHE A CZ  
120  N N   . TYR A 25  ? 0.8671 0.8101 0.8767 -0.0454 -0.0451 0.0214  1211 TYR A N   
121  C CA  . TYR A 25  ? 0.9608 0.9133 0.9626 -0.0494 -0.0489 0.0283  1211 TYR A CA  
122  C C   . TYR A 25  ? 1.0798 1.0361 1.0899 -0.0527 -0.0577 0.0388  1211 TYR A C   
123  O O   . TYR A 25  ? 1.2557 1.2165 1.2660 -0.0574 -0.0650 0.0449  1211 TYR A O   
124  C CB  . TYR A 25  ? 0.8323 0.7886 0.8184 -0.0497 -0.0419 0.0268  1211 TYR A CB  
125  C CG  . TYR A 25  ? 0.8549 0.8078 0.8318 -0.0471 -0.0335 0.0175  1211 TYR A CG  
126  C CD1 . TYR A 25  ? 0.8243 0.7777 0.7979 -0.0489 -0.0329 0.0135  1211 TYR A CD1 
127  C CD2 . TYR A 25  ? 0.9058 0.8548 0.8771 -0.0431 -0.0266 0.0128  1211 TYR A CD2 
128  C CE1 . TYR A 25  ? 0.8893 0.8390 0.8530 -0.0468 -0.0244 0.0045  1211 TYR A CE1 
129  C CE2 . TYR A 25  ? 0.7132 0.6578 0.6757 -0.0408 -0.0192 0.0047  1211 TYR A CE2 
130  C CZ  . TYR A 25  ? 0.8323 0.7770 0.7901 -0.0427 -0.0175 0.0002  1211 TYR A CZ  
131  O OH  . TYR A 25  ? 0.6882 0.6279 0.6358 -0.0406 -0.0092 -0.0084 1211 TYR A OH  
132  N N   . LYS A 26  ? 0.9638 0.9178 0.9798 -0.0510 -0.0573 0.0412  1212 LYS A N   
133  C CA  . LYS A 26  ? 1.1307 1.0870 1.1536 -0.0539 -0.0646 0.0508  1212 LYS A CA  
134  C C   . LYS A 26  ? 1.0377 0.9915 1.0792 -0.0544 -0.0725 0.0538  1212 LYS A C   
135  O O   . LYS A 26  ? 1.1359 1.0927 1.1810 -0.0582 -0.0817 0.0627  1212 LYS A O   
136  C CB  . LYS A 26  ? 0.9951 0.9496 1.0203 -0.0521 -0.0610 0.0518  1212 LYS A CB  
137  C CG  . LYS A 26  ? 1.1474 1.0946 1.1894 -0.0501 -0.0596 0.0491  1212 LYS A CG  
138  C CD  . LYS A 26  ? 1.3955 1.3420 1.4370 -0.0500 -0.0555 0.0509  1212 LYS A CD  
139  C CE  . LYS A 26  ? 1.5114 1.4515 1.5711 -0.0510 -0.0545 0.0505  1212 LYS A CE  
140  N NZ  . LYS A 26  ? 1.4550 1.3867 1.5220 -0.0506 -0.0498 0.0410  1212 LYS A NZ  
141  N N   . ASP A 27  ? 0.7901 0.7377 0.8442 -0.0512 -0.0690 0.0461  1213 ASP A N   
142  C CA  . ASP A 27  ? 0.9458 0.8905 1.0224 -0.0513 -0.0750 0.0466  1213 ASP A CA  
143  C C   . ASP A 27  ? 1.0063 0.9562 1.0830 -0.0535 -0.0831 0.0497  1213 ASP A C   
144  O O   . ASP A 27  ? 1.1927 1.1439 1.2859 -0.0551 -0.0932 0.0567  1213 ASP A O   
145  C CB  . ASP A 27  ? 0.9314 0.8674 1.0190 -0.0491 -0.0675 0.0347  1213 ASP A CB  
146  C CG  . ASP A 27  ? 1.1589 1.0890 1.2487 -0.0492 -0.0606 0.0326  1213 ASP A CG  
147  O OD1 . ASP A 27  ? 1.2140 1.1478 1.2993 -0.0499 -0.0619 0.0405  1213 ASP A OD1 
148  O OD2 . ASP A 27  ? 1.3129 1.2343 1.4078 -0.0498 -0.0535 0.0226  1213 ASP A OD2 
149  N N   . ASN A 28  ? 1.0103 0.9630 1.0690 -0.0541 -0.0787 0.0447  1214 ASN A N   
150  C CA  . ASN A 28  ? 1.0440 1.0023 1.0993 -0.0578 -0.0848 0.0470  1214 ASN A CA  
151  C C   . ASN A 28  ? 1.1705 1.1358 1.2085 -0.0648 -0.0904 0.0572  1214 ASN A C   
152  O O   . ASN A 28  ? 1.5055 1.4756 1.5374 -0.0701 -0.0954 0.0601  1214 ASN A O   
153  C CB  . ASN A 28  ? 0.9588 0.9157 1.0049 -0.0559 -0.0761 0.0351  1214 ASN A CB  
154  C CG  . ASN A 28  ? 0.9791 0.9276 1.0422 -0.0516 -0.0720 0.0243  1214 ASN A CG  
155  O OD1 . ASN A 28  ? 0.9885 0.9367 1.0582 -0.0516 -0.0723 0.0178  1214 ASN A OD1 
156  N ND2 . ASN A 28  ? 1.0773 1.0190 1.1474 -0.0493 -0.0676 0.0219  1214 ASN A ND2 
157  N N   . ASN A 29  ? 0.9432 0.9087 0.9728 -0.0662 -0.0891 0.0620  1215 ASN A N   
158  C CA  . ASN A 29  ? 1.2565 1.2269 1.2688 -0.0748 -0.0933 0.0701  1215 ASN A CA  
159  C C   . ASN A 29  ? 1.2297 1.2044 1.2201 -0.0791 -0.0844 0.0648  1215 ASN A C   
160  O O   . ASN A 29  ? 1.0918 1.0703 1.0674 -0.0890 -0.0872 0.0701  1215 ASN A O   
161  C CB  . ASN A 29  ? 1.2553 1.2274 1.2743 -0.0812 -0.1081 0.0808  1215 ASN A CB  
162  C CG  . ASN A 29  ? 1.4427 1.4105 1.4836 -0.0780 -0.1172 0.0878  1215 ASN A CG  
163  O OD1 . ASN A 29  ? 1.3914 1.3560 1.4348 -0.0747 -0.1130 0.0877  1215 ASN A OD1 
164  N ND2 . ASN A 29  ? 1.5279 1.4957 1.5858 -0.0793 -0.1294 0.0941  1215 ASN A ND2 
165  N N   . ARG A 30  ? 1.1036 1.0767 1.0919 -0.0728 -0.0732 0.0541  1216 ARG A N   
166  C CA  . ARG A 30  ? 0.9407 0.9173 0.9111 -0.0761 -0.0633 0.0483  1216 ARG A CA  
167  C C   . ARG A 30  ? 1.0184 0.9956 0.9816 -0.0764 -0.0576 0.0484  1216 ARG A C   
168  O O   . ARG A 30  ? 1.0641 1.0388 1.0278 -0.0697 -0.0491 0.0416  1216 ARG A O   
169  C CB  . ARG A 30  ? 0.6549 0.6279 0.6259 -0.0689 -0.0541 0.0372  1216 ARG A CB  
170  C CG  . ARG A 30  ? 1.3745 1.3509 1.3287 -0.0723 -0.0432 0.0311  1216 ARG A CG  
171  C CD  . ARG A 30  ? 1.3295 1.3122 1.2738 -0.0829 -0.0464 0.0352  1216 ARG A CD  
172  N NE  . ARG A 30  ? 1.1307 1.1130 1.0835 -0.0816 -0.0527 0.0346  1216 ARG A NE  
173  C CZ  . ARG A 30  ? 1.1247 1.1083 1.0708 -0.0821 -0.0464 0.0273  1216 ARG A CZ  
174  N NH1 . ARG A 30  ? 1.2596 1.2446 1.1903 -0.0840 -0.0334 0.0207  1216 ARG A NH1 
175  N NH2 . ARG A 30  ? 1.1630 1.1466 1.1189 -0.0809 -0.0527 0.0263  1216 ARG A NH2 
176  N N   . GLU A 31  ? 1.0061 0.9861 0.9622 -0.0850 -0.0626 0.0558  1217 GLU A N   
177  C CA  . GLU A 31  ? 1.1062 1.0873 1.0559 -0.0868 -0.0576 0.0554  1217 GLU A CA  
178  C C   . GLU A 31  ? 1.0581 1.0421 0.9985 -0.0874 -0.0445 0.0468  1217 GLU A C   
179  O O   . GLU A 31  ? 1.0168 1.0005 0.9601 -0.0823 -0.0387 0.0431  1217 GLU A O   
180  C CB  . GLU A 31  ? 1.0834 1.0656 1.0240 -0.0985 -0.0653 0.0639  1217 GLU A CB  
181  C CG  . GLU A 31  ? 1.0504 1.0335 0.9842 -0.1014 -0.0599 0.0623  1217 GLU A CG  
182  C CD  . GLU A 31  ? 1.1972 1.1809 1.1142 -0.1173 -0.0628 0.0665  1217 GLU A CD  
183  O OE1 . GLU A 31  ? 1.1184 1.1047 1.0236 -0.1271 -0.0586 0.0640  1217 GLU A OE1 
184  O OE2 . GLU A 31  ? 1.1989 1.1800 1.1133 -0.1210 -0.0686 0.0718  1217 GLU A OE2 
185  N N   . GLU A 32  ? 0.9701 0.9569 0.9004 -0.0940 -0.0396 0.0437  1218 GLU A N   
186  C CA  . GLU A 32  ? 0.8474 0.8367 0.7714 -0.0949 -0.0260 0.0352  1218 GLU A CA  
187  C C   . GLU A 32  ? 0.9596 0.9452 0.8928 -0.0813 -0.0200 0.0283  1218 GLU A C   
188  O O   . GLU A 32  ? 0.9566 0.9427 0.8923 -0.0777 -0.0125 0.0236  1218 GLU A O   
189  C CB  . GLU A 32  ? 1.0024 0.9952 0.9139 -0.1052 -0.0204 0.0328  1218 GLU A CB  
190  C CG  . GLU A 32  ? 1.3098 1.3057 1.2152 -0.1100 -0.0056 0.0247  1218 GLU A CG  
191  C CD  . GLU A 32  ? 1.4432 1.4429 1.3343 -0.1242 0.0008  0.0230  1218 GLU A CD  
192  O OE1 . GLU A 32  ? 1.5208 1.5208 1.4083 -0.1248 -0.0029 0.0248  1218 GLU A OE1 
193  O OE2 . GLU A 32  ? 1.3994 1.4018 1.2832 -0.1357 0.0103  0.0193  1218 GLU A OE2 
194  N N   . MET A 33  ? 1.0186 1.0000 0.9573 -0.0747 -0.0238 0.0275  1219 MET A N   
195  C CA  . MET A 33  ? 0.8363 0.8117 0.7811 -0.0638 -0.0191 0.0210  1219 MET A CA  
196  C C   . MET A 33  ? 0.8827 0.8550 0.8369 -0.0575 -0.0220 0.0229  1219 MET A C   
197  O O   . MET A 33  ? 0.7222 0.6915 0.6783 -0.0516 -0.0166 0.0185  1219 MET A O   
198  C CB  . MET A 33  ? 1.0130 0.9835 0.9613 -0.0603 -0.0228 0.0188  1219 MET A CB  
199  C CG  . MET A 33  ? 0.9481 0.9214 0.8867 -0.0652 -0.0186 0.0152  1219 MET A CG  
200  S SD  . MET A 33  ? 1.0107 0.9829 0.9394 -0.0629 -0.0032 0.0054  1219 MET A SD  
201  C CE  . MET A 33  ? 0.7681 0.7421 0.6865 -0.0678 0.0007  0.0008  1219 MET A CE  
202  N N   . TYR A 34  ? 0.8601 0.8328 0.8199 -0.0594 -0.0308 0.0301  1220 TYR A N   
203  C CA  . TYR A 34  ? 0.6848 0.6552 0.6528 -0.0550 -0.0333 0.0326  1220 TYR A CA  
204  C C   . TYR A 34  ? 0.6125 0.5872 0.5776 -0.0556 -0.0280 0.0315  1220 TYR A C   
205  O O   . TYR A 34  ? 0.8203 0.7929 0.7906 -0.0498 -0.0258 0.0295  1220 TYR A O   
206  C CB  . TYR A 34  ? 0.4198 0.3907 0.3933 -0.0587 -0.0429 0.0409  1220 TYR A CB  
207  C CG  . TYR A 34  ? 0.7560 0.7257 0.7366 -0.0562 -0.0449 0.0444  1220 TYR A CG  
208  C CD1 . TYR A 34  ? 0.6729 0.6364 0.6640 -0.0508 -0.0453 0.0430  1220 TYR A CD1 
209  C CD2 . TYR A 34  ? 0.6782 0.6523 0.6539 -0.0607 -0.0458 0.0484  1220 TYR A CD2 
210  C CE1 . TYR A 34  ? 0.6775 0.6403 0.6741 -0.0500 -0.0461 0.0463  1220 TYR A CE1 
211  C CE2 . TYR A 34  ? 0.8307 0.8042 0.8117 -0.0588 -0.0469 0.0513  1220 TYR A CE2 
212  C CZ  . TYR A 34  ? 0.9557 0.9239 0.9472 -0.0534 -0.0470 0.0506  1220 TYR A CZ  
213  O OH  . TYR A 34  ? 0.6318 0.5998 0.6277 -0.0528 -0.0470 0.0535  1220 TYR A OH  
214  N N   . ILE A 35  ? 0.6729 0.6535 0.6302 -0.0637 -0.0260 0.0323  1221 ILE A N   
215  C CA  . ILE A 35  ? 0.7183 0.7034 0.6744 -0.0658 -0.0200 0.0296  1221 ILE A CA  
216  C C   . ILE A 35  ? 0.7224 0.7075 0.6815 -0.0604 -0.0107 0.0220  1221 ILE A C   
217  O O   . ILE A 35  ? 0.9773 0.9642 0.9431 -0.0567 -0.0076 0.0197  1221 ILE A O   
218  C CB  . ILE A 35  ? 0.8345 0.8244 0.7803 -0.0785 -0.0188 0.0307  1221 ILE A CB  
219  C CG1 . ILE A 35  ? 0.7037 0.6926 0.6465 -0.0838 -0.0287 0.0389  1221 ILE A CG1 
220  C CG2 . ILE A 35  ? 0.5766 0.5709 0.5232 -0.0812 -0.0097 0.0246  1221 ILE A CG2 
221  C CD1 . ILE A 35  ? 0.7130 0.7043 0.6428 -0.0983 -0.0286 0.0403  1221 ILE A CD1 
222  N N   . ARG A 36  ? 0.6161 0.5993 0.5709 -0.0602 -0.0065 0.0181  1222 ARG A N   
223  C CA  . ARG A 36  ? 0.7864 0.7685 0.7436 -0.0555 0.0024  0.0112  1222 ARG A CA  
224  C C   . ARG A 36  ? 0.8285 0.8041 0.7935 -0.0451 -0.0007 0.0111  1222 ARG A C   
225  O O   . ARG A 36  ? 0.8297 0.8050 0.8014 -0.0403 0.0029  0.0083  1222 ARG A O   
226  C CB  . ARG A 36  ? 0.7633 0.7436 0.7122 -0.0576 0.0069  0.0076  1222 ARG A CB  
227  C CG  . ARG A 36  ? 0.8147 0.7896 0.7650 -0.0502 0.0137  0.0012  1222 ARG A CG  
228  C CD  . ARG A 36  ? 1.0177 0.9945 0.9592 -0.0555 0.0231  -0.0039 1222 ARG A CD  
229  N NE  . ARG A 36  ? 1.3324 1.3027 1.2744 -0.0481 0.0300  -0.0102 1222 ARG A NE  
230  C CZ  . ARG A 36  ? 1.4026 1.3657 1.3372 -0.0447 0.0301  -0.0134 1222 ARG A CZ  
231  N NH1 . ARG A 36  ? 1.3325 1.2956 1.2618 -0.0478 0.0238  -0.0110 1222 ARG A NH1 
232  N NH2 . ARG A 36  ? 1.4782 1.4340 1.4115 -0.0386 0.0363  -0.0192 1222 ARG A NH2 
233  N N   . TYR A 37  ? 0.6992 0.6692 0.6640 -0.0427 -0.0078 0.0142  1223 TYR A N   
234  C CA  . TYR A 37  ? 0.7193 0.6817 0.6894 -0.0359 -0.0110 0.0142  1223 TYR A CA  
235  C C   . TYR A 37  ? 0.8591 0.8243 0.8363 -0.0346 -0.0140 0.0181  1223 TYR A C   
236  O O   . TYR A 37  ? 0.7698 0.7304 0.7509 -0.0299 -0.0145 0.0174  1223 TYR A O   
237  C CB  . TYR A 37  ? 0.5291 0.4838 0.4983 -0.0354 -0.0156 0.0144  1223 TYR A CB  
238  C CG  . TYR A 37  ? 0.7577 0.7059 0.7205 -0.0334 -0.0109 0.0076  1223 TYR A CG  
239  C CD1 . TYR A 37  ? 0.9849 0.9238 0.9460 -0.0286 -0.0086 0.0032  1223 TYR A CD1 
240  C CD2 . TYR A 37  ? 0.9273 0.8784 0.8841 -0.0371 -0.0088 0.0056  1223 TYR A CD2 
241  C CE1 . TYR A 37  ? 1.0560 0.9879 1.0091 -0.0272 -0.0037 -0.0036 1223 TYR A CE1 
242  C CE2 . TYR A 37  ? 1.0340 0.9795 0.9836 -0.0355 -0.0035 -0.0013 1223 TYR A CE2 
243  C CZ  . TYR A 37  ? 0.9889 0.9245 0.9364 -0.0304 -0.0005 -0.0063 1223 TYR A CZ  
244  O OH  . TYR A 37  ? 0.8529 0.7818 0.7913 -0.0292 0.0053  -0.0138 1223 TYR A OH  
245  N N   . LEU A 38  ? 0.7180 0.6900 0.6958 -0.0394 -0.0164 0.0223  1224 LEU A N   
246  C CA  . LEU A 38  ? 0.6349 0.6100 0.6186 -0.0381 -0.0183 0.0250  1224 LEU A CA  
247  C C   . LEU A 38  ? 0.7298 0.7081 0.7184 -0.0351 -0.0129 0.0208  1224 LEU A C   
248  O O   . LEU A 38  ? 0.7931 0.7699 0.7880 -0.0305 -0.0144 0.0213  1224 LEU A O   
249  C CB  . LEU A 38  ? 0.6164 0.5987 0.5978 -0.0447 -0.0194 0.0282  1224 LEU A CB  
250  C CG  . LEU A 38  ? 0.9201 0.9019 0.8966 -0.0503 -0.0249 0.0333  1224 LEU A CG  
251  C CD1 . LEU A 38  ? 0.6224 0.6101 0.5955 -0.0566 -0.0250 0.0353  1224 LEU A CD1 
252  C CD2 . LEU A 38  ? 0.9875 0.9635 0.9694 -0.0469 -0.0300 0.0371  1224 LEU A CD2 
253  N N   . TYR A 39  ? 0.6937 0.6764 0.6804 -0.0384 -0.0066 0.0165  1225 TYR A N   
254  C CA  . TYR A 39  ? 0.7837 0.7698 0.7793 -0.0356 -0.0006 0.0117  1225 TYR A CA  
255  C C   . TYR A 39  ? 0.7242 0.7027 0.7238 -0.0276 -0.0006 0.0100  1225 TYR A C   
256  O O   . TYR A 39  ? 0.5993 0.5784 0.6093 -0.0228 -0.0008 0.0095  1225 TYR A O   
257  C CB  . TYR A 39  ? 0.5333 0.5254 0.5274 -0.0428 0.0082  0.0064  1225 TYR A CB  
258  C CG  . TYR A 39  ? 0.5183 0.5171 0.5100 -0.0513 0.0080  0.0073  1225 TYR A CG  
259  C CD1 . TYR A 39  ? 0.4356 0.4403 0.4376 -0.0514 0.0106  0.0044  1225 TYR A CD1 
260  C CD2 . TYR A 39  ? 0.5684 0.5670 0.5476 -0.0595 0.0046  0.0110  1225 TYR A CD2 
261  C CE1 . TYR A 39  ? 0.5210 0.5303 0.5186 -0.0600 0.0110  0.0040  1225 TYR A CE1 
262  C CE2 . TYR A 39  ? 0.5913 0.5938 0.5658 -0.0682 0.0039  0.0120  1225 TYR A CE2 
263  C CZ  . TYR A 39  ? 0.5068 0.5143 0.4894 -0.0687 0.0076  0.0080  1225 TYR A CZ  
264  O OH  . TYR A 39  ? 0.7879 0.7981 0.7637 -0.0783 0.0074  0.0078  1225 TYR A OH  
265  N N   . LYS A 40  ? 0.5133 0.4839 0.5043 -0.0265 -0.0009 0.0091  1226 LYS A N   
266  C CA  . LYS A 40  ? 0.7590 0.7201 0.7506 -0.0202 -0.0012 0.0071  1226 LYS A CA  
267  C C   . LYS A 40  ? 0.7704 0.7263 0.7656 -0.0170 -0.0090 0.0116  1226 LYS A C   
268  O O   . LYS A 40  ? 0.7225 0.6745 0.7235 -0.0126 -0.0104 0.0117  1226 LYS A O   
269  C CB  . LYS A 40  ? 0.7503 0.7028 0.7301 -0.0207 -0.0001 0.0044  1226 LYS A CB  
270  C CG  . LYS A 40  ? 0.8671 0.8223 0.8422 -0.0230 0.0087  -0.0009 1226 LYS A CG  
271  C CD  . LYS A 40  ? 0.9770 0.9243 0.9403 -0.0235 0.0095  -0.0041 1226 LYS A CD  
272  C CE  . LYS A 40  ? 1.1615 1.1023 1.1205 -0.0202 0.0171  -0.0104 1226 LYS A CE  
273  N NZ  . LYS A 40  ? 0.8717 0.8211 0.8339 -0.0230 0.0272  -0.0137 1226 LYS A NZ  
274  N N   . LEU A 41  ? 0.6101 0.5657 0.6023 -0.0202 -0.0140 0.0157  1227 LEU A N   
275  C CA  . LEU A 41  ? 0.7175 0.6685 0.7119 -0.0195 -0.0200 0.0199  1227 LEU A CA  
276  C C   . LEU A 41  ? 0.5601 0.5192 0.5649 -0.0177 -0.0214 0.0224  1227 LEU A C   
277  O O   . LEU A 41  ? 0.7118 0.6664 0.7199 -0.0156 -0.0256 0.0248  1227 LEU A O   
278  C CB  . LEU A 41  ? 0.5985 0.5492 0.5901 -0.0241 -0.0232 0.0233  1227 LEU A CB  
279  C CG  . LEU A 41  ? 0.5451 0.4924 0.5388 -0.0257 -0.0276 0.0276  1227 LEU A CG  
280  C CD1 . LEU A 41  ? 0.5090 0.4432 0.4986 -0.0252 -0.0296 0.0261  1227 LEU A CD1 
281  C CD2 . LEU A 41  ? 0.5437 0.4904 0.5368 -0.0304 -0.0289 0.0301  1227 LEU A CD2 
282  N N   . ARG A 42  ? 0.5436 0.5142 0.5533 -0.0195 -0.0180 0.0216  1228 ARG A N   
283  C CA  . ARG A 42  ? 0.6259 0.6052 0.6469 -0.0183 -0.0183 0.0223  1228 ARG A CA  
284  C C   . ARG A 42  ? 0.7667 0.7448 0.7986 -0.0126 -0.0173 0.0197  1228 ARG A C   
285  O O   . ARG A 42  ? 0.7037 0.6838 0.7454 -0.0098 -0.0216 0.0223  1228 ARG A O   
286  C CB  . ARG A 42  ? 0.7475 0.7376 0.7701 -0.0230 -0.0134 0.0197  1228 ARG A CB  
287  C CG  . ARG A 42  ? 0.7449 0.7444 0.7809 -0.0220 -0.0121 0.0178  1228 ARG A CG  
288  C CD  . ARG A 42  ? 0.8789 0.8866 0.9154 -0.0283 -0.0051 0.0125  1228 ARG A CD  
289  N NE  . ARG A 42  ? 1.0367 1.0434 1.0733 -0.0299 0.0021  0.0069  1228 ARG A NE  
290  C CZ  . ARG A 42  ? 0.7296 0.7415 0.7790 -0.0306 0.0097  -0.0001 1228 ARG A CZ  
291  N NH1 . ARG A 42  ? 0.9187 0.9379 0.9833 -0.0293 0.0103  -0.0028 1228 ARG A NH1 
292  N NH2 . ARG A 42  ? 0.6995 0.7100 0.7477 -0.0333 0.0175  -0.0051 1228 ARG A NH2 
293  N N   . ASP A 43  ? 0.7541 0.7292 0.7849 -0.0112 -0.0117 0.0150  1229 ASP A N   
294  C CA  . ASP A 43  ? 0.7783 0.7512 0.8207 -0.0056 -0.0100 0.0124  1229 ASP A CA  
295  C C   . ASP A 43  ? 0.7600 0.7212 0.8000 -0.0018 -0.0185 0.0170  1229 ASP A C   
296  O O   . ASP A 43  ? 0.7167 0.6777 0.7696 0.0026  -0.0224 0.0188  1229 ASP A O   
297  C CB  . ASP A 43  ? 0.7347 0.7054 0.7736 -0.0060 -0.0011 0.0063  1229 ASP A CB  
298  C CG  . ASP A 43  ? 0.9476 0.9295 0.9916 -0.0115 0.0082  0.0010  1229 ASP A CG  
299  O OD1 . ASP A 43  ? 0.8891 0.8803 0.9431 -0.0135 0.0081  0.0008  1229 ASP A OD1 
300  O OD2 . ASP A 43  ? 0.9913 0.9726 1.0283 -0.0150 0.0162  -0.0035 1229 ASP A OD2 
301  N N   . LEU A 44  ? 0.7906 0.7416 0.8147 -0.0044 -0.0215 0.0187  1230 LEU A N   
302  C CA  . LEU A 44  ? 0.8617 0.7991 0.8794 -0.0039 -0.0290 0.0222  1230 LEU A CA  
303  C C   . LEU A 44  ? 0.8260 0.7675 0.8509 -0.0051 -0.0364 0.0285  1230 LEU A C   
304  O O   . LEU A 44  ? 0.8072 0.7425 0.8357 -0.0035 -0.0431 0.0322  1230 LEU A O   
305  C CB  . LEU A 44  ? 0.7666 0.6931 0.7672 -0.0087 -0.0292 0.0210  1230 LEU A CB  
306  C CG  . LEU A 44  ? 0.7877 0.7065 0.7784 -0.0079 -0.0234 0.0147  1230 LEU A CG  
307  C CD1 . LEU A 44  ? 0.5303 0.4417 0.5085 -0.0131 -0.0234 0.0128  1230 LEU A CD1 
308  C CD2 . LEU A 44  ? 0.5076 0.4137 0.4956 -0.0044 -0.0250 0.0133  1230 LEU A CD2 
309  N N   . HIS A 45  ? 0.6896 0.6415 0.7158 -0.0085 -0.0352 0.0300  1231 HIS A N   
310  C CA  . HIS A 45  ? 0.5999 0.5575 0.6317 -0.0104 -0.0406 0.0354  1231 HIS A CA  
311  C C   . HIS A 45  ? 0.7943 0.7608 0.8445 -0.0053 -0.0424 0.0357  1231 HIS A C   
312  O O   . HIS A 45  ? 0.6792 0.6457 0.7350 -0.0054 -0.0497 0.0409  1231 HIS A O   
313  C CB  . HIS A 45  ? 0.4058 0.3727 0.4348 -0.0148 -0.0375 0.0360  1231 HIS A CB  
314  C CG  . HIS A 45  ? 0.6380 0.5966 0.6541 -0.0205 -0.0384 0.0380  1231 HIS A CG  
315  N ND1 . HIS A 45  ? 0.8835 0.8424 0.8935 -0.0229 -0.0343 0.0358  1231 HIS A ND1 
316  C CD2 . HIS A 45  ? 0.3938 0.3432 0.4034 -0.0254 -0.0425 0.0417  1231 HIS A CD2 
317  C CE1 . HIS A 45  ? 0.7204 0.6711 0.7233 -0.0278 -0.0357 0.0376  1231 HIS A CE1 
318  N NE2 . HIS A 45  ? 0.6791 0.6238 0.6810 -0.0301 -0.0398 0.0407  1231 HIS A NE2 
319  N N   . LEU A 46  ? 0.7739 0.7479 0.8344 -0.0019 -0.0356 0.0299  1232 LEU A N   
320  C CA  . LEU A 46  ? 0.5819 0.5651 0.6644 0.0027  -0.0357 0.0284  1232 LEU A CA  
321  C C   . LEU A 46  ? 0.7888 0.7628 0.8794 0.0082  -0.0415 0.0307  1232 LEU A C   
322  O O   . LEU A 46  ? 0.8593 0.8378 0.9677 0.0117  -0.0473 0.0335  1232 LEU A O   
323  C CB  . LEU A 46  ? 0.7507 0.7439 0.8427 0.0026  -0.0250 0.0202  1232 LEU A CB  
324  C CG  . LEU A 46  ? 0.7764 0.7809 0.8656 -0.0034 -0.0201 0.0174  1232 LEU A CG  
325  C CD1 . LEU A 46  ? 0.5499 0.5634 0.6512 -0.0053 -0.0095 0.0082  1232 LEU A CD1 
326  C CD2 . LEU A 46  ? 0.5305 0.5419 0.6244 -0.0042 -0.0262 0.0218  1232 LEU A CD2 
327  N N   . ASP A 47  ? 0.8317 0.7923 0.9094 0.0087  -0.0403 0.0296  1233 ASP A N   
328  C CA  . ASP A 47  ? 0.8691 0.8173 0.9497 0.0129  -0.0468 0.0324  1233 ASP A CA  
329  C C   . ASP A 47  ? 0.7682 0.7113 0.8461 0.0102  -0.0594 0.0412  1233 ASP A C   
330  O O   . ASP A 47  ? 0.9268 0.8690 1.0193 0.0138  -0.0673 0.0455  1233 ASP A O   
331  C CB  . ASP A 47  ? 1.1557 1.0883 1.2169 0.0120  -0.0435 0.0294  1233 ASP A CB  
332  C CG  . ASP A 47  ? 1.3901 1.3272 1.4539 0.0142  -0.0307 0.0210  1233 ASP A CG  
333  O OD1 . ASP A 47  ? 1.3597 1.3097 1.4427 0.0165  -0.0246 0.0174  1233 ASP A OD1 
334  O OD2 . ASP A 47  ? 1.3994 1.3270 1.4457 0.0124  -0.0263 0.0174  1233 ASP A OD2 
335  N N   . CYS A 48  ? 0.9400 0.8803 1.0008 0.0030  -0.0610 0.0438  1234 CYS A N   
336  C CA  . CYS A 48  ? 0.8126 0.7477 0.8678 -0.0025 -0.0714 0.0518  1234 CYS A CA  
337  C C   . CYS A 48  ? 0.8622 0.8132 0.9312 -0.0032 -0.0744 0.0556  1234 CYS A C   
338  O O   . CYS A 48  ? 0.9358 0.8838 1.0000 -0.0088 -0.0824 0.0626  1234 CYS A O   
339  C CB  . CYS A 48  ? 0.7365 0.6610 0.7685 -0.0114 -0.0700 0.0519  1234 CYS A CB  
340  S SG  . CYS A 48  ? 1.1673 1.0698 1.1814 -0.0126 -0.0695 0.0480  1234 CYS A SG  
341  N N   . ASP A 49  ? 0.7946 0.7616 0.8788 0.0011  -0.0673 0.0505  1235 ASP A N   
342  C CA  . ASP A 49  ? 0.6703 0.6529 0.7658 -0.0001 -0.0681 0.0520  1235 ASP A CA  
343  C C   . ASP A 49  ? 0.6569 0.6418 0.7363 -0.0081 -0.0663 0.0543  1235 ASP A C   
344  O O   . ASP A 49  ? 0.6126 0.6071 0.6972 -0.0105 -0.0689 0.0574  1235 ASP A O   
345  C CB  . ASP A 49  ? 0.7648 0.7496 0.8762 0.0020  -0.0794 0.0586  1235 ASP A CB  
346  C CG  . ASP A 49  ? 1.1995 1.1874 1.3365 0.0111  -0.0802 0.0555  1235 ASP A CG  
347  O OD1 . ASP A 49  ? 1.2992 1.2870 1.4396 0.0149  -0.0706 0.0478  1235 ASP A OD1 
348  O OD2 . ASP A 49  ? 1.1926 1.1831 1.3472 0.0140  -0.0902 0.0609  1235 ASP A OD2 
349  N N   . ASN A 50  ? 0.6957 0.6720 0.7569 -0.0121 -0.0615 0.0526  1236 ASN A N   
350  C CA  . ASN A 50  ? 0.7160 0.6944 0.7648 -0.0192 -0.0582 0.0538  1236 ASN A CA  
351  C C   . ASN A 50  ? 0.7120 0.7041 0.7661 -0.0177 -0.0504 0.0487  1236 ASN A C   
352  O O   . ASN A 50  ? 0.7968 0.7875 0.8448 -0.0177 -0.0445 0.0445  1236 ASN A O   
353  C CB  . ASN A 50  ? 0.9117 0.8762 0.9435 -0.0235 -0.0556 0.0527  1236 ASN A CB  
354  C CG  . ASN A 50  ? 0.7474 0.6954 0.7704 -0.0266 -0.0619 0.0556  1236 ASN A CG  
355  O OD1 . ASN A 50  ? 0.7614 0.7075 0.7882 -0.0278 -0.0697 0.0609  1236 ASN A OD1 
356  N ND2 . ASN A 50  ? 0.5529 0.4881 0.5636 -0.0289 -0.0589 0.0520  1236 ASN A ND2 
357  N N   . TYR A 51  ? 0.5237 0.5287 0.5885 -0.0174 -0.0507 0.0489  1237 TYR A N   
358  C CA  . TYR A 51  ? 0.6344 0.6509 0.7033 -0.0171 -0.0432 0.0428  1237 TYR A CA  
359  C C   . TYR A 51  ? 0.7353 0.7513 0.7889 -0.0232 -0.0390 0.0435  1237 TYR A C   
360  O O   . TYR A 51  ? 0.5957 0.6128 0.6448 -0.0241 -0.0335 0.0392  1237 TYR A O   
361  C CB  . TYR A 51  ? 0.6799 0.7100 0.7648 -0.0156 -0.0441 0.0412  1237 TYR A CB  
362  C CG  . TYR A 51  ? 0.7307 0.7623 0.8361 -0.0087 -0.0470 0.0388  1237 TYR A CG  
363  C CD1 . TYR A 51  ? 0.9175 0.9507 1.0319 -0.0055 -0.0402 0.0310  1237 TYR A CD1 
364  C CD2 . TYR A 51  ? 0.9229 0.9539 1.0392 -0.0062 -0.0566 0.0449  1237 TYR A CD2 
365  C CE1 . TYR A 51  ? 0.9881 1.0223 1.1240 0.0008  -0.0417 0.0284  1237 TYR A CE1 
366  C CE2 . TYR A 51  ? 1.0652 1.0969 1.2032 0.0008  -0.0601 0.0433  1237 TYR A CE2 
367  C CZ  . TYR A 51  ? 1.0684 1.1018 1.2170 0.0046  -0.0520 0.0348  1237 TYR A CZ  
368  O OH  . TYR A 51  ? 1.3249 1.3590 1.4974 0.0114  -0.0540 0.0327  1237 TYR A OH  
369  N N   . THR A 52  ? 0.6746 0.6883 0.7202 -0.0281 -0.0416 0.0493  1238 THR A N   
370  C CA  . THR A 52  ? 0.6269 0.6412 0.6611 -0.0338 -0.0371 0.0501  1238 THR A CA  
371  C C   . THR A 52  ? 0.5717 0.5749 0.5965 -0.0351 -0.0355 0.0500  1238 THR A C   
372  O O   . THR A 52  ? 0.4910 0.4951 0.5102 -0.0373 -0.0317 0.0487  1238 THR A O   
373  C CB  . THR A 52  ? 0.4564 0.4732 0.4863 -0.0397 -0.0380 0.0554  1238 THR A CB  
374  O OG1 . THR A 52  ? 0.6491 0.6552 0.6682 -0.0456 -0.0369 0.0589  1238 THR A OG1 
375  C CG2 . THR A 52  ? 0.6121 0.6311 0.6500 -0.0388 -0.0444 0.0588  1238 THR A CG2 
376  N N   . GLU A 53  ? 0.4039 0.3962 0.4272 -0.0339 -0.0389 0.0509  1239 GLU A N   
377  C CA  . GLU A 53  ? 0.5970 0.5795 0.6130 -0.0349 -0.0371 0.0493  1239 GLU A CA  
378  C C   . GLU A 53  ? 0.5606 0.5468 0.5791 -0.0305 -0.0342 0.0443  1239 GLU A C   
379  O O   . GLU A 53  ? 0.7078 0.6919 0.7209 -0.0322 -0.0319 0.0432  1239 GLU A O   
380  C CB  . GLU A 53  ? 0.3701 0.3385 0.3813 -0.0365 -0.0405 0.0504  1239 GLU A CB  
381  C CG  . GLU A 53  ? 0.6603 0.6276 0.6750 -0.0362 -0.0462 0.0536  1239 GLU A CG  
382  C CD  . GLU A 53  ? 0.7335 0.7029 0.7457 -0.0435 -0.0477 0.0589  1239 GLU A CD  
383  O OE1 . GLU A 53  ? 0.7188 0.6818 0.7231 -0.0511 -0.0447 0.0600  1239 GLU A OE1 
384  O OE2 . GLU A 53  ? 0.8418 0.8192 0.8610 -0.0423 -0.0516 0.0618  1239 GLU A OE2 
385  N N   . ALA A 54  ? 0.6306 0.6228 0.6583 -0.0258 -0.0341 0.0414  1240 ALA A N   
386  C CA  . ALA A 54  ? 0.7012 0.6976 0.7316 -0.0238 -0.0294 0.0357  1240 ALA A CA  
387  C C   . ALA A 54  ? 0.7163 0.7206 0.7428 -0.0284 -0.0254 0.0342  1240 ALA A C   
388  O O   . ALA A 54  ? 0.5567 0.5596 0.5767 -0.0309 -0.0227 0.0322  1240 ALA A O   
389  C CB  . ALA A 54  ? 0.6101 0.6116 0.6544 -0.0189 -0.0287 0.0321  1240 ALA A CB  
390  N N   . ALA A 55  ? 0.5263 0.5383 0.5555 -0.0303 -0.0255 0.0353  1241 ALA A N   
391  C CA  . ALA A 55  ? 0.4279 0.4457 0.4510 -0.0355 -0.0223 0.0342  1241 ALA A CA  
392  C C   . ALA A 55  ? 0.6848 0.6959 0.6960 -0.0396 -0.0234 0.0386  1241 ALA A C   
393  O O   . ALA A 55  ? 0.6342 0.6459 0.6387 -0.0437 -0.0217 0.0375  1241 ALA A O   
394  C CB  . ALA A 55  ? 0.4796 0.5050 0.5063 -0.0364 -0.0224 0.0350  1241 ALA A CB  
395  N N   . TYR A 56  ? 0.6137 0.6183 0.6233 -0.0396 -0.0262 0.0435  1242 TYR A N   
396  C CA  . TYR A 56  ? 0.5134 0.5120 0.5166 -0.0432 -0.0268 0.0471  1242 TYR A CA  
397  C C   . TYR A 56  ? 0.6942 0.6874 0.6949 -0.0425 -0.0276 0.0455  1242 TYR A C   
398  O O   . TYR A 56  ? 0.5570 0.5476 0.5537 -0.0458 -0.0288 0.0479  1242 TYR A O   
399  C CB  . TYR A 56  ? 0.6122 0.6034 0.6162 -0.0445 -0.0281 0.0508  1242 TYR A CB  
400  C CG  . TYR A 56  ? 0.6673 0.6630 0.6705 -0.0483 -0.0263 0.0539  1242 TYR A CG  
401  C CD1 . TYR A 56  ? 0.5635 0.5616 0.5628 -0.0521 -0.0242 0.0560  1242 TYR A CD1 
402  C CD2 . TYR A 56  ? 0.6764 0.6741 0.6820 -0.0486 -0.0270 0.0552  1242 TYR A CD2 
403  C CE1 . TYR A 56  ? 0.5664 0.5688 0.5639 -0.0560 -0.0211 0.0584  1242 TYR A CE1 
404  C CE2 . TYR A 56  ? 0.5704 0.5732 0.5742 -0.0531 -0.0246 0.0580  1242 TYR A CE2 
405  C CZ  . TYR A 56  ? 0.6689 0.6742 0.6685 -0.0566 -0.0209 0.0592  1242 TYR A CZ  
406  O OH  . TYR A 56  ? 0.6940 0.7044 0.6910 -0.0613 -0.0172 0.0615  1242 TYR A OH  
407  N N   . THR A 57  ? 0.4238 0.4151 0.4273 -0.0385 -0.0273 0.0419  1243 THR A N   
408  C CA  . THR A 57  ? 0.6741 0.6603 0.6744 -0.0383 -0.0274 0.0401  1243 THR A CA  
409  C C   . THR A 57  ? 0.7158 0.7078 0.7121 -0.0417 -0.0251 0.0376  1243 THR A C   
410  O O   . THR A 57  ? 0.7301 0.7196 0.7211 -0.0450 -0.0265 0.0390  1243 THR A O   
411  C CB  . THR A 57  ? 0.5964 0.5758 0.5984 -0.0337 -0.0272 0.0370  1243 THR A CB  
412  O OG1 . THR A 57  ? 0.7656 0.7490 0.7688 -0.0320 -0.0237 0.0322  1243 THR A OG1 
413  C CG2 . THR A 57  ? 0.7600 0.7360 0.7658 -0.0314 -0.0292 0.0383  1243 THR A CG2 
414  N N   . LEU A 58  ? 0.4865 0.4860 0.4858 -0.0422 -0.0215 0.0338  1244 LEU A N   
415  C CA  . LEU A 58  ? 0.4526 0.4569 0.4464 -0.0487 -0.0184 0.0308  1244 LEU A CA  
416  C C   . LEU A 58  ? 0.6494 0.6531 0.6338 -0.0553 -0.0214 0.0354  1244 LEU A C   
417  O O   . LEU A 58  ? 0.5394 0.5426 0.5152 -0.0623 -0.0216 0.0353  1244 LEU A O   
418  C CB  . LEU A 58  ? 0.4367 0.4489 0.4378 -0.0490 -0.0132 0.0246  1244 LEU A CB  
419  C CG  . LEU A 58  ? 0.5369 0.5496 0.5465 -0.0454 -0.0089 0.0190  1244 LEU A CG  
420  C CD1 . LEU A 58  ? 0.5235 0.5444 0.5435 -0.0473 -0.0024 0.0112  1244 LEU A CD1 
421  C CD2 . LEU A 58  ? 0.5118 0.5205 0.5126 -0.0497 -0.0070 0.0181  1244 LEU A CD2 
422  N N   . LEU A 59  ? 0.6229 0.6262 0.6086 -0.0540 -0.0238 0.0398  1245 LEU A N   
423  C CA  . LEU A 59  ? 0.5575 0.5594 0.5359 -0.0593 -0.0265 0.0446  1245 LEU A CA  
424  C C   . LEU A 59  ? 0.7101 0.7049 0.6863 -0.0606 -0.0316 0.0496  1245 LEU A C   
425  O O   . LEU A 59  ? 0.8965 0.8888 0.8676 -0.0653 -0.0352 0.0545  1245 LEU A O   
426  C CB  . LEU A 59  ? 0.4758 0.4784 0.4575 -0.0574 -0.0264 0.0480  1245 LEU A CB  
427  C CG  . LEU A 59  ? 0.4605 0.4707 0.4410 -0.0591 -0.0226 0.0448  1245 LEU A CG  
428  C CD1 . LEU A 59  ? 0.4677 0.4774 0.4486 -0.0591 -0.0225 0.0494  1245 LEU A CD1 
429  C CD2 . LEU A 59  ? 0.6583 0.6697 0.6278 -0.0666 -0.0215 0.0426  1245 LEU A CD2 
430  N N   . LEU A 60  ? 0.6705 0.6618 0.6514 -0.0564 -0.0322 0.0484  1246 LEU A N   
431  C CA  . LEU A 60  ? 0.7107 0.6963 0.6912 -0.0576 -0.0368 0.0519  1246 LEU A CA  
432  C C   . LEU A 60  ? 0.8378 0.8250 0.8090 -0.0642 -0.0379 0.0513  1246 LEU A C   
433  O O   . LEU A 60  ? 0.9146 0.8985 0.8829 -0.0684 -0.0439 0.0564  1246 LEU A O   
434  C CB  . LEU A 60  ? 0.7514 0.7321 0.7385 -0.0518 -0.0364 0.0495  1246 LEU A CB  
435  C CG  . LEU A 60  ? 0.6065 0.5828 0.6011 -0.0485 -0.0360 0.0506  1246 LEU A CG  
436  C CD1 . LEU A 60  ? 0.5764 0.5460 0.5741 -0.0447 -0.0351 0.0467  1246 LEU A CD1 
437  C CD2 . LEU A 60  ? 0.4076 0.3808 0.4065 -0.0515 -0.0393 0.0562  1246 LEU A CD2 
438  N N   . HIS A 61  ? 0.5348 0.5267 0.5024 -0.0660 -0.0321 0.0451  1247 HIS A N   
439  C CA  . HIS A 61  ? 0.6962 0.6898 0.6533 -0.0754 -0.0308 0.0432  1247 HIS A CA  
440  C C   . HIS A 61  ? 0.8544 0.8477 0.8013 -0.0845 -0.0338 0.0465  1247 HIS A C   
441  O O   . HIS A 61  ? 0.9657 0.9555 0.9031 -0.0928 -0.0393 0.0511  1247 HIS A O   
442  C CB  . HIS A 61  ? 0.6259 0.6245 0.5844 -0.0762 -0.0219 0.0344  1247 HIS A CB  
443  C CG  . HIS A 61  ? 0.7440 0.7430 0.6931 -0.0860 -0.0184 0.0312  1247 HIS A CG  
444  N ND1 . HIS A 61  ? 0.7996 0.8023 0.7519 -0.0875 -0.0089 0.0228  1247 HIS A ND1 
445  C CD2 . HIS A 61  ? 0.5780 0.5742 0.5153 -0.0957 -0.0230 0.0355  1247 HIS A CD2 
446  C CE1 . HIS A 61  ? 0.6852 0.6874 0.6268 -0.0987 -0.0065 0.0214  1247 HIS A CE1 
447  N NE2 . HIS A 61  ? 0.8224 0.8206 0.7537 -0.1041 -0.0156 0.0295  1247 HIS A NE2 
448  N N   . THR A 62  ? 0.6697 0.6661 0.6177 -0.0837 -0.0307 0.0442  1248 THR A N   
449  C CA  . THR A 62  ? 0.7173 0.7131 0.6534 -0.0933 -0.0316 0.0450  1248 THR A CA  
450  C C   . THR A 62  ? 0.7407 0.7303 0.6729 -0.0951 -0.0406 0.0548  1248 THR A C   
451  O O   . THR A 62  ? 0.8548 0.8409 0.7740 -0.1047 -0.0439 0.0575  1248 THR A O   
452  C CB  . THR A 62  ? 0.8747 0.8756 0.8141 -0.0908 -0.0261 0.0402  1248 THR A CB  
453  O OG1 . THR A 62  ? 0.6339 0.6343 0.5816 -0.0825 -0.0288 0.0455  1248 THR A OG1 
454  C CG2 . THR A 62  ? 0.5689 0.5762 0.5177 -0.0872 -0.0182 0.0310  1248 THR A CG2 
455  N N   . TRP A 63  ? 0.7174 0.7047 0.6615 -0.0864 -0.0444 0.0598  1249 TRP A N   
456  C CA  . TRP A 63  ? 0.8849 0.8663 0.8309 -0.0872 -0.0527 0.0688  1249 TRP A CA  
457  C C   . TRP A 63  ? 0.9306 0.9080 0.8684 -0.0954 -0.0603 0.0735  1249 TRP A C   
458  O O   . TRP A 63  ? 0.8824 0.8545 0.8176 -0.0999 -0.0688 0.0815  1249 TRP A O   
459  C CB  . TRP A 63  ? 0.7226 0.7022 0.6853 -0.0776 -0.0533 0.0707  1249 TRP A CB  
460  C CG  . TRP A 63  ? 1.1648 1.1390 1.1342 -0.0779 -0.0595 0.0786  1249 TRP A CG  
461  C CD1 . TRP A 63  ? 1.2367 1.2062 1.2132 -0.0785 -0.0676 0.0843  1249 TRP A CD1 
462  C CD2 . TRP A 63  ? 1.3986 1.3717 1.3703 -0.0778 -0.0581 0.0818  1249 TRP A CD2 
463  N NE1 . TRP A 63  ? 1.3040 1.2692 1.2895 -0.0783 -0.0715 0.0909  1249 TRP A NE1 
464  C CE2 . TRP A 63  ? 1.4673 1.4343 1.4491 -0.0781 -0.0652 0.0895  1249 TRP A CE2 
465  C CE3 . TRP A 63  ? 1.2721 1.2491 1.2393 -0.0777 -0.0512 0.0787  1249 TRP A CE3 
466  C CZ2 . TRP A 63  ? 1.4947 1.4587 1.4821 -0.0785 -0.0646 0.0940  1249 TRP A CZ2 
467  C CZ3 . TRP A 63  ? 1.2580 1.2326 1.2282 -0.0784 -0.0504 0.0832  1249 TRP A CZ3 
468  C CH2 . TRP A 63  ? 1.4132 1.3810 1.3934 -0.0788 -0.0566 0.0908  1249 TRP A CH2 
469  N N   . LEU A 64  ? 0.6777 0.6577 0.6114 -0.0979 -0.0572 0.0685  1250 LEU A N   
470  C CA  . LEU A 64  ? 0.7489 0.7261 0.6730 -0.1072 -0.0633 0.0722  1250 LEU A CA  
471  C C   . LEU A 64  ? 0.9477 0.9239 0.8521 -0.1220 -0.0620 0.0702  1250 LEU A C   
472  O O   . LEU A 64  ? 0.7501 0.7227 0.6428 -0.1333 -0.0681 0.0744  1250 LEU A O   
473  C CB  . LEU A 64  ? 0.6407 0.6210 0.5689 -0.1040 -0.0589 0.0672  1250 LEU A CB  
474  C CG  . LEU A 64  ? 0.8001 0.7793 0.7452 -0.0918 -0.0608 0.0684  1250 LEU A CG  
475  C CD1 . LEU A 64  ? 0.5670 0.5483 0.5130 -0.0895 -0.0559 0.0627  1250 LEU A CD1 
476  C CD2 . LEU A 64  ? 0.6774 0.6517 0.6292 -0.0923 -0.0723 0.0778  1250 LEU A CD2 
477  N N   . LEU A 65  ? 0.9835 0.9626 0.8841 -0.1232 -0.0538 0.0631  1251 LEU A N   
478  C CA  . LEU A 65  ? 0.7888 0.7661 0.6708 -0.1386 -0.0505 0.0585  1251 LEU A CA  
479  C C   . LEU A 65  ? 0.8921 0.8630 0.7615 -0.1460 -0.0563 0.0635  1251 LEU A C   
480  O O   . LEU A 65  ? 1.0286 0.9987 0.9061 -0.1373 -0.0593 0.0682  1251 LEU A O   
481  C CB  . LEU A 65  ? 1.0128 0.9969 0.8984 -0.1376 -0.0372 0.0457  1251 LEU A CB  
482  C CG  . LEU A 65  ? 0.8083 0.7974 0.7040 -0.1326 -0.0306 0.0402  1251 LEU A CG  
483  C CD1 . LEU A 65  ? 0.7652 0.7611 0.6711 -0.1280 -0.0189 0.0290  1251 LEU A CD1 
484  C CD2 . LEU A 65  ? 0.8029 0.7893 0.6849 -0.1471 -0.0306 0.0400  1251 LEU A CD2 
485  N N   . LYS A 66  ? 1.0218 0.9873 0.8703 -0.1635 -0.0571 0.0619  1252 LYS A N   
486  C CA  . LYS A 66  ? 1.0986 1.0557 0.9303 -0.1735 -0.0625 0.0659  1252 LYS A CA  
487  C C   . LYS A 66  ? 1.0873 1.0437 0.9025 -0.1873 -0.0523 0.0536  1252 LYS A C   
488  O O   . LYS A 66  ? 0.9309 0.8907 0.7440 -0.1945 -0.0438 0.0444  1252 LYS A O   
489  C CB  . LYS A 66  ? 1.0485 0.9958 0.8667 -0.1853 -0.0767 0.0777  1252 LYS A CB  
490  C CG  . LYS A 66  ? 1.1692 1.1159 1.0047 -0.1734 -0.0884 0.0902  1252 LYS A CG  
491  C CD  . LYS A 66  ? 1.3204 1.2579 1.1430 -0.1867 -0.1033 0.1018  1252 LYS A CD  
492  C CE  . LYS A 66  ? 1.3645 1.3016 1.1692 -0.2035 -0.1003 0.0970  1252 LYS A CE  
493  N NZ  . LYS A 66  ? 1.4206 1.3480 1.2086 -0.2198 -0.1156 0.1087  1252 LYS A NZ  
494  N N   . TRP A 67  ? 0.9914 0.9430 0.7954 -0.1916 -0.0521 0.0524  1253 TRP A N   
495  C CA  . TRP A 67  ? 1.1678 1.1177 0.9558 -0.2056 -0.0420 0.0393  1253 TRP A CA  
496  C C   . TRP A 67  ? 1.1852 1.1224 0.9451 -0.2291 -0.0479 0.0415  1253 TRP A C   
497  O O   . TRP A 67  ? 1.2308 1.1574 0.9704 -0.2399 -0.0527 0.0438  1253 TRP A O   
498  C CB  . TRP A 67  ? 1.2626 1.2124 1.0482 -0.2014 -0.0388 0.0363  1253 TRP A CB  
499  C CG  . TRP A 67  ? 0.9848 0.9464 0.7952 -0.1810 -0.0334 0.0348  1253 TRP A CG  
500  C CD1 . TRP A 67  ? 0.7849 0.7475 0.6066 -0.1674 -0.0388 0.0444  1253 TRP A CD1 
501  C CD2 . TRP A 67  ? 0.9606 0.9339 0.7876 -0.1733 -0.0218 0.0230  1253 TRP A CD2 
502  N NE1 . TRP A 67  ? 0.7996 0.7733 0.6412 -0.1531 -0.0314 0.0396  1253 TRP A NE1 
503  C CE2 . TRP A 67  ? 0.8252 0.8057 0.6708 -0.1557 -0.0218 0.0271  1253 TRP A CE2 
504  C CE3 . TRP A 67  ? 1.1429 1.1208 0.9721 -0.1802 -0.0112 0.0094  1253 TRP A CE3 
505  C CZ2 . TRP A 67  ? 0.8915 0.8832 0.7560 -0.1450 -0.0136 0.0194  1253 TRP A CZ2 
506  C CZ3 . TRP A 67  ? 0.8499 0.8395 0.7012 -0.1681 -0.0027 0.0014  1253 TRP A CZ3 
507  C CH2 . TRP A 67  ? 0.8100 0.8062 0.6779 -0.1507 -0.0048 0.0070  1253 TRP A CH2 
508  N N   . SER A 68  ? 1.2511 1.1885 1.0083 -0.2380 -0.0475 0.0408  1254 SER A N   
509  C CA  . SER A 68  ? 1.2810 1.2062 1.0103 -0.2628 -0.0530 0.0431  1254 SER A CA  
510  C C   . SER A 68  ? 1.3006 1.2292 1.0269 -0.2760 -0.0414 0.0320  1254 SER A C   
511  O O   . SER A 68  ? 1.4340 1.3742 1.1822 -0.2632 -0.0328 0.0267  1254 SER A O   
512  C CB  . SER A 68  ? 1.4211 1.3395 1.1470 -0.2626 -0.0718 0.0618  1254 SER A CB  
513  O OG  . SER A 68  ? 1.3767 1.3045 1.1242 -0.2488 -0.0734 0.0665  1254 SER A OG  
514  N N   . ASP A 69  ? 1.2477 1.1652 0.9460 -0.3028 -0.0406 0.0281  1255 ASP A N   
515  C CA  . ASP A 69  ? 1.3939 1.3130 1.0867 -0.3198 -0.0281 0.0168  1255 ASP A CA  
516  C C   . ASP A 69  ? 1.6185 1.5432 1.3206 -0.3154 -0.0326 0.0256  1255 ASP A C   
517  O O   . ASP A 69  ? 1.8569 1.7901 1.5713 -0.3146 -0.0194 0.0161  1255 ASP A O   
518  C CB  . ASP A 69  ? 1.4528 1.3562 1.1101 -0.3526 -0.0276 0.0119  1255 ASP A CB  
519  C CG  . ASP A 69  ? 1.7074 1.6050 1.3542 -0.3587 -0.0204 0.0000  1255 ASP A CG  
520  O OD1 . ASP A 69  ? 1.9184 1.8020 1.5350 -0.3864 -0.0184 -0.0065 1255 ASP A OD1 
521  O OD2 . ASP A 69  ? 1.4420 1.3488 1.1099 -0.3368 -0.0166 -0.0034 1255 ASP A OD2 
522  N N   . GLU A 70  ? 1.4374 1.3572 1.1348 -0.3124 -0.0510 0.0433  1256 GLU A N   
523  C CA  . GLU A 70  ? 1.3350 1.2600 1.0407 -0.3083 -0.0567 0.0521  1256 GLU A CA  
524  C C   . GLU A 70  ? 1.3328 1.2691 1.0531 -0.3050 -0.0387 0.0391  1256 GLU A C   
525  O O   . GLU A 70  ? 1.1429 1.0879 0.8819 -0.2889 -0.0392 0.0428  1256 GLU A O   
526  C CB  . GLU A 70  ? 1.3602 1.2900 1.0882 -0.2827 -0.0699 0.0655  1256 GLU A CB  
527  C CG  . GLU A 70  ? 1.5317 1.4504 1.2491 -0.2855 -0.0892 0.0807  1256 GLU A CG  
528  C CD  . GLU A 70  ? 1.6794 1.6031 1.4229 -0.2606 -0.0996 0.0918  1256 GLU A CD  
529  O OE1 . GLU A 70  ? 1.5936 1.5285 1.3611 -0.2412 -0.0911 0.0865  1256 GLU A OE1 
530  O OE2 . GLU A 70  ? 1.7721 1.6876 1.5126 -0.2612 -0.1161 0.1055  1256 GLU A OE2 
531  N N   . GLN A 85  ? 1.4351 1.4204 1.2594 -0.2760 0.0594  -0.0359 1271 GLN A N   
532  C CA  . GLN A 85  ? 1.3769 1.3623 1.2080 -0.2633 0.0522  -0.0349 1271 GLN A CA  
533  C C   . GLN A 85  ? 1.2384 1.2172 1.0527 -0.2604 0.0323  -0.0186 1271 GLN A C   
534  O O   . GLN A 85  ? 1.5080 1.4888 1.3278 -0.2454 0.0214  -0.0065 1271 GLN A O   
535  C CB  . GLN A 85  ? 1.4328 1.4277 1.2948 -0.2352 0.0536  -0.0360 1271 GLN A CB  
536  C CG  . GLN A 85  ? 1.7988 1.7994 1.6817 -0.2310 0.0660  -0.0507 1271 GLN A CG  
537  C CD  . GLN A 85  ? 1.6786 1.6876 1.5897 -0.2032 0.0632  -0.0482 1271 GLN A CD  
538  O OE1 . GLN A 85  ? 1.5419 1.5552 1.4677 -0.1946 0.0648  -0.0536 1271 GLN A OE1 
539  N NE2 . GLN A 85  ? 1.6638 1.6745 1.5813 -0.1903 0.0590  -0.0401 1271 GLN A NE2 
540  N N   . THR A 86  ? 0.8870 0.8576 0.6821 -0.2743 0.0276  -0.0187 1272 THR A N   
541  C CA  . THR A 86  ? 1.1094 1.0730 0.8907 -0.2711 0.0087  -0.0030 1272 THR A CA  
542  C C   . THR A 86  ? 1.2860 1.2557 1.0882 -0.2442 0.0027  0.0019  1272 THR A C   
543  O O   . THR A 86  ? 1.3749 1.3526 1.1975 -0.2316 0.0125  -0.0075 1272 THR A O   
544  C CB  . THR A 86  ? 1.5576 1.5086 1.3097 -0.2946 0.0048  -0.0039 1272 THR A CB  
545  O OG1 . THR A 86  ? 1.5201 1.4700 1.2749 -0.2845 0.0009  -0.0039 1272 THR A OG1 
546  C CG2 . THR A 86  ? 1.6685 1.6160 1.4090 -0.3199 0.0215  -0.0208 1272 THR A CG2 
547  N N   . HIS A 87  ? 1.0724 1.0379 0.8702 -0.2366 -0.0133 0.0166  1273 HIS A N   
548  C CA  . HIS A 87  ? 1.0657 1.0356 0.8813 -0.2138 -0.0190 0.0222  1273 HIS A CA  
549  C C   . HIS A 87  ? 1.1489 1.1232 0.9735 -0.2075 -0.0101 0.0118  1273 HIS A C   
550  O O   . HIS A 87  ? 1.1605 1.1438 1.0072 -0.1915 -0.0038 0.0071  1273 HIS A O   
551  C CB  . HIS A 87  ? 0.9975 0.9596 0.8035 -0.2131 -0.0357 0.0373  1273 HIS A CB  
552  C CG  . HIS A 87  ? 1.2312 1.1934 1.0429 -0.2070 -0.0460 0.0488  1273 HIS A CG  
553  N ND1 . HIS A 87  ? 1.1834 1.1423 1.0008 -0.1975 -0.0600 0.0621  1273 HIS A ND1 
554  C CD2 . HIS A 87  ? 1.2310 1.1967 1.0455 -0.2090 -0.0433 0.0482  1273 HIS A CD2 
555  C CE1 . HIS A 87  ? 1.1019 1.0622 0.9258 -0.1940 -0.0662 0.0688  1273 HIS A CE1 
556  N NE2 . HIS A 87  ? 1.1347 1.0992 0.9555 -0.2008 -0.0563 0.0607  1273 HIS A NE2 
557  N N   . ARG A 88  ? 1.1976 1.1651 1.0043 -0.2210 -0.0099 0.0083  1274 ARG A N   
558  C CA  . ARG A 88  ? 1.0933 1.0646 0.9060 -0.2172 -0.0016 -0.0022 1274 ARG A CA  
559  C C   . ARG A 88  ? 1.0171 0.9991 0.8516 -0.2114 0.0132  -0.0167 1274 ARG A C   
560  O O   . ARG A 88  ? 1.0351 1.0253 0.8883 -0.1956 0.0158  -0.0193 1274 ARG A O   
561  C CB  . ARG A 88  ? 1.1176 1.0783 0.9034 -0.2382 -0.0009 -0.0073 1274 ARG A CB  
562  C CG  . ARG A 88  ? 1.0091 0.9734 0.7980 -0.2402 0.0110  -0.0228 1274 ARG A CG  
563  C CD  . ARG A 88  ? 0.9255 0.8767 0.6834 -0.2662 0.0132  -0.0302 1274 ARG A CD  
564  N NE  . ARG A 88  ? 0.9530 0.8913 0.6866 -0.2731 -0.0022 -0.0151 1274 ARG A NE  
565  C CZ  . ARG A 88  ? 1.0615 0.9977 0.7933 -0.2621 -0.0108 -0.0058 1274 ARG A CZ  
566  N NH1 . ARG A 88  ? 1.0240 0.9706 0.7748 -0.2445 -0.0053 -0.0099 1274 ARG A NH1 
567  N NH2 . ARG A 88  ? 0.9343 0.8578 0.6459 -0.2692 -0.0250 0.0080  1274 ARG A NH2 
568  N N   . GLN A 89  ? 1.1249 1.1072 0.9587 -0.2243 0.0231  -0.0260 1275 GLN A N   
569  C CA  . GLN A 89  ? 1.1409 1.1333 0.9995 -0.2175 0.0370  -0.0396 1275 GLN A CA  
570  C C   . GLN A 89  ? 1.0784 1.0790 0.9611 -0.1948 0.0341  -0.0329 1275 GLN A C   
571  O O   . GLN A 89  ? 1.0302 1.0394 0.9363 -0.1816 0.0398  -0.0391 1275 GLN A O   
572  C CB  . GLN A 89  ? 1.1227 1.1136 0.9786 -0.2370 0.0511  -0.0531 1275 GLN A CB  
573  C CG  . GLN A 89  ? 1.4315 1.4174 1.2738 -0.2475 0.0482  -0.0460 1275 GLN A CG  
574  C CD  . GLN A 89  ? 1.4892 1.4624 1.2980 -0.2727 0.0438  -0.0440 1275 GLN A CD  
575  O OE1 . GLN A 89  ? 1.5128 1.4793 1.3053 -0.2719 0.0287  -0.0304 1275 GLN A OE1 
576  N NE2 . GLN A 89  ? 1.1783 1.1473 0.9771 -0.2965 0.0572  -0.0579 1275 GLN A NE2 
577  N N   . LEU A 90  ? 0.9442 0.9419 0.8216 -0.1913 0.0256  -0.0211 1276 LEU A N   
578  C CA  . LEU A 90  ? 0.8943 0.8978 0.7914 -0.1714 0.0228  -0.0154 1276 LEU A CA  
579  C C   . LEU A 90  ? 0.7374 0.7437 0.6446 -0.1540 0.0152  -0.0089 1276 LEU A C   
580  O O   . LEU A 90  ? 0.7171 0.7299 0.6446 -0.1391 0.0176  -0.0107 1276 LEU A O   
581  C CB  . LEU A 90  ? 0.6220 0.6213 0.5099 -0.1725 0.0151  -0.0050 1276 LEU A CB  
582  C CG  . LEU A 90  ? 0.7112 0.7142 0.6158 -0.1528 0.0111  0.0012  1276 LEU A CG  
583  C CD1 . LEU A 90  ? 0.5990 0.6086 0.5235 -0.1452 0.0226  -0.0086 1276 LEU A CD1 
584  C CD2 . LEU A 90  ? 0.6325 0.6315 0.5275 -0.1555 0.0039  0.0101  1276 LEU A CD2 
585  N N   . LYS A 91  ? 0.6223 0.6230 0.5147 -0.1572 0.0061  -0.0010 1277 LYS A N   
586  C CA  . LYS A 91  ? 0.6521 0.6546 0.5517 -0.1434 -0.0002 0.0055  1277 LYS A CA  
587  C C   . LYS A 91  ? 0.9024 0.9119 0.8129 -0.1397 0.0076  -0.0043 1277 LYS A C   
588  O O   . LYS A 91  ? 0.8839 0.8989 0.8096 -0.1254 0.0064  -0.0022 1277 LYS A O   
589  C CB  . LYS A 91  ? 0.6290 0.6233 0.5105 -0.1495 -0.0103 0.0153  1277 LYS A CB  
590  C CG  . LYS A 91  ? 0.6477 0.6425 0.5379 -0.1351 -0.0178 0.0251  1277 LYS A CG  
591  C CD  . LYS A 91  ? 0.6073 0.5930 0.4829 -0.1409 -0.0283 0.0359  1277 LYS A CD  
592  C CE  . LYS A 91  ? 0.6668 0.6529 0.5537 -0.1277 -0.0336 0.0445  1277 LYS A CE  
593  N NZ  . LYS A 91  ? 0.6964 0.6735 0.5734 -0.1324 -0.0440 0.0554  1277 LYS A NZ  
594  N N   . GLU A 92  ? 0.8235 0.8323 0.7257 -0.1540 0.0157  -0.0156 1278 GLU A N   
595  C CA  . GLU A 92  ? 0.7807 0.7964 0.6938 -0.1524 0.0239  -0.0269 1278 GLU A CA  
596  C C   . GLU A 92  ? 0.7710 0.7962 0.7120 -0.1400 0.0296  -0.0323 1278 GLU A C   
597  O O   . GLU A 92  ? 0.6215 0.6540 0.5783 -0.1289 0.0301  -0.0339 1278 GLU A O   
598  C CB  . GLU A 92  ? 0.7970 0.8086 0.6958 -0.1728 0.0328  -0.0399 1278 GLU A CB  
599  C CG  . GLU A 92  ? 1.0894 1.1093 1.0054 -0.1730 0.0443  -0.0557 1278 GLU A CG  
600  C CD  . GLU A 92  ? 1.2895 1.3039 1.1915 -0.1955 0.0547  -0.0706 1278 GLU A CD  
601  O OE1 . GLU A 92  ? 1.1833 1.1871 1.0567 -0.2101 0.0509  -0.0680 1278 GLU A OE1 
602  O OE2 . GLU A 92  ? 1.4589 1.4789 1.3789 -0.1995 0.0669  -0.0852 1278 GLU A OE2 
603  N N   . THR A 93  ? 0.7343 0.7590 0.6810 -0.1424 0.0338  -0.0347 1279 THR A N   
604  C CA  . THR A 93  ? 0.7875 0.8194 0.7603 -0.1309 0.0390  -0.0392 1279 THR A CA  
605  C C   . THR A 93  ? 0.7874 0.8212 0.7705 -0.1123 0.0296  -0.0277 1279 THR A C   
606  O O   . THR A 93  ? 0.7165 0.7567 0.7202 -0.1008 0.0303  -0.0297 1279 THR A O   
607  C CB  . THR A 93  ? 0.7962 0.8260 0.7701 -0.1382 0.0460  -0.0433 1279 THR A CB  
608  O OG1 . THR A 93  ? 1.2052 1.2277 1.1588 -0.1427 0.0384  -0.0328 1279 THR A OG1 
609  C CG2 . THR A 93  ? 0.4688 0.4982 0.4399 -0.1569 0.0589  -0.0582 1279 THR A CG2 
610  N N   . LEU A 94  ? 0.8140 0.8415 0.7831 -0.1104 0.0206  -0.0160 1280 LEU A N   
611  C CA  . LEU A 94  ? 0.8732 0.9005 0.8498 -0.0954 0.0124  -0.0060 1280 LEU A CA  
612  C C   . LEU A 94  ? 0.8381 0.8693 0.8195 -0.0888 0.0092  -0.0037 1280 LEU A C   
613  O O   . LEU A 94  ? 0.5120 0.5466 0.5079 -0.0774 0.0071  -0.0015 1280 LEU A O   
614  C CB  . LEU A 94  ? 0.4952 0.5149 0.4575 -0.0966 0.0042  0.0045  1280 LEU A CB  
615  C CG  . LEU A 94  ? 0.6017 0.6189 0.5675 -0.0925 0.0039  0.0065  1280 LEU A CG  
616  C CD1 . LEU A 94  ? 0.6630 0.6836 0.6369 -0.0965 0.0144  -0.0037 1280 LEU A CD1 
617  C CD2 . LEU A 94  ? 0.5141 0.5247 0.4640 -0.0993 -0.0024 0.0139  1280 LEU A CD2 
618  N N   . TYR A 95  ? 0.5501 0.5800 0.5177 -0.0970 0.0090  -0.0043 1281 TYR A N   
619  C CA  . TYR A 95  ? 0.5942 0.6284 0.5643 -0.0924 0.0075  -0.0030 1281 TYR A CA  
620  C C   . TYR A 95  ? 0.7106 0.7543 0.7000 -0.0877 0.0132  -0.0120 1281 TYR A C   
621  O O   . TYR A 95  ? 0.8131 0.8616 0.8122 -0.0789 0.0104  -0.0085 1281 TYR A O   
622  C CB  . TYR A 95  ? 0.6289 0.6596 0.5797 -0.1034 0.0080  -0.0040 1281 TYR A CB  
623  C CG  . TYR A 95  ? 0.7889 0.8124 0.7264 -0.1027 -0.0003 0.0082  1281 TYR A CG  
624  C CD1 . TYR A 95  ? 0.6546 0.6720 0.5909 -0.1002 -0.0067 0.0169  1281 TYR A CD1 
625  C CD2 . TYR A 95  ? 0.5404 0.5633 0.4684 -0.1047 -0.0010 0.0105  1281 TYR A CD2 
626  C CE1 . TYR A 95  ? 0.5824 0.5935 0.5111 -0.0996 -0.0139 0.0271  1281 TYR A CE1 
627  C CE2 . TYR A 95  ? 0.6680 0.6840 0.5872 -0.1043 -0.0077 0.0214  1281 TYR A CE2 
628  C CZ  . TYR A 95  ? 0.6993 0.7095 0.6205 -0.1016 -0.0144 0.0296  1281 TYR A CZ  
629  O OH  . TYR A 95  ? 0.6710 0.6744 0.5883 -0.1005 -0.0213 0.0401  1281 TYR A OH  
630  N N   . GLU A 96  ? 0.6033 0.6497 0.5993 -0.0944 0.0214  -0.0235 1282 GLU A N   
631  C CA  . GLU A 96  ? 0.5367 0.5926 0.5557 -0.0899 0.0269  -0.0329 1282 GLU A CA  
632  C C   . GLU A 96  ? 0.6611 0.7198 0.7003 -0.0756 0.0224  -0.0274 1282 GLU A C   
633  O O   . GLU A 96  ? 0.8036 0.8694 0.8585 -0.0677 0.0202  -0.0272 1282 GLU A O   
634  C CB  . GLU A 96  ? 0.4207 0.4777 0.4455 -0.1008 0.0378  -0.0472 1282 GLU A CB  
635  C CG  . GLU A 96  ? 0.6046 0.6606 0.6143 -0.1150 0.0435  -0.0564 1282 GLU A CG  
636  C CD  . GLU A 96  ? 1.2063 1.2615 1.2193 -0.1295 0.0558  -0.0718 1282 GLU A CD  
637  O OE1 . GLU A 96  ? 1.3059 1.3608 1.3311 -0.1293 0.0601  -0.0743 1282 GLU A OE1 
638  O OE2 . GLU A 96  ? 1.3578 1.4118 1.3602 -0.1425 0.0620  -0.0823 1282 GLU A OE2 
639  N N   . THR A 97  ? 0.5794 0.6322 0.6172 -0.0732 0.0207  -0.0228 1283 THR A N   
640  C CA  . THR A 97  ? 0.7179 0.7709 0.7720 -0.0611 0.0167  -0.0182 1283 THR A CA  
641  C C   . THR A 97  ? 0.8287 0.8800 0.8788 -0.0531 0.0072  -0.0070 1283 THR A C   
642  O O   . THR A 97  ? 0.6713 0.7268 0.7365 -0.0452 0.0037  -0.0051 1283 THR A O   
643  C CB  . THR A 97  ? 0.5616 0.6079 0.6111 -0.0618 0.0182  -0.0168 1283 THR A CB  
644  O OG1 . THR A 97  ? 0.8240 0.8690 0.8631 -0.0751 0.0260  -0.0242 1283 THR A OG1 
645  C CG2 . THR A 97  ? 0.6652 0.7131 0.7365 -0.0536 0.0204  -0.0198 1283 THR A CG2 
646  N N   . ILE A 98  ? 0.5259 0.5708 0.5566 -0.0564 0.0032  0.0004  1284 ILE A N   
647  C CA  . ILE A 98  ? 0.4848 0.5271 0.5102 -0.0517 -0.0038 0.0101  1284 ILE A CA  
648  C C   . ILE A 98  ? 0.6011 0.6514 0.6329 -0.0504 -0.0038 0.0090  1284 ILE A C   
649  O O   . ILE A 98  ? 0.5273 0.5791 0.5670 -0.0444 -0.0083 0.0139  1284 ILE A O   
650  C CB  . ILE A 98  ? 0.4794 0.5148 0.4854 -0.0575 -0.0064 0.0161  1284 ILE A CB  
651  C CG1 . ILE A 98  ? 0.4702 0.4984 0.4702 -0.0590 -0.0075 0.0179  1284 ILE A CG1 
652  C CG2 . ILE A 98  ? 0.4450 0.4779 0.4479 -0.0541 -0.0115 0.0248  1284 ILE A CG2 
653  C CD1 . ILE A 98  ? 0.6202 0.6424 0.6039 -0.0658 -0.0105 0.0229  1284 ILE A CD1 
654  N N   . ILE A 99  ? 0.5950 0.6502 0.6222 -0.0574 0.0013  0.0021  1285 ILE A N   
655  C CA  . ILE A 99  ? 0.4182 0.4818 0.4505 -0.0568 0.0022  0.0001  1285 ILE A CA  
656  C C   . ILE A 99  ? 0.5105 0.5811 0.5663 -0.0493 0.0009  -0.0026 1285 ILE A C   
657  O O   . ILE A 99  ? 0.6656 0.7420 0.7283 -0.0457 -0.0024 0.0006  1285 ILE A O   
658  C CB  . ILE A 99  ? 0.5191 0.5864 0.5435 -0.0663 0.0093  -0.0099 1285 ILE A CB  
659  C CG1 . ILE A 99  ? 0.4621 0.5214 0.4618 -0.0738 0.0086  -0.0051 1285 ILE A CG1 
660  C CG2 . ILE A 99  ? 0.3856 0.4637 0.4196 -0.0649 0.0113  -0.0145 1285 ILE A CG2 
661  C CD1 . ILE A 99  ? 0.4343 0.4937 0.4214 -0.0850 0.0149  -0.0144 1285 ILE A CD1 
662  N N   . GLY A 100 ? 0.4190 0.4891 0.4877 -0.0475 0.0035  -0.0080 1286 GLY A N   
663  C CA  . GLY A 100 ? 0.4500 0.5264 0.5443 -0.0402 0.0021  -0.0108 1286 GLY A CA  
664  C C   . GLY A 100 ? 0.6916 0.7634 0.7877 -0.0322 -0.0075 0.0008  1286 GLY A C   
665  O O   . GLY A 100 ? 0.5703 0.6473 0.6808 -0.0272 -0.0126 0.0035  1286 GLY A O   
666  N N   . TYR A 101 ? 0.7258 0.7872 0.8065 -0.0323 -0.0101 0.0076  1287 TYR A N   
667  C CA  . TYR A 101 ? 0.5083 0.5628 0.5888 -0.0268 -0.0181 0.0170  1287 TYR A CA  
668  C C   . TYR A 101 ? 0.6200 0.6769 0.6945 -0.0282 -0.0225 0.0237  1287 TYR A C   
669  O O   . TYR A 101 ? 0.5217 0.5798 0.6052 -0.0248 -0.0287 0.0284  1287 TYR A O   
670  C CB  . TYR A 101 ? 0.5367 0.5796 0.6021 -0.0278 -0.0186 0.0208  1287 TYR A CB  
671  C CG  . TYR A 101 ? 0.4952 0.5346 0.5648 -0.0264 -0.0145 0.0157  1287 TYR A CG  
672  C CD1 . TYR A 101 ? 0.4071 0.4513 0.4962 -0.0229 -0.0115 0.0092  1287 TYR A CD1 
673  C CD2 . TYR A 101 ? 0.5127 0.5438 0.5678 -0.0290 -0.0136 0.0174  1287 TYR A CD2 
674  C CE1 . TYR A 101 ? 0.3762 0.4169 0.4686 -0.0226 -0.0062 0.0044  1287 TYR A CE1 
675  C CE2 . TYR A 101 ? 0.5122 0.5403 0.5690 -0.0288 -0.0092 0.0129  1287 TYR A CE2 
676  C CZ  . TYR A 101 ? 0.6212 0.6538 0.6956 -0.0260 -0.0049 0.0064  1287 TYR A CZ  
677  O OH  . TYR A 101 ? 0.7017 0.7312 0.7769 -0.0269 0.0010  0.0018  1287 TYR A OH  
678  N N   . PHE A 102 ? 0.4037 0.4611 0.4627 -0.0342 -0.0192 0.0243  1288 PHE A N   
679  C CA  . PHE A 102 ? 0.5129 0.5722 0.5647 -0.0369 -0.0212 0.0302  1288 PHE A CA  
680  C C   . PHE A 102 ? 0.5248 0.5954 0.5903 -0.0354 -0.0226 0.0283  1288 PHE A C   
681  O O   . PHE A 102 ? 0.6424 0.7141 0.7071 -0.0361 -0.0269 0.0349  1288 PHE A O   
682  C CB  . PHE A 102 ? 0.3601 0.4191 0.3954 -0.0435 -0.0161 0.0296  1288 PHE A CB  
683  C CG  . PHE A 102 ? 0.6503 0.6981 0.6726 -0.0456 -0.0171 0.0353  1288 PHE A CG  
684  C CD1 . PHE A 102 ? 0.4815 0.5211 0.5039 -0.0436 -0.0217 0.0419  1288 PHE A CD1 
685  C CD2 . PHE A 102 ? 0.5993 0.6441 0.6096 -0.0503 -0.0139 0.0339  1288 PHE A CD2 
686  C CE1 . PHE A 102 ? 0.5729 0.6024 0.5862 -0.0457 -0.0220 0.0458  1288 PHE A CE1 
687  C CE2 . PHE A 102 ? 0.5811 0.6160 0.5826 -0.0519 -0.0157 0.0394  1288 PHE A CE2 
688  C CZ  . PHE A 102 ? 0.5852 0.6131 0.5897 -0.0492 -0.0193 0.0448  1288 PHE A CZ  
689  N N   . ASP A 103 ? 0.5036 0.5826 0.5819 -0.0344 -0.0185 0.0188  1289 ASP A N   
690  C CA  . ASP A 103 ? 0.4651 0.5559 0.5609 -0.0322 -0.0200 0.0156  1289 ASP A CA  
691  C C   . ASP A 103 ? 0.5482 0.6374 0.6595 -0.0259 -0.0296 0.0227  1289 ASP A C   
692  O O   . ASP A 103 ? 0.6300 0.7236 0.7438 -0.0263 -0.0353 0.0287  1289 ASP A O   
693  C CB  . ASP A 103 ? 0.4295 0.5280 0.5395 -0.0328 -0.0129 0.0024  1289 ASP A CB  
694  C CG  . ASP A 103 ? 0.4496 0.5620 0.5778 -0.0317 -0.0130 -0.0029 1289 ASP A CG  
695  O OD1 . ASP A 103 ? 0.4458 0.5637 0.5656 -0.0347 -0.0139 0.0003  1289 ASP A OD1 
696  O OD2 . ASP A 103 ? 0.6342 0.7523 0.7870 -0.0281 -0.0119 -0.0106 1289 ASP A OD2 
697  N N   . LYS A 104 ? 0.5355 0.6176 0.6552 -0.0210 -0.0317 0.0225  1290 LYS A N   
698  C CA  . LYS A 104 ? 0.6122 0.6896 0.7434 -0.0156 -0.0418 0.0300  1290 LYS A CA  
699  C C   . LYS A 104 ? 0.5417 0.6104 0.6548 -0.0194 -0.0481 0.0413  1290 LYS A C   
700  O O   . LYS A 104 ? 0.6201 0.6893 0.7392 -0.0192 -0.0568 0.0482  1290 LYS A O   
701  C CB  . LYS A 104 ? 0.5177 0.5869 0.6568 -0.0104 -0.0413 0.0276  1290 LYS A CB  
702  C CG  . LYS A 104 ? 0.6142 0.6918 0.7764 -0.0074 -0.0348 0.0162  1290 LYS A CG  
703  C CD  . LYS A 104 ? 1.1015 1.1730 1.2810 -0.0003 -0.0382 0.0168  1290 LYS A CD  
704  C CE  . LYS A 104 ? 1.0603 1.1388 1.2645 0.0017  -0.0293 0.0044  1290 LYS A CE  
705  N NZ  . LYS A 104 ? 0.9794 1.0557 1.2102 0.0101  -0.0351 0.0062  1290 LYS A NZ  
706  N N   . GLY A 105 ? 0.6106 0.6716 0.7024 -0.0242 -0.0436 0.0427  1291 GLY A N   
707  C CA  . GLY A 105 ? 0.5232 0.5751 0.5984 -0.0296 -0.0470 0.0514  1291 GLY A CA  
708  C C   . GLY A 105 ? 0.6040 0.6639 0.6738 -0.0358 -0.0463 0.0547  1291 GLY A C   
709  O O   . GLY A 105 ? 0.6591 0.7128 0.7174 -0.0420 -0.0485 0.0618  1291 GLY A O   
710  N N   . LYS A 106 ? 0.6899 0.7430 0.6789 -0.0315 0.0225  0.0530  1292 LYS A N   
711  C CA  . LYS A 106 ? 0.7413 0.8073 0.7277 -0.0341 0.0198  0.0523  1292 LYS A CA  
712  C C   . LYS A 106 ? 0.7976 0.8641 0.7838 -0.0402 0.0193  0.0454  1292 LYS A C   
713  O O   . LYS A 106 ? 0.6546 0.7309 0.6385 -0.0442 0.0187  0.0443  1292 LYS A O   
714  C CB  . LYS A 106 ? 0.6297 0.7065 0.6132 -0.0338 0.0198  0.0590  1292 LYS A CB  
715  C CG  . LYS A 106 ? 0.6832 0.7582 0.6684 -0.0273 0.0219  0.0672  1292 LYS A CG  
716  C CD  . LYS A 106 ? 0.6687 0.7589 0.6522 -0.0252 0.0205  0.0745  1292 LYS A CD  
717  C CE  . LYS A 106 ? 0.9146 1.0106 0.8956 -0.0257 0.0218  0.0806  1292 LYS A CE  
718  N NZ  . LYS A 106 ? 0.9631 1.0533 0.9475 -0.0192 0.0260  0.0886  1292 LYS A NZ  
719  N N   . MET A 107 ? 0.5717 0.6280 0.5606 -0.0412 0.0200  0.0408  1293 MET A N   
720  C CA  . MET A 107 ? 0.5990 0.6550 0.5895 -0.0457 0.0200  0.0349  1293 MET A CA  
721  C C   . MET A 107 ? 0.5709 0.6305 0.5629 -0.0441 0.0186  0.0316  1293 MET A C   
722  O O   . MET A 107 ? 0.5725 0.6266 0.5673 -0.0437 0.0184  0.0281  1293 MET A O   
723  C CB  . MET A 107 ? 0.5005 0.5454 0.4938 -0.0469 0.0212  0.0325  1293 MET A CB  
724  C CG  . MET A 107 ? 0.7550 0.7952 0.7472 -0.0487 0.0232  0.0350  1293 MET A CG  
725  S SD  . MET A 107 ? 0.6851 0.7323 0.6745 -0.0550 0.0245  0.0350  1293 MET A SD  
726  C CE  . MET A 107 ? 0.6483 0.7034 0.6330 -0.0518 0.0240  0.0419  1293 MET A CE  
727  N N   . TRP A 108 ? 0.4542 0.5236 0.4445 -0.0432 0.0176  0.0330  1294 TRP A N   
728  C CA  . TRP A 108 ? 0.4629 0.5355 0.4549 -0.0410 0.0166  0.0303  1294 TRP A CA  
729  C C   . TRP A 108 ? 0.5116 0.5847 0.5064 -0.0441 0.0180  0.0246  1294 TRP A C   
730  O O   . TRP A 108 ? 0.7303 0.8009 0.7276 -0.0415 0.0176  0.0221  1294 TRP A O   
731  C CB  . TRP A 108 ? 0.5320 0.6155 0.5220 -0.0394 0.0155  0.0331  1294 TRP A CB  
732  C CG  . TRP A 108 ? 0.6408 0.7237 0.6296 -0.0349 0.0145  0.0399  1294 TRP A CG  
733  C CD1 . TRP A 108 ? 0.5716 0.6448 0.5619 -0.0302 0.0148  0.0420  1294 TRP A CD1 
734  C CD2 . TRP A 108 ? 0.6796 0.7724 0.6658 -0.0346 0.0140  0.0458  1294 TRP A CD2 
735  N NE1 . TRP A 108 ? 0.5312 0.6069 0.5209 -0.0266 0.0152  0.0493  1294 TRP A NE1 
736  C CE2 . TRP A 108 ? 0.6611 0.7495 0.6483 -0.0290 0.0143  0.0521  1294 TRP A CE2 
737  C CE3 . TRP A 108 ? 0.5410 0.6465 0.5242 -0.0390 0.0136  0.0463  1294 TRP A CE3 
738  C CZ2 . TRP A 108 ? 0.5379 0.6349 0.5237 -0.0268 0.0141  0.0600  1294 TRP A CZ2 
739  C CZ3 . TRP A 108 ? 0.6979 0.8127 0.6789 -0.0373 0.0127  0.0536  1294 TRP A CZ3 
740  C CH2 . TRP A 108 ? 0.6594 0.7703 0.6421 -0.0309 0.0129  0.0608  1294 TRP A CH2 
741  N N   . GLU A 109 ? 0.6108 0.6871 0.6056 -0.0497 0.0204  0.0229  1295 GLU A N   
742  C CA  . GLU A 109 ? 0.5662 0.6430 0.5649 -0.0525 0.0231  0.0183  1295 GLU A CA  
743  C C   . GLU A 109 ? 0.3147 0.3826 0.3168 -0.0512 0.0226  0.0173  1295 GLU A C   
744  O O   . GLU A 109 ? 0.6810 0.7491 0.6866 -0.0498 0.0232  0.0148  1295 GLU A O   
745  C CB  . GLU A 109 ? 0.4959 0.5763 0.4943 -0.0592 0.0268  0.0172  1295 GLU A CB  
746  C CG  . GLU A 109 ? 0.7189 0.7990 0.7127 -0.0614 0.0261  0.0207  1295 GLU A CG  
747  C CD  . GLU A 109 ? 0.6417 0.7326 0.6311 -0.0618 0.0251  0.0225  1295 GLU A CD  
748  O OE1 . GLU A 109 ? 0.9204 1.0197 0.9098 -0.0654 0.0275  0.0193  1295 GLU A OE1 
749  O OE2 . GLU A 109 ? 0.7196 0.8113 0.7059 -0.0587 0.0224  0.0273  1295 GLU A OE2 
750  N N   . GLU A 110 ? 0.5501 0.6108 0.5512 -0.0516 0.0218  0.0194  1296 GLU A N   
751  C CA  . GLU A 110 ? 0.6790 0.7320 0.6831 -0.0510 0.0211  0.0182  1296 GLU A CA  
752  C C   . GLU A 110 ? 0.6798 0.7303 0.6838 -0.0461 0.0187  0.0175  1296 GLU A C   
753  O O   . GLU A 110 ? 0.6161 0.6650 0.6230 -0.0457 0.0183  0.0151  1296 GLU A O   
754  C CB  . GLU A 110 ? 0.5120 0.5577 0.5151 -0.0524 0.0213  0.0202  1296 GLU A CB  
755  C CG  . GLU A 110 ? 0.5513 0.5960 0.5559 -0.0577 0.0240  0.0200  1296 GLU A CG  
756  C CD  . GLU A 110 ? 0.6872 0.7301 0.6973 -0.0599 0.0251  0.0176  1296 GLU A CD  
757  O OE1 . GLU A 110 ? 0.7641 0.8098 0.7766 -0.0577 0.0241  0.0159  1296 GLU A OE1 
758  O OE2 . GLU A 110 ? 0.4680 0.5070 0.4804 -0.0636 0.0271  0.0180  1296 GLU A OE2 
759  N N   . ALA A 111 ? 0.5001 0.5504 0.5010 -0.0425 0.0174  0.0199  1297 ALA A N   
760  C CA  . ALA A 111 ? 0.3829 0.4297 0.3834 -0.0380 0.0159  0.0196  1297 ALA A CA  
761  C C   . ALA A 111 ? 0.6506 0.7023 0.6529 -0.0365 0.0156  0.0168  1297 ALA A C   
762  O O   . ALA A 111 ? 0.6669 0.7153 0.6702 -0.0345 0.0147  0.0147  1297 ALA A O   
763  C CB  . ALA A 111 ? 0.3296 0.3760 0.3275 -0.0345 0.0156  0.0239  1297 ALA A CB  
764  N N   . ILE A 112 ? 0.6089 0.6687 0.6115 -0.0375 0.0166  0.0165  1298 ILE A N   
765  C CA  . ILE A 112 ? 0.6298 0.6945 0.6347 -0.0357 0.0174  0.0138  1298 ILE A CA  
766  C C   . ILE A 112 ? 0.5404 0.6046 0.5494 -0.0370 0.0187  0.0110  1298 ILE A C   
767  O O   . ILE A 112 ? 0.7549 0.8192 0.7655 -0.0340 0.0184  0.0092  1298 ILE A O   
768  C CB  . ILE A 112 ? 0.4814 0.5553 0.4863 -0.0378 0.0194  0.0133  1298 ILE A CB  
769  C CG1 . ILE A 112 ? 0.3802 0.4574 0.3815 -0.0355 0.0175  0.0165  1298 ILE A CG1 
770  C CG2 . ILE A 112 ? 0.3432 0.4217 0.3518 -0.0365 0.0217  0.0098  1298 ILE A CG2 
771  C CD1 . ILE A 112 ? 0.4287 0.5162 0.4291 -0.0389 0.0192  0.0161  1298 ILE A CD1 
772  N N   . SER A 113 ? 0.6430 0.7067 0.6538 -0.0414 0.0204  0.0111  1299 SER A N   
773  C CA  . SER A 113 ? 0.5927 0.6573 0.6085 -0.0428 0.0220  0.0096  1299 SER A CA  
774  C C   . SER A 113 ? 0.5350 0.5947 0.5504 -0.0403 0.0189  0.0090  1299 SER A C   
775  O O   . SER A 113 ? 0.6442 0.7066 0.6627 -0.0388 0.0192  0.0078  1299 SER A O   
776  C CB  . SER A 113 ? 0.4039 0.4676 0.4219 -0.0480 0.0243  0.0105  1299 SER A CB  
777  O OG  . SER A 113 ? 0.7875 0.8441 0.8033 -0.0489 0.0218  0.0117  1299 SER A OG  
778  N N   . LEU A 114 ? 0.5083 0.5613 0.5201 -0.0402 0.0166  0.0099  1300 LEU A N   
779  C CA  . LEU A 114 ? 0.5152 0.5632 0.5260 -0.0388 0.0144  0.0086  1300 LEU A CA  
780  C C   . LEU A 114 ? 0.7086 0.7572 0.7180 -0.0342 0.0134  0.0075  1300 LEU A C   
781  O O   . LEU A 114 ? 0.4692 0.5182 0.4794 -0.0333 0.0125  0.0056  1300 LEU A O   
782  C CB  . LEU A 114 ? 0.6201 0.6600 0.6277 -0.0395 0.0137  0.0096  1300 LEU A CB  
783  C CG  . LEU A 114 ? 0.6944 0.7319 0.7037 -0.0438 0.0145  0.0101  1300 LEU A CG  
784  C CD1 . LEU A 114 ? 0.6790 0.7079 0.6859 -0.0439 0.0146  0.0103  1300 LEU A CD1 
785  C CD2 . LEU A 114 ? 0.4072 0.4481 0.4208 -0.0464 0.0144  0.0085  1300 LEU A CD2 
786  N N   . CYS A 115 ? 0.5823 0.6316 0.5896 -0.0315 0.0137  0.0088  1301 CYS A N   
787  C CA  . CYS A 115 ? 0.4954 0.5448 0.5017 -0.0270 0.0132  0.0079  1301 CYS A CA  
788  C C   . CYS A 115 ? 0.6038 0.6593 0.6139 -0.0259 0.0143  0.0058  1301 CYS A C   
789  O O   . CYS A 115 ? 0.5328 0.5871 0.5425 -0.0228 0.0136  0.0043  1301 CYS A O   
790  C CB  . CYS A 115 ? 0.3276 0.3789 0.3322 -0.0247 0.0135  0.0100  1301 CYS A CB  
791  S SG  . CYS A 115 ? 0.6610 0.7045 0.6620 -0.0236 0.0127  0.0134  1301 CYS A SG  
792  N N   . LYS A 116 ? 0.5346 0.5965 0.5484 -0.0283 0.0169  0.0058  1302 LYS A N   
793  C CA  . LYS A 116 ? 0.6185 0.6866 0.6371 -0.0269 0.0195  0.0045  1302 LYS A CA  
794  C C   . LYS A 116 ? 0.5562 0.6245 0.5767 -0.0269 0.0184  0.0041  1302 LYS A C   
795  O O   . LYS A 116 ? 0.7253 0.7964 0.7475 -0.0234 0.0190  0.0032  1302 LYS A O   
796  C CB  . LYS A 116 ? 0.3646 0.4390 0.3875 -0.0303 0.0240  0.0047  1302 LYS A CB  
797  C CG  . LYS A 116 ? 0.3421 0.4192 0.3633 -0.0306 0.0256  0.0043  1302 LYS A CG  
798  C CD  . LYS A 116 ? 0.5560 0.6383 0.5814 -0.0353 0.0308  0.0041  1302 LYS A CD  
799  C CE  . LYS A 116 ? 0.4532 0.5422 0.4806 -0.0362 0.0357  0.0020  1302 LYS A CE  
800  N NZ  . LYS A 116 ? 0.8043 0.8949 0.8307 -0.0312 0.0350  0.0003  1302 LYS A NZ  
801  N N   . GLU A 117 ? 0.5227 0.5885 0.5429 -0.0306 0.0169  0.0048  1303 GLU A N   
802  C CA  . GLU A 117 ? 0.6617 0.7295 0.6838 -0.0314 0.0155  0.0045  1303 GLU A CA  
803  C C   . GLU A 117 ? 0.6793 0.7435 0.6971 -0.0286 0.0126  0.0026  1303 GLU A C   
804  O O   . GLU A 117 ? 0.7648 0.8337 0.7844 -0.0270 0.0123  0.0021  1303 GLU A O   
805  C CB  . GLU A 117 ? 0.6020 0.6672 0.6243 -0.0363 0.0142  0.0051  1303 GLU A CB  
806  C CG  . GLU A 117 ? 0.7050 0.7750 0.7332 -0.0395 0.0174  0.0072  1303 GLU A CG  
807  C CD  . GLU A 117 ? 0.9146 0.9803 0.9427 -0.0442 0.0162  0.0078  1303 GLU A CD  
808  O OE1 . GLU A 117 ? 0.8866 0.9497 0.9127 -0.0453 0.0131  0.0064  1303 GLU A OE1 
809  O OE2 . GLU A 117 ? 0.9534 1.0180 0.9833 -0.0472 0.0188  0.0093  1303 GLU A OE2 
810  N N   . LEU A 118 ? 0.3642 0.4202 0.3767 -0.0281 0.0111  0.0018  1304 LEU A N   
811  C CA  . LEU A 118 ? 0.4128 0.4635 0.4210 -0.0256 0.0095  0.0000  1304 LEU A CA  
812  C C   . LEU A 118 ? 0.5809 0.6344 0.5898 -0.0204 0.0105  -0.0004 1304 LEU A C   
813  O O   . LEU A 118 ? 0.7259 0.7802 0.7339 -0.0186 0.0097  -0.0018 1304 LEU A O   
814  C CB  . LEU A 118 ? 0.4722 0.5136 0.4760 -0.0256 0.0093  0.0005  1304 LEU A CB  
815  C CG  . LEU A 118 ? 0.7230 0.7597 0.7258 -0.0301 0.0091  0.0005  1304 LEU A CG  
816  C CD1 . LEU A 118 ? 0.7480 0.7765 0.7477 -0.0291 0.0103  0.0022  1304 LEU A CD1 
817  C CD2 . LEU A 118 ? 0.5629 0.5989 0.5646 -0.0330 0.0078  -0.0025 1304 LEU A CD2 
818  N N   . ALA A 119 ? 0.6084 0.6638 0.6189 -0.0182 0.0124  0.0007  1305 ALA A N   
819  C CA  . ALA A 119 ? 0.4593 0.5166 0.4709 -0.0132 0.0139  0.0000  1305 ALA A CA  
820  C C   . ALA A 119 ? 0.6310 0.6958 0.6470 -0.0117 0.0154  -0.0005 1305 ALA A C   
821  O O   . ALA A 119 ? 0.5518 0.6168 0.5678 -0.0074 0.0158  -0.0016 1305 ALA A O   
822  C CB  . ALA A 119 ? 0.3368 0.3971 0.3503 -0.0122 0.0161  0.0008  1305 ALA A CB  
823  N N   . GLU A 120 ? 0.5518 0.6229 0.5722 -0.0151 0.0166  0.0007  1306 GLU A N   
824  C CA  . GLU A 120 ? 0.5818 0.6612 0.6075 -0.0133 0.0187  0.0015  1306 GLU A CA  
825  C C   . GLU A 120 ? 0.6543 0.7330 0.6765 -0.0125 0.0153  0.0006  1306 GLU A C   
826  O O   . GLU A 120 ? 0.7279 0.8103 0.7513 -0.0083 0.0162  0.0005  1306 GLU A O   
827  C CB  . GLU A 120 ? 0.5926 0.6788 0.6243 -0.0172 0.0211  0.0040  1306 GLU A CB  
828  C CG  . GLU A 120 ? 0.7109 0.8069 0.7504 -0.0145 0.0257  0.0060  1306 GLU A CG  
829  C CD  . GLU A 120 ? 1.1444 1.2469 1.1908 -0.0185 0.0287  0.0094  1306 GLU A CD  
830  O OE1 . GLU A 120 ? 1.0918 1.1907 1.1364 -0.0235 0.0266  0.0096  1306 GLU A OE1 
831  O OE2 . GLU A 120 ? 1.2953 1.4063 1.3495 -0.0164 0.0337  0.0122  1306 GLU A OE2 
832  N N   . GLN A 121 ? 0.6576 0.7316 0.6753 -0.0167 0.0117  -0.0004 1307 GLN A N   
833  C CA  . GLN A 121 ? 0.6925 0.7658 0.7061 -0.0172 0.0088  -0.0021 1307 GLN A CA  
834  C C   . GLN A 121 ? 0.7608 0.8273 0.7696 -0.0127 0.0086  -0.0042 1307 GLN A C   
835  O O   . GLN A 121 ? 0.7133 0.7825 0.7206 -0.0107 0.0079  -0.0051 1307 GLN A O   
836  C CB  . GLN A 121 ? 0.5958 0.6638 0.6054 -0.0230 0.0061  -0.0037 1307 GLN A CB  
837  C CG  . GLN A 121 ? 0.6856 0.7595 0.7000 -0.0275 0.0061  -0.0017 1307 GLN A CG  
838  C CD  . GLN A 121 ? 0.7108 0.7971 0.7302 -0.0283 0.0057  0.0002  1307 GLN A CD  
839  O OE1 . GLN A 121 ? 0.6039 0.6977 0.6303 -0.0281 0.0083  0.0037  1307 GLN A OE1 
840  N NE2 . GLN A 121 ? 0.7429 0.8318 0.7586 -0.0295 0.0029  -0.0017 1307 GLN A NE2 
841  N N   . TYR A 122 ? 0.5945 0.6525 0.6010 -0.0112 0.0093  -0.0046 1308 TYR A N   
842  C CA  . TYR A 122 ? 0.6982 0.7482 0.7003 -0.0072 0.0094  -0.0061 1308 TYR A CA  
843  C C   . TYR A 122 ? 0.5826 0.6373 0.5880 -0.0013 0.0116  -0.0058 1308 TYR A C   
844  O O   . TYR A 122 ? 0.9016 0.9532 0.9042 0.0019  0.0114  -0.0073 1308 TYR A O   
845  C CB  . TYR A 122 ? 0.4722 0.5135 0.4722 -0.0068 0.0099  -0.0053 1308 TYR A CB  
846  C CG  . TYR A 122 ? 0.5875 0.6220 0.5840 -0.0115 0.0089  -0.0054 1308 TYR A CG  
847  C CD1 . TYR A 122 ? 0.4961 0.5295 0.4898 -0.0158 0.0075  -0.0076 1308 TYR A CD1 
848  C CD2 . TYR A 122 ? 0.6705 0.7002 0.6666 -0.0117 0.0097  -0.0033 1308 TYR A CD2 
849  C CE1 . TYR A 122 ? 0.6586 0.6851 0.6497 -0.0201 0.0077  -0.0083 1308 TYR A CE1 
850  C CE2 . TYR A 122 ? 0.6727 0.6958 0.6662 -0.0154 0.0098  -0.0030 1308 TYR A CE2 
851  C CZ  . TYR A 122 ? 0.6736 0.6945 0.6648 -0.0196 0.0091  -0.0058 1308 TYR A CZ  
852  O OH  . TYR A 122 ? 0.6957 0.7097 0.6851 -0.0233 0.0103  -0.0060 1308 TYR A OH  
853  N N   . GLU A 123 ? 0.4735 0.5348 0.4850 0.0001  0.0144  -0.0043 1309 GLU A N   
854  C CA  . GLU A 123 ? 0.5038 0.5699 0.5199 0.0057  0.0179  -0.0042 1309 GLU A CA  
855  C C   . GLU A 123 ? 0.6997 0.7744 0.7191 0.0078  0.0191  -0.0034 1309 GLU A C   
856  O O   . GLU A 123 ? 0.8816 0.9565 0.9015 0.0132  0.0207  -0.0040 1309 GLU A O   
857  C CB  . GLU A 123 ? 0.5405 0.6116 0.5624 0.0055  0.0218  -0.0033 1309 GLU A CB  
858  C CG  . GLU A 123 ? 0.6355 0.7109 0.6627 0.0111  0.0268  -0.0039 1309 GLU A CG  
859  C CD  . GLU A 123 ? 0.8612 0.9436 0.8950 0.0094  0.0319  -0.0034 1309 GLU A CD  
860  O OE1 . GLU A 123 ? 0.9854 1.0689 1.0192 0.0039  0.0310  -0.0023 1309 GLU A OE1 
861  O OE2 . GLU A 123 ? 0.9681 1.0545 1.0074 0.0133  0.0373  -0.0042 1309 GLU A OE2 
862  N N   . MET A 124 ? 0.6995 0.7818 0.7216 0.0038  0.0184  -0.0015 1310 MET A N   
863  C CA  . MET A 124 ? 0.7381 0.8309 0.7643 0.0057  0.0196  0.0006  1310 MET A CA  
864  C C   . MET A 124 ? 0.8164 0.9137 0.8396 0.0015  0.0153  0.0011  1310 MET A C   
865  O O   . MET A 124 ? 0.8118 0.9194 0.8384 0.0033  0.0160  0.0035  1310 MET A O   
866  C CB  . MET A 124 ? 0.7386 0.8411 0.7746 0.0064  0.0252  0.0039  1310 MET A CB  
867  C CG  . MET A 124 ? 0.6825 0.7830 0.7223 0.0107  0.0306  0.0029  1310 MET A CG  
868  S SD  . MET A 124 ? 1.1821 1.2883 1.2303 0.0071  0.0366  0.0048  1310 MET A SD  
869  C CE  . MET A 124 ? 1.5344 1.6383 1.5856 0.0119  0.0428  0.0021  1310 MET A CE  
870  N N   . GLU A 125 ? 0.8275 0.9180 0.8449 -0.0041 0.0113  -0.0010 1311 GLU A N   
871  C CA  . GLU A 125 ? 0.7017 0.7973 0.7164 -0.0088 0.0076  -0.0013 1311 GLU A CA  
872  C C   . GLU A 125 ? 0.8474 0.9354 0.8529 -0.0104 0.0044  -0.0054 1311 GLU A C   
873  O O   . GLU A 125 ? 0.9246 1.0188 0.9275 -0.0136 0.0018  -0.0062 1311 GLU A O   
874  C CB  . GLU A 125 ? 0.7864 0.8828 0.8029 -0.0152 0.0063  -0.0006 1311 GLU A CB  
875  C CG  . GLU A 125 ? 0.9187 1.0286 0.9400 -0.0182 0.0053  0.0024  1311 GLU A CG  
876  C CD  . GLU A 125 ? 1.0544 1.1753 1.0856 -0.0141 0.0099  0.0076  1311 GLU A CD  
877  O OE1 . GLU A 125 ? 0.9147 1.0322 0.9499 -0.0121 0.0140  0.0085  1311 GLU A OE1 
878  O OE2 . GLU A 125 ? 1.1229 1.2565 1.1580 -0.0130 0.0099  0.0110  1311 GLU A OE2 
879  N N   . ILE A 126 ? 0.6967 0.7717 0.6974 -0.0084 0.0051  -0.0079 1312 ILE A N   
880  C CA  . ILE A 126 ? 0.6183 0.6844 0.6106 -0.0101 0.0034  -0.0118 1312 ILE A CA  
881  C C   . ILE A 126 ? 0.5905 0.6456 0.5804 -0.0046 0.0055  -0.0127 1312 ILE A C   
882  O O   . ILE A 126 ? 0.6758 0.7211 0.6593 -0.0050 0.0054  -0.0154 1312 ILE A O   
883  C CB  . ILE A 126 ? 0.7168 0.7755 0.7048 -0.0172 0.0020  -0.0143 1312 ILE A CB  
884  C CG1 . ILE A 126 ? 0.7152 0.7621 0.7030 -0.0160 0.0039  -0.0139 1312 ILE A CG1 
885  C CG2 . ILE A 126 ? 0.6170 0.6860 0.6089 -0.0226 0.0002  -0.0131 1312 ILE A CG2 
886  C CD1 . ILE A 126 ? 0.6758 0.7166 0.6614 -0.0220 0.0036  -0.0153 1312 ILE A CD1 
887  N N   . PHE A 127 ? 0.6785 0.7352 0.6741 0.0004  0.0080  -0.0103 1313 PHE A N   
888  C CA  . PHE A 127 ? 0.6570 0.7056 0.6521 0.0063  0.0102  -0.0107 1313 PHE A CA  
889  C C   . PHE A 127 ? 0.8383 0.8727 0.8272 0.0046  0.0097  -0.0125 1313 PHE A C   
890  O O   . PHE A 127 ? 0.6573 0.6835 0.6419 0.0071  0.0104  -0.0142 1313 PHE A O   
891  C CB  . PHE A 127 ? 0.5144 0.5668 0.5098 0.0116  0.0114  -0.0110 1313 PHE A CB  
892  C CG  . PHE A 127 ? 0.5562 0.6233 0.5590 0.0137  0.0130  -0.0082 1313 PHE A CG  
893  C CD1 . PHE A 127 ? 0.4178 0.4955 0.4209 0.0100  0.0109  -0.0070 1313 PHE A CD1 
894  C CD2 . PHE A 127 ? 0.4022 0.4730 0.4123 0.0187  0.0172  -0.0064 1313 PHE A CD2 
895  C CE1 . PHE A 127 ? 0.4944 0.5860 0.5053 0.0120  0.0131  -0.0033 1313 PHE A CE1 
896  C CE2 . PHE A 127 ? 0.6074 0.6913 0.6254 0.0204  0.0202  -0.0034 1313 PHE A CE2 
897  C CZ  . PHE A 127 ? 0.5776 0.6720 0.5964 0.0174  0.0183  -0.0013 1313 PHE A CZ  
898  N N   . ASP A 128 ? 0.7496 0.7807 0.7385 0.0005  0.0093  -0.0118 1314 ASP A N   
899  C CA  . ASP A 128 ? 0.6682 0.6861 0.6531 0.0002  0.0102  -0.0121 1314 ASP A CA  
900  C C   . ASP A 128 ? 0.6583 0.6742 0.6467 0.0042  0.0117  -0.0094 1314 ASP A C   
901  O O   . ASP A 128 ? 0.8078 0.8238 0.7976 0.0019  0.0117  -0.0074 1314 ASP A O   
902  C CB  . ASP A 128 ? 0.5152 0.5288 0.4969 -0.0064 0.0096  -0.0130 1314 ASP A CB  
903  C CG  . ASP A 128 ? 0.7872 0.7864 0.7643 -0.0069 0.0120  -0.0137 1314 ASP A CG  
904  O OD1 . ASP A 128 ? 0.8571 0.8503 0.8352 -0.0020 0.0137  -0.0115 1314 ASP A OD1 
905  O OD2 . ASP A 128 ? 0.8668 0.8608 0.8398 -0.0122 0.0127  -0.0164 1314 ASP A OD2 
906  N N   . TYR A 129 ? 0.5582 0.5724 0.5479 0.0100  0.0131  -0.0092 1315 TYR A N   
907  C CA  . TYR A 129 ? 0.6513 0.6656 0.6447 0.0136  0.0145  -0.0070 1315 TYR A CA  
908  C C   . TYR A 129 ? 0.5110 0.5164 0.5024 0.0128  0.0149  -0.0046 1315 TYR A C   
909  O O   . TYR A 129 ? 0.6805 0.6890 0.6749 0.0138  0.0152  -0.0021 1315 TYR A O   
910  C CB  . TYR A 129 ? 0.5832 0.5964 0.5784 0.0202  0.0163  -0.0078 1315 TYR A CB  
911  C CG  . TYR A 129 ? 0.5001 0.5238 0.4997 0.0228  0.0175  -0.0090 1315 TYR A CG  
912  C CD1 . TYR A 129 ? 0.3959 0.4292 0.3974 0.0192  0.0168  -0.0089 1315 TYR A CD1 
913  C CD2 . TYR A 129 ? 0.5625 0.5862 0.5651 0.0291  0.0201  -0.0098 1315 TYR A CD2 
914  C CE1 . TYR A 129 ? 0.2623 0.3055 0.2690 0.0220  0.0190  -0.0089 1315 TYR A CE1 
915  C CE2 . TYR A 129 ? 0.2599 0.2930 0.2675 0.0320  0.0226  -0.0104 1315 TYR A CE2 
916  C CZ  . TYR A 129 ? 0.7338 0.7769 0.7436 0.0285  0.0222  -0.0096 1315 TYR A CZ  
917  O OH  . TYR A 129 ? 0.4824 0.5354 0.4984 0.0319  0.0258  -0.0092 1315 TYR A OH  
918  N N   . GLU A 130 ? 0.5418 0.5364 0.5285 0.0112  0.0155  -0.0051 1316 GLU A N   
919  C CA  . GLU A 130 ? 0.7522 0.7383 0.7382 0.0111  0.0172  -0.0018 1316 GLU A CA  
920  C C   . GLU A 130 ? 0.8142 0.8050 0.8015 0.0067  0.0164  0.0002  1316 GLU A C   
921  O O   . GLU A 130 ? 0.8200 0.8125 0.8096 0.0077  0.0168  0.0041  1316 GLU A O   
922  C CB  . GLU A 130 ? 0.7272 0.6995 0.7084 0.0099  0.0197  -0.0029 1316 GLU A CB  
923  C CG  . GLU A 130 ? 1.8682 1.8347 1.8468 0.0133  0.0206  -0.0057 1316 GLU A CG  
924  C CD  . GLU A 130 ? 1.5692 1.5362 1.5429 0.0093  0.0197  -0.0107 1316 GLU A CD  
925  O OE1 . GLU A 130 ? 1.5074 1.4862 1.4823 0.0080  0.0169  -0.0123 1316 GLU A OE1 
926  O OE2 . GLU A 130 ? 1.4543 1.4101 1.4230 0.0072  0.0222  -0.0127 1316 GLU A OE2 
927  N N   . LEU A 131 ? 0.6397 0.6335 0.6254 0.0018  0.0152  -0.0025 1317 LEU A N   
928  C CA  . LEU A 131 ? 0.7142 0.7132 0.7014 -0.0024 0.0143  -0.0013 1317 LEU A CA  
929  C C   . LEU A 131 ? 0.6450 0.6550 0.6366 -0.0015 0.0130  0.0004  1317 LEU A C   
930  O O   . LEU A 131 ? 0.6590 0.6715 0.6519 -0.0035 0.0129  0.0029  1317 LEU A O   
931  C CB  . LEU A 131 ? 0.5353 0.5364 0.5206 -0.0077 0.0131  -0.0049 1317 LEU A CB  
932  C CG  . LEU A 131 ? 0.4537 0.4471 0.4365 -0.0124 0.0149  -0.0054 1317 LEU A CG  
933  C CD1 . LEU A 131 ? 0.4593 0.4402 0.4400 -0.0104 0.0187  -0.0037 1317 LEU A CD1 
934  C CD2 . LEU A 131 ? 0.5384 0.5330 0.5184 -0.0171 0.0139  -0.0100 1317 LEU A CD2 
935  N N   . LEU A 132 ? 0.7417 0.7582 0.7356 0.0013  0.0126  -0.0012 1318 LEU A N   
936  C CA  . LEU A 132 ? 0.5863 0.6131 0.5847 0.0019  0.0127  -0.0005 1318 LEU A CA  
937  C C   . LEU A 132 ? 0.6492 0.6765 0.6490 0.0042  0.0135  0.0023  1318 LEU A C   
938  O O   . LEU A 132 ? 0.6729 0.7070 0.6748 0.0021  0.0135  0.0038  1318 LEU A O   
939  C CB  . LEU A 132 ? 0.5099 0.5424 0.5110 0.0051  0.0136  -0.0028 1318 LEU A CB  
940  C CG  . LEU A 132 ? 0.5271 0.5703 0.5338 0.0052  0.0155  -0.0026 1318 LEU A CG  
941  C CD1 . LEU A 132 ? 0.5733 0.6211 0.5811 -0.0004 0.0149  -0.0016 1318 LEU A CD1 
942  C CD2 . LEU A 132 ? 0.4637 0.5123 0.4738 0.0082  0.0173  -0.0044 1318 LEU A CD2 
943  N N   . SER A 133 ? 0.6059 0.6263 0.6044 0.0082  0.0142  0.0033  1319 SER A N   
944  C CA  . SER A 133 ? 0.7949 0.8166 0.7951 0.0107  0.0147  0.0066  1319 SER A CA  
945  C C   . SER A 133 ? 0.6614 0.6824 0.6605 0.0078  0.0143  0.0107  1319 SER A C   
946  O O   . SER A 133 ? 0.7134 0.7417 0.7143 0.0073  0.0140  0.0134  1319 SER A O   
947  C CB  . SER A 133 ? 0.4973 0.5103 0.4967 0.0157  0.0158  0.0073  1319 SER A CB  
948  O OG  . SER A 133 ? 0.9698 0.9714 0.9654 0.0147  0.0165  0.0077  1319 SER A OG  
949  N N   . GLN A 134 ? 0.5653 0.5780 0.5616 0.0057  0.0148  0.0112  1320 GLN A N   
950  C CA  . GLN A 134 ? 0.6838 0.6946 0.6795 0.0034  0.0154  0.0152  1320 GLN A CA  
951  C C   . GLN A 134 ? 0.5926 0.6128 0.5895 -0.0006 0.0140  0.0149  1320 GLN A C   
952  O O   . GLN A 134 ? 0.6752 0.6997 0.6728 -0.0013 0.0140  0.0189  1320 GLN A O   
953  C CB  . GLN A 134 ? 0.6825 0.6823 0.6754 0.0012  0.0173  0.0144  1320 GLN A CB  
954  C CG  . GLN A 134 ? 0.8918 0.8806 0.8835 0.0044  0.0201  0.0157  1320 GLN A CG  
955  C CD  . GLN A 134 ? 1.0334 1.0231 1.0278 0.0087  0.0213  0.0219  1320 GLN A CD  
956  O OE1 . GLN A 134 ? 1.0885 1.0875 1.0851 0.0108  0.0191  0.0228  1320 GLN A OE1 
957  N NE2 . GLN A 134 ? 0.8706 0.8511 0.8652 0.0098  0.0252  0.0263  1320 GLN A NE2 
958  N N   . ASN A 135 ? 0.6457 0.6694 0.6429 -0.0030 0.0131  0.0107  1321 ASN A N   
959  C CA  . ASN A 135 ? 0.4937 0.5252 0.4925 -0.0070 0.0124  0.0102  1321 ASN A CA  
960  C C   . ASN A 135 ? 0.6407 0.6818 0.6419 -0.0063 0.0126  0.0113  1321 ASN A C   
961  O O   . ASN A 135 ? 0.5057 0.5518 0.5071 -0.0092 0.0126  0.0132  1321 ASN A O   
962  C CB  . ASN A 135 ? 0.5671 0.6011 0.5669 -0.0088 0.0120  0.0061  1321 ASN A CB  
963  C CG  . ASN A 135 ? 0.4798 0.5201 0.4817 -0.0132 0.0119  0.0059  1321 ASN A CG  
964  O OD1 . ASN A 135 ? 0.5944 0.6319 0.5956 -0.0167 0.0114  0.0055  1321 ASN A OD1 
965  N ND2 . ASN A 135 ? 0.5367 0.5853 0.5416 -0.0135 0.0131  0.0059  1321 ASN A ND2 
966  N N   . LEU A 136 ? 0.6088 0.6523 0.6116 -0.0028 0.0132  0.0097  1322 LEU A N   
967  C CA  . LEU A 136 ? 0.3763 0.4293 0.3816 -0.0024 0.0141  0.0097  1322 LEU A CA  
968  C C   . LEU A 136 ? 0.5057 0.5607 0.5099 -0.0020 0.0133  0.0144  1322 LEU A C   
969  O O   . LEU A 136 ? 0.7966 0.8607 0.8015 -0.0046 0.0135  0.0152  1322 LEU A O   
970  C CB  . LEU A 136 ? 0.4966 0.5507 0.5043 0.0017  0.0155  0.0067  1322 LEU A CB  
971  C CG  . LEU A 136 ? 0.4387 0.4940 0.4485 0.0014  0.0169  0.0030  1322 LEU A CG  
972  C CD1 . LEU A 136 ? 0.4953 0.5522 0.5082 0.0060  0.0192  0.0003  1322 LEU A CD1 
973  C CD2 . LEU A 136 ? 0.4315 0.4946 0.4437 -0.0036 0.0185  0.0023  1322 LEU A CD2 
974  N N   . ILE A 137 ? 0.3607 0.4078 0.3633 0.0012  0.0129  0.0177  1323 ILE A N   
975  C CA  . ILE A 137 ? 0.6360 0.6855 0.6384 0.0024  0.0126  0.0236  1323 ILE A CA  
976  C C   . ILE A 137 ? 0.6788 0.7316 0.6799 -0.0018 0.0122  0.0263  1323 ILE A C   
977  O O   . ILE A 137 ? 0.5739 0.6356 0.5751 -0.0028 0.0117  0.0299  1323 ILE A O   
978  C CB  . ILE A 137 ? 0.8465 0.8850 0.8483 0.0063  0.0136  0.0273  1323 ILE A CB  
979  C CG1 . ILE A 137 ? 0.6354 0.6703 0.6385 0.0108  0.0141  0.0253  1323 ILE A CG1 
980  C CG2 . ILE A 137 ? 0.3884 0.4301 0.3909 0.0075  0.0140  0.0350  1323 ILE A CG2 
981  C CD1 . ILE A 137 ? 0.8240 0.8691 0.8297 0.0126  0.0135  0.0259  1323 ILE A CD1 
982  N N   . GLN A 138 ? 0.4962 0.5424 0.4961 -0.0042 0.0126  0.0246  1324 GLN A N   
983  C CA  . GLN A 138 ? 0.5269 0.5745 0.5257 -0.0080 0.0126  0.0267  1324 GLN A CA  
984  C C   . GLN A 138 ? 0.6528 0.7108 0.6521 -0.0121 0.0121  0.0246  1324 GLN A C   
985  O O   . GLN A 138 ? 0.6781 0.7419 0.6765 -0.0142 0.0120  0.0278  1324 GLN A O   
986  C CB  . GLN A 138 ? 0.5698 0.6079 0.5676 -0.0099 0.0133  0.0243  1324 GLN A CB  
987  C CG  . GLN A 138 ? 0.6256 0.6540 0.6226 -0.0081 0.0154  0.0279  1324 GLN A CG  
988  C CD  . GLN A 138 ? 1.0013 1.0330 0.9986 -0.0074 0.0165  0.0347  1324 GLN A CD  
989  O OE1 . GLN A 138 ? 1.0348 1.0621 1.0318 -0.0089 0.0183  0.0366  1324 GLN A OE1 
990  N NE2 . GLN A 138 ? 0.9909 1.0311 0.9890 -0.0052 0.0155  0.0384  1324 GLN A NE2 
991  N N   . GLN A 139 ? 0.4421 0.5024 0.4430 -0.0134 0.0125  0.0194  1325 GLN A N   
992  C CA  . GLN A 139 ? 0.4876 0.5568 0.4897 -0.0177 0.0136  0.0172  1325 GLN A CA  
993  C C   . GLN A 139 ? 0.6762 0.7556 0.6782 -0.0180 0.0137  0.0188  1325 GLN A C   
994  O O   . GLN A 139 ? 0.7891 0.8761 0.7907 -0.0225 0.0147  0.0182  1325 GLN A O   
995  C CB  . GLN A 139 ? 0.3656 0.4360 0.3708 -0.0179 0.0153  0.0121  1325 GLN A CB  
996  C CG  . GLN A 139 ? 0.3537 0.4177 0.3594 -0.0188 0.0151  0.0104  1325 GLN A CG  
997  C CD  . GLN A 139 ? 0.5594 0.6275 0.5691 -0.0195 0.0175  0.0068  1325 GLN A CD  
998  O OE1 . GLN A 139 ? 0.7134 0.7784 0.7242 -0.0171 0.0173  0.0052  1325 GLN A OE1 
999  N NE2 . GLN A 139 ? 0.4501 0.5256 0.4622 -0.0228 0.0204  0.0058  1325 GLN A NE2 
1000 N N   . ALA A 140 ? 0.5478 0.6275 0.5501 -0.0135 0.0128  0.0206  1326 ALA A N   
1001 C CA  . ALA A 140 ? 0.4653 0.5560 0.4678 -0.0138 0.0127  0.0220  1326 ALA A CA  
1002 C C   . ALA A 140 ? 0.5553 0.6505 0.5554 -0.0147 0.0111  0.0285  1326 ALA A C   
1003 O O   . ALA A 140 ? 0.6806 0.7876 0.6800 -0.0176 0.0109  0.0295  1326 ALA A O   
1004 C CB  . ALA A 140 ? 0.3640 0.4534 0.3684 -0.0085 0.0125  0.0218  1326 ALA A CB  
1005 N N   . LYS A 141 ? 0.5472 0.6335 0.5464 -0.0123 0.0106  0.0329  1327 LYS A N   
1006 C CA  . LYS A 141 ? 0.7328 0.8224 0.7304 -0.0124 0.0101  0.0399  1327 LYS A CA  
1007 C C   . LYS A 141 ? 0.6731 0.7676 0.6686 -0.0181 0.0103  0.0389  1327 LYS A C   
1008 O O   . LYS A 141 ? 0.5720 0.6763 0.5659 -0.0200 0.0097  0.0429  1327 LYS A O   
1009 C CB  . LYS A 141 ? 0.5682 0.6451 0.5660 -0.0090 0.0112  0.0436  1327 LYS A CB  
1010 C CG  . LYS A 141 ? 0.7563 0.8295 0.7559 -0.0034 0.0118  0.0488  1327 LYS A CG  
1011 C CD  . LYS A 141 ? 1.0869 1.1477 1.0868 -0.0013 0.0145  0.0523  1327 LYS A CD  
1012 C CE  . LYS A 141 ? 0.9806 1.0429 0.9792 -0.0043 0.0153  0.0547  1327 LYS A CE  
1013 N NZ  . LYS A 141 ? 1.1680 1.2173 1.1672 -0.0031 0.0189  0.0564  1327 LYS A NZ  
1014 N N   . PHE A 142 ? 0.7335 0.8212 0.7292 -0.0208 0.0113  0.0338  1328 PHE A N   
1015 C CA  . PHE A 142 ? 0.6136 0.7034 0.6078 -0.0261 0.0121  0.0328  1328 PHE A CA  
1016 C C   . PHE A 142 ? 0.6497 0.7520 0.6432 -0.0307 0.0128  0.0302  1328 PHE A C   
1017 O O   . PHE A 142 ? 0.6901 0.7999 0.6810 -0.0341 0.0127  0.0328  1328 PHE A O   
1018 C CB  . PHE A 142 ? 0.5870 0.6671 0.5825 -0.0277 0.0132  0.0283  1328 PHE A CB  
1019 C CG  . PHE A 142 ? 0.6728 0.7411 0.6684 -0.0247 0.0130  0.0302  1328 PHE A CG  
1020 C CD1 . PHE A 142 ? 0.5895 0.6555 0.5841 -0.0219 0.0132  0.0363  1328 PHE A CD1 
1021 C CD2 . PHE A 142 ? 0.6401 0.7003 0.6371 -0.0249 0.0133  0.0260  1328 PHE A CD2 
1022 C CE1 . PHE A 142 ? 0.6533 0.7080 0.6484 -0.0196 0.0145  0.0374  1328 PHE A CE1 
1023 C CE2 . PHE A 142 ? 0.6149 0.6647 0.6117 -0.0230 0.0137  0.0268  1328 PHE A CE2 
1024 C CZ  . PHE A 142 ? 0.6803 0.7268 0.6762 -0.0206 0.0147  0.0322  1328 PHE A CZ  
1025 N N   . TYR A 143 ? 0.6826 0.7876 0.6784 -0.0311 0.0140  0.0249  1329 TYR A N   
1026 C CA  . TYR A 143 ? 0.6165 0.7328 0.6123 -0.0362 0.0161  0.0212  1329 TYR A CA  
1027 C C   . TYR A 143 ? 0.4536 0.5823 0.4470 -0.0367 0.0144  0.0249  1329 TYR A C   
1028 O O   . TYR A 143 ? 0.5795 0.7184 0.5711 -0.0425 0.0158  0.0232  1329 TYR A O   
1029 C CB  . TYR A 143 ? 0.6687 0.7855 0.6684 -0.0349 0.0185  0.0155  1329 TYR A CB  
1030 C CG  . TYR A 143 ? 0.7122 0.8226 0.7148 -0.0366 0.0217  0.0111  1329 TYR A CG  
1031 C CD1 . TYR A 143 ? 0.9879 1.0928 0.9898 -0.0396 0.0221  0.0119  1329 TYR A CD1 
1032 C CD2 . TYR A 143 ? 0.9672 1.0778 0.9742 -0.0349 0.0247  0.0065  1329 TYR A CD2 
1033 C CE1 . TYR A 143 ? 1.0158 1.1161 1.0213 -0.0412 0.0251  0.0087  1329 TYR A CE1 
1034 C CE2 . TYR A 143 ? 0.9277 1.0338 0.9382 -0.0361 0.0281  0.0035  1329 TYR A CE2 
1035 C CZ  . TYR A 143 ? 0.5902 0.6917 0.6001 -0.0393 0.0281  0.0049  1329 TYR A CZ  
1036 O OH  . TYR A 143 ? 0.6537 0.7521 0.6680 -0.0404 0.0315  0.0028  1329 TYR A OH  
1037 N N   . GLU A 144 ? 0.5686 0.6966 0.5623 -0.0309 0.0117  0.0302  1330 GLU A N   
1038 C CA  . GLU A 144 ? 0.5759 0.7168 0.5681 -0.0308 0.0098  0.0350  1330 GLU A CA  
1039 C C   . GLU A 144 ? 0.7375 0.8819 0.7261 -0.0335 0.0090  0.0404  1330 GLU A C   
1040 O O   . GLU A 144 ? 0.6826 0.8396 0.6683 -0.0390 0.0090  0.0403  1330 GLU A O   
1041 C CB  . GLU A 144 ? 0.7741 0.9122 0.7688 -0.0234 0.0079  0.0402  1330 GLU A CB  
1042 C CG  . GLU A 144 ? 0.8116 0.9640 0.8060 -0.0221 0.0057  0.0471  1330 GLU A CG  
1043 C CD  . GLU A 144 ? 1.1812 1.3481 1.1761 -0.0255 0.0057  0.0425  1330 GLU A CD  
1044 O OE1 . GLU A 144 ? 1.3387 1.5063 1.3336 -0.0303 0.0083  0.0341  1330 GLU A OE1 
1045 O OE2 . GLU A 144 ? 1.2041 1.3824 1.2000 -0.0236 0.0037  0.0476  1330 GLU A OE2 
1046 N N   . SER A 145 ? 0.4619 0.5947 0.4506 -0.0300 0.0088  0.0446  1331 SER A N   
1047 C CA  . SER A 145 ? 0.4160 0.5500 0.4020 -0.0312 0.0087  0.0501  1331 SER A CA  
1048 C C   . SER A 145 ? 0.5380 0.6772 0.5209 -0.0388 0.0099  0.0460  1331 SER A C   
1049 O O   . SER A 145 ? 0.5745 0.7225 0.5541 -0.0414 0.0094  0.0502  1331 SER A O   
1050 C CB  . SER A 145 ? 0.6156 0.7338 0.6029 -0.0280 0.0098  0.0516  1331 SER A CB  
1051 O OG  . SER A 145 ? 0.6135 0.7232 0.6038 -0.0222 0.0098  0.0524  1331 SER A OG  
1052 N N   . ILE A 146 ? 0.4756 0.6091 0.4596 -0.0424 0.0121  0.0383  1332 ILE A N   
1053 C CA  . ILE A 146 ? 0.4368 0.5734 0.4187 -0.0499 0.0145  0.0342  1332 ILE A CA  
1054 C C   . ILE A 146 ? 0.5520 0.7053 0.5307 -0.0548 0.0144  0.0340  1332 ILE A C   
1055 O O   . ILE A 146 ? 0.8786 1.0375 0.8534 -0.0602 0.0153  0.0348  1332 ILE A O   
1056 C CB  . ILE A 146 ? 0.5528 0.6829 0.5379 -0.0525 0.0178  0.0266  1332 ILE A CB  
1057 C CG1 . ILE A 146 ? 0.5955 0.7108 0.5824 -0.0506 0.0181  0.0267  1332 ILE A CG1 
1058 C CG2 . ILE A 146 ? 0.3924 0.5300 0.3758 -0.0610 0.0216  0.0218  1332 ILE A CG2 
1059 C CD1 . ILE A 146 ? 0.4565 0.5654 0.4477 -0.0516 0.0209  0.0208  1332 ILE A CD1 
1060 N N   . MET A 147 ? 0.5905 0.7520 0.5708 -0.0529 0.0134  0.0331  1333 MET A N   
1061 C CA  . MET A 147 ? 0.6392 0.8185 0.6169 -0.0581 0.0134  0.0319  1333 MET A CA  
1062 C C   . MET A 147 ? 0.5981 0.7894 0.5729 -0.0562 0.0096  0.0406  1333 MET A C   
1063 O O   . MET A 147 ? 0.7150 0.9209 0.6856 -0.0624 0.0095  0.0407  1333 MET A O   
1064 C CB  . MET A 147 ? 0.5726 0.7566 0.5540 -0.0570 0.0143  0.0269  1333 MET A CB  
1065 C CG  . MET A 147 ? 0.8038 0.9806 0.7885 -0.0600 0.0194  0.0179  1333 MET A CG  
1066 S SD  . MET A 147 ? 0.8753 1.0547 0.8570 -0.0707 0.0247  0.0126  1333 MET A SD  
1067 C CE  . MET A 147 ? 1.7987 1.9817 1.7851 -0.0749 0.0317  0.0025  1333 MET A CE  
1068 N N   . LYS A 148 ? 0.5994 0.7851 0.5765 -0.0481 0.0070  0.0480  1334 LYS A N   
1069 C CA  . LYS A 148 ? 0.6379 0.8364 0.6141 -0.0448 0.0039  0.0576  1334 LYS A CA  
1070 C C   . LYS A 148 ? 0.7559 0.9507 0.7308 -0.0414 0.0035  0.0666  1334 LYS A C   
1071 O O   . LYS A 148 ? 0.9133 1.1204 0.8874 -0.0392 0.0016  0.0754  1334 LYS A O   
1072 C CB  . LYS A 148 ? 0.5464 0.7441 0.5275 -0.0375 0.0024  0.0608  1334 LYS A CB  
1073 C CG  . LYS A 148 ? 0.6581 0.8618 0.6410 -0.0398 0.0027  0.0535  1334 LYS A CG  
1074 C CD  . LYS A 148 ? 0.9042 1.1172 0.8904 -0.0346 0.0002  0.0595  1334 LYS A CD  
1075 C CE  . LYS A 148 ? 1.2040 1.4343 1.1897 -0.0402 -0.0001 0.0540  1334 LYS A CE  
1076 N NZ  . LYS A 148 ? 1.4690 1.6946 1.4542 -0.0464 0.0039  0.0418  1334 LYS A NZ  
1077 N N   . ILE A 149 ? 0.7853 0.9635 0.7605 -0.0404 0.0055  0.0649  1335 ILE A N   
1078 C CA  . ILE A 149 ? 0.7290 0.9033 0.7031 -0.0379 0.0061  0.0723  1335 ILE A CA  
1079 C C   . ILE A 149 ? 0.9286 1.1015 0.8983 -0.0450 0.0078  0.0680  1335 ILE A C   
1080 O O   . ILE A 149 ? 0.9753 1.1363 0.9457 -0.0481 0.0097  0.0603  1335 ILE A O   
1081 C CB  . ILE A 149 ? 0.8120 0.9680 0.7904 -0.0311 0.0078  0.0743  1335 ILE A CB  
1082 C CG1 . ILE A 149 ? 0.7658 0.9240 0.7483 -0.0240 0.0070  0.0807  1335 ILE A CG1 
1083 C CG2 . ILE A 149 ? 0.4749 0.6240 0.4522 -0.0299 0.0099  0.0792  1335 ILE A CG2 
1084 C CD1 . ILE A 149 ? 0.7127 0.8529 0.6995 -0.0176 0.0095  0.0826  1335 ILE A CD1 
1085 N N   . LEU A 150 ? 1.1112 1.2968 1.0766 -0.0477 0.0071  0.0734  1336 LEU A N   
1086 C CA  . LEU A 150 ? 1.1358 1.3199 1.0964 -0.0544 0.0090  0.0704  1336 LEU A CA  
1087 C C   . LEU A 150 ? 0.9916 1.1602 0.9538 -0.0499 0.0109  0.0744  1336 LEU A C   
1088 O O   . LEU A 150 ? 0.9171 1.0854 0.8816 -0.0427 0.0109  0.0833  1336 LEU A O   
1089 C CB  . LEU A 150 ? 1.1829 1.3873 1.1376 -0.0594 0.0076  0.0744  1336 LEU A CB  
1090 C CG  . LEU A 150 ? 1.2540 1.4779 1.2063 -0.0652 0.0058  0.0709  1336 LEU A CG  
1091 C CD1 . LEU A 150 ? 0.8652 1.0971 0.8109 -0.0763 0.0078  0.0645  1336 LEU A CD1 
1092 C CD2 . LEU A 150 ? 0.9330 1.1542 0.8902 -0.0639 0.0056  0.0645  1336 LEU A CD2 
1093 N N   . ARG A 151 ? 0.5990 0.7545 0.5611 -0.0538 0.0133  0.0677  1337 ARG A N   
1094 C CA  . ARG A 151 ? 0.6344 0.7740 0.5985 -0.0501 0.0155  0.0699  1337 ARG A CA  
1095 C C   . ARG A 151 ? 0.6653 0.8064 0.6246 -0.0554 0.0171  0.0705  1337 ARG A C   
1096 O O   . ARG A 151 ? 0.6715 0.8145 0.6277 -0.0632 0.0182  0.0641  1337 ARG A O   
1097 C CB  . ARG A 151 ? 0.5228 0.6461 0.4909 -0.0504 0.0168  0.0623  1337 ARG A CB  
1098 C CG  . ARG A 151 ? 0.6566 0.7782 0.6288 -0.0463 0.0154  0.0603  1337 ARG A CG  
1099 C CD  . ARG A 151 ? 0.4913 0.6011 0.4665 -0.0482 0.0165  0.0522  1337 ARG A CD  
1100 N NE  . ARG A 151 ? 0.4711 0.5882 0.4456 -0.0539 0.0168  0.0457  1337 ARG A NE  
1101 C CZ  . ARG A 151 ? 0.4799 0.5897 0.4574 -0.0561 0.0184  0.0390  1337 ARG A CZ  
1102 N NH1 . ARG A 151 ? 0.3923 0.4887 0.3731 -0.0533 0.0188  0.0381  1337 ARG A NH1 
1103 N NH2 . ARG A 151 ? 0.3498 0.4666 0.3274 -0.0611 0.0200  0.0335  1337 ARG A NH2 
1104 N N   . PRO A 152 ? 0.5008 0.6407 0.4597 -0.0511 0.0182  0.0783  1338 PRO A N   
1105 C CA  . PRO A 152 ? 0.5112 0.6542 0.4649 -0.0554 0.0196  0.0800  1338 PRO A CA  
1106 C C   . PRO A 152 ? 0.5578 0.6861 0.5114 -0.0610 0.0223  0.0721  1338 PRO A C   
1107 O O   . PRO A 152 ? 0.6838 0.7965 0.6424 -0.0581 0.0236  0.0692  1338 PRO A O   
1108 C CB  . PRO A 152 ? 0.4374 0.5765 0.3931 -0.0476 0.0214  0.0895  1338 PRO A CB  
1109 C CG  . PRO A 152 ? 0.6676 0.8078 0.6287 -0.0399 0.0205  0.0942  1338 PRO A CG  
1110 C CD  . PRO A 152 ? 0.6228 0.7559 0.5864 -0.0420 0.0192  0.0853  1338 PRO A CD  
1111 N N   . LYS A 153 ? 0.6073 0.7409 0.5556 -0.0692 0.0234  0.0687  1339 LYS A N   
1112 C CA  . LYS A 153 ? 0.3524 0.4728 0.3008 -0.0750 0.0266  0.0619  1339 LYS A CA  
1113 C C   . LYS A 153 ? 0.7031 0.8099 0.6529 -0.0712 0.0289  0.0657  1339 LYS A C   
1114 O O   . LYS A 153 ? 0.5611 0.6732 0.5077 -0.0687 0.0291  0.0727  1339 LYS A O   
1115 C CB  . LYS A 153 ? 0.5621 0.6928 0.5044 -0.0849 0.0280  0.0579  1339 LYS A CB  
1116 C CG  . LYS A 153 ? 0.8349 0.9561 0.7744 -0.0910 0.0321  0.0554  1339 LYS A CG  
1117 C CD  . LYS A 153 ? 0.9217 1.0576 0.8526 -0.1001 0.0332  0.0544  1339 LYS A CD  
1118 C CE  . LYS A 153 ? 0.9836 1.1148 0.9094 -0.1024 0.0357  0.0580  1339 LYS A CE  
1119 N NZ  . LYS A 153 ? 0.8369 0.9646 0.7641 -0.0924 0.0340  0.0673  1339 LYS A NZ  
1120 N N   . PRO A 154 ? 0.4174 0.5072 0.3724 -0.0703 0.0307  0.0615  1340 PRO A N   
1121 C CA  . PRO A 154 ? 0.5376 0.6142 0.4941 -0.0674 0.0333  0.0642  1340 PRO A CA  
1122 C C   . PRO A 154 ? 0.6980 0.7708 0.6503 -0.0746 0.0364  0.0622  1340 PRO A C   
1123 O O   . PRO A 154 ? 0.5082 0.5849 0.4577 -0.0827 0.0373  0.0569  1340 PRO A O   
1124 C CB  . PRO A 154 ? 0.4058 0.4678 0.3694 -0.0651 0.0339  0.0596  1340 PRO A CB  
1125 C CG  . PRO A 154 ? 0.4640 0.5292 0.4283 -0.0708 0.0331  0.0528  1340 PRO A CG  
1126 C CD  . PRO A 154 ? 0.4526 0.5353 0.4125 -0.0718 0.0306  0.0545  1340 PRO A CD  
1127 N N   . ASP A 155 ? 0.5961 0.6607 0.5481 -0.0718 0.0388  0.0663  1341 ASP A N   
1128 C CA  . ASP A 155 ? 0.3717 0.4298 0.3203 -0.0780 0.0421  0.0644  1341 ASP A CA  
1129 C C   . ASP A 155 ? 0.6613 0.7001 0.6162 -0.0780 0.0447  0.0603  1341 ASP A C   
1130 O O   . ASP A 155 ? 0.6139 0.6445 0.5749 -0.0717 0.0444  0.0608  1341 ASP A O   
1131 C CB  . ASP A 155 ? 0.7573 0.8193 0.7010 -0.0754 0.0434  0.0718  1341 ASP A CB  
1132 C CG  . ASP A 155 ? 0.8969 0.9793 0.8324 -0.0793 0.0413  0.0749  1341 ASP A CG  
1133 O OD1 . ASP A 155 ? 0.9014 0.9898 0.8335 -0.0878 0.0412  0.0691  1341 ASP A OD1 
1134 O OD2 . ASP A 155 ? 0.9650 1.0583 0.8978 -0.0741 0.0404  0.0832  1341 ASP A OD2 
1135 N N   . TYR A 156 ? 0.5632 0.7079 0.7123 -0.0083 -0.0153 0.0015  1342 TYR A N   
1136 C CA  . TYR A 156 ? 0.5472 0.6890 0.6882 -0.0103 -0.0125 -0.0048 1342 TYR A CA  
1137 C C   . TYR A 156 ? 0.6380 0.7678 0.7660 -0.0164 -0.0125 -0.0159 1342 TYR A C   
1138 O O   . TYR A 156 ? 0.6073 0.7322 0.7384 -0.0198 -0.0161 -0.0190 1342 TYR A O   
1139 C CB  . TYR A 156 ? 0.5072 0.6563 0.6641 -0.0111 -0.0144 -0.0022 1342 TYR A CB  
1140 C CG  . TYR A 156 ? 0.5404 0.6998 0.7045 -0.0066 -0.0126 0.0092  1342 TYR A CG  
1141 C CD1 . TYR A 156 ? 0.4560 0.6186 0.6112 -0.0019 -0.0084 0.0104  1342 TYR A CD1 
1142 C CD2 . TYR A 156 ? 0.5246 0.6909 0.7043 -0.0075 -0.0150 0.0188  1342 TYR A CD2 
1143 C CE1 . TYR A 156 ? 0.2694 0.4418 0.4287 0.0020  -0.0060 0.0210  1342 TYR A CE1 
1144 C CE2 . TYR A 156 ? 0.3973 0.5746 0.5825 -0.0052 -0.0118 0.0298  1342 TYR A CE2 
1145 C CZ  . TYR A 156 ? 0.4734 0.6536 0.6471 -0.0003 -0.0070 0.0310  1342 TYR A CZ  
1146 O OH  . TYR A 156 ? 0.5044 0.6958 0.6812 0.0018  -0.0031 0.0423  1342 TYR A OH  
1147 N N   . PHE A 157 ? 0.4826 0.6077 0.5953 -0.0179 -0.0084 -0.0217 1343 PHE A N   
1148 C CA  . PHE A 157 ? 0.3663 0.4810 0.4644 -0.0254 -0.0066 -0.0313 1343 PHE A CA  
1149 C C   . PHE A 157 ? 0.5285 0.6497 0.6303 -0.0287 -0.0032 -0.0394 1343 PHE A C   
1150 O O   . PHE A 157 ? 0.5415 0.6671 0.6435 -0.0249 -0.0014 -0.0388 1343 PHE A O   
1151 C CB  . PHE A 157 ? 0.3200 0.4206 0.3946 -0.0261 -0.0058 -0.0314 1343 PHE A CB  
1152 C CG  . PHE A 157 ? 0.5364 0.6334 0.6088 -0.0194 -0.0103 -0.0244 1343 PHE A CG  
1153 C CD1 . PHE A 157 ? 0.4917 0.5849 0.5692 -0.0193 -0.0150 -0.0229 1343 PHE A CD1 
1154 C CD2 . PHE A 157 ? 0.4948 0.5930 0.5610 -0.0121 -0.0108 -0.0205 1343 PHE A CD2 
1155 C CE1 . PHE A 157 ? 0.6275 0.7193 0.7055 -0.0126 -0.0198 -0.0182 1343 PHE A CE1 
1156 C CE2 . PHE A 157 ? 0.4201 0.5183 0.4863 -0.0049 -0.0153 -0.0161 1343 PHE A CE2 
1157 C CZ  . PHE A 157 ? 0.4658 0.5611 0.5385 -0.0054 -0.0197 -0.0153 1343 PHE A CZ  
1158 N N   . ALA A 158 ? 0.6074 0.7299 0.7119 -0.0352 -0.0026 -0.0487 1344 ALA A N   
1159 C CA  . ALA A 158 ? 0.5624 0.6932 0.6720 -0.0385 0.0004  -0.0595 1344 ALA A CA  
1160 C C   . ALA A 158 ? 0.4029 0.5263 0.4931 -0.0479 0.0067  -0.0668 1344 ALA A C   
1161 O O   . ALA A 158 ? 0.6215 0.7366 0.6994 -0.0546 0.0082  -0.0691 1344 ALA A O   
1162 C CB  . ALA A 158 ? 0.2827 0.4224 0.4084 -0.0395 -0.0033 -0.0672 1344 ALA A CB  
1163 N N   . VAL A 159 ? 0.4824 0.6073 0.5687 -0.0487 0.0101  -0.0702 1345 VAL A N   
1164 C CA  . VAL A 159 ? 0.6040 0.7215 0.6725 -0.0594 0.0160  -0.0767 1345 VAL A CA  
1165 C C   . VAL A 159 ? 0.6334 0.7655 0.7137 -0.0643 0.0203  -0.0904 1345 VAL A C   
1166 O O   . VAL A 159 ? 0.4610 0.6022 0.5551 -0.0572 0.0180  -0.0928 1345 VAL A O   
1167 C CB  . VAL A 159 ? 0.5613 0.6656 0.6132 -0.0571 0.0152  -0.0699 1345 VAL A CB  
1168 C CG1 . VAL A 159 ? 0.6825 0.7788 0.7303 -0.0477 0.0095  -0.0577 1345 VAL A CG1 
1169 C CG2 . VAL A 159 ? 0.7853 0.8983 0.8471 -0.0517 0.0152  -0.0731 1345 VAL A CG2 
1170 N N   . GLY A 160 ? 0.4864 0.6213 0.5607 -0.0766 0.0265  -0.1002 1346 GLY A N   
1171 C CA  . GLY A 160 ? 0.6055 0.7578 0.6926 -0.0825 0.0313  -0.1158 1346 GLY A CA  
1172 C C   . GLY A 160 ? 0.6514 0.7978 0.7219 -0.0963 0.0393  -0.1199 1346 GLY A C   
1173 O O   . GLY A 160 ? 0.5415 0.6737 0.5894 -0.1066 0.0432  -0.1158 1346 GLY A O   
1174 N N   . TYR A 161 ? 0.6687 0.8244 0.7495 -0.0968 0.0408  -0.1279 1347 TYR A N   
1175 C CA  . TYR A 161 ? 0.6829 0.8340 0.7509 -0.1111 0.0477  -0.1322 1347 TYR A CA  
1176 C C   . TYR A 161 ? 0.8150 0.9902 0.8987 -0.1216 0.0558  -0.1508 1347 TYR A C   
1177 O O   . TYR A 161 ? 0.8920 1.0865 1.0008 -0.1140 0.0531  -0.1624 1347 TYR A O   
1178 C CB  . TYR A 161 ? 0.7206 0.8653 0.7900 -0.1041 0.0430  -0.1292 1347 TYR A CB  
1179 C CG  . TYR A 161 ? 0.6482 0.7734 0.7043 -0.0920 0.0350  -0.1129 1347 TYR A CG  
1180 C CD1 . TYR A 161 ? 0.7109 0.8129 0.7403 -0.0977 0.0339  -0.1033 1347 TYR A CD1 
1181 C CD2 . TYR A 161 ? 0.6263 0.7566 0.6960 -0.0750 0.0280  -0.1077 1347 TYR A CD2 
1182 C CE1 . TYR A 161 ? 0.5621 0.6495 0.5813 -0.0855 0.0260  -0.0909 1347 TYR A CE1 
1183 C CE2 . TYR A 161 ? 0.5902 0.7071 0.6492 -0.0643 0.0220  -0.0941 1347 TYR A CE2 
1184 C CZ  . TYR A 161 ? 0.6466 0.7436 0.6816 -0.0690 0.0209  -0.0866 1347 TYR A CZ  
1185 O OH  . TYR A 161 ? 0.6151 0.7014 0.6410 -0.0573 0.0144  -0.0753 1347 TYR A OH  
1186 N N   . TYR A 162 ? 0.7645 0.9387 0.8327 -0.1391 0.0655  -0.1544 1348 TYR A N   
1187 C CA  . TYR A 162 ? 0.7213 0.9219 0.8040 -0.1505 0.0749  -0.1730 1348 TYR A CA  
1188 C C   . TYR A 162 ? 0.9498 1.1457 1.0161 -0.1715 0.0853  -0.1751 1348 TYR A C   
1189 O O   . TYR A 162 ? 1.1864 1.3559 1.2226 -0.1803 0.0864  -0.1619 1348 TYR A O   
1190 C CB  . TYR A 162 ? 0.5965 0.8071 0.6790 -0.1519 0.0778  -0.1778 1348 TYR A CB  
1191 C CG  . TYR A 162 ? 0.6764 0.8896 0.7746 -0.1328 0.0664  -0.1750 1348 TYR A CG  
1192 C CD1 . TYR A 162 ? 0.6405 0.8752 0.7684 -0.1215 0.0606  -0.1879 1348 TYR A CD1 
1193 C CD2 . TYR A 162 ? 0.6045 0.7974 0.6875 -0.1264 0.0606  -0.1598 1348 TYR A CD2 
1194 C CE1 . TYR A 162 ? 0.5583 0.7924 0.6983 -0.1059 0.0494  -0.1844 1348 TYR A CE1 
1195 C CE2 . TYR A 162 ? 0.4957 0.6909 0.5936 -0.1111 0.0505  -0.1567 1348 TYR A CE2 
1196 C CZ  . TYR A 162 ? 0.7479 0.9628 0.8733 -0.1015 0.0450  -0.1683 1348 TYR A CZ  
1197 O OH  . TYR A 162 ? 0.7350 0.9493 0.8736 -0.0875 0.0338  -0.1641 1348 TYR A OH  
1198 N N   . GLY A 163 ? 0.8588 1.0803 0.9452 -0.1798 0.0924  -0.1926 1349 GLY A N   
1199 C CA  . GLY A 163 ? 1.0175 1.2389 1.0936 -0.2015 0.1029  -0.1963 1349 GLY A CA  
1200 C C   . GLY A 163 ? 0.9283 1.1538 1.0232 -0.1961 0.0975  -0.2017 1349 GLY A C   
1201 O O   . GLY A 163 ? 0.9885 1.2068 1.0925 -0.1765 0.0856  -0.1965 1349 GLY A O   
1202 N N   . GLN A 164 ? 0.9620 1.1995 1.0626 -0.2137 0.1064  -0.2122 1350 GLN A N   
1203 C CA  . GLN A 164 ? 1.0214 1.2638 1.1419 -0.2084 0.1007  -0.2193 1350 GLN A CA  
1204 C C   . GLN A 164 ? 1.0914 1.2989 1.1870 -0.2108 0.0943  -0.2023 1350 GLN A C   
1205 O O   . GLN A 164 ? 1.1063 1.3117 1.2130 -0.2065 0.0881  -0.2055 1350 GLN A O   
1206 C CB  . GLN A 164 ? 0.9666 1.2413 1.1106 -0.2250 0.1119  -0.2410 1350 GLN A CB  
1207 C CG  . GLN A 164 ? 0.8793 1.1822 1.0628 -0.2090 0.1054  -0.2611 1350 GLN A CG  
1208 C CD  . GLN A 164 ? 1.0312 1.3619 1.2327 -0.2018 0.1074  -0.2753 1350 GLN A CD  
1209 O OE1 . GLN A 164 ? 0.9124 1.2461 1.0992 -0.2115 0.1162  -0.2725 1350 GLN A OE1 
1210 N NE2 . GLN A 164 ? 0.9568 1.3065 1.1891 -0.1839 0.0979  -0.2912 1350 GLN A NE2 
1211 N N   . GLY A 165 ? 1.0486 1.2277 1.1100 -0.2166 0.0942  -0.1849 1351 GLY A N   
1212 C CA  . GLY A 165 ? 1.1766 1.3208 1.2125 -0.2176 0.0859  -0.1695 1351 GLY A CA  
1213 C C   . GLY A 165 ? 1.1925 1.3306 1.2400 -0.1916 0.0714  -0.1650 1351 GLY A C   
1214 O O   . GLY A 165 ? 1.2327 1.3558 1.2764 -0.1879 0.0633  -0.1613 1351 GLY A O   
1215 N N   . PHE A 166 ? 1.1494 1.2987 1.2099 -0.1737 0.0679  -0.1652 1352 PHE A N   
1216 C CA  . PHE A 166 ? 1.0915 1.2362 1.1612 -0.1493 0.0555  -0.1600 1352 PHE A CA  
1217 C C   . PHE A 166 ? 0.9424 1.1030 1.0392 -0.1392 0.0507  -0.1727 1352 PHE A C   
1218 O O   . PHE A 166 ? 0.6322 0.8177 0.7522 -0.1455 0.0564  -0.1900 1352 PHE A O   
1219 C CB  . PHE A 166 ? 1.0028 1.1534 1.0772 -0.1356 0.0532  -0.1555 1352 PHE A CB  
1220 C CG  . PHE A 166 ? 0.8337 0.9669 0.8823 -0.1420 0.0554  -0.1430 1352 PHE A CG  
1221 C CD1 . PHE A 166 ? 0.7519 0.8562 0.7740 -0.1404 0.0492  -0.1281 1352 PHE A CD1 
1222 C CD2 . PHE A 166 ? 0.8227 0.9681 0.8735 -0.1484 0.0624  -0.1475 1352 PHE A CD2 
1223 C CE1 . PHE A 166 ? 0.8299 0.9169 0.8283 -0.1451 0.0496  -0.1181 1352 PHE A CE1 
1224 C CE2 . PHE A 166 ? 0.8899 1.0178 0.9165 -0.1531 0.0633  -0.1368 1352 PHE A CE2 
1225 C CZ  . PHE A 166 ? 1.0001 1.0983 1.0005 -0.1515 0.0568  -0.1222 1352 PHE A CZ  
1226 N N   . PRO A 167 ? 0.9145 1.0615 1.0086 -0.1212 0.0393  -0.1648 1353 PRO A N   
1227 C CA  . PRO A 167 ? 0.8730 1.0299 0.9888 -0.1079 0.0322  -0.1751 1353 PRO A CA  
1228 C C   . PRO A 167 ? 0.9919 1.1705 1.1314 -0.0957 0.0311  -0.1850 1353 PRO A C   
1229 O O   . PRO A 167 ? 1.1059 1.2876 1.2426 -0.0941 0.0335  -0.1798 1353 PRO A O   
1230 C CB  . PRO A 167 ? 0.9685 1.1030 1.0684 -0.0906 0.0208  -0.1608 1353 PRO A CB  
1231 C CG  . PRO A 167 ? 0.7907 0.9037 0.8616 -0.0969 0.0218  -0.1445 1353 PRO A CG  
1232 C CD  . PRO A 167 ? 0.7430 0.8603 0.8082 -0.1196 0.0332  -0.1480 1353 PRO A CD  
1233 N N   . SER A 168 ? 0.9500 1.1417 1.1122 -0.0869 0.0259  -0.1995 1354 SER A N   
1234 C CA  . SER A 168 ? 1.0040 1.2143 1.1885 -0.0754 0.0225  -0.2113 1354 SER A CA  
1235 C C   . SER A 168 ? 1.0027 1.2023 1.1784 -0.0583 0.0155  -0.1966 1354 SER A C   
1236 O O   . SER A 168 ? 1.0722 1.2822 1.2572 -0.0549 0.0150  -0.1998 1354 SER A O   
1237 C CB  . SER A 168 ? 0.9855 1.2056 1.1921 -0.0660 0.0149  -0.2284 1354 SER A CB  
1238 O OG  . SER A 168 ? 1.0761 1.3114 1.2966 -0.0830 0.0221  -0.2446 1354 SER A OG  
1239 N N   . PHE A 169 ? 0.9351 1.1147 1.0933 -0.0478 0.0097  -0.1810 1355 PHE A N   
1240 C CA  . PHE A 169 ? 0.9765 1.1476 1.1263 -0.0331 0.0044  -0.1663 1355 PHE A CA  
1241 C C   . PHE A 169 ? 0.8778 1.0478 1.0183 -0.0413 0.0105  -0.1561 1355 PHE A C   
1242 O O   . PHE A 169 ? 0.7231 0.8949 0.8668 -0.0331 0.0074  -0.1504 1355 PHE A O   
1243 C CB  . PHE A 169 ? 1.0651 1.2189 1.1992 -0.0194 -0.0025 -0.1535 1355 PHE A CB  
1244 C CG  . PHE A 169 ? 1.2589 1.3972 1.3703 -0.0257 0.0001  -0.1399 1355 PHE A CG  
1245 C CD1 . PHE A 169 ? 1.3126 1.4460 1.4172 -0.0421 0.0047  -0.1439 1355 PHE A CD1 
1246 C CD2 . PHE A 169 ? 1.2024 1.3304 1.2988 -0.0152 -0.0028 -0.1236 1355 PHE A CD2 
1247 C CE1 . PHE A 169 ? 1.2087 1.3238 1.2899 -0.0471 0.0045  -0.1317 1355 PHE A CE1 
1248 C CE2 . PHE A 169 ? 1.0968 1.2102 1.1728 -0.0192 -0.0026 -0.1131 1355 PHE A CE2 
1249 C CZ  . PHE A 169 ? 1.0676 1.1727 1.1349 -0.0346 0.0002  -0.1171 1355 PHE A CZ  
1250 N N   . LEU A 170 ? 0.8577 1.0228 0.9854 -0.0575 0.0181  -0.1536 1356 LEU A N   
1251 C CA  . LEU A 170 ? 0.7733 0.9352 0.8901 -0.0652 0.0232  -0.1449 1356 LEU A CA  
1252 C C   . LEU A 170 ? 0.7673 0.9464 0.8950 -0.0787 0.0311  -0.1579 1356 LEU A C   
1253 O O   . LEU A 170 ? 0.8013 0.9811 0.9251 -0.0811 0.0333  -0.1534 1356 LEU A O   
1254 C CB  . LEU A 170 ? 0.7555 0.8970 0.8459 -0.0738 0.0255  -0.1328 1356 LEU A CB  
1255 C CG  . LEU A 170 ? 0.8135 0.9365 0.8872 -0.0618 0.0182  -0.1179 1356 LEU A CG  
1256 C CD1 . LEU A 170 ? 0.8994 1.0026 0.9473 -0.0721 0.0197  -0.1085 1356 LEU A CD1 
1257 C CD2 . LEU A 170 ? 0.8593 0.9852 0.9384 -0.0454 0.0133  -0.1089 1356 LEU A CD2 
1258 N N   . ARG A 171 ? 0.9651 1.1591 1.1067 -0.0876 0.0353  -0.1748 1357 ARG A N   
1259 C CA  . ARG A 171 ? 1.0950 1.3089 1.2461 -0.1031 0.0450  -0.1894 1357 ARG A CA  
1260 C C   . ARG A 171 ? 0.9015 1.1294 1.0651 -0.0973 0.0435  -0.1947 1357 ARG A C   
1261 O O   . ARG A 171 ? 0.8156 1.0532 0.9983 -0.0835 0.0351  -0.2026 1357 ARG A O   
1262 C CB  . ARG A 171 ? 1.2249 1.4591 1.3979 -0.1088 0.0476  -0.2103 1357 ARG A CB  
1263 C CG  . ARG A 171 ? 1.7272 1.9699 1.9230 -0.0894 0.0360  -0.2202 1357 ARG A CG  
1264 C CD  . ARG A 171 ? 1.7319 2.0015 1.9558 -0.0930 0.0374  -0.2459 1357 ARG A CD  
1265 N NE  . ARG A 171 ? 1.6980 1.9872 1.9399 -0.0871 0.0347  -0.2591 1357 ARG A NE  
1266 C CZ  . ARG A 171 ? 1.5004 1.8188 1.7652 -0.0941 0.0391  -0.2829 1357 ARG A CZ  
1267 N NH1 . ARG A 171 ? 1.4547 1.7873 1.7283 -0.1089 0.0480  -0.2956 1357 ARG A NH1 
1268 N NH2 . ARG A 171 ? 1.3293 1.6631 1.6086 -0.0864 0.0341  -0.2944 1357 ARG A NH2 
1269 N N   . ASN A 172 ? 0.8650 1.0928 1.0169 -0.1078 0.0504  -0.1914 1358 ASN A N   
1270 C CA  . ASN A 172 ? 0.8644 1.1056 1.0275 -0.1033 0.0486  -0.1975 1358 ASN A CA  
1271 C C   . ASN A 172 ? 0.7196 0.9539 0.8906 -0.0840 0.0357  -0.1894 1358 ASN A C   
1272 O O   . ASN A 172 ? 0.6006 0.8490 0.7911 -0.0757 0.0292  -0.2008 1358 ASN A O   
1273 C CB  . ASN A 172 ? 0.8660 1.1376 1.0537 -0.1075 0.0519  -0.2224 1358 ASN A CB  
1274 C CG  . ASN A 172 ? 0.9342 1.2176 1.1153 -0.1288 0.0667  -0.2314 1358 ASN A CG  
1275 O OD1 . ASN A 172 ? 1.1622 1.4340 1.3284 -0.1407 0.0729  -0.2250 1358 ASN A OD1 
1276 N ND2 . ASN A 172 ? 0.8904 1.1974 1.0823 -0.1342 0.0720  -0.2469 1358 ASN A ND2 
1277 N N   . LYS A 173 ? 0.7187 0.9314 0.8740 -0.0774 0.0317  -0.1702 1359 LYS A N   
1278 C CA  . LYS A 173 ? 0.4884 0.6938 0.6484 -0.0614 0.0213  -0.1600 1359 LYS A CA  
1279 C C   . LYS A 173 ? 0.5502 0.7399 0.6939 -0.0607 0.0209  -0.1418 1359 LYS A C   
1280 O O   . LYS A 173 ? 0.6772 0.8558 0.8016 -0.0702 0.0270  -0.1347 1359 LYS A O   
1281 C CB  . LYS A 173 ? 0.6799 0.8778 0.8401 -0.0512 0.0160  -0.1559 1359 LYS A CB  
1282 C CG  . LYS A 173 ? 0.7584 0.9697 0.9393 -0.0443 0.0102  -0.1727 1359 LYS A CG  
1283 C CD  . LYS A 173 ? 0.8433 1.0455 1.0208 -0.0356 0.0060  -0.1695 1359 LYS A CD  
1284 C CE  . LYS A 173 ? 0.8945 1.1085 1.0922 -0.0280 -0.0010 -0.1880 1359 LYS A CE  
1285 N NZ  . LYS A 173 ? 0.9469 1.1481 1.1395 -0.0139 -0.0089 -0.1815 1359 LYS A NZ  
1286 N N   . VAL A 174 ? 0.5138 0.7019 0.6656 -0.0496 0.0126  -0.1348 1360 VAL A N   
1287 C CA  . VAL A 174 ? 0.4395 0.6159 0.5820 -0.0470 0.0104  -0.1188 1360 VAL A CA  
1288 C C   . VAL A 174 ? 0.6071 0.7748 0.7481 -0.0351 0.0047  -0.1045 1360 VAL A C   
1289 O O   . VAL A 174 ? 0.5658 0.7373 0.7181 -0.0262 -0.0016 -0.1065 1360 VAL A O   
1290 C CB  . VAL A 174 ? 0.4200 0.6035 0.5754 -0.0452 0.0052  -0.1226 1360 VAL A CB  
1291 C CG1 . VAL A 174 ? 0.5220 0.6944 0.6671 -0.0463 0.0047  -0.1091 1360 VAL A CG1 
1292 C CG2 . VAL A 174 ? 0.3715 0.5706 0.5348 -0.0532 0.0091  -0.1417 1360 VAL A CG2 
1293 N N   . PHE A 175 ? 0.5194 0.6754 0.6454 -0.0348 0.0065  -0.0907 1361 PHE A N   
1294 C CA  . PHE A 175 ? 0.5585 0.7093 0.6823 -0.0243 0.0026  -0.0773 1361 PHE A CA  
1295 C C   . PHE A 175 ? 0.5442 0.6906 0.6661 -0.0234 0.0011  -0.0649 1361 PHE A C   
1296 O O   . PHE A 175 ? 0.5974 0.7379 0.7101 -0.0301 0.0036  -0.0642 1361 PHE A O   
1297 C CB  . PHE A 175 ? 0.5865 0.7295 0.6949 -0.0228 0.0053  -0.0738 1361 PHE A CB  
1298 C CG  . PHE A 175 ? 0.5713 0.7179 0.6827 -0.0225 0.0057  -0.0850 1361 PHE A CG  
1299 C CD1 . PHE A 175 ? 0.6274 0.7772 0.7386 -0.0339 0.0105  -0.0980 1361 PHE A CD1 
1300 C CD2 . PHE A 175 ? 0.6859 0.8331 0.8003 -0.0111 0.0014  -0.0830 1361 PHE A CD2 
1301 C CE1 . PHE A 175 ? 0.7969 0.9518 0.9142 -0.0341 0.0106  -0.1099 1361 PHE A CE1 
1302 C CE2 . PHE A 175 ? 0.6681 0.8181 0.7867 -0.0096 0.0004  -0.0949 1361 PHE A CE2 
1303 C CZ  . PHE A 175 ? 0.5640 0.7185 0.6856 -0.0213 0.0048  -0.1088 1361 PHE A CZ  
1304 N N   . ILE A 176 ? 0.3831 0.5313 0.5126 -0.0153 -0.0033 -0.0550 1362 ILE A N   
1305 C CA  . ILE A 176 ? 0.3655 0.5113 0.4945 -0.0136 -0.0044 -0.0422 1362 ILE A CA  
1306 C C   . ILE A 176 ? 0.4464 0.5896 0.5641 -0.0075 -0.0023 -0.0326 1362 ILE A C   
1307 O O   . ILE A 176 ? 0.5536 0.6993 0.6700 -0.0005 -0.0024 -0.0301 1362 ILE A O   
1308 C CB  . ILE A 176 ? 0.3487 0.4989 0.4932 -0.0103 -0.0102 -0.0365 1362 ILE A CB  
1309 C CG1 . ILE A 176 ? 0.4284 0.5815 0.5843 -0.0141 -0.0146 -0.0483 1362 ILE A CG1 
1310 C CG2 . ILE A 176 ? 0.4460 0.5955 0.5939 -0.0106 -0.0114 -0.0251 1362 ILE A CG2 
1311 C CD1 . ILE A 176 ? 0.4643 0.6161 0.6196 -0.0211 -0.0138 -0.0537 1362 ILE A CD1 
1312 N N   . TYR A 177 ? 0.3624 0.5001 0.4713 -0.0093 -0.0013 -0.0284 1363 TYR A N   
1313 C CA  . TYR A 177 ? 0.4017 0.5372 0.4994 -0.0031 -0.0006 -0.0219 1363 TYR A CA  
1314 C C   . TYR A 177 ? 0.3958 0.5376 0.5020 0.0007  -0.0020 -0.0115 1363 TYR A C   
1315 O O   . TYR A 177 ? 0.4837 0.6242 0.5970 -0.0036 -0.0040 -0.0106 1363 TYR A O   
1316 C CB  . TYR A 177 ? 0.5134 0.6356 0.5925 -0.0076 -0.0003 -0.0269 1363 TYR A CB  
1317 C CG  . TYR A 177 ? 0.8308 0.9473 0.8991 -0.0104 0.0014  -0.0353 1363 TYR A CG  
1318 C CD1 . TYR A 177 ? 0.8366 0.9553 0.9104 -0.0184 0.0040  -0.0451 1363 TYR A CD1 
1319 C CD2 . TYR A 177 ? 0.7079 0.8172 0.7614 -0.0052 -0.0003 -0.0345 1363 TYR A CD2 
1320 C CE1 . TYR A 177 ? 0.6329 0.7481 0.6996 -0.0223 0.0059  -0.0535 1363 TYR A CE1 
1321 C CE2 . TYR A 177 ? 0.6879 0.7909 0.7329 -0.0088 0.0004  -0.0422 1363 TYR A CE2 
1322 C CZ  . TYR A 177 ? 0.6438 0.7503 0.6963 -0.0178 0.0039  -0.0514 1363 TYR A CZ  
1323 O OH  . TYR A 177 ? 0.6399 0.7423 0.6868 -0.0220 0.0047  -0.0595 1363 TYR A OH  
1324 N N   . ARG A 178 ? 0.3725 0.5221 0.4783 0.0089  -0.0009 -0.0042 1364 ARG A N   
1325 C CA  . ARG A 178 ? 0.4307 0.5901 0.5456 0.0121  -0.0008 0.0052  1364 ARG A CA  
1326 C C   . ARG A 178 ? 0.5102 0.6654 0.6140 0.0156  -0.0024 0.0035  1364 ARG A C   
1327 O O   . ARG A 178 ? 0.7097 0.8613 0.7992 0.0213  -0.0028 0.0006  1364 ARG A O   
1328 C CB  . ARG A 178 ? 0.3910 0.5630 0.5098 0.0189  0.0021  0.0133  1364 ARG A CB  
1329 C CG  . ARG A 178 ? 0.3899 0.5761 0.5194 0.0210  0.0041  0.0234  1364 ARG A CG  
1330 C CD  . ARG A 178 ? 0.4654 0.6624 0.5979 0.0244  0.0078  0.0322  1364 ARG A CD  
1331 N NE  . ARG A 178 ? 0.4789 0.6930 0.6136 0.0298  0.0123  0.0392  1364 ARG A NE  
1332 C CZ  . ARG A 178 ? 0.6202 0.8477 0.7703 0.0256  0.0149  0.0487  1364 ARG A CZ  
1333 N NH1 . ARG A 178 ? 0.4187 0.6412 0.5822 0.0164  0.0118  0.0530  1364 ARG A NH1 
1334 N NH2 . ARG A 178 ? 0.5774 0.8243 0.7302 0.0306  0.0201  0.0532  1364 ARG A NH2 
1335 N N   . GLY A 179 ? 0.4233 0.5772 0.5333 0.0129  -0.0052 0.0046  1365 GLY A N   
1336 C CA  . GLY A 179 ? 0.5737 0.7211 0.6724 0.0171  -0.0091 0.0016  1365 GLY A CA  
1337 C C   . GLY A 179 ? 0.4829 0.6461 0.5851 0.0271  -0.0081 0.0058  1365 GLY A C   
1338 O O   . GLY A 179 ? 0.6308 0.8122 0.7488 0.0285  -0.0039 0.0134  1365 GLY A O   
1339 N N   . LYS A 180 ? 0.4797 0.6361 0.5664 0.0339  -0.0126 0.0007  1366 LYS A N   
1340 C CA  . LYS A 180 ? 0.5343 0.7076 0.6251 0.0447  -0.0130 0.0020  1366 LYS A CA  
1341 C C   . LYS A 180 ? 0.3973 0.5798 0.5050 0.0439  -0.0151 0.0034  1366 LYS A C   
1342 O O   . LYS A 180 ? 0.5673 0.7397 0.6802 0.0361  -0.0174 0.0032  1366 LYS A O   
1343 C CB  . LYS A 180 ? 0.6373 0.7977 0.7063 0.0529  -0.0203 -0.0058 1366 LYS A CB  
1344 C CG  . LYS A 180 ? 0.7977 0.9720 0.8626 0.0640  -0.0181 -0.0054 1366 LYS A CG  
1345 C CD  . LYS A 180 ? 0.9365 1.0900 0.9784 0.0656  -0.0230 -0.0113 1366 LYS A CD  
1346 C CE  . LYS A 180 ? 1.1782 1.3425 1.2128 0.0797  -0.0241 -0.0130 1366 LYS A CE  
1347 N NZ  . LYS A 180 ? 0.8104 1.0060 0.8599 0.0884  -0.0170 -0.0075 1366 LYS A NZ  
1348 N N   . GLU A 181 ? 0.6997 0.9033 0.8173 0.0523  -0.0143 0.0042  1367 GLU A N   
1349 C CA  . GLU A 181 ? 0.7281 0.9450 0.8665 0.0516  -0.0158 0.0051  1367 GLU A CA  
1350 C C   . GLU A 181 ? 0.5707 0.7647 0.6986 0.0521  -0.0271 -0.0039 1367 GLU A C   
1351 O O   . GLU A 181 ? 0.7540 0.9339 0.8614 0.0593  -0.0345 -0.0119 1367 GLU A O   
1352 C CB  . GLU A 181 ? 0.8122 1.0581 0.9609 0.0618  -0.0129 0.0046  1367 GLU A CB  
1353 C CG  . GLU A 181 ? 0.7217 0.9958 0.8993 0.0570  -0.0053 0.0129  1367 GLU A CG  
1354 C CD  . GLU A 181 ? 1.0104 1.3175 1.1977 0.0665  -0.0002 0.0117  1367 GLU A CD  
1355 O OE1 . GLU A 181 ? 1.0409 1.3489 1.2189 0.0786  -0.0074 0.0005  1367 GLU A OE1 
1356 O OE2 . GLU A 181 ? 0.9272 1.2593 1.1304 0.0619  0.0105  0.0216  1367 GLU A OE2 
1357 N N   . TYR A 182 ? 0.5332 0.7213 0.6732 0.0446  -0.0294 -0.0027 1368 TYR A N   
1358 C CA  . TYR A 182 ? 0.3747 0.5386 0.5032 0.0446  -0.0403 -0.0107 1368 TYR A CA  
1359 C C   . TYR A 182 ? 0.3299 0.4629 0.4276 0.0413  -0.0442 -0.0152 1368 TYR A C   
1360 O O   . TYR A 182 ? 0.6256 0.7352 0.7057 0.0423  -0.0537 -0.0220 1368 TYR A O   
1361 C CB  . TYR A 182 ? 0.3895 0.5591 0.5199 0.0560  -0.0490 -0.0189 1368 TYR A CB  
1362 C CG  . TYR A 182 ? 0.5923 0.7924 0.7558 0.0574  -0.0458 -0.0162 1368 TYR A CG  
1363 C CD1 . TYR A 182 ? 0.3843 0.5830 0.5660 0.0510  -0.0483 -0.0144 1368 TYR A CD1 
1364 C CD2 . TYR A 182 ? 0.5208 0.7529 0.6980 0.0650  -0.0401 -0.0156 1368 TYR A CD2 
1365 C CE1 . TYR A 182 ? 0.6315 0.8578 0.8449 0.0507  -0.0456 -0.0116 1368 TYR A CE1 
1366 C CE2 . TYR A 182 ? 0.3027 0.5655 0.5118 0.0642  -0.0358 -0.0129 1368 TYR A CE2 
1367 C CZ  . TYR A 182 ? 0.6342 0.8933 0.8618 0.0564  -0.0387 -0.0106 1368 TYR A CZ  
1368 O OH  . TYR A 182 ? 0.6117 0.9001 0.8723 0.0538  -0.0349 -0.0076 1368 TYR A OH  
1369 N N   . GLU A 183 ? 0.6197 0.7519 0.7098 0.0370  -0.0371 -0.0117 1369 GLU A N   
1370 C CA  . GLU A 183 ? 0.4807 0.5862 0.5452 0.0307  -0.0390 -0.0155 1369 GLU A CA  
1371 C C   . GLU A 183 ? 0.5374 0.6311 0.6037 0.0200  -0.0384 -0.0155 1369 GLU A C   
1372 O O   . GLU A 183 ? 0.5386 0.6454 0.6242 0.0151  -0.0327 -0.0108 1369 GLU A O   
1373 C CB  . GLU A 183 ? 0.5305 0.6398 0.5885 0.0295  -0.0322 -0.0135 1369 GLU A CB  
1374 C CG  . GLU A 183 ? 0.4923 0.5751 0.5222 0.0246  -0.0356 -0.0189 1369 GLU A CG  
1375 C CD  . GLU A 183 ? 0.7497 0.8366 0.7757 0.0236  -0.0298 -0.0181 1369 GLU A CD  
1376 O OE1 . GLU A 183 ? 0.6321 0.7401 0.6767 0.0256  -0.0229 -0.0132 1369 GLU A OE1 
1377 O OE2 . GLU A 183 ? 0.7528 0.8207 0.7572 0.0204  -0.0326 -0.0224 1369 GLU A OE2 
1378 N N   . ARG A 184 ? 0.8370 0.9041 0.8806 0.0169  -0.0452 -0.0212 1370 ARG A N   
1379 C CA  . ARG A 184 ? 0.7478 0.8012 0.7874 0.0079  -0.0457 -0.0229 1370 ARG A CA  
1380 C C   . ARG A 184 ? 0.7175 0.7560 0.7356 -0.0019 -0.0408 -0.0253 1370 ARG A C   
1381 O O   . ARG A 184 ? 0.6610 0.6903 0.6607 -0.0013 -0.0414 -0.0268 1370 ARG A O   
1382 C CB  . ARG A 184 ? 0.8677 0.8995 0.8925 0.0113  -0.0571 -0.0280 1370 ARG A CB  
1383 C CG  . ARG A 184 ? 0.8588 0.8885 0.8947 0.0081  -0.0594 -0.0285 1370 ARG A CG  
1384 C CD  . ARG A 184 ? 0.9266 0.9416 0.9564 0.0151  -0.0717 -0.0334 1370 ARG A CD  
1385 N NE  . ARG A 184 ? 1.0003 1.0263 1.0561 0.0156  -0.0736 -0.0324 1370 ARG A NE  
1386 C CZ  . ARG A 184 ? 0.8693 0.8841 0.9222 0.0097  -0.0748 -0.0339 1370 ARG A CZ  
1387 N NH1 . ARG A 184 ? 0.6970 0.6903 0.7213 0.0018  -0.0727 -0.0368 1370 ARG A NH1 
1388 N NH2 . ARG A 184 ? 0.9861 1.0122 1.0654 0.0118  -0.0783 -0.0330 1370 ARG A NH2 
1389 N N   . ARG A 185 ? 0.6141 0.6504 0.6345 -0.0109 -0.0368 -0.0267 1371 ARG A N   
1390 C CA  . ARG A 185 ? 0.5149 0.5419 0.5186 -0.0216 -0.0308 -0.0304 1371 ARG A CA  
1391 C C   . ARG A 185 ? 0.5864 0.5842 0.5544 -0.0271 -0.0346 -0.0340 1371 ARG A C   
1392 O O   . ARG A 185 ? 0.7056 0.6981 0.6600 -0.0341 -0.0299 -0.0357 1371 ARG A O   
1393 C CB  . ARG A 185 ? 0.4823 0.5145 0.4960 -0.0289 -0.0268 -0.0331 1371 ARG A CB  
1394 C CG  . ARG A 185 ? 0.6604 0.6875 0.6595 -0.0405 -0.0195 -0.0388 1371 ARG A CG  
1395 C CD  . ARG A 185 ? 0.5558 0.5929 0.5677 -0.0457 -0.0161 -0.0435 1371 ARG A CD  
1396 N NE  . ARG A 185 ? 0.8197 0.8453 0.8269 -0.0446 -0.0224 -0.0445 1371 ARG A NE  
1397 C CZ  . ARG A 185 ? 1.1843 1.1885 1.1638 -0.0514 -0.0232 -0.0485 1371 ARG A CZ  
1398 N NH1 . ARG A 185 ? 1.1704 1.1629 1.1248 -0.0614 -0.0174 -0.0512 1371 ARG A NH1 
1399 N NH2 . ARG A 185 ? 1.1679 1.1613 1.1438 -0.0484 -0.0302 -0.0497 1371 ARG A NH2 
1400 N N   . GLU A 186 ? 0.4561 0.4333 0.4079 -0.0243 -0.0440 -0.0353 1372 GLU A N   
1401 C CA  . GLU A 186 ? 0.7825 0.7273 0.6964 -0.0302 -0.0493 -0.0379 1372 GLU A CA  
1402 C C   . GLU A 186 ? 0.8400 0.7808 0.7438 -0.0262 -0.0522 -0.0370 1372 GLU A C   
1403 O O   . GLU A 186 ? 0.9520 0.8758 0.8322 -0.0355 -0.0508 -0.0381 1372 GLU A O   
1404 C CB  . GLU A 186 ? 0.9023 0.8237 0.8001 -0.0249 -0.0619 -0.0399 1372 GLU A CB  
1405 C CG  . GLU A 186 ? 0.9069 0.8282 0.8115 -0.0276 -0.0614 -0.0416 1372 GLU A CG  
1406 C CD  . GLU A 186 ? 1.0161 0.9633 0.9584 -0.0173 -0.0630 -0.0399 1372 GLU A CD  
1407 O OE1 . GLU A 186 ? 1.3589 1.3181 1.3159 -0.0070 -0.0671 -0.0382 1372 GLU A OE1 
1408 O OE2 . GLU A 186 ? 1.0225 0.9787 0.9799 -0.0197 -0.0604 -0.0405 1372 GLU A OE2 
1409 N N   . ASP A 187 ? 0.8589 0.8160 0.7808 -0.0125 -0.0564 -0.0355 1373 ASP A N   
1410 C CA  . ASP A 187 ? 0.7521 0.7084 0.6668 -0.0055 -0.0604 -0.0357 1373 ASP A CA  
1411 C C   . ASP A 187 ? 0.7552 0.7257 0.6772 -0.0105 -0.0503 -0.0342 1373 ASP A C   
1412 O O   . ASP A 187 ? 0.6573 0.6144 0.5611 -0.0124 -0.0530 -0.0355 1373 ASP A O   
1413 C CB  . ASP A 187 ? 0.7030 0.6805 0.6394 0.0106  -0.0651 -0.0351 1373 ASP A CB  
1414 C CG  . ASP A 187 ? 1.0277 0.9942 0.9609 0.0176  -0.0764 -0.0385 1373 ASP A CG  
1415 O OD1 . ASP A 187 ? 0.9602 0.8935 0.8632 0.0146  -0.0865 -0.0422 1373 ASP A OD1 
1416 O OD2 . ASP A 187 ? 1.0454 1.0357 1.0062 0.0257  -0.0758 -0.0376 1373 ASP A OD2 
1417 N N   . PHE A 188 ? 0.5271 0.5235 0.4762 -0.0121 -0.0400 -0.0319 1374 PHE A N   
1418 C CA  . PHE A 188 ? 0.6337 0.6455 0.5936 -0.0151 -0.0313 -0.0315 1374 PHE A CA  
1419 C C   . PHE A 188 ? 0.7070 0.7032 0.6487 -0.0297 -0.0272 -0.0354 1374 PHE A C   
1420 O O   . PHE A 188 ? 0.7821 0.7745 0.7156 -0.0325 -0.0260 -0.0371 1374 PHE A O   
1421 C CB  . PHE A 188 ? 0.4967 0.5342 0.4865 -0.0144 -0.0239 -0.0290 1374 PHE A CB  
1422 C CG  . PHE A 188 ? 0.7038 0.7553 0.7046 -0.0178 -0.0160 -0.0302 1374 PHE A CG  
1423 C CD1 . PHE A 188 ? 0.6259 0.6930 0.6381 -0.0084 -0.0147 -0.0273 1374 PHE A CD1 
1424 C CD2 . PHE A 188 ? 0.6449 0.6953 0.6453 -0.0297 -0.0101 -0.0353 1374 PHE A CD2 
1425 C CE1 . PHE A 188 ? 0.4709 0.5490 0.4930 -0.0104 -0.0090 -0.0295 1374 PHE A CE1 
1426 C CE2 . PHE A 188 ? 0.5676 0.6316 0.5802 -0.0318 -0.0042 -0.0385 1374 PHE A CE2 
1427 C CZ  . PHE A 188 ? 0.4133 0.4896 0.4363 -0.0219 -0.0043 -0.0356 1374 PHE A CZ  
1428 N N   . GLN A 189 ? 0.8849 0.8730 0.8207 -0.0394 -0.0248 -0.0373 1375 GLN A N   
1429 C CA  . GLN A 189 ? 0.8704 0.8483 0.7908 -0.0552 -0.0184 -0.0415 1375 GLN A CA  
1430 C C   . GLN A 189 ? 0.9074 0.8563 0.7947 -0.0613 -0.0242 -0.0418 1375 GLN A C   
1431 O O   . GLN A 189 ? 0.9905 0.9356 0.8691 -0.0726 -0.0188 -0.0445 1375 GLN A O   
1432 C CB  . GLN A 189 ? 0.7372 0.7106 0.6538 -0.0630 -0.0158 -0.0438 1375 GLN A CB  
1433 C CG  . GLN A 189 ? 0.9949 0.9579 0.8920 -0.0803 -0.0084 -0.0485 1375 GLN A CG  
1434 C CD  . GLN A 189 ? 1.1288 1.1068 1.0387 -0.0862 -0.0009 -0.0534 1375 GLN A CD  
1435 O OE1 . GLN A 189 ? 0.9924 0.9738 0.9124 -0.0793 -0.0048 -0.0523 1375 GLN A OE1 
1436 N NE2 . GLN A 189 ? 1.2547 1.2429 1.1658 -0.0986 0.0093  -0.0599 1375 GLN A NE2 
1437 N N   . MET A 190 ? 0.9460 0.8742 0.8158 -0.0538 -0.0361 -0.0396 1376 MET A N   
1438 C CA  . MET A 190 ? 0.9505 0.8452 0.7853 -0.0586 -0.0454 -0.0397 1376 MET A CA  
1439 C C   . MET A 190 ? 1.1121 1.0106 0.9488 -0.0547 -0.0472 -0.0399 1376 MET A C   
1440 O O   . MET A 190 ? 1.2323 1.1121 1.0481 -0.0662 -0.0478 -0.0407 1376 MET A O   
1441 C CB  . MET A 190 ? 1.0030 0.8781 0.8235 -0.0472 -0.0602 -0.0391 1376 MET A CB  
1442 C CG  . MET A 190 ? 0.9908 0.8226 0.7683 -0.0551 -0.0715 -0.0394 1376 MET A CG  
1443 S SD  . MET A 190 ? 1.8638 1.6741 1.6280 -0.0381 -0.0917 -0.0415 1376 MET A SD  
1444 C CE  . MET A 190 ? 1.3669 1.2043 1.1636 -0.0304 -0.0861 -0.0419 1376 MET A CE  
1445 N N   . GLN A 191 ? 0.9554 0.8782 0.8172 -0.0388 -0.0481 -0.0390 1377 GLN A N   
1446 C CA  . GLN A 191 ? 0.9489 0.8796 0.8160 -0.0321 -0.0496 -0.0397 1377 GLN A CA  
1447 C C   . GLN A 191 ? 0.9929 0.9343 0.8689 -0.0447 -0.0379 -0.0420 1377 GLN A C   
1448 O O   . GLN A 191 ? 1.0448 0.9757 0.9097 -0.0493 -0.0401 -0.0439 1377 GLN A O   
1449 C CB  . GLN A 191 ? 1.0939 1.0527 0.9874 -0.0139 -0.0497 -0.0380 1377 GLN A CB  
1450 C CG  . GLN A 191 ? 1.4694 1.4212 1.3530 0.0012  -0.0625 -0.0392 1377 GLN A CG  
1451 C CD  . GLN A 191 ? 1.4833 1.4666 1.3921 0.0170  -0.0592 -0.0378 1377 GLN A CD  
1452 O OE1 . GLN A 191 ? 1.3301 1.3366 1.2614 0.0215  -0.0529 -0.0348 1377 GLN A OE1 
1453 N NE2 . GLN A 191 ? 1.4065 1.3898 1.3105 0.0251  -0.0640 -0.0399 1377 GLN A NE2 
1454 N N   . LEU A 192 ? 0.8807 0.8427 0.7772 -0.0498 -0.0267 -0.0429 1378 LEU A N   
1455 C CA  . LEU A 192 ? 0.8603 0.8365 0.7692 -0.0605 -0.0159 -0.0475 1378 LEU A CA  
1456 C C   . LEU A 192 ? 0.9039 0.8603 0.7896 -0.0804 -0.0125 -0.0508 1378 LEU A C   
1457 O O   . LEU A 192 ? 1.0264 0.9872 0.9153 -0.0886 -0.0077 -0.0551 1378 LEU A O   
1458 C CB  . LEU A 192 ? 0.8610 0.8623 0.7963 -0.0594 -0.0077 -0.0485 1378 LEU A CB  
1459 C CG  . LEU A 192 ? 0.7751 0.7941 0.7265 -0.0698 0.0030  -0.0555 1378 LEU A CG  
1460 C CD1 . LEU A 192 ? 0.6266 0.6627 0.5963 -0.0648 0.0055  -0.0594 1378 LEU A CD1 
1461 C CD2 . LEU A 192 ? 0.7720 0.8061 0.7414 -0.0668 0.0058  -0.0552 1378 LEU A CD2 
1462 N N   . MET A 193 ? 1.0339 0.9697 0.8972 -0.0888 -0.0144 -0.0490 1379 MET A N   
1463 C CA  . MET A 193 ? 1.0142 0.9314 0.8533 -0.1093 -0.0098 -0.0511 1379 MET A CA  
1464 C C   . MET A 193 ? 1.0582 0.9528 0.8768 -0.1126 -0.0179 -0.0497 1379 MET A C   
1465 O O   . MET A 193 ? 1.0431 0.9274 0.8481 -0.1297 -0.0135 -0.0516 1379 MET A O   
1466 C CB  . MET A 193 ? 1.0384 0.9326 0.8523 -0.1144 -0.0133 -0.0482 1379 MET A CB  
1467 C CG  . MET A 193 ? 1.0910 0.9945 0.9058 -0.1283 -0.0011 -0.0522 1379 MET A CG  
1468 S SD  . MET A 193 ? 1.0714 1.0202 0.9312 -0.1238 0.0108  -0.0591 1379 MET A SD  
1469 C CE  . MET A 193 ? 0.9127 0.8689 0.7686 -0.1462 0.0242  -0.0670 1379 MET A CE  
1470 N N   . THR A 194 ? 1.0890 0.9765 0.9061 -0.0958 -0.0305 -0.0467 1380 THR A N   
1471 C CA  . THR A 194 ? 1.0398 0.9043 0.8373 -0.0959 -0.0414 -0.0459 1380 THR A CA  
1472 C C   . THR A 194 ? 1.1267 1.0094 0.9440 -0.0946 -0.0375 -0.0498 1380 THR A C   
1473 O O   . THR A 194 ? 1.0752 0.9399 0.8775 -0.1019 -0.0430 -0.0504 1380 THR A O   
1474 C CB  . THR A 194 ? 1.0503 0.9034 0.8403 -0.0766 -0.0571 -0.0435 1380 THR A CB  
1475 O OG1 . THR A 194 ? 0.8439 0.6642 0.6023 -0.0815 -0.0663 -0.0410 1380 THR A OG1 
1476 C CG2 . THR A 194 ? 1.0423 0.8848 0.8253 -0.0701 -0.0679 -0.0445 1380 THR A CG2 
1477 N N   . GLN A 195 ? 1.0267 0.9433 0.8771 -0.0852 -0.0291 -0.0525 1381 GLN A N   
1478 C CA  . GLN A 195 ? 0.8626 0.7954 0.7313 -0.0836 -0.0259 -0.0573 1381 GLN A CA  
1479 C C   . GLN A 195 ? 0.9701 0.9033 0.8375 -0.1058 -0.0157 -0.0626 1381 GLN A C   
1480 O O   . GLN A 195 ? 1.1405 1.0768 1.0145 -0.1100 -0.0152 -0.0673 1381 GLN A O   
1481 C CB  . GLN A 195 ? 1.0553 1.0217 0.9570 -0.0692 -0.0198 -0.0590 1381 GLN A CB  
1482 C CG  . GLN A 195 ? 1.3814 1.3526 1.2875 -0.0476 -0.0281 -0.0541 1381 GLN A CG  
1483 C CD  . GLN A 195 ? 1.5229 1.5243 1.4581 -0.0358 -0.0217 -0.0539 1381 GLN A CD  
1484 O OE1 . GLN A 195 ? 1.5960 1.6056 1.5370 -0.0217 -0.0250 -0.0491 1381 GLN A OE1 
1485 N NE2 . GLN A 195 ? 1.3566 1.3744 1.3098 -0.0420 -0.0132 -0.0594 1381 GLN A NE2 
1486 N N   . PHE A 196 ? 1.1182 1.0494 0.9776 -0.1201 -0.0073 -0.0626 1382 PHE A N   
1487 C CA  . PHE A 196 ? 1.1387 1.0722 0.9948 -0.1431 0.0042  -0.0680 1382 PHE A CA  
1488 C C   . PHE A 196 ? 1.2286 1.1341 1.0504 -0.1589 0.0042  -0.0632 1382 PHE A C   
1489 O O   . PHE A 196 ? 1.2816 1.1900 1.1013 -0.1579 0.0077  -0.0618 1382 PHE A O   
1490 C CB  . PHE A 196 ? 0.8276 0.7958 0.7136 -0.1440 0.0173  -0.0757 1382 PHE A CB  
1491 C CG  . PHE A 196 ? 0.9869 0.9802 0.9042 -0.1253 0.0158  -0.0788 1382 PHE A CG  
1492 C CD1 . PHE A 196 ? 1.0620 1.0679 0.9962 -0.1244 0.0167  -0.0858 1382 PHE A CD1 
1493 C CD2 . PHE A 196 ? 0.9986 1.0023 0.9279 -0.1090 0.0132  -0.0748 1382 PHE A CD2 
1494 C CE1 . PHE A 196 ? 0.9039 0.9296 0.8631 -0.1071 0.0146  -0.0884 1382 PHE A CE1 
1495 C CE2 . PHE A 196 ? 0.9061 0.9304 0.8606 -0.0935 0.0120  -0.0766 1382 PHE A CE2 
1496 C CZ  . PHE A 196 ? 0.8758 0.9100 0.8438 -0.0922 0.0125  -0.0833 1382 PHE A CZ  
1497 N N   . PRO A 197 ? 1.1986 1.0752 0.9922 -0.1739 -0.0003 -0.0605 1383 PRO A N   
1498 C CA  . PRO A 197 ? 1.1678 1.0111 0.9224 -0.1884 -0.0027 -0.0546 1383 PRO A CA  
1499 C C   . PRO A 197 ? 1.2819 1.1317 1.0303 -0.2145 0.0136  -0.0585 1383 PRO A C   
1500 O O   . PRO A 197 ? 1.2143 1.0400 0.9303 -0.2291 0.0150  -0.0542 1383 PRO A O   
1501 C CB  . PRO A 197 ? 1.1621 0.9678 0.8882 -0.1898 -0.0190 -0.0492 1383 PRO A CB  
1502 C CG  . PRO A 197 ? 1.1429 0.9643 0.8944 -0.1696 -0.0268 -0.0518 1383 PRO A CG  
1503 C CD  . PRO A 197 ? 1.0386 0.9021 0.8290 -0.1689 -0.0118 -0.0598 1383 PRO A CD  
1504 N N   . ASN A 198 ? 1.3532 1.2364 1.1325 -0.2201 0.0257  -0.0676 1384 ASN A N   
1505 C CA  . ASN A 198 ? 1.3829 1.2807 1.1622 -0.2440 0.0429  -0.0739 1384 ASN A CA  
1506 C C   . ASN A 198 ? 1.1915 1.1246 0.9976 -0.2367 0.0538  -0.0815 1384 ASN A C   
1507 O O   . ASN A 198 ? 1.0590 1.0099 0.8680 -0.2525 0.0684  -0.0886 1384 ASN A O   
1508 C CB  . ASN A 198 ? 1.3816 1.2949 1.1794 -0.2558 0.0487  -0.0815 1384 ASN A CB  
1509 C CG  . ASN A 198 ? 1.4950 1.3736 1.2590 -0.2775 0.0448  -0.0753 1384 ASN A CG  
1510 O OD1 . ASN A 198 ? 1.6848 1.5714 1.4600 -0.2903 0.0488  -0.0805 1384 ASN A OD1 
1511 N ND2 . ASN A 198 ? 1.1617 0.9998 0.8839 -0.2820 0.0358  -0.0642 1384 ASN A ND2 
1512 N N   . ALA A 199 ? 0.9600 0.9037 0.7860 -0.2123 0.0462  -0.0804 1385 ALA A N   
1513 C CA  . ALA A 199 ? 0.9541 0.9274 0.8047 -0.2040 0.0534  -0.0866 1385 ALA A CA  
1514 C C   . ALA A 199 ? 1.0516 1.0088 0.8760 -0.2101 0.0551  -0.0823 1385 ALA A C   
1515 O O   . ALA A 199 ? 1.0639 0.9853 0.8550 -0.2104 0.0454  -0.0724 1385 ALA A O   
1516 C CB  . ALA A 199 ? 0.9985 0.9836 0.8738 -0.1784 0.0442  -0.0847 1385 ALA A CB  
1517 N N   . GLU A 200 ? 0.9274 0.9103 0.7660 -0.2143 0.0664  -0.0908 1386 GLU A N   
1518 C CA  . GLU A 200 ? 1.1541 1.1261 0.9706 -0.2193 0.0691  -0.0888 1386 GLU A CA  
1519 C C   . GLU A 200 ? 1.1289 1.1187 0.9717 -0.1979 0.0638  -0.0903 1386 GLU A C   
1520 O O   . GLU A 200 ? 1.2421 1.2646 1.1207 -0.1898 0.0673  -0.0989 1386 GLU A O   
1521 C CB  . GLU A 200 ? 1.1587 1.1494 0.9724 -0.2406 0.0862  -0.0989 1386 GLU A CB  
1522 C CG  . GLU A 200 ? 1.4810 1.4558 1.2631 -0.2496 0.0900  -0.0966 1386 GLU A CG  
1523 C CD  . GLU A 200 ? 1.7134 1.7180 1.5191 -0.2395 0.0943  -0.1062 1386 GLU A CD  
1524 O OE1 . GLU A 200 ? 1.9083 1.9502 1.7529 -0.2333 0.0990  -0.1176 1386 GLU A OE1 
1525 O OE2 . GLU A 200 ? 1.4778 1.4671 1.2625 -0.2373 0.0917  -0.1030 1386 GLU A OE2 
1526 N N   . LYS A 201 ? 0.8917 0.8596 0.7175 -0.1885 0.0544  -0.0824 1387 LYS A N   
1527 C CA  . LYS A 201 ? 1.0182 1.0036 0.8715 -0.1690 0.0489  -0.0834 1387 LYS A CA  
1528 C C   . LYS A 201 ? 0.8604 0.8635 0.7210 -0.1715 0.0558  -0.0916 1387 LYS A C   
1529 O O   . LYS A 201 ? 1.0495 1.0343 0.8824 -0.1787 0.0566  -0.0899 1387 LYS A O   
1530 C CB  . LYS A 201 ? 1.0830 1.0447 0.9268 -0.1533 0.0341  -0.0728 1387 LYS A CB  
1531 C CG  . LYS A 201 ? 1.1455 1.0776 0.9571 -0.1552 0.0282  -0.0681 1387 LYS A CG  
1532 C CD  . LYS A 201 ? 1.1885 1.0986 0.9933 -0.1397 0.0125  -0.0596 1387 LYS A CD  
1533 C CE  . LYS A 201 ? 1.3896 1.2914 1.1922 -0.1292 0.0046  -0.0581 1387 LYS A CE  
1534 N NZ  . LYS A 201 ? 1.5567 1.4426 1.3305 -0.1417 0.0090  -0.0608 1387 LYS A NZ  
1535 N N   . MET A 202 ? 0.7271 0.7644 0.6239 -0.1646 0.0596  -0.1010 1388 MET A N   
1536 C CA  . MET A 202 ? 0.7523 0.8098 0.6596 -0.1653 0.0647  -0.1110 1388 MET A CA  
1537 C C   . MET A 202 ? 0.8585 0.8997 0.7550 -0.1556 0.0559  -0.1054 1388 MET A C   
1538 O O   . MET A 202 ? 0.9210 0.9449 0.8162 -0.1435 0.0445  -0.0952 1388 MET A O   
1539 C CB  . MET A 202 ? 0.6431 0.7364 0.5923 -0.1556 0.0653  -0.1218 1388 MET A CB  
1540 C CG  . MET A 202 ? 0.7352 0.8501 0.6961 -0.1672 0.0760  -0.1329 1388 MET A CG  
1541 S SD  . MET A 202 ? 0.9921 1.1478 1.0003 -0.1558 0.0751  -0.1490 1388 MET A SD  
1542 C CE  . MET A 202 ? 0.8097 0.9822 0.8244 -0.1531 0.0758  -0.1602 1388 MET A CE  
1543 N N   . ASN A 203 ? 0.9118 0.9595 0.8008 -0.1609 0.0610  -0.1132 1389 ASN A N   
1544 C CA  . ASN A 203 ? 1.0340 1.0671 0.9136 -0.1515 0.0521  -0.1097 1389 ASN A CA  
1545 C C   . ASN A 203 ? 1.0528 1.1131 0.9649 -0.1394 0.0488  -0.1192 1389 ASN A C   
1546 O O   . ASN A 203 ? 1.0904 1.1437 0.9961 -0.1336 0.0432  -0.1202 1389 ASN A O   
1547 C CB  . ASN A 203 ? 1.2847 1.2932 1.1210 -0.1651 0.0569  -0.1088 1389 ASN A CB  
1548 C CG  . ASN A 203 ? 1.6974 1.6746 1.5137 -0.1547 0.0436  -0.1003 1389 ASN A CG  
1549 O OD1 . ASN A 203 ? 1.8044 1.7897 1.6402 -0.1404 0.0353  -0.1025 1389 ASN A OD1 
1550 N ND2 . ASN A 203 ? 1.7835 1.7239 1.5614 -0.1617 0.0400  -0.0912 1389 ASN A ND2 
1551 N N   . THR A 204 ? 1.0205 1.1098 0.9669 -0.1348 0.0503  -0.1264 1390 THR A N   
1552 C CA  . THR A 204 ? 1.0038 1.1145 0.9821 -0.1212 0.0428  -0.1337 1390 THR A CA  
1553 C C   . THR A 204 ? 0.9025 1.0229 0.9110 -0.1097 0.0356  -0.1293 1390 THR A C   
1554 O O   . THR A 204 ? 0.9367 1.0565 0.9457 -0.1132 0.0393  -0.1256 1390 THR A O   
1555 C CB  . THR A 204 ? 1.0702 1.2115 1.0613 -0.1264 0.0510  -0.1522 1390 THR A CB  
1556 O OG1 . THR A 204 ? 1.1192 1.2776 1.1191 -0.1357 0.0610  -0.1589 1390 THR A OG1 
1557 C CG2 . THR A 204 ? 1.3970 1.5319 1.3580 -0.1368 0.0587  -0.1578 1390 THR A CG2 
1558 N N   . THR A 205 ? 0.7009 0.8286 0.7331 -0.0961 0.0246  -0.1294 1391 THR A N   
1559 C CA  . THR A 205 ? 0.6578 0.7949 0.7181 -0.0855 0.0173  -0.1253 1391 THR A CA  
1560 C C   . THR A 205 ? 0.7733 0.9379 0.8589 -0.0831 0.0171  -0.1410 1391 THR A C   
1561 O O   . THR A 205 ? 0.8939 1.0677 1.0026 -0.0748 0.0106  -0.1407 1391 THR A O   
1562 C CB  . THR A 205 ? 0.7133 0.8402 0.7845 -0.0732 0.0042  -0.1147 1391 THR A CB  
1563 O OG1 . THR A 205 ? 0.8331 0.9640 0.9095 -0.0693 -0.0018 -0.1223 1391 THR A OG1 
1564 C CG2 . THR A 205 ? 0.7457 0.8475 0.7949 -0.0737 0.0029  -0.1012 1391 THR A CG2 
1565 N N   . SER A 206 ? 0.9745 1.1517 1.0543 -0.0900 0.0237  -0.1555 1392 SER A N   
1566 C CA  . SER A 206 ? 0.6867 0.8924 0.7899 -0.0875 0.0231  -0.1742 1392 SER A CA  
1567 C C   . SER A 206 ? 0.7824 1.0030 0.8953 -0.0929 0.0306  -0.1812 1392 SER A C   
1568 O O   . SER A 206 ? 0.9849 1.1970 1.0802 -0.1039 0.0408  -0.1757 1392 SER A O   
1569 C CB  . SER A 206 ? 0.9497 1.1670 1.0418 -0.0942 0.0299  -0.1885 1392 SER A CB  
1570 O OG  . SER A 206 ? 0.9101 1.1100 0.9888 -0.0895 0.0231  -0.1818 1392 SER A OG  
1571 N N   . ALA A 207 ? 0.7362 0.9774 0.8768 -0.0848 0.0241  -0.1940 1393 ALA A N   
1572 C CA  . ALA A 207 ? 0.8284 1.0841 0.9804 -0.0883 0.0296  -0.2027 1393 ALA A CA  
1573 C C   . ALA A 207 ? 0.7172 0.9880 0.8577 -0.1046 0.0459  -0.2155 1393 ALA A C   
1574 O O   . ALA A 207 ? 0.8423 1.1286 0.9820 -0.1080 0.0498  -0.2288 1393 ALA A O   
1575 C CB  . ALA A 207 ? 0.8920 1.1663 1.0743 -0.0761 0.0178  -0.2170 1393 ALA A CB  
1576 N N   . PRO A 208 ? 0.9242 1.1901 1.0553 -0.1148 0.0552  -0.2110 1394 PRO A N   
1577 C CA  . PRO A 208 ? 0.7368 1.0139 0.8550 -0.1334 0.0716  -0.2201 1394 PRO A CA  
1578 C C   . PRO A 208 ? 0.9088 1.2231 1.0519 -0.1358 0.0765  -0.2457 1394 PRO A C   
1579 O O   . PRO A 208 ? 0.9044 1.2328 1.0753 -0.1235 0.0668  -0.2558 1394 PRO A O   
1580 C CB  . PRO A 208 ? 0.9309 1.1907 1.0384 -0.1395 0.0751  -0.2078 1394 PRO A CB  
1581 C CG  . PRO A 208 ? 0.9995 1.2577 1.1290 -0.1226 0.0619  -0.2042 1394 PRO A CG  
1582 C CD  . PRO A 208 ? 0.9593 1.2181 1.1012 -0.1075 0.0492  -0.2036 1394 PRO A CD  
1583 N N   . GLY A 209 ? 1.1791 1.5090 1.3111 -0.1521 0.0914  -0.2565 1395 GLY A N   
1584 C CA  . GLY A 209 ? 1.3459 1.7153 1.5006 -0.1569 0.0988  -0.2827 1395 GLY A CA  
1585 C C   . GLY A 209 ? 1.3720 1.7521 1.5413 -0.1635 0.1037  -0.2891 1395 GLY A C   
1586 O O   . GLY A 209 ? 1.2337 1.5896 1.3885 -0.1691 0.1053  -0.2725 1395 GLY A O   
1587 N N   . ASP A 210 ? 1.3774 1.7942 1.5766 -0.1619 0.1051  -0.3146 1396 ASP A N   
1588 C CA  . ASP A 210 ? 1.2932 1.7239 1.5110 -0.1670 0.1086  -0.3246 1396 ASP A CA  
1589 C C   . ASP A 210 ? 1.1581 1.5838 1.3535 -0.1922 0.1272  -0.3177 1396 ASP A C   
1590 O O   . ASP A 210 ? 0.9505 1.3666 1.1471 -0.1974 0.1282  -0.3121 1396 ASP A O   
1591 C CB  . ASP A 210 ? 1.2380 1.7122 1.4920 -0.1614 0.1070  -0.3566 1396 ASP A CB  
1592 C CG  . ASP A 210 ? 1.1511 1.6328 1.4310 -0.1547 0.0999  -0.3664 1396 ASP A CG  
1593 O OD1 . ASP A 210 ? 1.3072 1.7642 1.5754 -0.1588 0.1005  -0.3494 1396 ASP A OD1 
1594 O OD2 . ASP A 210 ? 0.9113 1.4227 1.2228 -0.1443 0.0925  -0.3920 1396 ASP A OD2 
1595 N N   . ASP A 211 ? 1.1370 1.5679 1.3108 -0.2079 0.1411  -0.3180 1397 ASP A N   
1596 C CA  . ASP A 211 ? 1.0369 1.4604 1.1850 -0.2342 0.1587  -0.3106 1397 ASP A CA  
1597 C C   . ASP A 211 ? 0.9341 1.3106 1.0530 -0.2363 0.1537  -0.2823 1397 ASP A C   
1598 O O   . ASP A 211 ? 0.8642 1.2318 0.9755 -0.2509 0.1601  -0.2771 1397 ASP A O   
1599 C CB  . ASP A 211 ? 1.1373 1.5677 1.2608 -0.2479 0.1721  -0.3126 1397 ASP A CB  
1600 C CG  . ASP A 211 ? 1.1804 1.5918 1.2906 -0.2311 0.1604  -0.3030 1397 ASP A CG  
1601 O OD1 . ASP A 211 ? 1.0386 1.4594 1.1751 -0.2089 0.1451  -0.3108 1397 ASP A OD1 
1602 O OD2 . ASP A 211 ? 1.2140 1.5999 1.2873 -0.2402 0.1655  -0.2877 1397 ASP A OD2 
1603 N N   . VAL A 212 ? 0.8612 1.2084 0.9648 -0.2216 0.1415  -0.2651 1398 VAL A N   
1604 C CA  . VAL A 212 ? 0.7258 1.0306 0.8040 -0.2205 0.1348  -0.2403 1398 VAL A CA  
1605 C C   . VAL A 212 ? 0.9037 1.2075 1.0040 -0.2103 0.1258  -0.2400 1398 VAL A C   
1606 O O   . VAL A 212 ? 0.8530 1.1357 0.9397 -0.2175 0.1261  -0.2285 1398 VAL A O   
1607 C CB  . VAL A 212 ? 0.8340 1.1136 0.8990 -0.2042 0.1222  -0.2251 1398 VAL A CB  
1608 C CG1 . VAL A 212 ? 0.8367 1.0760 0.8770 -0.2026 0.1153  -0.2018 1398 VAL A CG1 
1609 C CG2 . VAL A 212 ? 1.0723 1.3529 1.1168 -0.2111 0.1290  -0.2269 1398 VAL A CG2 
1610 N N   . LYS A 213 ? 0.8330 1.1589 0.9666 -0.1928 0.1165  -0.2536 1399 LYS A N   
1611 C CA  . LYS A 213 ? 0.7000 1.0271 0.8566 -0.1796 0.1062  -0.2560 1399 LYS A CA  
1612 C C   . LYS A 213 ? 0.7952 1.1346 0.9618 -0.1928 0.1141  -0.2660 1399 LYS A C   
1613 O O   . LYS A 213 ? 0.8648 1.1923 1.0376 -0.1852 0.1063  -0.2609 1399 LYS A O   
1614 C CB  . LYS A 213 ? 0.8412 1.1914 1.0302 -0.1606 0.0950  -0.2725 1399 LYS A CB  
1615 C CG  . LYS A 213 ? 1.0639 1.3981 1.2484 -0.1436 0.0823  -0.2608 1399 LYS A CG  
1616 C CD  . LYS A 213 ? 0.9353 1.2623 1.1378 -0.1231 0.0658  -0.2579 1399 LYS A CD  
1617 C CE  . LYS A 213 ? 0.6916 1.0407 0.9218 -0.1093 0.0551  -0.2767 1399 LYS A CE  
1618 N NZ  . LYS A 213 ? 0.7088 1.0460 0.9319 -0.1003 0.0468  -0.2667 1399 LYS A NZ  
1619 N N   . ASN A 214 ? 1.0457 1.4097 1.2141 -0.2126 0.1296  -0.2805 1400 ASN A N   
1620 C CA  . ASN A 214 ? 1.0464 1.4271 1.2280 -0.2279 0.1385  -0.2926 1400 ASN A CA  
1621 C C   . ASN A 214 ? 1.1145 1.4758 1.2642 -0.2540 0.1515  -0.2794 1400 ASN A C   
1622 O O   . ASN A 214 ? 1.3132 1.6820 1.4708 -0.2681 0.1577  -0.2854 1400 ASN A O   
1623 C CB  . ASN A 214 ? 0.9321 1.3615 1.1490 -0.2300 0.1449  -0.3234 1400 ASN A CB  
1624 C CG  . ASN A 214 ? 1.0024 1.4455 1.2495 -0.2031 0.1282  -0.3365 1400 ASN A CG  
1625 O OD1 . ASN A 214 ? 0.9922 1.4207 1.2314 -0.1878 0.1180  -0.3269 1400 ASN A OD1 
1626 N ND2 . ASN A 214 ? 1.0304 1.4997 1.3115 -0.1975 0.1243  -0.3586 1400 ASN A ND2 
1627 N N   . ALA A 215 ? 1.0944 1.4280 1.2077 -0.2597 0.1537  -0.2610 1401 ALA A N   
1628 C CA  . ALA A 215 ? 1.0559 1.3601 1.1317 -0.2819 0.1617  -0.2445 1401 ALA A CA  
1629 C C   . ALA A 215 ? 1.1113 1.3877 1.1821 -0.2797 0.1521  -0.2319 1401 ALA A C   
1630 O O   . ALA A 215 ? 1.1145 1.3845 1.2006 -0.2574 0.1378  -0.2290 1401 ALA A O   
1631 C CB  . ALA A 215 ? 0.9447 1.2187 0.9827 -0.2816 0.1602  -0.2267 1401 ALA A CB  
1632 N N   . PRO A 216 ? 1.2606 1.5193 1.3083 -0.3029 0.1593  -0.2242 1402 PRO A N   
1633 C CA  . PRO A 216 ? 1.3990 1.6309 1.4415 -0.3012 0.1491  -0.2135 1402 PRO A CA  
1634 C C   . PRO A 216 ? 1.2728 1.4581 1.2826 -0.2892 0.1347  -0.1897 1402 PRO A C   
1635 O O   . PRO A 216 ? 1.1636 1.3335 1.1788 -0.2750 0.1216  -0.1836 1402 PRO A O   
1636 C CB  . PRO A 216 ? 1.3924 1.6237 1.4219 -0.3331 0.1623  -0.2152 1402 PRO A CB  
1637 C CG  . PRO A 216 ? 1.2204 1.4545 1.2244 -0.3515 0.1770  -0.2138 1402 PRO A CG  
1638 C CD  . PRO A 216 ? 1.1993 1.4619 1.2240 -0.3327 0.1772  -0.2254 1402 PRO A CD  
1639 N N   . GLY A 217 ? 1.2548 1.4186 1.2311 -0.2943 0.1368  -0.1777 1403 GLY A N   
1640 C CA  . GLY A 217 ? 1.1724 1.2940 1.1182 -0.2828 0.1230  -0.1573 1403 GLY A CA  
1641 C C   . GLY A 217 ? 1.0841 1.2083 1.0475 -0.2529 0.1102  -0.1545 1403 GLY A C   
1642 O O   . GLY A 217 ? 1.0193 1.1750 1.0165 -0.2405 0.1108  -0.1674 1403 GLY A O   
1643 N N   . GLN A 218 ? 0.9629 1.0533 0.9028 -0.2419 0.0980  -0.1380 1404 GLN A N   
1644 C CA  . GLN A 218 ? 0.8222 0.9121 0.7750 -0.2157 0.0862  -0.1328 1404 GLN A CA  
1645 C C   . GLN A 218 ? 0.9969 1.0801 0.9362 -0.2110 0.0857  -0.1273 1404 GLN A C   
1646 O O   . GLN A 218 ? 1.0413 1.0945 0.9459 -0.2182 0.0837  -0.1164 1404 GLN A O   
1647 C CB  . GLN A 218 ? 0.6216 0.6821 0.5604 -0.2047 0.0724  -0.1197 1404 GLN A CB  
1648 C CG  . GLN A 218 ? 0.7566 0.8206 0.7089 -0.2047 0.0693  -0.1241 1404 GLN A CG  
1649 C CD  . GLN A 218 ? 1.0430 1.0750 0.9754 -0.1954 0.0551  -0.1114 1404 GLN A CD  
1650 O OE1 . GLN A 218 ? 1.2178 1.2193 1.1182 -0.1980 0.0494  -0.0998 1404 GLN A OE1 
1651 N NE2 . GLN A 218 ? 0.9081 0.9461 0.8586 -0.1832 0.0482  -0.1145 1404 GLN A NE2 
1652 N N   . TYR A 219 ? 0.9900 1.0988 0.9559 -0.1980 0.0859  -0.1351 1405 TYR A N   
1653 C CA  . TYR A 219 ? 1.0354 1.1379 0.9929 -0.1902 0.0827  -0.1299 1405 TYR A CA  
1654 C C   . TYR A 219 ? 0.9131 1.0172 0.8895 -0.1663 0.0705  -0.1242 1405 TYR A C   
1655 O O   . TYR A 219 ? 0.8773 1.0042 0.8841 -0.1558 0.0686  -0.1319 1405 TYR A O   
1656 C CB  . TYR A 219 ? 1.2042 1.3330 1.1716 -0.1978 0.0931  -0.1437 1405 TYR A CB  
1657 C CG  . TYR A 219 ? 1.2620 1.3990 1.2177 -0.2223 0.1078  -0.1522 1405 TYR A CG  
1658 C CD1 . TYR A 219 ? 1.3607 1.5196 1.3377 -0.2299 0.1140  -0.1638 1405 TYR A CD1 
1659 C CD2 . TYR A 219 ? 1.1029 1.2259 1.0258 -0.2383 0.1157  -0.1490 1405 TYR A CD2 
1660 C CE1 . TYR A 219 ? 1.5317 1.7007 1.5002 -0.2540 0.1284  -0.1719 1405 TYR A CE1 
1661 C CE2 . TYR A 219 ? 1.3058 1.4371 1.2165 -0.2630 0.1306  -0.1560 1405 TYR A CE2 
1662 C CZ  . TYR A 219 ? 1.5567 1.7124 1.4916 -0.2714 0.1374  -0.1675 1405 TYR A CZ  
1663 O OH  . TYR A 219 ? 1.5668 1.7339 1.4927 -0.2973 0.1532  -0.1750 1405 TYR A OH  
1664 N N   . ILE A 220 ? 0.8423 0.9217 0.7998 -0.1586 0.0622  -0.1109 1406 ILE A N   
1665 C CA  . ILE A 220 ? 0.5298 0.6082 0.5015 -0.1382 0.0513  -0.1033 1406 ILE A CA  
1666 C C   . ILE A 220 ? 0.7434 0.8217 0.7167 -0.1309 0.0477  -0.1008 1406 ILE A C   
1667 O O   . ILE A 220 ? 0.6595 0.7179 0.6077 -0.1362 0.0468  -0.0958 1406 ILE A O   
1668 C CB  . ILE A 220 ? 0.4842 0.5365 0.4375 -0.1322 0.0425  -0.0907 1406 ILE A CB  
1669 C CG1 . ILE A 220 ? 0.7334 0.7846 0.6869 -0.1365 0.0433  -0.0929 1406 ILE A CG1 
1670 C CG2 . ILE A 220 ? 0.4046 0.4608 0.3741 -0.1127 0.0335  -0.0839 1406 ILE A CG2 
1671 C CD1 . ILE A 220 ? 0.6523 0.6826 0.5935 -0.1257 0.0325  -0.0824 1406 ILE A CD1 
1672 N N   . GLN A 221 ? 0.6491 0.7477 0.6516 -0.1182 0.0441  -0.1041 1407 GLN A N   
1673 C CA  . GLN A 221 ? 0.4809 0.5817 0.4919 -0.1090 0.0383  -0.1018 1407 GLN A CA  
1674 C C   . GLN A 221 ? 0.7279 0.8219 0.7474 -0.0936 0.0284  -0.0897 1407 GLN A C   
1675 O O   . GLN A 221 ? 0.6524 0.7569 0.6897 -0.0852 0.0260  -0.0886 1407 GLN A O   
1676 C CB  . GLN A 221 ? 0.5444 0.6727 0.5834 -0.1059 0.0396  -0.1144 1407 GLN A CB  
1677 C CG  . GLN A 221 ? 0.6947 0.8271 0.7374 -0.1034 0.0369  -0.1181 1407 GLN A CG  
1678 C CD  . GLN A 221 ? 0.8410 1.0010 0.9090 -0.1016 0.0378  -0.1341 1407 GLN A CD  
1679 O OE1 . GLN A 221 ? 0.7110 0.8835 0.8027 -0.0924 0.0324  -0.1368 1407 GLN A OE1 
1680 N NE2 . GLN A 221 ? 0.8577 1.0269 0.9196 -0.1099 0.0439  -0.1454 1407 GLN A NE2 
1681 N N   . CYS A 222 ? 0.6894 0.7668 0.6965 -0.0897 0.0226  -0.0813 1408 CYS A N   
1682 C CA  . CYS A 222 ? 0.6291 0.7032 0.6453 -0.0763 0.0143  -0.0708 1408 CYS A CA  
1683 C C   . CYS A 222 ? 0.6720 0.7432 0.6939 -0.0703 0.0078  -0.0673 1408 CYS A C   
1684 O O   . CYS A 222 ? 0.7584 0.8136 0.7609 -0.0746 0.0065  -0.0674 1408 CYS A O   
1685 C CB  . CYS A 222 ? 0.6722 0.7264 0.6667 -0.0755 0.0115  -0.0633 1408 CYS A CB  
1686 S SG  . CYS A 222 ? 0.6764 0.7320 0.6836 -0.0589 0.0028  -0.0523 1408 CYS A SG  
1687 N N   . PHE A 2