data_2YMX
# 
_entry.id   2YMX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YMX         
PDBE  EBI-51524    
WWPDB D_1290051524 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2YMX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-10-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bourne, Y.'     1 ? 
'Renault, L.'    2 ? 
'Essono, S.'     3 ? 
'Mondielli, G.'  4 ? 
'Lamourette, P.' 5 ? 
'Bocquet, D.'    6 ? 
'Grassi, J.'     7 ? 
'Marchot, P.'    8 ? 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Characterization of Monoclonal Antibodies that Inhibit Acetylcholinesterase by Targeting the Peripheral Site and Backdoor Region
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                77266 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24146971 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0077226 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bourne, Y.'     1 
primary 'Renault, L.'    2 
primary 'Essono, S.'     3 
primary 'Mondielli, G.'  4 
primary 'Lamourette, P.' 5 
primary 'Boquet, D.'     6 
primary 'Grassi, J.'     7 
primary 'Marchot, P.'    8 
# 
_cell.entry_id           2YMX 
_cell.length_a           69.950 
_cell.length_b           129.111 
_cell.length_c           99.264 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2YMX 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'FAB ANTIBODY HEAVY CHAIN' 24132.043 1   ? ? 'VARIABLE DOMAIN' ? 
2 polymer     nat 'FAB ANTIBODY LIGHT CHAIN' 23574.840 1   ? ? 'VARIABLE DOMAIN' ? 
3 non-polymer syn GLYCEROL                   92.094    1   ? ? ?                 ? 
4 water       nat water                      18.015    212 ? ? ?                 ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKSLEWIGEMSPSTGRTTYNQNFKAKATLTVDQSSSTAY
MQLKSLTSEDSAVYYCARSVPLTTLIEDWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
;
;EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKSLEWIGEMSPSTGRTTYNQNFKAKATLTVDQSSSTAY
MQLKSLTSEDSAVYYCARSVPLTTLIEDWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
;
H ? 
2 'polypeptide(L)' no no 
;DIQMTQSPASLSASVGATVTITCRTSENIDSYLAWYQQRQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQS
EDVARYYCQHYSTTPWTFGGGTQLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIQMTQSPASLSASVGATVTITCRTSENIDSYLAWYQQRQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQS
EDVARYYCQHYSTTPWTFGGGTQLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   GLN n 
1 4   LEU n 
1 5   GLN n 
1 6   GLN n 
1 7   SER n 
1 8   GLY n 
1 9   PRO n 
1 10  GLU n 
1 11  LEU n 
1 12  VAL n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  LYS n 
1 20  ILE n 
1 21  SER n 
1 22  CYS n 
1 23  LYS n 
1 24  ALA n 
1 25  SER n 
1 26  GLY n 
1 27  TYR n 
1 28  SER n 
1 29  PHE n 
1 30  THR n 
1 31  GLY n 
1 32  TYR n 
1 33  TYR n 
1 34  MET n 
1 35  ASN n 
1 36  TRP n 
1 37  VAL n 
1 38  LYS n 
1 39  GLN n 
1 40  SER n 
1 41  PRO n 
1 42  GLU n 
1 43  LYS n 
1 44  SER n 
1 45  LEU n 
1 46  GLU n 
1 47  TRP n 
1 48  ILE n 
1 49  GLY n 
1 50  GLU n 
1 51  MET n 
1 52  SER n 
1 53  PRO n 
1 54  SER n 
1 55  THR n 
1 56  GLY n 
1 57  ARG n 
1 58  THR n 
1 59  THR n 
1 60  TYR n 
1 61  ASN n 
1 62  GLN n 
1 63  ASN n 
1 64  PHE n 
1 65  LYS n 
1 66  ALA n 
1 67  LYS n 
1 68  ALA n 
1 69  THR n 
1 70  LEU n 
1 71  THR n 
1 72  VAL n 
1 73  ASP n 
1 74  GLN n 
1 75  SER n 
1 76  SER n 
1 77  SER n 
1 78  THR n 
1 79  ALA n 
1 80  TYR n 
1 81  MET n 
1 82  GLN n 
1 83  LEU n 
1 84  LYS n 
1 85  SER n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  GLU n 
1 90  ASP n 
1 91  SER n 
1 92  ALA n 
1 93  VAL n 
1 94  TYR n 
1 95  TYR n 
1 96  CYS n 
1 97  ALA n 
1 98  ARG n 
1 99  SER n 
1 100 VAL n 
1 101 PRO n 
1 102 LEU n 
1 103 THR n 
1 104 THR n 
1 105 LEU n 
1 106 ILE n 
1 107 GLU n 
1 108 ASP n 
1 109 TRP n 
1 110 TYR n 
1 111 PHE n 
1 112 ASP n 
1 113 VAL n 
1 114 TRP n 
1 115 GLY n 
1 116 THR n 
1 117 GLY n 
1 118 THR n 
1 119 THR n 
1 120 VAL n 
1 121 THR n 
1 122 VAL n 
1 123 SER n 
1 124 SER n 
1 125 ALA n 
1 126 LYS n 
1 127 THR n 
1 128 THR n 
1 129 PRO n 
1 130 PRO n 
1 131 SER n 
1 132 VAL n 
1 133 TYR n 
1 134 PRO n 
1 135 LEU n 
1 136 ALA n 
1 137 PRO n 
1 138 GLY n 
1 139 SER n 
1 140 ALA n 
1 141 ALA n 
1 142 GLN n 
1 143 THR n 
1 144 ASN n 
1 145 SER n 
1 146 MET n 
1 147 VAL n 
1 148 THR n 
1 149 LEU n 
1 150 GLY n 
1 151 CYS n 
1 152 LEU n 
1 153 VAL n 
1 154 LYS n 
1 155 GLY n 
1 156 TYR n 
1 157 PHE n 
1 158 PRO n 
1 159 GLU n 
1 160 PRO n 
1 161 VAL n 
1 162 THR n 
1 163 VAL n 
1 164 THR n 
1 165 TRP n 
1 166 ASN n 
1 167 SER n 
1 168 GLY n 
1 169 SER n 
1 170 LEU n 
1 171 SER n 
1 172 SER n 
1 173 GLY n 
1 174 VAL n 
1 175 HIS n 
1 176 THR n 
1 177 PHE n 
1 178 PRO n 
1 179 ALA n 
1 180 VAL n 
1 181 LEU n 
1 182 GLN n 
1 183 SER n 
1 184 ASP n 
1 185 LEU n 
1 186 TYR n 
1 187 THR n 
1 188 LEU n 
1 189 SER n 
1 190 SER n 
1 191 SER n 
1 192 VAL n 
1 193 THR n 
1 194 VAL n 
1 195 PRO n 
1 196 SER n 
1 197 SER n 
1 198 THR n 
1 199 TRP n 
1 200 PRO n 
1 201 SER n 
1 202 GLU n 
1 203 THR n 
1 204 VAL n 
1 205 THR n 
1 206 CYS n 
1 207 ASN n 
1 208 VAL n 
1 209 ALA n 
1 210 HIS n 
1 211 PRO n 
1 212 ALA n 
1 213 SER n 
1 214 SER n 
1 215 THR n 
1 216 LYS n 
1 217 VAL n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 ILE n 
1 222 VAL n 
1 223 PRO n 
1 224 ARG n 
2 1   ASP n 
2 2   ILE n 
2 3   GLN n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ALA n 
2 10  SER n 
2 11  LEU n 
2 12  SER n 
2 13  ALA n 
2 14  SER n 
2 15  VAL n 
2 16  GLY n 
2 17  ALA n 
2 18  THR n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  ARG n 
2 25  THR n 
2 26  SER n 
2 27  GLU n 
2 28  ASN n 
2 29  ILE n 
2 30  ASP n 
2 31  SER n 
2 32  TYR n 
2 33  LEU n 
2 34  ALA n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  ARG n 
2 40  GLN n 
2 41  GLY n 
2 42  LYS n 
2 43  SER n 
2 44  PRO n 
2 45  GLN n 
2 46  LEU n 
2 47  LEU n 
2 48  VAL n 
2 49  TYR n 
2 50  ALA n 
2 51  ALA n 
2 52  THR n 
2 53  ASN n 
2 54  LEU n 
2 55  ALA n 
2 56  ASP n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  SER n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  GLN n 
2 71  TYR n 
2 72  SER n 
2 73  LEU n 
2 74  LYS n 
2 75  ILE n 
2 76  ASN n 
2 77  SER n 
2 78  LEU n 
2 79  GLN n 
2 80  SER n 
2 81  GLU n 
2 82  ASP n 
2 83  VAL n 
2 84  ALA n 
2 85  ARG n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  HIS n 
2 91  TYR n 
2 92  SER n 
2 93  THR n 
2 94  THR n 
2 95  PRO n 
2 96  TRP n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLY n 
2 101 GLY n 
2 102 THR n 
2 103 GLN n 
2 104 LEU n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 ALA n 
2 110 ASP n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 THR n 
2 115 VAL n 
2 116 SER n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 SER n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 THR n 
2 127 SER n 
2 128 GLY n 
2 129 GLY n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 PHE n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 LYS n 
2 143 ASP n 
2 144 ILE n 
2 145 ASN n 
2 146 VAL n 
2 147 LYS n 
2 148 TRP n 
2 149 LYS n 
2 150 ILE n 
2 151 ASP n 
2 152 GLY n 
2 153 SER n 
2 154 GLU n 
2 155 ARG n 
2 156 GLN n 
2 157 ASN n 
2 158 GLY n 
2 159 VAL n 
2 160 LEU n 
2 161 ASN n 
2 162 SER n 
2 163 TRP n 
2 164 THR n 
2 165 ASP n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 MET n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 THR n 
2 183 LYS n 
2 184 ASP n 
2 185 GLU n 
2 186 TYR n 
2 187 GLU n 
2 188 ARG n 
2 189 HIS n 
2 190 ASN n 
2 191 SER n 
2 192 TYR n 
2 193 THR n 
2 194 CYS n 
2 195 GLU n 
2 196 ALA n 
2 197 THR n 
2 198 HIS n 
2 199 LYS n 
2 200 THR n 
2 201 SER n 
2 202 THR n 
2 203 SER n 
2 204 PRO n 
2 205 ILE n 
2 206 VAL n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 ASN n 
2 213 GLU n 
2 214 CYS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'HOUSE MOUSE' 'MUS MUSCULUS' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'HOUSE MOUSE' 'MUS MUSCULUS' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2YMX 1 ? ? 2YMX ? 
2 PDB 2YMX 2 ? ? 2YMX ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2YMX H 1 ? 224 ? 2YMX 1 ? 224 ? 1 224 
2 2 2YMX L 1 ? 214 ? 2YMX 1 ? 214 ? 1 214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2YMX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '18% PEG 6000, 100 MM SODIUM CACODYLATE PH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2YMX 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   35565 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           0.449 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.80 
_reflns_shell.pdbx_redundancy        5.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2YMX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34833 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.38 
_refine.ls_R_factor_obs                          0.20937 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20845 
_refine.ls_R_factor_R_free                       0.25353 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  732 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.937 
_refine.B_iso_mean                               42.697 
_refine.aniso_B[1][1]                            1.38 
_refine.aniso_B[2][2]                            1.01 
_refine.aniso_B[3][3]                            -2.39 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'U VALUES WITH TLS ADDED. HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      'PDB ENTRIES 1FGV AND 1WEJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.166 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.142 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.748 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3320 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             212 
_refine_hist.number_atoms_total               3538 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.020  ? 3420 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.347  1.946  ? 4674 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.514  5.000  ? 436  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.687 24.697 ? 132  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.223 15.000 ? 536  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.684 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089  0.200  ? 536  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 2566 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.091  1.845  ? 1741 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.871  2.754  ? 2172 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.337  1.952  ? 1678 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       6.250  16.213 ? 5177 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2382 
_refine_ls_shell.R_factor_R_work                  0.282 
_refine_ls_shell.percent_reflns_obs               93.96 
_refine_ls_shell.R_factor_R_free                  0.372 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2YMX 
_struct.title                     'Crystal structure of inhibitory anti-AChE Fab408' 
_struct.pdbx_descriptor           'FAB ANTIBODY HEAVY CHAIN, FAB ANTIBODY LIGHT CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YMX 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNE SYSTEM, ACETYLCHOLINESTERASE, INHIBITION, BACK DOOR REGION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 28  ? THR A 30  ? SER H 28  THR H 30  5 ? 3 
HELX_P HELX_P2 2 GLN A 62  ? LYS A 65  ? GLN H 62  LYS H 65  5 ? 4 
HELX_P HELX_P3 3 GLN A 74  ? SER A 76  ? GLN H 74  SER H 76  5 ? 3 
HELX_P HELX_P4 4 THR A 87  ? SER A 91  ? THR H 87  SER H 91  5 ? 5 
HELX_P HELX_P5 5 SER A 167 ? SER A 169 ? SER H 167 SER H 169 5 ? 3 
HELX_P HELX_P6 6 PRO A 211 ? SER A 214 ? PRO H 211 SER H 214 5 ? 4 
HELX_P HELX_P7 7 GLN B 79  ? VAL B 83  ? GLN L 79  VAL L 83  5 ? 5 
HELX_P HELX_P8 8 SER B 121 ? THR B 126 ? SER L 121 THR L 126 1 ? 6 
HELX_P HELX_P9 9 LYS B 183 ? ARG B 188 ? LYS L 183 ARG L 188 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf2 disulf ? ? A CYS 151 SG ? ? ? 1_555 A CYS 206 SG ? ? H CYS 151 H CYS 206 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf3 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.111 ? 
disulf4 disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.048 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 157 A . ? PHE 157 H PRO 158 A ? PRO 158 H 1 -5.56 
2 GLU 159 A . ? GLU 159 H PRO 160 A ? PRO 160 H 1 2.51  
3 TRP 199 A . ? TRP 199 H PRO 200 A ? PRO 200 H 1 5.19  
4 SER 7   B . ? SER 7   L PRO 8   B ? PRO 8   L 1 -5.44 
5 THR 94  B . ? THR 94  L PRO 95  B ? PRO 95  L 1 -1.02 
6 TYR 140 B . ? TYR 140 L PRO 141 B ? PRO 141 L 1 1.93  
7 ARG 211 B . ? ARG 211 L ASN 212 B ? ASN 212 L 1 -9.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
HA ? 4 ? 
HB ? 4 ? 
HC ? 6 ? 
HD ? 2 ? 
HE ? 4 ? 
HF ? 4 ? 
HG ? 2 ? 
HH ? 3 ? 
LA ? 4 ? 
LB ? 6 ? 
LC ? 4 ? 
LD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HB 1 2 ? parallel      
HB 2 3 ? anti-parallel 
HB 3 4 ? anti-parallel 
HC 1 2 ? parallel      
HC 2 3 ? anti-parallel 
HC 3 4 ? anti-parallel 
HC 4 5 ? anti-parallel 
HC 5 6 ? anti-parallel 
HD 1 2 ? anti-parallel 
HE 1 2 ? anti-parallel 
HE 2 3 ? anti-parallel 
HE 3 4 ? parallel      
HF 1 2 ? anti-parallel 
HF 2 3 ? anti-parallel 
HF 3 4 ? anti-parallel 
HG 1 2 ? parallel      
HH 1 2 ? anti-parallel 
HH 2 3 ? anti-parallel 
LA 1 2 ? anti-parallel 
LA 2 3 ? anti-parallel 
LA 3 4 ? anti-parallel 
LB 1 2 ? parallel      
LB 2 3 ? anti-parallel 
LB 3 4 ? anti-parallel 
LB 4 5 ? anti-parallel 
LB 5 6 ? anti-parallel 
LC 1 2 ? anti-parallel 
LC 2 3 ? anti-parallel 
LC 3 4 ? anti-parallel 
LD 1 2 ? anti-parallel 
LD 2 3 ? anti-parallel 
LD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
HA 1 GLN A 3   ? GLN A 6   ? GLN H 3   GLN H 6   
HA 2 VAL A 18  ? SER A 25  ? VAL H 18  SER H 25  
HA 3 THR A 78  ? LEU A 83  ? THR H 78  LEU H 83  
HA 4 ALA A 68  ? ASP A 73  ? ALA H 68  ASP H 73  
HB 1 GLU A 10  ? VAL A 12  ? GLU H 10  VAL H 12  
HB 2 THR A 118 ? VAL A 122 ? THR H 118 VAL H 122 
HB 3 ALA A 92  ? PRO A 101 ? ALA H 92  PRO H 101 
HB 4 VAL A 113 ? TRP A 114 ? VAL H 113 TRP H 114 
HC 1 GLU A 10  ? VAL A 12  ? GLU H 10  VAL H 12  
HC 2 THR A 118 ? VAL A 122 ? THR H 118 VAL H 122 
HC 3 ALA A 92  ? PRO A 101 ? ALA H 92  PRO H 101 
HC 4 TYR A 32  ? GLN A 39  ? TYR H 32  GLN H 39  
HC 5 LEU A 45  ? MET A 51  ? LEU H 45  MET H 51  
HC 6 THR A 58  ? TYR A 60  ? THR H 58  TYR H 60  
HD 1 VAL A 113 ? TRP A 114 ? VAL H 113 TRP H 114 
HD 2 ALA A 92  ? PRO A 101 ? ALA H 92  PRO H 101 
HE 1 SER A 131 ? LEU A 135 ? SER H 131 LEU H 135 
HE 2 MET A 146 ? TYR A 156 ? MET H 146 TYR H 156 
HE 3 LEU A 185 ? PRO A 195 ? LEU H 185 PRO H 195 
HE 4 VAL A 180 ? GLN A 182 ? VAL H 180 GLN H 182 
HF 1 SER A 131 ? LEU A 135 ? SER H 131 LEU H 135 
HF 2 MET A 146 ? TYR A 156 ? MET H 146 TYR H 156 
HF 3 LEU A 185 ? PRO A 195 ? LEU H 185 PRO H 195 
HF 4 VAL A 174 ? THR A 176 ? VAL H 174 THR H 176 
HG 1 VAL A 180 ? GLN A 182 ? VAL H 180 GLN H 182 
HG 2 LEU A 185 ? PRO A 195 ? LEU H 185 PRO H 195 
HH 1 THR A 162 ? TRP A 165 ? THR H 162 TRP H 165 
HH 2 THR A 205 ? HIS A 210 ? THR H 205 HIS H 210 
HH 3 THR A 215 ? LYS A 220 ? THR H 215 LYS H 220 
LA 1 MET B 4   ? SER B 7   ? MET L 4   SER L 7   
LA 2 VAL B 19  ? THR B 25  ? VAL L 19  THR L 25  
LA 3 GLN B 70  ? ILE B 75  ? GLN L 70  ILE L 75  
LA 4 PHE B 62  ? SER B 67  ? PHE L 62  SER L 67  
LB 1 SER B 10  ? ALA B 13  ? SER L 10  ALA L 13  
LB 2 THR B 102 ? ILE B 106 ? THR L 102 ILE L 106 
LB 3 ARG B 85  ? HIS B 90  ? ARG L 85  HIS L 90  
LB 4 LEU B 33  ? GLN B 38  ? LEU L 33  GLN L 38  
LB 5 GLN B 45  ? TYR B 49  ? GLN L 45  TYR L 49  
LB 6 ASN B 53  ? LEU B 54  ? ASN L 53  LEU L 54  
LC 1 THR B 114 ? PHE B 118 ? THR L 114 PHE L 118 
LC 2 GLY B 129 ? PHE B 139 ? GLY L 129 PHE L 139 
LC 3 TYR B 173 ? THR B 182 ? TYR L 173 THR L 182 
LC 4 VAL B 159 ? TRP B 163 ? VAL L 159 TRP L 163 
LD 1 SER B 153 ? ARG B 155 ? SER L 153 ARG L 155 
LD 2 ASN B 145 ? ILE B 150 ? ASN L 145 ILE L 150 
LD 3 SER B 191 ? THR B 197 ? SER L 191 THR L 197 
LD 4 ILE B 205 ? ASN B 210 ? ILE L 205 ASN L 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
HA 1 2 N GLN A 5   ? N GLN H 5   O LYS A 23  ? O LYS H 23  
HA 2 3 N CYS A 22  ? N CYS H 22  O ALA A 79  ? O ALA H 79  
HA 3 4 N GLN A 82  ? N GLN H 82  O THR A 69  ? O THR H 69  
HB 1 2 N GLU A 10  ? N GLU H 10  O THR A 119 ? O THR H 119 
HB 2 3 N VAL A 120 ? N VAL H 120 O ALA A 92  ? O ALA H 92  
HB 3 4 N ARG A 98  ? N ARG H 98  O VAL A 113 ? O VAL H 113 
HC 1 2 N GLU A 10  ? N GLU H 10  O THR A 119 ? O THR H 119 
HC 2 3 N VAL A 120 ? N VAL H 120 O ALA A 92  ? O ALA H 92  
HC 3 4 N SER A 99  ? N SER H 99  O TYR A 33  ? O TYR H 33  
HC 4 5 N LYS A 38  ? N LYS H 38  O GLU A 46  ? O GLU H 46  
HC 5 6 N GLU A 50  ? N GLU H 50  O THR A 59  ? O THR H 59  
HD 1 2 O VAL A 113 ? O VAL H 113 N ARG A 98  ? N ARG H 98  
HE 1 2 N LEU A 135 ? N LEU H 135 O GLY A 150 ? O GLY H 150 
HE 2 3 N TYR A 156 ? N TYR H 156 O TYR A 186 ? O TYR H 186 
HE 3 4 N THR A 187 ? N THR H 187 O VAL A 180 ? O VAL H 180 
HF 1 2 N LEU A 135 ? N LEU H 135 O GLY A 150 ? O GLY H 150 
HF 2 3 N TYR A 156 ? N TYR H 156 O TYR A 186 ? O TYR H 186 
HF 3 4 N SER A 191 ? N SER H 191 O HIS A 175 ? O HIS H 175 
HG 1 2 N GLN A 182 ? N GLN H 182 O LEU A 185 ? O LEU H 185 
HH 1 2 N THR A 164 ? N THR H 164 O ASN A 207 ? O ASN H 207 
HH 2 3 N HIS A 210 ? N HIS H 210 O THR A 215 ? O THR H 215 
LA 1 2 N SER B 7   ? N SER L 7   O THR B 22  ? O THR L 22  
LA 2 3 N CYS B 23  ? N CYS L 23  O TYR B 71  ? O TYR L 71  
LA 3 4 N LYS B 74  ? N LYS L 74  O SER B 63  ? O SER L 63  
LB 1 2 N LEU B 11  ? N LEU L 11  O GLN B 103 ? O GLN L 103 
LB 2 3 N THR B 102 ? N THR L 102 O TYR B 86  ? O TYR L 86  
LB 3 4 N GLN B 89  ? N GLN L 89  O ALA B 34  ? O ALA L 34  
LB 4 5 N GLN B 37  ? N GLN L 37  O GLN B 45  ? O GLN L 45  
LB 5 6 N TYR B 49  ? N TYR L 49  O ASN B 53  ? O ASN L 53  
LC 1 2 N PHE B 118 ? N PHE L 118 O VAL B 133 ? O VAL L 133 
LC 2 3 N PHE B 139 ? N PHE L 139 O TYR B 173 ? O TYR L 173 
LC 3 4 N THR B 178 ? N THR L 178 O LEU B 160 ? O LEU L 160 
LD 1 2 N ARG B 155 ? N ARG L 155 O TRP B 148 ? O TRP L 148 
LD 2 3 N LYS B 149 ? N LYS L 149 O THR B 193 ? O THR L 193 
LD 3 4 N ALA B 196 ? N ALA L 196 O ILE B 205 ? O ILE L 205 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL L 1214' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 PHE A 177 ? PHE H 177 . ? 1_555 ? 
2  AC1 10 PRO A 178 ? PRO H 178 . ? 1_555 ? 
3  AC1 10 THR A 187 ? THR H 187 . ? 1_555 ? 
4  AC1 10 LEU A 188 ? LEU H 188 . ? 1_555 ? 
5  AC1 10 SER A 189 ? SER H 189 . ? 1_555 ? 
6  AC1 10 LEU B 160 ? LEU L 160 . ? 1_555 ? 
7  AC1 10 SER B 162 ? SER L 162 . ? 1_555 ? 
8  AC1 10 SER B 176 ? SER L 176 . ? 1_555 ? 
9  AC1 10 SER B 177 ? SER L 177 . ? 1_555 ? 
10 AC1 10 THR B 178 ? THR L 178 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2YMX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2YMX 
_atom_sites.fract_transf_matrix[1][1]   0.014296 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010074 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 39.330  7.869   28.120  1.00 76.24  ? 1    GLU H N   1 
ATOM   2    C CA  . GLU A 1 1   ? 39.721  6.497   28.554  1.00 78.34  ? 1    GLU H CA  1 
ATOM   3    C C   . GLU A 1 1   ? 38.568  5.751   29.250  1.00 75.80  ? 1    GLU H C   1 
ATOM   4    O O   . GLU A 1 1   ? 38.265  4.608   28.882  1.00 78.15  ? 1    GLU H O   1 
ATOM   5    C CB  . GLU A 1 1   ? 40.980  6.543   29.438  1.00 83.63  ? 1    GLU H CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 41.441  5.205   30.019  1.00 89.28  ? 1    GLU H CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 41.928  4.214   28.967  1.00 93.53  ? 1    GLU H CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 41.089  3.683   28.206  1.00 93.62  ? 1    GLU H OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 43.151  3.940   28.914  1.00 97.03  ? 1    GLU H OE2 1 
ATOM   10   N N   . VAL A 1 2   ? 37.933  6.386   30.242  1.00 69.86  ? 2    VAL H N   1 
ATOM   11   C CA  . VAL A 1 2   ? 36.783  5.779   30.927  1.00 66.40  ? 2    VAL H CA  1 
ATOM   12   C C   . VAL A 1 2   ? 35.568  5.789   29.998  1.00 63.97  ? 2    VAL H C   1 
ATOM   13   O O   . VAL A 1 2   ? 35.098  6.852   29.592  1.00 62.47  ? 2    VAL H O   1 
ATOM   14   C CB  . VAL A 1 2   ? 36.437  6.473   32.275  1.00 63.91  ? 2    VAL H CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? 35.188  5.865   32.893  1.00 62.78  ? 2    VAL H CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? 37.590  6.367   33.259  1.00 65.50  ? 2    VAL H CG2 1 
ATOM   17   N N   . GLN A 1 3   ? 35.072  4.604   29.657  1.00 63.15  ? 3    GLN H N   1 
ATOM   18   C CA  . GLN A 1 3   ? 33.872  4.491   28.826  1.00 61.83  ? 3    GLN H CA  1 
ATOM   19   C C   . GLN A 1 3   ? 32.846  3.520   29.414  1.00 60.01  ? 3    GLN H C   1 
ATOM   20   O O   . GLN A 1 3   ? 33.197  2.586   30.135  1.00 61.01  ? 3    GLN H O   1 
ATOM   21   C CB  . GLN A 1 3   ? 34.246  4.083   27.402  1.00 65.82  ? 3    GLN H CB  1 
ATOM   22   C CG  . GLN A 1 3   ? 35.062  5.147   26.676  1.00 65.62  ? 3    GLN H CG  1 
ATOM   23   C CD  . GLN A 1 3   ? 36.232  4.576   25.878  1.00 85.83  ? 3    GLN H CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? 36.275  3.381   25.553  1.00 89.98  ? 3    GLN H OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? 37.190  5.440   25.553  1.00 89.05  ? 3    GLN H NE2 1 
ATOM   26   N N   . LEU A 1 4   ? 31.574  3.766   29.108  1.00 55.83  ? 4    LEU H N   1 
ATOM   27   C CA  . LEU A 1 4   ? 30.479  2.926   29.568  1.00 53.55  ? 4    LEU H CA  1 
ATOM   28   C C   . LEU A 1 4   ? 29.578  2.587   28.390  1.00 52.26  ? 4    LEU H C   1 
ATOM   29   O O   . LEU A 1 4   ? 28.646  3.328   28.077  1.00 51.69  ? 4    LEU H O   1 
ATOM   30   C CB  . LEU A 1 4   ? 29.691  3.628   30.681  1.00 51.02  ? 4    LEU H CB  1 
ATOM   31   C CG  . LEU A 1 4   ? 30.396  3.835   32.030  1.00 50.82  ? 4    LEU H CG  1 
ATOM   32   C CD1 . LEU A 1 4   ? 29.483  4.564   33.006  1.00 48.98  ? 4    LEU H CD1 1 
ATOM   33   C CD2 . LEU A 1 4   ? 30.863  2.523   32.641  1.00 52.49  ? 4    LEU H CD2 1 
ATOM   34   N N   . GLN A 1 5   ? 29.876  1.465   27.740  1.00 53.41  ? 5    GLN H N   1 
ATOM   35   C CA  . GLN A 1 5   ? 29.175  1.042   26.523  1.00 53.03  ? 5    GLN H CA  1 
ATOM   36   C C   . GLN A 1 5   ? 27.896  0.286   26.889  1.00 51.89  ? 5    GLN H C   1 
ATOM   37   O O   . GLN A 1 5   ? 27.953  -0.790  27.475  1.00 53.58  ? 5    GLN H O   1 
ATOM   38   C CB  . GLN A 1 5   ? 30.090  0.174   25.633  1.00 55.96  ? 5    GLN H CB  1 
ATOM   39   C CG  . GLN A 1 5   ? 31.521  0.704   25.496  1.00 57.80  ? 5    GLN H CG  1 
ATOM   40   C CD  . GLN A 1 5   ? 32.408  -0.085  24.530  1.00 61.01  ? 5    GLN H CD  1 
ATOM   41   O OE1 . GLN A 1 5   ? 32.209  -1.281  24.289  1.00 61.54  ? 5    GLN H OE1 1 
ATOM   42   N NE2 . GLN A 1 5   ? 33.412  0.594   23.981  1.00 61.69  ? 5    GLN H NE2 1 
ATOM   43   N N   . GLN A 1 6   ? 26.747  0.864   26.546  1.00 49.63  ? 6    GLN H N   1 
ATOM   44   C CA  . GLN A 1 6   ? 25.449  0.248   26.843  1.00 48.74  ? 6    GLN H CA  1 
ATOM   45   C C   . GLN A 1 6   ? 24.921  -0.566  25.665  1.00 50.43  ? 6    GLN H C   1 
ATOM   46   O O   . GLN A 1 6   ? 25.413  -0.410  24.548  1.00 49.16  ? 6    GLN H O   1 
ATOM   47   C CB  . GLN A 1 6   ? 24.428  1.310   27.244  1.00 46.81  ? 6    GLN H CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 24.762  2.019   28.548  1.00 44.89  ? 6    GLN H CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 23.626  2.882   29.032  1.00 43.29  ? 6    GLN H CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 22.502  2.414   29.185  1.00 43.86  ? 6    GLN H OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 23.910  4.152   29.274  1.00 40.77  ? 6    GLN H NE2 1 
ATOM   52   N N   . SER A 1 7   ? 23.927  -1.420  25.915  1.00 51.28  ? 7    SER H N   1 
ATOM   53   C CA  . SER A 1 7   ? 23.332  -2.276  24.880  1.00 53.02  ? 7    SER H CA  1 
ATOM   54   C C   . SER A 1 7   ? 22.439  -1.487  23.923  1.00 53.05  ? 7    SER H C   1 
ATOM   55   O O   . SER A 1 7   ? 22.117  -0.314  24.175  1.00 52.00  ? 7    SER H O   1 
ATOM   56   C CB  . SER A 1 7   ? 22.551  -3.428  25.517  1.00 54.40  ? 7    SER H CB  1 
ATOM   57   O OG  . SER A 1 7   ? 21.481  -2.952  26.318  1.00 53.46  ? 7    SER H OG  1 
ATOM   58   N N   . GLY A 1 8   ? 22.038  -2.134  22.828  1.00 54.62  ? 8    GLY H N   1 
ATOM   59   C CA  . GLY A 1 8   ? 21.320  -1.462  21.736  1.00 55.59  ? 8    GLY H CA  1 
ATOM   60   C C   . GLY A 1 8   ? 19.880  -1.081  22.043  1.00 55.85  ? 8    GLY H C   1 
ATOM   61   O O   . GLY A 1 8   ? 19.365  -1.423  23.107  1.00 56.02  ? 8    GLY H O   1 
ATOM   62   N N   . PRO A 1 9   ? 19.217  -0.368  21.105  1.00 56.27  ? 9    PRO H N   1 
ATOM   63   C CA  . PRO A 1 9   ? 17.821  0.043   21.303  1.00 55.99  ? 9    PRO H CA  1 
ATOM   64   C C   . PRO A 1 9   ? 16.870  -1.153  21.372  1.00 57.58  ? 9    PRO H C   1 
ATOM   65   O O   . PRO A 1 9   ? 17.155  -2.211  20.810  1.00 59.21  ? 9    PRO H O   1 
ATOM   66   C CB  . PRO A 1 9   ? 17.529  0.920   20.079  1.00 55.73  ? 9    PRO H CB  1 
ATOM   67   C CG  . PRO A 1 9   ? 18.514  0.484   19.050  1.00 56.82  ? 9    PRO H CG  1 
ATOM   68   C CD  . PRO A 1 9   ? 19.750  0.105   19.813  1.00 56.16  ? 9    PRO H CD  1 
ATOM   69   N N   . GLU A 1 10  ? 15.763  -0.988  22.093  1.00 58.29  ? 10   GLU H N   1 
ATOM   70   C CA  . GLU A 1 10  ? 14.816  -2.084  22.333  1.00 59.08  ? 10   GLU H CA  1 
ATOM   71   C C   . GLU A 1 10  ? 13.384  -1.692  21.983  1.00 58.89  ? 10   GLU H C   1 
ATOM   72   O O   . GLU A 1 10  ? 12.916  -0.610  22.359  1.00 56.90  ? 10   GLU H O   1 
ATOM   73   C CB  . GLU A 1 10  ? 14.863  -2.522  23.798  1.00 60.01  ? 10   GLU H CB  1 
ATOM   74   C CG  . GLU A 1 10  ? 16.236  -2.922  24.301  1.00 62.01  ? 10   GLU H CG  1 
ATOM   75   C CD  . GLU A 1 10  ? 16.507  -4.415  24.207  1.00 66.64  ? 10   GLU H CD  1 
ATOM   76   O OE1 . GLU A 1 10  ? 15.835  -5.123  23.421  1.00 69.68  ? 10   GLU H OE1 1 
ATOM   77   O OE2 . GLU A 1 10  ? 17.397  -4.896  24.942  1.00 68.74  ? 10   GLU H OE2 1 
ATOM   78   N N   . LEU A 1 11  ? 12.695  -2.577  21.263  1.00 59.96  ? 11   LEU H N   1 
ATOM   79   C CA  . LEU A 1 11  ? 11.245  -2.480  21.105  1.00 60.72  ? 11   LEU H CA  1 
ATOM   80   C C   . LEU A 1 11  ? 10.619  -3.644  21.869  1.00 63.00  ? 11   LEU H C   1 
ATOM   81   O O   . LEU A 1 11  ? 10.841  -4.813  21.546  1.00 63.35  ? 11   LEU H O   1 
ATOM   82   C CB  . LEU A 1 11  ? 10.804  -2.466  19.626  1.00 61.57  ? 11   LEU H CB  1 
ATOM   83   C CG  . LEU A 1 11  ? 9.285   -2.499  19.333  1.00 63.17  ? 11   LEU H CG  1 
ATOM   84   C CD1 . LEU A 1 11  ? 8.589   -1.193  19.681  1.00 62.17  ? 11   LEU H CD1 1 
ATOM   85   C CD2 . LEU A 1 11  ? 8.963   -2.884  17.893  1.00 65.14  ? 11   LEU H CD2 1 
ATOM   86   N N   . VAL A 1 12  ? 9.857   -3.319  22.903  1.00 63.83  ? 12   VAL H N   1 
ATOM   87   C CA  . VAL A 1 12  ? 9.272   -4.363  23.728  1.00 66.83  ? 12   VAL H CA  1 
ATOM   88   C C   . VAL A 1 12  ? 7.751   -4.235  23.839  1.00 68.45  ? 12   VAL H C   1 
ATOM   89   O O   . VAL A 1 12  ? 7.215   -3.121  23.826  1.00 67.10  ? 12   VAL H O   1 
ATOM   90   C CB  . VAL A 1 12  ? 10.007  -4.473  25.088  1.00 66.35  ? 12   VAL H CB  1 
ATOM   91   C CG1 . VAL A 1 12  ? 9.041   -4.700  26.244  1.00 67.90  ? 12   VAL H CG1 1 
ATOM   92   C CG2 . VAL A 1 12  ? 11.030  -5.601  25.017  1.00 67.60  ? 12   VAL H CG2 1 
ATOM   93   N N   . LYS A 1 13  ? 7.070   -5.385  23.915  1.00 70.94  ? 13   LYS H N   1 
ATOM   94   C CA  . LYS A 1 13  ? 5.614   -5.425  24.002  1.00 73.04  ? 13   LYS H CA  1 
ATOM   95   C C   . LYS A 1 13  ? 5.110   -5.004  25.386  1.00 73.16  ? 13   LYS H C   1 
ATOM   96   O O   . LYS A 1 13  ? 5.761   -5.288  26.391  1.00 71.85  ? 13   LYS H O   1 
ATOM   97   C CB  . LYS A 1 13  ? 5.091   -6.803  23.600  1.00 76.41  ? 13   LYS H CB  1 
ATOM   98   C CG  . LYS A 1 13  ? 4.783   -6.882  22.117  1.00 77.80  ? 13   LYS H CG  1 
ATOM   99   C CD  . LYS A 1 13  ? 4.719   -8.314  21.617  1.00 81.22  ? 13   LYS H CD  1 
ATOM   100  C CE  . LYS A 1 13  ? 6.046   -8.725  20.994  1.00 80.66  ? 13   LYS H CE  1 
ATOM   101  N NZ  . LYS A 1 13  ? 5.926   -9.951  20.152  1.00 83.42  ? 13   LYS H NZ  1 
ATOM   102  N N   . PRO A 1 14  ? 3.956   -4.307  25.436  1.00 74.67  ? 14   PRO H N   1 
ATOM   103  C CA  . PRO A 1 14  ? 3.463   -3.666  26.659  1.00 75.57  ? 14   PRO H CA  1 
ATOM   104  C C   . PRO A 1 14  ? 3.150   -4.582  27.852  1.00 78.16  ? 14   PRO H C   1 
ATOM   105  O O   . PRO A 1 14  ? 2.397   -4.188  28.738  1.00 80.23  ? 14   PRO H O   1 
ATOM   106  C CB  . PRO A 1 14  ? 2.195   -2.944  26.184  1.00 76.57  ? 14   PRO H CB  1 
ATOM   107  C CG  . PRO A 1 14  ? 2.437   -2.691  24.739  1.00 75.92  ? 14   PRO H CG  1 
ATOM   108  C CD  . PRO A 1 14  ? 3.123   -3.939  24.275  1.00 76.33  ? 14   PRO H CD  1 
ATOM   109  N N   . GLY A 1 15  ? 3.731   -5.777  27.889  1.00 79.72  ? 15   GLY H N   1 
ATOM   110  C CA  . GLY A 1 15  ? 3.630   -6.644  29.065  1.00 82.16  ? 15   GLY H CA  1 
ATOM   111  C C   . GLY A 1 15  ? 4.978   -7.223  29.446  1.00 81.39  ? 15   GLY H C   1 
ATOM   112  O O   . GLY A 1 15  ? 5.200   -7.590  30.608  1.00 81.09  ? 15   GLY H O   1 
ATOM   113  N N   . ALA A 1 16  ? 5.880   -7.268  28.462  1.00 79.62  ? 16   ALA H N   1 
ATOM   114  C CA  . ALA A 1 16  ? 7.151   -7.993  28.545  1.00 78.90  ? 16   ALA H CA  1 
ATOM   115  C C   . ALA A 1 16  ? 8.159   -7.396  29.528  1.00 76.23  ? 16   ALA H C   1 
ATOM   116  O O   . ALA A 1 16  ? 7.832   -6.491  30.290  1.00 75.87  ? 16   ALA H O   1 
ATOM   117  C CB  . ALA A 1 16  ? 7.767   -8.120  27.158  1.00 78.04  ? 16   ALA H CB  1 
ATOM   118  N N   . SER A 1 17  ? 9.373   -7.945  29.515  1.00 75.86  ? 17   SER H N   1 
ATOM   119  C CA  . SER A 1 17  ? 10.510  -7.417  30.269  1.00 73.71  ? 17   SER H CA  1 
ATOM   120  C C   . SER A 1 17  ? 11.692  -7.170  29.335  1.00 72.29  ? 17   SER H C   1 
ATOM   121  O O   . SER A 1 17  ? 11.718  -7.684  28.213  1.00 73.48  ? 17   SER H O   1 
ATOM   122  C CB  . SER A 1 17  ? 10.934  -8.392  31.364  1.00 75.62  ? 17   SER H CB  1 
ATOM   123  O OG  . SER A 1 17  ? 10.125  -8.246  32.513  1.00 77.72  ? 17   SER H OG  1 
ATOM   124  N N   . VAL A 1 18  ? 12.667  -6.392  29.803  1.00 68.65  ? 18   VAL H N   1 
ATOM   125  C CA  . VAL A 1 18  ? 13.902  -6.160  29.061  1.00 67.16  ? 18   VAL H CA  1 
ATOM   126  C C   . VAL A 1 18  ? 15.099  -6.032  30.013  1.00 65.84  ? 18   VAL H C   1 
ATOM   127  O O   . VAL A 1 18  ? 14.962  -5.496  31.118  1.00 66.13  ? 18   VAL H O   1 
ATOM   128  C CB  . VAL A 1 18  ? 13.768  -4.929  28.120  1.00 65.60  ? 18   VAL H CB  1 
ATOM   129  C CG1 . VAL A 1 18  ? 13.644  -3.618  28.903  1.00 63.32  ? 18   VAL H CG1 1 
ATOM   130  C CG2 . VAL A 1 18  ? 14.918  -4.865  27.134  1.00 65.07  ? 18   VAL H CG2 1 
ATOM   131  N N   . LYS A 1 19  ? 16.260  -6.535  29.593  1.00 65.40  ? 19   LYS H N   1 
ATOM   132  C CA  . LYS A 1 19  ? 17.499  -6.368  30.357  1.00 64.29  ? 19   LYS H CA  1 
ATOM   133  C C   . LYS A 1 19  ? 18.540  -5.547  29.588  1.00 62.27  ? 19   LYS H C   1 
ATOM   134  O O   . LYS A 1 19  ? 18.956  -5.936  28.491  1.00 63.12  ? 19   LYS H O   1 
ATOM   135  C CB  . LYS A 1 19  ? 18.082  -7.722  30.773  1.00 67.10  ? 19   LYS H CB  1 
ATOM   136  C CG  . LYS A 1 19  ? 19.112  -7.610  31.891  1.00 67.12  ? 19   LYS H CG  1 
ATOM   137  C CD  . LYS A 1 19  ? 19.852  -8.911  32.144  1.00 69.10  ? 19   LYS H CD  1 
ATOM   138  C CE  . LYS A 1 19  ? 19.019  -9.866  32.969  1.00 72.21  ? 19   LYS H CE  1 
ATOM   139  N NZ  . LYS A 1 19  ? 19.889  -10.857 33.653  1.00 75.11  ? 19   LYS H NZ  1 
ATOM   140  N N   . ILE A 1 20  ? 18.950  -4.418  30.176  1.00 58.62  ? 20   ILE H N   1 
ATOM   141  C CA  . ILE A 1 20  ? 19.931  -3.491  29.574  1.00 55.87  ? 20   ILE H CA  1 
ATOM   142  C C   . ILE A 1 20  ? 21.309  -3.739  30.187  1.00 54.73  ? 20   ILE H C   1 
ATOM   143  O O   . ILE A 1 20  ? 21.413  -4.014  31.380  1.00 55.28  ? 20   ILE H O   1 
ATOM   144  C CB  . ILE A 1 20  ? 19.545  -2.013  29.833  1.00 54.07  ? 20   ILE H CB  1 
ATOM   145  C CG1 . ILE A 1 20  ? 18.060  -1.761  29.541  1.00 54.07  ? 20   ILE H CG1 1 
ATOM   146  C CG2 . ILE A 1 20  ? 20.433  -1.069  29.031  1.00 53.48  ? 20   ILE H CG2 1 
ATOM   147  C CD1 . ILE A 1 20  ? 17.564  -0.406  30.004  1.00 51.45  ? 20   ILE H CD1 1 
ATOM   148  N N   . SER A 1 21  ? 22.361  -3.642  29.376  1.00 53.41  ? 21   SER H N   1 
ATOM   149  C CA  . SER A 1 21  ? 23.733  -3.870  29.844  1.00 53.35  ? 21   SER H CA  1 
ATOM   150  C C   . SER A 1 21  ? 24.610  -2.603  29.782  1.00 51.54  ? 21   SER H C   1 
ATOM   151  O O   . SER A 1 21  ? 24.371  -1.693  28.973  1.00 48.33  ? 21   SER H O   1 
ATOM   152  C CB  . SER A 1 21  ? 24.384  -5.002  29.047  1.00 54.90  ? 21   SER H CB  1 
ATOM   153  O OG  . SER A 1 21  ? 24.610  -4.592  27.712  1.00 55.15  ? 21   SER H OG  1 
ATOM   154  N N   . CYS A 1 22  ? 25.631  -2.566  30.637  1.00 52.05  ? 22   CYS H N   1 
ATOM   155  C CA  . CYS A 1 22  ? 26.522  -1.409  30.744  1.00 50.92  ? 22   CYS H CA  1 
ATOM   156  C C   . CYS A 1 22  ? 27.965  -1.884  30.946  1.00 53.12  ? 22   CYS H C   1 
ATOM   157  O O   . CYS A 1 22  ? 28.352  -2.276  32.052  1.00 53.63  ? 22   CYS H O   1 
ATOM   158  C CB  . CYS A 1 22  ? 26.071  -0.503  31.898  1.00 49.68  ? 22   CYS H CB  1 
ATOM   159  S SG  . CYS A 1 22  ? 27.160  0.904   32.252  1.00 47.12  ? 22   CYS H SG  1 
ATOM   160  N N   . LYS A 1 23  ? 28.752  -1.866  29.871  1.00 53.62  ? 23   LYS H N   1 
ATOM   161  C CA  . LYS A 1 23  ? 30.112  -2.406  29.920  1.00 56.16  ? 23   LYS H CA  1 
ATOM   162  C C   . LYS A 1 23  ? 31.143  -1.328  30.232  1.00 54.67  ? 23   LYS H C   1 
ATOM   163  O O   . LYS A 1 23  ? 31.216  -0.308  29.542  1.00 54.45  ? 23   LYS H O   1 
ATOM   164  C CB  . LYS A 1 23  ? 30.463  -3.153  28.623  1.00 57.48  ? 23   LYS H CB  1 
ATOM   165  C CG  . LYS A 1 23  ? 31.694  -4.038  28.741  1.00 60.35  ? 23   LYS H CG  1 
ATOM   166  C CD  . LYS A 1 23  ? 31.878  -4.904  27.504  1.00 62.41  ? 23   LYS H CD  1 
ATOM   167  C CE  . LYS A 1 23  ? 33.168  -5.704  27.568  1.00 65.13  ? 23   LYS H CE  1 
ATOM   168  N NZ  . LYS A 1 23  ? 33.146  -6.709  28.665  1.00 67.84  ? 23   LYS H NZ  1 
ATOM   169  N N   . ALA A 1 24  ? 31.938  -1.563  31.275  1.00 55.92  ? 24   ALA H N   1 
ATOM   170  C CA  . ALA A 1 24  ? 32.903  -0.567  31.766  1.00 55.30  ? 24   ALA H CA  1 
ATOM   171  C C   . ALA A 1 24  ? 34.340  -0.769  31.250  1.00 56.27  ? 24   ALA H C   1 
ATOM   172  O O   . ALA A 1 24  ? 34.831  -1.894  31.168  1.00 58.60  ? 24   ALA H O   1 
ATOM   173  C CB  . ALA A 1 24  ? 32.885  -0.524  33.291  1.00 55.31  ? 24   ALA H CB  1 
ATOM   174  N N   . SER A 1 25  ? 35.011  0.335   30.927  1.00 54.99  ? 25   SER H N   1 
ATOM   175  C CA  . SER A 1 25  ? 36.403  0.284   30.481  1.00 56.19  ? 25   SER H CA  1 
ATOM   176  C C   . SER A 1 25  ? 37.218  1.463   30.991  1.00 54.62  ? 25   SER H C   1 
ATOM   177  O O   . SER A 1 25  ? 36.682  2.558   31.175  1.00 52.76  ? 25   SER H O   1 
ATOM   178  C CB  . SER A 1 25  ? 36.493  0.185   28.941  1.00 56.07  ? 25   SER H CB  1 
ATOM   179  O OG  . SER A 1 25  ? 35.529  1.012   28.305  1.00 54.04  ? 25   SER H OG  1 
ATOM   180  N N   . GLY A 1 26  ? 38.509  1.219   31.222  1.00 56.52  ? 26   GLY H N   1 
ATOM   181  C CA  . GLY A 1 26  ? 39.473  2.278   31.557  1.00 56.48  ? 26   GLY H CA  1 
ATOM   182  C C   . GLY A 1 26  ? 39.530  2.670   33.023  1.00 56.09  ? 26   GLY H C   1 
ATOM   183  O O   . GLY A 1 26  ? 40.090  3.716   33.374  1.00 55.95  ? 26   GLY H O   1 
ATOM   184  N N   . TYR A 1 27  ? 38.937  1.836   33.874  1.00 56.09  ? 27   TYR H N   1 
ATOM   185  C CA  . TYR A 1 27  ? 38.999  2.001   35.330  1.00 55.77  ? 27   TYR H CA  1 
ATOM   186  C C   . TYR A 1 27  ? 38.671  0.670   36.016  1.00 57.74  ? 27   TYR H C   1 
ATOM   187  O O   . TYR A 1 27  ? 38.171  -0.262  35.371  1.00 57.22  ? 27   TYR H O   1 
ATOM   188  C CB  . TYR A 1 27  ? 38.072  3.118   35.802  1.00 53.22  ? 27   TYR H CB  1 
ATOM   189  C CG  . TYR A 1 27  ? 36.598  2.753   35.874  1.00 52.59  ? 27   TYR H CG  1 
ATOM   190  C CD1 . TYR A 1 27  ? 35.799  2.770   34.731  1.00 50.51  ? 27   TYR H CD1 1 
ATOM   191  C CD2 . TYR A 1 27  ? 36.000  2.395   37.101  1.00 52.61  ? 27   TYR H CD2 1 
ATOM   192  C CE1 . TYR A 1 27  ? 34.453  2.439   34.794  1.00 49.93  ? 27   TYR H CE1 1 
ATOM   193  C CE2 . TYR A 1 27  ? 34.656  2.054   37.173  1.00 51.46  ? 27   TYR H CE2 1 
ATOM   194  C CZ  . TYR A 1 27  ? 33.883  2.086   36.019  1.00 50.12  ? 27   TYR H CZ  1 
ATOM   195  O OH  . TYR A 1 27  ? 32.546  1.760   36.063  1.00 49.16  ? 27   TYR H OH  1 
ATOM   196  N N   . SER A 1 28  ? 38.967  0.587   37.315  1.00 58.67  ? 28   SER H N   1 
ATOM   197  C CA  . SER A 1 28  ? 38.631  -0.578  38.133  1.00 60.12  ? 28   SER H CA  1 
ATOM   198  C C   . SER A 1 28  ? 37.123  -0.601  38.431  1.00 58.16  ? 28   SER H C   1 
ATOM   199  O O   . SER A 1 28  ? 36.632  0.119   39.315  1.00 57.08  ? 28   SER H O   1 
ATOM   200  C CB  . SER A 1 28  ? 39.446  -0.566  39.427  1.00 62.54  ? 28   SER H CB  1 
ATOM   201  O OG  . SER A 1 28  ? 39.339  -1.795  40.120  1.00 64.74  ? 28   SER H OG  1 
ATOM   202  N N   . PHE A 1 29  ? 36.410  -1.446  37.682  1.00 57.23  ? 29   PHE H N   1 
ATOM   203  C CA  . PHE A 1 29  ? 34.940  -1.537  37.690  1.00 54.83  ? 29   PHE H CA  1 
ATOM   204  C C   . PHE A 1 29  ? 34.307  -1.733  39.075  1.00 55.48  ? 29   PHE H C   1 
ATOM   205  O O   . PHE A 1 29  ? 33.319  -1.082  39.414  1.00 53.49  ? 29   PHE H O   1 
ATOM   206  C CB  . PHE A 1 29  ? 34.506  -2.657  36.734  1.00 54.76  ? 29   PHE H CB  1 
ATOM   207  C CG  . PHE A 1 29  ? 33.045  -3.010  36.808  1.00 53.60  ? 29   PHE H CG  1 
ATOM   208  C CD1 . PHE A 1 29  ? 32.060  -2.080  36.462  1.00 50.89  ? 29   PHE H CD1 1 
ATOM   209  C CD2 . PHE A 1 29  ? 32.653  -4.297  37.198  1.00 55.72  ? 29   PHE H CD2 1 
ATOM   210  C CE1 . PHE A 1 29  ? 30.719  -2.417  36.508  1.00 50.46  ? 29   PHE H CE1 1 
ATOM   211  C CE2 . PHE A 1 29  ? 31.309  -4.640  37.250  1.00 55.27  ? 29   PHE H CE2 1 
ATOM   212  C CZ  . PHE A 1 29  ? 30.342  -3.701  36.911  1.00 52.53  ? 29   PHE H CZ  1 
ATOM   213  N N   . THR A 1 30  ? 34.883  -2.635  39.864  1.00 58.16  ? 30   THR H N   1 
ATOM   214  C CA  . THR A 1 30  ? 34.368  -2.930  41.200  1.00 59.22  ? 30   THR H CA  1 
ATOM   215  C C   . THR A 1 30  ? 34.795  -1.867  42.227  1.00 58.94  ? 30   THR H C   1 
ATOM   216  O O   . THR A 1 30  ? 34.503  -1.990  43.407  1.00 60.03  ? 30   THR H O   1 
ATOM   217  C CB  . THR A 1 30  ? 34.816  -4.330  41.667  1.00 62.42  ? 30   THR H CB  1 
ATOM   218  O OG1 . THR A 1 30  ? 36.242  -4.402  41.642  1.00 63.72  ? 30   THR H OG1 1 
ATOM   219  C CG2 . THR A 1 30  ? 34.253  -5.412  40.757  1.00 63.04  ? 30   THR H CG2 1 
ATOM   220  N N   . GLY A 1 31  ? 35.472  -0.815  41.772  1.00 57.63  ? 31   GLY H N   1 
ATOM   221  C CA  . GLY A 1 31  ? 35.972  0.219   42.676  1.00 57.56  ? 31   GLY H CA  1 
ATOM   222  C C   . GLY A 1 31  ? 35.042  1.398   42.862  1.00 54.99  ? 31   GLY H C   1 
ATOM   223  O O   . GLY A 1 31  ? 35.257  2.220   43.754  1.00 55.81  ? 31   GLY H O   1 
ATOM   224  N N   . TYR A 1 32  ? 34.008  1.481   42.024  1.00 52.52  ? 32   TYR H N   1 
ATOM   225  C CA  . TYR A 1 32  ? 33.084  2.618   42.006  1.00 49.50  ? 32   TYR H CA  1 
ATOM   226  C C   . TYR A 1 32  ? 31.622  2.172   41.900  1.00 48.15  ? 32   TYR H C   1 
ATOM   227  O O   . TYR A 1 32  ? 31.309  1.230   41.182  1.00 48.12  ? 32   TYR H O   1 
ATOM   228  C CB  . TYR A 1 32  ? 33.387  3.515   40.793  1.00 47.89  ? 32   TYR H CB  1 
ATOM   229  C CG  . TYR A 1 32  ? 34.772  4.131   40.719  1.00 48.85  ? 32   TYR H CG  1 
ATOM   230  C CD1 . TYR A 1 32  ? 35.891  3.356   40.433  1.00 51.99  ? 32   TYR H CD1 1 
ATOM   231  C CD2 . TYR A 1 32  ? 34.951  5.513   40.882  1.00 48.03  ? 32   TYR H CD2 1 
ATOM   232  C CE1 . TYR A 1 32  ? 37.155  3.920   40.347  1.00 53.55  ? 32   TYR H CE1 1 
ATOM   233  C CE2 . TYR A 1 32  ? 36.207  6.090   40.790  1.00 48.62  ? 32   TYR H CE2 1 
ATOM   234  C CZ  . TYR A 1 32  ? 37.300  5.293   40.520  1.00 52.03  ? 32   TYR H CZ  1 
ATOM   235  O OH  . TYR A 1 32  ? 38.555  5.848   40.431  1.00 54.46  ? 32   TYR H OH  1 
ATOM   236  N N   . TYR A 1 33  ? 30.724  2.877   42.581  1.00 46.70  ? 33   TYR H N   1 
ATOM   237  C CA  . TYR A 1 33  ? 29.280  2.676   42.415  1.00 46.10  ? 33   TYR H CA  1 
ATOM   238  C C   . TYR A 1 33  ? 28.780  2.905   41.001  1.00 44.67  ? 33   TYR H C   1 
ATOM   239  O O   . TYR A 1 33  ? 29.308  3.753   40.270  1.00 43.17  ? 33   TYR H O   1 
ATOM   240  C CB  . TYR A 1 33  ? 28.496  3.621   43.331  1.00 45.22  ? 33   TYR H CB  1 
ATOM   241  C CG  . TYR A 1 33  ? 28.747  3.356   44.784  1.00 47.42  ? 33   TYR H CG  1 
ATOM   242  C CD1 . TYR A 1 33  ? 28.310  2.170   45.377  1.00 49.69  ? 33   TYR H CD1 1 
ATOM   243  C CD2 . TYR A 1 33  ? 29.422  4.282   45.561  1.00 47.35  ? 33   TYR H CD2 1 
ATOM   244  C CE1 . TYR A 1 33  ? 28.539  1.923   46.723  1.00 52.32  ? 33   TYR H CE1 1 
ATOM   245  C CE2 . TYR A 1 33  ? 29.653  4.053   46.899  1.00 49.69  ? 33   TYR H CE2 1 
ATOM   246  C CZ  . TYR A 1 33  ? 29.213  2.878   47.473  1.00 52.28  ? 33   TYR H CZ  1 
ATOM   247  O OH  . TYR A 1 33  ? 29.455  2.660   48.798  1.00 54.49  ? 33   TYR H OH  1 
ATOM   248  N N   . MET A 1 34  ? 27.721  2.176   40.655  1.00 45.25  ? 34   MET H N   1 
ATOM   249  C CA  . MET A 1 34  ? 27.051  2.304   39.366  1.00 44.29  ? 34   MET H CA  1 
ATOM   250  C C   . MET A 1 34  ? 25.587  2.710   39.565  1.00 42.60  ? 34   MET H C   1 
ATOM   251  O O   . MET A 1 34  ? 24.850  2.059   40.309  1.00 43.99  ? 34   MET H O   1 
ATOM   252  C CB  . MET A 1 34  ? 27.155  0.983   38.585  1.00 46.33  ? 34   MET H CB  1 
ATOM   253  C CG  . MET A 1 34  ? 26.812  1.090   37.102  1.00 46.24  ? 34   MET H CG  1 
ATOM   254  S SD  . MET A 1 34  ? 27.743  2.384   36.237  1.00 45.55  ? 34   MET H SD  1 
ATOM   255  C CE  . MET A 1 34  ? 29.416  1.771   36.452  1.00 46.14  ? 34   MET H CE  1 
ATOM   256  N N   . ASN A 1 35  ? 25.173  3.781   38.896  1.00 39.79  ? 35   ASN H N   1 
ATOM   257  C CA  . ASN A 1 35  ? 23.796  4.256   38.961  1.00 38.68  ? 35   ASN H CA  1 
ATOM   258  C C   . ASN A 1 35  ? 23.032  4.130   37.641  1.00 38.52  ? 35   ASN H C   1 
ATOM   259  O O   . ASN A 1 35  ? 23.624  3.968   36.561  1.00 38.08  ? 35   ASN H O   1 
ATOM   260  C CB  . ASN A 1 35  ? 23.743  5.704   39.481  1.00 37.40  ? 35   ASN H CB  1 
ATOM   261  C CG  . ASN A 1 35  ? 24.176  5.817   40.940  1.00 38.22  ? 35   ASN H CG  1 
ATOM   262  O OD1 . ASN A 1 35  ? 23.346  5.967   41.842  1.00 38.37  ? 35   ASN H OD1 1 
ATOM   263  N ND2 . ASN A 1 35  ? 25.484  5.707   41.176  1.00 38.72  ? 35   ASN H ND2 1 
ATOM   264  N N   . TRP A 1 36  ? 21.709  4.201   37.739  1.00 38.89  ? 36   TRP H N   1 
ATOM   265  C CA  . TRP A 1 36  ? 20.841  4.173   36.579  1.00 39.22  ? 36   TRP H CA  1 
ATOM   266  C C   . TRP A 1 36  ? 19.850  5.334   36.628  1.00 37.84  ? 36   TRP H C   1 
ATOM   267  O O   . TRP A 1 36  ? 19.309  5.650   37.686  1.00 38.05  ? 36   TRP H O   1 
ATOM   268  C CB  . TRP A 1 36  ? 20.124  2.824   36.480  1.00 41.36  ? 36   TRP H CB  1 
ATOM   269  C CG  . TRP A 1 36  ? 21.060  1.663   36.201  1.00 42.70  ? 36   TRP H CG  1 
ATOM   270  C CD1 . TRP A 1 36  ? 21.753  0.922   37.128  1.00 43.99  ? 36   TRP H CD1 1 
ATOM   271  C CD2 . TRP A 1 36  ? 21.404  1.114   34.915  1.00 42.98  ? 36   TRP H CD2 1 
ATOM   272  N NE1 . TRP A 1 36  ? 22.494  -0.058  36.503  1.00 44.96  ? 36   TRP H NE1 1 
ATOM   273  C CE2 . TRP A 1 36  ? 22.300  0.035   35.146  1.00 44.67  ? 36   TRP H CE2 1 
ATOM   274  C CE3 . TRP A 1 36  ? 21.038  1.417   33.593  1.00 42.17  ? 36   TRP H CE3 1 
ATOM   275  C CZ2 . TRP A 1 36  ? 22.838  -0.738  34.095  1.00 45.34  ? 36   TRP H CZ2 1 
ATOM   276  C CZ3 . TRP A 1 36  ? 21.574  0.643   32.552  1.00 42.64  ? 36   TRP H CZ3 1 
ATOM   277  C CH2 . TRP A 1 36  ? 22.459  -0.421  32.816  1.00 44.27  ? 36   TRP H CH2 1 
ATOM   278  N N   . VAL A 1 37  ? 19.641  5.963   35.471  1.00 37.16  ? 37   VAL H N   1 
ATOM   279  C CA  . VAL A 1 37  ? 18.814  7.164   35.315  1.00 36.04  ? 37   VAL H CA  1 
ATOM   280  C C   . VAL A 1 37  ? 17.875  7.009   34.114  1.00 37.17  ? 37   VAL H C   1 
ATOM   281  O O   . VAL A 1 37  ? 18.299  6.543   33.058  1.00 37.54  ? 37   VAL H O   1 
ATOM   282  C CB  . VAL A 1 37  ? 19.706  8.428   35.125  1.00 34.34  ? 37   VAL H CB  1 
ATOM   283  C CG1 . VAL A 1 37  ? 18.870  9.697   34.975  1.00 32.87  ? 37   VAL H CG1 1 
ATOM   284  C CG2 . VAL A 1 37  ? 20.682  8.549   36.286  1.00 33.44  ? 37   VAL H CG2 1 
ATOM   285  N N   . LYS A 1 38  ? 16.614  7.401   34.287  1.00 37.93  ? 38   LYS H N   1 
ATOM   286  C CA  . LYS A 1 38  ? 15.625  7.449   33.209  1.00 39.30  ? 38   LYS H CA  1 
ATOM   287  C C   . LYS A 1 38  ? 15.560  8.862   32.617  1.00 38.07  ? 38   LYS H C   1 
ATOM   288  O O   . LYS A 1 38  ? 15.590  9.843   33.352  1.00 38.06  ? 38   LYS H O   1 
ATOM   289  C CB  . LYS A 1 38  ? 14.243  7.043   33.756  1.00 40.38  ? 38   LYS H CB  1 
ATOM   290  C CG  . LYS A 1 38  ? 13.069  7.107   32.775  1.00 41.31  ? 38   LYS H CG  1 
ATOM   291  C CD  . LYS A 1 38  ? 11.783  6.579   33.406  1.00 43.48  ? 38   LYS H CD  1 
ATOM   292  C CE  . LYS A 1 38  ? 10.558  6.950   32.585  1.00 44.35  ? 38   LYS H CE  1 
ATOM   293  N NZ  . LYS A 1 38  ? 9.333   6.245   33.059  1.00 46.19  ? 38   LYS H NZ  1 
ATOM   294  N N   . GLN A 1 39  ? 15.475  8.964   31.298  1.00 38.14  ? 39   GLN H N   1 
ATOM   295  C CA  . GLN A 1 39  ? 15.158  10.247  30.664  1.00 37.70  ? 39   GLN H CA  1 
ATOM   296  C C   . GLN A 1 39  ? 13.906  10.138  29.789  1.00 40.05  ? 39   GLN H C   1 
ATOM   297  O O   . GLN A 1 39  ? 13.943  9.555   28.705  1.00 39.76  ? 39   GLN H O   1 
ATOM   298  C CB  . GLN A 1 39  ? 16.367  10.806  29.888  1.00 36.86  ? 39   GLN H CB  1 
ATOM   299  C CG  . GLN A 1 39  ? 16.066  12.137  29.223  1.00 36.18  ? 39   GLN H CG  1 
ATOM   300  C CD  . GLN A 1 39  ? 17.303  12.912  28.850  1.00 35.38  ? 39   GLN H CD  1 
ATOM   301  O OE1 . GLN A 1 39  ? 17.472  14.047  29.285  1.00 36.17  ? 39   GLN H OE1 1 
ATOM   302  N NE2 . GLN A 1 39  ? 18.173  12.312  28.046  1.00 34.18  ? 39   GLN H NE2 1 
ATOM   303  N N   . SER A 1 40  ? 12.799  10.695  30.272  1.00 42.42  ? 40   SER H N   1 
ATOM   304  C CA  . SER A 1 40  ? 11.510  10.622  29.567  1.00 47.57  ? 40   SER H CA  1 
ATOM   305  C C   . SER A 1 40  ? 11.593  11.392  28.235  1.00 48.93  ? 40   SER H C   1 
ATOM   306  O O   . SER A 1 40  ? 12.441  12.271  28.102  1.00 46.75  ? 40   SER H O   1 
ATOM   307  C CB  . SER A 1 40  ? 10.398  11.211  30.447  1.00 48.48  ? 40   SER H CB  1 
ATOM   308  O OG  . SER A 1 40  ? 10.606  12.611  30.661  1.00 48.06  ? 40   SER H OG  1 
ATOM   309  N N   . PRO A 1 41  ? 10.727  11.054  27.247  1.00 52.89  ? 41   PRO H N   1 
ATOM   310  C CA  . PRO A 1 41  ? 10.644  11.839  26.000  1.00 54.03  ? 41   PRO H CA  1 
ATOM   311  C C   . PRO A 1 41  ? 10.569  13.363  26.249  1.00 54.36  ? 41   PRO H C   1 
ATOM   312  O O   . PRO A 1 41  ? 11.070  14.145  25.440  1.00 53.98  ? 41   PRO H O   1 
ATOM   313  C CB  . PRO A 1 41  ? 9.353   11.326  25.325  1.00 56.74  ? 41   PRO H CB  1 
ATOM   314  C CG  . PRO A 1 41  ? 8.779   10.270  26.227  1.00 56.81  ? 41   PRO H CG  1 
ATOM   315  C CD  . PRO A 1 41  ? 9.853   9.865   27.197  1.00 55.37  ? 41   PRO H CD  1 
ATOM   316  N N   . GLU A 1 42  ? 9.971   13.757  27.374  1.00 55.73  ? 42   GLU H N   1 
ATOM   317  C CA  . GLU A 1 42  ? 9.906   15.156  27.818  1.00 55.96  ? 42   GLU H CA  1 
ATOM   318  C C   . GLU A 1 42  ? 11.252  15.685  28.353  1.00 54.40  ? 42   GLU H C   1 
ATOM   319  O O   . GLU A 1 42  ? 11.335  16.839  28.787  1.00 53.25  ? 42   GLU H O   1 
ATOM   320  C CB  . GLU A 1 42  ? 8.822   15.329  28.891  1.00 58.25  ? 42   GLU H CB  1 
ATOM   321  C CG  . GLU A 1 42  ? 7.432   14.841  28.490  1.00 63.93  ? 42   GLU H CG  1 
ATOM   322  C CD  . GLU A 1 42  ? 7.334   13.320  28.373  1.00 66.60  ? 42   GLU H CD  1 
ATOM   323  O OE1 . GLU A 1 42  ? 7.698   12.611  29.335  1.00 67.11  ? 42   GLU H OE1 1 
ATOM   324  O OE2 . GLU A 1 42  ? 6.893   12.824  27.312  1.00 69.98  ? 42   GLU H OE2 1 
ATOM   325  N N   . LYS A 1 43  ? 12.291  14.843  28.321  1.00 52.93  ? 43   LYS H N   1 
ATOM   326  C CA  . LYS A 1 43  ? 13.672  15.209  28.704  1.00 50.33  ? 43   LYS H CA  1 
ATOM   327  C C   . LYS A 1 43  ? 13.853  15.516  30.200  1.00 48.91  ? 43   LYS H C   1 
ATOM   328  O O   . LYS A 1 43  ? 14.781  16.220  30.594  1.00 46.08  ? 43   LYS H O   1 
ATOM   329  C CB  . LYS A 1 43  ? 14.224  16.358  27.835  1.00 52.29  ? 43   LYS H CB  1 
ATOM   330  C CG  . LYS A 1 43  ? 13.884  16.273  26.357  1.00 53.96  ? 43   LYS H CG  1 
ATOM   331  C CD  . LYS A 1 43  ? 14.376  17.515  25.629  1.00 57.13  ? 43   LYS H CD  1 
ATOM   332  C CE  . LYS A 1 43  ? 13.506  17.841  24.425  1.00 58.41  ? 43   LYS H CE  1 
ATOM   333  N NZ  . LYS A 1 43  ? 14.105  18.986  23.685  1.00 58.48  ? 43   LYS H NZ  1 
ATOM   334  N N   . SER A 1 44  ? 12.963  14.985  31.036  1.00 48.87  ? 44   SER H N   1 
ATOM   335  C CA  . SER A 1 44  ? 13.164  15.042  32.479  1.00 45.91  ? 44   SER H CA  1 
ATOM   336  C C   . SER A 1 44  ? 14.073  13.881  32.875  1.00 44.17  ? 44   SER H C   1 
ATOM   337  O O   . SER A 1 44  ? 14.061  12.840  32.217  1.00 47.12  ? 44   SER H O   1 
ATOM   338  C CB  . SER A 1 44  ? 11.826  14.962  33.214  1.00 48.16  ? 44   SER H CB  1 
ATOM   339  O OG  . SER A 1 44  ? 11.252  13.683  33.076  1.00 49.07  ? 44   SER H OG  1 
ATOM   340  N N   . LEU A 1 45  ? 14.856  14.061  33.942  1.00 39.66  ? 45   LEU H N   1 
ATOM   341  C CA  . LEU A 1 45  ? 15.772  13.029  34.436  1.00 36.41  ? 45   LEU H CA  1 
ATOM   342  C C   . LEU A 1 45  ? 15.292  12.430  35.770  1.00 37.87  ? 45   LEU H C   1 
ATOM   343  O O   . LEU A 1 45  ? 14.944  13.172  36.683  1.00 36.91  ? 45   LEU H O   1 
ATOM   344  C CB  . LEU A 1 45  ? 17.187  13.604  34.575  1.00 33.68  ? 45   LEU H CB  1 
ATOM   345  C CG  . LEU A 1 45  ? 17.925  13.918  33.258  1.00 32.06  ? 45   LEU H CG  1 
ATOM   346  C CD1 . LEU A 1 45  ? 19.230  14.659  33.526  1.00 29.57  ? 45   LEU H CD1 1 
ATOM   347  C CD2 . LEU A 1 45  ? 18.193  12.640  32.466  1.00 32.68  ? 45   LEU H CD2 1 
ATOM   348  N N   . GLU A 1 46  ? 15.275  11.100  35.877  1.00 38.63  ? 46   GLU H N   1 
ATOM   349  C CA  . GLU A 1 46  ? 14.867  10.420  37.126  1.00 41.17  ? 46   GLU H CA  1 
ATOM   350  C C   . GLU A 1 46  ? 15.912  9.404   37.574  1.00 40.83  ? 46   GLU H C   1 
ATOM   351  O O   . GLU A 1 46  ? 16.329  8.553   36.784  1.00 40.88  ? 46   GLU H O   1 
ATOM   352  C CB  . GLU A 1 46  ? 13.547  9.682   36.945  1.00 44.42  ? 46   GLU H CB  1 
ATOM   353  C CG  . GLU A 1 46  ? 12.311  10.553  36.874  1.00 47.16  ? 46   GLU H CG  1 
ATOM   354  C CD  . GLU A 1 46  ? 11.056  9.740   36.581  1.00 50.54  ? 46   GLU H CD  1 
ATOM   355  O OE1 . GLU A 1 46  ? 10.939  9.197   35.454  1.00 51.98  ? 46   GLU H OE1 1 
ATOM   356  O OE2 . GLU A 1 46  ? 10.180  9.658   37.467  1.00 53.41  ? 46   GLU H OE2 1 
ATOM   357  N N   . TRP A 1 47  ? 16.334  9.493   38.833  1.00 39.74  ? 47   TRP H N   1 
ATOM   358  C CA  . TRP A 1 47  ? 17.273  8.539   39.389  1.00 39.21  ? 47   TRP H CA  1 
ATOM   359  C C   . TRP A 1 47  ? 16.509  7.260   39.709  1.00 41.03  ? 47   TRP H C   1 
ATOM   360  O O   . TRP A 1 47  ? 15.527  7.286   40.465  1.00 41.72  ? 47   TRP H O   1 
ATOM   361  C CB  . TRP A 1 47  ? 17.913  9.101   40.659  1.00 39.49  ? 47   TRP H CB  1 
ATOM   362  C CG  . TRP A 1 47  ? 18.887  8.178   41.362  1.00 40.77  ? 47   TRP H CG  1 
ATOM   363  C CD1 . TRP A 1 47  ? 20.156  7.848   40.944  1.00 40.58  ? 47   TRP H CD1 1 
ATOM   364  C CD2 . TRP A 1 47  ? 18.693  7.504   42.626  1.00 42.45  ? 47   TRP H CD2 1 
ATOM   365  N NE1 . TRP A 1 47  ? 20.750  7.001   41.860  1.00 42.31  ? 47   TRP H NE1 1 
ATOM   366  C CE2 . TRP A 1 47  ? 19.879  6.775   42.899  1.00 43.27  ? 47   TRP H CE2 1 
ATOM   367  C CE3 . TRP A 1 47  ? 17.637  7.447   43.548  1.00 43.50  ? 47   TRP H CE3 1 
ATOM   368  C CZ2 . TRP A 1 47  ? 20.039  5.990   44.067  1.00 44.88  ? 47   TRP H CZ2 1 
ATOM   369  C CZ3 . TRP A 1 47  ? 17.795  6.651   44.721  1.00 45.73  ? 47   TRP H CZ3 1 
ATOM   370  C CH2 . TRP A 1 47  ? 18.985  5.938   44.956  1.00 45.87  ? 47   TRP H CH2 1 
ATOM   371  N N   . ILE A 1 48  ? 16.956  6.151   39.136  1.00 40.69  ? 48   ILE H N   1 
ATOM   372  C CA  . ILE A 1 48  ? 16.287  4.861   39.346  1.00 42.76  ? 48   ILE H CA  1 
ATOM   373  C C   . ILE A 1 48  ? 16.820  4.158   40.595  1.00 43.74  ? 48   ILE H C   1 
ATOM   374  O O   . ILE A 1 48  ? 16.053  3.616   41.394  1.00 45.77  ? 48   ILE H O   1 
ATOM   375  C CB  . ILE A 1 48  ? 16.425  3.947   38.102  1.00 42.82  ? 48   ILE H CB  1 
ATOM   376  C CG1 . ILE A 1 48  ? 15.665  4.555   36.917  1.00 41.59  ? 48   ILE H CG1 1 
ATOM   377  C CG2 . ILE A 1 48  ? 15.943  2.520   38.393  1.00 44.92  ? 48   ILE H CG2 1 
ATOM   378  C CD1 . ILE A 1 48  ? 16.032  3.941   35.583  1.00 42.03  ? 48   ILE H CD1 1 
ATOM   379  N N   . GLY A 1 49  ? 18.135  4.171   40.752  1.00 43.08  ? 49   GLY H N   1 
ATOM   380  C CA  . GLY A 1 49  ? 18.765  3.430   41.814  1.00 45.08  ? 49   GLY H CA  1 
ATOM   381  C C   . GLY A 1 49  ? 20.254  3.259   41.626  1.00 44.79  ? 49   GLY H C   1 
ATOM   382  O O   . GLY A 1 49  ? 20.816  3.608   40.584  1.00 43.43  ? 49   GLY H O   1 
ATOM   383  N N   . GLU A 1 50  ? 20.886  2.707   42.654  1.00 46.42  ? 50   GLU H N   1 
ATOM   384  C CA  . GLU A 1 50  ? 22.319  2.478   42.669  1.00 46.87  ? 50   GLU H CA  1 
ATOM   385  C C   . GLU A 1 50  ? 22.662  1.033   43.036  1.00 49.73  ? 50   GLU H C   1 
ATOM   386  O O   . GLU A 1 50  ? 21.966  0.404   43.847  1.00 51.21  ? 50   GLU H O   1 
ATOM   387  C CB  . GLU A 1 50  ? 22.964  3.413   43.670  1.00 46.08  ? 50   GLU H CB  1 
ATOM   388  C CG  . GLU A 1 50  ? 24.472  3.407   43.609  1.00 46.50  ? 50   GLU H CG  1 
ATOM   389  C CD  . GLU A 1 50  ? 25.084  4.370   44.595  1.00 46.26  ? 50   GLU H CD  1 
ATOM   390  O OE1 . GLU A 1 50  ? 24.963  4.101   45.806  1.00 46.98  ? 50   GLU H OE1 1 
ATOM   391  O OE2 . GLU A 1 50  ? 25.693  5.383   44.149  1.00 44.56  ? 50   GLU H OE2 1 
ATOM   392  N N   . MET A 1 51  ? 23.750  0.529   42.456  1.00 50.28  ? 51   MET H N   1 
ATOM   393  C CA  . MET A 1 51  ? 24.286  -0.801  42.779  1.00 53.41  ? 51   MET H CA  1 
ATOM   394  C C   . MET A 1 51  ? 25.788  -0.709  43.086  1.00 53.04  ? 51   MET H C   1 
ATOM   395  O O   . MET A 1 51  ? 26.500  0.078   42.476  1.00 51.25  ? 51   MET H O   1 
ATOM   396  C CB  . MET A 1 51  ? 24.019  -1.758  41.612  1.00 54.85  ? 51   MET H CB  1 
ATOM   397  C CG  . MET A 1 51  ? 24.349  -3.222  41.854  1.00 58.74  ? 51   MET H CG  1 
ATOM   398  S SD  . MET A 1 51  ? 24.277  -4.128  40.294  1.00 60.75  ? 51   MET H SD  1 
ATOM   399  C CE  . MET A 1 51  ? 25.409  -3.166  39.285  1.00 57.93  ? 51   MET H CE  1 
ATOM   400  N N   . SER A 1 52  ? 26.258  -1.484  44.059  1.00 54.55  ? 52   SER H N   1 
ATOM   401  C CA  . SER A 1 52  ? 27.692  -1.642  44.275  1.00 55.04  ? 52   SER H CA  1 
ATOM   402  C C   . SER A 1 52  ? 28.167  -2.906  43.539  1.00 56.76  ? 52   SER H C   1 
ATOM   403  O O   . SER A 1 52  ? 27.760  -4.006  43.903  1.00 59.09  ? 52   SER H O   1 
ATOM   404  C CB  . SER A 1 52  ? 28.012  -1.754  45.766  1.00 56.53  ? 52   SER H CB  1 
ATOM   405  O OG  . SER A 1 52  ? 29.310  -2.287  45.969  1.00 57.84  ? 52   SER H OG  1 
ATOM   406  N N   . PRO A 1 53  ? 29.040  -2.749  42.514  1.00 56.17  ? 53   PRO H N   1 
ATOM   407  C CA  . PRO A 1 53  ? 29.502  -3.870  41.671  1.00 57.52  ? 53   PRO H CA  1 
ATOM   408  C C   . PRO A 1 53  ? 30.431  -4.801  42.432  1.00 60.96  ? 53   PRO H C   1 
ATOM   409  O O   . PRO A 1 53  ? 30.670  -5.940  42.011  1.00 63.36  ? 53   PRO H O   1 
ATOM   410  C CB  . PRO A 1 53  ? 30.286  -3.178  40.538  1.00 55.42  ? 53   PRO H CB  1 
ATOM   411  C CG  . PRO A 1 53  ? 30.140  -1.713  40.750  1.00 53.17  ? 53   PRO H CG  1 
ATOM   412  C CD  . PRO A 1 53  ? 29.739  -1.495  42.178  1.00 53.57  ? 53   PRO H CD  1 
ATOM   413  N N   . SER A 1 54  ? 30.931  -4.297  43.553  1.00 61.80  ? 54   SER H N   1 
ATOM   414  C CA  . SER A 1 54  ? 31.860  -4.984  44.428  1.00 64.87  ? 54   SER H CA  1 
ATOM   415  C C   . SER A 1 54  ? 31.139  -5.940  45.375  1.00 67.51  ? 54   SER H C   1 
ATOM   416  O O   . SER A 1 54  ? 31.456  -7.137  45.422  1.00 69.61  ? 54   SER H O   1 
ATOM   417  C CB  . SER A 1 54  ? 32.636  -3.942  45.237  1.00 64.67  ? 54   SER H CB  1 
ATOM   418  O OG  . SER A 1 54  ? 33.856  -4.450  45.740  1.00 67.76  ? 54   SER H OG  1 
ATOM   419  N N   . THR A 1 55  ? 30.170  -5.415  46.125  1.00 66.71  ? 55   THR H N   1 
ATOM   420  C CA  . THR A 1 55  ? 29.496  -6.221  47.156  1.00 70.02  ? 55   THR H CA  1 
ATOM   421  C C   . THR A 1 55  ? 28.078  -6.675  46.777  1.00 69.62  ? 55   THR H C   1 
ATOM   422  O O   . THR A 1 55  ? 27.434  -7.375  47.543  1.00 72.45  ? 55   THR H O   1 
ATOM   423  C CB  . THR A 1 55  ? 29.471  -5.505  48.541  1.00 70.32  ? 55   THR H CB  1 
ATOM   424  O OG1 . THR A 1 55  ? 28.847  -4.217  48.414  1.00 67.63  ? 55   THR H OG1 1 
ATOM   425  C CG2 . THR A 1 55  ? 30.890  -5.328  49.112  1.00 71.40  ? 55   THR H CG2 1 
ATOM   426  N N   . GLY A 1 56  ? 27.593  -6.286  45.604  1.00 67.24  ? 56   GLY H N   1 
ATOM   427  C CA  . GLY A 1 56  ? 26.197  -6.554  45.247  1.00 67.17  ? 56   GLY H CA  1 
ATOM   428  C C   . GLY A 1 56  ? 25.148  -5.682  45.957  1.00 66.19  ? 56   GLY H C   1 
ATOM   429  O O   . GLY A 1 56  ? 23.974  -5.659  45.509  1.00 65.09  ? 56   GLY H O   1 
ATOM   430  N N   . ARG A 1 57  ? 25.559  -4.981  47.045  1.00 66.48  ? 57   ARG H N   1 
ATOM   431  C CA  . ARG A 1 57  ? 24.684  -4.027  47.802  1.00 66.27  ? 57   ARG H CA  1 
ATOM   432  C C   . ARG A 1 57  ? 23.974  -2.995  46.900  1.00 63.43  ? 57   ARG H C   1 
ATOM   433  O O   . ARG A 1 57  ? 24.602  -2.440  45.995  1.00 60.87  ? 57   ARG H O   1 
ATOM   434  C CB  . ARG A 1 57  ? 25.473  -3.250  48.875  1.00 65.88  ? 57   ARG H CB  1 
ATOM   435  C CG  . ARG A 1 57  ? 26.059  -4.043  50.032  1.00 69.51  ? 57   ARG H CG  1 
ATOM   436  C CD  . ARG A 1 57  ? 25.197  -5.213  50.483  1.00 72.91  ? 57   ARG H CD  1 
ATOM   437  N NE  . ARG A 1 57  ? 25.662  -5.742  51.756  1.00 76.36  ? 57   ARG H NE  1 
ATOM   438  C CZ  . ARG A 1 57  ? 26.403  -6.838  51.895  1.00 79.53  ? 57   ARG H CZ  1 
ATOM   439  N NH1 . ARG A 1 57  ? 26.765  -7.522  50.822  1.00 79.33  ? 57   ARG H NH1 1 
ATOM   440  N NH2 . ARG A 1 57  ? 26.776  -7.247  53.106  1.00 82.58  ? 57   ARG H NH2 1 
ATOM   441  N N   . THR A 1 58  ? 22.692  -2.719  47.178  1.00 64.22  ? 58   THR H N   1 
ATOM   442  C CA  . THR A 1 58  ? 21.817  -1.932  46.275  1.00 62.58  ? 58   THR H CA  1 
ATOM   443  C C   . THR A 1 58  ? 20.816  -0.976  46.969  1.00 61.77  ? 58   THR H C   1 
ATOM   444  O O   . THR A 1 58  ? 20.223  -1.347  47.986  1.00 61.98  ? 58   THR H O   1 
ATOM   445  C CB  . THR A 1 58  ? 21.030  -2.888  45.358  1.00 64.09  ? 58   THR H CB  1 
ATOM   446  O OG1 . THR A 1 58  ? 21.946  -3.511  44.453  1.00 65.10  ? 58   THR H OG1 1 
ATOM   447  C CG2 . THR A 1 58  ? 20.010  -2.124  44.527  1.00 62.71  ? 58   THR H CG2 1 
ATOM   448  N N   . THR A 1 59  ? 20.615  0.219   46.387  1.00 58.62  ? 59   THR H N   1 
ATOM   449  C CA  . THR A 1 59  ? 19.623  1.217   46.866  1.00 59.05  ? 59   THR H CA  1 
ATOM   450  C C   . THR A 1 59  ? 18.684  1.716   45.743  1.00 57.21  ? 59   THR H C   1 
ATOM   451  O O   . THR A 1 59  ? 19.156  2.259   44.738  1.00 56.71  ? 59   THR H O   1 
ATOM   452  C CB  . THR A 1 59  ? 20.309  2.454   47.510  1.00 58.08  ? 59   THR H CB  1 
ATOM   453  O OG1 . THR A 1 59  ? 21.097  2.049   48.637  1.00 61.38  ? 59   THR H OG1 1 
ATOM   454  C CG2 . THR A 1 59  ? 19.270  3.467   47.999  1.00 58.40  ? 59   THR H CG2 1 
ATOM   455  N N   . TYR A 1 60  ? 17.370  1.557   45.922  1.00 56.82  ? 60   TYR H N   1 
ATOM   456  C CA  . TYR A 1 60  ? 16.393  1.975   44.910  1.00 54.47  ? 60   TYR H CA  1 
ATOM   457  C C   . TYR A 1 60  ? 15.638  3.263   45.241  1.00 53.73  ? 60   TYR H C   1 
ATOM   458  O O   . TYR A 1 60  ? 15.400  3.593   46.406  1.00 53.18  ? 60   TYR H O   1 
ATOM   459  C CB  . TYR A 1 60  ? 15.365  0.877   44.651  1.00 57.06  ? 60   TYR H CB  1 
ATOM   460  C CG  . TYR A 1 60  ? 15.924  -0.345  43.974  1.00 57.86  ? 60   TYR H CG  1 
ATOM   461  C CD1 . TYR A 1 60  ? 16.106  -0.374  42.596  1.00 56.53  ? 60   TYR H CD1 1 
ATOM   462  C CD2 . TYR A 1 60  ? 16.257  -1.483  44.711  1.00 60.55  ? 60   TYR H CD2 1 
ATOM   463  C CE1 . TYR A 1 60  ? 16.620  -1.497  41.966  1.00 57.72  ? 60   TYR H CE1 1 
ATOM   464  C CE2 . TYR A 1 60  ? 16.761  -2.613  44.089  1.00 61.30  ? 60   TYR H CE2 1 
ATOM   465  C CZ  . TYR A 1 60  ? 16.948  -2.607  42.714  1.00 59.93  ? 60   TYR H CZ  1 
ATOM   466  O OH  . TYR A 1 60  ? 17.458  -3.714  42.076  1.00 61.09  ? 60   TYR H OH  1 
ATOM   467  N N   . ASN A 1 61  ? 15.275  3.988   44.185  1.00 51.60  ? 61   ASN H N   1 
ATOM   468  C CA  . ASN A 1 61  ? 14.263  5.022   44.251  1.00 50.78  ? 61   ASN H CA  1 
ATOM   469  C C   . ASN A 1 61  ? 12.963  4.257   44.392  1.00 53.21  ? 61   ASN H C   1 
ATOM   470  O O   . ASN A 1 61  ? 12.671  3.381   43.571  1.00 53.55  ? 61   ASN H O   1 
ATOM   471  C CB  . ASN A 1 61  ? 14.265  5.822   42.944  1.00 49.42  ? 61   ASN H CB  1 
ATOM   472  C CG  . ASN A 1 61  ? 13.205  6.902   42.903  1.00 48.89  ? 61   ASN H CG  1 
ATOM   473  O OD1 . ASN A 1 61  ? 12.154  6.803   43.546  1.00 50.73  ? 61   ASN H OD1 1 
ATOM   474  N ND2 . ASN A 1 61  ? 13.474  7.945   42.133  1.00 46.68  ? 61   ASN H ND2 1 
ATOM   475  N N   . GLN A 1 62  ? 12.186  4.572   45.426  1.00 54.06  ? 62   GLN H N   1 
ATOM   476  C CA  . GLN A 1 62  ? 11.010  3.760   45.740  1.00 58.18  ? 62   GLN H CA  1 
ATOM   477  C C   . GLN A 1 62  ? 9.991   3.708   44.603  1.00 58.48  ? 62   GLN H C   1 
ATOM   478  O O   . GLN A 1 62  ? 9.244   2.747   44.487  1.00 59.34  ? 62   GLN H O   1 
ATOM   479  C CB  . GLN A 1 62  ? 10.377  4.196   47.057  1.00 60.01  ? 62   GLN H CB  1 
ATOM   480  C CG  . GLN A 1 62  ? 11.236  3.842   48.259  1.00 62.11  ? 62   GLN H CG  1 
ATOM   481  C CD  . GLN A 1 62  ? 11.490  2.348   48.392  1.00 65.63  ? 62   GLN H CD  1 
ATOM   482  O OE1 . GLN A 1 62  ? 10.720  1.630   49.032  1.00 67.29  ? 62   GLN H OE1 1 
ATOM   483  N NE2 . GLN A 1 62  ? 12.572  1.868   47.763  1.00 65.93  ? 62   GLN H NE2 1 
ATOM   484  N N   . ASN A 1 63  ? 10.015  4.721   43.740  1.00 56.41  ? 63   ASN H N   1 
ATOM   485  C CA  . ASN A 1 63  ? 9.142   4.777   42.569  1.00 57.25  ? 63   ASN H CA  1 
ATOM   486  C C   . ASN A 1 63  ? 9.445   3.704   41.533  1.00 57.35  ? 63   ASN H C   1 
ATOM   487  O O   . ASN A 1 63  ? 8.593   3.385   40.700  1.00 59.95  ? 63   ASN H O   1 
ATOM   488  C CB  . ASN A 1 63  ? 9.195   6.171   41.940  1.00 56.39  ? 63   ASN H CB  1 
ATOM   489  C CG  . ASN A 1 63  ? 8.608   7.229   42.853  1.00 57.66  ? 63   ASN H CG  1 
ATOM   490  O OD1 . ASN A 1 63  ? 7.548   7.028   43.436  1.00 62.17  ? 63   ASN H OD1 1 
ATOM   491  N ND2 . ASN A 1 63  ? 9.302   8.345   43.004  1.00 57.53  ? 63   ASN H ND2 1 
ATOM   492  N N   . PHE A 1 64  ? 10.646  3.134   41.613  1.00 55.63  ? 64   PHE H N   1 
ATOM   493  C CA  . PHE A 1 64  ? 11.100  2.108   40.679  1.00 55.91  ? 64   PHE H CA  1 
ATOM   494  C C   . PHE A 1 64  ? 11.246  0.721   41.312  1.00 58.73  ? 64   PHE H C   1 
ATOM   495  O O   . PHE A 1 64  ? 11.663  -0.228  40.642  1.00 59.90  ? 64   PHE H O   1 
ATOM   496  C CB  . PHE A 1 64  ? 12.419  2.541   40.028  1.00 52.71  ? 64   PHE H CB  1 
ATOM   497  C CG  . PHE A 1 64  ? 12.265  3.678   39.057  1.00 49.74  ? 64   PHE H CG  1 
ATOM   498  C CD1 . PHE A 1 64  ? 11.881  3.438   37.734  1.00 49.57  ? 64   PHE H CD1 1 
ATOM   499  C CD2 . PHE A 1 64  ? 12.498  4.992   39.461  1.00 47.64  ? 64   PHE H CD2 1 
ATOM   500  C CE1 . PHE A 1 64  ? 11.730  4.490   36.837  1.00 47.36  ? 64   PHE H CE1 1 
ATOM   501  C CE2 . PHE A 1 64  ? 12.355  6.045   38.564  1.00 45.44  ? 64   PHE H CE2 1 
ATOM   502  C CZ  . PHE A 1 64  ? 11.965  5.795   37.256  1.00 45.58  ? 64   PHE H CZ  1 
ATOM   503  N N   . LYS A 1 65  ? 10.898  0.613   42.591  1.00 60.77  ? 65   LYS H N   1 
ATOM   504  C CA  . LYS A 1 65  ? 11.064  -0.627  43.347  1.00 64.26  ? 65   LYS H CA  1 
ATOM   505  C C   . LYS A 1 65  ? 10.346  -1.801  42.685  1.00 66.89  ? 65   LYS H C   1 
ATOM   506  O O   . LYS A 1 65  ? 10.899  -2.897  42.614  1.00 69.80  ? 65   LYS H O   1 
ATOM   507  C CB  . LYS A 1 65  ? 10.595  -0.445  44.794  1.00 65.91  ? 65   LYS H CB  1 
ATOM   508  C CG  . LYS A 1 65  ? 11.230  -1.429  45.766  1.00 68.99  ? 65   LYS H CG  1 
ATOM   509  C CD  . LYS A 1 65  ? 10.285  -1.793  46.902  1.00 72.22  ? 65   LYS H CD  1 
ATOM   510  C CE  . LYS A 1 65  ? 10.448  -3.267  47.271  1.00 75.52  ? 65   LYS H CE  1 
ATOM   511  N NZ  . LYS A 1 65  ? 9.482   -3.721  48.306  1.00 79.21  ? 65   LYS H NZ  1 
ATOM   512  N N   . ALA A 1 66  ? 9.129   -1.568  42.191  1.00 68.16  ? 66   ALA H N   1 
ATOM   513  C CA  . ALA A 1 66  ? 8.344   -2.611  41.508  1.00 71.74  ? 66   ALA H CA  1 
ATOM   514  C C   . ALA A 1 66  ? 8.772   -2.868  40.050  1.00 71.69  ? 66   ALA H C   1 
ATOM   515  O O   . ALA A 1 66  ? 8.433   -3.901  39.465  1.00 74.20  ? 66   ALA H O   1 
ATOM   516  C CB  . ALA A 1 66  ? 6.855   -2.280  41.572  1.00 72.95  ? 66   ALA H CB  1 
ATOM   517  N N   . LYS A 1 67  ? 9.524   -1.928  39.485  1.00 69.57  ? 67   LYS H N   1 
ATOM   518  C CA  . LYS A 1 67  ? 9.848   -1.905  38.056  1.00 68.66  ? 67   LYS H CA  1 
ATOM   519  C C   . LYS A 1 67  ? 11.226  -2.441  37.720  1.00 66.58  ? 67   LYS H C   1 
ATOM   520  O O   . LYS A 1 67  ? 11.388  -3.174  36.743  1.00 68.05  ? 67   LYS H O   1 
ATOM   521  C CB  . LYS A 1 67  ? 9.769   -0.464  37.520  1.00 68.56  ? 67   LYS H CB  1 
ATOM   522  C CG  . LYS A 1 67  ? 8.465   -0.099  36.828  1.00 70.96  ? 67   LYS H CG  1 
ATOM   523  C CD  . LYS A 1 67  ? 8.362   -0.707  35.436  1.00 71.29  ? 67   LYS H CD  1 
ATOM   524  C CE  . LYS A 1 67  ? 6.911   -0.768  34.984  1.00 72.83  ? 67   LYS H CE  1 
ATOM   525  N NZ  . LYS A 1 67  ? 6.060   -1.594  35.886  1.00 77.93  ? 67   LYS H NZ  1 
ATOM   526  N N   . ALA A 1 68  ? 12.219  -2.038  38.509  1.00 63.31  ? 68   ALA H N   1 
ATOM   527  C CA  . ALA A 1 68  ? 13.626  -2.222  38.152  1.00 60.23  ? 68   ALA H CA  1 
ATOM   528  C C   . ALA A 1 68  ? 14.333  -3.228  39.048  1.00 60.90  ? 68   ALA H C   1 
ATOM   529  O O   . ALA A 1 68  ? 14.073  -3.286  40.245  1.00 62.01  ? 68   ALA H O   1 
ATOM   530  C CB  . ALA A 1 68  ? 14.354  -0.884  38.201  1.00 56.56  ? 68   ALA H CB  1 
ATOM   531  N N   . THR A 1 69  ? 15.221  -4.022  38.453  1.00 59.86  ? 69   THR H N   1 
ATOM   532  C CA  . THR A 1 69  ? 16.142  -4.863  39.207  1.00 59.99  ? 69   THR H CA  1 
ATOM   533  C C   . THR A 1 69  ? 17.556  -4.683  38.671  1.00 58.58  ? 69   THR H C   1 
ATOM   534  O O   . THR A 1 69  ? 17.803  -4.869  37.471  1.00 57.34  ? 69   THR H O   1 
ATOM   535  C CB  . THR A 1 69  ? 15.750  -6.352  39.151  1.00 62.76  ? 69   THR H CB  1 
ATOM   536  O OG1 . THR A 1 69  ? 14.339  -6.484  39.350  1.00 63.64  ? 69   THR H OG1 1 
ATOM   537  C CG2 . THR A 1 69  ? 16.486  -7.122  40.224  1.00 64.22  ? 69   THR H CG2 1 
ATOM   538  N N   . LEU A 1 70  ? 18.483  -4.313  39.554  1.00 57.70  ? 70   LEU H N   1 
ATOM   539  C CA  . LEU A 1 70  ? 19.875  -4.111  39.150  1.00 56.56  ? 70   LEU H CA  1 
ATOM   540  C C   . LEU A 1 70  ? 20.712  -5.335  39.448  1.00 59.08  ? 70   LEU H C   1 
ATOM   541  O O   . LEU A 1 70  ? 20.637  -5.876  40.552  1.00 60.50  ? 70   LEU H O   1 
ATOM   542  C CB  . LEU A 1 70  ? 20.489  -2.889  39.848  1.00 54.61  ? 70   LEU H CB  1 
ATOM   543  C CG  . LEU A 1 70  ? 19.743  -1.552  39.816  1.00 51.74  ? 70   LEU H CG  1 
ATOM   544  C CD1 . LEU A 1 70  ? 20.614  -0.473  40.432  1.00 50.10  ? 70   LEU H CD1 1 
ATOM   545  C CD2 . LEU A 1 70  ? 19.303  -1.187  38.408  1.00 50.52  ? 70   LEU H CD2 1 
ATOM   546  N N   . THR A 1 71  ? 21.512  -5.753  38.465  1.00 59.45  ? 71   THR H N   1 
ATOM   547  C CA  . THR A 1 71  ? 22.399  -6.919  38.592  1.00 62.48  ? 71   THR H CA  1 
ATOM   548  C C   . THR A 1 71  ? 23.810  -6.626  38.079  1.00 62.17  ? 71   THR H C   1 
ATOM   549  O O   . THR A 1 71  ? 24.049  -5.587  37.464  1.00 59.36  ? 71   THR H O   1 
ATOM   550  C CB  . THR A 1 71  ? 21.847  -8.150  37.843  1.00 64.38  ? 71   THR H CB  1 
ATOM   551  O OG1 . THR A 1 71  ? 21.346  -7.742  36.565  1.00 62.51  ? 71   THR H OG1 1 
ATOM   552  C CG2 . THR A 1 71  ? 20.723  -8.825  38.648  1.00 66.28  ? 71   THR H CG2 1 
ATOM   553  N N   . VAL A 1 72  ? 24.732  -7.554  38.333  1.00 64.97  ? 72   VAL H N   1 
ATOM   554  C CA  . VAL A 1 72  ? 26.160  -7.374  38.032  1.00 65.40  ? 72   VAL H CA  1 
ATOM   555  C C   . VAL A 1 72  ? 26.800  -8.651  37.446  1.00 67.78  ? 72   VAL H C   1 
ATOM   556  O O   . VAL A 1 72  ? 26.317  -9.761  37.676  1.00 70.61  ? 72   VAL H O   1 
ATOM   557  C CB  . VAL A 1 72  ? 26.936  -6.916  39.302  1.00 65.71  ? 72   VAL H CB  1 
ATOM   558  C CG1 . VAL A 1 72  ? 27.078  -8.048  40.320  1.00 69.63  ? 72   VAL H CG1 1 
ATOM   559  C CG2 . VAL A 1 72  ? 28.293  -6.335  38.934  1.00 65.46  ? 72   VAL H CG2 1 
ATOM   560  N N   . ASP A 1 73  ? 27.877  -8.472  36.683  1.00 66.86  ? 73   ASP H N   1 
ATOM   561  C CA  . ASP A 1 73  ? 28.776  -9.564  36.299  1.00 69.18  ? 73   ASP H CA  1 
ATOM   562  C C   . ASP A 1 73  ? 30.201  -9.020  36.361  1.00 68.59  ? 73   ASP H C   1 
ATOM   563  O O   . ASP A 1 73  ? 30.652  -8.316  35.454  1.00 66.16  ? 73   ASP H O   1 
ATOM   564  C CB  . ASP A 1 73  ? 28.435  -10.098 34.902  1.00 69.17  ? 73   ASP H CB  1 
ATOM   565  C CG  . ASP A 1 73  ? 29.367  -11.224 34.439  1.00 71.81  ? 73   ASP H CG  1 
ATOM   566  O OD1 . ASP A 1 73  ? 30.022  -11.898 35.267  1.00 73.78  ? 73   ASP H OD1 1 
ATOM   567  O OD2 . ASP A 1 73  ? 29.437  -11.438 33.216  1.00 72.06  ? 73   ASP H OD2 1 
ATOM   568  N N   . GLN A 1 74  ? 30.889  -9.334  37.455  1.00 70.54  ? 74   GLN H N   1 
ATOM   569  C CA  . GLN A 1 74  ? 32.242  -8.843  37.707  1.00 70.87  ? 74   GLN H CA  1 
ATOM   570  C C   . GLN A 1 74  ? 33.260  -9.368  36.699  1.00 72.77  ? 74   GLN H C   1 
ATOM   571  O O   . GLN A 1 74  ? 34.259  -8.700  36.434  1.00 72.32  ? 74   GLN H O   1 
ATOM   572  C CB  . GLN A 1 74  ? 32.708  -9.234  39.108  1.00 73.19  ? 74   GLN H CB  1 
ATOM   573  C CG  . GLN A 1 74  ? 32.033  -8.492  40.249  1.00 72.00  ? 74   GLN H CG  1 
ATOM   574  C CD  . GLN A 1 74  ? 32.640  -8.830  41.599  1.00 74.40  ? 74   GLN H CD  1 
ATOM   575  O OE1 . GLN A 1 74  ? 33.287  -9.867  41.764  1.00 77.40  ? 74   GLN H OE1 1 
ATOM   576  N NE2 . GLN A 1 74  ? 32.436  -7.955  42.573  1.00 73.21  ? 74   GLN H NE2 1 
ATOM   577  N N   . SER A 1 75  ? 33.022  -10.562 36.152  1.00 74.66  ? 75   SER H N   1 
ATOM   578  C CA  . SER A 1 75  ? 33.987  -11.175 35.241  1.00 76.54  ? 75   SER H CA  1 
ATOM   579  C C   . SER A 1 75  ? 34.150  -10.363 33.958  1.00 74.32  ? 75   SER H C   1 
ATOM   580  O O   . SER A 1 75  ? 35.236  -10.325 33.381  1.00 76.09  ? 75   SER H O   1 
ATOM   581  C CB  . SER A 1 75  ? 33.621  -12.633 34.932  1.00 79.09  ? 75   SER H CB  1 
ATOM   582  O OG  . SER A 1 75  ? 32.470  -12.711 34.115  1.00 77.93  ? 75   SER H OG  1 
ATOM   583  N N   . SER A 1 76  ? 33.082  -9.692  33.537  1.00 71.32  ? 76   SER H N   1 
ATOM   584  C CA  . SER A 1 76  ? 33.070  -8.967  32.267  1.00 68.52  ? 76   SER H CA  1 
ATOM   585  C C   . SER A 1 76  ? 32.996  -7.445  32.440  1.00 64.90  ? 76   SER H C   1 
ATOM   586  O O   . SER A 1 76  ? 32.836  -6.706  31.464  1.00 62.10  ? 76   SER H O   1 
ATOM   587  C CB  . SER A 1 76  ? 31.893  -9.446  31.426  1.00 68.75  ? 76   SER H CB  1 
ATOM   588  O OG  . SER A 1 76  ? 30.701  -9.349  32.180  1.00 69.01  ? 76   SER H OG  1 
ATOM   589  N N   . SER A 1 77  ? 33.118  -6.993  33.685  1.00 64.19  ? 77   SER H N   1 
ATOM   590  C CA  . SER A 1 77  ? 32.956  -5.584  34.041  1.00 61.56  ? 77   SER H CA  1 
ATOM   591  C C   . SER A 1 77  ? 31.645  -5.017  33.490  1.00 58.96  ? 77   SER H C   1 
ATOM   592  O O   . SER A 1 77  ? 31.629  -3.949  32.876  1.00 57.07  ? 77   SER H O   1 
ATOM   593  C CB  . SER A 1 77  ? 34.164  -4.752  33.569  1.00 60.92  ? 77   SER H CB  1 
ATOM   594  O OG  . SER A 1 77  ? 35.378  -5.263  34.101  1.00 63.21  ? 77   SER H OG  1 
ATOM   595  N N   . THR A 1 78  ? 30.548  -5.738  33.712  1.00 59.37  ? 78   THR H N   1 
ATOM   596  C CA  . THR A 1 78  ? 29.244  -5.309  33.200  1.00 57.21  ? 78   THR H CA  1 
ATOM   597  C C   . THR A 1 78  ? 28.148  -5.268  34.276  1.00 56.83  ? 78   THR H C   1 
ATOM   598  O O   . THR A 1 78  ? 27.992  -6.195  35.074  1.00 57.96  ? 78   THR H O   1 
ATOM   599  C CB  . THR A 1 78  ? 28.805  -6.151  31.979  1.00 58.42  ? 78   THR H CB  1 
ATOM   600  O OG1 . THR A 1 78  ? 29.876  -6.189  31.027  1.00 58.69  ? 78   THR H OG1 1 
ATOM   601  C CG2 . THR A 1 78  ? 27.568  -5.560  31.295  1.00 56.14  ? 78   THR H CG2 1 
ATOM   602  N N   . ALA A 1 79  ? 27.410  -4.161  34.268  1.00 54.35  ? 79   ALA H N   1 
ATOM   603  C CA  . ALA A 1 79  ? 26.272  -3.921  35.138  1.00 54.12  ? 79   ALA H CA  1 
ATOM   604  C C   . ALA A 1 79  ? 25.004  -4.075  34.307  1.00 53.85  ? 79   ALA H C   1 
ATOM   605  O O   . ALA A 1 79  ? 24.984  -3.690  33.129  1.00 52.30  ? 79   ALA H O   1 
ATOM   606  C CB  . ALA A 1 79  ? 26.354  -2.502  35.697  1.00 51.90  ? 79   ALA H CB  1 
ATOM   607  N N   . TYR A 1 80  ? 23.943  -4.594  34.920  1.00 54.46  ? 80   TYR H N   1 
ATOM   608  C CA  . TYR A 1 80  ? 22.673  -4.817  34.216  1.00 55.37  ? 80   TYR H CA  1 
ATOM   609  C C   . TYR A 1 80  ? 21.484  -4.138  34.894  1.00 54.48  ? 80   TYR H C   1 
ATOM   610  O O   . TYR A 1 80  ? 21.511  -3.871  36.100  1.00 55.31  ? 80   TYR H O   1 
ATOM   611  C CB  . TYR A 1 80  ? 22.371  -6.325  34.075  1.00 58.84  ? 80   TYR H CB  1 
ATOM   612  C CG  . TYR A 1 80  ? 23.400  -7.124  33.297  1.00 60.25  ? 80   TYR H CG  1 
ATOM   613  C CD1 . TYR A 1 80  ? 23.423  -7.098  31.904  1.00 60.30  ? 80   TYR H CD1 1 
ATOM   614  C CD2 . TYR A 1 80  ? 24.334  -7.922  33.956  1.00 62.64  ? 80   TYR H CD2 1 
ATOM   615  C CE1 . TYR A 1 80  ? 24.359  -7.826  31.191  1.00 61.83  ? 80   TYR H CE1 1 
ATOM   616  C CE2 . TYR A 1 80  ? 25.270  -8.657  33.254  1.00 64.25  ? 80   TYR H CE2 1 
ATOM   617  C CZ  . TYR A 1 80  ? 25.277  -8.605  31.873  1.00 64.04  ? 80   TYR H CZ  1 
ATOM   618  O OH  . TYR A 1 80  ? 26.196  -9.340  31.166  1.00 66.31  ? 80   TYR H OH  1 
ATOM   619  N N   . MET A 1 81  ? 20.439  -3.866  34.110  1.00 53.49  ? 81   MET H N   1 
ATOM   620  C CA  . MET A 1 81  ? 19.153  -3.416  34.649  1.00 52.92  ? 81   MET H CA  1 
ATOM   621  C C   . MET A 1 81  ? 18.008  -4.043  33.864  1.00 54.62  ? 81   MET H C   1 
ATOM   622  O O   . MET A 1 81  ? 17.924  -3.887  32.634  1.00 53.43  ? 81   MET H O   1 
ATOM   623  C CB  . MET A 1 81  ? 19.025  -1.876  34.659  1.00 49.42  ? 81   MET H CB  1 
ATOM   624  C CG  . MET A 1 81  ? 17.661  -1.406  35.166  1.00 48.91  ? 81   MET H CG  1 
ATOM   625  S SD  . MET A 1 81  ? 17.430  0.374   35.354  1.00 45.74  ? 81   MET H SD  1 
ATOM   626  C CE  . MET A 1 81  ? 17.444  0.894   33.638  1.00 44.12  ? 81   MET H CE  1 
ATOM   627  N N   . GLN A 1 82  ? 17.151  -4.771  34.586  1.00 56.84  ? 82   GLN H N   1 
ATOM   628  C CA  . GLN A 1 82  ? 15.928  -5.342  34.034  1.00 59.11  ? 82   GLN H CA  1 
ATOM   629  C C   . GLN A 1 82  ? 14.717  -4.500  34.415  1.00 58.84  ? 82   GLN H C   1 
ATOM   630  O O   . GLN A 1 82  ? 14.579  -4.083  35.564  1.00 59.16  ? 82   GLN H O   1 
ATOM   631  C CB  . GLN A 1 82  ? 15.724  -6.784  34.522  1.00 62.62  ? 82   GLN H CB  1 
ATOM   632  C CG  . GLN A 1 82  ? 14.416  -7.391  34.031  1.00 65.24  ? 82   GLN H CG  1 
ATOM   633  C CD  . GLN A 1 82  ? 14.157  -8.772  34.582  1.00 69.08  ? 82   GLN H CD  1 
ATOM   634  O OE1 . GLN A 1 82  ? 14.851  -9.724  34.232  1.00 71.46  ? 82   GLN H OE1 1 
ATOM   635  N NE2 . GLN A 1 82  ? 13.146  -8.893  35.444  1.00 70.33  ? 82   GLN H NE2 1 
ATOM   636  N N   . LEU A 1 83  ? 13.836  -4.252  33.453  1.00 59.29  ? 83   LEU H N   1 
ATOM   637  C CA  . LEU A 1 83  ? 12.591  -3.547  33.732  1.00 59.98  ? 83   LEU H CA  1 
ATOM   638  C C   . LEU A 1 83  ? 11.407  -4.477  33.478  1.00 62.64  ? 83   LEU H C   1 
ATOM   639  O O   . LEU A 1 83  ? 11.240  -4.977  32.362  1.00 62.91  ? 83   LEU H O   1 
ATOM   640  C CB  . LEU A 1 83  ? 12.473  -2.252  32.908  1.00 57.73  ? 83   LEU H CB  1 
ATOM   641  C CG  . LEU A 1 83  ? 13.378  -1.021  33.136  1.00 55.40  ? 83   LEU H CG  1 
ATOM   642  C CD1 . LEU A 1 83  ? 13.390  -0.515  34.577  1.00 54.79  ? 83   LEU H CD1 1 
ATOM   643  C CD2 . LEU A 1 83  ? 14.792  -1.291  32.670  1.00 54.91  ? 83   LEU H CD2 1 
ATOM   644  N N   . LYS A 1 84  ? 10.594  -4.702  34.514  1.00 64.28  ? 84   LYS H N   1 
ATOM   645  C CA  . LYS A 1 84  ? 9.484   -5.666  34.446  1.00 68.03  ? 84   LYS H CA  1 
ATOM   646  C C   . LYS A 1 84  ? 8.134   -5.002  34.160  1.00 68.81  ? 84   LYS H C   1 
ATOM   647  O O   . LYS A 1 84  ? 7.957   -3.808  34.407  1.00 67.26  ? 84   LYS H O   1 
ATOM   648  C CB  . LYS A 1 84  ? 9.414   -6.499  35.725  1.00 69.61  ? 84   LYS H CB  1 
ATOM   649  N N   . SER A 1 85  ? 7.196   -5.797  33.641  1.00 71.92  ? 85   SER H N   1 
ATOM   650  C CA  . SER A 1 85  ? 5.819   -5.369  33.336  1.00 73.51  ? 85   SER H CA  1 
ATOM   651  C C   . SER A 1 85  ? 5.716   -3.984  32.704  1.00 71.33  ? 85   SER H C   1 
ATOM   652  O O   . SER A 1 85  ? 5.120   -3.074  33.282  1.00 71.72  ? 85   SER H O   1 
ATOM   653  C CB  . SER A 1 85  ? 4.927   -5.459  34.582  1.00 74.81  ? 85   SER H CB  1 
ATOM   654  O OG  . SER A 1 85  ? 4.216   -6.678  34.585  1.00 79.40  ? 85   SER H OG  1 
ATOM   655  N N   . LEU A 1 86  ? 6.276   -3.840  31.507  1.00 70.12  ? 86   LEU H N   1 
ATOM   656  C CA  . LEU A 1 86  ? 6.436   -2.529  30.883  1.00 68.40  ? 86   LEU H CA  1 
ATOM   657  C C   . LEU A 1 86  ? 5.133   -1.926  30.333  1.00 69.50  ? 86   LEU H C   1 
ATOM   658  O O   . LEU A 1 86  ? 4.265   -2.642  29.833  1.00 71.45  ? 86   LEU H O   1 
ATOM   659  C CB  . LEU A 1 86  ? 7.534   -2.592  29.817  1.00 67.29  ? 86   LEU H CB  1 
ATOM   660  C CG  . LEU A 1 86  ? 8.928   -2.906  30.386  1.00 66.19  ? 86   LEU H CG  1 
ATOM   661  C CD1 . LEU A 1 86  ? 9.822   -3.630  29.390  1.00 66.41  ? 86   LEU H CD1 1 
ATOM   662  C CD2 . LEU A 1 86  ? 9.611   -1.654  30.904  1.00 62.90  ? 86   LEU H CD2 1 
ATOM   663  N N   . THR A 1 87  ? 4.994   -0.611  30.483  1.00 67.74  ? 87   THR H N   1 
ATOM   664  C CA  . THR A 1 87  ? 3.864   0.154   29.941  1.00 69.23  ? 87   THR H CA  1 
ATOM   665  C C   . THR A 1 87  ? 4.434   1.319   29.150  1.00 66.56  ? 87   THR H C   1 
ATOM   666  O O   . THR A 1 87  ? 5.650   1.472   29.091  1.00 64.18  ? 87   THR H O   1 
ATOM   667  C CB  . THR A 1 87  ? 2.962   0.721   31.057  1.00 70.74  ? 87   THR H CB  1 
ATOM   668  O OG1 . THR A 1 87  ? 3.773   1.392   32.038  1.00 69.19  ? 87   THR H OG1 1 
ATOM   669  C CG2 . THR A 1 87  ? 2.146   -0.389  31.716  1.00 74.23  ? 87   THR H CG2 1 
ATOM   670  N N   . SER A 1 88  ? 3.566   2.140   28.554  1.00 67.29  ? 88   SER H N   1 
ATOM   671  C CA  . SER A 1 88  ? 3.990   3.333   27.807  1.00 64.96  ? 88   SER H CA  1 
ATOM   672  C C   . SER A 1 88  ? 4.833   4.283   28.637  1.00 62.70  ? 88   SER H C   1 
ATOM   673  O O   . SER A 1 88  ? 5.724   4.950   28.103  1.00 60.37  ? 88   SER H O   1 
ATOM   674  C CB  . SER A 1 88  ? 2.790   4.098   27.260  1.00 66.56  ? 88   SER H CB  1 
ATOM   675  O OG  . SER A 1 88  ? 2.222   3.426   26.156  1.00 68.50  ? 88   SER H OG  1 
ATOM   676  N N   . GLU A 1 89  ? 4.555   4.344   29.938  1.00 62.44  ? 89   GLU H N   1 
ATOM   677  C CA  . GLU A 1 89  ? 5.297   5.214   30.849  1.00 60.84  ? 89   GLU H CA  1 
ATOM   678  C C   . GLU A 1 89  ? 6.792   4.892   30.841  1.00 56.90  ? 89   GLU H C   1 
ATOM   679  O O   . GLU A 1 89  ? 7.613   5.728   31.198  1.00 54.43  ? 89   GLU H O   1 
ATOM   680  C CB  . GLU A 1 89  ? 4.761   5.092   32.285  1.00 63.71  ? 89   GLU H CB  1 
ATOM   681  C CG  . GLU A 1 89  ? 3.243   5.188   32.422  1.00 69.34  ? 89   GLU H CG  1 
ATOM   682  C CD  . GLU A 1 89  ? 2.687   6.520   31.936  1.00 70.21  ? 89   GLU H CD  1 
ATOM   683  O OE1 . GLU A 1 89  ? 3.248   7.582   32.289  1.00 67.68  ? 89   GLU H OE1 1 
ATOM   684  O OE2 . GLU A 1 89  ? 1.677   6.493   31.202  1.00 73.70  ? 89   GLU H OE2 1 
ATOM   685  N N   . ASP A 1 90  ? 7.128   3.670   30.436  1.00 56.12  ? 90   ASP H N   1 
ATOM   686  C CA  . ASP A 1 90  ? 8.491   3.166   30.527  1.00 53.29  ? 90   ASP H CA  1 
ATOM   687  C C   . ASP A 1 90  ? 9.310   3.438   29.255  1.00 51.13  ? 90   ASP H C   1 
ATOM   688  O O   . ASP A 1 90  ? 10.514  3.201   29.248  1.00 49.57  ? 90   ASP H O   1 
ATOM   689  C CB  . ASP A 1 90  ? 8.490   1.663   30.840  1.00 54.87  ? 90   ASP H CB  1 
ATOM   690  C CG  . ASP A 1 90  ? 7.787   1.321   32.163  1.00 56.18  ? 90   ASP H CG  1 
ATOM   691  O OD1 . ASP A 1 90  ? 8.127   1.906   33.214  1.00 54.52  ? 90   ASP H OD1 1 
ATOM   692  O OD2 . ASP A 1 90  ? 6.908   0.439   32.146  1.00 58.22  ? 90   ASP H OD2 1 
ATOM   693  N N   . SER A 1 91  ? 8.650   3.911   28.194  1.00 51.32  ? 91   SER H N   1 
ATOM   694  C CA  . SER A 1 91  ? 9.329   4.328   26.953  1.00 49.91  ? 91   SER H CA  1 
ATOM   695  C C   . SER A 1 91  ? 10.226  5.525   27.268  1.00 47.17  ? 91   SER H C   1 
ATOM   696  O O   . SER A 1 91  ? 9.729   6.586   27.627  1.00 46.17  ? 91   SER H O   1 
ATOM   697  C CB  . SER A 1 91  ? 8.325   4.735   25.869  1.00 51.19  ? 91   SER H CB  1 
ATOM   698  O OG  . SER A 1 91  ? 7.497   3.662   25.450  1.00 54.43  ? 91   SER H OG  1 
ATOM   699  N N   . ALA A 1 92  ? 11.540  5.334   27.145  1.00 45.97  ? 92   ALA H N   1 
ATOM   700  C CA  . ALA A 1 92  ? 12.521  6.325   27.576  1.00 43.96  ? 92   ALA H CA  1 
ATOM   701  C C   . ALA A 1 92  ? 13.946  5.944   27.162  1.00 42.63  ? 92   ALA H C   1 
ATOM   702  O O   . ALA A 1 92  ? 14.193  4.829   26.702  1.00 43.67  ? 92   ALA H O   1 
ATOM   703  C CB  . ALA A 1 92  ? 12.439  6.495   29.094  1.00 43.74  ? 92   ALA H CB  1 
ATOM   704  N N   . VAL A 1 93  ? 14.879  6.880   27.316  1.00 40.80  ? 93   VAL H N   1 
ATOM   705  C CA  . VAL A 1 93  ? 16.299  6.549   27.256  1.00 40.35  ? 93   VAL H CA  1 
ATOM   706  C C   . VAL A 1 93  ? 16.790  6.238   28.659  1.00 40.87  ? 93   VAL H C   1 
ATOM   707  O O   . VAL A 1 93  ? 16.525  7.001   29.604  1.00 41.44  ? 93   VAL H O   1 
ATOM   708  C CB  . VAL A 1 93  ? 17.161  7.683   26.651  1.00 38.61  ? 93   VAL H CB  1 
ATOM   709  C CG1 . VAL A 1 93  ? 18.642  7.316   26.728  1.00 37.43  ? 93   VAL H CG1 1 
ATOM   710  C CG2 . VAL A 1 93  ? 16.741  7.956   25.210  1.00 39.24  ? 93   VAL H CG2 1 
ATOM   711  N N   . TYR A 1 94  ? 17.490  5.110   28.804  1.00 41.75  ? 94   TYR H N   1 
ATOM   712  C CA  . TYR A 1 94  ? 18.045  4.729   30.103  1.00 40.78  ? 94   TYR H CA  1 
ATOM   713  C C   . TYR A 1 94  ? 19.552  4.803   30.065  1.00 40.15  ? 94   TYR H C   1 
ATOM   714  O O   . TYR A 1 94  ? 20.180  4.326   29.115  1.00 40.59  ? 94   TYR H O   1 
ATOM   715  C CB  . TYR A 1 94  ? 17.563  3.347   30.543  1.00 42.14  ? 94   TYR H CB  1 
ATOM   716  C CG  . TYR A 1 94  ? 16.076  3.309   30.780  1.00 42.53  ? 94   TYR H CG  1 
ATOM   717  C CD1 . TYR A 1 94  ? 15.191  3.084   29.722  1.00 43.24  ? 94   TYR H CD1 1 
ATOM   718  C CD2 . TYR A 1 94  ? 15.544  3.527   32.050  1.00 42.39  ? 94   TYR H CD2 1 
ATOM   719  C CE1 . TYR A 1 94  ? 13.820  3.073   29.921  1.00 44.22  ? 94   TYR H CE1 1 
ATOM   720  C CE2 . TYR A 1 94  ? 14.169  3.500   32.266  1.00 43.16  ? 94   TYR H CE2 1 
ATOM   721  C CZ  . TYR A 1 94  ? 13.313  3.268   31.204  1.00 44.06  ? 94   TYR H CZ  1 
ATOM   722  O OH  . TYR A 1 94  ? 11.954  3.252   31.392  1.00 45.08  ? 94   TYR H OH  1 
ATOM   723  N N   . TYR A 1 95  ? 20.117  5.436   31.093  1.00 38.77  ? 95   TYR H N   1 
ATOM   724  C CA  . TYR A 1 95  ? 21.556  5.609   31.212  1.00 38.06  ? 95   TYR H CA  1 
ATOM   725  C C   . TYR A 1 95  ? 22.062  4.827   32.397  1.00 39.23  ? 95   TYR H C   1 
ATOM   726  O O   . TYR A 1 95  ? 21.398  4.781   33.435  1.00 39.54  ? 95   TYR H O   1 
ATOM   727  C CB  . TYR A 1 95  ? 21.914  7.082   31.449  1.00 36.02  ? 95   TYR H CB  1 
ATOM   728  C CG  . TYR A 1 95  ? 21.700  7.989   30.252  1.00 35.17  ? 95   TYR H CG  1 
ATOM   729  C CD1 . TYR A 1 95  ? 22.608  8.003   29.190  1.00 34.89  ? 95   TYR H CD1 1 
ATOM   730  C CD2 . TYR A 1 95  ? 20.588  8.827   30.185  1.00 34.75  ? 95   TYR H CD2 1 
ATOM   731  C CE1 . TYR A 1 95  ? 22.411  8.826   28.082  1.00 34.13  ? 95   TYR H CE1 1 
ATOM   732  C CE2 . TYR A 1 95  ? 20.381  9.654   29.086  1.00 34.46  ? 95   TYR H CE2 1 
ATOM   733  C CZ  . TYR A 1 95  ? 21.299  9.654   28.047  1.00 34.01  ? 95   TYR H CZ  1 
ATOM   734  O OH  . TYR A 1 95  ? 21.103  10.477  26.968  1.00 35.12  ? 95   TYR H OH  1 
ATOM   735  N N   . CYS A 1 96  ? 23.233  4.222   32.249  1.00 40.29  ? 96   CYS H N   1 
ATOM   736  C CA  . CYS A 1 96  ? 24.036  3.851   33.418  1.00 41.69  ? 96   CYS H CA  1 
ATOM   737  C C   . CYS A 1 96  ? 24.991  5.017   33.670  1.00 40.57  ? 96   CYS H C   1 
ATOM   738  O O   . CYS A 1 96  ? 25.337  5.754   32.722  1.00 39.85  ? 96   CYS H O   1 
ATOM   739  C CB  . CYS A 1 96  ? 24.791  2.542   33.204  1.00 44.08  ? 96   CYS H CB  1 
ATOM   740  S SG  . CYS A 1 96  ? 26.021  2.557   31.869  1.00 45.20  ? 96   CYS H SG  1 
ATOM   741  N N   . ALA A 1 97  ? 25.417  5.204   34.921  1.00 39.78  ? 97   ALA H N   1 
ATOM   742  C CA  . ALA A 1 97  ? 26.302  6.341   35.259  1.00 39.06  ? 97   ALA H CA  1 
ATOM   743  C C   . ALA A 1 97  ? 27.196  6.055   36.469  1.00 40.14  ? 97   ALA H C   1 
ATOM   744  O O   . ALA A 1 97  ? 26.710  5.637   37.522  1.00 40.14  ? 97   ALA H O   1 
ATOM   745  C CB  . ALA A 1 97  ? 25.482  7.607   35.480  1.00 37.15  ? 97   ALA H CB  1 
ATOM   746  N N   . ARG A 1 98  ? 28.498  6.279   36.311  1.00 40.48  ? 98   ARG H N   1 
ATOM   747  C CA  . ARG A 1 98  ? 29.457  6.003   37.379  1.00 41.66  ? 98   ARG H CA  1 
ATOM   748  C C   . ARG A 1 98  ? 29.418  7.104   38.442  1.00 42.17  ? 98   ARG H C   1 
ATOM   749  O O   . ARG A 1 98  ? 29.321  8.294   38.122  1.00 40.04  ? 98   ARG H O   1 
ATOM   750  C CB  . ARG A 1 98  ? 30.868  5.839   36.817  1.00 42.59  ? 98   ARG H CB  1 
ATOM   751  C CG  . ARG A 1 98  ? 31.883  5.382   37.844  1.00 44.16  ? 98   ARG H CG  1 
ATOM   752  C CD  . ARG A 1 98  ? 33.290  5.337   37.281  1.00 45.64  ? 98   ARG H CD  1 
ATOM   753  N NE  . ARG A 1 98  ? 33.918  6.657   37.248  1.00 45.16  ? 98   ARG H NE  1 
ATOM   754  C CZ  . ARG A 1 98  ? 35.215  6.881   37.031  1.00 45.91  ? 98   ARG H CZ  1 
ATOM   755  N NH1 . ARG A 1 98  ? 36.064  5.880   36.825  1.00 47.39  ? 98   ARG H NH1 1 
ATOM   756  N NH2 . ARG A 1 98  ? 35.665  8.129   37.016  1.00 45.52  ? 98   ARG H NH2 1 
ATOM   757  N N   . SER A 1 99  ? 29.444  6.703   39.710  1.00 43.55  ? 99   SER H N   1 
ATOM   758  C CA  . SER A 1 99  ? 29.560  7.665   40.805  1.00 44.47  ? 99   SER H CA  1 
ATOM   759  C C   . SER A 1 99  ? 30.943  7.496   41.443  1.00 46.66  ? 99   SER H C   1 
ATOM   760  O O   . SER A 1 99  ? 31.867  7.057   40.774  1.00 48.47  ? 99   SER H O   1 
ATOM   761  C CB  . SER A 1 99  ? 28.413  7.484   41.795  1.00 45.24  ? 99   SER H CB  1 
ATOM   762  O OG  . SER A 1 99  ? 28.454  8.444   42.832  1.00 46.62  ? 99   SER H OG  1 
ATOM   763  N N   . VAL A 1 100 ? 31.093  7.820   42.727  1.00 48.82  ? 100  VAL H N   1 
ATOM   764  C CA  . VAL A 1 100 ? 32.425  7.844   43.359  1.00 50.32  ? 100  VAL H CA  1 
ATOM   765  C C   . VAL A 1 100 ? 32.954  6.468   43.796  1.00 52.27  ? 100  VAL H C   1 
ATOM   766  O O   . VAL A 1 100 ? 32.200  5.487   43.794  1.00 52.80  ? 100  VAL H O   1 
ATOM   767  C CB  . VAL A 1 100 ? 32.444  8.773   44.583  1.00 51.01  ? 100  VAL H CB  1 
ATOM   768  C CG1 . VAL A 1 100 ? 32.266  10.221  44.141  1.00 48.07  ? 100  VAL H CG1 1 
ATOM   769  C CG2 . VAL A 1 100 ? 31.403  8.314   45.600  1.00 50.96  ? 100  VAL H CG2 1 
ATOM   770  N N   . PRO A 1 101 ? 34.250  6.397   44.186  1.00 53.29  ? 101  PRO H N   1 
ATOM   771  C CA  . PRO A 1 101 ? 34.795  5.109   44.639  1.00 56.25  ? 101  PRO H CA  1 
ATOM   772  C C   . PRO A 1 101 ? 34.120  4.637   45.919  1.00 57.52  ? 101  PRO H C   1 
ATOM   773  O O   . PRO A 1 101 ? 33.525  5.447   46.642  1.00 56.17  ? 101  PRO H O   1 
ATOM   774  C CB  . PRO A 1 101 ? 36.279  5.409   44.890  1.00 57.12  ? 101  PRO H CB  1 
ATOM   775  C CG  . PRO A 1 101 ? 36.564  6.665   44.132  1.00 54.80  ? 101  PRO H CG  1 
ATOM   776  C CD  . PRO A 1 101 ? 35.287  7.448   44.182  1.00 52.61  ? 101  PRO H CD  1 
ATOM   777  N N   . LEU A 1 102 ? 34.201  3.338   46.180  1.00 59.80  ? 102  LEU H N   1 
ATOM   778  C CA  . LEU A 1 102 ? 33.616  2.748   47.376  1.00 62.60  ? 102  LEU H CA  1 
ATOM   779  C C   . LEU A 1 102 ? 34.404  3.117   48.630  1.00 65.30  ? 102  LEU H C   1 
ATOM   780  O O   . LEU A 1 102 ? 33.958  2.852   49.748  1.00 65.93  ? 102  LEU H O   1 
ATOM   781  C CB  . LEU A 1 102 ? 33.557  1.227   47.238  1.00 64.59  ? 102  LEU H CB  1 
ATOM   782  C CG  . LEU A 1 102 ? 33.144  0.657   45.885  1.00 63.50  ? 102  LEU H CG  1 
ATOM   783  C CD1 . LEU A 1 102 ? 33.454  -0.827  45.874  1.00 65.72  ? 102  LEU H CD1 1 
ATOM   784  C CD2 . LEU A 1 102 ? 31.679  0.914   45.572  1.00 60.71  ? 102  LEU H CD2 1 
ATOM   785  N N   . THR A 1 103 ? 35.567  3.737   48.431  1.00 68.22  ? 103  THR H N   1 
ATOM   786  C CA  . THR A 1 103 ? 36.475  4.106   49.519  1.00 73.66  ? 103  THR H CA  1 
ATOM   787  C C   . THR A 1 103 ? 36.394  5.594   49.894  1.00 74.18  ? 103  THR H C   1 
ATOM   788  O O   . THR A 1 103 ? 37.251  6.109   50.613  1.00 77.74  ? 103  THR H O   1 
ATOM   789  C CB  . THR A 1 103 ? 37.939  3.748   49.171  1.00 76.01  ? 103  THR H CB  1 
ATOM   790  O OG1 . THR A 1 103 ? 38.355  4.503   48.024  1.00 74.86  ? 103  THR H OG1 1 
ATOM   791  C CG2 . THR A 1 103 ? 38.099  2.237   48.890  1.00 77.94  ? 103  THR H CG2 1 
ATOM   792  N N   . THR A 1 104 ? 35.364  6.283   49.418  1.00 74.50  ? 104  THR H N   1 
ATOM   793  C CA  . THR A 1 104 ? 35.219  7.702   49.718  1.00 75.78  ? 104  THR H CA  1 
ATOM   794  C C   . THR A 1 104 ? 34.600  7.921   51.089  1.00 78.16  ? 104  THR H C   1 
ATOM   795  O O   . THR A 1 104 ? 33.513  7.415   51.381  1.00 78.86  ? 104  THR H O   1 
ATOM   796  C CB  . THR A 1 104 ? 34.369  8.468   48.669  1.00 73.55  ? 104  THR H CB  1 
ATOM   797  O OG1 . THR A 1 104 ? 33.122  7.793   48.442  1.00 72.02  ? 104  THR H OG1 1 
ATOM   798  C CG2 . THR A 1 104 ? 35.130  8.640   47.358  1.00 72.96  ? 104  THR H CG2 1 
ATOM   799  N N   . LEU A 1 105 ? 35.291  8.679   51.929  1.00 80.27  ? 105  LEU H N   1 
ATOM   800  C CA  . LEU A 1 105 ? 34.675  9.186   53.150  1.00 82.14  ? 105  LEU H CA  1 
ATOM   801  C C   . LEU A 1 105 ? 33.889  10.447  52.805  1.00 82.91  ? 105  LEU H C   1 
ATOM   802  O O   . LEU A 1 105 ? 32.840  10.714  53.401  1.00 81.95  ? 105  LEU H O   1 
ATOM   803  C CB  . LEU A 1 105 ? 35.728  9.467   54.225  1.00 82.09  ? 105  LEU H CB  1 
ATOM   804  C CG  . LEU A 1 105 ? 36.682  8.327   54.598  1.00 83.71  ? 105  LEU H CG  1 
ATOM   805  C CD1 . LEU A 1 105 ? 37.684  8.785   55.648  1.00 85.15  ? 105  LEU H CD1 1 
ATOM   806  C CD2 . LEU A 1 105 ? 35.908  7.114   55.086  1.00 85.51  ? 105  LEU H CD2 1 
ATOM   807  N N   . ILE A 1 106 ? 34.406  11.198  51.822  1.00 85.99  ? 106  ILE H N   1 
ATOM   808  C CA  . ILE A 1 106 ? 33.798  12.449  51.331  1.00 86.78  ? 106  ILE H CA  1 
ATOM   809  C C   . ILE A 1 106 ? 32.327  12.258  50.987  1.00 86.91  ? 106  ILE H C   1 
ATOM   810  O O   . ILE A 1 106 ? 31.910  11.175  50.566  1.00 89.76  ? 106  ILE H O   1 
ATOM   811  C CB  . ILE A 1 106 ? 34.529  13.034  50.086  1.00 85.68  ? 106  ILE H CB  1 
ATOM   812  C CG1 . ILE A 1 106 ? 34.733  11.959  48.999  1.00 86.56  ? 106  ILE H CG1 1 
ATOM   813  C CG2 . ILE A 1 106 ? 35.841  13.691  50.497  1.00 86.11  ? 106  ILE H CG2 1 
ATOM   814  C CD1 . ILE A 1 106 ? 34.725  12.473  47.570  1.00 85.81  ? 106  ILE H CD1 1 
ATOM   815  N N   . GLU A 1 107 ? 31.546  13.314  51.168  1.00 83.21  ? 107  GLU H N   1 
ATOM   816  C CA  . GLU A 1 107 ? 30.122  13.236  50.893  1.00 83.08  ? 107  GLU H CA  1 
ATOM   817  C C   . GLU A 1 107 ? 29.760  13.960  49.589  1.00 78.29  ? 107  GLU H C   1 
ATOM   818  O O   . GLU A 1 107 ? 29.038  14.963  49.589  1.00 77.10  ? 107  GLU H O   1 
ATOM   819  C CB  . GLU A 1 107 ? 29.308  13.715  52.101  1.00 85.33  ? 107  GLU H CB  1 
ATOM   820  C CG  . GLU A 1 107 ? 29.777  13.099  53.417  1.00 88.86  ? 107  GLU H CG  1 
ATOM   821  C CD  . GLU A 1 107 ? 28.636  12.587  54.269  1.00 90.68  ? 107  GLU H CD  1 
ATOM   822  O OE1 . GLU A 1 107 ? 27.550  13.207  54.251  1.00 89.68  ? 107  GLU H OE1 1 
ATOM   823  O OE2 . GLU A 1 107 ? 28.829  11.560  54.956  1.00 92.40  ? 107  GLU H OE2 1 
ATOM   824  N N   . ASP A 1 108 ? 30.290  13.420  48.488  1.00 74.28  ? 108  ASP H N   1 
ATOM   825  C CA  . ASP A 1 108 ? 30.053  13.909  47.138  1.00 67.62  ? 108  ASP H CA  1 
ATOM   826  C C   . ASP A 1 108 ? 29.537  12.757  46.259  1.00 65.93  ? 108  ASP H C   1 
ATOM   827  O O   . ASP A 1 108 ? 30.323  11.888  45.861  1.00 68.17  ? 108  ASP H O   1 
ATOM   828  C CB  . ASP A 1 108 ? 31.359  14.469  46.559  1.00 70.70  ? 108  ASP H CB  1 
ATOM   829  C CG  . ASP A 1 108 ? 31.680  15.877  47.055  1.00 73.18  ? 108  ASP H CG  1 
ATOM   830  O OD1 . ASP A 1 108 ? 30.777  16.744  47.042  1.00 77.15  ? 108  ASP H OD1 1 
ATOM   831  O OD2 . ASP A 1 108 ? 32.843  16.126  47.440  1.00 73.62  ? 108  ASP H OD2 1 
ATOM   832  N N   . TRP A 1 109 ? 28.231  12.755  45.953  1.00 59.11  ? 109  TRP H N   1 
ATOM   833  C CA  . TRP A 1 109 ? 27.569  11.655  45.210  1.00 55.33  ? 109  TRP H CA  1 
ATOM   834  C C   . TRP A 1 109 ? 27.073  12.040  43.786  1.00 52.16  ? 109  TRP H C   1 
ATOM   835  O O   . TRP A 1 109 ? 25.880  11.942  43.423  1.00 48.98  ? 109  TRP H O   1 
ATOM   836  C CB  . TRP A 1 109 ? 26.475  11.017  46.065  1.00 54.64  ? 109  TRP H CB  1 
ATOM   837  C CG  . TRP A 1 109 ? 26.849  10.958  47.529  1.00 57.05  ? 109  TRP H CG  1 
ATOM   838  C CD1 . TRP A 1 109 ? 26.190  11.561  48.573  1.00 55.99  ? 109  TRP H CD1 1 
ATOM   839  C CD2 . TRP A 1 109 ? 27.974  10.278  48.112  1.00 58.82  ? 109  TRP H CD2 1 
ATOM   840  N NE1 . TRP A 1 109 ? 26.827  11.291  49.757  1.00 56.37  ? 109  TRP H NE1 1 
ATOM   841  C CE2 . TRP A 1 109 ? 27.921  10.507  49.511  1.00 58.55  ? 109  TRP H CE2 1 
ATOM   842  C CE3 . TRP A 1 109 ? 29.012  9.484   47.591  1.00 60.09  ? 109  TRP H CE3 1 
ATOM   843  C CZ2 . TRP A 1 109 ? 28.876  9.977   50.404  1.00 61.35  ? 109  TRP H CZ2 1 
ATOM   844  C CZ3 . TRP A 1 109 ? 29.966  8.951   48.484  1.00 61.94  ? 109  TRP H CZ3 1 
ATOM   845  C CH2 . TRP A 1 109 ? 29.885  9.206   49.871  1.00 63.07  ? 109  TRP H CH2 1 
ATOM   846  N N   . TYR A 1 110 ? 28.045  12.465  42.989  1.00 51.32  ? 110  TYR H N   1 
ATOM   847  C CA  . TYR A 1 110 ? 27.829  12.942  41.627  1.00 48.50  ? 110  TYR H CA  1 
ATOM   848  C C   . TYR A 1 110 ? 27.982  11.798  40.618  1.00 47.03  ? 110  TYR H C   1 
ATOM   849  O O   . TYR A 1 110 ? 28.568  10.760  40.937  1.00 45.92  ? 110  TYR H O   1 
ATOM   850  C CB  . TYR A 1 110 ? 28.836  14.042  41.342  1.00 49.71  ? 110  TYR H CB  1 
ATOM   851  C CG  . TYR A 1 110 ? 30.273  13.712  41.706  1.00 54.08  ? 110  TYR H CG  1 
ATOM   852  C CD1 . TYR A 1 110 ? 31.114  13.046  40.807  1.00 56.07  ? 110  TYR H CD1 1 
ATOM   853  C CD2 . TYR A 1 110 ? 30.805  14.094  42.942  1.00 56.35  ? 110  TYR H CD2 1 
ATOM   854  C CE1 . TYR A 1 110 ? 32.441  12.763  41.130  1.00 60.45  ? 110  TYR H CE1 1 
ATOM   855  C CE2 . TYR A 1 110 ? 32.123  13.813  43.274  1.00 60.49  ? 110  TYR H CE2 1 
ATOM   856  C CZ  . TYR A 1 110 ? 32.938  13.151  42.372  1.00 62.97  ? 110  TYR H CZ  1 
ATOM   857  O OH  . TYR A 1 110 ? 34.245  12.873  42.719  1.00 66.26  ? 110  TYR H OH  1 
ATOM   858  N N   . PHE A 1 111 ? 27.440  11.977  39.416  1.00 43.25  ? 111  PHE H N   1 
ATOM   859  C CA  . PHE A 1 111 ? 27.627  10.997  38.344  1.00 42.24  ? 111  PHE H CA  1 
ATOM   860  C C   . PHE A 1 111 ? 28.651  11.553  37.351  1.00 41.73  ? 111  PHE H C   1 
ATOM   861  O O   . PHE A 1 111 ? 28.324  12.410  36.517  1.00 41.00  ? 111  PHE H O   1 
ATOM   862  C CB  . PHE A 1 111 ? 26.286  10.642  37.677  1.00 41.46  ? 111  PHE H CB  1 
ATOM   863  C CG  . PHE A 1 111 ? 25.178  10.329  38.656  1.00 41.35  ? 111  PHE H CG  1 
ATOM   864  C CD1 . PHE A 1 111 ? 25.418  9.541   39.774  1.00 42.96  ? 111  PHE H CD1 1 
ATOM   865  C CD2 . PHE A 1 111 ? 23.892  10.819  38.457  1.00 39.99  ? 111  PHE H CD2 1 
ATOM   866  C CE1 . PHE A 1 111 ? 24.402  9.263   40.687  1.00 42.97  ? 111  PHE H CE1 1 
ATOM   867  C CE2 . PHE A 1 111 ? 22.874  10.540  39.360  1.00 41.76  ? 111  PHE H CE2 1 
ATOM   868  C CZ  . PHE A 1 111 ? 23.125  9.748   40.474  1.00 42.30  ? 111  PHE H CZ  1 
ATOM   869  N N   . ASP A 1 112 ? 29.900  11.111  37.474  1.00 41.30  ? 112  ASP H N   1 
ATOM   870  C CA  . ASP A 1 112 ? 30.991  11.717  36.705  1.00 40.50  ? 112  ASP H CA  1 
ATOM   871  C C   . ASP A 1 112 ? 31.205  11.174  35.280  1.00 39.66  ? 112  ASP H C   1 
ATOM   872  O O   . ASP A 1 112 ? 31.831  11.841  34.470  1.00 40.72  ? 112  ASP H O   1 
ATOM   873  C CB  . ASP A 1 112 ? 32.305  11.677  37.490  1.00 41.65  ? 112  ASP H CB  1 
ATOM   874  C CG  . ASP A 1 112 ? 32.790  10.267  37.749  1.00 43.72  ? 112  ASP H CG  1 
ATOM   875  O OD1 . ASP A 1 112 ? 31.985  9.316   37.636  1.00 43.64  ? 112  ASP H OD1 1 
ATOM   876  O OD2 . ASP A 1 112 ? 33.984  10.113  38.075  1.00 45.83  ? 112  ASP H OD2 1 
ATOM   877  N N   . VAL A 1 113 ? 30.739  9.958   34.998  1.00 39.40  ? 113  VAL H N   1 
ATOM   878  C CA  . VAL A 1 113 ? 30.773  9.386   33.634  1.00 38.45  ? 113  VAL H CA  1 
ATOM   879  C C   . VAL A 1 113 ? 29.425  8.713   33.326  1.00 37.84  ? 113  VAL H C   1 
ATOM   880  O O   . VAL A 1 113 ? 29.006  7.823   34.064  1.00 38.18  ? 113  VAL H O   1 
ATOM   881  C CB  . VAL A 1 113 ? 31.928  8.353   33.422  1.00 40.27  ? 113  VAL H CB  1 
ATOM   882  C CG1 . VAL A 1 113 ? 31.932  7.826   31.984  1.00 40.33  ? 113  VAL H CG1 1 
ATOM   883  C CG2 . VAL A 1 113 ? 33.289  8.951   33.757  1.00 40.98  ? 113  VAL H CG2 1 
ATOM   884  N N   . TRP A 1 114 ? 28.747  9.148   32.250  1.00 35.59  ? 114  TRP H N   1 
ATOM   885  C CA  . TRP A 1 114 ? 27.419  8.623   31.873  1.00 34.94  ? 114  TRP H CA  1 
ATOM   886  C C   . TRP A 1 114 ? 27.563  7.660   30.706  1.00 36.61  ? 114  TRP H C   1 
ATOM   887  O O   . TRP A 1 114 ? 28.430  7.853   29.856  1.00 36.34  ? 114  TRP H O   1 
ATOM   888  C CB  . TRP A 1 114 ? 26.454  9.751   31.475  1.00 32.57  ? 114  TRP H CB  1 
ATOM   889  C CG  . TRP A 1 114 ? 25.998  10.630  32.625  1.00 30.54  ? 114  TRP H CG  1 
ATOM   890  C CD1 . TRP A 1 114 ? 26.796  11.413  33.429  1.00 29.72  ? 114  TRP H CD1 1 
ATOM   891  C CD2 . TRP A 1 114 ? 24.647  10.817  33.094  1.00 29.89  ? 114  TRP H CD2 1 
ATOM   892  N NE1 . TRP A 1 114 ? 26.025  12.070  34.364  1.00 28.89  ? 114  TRP H NE1 1 
ATOM   893  C CE2 . TRP A 1 114 ? 24.706  11.730  34.185  1.00 29.34  ? 114  TRP H CE2 1 
ATOM   894  C CE3 . TRP A 1 114 ? 23.399  10.316  32.692  1.00 30.34  ? 114  TRP H CE3 1 
ATOM   895  C CZ2 . TRP A 1 114 ? 23.563  12.154  34.881  1.00 28.97  ? 114  TRP H CZ2 1 
ATOM   896  C CZ3 . TRP A 1 114 ? 22.257  10.720  33.388  1.00 30.40  ? 114  TRP H CZ3 1 
ATOM   897  C CH2 . TRP A 1 114 ? 22.347  11.642  34.477  1.00 30.58  ? 114  TRP H CH2 1 
ATOM   898  N N   . GLY A 1 115 ? 26.717  6.629   30.655  1.00 37.83  ? 115  GLY H N   1 
ATOM   899  C CA  . GLY A 1 115 ? 26.773  5.636   29.581  1.00 38.86  ? 115  GLY H CA  1 
ATOM   900  C C   . GLY A 1 115 ? 26.295  6.172   28.248  1.00 38.17  ? 115  GLY H C   1 
ATOM   901  O O   . GLY A 1 115 ? 25.869  7.325   28.150  1.00 37.75  ? 115  GLY H O   1 
ATOM   902  N N   . THR A 1 116 ? 26.343  5.323   27.224  1.00 39.85  ? 116  THR H N   1 
ATOM   903  C CA  . THR A 1 116 ? 25.979  5.729   25.855  1.00 39.84  ? 116  THR H CA  1 
ATOM   904  C C   . THR A 1 116 ? 24.458  5.872   25.679  1.00 39.96  ? 116  THR H C   1 
ATOM   905  O O   . THR A 1 116 ? 23.985  6.505   24.728  1.00 39.71  ? 116  THR H O   1 
ATOM   906  C CB  . THR A 1 116 ? 26.573  4.772   24.795  1.00 40.96  ? 116  THR H CB  1 
ATOM   907  O OG1 . THR A 1 116 ? 26.144  3.426   25.059  1.00 42.38  ? 116  THR H OG1 1 
ATOM   908  C CG2 . THR A 1 116 ? 28.098  4.832   24.821  1.00 40.81  ? 116  THR H CG2 1 
ATOM   909  N N   . GLY A 1 117 ? 23.697  5.310   26.618  1.00 40.04  ? 117  GLY H N   1 
ATOM   910  C CA  . GLY A 1 117 ? 22.241  5.365   26.555  1.00 40.29  ? 117  GLY H CA  1 
ATOM   911  C C   . GLY A 1 117 ? 21.627  4.191   25.799  1.00 41.97  ? 117  GLY H C   1 
ATOM   912  O O   . GLY A 1 117 ? 22.171  3.726   24.788  1.00 42.31  ? 117  GLY H O   1 
ATOM   913  N N   . THR A 1 118 ? 20.482  3.723   26.294  1.00 42.20  ? 118  THR H N   1 
ATOM   914  C CA  . THR A 1 118 ? 19.707  2.676   25.642  1.00 44.07  ? 118  THR H CA  1 
ATOM   915  C C   . THR A 1 118 ? 18.270  3.160   25.504  1.00 44.72  ? 118  THR H C   1 
ATOM   916  O O   . THR A 1 118 ? 17.593  3.389   26.509  1.00 44.93  ? 118  THR H O   1 
ATOM   917  C CB  . THR A 1 118 ? 19.708  1.384   26.486  1.00 45.36  ? 118  THR H CB  1 
ATOM   918  O OG1 . THR A 1 118 ? 21.043  0.881   26.579  1.00 45.77  ? 118  THR H OG1 1 
ATOM   919  C CG2 . THR A 1 118 ? 18.798  0.310   25.878  1.00 47.34  ? 118  THR H CG2 1 
ATOM   920  N N   . THR A 1 119 ? 17.802  3.328   24.270  1.00 45.15  ? 119  THR H N   1 
ATOM   921  C CA  . THR A 1 119 ? 16.425  3.773   24.047  1.00 45.39  ? 119  THR H CA  1 
ATOM   922  C C   . THR A 1 119 ? 15.468  2.572   24.105  1.00 47.09  ? 119  THR H C   1 
ATOM   923  O O   . THR A 1 119 ? 15.647  1.587   23.393  1.00 48.51  ? 119  THR H O   1 
ATOM   924  C CB  . THR A 1 119 ? 16.273  4.558   22.725  1.00 45.91  ? 119  THR H CB  1 
ATOM   925  O OG1 . THR A 1 119 ? 17.209  5.648   22.703  1.00 44.29  ? 119  THR H OG1 1 
ATOM   926  C CG2 . THR A 1 119 ? 14.848  5.119   22.592  1.00 47.22  ? 119  THR H CG2 1 
ATOM   927  N N   . VAL A 1 120 ? 14.470  2.656   24.982  1.00 46.81  ? 120  VAL H N   1 
ATOM   928  C CA  . VAL A 1 120 ? 13.467  1.595   25.124  1.00 48.57  ? 120  VAL H CA  1 
ATOM   929  C C   . VAL A 1 120 ? 12.123  2.091   24.599  1.00 48.94  ? 120  VAL H C   1 
ATOM   930  O O   . VAL A 1 120 ? 11.628  3.120   25.046  1.00 48.22  ? 120  VAL H O   1 
ATOM   931  C CB  . VAL A 1 120 ? 13.332  1.110   26.593  1.00 48.59  ? 120  VAL H CB  1 
ATOM   932  C CG1 . VAL A 1 120 ? 12.205  0.090   26.723  1.00 50.91  ? 120  VAL H CG1 1 
ATOM   933  C CG2 . VAL A 1 120 ? 14.644  0.520   27.093  1.00 47.97  ? 120  VAL H CG2 1 
ATOM   934  N N   . THR A 1 121 ? 11.559  1.383   23.626  1.00 50.46  ? 121  THR H N   1 
ATOM   935  C CA  . THR A 1 121 ? 10.214  1.691   23.142  1.00 51.87  ? 121  THR H CA  1 
ATOM   936  C C   . THR A 1 121 ? 9.266   0.561   23.536  1.00 54.87  ? 121  THR H C   1 
ATOM   937  O O   . THR A 1 121 ? 9.521   -0.607  23.254  1.00 56.35  ? 121  THR H O   1 
ATOM   938  C CB  . THR A 1 121 ? 10.174  1.929   21.607  1.00 52.25  ? 121  THR H CB  1 
ATOM   939  O OG1 . THR A 1 121 ? 10.941  3.099   21.280  1.00 50.09  ? 121  THR H OG1 1 
ATOM   940  C CG2 . THR A 1 121 ? 8.725   2.110   21.104  1.00 53.86  ? 121  THR H CG2 1 
ATOM   941  N N   . VAL A 1 122 ? 8.183   0.917   24.216  1.00 56.28  ? 122  VAL H N   1 
ATOM   942  C CA  . VAL A 1 122 ? 7.155   -0.050  24.575  1.00 58.91  ? 122  VAL H CA  1 
ATOM   943  C C   . VAL A 1 122 ? 5.864   0.299   23.856  1.00 60.30  ? 122  VAL H C   1 
ATOM   944  O O   . VAL A 1 122 ? 5.312   1.377   24.055  1.00 60.03  ? 122  VAL H O   1 
ATOM   945  C CB  . VAL A 1 122 ? 6.946   -0.152  26.097  1.00 59.66  ? 122  VAL H CB  1 
ATOM   946  C CG1 . VAL A 1 122 ? 7.954   -1.112  26.700  1.00 60.66  ? 122  VAL H CG1 1 
ATOM   947  C CG2 . VAL A 1 122 ? 7.079   1.198   26.754  1.00 57.28  ? 122  VAL H CG2 1 
ATOM   948  N N   . SER A 1 123 ? 5.433   -0.598  22.974  1.00 61.81  ? 123  SER H N   1 
ATOM   949  C CA  . SER A 1 123 ? 4.179   -0.448  22.235  1.00 63.94  ? 123  SER H CA  1 
ATOM   950  C C   . SER A 1 123 ? 3.828   -1.736  21.505  1.00 66.35  ? 123  SER H C   1 
ATOM   951  O O   . SER A 1 123 ? 4.657   -2.634  21.374  1.00 66.06  ? 123  SER H O   1 
ATOM   952  C CB  . SER A 1 123 ? 4.214   0.755   21.275  1.00 63.21  ? 123  SER H CB  1 
ATOM   953  O OG  . SER A 1 123 ? 4.522   0.387   19.951  1.00 64.14  ? 123  SER H OG  1 
ATOM   954  N N   . SER A 1 124 ? 2.582   -1.816  21.050  1.00 68.71  ? 124  SER H N   1 
ATOM   955  C CA  . SER A 1 124 ? 2.068   -2.979  20.358  1.00 71.67  ? 124  SER H CA  1 
ATOM   956  C C   . SER A 1 124 ? 2.070   -2.723  18.864  1.00 72.47  ? 124  SER H C   1 
ATOM   957  O O   . SER A 1 124 ? 1.583   -3.541  18.081  1.00 74.57  ? 124  SER H O   1 
ATOM   958  C CB  . SER A 1 124 ? 0.645   -3.233  20.817  1.00 74.65  ? 124  SER H CB  1 
ATOM   959  O OG  . SER A 1 124 ? 0.543   -2.984  22.202  1.00 74.32  ? 124  SER H OG  1 
ATOM   960  N N   . ALA A 1 125 ? 2.608   -1.567  18.475  1.00 46.01  ? 125  ALA H N   1 
ATOM   961  C CA  . ALA A 1 125 ? 2.685   -1.196  17.068  1.00 44.84  ? 125  ALA H CA  1 
ATOM   962  C C   . ALA A 1 125 ? 3.711   -2.096  16.355  1.00 43.80  ? 125  ALA H C   1 
ATOM   963  O O   . ALA A 1 125 ? 4.719   -2.485  16.941  1.00 43.63  ? 125  ALA H O   1 
ATOM   964  C CB  . ALA A 1 125 ? 3.016   0.285   16.917  1.00 43.07  ? 125  ALA H CB  1 
ATOM   965  N N   . LYS A 1 126 ? 3.419   -2.458  15.112  1.00 43.99  ? 126  LYS H N   1 
ATOM   966  C CA  . LYS A 1 126 ? 4.241   -3.406  14.364  1.00 43.64  ? 126  LYS H CA  1 
ATOM   967  C C   . LYS A 1 126 ? 5.493   -2.755  13.773  1.00 40.77  ? 126  LYS H C   1 
ATOM   968  O O   . LYS A 1 126 ? 5.441   -1.644  13.250  1.00 39.60  ? 126  LYS H O   1 
ATOM   969  C CB  . LYS A 1 126 ? 3.417   -4.047  13.238  1.00 44.87  ? 126  LYS H CB  1 
ATOM   970  C CG  . LYS A 1 126 ? 2.452   -5.135  13.697  1.00 49.22  ? 126  LYS H CG  1 
ATOM   971  C CD  . LYS A 1 126 ? 3.179   -6.449  13.972  1.00 51.01  ? 126  LYS H CD  1 
ATOM   972  C CE  . LYS A 1 126 ? 2.544   -7.236  15.111  1.00 54.79  ? 126  LYS H CE  1 
ATOM   973  N NZ  . LYS A 1 126 ? 2.825   -6.554  16.411  1.00 55.93  ? 126  LYS H NZ  1 
ATOM   974  N N   . THR A 1 127 ? 6.618   -3.455  13.832  1.00 40.70  ? 127  THR H N   1 
ATOM   975  C CA  . THR A 1 127 ? 7.806   -3.007  13.094  1.00 38.20  ? 127  THR H CA  1 
ATOM   976  C C   . THR A 1 127 ? 7.481   -2.951  11.592  1.00 38.10  ? 127  THR H C   1 
ATOM   977  O O   . THR A 1 127 ? 6.996   -3.918  11.032  1.00 37.86  ? 127  THR H O   1 
ATOM   978  C CB  . THR A 1 127 ? 9.025   -3.925  13.363  1.00 38.06  ? 127  THR H CB  1 
ATOM   979  O OG1 . THR A 1 127 ? 9.364   -3.864  14.752  1.00 38.27  ? 127  THR H OG1 1 
ATOM   980  C CG2 . THR A 1 127 ? 10.240  -3.518  12.540  1.00 35.88  ? 127  THR H CG2 1 
ATOM   981  N N   . THR A 1 128 ? 7.750   -1.804  10.964  1.00 37.04  ? 128  THR H N   1 
ATOM   982  C CA  . THR A 1 128 ? 7.433   -1.551  9.556   1.00 36.42  ? 128  THR H CA  1 
ATOM   983  C C   . THR A 1 128 ? 8.630   -0.864  8.908   1.00 35.34  ? 128  THR H C   1 
ATOM   984  O O   . THR A 1 128 ? 9.153   0.120   9.457   1.00 34.49  ? 128  THR H O   1 
ATOM   985  C CB  . THR A 1 128 ? 6.204   -0.609  9.434   1.00 36.79  ? 128  THR H CB  1 
ATOM   986  O OG1 . THR A 1 128 ? 5.134   -1.120  10.227  1.00 37.74  ? 128  THR H OG1 1 
ATOM   987  C CG2 . THR A 1 128 ? 5.730   -0.475  7.996   1.00 36.99  ? 128  THR H CG2 1 
ATOM   988  N N   . PRO A 1 129 ? 9.060   -1.372  7.735   1.00 35.47  ? 129  PRO H N   1 
ATOM   989  C CA  . PRO A 1 129 ? 10.207  -0.789  7.050   1.00 34.91  ? 129  PRO H CA  1 
ATOM   990  C C   . PRO A 1 129 ? 9.830   0.549   6.388   1.00 35.18  ? 129  PRO H C   1 
ATOM   991  O O   . PRO A 1 129 ? 8.632   0.796   6.124   1.00 34.93  ? 129  PRO H O   1 
ATOM   992  C CB  . PRO A 1 129 ? 10.575  -1.859  6.006   1.00 34.03  ? 129  PRO H CB  1 
ATOM   993  C CG  . PRO A 1 129 ? 9.279   -2.523  5.690   1.00 35.11  ? 129  PRO H CG  1 
ATOM   994  C CD  . PRO A 1 129 ? 8.441   -2.471  6.955   1.00 35.71  ? 129  PRO H CD  1 
ATOM   995  N N   . PRO A 1 130 ? 10.839  1.406   6.133   1.00 35.80  ? 130  PRO H N   1 
ATOM   996  C CA  . PRO A 1 130 ? 10.595  2.711   5.527   1.00 35.77  ? 130  PRO H CA  1 
ATOM   997  C C   . PRO A 1 130 ? 10.316  2.667   4.013   1.00 35.59  ? 130  PRO H C   1 
ATOM   998  O O   . PRO A 1 130 ? 10.808  1.778   3.290   1.00 35.75  ? 130  PRO H O   1 
ATOM   999  C CB  . PRO A 1 130 ? 11.898  3.473   5.799   1.00 35.75  ? 130  PRO H CB  1 
ATOM   1000 C CG  . PRO A 1 130 ? 12.966  2.421   5.862   1.00 35.57  ? 130  PRO H CG  1 
ATOM   1001 C CD  . PRO A 1 130 ? 12.284  1.170   6.379   1.00 36.44  ? 130  PRO H CD  1 
ATOM   1002 N N   . SER A 1 131 ? 9.517   3.627   3.552   1.00 34.74  ? 131  SER H N   1 
ATOM   1003 C CA  . SER A 1 131 ? 9.489   3.987   2.140   1.00 34.78  ? 131  SER H CA  1 
ATOM   1004 C C   . SER A 1 131 ? 10.352  5.238   2.016   1.00 33.28  ? 131  SER H C   1 
ATOM   1005 O O   . SER A 1 131 ? 10.224  6.166   2.822   1.00 32.30  ? 131  SER H O   1 
ATOM   1006 C CB  . SER A 1 131 ? 8.070   4.282   1.679   1.00 36.08  ? 131  SER H CB  1 
ATOM   1007 O OG  . SER A 1 131 ? 7.295   3.114   1.717   1.00 38.73  ? 131  SER H OG  1 
ATOM   1008 N N   . VAL A 1 132 ? 11.249  5.249   1.030   1.00 32.14  ? 132  VAL H N   1 
ATOM   1009 C CA  . VAL A 1 132 ? 12.141  6.382   0.822   1.00 30.78  ? 132  VAL H CA  1 
ATOM   1010 C C   . VAL A 1 132 ? 11.808  7.078   -0.491  1.00 31.04  ? 132  VAL H C   1 
ATOM   1011 O O   . VAL A 1 132 ? 11.828  6.459   -1.567  1.00 32.27  ? 132  VAL H O   1 
ATOM   1012 C CB  . VAL A 1 132 ? 13.642  5.960   0.871   1.00 31.05  ? 132  VAL H CB  1 
ATOM   1013 C CG1 . VAL A 1 132 ? 14.544  7.180   0.692   1.00 29.91  ? 132  VAL H CG1 1 
ATOM   1014 C CG2 . VAL A 1 132 ? 13.928  5.269   2.206   1.00 30.37  ? 132  VAL H CG2 1 
ATOM   1015 N N   . TYR A 1 133 ? 11.472  8.362   -0.403  1.00 30.08  ? 133  TYR H N   1 
ATOM   1016 C CA  . TYR A 1 133 ? 11.036  9.103   -1.589  1.00 30.23  ? 133  TYR H CA  1 
ATOM   1017 C C   . TYR A 1 133 ? 12.007  10.230  -1.899  1.00 29.50  ? 133  TYR H C   1 
ATOM   1018 O O   . TYR A 1 133 ? 12.400  10.956  -0.989  1.00 28.57  ? 133  TYR H O   1 
ATOM   1019 C CB  . TYR A 1 133 ? 9.617   9.652   -1.383  1.00 30.74  ? 133  TYR H CB  1 
ATOM   1020 C CG  . TYR A 1 133 ? 8.586   8.584   -1.103  1.00 31.24  ? 133  TYR H CG  1 
ATOM   1021 C CD1 . TYR A 1 133 ? 8.417   7.490   -1.970  1.00 32.05  ? 133  TYR H CD1 1 
ATOM   1022 C CD2 . TYR A 1 133 ? 7.784   8.656   0.029   1.00 31.09  ? 133  TYR H CD2 1 
ATOM   1023 C CE1 . TYR A 1 133 ? 7.478   6.516   -1.701  1.00 33.02  ? 133  TYR H CE1 1 
ATOM   1024 C CE2 . TYR A 1 133 ? 6.814   7.691   0.291   1.00 32.70  ? 133  TYR H CE2 1 
ATOM   1025 C CZ  . TYR A 1 133 ? 6.669   6.617   -0.564  1.00 33.44  ? 133  TYR H CZ  1 
ATOM   1026 O OH  . TYR A 1 133 ? 5.680   5.650   -0.309  1.00 33.89  ? 133  TYR H OH  1 
ATOM   1027 N N   . PRO A 1 134 ? 12.404  10.363  -3.182  1.00 30.80  ? 134  PRO H N   1 
ATOM   1028 C CA  . PRO A 1 134 ? 13.316  11.415  -3.603  1.00 31.10  ? 134  PRO H CA  1 
ATOM   1029 C C   . PRO A 1 134 ? 12.589  12.750  -3.704  1.00 31.72  ? 134  PRO H C   1 
ATOM   1030 O O   . PRO A 1 134 ? 11.435  12.807  -4.163  1.00 32.64  ? 134  PRO H O   1 
ATOM   1031 C CB  . PRO A 1 134 ? 13.783  10.948  -4.985  1.00 32.48  ? 134  PRO H CB  1 
ATOM   1032 C CG  . PRO A 1 134 ? 12.644  10.121  -5.512  1.00 33.30  ? 134  PRO H CG  1 
ATOM   1033 C CD  . PRO A 1 134 ? 12.017  9.475   -4.302  1.00 32.16  ? 134  PRO H CD  1 
ATOM   1034 N N   . LEU A 1 135 ? 13.254  13.808  -3.252  1.00 31.29  ? 135  LEU H N   1 
ATOM   1035 C CA  . LEU A 1 135 ? 12.761  15.177  -3.403  1.00 32.04  ? 135  LEU H CA  1 
ATOM   1036 C C   . LEU A 1 135 ? 13.697  15.967  -4.321  1.00 34.00  ? 135  LEU H C   1 
ATOM   1037 O O   . LEU A 1 135 ? 14.819  16.299  -3.936  1.00 33.85  ? 135  LEU H O   1 
ATOM   1038 C CB  . LEU A 1 135 ? 12.632  15.858  -2.025  1.00 29.91  ? 135  LEU H CB  1 
ATOM   1039 C CG  . LEU A 1 135 ? 11.761  15.149  -0.981  1.00 29.07  ? 135  LEU H CG  1 
ATOM   1040 C CD1 . LEU A 1 135 ? 11.919  15.833  0.380   1.00 28.05  ? 135  LEU H CD1 1 
ATOM   1041 C CD2 . LEU A 1 135 ? 10.285  15.045  -1.405  1.00 30.92  ? 135  LEU H CD2 1 
ATOM   1042 N N   . ALA A 1 136 ? 13.234  16.251  -5.535  1.00 36.66  ? 136  ALA H N   1 
ATOM   1043 C CA  . ALA A 1 136 ? 14.048  16.922  -6.555  1.00 40.66  ? 136  ALA H CA  1 
ATOM   1044 C C   . ALA A 1 136 ? 13.301  18.149  -7.079  1.00 44.58  ? 136  ALA H C   1 
ATOM   1045 O O   . ALA A 1 136 ? 12.078  18.150  -7.092  1.00 44.31  ? 136  ALA H O   1 
ATOM   1046 C CB  . ALA A 1 136 ? 14.336  15.955  -7.701  1.00 41.04  ? 136  ALA H CB  1 
ATOM   1047 N N   . PRO A 1 137 ? 14.022  19.203  -7.517  1.00 49.39  ? 137  PRO H N   1 
ATOM   1048 C CA  . PRO A 1 137 ? 13.266  20.364  -8.031  1.00 54.30  ? 137  PRO H CA  1 
ATOM   1049 C C   . PRO A 1 137 ? 12.749  20.173  -9.473  1.00 60.17  ? 137  PRO H C   1 
ATOM   1050 O O   . PRO A 1 137 ? 13.102  19.197  -10.144 1.00 61.24  ? 137  PRO H O   1 
ATOM   1051 C CB  . PRO A 1 137 ? 14.300  21.491  -7.986  1.00 53.15  ? 137  PRO H CB  1 
ATOM   1052 C CG  . PRO A 1 137 ? 15.608  20.787  -8.208  1.00 52.46  ? 137  PRO H CG  1 
ATOM   1053 C CD  . PRO A 1 137 ? 15.477  19.461  -7.497  1.00 50.29  ? 137  PRO H CD  1 
ATOM   1054 N N   . GLY A 1 138 ? 11.904  21.099  -9.927  1.00 67.46  ? 138  GLY H N   1 
ATOM   1055 C CA  . GLY A 1 138 ? 11.486  21.148  -11.335 1.00 78.11  ? 138  GLY H CA  1 
ATOM   1056 C C   . GLY A 1 138 ? 11.740  22.504  -11.984 1.00 85.04  ? 138  GLY H C   1 
ATOM   1057 O O   . GLY A 1 138 ? 10.935  22.966  -12.801 1.00 88.22  ? 138  GLY H O   1 
ATOM   1058 N N   . SER A 1 139 ? 12.875  23.122  -11.642 1.00 88.26  ? 139  SER H N   1 
ATOM   1059 C CA  . SER A 1 139 ? 13.136  24.541  -11.942 1.00 92.36  ? 139  SER H CA  1 
ATOM   1060 C C   . SER A 1 139 ? 14.322  24.845  -12.860 1.00 96.92  ? 139  SER H C   1 
ATOM   1061 O O   . SER A 1 139 ? 14.469  25.992  -13.290 1.00 100.51 ? 139  SER H O   1 
ATOM   1062 C CB  . SER A 1 139 ? 13.329  25.327  -10.639 1.00 87.45  ? 139  SER H CB  1 
ATOM   1063 O OG  . SER A 1 139 ? 12.085  25.645  -10.053 1.00 85.76  ? 139  SER H OG  1 
ATOM   1064 N N   . ALA A 1 140 ? 15.152  23.838  -13.149 1.00 99.40  ? 140  ALA H N   1 
ATOM   1065 C CA  . ALA A 1 140 ? 16.470  24.022  -13.803 1.00 100.67 ? 140  ALA H CA  1 
ATOM   1066 C C   . ALA A 1 140 ? 17.377  25.049  -13.067 1.00 100.74 ? 140  ALA H C   1 
ATOM   1067 O O   . ALA A 1 140 ? 17.378  25.105  -11.828 1.00 97.81  ? 140  ALA H O   1 
ATOM   1068 C CB  . ALA A 1 140 ? 16.314  24.347  -15.293 1.00 100.78 ? 140  ALA H CB  1 
ATOM   1069 N N   . ALA A 1 141 ? 18.147  25.841  -13.817 1.00 102.33 ? 141  ALA H N   1 
ATOM   1070 C CA  . ALA A 1 141 ? 19.019  26.865  -13.229 1.00 100.05 ? 141  ALA H CA  1 
ATOM   1071 C C   . ALA A 1 141 ? 18.251  28.162  -12.992 1.00 99.02  ? 141  ALA H C   1 
ATOM   1072 O O   . ALA A 1 141 ? 18.221  28.685  -11.879 1.00 96.93  ? 141  ALA H O   1 
ATOM   1073 C CB  . ALA A 1 141 ? 20.229  27.117  -14.120 1.00 101.49 ? 141  ALA H CB  1 
ATOM   1074 N N   . ASN A 1 144 ? 18.836  30.132  -8.762  1.00 77.40  ? 144  ASN H N   1 
ATOM   1075 C CA  . ASN A 1 144 ? 19.854  30.161  -7.711  1.00 75.05  ? 144  ASN H CA  1 
ATOM   1076 C C   . ASN A 1 144 ? 21.178  29.496  -8.161  1.00 73.06  ? 144  ASN H C   1 
ATOM   1077 O O   . ASN A 1 144 ? 21.212  28.748  -9.147  1.00 72.14  ? 144  ASN H O   1 
ATOM   1078 C CB  . ASN A 1 144 ? 19.297  29.522  -6.417  1.00 73.85  ? 144  ASN H CB  1 
ATOM   1079 C CG  . ASN A 1 144 ? 19.890  30.127  -5.142  1.00 75.42  ? 144  ASN H CG  1 
ATOM   1080 O OD1 . ASN A 1 144 ? 20.478  31.215  -5.157  1.00 78.87  ? 144  ASN H OD1 1 
ATOM   1081 N ND2 . ASN A 1 144 ? 19.724  29.424  -4.026  1.00 71.32  ? 144  ASN H ND2 1 
ATOM   1082 N N   . SER A 1 145 ? 22.265  29.806  -7.450  1.00 70.54  ? 145  SER H N   1 
ATOM   1083 C CA  . SER A 1 145 ? 23.570  29.160  -7.654  1.00 67.77  ? 145  SER H CA  1 
ATOM   1084 C C   . SER A 1 145 ? 23.689  27.884  -6.817  1.00 63.39  ? 145  SER H C   1 
ATOM   1085 O O   . SER A 1 145 ? 24.576  27.059  -7.056  1.00 63.71  ? 145  SER H O   1 
ATOM   1086 C CB  . SER A 1 145 ? 24.698  30.119  -7.281  1.00 69.28  ? 145  SER H CB  1 
ATOM   1087 O OG  . SER A 1 145 ? 24.559  30.541  -5.933  1.00 70.06  ? 145  SER H OG  1 
ATOM   1088 N N   . MET A 1 146 ? 22.800  27.755  -5.829  1.00 58.30  ? 146  MET H N   1 
ATOM   1089 C CA  . MET A 1 146 ? 22.690  26.576  -4.974  1.00 55.11  ? 146  MET H CA  1 
ATOM   1090 C C   . MET A 1 146 ? 21.393  25.851  -5.296  1.00 51.16  ? 146  MET H C   1 
ATOM   1091 O O   . MET A 1 146 ? 20.400  26.478  -5.662  1.00 52.56  ? 146  MET H O   1 
ATOM   1092 C CB  . MET A 1 146 ? 22.660  26.966  -3.486  1.00 55.81  ? 146  MET H CB  1 
ATOM   1093 C CG  . MET A 1 146 ? 23.833  27.787  -2.976  1.00 58.87  ? 146  MET H CG  1 
ATOM   1094 S SD  . MET A 1 146 ? 25.403  26.897  -3.013  1.00 67.01  ? 146  MET H SD  1 
ATOM   1095 C CE  . MET A 1 146 ? 25.294  25.929  -1.512  1.00 64.04  ? 146  MET H CE  1 
ATOM   1096 N N   . VAL A 1 147 ? 21.384  24.534  -5.148  1.00 46.74  ? 147  VAL H N   1 
ATOM   1097 C CA  . VAL A 1 147 ? 20.142  23.779  -5.317  1.00 43.38  ? 147  VAL H CA  1 
ATOM   1098 C C   . VAL A 1 147 ? 19.884  22.909  -4.083  1.00 39.06  ? 147  VAL H C   1 
ATOM   1099 O O   . VAL A 1 147 ? 20.820  22.371  -3.496  1.00 38.35  ? 147  VAL H O   1 
ATOM   1100 C CB  . VAL A 1 147 ? 20.111  22.981  -6.656  1.00 44.19  ? 147  VAL H CB  1 
ATOM   1101 C CG1 . VAL A 1 147 ? 21.146  21.865  -6.679  1.00 45.05  ? 147  VAL H CG1 1 
ATOM   1102 C CG2 . VAL A 1 147 ? 18.719  22.416  -6.918  1.00 43.95  ? 147  VAL H CG2 1 
ATOM   1103 N N   . THR A 1 148 ? 18.622  22.813  -3.676  1.00 36.94  ? 148  THR H N   1 
ATOM   1104 C CA  . THR A 1 148 ? 18.239  22.006  -2.519  1.00 34.32  ? 148  THR H CA  1 
ATOM   1105 C C   . THR A 1 148 ? 17.525  20.723  -2.970  1.00 34.63  ? 148  THR H C   1 
ATOM   1106 O O   . THR A 1 148 ? 16.543  20.775  -3.721  1.00 35.19  ? 148  THR H O   1 
ATOM   1107 C CB  . THR A 1 148 ? 17.388  22.812  -1.496  1.00 33.16  ? 148  THR H CB  1 
ATOM   1108 O OG1 . THR A 1 148 ? 18.204  23.823  -0.892  1.00 32.97  ? 148  THR H OG1 1 
ATOM   1109 C CG2 . THR A 1 148 ? 16.833  21.932  -0.371  1.00 31.09  ? 148  THR H CG2 1 
ATOM   1110 N N   . LEU A 1 149 ? 18.064  19.585  -2.519  1.00 33.05  ? 149  LEU H N   1 
ATOM   1111 C CA  . LEU A 1 149 ? 17.490  18.260  -2.758  1.00 31.94  ? 149  LEU H CA  1 
ATOM   1112 C C   . LEU A 1 149 ? 17.084  17.650  -1.419  1.00 30.69  ? 149  LEU H C   1 
ATOM   1113 O O   . LEU A 1 149 ? 17.442  18.170  -0.358  1.00 29.96  ? 149  LEU H O   1 
ATOM   1114 C CB  . LEU A 1 149 ? 18.509  17.370  -3.466  1.00 32.35  ? 149  LEU H CB  1 
ATOM   1115 C CG  . LEU A 1 149 ? 19.252  17.927  -4.684  1.00 33.61  ? 149  LEU H CG  1 
ATOM   1116 C CD1 . LEU A 1 149 ? 20.436  17.028  -5.039  1.00 35.04  ? 149  LEU H CD1 1 
ATOM   1117 C CD2 . LEU A 1 149 ? 18.322  18.107  -5.864  1.00 35.29  ? 149  LEU H CD2 1 
ATOM   1118 N N   . GLY A 1 150 ? 16.290  16.584  -1.445  1.00 30.04  ? 150  GLY H N   1 
ATOM   1119 C CA  . GLY A 1 150 ? 15.848  15.996  -0.200  1.00 28.90  ? 150  GLY H CA  1 
ATOM   1120 C C   . GLY A 1 150 ? 15.470  14.548  -0.325  1.00 29.54  ? 150  GLY H C   1 
ATOM   1121 O O   . GLY A 1 150 ? 15.349  14.022  -1.436  1.00 30.07  ? 150  GLY H O   1 
ATOM   1122 N N   . CYS A 1 151 ? 15.297  13.920  0.834   1.00 29.97  ? 151  CYS H N   1 
ATOM   1123 C CA  . CYS A 1 151 ? 14.700  12.594  0.945   1.00 31.19  ? 151  CYS H CA  1 
ATOM   1124 C C   . CYS A 1 151 ? 13.620  12.601  1.994   1.00 29.18  ? 151  CYS H C   1 
ATOM   1125 O O   . CYS A 1 151 ? 13.830  13.135  3.082   1.00 27.39  ? 151  CYS H O   1 
ATOM   1126 C CB  . CYS A 1 151 ? 15.774  11.564  1.309   1.00 34.91  ? 151  CYS H CB  1 
ATOM   1127 S SG  . CYS A 1 151 ? 16.359  10.858  -0.223  1.00 43.24  ? 151  CYS H SG  1 
ATOM   1128 N N   . LEU A 1 152 ? 12.463  12.023  1.657   1.00 28.37  ? 152  LEU H N   1 
ATOM   1129 C CA  . LEU A 1 152 ? 11.365  11.842  2.593   1.00 28.29  ? 152  LEU H CA  1 
ATOM   1130 C C   . LEU A 1 152 ? 11.288  10.363  2.964   1.00 28.90  ? 152  LEU H C   1 
ATOM   1131 O O   . LEU A 1 152 ? 11.100  9.492   2.101   1.00 30.54  ? 152  LEU H O   1 
ATOM   1132 C CB  . LEU A 1 152 ? 10.037  12.289  1.953   1.00 28.80  ? 152  LEU H CB  1 
ATOM   1133 C CG  . LEU A 1 152 ? 8.724   12.104  2.733   1.00 29.19  ? 152  LEU H CG  1 
ATOM   1134 C CD1 . LEU A 1 152 ? 8.666   12.974  3.992   1.00 28.49  ? 152  LEU H CD1 1 
ATOM   1135 C CD2 . LEU A 1 152 ? 7.515   12.354  1.839   1.00 31.49  ? 152  LEU H CD2 1 
ATOM   1136 N N   . VAL A 1 153 ? 11.426  10.080  4.248   1.00 28.81  ? 153  VAL H N   1 
ATOM   1137 C CA  . VAL A 1 153 ? 11.404  8.713   4.745   1.00 29.39  ? 153  VAL H CA  1 
ATOM   1138 C C   . VAL A 1 153 ? 10.110  8.564   5.543   1.00 30.62  ? 153  VAL H C   1 
ATOM   1139 O O   . VAL A 1 153 ? 9.944   9.203   6.584   1.00 31.07  ? 153  VAL H O   1 
ATOM   1140 C CB  . VAL A 1 153 ? 12.650  8.448   5.623   1.00 29.25  ? 153  VAL H CB  1 
ATOM   1141 C CG1 . VAL A 1 153 ? 12.662  7.001   6.115   1.00 29.98  ? 153  VAL H CG1 1 
ATOM   1142 C CG2 . VAL A 1 153 ? 13.897  8.761   4.821   1.00 28.89  ? 153  VAL H CG2 1 
ATOM   1143 N N   . LYS A 1 154 ? 9.202   7.732   5.042   1.00 31.43  ? 154  LYS H N   1 
ATOM   1144 C CA  . LYS A 1 154 ? 7.840   7.671   5.572   1.00 32.67  ? 154  LYS H CA  1 
ATOM   1145 C C   . LYS A 1 154 ? 7.364   6.259   5.920   1.00 33.00  ? 154  LYS H C   1 
ATOM   1146 O O   . LYS A 1 154 ? 7.776   5.271   5.310   1.00 31.51  ? 154  LYS H O   1 
ATOM   1147 C CB  . LYS A 1 154 ? 6.898   8.338   4.557   1.00 34.20  ? 154  LYS H CB  1 
ATOM   1148 C CG  . LYS A 1 154 ? 5.503   8.613   5.038   1.00 38.38  ? 154  LYS H CG  1 
ATOM   1149 C CD  . LYS A 1 154 ? 4.658   9.170   3.904   1.00 39.63  ? 154  LYS H CD  1 
ATOM   1150 C CE  . LYS A 1 154 ? 3.208   9.235   4.329   1.00 41.42  ? 154  LYS H CE  1 
ATOM   1151 N NZ  . LYS A 1 154 ? 3.187   9.973   5.616   1.00 39.93  ? 154  LYS H NZ  1 
ATOM   1152 N N   . GLY A 1 155 ? 6.498   6.186   6.929   1.00 34.07  ? 155  GLY H N   1 
ATOM   1153 C CA  . GLY A 1 155 ? 5.719   4.984   7.217   1.00 35.12  ? 155  GLY H CA  1 
ATOM   1154 C C   . GLY A 1 155 ? 6.498   3.853   7.866   1.00 34.64  ? 155  GLY H C   1 
ATOM   1155 O O   . GLY A 1 155 ? 6.205   2.672   7.627   1.00 36.12  ? 155  GLY H O   1 
ATOM   1156 N N   . TYR A 1 156 ? 7.462   4.215   8.705   1.00 33.10  ? 156  TYR H N   1 
ATOM   1157 C CA  . TYR A 1 156 ? 8.308   3.241   9.396   1.00 33.03  ? 156  TYR H CA  1 
ATOM   1158 C C   . TYR A 1 156 ? 8.065   3.209   10.907  1.00 33.29  ? 156  TYR H C   1 
ATOM   1159 O O   . TYR A 1 156 ? 7.564   4.169   11.494  1.00 33.54  ? 156  TYR H O   1 
ATOM   1160 C CB  . TYR A 1 156 ? 9.794   3.480   9.090   1.00 30.79  ? 156  TYR H CB  1 
ATOM   1161 C CG  . TYR A 1 156 ? 10.405  4.685   9.774   1.00 29.99  ? 156  TYR H CG  1 
ATOM   1162 C CD1 . TYR A 1 156 ? 10.933  4.592   11.073  1.00 29.91  ? 156  TYR H CD1 1 
ATOM   1163 C CD2 . TYR A 1 156 ? 10.471  5.918   9.123   1.00 29.28  ? 156  TYR H CD2 1 
ATOM   1164 C CE1 . TYR A 1 156 ? 11.500  5.700   11.707  1.00 29.58  ? 156  TYR H CE1 1 
ATOM   1165 C CE2 . TYR A 1 156 ? 11.042  7.038   9.745   1.00 28.83  ? 156  TYR H CE2 1 
ATOM   1166 C CZ  . TYR A 1 156 ? 11.560  6.921   11.031  1.00 28.94  ? 156  TYR H CZ  1 
ATOM   1167 O OH  . TYR A 1 156 ? 12.095  8.018   11.660  1.00 29.35  ? 156  TYR H OH  1 
ATOM   1168 N N   . PHE A 1 157 ? 8.415   2.083   11.521  1.00 33.85  ? 157  PHE H N   1 
ATOM   1169 C CA  . PHE A 1 157 ? 8.359   1.909   12.977  1.00 34.05  ? 157  PHE H CA  1 
ATOM   1170 C C   . PHE A 1 157 ? 9.280   0.737   13.364  1.00 34.42  ? 157  PHE H C   1 
ATOM   1171 O O   . PHE A 1 157 ? 9.351   -0.265  12.647  1.00 33.50  ? 157  PHE H O   1 
ATOM   1172 C CB  . PHE A 1 157 ? 6.912   1.645   13.461  1.00 35.52  ? 157  PHE H CB  1 
ATOM   1173 C CG  . PHE A 1 157 ? 6.751   1.728   14.957  1.00 36.47  ? 157  PHE H CG  1 
ATOM   1174 C CD1 . PHE A 1 157 ? 6.600   2.963   15.592  1.00 36.35  ? 157  PHE H CD1 1 
ATOM   1175 C CD2 . PHE A 1 157 ? 6.783   0.578   15.738  1.00 37.92  ? 157  PHE H CD2 1 
ATOM   1176 C CE1 . PHE A 1 157 ? 6.475   3.046   16.971  1.00 37.97  ? 157  PHE H CE1 1 
ATOM   1177 C CE2 . PHE A 1 157 ? 6.659   0.648   17.114  1.00 39.04  ? 157  PHE H CE2 1 
ATOM   1178 C CZ  . PHE A 1 157 ? 6.504   1.890   17.733  1.00 39.42  ? 157  PHE H CZ  1 
ATOM   1179 N N   . PRO A 1 158 ? 10.005  0.860   14.496  1.00 34.30  ? 158  PRO H N   1 
ATOM   1180 C CA  . PRO A 1 158 ? 10.157  2.001   15.408  1.00 34.04  ? 158  PRO H CA  1 
ATOM   1181 C C   . PRO A 1 158 ? 11.283  2.936   14.951  1.00 32.54  ? 158  PRO H C   1 
ATOM   1182 O O   . PRO A 1 158 ? 11.830  2.739   13.870  1.00 30.49  ? 158  PRO H O   1 
ATOM   1183 C CB  . PRO A 1 158 ? 10.522  1.320   16.736  1.00 35.04  ? 158  PRO H CB  1 
ATOM   1184 C CG  . PRO A 1 158 ? 11.284  0.095   16.305  1.00 34.78  ? 158  PRO H CG  1 
ATOM   1185 C CD  . PRO A 1 158 ? 10.694  -0.347  15.002  1.00 34.75  ? 158  PRO H CD  1 
ATOM   1186 N N   . GLU A 1 159 ? 11.572  3.972   15.744  1.00 33.28  ? 159  GLU H N   1 
ATOM   1187 C CA  . GLU A 1 159 ? 12.829  4.713   15.661  1.00 33.35  ? 159  GLU H CA  1 
ATOM   1188 C C   . GLU A 1 159 ? 13.970  3.789   16.118  1.00 34.38  ? 159  GLU H C   1 
ATOM   1189 O O   . GLU A 1 159 ? 13.724  2.875   16.901  1.00 35.74  ? 159  GLU H O   1 
ATOM   1190 C CB  . GLU A 1 159 ? 12.782  5.939   16.586  1.00 34.99  ? 159  GLU H CB  1 
ATOM   1191 C CG  . GLU A 1 159 ? 12.085  7.138   15.991  1.00 34.58  ? 159  GLU H CG  1 
ATOM   1192 C CD  . GLU A 1 159 ? 12.982  7.934   15.060  1.00 35.97  ? 159  GLU H CD  1 
ATOM   1193 O OE1 . GLU A 1 159 ? 13.218  7.539   13.888  1.00 36.65  ? 159  GLU H OE1 1 
ATOM   1194 O OE2 . GLU A 1 159 ? 13.450  8.994   15.506  1.00 38.00  ? 159  GLU H OE2 1 
ATOM   1195 N N   . PRO A 1 160 ? 15.231  4.050   15.686  1.00 34.32  ? 160  PRO H N   1 
ATOM   1196 C CA  . PRO A 1 160 ? 15.682  5.158   14.853  1.00 32.72  ? 160  PRO H CA  1 
ATOM   1197 C C   . PRO A 1 160 ? 15.829  4.827   13.366  1.00 33.08  ? 160  PRO H C   1 
ATOM   1198 O O   . PRO A 1 160 ? 16.010  3.674   12.996  1.00 32.62  ? 160  PRO H O   1 
ATOM   1199 C CB  . PRO A 1 160 ? 17.065  5.462   15.436  1.00 34.11  ? 160  PRO H CB  1 
ATOM   1200 C CG  . PRO A 1 160 ? 17.570  4.144   15.928  1.00 35.07  ? 160  PRO H CG  1 
ATOM   1201 C CD  . PRO A 1 160 ? 16.369  3.264   16.209  1.00 35.37  ? 160  PRO H CD  1 
ATOM   1202 N N   . VAL A 1 161 ? 15.731  5.851   12.525  1.00 33.08  ? 161  VAL H N   1 
ATOM   1203 C CA  . VAL A 1 161 ? 16.278  5.794   11.161  1.00 33.67  ? 161  VAL H CA  1 
ATOM   1204 C C   . VAL A 1 161 ? 17.466  6.747   11.127  1.00 33.67  ? 161  VAL H C   1 
ATOM   1205 O O   . VAL A 1 161 ? 17.473  7.776   11.831  1.00 33.67  ? 161  VAL H O   1 
ATOM   1206 C CB  . VAL A 1 161 ? 15.223  6.149   10.076  1.00 33.77  ? 161  VAL H CB  1 
ATOM   1207 C CG1 . VAL A 1 161 ? 15.883  6.673   8.810   1.00 33.99  ? 161  VAL H CG1 1 
ATOM   1208 C CG2 . VAL A 1 161 ? 14.383  4.936   9.732   1.00 33.97  ? 161  VAL H CG2 1 
ATOM   1209 N N   . THR A 1 162 ? 18.494  6.376   10.373  1.00 33.53  ? 162  THR H N   1 
ATOM   1210 C CA  . THR A 1 162 ? 19.636  7.249   10.149  1.00 34.48  ? 162  THR H CA  1 
ATOM   1211 C C   . THR A 1 162 ? 19.746  7.539   8.657   1.00 33.27  ? 162  THR H C   1 
ATOM   1212 O O   . THR A 1 162 ? 19.414  6.698   7.821   1.00 34.25  ? 162  THR H O   1 
ATOM   1213 C CB  . THR A 1 162 ? 20.983  6.687   10.674  1.00 37.16  ? 162  THR H CB  1 
ATOM   1214 O OG1 . THR A 1 162 ? 21.338  5.515   9.937   1.00 38.23  ? 162  THR H OG1 1 
ATOM   1215 C CG2 . THR A 1 162 ? 20.933  6.384   12.190  1.00 37.71  ? 162  THR H CG2 1 
ATOM   1216 N N   . VAL A 1 163 ? 20.187  8.748   8.340   1.00 31.44  ? 163  VAL H N   1 
ATOM   1217 C CA  . VAL A 1 163 ? 20.255  9.228   6.973   1.00 29.24  ? 163  VAL H CA  1 
ATOM   1218 C C   . VAL A 1 163 ? 21.642  9.847   6.768   1.00 29.42  ? 163  VAL H C   1 
ATOM   1219 O O   . VAL A 1 163 ? 22.164  10.620  7.607   1.00 28.99  ? 163  VAL H O   1 
ATOM   1220 C CB  . VAL A 1 163 ? 19.156  10.301  6.704   1.00 28.31  ? 163  VAL H CB  1 
ATOM   1221 C CG1 . VAL A 1 163 ? 19.269  10.882  5.300   1.00 28.08  ? 163  VAL H CG1 1 
ATOM   1222 C CG2 . VAL A 1 163 ? 17.757  9.742   6.930   1.00 27.98  ? 163  VAL H CG2 1 
ATOM   1223 N N   . THR A 1 164 ? 22.260  9.502   5.650   1.00 29.39  ? 164  THR H N   1 
ATOM   1224 C CA  . THR A 1 164 ? 23.467  10.180  5.222   1.00 29.41  ? 164  THR H CA  1 
ATOM   1225 C C   . THR A 1 164 ? 23.289  10.573  3.768   1.00 29.54  ? 164  THR H C   1 
ATOM   1226 O O   . THR A 1 164 ? 22.332  10.146  3.114   1.00 29.45  ? 164  THR H O   1 
ATOM   1227 C CB  . THR A 1 164 ? 24.738  9.310   5.414   1.00 31.66  ? 164  THR H CB  1 
ATOM   1228 O OG1 . THR A 1 164 ? 24.601  8.074   4.683   1.00 31.13  ? 164  THR H OG1 1 
ATOM   1229 C CG2 . THR A 1 164 ? 25.021  9.052   6.914   1.00 31.30  ? 164  THR H CG2 1 
ATOM   1230 N N   . TRP A 1 165 ? 24.196  11.404  3.267   1.00 31.59  ? 165  TRP H N   1 
ATOM   1231 C CA  . TRP A 1 165 ? 24.189  11.795  1.857   1.00 31.89  ? 165  TRP H CA  1 
ATOM   1232 C C   . TRP A 1 165 ? 25.527  11.440  1.283   1.00 33.51  ? 165  TRP H C   1 
ATOM   1233 O O   . TRP A 1 165 ? 26.573  11.761  1.867   1.00 33.77  ? 165  TRP H O   1 
ATOM   1234 C CB  . TRP A 1 165 ? 23.902  13.290  1.672   1.00 31.45  ? 165  TRP H CB  1 
ATOM   1235 C CG  . TRP A 1 165 ? 22.458  13.658  2.007   1.00 29.61  ? 165  TRP H CG  1 
ATOM   1236 C CD1 . TRP A 1 165 ? 21.964  14.065  3.226   1.00 28.65  ? 165  TRP H CD1 1 
ATOM   1237 C CD2 . TRP A 1 165 ? 21.342  13.614  1.110   1.00 29.23  ? 165  TRP H CD2 1 
ATOM   1238 N NE1 . TRP A 1 165 ? 20.606  14.282  3.132   1.00 27.56  ? 165  TRP H NE1 1 
ATOM   1239 C CE2 . TRP A 1 165 ? 20.198  14.024  1.842   1.00 27.78  ? 165  TRP H CE2 1 
ATOM   1240 C CE3 . TRP A 1 165 ? 21.204  13.300  -0.255  1.00 30.06  ? 165  TRP H CE3 1 
ATOM   1241 C CZ2 . TRP A 1 165 ? 18.915  14.115  1.258   1.00 27.29  ? 165  TRP H CZ2 1 
ATOM   1242 C CZ3 . TRP A 1 165 ? 19.913  13.390  -0.847  1.00 29.74  ? 165  TRP H CZ3 1 
ATOM   1243 C CH2 . TRP A 1 165 ? 18.792  13.803  -0.080  1.00 28.13  ? 165  TRP H CH2 1 
ATOM   1244 N N   . ASN A 1 166 ? 25.489  10.749  0.146   1.00 34.94  ? 166  ASN H N   1 
ATOM   1245 C CA  . ASN A 1 166 ? 26.702  10.223  -0.509  1.00 37.25  ? 166  ASN H CA  1 
ATOM   1246 C C   . ASN A 1 166 ? 27.630  9.471   0.450   1.00 38.46  ? 166  ASN H C   1 
ATOM   1247 O O   . ASN A 1 166 ? 28.839  9.700   0.481   1.00 39.77  ? 166  ASN H O   1 
ATOM   1248 C CB  . ASN A 1 166 ? 27.455  11.332  -1.238  1.00 39.15  ? 166  ASN H CB  1 
ATOM   1249 C CG  . ASN A 1 166 ? 26.821  11.700  -2.556  1.00 39.50  ? 166  ASN H CG  1 
ATOM   1250 O OD1 . ASN A 1 166 ? 25.761  11.186  -2.909  1.00 39.17  ? 166  ASN H OD1 1 
ATOM   1251 N ND2 . ASN A 1 166 ? 27.475  12.587  -3.304  1.00 40.48  ? 166  ASN H ND2 1 
ATOM   1252 N N   . SER A 1 167 ? 27.021  8.584   1.235   1.00 38.14  ? 167  SER H N   1 
ATOM   1253 C CA  . SER A 1 167 ? 27.697  7.706   2.192   1.00 39.78  ? 167  SER H CA  1 
ATOM   1254 C C   . SER A 1 167 ? 28.418  8.465   3.274   1.00 40.52  ? 167  SER H C   1 
ATOM   1255 O O   . SER A 1 167 ? 29.446  8.022   3.768   1.00 43.39  ? 167  SER H O   1 
ATOM   1256 C CB  . SER A 1 167 ? 28.613  6.689   1.474   1.00 41.64  ? 167  SER H CB  1 
ATOM   1257 O OG  . SER A 1 167 ? 27.813  5.939   0.571   1.00 41.67  ? 167  SER H OG  1 
ATOM   1258 N N   . GLY A 1 168 ? 27.868  9.624   3.633   1.00 39.61  ? 168  GLY H N   1 
ATOM   1259 C CA  . GLY A 1 168 ? 28.461  10.475  4.644   1.00 40.48  ? 168  GLY H CA  1 
ATOM   1260 C C   . GLY A 1 168 ? 29.440  11.501  4.110   1.00 42.97  ? 168  GLY H C   1 
ATOM   1261 O O   . GLY A 1 168 ? 29.826  12.411  4.844   1.00 44.03  ? 168  GLY H O   1 
ATOM   1262 N N   . SER A 1 169 ? 29.848  11.376  2.845   1.00 44.53  ? 169  SER H N   1 
ATOM   1263 C CA  . SER A 1 169 ? 30.866  12.282  2.289   1.00 47.14  ? 169  SER H CA  1 
ATOM   1264 C C   . SER A 1 169 ? 30.292  13.671  1.985   1.00 46.51  ? 169  SER H C   1 
ATOM   1265 O O   . SER A 1 169 ? 31.038  14.641  1.823   1.00 48.82  ? 169  SER H O   1 
ATOM   1266 C CB  . SER A 1 169 ? 31.556  11.680  1.054   1.00 50.35  ? 169  SER H CB  1 
ATOM   1267 O OG  . SER A 1 169 ? 30.725  11.781  -0.089  1.00 50.09  ? 169  SER H OG  1 
ATOM   1268 N N   . LEU A 1 170 ? 28.965  13.756  1.919   1.00 43.62  ? 170  LEU H N   1 
ATOM   1269 C CA  . LEU A 1 170 ? 28.278  15.007  1.743   1.00 42.83  ? 170  LEU H CA  1 
ATOM   1270 C C   . LEU A 1 170 ? 27.614  15.332  3.088   1.00 40.93  ? 170  LEU H C   1 
ATOM   1271 O O   . LEU A 1 170 ? 26.597  14.733  3.452   1.00 39.68  ? 170  LEU H O   1 
ATOM   1272 C CB  . LEU A 1 170 ? 27.238  14.860  0.621   1.00 43.56  ? 170  LEU H CB  1 
ATOM   1273 C CG  . LEU A 1 170 ? 26.641  16.069  -0.114  1.00 43.81  ? 170  LEU H CG  1 
ATOM   1274 C CD1 . LEU A 1 170 ? 27.754  16.952  -0.676  1.00 45.97  ? 170  LEU H CD1 1 
ATOM   1275 C CD2 . LEU A 1 170 ? 25.757  15.547  -1.247  1.00 42.53  ? 170  LEU H CD2 1 
ATOM   1276 N N   . SER A 1 171 ? 28.204  16.262  3.838   1.00 41.70  ? 171  SER H N   1 
ATOM   1277 C CA  . SER A 1 171 ? 27.731  16.551  5.199   1.00 41.03  ? 171  SER H CA  1 
ATOM   1278 C C   . SER A 1 171 ? 27.448  18.017  5.497   1.00 40.83  ? 171  SER H C   1 
ATOM   1279 O O   . SER A 1 171 ? 26.585  18.321  6.334   1.00 39.68  ? 171  SER H O   1 
ATOM   1280 C CB  . SER A 1 171 ? 28.689  15.988  6.236   1.00 41.44  ? 171  SER H CB  1 
ATOM   1281 O OG  . SER A 1 171 ? 29.930  16.643  6.162   1.00 44.44  ? 171  SER H OG  1 
ATOM   1282 N N   . SER A 1 172 ? 28.143  18.920  4.813   1.00 41.38  ? 172  SER H N   1 
ATOM   1283 C CA  . SER A 1 172 ? 27.830  20.350  4.910   1.00 42.12  ? 172  SER H CA  1 
ATOM   1284 C C   . SER A 1 172 ? 26.560  20.637  4.127   1.00 40.32  ? 172  SER H C   1 
ATOM   1285 O O   . SER A 1 172 ? 26.348  20.072  3.048   1.00 41.91  ? 172  SER H O   1 
ATOM   1286 C CB  . SER A 1 172 ? 28.957  21.210  4.361   1.00 43.47  ? 172  SER H CB  1 
ATOM   1287 O OG  . SER A 1 172 ? 30.155  20.899  5.021   1.00 48.56  ? 172  SER H OG  1 
ATOM   1288 N N   . GLY A 1 173 ? 25.720  21.502  4.682   1.00 37.45  ? 173  GLY H N   1 
ATOM   1289 C CA  . GLY A 1 173 ? 24.483  21.908  4.034   1.00 35.58  ? 173  GLY H CA  1 
ATOM   1290 C C   . GLY A 1 173 ? 23.409  20.851  4.147   1.00 32.99  ? 173  GLY H C   1 
ATOM   1291 O O   . GLY A 1 173 ? 22.442  20.873  3.394   1.00 33.37  ? 173  GLY H O   1 
ATOM   1292 N N   . VAL A 1 174 ? 23.584  19.905  5.070   1.00 31.18  ? 174  VAL H N   1 
ATOM   1293 C CA  . VAL A 1 174 ? 22.572  18.878  5.306   1.00 29.32  ? 174  VAL H CA  1 
ATOM   1294 C C   . VAL A 1 174 ? 21.720  19.284  6.493   1.00 28.03  ? 174  VAL H C   1 
ATOM   1295 O O   . VAL A 1 174 ? 22.260  19.709  7.520   1.00 27.52  ? 174  VAL H O   1 
ATOM   1296 C CB  . VAL A 1 174 ? 23.197  17.495  5.617   1.00 29.50  ? 174  VAL H CB  1 
ATOM   1297 C CG1 . VAL A 1 174 ? 22.119  16.501  6.052   1.00 27.83  ? 174  VAL H CG1 1 
ATOM   1298 C CG2 . VAL A 1 174 ? 23.945  16.955  4.415   1.00 30.63  ? 174  VAL H CG2 1 
ATOM   1299 N N   . HIS A 1 175 ? 20.400  19.136  6.363   1.00 26.69  ? 175  HIS H N   1 
ATOM   1300 C CA  . HIS A 1 175 ? 19.512  19.241  7.510   1.00 26.68  ? 175  HIS H CA  1 
ATOM   1301 C C   . HIS A 1 175 ? 18.672  17.964  7.587   1.00 26.51  ? 175  HIS H C   1 
ATOM   1302 O O   . HIS A 1 175 ? 17.830  17.723  6.719   1.00 26.74  ? 175  HIS H O   1 
ATOM   1303 C CB  . HIS A 1 175 ? 18.584  20.461  7.377   1.00 26.58  ? 175  HIS H CB  1 
ATOM   1304 C CG  . HIS A 1 175 ? 19.305  21.779  7.416   1.00 27.38  ? 175  HIS H CG  1 
ATOM   1305 N ND1 . HIS A 1 175 ? 19.911  22.254  8.556   1.00 28.39  ? 175  HIS H ND1 1 
ATOM   1306 C CD2 . HIS A 1 175 ? 19.515  22.711  6.459   1.00 27.68  ? 175  HIS H CD2 1 
ATOM   1307 C CE1 . HIS A 1 175 ? 20.495  23.415  8.296   1.00 29.51  ? 175  HIS H CE1 1 
ATOM   1308 N NE2 . HIS A 1 175 ? 20.236  23.730  7.034   1.00 29.74  ? 175  HIS H NE2 1 
ATOM   1309 N N   . THR A 1 176 ? 18.887  17.160  8.627   1.00 26.56  ? 176  THR H N   1 
ATOM   1310 C CA  . THR A 1 176 ? 18.073  15.956  8.826   1.00 26.62  ? 176  THR H CA  1 
ATOM   1311 C C   . THR A 1 176 ? 17.216  16.240  10.032  1.00 26.80  ? 176  THR H C   1 
ATOM   1312 O O   . THR A 1 176 ? 17.742  16.582  11.102  1.00 27.57  ? 176  THR H O   1 
ATOM   1313 C CB  . THR A 1 176 ? 18.933  14.689  9.021   1.00 27.03  ? 176  THR H CB  1 
ATOM   1314 O OG1 . THR A 1 176 ? 19.732  14.484  7.836   1.00 28.20  ? 176  THR H OG1 1 
ATOM   1315 C CG2 . THR A 1 176 ? 18.061  13.451  9.278   1.00 25.68  ? 176  THR H CG2 1 
ATOM   1316 N N   . PHE A 1 177 ? 15.908  16.141  9.818   1.00 25.30  ? 177  PHE H N   1 
ATOM   1317 C CA  . PHE A 1 177 ? 14.867  16.586  10.751  1.00 26.00  ? 177  PHE H CA  1 
ATOM   1318 C C   . PHE A 1 177 ? 14.429  15.486  11.695  1.00 26.14  ? 177  PHE H C   1 
ATOM   1319 O O   . PHE A 1 177 ? 14.410  14.319  11.292  1.00 27.65  ? 177  PHE H O   1 
ATOM   1320 C CB  . PHE A 1 177 ? 13.679  17.172  9.951   1.00 25.22  ? 177  PHE H CB  1 
ATOM   1321 C CG  . PHE A 1 177 ? 14.054  18.413  9.172   1.00 24.52  ? 177  PHE H CG  1 
ATOM   1322 C CD1 . PHE A 1 177 ? 13.954  19.674  9.772   1.00 23.91  ? 177  PHE H CD1 1 
ATOM   1323 C CD2 . PHE A 1 177 ? 14.554  18.321  7.874   1.00 24.02  ? 177  PHE H CD2 1 
ATOM   1324 C CE1 . PHE A 1 177 ? 14.342  20.809  9.084   1.00 23.55  ? 177  PHE H CE1 1 
ATOM   1325 C CE2 . PHE A 1 177 ? 14.955  19.457  7.185   1.00 24.56  ? 177  PHE H CE2 1 
ATOM   1326 C CZ  . PHE A 1 177 ? 14.838  20.711  7.803   1.00 23.77  ? 177  PHE H CZ  1 
ATOM   1327 N N   . PRO A 1 178 ? 14.096  15.838  12.955  1.00 26.48  ? 178  PRO H N   1 
ATOM   1328 C CA  . PRO A 1 178 ? 13.533  14.869  13.907  1.00 27.20  ? 178  PRO H CA  1 
ATOM   1329 C C   . PRO A 1 178 ? 12.290  14.170  13.331  1.00 27.94  ? 178  PRO H C   1 
ATOM   1330 O O   . PRO A 1 178 ? 11.514  14.816  12.619  1.00 28.22  ? 178  PRO H O   1 
ATOM   1331 C CB  . PRO A 1 178 ? 13.149  15.757  15.099  1.00 28.02  ? 178  PRO H CB  1 
ATOM   1332 C CG  . PRO A 1 178 ? 14.168  16.869  15.064  1.00 28.20  ? 178  PRO H CG  1 
ATOM   1333 C CD  . PRO A 1 178 ? 14.309  17.161  13.583  1.00 26.46  ? 178  PRO H CD  1 
ATOM   1334 N N   . ALA A 1 179 ? 12.115  12.869  13.603  1.00 28.48  ? 179  ALA H N   1 
ATOM   1335 C CA  . ALA A 1 179 ? 10.977  12.106  13.091  1.00 29.27  ? 179  ALA H CA  1 
ATOM   1336 C C   . ALA A 1 179 ? 9.704   12.519  13.801  1.00 30.16  ? 179  ALA H C   1 
ATOM   1337 O O   . ALA A 1 179 ? 9.741   12.879  14.976  1.00 31.37  ? 179  ALA H O   1 
ATOM   1338 C CB  . ALA A 1 179 ? 11.189  10.609  13.269  1.00 29.76  ? 179  ALA H CB  1 
ATOM   1339 N N   . VAL A 1 180 ? 8.587   12.468  13.088  1.00 30.91  ? 180  VAL H N   1 
ATOM   1340 C CA  . VAL A 1 180 ? 7.291   12.774  13.672  1.00 32.34  ? 180  VAL H CA  1 
ATOM   1341 C C   . VAL A 1 180 ? 6.372   11.552  13.636  1.00 34.00  ? 180  VAL H C   1 
ATOM   1342 O O   . VAL A 1 180 ? 6.117   10.986  12.568  1.00 34.73  ? 180  VAL H O   1 
ATOM   1343 C CB  . VAL A 1 180 ? 6.611   13.971  12.958  1.00 32.45  ? 180  VAL H CB  1 
ATOM   1344 C CG1 . VAL A 1 180 ? 5.301   14.319  13.652  1.00 33.33  ? 180  VAL H CG1 1 
ATOM   1345 C CG2 . VAL A 1 180 ? 7.534   15.187  12.923  1.00 31.11  ? 180  VAL H CG2 1 
ATOM   1346 N N   . LEU A 1 181 ? 5.877   11.144  14.802  1.00 35.40  ? 181  LEU H N   1 
ATOM   1347 C CA  . LEU A 1 181 ? 4.942   10.027  14.890  1.00 38.93  ? 181  LEU H CA  1 
ATOM   1348 C C   . LEU A 1 181 ? 3.500   10.431  14.535  1.00 41.59  ? 181  LEU H C   1 
ATOM   1349 O O   . LEU A 1 181 ? 2.966   11.409  15.057  1.00 43.32  ? 181  LEU H O   1 
ATOM   1350 C CB  . LEU A 1 181 ? 4.995   9.394   16.289  1.00 40.42  ? 181  LEU H CB  1 
ATOM   1351 C CG  . LEU A 1 181 ? 4.204   8.111   16.591  1.00 42.76  ? 181  LEU H CG  1 
ATOM   1352 C CD1 . LEU A 1 181 ? 4.751   6.931   15.798  1.00 41.58  ? 181  LEU H CD1 1 
ATOM   1353 C CD2 . LEU A 1 181 ? 4.234   7.830   18.084  1.00 43.85  ? 181  LEU H CD2 1 
ATOM   1354 N N   . GLN A 1 182 ? 2.893   9.701   13.610  1.00 43.26  ? 182  GLN H N   1 
ATOM   1355 C CA  . GLN A 1 182 ? 1.444   9.758   13.438  1.00 44.98  ? 182  GLN H CA  1 
ATOM   1356 C C   . GLN A 1 182 ? 0.913   8.352   13.244  1.00 46.08  ? 182  GLN H C   1 
ATOM   1357 O O   . GLN A 1 182 ? 1.397   7.628   12.377  1.00 44.33  ? 182  GLN H O   1 
ATOM   1358 C CB  . GLN A 1 182 ? 1.003   10.671  12.284  1.00 46.43  ? 182  GLN H CB  1 
ATOM   1359 C CG  . GLN A 1 182 ? -0.512  10.568  12.007  1.00 52.89  ? 182  GLN H CG  1 
ATOM   1360 C CD  . GLN A 1 182 ? -1.159  11.858  11.516  1.00 57.01  ? 182  GLN H CD  1 
ATOM   1361 O OE1 . GLN A 1 182 ? -0.531  12.919  11.484  1.00 60.12  ? 182  GLN H OE1 1 
ATOM   1362 N NE2 . GLN A 1 182 ? -2.439  11.771  11.139  1.00 61.76  ? 182  GLN H NE2 1 
ATOM   1363 N N   . SER A 1 183 ? -0.085  7.991   14.061  1.00 48.24  ? 183  SER H N   1 
ATOM   1364 C CA  . SER A 1 183 ? -0.756  6.686   14.015  1.00 50.33  ? 183  SER H CA  1 
ATOM   1365 C C   . SER A 1 183 ? 0.218   5.507   13.921  1.00 49.42  ? 183  SER H C   1 
ATOM   1366 O O   . SER A 1 183 ? 0.092   4.646   13.029  1.00 48.91  ? 183  SER H O   1 
ATOM   1367 C CB  . SER A 1 183 ? -1.798  6.621   12.877  1.00 51.64  ? 183  SER H CB  1 
ATOM   1368 O OG  . SER A 1 183 ? -2.661  7.742   12.895  1.00 51.53  ? 183  SER H OG  1 
ATOM   1369 N N   . ASP A 1 184 ? 1.183   5.482   14.844  1.00 48.57  ? 184  ASP H N   1 
ATOM   1370 C CA  . ASP A 1 184 ? 2.095   4.342   15.010  1.00 48.47  ? 184  ASP H CA  1 
ATOM   1371 C C   . ASP A 1 184 ? 3.110   4.214   13.864  1.00 45.19  ? 184  ASP H C   1 
ATOM   1372 O O   . ASP A 1 184 ? 3.736   3.177   13.711  1.00 44.64  ? 184  ASP H O   1 
ATOM   1373 C CB  . ASP A 1 184 ? 1.319   3.013   15.191  1.00 52.94  ? 184  ASP H CB  1 
ATOM   1374 C CG  . ASP A 1 184 ? 0.528   2.953   16.504  1.00 56.80  ? 184  ASP H CG  1 
ATOM   1375 O OD1 . ASP A 1 184 ? 1.065   3.379   17.551  1.00 58.34  ? 184  ASP H OD1 1 
ATOM   1376 O OD2 . ASP A 1 184 ? -0.621  2.464   16.486  1.00 59.75  ? 184  ASP H OD2 1 
ATOM   1377 N N   . LEU A 1 185 ? 3.261   5.266   13.062  1.00 43.37  ? 185  LEU H N   1 
ATOM   1378 C CA  . LEU A 1 185 ? 4.274   5.296   11.992  1.00 41.19  ? 185  LEU H CA  1 
ATOM   1379 C C   . LEU A 1 185 ? 4.987   6.654   11.911  1.00 39.51  ? 185  LEU H C   1 
ATOM   1380 O O   . LEU A 1 185 ? 4.367   7.710   12.043  1.00 40.33  ? 185  LEU H O   1 
ATOM   1381 C CB  . LEU A 1 185 ? 3.667   4.930   10.632  1.00 41.69  ? 185  LEU H CB  1 
ATOM   1382 C CG  . LEU A 1 185 ? 3.068   3.522   10.439  1.00 43.43  ? 185  LEU H CG  1 
ATOM   1383 C CD1 . LEU A 1 185 ? 2.222   3.412   9.174   1.00 44.43  ? 185  LEU H CD1 1 
ATOM   1384 C CD2 . LEU A 1 185 ? 4.157   2.459   10.448  1.00 43.02  ? 185  LEU H CD2 1 
ATOM   1385 N N   . TYR A 1 186 ? 6.291   6.611   11.671  1.00 37.26  ? 186  TYR H N   1 
ATOM   1386 C CA  . TYR A 1 186 ? 7.100   7.825   11.630  1.00 35.16  ? 186  TYR H CA  1 
ATOM   1387 C C   . TYR A 1 186 ? 7.333   8.352   10.226  1.00 34.79  ? 186  TYR H C   1 
ATOM   1388 O O   . TYR A 1 186 ? 7.413   7.593   9.264   1.00 35.59  ? 186  TYR H O   1 
ATOM   1389 C CB  . TYR A 1 186 ? 8.456   7.564   12.252  1.00 33.85  ? 186  TYR H CB  1 
ATOM   1390 C CG  . TYR A 1 186 ? 8.436   7.411   13.732  1.00 34.69  ? 186  TYR H CG  1 
ATOM   1391 C CD1 . TYR A 1 186 ? 8.507   8.535   14.570  1.00 34.77  ? 186  TYR H CD1 1 
ATOM   1392 C CD2 . TYR A 1 186 ? 8.365   6.146   14.313  1.00 35.13  ? 186  TYR H CD2 1 
ATOM   1393 C CE1 . TYR A 1 186 ? 8.504   8.394   15.951  1.00 36.21  ? 186  TYR H CE1 1 
ATOM   1394 C CE2 . TYR A 1 186 ? 8.377   5.995   15.687  1.00 36.31  ? 186  TYR H CE2 1 
ATOM   1395 C CZ  . TYR A 1 186 ? 8.427   7.115   16.493  1.00 37.48  ? 186  TYR H CZ  1 
ATOM   1396 O OH  . TYR A 1 186 ? 8.425   6.952   17.849  1.00 38.51  ? 186  TYR H OH  1 
ATOM   1397 N N   . THR A 1 187 ? 7.433   9.672   10.147  1.00 34.30  ? 187  THR H N   1 
ATOM   1398 C CA  . THR A 1 187 ? 7.934   10.385  8.984   1.00 33.54  ? 187  THR H CA  1 
ATOM   1399 C C   . THR A 1 187 ? 9.154   11.218  9.423   1.00 30.65  ? 187  THR H C   1 
ATOM   1400 O O   . THR A 1 187 ? 9.137   11.890  10.477  1.00 29.10  ? 187  THR H O   1 
ATOM   1401 C CB  . THR A 1 187 ? 6.826   11.302  8.407   1.00 35.00  ? 187  THR H CB  1 
ATOM   1402 O OG1 . THR A 1 187 ? 5.658   10.523  8.155   1.00 37.75  ? 187  THR H OG1 1 
ATOM   1403 C CG2 . THR A 1 187 ? 7.263   11.992  7.110   1.00 34.59  ? 187  THR H CG2 1 
ATOM   1404 N N   . LEU A 1 188 ? 10.201  11.150  8.607   1.00 29.56  ? 188  LEU H N   1 
ATOM   1405 C CA  . LEU A 1 188 ? 11.420  11.932  8.780   1.00 30.15  ? 188  LEU H CA  1 
ATOM   1406 C C   . LEU A 1 188 ? 11.748  12.536  7.419   1.00 28.60  ? 188  LEU H C   1 
ATOM   1407 O O   . LEU A 1 188 ? 11.452  11.931  6.383   1.00 30.50  ? 188  LEU H O   1 
ATOM   1408 C CB  . LEU A 1 188 ? 12.565  10.998  9.254   1.00 30.64  ? 188  LEU H CB  1 
ATOM   1409 C CG  . LEU A 1 188 ? 14.037  11.390  9.271   1.00 30.99  ? 188  LEU H CG  1 
ATOM   1410 C CD1 . LEU A 1 188 ? 14.780  10.632  10.373  1.00 32.22  ? 188  LEU H CD1 1 
ATOM   1411 C CD2 . LEU A 1 188 ? 14.652  11.169  7.897   1.00 30.89  ? 188  LEU H CD2 1 
ATOM   1412 N N   . SER A 1 189 ? 12.338  13.722  7.390   1.00 27.42  ? 189  SER H N   1 
ATOM   1413 C CA  . SER A 1 189 ? 12.908  14.212  6.130   1.00 26.98  ? 189  SER H CA  1 
ATOM   1414 C C   . SER A 1 189 ? 14.341  14.699  6.294   1.00 26.75  ? 189  SER H C   1 
ATOM   1415 O O   . SER A 1 189 ? 14.792  14.995  7.418   1.00 27.03  ? 189  SER H O   1 
ATOM   1416 C CB  . SER A 1 189 ? 12.044  15.327  5.550   1.00 28.01  ? 189  SER H CB  1 
ATOM   1417 O OG  . SER A 1 189 ? 11.946  16.397  6.471   1.00 27.11  ? 189  SER H OG  1 
ATOM   1418 N N   . SER A 1 190 ? 15.044  14.836  5.176   1.00 25.05  ? 190  SER H N   1 
ATOM   1419 C CA  . SER A 1 190 ? 16.388  15.378  5.212   1.00 25.89  ? 190  SER H CA  1 
ATOM   1420 C C   . SER A 1 190 ? 16.612  16.199  3.950   1.00 26.14  ? 190  SER H C   1 
ATOM   1421 O O   . SER A 1 190 ? 16.211  15.781  2.866   1.00 26.96  ? 190  SER H O   1 
ATOM   1422 C CB  . SER A 1 190 ? 17.419  14.232  5.279   1.00 25.23  ? 190  SER H CB  1 
ATOM   1423 O OG  . SER A 1 190 ? 18.754  14.728  5.324   1.00 25.85  ? 190  SER H OG  1 
ATOM   1424 N N   . SER A 1 191 ? 17.226  17.372  4.092   1.00 25.57  ? 191  SER H N   1 
ATOM   1425 C CA  . SER A 1 191 ? 17.505  18.207  2.931   1.00 25.53  ? 191  SER H CA  1 
ATOM   1426 C C   . SER A 1 191 ? 18.996  18.329  2.793   1.00 26.40  ? 191  SER H C   1 
ATOM   1427 O O   . SER A 1 191 ? 19.734  18.267  3.792   1.00 26.96  ? 191  SER H O   1 
ATOM   1428 C CB  . SER A 1 191 ? 16.844  19.605  3.023   1.00 24.95  ? 191  SER H CB  1 
ATOM   1429 O OG  . SER A 1 191 ? 17.437  20.447  4.018   1.00 25.04  ? 191  SER H OG  1 
ATOM   1430 N N   . VAL A 1 192 ? 19.456  18.498  1.560   1.00 27.64  ? 192  VAL H N   1 
ATOM   1431 C CA  . VAL A 1 192 ? 20.860  18.801  1.327   1.00 28.86  ? 192  VAL H CA  1 
ATOM   1432 C C   . VAL A 1 192 ? 20.946  19.914  0.288   1.00 30.35  ? 192  VAL H C   1 
ATOM   1433 O O   . VAL A 1 192 ? 20.254  19.882  -0.725  1.00 31.04  ? 192  VAL H O   1 
ATOM   1434 C CB  . VAL A 1 192 ? 21.706  17.552  0.947   1.00 29.47  ? 192  VAL H CB  1 
ATOM   1435 C CG1 . VAL A 1 192 ? 21.296  16.968  -0.411  1.00 29.92  ? 192  VAL H CG1 1 
ATOM   1436 C CG2 . VAL A 1 192 ? 23.191  17.877  0.957   1.00 31.48  ? 192  VAL H CG2 1 
ATOM   1437 N N   . THR A 1 193 ? 21.793  20.901  0.551   1.00 31.51  ? 193  THR H N   1 
ATOM   1438 C CA  . THR A 1 193 ? 22.007  22.008  -0.379  1.00 33.34  ? 193  THR H CA  1 
ATOM   1439 C C   . THR A 1 193 ? 23.415  21.948  -0.927  1.00 36.17  ? 193  THR H C   1 
ATOM   1440 O O   . THR A 1 193 ? 24.379  21.916  -0.167  1.00 37.29  ? 193  THR H O   1 
ATOM   1441 C CB  . THR A 1 193 ? 21.730  23.364  0.298   1.00 32.89  ? 193  THR H CB  1 
ATOM   1442 O OG1 . THR A 1 193 ? 20.379  23.359  0.798   1.00 31.34  ? 193  THR H OG1 1 
ATOM   1443 C CG2 . THR A 1 193 ? 21.899  24.506  -0.697  1.00 33.76  ? 193  THR H CG2 1 
ATOM   1444 N N   . VAL A 1 194 ? 23.513  21.930  -2.254  1.00 38.42  ? 194  VAL H N   1 
ATOM   1445 C CA  . VAL A 1 194 ? 24.763  21.770  -2.987  1.00 41.55  ? 194  VAL H CA  1 
ATOM   1446 C C   . VAL A 1 194 ? 24.907  22.886  -4.033  1.00 43.76  ? 194  VAL H C   1 
ATOM   1447 O O   . VAL A 1 194 ? 23.909  23.473  -4.445  1.00 43.41  ? 194  VAL H O   1 
ATOM   1448 C CB  . VAL A 1 194 ? 24.860  20.365  -3.673  1.00 42.19  ? 194  VAL H CB  1 
ATOM   1449 C CG1 . VAL A 1 194 ? 25.009  19.259  -2.632  1.00 40.19  ? 194  VAL H CG1 1 
ATOM   1450 C CG2 . VAL A 1 194 ? 23.656  20.086  -4.561  1.00 42.23  ? 194  VAL H CG2 1 
ATOM   1451 N N   . PRO A 1 195 ? 26.142  23.175  -4.471  1.00 47.65  ? 195  PRO H N   1 
ATOM   1452 C CA  . PRO A 1 195 ? 26.260  24.107  -5.594  1.00 50.47  ? 195  PRO H CA  1 
ATOM   1453 C C   . PRO A 1 195 ? 25.557  23.529  -6.827  1.00 52.43  ? 195  PRO H C   1 
ATOM   1454 O O   . PRO A 1 195 ? 25.624  22.312  -7.074  1.00 51.58  ? 195  PRO H O   1 
ATOM   1455 C CB  . PRO A 1 195 ? 27.771  24.191  -5.832  1.00 53.00  ? 195  PRO H CB  1 
ATOM   1456 C CG  . PRO A 1 195 ? 28.409  23.661  -4.592  1.00 52.05  ? 195  PRO H CG  1 
ATOM   1457 C CD  . PRO A 1 195 ? 27.451  22.645  -4.050  1.00 48.78  ? 195  PRO H CD  1 
ATOM   1458 N N   . SER A 1 196 ? 24.880  24.389  -7.586  1.00 55.13  ? 196  SER H N   1 
ATOM   1459 C CA  . SER A 1 196 ? 24.126  23.941  -8.761  1.00 58.51  ? 196  SER H CA  1 
ATOM   1460 C C   . SER A 1 196 ? 25.040  23.458  -9.888  1.00 61.33  ? 196  SER H C   1 
ATOM   1461 O O   . SER A 1 196 ? 24.587  22.776  -10.802 1.00 64.01  ? 196  SER H O   1 
ATOM   1462 C CB  . SER A 1 196 ? 23.131  25.010  -9.239  1.00 59.78  ? 196  SER H CB  1 
ATOM   1463 O OG  . SER A 1 196 ? 23.777  26.248  -9.469  1.00 64.20  ? 196  SER H OG  1 
ATOM   1464 N N   . SER A 1 197 ? 26.326  23.801  -9.808  1.00 62.02  ? 197  SER H N   1 
ATOM   1465 C CA  . SER A 1 197 ? 27.326  23.286  -10.743 1.00 64.90  ? 197  SER H CA  1 
ATOM   1466 C C   . SER A 1 197 ? 27.616  21.799  -10.525 1.00 63.71  ? 197  SER H C   1 
ATOM   1467 O O   . SER A 1 197 ? 28.069  21.118  -11.440 1.00 65.32  ? 197  SER H O   1 
ATOM   1468 C CB  . SER A 1 197 ? 28.628  24.094  -10.667 1.00 67.61  ? 197  SER H CB  1 
ATOM   1469 O OG  . SER A 1 197 ? 29.178  24.082  -9.359  1.00 67.30  ? 197  SER H OG  1 
ATOM   1470 N N   . THR A 1 198 ? 27.332  21.298  -9.323  1.00 60.05  ? 198  THR H N   1 
ATOM   1471 C CA  . THR A 1 198 ? 27.625  19.900  -8.981  1.00 58.11  ? 198  THR H CA  1 
ATOM   1472 C C   . THR A 1 198 ? 26.428  18.948  -9.169  1.00 55.85  ? 198  THR H C   1 
ATOM   1473 O O   . THR A 1 198 ? 26.612  17.738  -9.272  1.00 55.81  ? 198  THR H O   1 
ATOM   1474 C CB  . THR A 1 198 ? 28.238  19.762  -7.563  1.00 56.99  ? 198  THR H CB  1 
ATOM   1475 O OG1 . THR A 1 198 ? 27.220  19.909  -6.565  1.00 52.88  ? 198  THR H OG1 1 
ATOM   1476 C CG2 . THR A 1 198 ? 29.332  20.820  -7.343  1.00 58.48  ? 198  THR H CG2 1 
ATOM   1477 N N   . TRP A 1 199 ? 25.216  19.497  -9.223  1.00 53.61  ? 199  TRP H N   1 
ATOM   1478 C CA  . TRP A 1 199 ? 24.009  18.706  -9.506  1.00 51.33  ? 199  TRP H CA  1 
ATOM   1479 C C   . TRP A 1 199 ? 23.202  19.347  -10.655 1.00 53.44  ? 199  TRP H C   1 
ATOM   1480 O O   . TRP A 1 199 ? 22.996  20.566  -10.656 1.00 54.24  ? 199  TRP H O   1 
ATOM   1481 C CB  . TRP A 1 199 ? 23.148  18.557  -8.240  1.00 46.87  ? 199  TRP H CB  1 
ATOM   1482 C CG  . TRP A 1 199 ? 22.057  17.543  -8.407  1.00 44.74  ? 199  TRP H CG  1 
ATOM   1483 C CD1 . TRP A 1 199 ? 22.148  16.198  -8.187  1.00 43.78  ? 199  TRP H CD1 1 
ATOM   1484 C CD2 . TRP A 1 199 ? 20.721  17.787  -8.874  1.00 43.73  ? 199  TRP H CD2 1 
ATOM   1485 N NE1 . TRP A 1 199 ? 20.945  15.590  -8.471  1.00 42.96  ? 199  TRP H NE1 1 
ATOM   1486 C CE2 . TRP A 1 199 ? 20.053  16.541  -8.897  1.00 43.29  ? 199  TRP H CE2 1 
ATOM   1487 C CE3 . TRP A 1 199 ? 20.025  18.935  -9.275  1.00 43.91  ? 199  TRP H CE3 1 
ATOM   1488 C CZ2 . TRP A 1 199 ? 18.718  16.414  -9.299  1.00 42.88  ? 199  TRP H CZ2 1 
ATOM   1489 C CZ3 . TRP A 1 199 ? 18.698  18.809  -9.670  1.00 43.90  ? 199  TRP H CZ3 1 
ATOM   1490 C CH2 . TRP A 1 199 ? 18.062  17.553  -9.684  1.00 43.75  ? 199  TRP H CH2 1 
ATOM   1491 N N   . PRO A 1 200 ? 22.723  18.536  -11.629 1.00 54.73  ? 200  PRO H N   1 
ATOM   1492 C CA  . PRO A 1 200 ? 22.764  17.076  -11.724 1.00 53.93  ? 200  PRO H CA  1 
ATOM   1493 C C   . PRO A 1 200 ? 23.995  16.487  -12.395 1.00 56.18  ? 200  PRO H C   1 
ATOM   1494 O O   . PRO A 1 200 ? 24.001  15.282  -12.682 1.00 56.05  ? 200  PRO H O   1 
ATOM   1495 C CB  . PRO A 1 200 ? 21.530  16.759  -12.573 1.00 54.61  ? 200  PRO H CB  1 
ATOM   1496 C CG  . PRO A 1 200 ? 21.424  17.918  -13.495 1.00 56.76  ? 200  PRO H CG  1 
ATOM   1497 C CD  . PRO A 1 200 ? 21.945  19.122  -12.741 1.00 56.21  ? 200  PRO H CD  1 
ATOM   1498 N N   . SER A 1 201 ? 25.027  17.295  -12.650 1.00 57.28  ? 201  SER H N   1 
ATOM   1499 C CA  . SER A 1 201 ? 26.230  16.764  -13.311 1.00 59.82  ? 201  SER H CA  1 
ATOM   1500 C C   . SER A 1 201 ? 26.934  15.708  -12.447 1.00 58.50  ? 201  SER H C   1 
ATOM   1501 O O   . SER A 1 201 ? 27.619  14.839  -12.969 1.00 59.24  ? 201  SER H O   1 
ATOM   1502 C CB  . SER A 1 201 ? 27.201  17.881  -13.724 1.00 61.36  ? 201  SER H CB  1 
ATOM   1503 O OG  . SER A 1 201 ? 27.599  18.646  -12.600 1.00 60.74  ? 201  SER H OG  1 
ATOM   1504 N N   . GLU A 1 202 ? 26.748  15.777  -11.129 1.00 56.01  ? 202  GLU H N   1 
ATOM   1505 C CA  . GLU A 1 202 ? 27.284  14.750  -10.236 1.00 55.04  ? 202  GLU H CA  1 
ATOM   1506 C C   . GLU A 1 202 ? 26.195  14.044  -9.440  1.00 51.63  ? 202  GLU H C   1 
ATOM   1507 O O   . GLU A 1 202 ? 25.108  14.589  -9.223  1.00 50.80  ? 202  GLU H O   1 
ATOM   1508 C CB  . GLU A 1 202 ? 28.353  15.325  -9.313  1.00 56.84  ? 202  GLU H CB  1 
ATOM   1509 C CG  . GLU A 1 202 ? 29.658  15.616  -10.031 1.00 62.83  ? 202  GLU H CG  1 
ATOM   1510 C CD  . GLU A 1 202 ? 30.396  16.790  -9.438  1.00 65.90  ? 202  GLU H CD  1 
ATOM   1511 O OE1 . GLU A 1 202 ? 30.369  16.942  -8.200  1.00 67.75  ? 202  GLU H OE1 1 
ATOM   1512 O OE2 . GLU A 1 202 ? 30.995  17.571  -10.210 1.00 69.30  ? 202  GLU H OE2 1 
ATOM   1513 N N   . THR A 1 203 ? 26.501  12.824  -9.012  1.00 49.17  ? 203  THR H N   1 
ATOM   1514 C CA  . THR A 1 203 ? 25.560  11.988  -8.277  1.00 46.01  ? 203  THR H CA  1 
ATOM   1515 C C   . THR A 1 203 ? 25.332  12.492  -6.848  1.00 42.37  ? 203  THR H C   1 
ATOM   1516 O O   . THR A 1 203 ? 26.280  12.851  -6.138  1.00 42.00  ? 203  THR H O   1 
ATOM   1517 C CB  . THR A 1 203 ? 26.027  10.516  -8.311  1.00 46.31  ? 203  THR H CB  1 
ATOM   1518 O OG1 . THR A 1 203 ? 26.193  10.131  -9.676  1.00 49.36  ? 203  THR H OG1 1 
ATOM   1519 C CG2 . THR A 1 203 ? 25.006  9.595   -7.726  1.00 45.37  ? 203  THR H CG2 1 
ATOM   1520 N N   . VAL A 1 204 ? 24.061  12.566  -6.469  1.00 39.61  ? 204  VAL H N   1 
ATOM   1521 C CA  . VAL A 1 204 ? 23.655  12.789  -5.074  1.00 37.16  ? 204  VAL H CA  1 
ATOM   1522 C C   . VAL A 1 204 ? 22.656  11.704  -4.663  1.00 36.47  ? 204  VAL H C   1 
ATOM   1523 O O   . VAL A 1 204 ? 21.620  11.511  -5.325  1.00 36.09  ? 204  VAL H O   1 
ATOM   1524 C CB  . VAL A 1 204 ? 23.103  14.223  -4.818  1.00 36.04  ? 204  VAL H CB  1 
ATOM   1525 C CG1 . VAL A 1 204 ? 22.539  14.359  -3.405  1.00 33.17  ? 204  VAL H CG1 1 
ATOM   1526 C CG2 . VAL A 1 204 ? 24.201  15.264  -5.033  1.00 36.47  ? 204  VAL H CG2 1 
ATOM   1527 N N   . THR A 1 205 ? 22.985  10.999  -3.575  1.00 35.92  ? 205  THR H N   1 
ATOM   1528 C CA  . THR A 1 205 ? 22.183  9.869   -3.076  1.00 33.92  ? 205  THR H CA  1 
ATOM   1529 C C   . THR A 1 205 ? 21.912  9.980   -1.593  1.00 32.54  ? 205  THR H C   1 
ATOM   1530 O O   . THR A 1 205 ? 22.841  10.192  -0.819  1.00 31.65  ? 205  THR H O   1 
ATOM   1531 C CB  . THR A 1 205 ? 22.951  8.551   -3.291  1.00 35.13  ? 205  THR H CB  1 
ATOM   1532 O OG1 . THR A 1 205 ? 23.229  8.386   -4.677  1.00 35.95  ? 205  THR H OG1 1 
ATOM   1533 C CG2 . THR A 1 205 ? 22.161  7.368   -2.797  1.00 34.21  ? 205  THR H CG2 1 
ATOM   1534 N N   . CYS A 1 206 ? 20.657  9.827   -1.165  1.00 31.88  ? 206  CYS H N   1 
ATOM   1535 C CA  . CYS A 1 206 ? 20.459  9.677   0.273   1.00 32.99  ? 206  CYS H CA  1 
ATOM   1536 C C   . CYS A 1 206 ? 20.486  8.207   0.654   1.00 32.46  ? 206  CYS H C   1 
ATOM   1537 O O   . CYS A 1 206 ? 19.938  7.356   -0.056  1.00 32.45  ? 206  CYS H O   1 
ATOM   1538 C CB  . CYS A 1 206 ? 19.194  10.352  0.766   1.00 35.27  ? 206  CYS H CB  1 
ATOM   1539 S SG  . CYS A 1 206 ? 17.729  9.449   0.325   1.00 39.02  ? 206  CYS H SG  1 
ATOM   1540 N N   . ASN A 1 207 ? 21.171  7.912   1.753   1.00 31.22  ? 207  ASN H N   1 
ATOM   1541 C CA  . ASN A 1 207 ? 21.275  6.553   2.278   1.00 30.39  ? 207  ASN H CA  1 
ATOM   1542 C C   . ASN A 1 207 ? 20.501  6.514   3.574   1.00 29.32  ? 207  ASN H C   1 
ATOM   1543 O O   . ASN A 1 207 ? 20.746  7.322   4.473   1.00 29.42  ? 207  ASN H O   1 
ATOM   1544 C CB  . ASN A 1 207 ? 22.729  6.188   2.566   1.00 31.09  ? 207  ASN H CB  1 
ATOM   1545 C CG  . ASN A 1 207 ? 23.689  6.777   1.548   1.00 32.23  ? 207  ASN H CG  1 
ATOM   1546 O OD1 . ASN A 1 207 ? 23.805  6.279   0.435   1.00 33.19  ? 207  ASN H OD1 1 
ATOM   1547 N ND2 . ASN A 1 207 ? 24.356  7.849   1.915   1.00 32.11  ? 207  ASN H ND2 1 
ATOM   1548 N N   . VAL A 1 208 ? 19.582  5.573   3.671   1.00 28.73  ? 208  VAL H N   1 
ATOM   1549 C CA  . VAL A 1 208 ? 18.647  5.493   4.792   1.00 28.30  ? 208  VAL H CA  1 
ATOM   1550 C C   . VAL A 1 208 ? 18.839  4.126   5.450   1.00 29.73  ? 208  VAL H C   1 
ATOM   1551 O O   . VAL A 1 208 ? 18.825  3.102   4.747   1.00 30.48  ? 208  VAL H O   1 
ATOM   1552 C CB  . VAL A 1 208 ? 17.203  5.671   4.292   1.00 27.69  ? 208  VAL H CB  1 
ATOM   1553 C CG1 . VAL A 1 208 ? 16.204  5.462   5.433   1.00 27.23  ? 208  VAL H CG1 1 
ATOM   1554 C CG2 . VAL A 1 208 ? 17.034  7.057   3.674   1.00 27.91  ? 208  VAL H CG2 1 
ATOM   1555 N N   . ALA A 1 209 ? 19.071  4.096   6.765   1.00 29.24  ? 209  ALA H N   1 
ATOM   1556 C CA  . ALA A 1 209 ? 19.163  2.814   7.464   1.00 29.52  ? 209  ALA H CA  1 
ATOM   1557 C C   . ALA A 1 209 ? 18.066  2.675   8.519   1.00 29.94  ? 209  ALA H C   1 
ATOM   1558 O O   . ALA A 1 209 ? 17.795  3.613   9.271   1.00 29.58  ? 209  ALA H O   1 
ATOM   1559 C CB  . ALA A 1 209 ? 20.548  2.597   8.064   1.00 31.58  ? 209  ALA H CB  1 
ATOM   1560 N N   . HIS A 1 210 ? 17.419  1.517   8.545   1.00 29.64  ? 210  HIS H N   1 
ATOM   1561 C CA  . HIS A 1 210 ? 16.414  1.235   9.573   1.00 30.13  ? 210  HIS H CA  1 
ATOM   1562 C C   . HIS A 1 210 ? 16.733  -0.120  10.201  1.00 31.30  ? 210  HIS H C   1 
ATOM   1563 O O   . HIS A 1 210 ? 16.210  -1.137  9.751   1.00 31.59  ? 210  HIS H O   1 
ATOM   1564 C CB  . HIS A 1 210 ? 15.017  1.234   8.975   1.00 29.01  ? 210  HIS H CB  1 
ATOM   1565 C CG  . HIS A 1 210 ? 13.927  1.105   9.996   1.00 30.19  ? 210  HIS H CG  1 
ATOM   1566 N ND1 . HIS A 1 210 ? 12.923  0.168   9.898   1.00 31.12  ? 210  HIS H ND1 1 
ATOM   1567 C CD2 . HIS A 1 210 ? 13.701  1.784   11.146  1.00 30.45  ? 210  HIS H CD2 1 
ATOM   1568 C CE1 . HIS A 1 210 ? 12.109  0.288   10.932  1.00 32.57  ? 210  HIS H CE1 1 
ATOM   1569 N NE2 . HIS A 1 210 ? 12.553  1.273   11.700  1.00 32.57  ? 210  HIS H NE2 1 
ATOM   1570 N N   . PRO A 1 211 ? 17.619  -0.127  11.221  1.00 31.93  ? 211  PRO H N   1 
ATOM   1571 C CA  . PRO A 1 211 ? 18.128  -1.358  11.825  1.00 33.32  ? 211  PRO H CA  1 
ATOM   1572 C C   . PRO A 1 211 ? 17.046  -2.277  12.339  1.00 33.76  ? 211  PRO H C   1 
ATOM   1573 O O   . PRO A 1 211 ? 17.175  -3.492  12.184  1.00 34.65  ? 211  PRO H O   1 
ATOM   1574 C CB  . PRO A 1 211 ? 18.976  -0.847  12.998  1.00 34.30  ? 211  PRO H CB  1 
ATOM   1575 C CG  . PRO A 1 211 ? 19.424  0.502   12.575  1.00 33.10  ? 211  PRO H CG  1 
ATOM   1576 C CD  . PRO A 1 211 ? 18.287  1.070   11.778  1.00 32.38  ? 211  PRO H CD  1 
ATOM   1577 N N   . ALA A 1 212 ? 15.995  -1.716  12.949  1.00 33.78  ? 212  ALA H N   1 
ATOM   1578 C CA  . ALA A 1 212 ? 14.880  -2.529  13.480  1.00 35.22  ? 212  ALA H CA  1 
ATOM   1579 C C   . ALA A 1 212 ? 14.284  -3.491  12.453  1.00 35.06  ? 212  ALA H C   1 
ATOM   1580 O O   . ALA A 1 212 ? 13.932  -4.618  12.797  1.00 36.83  ? 212  ALA H O   1 
ATOM   1581 C CB  . ALA A 1 212 ? 13.782  -1.650  14.067  1.00 35.19  ? 212  ALA H CB  1 
ATOM   1582 N N   . SER A 1 213 ? 14.153  -3.049  11.204  1.00 33.61  ? 213  SER H N   1 
ATOM   1583 C CA  . SER A 1 213 ? 13.581  -3.893  10.159  1.00 33.64  ? 213  SER H CA  1 
ATOM   1584 C C   . SER A 1 213 ? 14.669  -4.490  9.244   1.00 33.86  ? 213  SER H C   1 
ATOM   1585 O O   . SER A 1 213 ? 14.347  -5.077  8.207   1.00 34.23  ? 213  SER H O   1 
ATOM   1586 C CB  . SER A 1 213 ? 12.549  -3.113  9.331   1.00 33.26  ? 213  SER H CB  1 
ATOM   1587 O OG  . SER A 1 213 ? 13.174  -2.165  8.464   1.00 32.08  ? 213  SER H OG  1 
ATOM   1588 N N   . SER A 1 214 ? 15.938  -4.355  9.640   1.00 33.86  ? 214  SER H N   1 
ATOM   1589 C CA  . SER A 1 214 ? 17.057  -4.962  8.895   1.00 35.09  ? 214  SER H CA  1 
ATOM   1590 C C   . SER A 1 214 ? 17.155  -4.419  7.453   1.00 33.98  ? 214  SER H C   1 
ATOM   1591 O O   . SER A 1 214 ? 17.495  -5.152  6.529   1.00 34.39  ? 214  SER H O   1 
ATOM   1592 C CB  . SER A 1 214 ? 16.938  -6.508  8.891   1.00 37.15  ? 214  SER H CB  1 
ATOM   1593 O OG  . SER A 1 214 ? 17.046  -7.021  10.213  1.00 39.65  ? 214  SER H OG  1 
ATOM   1594 N N   . THR A 1 215 ? 16.875  -3.126  7.281   1.00 32.61  ? 215  THR H N   1 
ATOM   1595 C CA  . THR A 1 215 ? 16.718  -2.538  5.949   1.00 32.31  ? 215  THR H CA  1 
ATOM   1596 C C   . THR A 1 215 ? 17.731  -1.411  5.745   1.00 31.64  ? 215  THR H C   1 
ATOM   1597 O O   . THR A 1 215 ? 17.917  -0.586  6.627   1.00 32.23  ? 215  THR H O   1 
ATOM   1598 C CB  . THR A 1 215 ? 15.291  -1.931  5.777   1.00 31.96  ? 215  THR H CB  1 
ATOM   1599 O OG1 . THR A 1 215 ? 14.279  -2.904  6.091   1.00 32.33  ? 215  THR H OG1 1 
ATOM   1600 C CG2 . THR A 1 215 ? 15.076  -1.398  4.361   1.00 31.63  ? 215  THR H CG2 1 
ATOM   1601 N N   . LYS A 1 216 ? 18.399  -1.388  4.594   1.00 31.76  ? 216  LYS H N   1 
ATOM   1602 C CA  . LYS A 1 216 ? 19.082  -0.177  4.143   1.00 31.82  ? 216  LYS H CA  1 
ATOM   1603 C C   . LYS A 1 216 ? 18.607  0.185   2.738   1.00 31.00  ? 216  LYS H C   1 
ATOM   1604 O O   . LYS A 1 216 ? 18.512  -0.685  1.891   1.00 31.34  ? 216  LYS H O   1 
ATOM   1605 C CB  . LYS A 1 216 ? 20.621  -0.321  4.166   1.00 34.82  ? 216  LYS H CB  1 
ATOM   1606 C CG  . LYS A 1 216 ? 21.320  1.036   4.171   1.00 39.55  ? 216  LYS H CG  1 
ATOM   1607 C CD  . LYS A 1 216 ? 22.733  1.061   3.595   1.00 44.56  ? 216  LYS H CD  1 
ATOM   1608 C CE  . LYS A 1 216 ? 23.234  2.505   3.506   1.00 47.96  ? 216  LYS H CE  1 
ATOM   1609 N NZ  . LYS A 1 216 ? 24.372  2.680   2.542   1.00 53.04  ? 216  LYS H NZ  1 
ATOM   1610 N N   . VAL A 1 217 ? 18.305  1.466   2.505   1.00 30.32  ? 217  VAL H N   1 
ATOM   1611 C CA  . VAL A 1 217 ? 17.880  1.969   1.190   1.00 30.40  ? 217  VAL H CA  1 
ATOM   1612 C C   . VAL A 1 217 ? 18.759  3.130   0.701   1.00 30.96  ? 217  VAL H C   1 
ATOM   1613 O O   . VAL A 1 217 ? 18.985  4.116   1.422   1.00 30.45  ? 217  VAL H O   1 
ATOM   1614 C CB  . VAL A 1 217 ? 16.395  2.421   1.183   1.00 29.87  ? 217  VAL H CB  1 
ATOM   1615 C CG1 . VAL A 1 217 ? 16.003  3.017   -0.169  1.00 29.93  ? 217  VAL H CG1 1 
ATOM   1616 C CG2 . VAL A 1 217 ? 15.476  1.267   1.537   1.00 30.37  ? 217  VAL H CG2 1 
ATOM   1617 N N   . ASP A 1 218 ? 19.245  3.000   -0.533  1.00 31.91  ? 218  ASP H N   1 
ATOM   1618 C CA  . ASP A 1 218 ? 19.851  4.109   -1.268  1.00 32.92  ? 218  ASP H CA  1 
ATOM   1619 C C   . ASP A 1 218 ? 18.907  4.657   -2.335  1.00 33.29  ? 218  ASP H C   1 
ATOM   1620 O O   . ASP A 1 218 ? 18.330  3.892   -3.144  1.00 35.12  ? 218  ASP H O   1 
ATOM   1621 C CB  . ASP A 1 218 ? 21.124  3.645   -1.964  1.00 34.68  ? 218  ASP H CB  1 
ATOM   1622 C CG  . ASP A 1 218 ? 22.282  3.449   -1.012  1.00 35.96  ? 218  ASP H CG  1 
ATOM   1623 O OD1 . ASP A 1 218 ? 22.212  3.779   0.190   1.00 34.90  ? 218  ASP H OD1 1 
ATOM   1624 O OD2 . ASP A 1 218 ? 23.316  2.982   -1.498  1.00 39.68  ? 218  ASP H OD2 1 
ATOM   1625 N N   . LYS A 1 219 ? 18.756  5.978   -2.351  1.00 32.29  ? 219  LYS H N   1 
ATOM   1626 C CA  . LYS A 1 219 ? 17.937  6.652   -3.359  1.00 32.20  ? 219  LYS H CA  1 
ATOM   1627 C C   . LYS A 1 219 ? 18.776  7.740   -4.051  1.00 32.58  ? 219  LYS H C   1 
ATOM   1628 O O   . LYS A 1 219 ? 19.111  8.742   -3.424  1.00 30.92  ? 219  LYS H O   1 
ATOM   1629 C CB  . LYS A 1 219 ? 16.679  7.246   -2.705  1.00 31.58  ? 219  LYS H CB  1 
ATOM   1630 C CG  . LYS A 1 219 ? 15.514  7.480   -3.653  1.00 33.51  ? 219  LYS H CG  1 
ATOM   1631 C CD  . LYS A 1 219 ? 14.886  6.156   -4.058  1.00 32.99  ? 219  LYS H CD  1 
ATOM   1632 C CE  . LYS A 1 219 ? 13.947  6.372   -5.203  1.00 36.05  ? 219  LYS H CE  1 
ATOM   1633 N NZ  . LYS A 1 219 ? 13.099  5.170   -5.426  1.00 36.47  ? 219  LYS H NZ  1 
ATOM   1634 N N   . LYS A 1 220 ? 19.140  7.521   -5.318  1.00 33.79  ? 220  LYS H N   1 
ATOM   1635 C CA  . LYS A 1 220 ? 19.770  8.559   -6.138  1.00 35.08  ? 220  LYS H CA  1 
ATOM   1636 C C   . LYS A 1 220 ? 18.727  9.627   -6.485  1.00 35.07  ? 220  LYS H C   1 
ATOM   1637 O O   . LYS A 1 220 ? 17.591  9.290   -6.858  1.00 34.97  ? 220  LYS H O   1 
ATOM   1638 C CB  . LYS A 1 220 ? 20.357  7.964   -7.417  1.00 37.29  ? 220  LYS H CB  1 
ATOM   1639 C CG  . LYS A 1 220 ? 21.226  8.916   -8.238  1.00 39.55  ? 220  LYS H CG  1 
ATOM   1640 C CD  . LYS A 1 220 ? 21.775  8.216   -9.481  1.00 42.41  ? 220  LYS H CD  1 
ATOM   1641 C CE  . LYS A 1 220 ? 22.423  9.203   -10.437 1.00 44.70  ? 220  LYS H CE  1 
ATOM   1642 N NZ  . LYS A 1 220 ? 22.710  8.599   -11.769 1.00 47.45  ? 220  LYS H NZ  1 
ATOM   1643 N N   . ILE A 1 221 ? 19.106  10.901  -6.345  1.00 34.56  ? 221  ILE H N   1 
ATOM   1644 C CA  . ILE A 1 221 ? 18.230  12.018  -6.707  1.00 35.12  ? 221  ILE H CA  1 
ATOM   1645 C C   . ILE A 1 221 ? 18.502  12.434  -8.155  1.00 37.85  ? 221  ILE H C   1 
ATOM   1646 O O   . ILE A 1 221 ? 19.578  12.962  -8.464  1.00 38.17  ? 221  ILE H O   1 
ATOM   1647 C CB  . ILE A 1 221 ? 18.400  13.237  -5.758  1.00 33.58  ? 221  ILE H CB  1 
ATOM   1648 C CG1 . ILE A 1 221 ? 18.402  12.804  -4.280  1.00 31.37  ? 221  ILE H CG1 1 
ATOM   1649 C CG2 . ILE A 1 221 ? 17.308  14.276  -6.028  1.00 33.72  ? 221  ILE H CG2 1 
ATOM   1650 C CD1 . ILE A 1 221 ? 17.098  12.197  -3.798  1.00 30.20  ? 221  ILE H CD1 1 
ATOM   1651 N N   . VAL A 1 222 ? 17.534  12.164  -9.036  1.00 39.73  ? 222  VAL H N   1 
ATOM   1652 C CA  . VAL A 1 222 ? 17.623  12.511  -10.462 1.00 43.47  ? 222  VAL H CA  1 
ATOM   1653 C C   . VAL A 1 222 ? 16.653  13.671  -10.773 1.00 45.76  ? 222  VAL H C   1 
ATOM   1654 O O   . VAL A 1 222 ? 15.651  13.827  -10.067 1.00 44.91  ? 222  VAL H O   1 
ATOM   1655 C CB  . VAL A 1 222 ? 17.367  11.286  -11.393 1.00 44.70  ? 222  VAL H CB  1 
ATOM   1656 C CG1 . VAL A 1 222 ? 18.383  10.176  -11.120 1.00 44.74  ? 222  VAL H CG1 1 
ATOM   1657 C CG2 . VAL A 1 222 ? 15.947  10.754  -11.237 1.00 44.28  ? 222  VAL H CG2 1 
ATOM   1658 N N   . PRO A 1 223 ? 16.960  14.511  -11.798 1.00 49.41  ? 223  PRO H N   1 
ATOM   1659 C CA  . PRO A 1 223 ? 16.054  15.625  -12.134 1.00 51.90  ? 223  PRO H CA  1 
ATOM   1660 C C   . PRO A 1 223 ? 14.667  15.213  -12.651 1.00 55.43  ? 223  PRO H C   1 
ATOM   1661 O O   . PRO A 1 223 ? 14.453  14.048  -13.029 1.00 55.56  ? 223  PRO H O   1 
ATOM   1662 C CB  . PRO A 1 223 ? 16.829  16.426  -13.192 1.00 52.98  ? 223  PRO H CB  1 
ATOM   1663 C CG  . PRO A 1 223 ? 17.928  15.533  -13.659 1.00 53.87  ? 223  PRO H CG  1 
ATOM   1664 C CD  . PRO A 1 223 ? 18.249  14.634  -12.503 1.00 51.39  ? 223  PRO H CD  1 
ATOM   1665 N N   . ARG A 1 224 ? 13.758  16.195  -12.670 1.00 58.83  ? 224  ARG H N   1 
ATOM   1666 C CA  . ARG A 1 224 ? 12.316  16.015  -12.895 1.00 62.45  ? 224  ARG H CA  1 
ATOM   1667 C C   . ARG A 1 224 ? 11.672  15.371  -11.680 1.00 60.61  ? 224  ARG H C   1 
ATOM   1668 O O   . ARG A 1 224 ? 11.315  16.071  -10.739 1.00 61.09  ? 224  ARG H O   1 
ATOM   1669 C CB  . ARG A 1 224 ? 11.987  15.222  -14.165 1.00 66.14  ? 224  ARG H CB  1 
ATOM   1670 C CG  . ARG A 1 224 ? 10.505  14.890  -14.284 1.00 69.90  ? 224  ARG H CG  1 
ATOM   1671 C CD  . ARG A 1 224 ? 10.223  13.780  -15.276 1.00 73.57  ? 224  ARG H CD  1 
ATOM   1672 N NE  . ARG A 1 224 ? 10.678  14.134  -16.618 1.00 78.80  ? 224  ARG H NE  1 
ATOM   1673 C CZ  . ARG A 1 224 ? 11.731  13.591  -17.227 1.00 81.05  ? 224  ARG H CZ  1 
ATOM   1674 N NH1 . ARG A 1 224 ? 12.448  12.649  -16.624 1.00 81.21  ? 224  ARG H NH1 1 
ATOM   1675 N NH2 . ARG A 1 224 ? 12.067  13.987  -18.446 1.00 83.50  ? 224  ARG H NH2 1 
ATOM   1676 N N   . ASP B 2 1   ? 10.507  13.368  48.574  1.00 63.80  ? 1    ASP L N   1 
ATOM   1677 C CA  . ASP B 2 1   ? 11.213  13.826  47.347  1.00 60.63  ? 1    ASP L CA  1 
ATOM   1678 C C   . ASP B 2 1   ? 11.416  15.329  47.392  1.00 56.86  ? 1    ASP L C   1 
ATOM   1679 O O   . ASP B 2 1   ? 10.455  16.098  47.484  1.00 57.33  ? 1    ASP L O   1 
ATOM   1680 C CB  . ASP B 2 1   ? 10.419  13.449  46.089  1.00 64.29  ? 1    ASP L CB  1 
ATOM   1681 C CG  . ASP B 2 1   ? 10.336  11.933  45.866  1.00 68.32  ? 1    ASP L CG  1 
ATOM   1682 O OD1 . ASP B 2 1   ? 10.310  11.163  46.860  1.00 69.41  ? 1    ASP L OD1 1 
ATOM   1683 O OD2 . ASP B 2 1   ? 10.292  11.514  44.681  1.00 70.10  ? 1    ASP L OD2 1 
ATOM   1684 N N   . ILE B 2 2   ? 12.676  15.740  47.333  1.00 53.30  ? 2    ILE L N   1 
ATOM   1685 C CA  . ILE B 2 2   ? 13.020  17.151  47.244  1.00 50.41  ? 2    ILE L CA  1 
ATOM   1686 C C   . ILE B 2 2   ? 12.662  17.681  45.840  1.00 48.27  ? 2    ILE L C   1 
ATOM   1687 O O   . ILE B 2 2   ? 13.084  17.083  44.844  1.00 47.50  ? 2    ILE L O   1 
ATOM   1688 C CB  . ILE B 2 2   ? 14.520  17.368  47.584  1.00 48.50  ? 2    ILE L CB  1 
ATOM   1689 C CG1 . ILE B 2 2   ? 14.746  17.119  49.083  1.00 48.86  ? 2    ILE L CG1 1 
ATOM   1690 C CG2 . ILE B 2 2   ? 14.981  18.765  47.167  1.00 44.65  ? 2    ILE L CG2 1 
ATOM   1691 C CD1 . ILE B 2 2   ? 16.162  16.770  49.477  1.00 49.18  ? 2    ILE L CD1 1 
ATOM   1692 N N   . GLN B 2 3   ? 11.857  18.755  45.766  1.00 45.76  ? 3    GLN L N   1 
ATOM   1693 C CA  . GLN B 2 3   ? 11.565  19.382  44.470  1.00 43.78  ? 3    GLN L CA  1 
ATOM   1694 C C   . GLN B 2 3   ? 12.701  20.323  44.059  1.00 40.43  ? 3    GLN L C   1 
ATOM   1695 O O   . GLN B 2 3   ? 13.121  21.184  44.835  1.00 37.93  ? 3    GLN L O   1 
ATOM   1696 C CB  . GLN B 2 3   ? 10.221  20.122  44.413  1.00 46.33  ? 3    GLN L CB  1 
ATOM   1697 C CG  . GLN B 2 3   ? 9.923   20.612  42.988  1.00 48.43  ? 3    GLN L CG  1 
ATOM   1698 C CD  . GLN B 2 3   ? 8.544   21.224  42.780  1.00 51.46  ? 3    GLN L CD  1 
ATOM   1699 O OE1 . GLN B 2 3   ? 7.538   20.529  42.809  1.00 52.39  ? 3    GLN L OE1 1 
ATOM   1700 N NE2 . GLN B 2 3   ? 8.506   22.532  42.507  1.00 52.18  ? 3    GLN L NE2 1 
ATOM   1701 N N   . MET B 2 4   ? 13.170  20.131  42.827  1.00 38.06  ? 4    MET L N   1 
ATOM   1702 C CA  . MET B 2 4   ? 14.216  20.935  42.216  1.00 34.95  ? 4    MET L CA  1 
ATOM   1703 C C   . MET B 2 4   ? 13.567  21.710  41.097  1.00 34.12  ? 4    MET L C   1 
ATOM   1704 O O   . MET B 2 4   ? 13.112  21.114  40.112  1.00 34.66  ? 4    MET L O   1 
ATOM   1705 C CB  . MET B 2 4   ? 15.283  20.029  41.605  1.00 35.16  ? 4    MET L CB  1 
ATOM   1706 C CG  . MET B 2 4   ? 15.819  18.942  42.523  1.00 35.58  ? 4    MET L CG  1 
ATOM   1707 S SD  . MET B 2 4   ? 16.902  19.635  43.785  1.00 35.92  ? 4    MET L SD  1 
ATOM   1708 C CE  . MET B 2 4   ? 18.329  20.068  42.786  1.00 32.19  ? 4    MET L CE  1 
ATOM   1709 N N   . THR B 2 5   ? 13.514  23.031  41.249  1.00 32.09  ? 5    THR L N   1 
ATOM   1710 C CA  . THR B 2 5   ? 12.929  23.908  40.225  1.00 31.49  ? 5    THR L CA  1 
ATOM   1711 C C   . THR B 2 5   ? 13.990  24.771  39.582  1.00 29.15  ? 5    THR L C   1 
ATOM   1712 O O   . THR B 2 5   ? 14.605  25.599  40.247  1.00 27.45  ? 5    THR L O   1 
ATOM   1713 C CB  . THR B 2 5   ? 11.870  24.844  40.824  1.00 32.44  ? 5    THR L CB  1 
ATOM   1714 O OG1 . THR B 2 5   ? 10.923  24.049  41.554  1.00 33.19  ? 5    THR L OG1 1 
ATOM   1715 C CG2 . THR B 2 5   ? 11.168  25.634  39.717  1.00 32.47  ? 5    THR L CG2 1 
ATOM   1716 N N   . GLN B 2 6   ? 14.177  24.579  38.278  1.00 29.51  ? 6    GLN L N   1 
ATOM   1717 C CA  . GLN B 2 6   ? 15.115  25.398  37.518  1.00 28.58  ? 6    GLN L CA  1 
ATOM   1718 C C   . GLN B 2 6   ? 14.438  26.554  36.812  1.00 30.28  ? 6    GLN L C   1 
ATOM   1719 O O   . GLN B 2 6   ? 13.286  26.432  36.359  1.00 29.31  ? 6    GLN L O   1 
ATOM   1720 C CB  . GLN B 2 6   ? 15.803  24.567  36.474  1.00 28.17  ? 6    GLN L CB  1 
ATOM   1721 C CG  . GLN B 2 6   ? 16.884  23.684  37.021  1.00 28.01  ? 6    GLN L CG  1 
ATOM   1722 C CD  . GLN B 2 6   ? 17.594  22.958  35.915  1.00 27.94  ? 6    GLN L CD  1 
ATOM   1723 O OE1 . GLN B 2 6   ? 18.256  23.560  35.064  1.00 29.05  ? 6    GLN L OE1 1 
ATOM   1724 N NE2 . GLN B 2 6   ? 17.456  21.655  35.910  1.00 27.58  ? 6    GLN L NE2 1 
ATOM   1725 N N   . SER B 2 7   ? 15.171  27.658  36.703  1.00 29.57  ? 7    SER L N   1 
ATOM   1726 C CA  . SER B 2 7   ? 14.766  28.763  35.848  1.00 31.35  ? 7    SER L CA  1 
ATOM   1727 C C   . SER B 2 7   ? 15.968  29.505  35.255  1.00 30.22  ? 7    SER L C   1 
ATOM   1728 O O   . SER B 2 7   ? 17.084  29.462  35.801  1.00 29.04  ? 7    SER L O   1 
ATOM   1729 C CB  . SER B 2 7   ? 13.813  29.717  36.585  1.00 34.13  ? 7    SER L CB  1 
ATOM   1730 O OG  . SER B 2 7   ? 14.467  30.256  37.716  1.00 35.24  ? 7    SER L OG  1 
ATOM   1731 N N   . PRO B 2 8   ? 15.758  30.164  34.102  1.00 31.52  ? 8    PRO L N   1 
ATOM   1732 C CA  . PRO B 2 8   ? 14.502  30.121  33.331  1.00 32.18  ? 8    PRO L CA  1 
ATOM   1733 C C   . PRO B 2 8   ? 14.406  28.770  32.601  1.00 32.46  ? 8    PRO L C   1 
ATOM   1734 O O   . PRO B 2 8   ? 15.388  28.027  32.596  1.00 31.78  ? 8    PRO L O   1 
ATOM   1735 C CB  . PRO B 2 8   ? 14.674  31.286  32.347  1.00 32.93  ? 8    PRO L CB  1 
ATOM   1736 C CG  . PRO B 2 8   ? 16.154  31.391  32.126  1.00 31.31  ? 8    PRO L CG  1 
ATOM   1737 C CD  . PRO B 2 8   ? 16.815  30.942  33.423  1.00 31.03  ? 8    PRO L CD  1 
ATOM   1738 N N   . ALA B 2 9   ? 13.272  28.451  31.975  1.00 33.08  ? 9    ALA L N   1 
ATOM   1739 C CA  . ALA B 2 9   ? 13.177  27.207  31.174  1.00 33.36  ? 9    ALA L CA  1 
ATOM   1740 C C   . ALA B 2 9   ? 14.070  27.285  29.929  1.00 33.21  ? 9    ALA L C   1 
ATOM   1741 O O   . ALA B 2 9   ? 14.606  26.277  29.446  1.00 30.99  ? 9    ALA L O   1 
ATOM   1742 C CB  . ALA B 2 9   ? 11.740  26.940  30.764  1.00 34.83  ? 9    ALA L CB  1 
ATOM   1743 N N   . SER B 2 10  ? 14.245  28.509  29.445  1.00 32.92  ? 10   SER L N   1 
ATOM   1744 C CA  . SER B 2 10  ? 14.913  28.763  28.197  1.00 34.44  ? 10   SER L CA  1 
ATOM   1745 C C   . SER B 2 10  ? 15.664  30.080  28.325  1.00 33.30  ? 10   SER L C   1 
ATOM   1746 O O   . SER B 2 10  ? 15.145  31.031  28.899  1.00 32.57  ? 10   SER L O   1 
ATOM   1747 C CB  . SER B 2 10  ? 13.857  28.837  27.095  1.00 38.23  ? 10   SER L CB  1 
ATOM   1748 O OG  . SER B 2 10  ? 14.473  28.952  25.836  1.00 44.34  ? 10   SER L OG  1 
ATOM   1749 N N   . LEU B 2 11  ? 16.893  30.120  27.808  1.00 32.21  ? 11   LEU L N   1 
ATOM   1750 C CA  . LEU B 2 11  ? 17.750  31.287  27.897  1.00 32.50  ? 11   LEU L CA  1 
ATOM   1751 C C   . LEU B 2 11  ? 18.403  31.543  26.539  1.00 31.91  ? 11   LEU L C   1 
ATOM   1752 O O   . LEU B 2 11  ? 18.885  30.613  25.894  1.00 32.20  ? 11   LEU L O   1 
ATOM   1753 C CB  . LEU B 2 11  ? 18.830  31.032  28.962  1.00 34.70  ? 11   LEU L CB  1 
ATOM   1754 C CG  . LEU B 2 11  ? 19.657  32.178  29.559  1.00 37.94  ? 11   LEU L CG  1 
ATOM   1755 C CD1 . LEU B 2 11  ? 18.756  33.344  29.958  1.00 41.36  ? 11   LEU L CD1 1 
ATOM   1756 C CD2 . LEU B 2 11  ? 20.440  31.672  30.767  1.00 39.77  ? 11   LEU L CD2 1 
ATOM   1757 N N   . SER B 2 12  ? 18.417  32.796  26.111  1.00 29.96  ? 12   SER L N   1 
ATOM   1758 C CA  . SER B 2 12  ? 18.992  33.168  24.837  1.00 30.64  ? 12   SER L CA  1 
ATOM   1759 C C   . SER B 2 12  ? 19.991  34.302  25.084  1.00 29.79  ? 12   SER L C   1 
ATOM   1760 O O   . SER B 2 12  ? 19.630  35.322  25.686  1.00 29.65  ? 12   SER L O   1 
ATOM   1761 C CB  . SER B 2 12  ? 17.872  33.593  23.888  1.00 31.98  ? 12   SER L CB  1 
ATOM   1762 O OG  . SER B 2 12  ? 18.391  34.224  22.747  1.00 33.78  ? 12   SER L OG  1 
ATOM   1763 N N   . ALA B 2 13  ? 21.240  34.129  24.647  1.00 28.83  ? 13   ALA L N   1 
ATOM   1764 C CA  . ALA B 2 13  ? 22.275  35.152  24.863  1.00 27.92  ? 13   ALA L CA  1 
ATOM   1765 C C   . ALA B 2 13  ? 23.310  35.166  23.760  1.00 28.85  ? 13   ALA L C   1 
ATOM   1766 O O   . ALA B 2 13  ? 23.498  34.180  23.060  1.00 28.55  ? 13   ALA L O   1 
ATOM   1767 C CB  . ALA B 2 13  ? 22.962  34.937  26.201  1.00 27.03  ? 13   ALA L CB  1 
ATOM   1768 N N   . SER B 2 14  ? 23.980  36.302  23.594  1.00 29.13  ? 14   SER L N   1 
ATOM   1769 C CA  . SER B 2 14  ? 25.024  36.438  22.579  1.00 30.50  ? 14   SER L CA  1 
ATOM   1770 C C   . SER B 2 14  ? 26.305  35.730  22.958  1.00 29.13  ? 14   SER L C   1 
ATOM   1771 O O   . SER B 2 14  ? 26.625  35.637  24.148  1.00 27.74  ? 14   SER L O   1 
ATOM   1772 C CB  . SER B 2 14  ? 25.342  37.909  22.378  1.00 32.15  ? 14   SER L CB  1 
ATOM   1773 O OG  . SER B 2 14  ? 24.283  38.522  21.681  1.00 35.51  ? 14   SER L OG  1 
ATOM   1774 N N   . VAL B 2 15  ? 27.054  35.254  21.958  1.00 29.80  ? 15   VAL L N   1 
ATOM   1775 C CA  . VAL B 2 15  ? 28.421  34.781  22.223  1.00 30.01  ? 15   VAL L CA  1 
ATOM   1776 C C   . VAL B 2 15  ? 29.187  35.854  23.009  1.00 30.47  ? 15   VAL L C   1 
ATOM   1777 O O   . VAL B 2 15  ? 29.198  37.039  22.615  1.00 30.75  ? 15   VAL L O   1 
ATOM   1778 C CB  . VAL B 2 15  ? 29.180  34.437  20.929  1.00 31.57  ? 15   VAL L CB  1 
ATOM   1779 C CG1 . VAL B 2 15  ? 30.684  34.254  21.193  1.00 31.08  ? 15   VAL L CG1 1 
ATOM   1780 C CG2 . VAL B 2 15  ? 28.575  33.207  20.272  1.00 32.02  ? 15   VAL L CG2 1 
ATOM   1781 N N   . GLY B 2 16  ? 29.805  35.466  24.123  1.00 29.13  ? 16   GLY L N   1 
ATOM   1782 C CA  . GLY B 2 16  ? 30.578  36.424  24.930  1.00 30.59  ? 16   GLY L CA  1 
ATOM   1783 C C   . GLY B 2 16  ? 29.804  36.948  26.119  1.00 30.80  ? 16   GLY L C   1 
ATOM   1784 O O   . GLY B 2 16  ? 30.376  37.542  27.037  1.00 31.50  ? 16   GLY L O   1 
ATOM   1785 N N   . ALA B 2 17  ? 28.495  36.722  26.133  1.00 30.19  ? 17   ALA L N   1 
ATOM   1786 C CA  . ALA B 2 17  ? 27.692  37.120  27.276  1.00 29.81  ? 17   ALA L CA  1 
ATOM   1787 C C   . ALA B 2 17  ? 28.024  36.253  28.505  1.00 30.09  ? 17   ALA L C   1 
ATOM   1788 O O   . ALA B 2 17  ? 28.494  35.119  28.369  1.00 30.14  ? 17   ALA L O   1 
ATOM   1789 C CB  . ALA B 2 17  ? 26.205  37.035  26.946  1.00 29.29  ? 17   ALA L CB  1 
ATOM   1790 N N   . THR B 2 18  ? 27.794  36.810  29.691  1.00 30.17  ? 18   THR L N   1 
ATOM   1791 C CA  . THR B 2 18  ? 27.763  36.050  30.940  1.00 30.79  ? 18   THR L CA  1 
ATOM   1792 C C   . THR B 2 18  ? 26.304  35.695  31.216  1.00 30.62  ? 18   THR L C   1 
ATOM   1793 O O   . THR B 2 18  ? 25.428  36.561  31.111  1.00 33.41  ? 18   THR L O   1 
ATOM   1794 C CB  . THR B 2 18  ? 28.353  36.857  32.113  1.00 30.40  ? 18   THR L CB  1 
ATOM   1795 O OG1 . THR B 2 18  ? 29.747  36.990  31.902  1.00 32.92  ? 18   THR L OG1 1 
ATOM   1796 C CG2 . THR B 2 18  ? 28.149  36.147  33.458  1.00 29.52  ? 18   THR L CG2 1 
ATOM   1797 N N   . VAL B 2 19  ? 26.030  34.419  31.511  1.00 28.03  ? 19   VAL L N   1 
ATOM   1798 C CA  . VAL B 2 19  ? 24.653  33.972  31.768  1.00 27.94  ? 19   VAL L CA  1 
ATOM   1799 C C   . VAL B 2 19  ? 24.600  33.182  33.087  1.00 26.25  ? 19   VAL L C   1 
ATOM   1800 O O   . VAL B 2 19  ? 25.593  32.574  33.466  1.00 25.20  ? 19   VAL L O   1 
ATOM   1801 C CB  . VAL B 2 19  ? 24.089  33.099  30.609  1.00 28.55  ? 19   VAL L CB  1 
ATOM   1802 C CG1 . VAL B 2 19  ? 24.132  33.849  29.285  1.00 30.63  ? 19   VAL L CG1 1 
ATOM   1803 C CG2 . VAL B 2 19  ? 24.882  31.809  30.455  1.00 27.55  ? 19   VAL L CG2 1 
ATOM   1804 N N   . THR B 2 20  ? 23.438  33.186  33.744  1.00 25.79  ? 20   THR L N   1 
ATOM   1805 C CA  . THR B 2 20  ? 23.225  32.515  35.031  1.00 26.41  ? 20   THR L CA  1 
ATOM   1806 C C   . THR B 2 20  ? 21.927  31.717  34.970  1.00 26.23  ? 20   THR L C   1 
ATOM   1807 O O   . THR B 2 20  ? 20.893  32.240  34.548  1.00 28.43  ? 20   THR L O   1 
ATOM   1808 C CB  . THR B 2 20  ? 23.174  33.528  36.202  1.00 26.69  ? 20   THR L CB  1 
ATOM   1809 O OG1 . THR B 2 20  ? 24.420  34.236  36.257  1.00 28.82  ? 20   THR L OG1 1 
ATOM   1810 C CG2 . THR B 2 20  ? 22.964  32.808  37.531  1.00 27.62  ? 20   THR L CG2 1 
ATOM   1811 N N   . ILE B 2 21  ? 21.997  30.449  35.367  1.00 25.65  ? 21   ILE L N   1 
ATOM   1812 C CA  . ILE B 2 21  ? 20.843  29.546  35.434  1.00 27.25  ? 21   ILE L CA  1 
ATOM   1813 C C   . ILE B 2 21  ? 20.692  29.314  36.928  1.00 26.35  ? 21   ILE L C   1 
ATOM   1814 O O   . ILE B 2 21  ? 21.713  29.169  37.629  1.00 25.32  ? 21   ILE L O   1 
ATOM   1815 C CB  . ILE B 2 21  ? 21.153  28.196  34.734  1.00 28.17  ? 21   ILE L CB  1 
ATOM   1816 C CG1 . ILE B 2 21  ? 21.145  28.393  33.218  1.00 31.99  ? 21   ILE L CG1 1 
ATOM   1817 C CG2 . ILE B 2 21  ? 20.152  27.114  35.130  1.00 31.76  ? 21   ILE L CG2 1 
ATOM   1818 C CD1 . ILE B 2 21  ? 21.886  27.287  32.492  1.00 34.14  ? 21   ILE L CD1 1 
ATOM   1819 N N   . THR B 2 22  ? 19.455  29.271  37.417  1.00 25.35  ? 22   THR L N   1 
ATOM   1820 C CA  A THR B 2 22  ? 19.184  29.079  38.847  0.50 25.64  ? 22   THR L CA  1 
ATOM   1821 C CA  B THR B 2 22  ? 19.245  29.020  38.845  0.50 26.06  ? 22   THR L CA  1 
ATOM   1822 C C   . THR B 2 22  ? 18.460  27.748  39.120  1.00 26.37  ? 22   THR L C   1 
ATOM   1823 O O   . THR B 2 22  ? 17.676  27.258  38.269  1.00 25.84  ? 22   THR L O   1 
ATOM   1824 C CB  A THR B 2 22  ? 18.361  30.264  39.401  0.50 25.92  ? 22   THR L CB  1 
ATOM   1825 C CB  B THR B 2 22  ? 18.600  30.214  39.584  0.50 26.63  ? 22   THR L CB  1 
ATOM   1826 O OG1 A THR B 2 22  ? 18.923  31.498  38.936  0.50 25.34  ? 22   THR L OG1 1 
ATOM   1827 O OG1 B THR B 2 22  ? 17.323  30.523  39.001  0.50 27.82  ? 22   THR L OG1 1 
ATOM   1828 C CG2 A THR B 2 22  ? 18.308  30.267  40.933  0.50 25.63  ? 22   THR L CG2 1 
ATOM   1829 C CG2 B THR B 2 22  ? 19.504  31.432  39.537  0.50 26.67  ? 22   THR L CG2 1 
ATOM   1830 N N   . CYS B 2 23  ? 18.704  27.192  40.312  1.00 26.12  ? 23   CYS L N   1 
ATOM   1831 C CA  . CYS B 2 23  ? 18.081  25.970  40.770  1.00 27.63  ? 23   CYS L CA  1 
ATOM   1832 C C   . CYS B 2 23  ? 17.607  26.219  42.205  1.00 28.05  ? 23   CYS L C   1 
ATOM   1833 O O   . CYS B 2 23  ? 18.399  26.532  43.101  1.00 26.96  ? 23   CYS L O   1 
ATOM   1834 C CB  . CYS B 2 23  ? 19.063  24.796  40.697  1.00 29.75  ? 23   CYS L CB  1 
ATOM   1835 S SG  . CYS B 2 23  ? 18.457  23.188  41.307  1.00 34.39  ? 23   CYS L SG  1 
ATOM   1836 N N   . ARG B 2 24  ? 16.307  26.107  42.407  1.00 27.61  ? 24   ARG L N   1 
ATOM   1837 C CA  . ARG B 2 24  ? 15.724  26.348  43.725  1.00 30.28  ? 24   ARG L CA  1 
ATOM   1838 C C   . ARG B 2 24  ? 15.233  24.999  44.316  1.00 30.32  ? 24   ARG L C   1 
ATOM   1839 O O   . ARG B 2 24  ? 14.583  24.202  43.626  1.00 30.75  ? 24   ARG L O   1 
ATOM   1840 C CB  . ARG B 2 24  ? 14.580  27.357  43.586  1.00 33.63  ? 24   ARG L CB  1 
ATOM   1841 C CG  . ARG B 2 24  ? 13.805  27.613  44.859  1.00 38.29  ? 24   ARG L CG  1 
ATOM   1842 C CD  . ARG B 2 24  ? 12.631  28.560  44.612  1.00 43.21  ? 24   ARG L CD  1 
ATOM   1843 N NE  . ARG B 2 24  ? 11.558  27.988  43.780  1.00 45.60  ? 24   ARG L NE  1 
ATOM   1844 C CZ  . ARG B 2 24  ? 10.559  27.229  44.231  1.00 47.84  ? 24   ARG L CZ  1 
ATOM   1845 N NH1 . ARG B 2 24  ? 10.483  26.908  45.517  1.00 51.95  ? 24   ARG L NH1 1 
ATOM   1846 N NH2 . ARG B 2 24  ? 9.633   26.780  43.388  1.00 48.59  ? 24   ARG L NH2 1 
ATOM   1847 N N   . THR B 2 25  ? 15.553  24.726  45.576  1.00 29.32  ? 25   THR L N   1 
ATOM   1848 C CA  . THR B 2 25  ? 15.238  23.415  46.139  1.00 30.01  ? 25   THR L CA  1 
ATOM   1849 C C   . THR B 2 25  ? 14.148  23.533  47.230  1.00 31.49  ? 25   THR L C   1 
ATOM   1850 O O   . THR B 2 25  ? 14.022  24.584  47.862  1.00 31.39  ? 25   THR L O   1 
ATOM   1851 C CB  . THR B 2 25  ? 16.503  22.743  46.697  1.00 28.91  ? 25   THR L CB  1 
ATOM   1852 O OG1 . THR B 2 25  ? 17.008  23.534  47.777  1.00 29.16  ? 25   THR L OG1 1 
ATOM   1853 C CG2 . THR B 2 25  ? 17.572  22.641  45.609  1.00 28.41  ? 25   THR L CG2 1 
ATOM   1854 N N   . SER B 2 26  ? 13.387  22.457  47.465  1.00 33.77  ? 26   SER L N   1 
ATOM   1855 C CA  . SER B 2 26  ? 12.305  22.488  48.483  1.00 35.82  ? 26   SER L CA  1 
ATOM   1856 C C   . SER B 2 26  ? 12.818  22.421  49.932  1.00 37.74  ? 26   SER L C   1 
ATOM   1857 O O   . SER B 2 26  ? 12.064  22.707  50.878  1.00 38.04  ? 26   SER L O   1 
ATOM   1858 C CB  . SER B 2 26  ? 11.228  21.416  48.229  1.00 37.16  ? 26   SER L CB  1 
ATOM   1859 O OG  . SER B 2 26  ? 11.764  20.105  48.178  1.00 37.29  ? 26   SER L OG  1 
ATOM   1860 N N   . GLU B 2 27  ? 14.093  22.040  50.084  1.00 37.61  ? 27   GLU L N   1 
ATOM   1861 C CA  . GLU B 2 27  ? 14.760  21.864  51.398  1.00 40.00  ? 27   GLU L CA  1 
ATOM   1862 C C   . GLU B 2 27  ? 16.153  22.543  51.359  1.00 36.22  ? 27   GLU L C   1 
ATOM   1863 O O   . GLU B 2 27  ? 16.717  22.710  50.300  1.00 33.71  ? 27   GLU L O   1 
ATOM   1864 C CB  . GLU B 2 27  ? 14.948  20.359  51.701  1.00 42.89  ? 27   GLU L CB  1 
ATOM   1865 C CG  . GLU B 2 27  ? 13.693  19.483  51.693  1.00 48.09  ? 27   GLU L CG  1 
ATOM   1866 C CD  . GLU B 2 27  ? 12.763  19.775  52.849  1.00 52.30  ? 27   GLU L CD  1 
ATOM   1867 O OE1 . GLU B 2 27  ? 13.175  20.476  53.799  1.00 54.89  ? 27   GLU L OE1 1 
ATOM   1868 O OE2 . GLU B 2 27  ? 11.612  19.292  52.829  1.00 57.51  ? 27   GLU L OE2 1 
ATOM   1869 N N   . ASN B 2 28  ? 16.697  22.932  52.513  1.00 35.95  ? 28   ASN L N   1 
ATOM   1870 C CA  . ASN B 2 28  ? 18.134  23.245  52.587  1.00 33.62  ? 28   ASN L CA  1 
ATOM   1871 C C   . ASN B 2 28  ? 18.906  21.958  52.268  1.00 33.38  ? 28   ASN L C   1 
ATOM   1872 O O   . ASN B 2 28  ? 18.901  21.010  53.058  1.00 34.99  ? 28   ASN L O   1 
ATOM   1873 C CB  . ASN B 2 28  ? 18.487  23.778  53.996  1.00 34.06  ? 28   ASN L CB  1 
ATOM   1874 C CG  . ASN B 2 28  ? 19.977  24.011  54.211  1.00 32.48  ? 28   ASN L CG  1 
ATOM   1875 O OD1 . ASN B 2 28  ? 20.797  23.970  53.282  1.00 31.11  ? 28   ASN L OD1 1 
ATOM   1876 N ND2 . ASN B 2 28  ? 20.331  24.263  55.453  1.00 33.13  ? 28   ASN L ND2 1 
ATOM   1877 N N   . ILE B 2 29  ? 19.574  21.924  51.124  1.00 31.56  ? 29   ILE L N   1 
ATOM   1878 C CA  . ILE B 2 29  ? 20.378  20.740  50.728  1.00 31.79  ? 29   ILE L CA  1 
ATOM   1879 C C   . ILE B 2 29  ? 21.884  20.844  51.057  1.00 32.13  ? 29   ILE L C   1 
ATOM   1880 O O   . ILE B 2 29  ? 22.672  19.969  50.669  1.00 32.74  ? 29   ILE L O   1 
ATOM   1881 C CB  . ILE B 2 29  ? 20.164  20.375  49.236  1.00 30.07  ? 29   ILE L CB  1 
ATOM   1882 C CG1 . ILE B 2 29  ? 20.408  21.584  48.344  1.00 27.98  ? 29   ILE L CG1 1 
ATOM   1883 C CG2 . ILE B 2 29  ? 18.733  19.895  49.028  1.00 30.87  ? 29   ILE L CG2 1 
ATOM   1884 C CD1 . ILE B 2 29  ? 20.753  21.206  46.905  1.00 27.09  ? 29   ILE L CD1 1 
ATOM   1885 N N   . ASP B 2 30  ? 22.279  21.920  51.747  1.00 31.87  ? 30   ASP L N   1 
ATOM   1886 C CA  . ASP B 2 30  ? 23.642  22.076  52.262  1.00 31.50  ? 30   ASP L CA  1 
ATOM   1887 C C   . ASP B 2 30  ? 24.710  21.900  51.136  1.00 30.83  ? 30   ASP L C   1 
ATOM   1888 O O   . ASP B 2 30  ? 25.789  21.322  51.350  1.00 31.03  ? 30   ASP L O   1 
ATOM   1889 C CB  . ASP B 2 30  ? 23.849  21.107  53.442  1.00 34.11  ? 30   ASP L CB  1 
ATOM   1890 C CG  . ASP B 2 30  ? 25.154  21.337  54.168  1.00 35.32  ? 30   ASP L CG  1 
ATOM   1891 O OD1 . ASP B 2 30  ? 25.653  22.477  54.118  1.00 34.53  ? 30   ASP L OD1 1 
ATOM   1892 O OD2 . ASP B 2 30  ? 25.687  20.371  54.778  1.00 37.06  ? 30   ASP L OD2 1 
ATOM   1893 N N   . SER B 2 31  ? 24.387  22.405  49.945  1.00 28.57  ? 31   SER L N   1 
ATOM   1894 C CA  . SER B 2 31  ? 25.304  22.378  48.778  1.00 28.00  ? 31   SER L CA  1 
ATOM   1895 C C   . SER B 2 31  ? 25.643  20.979  48.254  1.00 29.11  ? 31   SER L C   1 
ATOM   1896 O O   . SER B 2 31  ? 26.666  20.821  47.559  1.00 29.16  ? 31   SER L O   1 
ATOM   1897 C CB  . SER B 2 31  ? 26.615  23.133  49.074  1.00 27.40  ? 31   SER L CB  1 
ATOM   1898 O OG  . SER B 2 31  ? 26.367  24.504  49.349  1.00 27.73  ? 31   SER L OG  1 
ATOM   1899 N N   . TYR B 2 32  ? 24.816  19.982  48.597  1.00 30.15  ? 32   TYR L N   1 
ATOM   1900 C CA  . TYR B 2 32  ? 24.911  18.632  48.018  1.00 31.33  ? 32   TYR L CA  1 
ATOM   1901 C C   . TYR B 2 32  ? 24.206  18.674  46.670  1.00 29.52  ? 32   TYR L C   1 
ATOM   1902 O O   . TYR B 2 32  ? 23.068  18.201  46.529  1.00 29.35  ? 32   TYR L O   1 
ATOM   1903 C CB  . TYR B 2 32  ? 24.256  17.580  48.937  1.00 33.38  ? 32   TYR L CB  1 
ATOM   1904 C CG  . TYR B 2 32  ? 25.087  17.235  50.143  1.00 36.19  ? 32   TYR L CG  1 
ATOM   1905 C CD1 . TYR B 2 32  ? 25.246  18.142  51.186  1.00 37.30  ? 32   TYR L CD1 1 
ATOM   1906 C CD2 . TYR B 2 32  ? 25.710  15.995  50.251  1.00 38.48  ? 32   TYR L CD2 1 
ATOM   1907 C CE1 . TYR B 2 32  ? 26.009  17.843  52.297  1.00 39.65  ? 32   TYR L CE1 1 
ATOM   1908 C CE2 . TYR B 2 32  ? 26.481  15.684  51.364  1.00 41.45  ? 32   TYR L CE2 1 
ATOM   1909 C CZ  . TYR B 2 32  ? 26.630  16.624  52.382  1.00 41.82  ? 32   TYR L CZ  1 
ATOM   1910 O OH  . TYR B 2 32  ? 27.385  16.342  53.503  1.00 45.57  ? 32   TYR L OH  1 
ATOM   1911 N N   . LEU B 2 33  ? 24.866  19.302  45.707  1.00 28.43  ? 33   LEU L N   1 
ATOM   1912 C CA  . LEU B 2 33  ? 24.246  19.569  44.416  1.00 28.00  ? 33   LEU L CA  1 
ATOM   1913 C C   . LEU B 2 33  ? 25.257  19.426  43.269  1.00 27.35  ? 33   LEU L C   1 
ATOM   1914 O O   . LEU B 2 33  ? 26.419  19.824  43.403  1.00 27.79  ? 33   LEU L O   1 
ATOM   1915 C CB  . LEU B 2 33  ? 23.633  20.969  44.431  1.00 27.42  ? 33   LEU L CB  1 
ATOM   1916 C CG  . LEU B 2 33  ? 22.951  21.397  43.132  1.00 26.86  ? 33   LEU L CG  1 
ATOM   1917 C CD1 . LEU B 2 33  ? 21.611  22.080  43.358  1.00 28.24  ? 33   LEU L CD1 1 
ATOM   1918 C CD2 . LEU B 2 33  ? 23.901  22.270  42.322  1.00 26.28  ? 33   LEU L CD2 1 
ATOM   1919 N N   . ALA B 2 34  ? 24.802  18.853  42.156  1.00 26.62  ? 34   ALA L N   1 
ATOM   1920 C CA  . ALA B 2 34  ? 25.622  18.725  40.950  1.00 25.65  ? 34   ALA L CA  1 
ATOM   1921 C C   . ALA B 2 34  ? 24.924  19.415  39.780  1.00 24.19  ? 34   ALA L C   1 
ATOM   1922 O O   . ALA B 2 34  ? 23.696  19.502  39.759  1.00 23.95  ? 34   ALA L O   1 
ATOM   1923 C CB  . ALA B 2 34  ? 25.878  17.253  40.632  1.00 26.26  ? 34   ALA L CB  1 
ATOM   1924 N N   . TRP B 2 35  ? 25.712  19.906  38.814  1.00 24.15  ? 35   TRP L N   1 
ATOM   1925 C CA  . TRP B 2 35  ? 25.185  20.438  37.565  1.00 23.26  ? 35   TRP L CA  1 
ATOM   1926 C C   . TRP B 2 35  ? 25.663  19.564  36.410  1.00 23.54  ? 35   TRP L C   1 
ATOM   1927 O O   . TRP B 2 35  ? 26.816  19.118  36.403  1.00 23.92  ? 35   TRP L O   1 
ATOM   1928 C CB  . TRP B 2 35  ? 25.666  21.890  37.290  1.00 22.93  ? 35   TRP L CB  1 
ATOM   1929 C CG  . TRP B 2 35  ? 25.026  22.921  38.174  1.00 22.81  ? 35   TRP L CG  1 
ATOM   1930 C CD1 . TRP B 2 35  ? 25.522  23.437  39.349  1.00 22.77  ? 35   TRP L CD1 1 
ATOM   1931 C CD2 . TRP B 2 35  ? 23.762  23.556  37.959  1.00 22.70  ? 35   TRP L CD2 1 
ATOM   1932 N NE1 . TRP B 2 35  ? 24.635  24.344  39.874  1.00 22.90  ? 35   TRP L NE1 1 
ATOM   1933 C CE2 . TRP B 2 35  ? 23.551  24.444  39.043  1.00 22.39  ? 35   TRP L CE2 1 
ATOM   1934 C CE3 . TRP B 2 35  ? 22.803  23.490  36.937  1.00 22.89  ? 35   TRP L CE3 1 
ATOM   1935 C CZ2 . TRP B 2 35  ? 22.410  25.245  39.145  1.00 23.26  ? 35   TRP L CZ2 1 
ATOM   1936 C CZ3 . TRP B 2 35  ? 21.665  24.287  37.034  1.00 22.77  ? 35   TRP L CZ3 1 
ATOM   1937 C CH2 . TRP B 2 35  ? 21.485  25.160  38.127  1.00 23.35  ? 35   TRP L CH2 1 
ATOM   1938 N N   . TYR B 2 36  ? 24.789  19.344  35.430  1.00 23.54  ? 36   TYR L N   1 
ATOM   1939 C CA  . TYR B 2 36  ? 25.169  18.612  34.200  1.00 24.93  ? 36   TYR L CA  1 
ATOM   1940 C C   . TYR B 2 36  ? 24.787  19.389  32.950  1.00 23.75  ? 36   TYR L C   1 
ATOM   1941 O O   . TYR B 2 36  ? 23.828  20.177  32.953  1.00 23.42  ? 36   TYR L O   1 
ATOM   1942 C CB  . TYR B 2 36  ? 24.547  17.189  34.140  1.00 26.29  ? 36   TYR L CB  1 
ATOM   1943 C CG  . TYR B 2 36  ? 24.850  16.344  35.380  1.00 28.12  ? 36   TYR L CG  1 
ATOM   1944 C CD1 . TYR B 2 36  ? 26.019  15.580  35.467  1.00 29.06  ? 36   TYR L CD1 1 
ATOM   1945 C CD2 . TYR B 2 36  ? 23.990  16.358  36.479  1.00 28.96  ? 36   TYR L CD2 1 
ATOM   1946 C CE1 . TYR B 2 36  ? 26.296  14.827  36.614  1.00 30.45  ? 36   TYR L CE1 1 
ATOM   1947 C CE2 . TYR B 2 36  ? 24.266  15.615  37.636  1.00 29.59  ? 36   TYR L CE2 1 
ATOM   1948 C CZ  . TYR B 2 36  ? 25.419  14.865  37.694  1.00 30.31  ? 36   TYR L CZ  1 
ATOM   1949 O OH  . TYR B 2 36  ? 25.696  14.133  38.845  1.00 32.22  ? 36   TYR L OH  1 
ATOM   1950 N N   . GLN B 2 37  ? 25.575  19.171  31.901  1.00 23.95  ? 37   GLN L N   1 
ATOM   1951 C CA  . GLN B 2 37  ? 25.296  19.644  30.542  1.00 24.15  ? 37   GLN L CA  1 
ATOM   1952 C C   . GLN B 2 37  ? 24.882  18.436  29.719  1.00 24.77  ? 37   GLN L C   1 
ATOM   1953 O O   . GLN B 2 37  ? 25.417  17.347  29.906  1.00 25.31  ? 37   GLN L O   1 
ATOM   1954 C CB  . GLN B 2 37  ? 26.577  20.217  29.932  1.00 24.53  ? 37   GLN L CB  1 
ATOM   1955 C CG  . GLN B 2 37  ? 26.433  20.835  28.545  1.00 24.95  ? 37   GLN L CG  1 
ATOM   1956 C CD  . GLN B 2 37  ? 27.799  21.216  27.980  1.00 26.11  ? 37   GLN L CD  1 
ATOM   1957 O OE1 . GLN B 2 37  ? 28.628  20.339  27.714  1.00 26.80  ? 37   GLN L OE1 1 
ATOM   1958 N NE2 . GLN B 2 37  ? 28.055  22.519  27.824  1.00 24.66  ? 37   GLN L NE2 1 
ATOM   1959 N N   . GLN B 2 38  ? 23.953  18.626  28.791  1.00 25.14  ? 38   GLN L N   1 
ATOM   1960 C CA  . GLN B 2 38  ? 23.654  17.589  27.813  1.00 26.71  ? 38   GLN L CA  1 
ATOM   1961 C C   . GLN B 2 38  ? 23.358  18.245  26.462  1.00 27.49  ? 38   GLN L C   1 
ATOM   1962 O O   . GLN B 2 38  ? 22.366  18.967  26.318  1.00 26.80  ? 38   GLN L O   1 
ATOM   1963 C CB  . GLN B 2 38  ? 22.466  16.730  28.253  1.00 27.31  ? 38   GLN L CB  1 
ATOM   1964 C CG  . GLN B 2 38  ? 22.083  15.612  27.273  1.00 28.58  ? 38   GLN L CG  1 
ATOM   1965 C CD  . GLN B 2 38  ? 20.862  14.820  27.752  1.00 30.18  ? 38   GLN L CD  1 
ATOM   1966 O OE1 . GLN B 2 38  ? 19.922  15.397  28.320  1.00 29.97  ? 38   GLN L OE1 1 
ATOM   1967 N NE2 . GLN B 2 38  ? 20.877  13.491  27.542  1.00 29.92  ? 38   GLN L NE2 1 
ATOM   1968 N N   . ARG B 2 39  ? 24.211  17.957  25.486  1.00 29.04  ? 39   ARG L N   1 
ATOM   1969 C CA  . ARG B 2 39  ? 24.022  18.450  24.121  1.00 31.23  ? 39   ARG L CA  1 
ATOM   1970 C C   . ARG B 2 39  ? 23.010  17.536  23.432  1.00 33.96  ? 39   ARG L C   1 
ATOM   1971 O O   . ARG B 2 39  ? 22.835  16.381  23.842  1.00 33.58  ? 39   ARG L O   1 
ATOM   1972 C CB  . ARG B 2 39  ? 25.348  18.477  23.348  1.00 30.80  ? 39   ARG L CB  1 
ATOM   1973 C CG  . ARG B 2 39  ? 26.371  19.388  23.979  1.00 30.32  ? 39   ARG L CG  1 
ATOM   1974 C CD  . ARG B 2 39  ? 27.512  19.686  23.026  1.00 30.69  ? 39   ARG L CD  1 
ATOM   1975 N NE  . ARG B 2 39  ? 28.420  20.660  23.616  1.00 30.40  ? 39   ARG L NE  1 
ATOM   1976 C CZ  . ARG B 2 39  ? 29.500  20.322  24.314  1.00 30.19  ? 39   ARG L CZ  1 
ATOM   1977 N NH1 . ARG B 2 39  ? 29.793  19.041  24.476  1.00 30.73  ? 39   ARG L NH1 1 
ATOM   1978 N NH2 . ARG B 2 39  ? 30.296  21.257  24.819  1.00 28.88  ? 39   ARG L NH2 1 
ATOM   1979 N N   . GLN B 2 40  ? 22.326  18.064  22.416  1.00 36.34  ? 40   GLN L N   1 
ATOM   1980 C CA  . GLN B 2 40  ? 21.358  17.276  21.651  1.00 39.41  ? 40   GLN L CA  1 
ATOM   1981 C C   . GLN B 2 40  ? 21.983  15.973  21.154  1.00 38.69  ? 40   GLN L C   1 
ATOM   1982 O O   . GLN B 2 40  ? 23.074  15.974  20.569  1.00 39.08  ? 40   GLN L O   1 
ATOM   1983 C CB  . GLN B 2 40  ? 20.828  18.053  20.437  1.00 44.72  ? 40   GLN L CB  1 
ATOM   1984 C CG  . GLN B 2 40  ? 19.723  17.270  19.711  1.00 51.44  ? 40   GLN L CG  1 
ATOM   1985 C CD  . GLN B 2 40  ? 19.730  17.388  18.187  1.00 57.03  ? 40   GLN L CD  1 
ATOM   1986 O OE1 . GLN B 2 40  ? 19.006  16.648  17.503  1.00 60.93  ? 40   GLN L OE1 1 
ATOM   1987 N NE2 . GLN B 2 40  ? 20.514  18.328  17.648  1.00 56.55  ? 40   GLN L NE2 1 
ATOM   1988 N N   . GLY B 2 41  ? 21.279  14.870  21.387  1.00 37.62  ? 41   GLY L N   1 
ATOM   1989 C CA  . GLY B 2 41  ? 21.709  13.564  20.894  1.00 38.15  ? 41   GLY L CA  1 
ATOM   1990 C C   . GLY B 2 41  ? 22.853  12.917  21.655  1.00 36.76  ? 41   GLY L C   1 
ATOM   1991 O O   . GLY B 2 41  ? 23.334  11.864  21.241  1.00 37.76  ? 41   GLY L O   1 
ATOM   1992 N N   . LYS B 2 42  ? 23.275  13.530  22.769  1.00 34.19  ? 42   LYS L N   1 
ATOM   1993 C CA  . LYS B 2 42  ? 24.447  13.081  23.529  1.00 32.80  ? 42   LYS L CA  1 
ATOM   1994 C C   . LYS B 2 42  ? 24.075  12.715  24.963  1.00 32.17  ? 42   LYS L C   1 
ATOM   1995 O O   . LYS B 2 42  ? 23.029  13.121  25.466  1.00 32.20  ? 42   LYS L O   1 
ATOM   1996 C CB  . LYS B 2 42  ? 25.516  14.185  23.603  1.00 31.89  ? 42   LYS L CB  1 
ATOM   1997 C CG  . LYS B 2 42  ? 26.057  14.701  22.270  1.00 32.92  ? 42   LYS L CG  1 
ATOM   1998 C CD  . LYS B 2 42  ? 26.735  13.604  21.476  1.00 34.33  ? 42   LYS L CD  1 
ATOM   1999 C CE  . LYS B 2 42  ? 27.580  14.245  20.382  1.00 35.99  ? 42   LYS L CE  1 
ATOM   2000 N NZ  . LYS B 2 42  ? 27.844  13.252  19.309  1.00 38.08  ? 42   LYS L NZ  1 
ATOM   2001 N N   . SER B 2 43  ? 24.965  11.982  25.618  1.00 32.10  ? 43   SER L N   1 
ATOM   2002 C CA  . SER B 2 43  ? 24.830  11.682  27.044  1.00 32.72  ? 43   SER L CA  1 
ATOM   2003 C C   . SER B 2 43  ? 25.208  12.912  27.873  1.00 31.26  ? 43   SER L C   1 
ATOM   2004 O O   . SER B 2 43  ? 26.042  13.711  27.429  1.00 31.33  ? 43   SER L O   1 
ATOM   2005 C CB  . SER B 2 43  ? 25.751  10.520  27.414  1.00 33.53  ? 43   SER L CB  1 
ATOM   2006 O OG  . SER B 2 43  ? 25.463  9.380   26.620  1.00 35.08  ? 43   SER L OG  1 
ATOM   2007 N N   . PRO B 2 44  ? 24.632  13.055  29.085  1.00 30.29  ? 44   PRO L N   1 
ATOM   2008 C CA  . PRO B 2 44  ? 25.042  14.155  29.964  1.00 29.16  ? 44   PRO L CA  1 
ATOM   2009 C C   . PRO B 2 44  ? 26.517  14.057  30.376  1.00 29.61  ? 44   PRO L C   1 
ATOM   2010 O O   . PRO B 2 44  ? 27.114  12.961  30.325  1.00 31.41  ? 44   PRO L O   1 
ATOM   2011 C CB  . PRO B 2 44  ? 24.124  14.001  31.191  1.00 29.72  ? 44   PRO L CB  1 
ATOM   2012 C CG  . PRO B 2 44  ? 22.948  13.243  30.707  1.00 29.86  ? 44   PRO L CG  1 
ATOM   2013 C CD  . PRO B 2 44  ? 23.447  12.342  29.607  1.00 31.07  ? 44   PRO L CD  1 
ATOM   2014 N N   . GLN B 2 45  ? 27.092  15.204  30.756  1.00 28.38  ? 45   GLN L N   1 
ATOM   2015 C CA  . GLN B 2 45  ? 28.425  15.288  31.350  1.00 28.06  ? 45   GLN L CA  1 
ATOM   2016 C C   . GLN B 2 45  ? 28.372  16.129  32.625  1.00 27.75  ? 45   GLN L C   1 
ATOM   2017 O O   . GLN B 2 45  ? 27.603  17.098  32.700  1.00 26.11  ? 45   GLN L O   1 
ATOM   2018 C CB  . GLN B 2 45  ? 29.415  15.927  30.384  1.00 29.43  ? 45   GLN L CB  1 
ATOM   2019 C CG  . GLN B 2 45  ? 29.709  15.066  29.178  1.00 31.30  ? 45   GLN L CG  1 
ATOM   2020 C CD  . GLN B 2 45  ? 30.831  15.624  28.344  1.00 33.43  ? 45   GLN L CD  1 
ATOM   2021 O OE1 . GLN B 2 45  ? 30.648  16.609  27.633  1.00 34.09  ? 45   GLN L OE1 1 
ATOM   2022 N NE2 . GLN B 2 45  ? 31.999  14.988  28.409  1.00 34.81  ? 45   GLN L NE2 1 
ATOM   2023 N N   . LEU B 2 46  ? 29.214  15.780  33.606  1.00 27.53  ? 46   LEU L N   1 
ATOM   2024 C CA  . LEU B 2 46  ? 29.263  16.522  34.863  1.00 27.02  ? 46   LEU L CA  1 
ATOM   2025 C C   . LEU B 2 46  ? 30.006  17.848  34.689  1.00 26.40  ? 46   LEU L C   1 
ATOM   2026 O O   . LEU B 2 46  ? 31.085  17.883  34.100  1.00 26.53  ? 46   LEU L O   1 
ATOM   2027 C CB  . LEU B 2 46  ? 29.952  15.691  35.949  1.00 28.81  ? 46   LEU L CB  1 
ATOM   2028 C CG  . LEU B 2 46  ? 30.130  16.296  37.353  1.00 28.34  ? 46   LEU L CG  1 
ATOM   2029 C CD1 . LEU B 2 46  ? 28.779  16.501  38.002  1.00 27.80  ? 46   LEU L CD1 1 
ATOM   2030 C CD2 . LEU B 2 46  ? 30.937  15.296  38.162  1.00 30.82  ? 46   LEU L CD2 1 
ATOM   2031 N N   . LEU B 2 47  ? 29.437  18.931  35.214  1.00 24.94  ? 47   LEU L N   1 
ATOM   2032 C CA  . LEU B 2 47  ? 30.112  20.230  35.167  1.00 24.07  ? 47   LEU L CA  1 
ATOM   2033 C C   . LEU B 2 47  ? 30.675  20.609  36.548  1.00 24.19  ? 47   LEU L C   1 
ATOM   2034 O O   . LEU B 2 47  ? 31.841  21.017  36.679  1.00 23.92  ? 47   LEU L O   1 
ATOM   2035 C CB  . LEU B 2 47  ? 29.136  21.317  34.687  1.00 22.96  ? 47   LEU L CB  1 
ATOM   2036 C CG  . LEU B 2 47  ? 28.504  21.185  33.291  1.00 23.01  ? 47   LEU L CG  1 
ATOM   2037 C CD1 . LEU B 2 47  ? 27.533  22.349  33.117  1.00 22.61  ? 47   LEU L CD1 1 
ATOM   2038 C CD2 . LEU B 2 47  ? 29.566  21.213  32.202  1.00 23.26  ? 47   LEU L CD2 1 
ATOM   2039 N N   . VAL B 2 48  ? 29.821  20.486  37.562  1.00 24.18  ? 48   VAL L N   1 
ATOM   2040 C CA  . VAL B 2 48  ? 30.078  21.035  38.902  1.00 24.36  ? 48   VAL L CA  1 
ATOM   2041 C C   . VAL B 2 48  ? 29.487  20.051  39.923  1.00 25.15  ? 48   VAL L C   1 
ATOM   2042 O O   . VAL B 2 48  ? 28.388  19.524  39.699  1.00 25.17  ? 48   VAL L O   1 
ATOM   2043 C CB  . VAL B 2 48  ? 29.413  22.445  39.084  1.00 23.75  ? 48   VAL L CB  1 
ATOM   2044 C CG1 . VAL B 2 48  ? 29.596  22.981  40.510  1.00 24.30  ? 48   VAL L CG1 1 
ATOM   2045 C CG2 . VAL B 2 48  ? 29.927  23.458  38.052  1.00 23.13  ? 48   VAL L CG2 1 
ATOM   2046 N N   . TYR B 2 49  ? 30.206  19.845  41.030  1.00 25.90  ? 49   TYR L N   1 
ATOM   2047 C CA  . TYR B 2 49  ? 29.720  19.078  42.188  1.00 27.65  ? 49   TYR L CA  1 
ATOM   2048 C C   . TYR B 2 49  ? 29.969  19.860  43.504  1.00 28.06  ? 49   TYR L C   1 
ATOM   2049 O O   . TYR B 2 49  ? 30.746  20.820  43.529  1.00 27.70  ? 49   TYR L O   1 
ATOM   2050 C CB  . TYR B 2 49  ? 30.337  17.665  42.222  1.00 29.75  ? 49   TYR L CB  1 
ATOM   2051 C CG  . TYR B 2 49  ? 31.832  17.665  42.455  1.00 31.53  ? 49   TYR L CG  1 
ATOM   2052 C CD1 . TYR B 2 49  ? 32.721  17.768  41.391  1.00 31.68  ? 49   TYR L CD1 1 
ATOM   2053 C CD2 . TYR B 2 49  ? 32.354  17.582  43.753  1.00 33.35  ? 49   TYR L CD2 1 
ATOM   2054 C CE1 . TYR B 2 49  ? 34.093  17.783  41.612  1.00 33.98  ? 49   TYR L CE1 1 
ATOM   2055 C CE2 . TYR B 2 49  ? 33.720  17.601  43.986  1.00 35.53  ? 49   TYR L CE2 1 
ATOM   2056 C CZ  . TYR B 2 49  ? 34.580  17.701  42.908  1.00 35.06  ? 49   TYR L CZ  1 
ATOM   2057 O OH  . TYR B 2 49  ? 35.931  17.714  43.141  1.00 38.11  ? 49   TYR L OH  1 
ATOM   2058 N N   . ALA B 2 50  ? 29.281  19.464  44.577  1.00 28.73  ? 50   ALA L N   1 
ATOM   2059 C CA  . ALA B 2 50  ? 29.295  20.182  45.852  1.00 29.18  ? 50   ALA L CA  1 
ATOM   2060 C C   . ALA B 2 50  ? 28.990  21.669  45.627  1.00 28.11  ? 50   ALA L C   1 
ATOM   2061 O O   . ALA B 2 50  ? 29.557  22.543  46.294  1.00 28.12  ? 50   ALA L O   1 
ATOM   2062 C CB  . ALA B 2 50  ? 30.610  19.972  46.605  1.00 30.77  ? 50   ALA L CB  1 
ATOM   2063 N N   . ALA B 2 51  ? 28.071  21.927  44.685  1.00 26.74  ? 51   ALA L N   1 
ATOM   2064 C CA  . ALA B 2 51  ? 27.585  23.290  44.319  1.00 26.34  ? 51   ALA L CA  1 
ATOM   2065 C C   . ALA B 2 51  ? 28.605  24.203  43.646  1.00 26.34  ? 51   ALA L C   1 
ATOM   2066 O O   . ALA B 2 51  ? 28.220  24.993  42.798  1.00 25.56  ? 51   ALA L O   1 
ATOM   2067 C CB  . ALA B 2 51  ? 26.909  24.000  45.510  1.00 26.51  ? 51   ALA L CB  1 
ATOM   2068 N N   . THR B 2 52  ? 29.894  24.081  44.000  1.00 28.35  ? 52   THR L N   1 
ATOM   2069 C CA  . THR B 2 52  ? 30.924  25.039  43.574  1.00 29.22  ? 52   THR L CA  1 
ATOM   2070 C C   . THR B 2 52  ? 32.225  24.427  43.011  1.00 30.01  ? 52   THR L C   1 
ATOM   2071 O O   . THR B 2 52  ? 33.080  25.169  42.536  1.00 30.40  ? 52   THR L O   1 
ATOM   2072 C CB  . THR B 2 52  ? 31.333  26.001  44.719  1.00 30.13  ? 52   THR L CB  1 
ATOM   2073 O OG1 . THR B 2 52  ? 31.939  25.249  45.763  1.00 32.29  ? 52   THR L OG1 1 
ATOM   2074 C CG2 . THR B 2 52  ? 30.121  26.697  45.295  1.00 30.66  ? 52   THR L CG2 1 
ATOM   2075 N N   . ASN B 2 53  ? 32.368  23.100  43.059  1.00 30.82  ? 53   ASN L N   1 
ATOM   2076 C CA  . ASN B 2 53  ? 33.601  22.434  42.586  1.00 32.70  ? 53   ASN L CA  1 
ATOM   2077 C C   . ASN B 2 53  ? 33.499  22.087  41.114  1.00 31.19  ? 53   ASN L C   1 
ATOM   2078 O O   . ASN B 2 53  ? 32.617  21.345  40.719  1.00 31.21  ? 53   ASN L O   1 
ATOM   2079 C CB  . ASN B 2 53  ? 33.899  21.149  43.365  1.00 34.55  ? 53   ASN L CB  1 
ATOM   2080 C CG  . ASN B 2 53  ? 34.378  21.402  44.783  1.00 38.23  ? 53   ASN L CG  1 
ATOM   2081 O OD1 . ASN B 2 53  ? 34.564  22.540  45.217  1.00 39.14  ? 53   ASN L OD1 1 
ATOM   2082 N ND2 . ASN B 2 53  ? 34.577  20.324  45.520  1.00 40.66  ? 53   ASN L ND2 1 
ATOM   2083 N N   . LEU B 2 54  ? 34.401  22.635  40.311  1.00 31.90  ? 54   LEU L N   1 
ATOM   2084 C CA  . LEU B 2 54  ? 34.413  22.380  38.885  1.00 33.10  ? 54   LEU L CA  1 
ATOM   2085 C C   . LEU B 2 54  ? 34.941  20.976  38.653  1.00 33.72  ? 54   LEU L C   1 
ATOM   2086 O O   . LEU B 2 54  ? 35.973  20.625  39.211  1.00 36.78  ? 54   LEU L O   1 
ATOM   2087 C CB  . LEU B 2 54  ? 35.302  23.415  38.198  1.00 35.41  ? 54   LEU L CB  1 
ATOM   2088 C CG  . LEU B 2 54  ? 34.960  23.844  36.774  1.00 37.68  ? 54   LEU L CG  1 
ATOM   2089 C CD1 . LEU B 2 54  ? 33.602  24.513  36.724  1.00 38.39  ? 54   LEU L CD1 1 
ATOM   2090 C CD2 . LEU B 2 54  ? 36.037  24.804  36.297  1.00 40.81  ? 54   LEU L CD2 1 
ATOM   2091 N N   . ALA B 2 55  ? 34.234  20.163  37.871  1.00 33.05  ? 55   ALA L N   1 
ATOM   2092 C CA  . ALA B 2 55  ? 34.693  18.800  37.546  1.00 34.45  ? 55   ALA L CA  1 
ATOM   2093 C C   . ALA B 2 55  ? 35.945  18.886  36.652  1.00 36.55  ? 55   ALA L C   1 
ATOM   2094 O O   . ALA B 2 55  ? 36.076  19.812  35.861  1.00 35.76  ? 55   ALA L O   1 
ATOM   2095 C CB  . ALA B 2 55  ? 33.590  18.014  36.861  1.00 32.89  ? 55   ALA L CB  1 
ATOM   2096 N N   . ASP B 2 56  ? 36.896  17.975  36.790  1.00 40.02  ? 56   ASP L N   1 
ATOM   2097 C CA  . ASP B 2 56  ? 38.147  18.175  36.027  1.00 42.56  ? 56   ASP L CA  1 
ATOM   2098 C C   . ASP B 2 56  ? 37.912  18.060  34.500  1.00 40.58  ? 56   ASP L C   1 
ATOM   2099 O O   . ASP B 2 56  ? 37.044  17.304  34.043  1.00 39.11  ? 56   ASP L O   1 
ATOM   2100 C CB  . ASP B 2 56  ? 39.293  17.308  36.556  1.00 48.82  ? 56   ASP L CB  1 
ATOM   2101 C CG  . ASP B 2 56  ? 39.089  15.843  36.272  1.00 53.13  ? 56   ASP L CG  1 
ATOM   2102 O OD1 . ASP B 2 56  ? 37.915  15.411  36.189  1.00 54.92  ? 56   ASP L OD1 1 
ATOM   2103 O OD2 . ASP B 2 56  ? 40.102  15.125  36.120  1.00 59.53  ? 56   ASP L OD2 1 
ATOM   2104 N N   . GLY B 2 57  ? 38.645  18.860  33.720  1.00 40.51  ? 57   GLY L N   1 
ATOM   2105 C CA  . GLY B 2 57  ? 38.427  18.922  32.272  1.00 39.12  ? 57   GLY L CA  1 
ATOM   2106 C C   . GLY B 2 57  ? 37.353  19.921  31.854  1.00 36.26  ? 57   GLY L C   1 
ATOM   2107 O O   . GLY B 2 57  ? 37.293  20.327  30.694  1.00 35.73  ? 57   GLY L O   1 
ATOM   2108 N N   . VAL B 2 58  ? 36.489  20.327  32.788  1.00 34.47  ? 58   VAL L N   1 
ATOM   2109 C CA  . VAL B 2 58  ? 35.444  21.313  32.482  1.00 30.61  ? 58   VAL L CA  1 
ATOM   2110 C C   . VAL B 2 58  ? 36.057  22.714  32.277  1.00 29.69  ? 58   VAL L C   1 
ATOM   2111 O O   . VAL B 2 58  ? 36.897  23.162  33.071  1.00 30.05  ? 58   VAL L O   1 
ATOM   2112 C CB  . VAL B 2 58  ? 34.333  21.338  33.572  1.00 29.96  ? 58   VAL L CB  1 
ATOM   2113 C CG1 . VAL B 2 58  ? 33.280  22.394  33.253  1.00 28.70  ? 58   VAL L CG1 1 
ATOM   2114 C CG2 . VAL B 2 58  ? 33.669  19.978  33.685  1.00 29.65  ? 58   VAL L CG2 1 
ATOM   2115 N N   . PRO B 2 59  ? 35.628  23.421  31.224  1.00 28.77  ? 59   PRO L N   1 
ATOM   2116 C CA  . PRO B 2 59  ? 36.144  24.768  30.959  1.00 29.27  ? 59   PRO L CA  1 
ATOM   2117 C C   . PRO B 2 59  ? 35.960  25.698  32.148  1.00 28.68  ? 59   PRO L C   1 
ATOM   2118 O O   . PRO B 2 59  ? 34.910  25.665  32.823  1.00 28.12  ? 59   PRO L O   1 
ATOM   2119 C CB  . PRO B 2 59  ? 35.270  25.233  29.791  1.00 28.23  ? 59   PRO L CB  1 
ATOM   2120 C CG  . PRO B 2 59  ? 34.995  23.962  29.056  1.00 28.65  ? 59   PRO L CG  1 
ATOM   2121 C CD  . PRO B 2 59  ? 34.725  22.967  30.151  1.00 28.13  ? 59   PRO L CD  1 
ATOM   2122 N N   . SER B 2 60  ? 36.974  26.508  32.419  1.00 29.15  ? 60   SER L N   1 
ATOM   2123 C CA  . SER B 2 60  ? 36.955  27.395  33.591  1.00 29.59  ? 60   SER L CA  1 
ATOM   2124 C C   . SER B 2 60  ? 35.939  28.546  33.513  1.00 28.25  ? 60   SER L C   1 
ATOM   2125 O O   . SER B 2 60  ? 35.708  29.214  34.521  1.00 28.64  ? 60   SER L O   1 
ATOM   2126 C CB  . SER B 2 60  ? 38.370  27.941  33.881  1.00 31.15  ? 60   SER L CB  1 
ATOM   2127 O OG  . SER B 2 60  ? 38.753  28.848  32.852  1.00 32.55  ? 60   SER L OG  1 
ATOM   2128 N N   . ARG B 2 61  ? 35.330  28.784  32.349  1.00 26.78  ? 61   ARG L N   1 
ATOM   2129 C CA  . ARG B 2 61  ? 34.266  29.795  32.244  1.00 26.44  ? 61   ARG L CA  1 
ATOM   2130 C C   . ARG B 2 61  ? 32.985  29.362  32.983  1.00 25.09  ? 61   ARG L C   1 
ATOM   2131 O O   . ARG B 2 61  ? 32.092  30.175  33.230  1.00 24.95  ? 61   ARG L O   1 
ATOM   2132 C CB  . ARG B 2 61  ? 33.964  30.155  30.778  1.00 26.48  ? 61   ARG L CB  1 
ATOM   2133 C CG  . ARG B 2 61  ? 33.273  29.073  29.973  1.00 26.87  ? 61   ARG L CG  1 
ATOM   2134 C CD  . ARG B 2 61  ? 32.852  29.603  28.590  1.00 27.65  ? 61   ARG L CD  1 
ATOM   2135 N NE  . ARG B 2 61  ? 32.346  28.542  27.705  1.00 26.53  ? 61   ARG L NE  1 
ATOM   2136 C CZ  . ARG B 2 61  ? 33.152  27.729  27.035  1.00 26.96  ? 61   ARG L CZ  1 
ATOM   2137 N NH1 . ARG B 2 61  ? 34.466  27.876  27.162  1.00 28.93  ? 61   ARG L NH1 1 
ATOM   2138 N NH2 . ARG B 2 61  ? 32.664  26.758  26.280  1.00 26.68  ? 61   ARG L NH2 1 
ATOM   2139 N N   . PHE B 2 62  ? 32.906  28.078  33.325  1.00 24.81  ? 62   PHE L N   1 
ATOM   2140 C CA  . PHE B 2 62  ? 31.814  27.557  34.146  1.00 24.03  ? 62   PHE L CA  1 
ATOM   2141 C C   . PHE B 2 62  ? 32.098  27.723  35.632  1.00 24.03  ? 62   PHE L C   1 
ATOM   2142 O O   . PHE B 2 62  ? 33.215  27.460  36.078  1.00 26.13  ? 62   PHE L O   1 
ATOM   2143 C CB  . PHE B 2 62  ? 31.567  26.068  33.856  1.00 23.54  ? 62   PHE L CB  1 
ATOM   2144 C CG  . PHE B 2 62  ? 30.914  25.798  32.522  1.00 23.44  ? 62   PHE L CG  1 
ATOM   2145 C CD1 . PHE B 2 62  ? 29.529  25.805  32.395  1.00 23.63  ? 62   PHE L CD1 1 
ATOM   2146 C CD2 . PHE B 2 62  ? 31.699  25.500  31.402  1.00 24.26  ? 62   PHE L CD2 1 
ATOM   2147 C CE1 . PHE B 2 62  ? 28.930  25.537  31.158  1.00 23.18  ? 62   PHE L CE1 1 
ATOM   2148 C CE2 . PHE B 2 62  ? 31.119  25.254  30.158  1.00 24.75  ? 62   PHE L CE2 1 
ATOM   2149 C CZ  . PHE B 2 62  ? 29.723  25.261  30.046  1.00 23.57  ? 62   PHE L CZ  1 
ATOM   2150 N N   . SER B 2 63  ? 31.089  28.106  36.405  1.00 23.50  ? 63   SER L N   1 
ATOM   2151 C CA  . SER B 2 63  ? 31.238  28.176  37.877  1.00 23.83  ? 63   SER L CA  1 
ATOM   2152 C C   . SER B 2 63  ? 29.881  27.927  38.531  1.00 23.61  ? 63   SER L C   1 
ATOM   2153 O O   . SER B 2 63  ? 28.845  28.126  37.892  1.00 22.85  ? 63   SER L O   1 
ATOM   2154 C CB  . SER B 2 63  ? 31.830  29.522  38.316  1.00 24.80  ? 63   SER L CB  1 
ATOM   2155 O OG  . SER B 2 63  ? 30.937  30.596  38.066  1.00 25.17  ? 63   SER L OG  1 
ATOM   2156 N N   . GLY B 2 64  ? 29.896  27.467  39.780  1.00 23.41  ? 64   GLY L N   1 
ATOM   2157 C CA  . GLY B 2 64  ? 28.680  27.289  40.552  1.00 24.26  ? 64   GLY L CA  1 
ATOM   2158 C C   . GLY B 2 64  ? 28.764  28.041  41.865  1.00 24.32  ? 64   GLY L C   1 
ATOM   2159 O O   . GLY B 2 64  ? 29.856  28.262  42.405  1.00 24.53  ? 64   GLY L O   1 
ATOM   2160 N N   . SER B 2 65  ? 27.606  28.435  42.384  1.00 23.08  ? 65   SER L N   1 
ATOM   2161 C CA  . SER B 2 65  ? 27.535  29.024  43.707  1.00 23.87  ? 65   SER L CA  1 
ATOM   2162 C C   . SER B 2 65  ? 26.170  28.729  44.331  1.00 22.95  ? 65   SER L C   1 
ATOM   2163 O O   . SER B 2 65  ? 25.253  28.241  43.658  1.00 22.94  ? 65   SER L O   1 
ATOM   2164 C CB  . SER B 2 65  ? 27.764  30.540  43.650  1.00 23.99  ? 65   SER L CB  1 
ATOM   2165 O OG  . SER B 2 65  ? 26.743  31.159  42.883  1.00 26.80  ? 65   SER L OG  1 
ATOM   2166 N N   . GLY B 2 66  ? 26.018  29.075  45.599  1.00 22.80  ? 66   GLY L N   1 
ATOM   2167 C CA  . GLY B 2 66  ? 24.717  28.888  46.261  1.00 22.98  ? 66   GLY L CA  1 
ATOM   2168 C C   . GLY B 2 66  ? 24.868  28.333  47.663  1.00 24.26  ? 66   GLY L C   1 
ATOM   2169 O O   . GLY B 2 66  ? 25.983  27.989  48.120  1.00 25.25  ? 66   GLY L O   1 
ATOM   2170 N N   . SER B 2 67  ? 23.739  28.224  48.352  1.00 24.75  ? 67   SER L N   1 
ATOM   2171 C CA  . SER B 2 67  ? 23.676  27.700  49.709  1.00 26.02  ? 67   SER L CA  1 
ATOM   2172 C C   . SER B 2 67  ? 22.176  27.657  49.995  1.00 26.17  ? 67   SER L C   1 
ATOM   2173 O O   . SER B 2 67  ? 21.392  28.173  49.196  1.00 25.26  ? 67   SER L O   1 
ATOM   2174 C CB  . SER B 2 67  ? 24.403  28.607  50.706  1.00 26.60  ? 67   SER L CB  1 
ATOM   2175 O OG  . SER B 2 67  ? 23.761  29.880  50.801  1.00 27.21  ? 67   SER L OG  1 
ATOM   2176 N N   . GLY B 2 68  ? 21.783  27.034  51.100  1.00 27.09  ? 68   GLY L N   1 
ATOM   2177 C CA  . GLY B 2 68  ? 20.367  26.940  51.485  1.00 28.73  ? 68   GLY L CA  1 
ATOM   2178 C C   . GLY B 2 68  ? 19.541  26.266  50.392  1.00 28.08  ? 68   GLY L C   1 
ATOM   2179 O O   . GLY B 2 68  ? 19.792  25.090  50.035  1.00 27.56  ? 68   GLY L O   1 
ATOM   2180 N N   . THR B 2 69  ? 18.590  27.029  49.860  1.00 27.46  ? 69   THR L N   1 
ATOM   2181 C CA  . THR B 2 69  ? 17.648  26.545  48.861  1.00 28.09  ? 69   THR L CA  1 
ATOM   2182 C C   . THR B 2 69  ? 17.857  27.151  47.467  1.00 28.24  ? 69   THR L C   1 
ATOM   2183 O O   . THR B 2 69  ? 17.048  26.905  46.564  1.00 30.11  ? 69   THR L O   1 
ATOM   2184 C CB  . THR B 2 69  ? 16.194  26.803  49.304  1.00 28.24  ? 69   THR L CB  1 
ATOM   2185 O OG1 . THR B 2 69  ? 16.005  28.212  49.463  1.00 27.42  ? 69   THR L OG1 1 
ATOM   2186 C CG2 . THR B 2 69  ? 15.872  26.084  50.622  1.00 29.67  ? 69   THR L CG2 1 
ATOM   2187 N N   . GLN B 2 70  ? 18.928  27.933  47.273  1.00 28.31  ? 70   GLN L N   1 
ATOM   2188 C CA  . GLN B 2 70  ? 19.163  28.564  45.968  1.00 27.90  ? 70   GLN L CA  1 
ATOM   2189 C C   . GLN B 2 70  ? 20.597  28.405  45.457  1.00 25.65  ? 70   GLN L C   1 
ATOM   2190 O O   . GLN B 2 70  ? 21.552  28.802  46.127  1.00 24.38  ? 70   GLN L O   1 
ATOM   2191 C CB  . GLN B 2 70  ? 18.746  30.050  45.962  1.00 31.15  ? 70   GLN L CB  1 
ATOM   2192 C CG  . GLN B 2 70  ? 18.998  30.702  44.596  1.00 35.84  ? 70   GLN L CG  1 
ATOM   2193 C CD  . GLN B 2 70  ? 18.009  31.784  44.197  1.00 41.40  ? 70   GLN L CD  1 
ATOM   2194 O OE1 . GLN B 2 70  ? 16.774  31.605  44.280  1.00 43.71  ? 70   GLN L OE1 1 
ATOM   2195 N NE2 . GLN B 2 70  ? 18.544  32.904  43.706  1.00 42.08  ? 70   GLN L NE2 1 
ATOM   2196 N N   . TYR B 2 71  ? 20.721  27.852  44.251  1.00 24.44  ? 71   TYR L N   1 
ATOM   2197 C CA  . TYR B 2 71  ? 22.031  27.541  43.629  1.00 22.98  ? 71   TYR L CA  1 
ATOM   2198 C C   . TYR B 2 71  ? 22.018  28.031  42.200  1.00 23.29  ? 71   TYR L C   1 
ATOM   2199 O O   . TYR B 2 71  ? 20.956  28.112  41.572  1.00 23.40  ? 71   TYR L O   1 
ATOM   2200 C CB  . TYR B 2 71  ? 22.320  26.017  43.704  1.00 22.74  ? 71   TYR L CB  1 
ATOM   2201 C CG  . TYR B 2 71  ? 22.311  25.535  45.132  1.00 23.35  ? 71   TYR L CG  1 
ATOM   2202 C CD1 . TYR B 2 71  ? 21.106  25.223  45.781  1.00 24.14  ? 71   TYR L CD1 1 
ATOM   2203 C CD2 . TYR B 2 71  ? 23.497  25.478  45.878  1.00 23.34  ? 71   TYR L CD2 1 
ATOM   2204 C CE1 . TYR B 2 71  ? 21.090  24.842  47.117  1.00 24.82  ? 71   TYR L CE1 1 
ATOM   2205 C CE2 . TYR B 2 71  ? 23.491  25.087  47.199  1.00 24.04  ? 71   TYR L CE2 1 
ATOM   2206 C CZ  . TYR B 2 71  ? 22.298  24.775  47.822  1.00 24.83  ? 71   TYR L CZ  1 
ATOM   2207 O OH  . TYR B 2 71  ? 22.298  24.393  49.145  1.00 26.42  ? 71   TYR L OH  1 
ATOM   2208 N N   . SER B 2 72  ? 23.198  28.345  41.672  1.00 23.04  ? 72   SER L N   1 
ATOM   2209 C CA  . SER B 2 72  ? 23.309  28.950  40.351  1.00 23.55  ? 72   SER L CA  1 
ATOM   2210 C C   . SER B 2 72  ? 24.476  28.350  39.624  1.00 22.23  ? 72   SER L C   1 
ATOM   2211 O O   . SER B 2 72  ? 25.490  27.994  40.244  1.00 22.66  ? 72   SER L O   1 
ATOM   2212 C CB  . SER B 2 72  ? 23.549  30.469  40.488  1.00 24.92  ? 72   SER L CB  1 
ATOM   2213 O OG  . SER B 2 72  ? 22.400  31.087  41.073  1.00 33.01  ? 72   SER L OG  1 
ATOM   2214 N N   . LEU B 2 73  ? 24.332  28.255  38.320  1.00 21.87  ? 73   LEU L N   1 
ATOM   2215 C CA  . LEU B 2 73  ? 25.412  27.883  37.438  1.00 22.07  ? 73   LEU L CA  1 
ATOM   2216 C C   . LEU B 2 73  ? 25.661  29.119  36.598  1.00 22.54  ? 73   LEU L C   1 
ATOM   2217 O O   . LEU B 2 73  ? 24.718  29.728  36.078  1.00 23.22  ? 73   LEU L O   1 
ATOM   2218 C CB  . LEU B 2 73  ? 25.037  26.676  36.544  1.00 22.17  ? 73   LEU L CB  1 
ATOM   2219 C CG  . LEU B 2 73  ? 26.088  26.232  35.510  1.00 21.69  ? 73   LEU L CG  1 
ATOM   2220 C CD1 . LEU B 2 73  ? 27.260  25.483  36.162  1.00 23.04  ? 73   LEU L CD1 1 
ATOM   2221 C CD2 . LEU B 2 73  ? 25.450  25.342  34.465  1.00 23.67  ? 73   LEU L CD2 1 
ATOM   2222 N N   . LYS B 2 74  ? 26.923  29.498  36.459  1.00 22.87  ? 74   LYS L N   1 
ATOM   2223 C CA  . LYS B 2 74  ? 27.269  30.668  35.664  1.00 23.39  ? 74   LYS L CA  1 
ATOM   2224 C C   . LYS B 2 74  ? 28.268  30.334  34.552  1.00 23.44  ? 74   LYS L C   1 
ATOM   2225 O O   . LYS B 2 74  ? 29.274  29.668  34.780  1.00 23.45  ? 74   LYS L O   1 
ATOM   2226 C CB  . LYS B 2 74  ? 27.863  31.769  36.581  1.00 25.74  ? 74   LYS L CB  1 
ATOM   2227 C CG  . LYS B 2 74  ? 28.271  33.046  35.835  1.00 28.23  ? 74   LYS L CG  1 
ATOM   2228 C CD  . LYS B 2 74  ? 28.557  34.220  36.767  1.00 33.53  ? 74   LYS L CD  1 
ATOM   2229 C CE  . LYS B 2 74  ? 30.013  34.240  37.214  1.00 38.28  ? 74   LYS L CE  1 
ATOM   2230 N NZ  . LYS B 2 74  ? 30.608  35.619  37.177  1.00 45.02  ? 74   LYS L NZ  1 
ATOM   2231 N N   . ILE B 2 75  ? 27.995  30.847  33.357  1.00 23.87  ? 75   ILE L N   1 
ATOM   2232 C CA  . ILE B 2 75  ? 28.923  30.746  32.242  1.00 24.28  ? 75   ILE L CA  1 
ATOM   2233 C C   . ILE B 2 75  ? 29.350  32.161  31.879  1.00 26.23  ? 75   ILE L C   1 
ATOM   2234 O O   . ILE B 2 75  ? 28.505  32.975  31.506  1.00 25.45  ? 75   ILE L O   1 
ATOM   2235 C CB  . ILE B 2 75  ? 28.258  30.076  31.023  1.00 24.87  ? 75   ILE L CB  1 
ATOM   2236 C CG1 . ILE B 2 75  ? 27.523  28.801  31.463  1.00 25.47  ? 75   ILE L CG1 1 
ATOM   2237 C CG2 . ILE B 2 75  ? 29.284  29.823  29.920  1.00 24.31  ? 75   ILE L CG2 1 
ATOM   2238 C CD1 . ILE B 2 75  ? 26.594  28.208  30.414  1.00 26.56  ? 75   ILE L CD1 1 
ATOM   2239 N N   . ASN B 2 76  ? 30.646  32.440  32.041  1.00 28.74  ? 76   ASN L N   1 
ATOM   2240 C CA  . ASN B 2 76  ? 31.294  33.657  31.563  1.00 34.64  ? 76   ASN L CA  1 
ATOM   2241 C C   . ASN B 2 76  ? 31.617  33.471  30.090  1.00 35.18  ? 76   ASN L C   1 
ATOM   2242 O O   . ASN B 2 76  ? 31.897  32.359  29.655  1.00 37.14  ? 76   ASN L O   1 
ATOM   2243 C CB  . ASN B 2 76  ? 32.617  33.850  32.283  1.00 38.43  ? 76   ASN L CB  1 
ATOM   2244 C CG  . ASN B 2 76  ? 32.454  34.541  33.584  1.00 42.01  ? 76   ASN L CG  1 
ATOM   2245 O OD1 . ASN B 2 76  ? 32.340  33.897  34.620  1.00 46.28  ? 76   ASN L OD1 1 
ATOM   2246 N ND2 . ASN B 2 76  ? 32.423  35.871  33.551  1.00 46.93  ? 76   ASN L ND2 1 
ATOM   2247 N N   . SER B 2 77  ? 31.595  34.556  29.332  1.00 38.88  ? 77   SER L N   1 
ATOM   2248 C CA  . SER B 2 77  ? 31.792  34.506  27.882  1.00 37.44  ? 77   SER L CA  1 
ATOM   2249 C C   . SER B 2 77  ? 31.241  33.218  27.251  1.00 34.57  ? 77   SER L C   1 
ATOM   2250 O O   . SER B 2 77  ? 31.976  32.294  26.886  1.00 35.77  ? 77   SER L O   1 
ATOM   2251 C CB  . SER B 2 77  ? 33.251  34.780  27.500  1.00 44.81  ? 77   SER L CB  1 
ATOM   2252 O OG  . SER B 2 77  ? 33.991  33.575  27.366  1.00 50.26  ? 77   SER L OG  1 
ATOM   2253 N N   . LEU B 2 78  ? 29.921  33.160  27.174  1.00 30.26  ? 78   LEU L N   1 
ATOM   2254 C CA  . LEU B 2 78  ? 29.207  32.092  26.483  1.00 29.25  ? 78   LEU L CA  1 
ATOM   2255 C C   . LEU B 2 78  ? 29.775  31.803  25.079  1.00 28.03  ? 78   LEU L C   1 
ATOM   2256 O O   . LEU B 2 78  ? 30.040  32.719  24.298  1.00 28.18  ? 78   LEU L O   1 
ATOM   2257 C CB  . LEU B 2 78  ? 27.724  32.481  26.373  1.00 28.92  ? 78   LEU L CB  1 
ATOM   2258 C CG  . LEU B 2 78  ? 26.805  31.487  25.699  1.00 30.05  ? 78   LEU L CG  1 
ATOM   2259 C CD1 . LEU B 2 78  ? 26.555  30.365  26.708  1.00 28.70  ? 78   LEU L CD1 1 
ATOM   2260 C CD2 . LEU B 2 78  ? 25.506  32.180  25.324  1.00 31.36  ? 78   LEU L CD2 1 
ATOM   2261 N N   . GLN B 2 79  ? 29.950  30.517  24.773  1.00 27.25  ? 79   GLN L N   1 
ATOM   2262 C CA  . GLN B 2 79  ? 30.467  30.071  23.472  1.00 28.15  ? 79   GLN L CA  1 
ATOM   2263 C C   . GLN B 2 79  ? 29.421  29.229  22.775  1.00 28.01  ? 79   GLN L C   1 
ATOM   2264 O O   . GLN B 2 79  ? 28.549  28.655  23.430  1.00 27.65  ? 79   GLN L O   1 
ATOM   2265 C CB  . GLN B 2 79  ? 31.776  29.291  23.652  1.00 28.49  ? 79   GLN L CB  1 
ATOM   2266 C CG  . GLN B 2 79  ? 32.878  30.120  24.306  1.00 28.66  ? 79   GLN L CG  1 
ATOM   2267 C CD  . GLN B 2 79  ? 33.237  31.341  23.496  1.00 30.49  ? 79   GLN L CD  1 
ATOM   2268 O OE1 . GLN B 2 79  ? 33.469  31.244  22.295  1.00 34.09  ? 79   GLN L OE1 1 
ATOM   2269 N NE2 . GLN B 2 79  ? 33.268  32.513  24.146  1.00 30.51  ? 79   GLN L NE2 1 
ATOM   2270 N N   . SER B 2 80  ? 29.468  29.170  21.444  1.00 28.49  ? 80   SER L N   1 
ATOM   2271 C CA  . SER B 2 80  ? 28.457  28.417  20.700  1.00 29.68  ? 80   SER L CA  1 
ATOM   2272 C C   . SER B 2 80  ? 28.376  26.922  21.127  1.00 29.09  ? 80   SER L C   1 
ATOM   2273 O O   . SER B 2 80  ? 27.281  26.371  21.134  1.00 29.97  ? 80   SER L O   1 
ATOM   2274 C CB  . SER B 2 80  ? 28.659  28.551  19.192  1.00 31.92  ? 80   SER L CB  1 
ATOM   2275 O OG  . SER B 2 80  ? 29.890  27.955  18.852  1.00 33.67  ? 80   SER L OG  1 
ATOM   2276 N N   . GLU B 2 81  ? 29.485  26.290  21.556  1.00 27.52  ? 81   GLU L N   1 
ATOM   2277 C CA  . GLU B 2 81  ? 29.409  24.880  22.025  1.00 26.95  ? 81   GLU L CA  1 
ATOM   2278 C C   . GLU B 2 81  ? 28.689  24.737  23.361  1.00 25.65  ? 81   GLU L C   1 
ATOM   2279 O O   . GLU B 2 81  ? 28.452  23.627  23.820  1.00 25.36  ? 81   GLU L O   1 
ATOM   2280 C CB  . GLU B 2 81  ? 30.779  24.193  22.124  1.00 27.83  ? 81   GLU L CB  1 
ATOM   2281 C CG  . GLU B 2 81  ? 31.693  24.726  23.230  1.00 27.56  ? 81   GLU L CG  1 
ATOM   2282 C CD  . GLU B 2 81  ? 32.603  25.860  22.760  1.00 28.52  ? 81   GLU L CD  1 
ATOM   2283 O OE1 . GLU B 2 81  ? 32.293  26.542  21.753  1.00 28.74  ? 81   GLU L OE1 1 
ATOM   2284 O OE2 . GLU B 2 81  ? 33.659  26.064  23.387  1.00 29.98  ? 81   GLU L OE2 1 
ATOM   2285 N N   . ASP B 2 82  ? 28.361  25.859  23.993  1.00 25.04  ? 82   ASP L N   1 
ATOM   2286 C CA  . ASP B 2 82  ? 27.599  25.839  25.242  1.00 24.13  ? 82   ASP L CA  1 
ATOM   2287 C C   . ASP B 2 82  ? 26.070  25.659  25.014  1.00 24.21  ? 82   ASP L C   1 
ATOM   2288 O O   . ASP B 2 82  ? 25.335  25.442  25.971  1.00 24.22  ? 82   ASP L O   1 
ATOM   2289 C CB  . ASP B 2 82  ? 27.882  27.096  26.078  1.00 23.97  ? 82   ASP L CB  1 
ATOM   2290 C CG  . ASP B 2 82  ? 29.363  27.271  26.427  1.00 24.78  ? 82   ASP L CG  1 
ATOM   2291 O OD1 . ASP B 2 82  ? 30.120  26.279  26.468  1.00 24.46  ? 82   ASP L OD1 1 
ATOM   2292 O OD2 . ASP B 2 82  ? 29.774  28.419  26.693  1.00 25.29  ? 82   ASP L OD2 1 
ATOM   2293 N N   . VAL B 2 83  ? 25.618  25.731  23.762  1.00 25.04  ? 83   VAL L N   1 
ATOM   2294 C CA  . VAL B 2 83  ? 24.228  25.400  23.389  1.00 25.53  ? 83   VAL L CA  1 
ATOM   2295 C C   . VAL B 2 83  ? 23.909  23.930  23.789  1.00 25.89  ? 83   VAL L C   1 
ATOM   2296 O O   . VAL B 2 83  ? 24.444  22.987  23.205  1.00 26.62  ? 83   VAL L O   1 
ATOM   2297 C CB  . VAL B 2 83  ? 23.997  25.621  21.882  1.00 26.84  ? 83   VAL L CB  1 
ATOM   2298 C CG1 . VAL B 2 83  ? 22.640  25.075  21.443  1.00 27.27  ? 83   VAL L CG1 1 
ATOM   2299 C CG2 . VAL B 2 83  ? 24.099  27.111  21.562  1.00 27.13  ? 83   VAL L CG2 1 
ATOM   2300 N N   . ALA B 2 84  ? 23.026  23.770  24.765  1.00 25.22  ? 84   ALA L N   1 
ATOM   2301 C CA  . ALA B 2 84  ? 22.763  22.480  25.440  1.00 26.88  ? 84   ALA L CA  1 
ATOM   2302 C C   . ALA B 2 84  ? 21.641  22.689  26.454  1.00 27.09  ? 84   ALA L C   1 
ATOM   2303 O O   . ALA B 2 84  ? 21.199  23.820  26.677  1.00 27.00  ? 84   ALA L O   1 
ATOM   2304 C CB  . ALA B 2 84  ? 24.018  21.981  26.176  1.00 25.35  ? 84   ALA L CB  1 
ATOM   2305 N N   . ARG B 2 85  ? 21.200  21.591  27.081  1.00 29.05  ? 85   ARG L N   1 
ATOM   2306 C CA  . ARG B 2 85  ? 20.285  21.645  28.214  1.00 29.61  ? 85   ARG L CA  1 
ATOM   2307 C C   . ARG B 2 85  ? 21.150  21.432  29.446  1.00 27.74  ? 85   ARG L C   1 
ATOM   2308 O O   . ARG B 2 85  ? 22.115  20.665  29.398  1.00 28.61  ? 85   ARG L O   1 
ATOM   2309 C CB  . ARG B 2 85  ? 19.215  20.555  28.128  1.00 33.95  ? 85   ARG L CB  1 
ATOM   2310 C CG  . ARG B 2 85  ? 18.165  20.794  27.054  1.00 40.76  ? 85   ARG L CG  1 
ATOM   2311 C CD  . ARG B 2 85  ? 17.033  19.767  27.089  1.00 45.13  ? 85   ARG L CD  1 
ATOM   2312 N NE  . ARG B 2 85  ? 16.248  19.860  28.328  1.00 48.02  ? 85   ARG L NE  1 
ATOM   2313 C CZ  . ARG B 2 85  ? 15.284  20.757  28.557  1.00 50.68  ? 85   ARG L CZ  1 
ATOM   2314 N NH1 . ARG B 2 85  ? 14.970  21.664  27.639  1.00 51.64  ? 85   ARG L NH1 1 
ATOM   2315 N NH2 . ARG B 2 85  ? 14.629  20.750  29.717  1.00 51.12  ? 85   ARG L NH2 1 
ATOM   2316 N N   . TYR B 2 86  ? 20.839  22.162  30.513  1.00 25.56  ? 86   TYR L N   1 
ATOM   2317 C CA  . TYR B 2 86  ? 21.566  22.108  31.783  1.00 23.60  ? 86   TYR L CA  1 
ATOM   2318 C C   . TYR B 2 86  ? 20.614  21.617  32.866  1.00 24.22  ? 86   TYR L C   1 
ATOM   2319 O O   . TYR B 2 86  ? 19.458  22.045  32.904  1.00 24.74  ? 86   TYR L O   1 
ATOM   2320 C CB  . TYR B 2 86  ? 22.128  23.510  32.127  1.00 22.80  ? 86   TYR L CB  1 
ATOM   2321 C CG  . TYR B 2 86  ? 23.195  23.905  31.126  1.00 21.61  ? 86   TYR L CG  1 
ATOM   2322 C CD1 . TYR B 2 86  ? 22.868  24.479  29.885  1.00 21.68  ? 86   TYR L CD1 1 
ATOM   2323 C CD2 . TYR B 2 86  ? 24.531  23.625  31.391  1.00 21.11  ? 86   TYR L CD2 1 
ATOM   2324 C CE1 . TYR B 2 86  ? 23.857  24.790  28.957  1.00 22.24  ? 86   TYR L CE1 1 
ATOM   2325 C CE2 . TYR B 2 86  ? 25.520  23.947  30.482  1.00 21.01  ? 86   TYR L CE2 1 
ATOM   2326 C CZ  . TYR B 2 86  ? 25.184  24.518  29.276  1.00 21.63  ? 86   TYR L CZ  1 
ATOM   2327 O OH  . TYR B 2 86  ? 26.197  24.805  28.394  1.00 22.85  ? 86   TYR L OH  1 
ATOM   2328 N N   . TYR B 2 87  ? 21.092  20.705  33.710  1.00 23.71  ? 87   TYR L N   1 
ATOM   2329 C CA  . TYR B 2 87  ? 20.282  20.137  34.793  1.00 24.06  ? 87   TYR L CA  1 
ATOM   2330 C C   . TYR B 2 87  ? 21.028  20.261  36.109  1.00 23.59  ? 87   TYR L C   1 
ATOM   2331 O O   . TYR B 2 87  ? 22.257  20.033  36.167  1.00 23.51  ? 87   TYR L O   1 
ATOM   2332 C CB  . TYR B 2 87  ? 20.039  18.650  34.561  1.00 25.27  ? 87   TYR L CB  1 
ATOM   2333 C CG  . TYR B 2 87  ? 19.255  18.295  33.335  1.00 26.42  ? 87   TYR L CG  1 
ATOM   2334 C CD1 . TYR B 2 87  ? 17.862  18.171  33.390  1.00 27.99  ? 87   TYR L CD1 1 
ATOM   2335 C CD2 . TYR B 2 87  ? 19.908  18.028  32.130  1.00 27.14  ? 87   TYR L CD2 1 
ATOM   2336 C CE1 . TYR B 2 87  ? 17.132  17.810  32.268  1.00 29.46  ? 87   TYR L CE1 1 
ATOM   2337 C CE2 . TYR B 2 87  ? 19.193  17.675  30.994  1.00 29.13  ? 87   TYR L CE2 1 
ATOM   2338 C CZ  . TYR B 2 87  ? 17.807  17.556  31.079  1.00 30.22  ? 87   TYR L CZ  1 
ATOM   2339 O OH  . TYR B 2 87  ? 17.098  17.209  29.956  1.00 32.70  ? 87   TYR L OH  1 
ATOM   2340 N N   . CYS B 2 88  ? 20.290  20.591  37.164  1.00 23.57  ? 88   CYS L N   1 
ATOM   2341 C CA  . CYS B 2 88  ? 20.789  20.446  38.530  1.00 24.67  ? 88   CYS L CA  1 
ATOM   2342 C C   . CYS B 2 88  ? 20.279  19.122  39.135  1.00 25.99  ? 88   CYS L C   1 
ATOM   2343 O O   . CYS B 2 88  ? 19.236  18.612  38.735  1.00 26.05  ? 88   CYS L O   1 
ATOM   2344 C CB  . CYS B 2 88  ? 20.385  21.637  39.433  1.00 25.78  ? 88   CYS L CB  1 
ATOM   2345 S SG  . CYS B 2 88  ? 18.596  21.961  39.595  1.00 29.40  ? 88   CYS L SG  1 
ATOM   2346 N N   . GLN B 2 89  ? 21.034  18.584  40.083  1.00 26.84  ? 89   GLN L N   1 
ATOM   2347 C CA  . GLN B 2 89  ? 20.658  17.360  40.815  1.00 28.04  ? 89   GLN L CA  1 
ATOM   2348 C C   . GLN B 2 89  ? 21.074  17.510  42.280  1.00 28.99  ? 89   GLN L C   1 
ATOM   2349 O O   . GLN B 2 89  ? 22.195  17.908  42.575  1.00 27.94  ? 89   GLN L O   1 
ATOM   2350 C CB  . GLN B 2 89  ? 21.354  16.145  40.185  1.00 28.97  ? 89   GLN L CB  1 
ATOM   2351 C CG  . GLN B 2 89  ? 21.106  14.807  40.888  1.00 32.07  ? 89   GLN L CG  1 
ATOM   2352 C CD  . GLN B 2 89  ? 22.386  14.017  41.108  1.00 34.12  ? 89   GLN L CD  1 
ATOM   2353 O OE1 . GLN B 2 89  ? 23.379  14.174  40.380  1.00 35.31  ? 89   GLN L OE1 1 
ATOM   2354 N NE2 . GLN B 2 89  ? 22.381  13.160  42.137  1.00 36.21  ? 89   GLN L NE2 1 
ATOM   2355 N N   . HIS B 2 90  ? 20.183  17.180  43.211  1.00 30.38  ? 90   HIS L N   1 
ATOM   2356 C CA  . HIS B 2 90  ? 20.600  17.123  44.614  1.00 32.58  ? 90   HIS L CA  1 
ATOM   2357 C C   . HIS B 2 90  ? 21.057  15.695  44.996  1.00 34.37  ? 90   HIS L C   1 
ATOM   2358 O O   . HIS B 2 90  ? 20.642  14.697  44.379  1.00 34.92  ? 90   HIS L O   1 
ATOM   2359 C CB  . HIS B 2 90  ? 19.475  17.594  45.556  1.00 33.92  ? 90   HIS L CB  1 
ATOM   2360 C CG  . HIS B 2 90  ? 18.584  16.483  46.017  1.00 36.96  ? 90   HIS L CG  1 
ATOM   2361 N ND1 . HIS B 2 90  ? 17.420  16.138  45.365  1.00 38.20  ? 90   HIS L ND1 1 
ATOM   2362 C CD2 . HIS B 2 90  ? 18.715  15.607  47.040  1.00 37.78  ? 90   HIS L CD2 1 
ATOM   2363 C CE1 . HIS B 2 90  ? 16.861  15.112  45.981  1.00 39.06  ? 90   HIS L CE1 1 
ATOM   2364 N NE2 . HIS B 2 90  ? 17.638  14.759  46.988  1.00 40.59  ? 90   HIS L NE2 1 
ATOM   2365 N N   . TYR B 2 91  ? 21.935  15.617  45.988  1.00 34.89  ? 91   TYR L N   1 
ATOM   2366 C CA  . TYR B 2 91  ? 22.208  14.343  46.655  1.00 38.53  ? 91   TYR L CA  1 
ATOM   2367 C C   . TYR B 2 91  ? 22.174  14.476  48.196  1.00 39.51  ? 91   TYR L C   1 
ATOM   2368 O O   . TYR B 2 91  ? 23.102  14.060  48.910  1.00 40.08  ? 91   TYR L O   1 
ATOM   2369 C CB  . TYR B 2 91  ? 23.491  13.667  46.122  1.00 38.78  ? 91   TYR L CB  1 
ATOM   2370 C CG  . TYR B 2 91  ? 24.703  14.572  45.947  1.00 39.21  ? 91   TYR L CG  1 
ATOM   2371 C CD1 . TYR B 2 91  ? 24.921  15.278  44.749  1.00 36.99  ? 91   TYR L CD1 1 
ATOM   2372 C CD2 . TYR B 2 91  ? 25.659  14.695  46.967  1.00 39.44  ? 91   TYR L CD2 1 
ATOM   2373 C CE1 . TYR B 2 91  ? 26.041  16.084  44.590  1.00 36.81  ? 91   TYR L CE1 1 
ATOM   2374 C CE2 . TYR B 2 91  ? 26.772  15.516  46.818  1.00 38.91  ? 91   TYR L CE2 1 
ATOM   2375 C CZ  . TYR B 2 91  ? 26.966  16.202  45.623  1.00 37.62  ? 91   TYR L CZ  1 
ATOM   2376 O OH  . TYR B 2 91  ? 28.081  17.012  45.471  1.00 36.68  ? 91   TYR L OH  1 
ATOM   2377 N N   . SER B 2 92  ? 21.072  15.042  48.696  1.00 41.46  ? 92   SER L N   1 
ATOM   2378 C CA  . SER B 2 92  ? 20.931  15.358  50.118  1.00 43.12  ? 92   SER L CA  1 
ATOM   2379 C C   . SER B 2 92  ? 20.267  14.241  50.937  1.00 47.30  ? 92   SER L C   1 
ATOM   2380 O O   . SER B 2 92  ? 20.875  13.705  51.874  1.00 49.48  ? 92   SER L O   1 
ATOM   2381 C CB  . SER B 2 92  ? 20.191  16.681  50.318  1.00 42.01  ? 92   SER L CB  1 
ATOM   2382 O OG  . SER B 2 92  ? 20.213  17.032  51.708  1.00 43.96  ? 92   SER L OG  1 
ATOM   2383 N N   . THR B 2 93  ? 19.017  13.916  50.604  1.00 49.05  ? 93   THR L N   1 
ATOM   2384 C CA  . THR B 2 93  ? 18.331  12.749  51.156  1.00 52.12  ? 93   THR L CA  1 
ATOM   2385 C C   . THR B 2 93  ? 17.771  11.978  49.969  1.00 52.64  ? 93   THR L C   1 
ATOM   2386 O O   . THR B 2 93  ? 17.414  12.590  48.958  1.00 53.08  ? 93   THR L O   1 
ATOM   2387 C CB  . THR B 2 93  ? 17.151  13.132  52.090  1.00 54.27  ? 93   THR L CB  1 
ATOM   2388 O OG1 . THR B 2 93  ? 16.176  13.872  51.346  1.00 54.28  ? 93   THR L OG1 1 
ATOM   2389 C CG2 . THR B 2 93  ? 17.617  13.971  53.278  1.00 53.37  ? 93   THR L CG2 1 
ATOM   2390 N N   . THR B 2 94  ? 17.690  10.649  50.074  1.00 52.99  ? 94   THR L N   1 
ATOM   2391 C CA  . THR B 2 94  ? 17.104  9.838   48.994  1.00 51.21  ? 94   THR L CA  1 
ATOM   2392 C C   . THR B 2 94  ? 15.600  10.107  48.891  1.00 50.38  ? 94   THR L C   1 
ATOM   2393 O O   . THR B 2 94  ? 14.961  10.419  49.895  1.00 50.85  ? 94   THR L O   1 
ATOM   2394 C CB  . THR B 2 94  ? 17.389  8.332   49.161  1.00 52.93  ? 94   THR L CB  1 
ATOM   2395 O OG1 . THR B 2 94  ? 17.216  7.959   50.534  1.00 56.36  ? 94   THR L OG1 1 
ATOM   2396 C CG2 . THR B 2 94  ? 18.817  8.004   48.714  1.00 53.24  ? 94   THR L CG2 1 
ATOM   2397 N N   . PRO B 2 95  ? 15.031  10.044  47.667  1.00 49.23  ? 95   PRO L N   1 
ATOM   2398 C CA  . PRO B 2 95  ? 15.679  9.766   46.394  1.00 47.14  ? 95   PRO L CA  1 
ATOM   2399 C C   . PRO B 2 95  ? 16.292  11.018  45.771  1.00 44.57  ? 95   PRO L C   1 
ATOM   2400 O O   . PRO B 2 95  ? 15.733  12.107  45.882  1.00 42.81  ? 95   PRO L O   1 
ATOM   2401 C CB  . PRO B 2 95  ? 14.522  9.254   45.537  1.00 47.83  ? 95   PRO L CB  1 
ATOM   2402 C CG  . PRO B 2 95  ? 13.349  10.024  46.028  1.00 47.81  ? 95   PRO L CG  1 
ATOM   2403 C CD  . PRO B 2 95  ? 13.576  10.236  47.502  1.00 49.71  ? 95   PRO L CD  1 
ATOM   2404 N N   . TRP B 2 96  ? 17.443  10.853  45.132  1.00 44.70  ? 96   TRP L N   1 
ATOM   2405 C CA  . TRP B 2 96  ? 18.075  11.949  44.405  1.00 43.19  ? 96   TRP L CA  1 
ATOM   2406 C C   . TRP B 2 96  ? 17.122  12.355  43.274  1.00 41.61  ? 96   TRP L C   1 
ATOM   2407 O O   . TRP B 2 96  ? 16.516  11.486  42.618  1.00 42.02  ? 96   TRP L O   1 
ATOM   2408 C CB  . TRP B 2 96  ? 19.497  11.536  43.962  1.00 45.74  ? 96   TRP L CB  1 
ATOM   2409 C CG  . TRP B 2 96  ? 20.339  11.056  45.180  1.00 52.48  ? 96   TRP L CG  1 
ATOM   2410 C CD1 . TRP B 2 96  ? 20.120  11.381  46.505  1.00 53.70  ? 96   TRP L CD1 1 
ATOM   2411 C CD2 . TRP B 2 96  ? 21.498  10.197  45.177  1.00 55.59  ? 96   TRP L CD2 1 
ATOM   2412 N NE1 . TRP B 2 96  ? 21.058  10.781  47.309  1.00 59.05  ? 96   TRP L NE1 1 
ATOM   2413 C CE2 . TRP B 2 96  ? 21.917  10.051  46.526  1.00 58.20  ? 96   TRP L CE2 1 
ATOM   2414 C CE3 . TRP B 2 96  ? 22.227  9.541   44.170  1.00 56.62  ? 96   TRP L CE3 1 
ATOM   2415 C CZ2 . TRP B 2 96  ? 23.032  9.266   46.893  1.00 59.38  ? 96   TRP L CZ2 1 
ATOM   2416 C CZ3 . TRP B 2 96  ? 23.343  8.753   44.546  1.00 57.99  ? 96   TRP L CZ3 1 
ATOM   2417 C CH2 . TRP B 2 96  ? 23.721  8.627   45.891  1.00 58.56  ? 96   TRP L CH2 1 
ATOM   2418 N N   . THR B 2 97  ? 16.900  13.666  43.120  1.00 37.87  ? 97   THR L N   1 
ATOM   2419 C CA  . THR B 2 97  ? 16.025  14.189  42.074  1.00 35.76  ? 97   THR L CA  1 
ATOM   2420 C C   . THR B 2 97  ? 16.757  15.300  41.315  1.00 33.13  ? 97   THR L C   1 
ATOM   2421 O O   . THR B 2 97  ? 17.739  15.856  41.807  1.00 31.60  ? 97   THR L O   1 
ATOM   2422 C CB  . THR B 2 97  ? 14.672  14.737  42.611  1.00 36.66  ? 97   THR L CB  1 
ATOM   2423 O OG1 . THR B 2 97  ? 14.907  15.722  43.622  1.00 36.38  ? 97   THR L OG1 1 
ATOM   2424 C CG2 . THR B 2 97  ? 13.771  13.615  43.197  1.00 38.44  ? 97   THR L CG2 1 
ATOM   2425 N N   . PHE B 2 98  ? 16.248  15.594  40.121  1.00 32.26  ? 98   PHE L N   1 
ATOM   2426 C CA  . PHE B 2 98  ? 16.831  16.539  39.156  1.00 29.94  ? 98   PHE L CA  1 
ATOM   2427 C C   . PHE B 2 98  ? 15.856  17.674  38.868  1.00 29.96  ? 98   PHE L C   1 
ATOM   2428 O O   . PHE B 2 98  ? 14.639  17.482  38.954  1.00 30.72  ? 98   PHE L O   1 
ATOM   2429 C CB  . PHE B 2 98  ? 17.058  15.834  37.819  1.00 29.80  ? 98   PHE L CB  1 
ATOM   2430 C CG  . PHE B 2 98  ? 18.165  14.798  37.818  1.00 30.34  ? 98   PHE L CG  1 
ATOM   2431 C CD1 . PHE B 2 98  ? 17.920  13.477  38.265  1.00 31.15  ? 98   PHE L CD1 1 
ATOM   2432 C CD2 . PHE B 2 98  ? 19.426  15.111  37.302  1.00 28.98  ? 98   PHE L CD2 1 
ATOM   2433 C CE1 . PHE B 2 98  ? 18.923  12.518  38.230  1.00 31.49  ? 98   PHE L CE1 1 
ATOM   2434 C CE2 . PHE B 2 98  ? 20.428  14.150  37.265  1.00 29.41  ? 98   PHE L CE2 1 
ATOM   2435 C CZ  . PHE B 2 98  ? 20.180  12.852  37.744  1.00 30.99  ? 98   PHE L CZ  1 
ATOM   2436 N N   . GLY B 2 99  ? 16.368  18.846  38.489  1.00 28.68  ? 99   GLY L N   1 
ATOM   2437 C CA  . GLY B 2 99  ? 15.502  19.910  37.968  1.00 29.07  ? 99   GLY L CA  1 
ATOM   2438 C C   . GLY B 2 99  ? 14.993  19.557  36.566  1.00 30.28  ? 99   GLY L C   1 
ATOM   2439 O O   . GLY B 2 99  ? 15.453  18.576  35.957  1.00 30.59  ? 99   GLY L O   1 
ATOM   2440 N N   . GLY B 2 100 ? 14.040  20.343  36.051  1.00 30.74  ? 100  GLY L N   1 
ATOM   2441 C CA  . GLY B 2 100 ? 13.423  20.057  34.746  1.00 31.30  ? 100  GLY L CA  1 
ATOM   2442 C C   . GLY B 2 100 ? 14.312  20.395  33.550  1.00 31.11  ? 100  GLY L C   1 
ATOM   2443 O O   . GLY B 2 100 ? 13.956  20.112  32.394  1.00 31.00  ? 100  GLY L O   1 
ATOM   2444 N N   . GLY B 2 101 ? 15.461  21.008  33.815  1.00 29.34  ? 101  GLY L N   1 
ATOM   2445 C CA  . GLY B 2 101 ? 16.365  21.439  32.734  1.00 29.20  ? 101  GLY L CA  1 
ATOM   2446 C C   . GLY B 2 101 ? 16.183  22.887  32.292  1.00 29.30  ? 101  GLY L C   1 
ATOM   2447 O O   . GLY B 2 101 ? 15.075  23.448  32.380  1.00 29.97  ? 101  GLY L O   1 
ATOM   2448 N N   . THR B 2 102 ? 17.278  23.493  31.825  1.00 27.54  ? 102  THR L N   1 
ATOM   2449 C CA  . THR B 2 102 ? 17.252  24.814  31.171  1.00 28.38  ? 102  THR L CA  1 
ATOM   2450 C C   . THR B 2 102 ? 17.936  24.678  29.804  1.00 28.53  ? 102  THR L C   1 
ATOM   2451 O O   . THR B 2 102 ? 19.040  24.148  29.725  1.00 28.02  ? 102  THR L O   1 
ATOM   2452 C CB  . THR B 2 102 ? 18.022  25.864  32.005  1.00 26.51  ? 102  THR L CB  1 
ATOM   2453 O OG1 . THR B 2 102 ? 17.331  26.090  33.239  1.00 27.06  ? 102  THR L OG1 1 
ATOM   2454 C CG2 . THR B 2 102 ? 18.201  27.213  31.240  1.00 26.13  ? 102  THR L CG2 1 
ATOM   2455 N N   . GLN B 2 103 ? 17.300  25.162  28.747  1.00 29.67  ? 103  GLN L N   1 
ATOM   2456 C CA  . GLN B 2 103 ? 17.879  25.105  27.404  1.00 31.19  ? 103  GLN L CA  1 
ATOM   2457 C C   . GLN B 2 103 ? 18.501  26.466  27.053  1.00 31.10  ? 103  GLN L C   1 
ATOM   2458 O O   . GLN B 2 103 ? 17.860  27.501  27.204  1.00 32.00  ? 103  GLN L O   1 
ATOM   2459 C CB  . GLN B 2 103 ? 16.794  24.689  26.383  1.00 34.59  ? 103  GLN L CB  1 
ATOM   2460 C CG  . GLN B 2 103 ? 17.121  24.892  24.901  1.00 37.96  ? 103  GLN L CG  1 
ATOM   2461 C CD  . GLN B 2 103 ? 18.183  23.943  24.333  1.00 40.46  ? 103  GLN L CD  1 
ATOM   2462 O OE1 . GLN B 2 103 ? 18.106  22.720  24.503  1.00 41.71  ? 103  GLN L OE1 1 
ATOM   2463 N NE2 . GLN B 2 103 ? 19.173  24.512  23.622  1.00 40.53  ? 103  GLN L NE2 1 
ATOM   2464 N N   . LEU B 2 104 ? 19.758  26.452  26.623  1.00 29.53  ? 104  LEU L N   1 
ATOM   2465 C CA  . LEU B 2 104 ? 20.442  27.655  26.250  1.00 29.95  ? 104  LEU L CA  1 
ATOM   2466 C C   . LEU B 2 104 ? 20.581  27.709  24.736  1.00 30.17  ? 104  LEU L C   1 
ATOM   2467 O O   . LEU B 2 104 ? 20.913  26.704  24.107  1.00 30.03  ? 104  LEU L O   1 
ATOM   2468 C CB  . LEU B 2 104 ? 21.815  27.700  26.918  1.00 30.37  ? 104  LEU L CB  1 
ATOM   2469 C CG  . LEU B 2 104 ? 22.755  28.900  26.801  1.00 33.16  ? 104  LEU L CG  1 
ATOM   2470 C CD1 . LEU B 2 104 ? 22.090  30.272  26.741  1.00 34.66  ? 104  LEU L CD1 1 
ATOM   2471 C CD2 . LEU B 2 104 ? 23.659  28.821  28.021  1.00 32.41  ? 104  LEU L CD2 1 
ATOM   2472 N N   . GLU B 2 105 ? 20.310  28.882  24.164  1.00 29.70  ? 105  GLU L N   1 
ATOM   2473 C CA  . GLU B 2 105 ? 20.529  29.125  22.743  1.00 30.39  ? 105  GLU L CA  1 
ATOM   2474 C C   . GLU B 2 105 ? 21.431  30.360  22.554  1.00 29.95  ? 105  GLU L C   1 
ATOM   2475 O O   . GLU B 2 105 ? 21.504  31.227  23.417  1.00 28.32  ? 105  GLU L O   1 
ATOM   2476 C CB  . GLU B 2 105 ? 19.194  29.299  21.976  1.00 33.71  ? 105  GLU L CB  1 
ATOM   2477 C CG  . GLU B 2 105 ? 18.576  30.684  22.081  1.00 35.26  ? 105  GLU L CG  1 
ATOM   2478 C CD  . GLU B 2 105 ? 17.851  31.186  20.827  1.00 38.14  ? 105  GLU L CD  1 
ATOM   2479 O OE1 . GLU B 2 105 ? 17.528  30.427  19.893  1.00 38.99  ? 105  GLU L OE1 1 
ATOM   2480 O OE2 . GLU B 2 105 ? 17.579  32.399  20.776  1.00 39.90  ? 105  GLU L OE2 1 
ATOM   2481 N N   . ILE B 2 106 ? 22.123  30.403  21.422  1.00 29.94  ? 106  ILE L N   1 
ATOM   2482 C CA  . ILE B 2 106 ? 22.897  31.560  21.015  1.00 31.56  ? 106  ILE L CA  1 
ATOM   2483 C C   . ILE B 2 106 ? 21.990  32.582  20.311  1.00 33.24  ? 106  ILE L C   1 
ATOM   2484 O O   . ILE B 2 106 ? 21.248  32.257  19.372  1.00 33.80  ? 106  ILE L O   1 
ATOM   2485 C CB  . ILE B 2 106 ? 24.031  31.148  20.035  1.00 33.38  ? 106  ILE L CB  1 
ATOM   2486 C CG1 . ILE B 2 106 ? 25.073  30.294  20.762  1.00 32.65  ? 106  ILE L CG1 1 
ATOM   2487 C CG2 . ILE B 2 106 ? 24.651  32.372  19.355  1.00 34.72  ? 106  ILE L CG2 1 
ATOM   2488 C CD1 . ILE B 2 106 ? 25.696  30.975  21.956  1.00 32.98  ? 106  ILE L CD1 1 
ATOM   2489 N N   . LYS B 2 107 ? 22.068  33.830  20.751  1.00 33.14  ? 107  LYS L N   1 
ATOM   2490 C CA  . LYS B 2 107 ? 21.364  34.890  20.055  1.00 35.88  ? 107  LYS L CA  1 
ATOM   2491 C C   . LYS B 2 107 ? 22.262  35.405  18.939  1.00 36.39  ? 107  LYS L C   1 
ATOM   2492 O O   . LYS B 2 107 ? 23.421  35.726  19.188  1.00 36.30  ? 107  LYS L O   1 
ATOM   2493 C CB  . LYS B 2 107 ? 21.021  36.002  21.046  1.00 37.39  ? 107  LYS L CB  1 
ATOM   2494 C CG  . LYS B 2 107 ? 20.261  37.176  20.446  1.00 41.74  ? 107  LYS L CG  1 
ATOM   2495 C CD  . LYS B 2 107 ? 20.176  38.329  21.444  1.00 43.99  ? 107  LYS L CD  1 
ATOM   2496 C CE  . LYS B 2 107 ? 19.770  37.856  22.833  1.00 42.38  ? 107  LYS L CE  1 
ATOM   2497 N NZ  . LYS B 2 107 ? 18.524  37.025  22.755  1.00 45.59  ? 107  LYS L NZ  1 
ATOM   2498 N N   . ARG B 2 108 ? 21.737  35.457  17.713  1.00 37.04  ? 108  ARG L N   1 
ATOM   2499 C CA  . ARG B 2 108 ? 22.455  35.991  16.537  1.00 38.20  ? 108  ARG L CA  1 
ATOM   2500 C C   . ARG B 2 108 ? 21.555  36.944  15.730  1.00 40.57  ? 108  ARG L C   1 
ATOM   2501 O O   . ARG B 2 108 ? 20.414  37.172  16.096  1.00 40.64  ? 108  ARG L O   1 
ATOM   2502 C CB  . ARG B 2 108 ? 22.963  34.868  15.608  1.00 38.46  ? 108  ARG L CB  1 
ATOM   2503 C CG  . ARG B 2 108 ? 21.879  33.880  15.186  1.00 38.62  ? 108  ARG L CG  1 
ATOM   2504 C CD  . ARG B 2 108 ? 22.120  33.298  13.807  1.00 39.99  ? 108  ARG L CD  1 
ATOM   2505 N NE  . ARG B 2 108 ? 21.998  34.296  12.750  1.00 42.13  ? 108  ARG L NE  1 
ATOM   2506 C CZ  . ARG B 2 108 ? 22.664  34.279  11.602  1.00 43.45  ? 108  ARG L CZ  1 
ATOM   2507 N NH1 . ARG B 2 108 ? 23.496  33.293  11.322  1.00 43.10  ? 108  ARG L NH1 1 
ATOM   2508 N NH2 . ARG B 2 108 ? 22.483  35.242  10.726  1.00 45.15  ? 108  ARG L NH2 1 
ATOM   2509 N N   . ALA B 2 109 ? 22.078  37.472  14.633  1.00 31.19  ? 109  ALA L N   1 
ATOM   2510 C CA  . ALA B 2 109 ? 21.298  38.366  13.747  1.00 31.81  ? 109  ALA L CA  1 
ATOM   2511 C C   . ALA B 2 109 ? 20.143  37.635  13.078  1.00 29.55  ? 109  ALA L C   1 
ATOM   2512 O O   . ALA B 2 109 ? 20.240  36.435  12.729  1.00 28.88  ? 109  ALA L O   1 
ATOM   2513 C CB  . ALA B 2 109 ? 22.201  38.997  12.687  1.00 32.52  ? 109  ALA L CB  1 
ATOM   2514 N N   . ASP B 2 110 ? 19.044  38.343  12.887  1.00 29.14  ? 110  ASP L N   1 
ATOM   2515 C CA  . ASP B 2 110 ? 17.918  37.776  12.169  1.00 27.80  ? 110  ASP L CA  1 
ATOM   2516 C C   . ASP B 2 110 ? 18.385  37.187  10.842  1.00 27.22  ? 110  ASP L C   1 
ATOM   2517 O O   . ASP B 2 110 ? 19.301  37.735  10.225  1.00 27.75  ? 110  ASP L O   1 
ATOM   2518 C CB  . ASP B 2 110 ? 16.878  38.859  11.889  1.00 29.75  ? 110  ASP L CB  1 
ATOM   2519 C CG  . ASP B 2 110 ? 16.149  39.319  13.134  1.00 31.67  ? 110  ASP L CG  1 
ATOM   2520 O OD1 . ASP B 2 110 ? 16.348  38.750  14.234  1.00 31.76  ? 110  ASP L OD1 1 
ATOM   2521 O OD2 . ASP B 2 110 ? 15.375  40.290  12.995  1.00 34.42  ? 110  ASP L OD2 1 
ATOM   2522 N N   . ALA B 2 111 ? 17.791  36.063  10.425  1.00 25.50  ? 111  ALA L N   1 
ATOM   2523 C CA  . ALA B 2 111 ? 18.126  35.425  9.134   1.00 25.32  ? 111  ALA L CA  1 
ATOM   2524 C C   . ALA B 2 111 ? 16.857  34.927  8.497   1.00 24.66  ? 111  ALA L C   1 
ATOM   2525 O O   . ALA B 2 111 ? 16.072  34.189  9.117   1.00 23.69  ? 111  ALA L O   1 
ATOM   2526 C CB  . ALA B 2 111 ? 19.152  34.283  9.314   1.00 25.64  ? 111  ALA L CB  1 
ATOM   2527 N N   . ALA B 2 112 ? 16.619  35.341  7.247   1.00 24.75  ? 112  ALA L N   1 
ATOM   2528 C CA  . ALA B 2 112 ? 15.407  34.936  6.532   1.00 24.29  ? 112  ALA L CA  1 
ATOM   2529 C C   . ALA B 2 112 ? 15.470  33.464  6.083   1.00 23.74  ? 112  ALA L C   1 
ATOM   2530 O O   . ALA B 2 112 ? 16.511  32.998  5.642   1.00 22.99  ? 112  ALA L O   1 
ATOM   2531 C CB  . ALA B 2 112 ? 15.190  35.841  5.308   1.00 24.93  ? 112  ALA L CB  1 
ATOM   2532 N N   . PRO B 2 113 ? 14.347  32.741  6.162   1.00 23.89  ? 113  PRO L N   1 
ATOM   2533 C CA  . PRO B 2 113 ? 14.373  31.317  5.742   1.00 24.05  ? 113  PRO L CA  1 
ATOM   2534 C C   . PRO B 2 113 ? 14.566  31.113  4.249   1.00 25.67  ? 113  PRO L C   1 
ATOM   2535 O O   . PRO B 2 113 ? 14.008  31.877  3.452   1.00 26.42  ? 113  PRO L O   1 
ATOM   2536 C CB  . PRO B 2 113 ? 12.978  30.806  6.125   1.00 24.25  ? 113  PRO L CB  1 
ATOM   2537 C CG  . PRO B 2 113 ? 12.146  32.041  6.403   1.00 24.87  ? 113  PRO L CG  1 
ATOM   2538 C CD  . PRO B 2 113 ? 13.113  33.094  6.884   1.00 24.32  ? 113  PRO L CD  1 
ATOM   2539 N N   . THR B 2 114 ? 15.328  30.089  3.870   1.00 25.44  ? 114  THR L N   1 
ATOM   2540 C CA  . THR B 2 114 ? 15.383  29.661  2.480   1.00 26.37  ? 114  THR L CA  1 
ATOM   2541 C C   . THR B 2 114 ? 14.334  28.570  2.334   1.00 26.74  ? 114  THR L C   1 
ATOM   2542 O O   . THR B 2 114 ? 14.411  27.537  2.998   1.00 26.33  ? 114  THR L O   1 
ATOM   2543 C CB  . THR B 2 114 ? 16.778  29.141  2.110   1.00 26.41  ? 114  THR L CB  1 
ATOM   2544 O OG1 . THR B 2 114 ? 17.709  30.209  2.266   1.00 26.82  ? 114  THR L OG1 1 
ATOM   2545 C CG2 . THR B 2 114 ? 16.840  28.612  0.651   1.00 26.79  ? 114  THR L CG2 1 
ATOM   2546 N N   . VAL B 2 115 ? 13.331  28.826  1.491   1.00 27.26  ? 115  VAL L N   1 
ATOM   2547 C CA  . VAL B 2 115 ? 12.190  27.963  1.416   1.00 27.13  ? 115  VAL L CA  1 
ATOM   2548 C C   . VAL B 2 115 ? 12.182  27.175  0.096   1.00 28.34  ? 115  VAL L C   1 
ATOM   2549 O O   . VAL B 2 115 ? 12.274  27.754  -0.994  1.00 29.30  ? 115  VAL L O   1 
ATOM   2550 C CB  . VAL B 2 115 ? 10.878  28.766  1.597   1.00 27.48  ? 115  VAL L CB  1 
ATOM   2551 C CG1 . VAL B 2 115 ? 9.685   27.828  1.599   1.00 27.08  ? 115  VAL L CG1 1 
ATOM   2552 C CG2 . VAL B 2 115 ? 10.921  29.594  2.901   1.00 27.20  ? 115  VAL L CG2 1 
ATOM   2553 N N   . SER B 2 116 ? 12.044  25.856  0.204   1.00 28.21  ? 116  SER L N   1 
ATOM   2554 C CA  . SER B 2 116 ? 11.959  24.966  -0.959  1.00 28.52  ? 116  SER L CA  1 
ATOM   2555 C C   . SER B 2 116 ? 10.740  24.069  -0.814  1.00 28.70  ? 116  SER L C   1 
ATOM   2556 O O   . SER B 2 116 ? 10.417  23.629  0.295   1.00 29.03  ? 116  SER L O   1 
ATOM   2557 C CB  . SER B 2 116 ? 13.208  24.097  -1.092  1.00 28.75  ? 116  SER L CB  1 
ATOM   2558 O OG  . SER B 2 116 ? 14.371  24.865  -0.915  1.00 29.29  ? 116  SER L OG  1 
ATOM   2559 N N   . ILE B 2 117 ? 10.053  23.817  -1.920  1.00 28.94  ? 117  ILE L N   1 
ATOM   2560 C CA  . ILE B 2 117 ? 8.826   23.035  -1.898  1.00 29.11  ? 117  ILE L CA  1 
ATOM   2561 C C   . ILE B 2 117 ? 8.956   21.936  -2.929  1.00 29.74  ? 117  ILE L C   1 
ATOM   2562 O O   . ILE B 2 117 ? 9.545   22.139  -3.995  1.00 30.54  ? 117  ILE L O   1 
ATOM   2563 C CB  . ILE B 2 117 ? 7.556   23.910  -2.143  1.00 30.09  ? 117  ILE L CB  1 
ATOM   2564 C CG1 . ILE B 2 117 ? 6.275   23.109  -1.857  1.00 31.01  ? 117  ILE L CG1 1 
ATOM   2565 C CG2 . ILE B 2 117 ? 7.556   24.509  -3.552  1.00 31.54  ? 117  ILE L CG2 1 
ATOM   2566 C CD1 . ILE B 2 117 ? 4.983   23.906  -1.983  1.00 32.13  ? 117  ILE L CD1 1 
ATOM   2567 N N   . PHE B 2 118 ? 8.421   20.766  -2.605  1.00 29.83  ? 118  PHE L N   1 
ATOM   2568 C CA  . PHE B 2 118 ? 8.565   19.600  -3.460  1.00 30.75  ? 118  PHE L CA  1 
ATOM   2569 C C   . PHE B 2 118 ? 7.215   18.928  -3.662  1.00 32.27  ? 118  PHE L C   1 
ATOM   2570 O O   . PHE B 2 118 ? 6.532   18.632  -2.697  1.00 31.95  ? 118  PHE L O   1 
ATOM   2571 C CB  . PHE B 2 118 ? 9.573   18.612  -2.870  1.00 29.74  ? 118  PHE L CB  1 
ATOM   2572 C CG  . PHE B 2 118 ? 10.954  19.190  -2.718  1.00 29.20  ? 118  PHE L CG  1 
ATOM   2573 C CD1 . PHE B 2 118 ? 11.306  19.889  -1.570  1.00 28.56  ? 118  PHE L CD1 1 
ATOM   2574 C CD2 . PHE B 2 118 ? 11.881  19.075  -3.737  1.00 30.21  ? 118  PHE L CD2 1 
ATOM   2575 C CE1 . PHE B 2 118 ? 12.578  20.442  -1.414  1.00 28.24  ? 118  PHE L CE1 1 
ATOM   2576 C CE2 . PHE B 2 118 ? 13.161  19.619  -3.607  1.00 30.17  ? 118  PHE L CE2 1 
ATOM   2577 C CZ  . PHE B 2 118 ? 13.519  20.296  -2.438  1.00 29.61  ? 118  PHE L CZ  1 
ATOM   2578 N N   . PRO B 2 119 ? 6.841   18.678  -4.925  1.00 34.42  ? 119  PRO L N   1 
ATOM   2579 C CA  . PRO B 2 119 ? 5.656   17.851  -5.180  1.00 35.82  ? 119  PRO L CA  1 
ATOM   2580 C C   . PRO B 2 119 ? 5.935   16.388  -4.777  1.00 35.05  ? 119  PRO L C   1 
ATOM   2581 O O   . PRO B 2 119 ? 7.098   16.037  -4.523  1.00 33.86  ? 119  PRO L O   1 
ATOM   2582 C CB  . PRO B 2 119 ? 5.455   17.984  -6.694  1.00 38.06  ? 119  PRO L CB  1 
ATOM   2583 C CG  . PRO B 2 119 ? 6.789   18.363  -7.229  1.00 38.01  ? 119  PRO L CG  1 
ATOM   2584 C CD  . PRO B 2 119 ? 7.453   19.187  -6.168  1.00 35.34  ? 119  PRO L CD  1 
ATOM   2585 N N   . PRO B 2 120 ? 4.884   15.543  -4.685  1.00 35.81  ? 120  PRO L N   1 
ATOM   2586 C CA  . PRO B 2 120 ? 5.085   14.113  -4.418  1.00 35.29  ? 120  PRO L CA  1 
ATOM   2587 C C   . PRO B 2 120 ? 5.971   13.490  -5.486  1.00 35.85  ? 120  PRO L C   1 
ATOM   2588 O O   . PRO B 2 120 ? 5.901   13.897  -6.651  1.00 37.37  ? 120  PRO L O   1 
ATOM   2589 C CB  . PRO B 2 120 ? 3.677   13.515  -4.566  1.00 37.18  ? 120  PRO L CB  1 
ATOM   2590 C CG  . PRO B 2 120 ? 2.750   14.660  -4.408  1.00 38.37  ? 120  PRO L CG  1 
ATOM   2591 C CD  . PRO B 2 120 ? 3.465   15.865  -4.921  1.00 37.69  ? 120  PRO L CD  1 
ATOM   2592 N N   . SER B 2 121 ? 6.785   12.510  -5.096  1.00 34.50  ? 121  SER L N   1 
ATOM   2593 C CA  . SER B 2 121 ? 7.541   11.689  -6.061  1.00 35.07  ? 121  SER L CA  1 
ATOM   2594 C C   . SER B 2 121 ? 6.641   10.729  -6.839  1.00 36.74  ? 121  SER L C   1 
ATOM   2595 O O   . SER B 2 121 ? 5.567   10.341  -6.368  1.00 36.55  ? 121  SER L O   1 
ATOM   2596 C CB  . SER B 2 121 ? 8.641   10.892  -5.342  1.00 33.41  ? 121  SER L CB  1 
ATOM   2597 O OG  . SER B 2 121 ? 8.081   10.039  -4.366  1.00 32.11  ? 121  SER L OG  1 
ATOM   2598 N N   . SER B 2 122 ? 7.066   10.349  -8.044  1.00 38.14  ? 122  SER L N   1 
ATOM   2599 C CA  . SER B 2 122 ? 6.337   9.331   -8.793  1.00 40.24  ? 122  SER L CA  1 
ATOM   2600 C C   . SER B 2 122 ? 6.280   8.014   -8.003  1.00 39.49  ? 122  SER L C   1 
ATOM   2601 O O   . SER B 2 122 ? 5.273   7.313   -8.032  1.00 39.96  ? 122  SER L O   1 
ATOM   2602 C CB  . SER B 2 122 ? 6.951   9.121   -10.179 1.00 42.52  ? 122  SER L CB  1 
ATOM   2603 O OG  . SER B 2 122 ? 8.317   8.769   -10.051 1.00 42.56  ? 122  SER L OG  1 
ATOM   2604 N N   . GLU B 2 123 ? 7.351   7.704   -7.268  1.00 38.03  ? 123  GLU L N   1 
ATOM   2605 C CA  . GLU B 2 123 ? 7.361   6.530   -6.399  1.00 38.13  ? 123  GLU L CA  1 
ATOM   2606 C C   . GLU B 2 123 ? 6.208   6.490   -5.402  1.00 37.94  ? 123  GLU L C   1 
ATOM   2607 O O   . GLU B 2 123 ? 5.552   5.456   -5.257  1.00 39.92  ? 123  GLU L O   1 
ATOM   2608 C CB  . GLU B 2 123 ? 8.687   6.413   -5.643  1.00 37.50  ? 123  GLU L CB  1 
ATOM   2609 C CG  . GLU B 2 123 ? 9.869   6.070   -6.549  1.00 39.98  ? 123  GLU L CG  1 
ATOM   2610 C CD  . GLU B 2 123 ? 10.681  7.286   -6.946  1.00 41.18  ? 123  GLU L CD  1 
ATOM   2611 O OE1 . GLU B 2 123 ? 10.097  8.388   -7.029  1.00 41.26  ? 123  GLU L OE1 1 
ATOM   2612 O OE2 . GLU B 2 123 ? 11.910  7.140   -7.185  1.00 42.41  ? 123  GLU L OE2 1 
ATOM   2613 N N   . GLN B 2 124 ? 5.964   7.604   -4.715  1.00 36.87  ? 124  GLN L N   1 
ATOM   2614 C CA  . GLN B 2 124 ? 4.915   7.645   -3.710  1.00 36.44  ? 124  GLN L CA  1 
ATOM   2615 C C   . GLN B 2 124 ? 3.528   7.553   -4.353  1.00 38.63  ? 124  GLN L C   1 
ATOM   2616 O O   . GLN B 2 124 ? 2.674   6.808   -3.883  1.00 39.44  ? 124  GLN L O   1 
ATOM   2617 C CB  . GLN B 2 124 ? 5.034   8.891   -2.834  1.00 35.25  ? 124  GLN L CB  1 
ATOM   2618 C CG  . GLN B 2 124 ? 4.094   8.824   -1.654  1.00 35.54  ? 124  GLN L CG  1 
ATOM   2619 C CD  . GLN B 2 124 ? 4.053   10.092  -0.862  1.00 35.21  ? 124  GLN L CD  1 
ATOM   2620 O OE1 . GLN B 2 124 ? 3.560   10.091  0.262   1.00 36.27  ? 124  GLN L OE1 1 
ATOM   2621 N NE2 . GLN B 2 124 ? 4.570   11.180  -1.427  1.00 34.95  ? 124  GLN L NE2 1 
ATOM   2622 N N   . LEU B 2 125 ? 3.327   8.289   -5.442  1.00 39.53  ? 125  LEU L N   1 
ATOM   2623 C CA  . LEU B 2 125 ? 2.067   8.241   -6.183  1.00 42.22  ? 125  LEU L CA  1 
ATOM   2624 C C   . LEU B 2 125 ? 1.654   6.811   -6.573  1.00 43.91  ? 125  LEU L C   1 
ATOM   2625 O O   . LEU B 2 125 ? 0.457   6.507   -6.607  1.00 45.25  ? 125  LEU L O   1 
ATOM   2626 C CB  . LEU B 2 125 ? 2.115   9.169   -7.402  1.00 43.47  ? 125  LEU L CB  1 
ATOM   2627 C CG  . LEU B 2 125 ? 2.241   10.674  -7.113  1.00 43.25  ? 125  LEU L CG  1 
ATOM   2628 C CD1 . LEU B 2 125 ? 2.451   11.388  -8.437  1.00 45.06  ? 125  LEU L CD1 1 
ATOM   2629 C CD2 . LEU B 2 125 ? 1.009   11.240  -6.391  1.00 43.92  ? 125  LEU L CD2 1 
ATOM   2630 N N   . THR B 2 126 ? 2.630   5.933   -6.831  1.00 43.39  ? 126  THR L N   1 
ATOM   2631 C CA  . THR B 2 126 ? 2.332   4.510   -7.113  1.00 45.33  ? 126  THR L CA  1 
ATOM   2632 C C   . THR B 2 126 ? 1.723   3.804   -5.910  1.00 45.76  ? 126  THR L C   1 
ATOM   2633 O O   . THR B 2 126 ? 1.014   2.824   -6.091  1.00 48.79  ? 126  THR L O   1 
ATOM   2634 C CB  . THR B 2 126 ? 3.545   3.671   -7.616  1.00 44.55  ? 126  THR L CB  1 
ATOM   2635 O OG1 . THR B 2 126 ? 4.526   3.518   -6.569  1.00 42.03  ? 126  THR L OG1 1 
ATOM   2636 C CG2 . THR B 2 126 ? 4.168   4.278   -8.876  1.00 45.02  ? 126  THR L CG2 1 
ATOM   2637 N N   . SER B 2 127 ? 1.981   4.295   -4.698  1.00 45.64  ? 127  SER L N   1 
ATOM   2638 C CA  . SER B 2 127 ? 1.364   3.708   -3.503  1.00 46.61  ? 127  SER L CA  1 
ATOM   2639 C C   . SER B 2 127 ? -0.064  4.221   -3.213  1.00 48.00  ? 127  SER L C   1 
ATOM   2640 O O   . SER B 2 127 ? -0.753  3.676   -2.351  1.00 48.55  ? 127  SER L O   1 
ATOM   2641 C CB  . SER B 2 127 ? 2.268   3.844   -2.267  1.00 45.93  ? 127  SER L CB  1 
ATOM   2642 O OG  . SER B 2 127 ? 2.331   5.183   -1.777  1.00 46.72  ? 127  SER L OG  1 
ATOM   2643 N N   . GLY B 2 128 ? -0.502  5.257   -3.926  1.00 48.39  ? 128  GLY L N   1 
ATOM   2644 C CA  . GLY B 2 128 ? -1.817  5.858   -3.675  1.00 49.95  ? 128  GLY L CA  1 
ATOM   2645 C C   . GLY B 2 128 ? -1.758  6.975   -2.629  1.00 48.04  ? 128  GLY L C   1 
ATOM   2646 O O   . GLY B 2 128 ? -2.798  7.443   -2.166  1.00 49.23  ? 128  GLY L O   1 
ATOM   2647 N N   . GLY B 2 129 ? -0.547  7.391   -2.257  1.00 44.96  ? 129  GLY L N   1 
ATOM   2648 C CA  . GLY B 2 129 ? -0.323  8.510   -1.345  1.00 42.67  ? 129  GLY L CA  1 
ATOM   2649 C C   . GLY B 2 129 ? 0.366   9.664   -2.052  1.00 41.10  ? 129  GLY L C   1 
ATOM   2650 O O   . GLY B 2 129 ? 0.916   9.491   -3.134  1.00 41.81  ? 129  GLY L O   1 
ATOM   2651 N N   . ALA B 2 130 ? 0.311   10.849  -1.449  1.00 39.57  ? 130  ALA L N   1 
ATOM   2652 C CA  . ALA B 2 130 ? 0.900   12.055  -2.027  1.00 38.25  ? 130  ALA L CA  1 
ATOM   2653 C C   . ALA B 2 130 ? 1.313   13.021  -0.919  1.00 36.96  ? 130  ALA L C   1 
ATOM   2654 O O   . ALA B 2 130 ? 0.465   13.604  -0.238  1.00 37.61  ? 130  ALA L O   1 
ATOM   2655 C CB  . ALA B 2 130 ? -0.082  12.732  -2.970  1.00 39.98  ? 130  ALA L CB  1 
ATOM   2656 N N   . SER B 2 131 ? 2.617   13.166  -0.734  1.00 35.31  ? 131  SER L N   1 
ATOM   2657 C CA  . SER B 2 131 ? 3.170   14.112  0.218   1.00 34.17  ? 131  SER L CA  1 
ATOM   2658 C C   . SER B 2 131 ? 3.811   15.291  -0.490  1.00 34.12  ? 131  SER L C   1 
ATOM   2659 O O   . SER B 2 131 ? 4.601   15.123  -1.423  1.00 34.44  ? 131  SER L O   1 
ATOM   2660 C CB  . SER B 2 131 ? 4.198   13.446  1.118   1.00 32.30  ? 131  SER L CB  1 
ATOM   2661 O OG  . SER B 2 131 ? 3.618   12.433  1.914   1.00 33.00  ? 131  SER L OG  1 
ATOM   2662 N N   . VAL B 2 132 ? 3.469   16.489  -0.028  1.00 34.01  ? 132  VAL L N   1 
ATOM   2663 C CA  . VAL B 2 132 ? 4.095   17.720  -0.471  1.00 33.26  ? 132  VAL L CA  1 
ATOM   2664 C C   . VAL B 2 132 ? 4.972   18.175  0.691   1.00 31.71  ? 132  VAL L C   1 
ATOM   2665 O O   . VAL B 2 132 ? 4.533   18.217  1.845   1.00 31.25  ? 132  VAL L O   1 
ATOM   2666 C CB  . VAL B 2 132 ? 3.055   18.819  -0.831  1.00 36.14  ? 132  VAL L CB  1 
ATOM   2667 C CG1 . VAL B 2 132 ? 3.748   19.967  -1.566  1.00 36.44  ? 132  VAL L CG1 1 
ATOM   2668 C CG2 . VAL B 2 132 ? 1.905   18.247  -1.669  1.00 37.53  ? 132  VAL L CG2 1 
ATOM   2669 N N   . VAL B 2 133 ? 6.224   18.486  0.391   1.00 29.80  ? 133  VAL L N   1 
ATOM   2670 C CA  . VAL B 2 133 ? 7.182   18.836  1.444   1.00 29.10  ? 133  VAL L CA  1 
ATOM   2671 C C   . VAL B 2 133 ? 7.675   20.249  1.244   1.00 29.17  ? 133  VAL L C   1 
ATOM   2672 O O   . VAL B 2 133 ? 7.990   20.668  0.124   1.00 30.32  ? 133  VAL L O   1 
ATOM   2673 C CB  . VAL B 2 133 ? 8.409   17.902  1.437   1.00 27.58  ? 133  VAL L CB  1 
ATOM   2674 C CG1 . VAL B 2 133 ? 9.444   18.373  2.464   1.00 25.60  ? 133  VAL L CG1 1 
ATOM   2675 C CG2 . VAL B 2 133 ? 7.954   16.470  1.702   1.00 27.94  ? 133  VAL L CG2 1 
ATOM   2676 N N   . CYS B 2 134 ? 7.765   20.951  2.355   1.00 29.35  ? 134  CYS L N   1 
ATOM   2677 C CA  . CYS B 2 134 ? 8.317   22.271  2.388   1.00 29.45  ? 134  CYS L CA  1 
ATOM   2678 C C   . CYS B 2 134 ? 9.496   22.320  3.363   1.00 27.83  ? 134  CYS L C   1 
ATOM   2679 O O   . CYS B 2 134 ? 9.356   21.974  4.546   1.00 27.80  ? 134  CYS L O   1 
ATOM   2680 C CB  . CYS B 2 134 ? 7.202   23.196  2.851   1.00 33.20  ? 134  CYS L CB  1 
ATOM   2681 S SG  . CYS B 2 134 ? 7.651   24.907  2.792   1.00 35.95  ? 134  CYS L SG  1 
ATOM   2682 N N   . PHE B 2 135 ? 10.657  22.746  2.879   1.00 26.63  ? 135  PHE L N   1 
ATOM   2683 C CA  . PHE B 2 135 ? 11.765  23.046  3.797   1.00 26.30  ? 135  PHE L CA  1 
ATOM   2684 C C   . PHE B 2 135 ? 11.910  24.556  4.015   1.00 25.55  ? 135  PHE L C   1 
ATOM   2685 O O   . PHE B 2 135 ? 11.921  25.330  3.054   1.00 26.65  ? 135  PHE L O   1 
ATOM   2686 C CB  . PHE B 2 135 ? 13.102  22.480  3.316   1.00 25.78  ? 135  PHE L CB  1 
ATOM   2687 C CG  . PHE B 2 135 ? 13.144  20.979  3.177   1.00 26.96  ? 135  PHE L CG  1 
ATOM   2688 C CD1 . PHE B 2 135 ? 13.021  20.146  4.288   1.00 26.82  ? 135  PHE L CD1 1 
ATOM   2689 C CD2 . PHE B 2 135 ? 13.365  20.397  1.932   1.00 28.52  ? 135  PHE L CD2 1 
ATOM   2690 C CE1 . PHE B 2 135 ? 13.083  18.752  4.151   1.00 27.42  ? 135  PHE L CE1 1 
ATOM   2691 C CE2 . PHE B 2 135 ? 13.426  19.000  1.778   1.00 29.08  ? 135  PHE L CE2 1 
ATOM   2692 C CZ  . PHE B 2 135 ? 13.284  18.181  2.893   1.00 28.05  ? 135  PHE L CZ  1 
ATOM   2693 N N   . LEU B 2 136 ? 12.031  24.961  5.276   1.00 24.78  ? 136  LEU L N   1 
ATOM   2694 C CA  . LEU B 2 136 ? 12.297  26.366  5.627   1.00 24.28  ? 136  LEU L CA  1 
ATOM   2695 C C   . LEU B 2 136 ? 13.612  26.358  6.403   1.00 23.70  ? 136  LEU L C   1 
ATOM   2696 O O   . LEU B 2 136 ? 13.634  26.035  7.586   1.00 23.73  ? 136  LEU L O   1 
ATOM   2697 C CB  . LEU B 2 136 ? 11.129  26.954  6.434   1.00 25.56  ? 136  LEU L CB  1 
ATOM   2698 C CG  . LEU B 2 136 ? 9.760   26.719  5.768   1.00 26.57  ? 136  LEU L CG  1 
ATOM   2699 C CD1 . LEU B 2 136 ? 9.059   25.516  6.382   1.00 27.32  ? 136  LEU L CD1 1 
ATOM   2700 C CD2 . LEU B 2 136 ? 8.848   27.944  5.868   1.00 27.91  ? 136  LEU L CD2 1 
ATOM   2701 N N   . ASN B 2 137 ? 14.706  26.657  5.708   1.00 23.24  ? 137  ASN L N   1 
ATOM   2702 C CA  . ASN B 2 137 ? 16.057  26.412  6.239   1.00 23.35  ? 137  ASN L CA  1 
ATOM   2703 C C   . ASN B 2 137 ? 16.839  27.638  6.629   1.00 23.95  ? 137  ASN L C   1 
ATOM   2704 O O   . ASN B 2 137 ? 16.793  28.669  5.910   1.00 24.53  ? 137  ASN L O   1 
ATOM   2705 C CB  . ASN B 2 137 ? 16.866  25.578  5.232   1.00 24.17  ? 137  ASN L CB  1 
ATOM   2706 C CG  . ASN B 2 137 ? 16.338  24.145  5.129   1.00 23.54  ? 137  ASN L CG  1 
ATOM   2707 O OD1 . ASN B 2 137 ? 15.553  23.729  5.978   1.00 23.32  ? 137  ASN L OD1 1 
ATOM   2708 N ND2 . ASN B 2 137 ? 16.718  23.409  4.075   1.00 24.28  ? 137  ASN L ND2 1 
ATOM   2709 N N   . ASN B 2 138 ? 17.637  27.493  7.709   1.00 23.65  ? 138  ASN L N   1 
ATOM   2710 C CA  . ASN B 2 138 ? 18.660  28.473  8.116   1.00 23.68  ? 138  ASN L CA  1 
ATOM   2711 C C   . ASN B 2 138 ? 18.064  29.835  8.422   1.00 23.28  ? 138  ASN L C   1 
ATOM   2712 O O   . ASN B 2 138 ? 18.490  30.854  7.875   1.00 23.43  ? 138  ASN L O   1 
ATOM   2713 C CB  . ASN B 2 138 ? 19.833  28.591  7.117   1.00 26.04  ? 138  ASN L CB  1 
ATOM   2714 C CG  . ASN B 2 138 ? 20.571  27.277  6.932   1.00 26.50  ? 138  ASN L CG  1 
ATOM   2715 O OD1 . ASN B 2 138 ? 20.090  26.391  6.229   1.00 27.28  ? 138  ASN L OD1 1 
ATOM   2716 N ND2 . ASN B 2 138 ? 21.702  27.126  7.601   1.00 27.15  ? 138  ASN L ND2 1 
ATOM   2717 N N   . PHE B 2 139 ? 17.058  29.834  9.290   1.00 22.39  ? 139  PHE L N   1 
ATOM   2718 C CA  . PHE B 2 139 ? 16.458  31.091  9.753   1.00 22.36  ? 139  PHE L CA  1 
ATOM   2719 C C   . PHE B 2 139 ? 16.715  31.410  11.226  1.00 22.30  ? 139  PHE L C   1 
ATOM   2720 O O   . PHE B 2 139 ? 17.044  30.527  12.025  1.00 22.32  ? 139  PHE L O   1 
ATOM   2721 C CB  . PHE B 2 139 ? 14.950  31.093  9.446   1.00 21.85  ? 139  PHE L CB  1 
ATOM   2722 C CG  . PHE B 2 139 ? 14.180  30.002  10.139  1.00 21.69  ? 139  PHE L CG  1 
ATOM   2723 C CD1 . PHE B 2 139 ? 13.672  30.195  11.430  1.00 21.34  ? 139  PHE L CD1 1 
ATOM   2724 C CD2 . PHE B 2 139 ? 13.930  28.773  9.492   1.00 21.18  ? 139  PHE L CD2 1 
ATOM   2725 C CE1 . PHE B 2 139 ? 12.958  29.190  12.083  1.00 21.35  ? 139  PHE L CE1 1 
ATOM   2726 C CE2 . PHE B 2 139 ? 13.195  27.777  10.138  1.00 20.85  ? 139  PHE L CE2 1 
ATOM   2727 C CZ  . PHE B 2 139 ? 12.717  27.978  11.429  1.00 21.24  ? 139  PHE L CZ  1 
ATOM   2728 N N   . TYR B 2 140 ? 16.568  32.682  11.584  1.00 22.29  ? 140  TYR L N   1 
ATOM   2729 C CA  . TYR B 2 140 ? 16.659  33.100  12.976  1.00 22.91  ? 140  TYR L CA  1 
ATOM   2730 C C   . TYR B 2 140 ? 15.794  34.361  13.143  1.00 23.52  ? 140  TYR L C   1 
ATOM   2731 O O   . TYR B 2 140 ? 15.795  35.213  12.248  1.00 23.35  ? 140  TYR L O   1 
ATOM   2732 C CB  . TYR B 2 140 ? 18.116  33.348  13.396  1.00 23.19  ? 140  TYR L CB  1 
ATOM   2733 C CG  . TYR B 2 140 ? 18.210  33.604  14.885  1.00 23.98  ? 140  TYR L CG  1 
ATOM   2734 C CD1 . TYR B 2 140 ? 18.041  34.894  15.395  1.00 24.05  ? 140  TYR L CD1 1 
ATOM   2735 C CD2 . TYR B 2 140 ? 18.389  32.549  15.789  1.00 24.18  ? 140  TYR L CD2 1 
ATOM   2736 C CE1 . TYR B 2 140 ? 18.077  35.140  16.753  1.00 24.96  ? 140  TYR L CE1 1 
ATOM   2737 C CE2 . TYR B 2 140 ? 18.434  32.788  17.153  1.00 24.89  ? 140  TYR L CE2 1 
ATOM   2738 C CZ  . TYR B 2 140 ? 18.272  34.085  17.629  1.00 25.56  ? 140  TYR L CZ  1 
ATOM   2739 O OH  . TYR B 2 140 ? 18.300  34.316  18.985  1.00 26.91  ? 140  TYR L OH  1 
ATOM   2740 N N   . PRO B 2 141 ? 15.044  34.475  14.259  1.00 23.82  ? 141  PRO L N   1 
ATOM   2741 C CA  . PRO B 2 141 ? 14.891  33.599  15.459  1.00 24.29  ? 141  PRO L CA  1 
ATOM   2742 C C   . PRO B 2 141 ? 14.031  32.340  15.199  1.00 24.42  ? 141  PRO L C   1 
ATOM   2743 O O   . PRO B 2 141 ? 13.495  32.164  14.092  1.00 22.65  ? 141  PRO L O   1 
ATOM   2744 C CB  . PRO B 2 141 ? 14.200  34.518  16.471  1.00 25.01  ? 141  PRO L CB  1 
ATOM   2745 C CG  . PRO B 2 141 ? 13.394  35.452  15.607  1.00 24.94  ? 141  PRO L CG  1 
ATOM   2746 C CD  . PRO B 2 141 ? 14.233  35.700  14.377  1.00 24.46  ? 141  PRO L CD  1 
ATOM   2747 N N   . LYS B 2 142 ? 13.911  31.473  16.212  1.00 25.73  ? 142  LYS L N   1 
ATOM   2748 C CA  . LYS B 2 142 ? 13.274  30.166  16.018  1.00 26.87  ? 142  LYS L CA  1 
ATOM   2749 C C   . LYS B 2 142 ? 11.759  30.258  15.730  1.00 26.28  ? 142  LYS L C   1 
ATOM   2750 O O   . LYS B 2 142 ? 11.187  29.349  15.132  1.00 25.85  ? 142  LYS L O   1 
ATOM   2751 C CB  . LYS B 2 142 ? 13.552  29.203  17.211  1.00 29.64  ? 142  LYS L CB  1 
ATOM   2752 C CG  . LYS B 2 142 ? 13.136  27.763  16.879  1.00 33.07  ? 142  LYS L CG  1 
ATOM   2753 C CD  . LYS B 2 142 ? 13.149  26.744  18.040  1.00 38.04  ? 142  LYS L CD  1 
ATOM   2754 C CE  . LYS B 2 142 ? 11.996  25.738  17.854  1.00 40.28  ? 142  LYS L CE  1 
ATOM   2755 N NZ  . LYS B 2 142 ? 12.304  24.301  18.134  1.00 41.43  ? 142  LYS L NZ  1 
ATOM   2756 N N   . ASP B 2 143 ? 11.128  31.348  16.160  1.00 27.16  ? 143  ASP L N   1 
ATOM   2757 C CA  A ASP B 2 143 ? 9.679   31.530  16.064  0.50 27.42  ? 143  ASP L CA  1 
ATOM   2758 C CA  B ASP B 2 143 ? 9.671   31.469  16.055  0.50 27.40  ? 143  ASP L CA  1 
ATOM   2759 C C   . ASP B 2 143 ? 9.226   31.566  14.595  1.00 26.71  ? 143  ASP L C   1 
ATOM   2760 O O   . ASP B 2 143 ? 9.595   32.486  13.874  1.00 26.06  ? 143  ASP L O   1 
ATOM   2761 C CB  A ASP B 2 143 ? 9.291   32.844  16.749  0.50 28.36  ? 143  ASP L CB  1 
ATOM   2762 C CB  B ASP B 2 143 ? 9.158   32.667  16.848  0.50 28.47  ? 143  ASP L CB  1 
ATOM   2763 C CG  A ASP B 2 143 ? 9.842   32.965  18.169  0.50 29.42  ? 143  ASP L CG  1 
ATOM   2764 C CG  B ASP B 2 143 ? 7.645   32.668  16.985  0.50 29.56  ? 143  ASP L CG  1 
ATOM   2765 O OD1 A ASP B 2 143 ? 11.084  33.098  18.362  0.50 29.32  ? 143  ASP L OD1 1 
ATOM   2766 O OD1 B ASP B 2 143 ? 7.031   31.586  16.934  0.50 30.24  ? 143  ASP L OD1 1 
ATOM   2767 O OD2 A ASP B 2 143 ? 9.011   32.939  19.094  0.50 30.27  ? 143  ASP L OD2 1 
ATOM   2768 O OD2 B ASP B 2 143 ? 7.067   33.750  17.143  0.50 30.90  ? 143  ASP L OD2 1 
ATOM   2769 N N   . ILE B 2 144 ? 8.448   30.581  14.159  1.00 26.42  ? 144  ILE L N   1 
ATOM   2770 C CA  . ILE B 2 144 ? 7.926   30.534  12.773  1.00 26.75  ? 144  ILE L CA  1 
ATOM   2771 C C   . ILE B 2 144 ? 6.537   29.859  12.795  1.00 28.41  ? 144  ILE L C   1 
ATOM   2772 O O   . ILE B 2 144 ? 6.229   29.101  13.720  1.00 28.62  ? 144  ILE L O   1 
ATOM   2773 C CB  . ILE B 2 144 ? 8.932   29.820  11.825  1.00 25.42  ? 144  ILE L CB  1 
ATOM   2774 C CG1 . ILE B 2 144 ? 8.634   30.064  10.322  1.00 25.08  ? 144  ILE L CG1 1 
ATOM   2775 C CG2 . ILE B 2 144 ? 9.021   28.340  12.160  1.00 25.17  ? 144  ILE L CG2 1 
ATOM   2776 C CD1 . ILE B 2 144 ? 9.837   29.781  9.428   1.00 24.38  ? 144  ILE L CD1 1 
ATOM   2777 N N   . ASN B 2 145 ? 5.676   30.179  11.829  1.00 29.56  ? 145  ASN L N   1 
ATOM   2778 C CA  . ASN B 2 145 ? 4.375   29.519  11.712  1.00 31.99  ? 145  ASN L CA  1 
ATOM   2779 C C   . ASN B 2 145 ? 4.167   29.134  10.248  1.00 31.19  ? 145  ASN L C   1 
ATOM   2780 O O   . ASN B 2 145 ? 4.402   29.948  9.372   1.00 30.50  ? 145  ASN L O   1 
ATOM   2781 C CB  . ASN B 2 145 ? 3.257   30.435  12.170  1.00 36.89  ? 145  ASN L CB  1 
ATOM   2782 C CG  . ASN B 2 145 ? 1.901   29.743  12.179  1.00 43.06  ? 145  ASN L CG  1 
ATOM   2783 O OD1 . ASN B 2 145 ? 0.992   30.105  11.411  1.00 47.43  ? 145  ASN L OD1 1 
ATOM   2784 N ND2 . ASN B 2 145 ? 1.757   28.721  13.039  1.00 43.97  ? 145  ASN L ND2 1 
ATOM   2785 N N   . VAL B 2 146 ? 3.762   27.897  9.984   1.00 30.71  ? 146  VAL L N   1 
ATOM   2786 C CA  . VAL B 2 146 ? 3.566   27.441  8.604   1.00 30.49  ? 146  VAL L CA  1 
ATOM   2787 C C   . VAL B 2 146 ? 2.088   27.093  8.382   1.00 32.48  ? 146  VAL L C   1 
ATOM   2788 O O   . VAL B 2 146 ? 1.452   26.479  9.244   1.00 33.36  ? 146  VAL L O   1 
ATOM   2789 C CB  . VAL B 2 146 ? 4.509   26.261  8.257   1.00 29.63  ? 146  VAL L CB  1 
ATOM   2790 C CG1 . VAL B 2 146 ? 4.084   25.536  6.979   1.00 29.67  ? 146  VAL L CG1 1 
ATOM   2791 C CG2 . VAL B 2 146 ? 5.954   26.752  8.159   1.00 27.92  ? 146  VAL L CG2 1 
ATOM   2792 N N   . LYS B 2 147 ? 1.537   27.512  7.237   1.00 33.10  ? 147  LYS L N   1 
ATOM   2793 C CA  . LYS B 2 147 ? 0.188   27.151  6.830   1.00 34.51  ? 147  LYS L CA  1 
ATOM   2794 C C   . LYS B 2 147 ? 0.256   26.569  5.425   1.00 34.49  ? 147  LYS L C   1 
ATOM   2795 O O   . LYS B 2 147 ? 1.067   27.000  4.615   1.00 33.51  ? 147  LYS L O   1 
ATOM   2796 C CB  . LYS B 2 147 ? -0.741  28.374  6.804   1.00 36.70  ? 147  LYS L CB  1 
ATOM   2797 C CG  . LYS B 2 147 ? -0.995  29.005  8.154   1.00 37.52  ? 147  LYS L CG  1 
ATOM   2798 C CD  . LYS B 2 147 ? -1.960  30.187  8.047   1.00 40.27  ? 147  LYS L CD  1 
ATOM   2799 C CE  . LYS B 2 147 ? -1.853  31.017  9.324   1.00 41.17  ? 147  LYS L CE  1 
ATOM   2800 N NZ  . LYS B 2 147 ? -2.843  32.130  9.446   1.00 43.80  ? 147  LYS L NZ  1 
ATOM   2801 N N   . TRP B 2 148 ? -0.595  25.592  5.149   1.00 35.18  ? 148  TRP L N   1 
ATOM   2802 C CA  . TRP B 2 148 ? -0.707  25.041  3.807   1.00 36.20  ? 148  TRP L CA  1 
ATOM   2803 C C   . TRP B 2 148 ? -1.992  25.529  3.183   1.00 38.64  ? 148  TRP L C   1 
ATOM   2804 O O   . TRP B 2 148 ? -3.045  25.576  3.835   1.00 40.49  ? 148  TRP L O   1 
ATOM   2805 C CB  . TRP B 2 148 ? -0.681  23.510  3.809   1.00 36.10  ? 148  TRP L CB  1 
ATOM   2806 C CG  . TRP B 2 148 ? 0.666   22.955  4.066   1.00 34.86  ? 148  TRP L CG  1 
ATOM   2807 C CD1 . TRP B 2 148 ? 1.223   22.677  5.284   1.00 33.59  ? 148  TRP L CD1 1 
ATOM   2808 C CD2 . TRP B 2 148 ? 1.655   22.634  3.084   1.00 33.69  ? 148  TRP L CD2 1 
ATOM   2809 N NE1 . TRP B 2 148 ? 2.497   22.192  5.117   1.00 31.84  ? 148  TRP L NE1 1 
ATOM   2810 C CE2 . TRP B 2 148 ? 2.780   22.139  3.775   1.00 32.63  ? 148  TRP L CE2 1 
ATOM   2811 C CE3 . TRP B 2 148 ? 1.686   22.685  1.677   1.00 34.50  ? 148  TRP L CE3 1 
ATOM   2812 C CZ2 . TRP B 2 148 ? 3.944   21.722  3.110   1.00 31.25  ? 148  TRP L CZ2 1 
ATOM   2813 C CZ3 . TRP B 2 148 ? 2.839   22.255  1.014   1.00 33.26  ? 148  TRP L CZ3 1 
ATOM   2814 C CH2 . TRP B 2 148 ? 3.951   21.792  1.733   1.00 31.79  ? 148  TRP L CH2 1 
ATOM   2815 N N   . LYS B 2 149 ? -1.889  25.889  1.912   1.00 39.64  ? 149  LYS L N   1 
ATOM   2816 C CA  . LYS B 2 149 ? -3.030  26.291  1.111   1.00 42.59  ? 149  LYS L CA  1 
ATOM   2817 C C   . LYS B 2 149 ? -3.111  25.421  -0.134  1.00 43.17  ? 149  LYS L C   1 
ATOM   2818 O O   . LYS B 2 149 ? -2.106  25.182  -0.801  1.00 40.54  ? 149  LYS L O   1 
ATOM   2819 C CB  . LYS B 2 149 ? -2.914  27.762  0.738   1.00 43.89  ? 149  LYS L CB  1 
ATOM   2820 C CG  . LYS B 2 149 ? -3.511  28.664  1.785   1.00 46.65  ? 149  LYS L CG  1 
ATOM   2821 C CD  . LYS B 2 149 ? -3.023  30.092  1.650   1.00 48.20  ? 149  LYS L CD  1 
ATOM   2822 C CE  . LYS B 2 149 ? -3.989  31.036  2.344   1.00 49.85  ? 149  LYS L CE  1 
ATOM   2823 N NZ  . LYS B 2 149 ? -3.277  31.965  3.263   1.00 50.57  ? 149  LYS L NZ  1 
ATOM   2824 N N   . ILE B 2 150 ? -4.317  24.934  -0.426  1.00 45.39  ? 150  ILE L N   1 
ATOM   2825 C CA  . ILE B 2 150 ? -4.566  24.146  -1.621  1.00 46.87  ? 150  ILE L CA  1 
ATOM   2826 C C   . ILE B 2 150 ? -5.618  24.905  -2.412  1.00 50.44  ? 150  ILE L C   1 
ATOM   2827 O O   . ILE B 2 150 ? -6.704  25.182  -1.890  1.00 52.27  ? 150  ILE L O   1 
ATOM   2828 C CB  . ILE B 2 150 ? -5.090  22.724  -1.310  1.00 47.50  ? 150  ILE L CB  1 
ATOM   2829 C CG1 . ILE B 2 150 ? -4.088  21.918  -0.466  1.00 44.96  ? 150  ILE L CG1 1 
ATOM   2830 C CG2 . ILE B 2 150 ? -5.413  21.990  -2.604  1.00 49.30  ? 150  ILE L CG2 1 
ATOM   2831 C CD1 . ILE B 2 150 ? -4.561  20.507  -0.164  1.00 45.54  ? 150  ILE L CD1 1 
ATOM   2832 N N   . ASP B 2 151 ? -5.289  25.265  -3.651  1.00 51.37  ? 151  ASP L N   1 
ATOM   2833 C CA  . ASP B 2 151 ? -6.146  26.152  -4.432  1.00 54.93  ? 151  ASP L CA  1 
ATOM   2834 C C   . ASP B 2 151 ? -6.620  27.354  -3.600  1.00 56.12  ? 151  ASP L C   1 
ATOM   2835 O O   . ASP B 2 151 ? -7.759  27.803  -3.732  1.00 58.51  ? 151  ASP L O   1 
ATOM   2836 C CB  . ASP B 2 151 ? -7.321  25.357  -4.965  1.00 57.77  ? 151  ASP L CB  1 
ATOM   2837 C CG  . ASP B 2 151 ? -6.936  24.473  -6.119  1.00 58.28  ? 151  ASP L CG  1 
ATOM   2838 O OD1 . ASP B 2 151 ? -5.841  24.671  -6.682  1.00 56.39  ? 151  ASP L OD1 1 
ATOM   2839 O OD2 . ASP B 2 151 ? -7.747  23.595  -6.484  1.00 60.90  ? 151  ASP L OD2 1 
ATOM   2840 N N   . GLY B 2 152 ? -5.746  27.844  -2.721  1.00 53.37  ? 152  GLY L N   1 
ATOM   2841 C CA  . GLY B 2 152 ? -6.054  29.005  -1.877  1.00 55.77  ? 152  GLY L CA  1 
ATOM   2842 C C   . GLY B 2 152 ? -6.786  28.772  -0.553  1.00 56.44  ? 152  GLY L C   1 
ATOM   2843 O O   . GLY B 2 152 ? -6.908  29.682  0.266   1.00 56.45  ? 152  GLY L O   1 
ATOM   2844 N N   . SER B 2 153 ? -7.274  27.558  -0.330  1.00 57.58  ? 153  SER L N   1 
ATOM   2845 C CA  . SER B 2 153 ? -7.965  27.233  0.922   1.00 58.28  ? 153  SER L CA  1 
ATOM   2846 C C   . SER B 2 153 ? -7.000  26.581  1.937   1.00 54.90  ? 153  SER L C   1 
ATOM   2847 O O   . SER B 2 153 ? -6.364  25.582  1.625   1.00 52.15  ? 153  SER L O   1 
ATOM   2848 C CB  . SER B 2 153 ? -9.171  26.325  0.613   1.00 61.68  ? 153  SER L CB  1 
ATOM   2849 O OG  . SER B 2 153 ? -9.700  25.708  1.774   1.00 63.44  ? 153  SER L OG  1 
ATOM   2850 N N   . GLU B 2 154 ? -6.907  27.145  3.142   1.00 54.11  ? 154  GLU L N   1 
ATOM   2851 C CA  . GLU B 2 154 ? -6.054  26.573  4.185   1.00 52.82  ? 154  GLU L CA  1 
ATOM   2852 C C   . GLU B 2 154 ? -6.404  25.125  4.533   1.00 52.83  ? 154  GLU L C   1 
ATOM   2853 O O   . GLU B 2 154 ? -7.560  24.798  4.807   1.00 54.66  ? 154  GLU L O   1 
ATOM   2854 C CB  . GLU B 2 154 ? -6.035  27.427  5.461   1.00 53.86  ? 154  GLU L CB  1 
ATOM   2855 C CG  . GLU B 2 154 ? -5.614  26.612  6.687   1.00 54.28  ? 154  GLU L CG  1 
ATOM   2856 C CD  . GLU B 2 154 ? -4.843  27.388  7.732   1.00 53.65  ? 154  GLU L CD  1 
ATOM   2857 O OE1 . GLU B 2 154 ? -5.171  28.576  7.960   1.00 55.26  ? 154  GLU L OE1 1 
ATOM   2858 O OE2 . GLU B 2 154 ? -3.922  26.786  8.338   1.00 51.62  ? 154  GLU L OE2 1 
ATOM   2859 N N   . ARG B 2 155 ? -5.375  24.282  4.541   1.00 50.74  ? 155  ARG L N   1 
ATOM   2860 C CA  . ARG B 2 155 ? -5.490  22.872  4.867   1.00 51.66  ? 155  ARG L CA  1 
ATOM   2861 C C   . ARG B 2 155 ? -4.646  22.554  6.102   1.00 51.03  ? 155  ARG L C   1 
ATOM   2862 O O   . ARG B 2 155 ? -3.465  22.862  6.138   1.00 47.18  ? 155  ARG L O   1 
ATOM   2863 C CB  . ARG B 2 155 ? -5.009  22.045  3.682   1.00 51.68  ? 155  ARG L CB  1 
ATOM   2864 C CG  . ARG B 2 155 ? -4.900  20.564  3.965   1.00 51.98  ? 155  ARG L CG  1 
ATOM   2865 C CD  . ARG B 2 155 ? -6.198  19.842  3.700   1.00 55.84  ? 155  ARG L CD  1 
ATOM   2866 N NE  . ARG B 2 155 ? -5.992  18.416  3.880   1.00 56.29  ? 155  ARG L NE  1 
ATOM   2867 C CZ  . ARG B 2 155 ? -6.851  17.477  3.502   1.00 59.19  ? 155  ARG L CZ  1 
ATOM   2868 N NH1 . ARG B 2 155 ? -8.001  17.801  2.903   1.00 61.43  ? 155  ARG L NH1 1 
ATOM   2869 N NH2 . ARG B 2 155 ? -6.544  16.206  3.715   1.00 58.88  ? 155  ARG L NH2 1 
ATOM   2870 N N   . GLN B 2 156 ? -5.265  21.935  7.107   1.00 54.15  ? 156  GLN L N   1 
ATOM   2871 C CA  . GLN B 2 156 ? -4.591  21.657  8.380   1.00 53.39  ? 156  GLN L CA  1 
ATOM   2872 C C   . GLN B 2 156 ? -4.423  20.166  8.627   1.00 52.81  ? 156  GLN L C   1 
ATOM   2873 O O   . GLN B 2 156 ? -3.389  19.742  9.150   1.00 50.60  ? 156  GLN L O   1 
ATOM   2874 C CB  . GLN B 2 156 ? -5.354  22.272  9.549   1.00 56.34  ? 156  GLN L CB  1 
ATOM   2875 C CG  . GLN B 2 156 ? -5.946  23.642  9.267   1.00 59.01  ? 156  GLN L CG  1 
ATOM   2876 C CD  . GLN B 2 156 ? -6.614  24.214  10.486  1.00 61.95  ? 156  GLN L CD  1 
ATOM   2877 O OE1 . GLN B 2 156 ? -7.846  24.264  10.572  1.00 65.18  ? 156  GLN L OE1 1 
ATOM   2878 N NE2 . GLN B 2 156 ? -5.807  24.612  11.465  1.00 61.04  ? 156  GLN L NE2 1 
ATOM   2879 N N   . ASN B 2 157 ? -5.431  19.378  8.250   1.00 53.23  ? 157  ASN L N   1 
ATOM   2880 C CA  . ASN B 2 157 ? -5.361  17.921  8.365   1.00 53.81  ? 157  ASN L CA  1 
ATOM   2881 C C   . ASN B 2 157 ? -4.234  17.343  7.521   1.00 50.26  ? 157  ASN L C   1 
ATOM   2882 O O   . ASN B 2 157 ? -4.131  17.671  6.334   1.00 49.38  ? 157  ASN L O   1 
ATOM   2883 C CB  . ASN B 2 157 ? -6.671  17.277  7.920   1.00 58.08  ? 157  ASN L CB  1 
ATOM   2884 C CG  . ASN B 2 157 ? -7.852  17.708  8.764   1.00 62.73  ? 157  ASN L CG  1 
ATOM   2885 O OD1 . ASN B 2 157 ? -7.682  18.262  9.847   1.00 64.49  ? 157  ASN L OD1 1 
ATOM   2886 N ND2 . ASN B 2 157 ? -9.057  17.445  8.275   1.00 67.06  ? 157  ASN L ND2 1 
ATOM   2887 N N   . GLY B 2 158 ? -3.413  16.490  8.142   1.00 48.14  ? 158  GLY L N   1 
ATOM   2888 C CA  . GLY B 2 158 ? -2.384  15.710  7.455   1.00 45.05  ? 158  GLY L CA  1 
ATOM   2889 C C   . GLY B 2 158 ? -1.037  16.403  7.362   1.00 42.51  ? 158  GLY L C   1 
ATOM   2890 O O   . GLY B 2 158 ? -0.206  16.044  6.532   1.00 39.33  ? 158  GLY L O   1 
ATOM   2891 N N   . VAL B 2 159 ? -0.840  17.402  8.215   1.00 41.69  ? 159  VAL L N   1 
ATOM   2892 C CA  . VAL B 2 159 ? 0.349   18.220  8.204   1.00 39.91  ? 159  VAL L CA  1 
ATOM   2893 C C   . VAL B 2 159 ? 1.229   17.794  9.383   1.00 39.92  ? 159  VAL L C   1 
ATOM   2894 O O   . VAL B 2 159 ? 0.755   17.679  10.516  1.00 41.75  ? 159  VAL L O   1 
ATOM   2895 C CB  . VAL B 2 159 ? 0.014   19.742  8.236   1.00 40.07  ? 159  VAL L CB  1 
ATOM   2896 C CG1 . VAL B 2 159 ? 1.281   20.592  8.330   1.00 36.62  ? 159  VAL L CG1 1 
ATOM   2897 C CG2 . VAL B 2 159 ? -0.774  20.133  6.992   1.00 40.38  ? 159  VAL L CG2 1 
ATOM   2898 N N   . LEU B 2 160 ? 2.486   17.509  9.079   1.00 36.74  ? 160  LEU L N   1 
ATOM   2899 C CA  . LEU B 2 160 ? 3.493   17.134  10.067  1.00 36.50  ? 160  LEU L CA  1 
ATOM   2900 C C   . LEU B 2 160 ? 4.664   18.099  9.963   1.00 34.87  ? 160  LEU L C   1 
ATOM   2901 O O   . LEU B 2 160 ? 5.199   18.325  8.868   1.00 34.89  ? 160  LEU L O   1 
ATOM   2902 C CB  . LEU B 2 160 ? 3.964   15.678  9.850   1.00 35.78  ? 160  LEU L CB  1 
ATOM   2903 C CG  . LEU B 2 160 ? 2.975   14.523  10.149  1.00 39.61  ? 160  LEU L CG  1 
ATOM   2904 C CD1 . LEU B 2 160 ? 3.661   13.168  9.922   1.00 39.24  ? 160  LEU L CD1 1 
ATOM   2905 C CD2 . LEU B 2 160 ? 2.308   14.580  11.530  1.00 40.37  ? 160  LEU L CD2 1 
ATOM   2906 N N   . ASN B 2 161 ? 5.059   18.656  11.109  1.00 34.02  ? 161  ASN L N   1 
ATOM   2907 C CA  . ASN B 2 161 ? 6.156   19.614  11.204  1.00 31.09  ? 161  ASN L CA  1 
ATOM   2908 C C   . ASN B 2 161 ? 7.260   19.160  12.136  1.00 30.96  ? 161  ASN L C   1 
ATOM   2909 O O   . ASN B 2 161 ? 6.982   18.607  13.207  1.00 31.03  ? 161  ASN L O   1 
ATOM   2910 C CB  . ASN B 2 161 ? 5.640   20.944  11.746  1.00 30.96  ? 161  ASN L CB  1 
ATOM   2911 C CG  . ASN B 2 161 ? 4.526   21.512  10.905  1.00 31.96  ? 161  ASN L CG  1 
ATOM   2912 O OD1 . ASN B 2 161 ? 4.635   21.586  9.675   1.00 31.06  ? 161  ASN L OD1 1 
ATOM   2913 N ND2 . ASN B 2 161 ? 3.443   21.894  11.552  1.00 33.28  ? 161  ASN L ND2 1 
ATOM   2914 N N   . SER B 2 162 ? 8.506   19.411  11.753  1.00 29.17  ? 162  SER L N   1 
ATOM   2915 C CA  . SER B 2 162 ? 9.580   19.281  12.720  1.00 31.12  ? 162  SER L CA  1 
ATOM   2916 C C   . SER B 2 162 ? 10.665  20.316  12.521  1.00 30.52  ? 162  SER L C   1 
ATOM   2917 O O   . SER B 2 162 ? 10.830  20.867  11.426  1.00 29.28  ? 162  SER L O   1 
ATOM   2918 C CB  . SER B 2 162 ? 10.131  17.845  12.807  1.00 32.09  ? 162  SER L CB  1 
ATOM   2919 O OG  . SER B 2 162 ? 11.031  17.606  11.777  1.00 34.06  ? 162  SER L OG  1 
ATOM   2920 N N   . TRP B 2 163 ? 11.379  20.595  13.610  1.00 31.86  ? 163  TRP L N   1 
ATOM   2921 C CA  . TRP B 2 163 ? 12.376  21.650  13.672  1.00 32.91  ? 163  TRP L CA  1 
ATOM   2922 C C   . TRP B 2 163 ? 13.705  21.014  14.038  1.00 31.35  ? 163  TRP L C   1 
ATOM   2923 O O   . TRP B 2 163 ? 13.748  20.157  14.933  1.00 31.42  ? 163  TRP L O   1 
ATOM   2924 C CB  . TRP B 2 163 ? 11.979  22.684  14.755  1.00 36.74  ? 163  TRP L CB  1 
ATOM   2925 C CG  . TRP B 2 163 ? 10.627  23.308  14.519  1.00 41.21  ? 163  TRP L CG  1 
ATOM   2926 C CD1 . TRP B 2 163 ? 10.382  24.551  13.995  1.00 42.78  ? 163  TRP L CD1 1 
ATOM   2927 C CD2 . TRP B 2 163 ? 9.339   22.717  14.776  1.00 42.05  ? 163  TRP L CD2 1 
ATOM   2928 N NE1 . TRP B 2 163 ? 9.019   24.762  13.895  1.00 44.47  ? 163  TRP L NE1 1 
ATOM   2929 C CE2 . TRP B 2 163 ? 8.358   23.658  14.369  1.00 44.62  ? 163  TRP L CE2 1 
ATOM   2930 C CE3 . TRP B 2 163 ? 8.917   21.482  15.301  1.00 43.65  ? 163  TRP L CE3 1 
ATOM   2931 C CZ2 . TRP B 2 163 ? 6.981   23.411  14.491  1.00 44.86  ? 163  TRP L CZ2 1 
ATOM   2932 C CZ3 . TRP B 2 163 ? 7.546   21.230  15.421  1.00 45.11  ? 163  TRP L CZ3 1 
ATOM   2933 C CH2 . TRP B 2 163 ? 6.595   22.193  15.012  1.00 46.81  ? 163  TRP L CH2 1 
ATOM   2934 N N   . THR B 2 164 ? 14.778  21.409  13.354  1.00 29.36  ? 164  THR L N   1 
ATOM   2935 C CA  . THR B 2 164 ? 16.115  21.082  13.839  1.00 30.27  ? 164  THR L CA  1 
ATOM   2936 C C   . THR B 2 164 ? 16.456  21.870  15.134  1.00 30.87  ? 164  THR L C   1 
ATOM   2937 O O   . THR B 2 164 ? 15.787  22.853  15.500  1.00 29.44  ? 164  THR L O   1 
ATOM   2938 C CB  . THR B 2 164 ? 17.219  21.355  12.795  1.00 30.86  ? 164  THR L CB  1 
ATOM   2939 O OG1 . THR B 2 164 ? 17.219  22.750  12.432  1.00 30.89  ? 164  THR L OG1 1 
ATOM   2940 C CG2 . THR B 2 164 ? 17.051  20.500  11.550  1.00 30.52  ? 164  THR L CG2 1 
ATOM   2941 N N   . ASP B 2 165 ? 17.485  21.415  15.839  1.00 30.97  ? 165  ASP L N   1 
ATOM   2942 C CA  . ASP B 2 165 ? 18.083  22.237  16.885  1.00 33.00  ? 165  ASP L CA  1 
ATOM   2943 C C   . ASP B 2 165 ? 19.010  23.238  16.251  1.00 30.44  ? 165  ASP L C   1 
ATOM   2944 O O   . ASP B 2 165 ? 19.330  23.111  15.065  1.00 29.87  ? 165  ASP L O   1 
ATOM   2945 C CB  . ASP B 2 165 ? 18.829  21.347  17.873  1.00 36.71  ? 165  ASP L CB  1 
ATOM   2946 C CG  . ASP B 2 165 ? 17.883  20.490  18.652  1.00 40.50  ? 165  ASP L CG  1 
ATOM   2947 O OD1 . ASP B 2 165 ? 17.197  21.026  19.550  1.00 46.78  ? 165  ASP L OD1 1 
ATOM   2948 O OD2 . ASP B 2 165 ? 17.782  19.300  18.326  1.00 44.14  ? 165  ASP L OD2 1 
ATOM   2949 N N   . GLN B 2 166 ? 19.442  24.219  17.040  1.00 30.02  ? 166  GLN L N   1 
ATOM   2950 C CA  . GLN B 2 166 ? 20.272  25.319  16.542  1.00 29.50  ? 166  GLN L CA  1 
ATOM   2951 C C   . GLN B 2 166 ? 21.575  24.833  15.898  1.00 31.54  ? 166  GLN L C   1 
ATOM   2952 O O   . GLN B 2 166 ? 22.269  23.976  16.454  1.00 32.16  ? 166  GLN L O   1 
ATOM   2953 C CB  . GLN B 2 166 ? 20.564  26.277  17.683  1.00 29.31  ? 166  GLN L CB  1 
ATOM   2954 C CG  . GLN B 2 166 ? 21.166  27.583  17.215  1.00 29.12  ? 166  GLN L CG  1 
ATOM   2955 C CD  . GLN B 2 166 ? 21.176  28.664  18.275  1.00 30.28  ? 166  GLN L CD  1 
ATOM   2956 O OE1 . GLN B 2 166 ? 20.832  29.825  17.988  1.00 30.64  ? 166  GLN L OE1 1 
ATOM   2957 N NE2 . GLN B 2 166 ? 21.591  28.316  19.483  1.00 29.94  ? 166  GLN L NE2 1 
ATOM   2958 N N   . ASP B 2 167 ? 21.916  25.392  14.743  1.00 31.74  ? 167  ASP L N   1 
ATOM   2959 C CA  . ASP B 2 167 ? 23.099  24.949  13.975  1.00 33.95  ? 167  ASP L CA  1 
ATOM   2960 C C   . ASP B 2 167 ? 24.417  25.369  14.623  1.00 35.76  ? 167  ASP L C   1 
ATOM   2961 O O   . ASP B 2 167 ? 24.590  26.523  14.991  1.00 34.67  ? 167  ASP L O   1 
ATOM   2962 C CB  . ASP B 2 167 ? 22.983  25.456  12.522  1.00 34.47  ? 167  ASP L CB  1 
ATOM   2963 C CG  . ASP B 2 167 ? 24.045  24.886  11.619  1.00 36.43  ? 167  ASP L CG  1 
ATOM   2964 O OD1 . ASP B 2 167 ? 25.135  25.482  11.521  1.00 39.90  ? 167  ASP L OD1 1 
ATOM   2965 O OD2 . ASP B 2 167 ? 23.774  23.845  11.011  1.00 38.25  ? 167  ASP L OD2 1 
ATOM   2966 N N   . SER B 2 168 ? 25.362  24.436  14.767  1.00 39.16  ? 168  SER L N   1 
ATOM   2967 C CA  . SER B 2 168 ? 26.627  24.731  15.514  1.00 43.08  ? 168  SER L CA  1 
ATOM   2968 C C   . SER B 2 168 ? 27.610  25.662  14.797  1.00 43.96  ? 168  SER L C   1 
ATOM   2969 O O   . SER B 2 168 ? 28.519  26.221  15.427  1.00 46.98  ? 168  SER L O   1 
ATOM   2970 C CB  . SER B 2 168 ? 27.345  23.437  15.951  1.00 44.84  ? 168  SER L CB  1 
ATOM   2971 O OG  . SER B 2 168 ? 27.488  22.547  14.855  1.00 45.90  ? 168  SER L OG  1 
ATOM   2972 N N   . LYS B 2 169 ? 27.417  25.808  13.486  1.00 44.14  ? 169  LYS L N   1 
ATOM   2973 C CA  . LYS B 2 169 ? 28.233  26.697  12.641  1.00 45.18  ? 169  LYS L CA  1 
ATOM   2974 C C   . LYS B 2 169 ? 27.624  28.087  12.540  1.00 42.78  ? 169  LYS L C   1 
ATOM   2975 O O   . LYS B 2 169 ? 28.288  29.084  12.868  1.00 45.14  ? 169  LYS L O   1 
ATOM   2976 C CB  . LYS B 2 169 ? 28.431  26.095  11.239  1.00 47.22  ? 169  LYS L CB  1 
ATOM   2977 C CG  . LYS B 2 169 ? 29.455  24.965  11.190  1.00 51.58  ? 169  LYS L CG  1 
ATOM   2978 C CD  . LYS B 2 169 ? 29.218  24.053  9.992   1.00 52.59  ? 169  LYS L CD  1 
ATOM   2979 C CE  . LYS B 2 169 ? 29.884  22.700  10.175  1.00 54.97  ? 169  LYS L CE  1 
ATOM   2980 N NZ  . LYS B 2 169 ? 31.344  22.892  10.400  1.00 57.95  ? 169  LYS L NZ  1 
ATOM   2981 N N   . ASP B 2 170 ? 26.359  28.149  12.122  1.00 38.02  ? 170  ASP L N   1 
ATOM   2982 C CA  . ASP B 2 170 ? 25.725  29.427  11.858  1.00 36.25  ? 170  ASP L CA  1 
ATOM   2983 C C   . ASP B 2 170 ? 24.627  29.862  12.842  1.00 33.34  ? 170  ASP L C   1 
ATOM   2984 O O   . ASP B 2 170 ? 24.101  30.942  12.694  1.00 32.03  ? 170  ASP L O   1 
ATOM   2985 C CB  . ASP B 2 170 ? 25.272  29.546  10.382  1.00 35.17  ? 170  ASP L CB  1 
ATOM   2986 C CG  . ASP B 2 170 ? 23.984  28.805  10.066  1.00 33.69  ? 170  ASP L CG  1 
ATOM   2987 O OD1 . ASP B 2 170 ? 23.372  28.125  10.937  1.00 33.18  ? 170  ASP L OD1 1 
ATOM   2988 O OD2 . ASP B 2 170 ? 23.556  28.905  8.894   1.00 31.74  ? 170  ASP L OD2 1 
ATOM   2989 N N   . SER B 2 171 ? 24.317  29.031  13.844  1.00 31.65  ? 171  SER L N   1 
ATOM   2990 C CA  . SER B 2 171 ? 23.335  29.380  14.914  1.00 29.38  ? 171  SER L CA  1 
ATOM   2991 C C   . SER B 2 171 ? 21.882  29.613  14.421  1.00 26.81  ? 171  SER L C   1 
ATOM   2992 O O   . SER B 2 171 ? 21.075  30.237  15.121  1.00 26.25  ? 171  SER L O   1 
ATOM   2993 C CB  . SER B 2 171 ? 23.794  30.582  15.745  1.00 30.36  ? 171  SER L CB  1 
ATOM   2994 O OG  . SER B 2 171 ? 25.003  30.355  16.475  1.00 31.40  ? 171  SER L OG  1 
ATOM   2995 N N   . THR B 2 172 ? 21.561  29.109  13.237  1.00 25.28  ? 172  THR L N   1 
ATOM   2996 C CA  . THR B 2 172 ? 20.197  29.196  12.702  1.00 23.83  ? 172  THR L CA  1 
ATOM   2997 C C   . THR B 2 172 ? 19.397  27.936  13.034  1.00 23.59  ? 172  THR L C   1 
ATOM   2998 O O   . THR B 2 172 ? 19.957  26.962  13.553  1.00 23.92  ? 172  THR L O   1 
ATOM   2999 C CB  . THR B 2 172 ? 20.227  29.374  11.173  1.00 23.51  ? 172  THR L CB  1 
ATOM   3000 O OG1 . THR B 2 172 ? 20.856  28.231  10.568  1.00 24.40  ? 172  THR L OG1 1 
ATOM   3001 C CG2 . THR B 2 172 ? 21.036  30.625  10.794  1.00 24.85  ? 172  THR L CG2 1 
ATOM   3002 N N   . TYR B 2 173 ? 18.094  27.964  12.728  1.00 22.84  ? 173  TYR L N   1 
ATOM   3003 C CA  . TYR B 2 173 ? 17.203  26.831  12.824  1.00 22.89  ? 173  TYR L CA  1 
ATOM   3004 C C   . TYR B 2 173 ? 16.658  26.538  11.425  1.00 23.07  ? 173  TYR L C   1 
ATOM   3005 O O   . TYR B 2 173 ? 16.703  27.410  10.517  1.00 22.55  ? 173  TYR L O   1 
ATOM   3006 C CB  . TYR B 2 173 ? 16.022  27.135  13.764  1.00 22.51  ? 173  TYR L CB  1 
ATOM   3007 C CG  . TYR B 2 173 ? 16.455  27.450  15.193  1.00 22.89  ? 173  TYR L CG  1 
ATOM   3008 C CD1 . TYR B 2 173 ? 16.820  28.745  15.572  1.00 22.91  ? 173  TYR L CD1 1 
ATOM   3009 C CD2 . TYR B 2 173 ? 16.481  26.447  16.156  1.00 23.17  ? 173  TYR L CD2 1 
ATOM   3010 C CE1 . TYR B 2 173 ? 17.221  29.030  16.882  1.00 23.83  ? 173  TYR L CE1 1 
ATOM   3011 C CE2 . TYR B 2 173 ? 16.860  26.717  17.463  1.00 23.77  ? 173  TYR L CE2 1 
ATOM   3012 C CZ  . TYR B 2 173 ? 17.228  27.996  17.820  1.00 24.24  ? 173  TYR L CZ  1 
ATOM   3013 O OH  . TYR B 2 173 ? 17.610  28.202  19.125  1.00 25.12  ? 173  TYR L OH  1 
ATOM   3014 N N   . SER B 2 174 ? 16.162  25.315  11.254  1.00 22.65  ? 174  SER L N   1 
ATOM   3015 C CA  . SER B 2 174 ? 15.531  24.897  10.015  1.00 22.79  ? 174  SER L CA  1 
ATOM   3016 C C   . SER B 2 174 ? 14.262  24.162  10.403  1.00 23.15  ? 174  SER L C   1 
ATOM   3017 O O   . SER B 2 174 ? 14.136  23.726  11.550  1.00 24.36  ? 174  SER L O   1 
ATOM   3018 C CB  . SER B 2 174 ? 16.489  24.018  9.198   1.00 22.82  ? 174  SER L CB  1 
ATOM   3019 O OG  . SER B 2 174 ? 17.615  24.779  8.727   1.00 22.80  ? 174  SER L OG  1 
ATOM   3020 N N   . MET B 2 175 ? 13.295  24.088  9.488   1.00 23.55  ? 175  MET L N   1 
ATOM   3021 C CA  . MET B 2 175 ? 11.998  23.470  9.759   1.00 24.11  ? 175  MET L CA  1 
ATOM   3022 C C   . MET B 2 175 ? 11.560  22.721  8.502   1.00 24.41  ? 175  MET L C   1 
ATOM   3023 O O   . MET B 2 175 ? 11.859  23.128  7.385   1.00 24.15  ? 175  MET L O   1 
ATOM   3024 C CB  . MET B 2 175 ? 10.917  24.498  10.145  1.00 25.05  ? 175  MET L CB  1 
ATOM   3025 C CG  . MET B 2 175 ? 9.508   23.902  10.277  1.00 26.27  ? 175  MET L CG  1 
ATOM   3026 S SD  . MET B 2 175 ? 8.313   25.216  10.544  1.00 28.99  ? 175  MET L SD  1 
ATOM   3027 C CE  . MET B 2 175 ? 6.779   24.351  10.899  1.00 29.62  ? 175  MET L CE  1 
ATOM   3028 N N   . SER B 2 176 ? 10.865  21.613  8.714   1.00 24.60  ? 176  SER L N   1 
ATOM   3029 C CA  . SER B 2 176 ? 10.326  20.810  7.629   1.00 25.26  ? 176  SER L CA  1 
ATOM   3030 C C   . SER B 2 176 ? 8.837   20.615  7.889   1.00 25.31  ? 176  SER L C   1 
ATOM   3031 O O   . SER B 2 176 ? 8.410   20.344  9.000   1.00 27.23  ? 176  SER L O   1 
ATOM   3032 C CB  . SER B 2 176 ? 11.020  19.442  7.532   1.00 25.65  ? 176  SER L CB  1 
ATOM   3033 O OG  . SER B 2 176 ? 10.421  18.652  6.500   1.00 27.70  ? 176  SER L OG  1 
ATOM   3034 N N   . SER B 2 177 ? 8.046   20.783  6.848   1.00 26.04  ? 177  SER L N   1 
ATOM   3035 C CA  . SER B 2 177 ? 6.607   20.587  6.931   1.00 26.71  ? 177  SER L CA  1 
ATOM   3036 C C   . SER B 2 177 ? 6.171   19.695  5.763   1.00 28.09  ? 177  SER L C   1 
ATOM   3037 O O   . SER B 2 177 ? 6.501   19.959  4.601   1.00 28.61  ? 177  SER L O   1 
ATOM   3038 C CB  . SER B 2 177 ? 5.911   21.942  6.873   1.00 27.06  ? 177  SER L CB  1 
ATOM   3039 O OG  . SER B 2 177 ? 4.527   21.786  7.016   1.00 28.38  ? 177  SER L OG  1 
ATOM   3040 N N   . THR B 2 178 ? 5.472   18.618  6.091   1.00 28.99  ? 178  THR L N   1 
ATOM   3041 C CA  . THR B 2 178 ? 4.989   17.670  5.109   1.00 29.75  ? 178  THR L CA  1 
ATOM   3042 C C   . THR B 2 178 ? 3.473   17.572  5.198   1.00 31.82  ? 178  THR L C   1 
ATOM   3043 O O   . THR B 2 178 ? 2.900   17.224  6.240   1.00 32.40  ? 178  THR L O   1 
ATOM   3044 C CB  . THR B 2 178 ? 5.572   16.268  5.332   1.00 30.19  ? 178  THR L CB  1 
ATOM   3045 O OG1 . THR B 2 178 ? 7.006   16.319  5.305   1.00 29.06  ? 178  THR L OG1 1 
ATOM   3046 C CG2 . THR B 2 178 ? 5.083   15.289  4.241   1.00 30.01  ? 178  THR L CG2 1 
ATOM   3047 N N   . LEU B 2 179 ? 2.828   17.875  4.084   1.00 32.35  ? 179  LEU L N   1 
ATOM   3048 C CA  . LEU B 2 179 ? 1.390   17.659  3.950   1.00 33.99  ? 179  LEU L CA  1 
ATOM   3049 C C   . LEU B 2 179 ? 1.150   16.369  3.154   1.00 35.01  ? 179  LEU L C   1 
ATOM   3050 O O   . LEU B 2 179 ? 1.627   16.251  2.020   1.00 34.78  ? 179  LEU L O   1 
ATOM   3051 C CB  . LEU B 2 179 ? 0.741   18.855  3.256   1.00 34.35  ? 179  LEU L CB  1 
ATOM   3052 C CG  . LEU B 2 179 ? -0.709  18.659  2.766   1.00 36.23  ? 179  LEU L CG  1 
ATOM   3053 C CD1 . LEU B 2 179 ? -1.681  18.691  3.934   1.00 37.58  ? 179  LEU L CD1 1 
ATOM   3054 C CD2 . LEU B 2 179 ? -1.047  19.700  1.718   1.00 36.95  ? 179  LEU L CD2 1 
ATOM   3055 N N   . THR B 2 180 ? 0.446   15.405  3.757   1.00 35.86  ? 180  THR L N   1 
ATOM   3056 C CA  . THR B 2 180 ? 0.156   14.143  3.080   1.00 38.25  ? 180  THR L CA  1 
ATOM   3057 C C   . THR B 2 180 ? -1.324  14.069  2.757   1.00 40.86  ? 180  THR L C   1 
ATOM   3058 O O   . THR B 2 180 ? -2.187  14.292  3.616   1.00 43.75  ? 180  THR L O   1 
ATOM   3059 C CB  . THR B 2 180 ? 0.577   12.894  3.882   1.00 37.49  ? 180  THR L CB  1 
ATOM   3060 O OG1 . THR B 2 180 ? 1.965   12.958  4.137   1.00 36.18  ? 180  THR L OG1 1 
ATOM   3061 C CG2 . THR B 2 180 ? 0.283   11.585  3.098   1.00 39.02  ? 180  THR L CG2 1 
ATOM   3062 N N   . LEU B 2 181 ? -1.585  13.769  1.493   1.00 42.31  ? 181  LEU L N   1 
ATOM   3063 C CA  . LEU B 2 181 ? -2.911  13.600  0.956   1.00 44.69  ? 181  LEU L CA  1 
ATOM   3064 C C   . LEU B 2 181 ? -2.971  12.240  0.277   1.00 46.16  ? 181  LEU L C   1 
ATOM   3065 O O   . LEU B 2 181 ? -1.969  11.531  0.179   1.00 43.65  ? 181  LEU L O   1 
ATOM   3066 C CB  . LEU B 2 181 ? -3.171  14.672  -0.099  1.00 45.66  ? 181  LEU L CB  1 
ATOM   3067 C CG  . LEU B 2 181 ? -3.039  16.153  0.221   1.00 45.27  ? 181  LEU L CG  1 
ATOM   3068 C CD1 . LEU B 2 181 ? -3.053  16.899  -1.101  1.00 46.52  ? 181  LEU L CD1 1 
ATOM   3069 C CD2 . LEU B 2 181 ? -4.211  16.581  1.088   1.00 46.85  ? 181  LEU L CD2 1 
ATOM   3070 N N   . THR B 2 182 ? -4.150  11.873  -0.189  1.00 48.89  ? 182  THR L N   1 
ATOM   3071 C CA  . THR B 2 182 ? -4.265  10.743  -1.102  1.00 51.31  ? 182  THR L CA  1 
ATOM   3072 C C   . THR B 2 182 ? -3.888  11.197  -2.522  1.00 51.42  ? 182  THR L C   1 
ATOM   3073 O O   . THR B 2 182 ? -3.984  12.383  -2.842  1.00 51.43  ? 182  THR L O   1 
ATOM   3074 C CB  . THR B 2 182 ? -5.686  10.139  -1.085  1.00 54.51  ? 182  THR L CB  1 
ATOM   3075 O OG1 . THR B 2 182 ? -6.642  11.145  -1.428  1.00 57.94  ? 182  THR L OG1 1 
ATOM   3076 C CG2 . THR B 2 182 ? -6.026  9.608   0.299   1.00 54.79  ? 182  THR L CG2 1 
ATOM   3077 N N   . LYS B 2 183 ? -3.440  10.257  -3.357  1.00 51.74  ? 183  LYS L N   1 
ATOM   3078 C CA  . LYS B 2 183 ? -3.216  10.521  -4.775  1.00 53.15  ? 183  LYS L CA  1 
ATOM   3079 C C   . LYS B 2 183 ? -4.487  11.117  -5.386  1.00 56.82  ? 183  LYS L C   1 
ATOM   3080 O O   . LYS B 2 183 ? -4.424  12.044  -6.197  1.00 57.51  ? 183  LYS L O   1 
ATOM   3081 C CB  . LYS B 2 183 ? -2.841  9.225   -5.504  1.00 53.54  ? 183  LYS L CB  1 
ATOM   3082 C CG  . LYS B 2 183 ? -2.412  9.407   -6.952  1.00 54.37  ? 183  LYS L CG  1 
ATOM   3083 C CD  . LYS B 2 183 ? -2.232  8.056   -7.619  1.00 55.77  ? 183  LYS L CD  1 
ATOM   3084 C CE  . LYS B 2 183 ? -1.752  8.155   -9.061  1.00 56.95  ? 183  LYS L CE  1 
ATOM   3085 N NZ  . LYS B 2 183 ? -2.806  8.641   -9.992  1.00 59.68  ? 183  LYS L NZ  1 
ATOM   3086 N N   . ASP B 2 184 ? -5.644  10.605  -4.977  1.00 59.50  ? 184  ASP L N   1 
ATOM   3087 C CA  . ASP B 2 184 ? -6.905  11.095  -5.524  1.00 63.28  ? 184  ASP L CA  1 
ATOM   3088 C C   . ASP B 2 184 ? -7.194  12.548  -5.183  1.00 63.57  ? 184  ASP L C   1 
ATOM   3089 O O   . ASP B 2 184 ? -7.490  13.330  -6.086  1.00 64.55  ? 184  ASP L O   1 
ATOM   3090 C CB  . ASP B 2 184 ? -8.064  10.181  -5.161  1.00 66.48  ? 184  ASP L CB  1 
ATOM   3091 C CG  . ASP B 2 184 ? -8.271  9.096   -6.194  1.00 69.38  ? 184  ASP L CG  1 
ATOM   3092 O OD1 . ASP B 2 184 ? -7.296  8.740   -6.899  1.00 69.19  ? 184  ASP L OD1 1 
ATOM   3093 O OD2 . ASP B 2 184 ? -9.402  8.602   -6.305  1.00 73.52  ? 184  ASP L OD2 1 
ATOM   3094 N N   . GLU B 2 185 ? -7.071  12.928  -3.911  1.00 61.88  ? 185  GLU L N   1 
ATOM   3095 C CA  . GLU B 2 185 ? -7.310  14.325  -3.556  1.00 63.03  ? 185  GLU L CA  1 
ATOM   3096 C C   . GLU B 2 185 ? -6.230  15.255  -4.090  1.00 60.08  ? 185  GLU L C   1 
ATOM   3097 O O   . GLU B 2 185 ? -6.521  16.395  -4.445  1.00 61.20  ? 185  GLU L O   1 
ATOM   3098 C CB  . GLU B 2 185 ? -7.595  14.546  -2.060  1.00 63.20  ? 185  GLU L CB  1 
ATOM   3099 C CG  . GLU B 2 185 ? -6.583  14.006  -1.067  1.00 62.04  ? 185  GLU L CG  1 
ATOM   3100 C CD  . GLU B 2 185 ? -7.125  13.957  0.363   1.00 63.92  ? 185  GLU L CD  1 
ATOM   3101 O OE1 . GLU B 2 185 ? -8.335  14.245  0.546   1.00 67.59  ? 185  GLU L OE1 1 
ATOM   3102 O OE2 . GLU B 2 185 ? -6.355  13.627  1.308   1.00 61.31  ? 185  GLU L OE2 1 
ATOM   3103 N N   . TYR B 2 186 ? -5.000  14.754  -4.186  1.00 58.05  ? 186  TYR L N   1 
ATOM   3104 C CA  . TYR B 2 186 ? -3.892  15.542  -4.719  1.00 55.92  ? 186  TYR L CA  1 
ATOM   3105 C C   . TYR B 2 186 ? -4.149  15.900  -6.179  1.00 58.46  ? 186  TYR L C   1 
ATOM   3106 O O   . TYR B 2 186 ? -3.861  17.005  -6.617  1.00 58.97  ? 186  TYR L O   1 
ATOM   3107 C CB  . TYR B 2 186 ? -2.542  14.819  -4.556  1.00 52.33  ? 186  TYR L CB  1 
ATOM   3108 C CG  . TYR B 2 186 ? -1.397  15.519  -5.259  1.00 50.15  ? 186  TYR L CG  1 
ATOM   3109 C CD1 . TYR B 2 186 ? -0.877  16.718  -4.768  1.00 48.55  ? 186  TYR L CD1 1 
ATOM   3110 C CD2 . TYR B 2 186 ? -0.860  14.998  -6.434  1.00 51.04  ? 186  TYR L CD2 1 
ATOM   3111 C CE1 . TYR B 2 186 ? 0.162   17.372  -5.418  1.00 47.37  ? 186  TYR L CE1 1 
ATOM   3112 C CE2 . TYR B 2 186 ? 0.172   15.645  -7.094  1.00 49.84  ? 186  TYR L CE2 1 
ATOM   3113 C CZ  . TYR B 2 186 ? 0.672   16.830  -6.585  1.00 48.47  ? 186  TYR L CZ  1 
ATOM   3114 O OH  . TYR B 2 186 ? 1.692   17.463  -7.248  1.00 48.10  ? 186  TYR L OH  1 
ATOM   3115 N N   . GLU B 2 187 ? -4.705  14.960  -6.921  1.00 61.13  ? 187  GLU L N   1 
ATOM   3116 C CA  . GLU B 2 187 ? -4.954  15.171  -8.344  1.00 65.74  ? 187  GLU L CA  1 
ATOM   3117 C C   . GLU B 2 187 ? -6.197  16.020  -8.669  1.00 68.39  ? 187  GLU L C   1 
ATOM   3118 O O   . GLU B 2 187 ? -6.375  16.454  -9.814  1.00 71.35  ? 187  GLU L O   1 
ATOM   3119 C CB  . GLU B 2 187 ? -4.934  13.828  -9.087  1.00 67.70  ? 187  GLU L CB  1 
ATOM   3120 C CG  . GLU B 2 187 ? -3.539  13.214  -9.030  1.00 66.77  ? 187  GLU L CG  1 
ATOM   3121 C CD  . GLU B 2 187 ? -3.444  11.834  -9.640  1.00 68.60  ? 187  GLU L CD  1 
ATOM   3122 O OE1 . GLU B 2 187 ? -4.483  11.278  -10.037 1.00 72.15  ? 187  GLU L OE1 1 
ATOM   3123 O OE2 . GLU B 2 187 ? -2.307  11.309  -9.709  1.00 68.82  ? 187  GLU L OE2 1 
ATOM   3124 N N   . ARG B 2 188 ? -7.039  16.272  -7.668  1.00 68.46  ? 188  ARG L N   1 
ATOM   3125 C CA  . ARG B 2 188 ? -8.244  17.095  -7.870  1.00 71.79  ? 188  ARG L CA  1 
ATOM   3126 C C   . ARG B 2 188 ? -7.879  18.582  -7.853  1.00 70.19  ? 188  ARG L C   1 
ATOM   3127 O O   . ARG B 2 188 ? -8.697  19.437  -8.179  1.00 72.17  ? 188  ARG L O   1 
ATOM   3128 C CB  . ARG B 2 188 ? -9.297  16.813  -6.791  1.00 73.53  ? 188  ARG L CB  1 
ATOM   3129 C CG  . ARG B 2 188 ? -10.249 15.651  -7.068  1.00 78.81  ? 188  ARG L CG  1 
ATOM   3130 C CD  . ARG B 2 188 ? -11.310 15.541  -5.971  1.00 81.66  ? 188  ARG L CD  1 
ATOM   3131 N NE  . ARG B 2 188 ? -10.687 15.377  -4.651  1.00 79.97  ? 188  ARG L NE  1 
ATOM   3132 C CZ  . ARG B 2 188 ? -11.214 15.757  -3.483  1.00 81.04  ? 188  ARG L CZ  1 
ATOM   3133 N NH1 . ARG B 2 188 ? -12.406 16.340  -3.426  1.00 83.89  ? 188  ARG L NH1 1 
ATOM   3134 N NH2 . ARG B 2 188 ? -10.532 15.555  -2.355  1.00 78.20  ? 188  ARG L NH2 1 
ATOM   3135 N N   . HIS B 2 189 ? -6.638  18.882  -7.482  1.00 65.80  ? 189  HIS L N   1 
ATOM   3136 C CA  . HIS B 2 189 ? -6.218  20.271  -7.287  1.00 63.89  ? 189  HIS L CA  1 
ATOM   3137 C C   . HIS B 2 189 ? -4.978  20.656  -8.079  1.00 60.85  ? 189  HIS L C   1 
ATOM   3138 O O   . HIS B 2 189 ? -4.266  19.793  -8.595  1.00 60.22  ? 189  HIS L O   1 
ATOM   3139 C CB  . HIS B 2 189 ? -6.056  20.571  -5.799  1.00 61.93  ? 189  HIS L CB  1 
ATOM   3140 C CG  . HIS B 2 189 ? -7.312  20.362  -5.015  1.00 65.24  ? 189  HIS L CG  1 
ATOM   3141 N ND1 . HIS B 2 189 ? -8.289  21.328  -4.904  1.00 68.52  ? 189  HIS L ND1 1 
ATOM   3142 C CD2 . HIS B 2 189 ? -7.769  19.285  -4.335  1.00 66.16  ? 189  HIS L CD2 1 
ATOM   3143 C CE1 . HIS B 2 189 ? -9.289  20.862  -4.178  1.00 70.16  ? 189  HIS L CE1 1 
ATOM   3144 N NE2 . HIS B 2 189 ? -8.998  19.624  -3.819  1.00 69.36  ? 189  HIS L NE2 1 
ATOM   3145 N N   . ASN B 2 190 ? -4.741  21.962  -8.174  1.00 59.94  ? 190  ASN L N   1 
ATOM   3146 C CA  . ASN B 2 190 ? -3.644  22.505  -8.967  1.00 58.86  ? 190  ASN L CA  1 
ATOM   3147 C C   . ASN B 2 190 ? -2.568  23.229  -8.143  1.00 54.86  ? 190  ASN L C   1 
ATOM   3148 O O   . ASN B 2 190 ? -1.374  22.918  -8.240  1.00 53.71  ? 190  ASN L O   1 
ATOM   3149 C CB  . ASN B 2 190 ? -4.214  23.445  -10.033 1.00 62.44  ? 190  ASN L CB  1 
ATOM   3150 C CG  . ASN B 2 190 ? -3.157  23.973  -10.983 1.00 62.81  ? 190  ASN L CG  1 
ATOM   3151 O OD1 . ASN B 2 190 ? -2.519  23.210  -11.724 1.00 63.10  ? 190  ASN L OD1 1 
ATOM   3152 N ND2 . ASN B 2 190 ? -2.972  25.296  -10.978 1.00 63.03  ? 190  ASN L ND2 1 
ATOM   3153 N N   . SER B 2 191 ? -3.001  24.196  -7.340  1.00 53.33  ? 191  SER L N   1 
ATOM   3154 C CA  . SER B 2 191 ? -2.098  25.104  -6.635  1.00 49.83  ? 191  SER L CA  1 
ATOM   3155 C C   . SER B 2 191 ? -1.768  24.562  -5.250  1.00 46.59  ? 191  SER L C   1 
ATOM   3156 O O   . SER B 2 191 ? -2.667  24.388  -4.430  1.00 46.80  ? 191  SER L O   1 
ATOM   3157 C CB  . SER B 2 191 ? -2.773  26.472  -6.524  1.00 51.59  ? 191  SER L CB  1 
ATOM   3158 O OG  . SER B 2 191 ? -1.897  27.470  -6.050  1.00 51.12  ? 191  SER L OG  1 
ATOM   3159 N N   . TYR B 2 192 ? -0.487  24.296  -4.985  1.00 43.01  ? 192  TYR L N   1 
ATOM   3160 C CA  . TYR B 2 192 ? -0.037  23.882  -3.640  1.00 40.53  ? 192  TYR L CA  1 
ATOM   3161 C C   . TYR B 2 192 ? 0.942   24.881  -3.052  1.00 38.10  ? 192  TYR L C   1 
ATOM   3162 O O   . TYR B 2 192 ? 1.989   25.134  -3.647  1.00 36.58  ? 192  TYR L O   1 
ATOM   3163 C CB  . TYR B 2 192 ? 0.575   22.472  -3.666  1.00 39.64  ? 192  TYR L CB  1 
ATOM   3164 C CG  . TYR B 2 192 ? -0.480  21.451  -3.943  1.00 41.64  ? 192  TYR L CG  1 
ATOM   3165 C CD1 . TYR B 2 192 ? -0.876  21.172  -5.260  1.00 43.98  ? 192  TYR L CD1 1 
ATOM   3166 C CD2 . TYR B 2 192 ? -1.152  20.815  -2.902  1.00 41.67  ? 192  TYR L CD2 1 
ATOM   3167 C CE1 . TYR B 2 192 ? -1.884  20.267  -5.534  1.00 46.02  ? 192  TYR L CE1 1 
ATOM   3168 C CE2 . TYR B 2 192 ? -2.176  19.911  -3.169  1.00 44.03  ? 192  TYR L CE2 1 
ATOM   3169 C CZ  . TYR B 2 192 ? -2.536  19.646  -4.487  1.00 46.13  ? 192  TYR L CZ  1 
ATOM   3170 O OH  . TYR B 2 192 ? -3.542  18.751  -4.773  1.00 47.93  ? 192  TYR L OH  1 
ATOM   3171 N N   . THR B 2 193 ? 0.586   25.432  -1.883  1.00 37.37  ? 193  THR L N   1 
ATOM   3172 C CA  . THR B 2 193 ? 1.300   26.552  -1.248  1.00 36.29  ? 193  THR L CA  1 
ATOM   3173 C C   . THR B 2 193 ? 1.723   26.267  0.198   1.00 35.23  ? 193  THR L C   1 
ATOM   3174 O O   . THR B 2 193 ? 0.906   25.873  1.031   1.00 35.29  ? 193  THR L O   1 
ATOM   3175 C CB  . THR B 2 193 ? 0.445   27.852  -1.280  1.00 37.76  ? 193  THR L CB  1 
ATOM   3176 O OG1 . THR B 2 193 ? 0.214   28.234  -2.638  1.00 39.20  ? 193  THR L OG1 1 
ATOM   3177 C CG2 . THR B 2 193 ? 1.113   28.998  -0.529  1.00 36.08  ? 193  THR L CG2 1 
ATOM   3178 N N   . CYS B 2 194 ? 3.012   26.480  0.459   1.00 33.65  ? 194  CYS L N   1 
ATOM   3179 C CA  . CYS B 2 194 ? 3.595   26.484  1.780   1.00 33.48  ? 194  CYS L CA  1 
ATOM   3180 C C   . CYS B 2 194 ? 3.729   27.965  2.158   1.00 32.38  ? 194  CYS L C   1 
ATOM   3181 O O   . CYS B 2 194 ? 4.403   28.714  1.458   1.00 31.80  ? 194  CYS L O   1 
ATOM   3182 C CB  . CYS B 2 194 ? 4.977   25.801  1.698   1.00 34.16  ? 194  CYS L CB  1 
ATOM   3183 S SG  . CYS B 2 194 ? 5.868   25.814  3.230   1.00 41.00  ? 194  CYS L SG  1 
ATOM   3184 N N   . GLU B 2 195 ? 3.073   28.397  3.244   1.00 32.13  ? 195  GLU L N   1 
ATOM   3185 C CA  . GLU B 2 195 ? 3.046   29.813  3.624   1.00 32.25  ? 195  GLU L CA  1 
ATOM   3186 C C   . GLU B 2 195 ? 3.500   30.026  5.079   1.00 31.22  ? 195  GLU L C   1 
ATOM   3187 O O   . GLU B 2 195 ? 2.875   29.494  5.999   1.00 31.91  ? 195  GLU L O   1 
ATOM   3188 C CB  . GLU B 2 195 ? 1.618   30.348  3.444   1.00 35.51  ? 195  GLU L CB  1 
ATOM   3189 C CG  . GLU B 2 195 ? 1.468   31.834  3.664   1.00 36.55  ? 195  GLU L CG  1 
ATOM   3190 C CD  . GLU B 2 195 ? 0.078   32.319  3.316   1.00 40.36  ? 195  GLU L CD  1 
ATOM   3191 O OE1 . GLU B 2 195 ? -0.469  31.969  2.242   1.00 42.46  ? 195  GLU L OE1 1 
ATOM   3192 O OE2 . GLU B 2 195 ? -0.467  33.048  4.146   1.00 41.46  ? 195  GLU L OE2 1 
ATOM   3193 N N   . ALA B 2 196 ? 4.539   30.845  5.278   1.00 29.50  ? 196  ALA L N   1 
ATOM   3194 C CA  . ALA B 2 196 ? 5.187   31.037  6.581   1.00 28.42  ? 196  ALA L CA  1 
ATOM   3195 C C   . ALA B 2 196 ? 5.111   32.474  7.069   1.00 28.86  ? 196  ALA L C   1 
ATOM   3196 O O   . ALA B 2 196 ? 5.094   33.418  6.268   1.00 30.44  ? 196  ALA L O   1 
ATOM   3197 C CB  . ALA B 2 196 ? 6.650   30.619  6.491   1.00 26.15  ? 196  ALA L CB  1 
ATOM   3198 N N   . THR B 2 197 ? 5.056   32.645  8.378   1.00 28.23  ? 197  THR L N   1 
ATOM   3199 C CA  . THR B 2 197 ? 5.212   33.946  8.954   1.00 28.92  ? 197  THR L CA  1 
ATOM   3200 C C   . THR B 2 197 ? 6.423   33.907  9.840   1.00 28.93  ? 197  THR L C   1 
ATOM   3201 O O   . THR B 2 197 ? 6.584   33.017  10.691  1.00 28.66  ? 197  THR L O   1 
ATOM   3202 C CB  . THR B 2 197 ? 3.974   34.410  9.736   1.00 30.83  ? 197  THR L CB  1 
ATOM   3203 O OG1 . THR B 2 197 ? 3.543   33.355  10.607  1.00 31.24  ? 197  THR L OG1 1 
ATOM   3204 C CG2 . THR B 2 197 ? 2.848   34.752  8.773   1.00 31.84  ? 197  THR L CG2 1 
ATOM   3205 N N   . HIS B 2 198 ? 7.282   34.878  9.616   1.00 28.00  ? 198  HIS L N   1 
ATOM   3206 C CA  . HIS B 2 198 ? 8.532   34.935  10.321  1.00 27.60  ? 198  HIS L CA  1 
ATOM   3207 C C   . HIS B 2 198 ? 8.826   36.408  10.427  1.00 28.99  ? 198  HIS L C   1 
ATOM   3208 O O   . HIS B 2 198 ? 8.444   37.158  9.533   1.00 30.32  ? 198  HIS L O   1 
ATOM   3209 C CB  . HIS B 2 198 ? 9.628   34.228  9.522   1.00 25.18  ? 198  HIS L CB  1 
ATOM   3210 C CG  . HIS B 2 198 ? 10.899  34.072  10.292  1.00 24.22  ? 198  HIS L CG  1 
ATOM   3211 N ND1 . HIS B 2 198 ? 12.042  34.779  9.993   1.00 23.51  ? 198  HIS L ND1 1 
ATOM   3212 C CD2 . HIS B 2 198 ? 11.181  33.339  11.395  1.00 23.53  ? 198  HIS L CD2 1 
ATOM   3213 C CE1 . HIS B 2 198 ? 12.988  34.468  10.867  1.00 23.46  ? 198  HIS L CE1 1 
ATOM   3214 N NE2 . HIS B 2 198 ? 12.494  33.591  11.722  1.00 23.11  ? 198  HIS L NE2 1 
ATOM   3215 N N   . LYS B 2 199 ? 9.519   36.811  11.490  1.00 29.45  ? 199  LYS L N   1 
ATOM   3216 C CA  . LYS B 2 199 ? 9.833   38.220  11.699  1.00 30.14  ? 199  LYS L CA  1 
ATOM   3217 C C   . LYS B 2 199 ? 10.688  38.881  10.606  1.00 28.87  ? 199  LYS L C   1 
ATOM   3218 O O   . LYS B 2 199 ? 10.717  40.102  10.530  1.00 29.94  ? 199  LYS L O   1 
ATOM   3219 C CB  . LYS B 2 199 ? 10.401  38.468  13.097  1.00 31.81  ? 199  LYS L CB  1 
ATOM   3220 C CG  . LYS B 2 199 ? 11.880  38.221  13.247  1.00 33.23  ? 199  LYS L CG  1 
ATOM   3221 C CD  . LYS B 2 199 ? 12.436  38.911  14.494  1.00 37.91  ? 199  LYS L CD  1 
ATOM   3222 C CE  . LYS B 2 199 ? 12.226  40.412  14.429  1.00 40.72  ? 199  LYS L CE  1 
ATOM   3223 N NZ  . LYS B 2 199 ? 12.984  41.078  15.512  1.00 43.22  ? 199  LYS L NZ  1 
ATOM   3224 N N   . THR B 2 200 ? 11.349  38.099  9.750   1.00 26.39  ? 200  THR L N   1 
ATOM   3225 C CA  . THR B 2 200 ? 12.172  38.681  8.686   1.00 25.47  ? 200  THR L CA  1 
ATOM   3226 C C   . THR B 2 200 ? 11.351  39.162  7.472   1.00 25.92  ? 200  THR L C   1 
ATOM   3227 O O   . THR B 2 200 ? 11.915  39.692  6.504   1.00 25.94  ? 200  THR L O   1 
ATOM   3228 C CB  . THR B 2 200 ? 13.251  37.698  8.193   1.00 24.71  ? 200  THR L CB  1 
ATOM   3229 O OG1 . THR B 2 200 ? 12.608  36.502  7.758   1.00 23.97  ? 200  THR L OG1 1 
ATOM   3230 C CG2 . THR B 2 200 ? 14.285  37.370  9.303   1.00 23.80  ? 200  THR L CG2 1 
ATOM   3231 N N   . SER B 2 201 ? 10.047  38.919  7.490   1.00 26.25  ? 201  SER L N   1 
ATOM   3232 C CA  . SER B 2 201 ? 9.167   39.409  6.422   1.00 28.34  ? 201  SER L CA  1 
ATOM   3233 C C   . SER B 2 201 ? 7.887   39.992  6.998   1.00 29.76  ? 201  SER L C   1 
ATOM   3234 O O   . SER B 2 201 ? 7.248   39.400  7.871   1.00 29.63  ? 201  SER L O   1 
ATOM   3235 C CB  . SER B 2 201 ? 8.851   38.291  5.409   1.00 28.45  ? 201  SER L CB  1 
ATOM   3236 O OG  . SER B 2 201 ? 7.888   38.696  4.421   1.00 30.45  ? 201  SER L OG  1 
ATOM   3237 N N   . THR B 2 202 ? 7.509   41.157  6.480   1.00 31.64  ? 202  THR L N   1 
ATOM   3238 C CA  . THR B 2 202 ? 6.286   41.822  6.898   1.00 33.26  ? 202  THR L CA  1 
ATOM   3239 C C   . THR B 2 202 ? 5.093   41.005  6.442   1.00 34.58  ? 202  THR L C   1 
ATOM   3240 O O   . THR B 2 202 ? 4.176   40.772  7.207   1.00 35.95  ? 202  THR L O   1 
ATOM   3241 C CB  . THR B 2 202 ? 6.214   43.238  6.305   1.00 34.46  ? 202  THR L CB  1 
ATOM   3242 O OG1 . THR B 2 202 ? 7.380   43.946  6.742   1.00 34.38  ? 202  THR L OG1 1 
ATOM   3243 C CG2 . THR B 2 202 ? 4.962   43.966  6.791   1.00 35.52  ? 202  THR L CG2 1 
ATOM   3244 N N   . SER B 2 203 ? 5.112   40.552  5.199   1.00 35.05  ? 203  SER L N   1 
ATOM   3245 C CA  . SER B 2 203 ? 3.998   39.813  4.654   1.00 36.32  ? 203  SER L CA  1 
ATOM   3246 C C   . SER B 2 203 ? 4.298   38.311  4.755   1.00 34.80  ? 203  SER L C   1 
ATOM   3247 O O   . SER B 2 203 ? 5.422   37.933  5.065   1.00 32.60  ? 203  SER L O   1 
ATOM   3248 C CB  . SER B 2 203 ? 3.773   40.239  3.206   1.00 39.36  ? 203  SER L CB  1 
ATOM   3249 O OG  . SER B 2 203 ? 4.825   39.728  2.396   1.00 42.41  ? 203  SER L OG  1 
ATOM   3250 N N   . PRO B 2 204 ? 3.291   37.453  4.513   1.00 35.34  ? 204  PRO L N   1 
ATOM   3251 C CA  . PRO B 2 204 ? 3.600   36.026  4.555   1.00 34.00  ? 204  PRO L CA  1 
ATOM   3252 C C   . PRO B 2 204 ? 4.577   35.611  3.437   1.00 32.96  ? 204  PRO L C   1 
ATOM   3253 O O   . PRO B 2 204 ? 4.535   36.158  2.308   1.00 33.69  ? 204  PRO L O   1 
ATOM   3254 C CB  . PRO B 2 204 ? 2.237   35.357  4.364   1.00 35.77  ? 204  PRO L CB  1 
ATOM   3255 C CG  . PRO B 2 204 ? 1.227   36.410  4.748   1.00 38.14  ? 204  PRO L CG  1 
ATOM   3256 C CD  . PRO B 2 204 ? 1.844   37.715  4.363   1.00 37.65  ? 204  PRO L CD  1 
ATOM   3257 N N   . ILE B 2 205 ? 5.432   34.647  3.762   1.00 31.01  ? 205  ILE L N   1 
ATOM   3258 C CA  . ILE B 2 205 ? 6.406   34.087  2.823   1.00 29.93  ? 205  ILE L CA  1 
ATOM   3259 C C   . ILE B 2 205 ? 5.683   32.964  2.086   1.00 31.31  ? 205  ILE L C   1 
ATOM   3260 O O   . ILE B 2 205 ? 5.245   31.985  2.687   1.00 31.32  ? 205  ILE L O   1 
ATOM   3261 C CB  . ILE B 2 205 ? 7.669   33.593  3.590   1.00 28.46  ? 205  ILE L CB  1 
ATOM   3262 C CG1 . ILE B 2 205 ? 8.287   34.750  4.363   1.00 27.44  ? 205  ILE L CG1 1 
ATOM   3263 C CG2 . ILE B 2 205 ? 8.714   32.988  2.651   1.00 27.47  ? 205  ILE L CG2 1 
ATOM   3264 C CD1 . ILE B 2 205 ? 8.873   34.347  5.698   1.00 26.46  ? 205  ILE L CD1 1 
ATOM   3265 N N   . VAL B 2 206 ? 5.514   33.127  0.783   1.00 32.51  ? 206  VAL L N   1 
ATOM   3266 C CA  . VAL B 2 206 ? 4.680   32.224  -0.015  1.00 34.73  ? 206  VAL L CA  1 
ATOM   3267 C C   . VAL B 2 206 ? 5.530   31.432  -1.001  1.00 35.18  ? 206  VAL L C   1 
ATOM   3268 O O   . VAL B 2 206 ? 6.218   32.030  -1.837  1.00 35.78  ? 206  VAL L O   1 
ATOM   3269 C CB  . VAL B 2 206 ? 3.592   33.007  -0.791  1.00 36.48  ? 206  VAL L CB  1 
ATOM   3270 C CG1 . VAL B 2 206 ? 2.779   32.088  -1.695  1.00 38.49  ? 206  VAL L CG1 1 
ATOM   3271 C CG2 . VAL B 2 206 ? 2.696   33.769  0.189   1.00 36.81  ? 206  VAL L CG2 1 
ATOM   3272 N N   . LYS B 2 207 ? 5.475   30.104  -0.882  1.00 34.48  ? 207  LYS L N   1 
ATOM   3273 C CA  . LYS B 2 207 ? 6.116   29.206  -1.827  1.00 35.49  ? 207  LYS L CA  1 
ATOM   3274 C C   . LYS B 2 207 ? 5.112   28.212  -2.415  1.00 36.21  ? 207  LYS L C   1 
ATOM   3275 O O   . LYS B 2 207 ? 4.488   27.445  -1.685  1.00 34.80  ? 207  LYS L O   1 
ATOM   3276 C CB  . LYS B 2 207 ? 7.305   28.491  -1.173  1.00 33.81  ? 207  LYS L CB  1 
ATOM   3277 C CG  . LYS B 2 207 ? 8.261   27.877  -2.179  1.00 36.07  ? 207  LYS L CG  1 
ATOM   3278 C CD  . LYS B 2 207 ? 9.177   28.905  -2.819  1.00 37.12  ? 207  LYS L CD  1 
ATOM   3279 C CE  . LYS B 2 207 ? 9.960   28.253  -3.941  1.00 40.13  ? 207  LYS L CE  1 
ATOM   3280 N NZ  . LYS B 2 207 ? 10.892  29.224  -4.571  1.00 41.16  ? 207  LYS L NZ  1 
ATOM   3281 N N   . SER B 2 208 ? 4.969   28.232  -3.743  1.00 38.65  ? 208  SER L N   1 
ATOM   3282 C CA  . SER B 2 208 ? 3.958   27.428  -4.427  1.00 41.12  ? 208  SER L CA  1 
ATOM   3283 C C   . SER B 2 208 ? 4.490   26.662  -5.639  1.00 42.80  ? 208  SER L C   1 
ATOM   3284 O O   . SER B 2 208 ? 5.550   26.974  -6.189  1.00 42.78  ? 208  SER L O   1 
ATOM   3285 C CB  . SER B 2 208 ? 2.788   28.307  -4.881  1.00 43.76  ? 208  SER L CB  1 
ATOM   3286 O OG  . SER B 2 208 ? 2.321   29.079  -3.790  1.00 44.72  ? 208  SER L OG  1 
ATOM   3287 N N   . PHE B 2 209 ? 3.748   25.637  -6.034  1.00 44.01  ? 209  PHE L N   1 
ATOM   3288 C CA  . PHE B 2 209 ? 3.901   25.065  -7.358  1.00 46.11  ? 209  PHE L CA  1 
ATOM   3289 C C   . PHE B 2 209 ? 2.524   24.771  -7.910  1.00 49.87  ? 209  PHE L C   1 
ATOM   3290 O O   . PHE B 2 209 ? 1.552   24.604  -7.152  1.00 49.50  ? 209  PHE L O   1 
ATOM   3291 C CB  . PHE B 2 209 ? 4.803   23.821  -7.360  1.00 44.40  ? 209  PHE L CB  1 
ATOM   3292 C CG  . PHE B 2 209 ? 4.218   22.636  -6.654  1.00 43.57  ? 209  PHE L CG  1 
ATOM   3293 C CD1 . PHE B 2 209 ? 3.356   21.757  -7.328  1.00 45.83  ? 209  PHE L CD1 1 
ATOM   3294 C CD2 . PHE B 2 209 ? 4.546   22.377  -5.328  1.00 41.76  ? 209  PHE L CD2 1 
ATOM   3295 C CE1 . PHE B 2 209 ? 2.820   20.652  -6.690  1.00 45.22  ? 209  PHE L CE1 1 
ATOM   3296 C CE2 . PHE B 2 209 ? 4.012   21.272  -4.681  1.00 41.98  ? 209  PHE L CE2 1 
ATOM   3297 C CZ  . PHE B 2 209 ? 3.135   20.415  -5.363  1.00 43.47  ? 209  PHE L CZ  1 
ATOM   3298 N N   . ASN B 2 210 ? 2.455   24.728  -9.237  1.00 53.20  ? 210  ASN L N   1 
ATOM   3299 C CA  . ASN B 2 210 ? 1.262   24.370  -9.942  1.00 57.78  ? 210  ASN L CA  1 
ATOM   3300 C C   . ASN B 2 210 ? 1.441   22.992  -10.514 1.00 60.09  ? 210  ASN L C   1 
ATOM   3301 O O   . ASN B 2 210 ? 2.428   22.700  -11.185 1.00 58.80  ? 210  ASN L O   1 
ATOM   3302 C CB  . ASN B 2 210 ? 0.979   25.367  -11.055 1.00 60.68  ? 210  ASN L CB  1 
ATOM   3303 C CG  . ASN B 2 210 ? 0.044   26.470  -10.624 1.00 61.64  ? 210  ASN L CG  1 
ATOM   3304 O OD1 . ASN B 2 210 ? -0.214  26.658  -9.439  1.00 60.29  ? 210  ASN L OD1 1 
ATOM   3305 N ND2 . ASN B 2 210 ? -0.482  27.201  -11.593 1.00 65.88  ? 210  ASN L ND2 1 
ATOM   3306 N N   . ARG B 2 211 ? 0.478   22.143  -10.217 1.00 64.03  ? 211  ARG L N   1 
ATOM   3307 C CA  . ARG B 2 211 ? 0.505   20.769  -10.629 1.00 70.64  ? 211  ARG L CA  1 
ATOM   3308 C C   . ARG B 2 211 ? -0.292  20.618  -11.936 1.00 78.14  ? 211  ARG L C   1 
ATOM   3309 O O   . ARG B 2 211 ? -1.510  20.471  -11.867 1.00 85.55  ? 211  ARG L O   1 
ATOM   3310 C CB  . ARG B 2 211 ? -0.145  19.971  -9.501  1.00 68.53  ? 211  ARG L CB  1 
ATOM   3311 C CG  . ARG B 2 211 ? -0.227  18.488  -9.725  1.00 69.75  ? 211  ARG L CG  1 
ATOM   3312 C CD  . ARG B 2 211 ? -1.477  17.927  -9.082  1.00 70.80  ? 211  ARG L CD  1 
ATOM   3313 N NE  . ARG B 2 211 ? -1.817  16.693  -9.766  1.00 74.54  ? 211  ARG L NE  1 
ATOM   3314 C CZ  . ARG B 2 211 ? -2.671  16.617  -10.781 1.00 77.27  ? 211  ARG L CZ  1 
ATOM   3315 N NH1 . ARG B 2 211 ? -3.311  17.702  -11.207 1.00 78.27  ? 211  ARG L NH1 1 
ATOM   3316 N NH2 . ARG B 2 211 ? -2.894  15.447  -11.359 1.00 80.31  ? 211  ARG L NH2 1 
ATOM   3317 N N   . ASN B 2 212 ? 0.317   20.697  -13.129 1.00 84.16  ? 212  ASN L N   1 
ATOM   3318 C CA  . ASN B 2 212 ? 1.692   21.117  -13.408 1.00 86.17  ? 212  ASN L CA  1 
ATOM   3319 C C   . ASN B 2 212 ? 1.685   22.415  -14.242 1.00 92.73  ? 212  ASN L C   1 
ATOM   3320 O O   . ASN B 2 212 ? 0.748   22.654  -15.020 1.00 93.73  ? 212  ASN L O   1 
ATOM   3321 C CB  . ASN B 2 212 ? 2.458   19.998  -14.136 1.00 86.87  ? 212  ASN L CB  1 
ATOM   3322 C CG  . ASN B 2 212 ? 3.870   20.408  -14.554 1.00 86.07  ? 212  ASN L CG  1 
ATOM   3323 O OD1 . ASN B 2 212 ? 4.630   20.976  -13.768 1.00 82.66  ? 212  ASN L OD1 1 
ATOM   3324 N ND2 . ASN B 2 212 ? 4.226   20.106  -15.801 1.00 87.48  ? 212  ASN L ND2 1 
ATOM   3325 N N   . GLU B 2 213 ? 2.724   23.243  -14.062 1.00 58.38  ? 213  GLU L N   1 
ATOM   3326 C CA  . GLU B 2 213 ? 2.836   24.568  -14.691 1.00 60.84  ? 213  GLU L CA  1 
ATOM   3327 C C   . GLU B 2 213 ? 4.062   25.317  -14.169 1.00 63.08  ? 213  GLU L C   1 
ATOM   3328 O O   . GLU B 2 213 ? 3.945   26.367  -13.524 1.00 65.62  ? 213  GLU L O   1 
ATOM   3329 C CB  . GLU B 2 213 ? 1.565   25.394  -14.469 1.00 64.92  ? 213  GLU L CB  1 
HETATM 3330 C C1  . GOL C 3 .   ? 10.260  16.043  8.801   1.00 45.68  ? 1214 GOL L C1  1 
HETATM 3331 O O1  . GOL C 3 .   ? 11.120  15.255  9.644   1.00 46.81  ? 1214 GOL L O1  1 
HETATM 3332 C C2  . GOL C 3 .   ? 8.810   15.817  9.218   1.00 47.52  ? 1214 GOL L C2  1 
HETATM 3333 O O2  . GOL C 3 .   ? 8.511   14.428  9.054   1.00 51.79  ? 1214 GOL L O2  1 
HETATM 3334 C C3  . GOL C 3 .   ? 7.783   16.627  8.418   1.00 41.78  ? 1214 GOL L C3  1 
HETATM 3335 O O3  . GOL C 3 .   ? 8.311   17.485  7.397   1.00 35.40  ? 1214 GOL L O3  1 
HETATM 3336 O O   . HOH D 4 .   ? 22.136  1.863   22.374  1.00 54.90  ? 2001 HOH H O   1 
HETATM 3337 O O   . HOH D 4 .   ? 11.800  17.352  36.303  1.00 46.81  ? 2002 HOH H O   1 
HETATM 3338 O O   . HOH D 4 .   ? 40.095  2.575   38.738  1.00 47.50  ? 2003 HOH H O   1 
HETATM 3339 O O   . HOH D 4 .   ? 28.183  0.000   49.633  0.50 29.12  ? 2004 HOH H O   1 
HETATM 3340 O O   . HOH D 4 .   ? 10.093  3.692   33.477  1.00 45.00  ? 2005 HOH H O   1 
HETATM 3341 O O   . HOH D 4 .   ? 35.803  12.333  34.158  1.00 46.37  ? 2006 HOH H O   1 
HETATM 3342 O O   . HOH D 4 .   ? 7.650   -5.934  19.191  1.00 54.89  ? 2007 HOH H O   1 
HETATM 3343 O O   . HOH D 4 .   ? 13.969  16.316  35.365  1.00 36.05  ? 2008 HOH H O   1 
HETATM 3344 O O   . HOH D 4 .   ? 14.050  13.824  39.276  1.00 30.20  ? 2009 HOH H O   1 
HETATM 3345 O O   . HOH D 4 .   ? 7.947   8.011   38.263  1.00 55.26  ? 2010 HOH H O   1 
HETATM 3346 O O   . HOH D 4 .   ? 1.537   0.409   12.178  1.00 47.56  ? 2011 HOH H O   1 
HETATM 3347 O O   . HOH D 4 .   ? 14.700  11.138  40.580  1.00 31.70  ? 2012 HOH H O   1 
HETATM 3348 O O   . HOH D 4 .   ? 24.512  13.940  7.272   1.00 40.44  ? 2013 HOH H O   1 
HETATM 3349 O O   . HOH D 4 .   ? 29.512  9.380   -3.884  1.00 51.72  ? 2014 HOH H O   1 
HETATM 3350 O O   . HOH D 4 .   ? 11.426  10.867  41.875  1.00 45.28  ? 2015 HOH H O   1 
HETATM 3351 O O   . HOH D 4 .   ? 13.234  6.628   47.507  1.00 38.53  ? 2016 HOH H O   1 
HETATM 3352 O O   . HOH D 4 .   ? 23.309  -10.766 35.885  1.00 45.48  ? 2017 HOH H O   1 
HETATM 3353 O O   . HOH D 4 .   ? 22.211  9.763   24.723  1.00 37.91  ? 2018 HOH H O   1 
HETATM 3354 O O   . HOH D 4 .   ? 33.601  8.928   40.535  1.00 48.22  ? 2019 HOH H O   1 
HETATM 3355 O O   . HOH D 4 .   ? 24.224  12.882  51.187  1.00 39.56  ? 2020 HOH H O   1 
HETATM 3356 O O   . HOH D 4 .   ? 30.875  13.574  32.775  1.00 40.33  ? 2021 HOH H O   1 
HETATM 3357 O O   . HOH D 4 .   ? 34.076  14.694  34.888  1.00 55.04  ? 2022 HOH H O   1 
HETATM 3358 O O   . HOH D 4 .   ? 29.463  11.533  30.835  1.00 32.20  ? 2023 HOH H O   1 
HETATM 3359 O O   . HOH D 4 .   ? 24.255  2.980   23.354  1.00 45.48  ? 2024 HOH H O   1 
HETATM 3360 O O   . HOH D 4 .   ? 11.438  5.975   23.423  1.00 51.90  ? 2025 HOH H O   1 
HETATM 3361 O O   . HOH D 4 .   ? 10.209  4.546   18.302  1.00 33.77  ? 2026 HOH H O   1 
HETATM 3362 O O   . HOH D 4 .   ? 5.479   -4.025  19.075  1.00 46.75  ? 2027 HOH H O   1 
HETATM 3363 O O   . HOH D 4 .   ? 3.241   3.722   19.396  1.00 53.21  ? 2028 HOH H O   1 
HETATM 3364 O O   . HOH D 4 .   ? -0.113  0.329   21.531  1.00 42.91  ? 2029 HOH H O   1 
HETATM 3365 O O   . HOH D 4 .   ? 0.512   -1.463  14.343  1.00 53.39  ? 2030 HOH H O   1 
HETATM 3366 O O   . HOH D 4 .   ? 3.595   0.448   13.717  1.00 38.77  ? 2031 HOH H O   1 
HETATM 3367 O O   . HOH D 4 .   ? 5.713   -6.206  11.964  1.00 44.27  ? 2032 HOH H O   1 
HETATM 3368 O O   . HOH D 4 .   ? 7.066   -5.798  15.609  1.00 37.62  ? 2033 HOH H O   1 
HETATM 3369 O O   . HOH D 4 .   ? 2.498   -1.345  10.165  1.00 40.72  ? 2034 HOH H O   1 
HETATM 3370 O O   . HOH D 4 .   ? 6.829   1.800   4.134   1.00 43.49  ? 2035 HOH H O   1 
HETATM 3371 O O   . HOH D 4 .   ? 12.250  -1.082  2.389   1.00 49.74  ? 2036 HOH H O   1 
HETATM 3372 O O   . HOH D 4 .   ? 8.166   1.648   -0.759  1.00 39.30  ? 2037 HOH H O   1 
HETATM 3373 O O   . HOH D 4 .   ? 11.467  2.800   -0.377  1.00 44.52  ? 2038 HOH H O   1 
HETATM 3374 O O   . HOH D 4 .   ? 11.310  4.649   -3.680  1.00 49.74  ? 2039 HOH H O   1 
HETATM 3375 O O   . HOH D 4 .   ? 5.844   3.226   -1.867  1.00 44.38  ? 2040 HOH H O   1 
HETATM 3376 O O   . HOH D 4 .   ? 4.426   5.603   2.668   1.00 48.00  ? 2041 HOH H O   1 
HETATM 3377 O O   . HOH D 4 .   ? 27.413  26.303  -8.529  1.00 53.68  ? 2042 HOH H O   1 
HETATM 3378 O O   . HOH D 4 .   ? 17.943  26.473  -7.388  1.00 51.63  ? 2043 HOH H O   1 
HETATM 3379 O O   . HOH D 4 .   ? 16.699  24.873  -5.183  1.00 34.18  ? 2044 HOH H O   1 
HETATM 3380 O O   . HOH D 4 .   ? 18.512  25.982  -2.457  1.00 45.10  ? 2045 HOH H O   1 
HETATM 3381 O O   . HOH D 4 .   ? 14.807  22.557  -4.632  1.00 43.81  ? 2046 HOH H O   1 
HETATM 3382 O O   . HOH D 4 .   ? 17.863  24.992  1.965   1.00 28.80  ? 2047 HOH H O   1 
HETATM 3383 O O   . HOH D 4 .   ? 4.293   1.882   5.850   1.00 46.35  ? 2048 HOH H O   1 
HETATM 3384 O O   . HOH D 4 .   ? 13.740  0.695   18.866  1.00 46.05  ? 2049 HOH H O   1 
HETATM 3385 O O   . HOH D 4 .   ? 16.040  8.797   13.991  1.00 37.22  ? 2050 HOH H O   1 
HETATM 3386 O O   . HOH D 4 .   ? 14.261  11.288  14.798  1.00 40.69  ? 2051 HOH H O   1 
HETATM 3387 O O   . HOH D 4 .   ? 15.811  1.024   13.797  1.00 29.03  ? 2052 HOH H O   1 
HETATM 3388 O O   . HOH D 4 .   ? 20.460  3.581   14.418  1.00 48.18  ? 2053 HOH H O   1 
HETATM 3389 O O   . HOH D 4 .   ? 22.412  5.844   6.852   1.00 36.95  ? 2054 HOH H O   1 
HETATM 3390 O O   . HOH D 4 .   ? 20.412  10.605  10.715  1.00 29.13  ? 2055 HOH H O   1 
HETATM 3391 O O   . HOH D 4 .   ? 22.029  13.423  8.145   1.00 29.62  ? 2056 HOH H O   1 
HETATM 3392 O O   . HOH D 4 .   ? 25.256  5.497   5.097   1.00 42.04  ? 2057 HOH H O   1 
HETATM 3393 O O   . HOH D 4 .   ? 25.910  12.843  5.201   1.00 28.29  ? 2058 HOH H O   1 
HETATM 3394 O O   . HOH D 4 .   ? 31.013  8.861   -1.679  1.00 54.91  ? 2059 HOH H O   1 
HETATM 3395 O O   . HOH D 4 .   ? 25.557  9.261   -5.151  1.00 39.75  ? 2060 HOH H O   1 
HETATM 3396 O O   . HOH D 4 .   ? 25.842  6.773   -1.472  1.00 36.35  ? 2061 HOH H O   1 
HETATM 3397 O O   . HOH D 4 .   ? 30.213  18.180  2.770   1.00 36.09  ? 2062 HOH H O   1 
HETATM 3398 O O   . HOH D 4 .   ? 25.788  16.422  8.031   1.00 44.16  ? 2063 HOH H O   1 
HETATM 3399 O O   . HOH D 4 .   ? 26.738  20.654  0.602   1.00 45.28  ? 2064 HOH H O   1 
HETATM 3400 O O   . HOH D 4 .   ? 19.724  21.731  3.108   1.00 28.59  ? 2065 HOH H O   1 
HETATM 3401 O O   . HOH D 4 .   ? 23.607  22.226  7.714   1.00 32.72  ? 2066 HOH H O   1 
HETATM 3402 O O   . HOH D 4 .   ? 20.517  20.392  10.696  1.00 40.79  ? 2067 HOH H O   1 
HETATM 3403 O O   . HOH D 4 .   ? 23.146  24.723  6.564   1.00 39.05  ? 2068 HOH H O   1 
HETATM 3404 O O   . HOH D 4 .   ? 21.092  17.521  10.443  1.00 36.53  ? 2069 HOH H O   1 
HETATM 3405 O O   . HOH D 4 .   ? 18.179  14.400  13.443  1.00 43.28  ? 2070 HOH H O   1 
HETATM 3406 O O   . HOH D 4 .   ? 16.319  12.494  12.676  1.00 39.61  ? 2071 HOH H O   1 
HETATM 3407 O O   . HOH D 4 .   ? 4.363   9.532   10.012  1.00 36.83  ? 2072 HOH H O   1 
HETATM 3408 O O   . HOH D 4 .   ? 6.482   12.717  17.434  1.00 39.26  ? 2073 HOH H O   1 
HETATM 3409 O O   . HOH D 4 .   ? 0.349   12.881  8.101   1.00 44.28  ? 2074 HOH H O   1 
HETATM 3410 O O   . HOH D 4 .   ? -1.402  9.420   16.039  1.00 41.34  ? 2075 HOH H O   1 
HETATM 3411 O O   . HOH D 4 .   ? 25.480  25.262  1.088   1.00 62.37  ? 2076 HOH H O   1 
HETATM 3412 O O   . HOH D 4 .   ? 27.412  17.715  -4.605  1.00 50.74  ? 2077 HOH H O   1 
HETATM 3413 O O   . HOH D 4 .   ? 22.326  12.484  -8.590  1.00 31.82  ? 2078 HOH H O   1 
HETATM 3414 O O   . HOH D 4 .   ? 22.686  12.831  -11.106 1.00 43.65  ? 2079 HOH H O   1 
HETATM 3415 O O   . HOH D 4 .   ? 29.236  12.080  -10.341 1.00 47.59  ? 2080 HOH H O   1 
HETATM 3416 O O   . HOH D 4 .   ? 19.849  -1.137  8.751   1.00 35.95  ? 2081 HOH H O   1 
HETATM 3417 O O   . HOH D 4 .   ? 14.568  -7.100  11.147  1.00 40.64  ? 2082 HOH H O   1 
HETATM 3418 O O   . HOH D 4 .   ? 13.436  -8.435  9.050   1.00 36.39  ? 2083 HOH H O   1 
HETATM 3419 O O   . HOH D 4 .   ? 20.232  -3.967  8.618   1.00 44.88  ? 2084 HOH H O   1 
HETATM 3420 O O   . HOH D 4 .   ? 20.503  -4.245  5.847   1.00 35.60  ? 2085 HOH H O   1 
HETATM 3421 O O   . HOH D 4 .   ? 15.463  10.313  -7.852  1.00 30.95  ? 2086 HOH H O   1 
HETATM 3422 O O   . HOH D 4 .   ? 14.163  12.529  -8.136  1.00 39.34  ? 2087 HOH H O   1 
HETATM 3423 O O   . HOH E 4 .   ? 14.601  13.750  47.712  1.00 35.88  ? 2001 HOH L O   1 
HETATM 3424 O O   . HOH E 4 .   ? 11.817  23.658  44.356  1.00 32.36  ? 2002 HOH L O   1 
HETATM 3425 O O   . HOH E 4 .   ? 12.156  18.076  40.975  1.00 44.65  ? 2003 HOH L O   1 
HETATM 3426 O O   . HOH E 4 .   ? 14.477  28.514  40.042  1.00 37.86  ? 2004 HOH L O   1 
HETATM 3427 O O   . HOH E 4 .   ? 26.863  33.979  17.013  1.00 45.23  ? 2005 HOH L O   1 
HETATM 3428 O O   . HOH E 4 .   ? 12.737  22.674  36.801  1.00 31.51  ? 2006 HOH L O   1 
HETATM 3429 O O   . HOH E 4 .   ? 11.983  30.634  29.688  1.00 40.87  ? 2007 HOH L O   1 
HETATM 3430 O O   . HOH E 4 .   ? 11.111  30.208  32.511  1.00 39.84  ? 2008 HOH L O   1 
HETATM 3431 O O   . HOH E 4 .   ? 14.558  32.775  25.744  1.00 47.76  ? 2009 HOH L O   1 
HETATM 3432 O O   . HOH E 4 .   ? 32.160  19.460  29.695  1.00 44.54  ? 2010 HOH L O   1 
HETATM 3433 O O   . HOH E 4 .   ? 23.273  38.621  25.233  1.00 33.53  ? 2011 HOH L O   1 
HETATM 3434 O O   . HOH E 4 .   ? 26.072  35.729  19.215  1.00 27.12  ? 2012 HOH L O   1 
HETATM 3435 O O   . HOH E 4 .   ? 28.400  39.571  24.038  1.00 48.72  ? 2013 HOH L O   1 
HETATM 3436 O O   . HOH E 4 .   ? 26.531  39.731  29.493  1.00 43.97  ? 2014 HOH L O   1 
HETATM 3437 O O   . HOH E 4 .   ? 23.486  38.548  29.607  1.00 50.59  ? 2015 HOH L O   1 
HETATM 3438 O O   . HOH E 4 .   ? 21.648  35.243  32.835  1.00 39.89  ? 2016 HOH L O   1 
HETATM 3439 O O   . HOH E 4 .   ? 12.495  26.816  48.320  1.00 51.67  ? 2017 HOH L O   1 
HETATM 3440 O O   . HOH E 4 .   ? 15.321  23.001  54.982  1.00 34.01  ? 2018 HOH L O   1 
HETATM 3441 O O   . HOH E 4 .   ? 17.991  18.206  52.899  1.00 42.06  ? 2019 HOH L O   1 
HETATM 3442 O O   . HOH E 4 .   ? 23.107  25.571  53.151  1.00 27.06  ? 2020 HOH L O   1 
HETATM 3443 O O   . HOH E 4 .   ? 18.338  24.214  57.633  1.00 45.27  ? 2021 HOH L O   1 
HETATM 3444 O O   . HOH E 4 .   ? 28.737  20.139  51.585  1.00 50.12  ? 2022 HOH L O   1 
HETATM 3445 O O   . HOH E 4 .   ? 23.232  21.451  57.693  1.00 44.78  ? 2023 HOH L O   1 
HETATM 3446 O O   . HOH E 4 .   ? 25.612  25.449  42.398  1.00 22.08  ? 2024 HOH L O   1 
HETATM 3447 O O   . HOH E 4 .   ? 28.146  17.657  27.556  1.00 25.39  ? 2025 HOH L O   1 
HETATM 3448 O O   . HOH E 4 .   ? 31.332  20.662  27.927  1.00 35.91  ? 2026 HOH L O   1 
HETATM 3449 O O   . HOH E 4 .   ? 30.508  23.591  26.816  1.00 23.77  ? 2027 HOH L O   1 
HETATM 3450 O O   . HOH E 4 .   ? 20.282  13.312  23.958  1.00 48.65  ? 2028 HOH L O   1 
HETATM 3451 O O   . HOH E 4 .   ? 26.465  16.287  26.190  1.00 24.78  ? 2029 HOH L O   1 
HETATM 3452 O O   . HOH E 4 .   ? 26.457  22.426  21.292  1.00 32.38  ? 2030 HOH L O   1 
HETATM 3453 O O   . HOH E 4 .   ? 28.354  16.544  24.030  1.00 38.40  ? 2031 HOH L O   1 
HETATM 3454 O O   . HOH E 4 .   ? 32.131  18.394  26.106  1.00 45.13  ? 2032 HOH L O   1 
HETATM 3455 O O   . HOH E 4 .   ? 22.497  20.995  22.061  1.00 35.08  ? 2033 HOH L O   1 
HETATM 3456 O O   . HOH E 4 .   ? 18.807  18.827  14.703  1.00 31.47  ? 2034 HOH L O   1 
HETATM 3457 O O   . HOH E 4 .   ? 21.394  36.033  7.099   1.00 52.04  ? 2035 HOH L O   1 
HETATM 3458 O O   . HOH E 4 .   ? 32.374  12.845  30.314  1.00 41.86  ? 2036 HOH L O   1 
HETATM 3459 O O   . HOH E 4 .   ? 32.786  16.265  32.898  1.00 32.23  ? 2037 HOH L O   1 
HETATM 3460 O O   . HOH E 4 .   ? 30.344  22.945  48.885  1.00 43.34  ? 2038 HOH L O   1 
HETATM 3461 O O   . HOH E 4 .   ? 32.719  27.330  40.726  1.00 31.40  ? 2039 HOH L O   1 
HETATM 3462 O O   . HOH E 4 .   ? 33.163  29.039  46.270  1.00 42.08  ? 2040 HOH L O   1 
HETATM 3463 O O   . HOH E 4 .   ? 36.576  24.808  41.283  1.00 33.61  ? 2041 HOH L O   1 
HETATM 3464 O O   . HOH E 4 .   ? 37.223  21.092  41.741  1.00 50.04  ? 2042 HOH L O   1 
HETATM 3465 O O   . HOH E 4 .   ? -7.983  21.980  1.334   1.00 49.91  ? 2043 HOH L O   1 
HETATM 3466 O O   . HOH E 4 .   ? 35.438  15.087  38.381  1.00 41.06  ? 2044 HOH L O   1 
HETATM 3467 O O   . HOH E 4 .   ? 36.666  20.710  27.387  1.00 46.20  ? 2045 HOH L O   1 
HETATM 3468 O O   . HOH E 4 .   ? 39.936  22.678  30.816  1.00 39.44  ? 2046 HOH L O   1 
HETATM 3469 O O   . HOH E 4 .   ? 34.364  31.294  35.825  1.00 36.71  ? 2047 HOH L O   1 
HETATM 3470 O O   . HOH E 4 .   ? 35.730  28.069  37.009  1.00 47.02  ? 2048 HOH L O   1 
HETATM 3471 O O   . HOH E 4 .   ? 31.533  31.505  35.591  1.00 27.16  ? 2049 HOH L O   1 
HETATM 3472 O O   . HOH E 4 .   ? 34.725  27.474  38.918  1.00 39.58  ? 2050 HOH L O   1 
HETATM 3473 O O   . HOH E 4 .   ? 29.514  31.418  40.034  1.00 35.22  ? 2051 HOH L O   1 
HETATM 3474 O O   . HOH E 4 .   ? 32.562  29.687  42.409  1.00 45.64  ? 2052 HOH L O   1 
HETATM 3475 O O   . HOH E 4 .   ? 27.034  31.204  40.202  1.00 32.74  ? 2053 HOH L O   1 
HETATM 3476 O O   . HOH E 4 .   ? 26.177  31.713  47.401  1.00 39.50  ? 2054 HOH L O   1 
HETATM 3477 O O   . HOH E 4 .   ? 24.072  31.648  48.994  1.00 35.94  ? 2055 HOH L O   1 
HETATM 3478 O O   . HOH E 4 .   ? 22.490  30.221  53.155  1.00 27.06  ? 2056 HOH L O   1 
HETATM 3479 O O   . HOH E 4 .   ? 22.615  31.265  44.138  1.00 40.67  ? 2057 HOH L O   1 
HETATM 3480 O O   . HOH E 4 .   ? 31.592  30.662  20.197  1.00 25.73  ? 2058 HOH L O   1 
HETATM 3481 O O   . HOH E 4 .   ? 33.800  35.484  23.068  1.00 38.92  ? 2059 HOH L O   1 
HETATM 3482 O O   . HOH E 4 .   ? 26.034  25.616  18.804  1.00 36.58  ? 2060 HOH L O   1 
HETATM 3483 O O   . HOH E 4 .   ? 30.002  25.510  17.996  1.00 36.41  ? 2061 HOH L O   1 
HETATM 3484 O O   . HOH E 4 .   ? 33.148  28.154  19.915  1.00 31.72  ? 2062 HOH L O   1 
HETATM 3485 O O   . HOH E 4 .   ? 35.146  24.084  24.396  0.50 28.27  ? 2063 HOH L O   1 
HETATM 3486 O O   . HOH E 4 .   ? 11.617  18.870  31.919  1.00 51.30  ? 2064 HOH L O   1 
HETATM 3487 O O   . HOH E 4 .   ? 12.917  23.400  33.875  1.00 37.60  ? 2065 HOH L O   1 
HETATM 3488 O O   . HOH E 4 .   ? 19.214  26.234  21.120  1.00 40.37  ? 2066 HOH L O   1 
HETATM 3489 O O   . HOH E 4 .   ? 15.233  32.103  18.532  1.00 31.09  ? 2067 HOH L O   1 
HETATM 3490 O O   . HOH E 4 .   ? 17.999  38.655  16.231  1.00 30.90  ? 2068 HOH L O   1 
HETATM 3491 O O   . HOH E 4 .   ? 24.852  37.197  13.908  1.00 40.59  ? 2069 HOH L O   1 
HETATM 3492 O O   . HOH E 4 .   ? 19.012  41.123  13.308  1.00 35.77  ? 2070 HOH L O   1 
HETATM 3493 O O   . HOH E 4 .   ? 14.724  40.753  10.260  1.00 35.96  ? 2071 HOH L O   1 
HETATM 3494 O O   . HOH E 4 .   ? 18.345  37.219  5.976   1.00 43.69  ? 2072 HOH L O   1 
HETATM 3495 O O   . HOH E 4 .   ? 18.396  31.092  4.712   1.00 25.83  ? 2073 HOH L O   1 
HETATM 3496 O O   . HOH E 4 .   ? 13.235  31.122  0.060   1.00 42.52  ? 2074 HOH L O   1 
HETATM 3497 O O   . HOH E 4 .   ? 15.135  25.227  1.455   1.00 27.74  ? 2075 HOH L O   1 
HETATM 3498 O O   . HOH E 4 .   ? 15.278  26.412  -2.786  1.00 39.99  ? 2076 HOH L O   1 
HETATM 3499 O O   . HOH E 4 .   ? 11.333  25.132  -4.408  1.00 28.68  ? 2077 HOH L O   1 
HETATM 3500 O O   . HOH E 4 .   ? 9.049   22.909  -6.941  1.00 46.66  ? 2078 HOH L O   1 
HETATM 3501 O O   . HOH E 4 .   ? 12.204  22.682  -5.105  1.00 34.74  ? 2079 HOH L O   1 
HETATM 3502 O O   . HOH E 4 .   ? 7.217   14.712  -1.813  1.00 32.43  ? 2080 HOH L O   1 
HETATM 3503 O O   . HOH E 4 .   ? 4.404   14.917  -8.899  1.00 49.81  ? 2081 HOH L O   1 
HETATM 3504 O O   . HOH E 4 .   ? 6.965   11.718  -2.234  1.00 32.33  ? 2082 HOH L O   1 
HETATM 3505 O O   . HOH E 4 .   ? 9.982   10.908  -8.543  1.00 51.77  ? 2083 HOH L O   1 
HETATM 3506 O O   . HOH E 4 .   ? 3.877   7.414   -10.317 1.00 43.73  ? 2084 HOH L O   1 
HETATM 3507 O O   . HOH E 4 .   ? -1.800  4.847   -7.655  1.00 51.99  ? 2085 HOH L O   1 
HETATM 3508 O O   . HOH E 4 .   ? 1.240   6.410   -10.013 1.00 40.13  ? 2086 HOH L O   1 
HETATM 3509 O O   . HOH E 4 .   ? -1.712  1.817   -5.497  1.00 45.18  ? 2087 HOH L O   1 
HETATM 3510 O O   . HOH E 4 .   ? 3.692   0.943   -5.210  1.00 40.34  ? 2088 HOH L O   1 
HETATM 3511 O O   . HOH E 4 .   ? -5.840  7.478   -3.423  1.00 46.06  ? 2089 HOH L O   1 
HETATM 3512 O O   . HOH E 4 .   ? 19.535  26.953  3.334   1.00 41.06  ? 2090 HOH L O   1 
HETATM 3513 O O   . HOH E 4 .   ? 14.652  23.480  17.876  1.00 42.20  ? 2091 HOH L O   1 
HETATM 3514 O O   . HOH E 4 .   ? 9.930   35.174  13.851  1.00 23.69  ? 2092 HOH L O   1 
HETATM 3515 O O   . HOH E 4 .   ? 7.752   28.768  16.487  1.00 42.91  ? 2093 HOH L O   1 
HETATM 3516 O O   . HOH E 4 .   ? -0.932  27.945  11.453  1.00 52.33  ? 2094 HOH L O   1 
HETATM 3517 O O   . HOH E 4 .   ? 1.265   32.424  9.634   1.00 44.71  ? 2095 HOH L O   1 
HETATM 3518 O O   . HOH E 4 .   ? 3.727   26.051  12.100  1.00 33.42  ? 2096 HOH L O   1 
HETATM 3519 O O   . HOH E 4 .   ? -2.106  24.762  7.493   1.00 32.94  ? 2097 HOH L O   1 
HETATM 3520 O O   . HOH E 4 .   ? -8.644  22.974  -1.080  1.00 51.25  ? 2098 HOH L O   1 
HETATM 3521 O O   . HOH E 4 .   ? -9.713  22.026  12.381  1.00 54.03  ? 2099 HOH L O   1 
HETATM 3522 O O   . HOH E 4 .   ? -3.399  23.165  12.214  1.00 58.14  ? 2100 HOH L O   1 
HETATM 3523 O O   . HOH E 4 .   ? -5.435  14.092  7.016   1.00 47.51  ? 2101 HOH L O   1 
HETATM 3524 O O   . HOH E 4 .   ? 2.338   14.402  6.553   1.00 29.98  ? 2102 HOH L O   1 
HETATM 3525 O O   . HOH E 4 .   ? 3.504   18.032  13.680  1.00 38.08  ? 2103 HOH L O   1 
HETATM 3526 O O   . HOH E 4 .   ? 8.009   17.984  15.788  1.00 40.77  ? 2104 HOH L O   1 
HETATM 3527 O O   . HOH E 4 .   ? 10.713  18.493  15.843  1.00 38.42  ? 2105 HOH L O   1 
HETATM 3528 O O   . HOH E 4 .   ? 19.620  23.630  12.408  1.00 34.22  ? 2106 HOH L O   1 
HETATM 3529 O O   . HOH E 4 .   ? 17.709  18.528  21.859  1.00 52.58  ? 2107 HOH L O   1 
HETATM 3530 O O   . HOH E 4 .   ? 18.952  24.030  19.881  1.00 33.12  ? 2108 HOH L O   1 
HETATM 3531 O O   . HOH E 4 .   ? 24.406  21.413  14.236  1.00 39.90  ? 2109 HOH L O   1 
HETATM 3532 O O   . HOH E 4 .   ? 28.559  30.112  15.515  1.00 50.96  ? 2110 HOH L O   1 
HETATM 3533 O O   . HOH E 4 .   ? 31.409  30.272  12.879  1.00 47.72  ? 2111 HOH L O   1 
HETATM 3534 O O   . HOH E 4 .   ? 19.580  25.582  10.499  1.00 26.52  ? 2112 HOH L O   1 
HETATM 3535 O O   . HOH E 4 .   ? 1.584   31.517  7.432   1.00 45.01  ? 2113 HOH L O   1 
HETATM 3536 O O   . HOH E 4 .   ? -1.023  32.336  -1.056  1.00 56.05  ? 2114 HOH L O   1 
HETATM 3537 O O   . HOH E 4 .   ? -1.550  35.329  2.320   1.00 53.19  ? 2115 HOH L O   1 
HETATM 3538 O O   . HOH E 4 .   ? 5.620   33.930  13.694  1.00 45.23  ? 2116 HOH L O   1 
HETATM 3539 O O   . HOH E 4 .   ? 6.041   36.867  7.662   1.00 29.37  ? 2117 HOH L O   1 
HETATM 3540 O O   . HOH E 4 .   ? 6.509   39.490  10.538  1.00 37.06  ? 2118 HOH L O   1 
HETATM 3541 O O   . HOH E 4 .   ? 11.982  36.501  5.126   1.00 25.00  ? 2119 HOH L O   1 
HETATM 3542 O O   . HOH E 4 .   ? 6.931   41.226  3.060   1.00 30.31  ? 2120 HOH L O   1 
HETATM 3543 O O   . HOH E 4 .   ? 9.440   39.292  2.213   1.00 30.30  ? 2121 HOH L O   1 
HETATM 3544 O O   . HOH E 4 .   ? 3.271   37.450  0.198   1.00 42.97  ? 2122 HOH L O   1 
HETATM 3545 O O   . HOH E 4 .   ? 6.398   35.552  -0.543  1.00 32.86  ? 2123 HOH L O   1 
HETATM 3546 O O   . HOH E 4 .   ? 6.148   34.625  -2.961  1.00 30.74  ? 2124 HOH L O   1 
HETATM 3547 O O   . HOH E 4 .   ? 6.493   30.357  -5.214  1.00 33.58  ? 2125 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU H . n 
A 1 2   VAL 2   2   2   VAL VAL H . n 
A 1 3   GLN 3   3   3   GLN GLN H . n 
A 1 4   LEU 4   4   4   LEU LEU H . n 
A 1 5   GLN 5   5   5   GLN GLN H . n 
A 1 6   GLN 6   6   6   GLN GLN H . n 
A 1 7   SER 7   7   7   SER SER H . n 
A 1 8   GLY 8   8   8   GLY GLY H . n 
A 1 9   PRO 9   9   9   PRO PRO H . n 
A 1 10  GLU 10  10  10  GLU GLU H . n 
A 1 11  LEU 11  11  11  LEU LEU H . n 
A 1 12  VAL 12  12  12  VAL VAL H . n 
A 1 13  LYS 13  13  13  LYS LYS H . n 
A 1 14  PRO 14  14  14  PRO PRO H . n 
A 1 15  GLY 15  15  15  GLY GLY H . n 
A 1 16  ALA 16  16  16  ALA ALA H . n 
A 1 17  SER 17  17  17  SER SER H . n 
A 1 18  VAL 18  18  18  VAL VAL H . n 
A 1 19  LYS 19  19  19  LYS LYS H . n 
A 1 20  ILE 20  20  20  ILE ILE H . n 
A 1 21  SER 21  21  21  SER SER H . n 
A 1 22  CYS 22  22  22  CYS CYS H . n 
A 1 23  LYS 23  23  23  LYS LYS H . n 
A 1 24  ALA 24  24  24  ALA ALA H . n 
A 1 25  SER 25  25  25  SER SER H . n 
A 1 26  GLY 26  26  26  GLY GLY H . n 
A 1 27  TYR 27  27  27  TYR TYR H . n 
A 1 28  SER 28  28  28  SER SER H . n 
A 1 29  PHE 29  29  29  PHE PHE H . n 
A 1 30  THR 30  30  30  THR THR H . n 
A 1 31  GLY 31  31  31  GLY GLY H . n 
A 1 32  TYR 32  32  32  TYR TYR H . n 
A 1 33  TYR 33  33  33  TYR TYR H . n 
A 1 34  MET 34  34  34  MET MET H . n 
A 1 35  ASN 35  35  35  ASN ASN H . n 
A 1 36  TRP 36  36  36  TRP TRP H . n 
A 1 37  VAL 37  37  37  VAL VAL H . n 
A 1 38  LYS 38  38  38  LYS LYS H . n 
A 1 39  GLN 39  39  39  GLN GLN H . n 
A 1 40  SER 40  40  40  SER SER H . n 
A 1 41  PRO 41  41  41  PRO PRO H . n 
A 1 42  GLU 42  42  42  GLU GLU H . n 
A 1 43  LYS 43  43  43  LYS LYS H . n 
A 1 44  SER 44  44  44  SER SER H . n 
A 1 45  LEU 45  45  45  LEU LEU H . n 
A 1 46  GLU 46  46  46  GLU GLU H . n 
A 1 47  TRP 47  47  47  TRP TRP H . n 
A 1 48  ILE 48  48  48  ILE ILE H . n 
A 1 49  GLY 49  49  49  GLY GLY H . n 
A 1 50  GLU 50  50  50  GLU GLU H . n 
A 1 51  MET 51  51  51  MET MET H . n 
A 1 52  SER 52  52  52  SER SER H . n 
A 1 53  PRO 53  53  53  PRO PRO H . n 
A 1 54  SER 54  54  54  SER SER H . n 
A 1 55  THR 55  55  55  THR THR H . n 
A 1 56  GLY 56  56  56  GLY GLY H . n 
A 1 57  ARG 57  57  57  ARG ARG H . n 
A 1 58  THR 58  58  58  THR THR H . n 
A 1 59  THR 59  59  59  THR THR H . n 
A 1 60  TYR 60  60  60  TYR TYR H . n 
A 1 61  ASN 61  61  61  ASN ASN H . n 
A 1 62  GLN 62  62  62  GLN GLN H . n 
A 1 63  ASN 63  63  63  ASN ASN H . n 
A 1 64  PHE 64  64  64  PHE PHE H . n 
A 1 65  LYS 65  65  65  LYS LYS H . n 
A 1 66  ALA 66  66  66  ALA ALA H . n 
A 1 67  LYS 67  67  67  LYS LYS H . n 
A 1 68  ALA 68  68  68  ALA ALA H . n 
A 1 69  THR 69  69  69  THR THR H . n 
A 1 70  LEU 70  70  70  LEU LEU H . n 
A 1 71  THR 71  71  71  THR THR H . n 
A 1 72  VAL 72  72  72  VAL VAL H . n 
A 1 73  ASP 73  73  73  ASP ASP H . n 
A 1 74  GLN 74  74  74  GLN GLN H . n 
A 1 75  SER 75  75  75  SER SER H . n 
A 1 76  SER 76  76  76  SER SER H . n 
A 1 77  SER 77  77  77  SER SER H . n 
A 1 78  THR 78  78  78  THR THR H . n 
A 1 79  ALA 79  79  79  ALA ALA H . n 
A 1 80  TYR 80  80  80  TYR TYR H . n 
A 1 81  MET 81  81  81  MET MET H . n 
A 1 82  GLN 82  82  82  GLN GLN H . n 
A 1 83  LEU 83  83  83  LEU LEU H . n 
A 1 84  LYS 84  84  84  LYS LYS H . n 
A 1 85  SER 85  85  85  SER SER H . n 
A 1 86  LEU 86  86  86  LEU LEU H . n 
A 1 87  THR 87  87  87  THR THR H . n 
A 1 88  SER 88  88  88  SER SER H . n 
A 1 89  GLU 89  89  89  GLU GLU H . n 
A 1 90  ASP 90  90  90  ASP ASP H . n 
A 1 91  SER 91  91  91  SER SER H . n 
A 1 92  ALA 92  92  92  ALA ALA H . n 
A 1 93  VAL 93  93  93  VAL VAL H . n 
A 1 94  TYR 94  94  94  TYR TYR H . n 
A 1 95  TYR 95  95  95  TYR TYR H . n 
A 1 96  CYS 96  96  96  CYS CYS H . n 
A 1 97  ALA 97  97  97  ALA ALA H . n 
A 1 98  ARG 98  98  98  ARG ARG H . n 
A 1 99  SER 99  99  99  SER SER H . n 
A 1 100 VAL 100 100 100 VAL VAL H . n 
A 1 101 PRO 101 101 101 PRO PRO H . n 
A 1 102 LEU 102 102 102 LEU LEU H . n 
A 1 103 THR 103 103 103 THR THR H . n 
A 1 104 THR 104 104 104 THR THR H . n 
A 1 105 LEU 105 105 105 LEU LEU H . n 
A 1 106 ILE 106 106 106 ILE ILE H . n 
A 1 107 GLU 107 107 107 GLU GLU H . n 
A 1 108 ASP 108 108 108 ASP ASP H . n 
A 1 109 TRP 109 109 109 TRP TRP H . n 
A 1 110 TYR 110 110 110 TYR TYR H . n 
A 1 111 PHE 111 111 111 PHE PHE H . n 
A 1 112 ASP 112 112 112 ASP ASP H . n 
A 1 113 VAL 113 113 113 VAL VAL H . n 
A 1 114 TRP 114 114 114 TRP TRP H . n 
A 1 115 GLY 115 115 115 GLY GLY H . n 
A 1 116 THR 116 116 116 THR THR H . n 
A 1 117 GLY 117 117 117 GLY GLY H . n 
A 1 118 THR 118 118 118 THR THR H . n 
A 1 119 THR 119 119 119 THR THR H . n 
A 1 120 VAL 120 120 120 VAL VAL H . n 
A 1 121 THR 121 121 121 THR THR H . n 
A 1 122 VAL 122 122 122 VAL VAL H . n 
A 1 123 SER 123 123 123 SER SER H . n 
A 1 124 SER 124 124 124 SER SER H . n 
A 1 125 ALA 125 125 125 ALA ALA H . n 
A 1 126 LYS 126 126 126 LYS LYS H . n 
A 1 127 THR 127 127 127 THR THR H . n 
A 1 128 THR 128 128 128 THR THR H . n 
A 1 129 PRO 129 129 129 PRO PRO H . n 
A 1 130 PRO 130 130 130 PRO PRO H . n 
A 1 131 SER 131 131 131 SER SER H . n 
A 1 132 VAL 132 132 132 VAL VAL H . n 
A 1 133 TYR 133 133 133 TYR TYR H . n 
A 1 134 PRO 134 134 134 PRO PRO H . n 
A 1 135 LEU 135 135 135 LEU LEU H . n 
A 1 136 ALA 136 136 136 ALA ALA H . n 
A 1 137 PRO 137 137 137 PRO PRO H . n 
A 1 138 GLY 138 138 138 GLY GLY H . n 
A 1 139 SER 139 139 139 SER SER H . n 
A 1 140 ALA 140 140 140 ALA ALA H . n 
A 1 141 ALA 141 141 141 ALA ALA H . n 
A 1 142 GLN 142 142 ?   ?   ?   H . n 
A 1 143 THR 143 143 ?   ?   ?   H . n 
A 1 144 ASN 144 144 144 ASN ASN H . n 
A 1 145 SER 145 145 145 SER SER H . n 
A 1 146 MET 146 146 146 MET MET H . n 
A 1 147 VAL 147 147 147 VAL VAL H . n 
A 1 148 THR 148 148 148 THR THR H . n 
A 1 149 LEU 149 149 149 LEU LEU H . n 
A 1 150 GLY 150 150 150 GLY GLY H . n 
A 1 151 CYS 151 151 151 CYS CYS H . n 
A 1 152 LEU 152 152 152 LEU LEU H . n 
A 1 153 VAL 153 153 153 VAL VAL H . n 
A 1 154 LYS 154 154 154 LYS LYS H . n 
A 1 155 GLY 155 155 155 GLY GLY H . n 
A 1 156 TYR 156 156 156 TYR TYR H . n 
A 1 157 PHE 157 157 157 PHE PHE H . n 
A 1 158 PRO 158 158 158 PRO PRO H . n 
A 1 159 GLU 159 159 159 GLU GLU H . n 
A 1 160 PRO 160 160 160 PRO PRO H . n 
A 1 161 VAL 161 161 161 VAL VAL H . n 
A 1 162 THR 162 162 162 THR THR H . n 
A 1 163 VAL 163 163 163 VAL VAL H . n 
A 1 164 THR 164 164 164 THR THR H . n 
A 1 165 TRP 165 165 165 TRP TRP H . n 
A 1 166 ASN 166 166 166 ASN ASN H . n 
A 1 167 SER 167 167 167 SER SER H . n 
A 1 168 GLY 168 168 168 GLY GLY H . n 
A 1 169 SER 169 169 169 SER SER H . n 
A 1 170 LEU 170 170 170 LEU LEU H . n 
A 1 171 SER 171 171 171 SER SER H . n 
A 1 172 SER 172 172 172 SER SER H . n 
A 1 173 GLY 173 173 173 GLY GLY H . n 
A 1 174 VAL 174 174 174 VAL VAL H . n 
A 1 175 HIS 175 175 175 HIS HIS H . n 
A 1 176 THR 176 176 176 THR THR H . n 
A 1 177 PHE 177 177 177 PHE PHE H . n 
A 1 178 PRO 178 178 178 PRO PRO H . n 
A 1 179 ALA 179 179 179 ALA ALA H . n 
A 1 180 VAL 180 180 180 VAL VAL H . n 
A 1 181 LEU 181 181 181 LEU LEU H . n 
A 1 182 GLN 182 182 182 GLN GLN H . n 
A 1 183 SER 183 183 183 SER SER H . n 
A 1 184 ASP 184 184 184 ASP ASP H . n 
A 1 185 LEU 185 185 185 LEU LEU H . n 
A 1 186 TYR 186 186 186 TYR TYR H . n 
A 1 187 THR 187 187 187 THR THR H . n 
A 1 188 LEU 188 188 188 LEU LEU H . n 
A 1 189 SER 189 189 189 SER SER H . n 
A 1 190 SER 190 190 190 SER SER H . n 
A 1 191 SER 191 191 191 SER SER H . n 
A 1 192 VAL 192 192 192 VAL VAL H . n 
A 1 193 THR 193 193 193 THR THR H . n 
A 1 194 VAL 194 194 194 VAL VAL H . n 
A 1 195 PRO 195 195 195 PRO PRO H . n 
A 1 196 SER 196 196 196 SER SER H . n 
A 1 197 SER 197 197 197 SER SER H . n 
A 1 198 THR 198 198 198 THR THR H . n 
A 1 199 TRP 199 199 199 TRP TRP H . n 
A 1 200 PRO 200 200 200 PRO PRO H . n 
A 1 201 SER 201 201 201 SER SER H . n 
A 1 202 GLU 202 202 202 GLU GLU H . n 
A 1 203 THR 203 203 203 THR THR H . n 
A 1 204 VAL 204 204 204 VAL VAL H . n 
A 1 205 THR 205 205 205 THR THR H . n 
A 1 206 CYS 206 206 206 CYS CYS H . n 
A 1 207 ASN 207 207 207 ASN ASN H . n 
A 1 208 VAL 208 208 208 VAL VAL H . n 
A 1 209 ALA 209 209 209 ALA ALA H . n 
A 1 210 HIS 210 210 210 HIS HIS H . n 
A 1 211 PRO 211 211 211 PRO PRO H . n 
A 1 212 ALA 212 212 212 ALA ALA H . n 
A 1 213 SER 213 213 213 SER SER H . n 
A 1 214 SER 214 214 214 SER SER H . n 
A 1 215 THR 215 215 215 THR THR H . n 
A 1 216 LYS 216 216 216 LYS LYS H . n 
A 1 217 VAL 217 217 217 VAL VAL H . n 
A 1 218 ASP 218 218 218 ASP ASP H . n 
A 1 219 LYS 219 219 219 LYS LYS H . n 
A 1 220 LYS 220 220 220 LYS LYS H . n 
A 1 221 ILE 221 221 221 ILE ILE H . n 
A 1 222 VAL 222 222 222 VAL VAL H . n 
A 1 223 PRO 223 223 223 PRO PRO H . n 
A 1 224 ARG 224 224 224 ARG ARG H . n 
B 2 1   ASP 1   1   1   ASP ASP L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   GLN 3   3   3   GLN GLN L . n 
B 2 4   MET 4   4   4   MET MET L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   SER 7   7   7   SER SER L . n 
B 2 8   PRO 8   8   8   PRO PRO L . n 
B 2 9   ALA 9   9   9   ALA ALA L . n 
B 2 10  SER 10  10  10  SER SER L . n 
B 2 11  LEU 11  11  11  LEU LEU L . n 
B 2 12  SER 12  12  12  SER SER L . n 
B 2 13  ALA 13  13  13  ALA ALA L . n 
B 2 14  SER 14  14  14  SER SER L . n 
B 2 15  VAL 15  15  15  VAL VAL L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  ALA 17  17  17  ALA ALA L . n 
B 2 18  THR 18  18  18  THR THR L . n 
B 2 19  VAL 19  19  19  VAL VAL L . n 
B 2 20  THR 20  20  20  THR THR L . n 
B 2 21  ILE 21  21  21  ILE ILE L . n 
B 2 22  THR 22  22  22  THR THR L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  ARG 24  24  24  ARG ARG L . n 
B 2 25  THR 25  25  25  THR THR L . n 
B 2 26  SER 26  26  26  SER SER L . n 
B 2 27  GLU 27  27  27  GLU GLU L . n 
B 2 28  ASN 28  28  28  ASN ASN L . n 
B 2 29  ILE 29  29  29  ILE ILE L . n 
B 2 30  ASP 30  30  30  ASP ASP L . n 
B 2 31  SER 31  31  31  SER SER L . n 
B 2 32  TYR 32  32  32  TYR TYR L . n 
B 2 33  LEU 33  33  33  LEU LEU L . n 
B 2 34  ALA 34  34  34  ALA ALA L . n 
B 2 35  TRP 35  35  35  TRP TRP L . n 
B 2 36  TYR 36  36  36  TYR TYR L . n 
B 2 37  GLN 37  37  37  GLN GLN L . n 
B 2 38  GLN 38  38  38  GLN GLN L . n 
B 2 39  ARG 39  39  39  ARG ARG L . n 
B 2 40  GLN 40  40  40  GLN GLN L . n 
B 2 41  GLY 41  41  41  GLY GLY L . n 
B 2 42  LYS 42  42  42  LYS LYS L . n 
B 2 43  SER 43  43  43  SER SER L . n 
B 2 44  PRO 44  44  44  PRO PRO L . n 
B 2 45  GLN 45  45  45  GLN GLN L . n 
B 2 46  LEU 46  46  46  LEU LEU L . n 
B 2 47  LEU 47  47  47  LEU LEU L . n 
B 2 48  VAL 48  48  48  VAL VAL L . n 
B 2 49  TYR 49  49  49  TYR TYR L . n 
B 2 50  ALA 50  50  50  ALA ALA L . n 
B 2 51  ALA 51  51  51  ALA ALA L . n 
B 2 52  THR 52  52  52  THR THR L . n 
B 2 53  ASN 53  53  53  ASN ASN L . n 
B 2 54  LEU 54  54  54  LEU LEU L . n 
B 2 55  ALA 55  55  55  ALA ALA L . n 
B 2 56  ASP 56  56  56  ASP ASP L . n 
B 2 57  GLY 57  57  57  GLY GLY L . n 
B 2 58  VAL 58  58  58  VAL VAL L . n 
B 2 59  PRO 59  59  59  PRO PRO L . n 
B 2 60  SER 60  60  60  SER SER L . n 
B 2 61  ARG 61  61  61  ARG ARG L . n 
B 2 62  PHE 62  62  62  PHE PHE L . n 
B 2 63  SER 63  63  63  SER SER L . n 
B 2 64  GLY 64  64  64  GLY GLY L . n 
B 2 65  SER 65  65  65  SER SER L . n 
B 2 66  GLY 66  66  66  GLY GLY L . n 
B 2 67  SER 67  67  67  SER SER L . n 
B 2 68  GLY 68  68  68  GLY GLY L . n 
B 2 69  THR 69  69  69  THR THR L . n 
B 2 70  GLN 70  70  70  GLN GLN L . n 
B 2 71  TYR 71  71  71  TYR TYR L . n 
B 2 72  SER 72  72  72  SER SER L . n 
B 2 73  LEU 73  73  73  LEU LEU L . n 
B 2 74  LYS 74  74  74  LYS LYS L . n 
B 2 75  ILE 75  75  75  ILE ILE L . n 
B 2 76  ASN 76  76  76  ASN ASN L . n 
B 2 77  SER 77  77  77  SER SER L . n 
B 2 78  LEU 78  78  78  LEU LEU L . n 
B 2 79  GLN 79  79  79  GLN GLN L . n 
B 2 80  SER 80  80  80  SER SER L . n 
B 2 81  GLU 81  81  81  GLU GLU L . n 
B 2 82  ASP 82  82  82  ASP ASP L . n 
B 2 83  VAL 83  83  83  VAL VAL L . n 
B 2 84  ALA 84  84  84  ALA ALA L . n 
B 2 85  ARG 85  85  85  ARG ARG L . n 
B 2 86  TYR 86  86  86  TYR TYR L . n 
B 2 87  TYR 87  87  87  TYR TYR L . n 
B 2 88  CYS 88  88  88  CYS CYS L . n 
B 2 89  GLN 89  89  89  GLN GLN L . n 
B 2 90  HIS 90  90  90  HIS HIS L . n 
B 2 91  TYR 91  91  91  TYR TYR L . n 
B 2 92  SER 92  92  92  SER SER L . n 
B 2 93  THR 93  93  93  THR THR L . n 
B 2 94  THR 94  94  94  THR THR L . n 
B 2 95  PRO 95  95  95  PRO PRO L . n 
B 2 96  TRP 96  96  96  TRP TRP L . n 
B 2 97  THR 97  97  97  THR THR L . n 
B 2 98  PHE 98  98  98  PHE PHE L . n 
B 2 99  GLY 99  99  99  GLY GLY L . n 
B 2 100 GLY 100 100 100 GLY GLY L . n 
B 2 101 GLY 101 101 101 GLY GLY L . n 
B 2 102 THR 102 102 102 THR THR L . n 
B 2 103 GLN 103 103 103 GLN GLN L . n 
B 2 104 LEU 104 104 104 LEU LEU L . n 
B 2 105 GLU 105 105 105 GLU GLU L . n 
B 2 106 ILE 106 106 106 ILE ILE L . n 
B 2 107 LYS 107 107 107 LYS LYS L . n 
B 2 108 ARG 108 108 108 ARG ARG L . n 
B 2 109 ALA 109 109 109 ALA ALA L . n 
B 2 110 ASP 110 110 110 ASP ASP L . n 
B 2 111 ALA 111 111 111 ALA ALA L . n 
B 2 112 ALA 112 112 112 ALA ALA L . n 
B 2 113 PRO 113 113 113 PRO PRO L . n 
B 2 114 THR 114 114 114 THR THR L . n 
B 2 115 VAL 115 115 115 VAL VAL L . n 
B 2 116 SER 116 116 116 SER SER L . n 
B 2 117 ILE 117 117 117 ILE ILE L . n 
B 2 118 PHE 118 118 118 PHE PHE L . n 
B 2 119 PRO 119 119 119 PRO PRO L . n 
B 2 120 PRO 120 120 120 PRO PRO L . n 
B 2 121 SER 121 121 121 SER SER L . n 
B 2 122 SER 122 122 122 SER SER L . n 
B 2 123 GLU 123 123 123 GLU GLU L . n 
B 2 124 GLN 124 124 124 GLN GLN L . n 
B 2 125 LEU 125 125 125 LEU LEU L . n 
B 2 126 THR 126 126 126 THR THR L . n 
B 2 127 SER 127 127 127 SER SER L . n 
B 2 128 GLY 128 128 128 GLY GLY L . n 
B 2 129 GLY 129 129 129 GLY GLY L . n 
B 2 130 ALA 130 130 130 ALA ALA L . n 
B 2 131 SER 131 131 131 SER SER L . n 
B 2 132 VAL 132 132 132 VAL VAL L . n 
B 2 133 VAL 133 133 133 VAL VAL L . n 
B 2 134 CYS 134 134 134 CYS CYS L . n 
B 2 135 PHE 135 135 135 PHE PHE L . n 
B 2 136 LEU 136 136 136 LEU LEU L . n 
B 2 137 ASN 137 137 137 ASN ASN L . n 
B 2 138 ASN 138 138 138 ASN ASN L . n 
B 2 139 PHE 139 139 139 PHE PHE L . n 
B 2 140 TYR 140 140 140 TYR TYR L . n 
B 2 141 PRO 141 141 141 PRO PRO L . n 
B 2 142 LYS 142 142 142 LYS LYS L . n 
B 2 143 ASP 143 143 143 ASP ASP L . n 
B 2 144 ILE 144 144 144 ILE ILE L . n 
B 2 145 ASN 145 145 145 ASN ASN L . n 
B 2 146 VAL 146 146 146 VAL VAL L . n 
B 2 147 LYS 147 147 147 LYS LYS L . n 
B 2 148 TRP 148 148 148 TRP TRP L . n 
B 2 149 LYS 149 149 149 LYS LYS L . n 
B 2 150 ILE 150 150 150 ILE ILE L . n 
B 2 151 ASP 151 151 151 ASP ASP L . n 
B 2 152 GLY 152 152 152 GLY GLY L . n 
B 2 153 SER 153 153 153 SER SER L . n 
B 2 154 GLU 154 154 154 GLU GLU L . n 
B 2 155 ARG 155 155 155 ARG ARG L . n 
B 2 156 GLN 156 156 156 GLN GLN L . n 
B 2 157 ASN 157 157 157 ASN ASN L . n 
B 2 158 GLY 158 158 158 GLY GLY L . n 
B 2 159 VAL 159 159 159 VAL VAL L . n 
B 2 160 LEU 160 160 160 LEU LEU L . n 
B 2 161 ASN 161 161 161 ASN ASN L . n 
B 2 162 SER 162 162 162 SER SER L . n 
B 2 163 TRP 163 163 163 TRP TRP L . n 
B 2 164 THR 164 164 164 THR THR L . n 
B 2 165 ASP 165 165 165 ASP ASP L . n 
B 2 166 GLN 166 166 166 GLN GLN L . n 
B 2 167 ASP 167 167 167 ASP ASP L . n 
B 2 168 SER 168 168 168 SER SER L . n 
B 2 169 LYS 169 169 169 LYS LYS L . n 
B 2 170 ASP 170 170 170 ASP ASP L . n 
B 2 171 SER 171 171 171 SER SER L . n 
B 2 172 THR 172 172 172 THR THR L . n 
B 2 173 TYR 173 173 173 TYR TYR L . n 
B 2 174 SER 174 174 174 SER SER L . n 
B 2 175 MET 175 175 175 MET MET L . n 
B 2 176 SER 176 176 176 SER SER L . n 
B 2 177 SER 177 177 177 SER SER L . n 
B 2 178 THR 178 178 178 THR THR L . n 
B 2 179 LEU 179 179 179 LEU LEU L . n 
B 2 180 THR 180 180 180 THR THR L . n 
B 2 181 LEU 181 181 181 LEU LEU L . n 
B 2 182 THR 182 182 182 THR THR L . n 
B 2 183 LYS 183 183 183 LYS LYS L . n 
B 2 184 ASP 184 184 184 ASP ASP L . n 
B 2 185 GLU 185 185 185 GLU GLU L . n 
B 2 186 TYR 186 186 186 TYR TYR L . n 
B 2 187 GLU 187 187 187 GLU GLU L . n 
B 2 188 ARG 188 188 188 ARG ARG L . n 
B 2 189 HIS 189 189 189 HIS HIS L . n 
B 2 190 ASN 190 190 190 ASN ASN L . n 
B 2 191 SER 191 191 191 SER SER L . n 
B 2 192 TYR 192 192 192 TYR TYR L . n 
B 2 193 THR 193 193 193 THR THR L . n 
B 2 194 CYS 194 194 194 CYS CYS L . n 
B 2 195 GLU 195 195 195 GLU GLU L . n 
B 2 196 ALA 196 196 196 ALA ALA L . n 
B 2 197 THR 197 197 197 THR THR L . n 
B 2 198 HIS 198 198 198 HIS HIS L . n 
B 2 199 LYS 199 199 199 LYS LYS L . n 
B 2 200 THR 200 200 200 THR THR L . n 
B 2 201 SER 201 201 201 SER SER L . n 
B 2 202 THR 202 202 202 THR THR L . n 
B 2 203 SER 203 203 203 SER SER L . n 
B 2 204 PRO 204 204 204 PRO PRO L . n 
B 2 205 ILE 205 205 205 ILE ILE L . n 
B 2 206 VAL 206 206 206 VAL VAL L . n 
B 2 207 LYS 207 207 207 LYS LYS L . n 
B 2 208 SER 208 208 208 SER SER L . n 
B 2 209 PHE 209 209 209 PHE PHE L . n 
B 2 210 ASN 210 210 210 ASN ASN L . n 
B 2 211 ARG 211 211 211 ARG ARG L . n 
B 2 212 ASN 212 212 212 ASN ASN L . n 
B 2 213 GLU 213 213 213 GLU GLU L . n 
B 2 214 CYS 214 214 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1   1214 1214 GOL GOL L . 
D 4 HOH 1   2001 2001 HOH HOH H . 
D 4 HOH 2   2002 2002 HOH HOH H . 
D 4 HOH 3   2003 2003 HOH HOH H . 
D 4 HOH 4   2004 2004 HOH HOH H . 
D 4 HOH 5   2005 2005 HOH HOH H . 
D 4 HOH 6   2006 2006 HOH HOH H . 
D 4 HOH 7   2007 2007 HOH HOH H . 
D 4 HOH 8   2008 2008 HOH HOH H . 
D 4 HOH 9   2009 2009 HOH HOH H . 
D 4 HOH 10  2010 2010 HOH HOH H . 
D 4 HOH 11  2011 2011 HOH HOH H . 
D 4 HOH 12  2012 2012 HOH HOH H . 
D 4 HOH 13  2013 2013 HOH HOH H . 
D 4 HOH 14  2014 2014 HOH HOH H . 
D 4 HOH 15  2015 2015 HOH HOH H . 
D 4 HOH 16  2016 2016 HOH HOH H . 
D 4 HOH 17  2017 2017 HOH HOH H . 
D 4 HOH 18  2018 2018 HOH HOH H . 
D 4 HOH 19  2019 2019 HOH HOH H . 
D 4 HOH 20  2020 2020 HOH HOH H . 
D 4 HOH 21  2021 2021 HOH HOH H . 
D 4 HOH 22  2022 2022 HOH HOH H . 
D 4 HOH 23  2023 2023 HOH HOH H . 
D 4 HOH 24  2024 2024 HOH HOH H . 
D 4 HOH 25  2025 2025 HOH HOH H . 
D 4 HOH 26  2026 2026 HOH HOH H . 
D 4 HOH 27  2027 2027 HOH HOH H . 
D 4 HOH 28  2028 2028 HOH HOH H . 
D 4 HOH 29  2029 2029 HOH HOH H . 
D 4 HOH 30  2030 2030 HOH HOH H . 
D 4 HOH 31  2031 2031 HOH HOH H . 
D 4 HOH 32  2032 2032 HOH HOH H . 
D 4 HOH 33  2033 2033 HOH HOH H . 
D 4 HOH 34  2034 2034 HOH HOH H . 
D 4 HOH 35  2035 2035 HOH HOH H . 
D 4 HOH 36  2036 2036 HOH HOH H . 
D 4 HOH 37  2037 2037 HOH HOH H . 
D 4 HOH 38  2038 2038 HOH HOH H . 
D 4 HOH 39  2039 2039 HOH HOH H . 
D 4 HOH 40  2040 2040 HOH HOH H . 
D 4 HOH 41  2041 2041 HOH HOH H . 
D 4 HOH 42  2042 2042 HOH HOH H . 
D 4 HOH 43  2043 2043 HOH HOH H . 
D 4 HOH 44  2044 2044 HOH HOH H . 
D 4 HOH 45  2045 2045 HOH HOH H . 
D 4 HOH 46  2046 2046 HOH HOH H . 
D 4 HOH 47  2047 2047 HOH HOH H . 
D 4 HOH 48  2048 2048 HOH HOH H . 
D 4 HOH 49  2049 2049 HOH HOH H . 
D 4 HOH 50  2050 2050 HOH HOH H . 
D 4 HOH 51  2051 2051 HOH HOH H . 
D 4 HOH 52  2052 2052 HOH HOH H . 
D 4 HOH 53  2053 2053 HOH HOH H . 
D 4 HOH 54  2054 2054 HOH HOH H . 
D 4 HOH 55  2055 2055 HOH HOH H . 
D 4 HOH 56  2056 2056 HOH HOH H . 
D 4 HOH 57  2057 2057 HOH HOH H . 
D 4 HOH 58  2058 2058 HOH HOH H . 
D 4 HOH 59  2059 2059 HOH HOH H . 
D 4 HOH 60  2060 2060 HOH HOH H . 
D 4 HOH 61  2061 2061 HOH HOH H . 
D 4 HOH 62  2062 2062 HOH HOH H . 
D 4 HOH 63  2063 2063 HOH HOH H . 
D 4 HOH 64  2064 2064 HOH HOH H . 
D 4 HOH 65  2065 2065 HOH HOH H . 
D 4 HOH 66  2066 2066 HOH HOH H . 
D 4 HOH 67  2067 2067 HOH HOH H . 
D 4 HOH 68  2068 2068 HOH HOH H . 
D 4 HOH 69  2069 2069 HOH HOH H . 
D 4 HOH 70  2070 2070 HOH HOH H . 
D 4 HOH 71  2071 2071 HOH HOH H . 
D 4 HOH 72  2072 2072 HOH HOH H . 
D 4 HOH 73  2073 2073 HOH HOH H . 
D 4 HOH 74  2074 2074 HOH HOH H . 
D 4 HOH 75  2075 2075 HOH HOH H . 
D 4 HOH 76  2076 2076 HOH HOH H . 
D 4 HOH 77  2077 2077 HOH HOH H . 
D 4 HOH 78  2078 2078 HOH HOH H . 
D 4 HOH 79  2079 2079 HOH HOH H . 
D 4 HOH 80  2080 2080 HOH HOH H . 
D 4 HOH 81  2081 2081 HOH HOH H . 
D 4 HOH 82  2082 2082 HOH HOH H . 
D 4 HOH 83  2083 2083 HOH HOH H . 
D 4 HOH 84  2084 2084 HOH HOH H . 
D 4 HOH 85  2085 2085 HOH HOH H . 
D 4 HOH 86  2086 2086 HOH HOH H . 
D 4 HOH 87  2087 2087 HOH HOH H . 
E 4 HOH 1   2001 2001 HOH HOH L . 
E 4 HOH 2   2002 2002 HOH HOH L . 
E 4 HOH 3   2003 2003 HOH HOH L . 
E 4 HOH 4   2004 2004 HOH HOH L . 
E 4 HOH 5   2005 2005 HOH HOH L . 
E 4 HOH 6   2006 2006 HOH HOH L . 
E 4 HOH 7   2007 2007 HOH HOH L . 
E 4 HOH 8   2008 2008 HOH HOH L . 
E 4 HOH 9   2009 2009 HOH HOH L . 
E 4 HOH 10  2010 2010 HOH HOH L . 
E 4 HOH 11  2011 2011 HOH HOH L . 
E 4 HOH 12  2012 2012 HOH HOH L . 
E 4 HOH 13  2013 2013 HOH HOH L . 
E 4 HOH 14  2014 2014 HOH HOH L . 
E 4 HOH 15  2015 2015 HOH HOH L . 
E 4 HOH 16  2016 2016 HOH HOH L . 
E 4 HOH 17  2017 2017 HOH HOH L . 
E 4 HOH 18  2018 2018 HOH HOH L . 
E 4 HOH 19  2019 2019 HOH HOH L . 
E 4 HOH 20  2020 2020 HOH HOH L . 
E 4 HOH 21  2021 2021 HOH HOH L . 
E 4 HOH 22  2022 2022 HOH HOH L . 
E 4 HOH 23  2023 2023 HOH HOH L . 
E 4 HOH 24  2024 2024 HOH HOH L . 
E 4 HOH 25  2025 2025 HOH HOH L . 
E 4 HOH 26  2026 2026 HOH HOH L . 
E 4 HOH 27  2027 2027 HOH HOH L . 
E 4 HOH 28  2028 2028 HOH HOH L . 
E 4 HOH 29  2029 2029 HOH HOH L . 
E 4 HOH 30  2030 2030 HOH HOH L . 
E 4 HOH 31  2031 2031 HOH HOH L . 
E 4 HOH 32  2032 2032 HOH HOH L . 
E 4 HOH 33  2033 2033 HOH HOH L . 
E 4 HOH 34  2034 2034 HOH HOH L . 
E 4 HOH 35  2035 2035 HOH HOH L . 
E 4 HOH 36  2036 2036 HOH HOH L . 
E 4 HOH 37  2037 2037 HOH HOH L . 
E 4 HOH 38  2038 2038 HOH HOH L . 
E 4 HOH 39  2039 2039 HOH HOH L . 
E 4 HOH 40  2040 2040 HOH HOH L . 
E 4 HOH 41  2041 2041 HOH HOH L . 
E 4 HOH 42  2042 2042 HOH HOH L . 
E 4 HOH 43  2043 2043 HOH HOH L . 
E 4 HOH 44  2044 2044 HOH HOH L . 
E 4 HOH 45  2045 2045 HOH HOH L . 
E 4 HOH 46  2046 2046 HOH HOH L . 
E 4 HOH 47  2047 2047 HOH HOH L . 
E 4 HOH 48  2048 2048 HOH HOH L . 
E 4 HOH 49  2049 2049 HOH HOH L . 
E 4 HOH 50  2050 2050 HOH HOH L . 
E 4 HOH 51  2051 2051 HOH HOH L . 
E 4 HOH 52  2052 2052 HOH HOH L . 
E 4 HOH 53  2053 2053 HOH HOH L . 
E 4 HOH 54  2054 2054 HOH HOH L . 
E 4 HOH 55  2055 2055 HOH HOH L . 
E 4 HOH 56  2056 2056 HOH HOH L . 
E 4 HOH 57  2057 2057 HOH HOH L . 
E 4 HOH 58  2058 2058 HOH HOH L . 
E 4 HOH 59  2059 2059 HOH HOH L . 
E 4 HOH 60  2060 2060 HOH HOH L . 
E 4 HOH 61  2061 2061 HOH HOH L . 
E 4 HOH 62  2062 2062 HOH HOH L . 
E 4 HOH 63  2063 2063 HOH HOH L . 
E 4 HOH 64  2064 2064 HOH HOH L . 
E 4 HOH 65  2065 2065 HOH HOH L . 
E 4 HOH 66  2066 2066 HOH HOH L . 
E 4 HOH 67  2067 2067 HOH HOH L . 
E 4 HOH 68  2068 2068 HOH HOH L . 
E 4 HOH 69  2069 2069 HOH HOH L . 
E 4 HOH 70  2070 2070 HOH HOH L . 
E 4 HOH 71  2071 2071 HOH HOH L . 
E 4 HOH 72  2072 2072 HOH HOH L . 
E 4 HOH 73  2073 2073 HOH HOH L . 
E 4 HOH 74  2074 2074 HOH HOH L . 
E 4 HOH 75  2075 2075 HOH HOH L . 
E 4 HOH 76  2076 2076 HOH HOH L . 
E 4 HOH 77  2077 2077 HOH HOH L . 
E 4 HOH 78  2078 2078 HOH HOH L . 
E 4 HOH 79  2079 2079 HOH HOH L . 
E 4 HOH 80  2080 2080 HOH HOH L . 
E 4 HOH 81  2081 2081 HOH HOH L . 
E 4 HOH 82  2082 2082 HOH HOH L . 
E 4 HOH 83  2083 2083 HOH HOH L . 
E 4 HOH 84  2084 2084 HOH HOH L . 
E 4 HOH 85  2085 2085 HOH HOH L . 
E 4 HOH 86  2086 2086 HOH HOH L . 
E 4 HOH 87  2087 2087 HOH HOH L . 
E 4 HOH 88  2088 2088 HOH HOH L . 
E 4 HOH 89  2089 2089 HOH HOH L . 
E 4 HOH 90  2090 2090 HOH HOH L . 
E 4 HOH 91  2091 2091 HOH HOH L . 
E 4 HOH 92  2092 2092 HOH HOH L . 
E 4 HOH 93  2093 2093 HOH HOH L . 
E 4 HOH 94  2094 2094 HOH HOH L . 
E 4 HOH 95  2095 2095 HOH HOH L . 
E 4 HOH 96  2096 2096 HOH HOH L . 
E 4 HOH 97  2097 2097 HOH HOH L . 
E 4 HOH 98  2098 2098 HOH HOH L . 
E 4 HOH 99  2099 2099 HOH HOH L . 
E 4 HOH 100 2100 2100 HOH HOH L . 
E 4 HOH 101 2101 2101 HOH HOH L . 
E 4 HOH 102 2102 2102 HOH HOH L . 
E 4 HOH 103 2103 2103 HOH HOH L . 
E 4 HOH 104 2104 2104 HOH HOH L . 
E 4 HOH 105 2105 2105 HOH HOH L . 
E 4 HOH 106 2106 2106 HOH HOH L . 
E 4 HOH 107 2107 2107 HOH HOH L . 
E 4 HOH 108 2108 2108 HOH HOH L . 
E 4 HOH 109 2109 2109 HOH HOH L . 
E 4 HOH 110 2110 2110 HOH HOH L . 
E 4 HOH 111 2111 2111 HOH HOH L . 
E 4 HOH 112 2112 2112 HOH HOH L . 
E 4 HOH 113 2113 2113 HOH HOH L . 
E 4 HOH 114 2114 2114 HOH HOH L . 
E 4 HOH 115 2115 2115 HOH HOH L . 
E 4 HOH 116 2116 2116 HOH HOH L . 
E 4 HOH 117 2117 2117 HOH HOH L . 
E 4 HOH 118 2118 2118 HOH HOH L . 
E 4 HOH 119 2119 2119 HOH HOH L . 
E 4 HOH 120 2120 2120 HOH HOH L . 
E 4 HOH 121 2121 2121 HOH HOH L . 
E 4 HOH 122 2122 2122 HOH HOH L . 
E 4 HOH 123 2123 2123 HOH HOH L . 
E 4 HOH 124 2124 2124 HOH HOH L . 
E 4 HOH 125 2125 2125 HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3830  ? 
1 MORE         -26.1 ? 
1 'SSA (A^2)'  19830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    H 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2004 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-10-23 
2 'Structure model' 1 1 2013-10-30 
3 'Structure model' 1 2 2017-08-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_detector 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_detector.type' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 22.4888 12.0193 35.6524 0.3216 0.1691 0.1129 -0.0169 0.0733  0.0555  1.1385 2.8640 2.2047 0.3447  
-0.5955 1.0496 -0.3236 -0.0323 -0.2242 0.1895  0.2196  0.1572 0.7599  -0.0476 0.1039 
'X-RAY DIFFRACTION' 2 ? refined 10.8741 17.7850 3.0512  0.0187 0.2885 0.1673 -0.0048 -0.0176 -0.1317 0.2475 5.0973 1.3998 -0.2580 
-0.0545 0.7128 -0.0118 0.2416  -0.1464 -0.2232 -0.0850 0.1616 -0.0936 -0.2522 0.0968 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 L 1   ? ? L 108 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 H 1   ? ? H 124 ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 L 109 ? ? L 212 ? ? ? ? 
'X-RAY DIFFRACTION' 4 2 H 125 ? ? H 224 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.7.0032 ? 1 ? ? ? ? 
XDS    'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
AMoRE  phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO H 14  ? ? -61.79  21.79   
2 1 ALA H 16  ? ? -68.66  -172.85 
3 1 SER H 99  ? ? -110.66 -152.65 
4 1 GLU H 107 ? ? -105.35 64.53   
5 1 TRP H 109 ? ? -112.40 59.12   
6 1 ALA H 140 ? ? 53.61   -143.16 
7 1 ALA L 51  ? ? 67.49   -32.86  
8 1 SER L 77  ? ? 32.81   73.56   
9 1 SER L 92  ? ? -92.43  -61.85  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 H LYS 84  ? CG  ? A LYS 84  CG  
2 1 Y 1 H LYS 84  ? CD  ? A LYS 84  CD  
3 1 Y 1 H LYS 84  ? CE  ? A LYS 84  CE  
4 1 Y 1 H LYS 84  ? NZ  ? A LYS 84  NZ  
5 1 Y 1 L GLU 213 ? CG  ? B GLU 213 CG  
6 1 Y 1 L GLU 213 ? CD  ? B GLU 213 CD  
7 1 Y 1 L GLU 213 ? OE1 ? B GLU 213 OE1 
8 1 Y 1 L GLU 213 ? OE2 ? B GLU 213 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H GLN 142 ? A GLN 142 
2 1 Y 1 H THR 143 ? A THR 143 
3 1 Y 1 L CYS 214 ? B CYS 214 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
#