data_2YRY
# 
_entry.id   2YRY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YRY         
RCSB  RCSB027058   
WWPDB D_1000027058 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000946.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2YRY 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, H.'                                                 1 
'Sato, M.'                                               2 
'Koshiba, S.'                                            3 
'Watanabe, S.'                                           4 
'Harada, T.'                                             5 
'Kigawa, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, H.'       1 
primary 'Sato, M.'     2 
primary 'Koshiba, S.'  3 
primary 'Watanabe, S.' 4 
primary 'Harada, T.'   5 
primary 'Kigawa, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_cell.entry_id           2YRY 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2YRY 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Pleckstrin homology domain-containing family A member 6' 
_entity.formula_weight             13730.462 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PH domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphoinositol 3-phosphate-binding protein 3, PEPP-3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGGKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSD
NISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGGKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSD
NISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000946.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLY n 
1 9   LYS n 
1 10  ARG n 
1 11  SER n 
1 12  HIS n 
1 13  SER n 
1 14  MET n 
1 15  LYS n 
1 16  ARG n 
1 17  ASN n 
1 18  PRO n 
1 19  ASN n 
1 20  ALA n 
1 21  PRO n 
1 22  VAL n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  GLY n 
1 27  TRP n 
1 28  LEU n 
1 29  PHE n 
1 30  LYS n 
1 31  GLN n 
1 32  ALA n 
1 33  SER n 
1 34  SER n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  GLN n 
1 39  TRP n 
1 40  ASN n 
1 41  LYS n 
1 42  ARG n 
1 43  TRP n 
1 44  PHE n 
1 45  VAL n 
1 46  LEU n 
1 47  VAL n 
1 48  ASP n 
1 49  ARG n 
1 50  CYS n 
1 51  LEU n 
1 52  PHE n 
1 53  TYR n 
1 54  TYR n 
1 55  LYS n 
1 56  ASP n 
1 57  GLU n 
1 58  LYS n 
1 59  GLU n 
1 60  GLU n 
1 61  SER n 
1 62  ILE n 
1 63  LEU n 
1 64  GLY n 
1 65  SER n 
1 66  ILE n 
1 67  PRO n 
1 68  LEU n 
1 69  LEU n 
1 70  SER n 
1 71  PHE n 
1 72  ARG n 
1 73  VAL n 
1 74  ALA n 
1 75  ALA n 
1 76  VAL n 
1 77  GLN n 
1 78  PRO n 
1 79  SER n 
1 80  ASP n 
1 81  ASN n 
1 82  ILE n 
1 83  SER n 
1 84  ARG n 
1 85  LYS n 
1 86  HIS n 
1 87  THR n 
1 88  PHE n 
1 89  LYS n 
1 90  ALA n 
1 91  GLU n 
1 92  HIS n 
1 93  ALA n 
1 94  GLY n 
1 95  VAL n 
1 96  ARG n 
1 97  THR n 
1 98  TYR n 
1 99  PHE n 
1 100 PHE n 
1 101 SER n 
1 102 ALA n 
1 103 GLU n 
1 104 SER n 
1 105 PRO n 
1 106 GLU n 
1 107 GLU n 
1 108 GLN n 
1 109 GLU n 
1 110 ALA n 
1 111 TRP n 
1 112 ILE n 
1 113 GLN n 
1 114 ALA n 
1 115 MET n 
1 116 GLY n 
1 117 GLU n 
1 118 ALA n 
1 119 ALA n 
1 120 ARG n 
1 121 VAL n 
1 122 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PLEKHA6 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P060515-01 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PKHA6_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y2H5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHT
FKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2YRY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 122 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y2H5 
_struct_ref_seq.db_align_beg                  46 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  160 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YRY GLY A 1 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 1 1 
1 2YRY SER A 2 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 2 2 
1 2YRY SER A 3 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 3 3 
1 2YRY GLY A 4 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 4 4 
1 2YRY SER A 5 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 5 5 
1 2YRY SER A 6 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 6 6 
1 2YRY GLY A 7 ? UNP Q9Y2H5 ? ? 'EXPRESSION TAG' 7 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.21mM PH domain U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2YRY 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations,target function' 
_pdbx_nmr_ensemble.entry_id                                      2YRY 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2YRY 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRVIEW 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9820   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.method            'SOLUTION NMR' 
_exptl.entry_id          2YRY 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2YRY 
_struct.title                     
'Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human' 
_struct.pdbx_descriptor           'Pleckstrin homology domain-containing family A member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YRY 
_struct_keywords.text            
;PH domain, PEPP-3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        105 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ALA 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        119 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         105 
_struct_conf.end_auth_comp_id        ALA 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         119 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 64 ? PRO A 67  ? GLY A 64 PRO A 67  
A 2 CYS A 50 ? TYR A 54  ? CYS A 50 TYR A 54  
A 3 TRP A 39 ? VAL A 47  ? TRP A 39 VAL A 47  
A 4 VAL A 22 ? GLN A 31  ? VAL A 22 GLN A 31  
A 5 THR A 97 ? SER A 101 ? THR A 97 SER A 101 
A 6 THR A 87 ? GLU A 91  ? THR A 87 GLU A 91  
A 7 ARG A 72 ? ALA A 75  ? ARG A 72 ALA A 75  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 66  ? O ILE A 66  N LEU A 51  ? N LEU A 51  
A 2 3 O PHE A 52  ? O PHE A 52  N VAL A 45  ? N VAL A 45  
A 3 4 O LEU A 46  ? O LEU A 46  N LYS A 24  ? N LYS A 24  
A 4 5 N PHE A 29  ? N PHE A 29  O SER A 101 ? O SER A 101 
A 5 6 O PHE A 100 ? O PHE A 100 N PHE A 88  ? N PHE A 88  
A 6 7 O LYS A 89  ? O LYS A 89  N ALA A 74  ? N ALA A 74  
# 
_atom_sites.entry_id                    2YRY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -28.299 9.745   19.443  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -27.557 9.746   18.196  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -26.672 10.968  18.048  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -26.943 12.014  18.639  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -27.818 9.745   20.297  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -26.940 8.861   18.156  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -28.258 9.722   17.374  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -25.611 10.837  17.259  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -24.680 11.938  17.041  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -23.971 11.791  15.697  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -23.192 10.860  15.492  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -23.649 11.994  18.170  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -24.267 12.296  19.409  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -25.449 9.978   16.816  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -25.248 12.856  17.037  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -23.155 11.038  18.251  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -22.919 12.759  17.949  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -25.134 12.675  19.251  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -24.248 12.718  14.785  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -23.641 12.691  13.460  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -22.369 13.533  13.428  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -21.999 14.157  14.421  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -24.631 13.202  12.412  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -25.490 12.164  11.972  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -24.878 13.435  15.009  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -23.386 11.666  13.233  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -25.231 13.990  12.841  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -24.086 13.586  11.562  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -26.386 12.499  11.896  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -21.704 13.545  12.276  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -20.481 14.313  12.135  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -19.347 13.494  11.550  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -19.517 12.314  11.246  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -22.046 13.028  11.517  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -20.671 15.157  11.489  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -20.183 14.676  13.107  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -18.186 14.122  11.392  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -17.021 13.446  10.835  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -17.409 12.605  9.622   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -16.943 11.477  9.460   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -16.364 12.559  11.895  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -17.119 11.380  12.112  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -18.113 15.064  11.653  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -16.316 14.202  10.523  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -15.374 12.283  11.566  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -16.295 13.106  12.824  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -17.995 11.487  11.736  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -18.265 13.163  8.772   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -18.719 12.465  7.576   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -18.292 13.211  6.316   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -17.713 12.627  5.401   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -20.241 12.308  7.598   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -20.881 13.564  7.752   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -18.600 14.066  8.956   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -18.265 11.485  7.571   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -20.568 11.863  6.671   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -20.522 11.670  8.423   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -21.810 13.479  7.529   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -18.583 14.508  6.276   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -18.222 15.315  5.125   1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -19.395 15.555  4.195   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -20.323 14.750  4.135   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -19.046 14.921  7.035   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -17.848 16.267  5.469   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -17.441 14.809  4.576   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLY A 1 8   ? -19.354 16.667  3.468   1.00 0.00 ? 8   GLY A N    1  
ATOM 67    C CA   . GLY A 1 8   ? -20.428 16.992  2.548   1.00 0.00 ? 8   GLY A CA   1  
ATOM 68    C C    . GLY A 1 8   ? -19.916 17.514  1.220   1.00 0.00 ? 8   GLY A C    1  
ATOM 69    O O    . GLY A 1 8   ? -20.324 18.584  0.766   1.00 0.00 ? 8   GLY A O    1  
ATOM 70    H H    . GLY A 1 8   ? -18.588 17.273  3.557   1.00 0.00 ? 8   GLY A H    1  
ATOM 71    H HA2  . GLY A 1 8   ? -21.017 16.104  2.371   1.00 0.00 ? 8   GLY A HA2  1  
ATOM 72    H HA3  . GLY A 1 8   ? -21.058 17.745  2.999   1.00 0.00 ? 8   GLY A HA3  1  
ATOM 73    N N    . LYS A 1 9   ? -19.019 16.759  0.595   1.00 0.00 ? 9   LYS A N    1  
ATOM 74    C CA   . LYS A 1 9   ? -18.449 17.151  -0.688  1.00 0.00 ? 9   LYS A CA   1  
ATOM 75    C C    . LYS A 1 9   ? -17.565 16.043  -1.252  1.00 0.00 ? 9   LYS A C    1  
ATOM 76    O O    . LYS A 1 9   ? -16.863 15.358  -0.509  1.00 0.00 ? 9   LYS A O    1  
ATOM 77    C CB   . LYS A 1 9   ? -17.637 18.439  -0.537  1.00 0.00 ? 9   LYS A CB   1  
ATOM 78    C CG   . LYS A 1 9   ? -16.849 18.811  -1.781  1.00 0.00 ? 9   LYS A CG   1  
ATOM 79    C CD   . LYS A 1 9   ? -15.700 19.750  -1.454  1.00 0.00 ? 9   LYS A CD   1  
ATOM 80    C CE   . LYS A 1 9   ? -16.179 21.186  -1.304  1.00 0.00 ? 9   LYS A CE   1  
ATOM 81    N NZ   . LYS A 1 9   ? -15.095 22.165  -1.593  1.00 0.00 ? 9   LYS A NZ   1  
ATOM 82    H H    . LYS A 1 9   ? -18.733 15.917  1.008   1.00 0.00 ? 9   LYS A H    1  
ATOM 83    H HA   . LYS A 1 9   ? -19.265 17.328  -1.373  1.00 0.00 ? 9   LYS A HA   1  
ATOM 84    H HB2  . LYS A 1 9   ? -18.311 19.251  -0.307  1.00 0.00 ? 9   LYS A HB2  1  
ATOM 85    H HB3  . LYS A 1 9   ? -16.941 18.318  0.281   1.00 0.00 ? 9   LYS A HB3  1  
ATOM 86    H HG2  . LYS A 1 9   ? -16.449 17.912  -2.226  1.00 0.00 ? 9   LYS A HG2  1  
ATOM 87    H HG3  . LYS A 1 9   ? -17.511 19.298  -2.483  1.00 0.00 ? 9   LYS A HG3  1  
ATOM 88    H HD2  . LYS A 1 9   ? -15.243 19.436  -0.527  1.00 0.00 ? 9   LYS A HD2  1  
ATOM 89    H HD3  . LYS A 1 9   ? -14.971 19.704  -2.251  1.00 0.00 ? 9   LYS A HD3  1  
ATOM 90    H HE2  . LYS A 1 9   ? -16.995 21.353  -1.989  1.00 0.00 ? 9   LYS A HE2  1  
ATOM 91    H HE3  . LYS A 1 9   ? -16.523 21.332  -0.290  1.00 0.00 ? 9   LYS A HE3  1  
ATOM 92    H HZ1  . LYS A 1 9   ? -15.198 22.537  -2.559  1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 93    H HZ2  . LYS A 1 9   ? -14.166 21.705  -1.507  1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 94    H HZ3  . LYS A 1 9   ? -15.140 22.957  -0.921  1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 95    N N    . ARG A 1 10  ? -17.604 15.874  -2.570  1.00 0.00 ? 10  ARG A N    1  
ATOM 96    C CA   . ARG A 1 10  ? -16.806 14.850  -3.233  1.00 0.00 ? 10  ARG A CA   1  
ATOM 97    C C    . ARG A 1 10  ? -15.637 15.475  -3.987  1.00 0.00 ? 10  ARG A C    1  
ATOM 98    O O    . ARG A 1 10  ? -15.830 16.186  -4.973  1.00 0.00 ? 10  ARG A O    1  
ATOM 99    C CB   . ARG A 1 10  ? -17.675 14.041  -4.197  1.00 0.00 ? 10  ARG A CB   1  
ATOM 100   C CG   . ARG A 1 10  ? -18.540 12.998  -3.509  1.00 0.00 ? 10  ARG A CG   1  
ATOM 101   C CD   . ARG A 1 10  ? -19.767 13.626  -2.868  1.00 0.00 ? 10  ARG A CD   1  
ATOM 102   N NE   . ARG A 1 10  ? -20.639 14.256  -3.856  1.00 0.00 ? 10  ARG A NE   1  
ATOM 103   C CZ   . ARG A 1 10  ? -21.916 14.544  -3.631  1.00 0.00 ? 10  ARG A CZ   1  
ATOM 104   N NH1  . ARG A 1 10  ? -22.467 14.261  -2.459  1.00 0.00 ? 10  ARG A NH1  1  
ATOM 105   N NH2  . ARG A 1 10  ? -22.645 15.117  -4.580  1.00 0.00 ? 10  ARG A NH2  1  
ATOM 106   H H    . ARG A 1 10  ? -18.184 16.452  -3.109  1.00 0.00 ? 10  ARG A H    1  
ATOM 107   H HA   . ARG A 1 10  ? -16.417 14.189  -2.473  1.00 0.00 ? 10  ARG A HA   1  
ATOM 108   H HB2  . ARG A 1 10  ? -18.325 14.718  -4.733  1.00 0.00 ? 10  ARG A HB2  1  
ATOM 109   H HB3  . ARG A 1 10  ? -17.034 13.536  -4.903  1.00 0.00 ? 10  ARG A HB3  1  
ATOM 110   H HG2  . ARG A 1 10  ? -18.862 12.271  -4.240  1.00 0.00 ? 10  ARG A HG2  1  
ATOM 111   H HG3  . ARG A 1 10  ? -17.956 12.507  -2.744  1.00 0.00 ? 10  ARG A HG3  1  
ATOM 112   H HD2  . ARG A 1 10  ? -20.321 12.857  -2.351  1.00 0.00 ? 10  ARG A HD2  1  
ATOM 113   H HD3  . ARG A 1 10  ? -19.443 14.373  -2.159  1.00 0.00 ? 10  ARG A HD3  1  
ATOM 114   H HE   . ARG A 1 10  ? -20.253 14.473  -4.729  1.00 0.00 ? 10  ARG A HE   1  
ATOM 115   H HH11 . ARG A 1 10  ? -21.920 13.830  -1.741  1.00 0.00 ? 10  ARG A HH11 1  
ATOM 116   H HH12 . ARG A 1 10  ? -23.429 14.480  -2.292  1.00 0.00 ? 10  ARG A HH12 1  
ATOM 117   H HH21 . ARG A 1 10  ? -22.234 15.332  -5.465  1.00 0.00 ? 10  ARG A HH21 1  
ATOM 118   H HH22 . ARG A 1 10  ? -23.606 15.333  -4.410  1.00 0.00 ? 10  ARG A HH22 1  
ATOM 119   N N    . SER A 1 11  ? -14.423 15.206  -3.516  1.00 0.00 ? 11  SER A N    1  
ATOM 120   C CA   . SER A 1 11  ? -13.223 15.745  -4.144  1.00 0.00 ? 11  SER A CA   1  
ATOM 121   C C    . SER A 1 11  ? -12.583 14.715  -5.069  1.00 0.00 ? 11  SER A C    1  
ATOM 122   O O    . SER A 1 11  ? -12.240 15.018  -6.213  1.00 0.00 ? 11  SER A O    1  
ATOM 123   C CB   . SER A 1 11  ? -12.217 16.183  -3.077  1.00 0.00 ? 11  SER A CB   1  
ATOM 124   O OG   . SER A 1 11  ? -11.053 16.735  -3.669  1.00 0.00 ? 11  SER A OG   1  
ATOM 125   H H    . SER A 1 11  ? -14.334 14.632  -2.727  1.00 0.00 ? 11  SER A H    1  
ATOM 126   H HA   . SER A 1 11  ? -13.512 16.606  -4.728  1.00 0.00 ? 11  SER A HA   1  
ATOM 127   H HB2  . SER A 1 11  ? -12.671 16.928  -2.442  1.00 0.00 ? 11  SER A HB2  1  
ATOM 128   H HB3  . SER A 1 11  ? -11.933 15.327  -2.482  1.00 0.00 ? 11  SER A HB3  1  
ATOM 129   H HG   . SER A 1 11  ? -11.286 17.160  -4.497  1.00 0.00 ? 11  SER A HG   1  
ATOM 130   N N    . HIS A 1 12  ? -12.426 13.494  -4.567  1.00 0.00 ? 12  HIS A N    1  
ATOM 131   C CA   . HIS A 1 12  ? -11.828 12.417  -5.348  1.00 0.00 ? 12  HIS A CA   1  
ATOM 132   C C    . HIS A 1 12  ? -12.700 11.166  -5.304  1.00 0.00 ? 12  HIS A C    1  
ATOM 133   O O    . HIS A 1 12  ? -13.263 10.826  -4.263  1.00 0.00 ? 12  HIS A O    1  
ATOM 134   C CB   . HIS A 1 12  ? -10.428 12.096  -4.825  1.00 0.00 ? 12  HIS A CB   1  
ATOM 135   C CG   . HIS A 1 12  ? -9.353  12.943  -5.433  1.00 0.00 ? 12  HIS A CG   1  
ATOM 136   N ND1  . HIS A 1 12  ? -9.193  14.281  -5.139  1.00 0.00 ? 12  HIS A ND1  1  
ATOM 137   C CD2  . HIS A 1 12  ? -8.379  12.635  -6.321  1.00 0.00 ? 12  HIS A CD2  1  
ATOM 138   C CE1  . HIS A 1 12  ? -8.168  14.760  -5.822  1.00 0.00 ? 12  HIS A CE1  1  
ATOM 139   N NE2  . HIS A 1 12  ? -7.657  13.781  -6.547  1.00 0.00 ? 12  HIS A NE2  1  
ATOM 140   H H    . HIS A 1 12  ? -12.719 13.314  -3.650  1.00 0.00 ? 12  HIS A H    1  
ATOM 141   H HA   . HIS A 1 12  ? -11.753 12.752  -6.371  1.00 0.00 ? 12  HIS A HA   1  
ATOM 142   H HB2  . HIS A 1 12  ? -10.406 12.249  -3.756  1.00 0.00 ? 12  HIS A HB2  1  
ATOM 143   H HB3  . HIS A 1 12  ? -10.199 11.062  -5.040  1.00 0.00 ? 12  HIS A HB3  1  
ATOM 144   H HD1  . HIS A 1 12  ? -9.748  14.802  -4.523  1.00 0.00 ? 12  HIS A HD1  1  
ATOM 145   H HD2  . HIS A 1 12  ? -8.203  11.668  -6.770  1.00 0.00 ? 12  HIS A HD2  1  
ATOM 146   H HE1  . HIS A 1 12  ? -7.809  15.777  -5.793  1.00 0.00 ? 12  HIS A HE1  1  
ATOM 147   H HE2  . HIS A 1 12  ? -6.943  13.884  -7.210  1.00 0.00 ? 12  HIS A HE2  1  
ATOM 148   N N    . SER A 1 13  ? -12.807 10.484  -6.440  1.00 0.00 ? 13  SER A N    1  
ATOM 149   C CA   . SER A 1 13  ? -13.614 9.273   -6.532  1.00 0.00 ? 13  SER A CA   1  
ATOM 150   C C    . SER A 1 13  ? -12.770 8.092   -7.000  1.00 0.00 ? 13  SER A C    1  
ATOM 151   O O    . SER A 1 13  ? -12.609 7.866   -8.199  1.00 0.00 ? 13  SER A O    1  
ATOM 152   C CB   . SER A 1 13  ? -14.787 9.488   -7.491  1.00 0.00 ? 13  SER A CB   1  
ATOM 153   O OG   . SER A 1 13  ? -15.633 8.352   -7.524  1.00 0.00 ? 13  SER A OG   1  
ATOM 154   H H    . SER A 1 13  ? -12.334 10.806  -7.236  1.00 0.00 ? 13  SER A H    1  
ATOM 155   H HA   . SER A 1 13  ? -14.001 9.057   -5.547  1.00 0.00 ? 13  SER A HA   1  
ATOM 156   H HB2  . SER A 1 13  ? -15.363 10.341  -7.166  1.00 0.00 ? 13  SER A HB2  1  
ATOM 157   H HB3  . SER A 1 13  ? -14.406 9.668   -8.486  1.00 0.00 ? 13  SER A HB3  1  
ATOM 158   H HG   . SER A 1 13  ? -15.109 7.558   -7.392  1.00 0.00 ? 13  SER A HG   1  
ATOM 159   N N    . MET A 1 14  ? -12.232 7.342   -6.044  1.00 0.00 ? 14  MET A N    1  
ATOM 160   C CA   . MET A 1 14  ? -11.405 6.183   -6.358  1.00 0.00 ? 14  MET A CA   1  
ATOM 161   C C    . MET A 1 14  ? -11.981 4.918   -5.729  1.00 0.00 ? 14  MET A C    1  
ATOM 162   O O    . MET A 1 14  ? -12.397 4.922   -4.571  1.00 0.00 ? 14  MET A O    1  
ATOM 163   C CB   . MET A 1 14  ? -9.973  6.404   -5.867  1.00 0.00 ? 14  MET A CB   1  
ATOM 164   C CG   . MET A 1 14  ? -9.275  7.577   -6.535  1.00 0.00 ? 14  MET A CG   1  
ATOM 165   S SD   . MET A 1 14  ? -8.975  7.298   -8.291  1.00 0.00 ? 14  MET A SD   1  
ATOM 166   C CE   . MET A 1 14  ? -7.761  5.983   -8.221  1.00 0.00 ? 14  MET A CE   1  
ATOM 167   H H    . MET A 1 14  ? -12.396 7.572   -5.106  1.00 0.00 ? 14  MET A H    1  
ATOM 168   H HA   . MET A 1 14  ? -11.393 6.064   -7.431  1.00 0.00 ? 14  MET A HA   1  
ATOM 169   H HB2  . MET A 1 14  ? -9.993  6.583   -4.802  1.00 0.00 ? 14  MET A HB2  1  
ATOM 170   H HB3  . MET A 1 14  ? -9.396  5.512   -6.062  1.00 0.00 ? 14  MET A HB3  1  
ATOM 171   H HG2  . MET A 1 14  ? -9.893  8.456   -6.426  1.00 0.00 ? 14  MET A HG2  1  
ATOM 172   H HG3  . MET A 1 14  ? -8.328  7.743   -6.043  1.00 0.00 ? 14  MET A HG3  1  
ATOM 173   H HE1  . MET A 1 14  ? -7.555  5.631   -9.222  1.00 0.00 ? 14  MET A HE1  1  
ATOM 174   H HE2  . MET A 1 14  ? -6.851  6.355   -7.776  1.00 0.00 ? 14  MET A HE2  1  
ATOM 175   H HE3  . MET A 1 14  ? -8.147  5.169   -7.625  1.00 0.00 ? 14  MET A HE3  1  
ATOM 176   N N    . LYS A 1 15  ? -12.001 3.836   -6.500  1.00 0.00 ? 15  LYS A N    1  
ATOM 177   C CA   . LYS A 1 15  ? -12.525 2.563   -6.020  1.00 0.00 ? 15  LYS A CA   1  
ATOM 178   C C    . LYS A 1 15  ? -12.147 1.427   -6.966  1.00 0.00 ? 15  LYS A C    1  
ATOM 179   O O    . LYS A 1 15  ? -12.058 1.621   -8.178  1.00 0.00 ? 15  LYS A O    1  
ATOM 180   C CB   . LYS A 1 15  ? -14.047 2.636   -5.875  1.00 0.00 ? 15  LYS A CB   1  
ATOM 181   C CG   . LYS A 1 15  ? -14.605 1.682   -4.833  1.00 0.00 ? 15  LYS A CG   1  
ATOM 182   C CD   . LYS A 1 15  ? -16.124 1.709   -4.810  1.00 0.00 ? 15  LYS A CD   1  
ATOM 183   C CE   . LYS A 1 15  ? -16.713 0.916   -5.967  1.00 0.00 ? 15  LYS A CE   1  
ATOM 184   N NZ   . LYS A 1 15  ? -18.195 0.806   -5.867  1.00 0.00 ? 15  LYS A NZ   1  
ATOM 185   H H    . LYS A 1 15  ? -11.655 3.895   -7.416  1.00 0.00 ? 15  LYS A H    1  
ATOM 186   H HA   . LYS A 1 15  ? -12.089 2.369   -5.052  1.00 0.00 ? 15  LYS A HA   1  
ATOM 187   H HB2  . LYS A 1 15  ? -14.322 3.642   -5.596  1.00 0.00 ? 15  LYS A HB2  1  
ATOM 188   H HB3  . LYS A 1 15  ? -14.498 2.399   -6.828  1.00 0.00 ? 15  LYS A HB3  1  
ATOM 189   H HG2  . LYS A 1 15  ? -14.277 0.679   -5.063  1.00 0.00 ? 15  LYS A HG2  1  
ATOM 190   H HG3  . LYS A 1 15  ? -14.234 1.970   -3.860  1.00 0.00 ? 15  LYS A HG3  1  
ATOM 191   H HD2  . LYS A 1 15  ? -16.470 1.279   -3.882  1.00 0.00 ? 15  LYS A HD2  1  
ATOM 192   H HD3  . LYS A 1 15  ? -16.459 2.734   -4.881  1.00 0.00 ? 15  LYS A HD3  1  
ATOM 193   H HE2  . LYS A 1 15  ? -16.460 1.412   -6.892  1.00 0.00 ? 15  LYS A HE2  1  
ATOM 194   H HE3  . LYS A 1 15  ? -16.286 -0.076  -5.961  1.00 0.00 ? 15  LYS A HE3  1  
ATOM 195   H HZ1  . LYS A 1 15  ? -18.520 1.174   -4.950  1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 196   H HZ2  . LYS A 1 15  ? -18.486 -0.189  -5.952  1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 197   H HZ3  . LYS A 1 15  ? -18.646 1.354   -6.627  1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 198   N N    . ARG A 1 16  ? -11.929 0.243   -6.403  1.00 0.00 ? 16  ARG A N    1  
ATOM 199   C CA   . ARG A 1 16  ? -11.562 -0.924  -7.197  1.00 0.00 ? 16  ARG A CA   1  
ATOM 200   C C    . ARG A 1 16  ? -12.713 -1.349  -8.103  1.00 0.00 ? 16  ARG A C    1  
ATOM 201   O O    . ARG A 1 16  ? -13.723 -1.873  -7.635  1.00 0.00 ? 16  ARG A O    1  
ATOM 202   C CB   . ARG A 1 16  ? -11.162 -2.084  -6.284  1.00 0.00 ? 16  ARG A CB   1  
ATOM 203   C CG   . ARG A 1 16  ? -10.860 -3.372  -7.031  1.00 0.00 ? 16  ARG A CG   1  
ATOM 204   C CD   . ARG A 1 16  ? -10.260 -4.423  -6.111  1.00 0.00 ? 16  ARG A CD   1  
ATOM 205   N NE   . ARG A 1 16  ? -10.319 -5.760  -6.695  1.00 0.00 ? 16  ARG A NE   1  
ATOM 206   C CZ   . ARG A 1 16  ? -10.108 -6.874  -6.003  1.00 0.00 ? 16  ARG A CZ   1  
ATOM 207   N NH1  . ARG A 1 16  ? -9.827  -6.812  -4.709  1.00 0.00 ? 16  ARG A NH1  1  
ATOM 208   N NH2  . ARG A 1 16  ? -10.179 -8.054  -6.606  1.00 0.00 ? 16  ARG A NH2  1  
ATOM 209   H H    . ARG A 1 16  ? -12.016 0.151   -5.432  1.00 0.00 ? 16  ARG A H    1  
ATOM 210   H HA   . ARG A 1 16  ? -10.716 -0.654  -7.812  1.00 0.00 ? 16  ARG A HA   1  
ATOM 211   H HB2  . ARG A 1 16  ? -10.281 -1.801  -5.727  1.00 0.00 ? 16  ARG A HB2  1  
ATOM 212   H HB3  . ARG A 1 16  ? -11.969 -2.275  -5.592  1.00 0.00 ? 16  ARG A HB3  1  
ATOM 213   H HG2  . ARG A 1 16  ? -11.778 -3.758  -7.450  1.00 0.00 ? 16  ARG A HG2  1  
ATOM 214   H HG3  . ARG A 1 16  ? -10.161 -3.160  -7.826  1.00 0.00 ? 16  ARG A HG3  1  
ATOM 215   H HD2  . ARG A 1 16  ? -9.228  -4.169  -5.921  1.00 0.00 ? 16  ARG A HD2  1  
ATOM 216   H HD3  . ARG A 1 16  ? -10.808 -4.422  -5.180  1.00 0.00 ? 16  ARG A HD3  1  
ATOM 217   H HE   . ARG A 1 16  ? -10.525 -5.829  -7.650  1.00 0.00 ? 16  ARG A HE   1  
ATOM 218   H HH11 . ARG A 1 16  ? -9.774  -5.924  -4.252  1.00 0.00 ? 16  ARG A HH11 1  
ATOM 219   H HH12 . ARG A 1 16  ? -9.670  -7.652  -4.190  1.00 0.00 ? 16  ARG A HH12 1  
ATOM 220   H HH21 . ARG A 1 16  ? -10.391 -8.105  -7.581  1.00 0.00 ? 16  ARG A HH21 1  
ATOM 221   H HH22 . ARG A 1 16  ? -10.020 -8.892  -6.084  1.00 0.00 ? 16  ARG A HH22 1  
ATOM 222   N N    . ASN A 1 17  ? -12.553 -1.119  -9.403  1.00 0.00 ? 17  ASN A N    1  
ATOM 223   C CA   . ASN A 1 17  ? -13.580 -1.478  -10.374 1.00 0.00 ? 17  ASN A CA   1  
ATOM 224   C C    . ASN A 1 17  ? -14.028 -2.923  -10.184 1.00 0.00 ? 17  ASN A C    1  
ATOM 225   O O    . ASN A 1 17  ? -13.239 -3.804  -9.840  1.00 0.00 ? 17  ASN A O    1  
ATOM 226   C CB   . ASN A 1 17  ? -13.056 -1.278  -11.798 1.00 0.00 ? 17  ASN A CB   1  
ATOM 227   C CG   . ASN A 1 17  ? -13.334 0.117   -12.325 1.00 0.00 ? 17  ASN A CG   1  
ATOM 228   O OD1  . ASN A 1 17  ? -14.308 0.339   -13.044 1.00 0.00 ? 17  ASN A OD1  1  
ATOM 229   N ND2  . ASN A 1 17  ? -12.474 1.065   -11.970 1.00 0.00 ? 17  ASN A ND2  1  
ATOM 230   H H    . ASN A 1 17  ? -11.726 -0.698  -9.716  1.00 0.00 ? 17  ASN A H    1  
ATOM 231   H HA   . ASN A 1 17  ? -14.427 -0.827  -10.217 1.00 0.00 ? 17  ASN A HA   1  
ATOM 232   H HB2  . ASN A 1 17  ? -11.988 -1.439  -11.808 1.00 0.00 ? 17  ASN A HB2  1  
ATOM 233   H HB3  . ASN A 1 17  ? -13.531 -1.992  -12.454 1.00 0.00 ? 17  ASN A HB3  1  
ATOM 234   H HD21 . ASN A 1 17  ? -11.720 0.816   -11.396 1.00 0.00 ? 17  ASN A HD21 1  
ATOM 235   H HD22 . ASN A 1 17  ? -12.630 1.976   -12.297 1.00 0.00 ? 17  ASN A HD22 1  
ATOM 236   N N    . PRO A 1 18  ? -15.326 -3.176  -10.413 1.00 0.00 ? 18  PRO A N    1  
ATOM 237   C CA   . PRO A 1 18  ? -15.908 -4.514  -10.274 1.00 0.00 ? 18  PRO A CA   1  
ATOM 238   C C    . PRO A 1 18  ? -15.430 -5.470  -11.361 1.00 0.00 ? 18  PRO A C    1  
ATOM 239   O O    . PRO A 1 18  ? -15.420 -6.686  -11.171 1.00 0.00 ? 18  PRO A O    1  
ATOM 240   C CB   . PRO A 1 18  ? -17.412 -4.261  -10.408 1.00 0.00 ? 18  PRO A CB   1  
ATOM 241   C CG   . PRO A 1 18  ? -17.516 -3.007  -11.206 1.00 0.00 ? 18  PRO A CG   1  
ATOM 242   C CD   . PRO A 1 18  ? -16.323 -2.175  -10.825 1.00 0.00 ? 18  PRO A CD   1  
ATOM 243   H HA   . PRO A 1 18  ? -15.698 -4.939  -9.304  1.00 0.00 ? 18  PRO A HA   1  
ATOM 244   H HB2  . PRO A 1 18  ? -17.875 -5.095  -10.918 1.00 0.00 ? 18  PRO A HB2  1  
ATOM 245   H HB3  . PRO A 1 18  ? -17.850 -4.143  -9.429  1.00 0.00 ? 18  PRO A HB3  1  
ATOM 246   H HG2  . PRO A 1 18  ? -17.491 -3.239  -12.260 1.00 0.00 ? 18  PRO A HG2  1  
ATOM 247   H HG3  . PRO A 1 18  ? -18.430 -2.489  -10.956 1.00 0.00 ? 18  PRO A HG3  1  
ATOM 248   H HD2  . PRO A 1 18  ? -15.972 -1.608  -11.675 1.00 0.00 ? 18  PRO A HD2  1  
ATOM 249   H HD3  . PRO A 1 18  ? -16.569 -1.516  -10.006 1.00 0.00 ? 18  PRO A HD3  1  
ATOM 250   N N    . ASN A 1 19  ? -15.033 -4.913  -12.500 1.00 0.00 ? 19  ASN A N    1  
ATOM 251   C CA   . ASN A 1 19  ? -14.552 -5.717  -13.618 1.00 0.00 ? 19  ASN A CA   1  
ATOM 252   C C    . ASN A 1 19  ? -13.063 -5.484  -13.856 1.00 0.00 ? 19  ASN A C    1  
ATOM 253   O O    . ASN A 1 19  ? -12.606 -5.443  -14.997 1.00 0.00 ? 19  ASN A O    1  
ATOM 254   C CB   . ASN A 1 19  ? -15.341 -5.387  -14.887 1.00 0.00 ? 19  ASN A CB   1  
ATOM 255   C CG   . ASN A 1 19  ? -16.575 -6.254  -15.044 1.00 0.00 ? 19  ASN A CG   1  
ATOM 256   O OD1  . ASN A 1 19  ? -16.602 -7.171  -15.865 1.00 0.00 ? 19  ASN A OD1  1  
ATOM 257   N ND2  . ASN A 1 19  ? -17.603 -5.967  -14.255 1.00 0.00 ? 19  ASN A ND2  1  
ATOM 258   H H    . ASN A 1 19  ? -15.064 -3.938  -12.592 1.00 0.00 ? 19  ASN A H    1  
ATOM 259   H HA   . ASN A 1 19  ? -14.707 -6.756  -13.369 1.00 0.00 ? 19  ASN A HA   1  
ATOM 260   H HB2  . ASN A 1 19  ? -15.653 -4.353  -14.850 1.00 0.00 ? 19  ASN A HB2  1  
ATOM 261   H HB3  . ASN A 1 19  ? -14.706 -5.536  -15.748 1.00 0.00 ? 19  ASN A HB3  1  
ATOM 262   H HD21 . ASN A 1 19  ? -17.510 -5.223  -13.624 1.00 0.00 ? 19  ASN A HD21 1  
ATOM 263   H HD22 . ASN A 1 19  ? -18.414 -6.513  -14.334 1.00 0.00 ? 19  ASN A HD22 1  
ATOM 264   N N    . ALA A 1 20  ? -12.313 -5.334  -12.769 1.00 0.00 ? 20  ALA A N    1  
ATOM 265   C CA   . ALA A 1 20  ? -10.876 -5.108  -12.859 1.00 0.00 ? 20  ALA A CA   1  
ATOM 266   C C    . ALA A 1 20  ? -10.097 -6.308  -12.330 1.00 0.00 ? 20  ALA A C    1  
ATOM 267   O O    . ALA A 1 20  ? -10.304 -6.766  -11.207 1.00 0.00 ? 20  ALA A O    1  
ATOM 268   C CB   . ALA A 1 20  ? -10.491 -3.849  -12.096 1.00 0.00 ? 20  ALA A CB   1  
ATOM 269   H H    . ALA A 1 20  ? -12.736 -5.377  -11.887 1.00 0.00 ? 20  ALA A H    1  
ATOM 270   H HA   . ALA A 1 20  ? -10.626 -4.959  -13.900 1.00 0.00 ? 20  ALA A HA   1  
ATOM 271   H HB1  . ALA A 1 20  ? -9.886  -4.116  -11.243 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 272   H HB2  . ALA A 1 20  ? -9.928  -3.194  -12.745 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 273   H HB3  . ALA A 1 20  ? -11.384 -3.343  -11.762 1.00 0.00 ? 20  ALA A HB3  1  
ATOM 274   N N    . PRO A 1 21  ? -9.180  -6.830  -13.158 1.00 0.00 ? 21  PRO A N    1  
ATOM 275   C CA   . PRO A 1 21  ? -8.353  -7.985  -12.795 1.00 0.00 ? 21  PRO A CA   1  
ATOM 276   C C    . PRO A 1 21  ? -7.329  -7.648  -11.716 1.00 0.00 ? 21  PRO A C    1  
ATOM 277   O O    . PRO A 1 21  ? -6.614  -6.651  -11.814 1.00 0.00 ? 21  PRO A O    1  
ATOM 278   C CB   . PRO A 1 21  ? -7.649  -8.343  -14.106 1.00 0.00 ? 21  PRO A CB   1  
ATOM 279   C CG   . PRO A 1 21  ? -7.623  -7.071  -14.882 1.00 0.00 ? 21  PRO A CG   1  
ATOM 280   C CD   . PRO A 1 21  ? -8.880  -6.335  -14.512 1.00 0.00 ? 21  PRO A CD   1  
ATOM 281   H HA   . PRO A 1 21  ? -8.956  -8.819  -12.469 1.00 0.00 ? 21  PRO A HA   1  
ATOM 282   H HB2  . PRO A 1 21  ? -6.650  -8.699  -13.895 1.00 0.00 ? 21  PRO A HB2  1  
ATOM 283   H HB3  . PRO A 1 21  ? -8.208  -9.108  -14.622 1.00 0.00 ? 21  PRO A HB3  1  
ATOM 284   H HG2  . PRO A 1 21  ? -6.754  -6.492  -14.608 1.00 0.00 ? 21  PRO A HG2  1  
ATOM 285   H HG3  . PRO A 1 21  ? -7.613  -7.288  -15.940 1.00 0.00 ? 21  PRO A HG3  1  
ATOM 286   H HD2  . PRO A 1 21  ? -8.705  -5.269  -14.502 1.00 0.00 ? 21  PRO A HD2  1  
ATOM 287   H HD3  . PRO A 1 21  ? -9.678  -6.582  -15.197 1.00 0.00 ? 21  PRO A HD3  1  
ATOM 288   N N    . VAL A 1 22  ? -7.265  -8.485  -10.685 1.00 0.00 ? 22  VAL A N    1  
ATOM 289   C CA   . VAL A 1 22  ? -6.328  -8.276  -9.588  1.00 0.00 ? 22  VAL A CA   1  
ATOM 290   C C    . VAL A 1 22  ? -4.886  -8.416  -10.063 1.00 0.00 ? 22  VAL A C    1  
ATOM 291   O O    . VAL A 1 22  ? -4.468  -9.484  -10.511 1.00 0.00 ? 22  VAL A O    1  
ATOM 292   C CB   . VAL A 1 22  ? -6.577  -9.272  -8.440  1.00 0.00 ? 22  VAL A CB   1  
ATOM 293   C CG1  . VAL A 1 22  ? -6.454  -10.704 -8.939  1.00 0.00 ? 22  VAL A CG1  1  
ATOM 294   C CG2  . VAL A 1 22  ? -5.612  -9.014  -7.292  1.00 0.00 ? 22  VAL A CG2  1  
ATOM 295   H H    . VAL A 1 22  ? -7.861  -9.262  -10.663 1.00 0.00 ? 22  VAL A H    1  
ATOM 296   H HA   . VAL A 1 22  ? -6.476  -7.276  -9.208  1.00 0.00 ? 22  VAL A HA   1  
ATOM 297   H HB   . VAL A 1 22  ? -7.584  -9.127  -8.076  1.00 0.00 ? 22  VAL A HB   1  
ATOM 298   H HG11 . VAL A 1 22  ? -6.956  -10.798 -9.891  1.00 0.00 ? 22  VAL A HG11 1  
ATOM 299   H HG12 . VAL A 1 22  ? -5.411  -10.957 -9.054  1.00 0.00 ? 22  VAL A HG12 1  
ATOM 300   H HG13 . VAL A 1 22  ? -6.911  -11.374 -8.225  1.00 0.00 ? 22  VAL A HG13 1  
ATOM 301   H HG21 . VAL A 1 22  ? -4.628  -8.814  -7.687  1.00 0.00 ? 22  VAL A HG21 1  
ATOM 302   H HG22 . VAL A 1 22  ? -5.953  -8.163  -6.722  1.00 0.00 ? 22  VAL A HG22 1  
ATOM 303   H HG23 . VAL A 1 22  ? -5.573  -9.884  -6.652  1.00 0.00 ? 22  VAL A HG23 1  
ATOM 304   N N    . THR A 1 23  ? -4.128  -7.328  -9.962  1.00 0.00 ? 23  THR A N    1  
ATOM 305   C CA   . THR A 1 23  ? -2.732  -7.328  -10.382 1.00 0.00 ? 23  THR A CA   1  
ATOM 306   C C    . THR A 1 23  ? -1.887  -8.222  -9.481  1.00 0.00 ? 23  THR A C    1  
ATOM 307   O O    . THR A 1 23  ? -1.283  -9.191  -9.941  1.00 0.00 ? 23  THR A O    1  
ATOM 308   C CB   . THR A 1 23  ? -2.142  -5.905  -10.372 1.00 0.00 ? 23  THR A CB   1  
ATOM 309   O OG1  . THR A 1 23  ? -3.018  -5.007  -11.063 1.00 0.00 ? 23  THR A OG1  1  
ATOM 310   C CG2  . THR A 1 23  ? -0.769  -5.884  -11.025 1.00 0.00 ? 23  THR A CG2  1  
ATOM 311   H H    . THR A 1 23  ? -4.518  -6.507  -9.597  1.00 0.00 ? 23  THR A H    1  
ATOM 312   H HA   . THR A 1 23  ? -2.687  -7.707  -11.392 1.00 0.00 ? 23  THR A HA   1  
ATOM 313   H HB   . THR A 1 23  ? -2.042  -5.581  -9.346  1.00 0.00 ? 23  THR A HB   1  
ATOM 314   H HG1  . THR A 1 23  ? -2.508  -4.281  -11.429 1.00 0.00 ? 23  THR A HG1  1  
ATOM 315   H HG21 . THR A 1 23  ? -0.582  -4.904  -11.437 1.00 0.00 ? 23  THR A HG21 1  
ATOM 316   H HG22 . THR A 1 23  ? -0.734  -6.620  -11.815 1.00 0.00 ? 23  THR A HG22 1  
ATOM 317   H HG23 . THR A 1 23  ? -0.015  -6.114  -10.286 1.00 0.00 ? 23  THR A HG23 1  
ATOM 318   N N    . LYS A 1 24  ? -1.849  -7.892  -8.195  1.00 0.00 ? 24  LYS A N    1  
ATOM 319   C CA   . LYS A 1 24  ? -1.080  -8.665  -7.228  1.00 0.00 ? 24  LYS A CA   1  
ATOM 320   C C    . LYS A 1 24  ? -1.676  -8.537  -5.830  1.00 0.00 ? 24  LYS A C    1  
ATOM 321   O O    . LYS A 1 24  ? -2.080  -7.451  -5.415  1.00 0.00 ? 24  LYS A O    1  
ATOM 322   C CB   . LYS A 1 24  ? 0.378   -8.201  -7.216  1.00 0.00 ? 24  LYS A CB   1  
ATOM 323   C CG   . LYS A 1 24  ? 1.301   -9.113  -6.426  1.00 0.00 ? 24  LYS A CG   1  
ATOM 324   C CD   . LYS A 1 24  ? 2.659   -8.470  -6.198  1.00 0.00 ? 24  LYS A CD   1  
ATOM 325   C CE   . LYS A 1 24  ? 3.527   -9.313  -5.276  1.00 0.00 ? 24  LYS A CE   1  
ATOM 326   N NZ   . LYS A 1 24  ? 4.173   -10.442 -6.000  1.00 0.00 ? 24  LYS A NZ   1  
ATOM 327   H H    . LYS A 1 24  ? -2.352  -7.108  -7.888  1.00 0.00 ? 24  LYS A H    1  
ATOM 328   H HA   . LYS A 1 24  ? -1.116  -9.702  -7.528  1.00 0.00 ? 24  LYS A HA   1  
ATOM 329   H HB2  . LYS A 1 24  ? 0.737   -8.154  -8.234  1.00 0.00 ? 24  LYS A HB2  1  
ATOM 330   H HB3  . LYS A 1 24  ? 0.425   -7.212  -6.781  1.00 0.00 ? 24  LYS A HB3  1  
ATOM 331   H HG2  . LYS A 1 24  ? 0.850   -9.325  -5.468  1.00 0.00 ? 24  LYS A HG2  1  
ATOM 332   H HG3  . LYS A 1 24  ? 1.437   -10.034 -6.974  1.00 0.00 ? 24  LYS A HG3  1  
ATOM 333   H HD2  . LYS A 1 24  ? 3.162   -8.363  -7.148  1.00 0.00 ? 24  LYS A HD2  1  
ATOM 334   H HD3  . LYS A 1 24  ? 2.516   -7.496  -5.753  1.00 0.00 ? 24  LYS A HD3  1  
ATOM 335   H HE2  . LYS A 1 24  ? 4.293   -8.684  -4.850  1.00 0.00 ? 24  LYS A HE2  1  
ATOM 336   H HE3  . LYS A 1 24  ? 2.907   -9.710  -4.485  1.00 0.00 ? 24  LYS A HE3  1  
ATOM 337   H HZ1  . LYS A 1 24  ? 4.198   -11.287 -5.395  1.00 0.00 ? 24  LYS A HZ1  1  
ATOM 338   H HZ2  . LYS A 1 24  ? 5.146   -10.187 -6.262  1.00 0.00 ? 24  LYS A HZ2  1  
ATOM 339   H HZ3  . LYS A 1 24  ? 3.640   -10.663 -6.865  1.00 0.00 ? 24  LYS A HZ3  1  
ATOM 340   N N    . ALA A 1 25  ? -1.727  -9.652  -5.108  1.00 0.00 ? 25  ALA A N    1  
ATOM 341   C CA   . ALA A 1 25  ? -2.271  -9.662  -3.756  1.00 0.00 ? 25  ALA A CA   1  
ATOM 342   C C    . ALA A 1 25  ? -1.346  -10.406 -2.798  1.00 0.00 ? 25  ALA A C    1  
ATOM 343   O O    . ALA A 1 25  ? -0.723  -11.400 -3.168  1.00 0.00 ? 25  ALA A O    1  
ATOM 344   C CB   . ALA A 1 25  ? -3.657  -10.291 -3.749  1.00 0.00 ? 25  ALA A CB   1  
ATOM 345   H H    . ALA A 1 25  ? -1.389  -10.487 -5.494  1.00 0.00 ? 25  ALA A H    1  
ATOM 346   H HA   . ALA A 1 25  ? -2.366  -8.638  -3.426  1.00 0.00 ? 25  ALA A HA   1  
ATOM 347   H HB1  . ALA A 1 25  ? -4.366  -9.592  -3.332  1.00 0.00 ? 25  ALA A HB1  1  
ATOM 348   H HB2  . ALA A 1 25  ? -3.945  -10.535 -4.761  1.00 0.00 ? 25  ALA A HB2  1  
ATOM 349   H HB3  . ALA A 1 25  ? -3.641  -11.190 -3.151  1.00 0.00 ? 25  ALA A HB3  1  
ATOM 350   N N    . GLY A 1 26  ? -1.262  -9.916  -1.565  1.00 0.00 ? 26  GLY A N    1  
ATOM 351   C CA   . GLY A 1 26  ? -0.410  -10.547 -0.573  1.00 0.00 ? 26  GLY A CA   1  
ATOM 352   C C    . GLY A 1 26  ? -0.465  -9.845  0.769   1.00 0.00 ? 26  GLY A C    1  
ATOM 353   O O    . GLY A 1 26  ? -0.611  -8.624  0.833   1.00 0.00 ? 26  GLY A O    1  
ATOM 354   H H    . GLY A 1 26  ? -1.782  -9.121  -1.326  1.00 0.00 ? 26  GLY A H    1  
ATOM 355   H HA2  . GLY A 1 26  ? -0.723  -11.572 -0.445  1.00 0.00 ? 26  GLY A HA2  1  
ATOM 356   H HA3  . GLY A 1 26  ? 0.609   -10.535 -0.931  1.00 0.00 ? 26  GLY A HA3  1  
ATOM 357   N N    . TRP A 1 27  ? -0.349  -10.617 1.843   1.00 0.00 ? 27  TRP A N    1  
ATOM 358   C CA   . TRP A 1 27  ? -0.388  -10.062 3.191   1.00 0.00 ? 27  TRP A CA   1  
ATOM 359   C C    . TRP A 1 27  ? 0.875   -9.262  3.488   1.00 0.00 ? 27  TRP A C    1  
ATOM 360   O O    . TRP A 1 27  ? 1.981   -9.806  3.489   1.00 0.00 ? 27  TRP A O    1  
ATOM 361   C CB   . TRP A 1 27  ? -0.552  -11.180 4.222   1.00 0.00 ? 27  TRP A CB   1  
ATOM 362   C CG   . TRP A 1 27  ? -1.954  -11.702 4.315   1.00 0.00 ? 27  TRP A CG   1  
ATOM 363   C CD1  . TRP A 1 27  ? -2.473  -12.779 3.655   1.00 0.00 ? 27  TRP A CD1  1  
ATOM 364   C CD2  . TRP A 1 27  ? -3.016  -11.167 5.112   1.00 0.00 ? 27  TRP A CD2  1  
ATOM 365   N NE1  . TRP A 1 27  ? -3.794  -12.946 3.994   1.00 0.00 ? 27  TRP A NE1  1  
ATOM 366   C CE2  . TRP A 1 27  ? -4.151  -11.971 4.887   1.00 0.00 ? 27  TRP A CE2  1  
ATOM 367   C CE3  . TRP A 1 27  ? -3.119  -10.090 5.996   1.00 0.00 ? 27  TRP A CE3  1  
ATOM 368   C CZ2  . TRP A 1 27  ? -5.371  -11.728 5.513   1.00 0.00 ? 27  TRP A CZ2  1  
ATOM 369   C CZ3  . TRP A 1 27  ? -4.330  -9.850  6.616   1.00 0.00 ? 27  TRP A CZ3  1  
ATOM 370   C CH2  . TRP A 1 27  ? -5.442  -10.666 6.374   1.00 0.00 ? 27  TRP A CH2  1  
ATOM 371   H H    . TRP A 1 27  ? -0.235  -11.584 1.728   1.00 0.00 ? 27  TRP A H    1  
ATOM 372   H HA   . TRP A 1 27  ? -1.241  -9.401  3.252   1.00 0.00 ? 27  TRP A HA   1  
ATOM 373   H HB2  . TRP A 1 27  ? 0.093   -12.004 3.955   1.00 0.00 ? 27  TRP A HB2  1  
ATOM 374   H HB3  . TRP A 1 27  ? -0.269  -10.807 5.195   1.00 0.00 ? 27  TRP A HB3  1  
ATOM 375   H HD1  . TRP A 1 27  ? -1.916  -13.398 2.968   1.00 0.00 ? 27  TRP A HD1  1  
ATOM 376   H HE1  . TRP A 1 27  ? -4.384  -13.651 3.653   1.00 0.00 ? 27  TRP A HE1  1  
ATOM 377   H HE3  . TRP A 1 27  ? -2.272  -9.449  6.196   1.00 0.00 ? 27  TRP A HE3  1  
ATOM 378   H HZ2  . TRP A 1 27  ? -6.237  -12.349 5.337   1.00 0.00 ? 27  TRP A HZ2  1  
ATOM 379   H HZ3  . TRP A 1 27  ? -4.428  -9.021  7.302   1.00 0.00 ? 27  TRP A HZ3  1  
ATOM 380   H HH2  . TRP A 1 27  ? -6.368  -10.442 6.880   1.00 0.00 ? 27  TRP A HH2  1  
ATOM 381   N N    . LEU A 1 28  ? 0.706   -7.968  3.739   1.00 0.00 ? 28  LEU A N    1  
ATOM 382   C CA   . LEU A 1 28  ? 1.835   -7.093  4.037   1.00 0.00 ? 28  LEU A CA   1  
ATOM 383   C C    . LEU A 1 28  ? 1.639   -6.390  5.376   1.00 0.00 ? 28  LEU A C    1  
ATOM 384   O O    . LEU A 1 28  ? 0.553   -6.425  5.955   1.00 0.00 ? 28  LEU A O    1  
ATOM 385   C CB   . LEU A 1 28  ? 2.010   -6.057  2.925   1.00 0.00 ? 28  LEU A CB   1  
ATOM 386   C CG   . LEU A 1 28  ? 2.785   -6.522  1.691   1.00 0.00 ? 28  LEU A CG   1  
ATOM 387   C CD1  . LEU A 1 28  ? 2.620   -5.527  0.552   1.00 0.00 ? 28  LEU A CD1  1  
ATOM 388   C CD2  . LEU A 1 28  ? 4.257   -6.713  2.026   1.00 0.00 ? 28  LEU A CD2  1  
ATOM 389   H H    . LEU A 1 28  ? -0.198  -7.592  3.724   1.00 0.00 ? 28  LEU A H    1  
ATOM 390   H HA   . LEU A 1 28  ? 2.723   -7.705  4.091   1.00 0.00 ? 28  LEU A HA   1  
ATOM 391   H HB2  . LEU A 1 28  ? 1.027   -5.750  2.602   1.00 0.00 ? 28  LEU A HB2  1  
ATOM 392   H HB3  . LEU A 1 28  ? 2.531   -5.208  3.344   1.00 0.00 ? 28  LEU A HB3  1  
ATOM 393   H HG   . LEU A 1 28  ? 2.389   -7.473  1.363   1.00 0.00 ? 28  LEU A HG   1  
ATOM 394   H HD11 . LEU A 1 28  ? 2.843   -6.014  -0.385  1.00 0.00 ? 28  LEU A HD11 1  
ATOM 395   H HD12 . LEU A 1 28  ? 3.297   -4.698  0.697   1.00 0.00 ? 28  LEU A HD12 1  
ATOM 396   H HD13 . LEU A 1 28  ? 1.603   -5.163  0.537   1.00 0.00 ? 28  LEU A HD13 1  
ATOM 397   H HD21 . LEU A 1 28  ? 4.679   -5.771  2.344   1.00 0.00 ? 28  LEU A HD21 1  
ATOM 398   H HD22 . LEU A 1 28  ? 4.782   -7.066  1.151   1.00 0.00 ? 28  LEU A HD22 1  
ATOM 399   H HD23 . LEU A 1 28  ? 4.354   -7.438  2.821   1.00 0.00 ? 28  LEU A HD23 1  
ATOM 400   N N    . PHE A 1 29  ? 2.698   -5.750  5.863   1.00 0.00 ? 29  PHE A N    1  
ATOM 401   C CA   . PHE A 1 29  ? 2.642   -5.037  7.134   1.00 0.00 ? 29  PHE A CA   1  
ATOM 402   C C    . PHE A 1 29  ? 2.683   -3.528  6.913   1.00 0.00 ? 29  PHE A C    1  
ATOM 403   O O    . PHE A 1 29  ? 3.684   -2.984  6.445   1.00 0.00 ? 29  PHE A O    1  
ATOM 404   C CB   . PHE A 1 29  ? 3.804   -5.464  8.033   1.00 0.00 ? 29  PHE A CB   1  
ATOM 405   C CG   . PHE A 1 29  ? 3.668   -6.862  8.565   1.00 0.00 ? 29  PHE A CG   1  
ATOM 406   C CD1  . PHE A 1 29  ? 3.731   -7.951  7.711   1.00 0.00 ? 29  PHE A CD1  1  
ATOM 407   C CD2  . PHE A 1 29  ? 3.477   -7.087  9.919   1.00 0.00 ? 29  PHE A CD2  1  
ATOM 408   C CE1  . PHE A 1 29  ? 3.607   -9.239  8.197   1.00 0.00 ? 29  PHE A CE1  1  
ATOM 409   C CE2  . PHE A 1 29  ? 3.352   -8.372  10.411  1.00 0.00 ? 29  PHE A CE2  1  
ATOM 410   C CZ   . PHE A 1 29  ? 3.416   -9.450  9.549   1.00 0.00 ? 29  PHE A CZ   1  
ATOM 411   H H    . PHE A 1 29  ? 3.536   -5.758  5.355   1.00 0.00 ? 29  PHE A H    1  
ATOM 412   H HA   . PHE A 1 29  ? 1.712   -5.293  7.616   1.00 0.00 ? 29  PHE A HA   1  
ATOM 413   H HB2  . PHE A 1 29  ? 4.724   -5.412  7.470   1.00 0.00 ? 29  PHE A HB2  1  
ATOM 414   H HB3  . PHE A 1 29  ? 3.864   -4.791  8.876   1.00 0.00 ? 29  PHE A HB3  1  
ATOM 415   H HD1  . PHE A 1 29  ? 3.880   -7.788  6.653   1.00 0.00 ? 29  PHE A HD1  1  
ATOM 416   H HD2  . PHE A 1 29  ? 3.425   -6.245  10.594  1.00 0.00 ? 29  PHE A HD2  1  
ATOM 417   H HE1  . PHE A 1 29  ? 3.657   -10.079 7.521   1.00 0.00 ? 29  PHE A HE1  1  
ATOM 418   H HE2  . PHE A 1 29  ? 3.202   -8.534  11.468  1.00 0.00 ? 29  PHE A HE2  1  
ATOM 419   H HZ   . PHE A 1 29  ? 3.319   -10.455 9.931   1.00 0.00 ? 29  PHE A HZ   1  
ATOM 420   N N    . LYS A 1 30  ? 1.588   -2.856  7.252   1.00 0.00 ? 30  LYS A N    1  
ATOM 421   C CA   . LYS A 1 30  ? 1.497   -1.410  7.092   1.00 0.00 ? 30  LYS A CA   1  
ATOM 422   C C    . LYS A 1 30  ? 1.885   -0.694  8.383   1.00 0.00 ? 30  LYS A C    1  
ATOM 423   O O    . LYS A 1 30  ? 1.248   -0.879  9.420   1.00 0.00 ? 30  LYS A O    1  
ATOM 424   C CB   . LYS A 1 30  ? 0.078   -1.010  6.682   1.00 0.00 ? 30  LYS A CB   1  
ATOM 425   C CG   . LYS A 1 30  ? -0.052  0.451   6.286   1.00 0.00 ? 30  LYS A CG   1  
ATOM 426   C CD   . LYS A 1 30  ? -1.335  0.707   5.514   1.00 0.00 ? 30  LYS A CD   1  
ATOM 427   C CE   . LYS A 1 30  ? -1.359  2.108   4.921   1.00 0.00 ? 30  LYS A CE   1  
ATOM 428   N NZ   . LYS A 1 30  ? -1.605  3.145   5.960   1.00 0.00 ? 30  LYS A NZ   1  
ATOM 429   H H    . LYS A 1 30  ? 0.822   -3.346  7.620   1.00 0.00 ? 30  LYS A H    1  
ATOM 430   H HA   . LYS A 1 30  ? 2.184   -1.118  6.313   1.00 0.00 ? 30  LYS A HA   1  
ATOM 431   H HB2  . LYS A 1 30  ? -0.226  -1.618  5.842   1.00 0.00 ? 30  LYS A HB2  1  
ATOM 432   H HB3  . LYS A 1 30  ? -0.590  -1.197  7.511   1.00 0.00 ? 30  LYS A HB3  1  
ATOM 433   H HG2  . LYS A 1 30  ? -0.055  1.058   7.179   1.00 0.00 ? 30  LYS A HG2  1  
ATOM 434   H HG3  . LYS A 1 30  ? 0.791   0.722   5.666   1.00 0.00 ? 30  LYS A HG3  1  
ATOM 435   H HD2  . LYS A 1 30  ? -1.413  -0.012  4.712   1.00 0.00 ? 30  LYS A HD2  1  
ATOM 436   H HD3  . LYS A 1 30  ? -2.176  0.594   6.183   1.00 0.00 ? 30  LYS A HD3  1  
ATOM 437   H HE2  . LYS A 1 30  ? -0.408  2.301   4.450   1.00 0.00 ? 30  LYS A HE2  1  
ATOM 438   H HE3  . LYS A 1 30  ? -2.144  2.158   4.181   1.00 0.00 ? 30  LYS A HE3  1  
ATOM 439   H HZ1  . LYS A 1 30  ? -0.707  3.430   6.401   1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 440   H HZ2  . LYS A 1 30  ? -2.237  2.771   6.697   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 441   H HZ3  . LYS A 1 30  ? -2.049  3.982   5.532   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 442   N N    . GLN A 1 31  ? 2.931   0.122   8.310   1.00 0.00 ? 31  GLN A N    1  
ATOM 443   C CA   . GLN A 1 31  ? 3.402   0.865   9.473   1.00 0.00 ? 31  GLN A CA   1  
ATOM 444   C C    . GLN A 1 31  ? 2.302   1.767   10.024  1.00 0.00 ? 31  GLN A C    1  
ATOM 445   O O    . GLN A 1 31  ? 1.468   2.274   9.275   1.00 0.00 ? 31  GLN A O    1  
ATOM 446   C CB   . GLN A 1 31  ? 4.629   1.702   9.107   1.00 0.00 ? 31  GLN A CB   1  
ATOM 447   C CG   . GLN A 1 31  ? 5.588   1.914   10.266  1.00 0.00 ? 31  GLN A CG   1  
ATOM 448   C CD   . GLN A 1 31  ? 6.339   3.227   10.170  1.00 0.00 ? 31  GLN A CD   1  
ATOM 449   O OE1  . GLN A 1 31  ? 5.762   4.300   10.350  1.00 0.00 ? 31  GLN A OE1  1  
ATOM 450   N NE2  . GLN A 1 31  ? 7.634   3.150   9.885   1.00 0.00 ? 31  GLN A NE2  1  
ATOM 451   H H    . GLN A 1 31  ? 3.397   0.227   7.455   1.00 0.00 ? 31  GLN A H    1  
ATOM 452   H HA   . GLN A 1 31  ? 3.679   0.150   10.233  1.00 0.00 ? 31  GLN A HA   1  
ATOM 453   H HB2  . GLN A 1 31  ? 5.163   1.207   8.310   1.00 0.00 ? 31  GLN A HB2  1  
ATOM 454   H HB3  . GLN A 1 31  ? 4.298   2.670   8.760   1.00 0.00 ? 31  GLN A HB3  1  
ATOM 455   H HG2  . GLN A 1 31  ? 5.027   1.906   11.189  1.00 0.00 ? 31  GLN A HG2  1  
ATOM 456   H HG3  . GLN A 1 31  ? 6.305   1.106   10.275  1.00 0.00 ? 31  GLN A HG3  1  
ATOM 457   H HE21 . GLN A 1 31  ? 8.026   2.261   9.753   1.00 0.00 ? 31  GLN A HE21 1  
ATOM 458   H HE22 . GLN A 1 31  ? 8.143   3.983   9.816   1.00 0.00 ? 31  GLN A HE22 1  
ATOM 459   N N    . ALA A 1 32  ? 2.307   1.961   11.339  1.00 0.00 ? 32  ALA A N    1  
ATOM 460   C CA   . ALA A 1 32  ? 1.311   2.802   11.991  1.00 0.00 ? 32  ALA A CA   1  
ATOM 461   C C    . ALA A 1 32  ? 1.643   4.281   11.816  1.00 0.00 ? 32  ALA A C    1  
ATOM 462   O O    . ALA A 1 32  ? 2.749   4.635   11.408  1.00 0.00 ? 32  ALA A O    1  
ATOM 463   C CB   . ALA A 1 32  ? 1.210   2.453   13.468  1.00 0.00 ? 32  ALA A CB   1  
ATOM 464   H H    . ALA A 1 32  ? 2.998   1.529   11.883  1.00 0.00 ? 32  ALA A H    1  
ATOM 465   H HA   . ALA A 1 32  ? 0.353   2.602   11.532  1.00 0.00 ? 32  ALA A HA   1  
ATOM 466   H HB1  . ALA A 1 32  ? 2.202   2.316   13.874  1.00 0.00 ? 32  ALA A HB1  1  
ATOM 467   H HB2  . ALA A 1 32  ? 0.714   3.256   13.994  1.00 0.00 ? 32  ALA A HB2  1  
ATOM 468   H HB3  . ALA A 1 32  ? 0.644   1.542   13.584  1.00 0.00 ? 32  ALA A HB3  1  
ATOM 469   N N    . SER A 1 33  ? 0.677   5.140   12.126  1.00 0.00 ? 33  SER A N    1  
ATOM 470   C CA   . SER A 1 33  ? 0.865   6.580   11.999  1.00 0.00 ? 33  SER A CA   1  
ATOM 471   C C    . SER A 1 33  ? 1.967   7.069   12.934  1.00 0.00 ? 33  SER A C    1  
ATOM 472   O O    . SER A 1 33  ? 2.326   6.390   13.896  1.00 0.00 ? 33  SER A O    1  
ATOM 473   C CB   . SER A 1 33  ? -0.442  7.315   12.304  1.00 0.00 ? 33  SER A CB   1  
ATOM 474   O OG   . SER A 1 33  ? -0.697  7.345   13.697  1.00 0.00 ? 33  SER A OG   1  
ATOM 475   H H    . SER A 1 33  ? -0.184  4.796   12.446  1.00 0.00 ? 33  SER A H    1  
ATOM 476   H HA   . SER A 1 33  ? 1.156   6.788   10.980  1.00 0.00 ? 33  SER A HA   1  
ATOM 477   H HB2  . SER A 1 33  ? -0.374  8.329   11.940  1.00 0.00 ? 33  SER A HB2  1  
ATOM 478   H HB3  . SER A 1 33  ? -1.259  6.810   11.810  1.00 0.00 ? 33  SER A HB3  1  
ATOM 479   H HG   . SER A 1 33  ? -0.499  6.486   14.078  1.00 0.00 ? 33  SER A HG   1  
ATOM 480   N N    . SER A 1 34  ? 2.499   8.251   12.644  1.00 0.00 ? 34  SER A N    1  
ATOM 481   C CA   . SER A 1 34  ? 3.563   8.831   13.455  1.00 0.00 ? 34  SER A CA   1  
ATOM 482   C C    . SER A 1 34  ? 3.284   8.629   14.942  1.00 0.00 ? 34  SER A C    1  
ATOM 483   O O    . SER A 1 34  ? 4.203   8.448   15.739  1.00 0.00 ? 34  SER A O    1  
ATOM 484   C CB   . SER A 1 34  ? 3.711   10.323  13.151  1.00 0.00 ? 34  SER A CB   1  
ATOM 485   O OG   . SER A 1 34  ? 4.497   10.969  14.137  1.00 0.00 ? 34  SER A OG   1  
ATOM 486   H H    . SER A 1 34  ? 2.170   8.745   11.863  1.00 0.00 ? 34  SER A H    1  
ATOM 487   H HA   . SER A 1 34  ? 4.484   8.327   13.203  1.00 0.00 ? 34  SER A HA   1  
ATOM 488   H HB2  . SER A 1 34  ? 4.188   10.446  12.190  1.00 0.00 ? 34  SER A HB2  1  
ATOM 489   H HB3  . SER A 1 34  ? 2.733   10.781  13.128  1.00 0.00 ? 34  SER A HB3  1  
ATOM 490   H HG   . SER A 1 34  ? 5.412   10.998  13.849  1.00 0.00 ? 34  SER A HG   1  
ATOM 491   N N    . GLY A 1 35  ? 2.005   8.662   15.307  1.00 0.00 ? 35  GLY A N    1  
ATOM 492   C CA   . GLY A 1 35  ? 1.626   8.482   16.696  1.00 0.00 ? 35  GLY A CA   1  
ATOM 493   C C    . GLY A 1 35  ? 2.227   7.229   17.303  1.00 0.00 ? 35  GLY A C    1  
ATOM 494   O O    . GLY A 1 35  ? 3.393   7.219   17.696  1.00 0.00 ? 35  GLY A O    1  
ATOM 495   H H    . GLY A 1 35  ? 1.315   8.810   14.628  1.00 0.00 ? 35  GLY A H    1  
ATOM 496   H HA2  . GLY A 1 35  ? 1.958   9.339   17.263  1.00 0.00 ? 35  GLY A HA2  1  
ATOM 497   H HA3  . GLY A 1 35  ? 0.550   8.417   16.758  1.00 0.00 ? 35  GLY A HA3  1  
ATOM 498   N N    . VAL A 1 36  ? 1.427   6.170   17.382  1.00 0.00 ? 36  VAL A N    1  
ATOM 499   C CA   . VAL A 1 36  ? 1.886   4.907   17.946  1.00 0.00 ? 36  VAL A CA   1  
ATOM 500   C C    . VAL A 1 36  ? 2.913   4.239   17.038  1.00 0.00 ? 36  VAL A C    1  
ATOM 501   O O    . VAL A 1 36  ? 2.745   4.197   15.819  1.00 0.00 ? 36  VAL A O    1  
ATOM 502   C CB   . VAL A 1 36  ? 0.713   3.936   18.177  1.00 0.00 ? 36  VAL A CB   1  
ATOM 503   C CG1  . VAL A 1 36  ? 0.047   3.579   16.857  1.00 0.00 ? 36  VAL A CG1  1  
ATOM 504   C CG2  . VAL A 1 36  ? 1.191   2.684   18.897  1.00 0.00 ? 36  VAL A CG2  1  
ATOM 505   H H    . VAL A 1 36  ? 0.507   6.240   17.052  1.00 0.00 ? 36  VAL A H    1  
ATOM 506   H HA   . VAL A 1 36  ? 2.347   5.115   18.901  1.00 0.00 ? 36  VAL A HA   1  
ATOM 507   H HB   . VAL A 1 36  ? -0.018  4.428   18.802  1.00 0.00 ? 36  VAL A HB   1  
ATOM 508   H HG11 . VAL A 1 36  ? 0.391   4.255   16.087  1.00 0.00 ? 36  VAL A HG11 1  
ATOM 509   H HG12 . VAL A 1 36  ? 0.301   2.565   16.587  1.00 0.00 ? 36  VAL A HG12 1  
ATOM 510   H HG13 . VAL A 1 36  ? -1.025  3.668   16.959  1.00 0.00 ? 36  VAL A HG13 1  
ATOM 511   H HG21 . VAL A 1 36  ? 0.801   2.676   19.904  1.00 0.00 ? 36  VAL A HG21 1  
ATOM 512   H HG22 . VAL A 1 36  ? 0.842   1.810   18.368  1.00 0.00 ? 36  VAL A HG22 1  
ATOM 513   H HG23 . VAL A 1 36  ? 2.271   2.677   18.930  1.00 0.00 ? 36  VAL A HG23 1  
ATOM 514   N N    . LYS A 1 37  ? 3.977   3.718   17.639  1.00 0.00 ? 37  LYS A N    1  
ATOM 515   C CA   . LYS A 1 37  ? 5.031   3.050   16.886  1.00 0.00 ? 37  LYS A CA   1  
ATOM 516   C C    . LYS A 1 37  ? 4.816   1.540   16.870  1.00 0.00 ? 37  LYS A C    1  
ATOM 517   O O    . LYS A 1 37  ? 5.141   0.849   17.834  1.00 0.00 ? 37  LYS A O    1  
ATOM 518   C CB   . LYS A 1 37  ? 6.400   3.375   17.488  1.00 0.00 ? 37  LYS A CB   1  
ATOM 519   C CG   . LYS A 1 37  ? 6.781   4.841   17.378  1.00 0.00 ? 37  LYS A CG   1  
ATOM 520   C CD   . LYS A 1 37  ? 7.448   5.146   16.047  1.00 0.00 ? 37  LYS A CD   1  
ATOM 521   C CE   . LYS A 1 37  ? 8.329   6.382   16.135  1.00 0.00 ? 37  LYS A CE   1  
ATOM 522   N NZ   . LYS A 1 37  ? 7.569   7.628   15.838  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 523   H H    . LYS A 1 37  ? 4.054   3.783   18.614  1.00 0.00 ? 37  LYS A H    1  
ATOM 524   H HA   . LYS A 1 37  ? 4.998   3.417   15.871  1.00 0.00 ? 37  LYS A HA   1  
ATOM 525   H HB2  . LYS A 1 37  ? 6.394   3.103   18.533  1.00 0.00 ? 37  LYS A HB2  1  
ATOM 526   H HB3  . LYS A 1 37  ? 7.152   2.790   16.977  1.00 0.00 ? 37  LYS A HB3  1  
ATOM 527   H HG2  . LYS A 1 37  ? 5.889   5.443   17.467  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 528   H HG3  . LYS A 1 37  ? 7.466   5.087   18.177  1.00 0.00 ? 37  LYS A HG3  1  
ATOM 529   H HD2  . LYS A 1 37  ? 8.058   4.303   15.758  1.00 0.00 ? 37  LYS A HD2  1  
ATOM 530   H HD3  . LYS A 1 37  ? 6.683   5.311   15.301  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 531   H HE2  . LYS A 1 37  ? 8.736   6.448   17.132  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 532   H HE3  . LYS A 1 37  ? 9.136   6.285   15.423  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 533   H HZ1  . LYS A 1 37  ? 7.479   7.756   14.810  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 534   H HZ2  . LYS A 1 37  ? 8.062   8.451   16.238  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 535   H HZ3  . LYS A 1 37  ? 6.617   7.573   16.254  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 536   N N    . GLN A 1 38  ? 4.268   1.037   15.769  1.00 0.00 ? 38  GLN A N    1  
ATOM 537   C CA   . GLN A 1 38  ? 4.011   -0.392  15.628  1.00 0.00 ? 38  GLN A CA   1  
ATOM 538   C C    . GLN A 1 38  ? 3.572   -0.729  14.207  1.00 0.00 ? 38  GLN A C    1  
ATOM 539   O O    . GLN A 1 38  ? 3.336   0.163   13.392  1.00 0.00 ? 38  GLN A O    1  
ATOM 540   C CB   . GLN A 1 38  ? 2.941   -0.839  16.625  1.00 0.00 ? 38  GLN A CB   1  
ATOM 541   C CG   . GLN A 1 38  ? 1.543   -0.352  16.277  1.00 0.00 ? 38  GLN A CG   1  
ATOM 542   C CD   . GLN A 1 38  ? 0.475   -0.966  17.160  1.00 0.00 ? 38  GLN A CD   1  
ATOM 543   O OE1  . GLN A 1 38  ? -0.039  -0.319  18.073  1.00 0.00 ? 38  GLN A OE1  1  
ATOM 544   N NE2  . GLN A 1 38  ? 0.133   -2.220  16.891  1.00 0.00 ? 38  GLN A NE2  1  
ATOM 545   H H    . GLN A 1 38  ? 4.031   1.639   15.034  1.00 0.00 ? 38  GLN A H    1  
ATOM 546   H HA   . GLN A 1 38  ? 4.930   -0.916  15.842  1.00 0.00 ? 38  GLN A HA   1  
ATOM 547   H HB2  . GLN A 1 38  ? 2.925   -1.918  16.659  1.00 0.00 ? 38  GLN A HB2  1  
ATOM 548   H HB3  . GLN A 1 38  ? 3.197   -0.460  17.604  1.00 0.00 ? 38  GLN A HB3  1  
ATOM 549   H HG2  . GLN A 1 38  ? 1.511   0.721   16.393  1.00 0.00 ? 38  GLN A HG2  1  
ATOM 550   H HG3  . GLN A 1 38  ? 1.333   -0.609  15.250  1.00 0.00 ? 38  GLN A HG3  1  
ATOM 551   H HE21 . GLN A 1 38  ? 0.586   -2.674  16.149  1.00 0.00 ? 38  GLN A HE21 1  
ATOM 552   H HE22 . GLN A 1 38  ? -0.554  -2.642  17.447  1.00 0.00 ? 38  GLN A HE22 1  
ATOM 553   N N    . TRP A 1 39  ? 3.464   -2.020  13.918  1.00 0.00 ? 39  TRP A N    1  
ATOM 554   C CA   . TRP A 1 39  ? 3.053   -2.475  12.594  1.00 0.00 ? 39  TRP A CA   1  
ATOM 555   C C    . TRP A 1 39  ? 1.691   -3.158  12.652  1.00 0.00 ? 39  TRP A C    1  
ATOM 556   O O    . TRP A 1 39  ? 1.356   -3.813  13.638  1.00 0.00 ? 39  TRP A O    1  
ATOM 557   C CB   . TRP A 1 39  ? 4.095   -3.435  12.016  1.00 0.00 ? 39  TRP A CB   1  
ATOM 558   C CG   . TRP A 1 39  ? 5.378   -2.760  11.636  1.00 0.00 ? 39  TRP A CG   1  
ATOM 559   C CD1  . TRP A 1 39  ? 6.456   -2.534  12.444  1.00 0.00 ? 39  TRP A CD1  1  
ATOM 560   C CD2  . TRP A 1 39  ? 5.716   -2.222  10.353  1.00 0.00 ? 39  TRP A CD2  1  
ATOM 561   N NE1  . TRP A 1 39  ? 7.443   -1.888  11.740  1.00 0.00 ? 39  TRP A NE1  1  
ATOM 562   C CE2  . TRP A 1 39  ? 7.014   -1.686  10.455  1.00 0.00 ? 39  TRP A CE2  1  
ATOM 563   C CE3  . TRP A 1 39  ? 5.049   -2.143  9.127   1.00 0.00 ? 39  TRP A CE3  1  
ATOM 564   C CZ2  . TRP A 1 39  ? 7.656   -1.079  9.378   1.00 0.00 ? 39  TRP A CZ2  1  
ATOM 565   C CZ3  . TRP A 1 39  ? 5.686   -1.540  8.060   1.00 0.00 ? 39  TRP A CZ3  1  
ATOM 566   C CH2  . TRP A 1 39  ? 6.979   -1.016  8.190   1.00 0.00 ? 39  TRP A CH2  1  
ATOM 567   H H    . TRP A 1 39  ? 3.665   -2.685  14.610  1.00 0.00 ? 39  TRP A H    1  
ATOM 568   H HA   . TRP A 1 39  ? 2.982   -1.608  11.954  1.00 0.00 ? 39  TRP A HA   1  
ATOM 569   H HB2  . TRP A 1 39  ? 4.322   -4.194  12.749  1.00 0.00 ? 39  TRP A HB2  1  
ATOM 570   H HB3  . TRP A 1 39  ? 3.689   -3.904  11.131  1.00 0.00 ? 39  TRP A HB3  1  
ATOM 571   H HD1  . TRP A 1 39  ? 6.509   -2.824  13.482  1.00 0.00 ? 39  TRP A HD1  1  
ATOM 572   H HE1  . TRP A 1 39  ? 8.314   -1.618  12.100  1.00 0.00 ? 39  TRP A HE1  1  
ATOM 573   H HE3  . TRP A 1 39  ? 4.052   -2.542  9.007   1.00 0.00 ? 39  TRP A HE3  1  
ATOM 574   H HZ2  . TRP A 1 39  ? 8.652   -0.671  9.462   1.00 0.00 ? 39  TRP A HZ2  1  
ATOM 575   H HZ3  . TRP A 1 39  ? 5.186   -1.469  7.105   1.00 0.00 ? 39  TRP A HZ3  1  
ATOM 576   H HH2  . TRP A 1 39  ? 7.438   -0.554  7.330   1.00 0.00 ? 39  TRP A HH2  1  
ATOM 577   N N    . ASN A 1 40  ? 0.910   -3.000  11.588  1.00 0.00 ? 40  ASN A N    1  
ATOM 578   C CA   . ASN A 1 40  ? -0.417  -3.602  11.519  1.00 0.00 ? 40  ASN A CA   1  
ATOM 579   C C    . ASN A 1 40  ? -0.563  -4.453  10.261  1.00 0.00 ? 40  ASN A C    1  
ATOM 580   O O    . ASN A 1 40  ? -0.733  -3.929  9.160   1.00 0.00 ? 40  ASN A O    1  
ATOM 581   C CB   . ASN A 1 40  ? -1.494  -2.516  11.542  1.00 0.00 ? 40  ASN A CB   1  
ATOM 582   C CG   . ASN A 1 40  ? -1.563  -1.797  12.875  1.00 0.00 ? 40  ASN A CG   1  
ATOM 583   O OD1  . ASN A 1 40  ? -2.534  -1.937  13.619  1.00 0.00 ? 40  ASN A OD1  1  
ATOM 584   N ND2  . ASN A 1 40  ? -0.529  -1.023  13.184  1.00 0.00 ? 40  ASN A ND2  1  
ATOM 585   H H    . ASN A 1 40  ? 1.232   -2.466  10.832  1.00 0.00 ? 40  ASN A H    1  
ATOM 586   H HA   . ASN A 1 40  ? -0.539  -4.236  12.384  1.00 0.00 ? 40  ASN A HA   1  
ATOM 587   H HB2  . ASN A 1 40  ? -1.279  -1.788  10.773  1.00 0.00 ? 40  ASN A HB2  1  
ATOM 588   H HB3  . ASN A 1 40  ? -2.456  -2.966  11.346  1.00 0.00 ? 40  ASN A HB3  1  
ATOM 589   H HD21 . ASN A 1 40  ? 0.209   -0.959  12.543  1.00 0.00 ? 40  ASN A HD21 1  
ATOM 590   H HD22 . ASN A 1 40  ? -0.547  -0.547  14.040  1.00 0.00 ? 40  ASN A HD22 1  
ATOM 591   N N    . LYS A 1 41  ? -0.497  -5.769  10.432  1.00 0.00 ? 41  LYS A N    1  
ATOM 592   C CA   . LYS A 1 41  ? -0.623  -6.694  9.313   1.00 0.00 ? 41  LYS A CA   1  
ATOM 593   C C    . LYS A 1 41  ? -2.015  -6.612  8.694   1.00 0.00 ? 41  LYS A C    1  
ATOM 594   O O    . LYS A 1 41  ? -3.022  -6.757  9.387   1.00 0.00 ? 41  LYS A O    1  
ATOM 595   C CB   . LYS A 1 41  ? -0.342  -8.126  9.773   1.00 0.00 ? 41  LYS A CB   1  
ATOM 596   C CG   . LYS A 1 41  ? -0.148  -9.106  8.629   1.00 0.00 ? 41  LYS A CG   1  
ATOM 597   C CD   . LYS A 1 41  ? -0.409  -10.536 9.070   1.00 0.00 ? 41  LYS A CD   1  
ATOM 598   C CE   . LYS A 1 41  ? -0.313  -11.506 7.902   1.00 0.00 ? 41  LYS A CE   1  
ATOM 599   N NZ   . LYS A 1 41  ? 1.040   -11.493 7.281   1.00 0.00 ? 41  LYS A NZ   1  
ATOM 600   H H    . LYS A 1 41  ? -0.360  -6.127  11.335  1.00 0.00 ? 41  LYS A H    1  
ATOM 601   H HA   . LYS A 1 41  ? 0.106   -6.415  8.567   1.00 0.00 ? 41  LYS A HA   1  
ATOM 602   H HB2  . LYS A 1 41  ? 0.554   -8.128  10.377  1.00 0.00 ? 41  LYS A HB2  1  
ATOM 603   H HB3  . LYS A 1 41  ? -1.172  -8.467  10.375  1.00 0.00 ? 41  LYS A HB3  1  
ATOM 604   H HG2  . LYS A 1 41  ? -0.833  -8.856  7.833   1.00 0.00 ? 41  LYS A HG2  1  
ATOM 605   H HG3  . LYS A 1 41  ? 0.869   -9.029  8.270   1.00 0.00 ? 41  LYS A HG3  1  
ATOM 606   H HD2  . LYS A 1 41  ? 0.322   -10.814 9.815   1.00 0.00 ? 41  LYS A HD2  1  
ATOM 607   H HD3  . LYS A 1 41  ? -1.401  -10.597 9.496   1.00 0.00 ? 41  LYS A HD3  1  
ATOM 608   H HE2  . LYS A 1 41  ? -0.526  -12.502 8.259   1.00 0.00 ? 41  LYS A HE2  1  
ATOM 609   H HE3  . LYS A 1 41  ? -1.044  -11.226 7.158   1.00 0.00 ? 41  LYS A HE3  1  
ATOM 610   H HZ1  . LYS A 1 41  ? 1.238   -12.412 6.835   1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 611   H HZ2  . LYS A 1 41  ? 1.764   -11.308 8.005   1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 612   H HZ3  . LYS A 1 41  ? 1.094   -10.750 6.556   1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 613   N N    . ARG A 1 42  ? -2.064  -6.381  7.386   1.00 0.00 ? 42  ARG A N    1  
ATOM 614   C CA   . ARG A 1 42  ? -3.332  -6.280  6.675   1.00 0.00 ? 42  ARG A CA   1  
ATOM 615   C C    . ARG A 1 42  ? -3.227  -6.904  5.286   1.00 0.00 ? 42  ARG A C    1  
ATOM 616   O O    . ARG A 1 42  ? -2.134  -7.218  4.817   1.00 0.00 ? 42  ARG A O    1  
ATOM 617   C CB   . ARG A 1 42  ? -3.760  -4.816  6.557   1.00 0.00 ? 42  ARG A CB   1  
ATOM 618   C CG   . ARG A 1 42  ? -4.122  -4.179  7.888   1.00 0.00 ? 42  ARG A CG   1  
ATOM 619   C CD   . ARG A 1 42  ? -5.600  -4.351  8.205   1.00 0.00 ? 42  ARG A CD   1  
ATOM 620   N NE   . ARG A 1 42  ? -5.860  -4.305  9.641   1.00 0.00 ? 42  ARG A NE   1  
ATOM 621   C CZ   . ARG A 1 42  ? -5.995  -3.175  10.328  1.00 0.00 ? 42  ARG A CZ   1  
ATOM 622   N NH1  . ARG A 1 42  ? -5.895  -2.005  9.712   1.00 0.00 ? 42  ARG A NH1  1  
ATOM 623   N NH2  . ARG A 1 42  ? -6.232  -3.215  11.633  1.00 0.00 ? 42  ARG A NH2  1  
ATOM 624   H H    . ARG A 1 42  ? -1.226  -6.274  6.888   1.00 0.00 ? 42  ARG A H    1  
ATOM 625   H HA   . ARG A 1 42  ? -4.075  -6.819  7.243   1.00 0.00 ? 42  ARG A HA   1  
ATOM 626   H HB2  . ARG A 1 42  ? -2.951  -4.250  6.120   1.00 0.00 ? 42  ARG A HB2  1  
ATOM 627   H HB3  . ARG A 1 42  ? -4.621  -4.757  5.908   1.00 0.00 ? 42  ARG A HB3  1  
ATOM 628   H HG2  . ARG A 1 42  ? -3.541  -4.645  8.670   1.00 0.00 ? 42  ARG A HG2  1  
ATOM 629   H HG3  . ARG A 1 42  ? -3.892  -3.124  7.846   1.00 0.00 ? 42  ARG A HG3  1  
ATOM 630   H HD2  . ARG A 1 42  ? -6.152  -3.558  7.723   1.00 0.00 ? 42  ARG A HD2  1  
ATOM 631   H HD3  . ARG A 1 42  ? -5.928  -5.305  7.819   1.00 0.00 ? 42  ARG A HD3  1  
ATOM 632   H HE   . ARG A 1 42  ? -5.938  -5.158  10.116  1.00 0.00 ? 42  ARG A HE   1  
ATOM 633   H HH11 . ARG A 1 42  ? -5.718  -1.972  8.728   1.00 0.00 ? 42  ARG A HH11 1  
ATOM 634   H HH12 . ARG A 1 42  ? -5.998  -1.156  10.231  1.00 0.00 ? 42  ARG A HH12 1  
ATOM 635   H HH21 . ARG A 1 42  ? -6.308  -4.095  12.100  1.00 0.00 ? 42  ARG A HH21 1  
ATOM 636   H HH22 . ARG A 1 42  ? -6.333  -2.365  12.148  1.00 0.00 ? 42  ARG A HH22 1  
ATOM 637   N N    . TRP A 1 43  ? -4.371  -7.080  4.635   1.00 0.00 ? 43  TRP A N    1  
ATOM 638   C CA   . TRP A 1 43  ? -4.408  -7.667  3.300   1.00 0.00 ? 43  TRP A CA   1  
ATOM 639   C C    . TRP A 1 43  ? -4.259  -6.592  2.229   1.00 0.00 ? 43  TRP A C    1  
ATOM 640   O O    . TRP A 1 43  ? -5.095  -5.696  2.114   1.00 0.00 ? 43  TRP A O    1  
ATOM 641   C CB   . TRP A 1 43  ? -5.716  -8.432  3.093   1.00 0.00 ? 43  TRP A CB   1  
ATOM 642   C CG   . TRP A 1 43  ? -5.779  -9.158  1.783   1.00 0.00 ? 43  TRP A CG   1  
ATOM 643   C CD1  . TRP A 1 43  ? -6.739  -9.031  0.821   1.00 0.00 ? 43  TRP A CD1  1  
ATOM 644   C CD2  . TRP A 1 43  ? -4.843  -10.125 1.294   1.00 0.00 ? 43  TRP A CD2  1  
ATOM 645   N NE1  . TRP A 1 43  ? -6.457  -9.860  -0.238  1.00 0.00 ? 43  TRP A NE1  1  
ATOM 646   C CE2  . TRP A 1 43  ? -5.299  -10.542 0.028   1.00 0.00 ? 43  TRP A CE2  1  
ATOM 647   C CE3  . TRP A 1 43  ? -3.664  -10.678 1.801   1.00 0.00 ? 43  TRP A CE3  1  
ATOM 648   C CZ2  . TRP A 1 43  ? -4.616  -11.486 -0.735  1.00 0.00 ? 43  TRP A CZ2  1  
ATOM 649   C CZ3  . TRP A 1 43  ? -2.988  -11.615 1.043   1.00 0.00 ? 43  TRP A CZ3  1  
ATOM 650   C CH2  . TRP A 1 43  ? -3.465  -12.011 -0.214  1.00 0.00 ? 43  TRP A CH2  1  
ATOM 651   H H    . TRP A 1 43  ? -5.211  -6.809  5.061   1.00 0.00 ? 43  TRP A H    1  
ATOM 652   H HA   . TRP A 1 43  ? -3.581  -8.356  3.219   1.00 0.00 ? 43  TRP A HA   1  
ATOM 653   H HB2  . TRP A 1 43  ? -5.829  -9.159  3.883   1.00 0.00 ? 43  TRP A HB2  1  
ATOM 654   H HB3  . TRP A 1 43  ? -6.542  -7.736  3.129   1.00 0.00 ? 43  TRP A HB3  1  
ATOM 655   H HD1  . TRP A 1 43  ? -7.591  -8.372  0.895   1.00 0.00 ? 43  TRP A HD1  1  
ATOM 656   H HE1  . TRP A 1 43  ? -6.997  -9.948  -1.051  1.00 0.00 ? 43  TRP A HE1  1  
ATOM 657   H HE3  . TRP A 1 43  ? -3.281  -10.386 2.768   1.00 0.00 ? 43  TRP A HE3  1  
ATOM 658   H HZ2  . TRP A 1 43  ? -4.970  -11.801 -1.706  1.00 0.00 ? 43  TRP A HZ2  1  
ATOM 659   H HZ3  . TRP A 1 43  ? -2.075  -12.054 1.419   1.00 0.00 ? 43  TRP A HZ3  1  
ATOM 660   H HH2  . TRP A 1 43  ? -2.904  -12.745 -0.771  1.00 0.00 ? 43  TRP A HH2  1  
ATOM 661   N N    . PHE A 1 44  ? -3.189  -6.688  1.446   1.00 0.00 ? 44  PHE A N    1  
ATOM 662   C CA   . PHE A 1 44  ? -2.930  -5.722  0.384   1.00 0.00 ? 44  PHE A CA   1  
ATOM 663   C C    . PHE A 1 44  ? -3.338  -6.286  -0.974  1.00 0.00 ? 44  PHE A C    1  
ATOM 664   O O    . PHE A 1 44  ? -3.115  -7.462  -1.264  1.00 0.00 ? 44  PHE A O    1  
ATOM 665   C CB   . PHE A 1 44  ? -1.450  -5.337  0.365   1.00 0.00 ? 44  PHE A CB   1  
ATOM 666   C CG   . PHE A 1 44  ? -1.125  -4.162  1.242   1.00 0.00 ? 44  PHE A CG   1  
ATOM 667   C CD1  . PHE A 1 44  ? -1.529  -4.136  2.567   1.00 0.00 ? 44  PHE A CD1  1  
ATOM 668   C CD2  . PHE A 1 44  ? -0.415  -3.082  0.741   1.00 0.00 ? 44  PHE A CD2  1  
ATOM 669   C CE1  . PHE A 1 44  ? -1.232  -3.055  3.375   1.00 0.00 ? 44  PHE A CE1  1  
ATOM 670   C CE2  . PHE A 1 44  ? -0.115  -1.999  1.544   1.00 0.00 ? 44  PHE A CE2  1  
ATOM 671   C CZ   . PHE A 1 44  ? -0.523  -1.986  2.864   1.00 0.00 ? 44  PHE A CZ   1  
ATOM 672   H H    . PHE A 1 44  ? -2.558  -7.425  1.586   1.00 0.00 ? 44  PHE A H    1  
ATOM 673   H HA   . PHE A 1 44  ? -3.520  -4.842  0.586   1.00 0.00 ? 44  PHE A HA   1  
ATOM 674   H HB2  . PHE A 1 44  ? -0.862  -6.177  0.706   1.00 0.00 ? 44  PHE A HB2  1  
ATOM 675   H HB3  . PHE A 1 44  ? -1.163  -5.089  -0.645  1.00 0.00 ? 44  PHE A HB3  1  
ATOM 676   H HD1  . PHE A 1 44  ? -2.082  -4.972  2.969   1.00 0.00 ? 44  PHE A HD1  1  
ATOM 677   H HD2  . PHE A 1 44  ? -0.095  -3.092  -0.292  1.00 0.00 ? 44  PHE A HD2  1  
ATOM 678   H HE1  . PHE A 1 44  ? -1.552  -3.048  4.406   1.00 0.00 ? 44  PHE A HE1  1  
ATOM 679   H HE2  . PHE A 1 44  ? 0.439   -1.164  1.141   1.00 0.00 ? 44  PHE A HE2  1  
ATOM 680   H HZ   . PHE A 1 44  ? -0.291  -1.140  3.493   1.00 0.00 ? 44  PHE A HZ   1  
ATOM 681   N N    . VAL A 1 45  ? -3.937  -5.438  -1.805  1.00 0.00 ? 45  VAL A N    1  
ATOM 682   C CA   . VAL A 1 45  ? -4.376  -5.850  -3.133  1.00 0.00 ? 45  VAL A CA   1  
ATOM 683   C C    . VAL A 1 45  ? -4.129  -4.750  -4.159  1.00 0.00 ? 45  VAL A C    1  
ATOM 684   O O    . VAL A 1 45  ? -4.514  -3.598  -3.955  1.00 0.00 ? 45  VAL A O    1  
ATOM 685   C CB   . VAL A 1 45  ? -5.872  -6.217  -3.141  1.00 0.00 ? 45  VAL A CB   1  
ATOM 686   C CG1  . VAL A 1 45  ? -6.311  -6.638  -4.535  1.00 0.00 ? 45  VAL A CG1  1  
ATOM 687   C CG2  . VAL A 1 45  ? -6.155  -7.317  -2.129  1.00 0.00 ? 45  VAL A CG2  1  
ATOM 688   H H    . VAL A 1 45  ? -4.087  -4.513  -1.517  1.00 0.00 ? 45  VAL A H    1  
ATOM 689   H HA   . VAL A 1 45  ? -3.810  -6.726  -3.414  1.00 0.00 ? 45  VAL A HA   1  
ATOM 690   H HB   . VAL A 1 45  ? -6.438  -5.342  -2.858  1.00 0.00 ? 45  VAL A HB   1  
ATOM 691   H HG11 . VAL A 1 45  ? -5.909  -5.948  -5.262  1.00 0.00 ? 45  VAL A HG11 1  
ATOM 692   H HG12 . VAL A 1 45  ? -5.948  -7.634  -4.742  1.00 0.00 ? 45  VAL A HG12 1  
ATOM 693   H HG13 . VAL A 1 45  ? -7.390  -6.630  -4.590  1.00 0.00 ? 45  VAL A HG13 1  
ATOM 694   H HG21 . VAL A 1 45  ? -6.879  -8.006  -2.538  1.00 0.00 ? 45  VAL A HG21 1  
ATOM 695   H HG22 . VAL A 1 45  ? -5.240  -7.845  -1.906  1.00 0.00 ? 45  VAL A HG22 1  
ATOM 696   H HG23 . VAL A 1 45  ? -6.548  -6.880  -1.222  1.00 0.00 ? 45  VAL A HG23 1  
ATOM 697   N N    . LEU A 1 46  ? -3.484  -5.113  -5.262  1.00 0.00 ? 46  LEU A N    1  
ATOM 698   C CA   . LEU A 1 46  ? -3.185  -4.157  -6.323  1.00 0.00 ? 46  LEU A CA   1  
ATOM 699   C C    . LEU A 1 46  ? -4.129  -4.343  -7.506  1.00 0.00 ? 46  LEU A C    1  
ATOM 700   O O    . LEU A 1 46  ? -4.092  -5.367  -8.189  1.00 0.00 ? 46  LEU A O    1  
ATOM 701   C CB   . LEU A 1 46  ? -1.735  -4.313  -6.783  1.00 0.00 ? 46  LEU A CB   1  
ATOM 702   C CG   . LEU A 1 46  ? -1.218  -3.244  -7.747  1.00 0.00 ? 46  LEU A CG   1  
ATOM 703   C CD1  . LEU A 1 46  ? -0.958  -1.940  -7.008  1.00 0.00 ? 46  LEU A CD1  1  
ATOM 704   C CD2  . LEU A 1 46  ? 0.045   -3.723  -8.447  1.00 0.00 ? 46  LEU A CD2  1  
ATOM 705   H H    . LEU A 1 46  ? -3.202  -6.045  -5.368  1.00 0.00 ? 46  LEU A H    1  
ATOM 706   H HA   . LEU A 1 46  ? -3.322  -3.163  -5.921  1.00 0.00 ? 46  LEU A HA   1  
ATOM 707   H HB2  . LEU A 1 46  ? -1.106  -4.299  -5.906  1.00 0.00 ? 46  LEU A HB2  1  
ATOM 708   H HB3  . LEU A 1 46  ? -1.646  -5.272  -7.273  1.00 0.00 ? 46  LEU A HB3  1  
ATOM 709   H HG   . LEU A 1 46  ? -1.969  -3.055  -8.502  1.00 0.00 ? 46  LEU A HG   1  
ATOM 710   H HD11 . LEU A 1 46  ? -1.704  -1.807  -6.239  1.00 0.00 ? 46  LEU A HD11 1  
ATOM 711   H HD12 . LEU A 1 46  ? -1.007  -1.116  -7.704  1.00 0.00 ? 46  LEU A HD12 1  
ATOM 712   H HD13 . LEU A 1 46  ? 0.024   -1.972  -6.557  1.00 0.00 ? 46  LEU A HD13 1  
ATOM 713   H HD21 . LEU A 1 46  ? 0.594   -4.381  -7.789  1.00 0.00 ? 46  LEU A HD21 1  
ATOM 714   H HD22 . LEU A 1 46  ? 0.661   -2.873  -8.701  1.00 0.00 ? 46  LEU A HD22 1  
ATOM 715   H HD23 . LEU A 1 46  ? -0.223  -4.255  -9.348  1.00 0.00 ? 46  LEU A HD23 1  
ATOM 716   N N    . VAL A 1 47  ? -4.974  -3.345  -7.745  1.00 0.00 ? 47  VAL A N    1  
ATOM 717   C CA   . VAL A 1 47  ? -5.926  -3.397  -8.848  1.00 0.00 ? 47  VAL A CA   1  
ATOM 718   C C    . VAL A 1 47  ? -6.062  -2.036  -9.522  1.00 0.00 ? 47  VAL A C    1  
ATOM 719   O O    . VAL A 1 47  ? -6.118  -1.004  -8.853  1.00 0.00 ? 47  VAL A O    1  
ATOM 720   C CB   . VAL A 1 47  ? -7.315  -3.862  -8.370  1.00 0.00 ? 47  VAL A CB   1  
ATOM 721   C CG1  . VAL A 1 47  ? -8.370  -3.565  -9.425  1.00 0.00 ? 47  VAL A CG1  1  
ATOM 722   C CG2  . VAL A 1 47  ? -7.292  -5.344  -8.029  1.00 0.00 ? 47  VAL A CG2  1  
ATOM 723   H H    . VAL A 1 47  ? -4.957  -2.555  -7.166  1.00 0.00 ? 47  VAL A H    1  
ATOM 724   H HA   . VAL A 1 47  ? -5.560  -4.111  -9.572  1.00 0.00 ? 47  VAL A HA   1  
ATOM 725   H HB   . VAL A 1 47  ? -7.567  -3.312  -7.476  1.00 0.00 ? 47  VAL A HB   1  
ATOM 726   H HG11 . VAL A 1 47  ? -9.121  -4.341  -9.410  1.00 0.00 ? 47  VAL A HG11 1  
ATOM 727   H HG12 . VAL A 1 47  ? -8.831  -2.611  -9.215  1.00 0.00 ? 47  VAL A HG12 1  
ATOM 728   H HG13 . VAL A 1 47  ? -7.905  -3.533  -10.400 1.00 0.00 ? 47  VAL A HG13 1  
ATOM 729   H HG21 . VAL A 1 47  ? -6.271  -5.694  -8.010  1.00 0.00 ? 47  VAL A HG21 1  
ATOM 730   H HG22 . VAL A 1 47  ? -7.744  -5.497  -7.061  1.00 0.00 ? 47  VAL A HG22 1  
ATOM 731   H HG23 . VAL A 1 47  ? -7.847  -5.894  -8.776  1.00 0.00 ? 47  VAL A HG23 1  
ATOM 732   N N    . ASP A 1 48  ? -6.115  -2.042  -10.849 1.00 0.00 ? 48  ASP A N    1  
ATOM 733   C CA   . ASP A 1 48  ? -6.246  -0.808  -11.615 1.00 0.00 ? 48  ASP A CA   1  
ATOM 734   C C    . ASP A 1 48  ? -5.095  0.146   -11.308 1.00 0.00 ? 48  ASP A C    1  
ATOM 735   O O    . ASP A 1 48  ? -5.315  1.301   -10.941 1.00 0.00 ? 48  ASP A O    1  
ATOM 736   C CB   . ASP A 1 48  ? -7.582  -0.131  -11.307 1.00 0.00 ? 48  ASP A CB   1  
ATOM 737   C CG   . ASP A 1 48  ? -8.078  0.722   -12.458 1.00 0.00 ? 48  ASP A CG   1  
ATOM 738   O OD1  . ASP A 1 48  ? -8.472  0.147   -13.494 1.00 0.00 ? 48  ASP A OD1  1  
ATOM 739   O OD2  . ASP A 1 48  ? -8.072  1.963   -12.324 1.00 0.00 ? 48  ASP A OD2  1  
ATOM 740   H H    . ASP A 1 48  ? -6.066  -2.897  -11.326 1.00 0.00 ? 48  ASP A H    1  
ATOM 741   H HA   . ASP A 1 48  ? -6.215  -1.063  -12.663 1.00 0.00 ? 48  ASP A HA   1  
ATOM 742   H HB2  . ASP A 1 48  ? -8.323  -0.889  -11.099 1.00 0.00 ? 48  ASP A HB2  1  
ATOM 743   H HB3  . ASP A 1 48  ? -7.466  0.501   -10.438 1.00 0.00 ? 48  ASP A HB3  1  
ATOM 744   N N    . ARG A 1 49  ? -3.870  -0.344  -11.461 1.00 0.00 ? 49  ARG A N    1  
ATOM 745   C CA   . ARG A 1 49  ? -2.685  0.464   -11.198 1.00 0.00 ? 49  ARG A CA   1  
ATOM 746   C C    . ARG A 1 49  ? -2.827  1.226   -9.884  1.00 0.00 ? 49  ARG A C    1  
ATOM 747   O O    . ARG A 1 49  ? -2.262  2.307   -9.718  1.00 0.00 ? 49  ARG A O    1  
ATOM 748   C CB   . ARG A 1 49  ? -2.447  1.447   -12.346 1.00 0.00 ? 49  ARG A CB   1  
ATOM 749   C CG   . ARG A 1 49  ? -1.002  1.900   -12.470 1.00 0.00 ? 49  ARG A CG   1  
ATOM 750   C CD   . ARG A 1 49  ? -0.645  2.238   -13.909 1.00 0.00 ? 49  ARG A CD   1  
ATOM 751   N NE   . ARG A 1 49  ? -0.719  1.069   -14.780 1.00 0.00 ? 49  ARG A NE   1  
ATOM 752   C CZ   . ARG A 1 49  ? -0.180  1.021   -15.993 1.00 0.00 ? 49  ARG A CZ   1  
ATOM 753   N NH1  . ARG A 1 49  ? 0.470   2.071   -16.476 1.00 0.00 ? 49  ARG A NH1  1  
ATOM 754   N NH2  . ARG A 1 49  ? -0.289  -0.080  -16.726 1.00 0.00 ? 49  ARG A NH2  1  
ATOM 755   H H    . ARG A 1 49  ? -3.759  -1.272  -11.757 1.00 0.00 ? 49  ARG A H    1  
ATOM 756   H HA   . ARG A 1 49  ? -1.839  -0.202  -11.125 1.00 0.00 ? 49  ARG A HA   1  
ATOM 757   H HB2  . ARG A 1 49  ? -2.733  0.974   -13.275 1.00 0.00 ? 49  ARG A HB2  1  
ATOM 758   H HB3  . ARG A 1 49  ? -3.064  2.319   -12.191 1.00 0.00 ? 49  ARG A HB3  1  
ATOM 759   H HG2  . ARG A 1 49  ? -0.857  2.779   -11.859 1.00 0.00 ? 49  ARG A HG2  1  
ATOM 760   H HG3  . ARG A 1 49  ? -0.355  1.108   -12.124 1.00 0.00 ? 49  ARG A HG3  1  
ATOM 761   H HD2  . ARG A 1 49  ? -1.333  2.988   -14.270 1.00 0.00 ? 49  ARG A HD2  1  
ATOM 762   H HD3  . ARG A 1 49  ? 0.361   2.631   -13.933 1.00 0.00 ? 49  ARG A HD3  1  
ATOM 763   H HE   . ARG A 1 49  ? -1.194  0.281   -14.443 1.00 0.00 ? 49  ARG A HE   1  
ATOM 764   H HH11 . ARG A 1 49  ? 0.555   2.901   -15.925 1.00 0.00 ? 49  ARG A HH11 1  
ATOM 765   H HH12 . ARG A 1 49  ? 0.876   2.032   -17.389 1.00 0.00 ? 49  ARG A HH12 1  
ATOM 766   H HH21 . ARG A 1 49  ? -0.778  -0.874  -16.366 1.00 0.00 ? 49  ARG A HH21 1  
ATOM 767   H HH22 . ARG A 1 49  ? 0.117   -0.115  -17.639 1.00 0.00 ? 49  ARG A HH22 1  
ATOM 768   N N    . CYS A 1 50  ? -3.585  0.655   -8.954  1.00 0.00 ? 50  CYS A N    1  
ATOM 769   C CA   . CYS A 1 50  ? -3.803  1.280   -7.655  1.00 0.00 ? 50  CYS A CA   1  
ATOM 770   C C    . CYS A 1 50  ? -3.693  0.254   -6.532  1.00 0.00 ? 50  CYS A C    1  
ATOM 771   O O    . CYS A 1 50  ? -3.903  -0.941  -6.745  1.00 0.00 ? 50  CYS A O    1  
ATOM 772   C CB   . CYS A 1 50  ? -5.175  1.954   -7.613  1.00 0.00 ? 50  CYS A CB   1  
ATOM 773   S SG   . CYS A 1 50  ? -5.330  3.381   -8.714  1.00 0.00 ? 50  CYS A SG   1  
ATOM 774   H H    . CYS A 1 50  ? -4.009  -0.208  -9.146  1.00 0.00 ? 50  CYS A H    1  
ATOM 775   H HA   . CYS A 1 50  ? -3.038  2.030   -7.517  1.00 0.00 ? 50  CYS A HA   1  
ATOM 776   H HB2  . CYS A 1 50  ? -5.929  1.236   -7.900  1.00 0.00 ? 50  CYS A HB2  1  
ATOM 777   H HB3  . CYS A 1 50  ? -5.372  2.291   -6.606  1.00 0.00 ? 50  CYS A HB3  1  
ATOM 778   H HG   . CYS A 1 50  ? -6.595  3.772   -8.699  1.00 0.00 ? 50  CYS A HG   1  
ATOM 779   N N    . LEU A 1 51  ? -3.360  0.727   -5.336  1.00 0.00 ? 51  LEU A N    1  
ATOM 780   C CA   . LEU A 1 51  ? -3.220  -0.150  -4.178  1.00 0.00 ? 51  LEU A CA   1  
ATOM 781   C C    . LEU A 1 51  ? -4.457  -0.080  -3.289  1.00 0.00 ? 51  LEU A C    1  
ATOM 782   O O    . LEU A 1 51  ? -5.003  0.998   -3.051  1.00 0.00 ? 51  LEU A O    1  
ATOM 783   C CB   . LEU A 1 51  ? -1.977  0.231   -3.373  1.00 0.00 ? 51  LEU A CB   1  
ATOM 784   C CG   . LEU A 1 51  ? -1.317  -0.899  -2.582  1.00 0.00 ? 51  LEU A CG   1  
ATOM 785   C CD1  . LEU A 1 51  ? 0.150   -0.588  -2.329  1.00 0.00 ? 51  LEU A CD1  1  
ATOM 786   C CD2  . LEU A 1 51  ? -2.049  -1.128  -1.268  1.00 0.00 ? 51  LEU A CD2  1  
ATOM 787   H H    . LEU A 1 51  ? -3.205  1.688   -5.227  1.00 0.00 ? 51  LEU A H    1  
ATOM 788   H HA   . LEU A 1 51  ? -3.108  -1.161  -4.540  1.00 0.00 ? 51  LEU A HA   1  
ATOM 789   H HB2  . LEU A 1 51  ? -1.244  0.624   -4.061  1.00 0.00 ? 51  LEU A HB2  1  
ATOM 790   H HB3  . LEU A 1 51  ? -2.261  1.004   -2.673  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 791   H HG   . LEU A 1 51  ? -1.369  -1.812  -3.159  1.00 0.00 ? 51  LEU A HG   1  
ATOM 792   H HD11 . LEU A 1 51  ? 0.272   -0.221  -1.322  1.00 0.00 ? 51  LEU A HD11 1  
ATOM 793   H HD12 . LEU A 1 51  ? 0.484   0.164   -3.029  1.00 0.00 ? 51  LEU A HD12 1  
ATOM 794   H HD13 . LEU A 1 51  ? 0.736   -1.486  -2.459  1.00 0.00 ? 51  LEU A HD13 1  
ATOM 795   H HD21 . LEU A 1 51  ? -2.420  -2.142  -1.235  1.00 0.00 ? 51  LEU A HD21 1  
ATOM 796   H HD22 . LEU A 1 51  ? -2.877  -0.439  -1.192  1.00 0.00 ? 51  LEU A HD22 1  
ATOM 797   H HD23 . LEU A 1 51  ? -1.369  -0.966  -0.444  1.00 0.00 ? 51  LEU A HD23 1  
ATOM 798   N N    . PHE A 1 52  ? -4.894  -1.235  -2.799  1.00 0.00 ? 52  PHE A N    1  
ATOM 799   C CA   . PHE A 1 52  ? -6.066  -1.305  -1.935  1.00 0.00 ? 52  PHE A CA   1  
ATOM 800   C C    . PHE A 1 52  ? -5.849  -2.306  -0.804  1.00 0.00 ? 52  PHE A C    1  
ATOM 801   O O    . PHE A 1 52  ? -5.627  -3.493  -1.045  1.00 0.00 ? 52  PHE A O    1  
ATOM 802   C CB   . PHE A 1 52  ? -7.303  -1.696  -2.747  1.00 0.00 ? 52  PHE A CB   1  
ATOM 803   C CG   . PHE A 1 52  ? -7.521  -0.834  -3.958  1.00 0.00 ? 52  PHE A CG   1  
ATOM 804   C CD1  . PHE A 1 52  ? -7.622  0.542   -3.836  1.00 0.00 ? 52  PHE A CD1  1  
ATOM 805   C CD2  . PHE A 1 52  ? -7.626  -1.401  -5.218  1.00 0.00 ? 52  PHE A CD2  1  
ATOM 806   C CE1  . PHE A 1 52  ? -7.823  1.338   -4.948  1.00 0.00 ? 52  PHE A CE1  1  
ATOM 807   C CE2  . PHE A 1 52  ? -7.827  -0.611  -6.334  1.00 0.00 ? 52  PHE A CE2  1  
ATOM 808   C CZ   . PHE A 1 52  ? -7.927  0.760   -6.199  1.00 0.00 ? 52  PHE A CZ   1  
ATOM 809   H H    . PHE A 1 52  ? -4.416  -2.061  -3.025  1.00 0.00 ? 52  PHE A H    1  
ATOM 810   H HA   . PHE A 1 52  ? -6.221  -0.326  -1.508  1.00 0.00 ? 52  PHE A HA   1  
ATOM 811   H HB2  . PHE A 1 52  ? -7.196  -2.717  -3.082  1.00 0.00 ? 52  PHE A HB2  1  
ATOM 812   H HB3  . PHE A 1 52  ? -8.177  -1.616  -2.119  1.00 0.00 ? 52  PHE A HB3  1  
ATOM 813   H HD1  . PHE A 1 52  ? -7.542  0.995   -2.858  1.00 0.00 ? 52  PHE A HD1  1  
ATOM 814   H HD2  . PHE A 1 52  ? -7.550  -2.473  -5.325  1.00 0.00 ? 52  PHE A HD2  1  
ATOM 815   H HE1  . PHE A 1 52  ? -7.901  2.409   -4.839  1.00 0.00 ? 52  PHE A HE1  1  
ATOM 816   H HE2  . PHE A 1 52  ? -7.908  -1.064  -7.310  1.00 0.00 ? 52  PHE A HE2  1  
ATOM 817   H HZ   . PHE A 1 52  ? -8.083  1.380   -7.069  1.00 0.00 ? 52  PHE A HZ   1  
ATOM 818   N N    . TYR A 1 53  ? -5.915  -1.819  0.430   1.00 0.00 ? 53  TYR A N    1  
ATOM 819   C CA   . TYR A 1 53  ? -5.722  -2.669  1.599   1.00 0.00 ? 53  TYR A CA   1  
ATOM 820   C C    . TYR A 1 53  ? -7.043  -2.901  2.327   1.00 0.00 ? 53  TYR A C    1  
ATOM 821   O O    . TYR A 1 53  ? -7.774  -1.956  2.626   1.00 0.00 ? 53  TYR A O    1  
ATOM 822   C CB   . TYR A 1 53  ? -4.705  -2.040  2.552   1.00 0.00 ? 53  TYR A CB   1  
ATOM 823   C CG   . TYR A 1 53  ? -5.197  -0.771  3.211   1.00 0.00 ? 53  TYR A CG   1  
ATOM 824   C CD1  . TYR A 1 53  ? -5.899  -0.815  4.409   1.00 0.00 ? 53  TYR A CD1  1  
ATOM 825   C CD2  . TYR A 1 53  ? -4.961  0.471   2.635   1.00 0.00 ? 53  TYR A CD2  1  
ATOM 826   C CE1  . TYR A 1 53  ? -6.351  0.341   5.015   1.00 0.00 ? 53  TYR A CE1  1  
ATOM 827   C CE2  . TYR A 1 53  ? -5.408  1.633   3.234   1.00 0.00 ? 53  TYR A CE2  1  
ATOM 828   C CZ   . TYR A 1 53  ? -6.102  1.563   4.424   1.00 0.00 ? 53  TYR A CZ   1  
ATOM 829   O OH   . TYR A 1 53  ? -6.551  2.717   5.023   1.00 0.00 ? 53  TYR A OH   1  
ATOM 830   H H    . TYR A 1 53  ? -6.095  -0.864  0.558   1.00 0.00 ? 53  TYR A H    1  
ATOM 831   H HA   . TYR A 1 53  ? -5.341  -3.621  1.258   1.00 0.00 ? 53  TYR A HA   1  
ATOM 832   H HB2  . TYR A 1 53  ? -4.467  -2.747  3.331   1.00 0.00 ? 53  TYR A HB2  1  
ATOM 833   H HB3  . TYR A 1 53  ? -3.806  -1.801  2.002   1.00 0.00 ? 53  TYR A HB3  1  
ATOM 834   H HD1  . TYR A 1 53  ? -6.092  -1.773  4.870   1.00 0.00 ? 53  TYR A HD1  1  
ATOM 835   H HD2  . TYR A 1 53  ? -4.417  0.522   1.703   1.00 0.00 ? 53  TYR A HD2  1  
ATOM 836   H HE1  . TYR A 1 53  ? -6.895  0.287   5.947   1.00 0.00 ? 53  TYR A HE1  1  
ATOM 837   H HE2  . TYR A 1 53  ? -5.214  2.589   2.772   1.00 0.00 ? 53  TYR A HE2  1  
ATOM 838   H HH   . TYR A 1 53  ? -7.509  2.698   5.078   1.00 0.00 ? 53  TYR A HH   1  
ATOM 839   N N    . TYR A 1 54  ? -7.341  -4.164  2.610   1.00 0.00 ? 54  TYR A N    1  
ATOM 840   C CA   . TYR A 1 54  ? -8.574  -4.521  3.302   1.00 0.00 ? 54  TYR A CA   1  
ATOM 841   C C    . TYR A 1 54  ? -8.277  -5.084  4.689   1.00 0.00 ? 54  TYR A C    1  
ATOM 842   O O    . TYR A 1 54  ? -7.201  -5.631  4.933   1.00 0.00 ? 54  TYR A O    1  
ATOM 843   C CB   . TYR A 1 54  ? -9.365  -5.543  2.484   1.00 0.00 ? 54  TYR A CB   1  
ATOM 844   C CG   . TYR A 1 54  ? -9.790  -5.032  1.125   1.00 0.00 ? 54  TYR A CG   1  
ATOM 845   C CD1  . TYR A 1 54  ? -8.953  -5.154  0.023   1.00 0.00 ? 54  TYR A CD1  1  
ATOM 846   C CD2  . TYR A 1 54  ? -11.027 -4.428  0.945   1.00 0.00 ? 54  TYR A CD2  1  
ATOM 847   C CE1  . TYR A 1 54  ? -9.336  -4.688  -1.220  1.00 0.00 ? 54  TYR A CE1  1  
ATOM 848   C CE2  . TYR A 1 54  ? -11.420 -3.961  -0.295  1.00 0.00 ? 54  TYR A CE2  1  
ATOM 849   C CZ   . TYR A 1 54  ? -10.571 -4.093  -1.374  1.00 0.00 ? 54  TYR A CZ   1  
ATOM 850   O OH   . TYR A 1 54  ? -10.958 -3.628  -2.610  1.00 0.00 ? 54  TYR A OH   1  
ATOM 851   H H    . TYR A 1 54  ? -6.718  -4.873  2.347   1.00 0.00 ? 54  TYR A H    1  
ATOM 852   H HA   . TYR A 1 54  ? -9.166  -3.624  3.409   1.00 0.00 ? 54  TYR A HA   1  
ATOM 853   H HB2  . TYR A 1 54  ? -8.756  -6.421  2.332   1.00 0.00 ? 54  TYR A HB2  1  
ATOM 854   H HB3  . TYR A 1 54  ? -10.256 -5.818  3.029   1.00 0.00 ? 54  TYR A HB3  1  
ATOM 855   H HD1  . TYR A 1 54  ? -7.986  -5.621  0.147   1.00 0.00 ? 54  TYR A HD1  1  
ATOM 856   H HD2  . TYR A 1 54  ? -11.690 -4.326  1.792   1.00 0.00 ? 54  TYR A HD2  1  
ATOM 857   H HE1  . TYR A 1 54  ? -8.672  -4.792  -2.065  1.00 0.00 ? 54  TYR A HE1  1  
ATOM 858   H HE2  . TYR A 1 54  ? -12.387 -3.494  -0.415  1.00 0.00 ? 54  TYR A HE2  1  
ATOM 859   H HH   . TYR A 1 54  ? -11.237 -4.366  -3.156  1.00 0.00 ? 54  TYR A HH   1  
ATOM 860   N N    . LYS A 1 55  ? -9.239  -4.945  5.595   1.00 0.00 ? 55  LYS A N    1  
ATOM 861   C CA   . LYS A 1 55  ? -9.084  -5.440  6.957   1.00 0.00 ? 55  LYS A CA   1  
ATOM 862   C C    . LYS A 1 55  ? -8.723  -6.923  6.960   1.00 0.00 ? 55  LYS A C    1  
ATOM 863   O O    . LYS A 1 55  ? -8.004  -7.394  7.841   1.00 0.00 ? 55  LYS A O    1  
ATOM 864   C CB   . LYS A 1 55  ? -10.373 -5.217  7.753   1.00 0.00 ? 55  LYS A CB   1  
ATOM 865   C CG   . LYS A 1 55  ? -11.586 -5.905  7.151   1.00 0.00 ? 55  LYS A CG   1  
ATOM 866   C CD   . LYS A 1 55  ? -12.659 -6.158  8.196   1.00 0.00 ? 55  LYS A CD   1  
ATOM 867   C CE   . LYS A 1 55  ? -14.034 -6.299  7.561   1.00 0.00 ? 55  LYS A CE   1  
ATOM 868   N NZ   . LYS A 1 55  ? -14.564 -4.991  7.088   1.00 0.00 ? 55  LYS A NZ   1  
ATOM 869   H H    . LYS A 1 55  ? -10.074 -4.500  5.340   1.00 0.00 ? 55  LYS A H    1  
ATOM 870   H HA   . LYS A 1 55  ? -8.283  -4.886  7.423   1.00 0.00 ? 55  LYS A HA   1  
ATOM 871   H HB2  . LYS A 1 55  ? -10.232 -5.592  8.755   1.00 0.00 ? 55  LYS A HB2  1  
ATOM 872   H HB3  . LYS A 1 55  ? -10.573 -4.156  7.799   1.00 0.00 ? 55  LYS A HB3  1  
ATOM 873   H HG2  . LYS A 1 55  ? -11.996 -5.277  6.374   1.00 0.00 ? 55  LYS A HG2  1  
ATOM 874   H HG3  . LYS A 1 55  ? -11.279 -6.850  6.727   1.00 0.00 ? 55  LYS A HG3  1  
ATOM 875   H HD2  . LYS A 1 55  ? -12.425 -7.069  8.727   1.00 0.00 ? 55  LYS A HD2  1  
ATOM 876   H HD3  . LYS A 1 55  ? -12.676 -5.329  8.890   1.00 0.00 ? 55  LYS A HD3  1  
ATOM 877   H HE2  . LYS A 1 55  ? -13.960 -6.973  6.721   1.00 0.00 ? 55  LYS A HE2  1  
ATOM 878   H HE3  . LYS A 1 55  ? -14.713 -6.710  8.293   1.00 0.00 ? 55  LYS A HE3  1  
ATOM 879   H HZ1  . LYS A 1 55  ? -14.821 -5.051  6.083   1.00 0.00 ? 55  LYS A HZ1  1  
ATOM 880   H HZ2  . LYS A 1 55  ? -13.843 -4.250  7.206   1.00 0.00 ? 55  LYS A HZ2  1  
ATOM 881   H HZ3  . LYS A 1 55  ? -15.407 -4.728  7.636   1.00 0.00 ? 55  LYS A HZ3  1  
ATOM 882   N N    . ASP A 1 56  ? -9.226  -7.651  5.969   1.00 0.00 ? 56  ASP A N    1  
ATOM 883   C CA   . ASP A 1 56  ? -8.954  -9.079  5.856   1.00 0.00 ? 56  ASP A CA   1  
ATOM 884   C C    . ASP A 1 56  ? -9.060  -9.539  4.406   1.00 0.00 ? 56  ASP A C    1  
ATOM 885   O O    . ASP A 1 56  ? -9.402  -8.756  3.520   1.00 0.00 ? 56  ASP A O    1  
ATOM 886   C CB   . ASP A 1 56  ? -9.925  -9.875  6.729   1.00 0.00 ? 56  ASP A CB   1  
ATOM 887   C CG   . ASP A 1 56  ? -9.756  -9.575  8.206   1.00 0.00 ? 56  ASP A CG   1  
ATOM 888   O OD1  . ASP A 1 56  ? -8.639  -9.776  8.728   1.00 0.00 ? 56  ASP A OD1  1  
ATOM 889   O OD2  . ASP A 1 56  ? -10.740 -9.139  8.839   1.00 0.00 ? 56  ASP A OD2  1  
ATOM 890   H H    . ASP A 1 56  ? -9.792  -7.217  5.297   1.00 0.00 ? 56  ASP A H    1  
ATOM 891   H HA   . ASP A 1 56  ? -7.947  -9.254  6.203   1.00 0.00 ? 56  ASP A HA   1  
ATOM 892   H HB2  . ASP A 1 56  ? -10.938 -9.630  6.445   1.00 0.00 ? 56  ASP A HB2  1  
ATOM 893   H HB3  . ASP A 1 56  ? -9.757  -10.931 6.573   1.00 0.00 ? 56  ASP A HB3  1  
ATOM 894   N N    . GLU A 1 57  ? -8.764  -10.814 4.171   1.00 0.00 ? 57  GLU A N    1  
ATOM 895   C CA   . GLU A 1 57  ? -8.824  -11.377 2.827   1.00 0.00 ? 57  GLU A CA   1  
ATOM 896   C C    . GLU A 1 57  ? -10.251 -11.340 2.286   1.00 0.00 ? 57  GLU A C    1  
ATOM 897   O O    . GLU A 1 57  ? -10.480 -11.545 1.094   1.00 0.00 ? 57  GLU A O    1  
ATOM 898   C CB   . GLU A 1 57  ? -8.305  -12.816 2.829   1.00 0.00 ? 57  GLU A CB   1  
ATOM 899   C CG   . GLU A 1 57  ? -9.107  -13.751 3.718   1.00 0.00 ? 57  GLU A CG   1  
ATOM 900   C CD   . GLU A 1 57  ? -10.361 -14.269 3.040   1.00 0.00 ? 57  GLU A CD   1  
ATOM 901   O OE1  . GLU A 1 57  ? -10.306 -14.549 1.824   1.00 0.00 ? 57  GLU A OE1  1  
ATOM 902   O OE2  . GLU A 1 57  ? -11.397 -14.393 3.725   1.00 0.00 ? 57  GLU A OE2  1  
ATOM 903   H H    . GLU A 1 57  ? -8.498  -11.388 4.919   1.00 0.00 ? 57  GLU A H    1  
ATOM 904   H HA   . GLU A 1 57  ? -8.194  -10.777 2.188   1.00 0.00 ? 57  GLU A HA   1  
ATOM 905   H HB2  . GLU A 1 57  ? -8.335  -13.198 1.820   1.00 0.00 ? 57  GLU A HB2  1  
ATOM 906   H HB3  . GLU A 1 57  ? -7.282  -12.816 3.174   1.00 0.00 ? 57  GLU A HB3  1  
ATOM 907   H HG2  . GLU A 1 57  ? -8.487  -14.594 3.985   1.00 0.00 ? 57  GLU A HG2  1  
ATOM 908   H HG3  . GLU A 1 57  ? -9.394  -13.219 4.613   1.00 0.00 ? 57  GLU A HG3  1  
ATOM 909   N N    . LYS A 1 58  ? -11.206 -11.077 3.171   1.00 0.00 ? 58  LYS A N    1  
ATOM 910   C CA   . LYS A 1 58  ? -12.611 -11.012 2.784   1.00 0.00 ? 58  LYS A CA   1  
ATOM 911   C C    . LYS A 1 58  ? -12.837 -9.925  1.739   1.00 0.00 ? 58  LYS A C    1  
ATOM 912   O O    . LYS A 1 58  ? -13.666 -10.077 0.842   1.00 0.00 ? 58  LYS A O    1  
ATOM 913   C CB   . LYS A 1 58  ? -13.487 -10.746 4.010   1.00 0.00 ? 58  LYS A CB   1  
ATOM 914   C CG   . LYS A 1 58  ? -13.484 -11.883 5.018   1.00 0.00 ? 58  LYS A CG   1  
ATOM 915   C CD   . LYS A 1 58  ? -14.576 -11.707 6.060   1.00 0.00 ? 58  LYS A CD   1  
ATOM 916   C CE   . LYS A 1 58  ? -15.890 -12.319 5.600   1.00 0.00 ? 58  LYS A CE   1  
ATOM 917   N NZ   . LYS A 1 58  ? -15.952 -13.779 5.887   1.00 0.00 ? 58  LYS A NZ   1  
ATOM 918   H H    . LYS A 1 58  ? -10.961 -10.922 4.107   1.00 0.00 ? 58  LYS A H    1  
ATOM 919   H HA   . LYS A 1 58  ? -12.882 -11.966 2.358   1.00 0.00 ? 58  LYS A HA   1  
ATOM 920   H HB2  . LYS A 1 58  ? -13.132 -9.854  4.504   1.00 0.00 ? 58  LYS A HB2  1  
ATOM 921   H HB3  . LYS A 1 58  ? -14.504 -10.586 3.683   1.00 0.00 ? 58  LYS A HB3  1  
ATOM 922   H HG2  . LYS A 1 58  ? -13.646 -12.815 4.497   1.00 0.00 ? 58  LYS A HG2  1  
ATOM 923   H HG3  . LYS A 1 58  ? -12.525 -11.909 5.515   1.00 0.00 ? 58  LYS A HG3  1  
ATOM 924   H HD2  . LYS A 1 58  ? -14.268 -12.189 6.976   1.00 0.00 ? 58  LYS A HD2  1  
ATOM 925   H HD3  . LYS A 1 58  ? -14.724 -10.651 6.239   1.00 0.00 ? 58  LYS A HD3  1  
ATOM 926   H HE2  . LYS A 1 58  ? -16.701 -11.826 6.113   1.00 0.00 ? 58  LYS A HE2  1  
ATOM 927   H HE3  . LYS A 1 58  ? -15.990 -12.166 4.536   1.00 0.00 ? 58  LYS A HE3  1  
ATOM 928   H HZ1  . LYS A 1 58  ? -15.628 -14.320 5.060   1.00 0.00 ? 58  LYS A HZ1  1  
ATOM 929   H HZ2  . LYS A 1 58  ? -16.929 -14.058 6.110   1.00 0.00 ? 58  LYS A HZ2  1  
ATOM 930   H HZ3  . LYS A 1 58  ? -15.344 -14.010 6.699   1.00 0.00 ? 58  LYS A HZ3  1  
ATOM 931   N N    . GLU A 1 59  ? -12.095 -8.829  1.860   1.00 0.00 ? 59  GLU A N    1  
ATOM 932   C CA   . GLU A 1 59  ? -12.215 -7.717  0.924   1.00 0.00 ? 59  GLU A CA   1  
ATOM 933   C C    . GLU A 1 59  ? -13.639 -7.169  0.912   1.00 0.00 ? 59  GLU A C    1  
ATOM 934   O O    . GLU A 1 59  ? -14.203 -6.902  -0.149  1.00 0.00 ? 59  GLU A O    1  
ATOM 935   C CB   . GLU A 1 59  ? -11.816 -8.162  -0.484  1.00 0.00 ? 59  GLU A CB   1  
ATOM 936   C CG   . GLU A 1 59  ? -10.351 -8.545  -0.609  1.00 0.00 ? 59  GLU A CG   1  
ATOM 937   C CD   . GLU A 1 59  ? -10.112 -9.594  -1.678  1.00 0.00 ? 59  GLU A CD   1  
ATOM 938   O OE1  . GLU A 1 59  ? -10.793 -10.640 -1.645  1.00 0.00 ? 59  GLU A OE1  1  
ATOM 939   O OE2  . GLU A 1 59  ? -9.244  -9.369  -2.547  1.00 0.00 ? 59  GLU A OE2  1  
ATOM 940   H H    . GLU A 1 59  ? -11.451 -8.767  2.596   1.00 0.00 ? 59  GLU A H    1  
ATOM 941   H HA   . GLU A 1 59  ? -11.545 -6.936  1.249   1.00 0.00 ? 59  GLU A HA   1  
ATOM 942   H HB2  . GLU A 1 59  ? -12.416 -9.016  -0.763  1.00 0.00 ? 59  GLU A HB2  1  
ATOM 943   H HB3  . GLU A 1 59  ? -12.015 -7.354  -1.173  1.00 0.00 ? 59  GLU A HB3  1  
ATOM 944   H HG2  . GLU A 1 59  ? -9.782  -7.663  -0.859  1.00 0.00 ? 59  GLU A HG2  1  
ATOM 945   H HG3  . GLU A 1 59  ? -10.012 -8.935  0.339   1.00 0.00 ? 59  GLU A HG3  1  
ATOM 946   N N    . GLU A 1 60  ? -14.214 -7.004  2.100   1.00 0.00 ? 60  GLU A N    1  
ATOM 947   C CA   . GLU A 1 60  ? -15.572 -6.489  2.225   1.00 0.00 ? 60  GLU A CA   1  
ATOM 948   C C    . GLU A 1 60  ? -15.693 -5.109  1.584   1.00 0.00 ? 60  GLU A C    1  
ATOM 949   O O    . GLU A 1 60  ? -16.491 -4.905  0.670   1.00 0.00 ? 60  GLU A O    1  
ATOM 950   C CB   . GLU A 1 60  ? -15.980 -6.416  3.698   1.00 0.00 ? 60  GLU A CB   1  
ATOM 951   C CG   . GLU A 1 60  ? -16.299 -7.770  4.309   1.00 0.00 ? 60  GLU A CG   1  
ATOM 952   C CD   . GLU A 1 60  ? -17.680 -8.270  3.932   1.00 0.00 ? 60  GLU A CD   1  
ATOM 953   O OE1  . GLU A 1 60  ? -18.053 -8.145  2.747   1.00 0.00 ? 60  GLU A OE1  1  
ATOM 954   O OE2  . GLU A 1 60  ? -18.387 -8.785  4.822   1.00 0.00 ? 60  GLU A OE2  1  
ATOM 955   H H    . GLU A 1 60  ? -13.713 -7.235  2.910   1.00 0.00 ? 60  GLU A H    1  
ATOM 956   H HA   . GLU A 1 60  ? -16.234 -7.170  1.712   1.00 0.00 ? 60  GLU A HA   1  
ATOM 957   H HB2  . GLU A 1 60  ? -15.172 -5.971  4.261   1.00 0.00 ? 60  GLU A HB2  1  
ATOM 958   H HB3  . GLU A 1 60  ? -16.855 -5.790  3.786   1.00 0.00 ? 60  GLU A HB3  1  
ATOM 959   H HG2  . GLU A 1 60  ? -15.568 -8.487  3.967   1.00 0.00 ? 60  GLU A HG2  1  
ATOM 960   H HG3  . GLU A 1 60  ? -16.244 -7.687  5.385   1.00 0.00 ? 60  GLU A HG3  1  
ATOM 961   N N    . SER A 1 61  ? -14.893 -4.165  2.071   1.00 0.00 ? 61  SER A N    1  
ATOM 962   C CA   . SER A 1 61  ? -14.913 -2.804  1.549   1.00 0.00 ? 61  SER A CA   1  
ATOM 963   C C    . SER A 1 61  ? -13.535 -2.159  1.663   1.00 0.00 ? 61  SER A C    1  
ATOM 964   O O    . SER A 1 61  ? -12.813 -2.379  2.636   1.00 0.00 ? 61  SER A O    1  
ATOM 965   C CB   . SER A 1 61  ? -15.946 -1.962  2.300   1.00 0.00 ? 61  SER A CB   1  
ATOM 966   O OG   . SER A 1 61  ? -17.225 -2.068  1.699   1.00 0.00 ? 61  SER A OG   1  
ATOM 967   H H    . SER A 1 61  ? -14.278 -4.390  2.800   1.00 0.00 ? 61  SER A H    1  
ATOM 968   H HA   . SER A 1 61  ? -15.189 -2.852  0.506   1.00 0.00 ? 61  SER A HA   1  
ATOM 969   H HB2  . SER A 1 61  ? -16.012 -2.305  3.321   1.00 0.00 ? 61  SER A HB2  1  
ATOM 970   H HB3  . SER A 1 61  ? -15.640 -0.926  2.287   1.00 0.00 ? 61  SER A HB3  1  
ATOM 971   H HG   . SER A 1 61  ? -17.539 -2.972  1.773   1.00 0.00 ? 61  SER A HG   1  
ATOM 972   N N    . ILE A 1 62  ? -13.177 -1.362  0.662   1.00 0.00 ? 62  ILE A N    1  
ATOM 973   C CA   . ILE A 1 62  ? -11.886 -0.684  0.650   1.00 0.00 ? 62  ILE A CA   1  
ATOM 974   C C    . ILE A 1 62  ? -11.793 0.340   1.776   1.00 0.00 ? 62  ILE A C    1  
ATOM 975   O O    . ILE A 1 62  ? -12.573 1.291   1.832   1.00 0.00 ? 62  ILE A O    1  
ATOM 976   C CB   . ILE A 1 62  ? -11.635 0.024   -0.694  1.00 0.00 ? 62  ILE A CB   1  
ATOM 977   C CG1  . ILE A 1 62  ? -11.572 -0.998  -1.831  1.00 0.00 ? 62  ILE A CG1  1  
ATOM 978   C CG2  . ILE A 1 62  ? -10.350 0.836   -0.633  1.00 0.00 ? 62  ILE A CG2  1  
ATOM 979   C CD1  . ILE A 1 62  ? -11.637 -0.376  -3.208  1.00 0.00 ? 62  ILE A CD1  1  
ATOM 980   H H    . ILE A 1 62  ? -13.795 -1.226  -0.085  1.00 0.00 ? 62  ILE A H    1  
ATOM 981   H HA   . ILE A 1 62  ? -11.117 -1.430  0.790   1.00 0.00 ? 62  ILE A HA   1  
ATOM 982   H HB   . ILE A 1 62  ? -12.454 0.704   -0.876  1.00 0.00 ? 62  ILE A HB   1  
ATOM 983   H HG12 . ILE A 1 62  ? -10.648 -1.550  -1.760  1.00 0.00 ? 62  ILE A HG12 1  
ATOM 984   H HG13 . ILE A 1 62  ? -12.403 -1.683  -1.735  1.00 0.00 ? 62  ILE A HG13 1  
ATOM 985   H HG21 . ILE A 1 62  ? -10.267 1.445   -1.522  1.00 0.00 ? 62  ILE A HG21 1  
ATOM 986   H HG22 . ILE A 1 62  ? -10.369 1.474   0.238   1.00 0.00 ? 62  ILE A HG22 1  
ATOM 987   H HG23 . ILE A 1 62  ? -9.504  0.168   -0.573  1.00 0.00 ? 62  ILE A HG23 1  
ATOM 988   H HD11 . ILE A 1 62  ? -11.798 -1.150  -3.945  1.00 0.00 ? 62  ILE A HD11 1  
ATOM 989   H HD12 . ILE A 1 62  ? -12.453 0.330   -3.246  1.00 0.00 ? 62  ILE A HD12 1  
ATOM 990   H HD13 . ILE A 1 62  ? -10.709 0.132   -3.418  1.00 0.00 ? 62  ILE A HD13 1  
ATOM 991   N N    . LEU A 1 63  ? -10.832 0.139   2.672   1.00 0.00 ? 63  LEU A N    1  
ATOM 992   C CA   . LEU A 1 63  ? -10.634 1.046   3.797   1.00 0.00 ? 63  LEU A CA   1  
ATOM 993   C C    . LEU A 1 63  ? -9.869  2.293   3.364   1.00 0.00 ? 63  LEU A C    1  
ATOM 994   O O    . LEU A 1 63  ? -10.224 3.411   3.733   1.00 0.00 ? 63  LEU A O    1  
ATOM 995   C CB   . LEU A 1 63  ? -9.879  0.336   4.922   1.00 0.00 ? 63  LEU A CB   1  
ATOM 996   C CG   . LEU A 1 63  ? -10.406 -1.043  5.319   1.00 0.00 ? 63  LEU A CG   1  
ATOM 997   C CD1  . LEU A 1 63  ? -9.476  -1.701  6.326   1.00 0.00 ? 63  LEU A CD1  1  
ATOM 998   C CD2  . LEU A 1 63  ? -11.815 -0.933  5.883   1.00 0.00 ? 63  LEU A CD2  1  
ATOM 999   H H    . LEU A 1 63  ? -10.241 -0.636  2.574   1.00 0.00 ? 63  LEU A H    1  
ATOM 1000  H HA   . LEU A 1 63  ? -11.607 1.343   4.159   1.00 0.00 ? 63  LEU A HA   1  
ATOM 1001  H HB2  . LEU A 1 63  ? -8.852  0.220   4.610   1.00 0.00 ? 63  LEU A HB2  1  
ATOM 1002  H HB3  . LEU A 1 63  ? -9.917  0.971   5.797   1.00 0.00 ? 63  LEU A HB3  1  
ATOM 1003  H HG   . LEU A 1 63  ? -10.445 -1.673  4.440   1.00 0.00 ? 63  LEU A HG   1  
ATOM 1004  H HD11 . LEU A 1 63  ? -8.772  -2.333  5.807   1.00 0.00 ? 63  LEU A HD11 1  
ATOM 1005  H HD12 . LEU A 1 63  ? -10.056 -2.297  7.015   1.00 0.00 ? 63  LEU A HD12 1  
ATOM 1006  H HD13 . LEU A 1 63  ? -8.941  -0.938  6.873   1.00 0.00 ? 63  LEU A HD13 1  
ATOM 1007  H HD21 . LEU A 1 63  ? -12.040 -1.815  6.464   1.00 0.00 ? 63  LEU A HD21 1  
ATOM 1008  H HD22 . LEU A 1 63  ? -12.522 -0.846  5.071   1.00 0.00 ? 63  LEU A HD22 1  
ATOM 1009  H HD23 . LEU A 1 63  ? -11.883 -0.059  6.514   1.00 0.00 ? 63  LEU A HD23 1  
ATOM 1010  N N    . GLY A 1 64  ? -8.817  2.092   2.575   1.00 0.00 ? 64  GLY A N    1  
ATOM 1011  C CA   . GLY A 1 64  ? -8.020  3.209   2.102   1.00 0.00 ? 64  GLY A CA   1  
ATOM 1012  C C    . GLY A 1 64  ? -7.328  2.912   0.787   1.00 0.00 ? 64  GLY A C    1  
ATOM 1013  O O    . GLY A 1 64  ? -6.789  1.822   0.594   1.00 0.00 ? 64  GLY A O    1  
ATOM 1014  H H    . GLY A 1 64  ? -8.581  1.178   2.313   1.00 0.00 ? 64  GLY A H    1  
ATOM 1015  H HA2  . GLY A 1 64  ? -8.663  4.067   1.974   1.00 0.00 ? 64  GLY A HA2  1  
ATOM 1016  H HA3  . GLY A 1 64  ? -7.271  3.441   2.845   1.00 0.00 ? 64  GLY A HA3  1  
ATOM 1017  N N    . SER A 1 65  ? -7.346  3.882   -0.121  1.00 0.00 ? 65  SER A N    1  
ATOM 1018  C CA   . SER A 1 65  ? -6.720  3.717   -1.428  1.00 0.00 ? 65  SER A CA   1  
ATOM 1019  C C    . SER A 1 65  ? -5.566  4.699   -1.606  1.00 0.00 ? 65  SER A C    1  
ATOM 1020  O O    . SER A 1 65  ? -5.620  5.831   -1.123  1.00 0.00 ? 65  SER A O    1  
ATOM 1021  C CB   . SER A 1 65  ? -7.751  3.917   -2.540  1.00 0.00 ? 65  SER A CB   1  
ATOM 1022  O OG   . SER A 1 65  ? -8.720  2.883   -2.530  1.00 0.00 ? 65  SER A OG   1  
ATOM 1023  H H    . SER A 1 65  ? -7.792  4.728   0.092   1.00 0.00 ? 65  SER A H    1  
ATOM 1024  H HA   . SER A 1 65  ? -6.332  2.711   -1.485  1.00 0.00 ? 65  SER A HA   1  
ATOM 1025  H HB2  . SER A 1 65  ? -8.251  4.863   -2.398  1.00 0.00 ? 65  SER A HB2  1  
ATOM 1026  H HB3  . SER A 1 65  ? -7.250  3.916   -3.497  1.00 0.00 ? 65  SER A HB3  1  
ATOM 1027  H HG   . SER A 1 65  ? -9.241  2.924   -3.335  1.00 0.00 ? 65  SER A HG   1  
ATOM 1028  N N    . ILE A 1 66  ? -4.524  4.258   -2.302  1.00 0.00 ? 66  ILE A N    1  
ATOM 1029  C CA   . ILE A 1 66  ? -3.357  5.098   -2.545  1.00 0.00 ? 66  ILE A CA   1  
ATOM 1030  C C    . ILE A 1 66  ? -2.841  4.923   -3.969  1.00 0.00 ? 66  ILE A C    1  
ATOM 1031  O O    . ILE A 1 66  ? -2.479  3.826   -4.394  1.00 0.00 ? 66  ILE A O    1  
ATOM 1032  C CB   . ILE A 1 66  ? -2.220  4.782   -1.555  1.00 0.00 ? 66  ILE A CB   1  
ATOM 1033  C CG1  . ILE A 1 66  ? -2.698  4.980   -0.115  1.00 0.00 ? 66  ILE A CG1  1  
ATOM 1034  C CG2  . ILE A 1 66  ? -1.009  5.657   -1.843  1.00 0.00 ? 66  ILE A CG2  1  
ATOM 1035  C CD1  . ILE A 1 66  ? -2.006  4.075   0.880   1.00 0.00 ? 66  ILE A CD1  1  
ATOM 1036  H H    . ILE A 1 66  ? -4.540  3.347   -2.661  1.00 0.00 ? 66  ILE A H    1  
ATOM 1037  H HA   . ILE A 1 66  ? -3.654  6.128   -2.404  1.00 0.00 ? 66  ILE A HA   1  
ATOM 1038  H HB   . ILE A 1 66  ? -1.930  3.751   -1.693  1.00 0.00 ? 66  ILE A HB   1  
ATOM 1039  H HG12 . ILE A 1 66  ? -2.514  6.000   0.181   1.00 0.00 ? 66  ILE A HG12 1  
ATOM 1040  H HG13 . ILE A 1 66  ? -3.758  4.780   -0.065  1.00 0.00 ? 66  ILE A HG13 1  
ATOM 1041  H HG21 . ILE A 1 66  ? -1.059  6.017   -2.860  1.00 0.00 ? 66  ILE A HG21 1  
ATOM 1042  H HG22 . ILE A 1 66  ? -1.003  6.496   -1.164  1.00 0.00 ? 66  ILE A HG22 1  
ATOM 1043  H HG23 . ILE A 1 66  ? -0.107  5.079   -1.710  1.00 0.00 ? 66  ILE A HG23 1  
ATOM 1044  H HD11 . ILE A 1 66  ? -2.632  3.217   1.082   1.00 0.00 ? 66  ILE A HD11 1  
ATOM 1045  H HD12 . ILE A 1 66  ? -1.063  3.743   0.471   1.00 0.00 ? 66  ILE A HD12 1  
ATOM 1046  H HD13 . ILE A 1 66  ? -1.831  4.616   1.798   1.00 0.00 ? 66  ILE A HD13 1  
ATOM 1047  N N    . PRO A 1 67  ? -2.803  6.030   -4.724  1.00 0.00 ? 67  PRO A N    1  
ATOM 1048  C CA   . PRO A 1 67  ? -2.329  6.026   -6.112  1.00 0.00 ? 67  PRO A CA   1  
ATOM 1049  C C    . PRO A 1 67  ? -0.826  5.788   -6.211  1.00 0.00 ? 67  PRO A C    1  
ATOM 1050  O O    . PRO A 1 67  ? -0.027  6.594   -5.732  1.00 0.00 ? 67  PRO A O    1  
ATOM 1051  C CB   . PRO A 1 67  ? -2.683  7.429   -6.612  1.00 0.00 ? 67  PRO A CB   1  
ATOM 1052  C CG   . PRO A 1 67  ? -2.723  8.270   -5.383  1.00 0.00 ? 67  PRO A CG   1  
ATOM 1053  C CD   . PRO A 1 67  ? -3.218  7.372   -4.283  1.00 0.00 ? 67  PRO A CD   1  
ATOM 1054  H HA   . PRO A 1 67  ? -2.849  5.289   -6.706  1.00 0.00 ? 67  PRO A HA   1  
ATOM 1055  H HB2  . PRO A 1 67  ? -1.923  7.770   -7.301  1.00 0.00 ? 67  PRO A HB2  1  
ATOM 1056  H HB3  . PRO A 1 67  ? -3.642  7.407   -7.107  1.00 0.00 ? 67  PRO A HB3  1  
ATOM 1057  H HG2  . PRO A 1 67  ? -1.733  8.633   -5.154  1.00 0.00 ? 67  PRO A HG2  1  
ATOM 1058  H HG3  . PRO A 1 67  ? -3.404  9.096   -5.526  1.00 0.00 ? 67  PRO A HG3  1  
ATOM 1059  H HD2  . PRO A 1 67  ? -2.750  7.632   -3.345  1.00 0.00 ? 67  PRO A HD2  1  
ATOM 1060  H HD3  . PRO A 1 67  ? -4.293  7.434   -4.200  1.00 0.00 ? 67  PRO A HD3  1  
ATOM 1061  N N    . LEU A 1 68  ? -0.448  4.679   -6.835  1.00 0.00 ? 68  LEU A N    1  
ATOM 1062  C CA   . LEU A 1 68  ? 0.961   4.335   -6.998  1.00 0.00 ? 68  LEU A CA   1  
ATOM 1063  C C    . LEU A 1 68  ? 1.515   4.909   -8.298  1.00 0.00 ? 68  LEU A C    1  
ATOM 1064  O O    . LEU A 1 68  ? 2.718   5.139   -8.424  1.00 0.00 ? 68  LEU A O    1  
ATOM 1065  C CB   . LEU A 1 68  ? 1.141   2.816   -6.979  1.00 0.00 ? 68  LEU A CB   1  
ATOM 1066  C CG   . LEU A 1 68  ? 1.082   2.150   -5.605  1.00 0.00 ? 68  LEU A CG   1  
ATOM 1067  C CD1  . LEU A 1 68  ? 0.918   0.644   -5.748  1.00 0.00 ? 68  LEU A CD1  1  
ATOM 1068  C CD2  . LEU A 1 68  ? 2.330   2.478   -4.799  1.00 0.00 ? 68  LEU A CD2  1  
ATOM 1069  H H    . LEU A 1 68  ? -1.130  4.075   -7.195  1.00 0.00 ? 68  LEU A H    1  
ATOM 1070  H HA   . LEU A 1 68  ? 1.504   4.764   -6.169  1.00 0.00 ? 68  LEU A HA   1  
ATOM 1071  H HB2  . LEU A 1 68  ? 0.363   2.384   -7.590  1.00 0.00 ? 68  LEU A HB2  1  
ATOM 1072  H HB3  . LEU A 1 68  ? 2.104   2.593   -7.415  1.00 0.00 ? 68  LEU A HB3  1  
ATOM 1073  H HG   . LEU A 1 68  ? 0.225   2.528   -5.065  1.00 0.00 ? 68  LEU A HG   1  
ATOM 1074  H HD11 . LEU A 1 68  ? 1.417   0.149   -4.929  1.00 0.00 ? 68  LEU A HD11 1  
ATOM 1075  H HD12 . LEU A 1 68  ? 1.351   0.322   -6.683  1.00 0.00 ? 68  LEU A HD12 1  
ATOM 1076  H HD13 . LEU A 1 68  ? -0.133  0.394   -5.734  1.00 0.00 ? 68  LEU A HD13 1  
ATOM 1077  H HD21 . LEU A 1 68  ? 3.184   1.987   -5.242  1.00 0.00 ? 68  LEU A HD21 1  
ATOM 1078  H HD22 . LEU A 1 68  ? 2.203   2.133   -3.783  1.00 0.00 ? 68  LEU A HD22 1  
ATOM 1079  H HD23 . LEU A 1 68  ? 2.488   3.547   -4.798  1.00 0.00 ? 68  LEU A HD23 1  
ATOM 1080  N N    . LEU A 1 69  ? 0.629   5.139   -9.261  1.00 0.00 ? 69  LEU A N    1  
ATOM 1081  C CA   . LEU A 1 69  ? 1.029   5.689   -10.552 1.00 0.00 ? 69  LEU A CA   1  
ATOM 1082  C C    . LEU A 1 69  ? 1.738   7.028   -10.378 1.00 0.00 ? 69  LEU A C    1  
ATOM 1083  O O    . LEU A 1 69  ? 2.343   7.548   -11.315 1.00 0.00 ? 69  LEU A O    1  
ATOM 1084  C CB   . LEU A 1 69  ? -0.193  5.860   -11.456 1.00 0.00 ? 69  LEU A CB   1  
ATOM 1085  C CG   . LEU A 1 69  ? -0.088  6.944   -12.529 1.00 0.00 ? 69  LEU A CG   1  
ATOM 1086  C CD1  . LEU A 1 69  ? 0.956   6.567   -13.568 1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1087  C CD2  . LEU A 1 69  ? -1.440  7.176   -13.188 1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1088  H H    . LEU A 1 69  ? -0.315  4.936   -9.101  1.00 0.00 ? 69  LEU A H    1  
ATOM 1089  H HA   . LEU A 1 69  ? 1.712   4.990   -11.012 1.00 0.00 ? 69  LEU A HA   1  
ATOM 1090  H HB2  . LEU A 1 69  ? -0.371  4.919   -11.953 1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1091  H HB3  . LEU A 1 69  ? -1.039  6.098   -10.826 1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1092  H HG   . LEU A 1 69  ? 0.223   7.871   -12.066 1.00 0.00 ? 69  LEU A HG   1  
ATOM 1093  H HD11 . LEU A 1 69  ? 1.881   6.313   -13.073 1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1094  H HD12 . LEU A 1 69  ? 1.121   7.402   -14.233 1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1095  H HD13 . LEU A 1 69  ? 0.607   5.718   -14.138 1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1096  H HD21 . LEU A 1 69  ? -1.738  6.284   -13.719 1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1097  H HD22 . LEU A 1 69  ? -1.365  8.000   -13.882 1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1098  H HD23 . LEU A 1 69  ? -2.174  7.408   -12.431 1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1099  N N    . SER A 1 70  ? 1.662   7.580   -9.171  1.00 0.00 ? 70  SER A N    1  
ATOM 1100  C CA   . SER A 1 70  ? 2.296   8.859   -8.874  1.00 0.00 ? 70  SER A CA   1  
ATOM 1101  C C    . SER A 1 70  ? 3.299   8.716   -7.733  1.00 0.00 ? 70  SER A C    1  
ATOM 1102  O O    . SER A 1 70  ? 3.397   9.584   -6.865  1.00 0.00 ? 70  SER A O    1  
ATOM 1103  C CB   . SER A 1 70  ? 1.238   9.903   -8.511  1.00 0.00 ? 70  SER A CB   1  
ATOM 1104  O OG   . SER A 1 70  ? 0.333   10.106  -9.582  1.00 0.00 ? 70  SER A OG   1  
ATOM 1105  H H    . SER A 1 70  ? 1.165   7.116   -8.464  1.00 0.00 ? 70  SER A H    1  
ATOM 1106  H HA   . SER A 1 70  ? 2.820   9.183   -9.760  1.00 0.00 ? 70  SER A HA   1  
ATOM 1107  H HB2  . SER A 1 70  ? 0.686   9.567   -7.647  1.00 0.00 ? 70  SER A HB2  1  
ATOM 1108  H HB3  . SER A 1 70  ? 1.725   10.841  -8.284  1.00 0.00 ? 70  SER A HB3  1  
ATOM 1109  H HG   . SER A 1 70  ? -0.130  10.938  -9.457  1.00 0.00 ? 70  SER A HG   1  
ATOM 1110  N N    . PHE A 1 71  ? 4.042   7.615   -7.741  1.00 0.00 ? 71  PHE A N    1  
ATOM 1111  C CA   . PHE A 1 71  ? 5.037   7.357   -6.707  1.00 0.00 ? 71  PHE A CA   1  
ATOM 1112  C C    . PHE A 1 71  ? 6.243   6.621   -7.285  1.00 0.00 ? 71  PHE A C    1  
ATOM 1113  O O    . PHE A 1 71  ? 6.196   6.115   -8.406  1.00 0.00 ? 71  PHE A O    1  
ATOM 1114  C CB   . PHE A 1 71  ? 4.423   6.537   -5.571  1.00 0.00 ? 71  PHE A CB   1  
ATOM 1115  C CG   . PHE A 1 71  ? 3.679   7.370   -4.566  1.00 0.00 ? 71  PHE A CG   1  
ATOM 1116  C CD1  . PHE A 1 71  ? 2.424   7.878   -4.861  1.00 0.00 ? 71  PHE A CD1  1  
ATOM 1117  C CD2  . PHE A 1 71  ? 4.234   7.644   -3.327  1.00 0.00 ? 71  PHE A CD2  1  
ATOM 1118  C CE1  . PHE A 1 71  ? 1.737   8.645   -3.939  1.00 0.00 ? 71  PHE A CE1  1  
ATOM 1119  C CE2  . PHE A 1 71  ? 3.552   8.410   -2.400  1.00 0.00 ? 71  PHE A CE2  1  
ATOM 1120  C CZ   . PHE A 1 71  ? 2.301   8.910   -2.706  1.00 0.00 ? 71  PHE A CZ   1  
ATOM 1121  H H    . PHE A 1 71  ? 3.917   6.960   -8.460  1.00 0.00 ? 71  PHE A H    1  
ATOM 1122  H HA   . PHE A 1 71  ? 5.364   8.308   -6.318  1.00 0.00 ? 71  PHE A HA   1  
ATOM 1123  H HB2  . PHE A 1 71  ? 3.729   5.822   -5.987  1.00 0.00 ? 71  PHE A HB2  1  
ATOM 1124  H HB3  . PHE A 1 71  ? 5.208   6.011   -5.051  1.00 0.00 ? 71  PHE A HB3  1  
ATOM 1125  H HD1  . PHE A 1 71  ? 1.980   7.670   -5.824  1.00 0.00 ? 71  PHE A HD1  1  
ATOM 1126  H HD2  . PHE A 1 71  ? 5.212   7.253   -3.086  1.00 0.00 ? 71  PHE A HD2  1  
ATOM 1127  H HE1  . PHE A 1 71  ? 0.760   9.034   -4.181  1.00 0.00 ? 71  PHE A HE1  1  
ATOM 1128  H HE2  . PHE A 1 71  ? 3.996   8.616   -1.438  1.00 0.00 ? 71  PHE A HE2  1  
ATOM 1129  H HZ   . PHE A 1 71  ? 1.767   9.510   -1.984  1.00 0.00 ? 71  PHE A HZ   1  
ATOM 1130  N N    . ARG A 1 72  ? 7.322   6.567   -6.511  1.00 0.00 ? 72  ARG A N    1  
ATOM 1131  C CA   . ARG A 1 72  ? 8.541   5.895   -6.946  1.00 0.00 ? 72  ARG A CA   1  
ATOM 1132  C C    . ARG A 1 72  ? 8.992   4.865   -5.914  1.00 0.00 ? 72  ARG A C    1  
ATOM 1133  O O    . ARG A 1 72  ? 9.905   5.116   -5.128  1.00 0.00 ? 72  ARG A O    1  
ATOM 1134  C CB   . ARG A 1 72  ? 9.655   6.917   -7.182  1.00 0.00 ? 72  ARG A CB   1  
ATOM 1135  C CG   . ARG A 1 72  ? 9.822   7.911   -6.044  1.00 0.00 ? 72  ARG A CG   1  
ATOM 1136  C CD   . ARG A 1 72  ? 11.200  8.552   -6.061  1.00 0.00 ? 72  ARG A CD   1  
ATOM 1137  N NE   . ARG A 1 72  ? 12.259  7.580   -5.801  1.00 0.00 ? 72  ARG A NE   1  
ATOM 1138  C CZ   . ARG A 1 72  ? 13.479  7.914   -5.393  1.00 0.00 ? 72  ARG A CZ   1  
ATOM 1139  N NH1  . ARG A 1 72  ? 13.791  9.188   -5.200  1.00 0.00 ? 72  ARG A NH1  1  
ATOM 1140  N NH2  . ARG A 1 72  ? 14.388  6.972   -5.178  1.00 0.00 ? 72  ARG A NH2  1  
ATOM 1141  H H    . ARG A 1 72  ? 7.299   6.989   -5.627  1.00 0.00 ? 72  ARG A H    1  
ATOM 1142  H HA   . ARG A 1 72  ? 8.328   5.388   -7.875  1.00 0.00 ? 72  ARG A HA   1  
ATOM 1143  H HB2  . ARG A 1 72  ? 10.590  6.391   -7.310  1.00 0.00 ? 72  ARG A HB2  1  
ATOM 1144  H HB3  . ARG A 1 72  ? 9.435   7.469   -8.083  1.00 0.00 ? 72  ARG A HB3  1  
ATOM 1145  H HG2  . ARG A 1 72  ? 9.076   8.685   -6.142  1.00 0.00 ? 72  ARG A HG2  1  
ATOM 1146  H HG3  . ARG A 1 72  ? 9.686   7.394   -5.105  1.00 0.00 ? 72  ARG A HG3  1  
ATOM 1147  H HD2  . ARG A 1 72  ? 11.364  8.996   -7.032  1.00 0.00 ? 72  ARG A HD2  1  
ATOM 1148  H HD3  . ARG A 1 72  ? 11.235  9.320   -5.303  1.00 0.00 ? 72  ARG A HD3  1  
ATOM 1149  H HE   . ARG A 1 72  ? 12.050  6.633   -5.937  1.00 0.00 ? 72  ARG A HE   1  
ATOM 1150  H HH11 . ARG A 1 72  ? 13.108  9.899   -5.361  1.00 0.00 ? 72  ARG A HH11 1  
ATOM 1151  H HH12 . ARG A 1 72  ? 14.710  9.436   -4.892  1.00 0.00 ? 72  ARG A HH12 1  
ATOM 1152  H HH21 . ARG A 1 72  ? 14.156  6.011   -5.322  1.00 0.00 ? 72  ARG A HH21 1  
ATOM 1153  H HH22 . ARG A 1 72  ? 15.306  7.224   -4.871  1.00 0.00 ? 72  ARG A HH22 1  
ATOM 1154  N N    . VAL A 1 73  ? 8.344   3.704   -5.923  1.00 0.00 ? 73  VAL A N    1  
ATOM 1155  C CA   . VAL A 1 73  ? 8.678   2.636   -4.989  1.00 0.00 ? 73  VAL A CA   1  
ATOM 1156  C C    . VAL A 1 73  ? 10.170  2.326   -5.019  1.00 0.00 ? 73  VAL A C    1  
ATOM 1157  O O    . VAL A 1 73  ? 10.809  2.402   -6.068  1.00 0.00 ? 73  VAL A O    1  
ATOM 1158  C CB   . VAL A 1 73  ? 7.891   1.349   -5.304  1.00 0.00 ? 73  VAL A CB   1  
ATOM 1159  C CG1  . VAL A 1 73  ? 8.236   0.254   -4.306  1.00 0.00 ? 73  VAL A CG1  1  
ATOM 1160  C CG2  . VAL A 1 73  ? 6.396   1.627   -5.309  1.00 0.00 ? 73  VAL A CG2  1  
ATOM 1161  H H    . VAL A 1 73  ? 7.625   3.563   -6.574  1.00 0.00 ? 73  VAL A H    1  
ATOM 1162  H HA   . VAL A 1 73  ? 8.407   2.963   -3.996  1.00 0.00 ? 73  VAL A HA   1  
ATOM 1163  H HB   . VAL A 1 73  ? 8.176   1.010   -6.290  1.00 0.00 ? 73  VAL A HB   1  
ATOM 1164  H HG11 . VAL A 1 73  ? 9.277   -0.015  -4.412  1.00 0.00 ? 73  VAL A HG11 1  
ATOM 1165  H HG12 . VAL A 1 73  ? 8.056   0.612   -3.303  1.00 0.00 ? 73  VAL A HG12 1  
ATOM 1166  H HG13 . VAL A 1 73  ? 7.620   -0.612  -4.496  1.00 0.00 ? 73  VAL A HG13 1  
ATOM 1167  H HG21 . VAL A 1 73  ? 6.195   2.512   -5.894  1.00 0.00 ? 73  VAL A HG21 1  
ATOM 1168  H HG22 . VAL A 1 73  ? 5.875   0.784   -5.738  1.00 0.00 ? 73  VAL A HG22 1  
ATOM 1169  H HG23 . VAL A 1 73  ? 6.055   1.781   -4.295  1.00 0.00 ? 73  VAL A HG23 1  
ATOM 1170  N N    . ALA A 1 74  ? 10.719  1.976   -3.860  1.00 0.00 ? 74  ALA A N    1  
ATOM 1171  C CA   . ALA A 1 74  ? 12.137  1.652   -3.754  1.00 0.00 ? 74  ALA A CA   1  
ATOM 1172  C C    . ALA A 1 74  ? 12.469  1.089   -2.376  1.00 0.00 ? 74  ALA A C    1  
ATOM 1173  O O    . ALA A 1 74  ? 11.977  1.578   -1.360  1.00 0.00 ? 74  ALA A O    1  
ATOM 1174  C CB   . ALA A 1 74  ? 12.982  2.884   -4.040  1.00 0.00 ? 74  ALA A CB   1  
ATOM 1175  H H    . ALA A 1 74  ? 10.158  1.933   -3.059  1.00 0.00 ? 74  ALA A H    1  
ATOM 1176  H HA   . ALA A 1 74  ? 12.366  0.907   -4.502  1.00 0.00 ? 74  ALA A HA   1  
ATOM 1177  H HB1  . ALA A 1 74  ? 13.919  2.582   -4.485  1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1178  H HB2  . ALA A 1 74  ? 12.452  3.533   -4.722  1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1179  H HB3  . ALA A 1 74  ? 13.175  3.411   -3.117  1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1180  N N    . ALA A 1 75  ? 13.306  0.057   -2.351  1.00 0.00 ? 75  ALA A N    1  
ATOM 1181  C CA   . ALA A 1 75  ? 13.704  -0.572  -1.098  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1182  C C    . ALA A 1 75  ? 14.200  0.465   -0.096  1.00 0.00 ? 75  ALA A C    1  
ATOM 1183  O O    . ALA A 1 75  ? 14.967  1.363   -0.444  1.00 0.00 ? 75  ALA A O    1  
ATOM 1184  C CB   . ALA A 1 75  ? 14.779  -1.620  -1.351  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1185  H H    . ALA A 1 75  ? 13.665  -0.289  -3.194  1.00 0.00 ? 75  ALA A H    1  
ATOM 1186  H HA   . ALA A 1 75  ? 12.840  -1.072  -0.685  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1187  H HB1  . ALA A 1 75  ? 14.313  -2.575  -1.541  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1188  H HB2  . ALA A 1 75  ? 15.368  -1.329  -2.209  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1189  H HB3  . ALA A 1 75  ? 15.418  -1.696  -0.485  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1190  N N    . VAL A 1 76  ? 13.757  0.336   1.151   1.00 0.00 ? 76  VAL A N    1  
ATOM 1191  C CA   . VAL A 1 76  ? 14.156  1.262   2.204   1.00 0.00 ? 76  VAL A CA   1  
ATOM 1192  C C    . VAL A 1 76  ? 15.666  1.472   2.208   1.00 0.00 ? 76  VAL A C    1  
ATOM 1193  O O    . VAL A 1 76  ? 16.428  0.567   1.871   1.00 0.00 ? 76  VAL A O    1  
ATOM 1194  C CB   . VAL A 1 76  ? 13.715  0.759   3.591   1.00 0.00 ? 76  VAL A CB   1  
ATOM 1195  C CG1  . VAL A 1 76  ? 12.201  0.828   3.728   1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1196  C CG2  . VAL A 1 76  ? 14.215  -0.658  3.827   1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1197  H H    . VAL A 1 76  ? 13.148  -0.400  1.368   1.00 0.00 ? 76  VAL A H    1  
ATOM 1198  H HA   . VAL A 1 76  ? 13.671  2.209   2.017   1.00 0.00 ? 76  VAL A HA   1  
ATOM 1199  H HB   . VAL A 1 76  ? 14.151  1.402   4.341   1.00 0.00 ? 76  VAL A HB   1  
ATOM 1200  H HG11 . VAL A 1 76  ? 11.848  1.773   3.342   1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1201  H HG12 . VAL A 1 76  ? 11.752  0.020   3.170   1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1202  H HG13 . VAL A 1 76  ? 11.930  0.741   4.770   1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1203  H HG21 . VAL A 1 76  ? 13.557  -1.359  3.336   1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1204  H HG22 . VAL A 1 76  ? 15.213  -0.758  3.427   1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1205  H HG23 . VAL A 1 76  ? 14.231  -0.863  4.888   1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1206  N N    . GLN A 1 77  ? 16.090  2.671   2.593   1.00 0.00 ? 77  GLN A N    1  
ATOM 1207  C CA   . GLN A 1 77  ? 17.510  3.000   2.641   1.00 0.00 ? 77  GLN A CA   1  
ATOM 1208  C C    . GLN A 1 77  ? 18.223  2.179   3.710   1.00 0.00 ? 77  GLN A C    1  
ATOM 1209  O O    . GLN A 1 77  ? 17.611  1.683   4.657   1.00 0.00 ? 77  GLN A O    1  
ATOM 1210  C CB   . GLN A 1 77  ? 17.701  4.492   2.915   1.00 0.00 ? 77  GLN A CB   1  
ATOM 1211  C CG   . GLN A 1 77  ? 17.510  5.366   1.686   1.00 0.00 ? 77  GLN A CG   1  
ATOM 1212  C CD   . GLN A 1 77  ? 17.998  6.786   1.897   1.00 0.00 ? 77  GLN A CD   1  
ATOM 1213  O OE1  . GLN A 1 77  ? 17.469  7.518   2.734   1.00 0.00 ? 77  GLN A OE1  1  
ATOM 1214  N NE2  . GLN A 1 77  ? 19.012  7.183   1.138   1.00 0.00 ? 77  GLN A NE2  1  
ATOM 1215  H H    . GLN A 1 77  ? 15.433  3.351   2.849   1.00 0.00 ? 77  GLN A H    1  
ATOM 1216  H HA   . GLN A 1 77  ? 17.938  2.762   1.678   1.00 0.00 ? 77  GLN A HA   1  
ATOM 1217  H HB2  . GLN A 1 77  ? 16.989  4.802   3.665   1.00 0.00 ? 77  GLN A HB2  1  
ATOM 1218  H HB3  . GLN A 1 77  ? 18.701  4.652   3.291   1.00 0.00 ? 77  GLN A HB3  1  
ATOM 1219  H HG2  . GLN A 1 77  ? 18.058  4.933   0.863   1.00 0.00 ? 77  GLN A HG2  1  
ATOM 1220  H HG3  . GLN A 1 77  ? 16.458  5.395   1.441   1.00 0.00 ? 77  GLN A HG3  1  
ATOM 1221  H HE21 . GLN A 1 77  ? 19.382  6.545   0.491   1.00 0.00 ? 77  GLN A HE21 1  
ATOM 1222  H HE22 . GLN A 1 77  ? 19.347  8.095   1.253   1.00 0.00 ? 77  GLN A HE22 1  
ATOM 1223  N N    . PRO A 1 78  ? 19.547  2.030   3.558   1.00 0.00 ? 78  PRO A N    1  
ATOM 1224  C CA   . PRO A 1 78  ? 20.372  1.269   4.501   1.00 0.00 ? 78  PRO A CA   1  
ATOM 1225  C C    . PRO A 1 78  ? 20.507  1.970   5.849   1.00 0.00 ? 78  PRO A C    1  
ATOM 1226  O O    . PRO A 1 78  ? 21.171  1.469   6.756   1.00 0.00 ? 78  PRO A O    1  
ATOM 1227  C CB   . PRO A 1 78  ? 21.731  1.191   3.801   1.00 0.00 ? 78  PRO A CB   1  
ATOM 1228  C CG   . PRO A 1 78  ? 21.761  2.375   2.899   1.00 0.00 ? 78  PRO A CG   1  
ATOM 1229  C CD   . PRO A 1 78  ? 20.341  2.593   2.453   1.00 0.00 ? 78  PRO A CD   1  
ATOM 1230  H HA   . PRO A 1 78  ? 19.985  0.272   4.653   1.00 0.00 ? 78  PRO A HA   1  
ATOM 1231  H HB2  . PRO A 1 78  ? 22.521  1.234   4.538   1.00 0.00 ? 78  PRO A HB2  1  
ATOM 1232  H HB3  . PRO A 1 78  ? 21.800  0.268   3.244   1.00 0.00 ? 78  PRO A HB3  1  
ATOM 1233  H HG2  . PRO A 1 78  ? 22.121  3.238   3.437   1.00 0.00 ? 78  PRO A HG2  1  
ATOM 1234  H HG3  . PRO A 1 78  ? 22.393  2.172   2.047   1.00 0.00 ? 78  PRO A HG3  1  
ATOM 1235  H HD2  . PRO A 1 78  ? 20.141  3.647   2.332   1.00 0.00 ? 78  PRO A HD2  1  
ATOM 1236  H HD3  . PRO A 1 78  ? 20.149  2.063   1.532   1.00 0.00 ? 78  PRO A HD3  1  
ATOM 1237  N N    . SER A 1 79  ? 19.872  3.131   5.973   1.00 0.00 ? 79  SER A N    1  
ATOM 1238  C CA   . SER A 1 79  ? 19.924  3.903   7.209   1.00 0.00 ? 79  SER A CA   1  
ATOM 1239  C C    . SER A 1 79  ? 18.519  4.244   7.697   1.00 0.00 ? 79  SER A C    1  
ATOM 1240  O O    . SER A 1 79  ? 18.338  5.131   8.531   1.00 0.00 ? 79  SER A O    1  
ATOM 1241  C CB   . SER A 1 79  ? 20.730  5.186   7.001   1.00 0.00 ? 79  SER A CB   1  
ATOM 1242  O OG   . SER A 1 79  ? 20.028  6.101   6.177   1.00 0.00 ? 79  SER A OG   1  
ATOM 1243  H H    . SER A 1 79  ? 19.358  3.479   5.214   1.00 0.00 ? 79  SER A H    1  
ATOM 1244  H HA   . SER A 1 79  ? 20.415  3.297   7.957   1.00 0.00 ? 79  SER A HA   1  
ATOM 1245  H HB2  . SER A 1 79  ? 20.916  5.651   7.957   1.00 0.00 ? 79  SER A HB2  1  
ATOM 1246  H HB3  . SER A 1 79  ? 21.671  4.944   6.529   1.00 0.00 ? 79  SER A HB3  1  
ATOM 1247  H HG   . SER A 1 79  ? 19.782  6.873   6.693   1.00 0.00 ? 79  SER A HG   1  
ATOM 1248  N N    . ASP A 1 80  ? 17.528  3.534   7.169   1.00 0.00 ? 80  ASP A N    1  
ATOM 1249  C CA   . ASP A 1 80  ? 16.139  3.760   7.549   1.00 0.00 ? 80  ASP A CA   1  
ATOM 1250  C C    . ASP A 1 80  ? 15.933  3.493   9.037   1.00 0.00 ? 80  ASP A C    1  
ATOM 1251  O O    . ASP A 1 80  ? 16.848  3.051   9.731   1.00 0.00 ? 80  ASP A O    1  
ATOM 1252  C CB   . ASP A 1 80  ? 15.210  2.867   6.725   1.00 0.00 ? 80  ASP A CB   1  
ATOM 1253  C CG   . ASP A 1 80  ? 15.333  1.402   7.099   1.00 0.00 ? 80  ASP A CG   1  
ATOM 1254  O OD1  . ASP A 1 80  ? 16.365  1.027   7.693   1.00 0.00 ? 80  ASP A OD1  1  
ATOM 1255  O OD2  . ASP A 1 80  ? 14.397  0.632   6.796   1.00 0.00 ? 80  ASP A OD2  1  
ATOM 1256  H H    . ASP A 1 80  ? 17.737  2.840   6.508   1.00 0.00 ? 80  ASP A H    1  
ATOM 1257  H HA   . ASP A 1 80  ? 15.903  4.793   7.346   1.00 0.00 ? 80  ASP A HA   1  
ATOM 1258  H HB2  . ASP A 1 80  ? 14.188  3.175   6.886   1.00 0.00 ? 80  ASP A HB2  1  
ATOM 1259  H HB3  . ASP A 1 80  ? 15.454  2.974   5.678   1.00 0.00 ? 80  ASP A HB3  1  
ATOM 1260  N N    . ASN A 1 81  ? 14.725  3.765   9.520   1.00 0.00 ? 81  ASN A N    1  
ATOM 1261  C CA   . ASN A 1 81  ? 14.399  3.556   10.926  1.00 0.00 ? 81  ASN A CA   1  
ATOM 1262  C C    . ASN A 1 81  ? 13.441  2.380   11.094  1.00 0.00 ? 81  ASN A C    1  
ATOM 1263  O O    . ASN A 1 81  ? 12.557  2.404   11.950  1.00 0.00 ? 81  ASN A O    1  
ATOM 1264  C CB   . ASN A 1 81  ? 13.779  4.822   11.522  1.00 0.00 ? 81  ASN A CB   1  
ATOM 1265  C CG   . ASN A 1 81  ? 14.822  5.755   12.106  1.00 0.00 ? 81  ASN A CG   1  
ATOM 1266  O OD1  . ASN A 1 81  ? 14.805  6.052   13.301  1.00 0.00 ? 81  ASN A OD1  1  
ATOM 1267  N ND2  . ASN A 1 81  ? 15.735  6.224   11.264  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 1268  H H    . ASN A 1 81  ? 14.036  4.115   8.917   1.00 0.00 ? 81  ASN A H    1  
ATOM 1269  H HA   . ASN A 1 81  ? 15.317  3.334   11.450  1.00 0.00 ? 81  ASN A HA   1  
ATOM 1270  H HB2  . ASN A 1 81  ? 13.244  5.351   10.747  1.00 0.00 ? 81  ASN A HB2  1  
ATOM 1271  H HB3  . ASN A 1 81  ? 13.090  4.544   12.305  1.00 0.00 ? 81  ASN A HB3  1  
ATOM 1272  H HD21 . ASN A 1 81  ? 15.686  5.945   10.325  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 1273  H HD22 . ASN A 1 81  ? 16.421  6.829   11.615  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 1274  N N    . ILE A 1 82  ? 13.624  1.353   10.270  1.00 0.00 ? 82  ILE A N    1  
ATOM 1275  C CA   . ILE A 1 82  ? 12.777  0.168   10.329  1.00 0.00 ? 82  ILE A CA   1  
ATOM 1276  C C    . ILE A 1 82  ? 13.553  -1.037  10.849  1.00 0.00 ? 82  ILE A C    1  
ATOM 1277  O O    . ILE A 1 82  ? 14.539  -1.460  10.247  1.00 0.00 ? 82  ILE A O    1  
ATOM 1278  C CB   . ILE A 1 82  ? 12.189  -0.172  8.946   1.00 0.00 ? 82  ILE A CB   1  
ATOM 1279  C CG1  . ILE A 1 82  ? 11.655  1.092   8.270   1.00 0.00 ? 82  ILE A CG1  1  
ATOM 1280  C CG2  . ILE A 1 82  ? 11.088  -1.213  9.081   1.00 0.00 ? 82  ILE A CG2  1  
ATOM 1281  C CD1  . ILE A 1 82  ? 10.267  1.481   8.726   1.00 0.00 ? 82  ILE A CD1  1  
ATOM 1282  H H    . ILE A 1 82  ? 14.345  1.393   9.609   1.00 0.00 ? 82  ILE A H    1  
ATOM 1283  H HA   . ILE A 1 82  ? 11.960  0.376   11.004  1.00 0.00 ? 82  ILE A HA   1  
ATOM 1284  H HB   . ILE A 1 82  ? 12.976  -0.592  8.339   1.00 0.00 ? 82  ILE A HB   1  
ATOM 1285  H HG12 . ILE A 1 82  ? 12.317  1.916   8.485   1.00 0.00 ? 82  ILE A HG12 1  
ATOM 1286  H HG13 . ILE A 1 82  ? 11.622  0.933   7.202   1.00 0.00 ? 82  ILE A HG13 1  
ATOM 1287  H HG21 . ILE A 1 82  ? 11.525  -2.201  9.080   1.00 0.00 ? 82  ILE A HG21 1  
ATOM 1288  H HG22 . ILE A 1 82  ? 10.557  -1.057  10.007  1.00 0.00 ? 82  ILE A HG22 1  
ATOM 1289  H HG23 . ILE A 1 82  ? 10.403  -1.122  8.252   1.00 0.00 ? 82  ILE A HG23 1  
ATOM 1290  H HD11 . ILE A 1 82  ? 10.168  2.557   8.701   1.00 0.00 ? 82  ILE A HD11 1  
ATOM 1291  H HD12 . ILE A 1 82  ? 9.533   1.038   8.069   1.00 0.00 ? 82  ILE A HD12 1  
ATOM 1292  H HD13 . ILE A 1 82  ? 10.107  1.129   9.734   1.00 0.00 ? 82  ILE A HD13 1  
ATOM 1293  N N    . SER A 1 83  ? 13.100  -1.586  11.972  1.00 0.00 ? 83  SER A N    1  
ATOM 1294  C CA   . SER A 1 83  ? 13.752  -2.742  12.575  1.00 0.00 ? 83  SER A CA   1  
ATOM 1295  C C    . SER A 1 83  ? 13.692  -3.948  11.643  1.00 0.00 ? 83  SER A C    1  
ATOM 1296  O O    . SER A 1 83  ? 14.701  -4.611  11.402  1.00 0.00 ? 83  SER A O    1  
ATOM 1297  C CB   . SER A 1 83  ? 13.095  -3.084  13.914  1.00 0.00 ? 83  SER A CB   1  
ATOM 1298  O OG   . SER A 1 83  ? 13.549  -2.219  14.940  1.00 0.00 ? 83  SER A OG   1  
ATOM 1299  H H    . SER A 1 83  ? 12.308  -1.203  12.405  1.00 0.00 ? 83  SER A H    1  
ATOM 1300  H HA   . SER A 1 83  ? 14.787  -2.486  12.747  1.00 0.00 ? 83  SER A HA   1  
ATOM 1301  H HB2  . SER A 1 83  ? 12.024  -2.984  13.822  1.00 0.00 ? 83  SER A HB2  1  
ATOM 1302  H HB3  . SER A 1 83  ? 13.340  -4.102  14.182  1.00 0.00 ? 83  SER A HB3  1  
ATOM 1303  H HG   . SER A 1 83  ? 14.465  -1.983  14.779  1.00 0.00 ? 83  SER A HG   1  
ATOM 1304  N N    . ARG A 1 84  ? 12.501  -4.226  11.122  1.00 0.00 ? 84  ARG A N    1  
ATOM 1305  C CA   . ARG A 1 84  ? 12.308  -5.353  10.217  1.00 0.00 ? 84  ARG A CA   1  
ATOM 1306  C C    . ARG A 1 84  ? 13.079  -5.145  8.917   1.00 0.00 ? 84  ARG A C    1  
ATOM 1307  O O    . ARG A 1 84  ? 13.218  -4.019  8.438   1.00 0.00 ? 84  ARG A O    1  
ATOM 1308  C CB   . ARG A 1 84  ? 10.820  -5.542  9.915   1.00 0.00 ? 84  ARG A CB   1  
ATOM 1309  C CG   . ARG A 1 84  ? 9.996   -5.930  11.132  1.00 0.00 ? 84  ARG A CG   1  
ATOM 1310  C CD   . ARG A 1 84  ? 8.542   -5.515  10.976  1.00 0.00 ? 84  ARG A CD   1  
ATOM 1311  N NE   . ARG A 1 84  ? 7.638   -6.400  11.707  1.00 0.00 ? 84  ARG A NE   1  
ATOM 1312  C CZ   . ARG A 1 84  ? 7.580   -6.457  13.033  1.00 0.00 ? 84  ARG A CZ   1  
ATOM 1313  N NH1  . ARG A 1 84  ? 8.368   -5.686  13.769  1.00 0.00 ? 84  ARG A NH1  1  
ATOM 1314  N NH2  . ARG A 1 84  ? 6.731   -7.288  13.625  1.00 0.00 ? 84  ARG A NH2  1  
ATOM 1315  H H    . ARG A 1 84  ? 11.735  -3.661  11.352  1.00 0.00 ? 84  ARG A H    1  
ATOM 1316  H HA   . ARG A 1 84  ? 12.682  -6.239  10.706  1.00 0.00 ? 84  ARG A HA   1  
ATOM 1317  H HB2  . ARG A 1 84  ? 10.424  -4.618  9.520   1.00 0.00 ? 84  ARG A HB2  1  
ATOM 1318  H HB3  . ARG A 1 84  ? 10.712  -6.318  9.172   1.00 0.00 ? 84  ARG A HB3  1  
ATOM 1319  H HG2  . ARG A 1 84  ? 10.041  -7.002  11.260  1.00 0.00 ? 84  ARG A HG2  1  
ATOM 1320  H HG3  . ARG A 1 84  ? 10.409  -5.444  12.004  1.00 0.00 ? 84  ARG A HG3  1  
ATOM 1321  H HD2  . ARG A 1 84  ? 8.426   -4.509  11.350  1.00 0.00 ? 84  ARG A HD2  1  
ATOM 1322  H HD3  . ARG A 1 84  ? 8.285   -5.540  9.927   1.00 0.00 ? 84  ARG A HD3  1  
ATOM 1323  H HE   . ARG A 1 84  ? 7.047   -6.979  11.183  1.00 0.00 ? 84  ARG A HE   1  
ATOM 1324  H HH11 . ARG A 1 84  ? 9.007   -5.058  13.325  1.00 0.00 ? 84  ARG A HH11 1  
ATOM 1325  H HH12 . ARG A 1 84  ? 8.321   -5.730  14.767  1.00 0.00 ? 84  ARG A HH12 1  
ATOM 1326  H HH21 . ARG A 1 84  ? 6.136   -7.871  13.074  1.00 0.00 ? 84  ARG A HH21 1  
ATOM 1327  H HH22 . ARG A 1 84  ? 6.688   -7.331  14.623  1.00 0.00 ? 84  ARG A HH22 1  
ATOM 1328  N N    . LYS A 1 85  ? 13.580  -6.238  8.351   1.00 0.00 ? 85  LYS A N    1  
ATOM 1329  C CA   . LYS A 1 85  ? 14.337  -6.177  7.106   1.00 0.00 ? 85  LYS A CA   1  
ATOM 1330  C C    . LYS A 1 85  ? 13.426  -6.406  5.904   1.00 0.00 ? 85  LYS A C    1  
ATOM 1331  O O    . LYS A 1 85  ? 12.236  -6.681  6.058   1.00 0.00 ? 85  LYS A O    1  
ATOM 1332  C CB   . LYS A 1 85  ? 15.458  -7.218  7.116   1.00 0.00 ? 85  LYS A CB   1  
ATOM 1333  C CG   . LYS A 1 85  ? 16.422  -7.063  8.280   1.00 0.00 ? 85  LYS A CG   1  
ATOM 1334  C CD   . LYS A 1 85  ? 17.515  -8.118  8.242   1.00 0.00 ? 85  LYS A CD   1  
ATOM 1335  C CE   . LYS A 1 85  ? 18.609  -7.823  9.258   1.00 0.00 ? 85  LYS A CE   1  
ATOM 1336  N NZ   . LYS A 1 85  ? 19.462  -9.016  9.516   1.00 0.00 ? 85  LYS A NZ   1  
ATOM 1337  H H    . LYS A 1 85  ? 13.436  -7.107  8.781   1.00 0.00 ? 85  LYS A H    1  
ATOM 1338  H HA   . LYS A 1 85  ? 14.772  -5.192  7.030   1.00 0.00 ? 85  LYS A HA   1  
ATOM 1339  H HB2  . LYS A 1 85  ? 15.018  -8.203  7.169   1.00 0.00 ? 85  LYS A HB2  1  
ATOM 1340  H HB3  . LYS A 1 85  ? 16.020  -7.133  6.197   1.00 0.00 ? 85  LYS A HB3  1  
ATOM 1341  H HG2  . LYS A 1 85  ? 16.878  -6.086  8.230   1.00 0.00 ? 85  LYS A HG2  1  
ATOM 1342  H HG3  . LYS A 1 85  ? 15.873  -7.159  9.206   1.00 0.00 ? 85  LYS A HG3  1  
ATOM 1343  H HD2  . LYS A 1 85  ? 17.082  -9.081  8.467   1.00 0.00 ? 85  LYS A HD2  1  
ATOM 1344  H HD3  . LYS A 1 85  ? 17.950  -8.138  7.253   1.00 0.00 ? 85  LYS A HD3  1  
ATOM 1345  H HE2  . LYS A 1 85  ? 19.227  -7.024  8.879   1.00 0.00 ? 85  LYS A HE2  1  
ATOM 1346  H HE3  . LYS A 1 85  ? 18.148  -7.514  10.184  1.00 0.00 ? 85  LYS A HE3  1  
ATOM 1347  H HZ1  . LYS A 1 85  ? 19.053  -9.854  9.057   1.00 0.00 ? 85  LYS A HZ1  1  
ATOM 1348  H HZ2  . LYS A 1 85  ? 19.530  -9.192  10.539  1.00 0.00 ? 85  LYS A HZ2  1  
ATOM 1349  H HZ3  . LYS A 1 85  ? 20.419  -8.859  9.139   1.00 0.00 ? 85  LYS A HZ3  1  
ATOM 1350  N N    . HIS A 1 86  ? 13.994  -6.293  4.708   1.00 0.00 ? 86  HIS A N    1  
ATOM 1351  C CA   . HIS A 1 86  ? 13.233  -6.490  3.479   1.00 0.00 ? 86  HIS A CA   1  
ATOM 1352  C C    . HIS A 1 86  ? 12.007  -5.583  3.447   1.00 0.00 ? 86  HIS A C    1  
ATOM 1353  O O    . HIS A 1 86  ? 10.882  -6.046  3.256   1.00 0.00 ? 86  HIS A O    1  
ATOM 1354  C CB   . HIS A 1 86  ? 12.803  -7.952  3.349   1.00 0.00 ? 86  HIS A CB   1  
ATOM 1355  C CG   . HIS A 1 86  ? 13.804  -8.921  3.898   1.00 0.00 ? 86  HIS A CG   1  
ATOM 1356  N ND1  . HIS A 1 86  ? 15.051  -9.112  3.340   1.00 0.00 ? 86  HIS A ND1  1  
ATOM 1357  C CD2  . HIS A 1 86  ? 13.738  -9.755  4.962   1.00 0.00 ? 86  HIS A CD2  1  
ATOM 1358  C CE1  . HIS A 1 86  ? 15.707  -10.023 4.036   1.00 0.00 ? 86  HIS A CE1  1  
ATOM 1359  N NE2  . HIS A 1 86  ? 14.933  -10.429 5.026   1.00 0.00 ? 86  HIS A NE2  1  
ATOM 1360  H H    . HIS A 1 86  ? 14.946  -6.072  4.650   1.00 0.00 ? 86  HIS A H    1  
ATOM 1361  H HA   . HIS A 1 86  ? 13.873  -6.237  2.648   1.00 0.00 ? 86  HIS A HA   1  
ATOM 1362  H HB2  . HIS A 1 86  ? 11.875  -8.096  3.883   1.00 0.00 ? 86  HIS A HB2  1  
ATOM 1363  H HB3  . HIS A 1 86  ? 12.652  -8.185  2.305   1.00 0.00 ? 86  HIS A HB3  1  
ATOM 1364  H HD1  . HIS A 1 86  ? 15.401  -8.650  2.551   1.00 0.00 ? 86  HIS A HD1  1  
ATOM 1365  H HD2  . HIS A 1 86  ? 12.900  -9.871  5.636   1.00 0.00 ? 86  HIS A HD2  1  
ATOM 1366  H HE1  . HIS A 1 86  ? 16.707  -10.376 3.832   1.00 0.00 ? 86  HIS A HE1  1  
ATOM 1367  H HE2  . HIS A 1 86  ? 15.142  -11.162 5.642   1.00 0.00 ? 86  HIS A HE2  1  
ATOM 1368  N N    . THR A 1 87  ? 12.231  -4.286  3.637   1.00 0.00 ? 87  THR A N    1  
ATOM 1369  C CA   . THR A 1 87  ? 11.145  -3.314  3.633   1.00 0.00 ? 87  THR A CA   1  
ATOM 1370  C C    . THR A 1 87  ? 11.208  -2.425  2.396   1.00 0.00 ? 87  THR A C    1  
ATOM 1371  O O    . THR A 1 87  ? 12.269  -2.256  1.794   1.00 0.00 ? 87  THR A O    1  
ATOM 1372  C CB   . THR A 1 87  ? 11.180  -2.426  4.891   1.00 0.00 ? 87  THR A CB   1  
ATOM 1373  O OG1  . THR A 1 87  ? 11.113  -3.241  6.067   1.00 0.00 ? 87  THR A OG1  1  
ATOM 1374  C CG2  . THR A 1 87  ? 10.026  -1.436  4.887   1.00 0.00 ? 87  THR A CG2  1  
ATOM 1375  H H    . THR A 1 87  ? 13.149  -3.978  3.785   1.00 0.00 ? 87  THR A H    1  
ATOM 1376  H HA   . THR A 1 87  ? 10.211  -3.857  3.627   1.00 0.00 ? 87  THR A HA   1  
ATOM 1377  H HB   . THR A 1 87  ? 12.109  -1.874  4.898   1.00 0.00 ? 87  THR A HB   1  
ATOM 1378  H HG1  . THR A 1 87  ? 11.540  -4.084  5.898   1.00 0.00 ? 87  THR A HG1  1  
ATOM 1379  H HG21 . THR A 1 87  ? 10.094  -0.808  4.012   1.00 0.00 ? 87  THR A HG21 1  
ATOM 1380  H HG22 . THR A 1 87  ? 10.075  -0.822  5.775   1.00 0.00 ? 87  THR A HG22 1  
ATOM 1381  H HG23 . THR A 1 87  ? 9.090   -1.974  4.873   1.00 0.00 ? 87  THR A HG23 1  
ATOM 1382  N N    . PHE A 1 88  ? 10.066  -1.858  2.022   1.00 0.00 ? 88  PHE A N    1  
ATOM 1383  C CA   . PHE A 1 88  ? 9.992   -0.985  0.856   1.00 0.00 ? 88  PHE A CA   1  
ATOM 1384  C C    . PHE A 1 88  ? 9.009   0.157   1.093   1.00 0.00 ? 88  PHE A C    1  
ATOM 1385  O O    . PHE A 1 88  ? 7.905   -0.052  1.596   1.00 0.00 ? 88  PHE A O    1  
ATOM 1386  C CB   . PHE A 1 88  ? 9.574   -1.785  -0.380  1.00 0.00 ? 88  PHE A CB   1  
ATOM 1387  C CG   . PHE A 1 88  ? 8.369   -2.652  -0.153  1.00 0.00 ? 88  PHE A CG   1  
ATOM 1388  C CD1  . PHE A 1 88  ? 8.412   -3.696  0.757   1.00 0.00 ? 88  PHE A CD1  1  
ATOM 1389  C CD2  . PHE A 1 88  ? 7.193   -2.423  -0.849  1.00 0.00 ? 88  PHE A CD2  1  
ATOM 1390  C CE1  . PHE A 1 88  ? 7.305   -4.496  0.967   1.00 0.00 ? 88  PHE A CE1  1  
ATOM 1391  C CE2  . PHE A 1 88  ? 6.083   -3.220  -0.643  1.00 0.00 ? 88  PHE A CE2  1  
ATOM 1392  C CZ   . PHE A 1 88  ? 6.138   -4.257  0.267   1.00 0.00 ? 88  PHE A CZ   1  
ATOM 1393  H H    . PHE A 1 88  ? 9.254   -2.031  2.542   1.00 0.00 ? 88  PHE A H    1  
ATOM 1394  H HA   . PHE A 1 88  ? 10.975  -0.570  0.690   1.00 0.00 ? 88  PHE A HA   1  
ATOM 1395  H HB2  . PHE A 1 88  ? 9.343   -1.100  -1.182  1.00 0.00 ? 88  PHE A HB2  1  
ATOM 1396  H HB3  . PHE A 1 88  ? 10.392  -2.422  -0.681  1.00 0.00 ? 88  PHE A HB3  1  
ATOM 1397  H HD1  . PHE A 1 88  ? 9.323   -3.884  1.306   1.00 0.00 ? 88  PHE A HD1  1  
ATOM 1398  H HD2  . PHE A 1 88  ? 7.148   -1.611  -1.562  1.00 0.00 ? 88  PHE A HD2  1  
ATOM 1399  H HE1  . PHE A 1 88  ? 7.351   -5.307  1.679   1.00 0.00 ? 88  PHE A HE1  1  
ATOM 1400  H HE2  . PHE A 1 88  ? 5.172   -3.030  -1.192  1.00 0.00 ? 88  PHE A HE2  1  
ATOM 1401  H HZ   . PHE A 1 88  ? 5.272   -4.881  0.429   1.00 0.00 ? 88  PHE A HZ   1  
ATOM 1402  N N    . LYS A 1 89  ? 9.418   1.368   0.728   1.00 0.00 ? 89  LYS A N    1  
ATOM 1403  C CA   . LYS A 1 89  ? 8.576   2.545   0.899   1.00 0.00 ? 89  LYS A CA   1  
ATOM 1404  C C    . LYS A 1 89  ? 8.412   3.293   -0.420  1.00 0.00 ? 89  LYS A C    1  
ATOM 1405  O O    . LYS A 1 89  ? 9.314   3.301   -1.256  1.00 0.00 ? 89  LYS A O    1  
ATOM 1406  C CB   . LYS A 1 89  ? 9.174   3.477   1.955   1.00 0.00 ? 89  LYS A CB   1  
ATOM 1407  C CG   . LYS A 1 89  ? 10.662  3.726   1.773   1.00 0.00 ? 89  LYS A CG   1  
ATOM 1408  C CD   . LYS A 1 89  ? 10.921  4.876   0.814   1.00 0.00 ? 89  LYS A CD   1  
ATOM 1409  C CE   . LYS A 1 89  ? 12.296  4.767   0.174   1.00 0.00 ? 89  LYS A CE   1  
ATOM 1410  N NZ   . LYS A 1 89  ? 12.390  5.570   -1.078  1.00 0.00 ? 89  LYS A NZ   1  
ATOM 1411  H H    . LYS A 1 89  ? 10.310  1.471   0.332   1.00 0.00 ? 89  LYS A H    1  
ATOM 1412  H HA   . LYS A 1 89  ? 7.605   2.212   1.234   1.00 0.00 ? 89  LYS A HA   1  
ATOM 1413  H HB2  . LYS A 1 89  ? 8.663   4.427   1.911   1.00 0.00 ? 89  LYS A HB2  1  
ATOM 1414  H HB3  . LYS A 1 89  ? 9.021   3.040   2.932   1.00 0.00 ? 89  LYS A HB3  1  
ATOM 1415  H HG2  . LYS A 1 89  ? 11.097  3.966   2.732   1.00 0.00 ? 89  LYS A HG2  1  
ATOM 1416  H HG3  . LYS A 1 89  ? 11.122  2.831   1.381   1.00 0.00 ? 89  LYS A HG3  1  
ATOM 1417  H HD2  . LYS A 1 89  ? 10.172  4.861   0.037   1.00 0.00 ? 89  LYS A HD2  1  
ATOM 1418  H HD3  . LYS A 1 89  ? 10.859  5.808   1.358   1.00 0.00 ? 89  LYS A HD3  1  
ATOM 1419  H HE2  . LYS A 1 89  ? 13.035  5.123   0.875   1.00 0.00 ? 89  LYS A HE2  1  
ATOM 1420  H HE3  . LYS A 1 89  ? 12.490  3.731   -0.058  1.00 0.00 ? 89  LYS A HE3  1  
ATOM 1421  H HZ1  . LYS A 1 89  ? 11.462  5.615   -1.544  1.00 0.00 ? 89  LYS A HZ1  1  
ATOM 1422  H HZ2  . LYS A 1 89  ? 13.074  5.135   -1.730  1.00 0.00 ? 89  LYS A HZ2  1  
ATOM 1423  H HZ3  . LYS A 1 89  ? 12.704  6.537   -0.859  1.00 0.00 ? 89  LYS A HZ3  1  
ATOM 1424  N N    . ALA A 1 90  ? 7.254   3.921   -0.599  1.00 0.00 ? 90  ALA A N    1  
ATOM 1425  C CA   . ALA A 1 90  ? 6.974   4.675   -1.814  1.00 0.00 ? 90  ALA A CA   1  
ATOM 1426  C C    . ALA A 1 90  ? 6.808   6.161   -1.513  1.00 0.00 ? 90  ALA A C    1  
ATOM 1427  O O    . ALA A 1 90  ? 6.128   6.538   -0.560  1.00 0.00 ? 90  ALA A O    1  
ATOM 1428  C CB   . ALA A 1 90  ? 5.728   4.131   -2.497  1.00 0.00 ? 90  ALA A CB   1  
ATOM 1429  H H    . ALA A 1 90  ? 6.573   3.878   0.104   1.00 0.00 ? 90  ALA A H    1  
ATOM 1430  H HA   . ALA A 1 90  ? 7.809   4.545   -2.488  1.00 0.00 ? 90  ALA A HA   1  
ATOM 1431  H HB1  . ALA A 1 90  ? 5.998   3.705   -3.452  1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1432  H HB2  . ALA A 1 90  ? 5.282   3.368   -1.876  1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1433  H HB3  . ALA A 1 90  ? 5.020   4.933   -2.647  1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1434  N N    . GLU A 1 91  ? 7.436   6.999   -2.332  1.00 0.00 ? 91  GLU A N    1  
ATOM 1435  C CA   . GLU A 1 91  ? 7.358   8.444   -2.151  1.00 0.00 ? 91  GLU A CA   1  
ATOM 1436  C C    . GLU A 1 91  ? 6.939   9.133   -3.447  1.00 0.00 ? 91  GLU A C    1  
ATOM 1437  O O    . GLU A 1 91  ? 7.337   8.724   -4.538  1.00 0.00 ? 91  GLU A O    1  
ATOM 1438  C CB   . GLU A 1 91  ? 8.706   8.995   -1.681  1.00 0.00 ? 91  GLU A CB   1  
ATOM 1439  C CG   . GLU A 1 91  ? 9.618   9.424   -2.818  1.00 0.00 ? 91  GLU A CG   1  
ATOM 1440  C CD   . GLU A 1 91  ? 11.083  9.416   -2.426  1.00 0.00 ? 91  GLU A CD   1  
ATOM 1441  O OE1  . GLU A 1 91  ? 11.600  8.331   -2.086  1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1442  O OE2  . GLU A 1 91  ? 11.712  10.494  -2.460  1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1443  H H    . GLU A 1 91  ? 7.963   6.638   -3.075  1.00 0.00 ? 91  GLU A H    1  
ATOM 1444  H HA   . GLU A 1 91  ? 6.615   8.644   -1.395  1.00 0.00 ? 91  GLU A HA   1  
ATOM 1445  H HB2  . GLU A 1 91  ? 8.530   9.849   -1.045  1.00 0.00 ? 91  GLU A HB2  1  
ATOM 1446  H HB3  . GLU A 1 91  ? 9.213   8.231   -1.110  1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1447  H HG2  . GLU A 1 91  ? 9.480   8.748   -3.648  1.00 0.00 ? 91  GLU A HG2  1  
ATOM 1448  H HG3  . GLU A 1 91  ? 9.348   10.425  -3.121  1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1449  N N    . HIS A 1 92  ? 6.132   10.182  -3.318  1.00 0.00 ? 92  HIS A N    1  
ATOM 1450  C CA   . HIS A 1 92  ? 5.658   10.929  -4.478  1.00 0.00 ? 92  HIS A CA   1  
ATOM 1451  C C    . HIS A 1 92  ? 6.327   12.298  -4.553  1.00 0.00 ? 92  HIS A C    1  
ATOM 1452  O O    . HIS A 1 92  ? 6.088   13.067  -5.484  1.00 0.00 ? 92  HIS A O    1  
ATOM 1453  C CB   . HIS A 1 92  ? 4.139   11.093  -4.420  1.00 0.00 ? 92  HIS A CB   1  
ATOM 1454  C CG   . HIS A 1 92  ? 3.618   12.171  -5.319  1.00 0.00 ? 92  HIS A CG   1  
ATOM 1455  N ND1  . HIS A 1 92  ? 2.937   13.276  -4.853  1.00 0.00 ? 92  HIS A ND1  1  
ATOM 1456  C CD2  . HIS A 1 92  ? 3.683   12.310  -6.664  1.00 0.00 ? 92  HIS A CD2  1  
ATOM 1457  C CE1  . HIS A 1 92  ? 2.604   14.047  -5.873  1.00 0.00 ? 92  HIS A CE1  1  
ATOM 1458  N NE2  . HIS A 1 92  ? 3.046   13.484  -6.983  1.00 0.00 ? 92  HIS A NE2  1  
ATOM 1459  H H    . HIS A 1 92  ? 5.850   10.460  -2.422  1.00 0.00 ? 92  HIS A H    1  
ATOM 1460  H HA   . HIS A 1 92  ? 5.917   10.367  -5.362  1.00 0.00 ? 92  HIS A HA   1  
ATOM 1461  H HB2  . HIS A 1 92  ? 3.672   10.164  -4.711  1.00 0.00 ? 92  HIS A HB2  1  
ATOM 1462  H HB3  . HIS A 1 92  ? 3.848   11.334  -3.407  1.00 0.00 ? 92  HIS A HB3  1  
ATOM 1463  H HD1  . HIS A 1 92  ? 2.728   13.465  -3.915  1.00 0.00 ? 92  HIS A HD1  1  
ATOM 1464  H HD2  . HIS A 1 92  ? 4.149   11.625  -7.358  1.00 0.00 ? 92  HIS A HD2  1  
ATOM 1465  H HE1  . HIS A 1 92  ? 2.064   14.980  -5.810  1.00 0.00 ? 92  HIS A HE1  1  
ATOM 1466  H HE2  . HIS A 1 92  ? 2.860   13.803  -7.890  1.00 0.00 ? 92  HIS A HE2  1  
ATOM 1467  N N    . ALA A 1 93  ? 7.165   12.597  -3.565  1.00 0.00 ? 93  ALA A N    1  
ATOM 1468  C CA   . ALA A 1 93  ? 7.869   13.872  -3.520  1.00 0.00 ? 93  ALA A CA   1  
ATOM 1469  C C    . ALA A 1 93  ? 6.898   15.040  -3.657  1.00 0.00 ? 93  ALA A C    1  
ATOM 1470  O O    . ALA A 1 93  ? 7.128   15.964  -4.437  1.00 0.00 ? 93  ALA A O    1  
ATOM 1471  C CB   . ALA A 1 93  ? 8.926   13.931  -4.614  1.00 0.00 ? 93  ALA A CB   1  
ATOM 1472  H H    . ALA A 1 93  ? 7.315   11.943  -2.851  1.00 0.00 ? 93  ALA A H    1  
ATOM 1473  H HA   . ALA A 1 93  ? 8.370   13.944  -2.566  1.00 0.00 ? 93  ALA A HA   1  
ATOM 1474  H HB1  . ALA A 1 93  ? 8.525   14.446  -5.474  1.00 0.00 ? 93  ALA A HB1  1  
ATOM 1475  H HB2  . ALA A 1 93  ? 9.792   14.462  -4.248  1.00 0.00 ? 93  ALA A HB2  1  
ATOM 1476  H HB3  . ALA A 1 93  ? 9.210   12.928  -4.894  1.00 0.00 ? 93  ALA A HB3  1  
ATOM 1477  N N    . GLY A 1 94  ? 5.811   14.992  -2.893  1.00 0.00 ? 94  GLY A N    1  
ATOM 1478  C CA   . GLY A 1 94  ? 4.821   16.052  -2.945  1.00 0.00 ? 94  GLY A CA   1  
ATOM 1479  C C    . GLY A 1 94  ? 3.686   15.834  -1.964  1.00 0.00 ? 94  GLY A C    1  
ATOM 1480  O O    . GLY A 1 94  ? 3.216   16.777  -1.327  1.00 0.00 ? 94  GLY A O    1  
ATOM 1481  H H    . GLY A 1 94  ? 5.680   14.231  -2.290  1.00 0.00 ? 94  GLY A H    1  
ATOM 1482  H HA2  . GLY A 1 94  ? 5.303   16.991  -2.719  1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1483  H HA3  . GLY A 1 94  ? 4.413   16.099  -3.944  1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1484  N N    . VAL A 1 95  ? 3.242   14.587  -1.842  1.00 0.00 ? 95  VAL A N    1  
ATOM 1485  C CA   . VAL A 1 95  ? 2.155   14.247  -0.932  1.00 0.00 ? 95  VAL A CA   1  
ATOM 1486  C C    . VAL A 1 95  ? 2.689   13.644  0.362   1.00 0.00 ? 95  VAL A C    1  
ATOM 1487  O O    . VAL A 1 95  ? 2.557   14.234  1.434   1.00 0.00 ? 95  VAL A O    1  
ATOM 1488  C CB   . VAL A 1 95  ? 1.170   13.256  -1.580  1.00 0.00 ? 95  VAL A CB   1  
ATOM 1489  C CG1  . VAL A 1 95  ? 0.056   12.898  -0.608  1.00 0.00 ? 95  VAL A CG1  1  
ATOM 1490  C CG2  . VAL A 1 95  ? 0.601   13.834  -2.867  1.00 0.00 ? 95  VAL A CG2  1  
ATOM 1491  H H    . VAL A 1 95  ? 3.657   13.878  -2.377  1.00 0.00 ? 95  VAL A H    1  
ATOM 1492  H HA   . VAL A 1 95  ? 1.618   15.156  -0.700  1.00 0.00 ? 95  VAL A HA   1  
ATOM 1493  H HB   . VAL A 1 95  ? 1.709   12.352  -1.823  1.00 0.00 ? 95  VAL A HB   1  
ATOM 1494  H HG11 . VAL A 1 95  ? 0.457   12.838  0.393   1.00 0.00 ? 95  VAL A HG11 1  
ATOM 1495  H HG12 . VAL A 1 95  ? -0.712  13.658  -0.645  1.00 0.00 ? 95  VAL A HG12 1  
ATOM 1496  H HG13 . VAL A 1 95  ? -0.369  11.944  -0.882  1.00 0.00 ? 95  VAL A HG13 1  
ATOM 1497  H HG21 . VAL A 1 95  ? 1.267   14.596  -3.245  1.00 0.00 ? 95  VAL A HG21 1  
ATOM 1498  H HG22 . VAL A 1 95  ? 0.500   13.048  -3.600  1.00 0.00 ? 95  VAL A HG22 1  
ATOM 1499  H HG23 . VAL A 1 95  ? -0.368  14.269  -2.669  1.00 0.00 ? 95  VAL A HG23 1  
ATOM 1500  N N    . ARG A 1 96  ? 3.294   12.466  0.253   1.00 0.00 ? 96  ARG A N    1  
ATOM 1501  C CA   . ARG A 1 96  ? 3.848   11.781  1.415   1.00 0.00 ? 96  ARG A CA   1  
ATOM 1502  C C    . ARG A 1 96  ? 4.650   10.554  0.992   1.00 0.00 ? 96  ARG A C    1  
ATOM 1503  O O    . ARG A 1 96  ? 4.789   10.269  -0.198  1.00 0.00 ? 96  ARG A O    1  
ATOM 1504  C CB   . ARG A 1 96  ? 2.729   11.368  2.372   1.00 0.00 ? 96  ARG A CB   1  
ATOM 1505  C CG   . ARG A 1 96  ? 1.990   10.112  1.939   1.00 0.00 ? 96  ARG A CG   1  
ATOM 1506  C CD   . ARG A 1 96  ? 0.714   9.911   2.742   1.00 0.00 ? 96  ARG A CD   1  
ATOM 1507  N NE   . ARG A 1 96  ? 0.987   9.407   4.085   1.00 0.00 ? 96  ARG A NE   1  
ATOM 1508  C CZ   . ARG A 1 96  ? 0.046   9.218   5.004   1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1509  N NH1  . ARG A 1 96  ? -1.221  9.491   4.726   1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1510  N NH2  . ARG A 1 96  ? 0.373   8.756   6.204   1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1511  H H    . ARG A 1 96  ? 3.368   12.045  -0.629  1.00 0.00 ? 96  ARG A H    1  
ATOM 1512  H HA   . ARG A 1 96  ? 4.507   12.470  1.923   1.00 0.00 ? 96  ARG A HA   1  
ATOM 1513  H HB2  . ARG A 1 96  ? 3.153   11.189  3.349   1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1514  H HB3  . ARG A 1 96  ? 2.014   12.174  2.441   1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1515  H HG2  . ARG A 1 96  ? 1.734   10.199  0.893   1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1516  H HG3  . ARG A 1 96  ? 2.635   9.258   2.084   1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1517  H HD2  . ARG A 1 96  ? 0.201   10.858  2.820   1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1518  H HD3  . ARG A 1 96  ? 0.086   9.203   2.222   1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1519  H HE   . ARG A 1 96  ? 1.917   9.199   4.312   1.00 0.00 ? 96  ARG A HE   1  
ATOM 1520  H HH11 . ARG A 1 96  ? -1.470  9.839   3.822   1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1521  H HH12 . ARG A 1 96  ? -1.928  9.347   5.419   1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1522  H HH21 . ARG A 1 96  ? 1.327   8.549   6.417   1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1523  H HH22 . ARG A 1 96  ? -0.336  8.615   6.895   1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1524  N N    . THR A 1 97  ? 5.177   9.830   1.975   1.00 0.00 ? 97  THR A N    1  
ATOM 1525  C CA   . THR A 1 97  ? 5.966   8.635   1.706   1.00 0.00 ? 97  THR A CA   1  
ATOM 1526  C C    . THR A 1 97  ? 5.446   7.442   2.499   1.00 0.00 ? 97  THR A C    1  
ATOM 1527  O O    . THR A 1 97  ? 5.586   7.389   3.722   1.00 0.00 ? 97  THR A O    1  
ATOM 1528  C CB   . THR A 1 97  ? 7.452   8.855   2.045   1.00 0.00 ? 97  THR A CB   1  
ATOM 1529  O OG1  . THR A 1 97  ? 7.942   10.019  1.371   1.00 0.00 ? 97  THR A OG1  1  
ATOM 1530  C CG2  . THR A 1 97  ? 8.283   7.644   1.646   1.00 0.00 ? 97  THR A CG2  1  
ATOM 1531  H H    . THR A 1 97  ? 5.031   10.108  2.903   1.00 0.00 ? 97  THR A H    1  
ATOM 1532  H HA   . THR A 1 97  ? 5.888   8.415   0.651   1.00 0.00 ? 97  THR A HA   1  
ATOM 1533  H HB   . THR A 1 97  ? 7.544   9.000   3.112   1.00 0.00 ? 97  THR A HB   1  
ATOM 1534  H HG1  . THR A 1 97  ? 8.617   10.440  1.908   1.00 0.00 ? 97  THR A HG1  1  
ATOM 1535  H HG21 . THR A 1 97  ? 8.340   7.586   0.570   1.00 0.00 ? 97  THR A HG21 1  
ATOM 1536  H HG22 . THR A 1 97  ? 7.821   6.747   2.031   1.00 0.00 ? 97  THR A HG22 1  
ATOM 1537  H HG23 . THR A 1 97  ? 9.278   7.740   2.055   1.00 0.00 ? 97  THR A HG23 1  
ATOM 1538  N N    . TYR A 1 98  ? 4.847   6.486   1.798   1.00 0.00 ? 98  TYR A N    1  
ATOM 1539  C CA   . TYR A 1 98  ? 4.304   5.294   2.438   1.00 0.00 ? 98  TYR A CA   1  
ATOM 1540  C C    . TYR A 1 98  ? 5.397   4.255   2.670   1.00 0.00 ? 98  TYR A C    1  
ATOM 1541  O O    . TYR A 1 98  ? 6.469   4.319   2.068   1.00 0.00 ? 98  TYR A O    1  
ATOM 1542  C CB   . TYR A 1 98  ? 3.187   4.694   1.583   1.00 0.00 ? 98  TYR A CB   1  
ATOM 1543  C CG   . TYR A 1 98  ? 1.859   5.399   1.739   1.00 0.00 ? 98  TYR A CG   1  
ATOM 1544  C CD1  . TYR A 1 98  ? 1.041   5.149   2.834   1.00 0.00 ? 98  TYR A CD1  1  
ATOM 1545  C CD2  . TYR A 1 98  ? 1.423   6.317   0.791   1.00 0.00 ? 98  TYR A CD2  1  
ATOM 1546  C CE1  . TYR A 1 98  ? -0.173  5.791   2.979   1.00 0.00 ? 98  TYR A CE1  1  
ATOM 1547  C CE2  . TYR A 1 98  ? 0.210   6.965   0.930   1.00 0.00 ? 98  TYR A CE2  1  
ATOM 1548  C CZ   . TYR A 1 98  ? -0.584  6.698   2.025   1.00 0.00 ? 98  TYR A CZ   1  
ATOM 1549  O OH   . TYR A 1 98  ? -1.793  7.341   2.168   1.00 0.00 ? 98  TYR A OH   1  
ATOM 1550  H H    . TYR A 1 98  ? 4.766   6.585   0.826   1.00 0.00 ? 98  TYR A H    1  
ATOM 1551  H HA   . TYR A 1 98  ? 3.894   5.588   3.393   1.00 0.00 ? 98  TYR A HA   1  
ATOM 1552  H HB2  . TYR A 1 98  ? 3.471   4.748   0.543   1.00 0.00 ? 98  TYR A HB2  1  
ATOM 1553  H HB3  . TYR A 1 98  ? 3.048   3.659   1.860   1.00 0.00 ? 98  TYR A HB3  1  
ATOM 1554  H HD1  . TYR A 1 98  ? 1.366   4.438   3.579   1.00 0.00 ? 98  TYR A HD1  1  
ATOM 1555  H HD2  . TYR A 1 98  ? 2.047   6.524   -0.066  1.00 0.00 ? 98  TYR A HD2  1  
ATOM 1556  H HE1  . TYR A 1 98  ? -0.795  5.583   3.837   1.00 0.00 ? 98  TYR A HE1  1  
ATOM 1557  H HE2  . TYR A 1 98  ? -0.112  7.676   0.183   1.00 0.00 ? 98  TYR A HE2  1  
ATOM 1558  H HH   . TYR A 1 98  ? -1.712  8.029   2.832   1.00 0.00 ? 98  TYR A HH   1  
ATOM 1559  N N    . PHE A 1 99  ? 5.117   3.298   3.548   1.00 0.00 ? 99  PHE A N    1  
ATOM 1560  C CA   . PHE A 1 99  ? 6.075   2.244   3.861   1.00 0.00 ? 99  PHE A CA   1  
ATOM 1561  C C    . PHE A 1 99  ? 5.387   0.883   3.916   1.00 0.00 ? 99  PHE A C    1  
ATOM 1562  O O    . PHE A 1 99  ? 4.200   0.786   4.226   1.00 0.00 ? 99  PHE A O    1  
ATOM 1563  C CB   . PHE A 1 99  ? 6.765   2.533   5.196   1.00 0.00 ? 99  PHE A CB   1  
ATOM 1564  C CG   . PHE A 1 99  ? 7.952   3.445   5.071   1.00 0.00 ? 99  PHE A CG   1  
ATOM 1565  C CD1  . PHE A 1 99  ? 7.789   4.771   4.703   1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1566  C CD2  . PHE A 1 99  ? 9.232   2.976   5.321   1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1567  C CE1  . PHE A 1 99  ? 8.879   5.613   4.588   1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1568  C CE2  . PHE A 1 99  ? 10.326  3.814   5.208   1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1569  C CZ   . PHE A 1 99  ? 10.149  5.133   4.840   1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1570  H H    . PHE A 1 99  ? 4.245   3.300   3.997   1.00 0.00 ? 99  PHE A H    1  
ATOM 1571  H HA   . PHE A 1 99  ? 6.817   2.228   3.078   1.00 0.00 ? 99  PHE A HA   1  
ATOM 1572  H HB2  . PHE A 1 99  ? 6.058   2.999   5.865   1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1573  H HB3  . PHE A 1 99  ? 7.104   1.603   5.627   1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1574  H HD1  . PHE A 1 99  ? 6.794   5.147   4.506   1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1575  H HD2  . PHE A 1 99  ? 9.372   1.944   5.608   1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1576  H HE1  . PHE A 1 99  ? 8.737   6.644   4.300   1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1577  H HE2  . PHE A 1 99  ? 11.318  3.436   5.405   1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1578  H HZ   . PHE A 1 99  ? 11.002  5.789   4.751   1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1579  N N    . PHE A 1 100 ? 6.143   -0.168  3.613   1.00 0.00 ? 100 PHE A N    1  
ATOM 1580  C CA   . PHE A 1 100 ? 5.607   -1.524  3.626   1.00 0.00 ? 100 PHE A CA   1  
ATOM 1581  C C    . PHE A 1 100 ? 6.720   -2.547  3.835   1.00 0.00 ? 100 PHE A C    1  
ATOM 1582  O O    . PHE A 1 100 ? 7.626   -2.670  3.011   1.00 0.00 ? 100 PHE A O    1  
ATOM 1583  C CB   . PHE A 1 100 ? 4.869   -1.816  2.318   1.00 0.00 ? 100 PHE A CB   1  
ATOM 1584  C CG   . PHE A 1 100 ? 3.868   -0.760  1.945   1.00 0.00 ? 100 PHE A CG   1  
ATOM 1585  C CD1  . PHE A 1 100 ? 2.698   -0.610  2.671   1.00 0.00 ? 100 PHE A CD1  1  
ATOM 1586  C CD2  . PHE A 1 100 ? 4.098   0.081   0.868   1.00 0.00 ? 100 PHE A CD2  1  
ATOM 1587  C CE1  . PHE A 1 100 ? 1.775   0.361   2.331   1.00 0.00 ? 100 PHE A CE1  1  
ATOM 1588  C CE2  . PHE A 1 100 ? 3.179   1.054   0.524   1.00 0.00 ? 100 PHE A CE2  1  
ATOM 1589  C CZ   . PHE A 1 100 ? 2.015   1.194   1.255   1.00 0.00 ? 100 PHE A CZ   1  
ATOM 1590  H H    . PHE A 1 100 ? 7.083   -0.027  3.374   1.00 0.00 ? 100 PHE A H    1  
ATOM 1591  H HA   . PHE A 1 100 ? 4.910   -1.596  4.446   1.00 0.00 ? 100 PHE A HA   1  
ATOM 1592  H HB2  . PHE A 1 100 ? 5.589   -1.889  1.516   1.00 0.00 ? 100 PHE A HB2  1  
ATOM 1593  H HB3  . PHE A 1 100 ? 4.345   -2.755  2.411   1.00 0.00 ? 100 PHE A HB3  1  
ATOM 1594  H HD1  . PHE A 1 100 ? 2.509   -1.261  3.513   1.00 0.00 ? 100 PHE A HD1  1  
ATOM 1595  H HD2  . PHE A 1 100 ? 5.007   -0.027  0.295   1.00 0.00 ? 100 PHE A HD2  1  
ATOM 1596  H HE1  . PHE A 1 100 ? 0.866   0.467   2.905   1.00 0.00 ? 100 PHE A HE1  1  
ATOM 1597  H HE2  . PHE A 1 100 ? 3.369   1.704   -0.318  1.00 0.00 ? 100 PHE A HE2  1  
ATOM 1598  H HZ   . PHE A 1 100 ? 1.296   1.953   0.988   1.00 0.00 ? 100 PHE A HZ   1  
ATOM 1599  N N    . SER A 1 101 ? 6.645   -3.277  4.943   1.00 0.00 ? 101 SER A N    1  
ATOM 1600  C CA   . SER A 1 101 ? 7.648   -4.285  5.263   1.00 0.00 ? 101 SER A CA   1  
ATOM 1601  C C    . SER A 1 101 ? 7.224   -5.657  4.746   1.00 0.00 ? 101 SER A C    1  
ATOM 1602  O O    . SER A 1 101 ? 6.040   -5.908  4.519   1.00 0.00 ? 101 SER A O    1  
ATOM 1603  C CB   . SER A 1 101 ? 7.876   -4.346  6.775   1.00 0.00 ? 101 SER A CB   1  
ATOM 1604  O OG   . SER A 1 101 ? 8.752   -5.407  7.116   1.00 0.00 ? 101 SER A OG   1  
ATOM 1605  H H    . SER A 1 101 ? 5.898   -3.131  5.561   1.00 0.00 ? 101 SER A H    1  
ATOM 1606  H HA   . SER A 1 101 ? 8.570   -4.001  4.780   1.00 0.00 ? 101 SER A HA   1  
ATOM 1607  H HB2  . SER A 1 101 ? 8.309   -3.416  7.109   1.00 0.00 ? 101 SER A HB2  1  
ATOM 1608  H HB3  . SER A 1 101 ? 6.930   -4.502  7.273   1.00 0.00 ? 101 SER A HB3  1  
ATOM 1609  H HG   . SER A 1 101 ? 9.251   -5.170  7.901   1.00 0.00 ? 101 SER A HG   1  
ATOM 1610  N N    . ALA A 1 102 ? 8.199   -6.540  4.562   1.00 0.00 ? 102 ALA A N    1  
ATOM 1611  C CA   . ALA A 1 102 ? 7.928   -7.887  4.074   1.00 0.00 ? 102 ALA A CA   1  
ATOM 1612  C C    . ALA A 1 102 ? 8.660   -8.931  4.909   1.00 0.00 ? 102 ALA A C    1  
ATOM 1613  O O    . ALA A 1 102 ? 9.821   -8.746  5.272   1.00 0.00 ? 102 ALA A O    1  
ATOM 1614  C CB   . ALA A 1 102 ? 8.324   -8.007  2.609   1.00 0.00 ? 102 ALA A CB   1  
ATOM 1615  H H    . ALA A 1 102 ? 9.123   -6.281  4.761   1.00 0.00 ? 102 ALA A H    1  
ATOM 1616  H HA   . ALA A 1 102 ? 6.864   -8.061  4.149   1.00 0.00 ? 102 ALA A HA   1  
ATOM 1617  H HB1  . ALA A 1 102 ? 8.167   -9.022  2.276   1.00 0.00 ? 102 ALA A HB1  1  
ATOM 1618  H HB2  . ALA A 1 102 ? 7.719   -7.335  2.018   1.00 0.00 ? 102 ALA A HB2  1  
ATOM 1619  H HB3  . ALA A 1 102 ? 9.366   -7.747  2.496   1.00 0.00 ? 102 ALA A HB3  1  
ATOM 1620  N N    . GLU A 1 103 ? 7.973   -10.029 5.210   1.00 0.00 ? 103 GLU A N    1  
ATOM 1621  C CA   . GLU A 1 103 ? 8.559   -11.102 6.004   1.00 0.00 ? 103 GLU A CA   1  
ATOM 1622  C C    . GLU A 1 103 ? 9.807   -11.661 5.327   1.00 0.00 ? 103 GLU A C    1  
ATOM 1623  O O    . GLU A 1 103 ? 10.863  -11.783 5.949   1.00 0.00 ? 103 GLU A O    1  
ATOM 1624  C CB   . GLU A 1 103 ? 7.539   -12.222 6.222   1.00 0.00 ? 103 GLU A CB   1  
ATOM 1625  C CG   . GLU A 1 103 ? 6.249   -11.751 6.873   1.00 0.00 ? 103 GLU A CG   1  
ATOM 1626  C CD   . GLU A 1 103 ? 5.146   -12.789 6.797   1.00 0.00 ? 103 GLU A CD   1  
ATOM 1627  O OE1  . GLU A 1 103 ? 5.262   -13.830 7.477   1.00 0.00 ? 103 GLU A OE1  1  
ATOM 1628  O OE2  . GLU A 1 103 ? 4.166   -12.558 6.058   1.00 0.00 ? 103 GLU A OE2  1  
ATOM 1629  H H    . GLU A 1 103 ? 7.051   -10.119 4.891   1.00 0.00 ? 103 GLU A H    1  
ATOM 1630  H HA   . GLU A 1 103 ? 8.839   -10.691 6.963   1.00 0.00 ? 103 GLU A HA   1  
ATOM 1631  H HB2  . GLU A 1 103 ? 7.297   -12.662 5.266   1.00 0.00 ? 103 GLU A HB2  1  
ATOM 1632  H HB3  . GLU A 1 103 ? 7.982   -12.977 6.854   1.00 0.00 ? 103 GLU A HB3  1  
ATOM 1633  H HG2  . GLU A 1 103 ? 6.445   -11.532 7.912   1.00 0.00 ? 103 GLU A HG2  1  
ATOM 1634  H HG3  . GLU A 1 103 ? 5.915   -10.854 6.373   1.00 0.00 ? 103 GLU A HG3  1  
ATOM 1635  N N    . SER A 1 104 ? 9.678   -12.001 4.048   1.00 0.00 ? 104 SER A N    1  
ATOM 1636  C CA   . SER A 1 104 ? 10.793  -12.551 3.287   1.00 0.00 ? 104 SER A CA   1  
ATOM 1637  C C    . SER A 1 104 ? 11.235  -11.582 2.194   1.00 0.00 ? 104 SER A C    1  
ATOM 1638  O O    . SER A 1 104 ? 10.460  -10.759 1.708   1.00 0.00 ? 104 SER A O    1  
ATOM 1639  C CB   . SER A 1 104 ? 10.401  -13.893 2.666   1.00 0.00 ? 104 SER A CB   1  
ATOM 1640  O OG   . SER A 1 104 ? 9.237   -13.766 1.868   1.00 0.00 ? 104 SER A OG   1  
ATOM 1641  H H    . SER A 1 104 ? 8.810   -11.880 3.608   1.00 0.00 ? 104 SER A H    1  
ATOM 1642  H HA   . SER A 1 104 ? 11.616  -12.706 3.969   1.00 0.00 ? 104 SER A HA   1  
ATOM 1643  H HB2  . SER A 1 104 ? 11.210  -14.250 2.047   1.00 0.00 ? 104 SER A HB2  1  
ATOM 1644  H HB3  . SER A 1 104 ? 10.207  -14.608 3.453   1.00 0.00 ? 104 SER A HB3  1  
ATOM 1645  H HG   . SER A 1 104 ? 8.881   -14.637 1.678   1.00 0.00 ? 104 SER A HG   1  
ATOM 1646  N N    . PRO A 1 105 ? 12.512  -11.682 1.797   1.00 0.00 ? 105 PRO A N    1  
ATOM 1647  C CA   . PRO A 1 105 ? 13.088  -10.824 0.758   1.00 0.00 ? 105 PRO A CA   1  
ATOM 1648  C C    . PRO A 1 105 ? 12.531  -11.137 -0.627  1.00 0.00 ? 105 PRO A C    1  
ATOM 1649  O O    . PRO A 1 105 ? 12.648  -10.332 -1.549  1.00 0.00 ? 105 PRO A O    1  
ATOM 1650  C CB   . PRO A 1 105 ? 14.583  -11.147 0.818   1.00 0.00 ? 105 PRO A CB   1  
ATOM 1651  C CG   . PRO A 1 105 ? 14.650  -12.525 1.380   1.00 0.00 ? 105 PRO A CG   1  
ATOM 1652  C CD   . PRO A 1 105 ? 13.493  -12.641 2.333   1.00 0.00 ? 105 PRO A CD   1  
ATOM 1653  H HA   . PRO A 1 105 ? 12.935  -9.777  0.977   1.00 0.00 ? 105 PRO A HA   1  
ATOM 1654  H HB2  . PRO A 1 105 ? 15.004  -11.103 -0.176  1.00 0.00 ? 105 PRO A HB2  1  
ATOM 1655  H HB3  . PRO A 1 105 ? 15.083  -10.436 1.458   1.00 0.00 ? 105 PRO A HB3  1  
ATOM 1656  H HG2  . PRO A 1 105 ? 14.556  -13.250 0.585   1.00 0.00 ? 105 PRO A HG2  1  
ATOM 1657  H HG3  . PRO A 1 105 ? 15.584  -12.662 1.905   1.00 0.00 ? 105 PRO A HG3  1  
ATOM 1658  H HD2  . PRO A 1 105 ? 13.096  -13.645 2.324   1.00 0.00 ? 105 PRO A HD2  1  
ATOM 1659  H HD3  . PRO A 1 105 ? 13.798  -12.363 3.331   1.00 0.00 ? 105 PRO A HD3  1  
ATOM 1660  N N    . GLU A 1 106 ? 11.925  -12.313 -0.764  1.00 0.00 ? 106 GLU A N    1  
ATOM 1661  C CA   . GLU A 1 106 ? 11.350  -12.731 -2.037  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1662  C C    . GLU A 1 106 ? 10.055  -11.978 -2.323  1.00 0.00 ? 106 GLU A C    1  
ATOM 1663  O O    . GLU A 1 106 ? 9.774   -11.618 -3.466  1.00 0.00 ? 106 GLU A O    1  
ATOM 1664  C CB   . GLU A 1 106 ? 11.086  -14.238 -2.031  1.00 0.00 ? 106 GLU A CB   1  
ATOM 1665  C CG   . GLU A 1 106 ? 12.341  -15.077 -2.205  1.00 0.00 ? 106 GLU A CG   1  
ATOM 1666  C CD   . GLU A 1 106 ? 13.154  -15.181 -0.930  1.00 0.00 ? 106 GLU A CD   1  
ATOM 1667  O OE1  . GLU A 1 106 ? 12.588  -15.592 0.104   1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1668  O OE2  . GLU A 1 106 ? 14.359  -14.852 -0.967  1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1669  H H    . GLU A 1 106 ? 11.863  -12.912 0.009   1.00 0.00 ? 106 GLU A H    1  
ATOM 1670  H HA   . GLU A 1 106 ? 12.064  -12.504 -2.814  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1671  H HB2  . GLU A 1 106 ? 10.625  -14.508 -1.092  1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1672  H HB3  . GLU A 1 106 ? 10.406  -14.475 -2.836  1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1673  H HG2  . GLU A 1 106 ? 12.054  -16.072 -2.513  1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1674  H HG3  . GLU A 1 106 ? 12.955  -14.628 -2.972  1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1675  N N    . GLU A 1 107 ? 9.269   -11.743 -1.277  1.00 0.00 ? 107 GLU A N    1  
ATOM 1676  C CA   . GLU A 1 107 ? 8.003   -11.034 -1.416  1.00 0.00 ? 107 GLU A CA   1  
ATOM 1677  C C    . GLU A 1 107 ? 8.237   -9.555  -1.708  1.00 0.00 ? 107 GLU A C    1  
ATOM 1678  O O    . GLU A 1 107 ? 7.602   -8.978  -2.591  1.00 0.00 ? 107 GLU A O    1  
ATOM 1679  C CB   . GLU A 1 107 ? 7.164   -11.187 -0.146  1.00 0.00 ? 107 GLU A CB   1  
ATOM 1680  C CG   . GLU A 1 107 ? 6.356   -12.473 -0.102  1.00 0.00 ? 107 GLU A CG   1  
ATOM 1681  C CD   . GLU A 1 107 ? 7.229   -13.713 -0.131  1.00 0.00 ? 107 GLU A CD   1  
ATOM 1682  O OE1  . GLU A 1 107 ? 8.008   -13.866 -1.094  1.00 0.00 ? 107 GLU A OE1  1  
ATOM 1683  O OE2  . GLU A 1 107 ? 7.133   -14.529 0.809   1.00 0.00 ? 107 GLU A OE2  1  
ATOM 1684  H H    . GLU A 1 107 ? 9.548   -12.055 -0.390  1.00 0.00 ? 107 GLU A H    1  
ATOM 1685  H HA   . GLU A 1 107 ? 7.467   -11.472 -2.245  1.00 0.00 ? 107 GLU A HA   1  
ATOM 1686  H HB2  . GLU A 1 107 ? 7.823   -11.171 0.710   1.00 0.00 ? 107 GLU A HB2  1  
ATOM 1687  H HB3  . GLU A 1 107 ? 6.480   -10.355 -0.078  1.00 0.00 ? 107 GLU A HB3  1  
ATOM 1688  H HG2  . GLU A 1 107 ? 5.771   -12.485 0.806   1.00 0.00 ? 107 GLU A HG2  1  
ATOM 1689  H HG3  . GLU A 1 107 ? 5.694   -12.497 -0.955  1.00 0.00 ? 107 GLU A HG3  1  
ATOM 1690  N N    . GLN A 1 108 ? 9.153   -8.948  -0.960  1.00 0.00 ? 108 GLN A N    1  
ATOM 1691  C CA   . GLN A 1 108 ? 9.470   -7.536  -1.138  1.00 0.00 ? 108 GLN A CA   1  
ATOM 1692  C C    . GLN A 1 108 ? 9.841   -7.239  -2.587  1.00 0.00 ? 108 GLN A C    1  
ATOM 1693  O O    . GLN A 1 108 ? 9.201   -6.420  -3.246  1.00 0.00 ? 108 GLN A O    1  
ATOM 1694  C CB   . GLN A 1 108 ? 10.618  -7.129  -0.212  1.00 0.00 ? 108 GLN A CB   1  
ATOM 1695  C CG   . GLN A 1 108 ? 11.153  -5.732  -0.484  1.00 0.00 ? 108 GLN A CG   1  
ATOM 1696  C CD   . GLN A 1 108 ? 12.595  -5.564  -0.049  1.00 0.00 ? 108 GLN A CD   1  
ATOM 1697  O OE1  . GLN A 1 108 ? 13.378  -6.514  -0.075  1.00 0.00 ? 108 GLN A OE1  1  
ATOM 1698  N NE2  . GLN A 1 108 ? 12.956  -4.351  0.353   1.00 0.00 ? 108 GLN A NE2  1  
ATOM 1699  H H    . GLN A 1 108 ? 9.626   -9.461  -0.273  1.00 0.00 ? 108 GLN A H    1  
ATOM 1700  H HA   . GLN A 1 108 ? 8.592   -6.964  -0.880  1.00 0.00 ? 108 GLN A HA   1  
ATOM 1701  H HB2  . GLN A 1 108 ? 10.272  -7.166  0.810   1.00 0.00 ? 108 GLN A HB2  1  
ATOM 1702  H HB3  . GLN A 1 108 ? 11.430  -7.831  -0.335  1.00 0.00 ? 108 GLN A HB3  1  
ATOM 1703  H HG2  . GLN A 1 108 ? 11.087  -5.534  -1.543  1.00 0.00 ? 108 GLN A HG2  1  
ATOM 1704  H HG3  . GLN A 1 108 ? 10.545  -5.018  0.053   1.00 0.00 ? 108 GLN A HG3  1  
ATOM 1705  H HE21 . GLN A 1 108 ? 12.278  -3.642  0.348   1.00 0.00 ? 108 GLN A HE21 1  
ATOM 1706  H HE22 . GLN A 1 108 ? 13.882  -4.215  0.640   1.00 0.00 ? 108 GLN A HE22 1  
ATOM 1707  N N    . GLU A 1 109 ? 10.878  -7.911  -3.077  1.00 0.00 ? 109 GLU A N    1  
ATOM 1708  C CA   . GLU A 1 109 ? 11.333  -7.718  -4.449  1.00 0.00 ? 109 GLU A CA   1  
ATOM 1709  C C    . GLU A 1 109 ? 10.186  -7.914  -5.436  1.00 0.00 ? 109 GLU A C    1  
ATOM 1710  O O    . GLU A 1 109 ? 9.968   -7.088  -6.322  1.00 0.00 ? 109 GLU A O    1  
ATOM 1711  C CB   . GLU A 1 109 ? 12.471  -8.688  -4.774  1.00 0.00 ? 109 GLU A CB   1  
ATOM 1712  C CG   . GLU A 1 109 ? 11.995  -10.024 -5.320  1.00 0.00 ? 109 GLU A CG   1  
ATOM 1713  C CD   . GLU A 1 109 ? 13.141  -10.932 -5.721  1.00 0.00 ? 109 GLU A CD   1  
ATOM 1714  O OE1  . GLU A 1 109 ? 14.002  -10.487 -6.509  1.00 0.00 ? 109 GLU A OE1  1  
ATOM 1715  O OE2  . GLU A 1 109 ? 13.177  -12.087 -5.247  1.00 0.00 ? 109 GLU A OE2  1  
ATOM 1716  H H    . GLU A 1 109 ? 11.348  -8.551  -2.503  1.00 0.00 ? 109 GLU A H    1  
ATOM 1717  H HA   . GLU A 1 109 ? 11.699  -6.706  -4.537  1.00 0.00 ? 109 GLU A HA   1  
ATOM 1718  H HB2  . GLU A 1 109 ? 13.119  -8.232  -5.508  1.00 0.00 ? 109 GLU A HB2  1  
ATOM 1719  H HB3  . GLU A 1 109 ? 13.038  -8.873  -3.873  1.00 0.00 ? 109 GLU A HB3  1  
ATOM 1720  H HG2  . GLU A 1 109 ? 11.411  -10.521 -4.560  1.00 0.00 ? 109 GLU A HG2  1  
ATOM 1721  H HG3  . GLU A 1 109 ? 11.377  -9.844  -6.187  1.00 0.00 ? 109 GLU A HG3  1  
ATOM 1722  N N    . ALA A 1 110 ? 9.456   -9.013  -5.275  1.00 0.00 ? 110 ALA A N    1  
ATOM 1723  C CA   . ALA A 1 110 ? 8.331   -9.317  -6.150  1.00 0.00 ? 110 ALA A CA   1  
ATOM 1724  C C    . ALA A 1 110 ? 7.316   -8.179  -6.155  1.00 0.00 ? 110 ALA A C    1  
ATOM 1725  O O    . ALA A 1 110 ? 6.822   -7.779  -7.210  1.00 0.00 ? 110 ALA A O    1  
ATOM 1726  C CB   . ALA A 1 110 ? 7.666   -10.617 -5.723  1.00 0.00 ? 110 ALA A CB   1  
ATOM 1727  H H    . ALA A 1 110 ? 9.679   -9.633  -4.550  1.00 0.00 ? 110 ALA A H    1  
ATOM 1728  H HA   . ALA A 1 110 ? 8.713   -9.449  -7.152  1.00 0.00 ? 110 ALA A HA   1  
ATOM 1729  H HB1  . ALA A 1 110 ? 7.466   -11.222 -6.595  1.00 0.00 ? 110 ALA A HB1  1  
ATOM 1730  H HB2  . ALA A 1 110 ? 8.325   -11.154 -5.055  1.00 0.00 ? 110 ALA A HB2  1  
ATOM 1731  H HB3  . ALA A 1 110 ? 6.739   -10.398 -5.215  1.00 0.00 ? 110 ALA A HB3  1  
ATOM 1732  N N    . TRP A 1 111 ? 7.008   -7.662  -4.971  1.00 0.00 ? 111 TRP A N    1  
ATOM 1733  C CA   . TRP A 1 111 ? 6.051   -6.569  -4.840  1.00 0.00 ? 111 TRP A CA   1  
ATOM 1734  C C    . TRP A 1 111 ? 6.516   -5.341  -5.615  1.00 0.00 ? 111 TRP A C    1  
ATOM 1735  O O    . TRP A 1 111 ? 5.736   -4.721  -6.338  1.00 0.00 ? 111 TRP A O    1  
ATOM 1736  C CB   . TRP A 1 111 ? 5.852   -6.212  -3.365  1.00 0.00 ? 111 TRP A CB   1  
ATOM 1737  C CG   . TRP A 1 111 ? 4.743   -6.980  -2.712  1.00 0.00 ? 111 TRP A CG   1  
ATOM 1738  C CD1  . TRP A 1 111 ? 4.867   -7.931  -1.740  1.00 0.00 ? 111 TRP A CD1  1  
ATOM 1739  C CD2  . TRP A 1 111 ? 3.343   -6.864  -2.987  1.00 0.00 ? 111 TRP A CD2  1  
ATOM 1740  N NE1  . TRP A 1 111 ? 3.627   -8.412  -1.393  1.00 0.00 ? 111 TRP A NE1  1  
ATOM 1741  C CE2  . TRP A 1 111 ? 2.676   -7.773  -2.143  1.00 0.00 ? 111 TRP A CE2  1  
ATOM 1742  C CE3  . TRP A 1 111 ? 2.588   -6.079  -3.862  1.00 0.00 ? 111 TRP A CE3  1  
ATOM 1743  C CZ2  . TRP A 1 111 ? 1.291   -7.918  -2.151  1.00 0.00 ? 111 TRP A CZ2  1  
ATOM 1744  C CZ3  . TRP A 1 111 ? 1.213   -6.224  -3.870  1.00 0.00 ? 111 TRP A CZ3  1  
ATOM 1745  C CH2  . TRP A 1 111 ? 0.576   -7.137  -3.018  1.00 0.00 ? 111 TRP A CH2  1  
ATOM 1746  H H    . TRP A 1 111 ? 7.435   -8.023  -4.166  1.00 0.00 ? 111 TRP A H    1  
ATOM 1747  H HA   . TRP A 1 111 ? 5.109   -6.904  -5.249  1.00 0.00 ? 111 TRP A HA   1  
ATOM 1748  H HB2  . TRP A 1 111 ? 6.764   -6.420  -2.825  1.00 0.00 ? 111 TRP A HB2  1  
ATOM 1749  H HB3  . TRP A 1 111 ? 5.622   -5.160  -3.286  1.00 0.00 ? 111 TRP A HB3  1  
ATOM 1750  H HD1  . TRP A 1 111 ? 5.807   -8.249  -1.316  1.00 0.00 ? 111 TRP A HD1  1  
ATOM 1751  H HE1  . TRP A 1 111 ? 3.453   -9.100  -0.716  1.00 0.00 ? 111 TRP A HE1  1  
ATOM 1752  H HE3  . TRP A 1 111 ? 3.060   -5.370  -4.526  1.00 0.00 ? 111 TRP A HE3  1  
ATOM 1753  H HZ2  . TRP A 1 111 ? 0.785   -8.617  -1.501  1.00 0.00 ? 111 TRP A HZ2  1  
ATOM 1754  H HZ3  . TRP A 1 111 ? 0.613   -5.626  -4.539  1.00 0.00 ? 111 TRP A HZ3  1  
ATOM 1755  H HH2  . TRP A 1 111 ? -0.499  -7.216  -3.058  1.00 0.00 ? 111 TRP A HH2  1  
ATOM 1756  N N    . ILE A 1 112 ? 7.789   -4.996  -5.458  1.00 0.00 ? 112 ILE A N    1  
ATOM 1757  C CA   . ILE A 1 112 ? 8.357   -3.842  -6.145  1.00 0.00 ? 112 ILE A CA   1  
ATOM 1758  C C    . ILE A 1 112 ? 8.217   -3.979  -7.658  1.00 0.00 ? 112 ILE A C    1  
ATOM 1759  O O    . ILE A 1 112 ? 8.033   -2.990  -8.365  1.00 0.00 ? 112 ILE A O    1  
ATOM 1760  C CB   . ILE A 1 112 ? 9.845   -3.654  -5.794  1.00 0.00 ? 112 ILE A CB   1  
ATOM 1761  C CG1  . ILE A 1 112 ? 9.997   -3.249  -4.326  1.00 0.00 ? 112 ILE A CG1  1  
ATOM 1762  C CG2  . ILE A 1 112 ? 10.477  -2.612  -6.705  1.00 0.00 ? 112 ILE A CG2  1  
ATOM 1763  C CD1  . ILE A 1 112 ? 11.426  -3.296  -3.832  1.00 0.00 ? 112 ILE A CD1  1  
ATOM 1764  H H    . ILE A 1 112 ? 8.361   -5.530  -4.868  1.00 0.00 ? 112 ILE A H    1  
ATOM 1765  H HA   . ILE A 1 112 ? 7.818   -2.964  -5.822  1.00 0.00 ? 112 ILE A HA   1  
ATOM 1766  H HB   . ILE A 1 112 ? 10.352  -4.593  -5.955  1.00 0.00 ? 112 ILE A HB   1  
ATOM 1767  H HG12 . ILE A 1 112 ? 9.636   -2.240  -4.198  1.00 0.00 ? 112 ILE A HG12 1  
ATOM 1768  H HG13 . ILE A 1 112 ? 9.411   -3.917  -3.713  1.00 0.00 ? 112 ILE A HG13 1  
ATOM 1769  H HG21 . ILE A 1 112 ? 9.977   -1.665  -6.569  1.00 0.00 ? 112 ILE A HG21 1  
ATOM 1770  H HG22 . ILE A 1 112 ? 11.522  -2.506  -6.459  1.00 0.00 ? 112 ILE A HG22 1  
ATOM 1771  H HG23 . ILE A 1 112 ? 10.379  -2.927  -7.733  1.00 0.00 ? 112 ILE A HG23 1  
ATOM 1772  H HD11 . ILE A 1 112 ? 11.716  -4.324  -3.667  1.00 0.00 ? 112 ILE A HD11 1  
ATOM 1773  H HD12 . ILE A 1 112 ? 12.078  -2.854  -4.570  1.00 0.00 ? 112 ILE A HD12 1  
ATOM 1774  H HD13 . ILE A 1 112 ? 11.505  -2.747  -2.905  1.00 0.00 ? 112 ILE A HD13 1  
ATOM 1775  N N    . GLN A 1 113 ? 8.304   -5.213  -8.145  1.00 0.00 ? 113 GLN A N    1  
ATOM 1776  C CA   . GLN A 1 113 ? 8.185   -5.479  -9.574  1.00 0.00 ? 113 GLN A CA   1  
ATOM 1777  C C    . GLN A 1 113 ? 6.847   -4.984  -10.111 1.00 0.00 ? 113 GLN A C    1  
ATOM 1778  O O    . GLN A 1 113 ? 6.783   -4.368  -11.174 1.00 0.00 ? 113 GLN A O    1  
ATOM 1779  C CB   . GLN A 1 113 ? 8.337   -6.976  -9.849  1.00 0.00 ? 113 GLN A CB   1  
ATOM 1780  C CG   . GLN A 1 113 ? 9.673   -7.545  -9.401  1.00 0.00 ? 113 GLN A CG   1  
ATOM 1781  C CD   . GLN A 1 113 ? 10.094  -8.755  -10.212 1.00 0.00 ? 113 GLN A CD   1  
ATOM 1782  O OE1  . GLN A 1 113 ? 9.460   -9.809  -10.151 1.00 0.00 ? 113 GLN A OE1  1  
ATOM 1783  N NE2  . GLN A 1 113 ? 11.168  -8.609  -10.979 1.00 0.00 ? 113 GLN A NE2  1  
ATOM 1784  H H    . GLN A 1 113 ? 8.451   -5.961  -7.530  1.00 0.00 ? 113 GLN A H    1  
ATOM 1785  H HA   . GLN A 1 113 ? 8.979   -4.948  -10.077 1.00 0.00 ? 113 GLN A HA   1  
ATOM 1786  H HB2  . GLN A 1 113 ? 7.551   -7.506  -9.332  1.00 0.00 ? 113 GLN A HB2  1  
ATOM 1787  H HB3  . GLN A 1 113 ? 8.236   -7.146  -10.911 1.00 0.00 ? 113 GLN A HB3  1  
ATOM 1788  H HG2  . GLN A 1 113 ? 10.429  -6.781  -9.505  1.00 0.00 ? 113 GLN A HG2  1  
ATOM 1789  H HG3  . GLN A 1 113 ? 9.596   -7.835  -8.363  1.00 0.00 ? 113 GLN A HG3  1  
ATOM 1790  H HE21 . GLN A 1 113 ? 11.623  -7.740  -10.977 1.00 0.00 ? 113 GLN A HE21 1  
ATOM 1791  H HE22 . GLN A 1 113 ? 11.463  -9.374  -11.513 1.00 0.00 ? 113 GLN A HE22 1  
ATOM 1792  N N    . ALA A 1 114 ? 5.779   -5.257  -9.368  1.00 0.00 ? 114 ALA A N    1  
ATOM 1793  C CA   . ALA A 1 114 ? 4.442   -4.838  -9.768  1.00 0.00 ? 114 ALA A CA   1  
ATOM 1794  C C    . ALA A 1 114 ? 4.176   -3.391  -9.366  1.00 0.00 ? 114 ALA A C    1  
ATOM 1795  O O    . ALA A 1 114 ? 3.783   -2.569  -10.193 1.00 0.00 ? 114 ALA A O    1  
ATOM 1796  C CB   . ALA A 1 114 ? 3.395   -5.758  -9.158  1.00 0.00 ? 114 ALA A CB   1  
ATOM 1797  H H    . ALA A 1 114 ? 5.894   -5.751  -8.530  1.00 0.00 ? 114 ALA A H    1  
ATOM 1798  H HA   . ALA A 1 114 ? 4.375   -4.920  -10.844 1.00 0.00 ? 114 ALA A HA   1  
ATOM 1799  H HB1  . ALA A 1 114 ? 3.757   -6.140  -8.216  1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1800  H HB2  . ALA A 1 114 ? 2.481   -5.205  -8.996  1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1801  H HB3  . ALA A 1 114 ? 3.204   -6.581  -9.831  1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1802  N N    . MET A 1 115 ? 4.392   -3.088  -8.090  1.00 0.00 ? 115 MET A N    1  
ATOM 1803  C CA   . MET A 1 115 ? 4.176   -1.740  -7.578  1.00 0.00 ? 115 MET A CA   1  
ATOM 1804  C C    . MET A 1 115 ? 5.121   -0.747  -8.247  1.00 0.00 ? 115 MET A C    1  
ATOM 1805  O O    . MET A 1 115 ? 4.683   0.231   -8.852  1.00 0.00 ? 115 MET A O    1  
ATOM 1806  C CB   . MET A 1 115 ? 4.376   -1.709  -6.062  1.00 0.00 ? 115 MET A CB   1  
ATOM 1807  C CG   . MET A 1 115 ? 3.201   -2.277  -5.282  1.00 0.00 ? 115 MET A CG   1  
ATOM 1808  S SD   . MET A 1 115 ? 3.058   -1.572  -3.629  1.00 0.00 ? 115 MET A SD   1  
ATOM 1809  C CE   . MET A 1 115 ? 2.814   -3.052  -2.650  1.00 0.00 ? 115 MET A CE   1  
ATOM 1810  H H    . MET A 1 115 ? 4.705   -3.787  -7.478  1.00 0.00 ? 115 MET A H    1  
ATOM 1811  H HA   . MET A 1 115 ? 3.159   -1.459  -7.804  1.00 0.00 ? 115 MET A HA   1  
ATOM 1812  H HB2  . MET A 1 115 ? 5.256   -2.283  -5.814  1.00 0.00 ? 115 MET A HB2  1  
ATOM 1813  H HB3  . MET A 1 115 ? 4.524   -0.685  -5.750  1.00 0.00 ? 115 MET A HB3  1  
ATOM 1814  H HG2  . MET A 1 115 ? 2.291   -2.070  -5.826  1.00 0.00 ? 115 MET A HG2  1  
ATOM 1815  H HG3  . MET A 1 115 ? 3.329   -3.346  -5.194  1.00 0.00 ? 115 MET A HG3  1  
ATOM 1816  H HE1  . MET A 1 115 ? 3.414   -3.854  -3.055  1.00 0.00 ? 115 MET A HE1  1  
ATOM 1817  H HE2  . MET A 1 115 ? 3.110   -2.862  -1.629  1.00 0.00 ? 115 MET A HE2  1  
ATOM 1818  H HE3  . MET A 1 115 ? 1.772   -3.334  -2.677  1.00 0.00 ? 115 MET A HE3  1  
ATOM 1819  N N    . GLY A 1 116 ? 6.421   -1.004  -8.134  1.00 0.00 ? 116 GLY A N    1  
ATOM 1820  C CA   . GLY A 1 116 ? 7.406   -0.123  -8.732  1.00 0.00 ? 116 GLY A CA   1  
ATOM 1821  C C    . GLY A 1 116 ? 7.081   0.217   -10.173 1.00 0.00 ? 116 GLY A C    1  
ATOM 1822  O O    . GLY A 1 116 ? 7.084   1.387   -10.557 1.00 0.00 ? 116 GLY A O    1  
ATOM 1823  H H    . GLY A 1 116 ? 6.713   -1.798  -7.639  1.00 0.00 ? 116 GLY A H    1  
ATOM 1824  H HA2  . GLY A 1 116 ? 7.452   0.791   -8.159  1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1825  H HA3  . GLY A 1 116 ? 8.372   -0.606  -8.698  1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1826  N N    . GLU A 1 117 ? 6.801   -0.807  -10.973 1.00 0.00 ? 117 GLU A N    1  
ATOM 1827  C CA   . GLU A 1 117 ? 6.475   -0.610  -12.380 1.00 0.00 ? 117 GLU A CA   1  
ATOM 1828  C C    . GLU A 1 117 ? 5.137   0.108   -12.533 1.00 0.00 ? 117 GLU A C    1  
ATOM 1829  O O    . GLU A 1 117 ? 5.055   1.165   -13.159 1.00 0.00 ? 117 GLU A O    1  
ATOM 1830  C CB   . GLU A 1 117 ? 6.431   -1.954  -13.110 1.00 0.00 ? 117 GLU A CB   1  
ATOM 1831  C CG   . GLU A 1 117 ? 7.782   -2.402  -13.642 1.00 0.00 ? 117 GLU A CG   1  
ATOM 1832  C CD   . GLU A 1 117 ? 8.045   -1.911  -15.053 1.00 0.00 ? 117 GLU A CD   1  
ATOM 1833  O OE1  . GLU A 1 117 ? 8.360   -0.714  -15.216 1.00 0.00 ? 117 GLU A OE1  1  
ATOM 1834  O OE2  . GLU A 1 117 ? 7.935   -2.726  -15.993 1.00 0.00 ? 117 GLU A OE2  1  
ATOM 1835  H H    . GLU A 1 117 ? 6.815   -1.716  -10.608 1.00 0.00 ? 117 GLU A H    1  
ATOM 1836  H HA   . GLU A 1 117 ? 7.249   0.002   -12.818 1.00 0.00 ? 117 GLU A HA   1  
ATOM 1837  H HB2  . GLU A 1 117 ? 6.067   -2.708  -12.428 1.00 0.00 ? 117 GLU A HB2  1  
ATOM 1838  H HB3  . GLU A 1 117 ? 5.748   -1.875  -13.943 1.00 0.00 ? 117 GLU A HB3  1  
ATOM 1839  H HG2  . GLU A 1 117 ? 8.555   -2.018  -12.994 1.00 0.00 ? 117 GLU A HG2  1  
ATOM 1840  H HG3  . GLU A 1 117 ? 7.815   -3.481  -13.640 1.00 0.00 ? 117 GLU A HG3  1  
ATOM 1841  N N    . ALA A 1 118 ? 4.090   -0.474  -11.957 1.00 0.00 ? 118 ALA A N    1  
ATOM 1842  C CA   . ALA A 1 118 ? 2.757   0.110   -12.027 1.00 0.00 ? 118 ALA A CA   1  
ATOM 1843  C C    . ALA A 1 118 ? 2.780   1.582   -11.631 1.00 0.00 ? 118 ALA A C    1  
ATOM 1844  O O    . ALA A 1 118 ? 1.913   2.357   -12.034 1.00 0.00 ? 118 ALA A O    1  
ATOM 1845  C CB   . ALA A 1 118 ? 1.795   -0.663  -11.136 1.00 0.00 ? 118 ALA A CB   1  
ATOM 1846  H H    . ALA A 1 118 ? 4.219   -1.315  -11.471 1.00 0.00 ? 118 ALA A H    1  
ATOM 1847  H HA   . ALA A 1 118 ? 2.410   0.028   -13.047 1.00 0.00 ? 118 ALA A HA   1  
ATOM 1848  H HB1  . ALA A 1 118 ? 1.717   -1.680  -11.489 1.00 0.00 ? 118 ALA A HB1  1  
ATOM 1849  H HB2  . ALA A 1 118 ? 2.164   -0.660  -10.121 1.00 0.00 ? 118 ALA A HB2  1  
ATOM 1850  H HB3  . ALA A 1 118 ? 0.822   -0.195  -11.167 1.00 0.00 ? 118 ALA A HB3  1  
ATOM 1851  N N    . ALA A 1 119 ? 3.778   1.961   -10.839 1.00 0.00 ? 119 ALA A N    1  
ATOM 1852  C CA   . ALA A 1 119 ? 3.915   3.341   -10.389 1.00 0.00 ? 119 ALA A CA   1  
ATOM 1853  C C    . ALA A 1 119 ? 4.391   4.243   -11.523 1.00 0.00 ? 119 ALA A C    1  
ATOM 1854  O O    . ALA A 1 119 ? 3.812   5.300   -11.774 1.00 0.00 ? 119 ALA A O    1  
ATOM 1855  C CB   . ALA A 1 119 ? 4.874   3.420   -9.211  1.00 0.00 ? 119 ALA A CB   1  
ATOM 1856  H H    . ALA A 1 119 ? 4.438   1.297   -10.551 1.00 0.00 ? 119 ALA A H    1  
ATOM 1857  H HA   . ALA A 1 119 ? 2.945   3.681   -10.056 1.00 0.00 ? 119 ALA A HA   1  
ATOM 1858  H HB1  . ALA A 1 119 ? 5.595   4.204   -9.386  1.00 0.00 ? 119 ALA A HB1  1  
ATOM 1859  H HB2  . ALA A 1 119 ? 4.318   3.636   -8.310  1.00 0.00 ? 119 ALA A HB2  1  
ATOM 1860  H HB3  . ALA A 1 119 ? 5.387   2.476   -9.101  1.00 0.00 ? 119 ALA A HB3  1  
ATOM 1861  N N    . ARG A 1 120 ? 5.451   3.819   -12.204 1.00 0.00 ? 120 ARG A N    1  
ATOM 1862  C CA   . ARG A 1 120 ? 6.006   4.590   -13.310 1.00 0.00 ? 120 ARG A CA   1  
ATOM 1863  C C    . ARG A 1 120 ? 4.896   5.231   -14.138 1.00 0.00 ? 120 ARG A C    1  
ATOM 1864  O O    . ARG A 1 120 ? 3.827   4.648   -14.318 1.00 0.00 ? 120 ARG A O    1  
ATOM 1865  C CB   . ARG A 1 120 ? 6.869   3.694   -14.201 1.00 0.00 ? 120 ARG A CB   1  
ATOM 1866  C CG   . ARG A 1 120 ? 8.317   3.598   -13.748 1.00 0.00 ? 120 ARG A CG   1  
ATOM 1867  C CD   . ARG A 1 120 ? 8.930   2.258   -14.122 1.00 0.00 ? 120 ARG A CD   1  
ATOM 1868  N NE   . ARG A 1 120 ? 10.089  1.936   -13.294 1.00 0.00 ? 120 ARG A NE   1  
ATOM 1869  C CZ   . ARG A 1 120 ? 11.302  2.437   -13.501 1.00 0.00 ? 120 ARG A CZ   1  
ATOM 1870  N NH1  . ARG A 1 120 ? 11.513  3.279   -14.503 1.00 0.00 ? 120 ARG A NH1  1  
ATOM 1871  N NH2  . ARG A 1 120 ? 12.307  2.096   -12.704 1.00 0.00 ? 120 ARG A NH2  1  
ATOM 1872  H H    . ARG A 1 120 ? 5.869   2.968   -11.957 1.00 0.00 ? 120 ARG A H    1  
ATOM 1873  H HA   . ARG A 1 120 ? 6.624   5.371   -12.893 1.00 0.00 ? 120 ARG A HA   1  
ATOM 1874  H HB2  . ARG A 1 120 ? 6.450   2.699   -14.206 1.00 0.00 ? 120 ARG A HB2  1  
ATOM 1875  H HB3  . ARG A 1 120 ? 6.855   4.087   -15.207 1.00 0.00 ? 120 ARG A HB3  1  
ATOM 1876  H HG2  . ARG A 1 120 ? 8.886   4.386   -14.220 1.00 0.00 ? 120 ARG A HG2  1  
ATOM 1877  H HG3  . ARG A 1 120 ? 8.357   3.716   -12.675 1.00 0.00 ? 120 ARG A HG3  1  
ATOM 1878  H HD2  . ARG A 1 120 ? 8.184   1.488   -13.995 1.00 0.00 ? 120 ARG A HD2  1  
ATOM 1879  H HD3  . ARG A 1 120 ? 9.237   2.294   -15.157 1.00 0.00 ? 120 ARG A HD3  1  
ATOM 1880  H HE   . ARG A 1 120 ? 9.956   1.316   -12.548 1.00 0.00 ? 120 ARG A HE   1  
ATOM 1881  H HH11 . ARG A 1 120 ? 10.757  3.538   -15.105 1.00 0.00 ? 120 ARG A HH11 1  
ATOM 1882  H HH12 . ARG A 1 120 ? 12.427  3.656   -14.656 1.00 0.00 ? 120 ARG A HH12 1  
ATOM 1883  H HH21 . ARG A 1 120 ? 12.152  1.462   -11.948 1.00 0.00 ? 120 ARG A HH21 1  
ATOM 1884  H HH22 . ARG A 1 120 ? 13.219  2.473   -12.861 1.00 0.00 ? 120 ARG A HH22 1  
ATOM 1885  N N    . VAL A 1 121 ? 5.158   6.434   -14.639 1.00 0.00 ? 121 VAL A N    1  
ATOM 1886  C CA   . VAL A 1 121 ? 4.182   7.154   -15.448 1.00 0.00 ? 121 VAL A CA   1  
ATOM 1887  C C    . VAL A 1 121 ? 4.527   7.069   -16.931 1.00 0.00 ? 121 VAL A C    1  
ATOM 1888  O O    . VAL A 1 121 ? 3.660   7.225   -17.790 1.00 0.00 ? 121 VAL A O    1  
ATOM 1889  C CB   . VAL A 1 121 ? 4.094   8.635   -15.036 1.00 0.00 ? 121 VAL A CB   1  
ATOM 1890  C CG1  . VAL A 1 121 ? 2.831   9.271   -15.595 1.00 0.00 ? 121 VAL A CG1  1  
ATOM 1891  C CG2  . VAL A 1 121 ? 4.145   8.770   -13.522 1.00 0.00 ? 121 VAL A CG2  1  
ATOM 1892  H H    . VAL A 1 121 ? 6.028   6.847   -14.461 1.00 0.00 ? 121 VAL A H    1  
ATOM 1893  H HA   . VAL A 1 121 ? 3.215   6.699   -15.288 1.00 0.00 ? 121 VAL A HA   1  
ATOM 1894  H HB   . VAL A 1 121 ? 4.946   9.154   -15.451 1.00 0.00 ? 121 VAL A HB   1  
ATOM 1895  H HG11 . VAL A 1 121 ? 2.471   8.685   -16.427 1.00 0.00 ? 121 VAL A HG11 1  
ATOM 1896  H HG12 . VAL A 1 121 ? 2.075   9.308   -14.824 1.00 0.00 ? 121 VAL A HG12 1  
ATOM 1897  H HG13 . VAL A 1 121 ? 3.051   10.274  -15.931 1.00 0.00 ? 121 VAL A HG13 1  
ATOM 1898  H HG21 . VAL A 1 121 ? 4.897   8.104   -13.125 1.00 0.00 ? 121 VAL A HG21 1  
ATOM 1899  H HG22 . VAL A 1 121 ? 4.391   9.789   -13.260 1.00 0.00 ? 121 VAL A HG22 1  
ATOM 1900  H HG23 . VAL A 1 121 ? 3.182   8.514   -13.105 1.00 0.00 ? 121 VAL A HG23 1  
ATOM 1901  N N    . GLN A 1 122 ? 5.800   6.822   -17.223 1.00 0.00 ? 122 GLN A N    1  
ATOM 1902  C CA   . GLN A 1 122 ? 6.260   6.717   -18.602 1.00 0.00 ? 122 GLN A CA   1  
ATOM 1903  C C    . GLN A 1 122 ? 5.308   5.860   -19.430 1.00 0.00 ? 122 GLN A C    1  
ATOM 1904  O O    . GLN A 1 122 ? 5.099   6.116   -20.617 1.00 0.00 ? 122 GLN A O    1  
ATOM 1905  C CB   . GLN A 1 122 ? 7.670   6.123   -18.648 1.00 0.00 ? 122 GLN A CB   1  
ATOM 1906  C CG   . GLN A 1 122 ? 8.373   6.328   -19.980 1.00 0.00 ? 122 GLN A CG   1  
ATOM 1907  C CD   . GLN A 1 122 ? 8.658   7.788   -20.272 1.00 0.00 ? 122 GLN A CD   1  
ATOM 1908  O OE1  . GLN A 1 122 ? 7.920   8.441   -21.010 1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1909  N NE2  . GLN A 1 122 ? 9.733   8.309   -19.692 1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1910  H H    . GLN A 1 122 ? 6.444   6.707   -16.494 1.00 0.00 ? 122 GLN A H    1  
ATOM 1911  H HA   . GLN A 1 122 ? 6.285   7.712   -19.020 1.00 0.00 ? 122 GLN A HA   1  
ATOM 1912  H HB2  . GLN A 1 122 ? 8.267   6.584   -17.876 1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1913  H HB3  . GLN A 1 122 ? 7.607   5.062   -18.459 1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1914  H HG2  . GLN A 1 122 ? 9.310   5.791   -19.965 1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1915  H HG3  . GLN A 1 122 ? 7.746   5.934   -20.767 1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1916  H HE21 . GLN A 1 122 ? 10.275  7.728   -19.117 1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1917  H HE22 . GLN A 1 122 ? 9.941   9.250   -19.863 1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1918  N N    . GLY A 1 1   ? -36.252 23.365  -16.213 1.00 0.00 ? 1   GLY A N    2  
ATOM 1919  C CA   . GLY A 1 1   ? -35.248 22.418  -15.763 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1920  C C    . GLY A 1 1   ? -35.793 21.437  -14.744 1.00 0.00 ? 1   GLY A C    2  
ATOM 1921  O O    . GLY A 1 1   ? -36.363 21.838  -13.729 1.00 0.00 ? 1   GLY A O    2  
ATOM 1922  H H1   . GLY A 1 1   ? -35.984 24.147  -16.739 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1923  H HA2  . GLY A 1 1   ? -34.880 21.868  -16.616 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1924  H HA3  . GLY A 1 1   ? -34.429 22.964  -15.318 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1925  N N    . SER A 1 2   ? -35.618 20.148  -15.014 1.00 0.00 ? 2   SER A N    2  
ATOM 1926  C CA   . SER A 1 2   ? -36.101 19.106  -14.115 1.00 0.00 ? 2   SER A CA   2  
ATOM 1927  C C    . SER A 1 2   ? -35.034 18.736  -13.089 1.00 0.00 ? 2   SER A C    2  
ATOM 1928  O O    . SER A 1 2   ? -35.282 18.755  -11.884 1.00 0.00 ? 2   SER A O    2  
ATOM 1929  C CB   . SER A 1 2   ? -36.512 17.866  -14.911 1.00 0.00 ? 2   SER A CB   2  
ATOM 1930  O OG   . SER A 1 2   ? -35.431 17.376  -15.685 1.00 0.00 ? 2   SER A OG   2  
ATOM 1931  H H    . SER A 1 2   ? -35.155 19.891  -15.839 1.00 0.00 ? 2   SER A H    2  
ATOM 1932  H HA   . SER A 1 2   ? -36.965 19.492  -13.595 1.00 0.00 ? 2   SER A HA   2  
ATOM 1933  H HB2  . SER A 1 2   ? -36.830 17.092  -14.229 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1934  H HB3  . SER A 1 2   ? -37.327 18.120  -15.572 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1935  H HG   . SER A 1 2   ? -35.538 17.654  -16.598 1.00 0.00 ? 2   SER A HG   2  
ATOM 1936  N N    . SER A 1 3   ? -33.845 18.398  -13.578 1.00 0.00 ? 3   SER A N    2  
ATOM 1937  C CA   . SER A 1 3   ? -32.739 18.020  -12.705 1.00 0.00 ? 3   SER A CA   2  
ATOM 1938  C C    . SER A 1 3   ? -31.398 18.271  -13.387 1.00 0.00 ? 3   SER A C    2  
ATOM 1939  O O    . SER A 1 3   ? -31.244 18.037  -14.585 1.00 0.00 ? 3   SER A O    2  
ATOM 1940  C CB   . SER A 1 3   ? -32.855 16.546  -12.311 1.00 0.00 ? 3   SER A CB   2  
ATOM 1941  O OG   . SER A 1 3   ? -32.128 16.277  -11.125 1.00 0.00 ? 3   SER A OG   2  
ATOM 1942  H H    . SER A 1 3   ? -33.708 18.402  -14.548 1.00 0.00 ? 3   SER A H    2  
ATOM 1943  H HA   . SER A 1 3   ? -32.797 18.627  -11.815 1.00 0.00 ? 3   SER A HA   2  
ATOM 1944  H HB2  . SER A 1 3   ? -33.893 16.301  -12.146 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1945  H HB3  . SER A 1 3   ? -32.462 15.931  -13.107 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1946  H HG   . SER A 1 3   ? -31.301 15.844  -11.347 1.00 0.00 ? 3   SER A HG   2  
ATOM 1947  N N    . GLY A 1 4   ? -30.429 18.751  -12.614 1.00 0.00 ? 4   GLY A N    2  
ATOM 1948  C CA   . GLY A 1 4   ? -29.113 19.028  -13.159 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1949  C C    . GLY A 1 4   ? -28.005 18.777  -12.155 1.00 0.00 ? 4   GLY A C    2  
ATOM 1950  O O    . GLY A 1 4   ? -27.258 19.691  -11.804 1.00 0.00 ? 4   GLY A O    2  
ATOM 1951  H H    . GLY A 1 4   ? -30.609 18.919  -11.665 1.00 0.00 ? 4   GLY A H    2  
ATOM 1952  H HA2  . GLY A 1 4   ? -28.953 18.398  -14.021 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1953  H HA3  . GLY A 1 4   ? -29.074 20.062  -13.470 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1954  N N    . SER A 1 5   ? -27.898 17.536  -11.691 1.00 0.00 ? 5   SER A N    2  
ATOM 1955  C CA   . SER A 1 5   ? -26.876 17.170  -10.718 1.00 0.00 ? 5   SER A CA   2  
ATOM 1956  C C    . SER A 1 5   ? -25.480 17.305  -11.318 1.00 0.00 ? 5   SER A C    2  
ATOM 1957  O O    . SER A 1 5   ? -25.230 16.867  -12.440 1.00 0.00 ? 5   SER A O    2  
ATOM 1958  C CB   . SER A 1 5   ? -27.098 15.737  -10.230 1.00 0.00 ? 5   SER A CB   2  
ATOM 1959  O OG   . SER A 1 5   ? -26.084 15.345  -9.321  1.00 0.00 ? 5   SER A OG   2  
ATOM 1960  H H    . SER A 1 5   ? -28.523 16.852  -12.010 1.00 0.00 ? 5   SER A H    2  
ATOM 1961  H HA   . SER A 1 5   ? -26.962 17.844  -9.878  1.00 0.00 ? 5   SER A HA   2  
ATOM 1962  H HB2  . SER A 1 5   ? -28.054 15.671  -9.734  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1963  H HB3  . SER A 1 5   ? -27.085 15.065  -11.077 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1964  H HG   . SER A 1 5   ? -25.224 15.569  -9.684  1.00 0.00 ? 5   SER A HG   2  
ATOM 1965  N N    . SER A 1 6   ? -24.574 17.915  -10.560 1.00 0.00 ? 6   SER A N    2  
ATOM 1966  C CA   . SER A 1 6   ? -23.204 18.112  -11.017 1.00 0.00 ? 6   SER A CA   2  
ATOM 1967  C C    . SER A 1 6   ? -22.214 17.903  -9.875  1.00 0.00 ? 6   SER A C    2  
ATOM 1968  O O    . SER A 1 6   ? -22.432 18.368  -8.757  1.00 0.00 ? 6   SER A O    2  
ATOM 1969  C CB   . SER A 1 6   ? -23.036 19.516  -11.601 1.00 0.00 ? 6   SER A CB   2  
ATOM 1970  O OG   . SER A 1 6   ? -22.893 20.482  -10.575 1.00 0.00 ? 6   SER A OG   2  
ATOM 1971  H H    . SER A 1 6   ? -24.835 18.242  -9.674  1.00 0.00 ? 6   SER A H    2  
ATOM 1972  H HA   . SER A 1 6   ? -23.004 17.384  -11.789 1.00 0.00 ? 6   SER A HA   2  
ATOM 1973  H HB2  . SER A 1 6   ? -22.156 19.540  -12.227 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1974  H HB3  . SER A 1 6   ? -23.905 19.763  -12.194 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1975  H HG   . SER A 1 6   ? -22.483 21.273  -10.933 1.00 0.00 ? 6   SER A HG   2  
ATOM 1976  N N    . GLY A 1 7   ? -21.125 17.199  -10.165 1.00 0.00 ? 7   GLY A N    2  
ATOM 1977  C CA   . GLY A 1 7   ? -20.117 16.939  -9.153  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1978  C C    . GLY A 1 7   ? -18.724 16.819  -9.739  1.00 0.00 ? 7   GLY A C    2  
ATOM 1979  O O    . GLY A 1 7   ? -18.189 17.781  -10.288 1.00 0.00 ? 7   GLY A O    2  
ATOM 1980  H H    . GLY A 1 7   ? -21.004 16.853  -11.074 1.00 0.00 ? 7   GLY A H    2  
ATOM 1981  H HA2  . GLY A 1 7   ? -20.127 17.746  -8.436  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1982  H HA3  . GLY A 1 7   ? -20.363 16.017  -8.646  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1983  N N    . GLY A 1 8   ? -18.134 15.633  -9.620  1.00 0.00 ? 8   GLY A N    2  
ATOM 1984  C CA   . GLY A 1 8   ? -16.799 15.414  -10.145 1.00 0.00 ? 8   GLY A CA   2  
ATOM 1985  C C    . GLY A 1 8   ? -16.793 15.215  -11.648 1.00 0.00 ? 8   GLY A C    2  
ATOM 1986  O O    . GLY A 1 8   ? -17.804 14.832  -12.236 1.00 0.00 ? 8   GLY A O    2  
ATOM 1987  H H    . GLY A 1 8   ? -18.609 14.902  -9.172  1.00 0.00 ? 8   GLY A H    2  
ATOM 1988  H HA2  . GLY A 1 8   ? -16.184 16.267  -9.902  1.00 0.00 ? 8   GLY A HA2  2  
ATOM 1989  H HA3  . GLY A 1 8   ? -16.380 14.535  -9.676  1.00 0.00 ? 8   GLY A HA3  2  
ATOM 1990  N N    . LYS A 1 9   ? -15.650 15.477  -12.273 1.00 0.00 ? 9   LYS A N    2  
ATOM 1991  C CA   . LYS A 1 9   ? -15.514 15.325  -13.717 1.00 0.00 ? 9   LYS A CA   2  
ATOM 1992  C C    . LYS A 1 9   ? -15.560 13.854  -14.116 1.00 0.00 ? 9   LYS A C    2  
ATOM 1993  O O    . LYS A 1 9   ? -16.385 13.448  -14.935 1.00 0.00 ? 9   LYS A O    2  
ATOM 1994  C CB   . LYS A 1 9   ? -14.204 15.954  -14.195 1.00 0.00 ? 9   LYS A CB   2  
ATOM 1995  C CG   . LYS A 1 9   ? -14.185 16.261  -15.683 1.00 0.00 ? 9   LYS A CG   2  
ATOM 1996  C CD   . LYS A 1 9   ? -14.799 17.619  -15.980 1.00 0.00 ? 9   LYS A CD   2  
ATOM 1997  C CE   . LYS A 1 9   ? -15.005 17.823  -17.473 1.00 0.00 ? 9   LYS A CE   2  
ATOM 1998  N NZ   . LYS A 1 9   ? -15.467 19.204  -17.785 1.00 0.00 ? 9   LYS A NZ   2  
ATOM 1999  H H    . LYS A 1 9   ? -14.877 15.779  -11.749 1.00 0.00 ? 9   LYS A H    2  
ATOM 2000  H HA   . LYS A 1 9   ? -16.342 15.838  -14.183 1.00 0.00 ? 9   LYS A HA   2  
ATOM 2001  H HB2  . LYS A 1 9   ? -14.043 16.876  -13.656 1.00 0.00 ? 9   LYS A HB2  2  
ATOM 2002  H HB3  . LYS A 1 9   ? -13.392 15.274  -13.979 1.00 0.00 ? 9   LYS A HB3  2  
ATOM 2003  H HG2  . LYS A 1 9   ? -13.162 16.258  -16.029 1.00 0.00 ? 9   LYS A HG2  2  
ATOM 2004  H HG3  . LYS A 1 9   ? -14.746 15.500  -16.206 1.00 0.00 ? 9   LYS A HG3  2  
ATOM 2005  H HD2  . LYS A 1 9   ? -15.755 17.688  -15.483 1.00 0.00 ? 9   LYS A HD2  2  
ATOM 2006  H HD3  . LYS A 1 9   ? -14.141 18.391  -15.607 1.00 0.00 ? 9   LYS A HD3  2  
ATOM 2007  H HE2  . LYS A 1 9   ? -14.070 17.642  -17.980 1.00 0.00 ? 9   LYS A HE2  2  
ATOM 2008  H HE3  . LYS A 1 9   ? -15.745 17.118  -17.820 1.00 0.00 ? 9   LYS A HE3  2  
ATOM 2009  H HZ1  . LYS A 1 9   ? -16.392 19.173  -18.258 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 2010  H HZ2  . LYS A 1 9   ? -14.784 19.675  -18.413 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 2011  H HZ3  . LYS A 1 9   ? -15.555 19.758  -16.910 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 2012  N N    . ARG A 1 10  ? -14.670 13.059  -13.531 1.00 0.00 ? 10  ARG A N    2  
ATOM 2013  C CA   . ARG A 1 10  ? -14.609 11.632  -13.826 1.00 0.00 ? 10  ARG A CA   2  
ATOM 2014  C C    . ARG A 1 10  ? -14.958 10.806  -12.591 1.00 0.00 ? 10  ARG A C    2  
ATOM 2015  O O    . ARG A 1 10  ? -15.806 9.916   -12.647 1.00 0.00 ? 10  ARG A O    2  
ATOM 2016  C CB   . ARG A 1 10  ? -13.216 11.252  -14.329 1.00 0.00 ? 10  ARG A CB   2  
ATOM 2017  C CG   . ARG A 1 10  ? -13.202 10.012  -15.207 1.00 0.00 ? 10  ARG A CG   2  
ATOM 2018  C CD   . ARG A 1 10  ? -13.975 10.234  -16.498 1.00 0.00 ? 10  ARG A CD   2  
ATOM 2019  N NE   . ARG A 1 10  ? -13.541 9.330   -17.559 1.00 0.00 ? 10  ARG A NE   2  
ATOM 2020  C CZ   . ARG A 1 10  ? -12.345 9.393   -18.135 1.00 0.00 ? 10  ARG A CZ   2  
ATOM 2021  N NH1  . ARG A 1 10  ? -11.470 10.313  -17.753 1.00 0.00 ? 10  ARG A NH1  2  
ATOM 2022  N NH2  . ARG A 1 10  ? -12.023 8.535   -19.094 1.00 0.00 ? 10  ARG A NH2  2  
ATOM 2023  H H    . ARG A 1 10  ? -14.038 13.440  -12.886 1.00 0.00 ? 10  ARG A H    2  
ATOM 2024  H HA   . ARG A 1 10  ? -15.332 11.422  -14.600 1.00 0.00 ? 10  ARG A HA   2  
ATOM 2025  H HB2  . ARG A 1 10  ? -12.816 12.076  -14.902 1.00 0.00 ? 10  ARG A HB2  2  
ATOM 2026  H HB3  . ARG A 1 10  ? -12.576 11.072  -13.479 1.00 0.00 ? 10  ARG A HB3  2  
ATOM 2027  H HG2  . ARG A 1 10  ? -12.180 9.766   -15.452 1.00 0.00 ? 10  ARG A HG2  2  
ATOM 2028  H HG3  . ARG A 1 10  ? -13.652 9.194   -14.665 1.00 0.00 ? 10  ARG A HG3  2  
ATOM 2029  H HD2  . ARG A 1 10  ? -15.025 10.070  -16.306 1.00 0.00 ? 10  ARG A HD2  2  
ATOM 2030  H HD3  . ARG A 1 10  ? -13.824 11.253  -16.821 1.00 0.00 ? 10  ARG A HD3  2  
ATOM 2031  H HE   . ARG A 1 10  ? -14.172 8.643   -17.856 1.00 0.00 ? 10  ARG A HE   2  
ATOM 2032  H HH11 . ARG A 1 10  ? -11.710 10.960  -17.030 1.00 0.00 ? 10  ARG A HH11 2  
ATOM 2033  H HH12 . ARG A 1 10  ? -10.570 10.358  -18.187 1.00 0.00 ? 10  ARG A HH12 2  
ATOM 2034  H HH21 . ARG A 1 10  ? -12.680 7.840   -19.384 1.00 0.00 ? 10  ARG A HH21 2  
ATOM 2035  H HH22 . ARG A 1 10  ? -11.124 8.583   -19.527 1.00 0.00 ? 10  ARG A HH22 2  
ATOM 2036  N N    . SER A 1 11  ? -14.298 11.108  -11.478 1.00 0.00 ? 11  SER A N    2  
ATOM 2037  C CA   . SER A 1 11  ? -14.535 10.391  -10.230 1.00 0.00 ? 11  SER A CA   2  
ATOM 2038  C C    . SER A 1 11  ? -14.176 11.259  -9.028  1.00 0.00 ? 11  SER A C    2  
ATOM 2039  O O    . SER A 1 11  ? -13.164 11.961  -9.034  1.00 0.00 ? 11  SER A O    2  
ATOM 2040  C CB   . SER A 1 11  ? -13.721 9.096   -10.199 1.00 0.00 ? 11  SER A CB   2  
ATOM 2041  O OG   . SER A 1 11  ? -14.305 8.148   -9.323  1.00 0.00 ? 11  SER A OG   2  
ATOM 2042  H H    . SER A 1 11  ? -13.634 11.829  -11.497 1.00 0.00 ? 11  SER A H    2  
ATOM 2043  H HA   . SER A 1 11  ? -15.586 10.147  -10.183 1.00 0.00 ? 11  SER A HA   2  
ATOM 2044  H HB2  . SER A 1 11  ? -13.683 8.674   -11.192 1.00 0.00 ? 11  SER A HB2  2  
ATOM 2045  H HB3  . SER A 1 11  ? -12.718 9.312   -9.860  1.00 0.00 ? 11  SER A HB3  2  
ATOM 2046  H HG   . SER A 1 11  ? -14.781 7.489   -9.834  1.00 0.00 ? 11  SER A HG   2  
ATOM 2047  N N    . HIS A 1 12  ? -15.014 11.207  -7.997  1.00 0.00 ? 12  HIS A N    2  
ATOM 2048  C CA   . HIS A 1 12  ? -14.786 11.987  -6.786  1.00 0.00 ? 12  HIS A CA   2  
ATOM 2049  C C    . HIS A 1 12  ? -13.854 11.248  -5.831  1.00 0.00 ? 12  HIS A C    2  
ATOM 2050  O O    . HIS A 1 12  ? -12.833 11.787  -5.404  1.00 0.00 ? 12  HIS A O    2  
ATOM 2051  C CB   . HIS A 1 12  ? -16.114 12.289  -6.091  1.00 0.00 ? 12  HIS A CB   2  
ATOM 2052  C CG   . HIS A 1 12  ? -15.986 13.244  -4.944  1.00 0.00 ? 12  HIS A CG   2  
ATOM 2053  N ND1  . HIS A 1 12  ? -15.416 14.493  -5.065  1.00 0.00 ? 12  HIS A ND1  2  
ATOM 2054  C CD2  . HIS A 1 12  ? -16.361 13.127  -3.649  1.00 0.00 ? 12  HIS A CD2  2  
ATOM 2055  C CE1  . HIS A 1 12  ? -15.444 15.103  -3.893  1.00 0.00 ? 12  HIS A CE1  2  
ATOM 2056  N NE2  . HIS A 1 12  ? -16.013 14.295  -3.017  1.00 0.00 ? 12  HIS A NE2  2  
ATOM 2057  H H    . HIS A 1 12  ? -15.803 10.629  -8.052  1.00 0.00 ? 12  HIS A H    2  
ATOM 2058  H HA   . HIS A 1 12  ? -14.321 12.918  -7.074  1.00 0.00 ? 12  HIS A HA   2  
ATOM 2059  H HB2  . HIS A 1 12  ? -16.797 12.720  -6.807  1.00 0.00 ? 12  HIS A HB2  2  
ATOM 2060  H HB3  . HIS A 1 12  ? -16.532 11.367  -5.712  1.00 0.00 ? 12  HIS A HB3  2  
ATOM 2061  H HD1  . HIS A 1 12  ? -15.044 14.875  -5.887  1.00 0.00 ? 12  HIS A HD1  2  
ATOM 2062  H HD2  . HIS A 1 12  ? -16.844 12.273  -3.195  1.00 0.00 ? 12  HIS A HD2  2  
ATOM 2063  H HE1  . HIS A 1 12  ? -15.066 16.093  -3.687  1.00 0.00 ? 12  HIS A HE1  2  
ATOM 2064  H HE2  . HIS A 1 12  ? -16.083 14.466  -2.055  1.00 0.00 ? 12  HIS A HE2  2  
ATOM 2065  N N    . SER A 1 13  ? -14.213 10.013  -5.499  1.00 0.00 ? 13  SER A N    2  
ATOM 2066  C CA   . SER A 1 13  ? -13.412 9.202   -4.590  1.00 0.00 ? 13  SER A CA   2  
ATOM 2067  C C    . SER A 1 13  ? -12.812 8.002   -5.317  1.00 0.00 ? 13  SER A C    2  
ATOM 2068  O O    . SER A 1 13  ? -13.392 7.489   -6.274  1.00 0.00 ? 13  SER A O    2  
ATOM 2069  C CB   . SER A 1 13  ? -14.264 8.724   -3.412  1.00 0.00 ? 13  SER A CB   2  
ATOM 2070  O OG   . SER A 1 13  ? -15.407 8.019   -3.863  1.00 0.00 ? 13  SER A OG   2  
ATOM 2071  H H    . SER A 1 13  ? -15.039 9.639   -5.872  1.00 0.00 ? 13  SER A H    2  
ATOM 2072  H HA   . SER A 1 13  ? -12.609 9.819   -4.215  1.00 0.00 ? 13  SER A HA   2  
ATOM 2073  H HB2  . SER A 1 13  ? -13.675 8.070   -2.787  1.00 0.00 ? 13  SER A HB2  2  
ATOM 2074  H HB3  . SER A 1 13  ? -14.586 9.579   -2.835  1.00 0.00 ? 13  SER A HB3  2  
ATOM 2075  H HG   . SER A 1 13  ? -15.132 7.271   -4.398  1.00 0.00 ? 13  SER A HG   2  
ATOM 2076  N N    . MET A 1 14  ? -11.646 7.561   -4.856  1.00 0.00 ? 14  MET A N    2  
ATOM 2077  C CA   . MET A 1 14  ? -10.968 6.421   -5.462  1.00 0.00 ? 14  MET A CA   2  
ATOM 2078  C C    . MET A 1 14  ? -11.561 5.107   -4.963  1.00 0.00 ? 14  MET A C    2  
ATOM 2079  O O    . MET A 1 14  ? -11.691 4.891   -3.758  1.00 0.00 ? 14  MET A O    2  
ATOM 2080  C CB   . MET A 1 14  ? -9.470  6.468   -5.152  1.00 0.00 ? 14  MET A CB   2  
ATOM 2081  C CG   . MET A 1 14  ? -8.723  7.541   -5.927  1.00 0.00 ? 14  MET A CG   2  
ATOM 2082  S SD   . MET A 1 14  ? -8.704  7.230   -7.703  1.00 0.00 ? 14  MET A SD   2  
ATOM 2083  C CE   . MET A 1 14  ? -7.882  5.640   -7.759  1.00 0.00 ? 14  MET A CE   2  
ATOM 2084  H H    . MET A 1 14  ? -11.232 8.011   -4.091  1.00 0.00 ? 14  MET A H    2  
ATOM 2085  H HA   . MET A 1 14  ? -11.107 6.482   -6.531  1.00 0.00 ? 14  MET A HA   2  
ATOM 2086  H HB2  . MET A 1 14  ? -9.339  6.658   -4.098  1.00 0.00 ? 14  MET A HB2  2  
ATOM 2087  H HB3  . MET A 1 14  ? -9.034  5.510   -5.394  1.00 0.00 ? 14  MET A HB3  2  
ATOM 2088  H HG2  . MET A 1 14  ? -9.199  8.494   -5.748  1.00 0.00 ? 14  MET A HG2  2  
ATOM 2089  H HG3  . MET A 1 14  ? -7.704  7.578   -5.571  1.00 0.00 ? 14  MET A HG3  2  
ATOM 2090  H HE1  . MET A 1 14  ? -8.622  4.855   -7.837  1.00 0.00 ? 14  MET A HE1  2  
ATOM 2091  H HE2  . MET A 1 14  ? -7.227  5.603   -8.617  1.00 0.00 ? 14  MET A HE2  2  
ATOM 2092  H HE3  . MET A 1 14  ? -7.303  5.502   -6.858  1.00 0.00 ? 14  MET A HE3  2  
ATOM 2093  N N    . LYS A 1 15  ? -11.920 4.233   -5.897  1.00 0.00 ? 15  LYS A N    2  
ATOM 2094  C CA   . LYS A 1 15  ? -12.498 2.939   -5.554  1.00 0.00 ? 15  LYS A CA   2  
ATOM 2095  C C    . LYS A 1 15  ? -12.013 1.855   -6.510  1.00 0.00 ? 15  LYS A C    2  
ATOM 2096  O O    . LYS A 1 15  ? -11.833 2.101   -7.703  1.00 0.00 ? 15  LYS A O    2  
ATOM 2097  C CB   . LYS A 1 15  ? -14.026 3.017   -5.586  1.00 0.00 ? 15  LYS A CB   2  
ATOM 2098  C CG   . LYS A 1 15  ? -14.627 3.701   -4.370  1.00 0.00 ? 15  LYS A CG   2  
ATOM 2099  C CD   . LYS A 1 15  ? -16.088 3.328   -4.185  1.00 0.00 ? 15  LYS A CD   2  
ATOM 2100  C CE   . LYS A 1 15  ? -16.595 3.728   -2.808  1.00 0.00 ? 15  LYS A CE   2  
ATOM 2101  N NZ   . LYS A 1 15  ? -18.066 3.532   -2.680  1.00 0.00 ? 15  LYS A NZ   2  
ATOM 2102  H H    . LYS A 1 15  ? -11.791 4.463   -6.842  1.00 0.00 ? 15  LYS A H    2  
ATOM 2103  H HA   . LYS A 1 15  ? -12.180 2.689   -4.553  1.00 0.00 ? 15  LYS A HA   2  
ATOM 2104  H HB2  . LYS A 1 15  ? -14.329 3.563   -6.467  1.00 0.00 ? 15  LYS A HB2  2  
ATOM 2105  H HB3  . LYS A 1 15  ? -14.424 2.013   -5.641  1.00 0.00 ? 15  LYS A HB3  2  
ATOM 2106  H HG2  . LYS A 1 15  ? -14.076 3.402   -3.491  1.00 0.00 ? 15  LYS A HG2  2  
ATOM 2107  H HG3  . LYS A 1 15  ? -14.551 4.772   -4.498  1.00 0.00 ? 15  LYS A HG3  2  
ATOM 2108  H HD2  . LYS A 1 15  ? -16.678 3.835   -4.934  1.00 0.00 ? 15  LYS A HD2  2  
ATOM 2109  H HD3  . LYS A 1 15  ? -16.195 2.259   -4.302  1.00 0.00 ? 15  LYS A HD3  2  
ATOM 2110  H HE2  . LYS A 1 15  ? -16.094 3.126   -2.065  1.00 0.00 ? 15  LYS A HE2  2  
ATOM 2111  H HE3  . LYS A 1 15  ? -16.363 4.770   -2.642  1.00 0.00 ? 15  LYS A HE3  2  
ATOM 2112  H HZ1  . LYS A 1 15  ? -18.266 2.623   -2.217  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM 2113  H HZ2  . LYS A 1 15  ? -18.510 3.536   -3.621  1.00 0.00 ? 15  LYS A HZ2  2  
ATOM 2114  H HZ3  . LYS A 1 15  ? -18.480 4.298   -2.111  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM 2115  N N    . ARG A 1 16  ? -11.805 0.654   -5.979  1.00 0.00 ? 16  ARG A N    2  
ATOM 2116  C CA   . ARG A 1 16  ? -11.341 -0.468  -6.786  1.00 0.00 ? 16  ARG A CA   2  
ATOM 2117  C C    . ARG A 1 16  ? -12.517 -1.209  -7.414  1.00 0.00 ? 16  ARG A C    2  
ATOM 2118  O O    . ARG A 1 16  ? -13.515 -1.486  -6.750  1.00 0.00 ? 16  ARG A O    2  
ATOM 2119  C CB   . ARG A 1 16  ? -10.515 -1.431  -5.931  1.00 0.00 ? 16  ARG A CB   2  
ATOM 2120  C CG   . ARG A 1 16  ? -10.017 -2.648  -6.694  1.00 0.00 ? 16  ARG A CG   2  
ATOM 2121  C CD   . ARG A 1 16  ? -9.874  -3.857  -5.782  1.00 0.00 ? 16  ARG A CD   2  
ATOM 2122  N NE   . ARG A 1 16  ? -9.700  -5.095  -6.538  1.00 0.00 ? 16  ARG A NE   2  
ATOM 2123  C CZ   . ARG A 1 16  ? -9.803  -6.305  -6.000  1.00 0.00 ? 16  ARG A CZ   2  
ATOM 2124  N NH1  . ARG A 1 16  ? -10.079 -6.439  -4.710  1.00 0.00 ? 16  ARG A NH1  2  
ATOM 2125  N NH2  . ARG A 1 16  ? -9.631  -7.384  -6.752  1.00 0.00 ? 16  ARG A NH2  2  
ATOM 2126  H H    . ARG A 1 16  ? -11.966 0.520   -5.022  1.00 0.00 ? 16  ARG A H    2  
ATOM 2127  H HA   . ARG A 1 16  ? -10.716 -0.074  -7.574  1.00 0.00 ? 16  ARG A HA   2  
ATOM 2128  H HB2  . ARG A 1 16  ? -9.658  -0.904  -5.540  1.00 0.00 ? 16  ARG A HB2  2  
ATOM 2129  H HB3  . ARG A 1 16  ? -11.123 -1.774  -5.108  1.00 0.00 ? 16  ARG A HB3  2  
ATOM 2130  H HG2  . ARG A 1 16  ? -10.722 -2.884  -7.477  1.00 0.00 ? 16  ARG A HG2  2  
ATOM 2131  H HG3  . ARG A 1 16  ? -9.056  -2.420  -7.129  1.00 0.00 ? 16  ARG A HG3  2  
ATOM 2132  H HD2  . ARG A 1 16  ? -9.014  -3.711  -5.146  1.00 0.00 ? 16  ARG A HD2  2  
ATOM 2133  H HD3  . ARG A 1 16  ? -10.762 -3.939  -5.174  1.00 0.00 ? 16  ARG A HD3  2  
ATOM 2134  H HE   . ARG A 1 16  ? -9.495  -5.019  -7.493  1.00 0.00 ? 16  ARG A HE   2  
ATOM 2135  H HH11 . ARG A 1 16  ? -10.210 -5.628  -4.140  1.00 0.00 ? 16  ARG A HH11 2  
ATOM 2136  H HH12 . ARG A 1 16  ? -10.157 -7.351  -4.307  1.00 0.00 ? 16  ARG A HH12 2  
ATOM 2137  H HH21 . ARG A 1 16  ? -9.423  -7.286  -7.725  1.00 0.00 ? 16  ARG A HH21 2  
ATOM 2138  H HH22 . ARG A 1 16  ? -9.708  -8.294  -6.347  1.00 0.00 ? 16  ARG A HH22 2  
ATOM 2139  N N    . ASN A 1 17  ? -12.392 -1.526  -8.699  1.00 0.00 ? 17  ASN A N    2  
ATOM 2140  C CA   . ASN A 1 17  ? -13.446 -2.234  -9.418  1.00 0.00 ? 17  ASN A CA   2  
ATOM 2141  C C    . ASN A 1 17  ? -13.236 -3.743  -9.344  1.00 0.00 ? 17  ASN A C    2  
ATOM 2142  O O    . ASN A 1 17  ? -12.111 -4.241  -9.398  1.00 0.00 ? 17  ASN A O    2  
ATOM 2143  C CB   . ASN A 1 17  ? -13.486 -1.784  -10.880 1.00 0.00 ? 17  ASN A CB   2  
ATOM 2144  C CG   . ASN A 1 17  ? -14.020 -0.373  -11.036 1.00 0.00 ? 17  ASN A CG   2  
ATOM 2145  O OD1  . ASN A 1 17  ? -15.226 -0.165  -11.166 1.00 0.00 ? 17  ASN A OD1  2  
ATOM 2146  N ND2  . ASN A 1 17  ? -13.121 0.604   -11.025 1.00 0.00 ? 17  ASN A ND2  2  
ATOM 2147  H H    . ASN A 1 17  ? -11.573 -1.278  -9.175  1.00 0.00 ? 17  ASN A H    2  
ATOM 2148  H HA   . ASN A 1 17  ? -14.388 -1.990  -8.950  1.00 0.00 ? 17  ASN A HA   2  
ATOM 2149  H HB2  . ASN A 1 17  ? -12.485 -1.817  -11.287 1.00 0.00 ? 17  ASN A HB2  2  
ATOM 2150  H HB3  . ASN A 1 17  ? -14.120 -2.454  -11.439 1.00 0.00 ? 17  ASN A HB3  2  
ATOM 2151  H HD21 . ASN A 1 17  ? -12.176 0.364   -10.918 1.00 0.00 ? 17  ASN A HD21 2  
ATOM 2152  H HD22 . ASN A 1 17  ? -13.439 1.526   -11.124 1.00 0.00 ? 17  ASN A HD22 2  
ATOM 2153  N N    . PRO A 1 18  ? -14.343 -4.489  -9.218  1.00 0.00 ? 18  PRO A N    2  
ATOM 2154  C CA   . PRO A 1 18  ? -14.306 -5.952  -9.135  1.00 0.00 ? 18  PRO A CA   2  
ATOM 2155  C C    . PRO A 1 18  ? -13.903 -6.598  -10.456 1.00 0.00 ? 18  PRO A C    2  
ATOM 2156  O O    . PRO A 1 18  ? -13.164 -7.581  -10.478 1.00 0.00 ? 18  PRO A O    2  
ATOM 2157  C CB   . PRO A 1 18  ? -15.747 -6.323  -8.776  1.00 0.00 ? 18  PRO A CB   2  
ATOM 2158  C CG   . PRO A 1 18  ? -16.569 -5.192  -9.290  1.00 0.00 ? 18  PRO A CG   2  
ATOM 2159  C CD   . PRO A 1 18  ? -15.716 -3.962  -9.147  1.00 0.00 ? 18  PRO A CD   2  
ATOM 2160  H HA   . PRO A 1 18  ? -13.641 -6.289  -8.354  1.00 0.00 ? 18  PRO A HA   2  
ATOM 2161  H HB2  . PRO A 1 18  ? -16.012 -7.255  -9.256  1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2162  H HB3  . PRO A 1 18  ? -15.841 -6.424  -7.705  1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2163  H HG2  . PRO A 1 18  ? -16.816 -5.359  -10.327 1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2164  H HG3  . PRO A 1 18  ? -17.468 -5.095  -8.700  1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2165  H HD2  . PRO A 1 18  ? -15.907 -3.274  -9.957  1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2166  H HD3  . PRO A 1 18  ? -15.897 -3.486  -8.194  1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2167  N N    . ASN A 1 19  ? -14.394 -6.038  -11.557 1.00 0.00 ? 19  ASN A N    2  
ATOM 2168  C CA   . ASN A 1 19  ? -14.085 -6.560  -12.883 1.00 0.00 ? 19  ASN A CA   2  
ATOM 2169  C C    . ASN A 1 19  ? -12.585 -6.501  -13.155 1.00 0.00 ? 19  ASN A C    2  
ATOM 2170  O O    . ASN A 1 19  ? -12.008 -7.432  -13.716 1.00 0.00 ? 19  ASN A O    2  
ATOM 2171  C CB   . ASN A 1 19  ? -14.840 -5.769  -13.954 1.00 0.00 ? 19  ASN A CB   2  
ATOM 2172  C CG   . ASN A 1 19  ? -14.370 -4.330  -14.050 1.00 0.00 ? 19  ASN A CG   2  
ATOM 2173  O OD1  . ASN A 1 19  ? -13.326 -4.044  -14.637 1.00 0.00 ? 19  ASN A OD1  2  
ATOM 2174  N ND2  . ASN A 1 19  ? -15.140 -3.417  -13.470 1.00 0.00 ? 19  ASN A ND2  2  
ATOM 2175  H H    . ASN A 1 19  ? -14.979 -5.255  -11.476 1.00 0.00 ? 19  ASN A H    2  
ATOM 2176  H HA   . ASN A 1 19  ? -14.405 -7.590  -12.917 1.00 0.00 ? 19  ASN A HA   2  
ATOM 2177  H HB2  . ASN A 1 19  ? -14.689 -6.241  -14.914 1.00 0.00 ? 19  ASN A HB2  2  
ATOM 2178  H HB3  . ASN A 1 19  ? -15.893 -5.770  -13.719 1.00 0.00 ? 19  ASN A HB3  2  
ATOM 2179  H HD21 . ASN A 1 19  ? -15.957 -3.718  -13.020 1.00 0.00 ? 19  ASN A HD21 2  
ATOM 2180  H HD22 . ASN A 1 19  ? -14.860 -2.479  -13.517 1.00 0.00 ? 19  ASN A HD22 2  
ATOM 2181  N N    . ALA A 1 20  ? -11.959 -5.400  -12.752 1.00 0.00 ? 20  ALA A N    2  
ATOM 2182  C CA   . ALA A 1 20  ? -10.526 -5.220  -12.949 1.00 0.00 ? 20  ALA A CA   2  
ATOM 2183  C C    . ALA A 1 20  ? -9.742  -6.398  -12.380 1.00 0.00 ? 20  ALA A C    2  
ATOM 2184  O O    . ALA A 1 20  ? -9.965  -6.836  -11.251 1.00 0.00 ? 20  ALA A O    2  
ATOM 2185  C CB   . ALA A 1 20  ? -10.065 -3.918  -12.311 1.00 0.00 ? 20  ALA A CB   2  
ATOM 2186  H H    . ALA A 1 20  ? -12.473 -4.692  -12.311 1.00 0.00 ? 20  ALA A H    2  
ATOM 2187  H HA   . ALA A 1 20  ? -10.340 -5.157  -14.012 1.00 0.00 ? 20  ALA A HA   2  
ATOM 2188  H HB1  . ALA A 1 20  ? -9.372  -4.135  -11.512 1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2189  H HB2  . ALA A 1 20  ? -9.576  -3.307  -13.056 1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2190  H HB3  . ALA A 1 20  ? -10.918 -3.390  -11.915 1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2191  N N    . PRO A 1 21  ? -8.800  -6.924  -13.177 1.00 0.00 ? 21  PRO A N    2  
ATOM 2192  C CA   . PRO A 1 21  ? -7.964  -8.058  -12.773 1.00 0.00 ? 21  PRO A CA   2  
ATOM 2193  C C    . PRO A 1 21  ? -6.968  -7.684  -11.681 1.00 0.00 ? 21  PRO A C    2  
ATOM 2194  O O    . PRO A 1 21  ? -6.279  -6.668  -11.776 1.00 0.00 ? 21  PRO A O    2  
ATOM 2195  C CB   . PRO A 1 21  ? -7.228  -8.433  -14.062 1.00 0.00 ? 21  PRO A CB   2  
ATOM 2196  C CG   . PRO A 1 21  ? -7.204  -7.177  -14.863 1.00 0.00 ? 21  PRO A CG   2  
ATOM 2197  C CD   . PRO A 1 21  ? -8.480  -6.452  -14.535 1.00 0.00 ? 21  PRO A CD   2  
ATOM 2198  H HA   . PRO A 1 21  ? -8.563  -8.894  -12.442 1.00 0.00 ? 21  PRO A HA   2  
ATOM 2199  H HB2  . PRO A 1 21  ? -6.229  -8.770  -13.824 1.00 0.00 ? 21  PRO A HB2  2  
ATOM 2200  H HB3  . PRO A 1 21  ? -7.766  -9.217  -14.573 1.00 0.00 ? 21  PRO A HB3  2  
ATOM 2201  H HG2  . PRO A 1 21  ? -6.350  -6.580  -14.584 1.00 0.00 ? 21  PRO A HG2  2  
ATOM 2202  H HG3  . PRO A 1 21  ? -7.170  -7.415  -15.916 1.00 0.00 ? 21  PRO A HG3  2  
ATOM 2203  H HD2  . PRO A 1 21  ? -8.319  -5.384  -14.544 1.00 0.00 ? 21  PRO A HD2  2  
ATOM 2204  H HD3  . PRO A 1 21  ? -9.259  -6.724  -15.231 1.00 0.00 ? 21  PRO A HD3  2  
ATOM 2205  N N    . VAL A 1 22  ? -6.898  -8.511  -10.642 1.00 0.00 ? 22  VAL A N    2  
ATOM 2206  C CA   . VAL A 1 22  ? -5.985  -8.267  -9.532  1.00 0.00 ? 22  VAL A CA   2  
ATOM 2207  C C    . VAL A 1 22  ? -4.533  -8.425  -9.969  1.00 0.00 ? 22  VAL A C    2  
ATOM 2208  O O    . VAL A 1 22  ? -4.103  -9.512  -10.355 1.00 0.00 ? 22  VAL A O    2  
ATOM 2209  C CB   . VAL A 1 22  ? -6.262  -9.224  -8.357  1.00 0.00 ? 22  VAL A CB   2  
ATOM 2210  C CG1  . VAL A 1 22  ? -6.158  -10.672 -8.811  1.00 0.00 ? 22  VAL A CG1  2  
ATOM 2211  C CG2  . VAL A 1 22  ? -5.305  -8.947  -7.207  1.00 0.00 ? 22  VAL A CG2  2  
ATOM 2212  H H    . VAL A 1 22  ? -7.473  -9.304  -10.623 1.00 0.00 ? 22  VAL A H    2  
ATOM 2213  H HA   . VAL A 1 22  ? -6.139  -7.254  -9.188  1.00 0.00 ? 22  VAL A HA   2  
ATOM 2214  H HB   . VAL A 1 22  ? -7.270  -9.051  -8.008  1.00 0.00 ? 22  VAL A HB   2  
ATOM 2215  H HG11 . VAL A 1 22  ? -6.677  -11.307 -8.108  1.00 0.00 ? 22  VAL A HG11 2  
ATOM 2216  H HG12 . VAL A 1 22  ? -6.603  -10.775 -9.790  1.00 0.00 ? 22  VAL A HG12 2  
ATOM 2217  H HG13 . VAL A 1 22  ? -5.118  -10.961 -8.856  1.00 0.00 ? 22  VAL A HG13 2  
ATOM 2218  H HG21 . VAL A 1 22  ? -4.309  -9.258  -7.485  1.00 0.00 ? 22  VAL A HG21 2  
ATOM 2219  H HG22 . VAL A 1 22  ? -5.304  -7.890  -6.987  1.00 0.00 ? 22  VAL A HG22 2  
ATOM 2220  H HG23 . VAL A 1 22  ? -5.623  -9.496  -6.333  1.00 0.00 ? 22  VAL A HG23 2  
ATOM 2221  N N    . THR A 1 23  ? -3.779  -7.331  -9.907  1.00 0.00 ? 23  THR A N    2  
ATOM 2222  C CA   . THR A 1 23  ? -2.375  -7.347  -10.297 1.00 0.00 ? 23  THR A CA   2  
ATOM 2223  C C    . THR A 1 23  ? -1.558  -8.243  -9.373  1.00 0.00 ? 23  THR A C    2  
ATOM 2224  O O    . THR A 1 23  ? -0.900  -9.181  -9.824  1.00 0.00 ? 23  THR A O    2  
ATOM 2225  C CB   . THR A 1 23  ? -1.772  -5.930  -10.284 1.00 0.00 ? 23  THR A CB   2  
ATOM 2226  O OG1  . THR A 1 23  ? -2.593  -5.041  -11.049 1.00 0.00 ? 23  THR A OG1  2  
ATOM 2227  C CG2  . THR A 1 23  ? -0.360  -5.937  -10.849 1.00 0.00 ? 23  THR A CG2  2  
ATOM 2228  H H    . THR A 1 23  ? -4.179  -6.494  -9.591  1.00 0.00 ? 23  THR A H    2  
ATOM 2229  H HA   . THR A 1 23  ? -2.313  -7.733  -11.304 1.00 0.00 ? 23  THR A HA   2  
ATOM 2230  H HB   . THR A 1 23  ? -1.734  -5.581  -9.261  1.00 0.00 ? 23  THR A HB   2  
ATOM 2231  H HG1  . THR A 1 23  ? -3.503  -5.105  -10.747 1.00 0.00 ? 23  THR A HG1  2  
ATOM 2232  H HG21 . THR A 1 23  ? 0.186   -6.774  -10.440 1.00 0.00 ? 23  THR A HG21 2  
ATOM 2233  H HG22 . THR A 1 23  ? 0.139   -5.017  -10.582 1.00 0.00 ? 23  THR A HG22 2  
ATOM 2234  H HG23 . THR A 1 23  ? -0.403  -6.025  -11.924 1.00 0.00 ? 23  THR A HG23 2  
ATOM 2235  N N    . LYS A 1 24  ? -1.604  -7.950  -8.079  1.00 0.00 ? 24  LYS A N    2  
ATOM 2236  C CA   . LYS A 1 24  ? -0.870  -8.730  -7.090  1.00 0.00 ? 24  LYS A CA   2  
ATOM 2237  C C    . LYS A 1 24  ? -1.566  -8.683  -5.733  1.00 0.00 ? 24  LYS A C    2  
ATOM 2238  O O    . LYS A 1 24  ? -2.007  -7.624  -5.288  1.00 0.00 ? 24  LYS A O    2  
ATOM 2239  C CB   . LYS A 1 24  ? 0.562   -8.207  -6.958  1.00 0.00 ? 24  LYS A CB   2  
ATOM 2240  C CG   . LYS A 1 24  ? 1.550   -9.253  -6.471  1.00 0.00 ? 24  LYS A CG   2  
ATOM 2241  C CD   . LYS A 1 24  ? 2.860   -8.621  -6.031  1.00 0.00 ? 24  LYS A CD   2  
ATOM 2242  C CE   . LYS A 1 24  ? 3.589   -9.495  -5.022  1.00 0.00 ? 24  LYS A CE   2  
ATOM 2243  N NZ   . LYS A 1 24  ? 4.117   -10.740 -5.646  1.00 0.00 ? 24  LYS A NZ   2  
ATOM 2244  H H    . LYS A 1 24  ? -2.147  -7.189  -7.780  1.00 0.00 ? 24  LYS A H    2  
ATOM 2245  H HA   . LYS A 1 24  ? -0.840  -9.754  -7.430  1.00 0.00 ? 24  LYS A HA   2  
ATOM 2246  H HB2  . LYS A 1 24  ? 0.893   -7.852  -7.923  1.00 0.00 ? 24  LYS A HB2  2  
ATOM 2247  H HB3  . LYS A 1 24  ? 0.569   -7.382  -6.260  1.00 0.00 ? 24  LYS A HB3  2  
ATOM 2248  H HG2  . LYS A 1 24  ? 1.118   -9.780  -5.633  1.00 0.00 ? 24  LYS A HG2  2  
ATOM 2249  H HG3  . LYS A 1 24  ? 1.748   -9.949  -7.273  1.00 0.00 ? 24  LYS A HG3  2  
ATOM 2250  H HD2  . LYS A 1 24  ? 3.492   -8.484  -6.895  1.00 0.00 ? 24  LYS A HD2  2  
ATOM 2251  H HD3  . LYS A 1 24  ? 2.652   -7.661  -5.579  1.00 0.00 ? 24  LYS A HD3  2  
ATOM 2252  H HE2  . LYS A 1 24  ? 4.412   -8.933  -4.608  1.00 0.00 ? 24  LYS A HE2  2  
ATOM 2253  H HE3  . LYS A 1 24  ? 2.902   -9.761  -4.233  1.00 0.00 ? 24  LYS A HE3  2  
ATOM 2254  H HZ1  . LYS A 1 24  ? 4.522   -10.528 -6.580  1.00 0.00 ? 24  LYS A HZ1  2  
ATOM 2255  H HZ2  . LYS A 1 24  ? 3.351   -11.434 -5.761  1.00 0.00 ? 24  LYS A HZ2  2  
ATOM 2256  H HZ3  . LYS A 1 24  ? 4.858   -11.154 -5.046  1.00 0.00 ? 24  LYS A HZ3  2  
ATOM 2257  N N    . ALA A 1 25  ? -1.659  -9.837  -5.081  1.00 0.00 ? 25  ALA A N    2  
ATOM 2258  C CA   . ALA A 1 25  ? -2.299  -9.926  -3.774  1.00 0.00 ? 25  ALA A CA   2  
ATOM 2259  C C    . ALA A 1 25  ? -1.401  -10.644 -2.772  1.00 0.00 ? 25  ALA A C    2  
ATOM 2260  O O    . ALA A 1 25  ? -0.780  -11.656 -3.094  1.00 0.00 ? 25  ALA A O    2  
ATOM 2261  C CB   . ALA A 1 25  ? -3.639  -10.637 -3.889  1.00 0.00 ? 25  ALA A CB   2  
ATOM 2262  H H    . ALA A 1 25  ? -1.289  -10.647 -5.488  1.00 0.00 ? 25  ALA A H    2  
ATOM 2263  H HA   . ALA A 1 25  ? -2.481  -8.921  -3.423  1.00 0.00 ? 25  ALA A HA   2  
ATOM 2264  H HB1  . ALA A 1 25  ? -4.427  -9.974  -3.565  1.00 0.00 ? 25  ALA A HB1  2  
ATOM 2265  H HB2  . ALA A 1 25  ? -3.807  -10.922 -4.918  1.00 0.00 ? 25  ALA A HB2  2  
ATOM 2266  H HB3  . ALA A 1 25  ? -3.632  -11.520 -3.267  1.00 0.00 ? 25  ALA A HB3  2  
ATOM 2267  N N    . GLY A 1 26  ? -1.337  -10.112 -1.555  1.00 0.00 ? 26  GLY A N    2  
ATOM 2268  C CA   . GLY A 1 26  ? -0.511  -10.715 -0.525  1.00 0.00 ? 26  GLY A CA   2  
ATOM 2269  C C    . GLY A 1 26  ? -0.604  -9.980  0.797   1.00 0.00 ? 26  GLY A C    2  
ATOM 2270  O O    . GLY A 1 26  ? -0.820  -8.768  0.827   1.00 0.00 ? 26  GLY A O    2  
ATOM 2271  H H    . GLY A 1 26  ? -1.854  -9.304  -1.355  1.00 0.00 ? 26  GLY A H    2  
ATOM 2272  H HA2  . GLY A 1 26  ? -0.826  -11.738 -0.379  1.00 0.00 ? 26  GLY A HA2  2  
ATOM 2273  H HA3  . GLY A 1 26  ? 0.517   -10.710 -0.854  1.00 0.00 ? 26  GLY A HA3  2  
ATOM 2274  N N    . TRP A 1 27  ? -0.444  -10.713 1.893   1.00 0.00 ? 27  TRP A N    2  
ATOM 2275  C CA   . TRP A 1 27  ? -0.513  -10.122 3.225   1.00 0.00 ? 27  TRP A CA   2  
ATOM 2276  C C    . TRP A 1 27  ? 0.724   -9.277  3.510   1.00 0.00 ? 27  TRP A C    2  
ATOM 2277  O O    . TRP A 1 27  ? 1.818   -9.806  3.704   1.00 0.00 ? 27  TRP A O    2  
ATOM 2278  C CB   . TRP A 1 27  ? -0.653  -11.216 4.284   1.00 0.00 ? 27  TRP A CB   2  
ATOM 2279  C CG   . TRP A 1 27  ? -2.060  -11.708 4.447   1.00 0.00 ? 27  TRP A CG   2  
ATOM 2280  C CD1  . TRP A 1 27  ? -2.609  -12.823 3.882   1.00 0.00 ? 27  TRP A CD1  2  
ATOM 2281  C CD2  . TRP A 1 27  ? -3.095  -11.099 5.226   1.00 0.00 ? 27  TRP A CD2  2  
ATOM 2282  N NE1  . TRP A 1 27  ? -3.923  -12.945 4.263   1.00 0.00 ? 27  TRP A NE1  2  
ATOM 2283  C CE2  . TRP A 1 27  ? -4.246  -11.900 5.088   1.00 0.00 ? 27  TRP A CE2  2  
ATOM 2284  C CE3  . TRP A 1 27  ? -3.162  -9.957  6.028   1.00 0.00 ? 27  TRP A CE3  2  
ATOM 2285  C CZ2  . TRP A 1 27  ? -5.447  -11.592 5.722   1.00 0.00 ? 27  TRP A CZ2  2  
ATOM 2286  C CZ3  . TRP A 1 27  ? -4.355  -9.653  6.656   1.00 0.00 ? 27  TRP A CZ3  2  
ATOM 2287  C CH2  . TRP A 1 27  ? -5.484  -10.468 6.501   1.00 0.00 ? 27  TRP A CH2  2  
ATOM 2288  H H    . TRP A 1 27  ? -0.275  -11.674 1.805   1.00 0.00 ? 27  TRP A H    2  
ATOM 2289  H HA   . TRP A 1 27  ? -1.385  -9.486  3.259   1.00 0.00 ? 27  TRP A HA   2  
ATOM 2290  H HB2  . TRP A 1 27  ? -0.036  -12.058 4.007   1.00 0.00 ? 27  TRP A HB2  2  
ATOM 2291  H HB3  . TRP A 1 27  ? -0.322  -10.829 5.237   1.00 0.00 ? 27  TRP A HB3  2  
ATOM 2292  H HD1  . TRP A 1 27  ? -2.076  -13.501 3.232   1.00 0.00 ? 27  TRP A HD1  2  
ATOM 2293  H HE1  . TRP A 1 27  ? -4.531  -13.664 3.989   1.00 0.00 ? 27  TRP A HE1  2  
ATOM 2294  H HE3  . TRP A 1 27  ? -2.303  -9.316  6.160   1.00 0.00 ? 27  TRP A HE3  2  
ATOM 2295  H HZ2  . TRP A 1 27  ? -6.326  -12.211 5.612   1.00 0.00 ? 27  TRP A HZ2  2  
ATOM 2296  H HZ3  . TRP A 1 27  ? -4.426  -8.773  7.279   1.00 0.00 ? 27  TRP A HZ3  2  
ATOM 2297  H HH2  . TRP A 1 27  ? -6.395  -10.192 7.010   1.00 0.00 ? 27  TRP A HH2  2  
ATOM 2298  N N    . LEU A 1 28  ? 0.543   -7.961  3.534   1.00 0.00 ? 28  LEU A N    2  
ATOM 2299  C CA   . LEU A 1 28  ? 1.645   -7.042  3.796   1.00 0.00 ? 28  LEU A CA   2  
ATOM 2300  C C    . LEU A 1 28  ? 1.466   -6.348  5.143   1.00 0.00 ? 28  LEU A C    2  
ATOM 2301  O O    . LEU A 1 28  ? 0.434   -6.495  5.797   1.00 0.00 ? 28  LEU A O    2  
ATOM 2302  C CB   . LEU A 1 28  ? 1.741   -5.999  2.681   1.00 0.00 ? 28  LEU A CB   2  
ATOM 2303  C CG   . LEU A 1 28  ? 2.403   -6.464  1.383   1.00 0.00 ? 28  LEU A CG   2  
ATOM 2304  C CD1  . LEU A 1 28  ? 2.314   -5.379  0.321   1.00 0.00 ? 28  LEU A CD1  2  
ATOM 2305  C CD2  . LEU A 1 28  ? 3.854   -6.851  1.633   1.00 0.00 ? 28  LEU A CD2  2  
ATOM 2306  H H    . LEU A 1 28  ? -0.353  -7.598  3.372   1.00 0.00 ? 28  LEU A H    2  
ATOM 2307  H HA   . LEU A 1 28  ? 2.558   -7.618  3.820   1.00 0.00 ? 28  LEU A HA   2  
ATOM 2308  H HB2  . LEU A 1 28  ? 0.740   -5.675  2.444   1.00 0.00 ? 28  LEU A HB2  2  
ATOM 2309  H HB3  . LEU A 1 28  ? 2.309   -5.161  3.061   1.00 0.00 ? 28  LEU A HB3  2  
ATOM 2310  H HG   . LEU A 1 28  ? 1.882   -7.336  1.013   1.00 0.00 ? 28  LEU A HG   2  
ATOM 2311  H HD11 . LEU A 1 28  ? 1.619   -5.684  -0.447  1.00 0.00 ? 28  LEU A HD11 2  
ATOM 2312  H HD12 . LEU A 1 28  ? 3.289   -5.223  -0.117  1.00 0.00 ? 28  LEU A HD12 2  
ATOM 2313  H HD13 . LEU A 1 28  ? 1.972   -4.460  0.773   1.00 0.00 ? 28  LEU A HD13 2  
ATOM 2314  H HD21 . LEU A 1 28  ? 4.325   -7.104  0.695   1.00 0.00 ? 28  LEU A HD21 2  
ATOM 2315  H HD22 . LEU A 1 28  ? 3.889   -7.703  2.296   1.00 0.00 ? 28  LEU A HD22 2  
ATOM 2316  H HD23 . LEU A 1 28  ? 4.375   -6.020  2.086   1.00 0.00 ? 28  LEU A HD23 2  
ATOM 2317  N N    . PHE A 1 29  ? 2.478   -5.589  5.550   1.00 0.00 ? 29  PHE A N    2  
ATOM 2318  C CA   . PHE A 1 29  ? 2.433   -4.870  6.818   1.00 0.00 ? 29  PHE A CA   2  
ATOM 2319  C C    . PHE A 1 29  ? 2.587   -3.368  6.598   1.00 0.00 ? 29  PHE A C    2  
ATOM 2320  O O    . PHE A 1 29  ? 3.487   -2.922  5.886   1.00 0.00 ? 29  PHE A O    2  
ATOM 2321  C CB   . PHE A 1 29  ? 3.533   -5.375  7.754   1.00 0.00 ? 29  PHE A CB   2  
ATOM 2322  C CG   . PHE A 1 29  ? 3.370   -6.816  8.149   1.00 0.00 ? 29  PHE A CG   2  
ATOM 2323  C CD1  . PHE A 1 29  ? 3.418   -7.819  7.194   1.00 0.00 ? 29  PHE A CD1  2  
ATOM 2324  C CD2  . PHE A 1 29  ? 3.168   -7.166  9.474   1.00 0.00 ? 29  PHE A CD2  2  
ATOM 2325  C CE1  . PHE A 1 29  ? 3.269   -9.145  7.553   1.00 0.00 ? 29  PHE A CE1  2  
ATOM 2326  C CE2  . PHE A 1 29  ? 3.019   -8.491  9.839   1.00 0.00 ? 29  PHE A CE2  2  
ATOM 2327  C CZ   . PHE A 1 29  ? 3.068   -9.481  8.878   1.00 0.00 ? 29  PHE A CZ   2  
ATOM 2328  H H    . PHE A 1 29  ? 3.275   -5.511  4.984   1.00 0.00 ? 29  PHE A H    2  
ATOM 2329  H HA   . PHE A 1 29  ? 1.472   -5.059  7.271   1.00 0.00 ? 29  PHE A HA   2  
ATOM 2330  H HB2  . PHE A 1 29  ? 4.489   -5.273  7.263   1.00 0.00 ? 29  PHE A HB2  2  
ATOM 2331  H HB3  . PHE A 1 29  ? 3.530   -4.781  8.655   1.00 0.00 ? 29  PHE A HB3  2  
ATOM 2332  H HD1  . PHE A 1 29  ? 3.575   -7.556  6.157   1.00 0.00 ? 29  PHE A HD1  2  
ATOM 2333  H HD2  . PHE A 1 29  ? 3.129   -6.393  10.227  1.00 0.00 ? 29  PHE A HD2  2  
ATOM 2334  H HE1  . PHE A 1 29  ? 3.308   -9.917  6.799   1.00 0.00 ? 29  PHE A HE1  2  
ATOM 2335  H HE2  . PHE A 1 29  ? 2.862   -8.751  10.875  1.00 0.00 ? 29  PHE A HE2  2  
ATOM 2336  H HZ   . PHE A 1 29  ? 2.952   -10.517 9.161   1.00 0.00 ? 29  PHE A HZ   2  
ATOM 2337  N N    . LYS A 1 30  ? 1.701   -2.593  7.215   1.00 0.00 ? 30  LYS A N    2  
ATOM 2338  C CA   . LYS A 1 30  ? 1.737   -1.140  7.088   1.00 0.00 ? 30  LYS A CA   2  
ATOM 2339  C C    . LYS A 1 30  ? 2.192   -0.492  8.392   1.00 0.00 ? 30  LYS A C    2  
ATOM 2340  O O    . LYS A 1 30  ? 1.542   -0.636  9.427   1.00 0.00 ? 30  LYS A O    2  
ATOM 2341  C CB   . LYS A 1 30  ? 0.357   -0.608  6.696   1.00 0.00 ? 30  LYS A CB   2  
ATOM 2342  C CG   . LYS A 1 30  ? 0.395   0.771   6.062   1.00 0.00 ? 30  LYS A CG   2  
ATOM 2343  C CD   . LYS A 1 30  ? -0.827  1.018   5.192   1.00 0.00 ? 30  LYS A CD   2  
ATOM 2344  C CE   . LYS A 1 30  ? -1.157  2.501   5.104   1.00 0.00 ? 30  LYS A CE   2  
ATOM 2345  N NZ   . LYS A 1 30  ? -1.770  3.008   6.363   1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2346  H H    . LYS A 1 30  ? 1.007   -3.007  7.769   1.00 0.00 ? 30  LYS A H    2  
ATOM 2347  H HA   . LYS A 1 30  ? 2.443   -0.892  6.311   1.00 0.00 ? 30  LYS A HA   2  
ATOM 2348  H HB2  . LYS A 1 30  ? -0.094  -1.293  5.993   1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2349  H HB3  . LYS A 1 30  ? -0.261  -0.557  7.582   1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2350  H HG2  . LYS A 1 30  ? 0.424   1.517   6.842   1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2351  H HG3  . LYS A 1 30  ? 1.283   0.852   5.451   1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2352  H HD2  . LYS A 1 30  ? -0.632  0.645   4.198   1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2353  H HD3  . LYS A 1 30  ? -1.672  0.494   5.616   1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2354  H HE2  . LYS A 1 30  ? -0.248  3.048   4.910   1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2355  H HE3  . LYS A 1 30  ? -1.850  2.653   4.289   1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2356  H HZ1  . LYS A 1 30  ? -1.227  2.674   7.184   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2357  H HZ2  . LYS A 1 30  ? -2.749  2.668   6.445   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2358  H HZ3  . LYS A 1 30  ? -1.775  4.048   6.363   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2359  N N    . GLN A 1 31  ? 3.312   0.222   8.333   1.00 0.00 ? 31  GLN A N    2  
ATOM 2360  C CA   . GLN A 1 31  ? 3.852   0.893   9.509   1.00 0.00 ? 31  GLN A CA   2  
ATOM 2361  C C    . GLN A 1 31  ? 2.770   1.696   10.223  1.00 0.00 ? 31  GLN A C    2  
ATOM 2362  O O    . GLN A 1 31  ? 1.842   2.203   9.593   1.00 0.00 ? 31  GLN A O    2  
ATOM 2363  C CB   . GLN A 1 31  ? 5.008   1.813   9.112   1.00 0.00 ? 31  GLN A CB   2  
ATOM 2364  C CG   . GLN A 1 31  ? 6.047   1.992   10.207  1.00 0.00 ? 31  GLN A CG   2  
ATOM 2365  C CD   . GLN A 1 31  ? 6.881   3.244   10.021  1.00 0.00 ? 31  GLN A CD   2  
ATOM 2366  O OE1  . GLN A 1 31  ? 6.397   4.360   10.211  1.00 0.00 ? 31  GLN A OE1  2  
ATOM 2367  N NE2  . GLN A 1 31  ? 8.143   3.066   9.647   1.00 0.00 ? 31  GLN A NE2  2  
ATOM 2368  H H    . GLN A 1 31  ? 3.785   0.299   7.479   1.00 0.00 ? 31  GLN A H    2  
ATOM 2369  H HA   . GLN A 1 31  ? 4.223   0.134   10.182  1.00 0.00 ? 31  GLN A HA   2  
ATOM 2370  H HB2  . GLN A 1 31  ? 5.499   1.399   8.243   1.00 0.00 ? 31  GLN A HB2  2  
ATOM 2371  H HB3  . GLN A 1 31  ? 4.609   2.785   8.861   1.00 0.00 ? 31  GLN A HB3  2  
ATOM 2372  H HG2  . GLN A 1 31  ? 5.541   2.054   11.159  1.00 0.00 ? 31  GLN A HG2  2  
ATOM 2373  H HG3  . GLN A 1 31  ? 6.705   1.135   10.205  1.00 0.00 ? 31  GLN A HG3  2  
ATOM 2374  H HE21 . GLN A 1 31  ? 8.460   2.148   9.513   1.00 0.00 ? 31  GLN A HE21 2  
ATOM 2375  H HE22 . GLN A 1 31  ? 8.704   3.858   9.519   1.00 0.00 ? 31  GLN A HE22 2  
ATOM 2376  N N    . ALA A 1 32  ? 2.896   1.808   11.541  1.00 0.00 ? 32  ALA A N    2  
ATOM 2377  C CA   . ALA A 1 32  ? 1.930   2.551   12.341  1.00 0.00 ? 32  ALA A CA   2  
ATOM 2378  C C    . ALA A 1 32  ? 1.999   4.044   12.038  1.00 0.00 ? 32  ALA A C    2  
ATOM 2379  O O    . ALA A 1 32  ? 3.074   4.643   12.066  1.00 0.00 ? 32  ALA A O    2  
ATOM 2380  C CB   . ALA A 1 32  ? 2.165   2.299   13.823  1.00 0.00 ? 32  ALA A CB   2  
ATOM 2381  H H    . ALA A 1 32  ? 3.657   1.382   11.987  1.00 0.00 ? 32  ALA A H    2  
ATOM 2382  H HA   . ALA A 1 32  ? 0.942   2.189   12.092  1.00 0.00 ? 32  ALA A HA   2  
ATOM 2383  H HB1  . ALA A 1 32  ? 3.226   2.304   14.024  1.00 0.00 ? 32  ALA A HB1  2  
ATOM 2384  H HB2  . ALA A 1 32  ? 1.685   3.075   14.400  1.00 0.00 ? 32  ALA A HB2  2  
ATOM 2385  H HB3  . ALA A 1 32  ? 1.752   1.339   14.095  1.00 0.00 ? 32  ALA A HB3  2  
ATOM 2386  N N    . SER A 1 33  ? 0.847   4.639   11.749  1.00 0.00 ? 33  SER A N    2  
ATOM 2387  C CA   . SER A 1 33  ? 0.778   6.062   11.437  1.00 0.00 ? 33  SER A CA   2  
ATOM 2388  C C    . SER A 1 33  ? 0.544   6.884   12.700  1.00 0.00 ? 33  SER A C    2  
ATOM 2389  O O    . SER A 1 33  ? -0.405  6.642   13.445  1.00 0.00 ? 33  SER A O    2  
ATOM 2390  C CB   . SER A 1 33  ? -0.338  6.330   10.426  1.00 0.00 ? 33  SER A CB   2  
ATOM 2391  O OG   . SER A 1 33  ? -0.080  5.676   9.196   1.00 0.00 ? 33  SER A OG   2  
ATOM 2392  H H    . SER A 1 33  ? 0.023   4.107   11.743  1.00 0.00 ? 33  SER A H    2  
ATOM 2393  H HA   . SER A 1 33  ? 1.723   6.352   11.003  1.00 0.00 ? 33  SER A HA   2  
ATOM 2394  H HB2  . SER A 1 33  ? -1.274  5.968   10.823  1.00 0.00 ? 33  SER A HB2  2  
ATOM 2395  H HB3  . SER A 1 33  ? -0.410  7.394   10.247  1.00 0.00 ? 33  SER A HB3  2  
ATOM 2396  H HG   . SER A 1 33  ? -0.200  4.730   9.304   1.00 0.00 ? 33  SER A HG   2  
ATOM 2397  N N    . SER A 1 34  ? 1.418   7.859   12.935  1.00 0.00 ? 34  SER A N    2  
ATOM 2398  C CA   . SER A 1 34  ? 1.310   8.716   14.109  1.00 0.00 ? 34  SER A CA   2  
ATOM 2399  C C    . SER A 1 34  ? 0.940   7.900   15.345  1.00 0.00 ? 34  SER A C    2  
ATOM 2400  O O    . SER A 1 34  ? 0.083   8.298   16.132  1.00 0.00 ? 34  SER A O    2  
ATOM 2401  C CB   . SER A 1 34  ? 0.265   9.809   13.875  1.00 0.00 ? 34  SER A CB   2  
ATOM 2402  O OG   . SER A 1 34  ? 0.381   10.840  14.841  1.00 0.00 ? 34  SER A OG   2  
ATOM 2403  H H    . SER A 1 34  ? 2.153   8.003   12.303  1.00 0.00 ? 34  SER A H    2  
ATOM 2404  H HA   . SER A 1 34  ? 2.272   9.178   14.272  1.00 0.00 ? 34  SER A HA   2  
ATOM 2405  H HB2  . SER A 1 34  ? 0.407   10.234  12.893  1.00 0.00 ? 34  SER A HB2  2  
ATOM 2406  H HB3  . SER A 1 34  ? -0.723  9.379   13.942  1.00 0.00 ? 34  SER A HB3  2  
ATOM 2407  H HG   . SER A 1 34  ? -0.006  11.647  14.495  1.00 0.00 ? 34  SER A HG   2  
ATOM 2408  N N    . GLY A 1 35  ? 1.595   6.754   15.508  1.00 0.00 ? 35  GLY A N    2  
ATOM 2409  C CA   . GLY A 1 35  ? 1.323   5.900   16.648  1.00 0.00 ? 35  GLY A CA   2  
ATOM 2410  C C    . GLY A 1 35  ? 2.567   5.200   17.159  1.00 0.00 ? 35  GLY A C    2  
ATOM 2411  O O    . GLY A 1 35  ? 3.646   5.336   16.582  1.00 0.00 ? 35  GLY A O    2  
ATOM 2412  H H    . GLY A 1 35  ? 2.269   6.488   14.848  1.00 0.00 ? 35  GLY A H    2  
ATOM 2413  H HA2  . GLY A 1 35  ? 0.908   6.501   17.444  1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2414  H HA3  . GLY A 1 35  ? 0.597   5.153   16.359  1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2415  N N    . VAL A 1 36  ? 2.418   4.450   18.246  1.00 0.00 ? 36  VAL A N    2  
ATOM 2416  C CA   . VAL A 1 36  ? 3.538   3.726   18.835  1.00 0.00 ? 36  VAL A CA   2  
ATOM 2417  C C    . VAL A 1 36  ? 4.236   2.854   17.798  1.00 0.00 ? 36  VAL A C    2  
ATOM 2418  O O    . VAL A 1 36  ? 3.605   2.350   16.869  1.00 0.00 ? 36  VAL A O    2  
ATOM 2419  C CB   . VAL A 1 36  ? 3.080   2.841   20.009  1.00 0.00 ? 36  VAL A CB   2  
ATOM 2420  C CG1  . VAL A 1 36  ? 2.190   1.713   19.512  1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2421  C CG2  . VAL A 1 36  ? 4.282   2.291   20.762  1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2422  H H    . VAL A 1 36  ? 1.533   4.380   18.661  1.00 0.00 ? 36  VAL A H    2  
ATOM 2423  H HA   . VAL A 1 36  ? 4.243   4.453   19.213  1.00 0.00 ? 36  VAL A HA   2  
ATOM 2424  H HB   . VAL A 1 36  ? 2.504   3.451   20.690  1.00 0.00 ? 36  VAL A HB   2  
ATOM 2425  H HG11 . VAL A 1 36  ? 2.211   0.898   20.221  1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2426  H HG12 . VAL A 1 36  ? 1.177   2.073   19.405  1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2427  H HG13 . VAL A 1 36  ? 2.551   1.365   18.555  1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2428  H HG21 . VAL A 1 36  ? 4.795   3.099   21.262  1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2429  H HG22 . VAL A 1 36  ? 3.948   1.569   21.493  1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2430  H HG23 . VAL A 1 36  ? 4.956   1.813   20.066  1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2431  N N    . LYS A 1 37  ? 5.543   2.679   17.962  1.00 0.00 ? 37  LYS A N    2  
ATOM 2432  C CA   . LYS A 1 37  ? 6.328   1.866   17.041  1.00 0.00 ? 37  LYS A CA   2  
ATOM 2433  C C    . LYS A 1 37  ? 5.736   0.466   16.911  1.00 0.00 ? 37  LYS A C    2  
ATOM 2434  O O    . LYS A 1 37  ? 5.778   -0.324  17.853  1.00 0.00 ? 37  LYS A O    2  
ATOM 2435  C CB   . LYS A 1 37  ? 7.779   1.775   17.519  1.00 0.00 ? 37  LYS A CB   2  
ATOM 2436  C CG   . LYS A 1 37  ? 8.694   1.046   16.550  1.00 0.00 ? 37  LYS A CG   2  
ATOM 2437  C CD   . LYS A 1 37  ? 10.088  0.867   17.128  1.00 0.00 ? 37  LYS A CD   2  
ATOM 2438  C CE   . LYS A 1 37  ? 10.873  2.169   17.105  1.00 0.00 ? 37  LYS A CE   2  
ATOM 2439  N NZ   . LYS A 1 37  ? 11.198  2.596   15.716  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 2440  H H    . LYS A 1 37  ? 5.990   3.107   18.722  1.00 0.00 ? 37  LYS A H    2  
ATOM 2441  H HA   . LYS A 1 37  ? 6.306   2.345   16.074  1.00 0.00 ? 37  LYS A HA   2  
ATOM 2442  H HB2  . LYS A 1 37  ? 8.162   2.775   17.660  1.00 0.00 ? 37  LYS A HB2  2  
ATOM 2443  H HB3  . LYS A 1 37  ? 7.802   1.253   18.465  1.00 0.00 ? 37  LYS A HB3  2  
ATOM 2444  H HG2  . LYS A 1 37  ? 8.276   0.073   16.337  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 2445  H HG3  . LYS A 1 37  ? 8.764   1.618   15.636  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 2446  H HD2  . LYS A 1 37  ? 10.004  0.528   18.150  1.00 0.00 ? 37  LYS A HD2  2  
ATOM 2447  H HD3  . LYS A 1 37  ? 10.617  0.127   16.544  1.00 0.00 ? 37  LYS A HD3  2  
ATOM 2448  H HE2  . LYS A 1 37  ? 10.283  2.938   17.580  1.00 0.00 ? 37  LYS A HE2  2  
ATOM 2449  H HE3  . LYS A 1 37  ? 11.792  2.030   17.654  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 2450  H HZ1  . LYS A 1 37  ? 10.482  2.236   15.054  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 2451  H HZ2  . LYS A 1 37  ? 12.129  2.226   15.437  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 2452  H HZ3  . LYS A 1 37  ? 11.219  3.634   15.657  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 2453  N N    . GLN A 1 38  ? 5.187   0.168   15.738  1.00 0.00 ? 38  GLN A N    2  
ATOM 2454  C CA   . GLN A 1 38  ? 4.588   -1.137  15.486  1.00 0.00 ? 38  GLN A CA   2  
ATOM 2455  C C    . GLN A 1 38  ? 4.253   -1.306  14.007  1.00 0.00 ? 38  GLN A C    2  
ATOM 2456  O O    . GLN A 1 38  ? 4.395   -0.372  13.218  1.00 0.00 ? 38  GLN A O    2  
ATOM 2457  C CB   . GLN A 1 38  ? 3.325   -1.314  16.330  1.00 0.00 ? 38  GLN A CB   2  
ATOM 2458  C CG   . GLN A 1 38  ? 2.158   -0.457  15.866  1.00 0.00 ? 38  GLN A CG   2  
ATOM 2459  C CD   . GLN A 1 38  ? 0.856   -0.823  16.552  1.00 0.00 ? 38  GLN A CD   2  
ATOM 2460  O OE1  . GLN A 1 38  ? -0.125  -1.178  15.898  1.00 0.00 ? 38  GLN A OE1  2  
ATOM 2461  N NE2  . GLN A 1 38  ? 0.841   -0.739  17.877  1.00 0.00 ? 38  GLN A NE2  2  
ATOM 2462  H H    . GLN A 1 38  ? 5.184   0.841   15.026  1.00 0.00 ? 38  GLN A H    2  
ATOM 2463  H HA   . GLN A 1 38  ? 5.306   -1.892  15.767  1.00 0.00 ? 38  GLN A HA   2  
ATOM 2464  H HB2  . GLN A 1 38  ? 3.021   -2.349  16.291  1.00 0.00 ? 38  GLN A HB2  2  
ATOM 2465  H HB3  . GLN A 1 38  ? 3.551   -1.052  17.353  1.00 0.00 ? 38  GLN A HB3  2  
ATOM 2466  H HG2  . GLN A 1 38  ? 2.380   0.578   16.080  1.00 0.00 ? 38  GLN A HG2  2  
ATOM 2467  H HG3  . GLN A 1 38  ? 2.035   -0.585  14.801  1.00 0.00 ? 38  GLN A HG3  2  
ATOM 2468  H HE21 . GLN A 1 38  ? 1.660   -0.448  18.332  1.00 0.00 ? 38  GLN A HE21 2  
ATOM 2469  H HE22 . GLN A 1 38  ? 0.013   -0.969  18.346  1.00 0.00 ? 38  GLN A HE22 2  
ATOM 2470  N N    . TRP A 1 39  ? 3.807   -2.502  13.640  1.00 0.00 ? 39  TRP A N    2  
ATOM 2471  C CA   . TRP A 1 39  ? 3.452   -2.792  12.255  1.00 0.00 ? 39  TRP A CA   2  
ATOM 2472  C C    . TRP A 1 39  ? 2.156   -3.592  12.182  1.00 0.00 ? 39  TRP A C    2  
ATOM 2473  O O    . TRP A 1 39  ? 2.100   -4.741  12.617  1.00 0.00 ? 39  TRP A O    2  
ATOM 2474  C CB   . TRP A 1 39  ? 4.581   -3.563  11.569  1.00 0.00 ? 39  TRP A CB   2  
ATOM 2475  C CG   . TRP A 1 39  ? 5.792   -2.723  11.293  1.00 0.00 ? 39  TRP A CG   2  
ATOM 2476  C CD1  . TRP A 1 39  ? 6.769   -2.377  12.182  1.00 0.00 ? 39  TRP A CD1  2  
ATOM 2477  C CD2  . TRP A 1 39  ? 6.152   -2.123  10.044  1.00 0.00 ? 39  TRP A CD2  2  
ATOM 2478  N NE1  . TRP A 1 39  ? 7.715   -1.598  11.561  1.00 0.00 ? 39  TRP A NE1  2  
ATOM 2479  C CE2  . TRP A 1 39  ? 7.360   -1.428  10.249  1.00 0.00 ? 39  TRP A CE2  2  
ATOM 2480  C CE3  . TRP A 1 39  ? 5.572   -2.106  8.772   1.00 0.00 ? 39  TRP A CE3  2  
ATOM 2481  C CZ2  . TRP A 1 39  ? 7.995   -0.724  9.229   1.00 0.00 ? 39  TRP A CZ2  2  
ATOM 2482  C CZ3  . TRP A 1 39  ? 6.205   -1.408  7.761   1.00 0.00 ? 39  TRP A CZ3  2  
ATOM 2483  C CH2  . TRP A 1 39  ? 7.406   -0.725  7.994   1.00 0.00 ? 39  TRP A CH2  2  
ATOM 2484  H H    . TRP A 1 39  ? 3.715   -3.206  14.315  1.00 0.00 ? 39  TRP A H    2  
ATOM 2485  H HA   . TRP A 1 39  ? 3.310   -1.851  11.746  1.00 0.00 ? 39  TRP A HA   2  
ATOM 2486  H HB2  . TRP A 1 39  ? 4.883   -4.385  12.200  1.00 0.00 ? 39  TRP A HB2  2  
ATOM 2487  H HB3  . TRP A 1 39  ? 4.221   -3.950  10.626  1.00 0.00 ? 39  TRP A HB3  2  
ATOM 2488  H HD1  . TRP A 1 39  ? 6.782   -2.678  13.218  1.00 0.00 ? 39  TRP A HD1  2  
ATOM 2489  H HE1  . TRP A 1 39  ? 8.515   -1.225  11.988  1.00 0.00 ? 39  TRP A HE1  2  
ATOM 2490  H HE3  . TRP A 1 39  ? 4.647   -2.626  8.573   1.00 0.00 ? 39  TRP A HE3  2  
ATOM 2491  H HZ2  . TRP A 1 39  ? 8.922   -0.194  9.393   1.00 0.00 ? 39  TRP A HZ2  2  
ATOM 2492  H HZ3  . TRP A 1 39  ? 5.772   -1.383  6.772   1.00 0.00 ? 39  TRP A HZ3  2  
ATOM 2493  H HH2  . TRP A 1 39  ? 7.864   -0.192  7.175   1.00 0.00 ? 39  TRP A HH2  2  
ATOM 2494  N N    . ASN A 1 40  ? 1.116   -2.976  11.628  1.00 0.00 ? 40  ASN A N    2  
ATOM 2495  C CA   . ASN A 1 40  ? -0.180  -3.632  11.499  1.00 0.00 ? 40  ASN A CA   2  
ATOM 2496  C C    . ASN A 1 40  ? -0.245  -4.460  10.219  1.00 0.00 ? 40  ASN A C    2  
ATOM 2497  O O    . ASN A 1 40  ? 0.027   -3.960  9.128   1.00 0.00 ? 40  ASN A O    2  
ATOM 2498  C CB   . ASN A 1 40  ? -1.303  -2.593  11.505  1.00 0.00 ? 40  ASN A CB   2  
ATOM 2499  C CG   . ASN A 1 40  ? -1.463  -1.922  12.855  1.00 0.00 ? 40  ASN A CG   2  
ATOM 2500  O OD1  . ASN A 1 40  ? -2.348  -2.275  13.635  1.00 0.00 ? 40  ASN A OD1  2  
ATOM 2501  N ND2  . ASN A 1 40  ? -0.605  -0.949  13.138  1.00 0.00 ? 40  ASN A ND2  2  
ATOM 2502  H H    . ASN A 1 40  ? 1.223   -2.059  11.300  1.00 0.00 ? 40  ASN A H    2  
ATOM 2503  H HA   . ASN A 1 40  ? -0.305  -4.289  12.346  1.00 0.00 ? 40  ASN A HA   2  
ATOM 2504  H HB2  . ASN A 1 40  ? -1.085  -1.832  10.770  1.00 0.00 ? 40  ASN A HB2  2  
ATOM 2505  H HB3  . ASN A 1 40  ? -2.234  -3.076  11.250  1.00 0.00 ? 40  ASN A HB3  2  
ATOM 2506  H HD21 . ASN A 1 40  ? 0.074   -0.722  12.469  1.00 0.00 ? 40  ASN A HD21 2  
ATOM 2507  H HD22 . ASN A 1 40  ? -0.685  -0.499  14.004  1.00 0.00 ? 40  ASN A HD22 2  
ATOM 2508  N N    . LYS A 1 41  ? -0.608  -5.731  10.361  1.00 0.00 ? 41  LYS A N    2  
ATOM 2509  C CA   . LYS A 1 41  ? -0.711  -6.630  9.218   1.00 0.00 ? 41  LYS A CA   2  
ATOM 2510  C C    . LYS A 1 41  ? -2.105  -6.568  8.602   1.00 0.00 ? 41  LYS A C    2  
ATOM 2511  O O    . LYS A 1 41  ? -3.108  -6.759  9.290   1.00 0.00 ? 41  LYS A O    2  
ATOM 2512  C CB   . LYS A 1 41  ? -0.393  -8.065  9.642   1.00 0.00 ? 41  LYS A CB   2  
ATOM 2513  C CG   . LYS A 1 41  ? -0.624  -9.089  8.544   1.00 0.00 ? 41  LYS A CG   2  
ATOM 2514  C CD   . LYS A 1 41  ? -0.954  -10.457 9.117   1.00 0.00 ? 41  LYS A CD   2  
ATOM 2515  C CE   . LYS A 1 41  ? -0.558  -11.572 8.161   1.00 0.00 ? 41  LYS A CE   2  
ATOM 2516  N NZ   . LYS A 1 41  ? 0.918   -11.758 8.107   1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2517  H H    . LYS A 1 41  ? -0.813  -6.072  11.258  1.00 0.00 ? 41  LYS A H    2  
ATOM 2518  H HA   . LYS A 1 41  ? 0.010   -6.313  8.480   1.00 0.00 ? 41  LYS A HA   2  
ATOM 2519  H HB2  . LYS A 1 41  ? 0.643   -8.118  9.942   1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2520  H HB3  . LYS A 1 41  ? -1.017  -8.326  10.485  1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2521  H HG2  . LYS A 1 41  ? -1.447  -8.762  7.926   1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2522  H HG3  . LYS A 1 41  ? 0.271   -9.167  7.943   1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2523  H HD2  . LYS A 1 41  ? -0.419  -10.587 10.046  1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2524  H HD3  . LYS A 1 41  ? -2.018  -10.513 9.302   1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2525  H HE2  . LYS A 1 41  ? -1.017  -12.491 8.492   1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2526  H HE3  . LYS A 1 41  ? -0.918  -11.326 7.173   1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2527  H HZ1  . LYS A 1 41  ? 1.382   -10.864 7.849   1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2528  H HZ2  . LYS A 1 41  ? 1.161   -12.480 7.399   1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2529  H HZ3  . LYS A 1 41  ? 1.274   -12.066 9.035   1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2530  N N    . ARG A 1 42  ? -2.161  -6.302  7.301   1.00 0.00 ? 42  ARG A N    2  
ATOM 2531  C CA   . ARG A 1 42  ? -3.432  -6.215  6.592   1.00 0.00 ? 42  ARG A CA   2  
ATOM 2532  C C    . ARG A 1 42  ? -3.312  -6.798  5.187   1.00 0.00 ? 42  ARG A C    2  
ATOM 2533  O O    . ARG A 1 42  ? -2.214  -6.900  4.638   1.00 0.00 ? 42  ARG A O    2  
ATOM 2534  C CB   . ARG A 1 42  ? -3.899  -4.760  6.514   1.00 0.00 ? 42  ARG A CB   2  
ATOM 2535  C CG   . ARG A 1 42  ? -4.045  -4.094  7.872   1.00 0.00 ? 42  ARG A CG   2  
ATOM 2536  C CD   . ARG A 1 42  ? -5.446  -4.279  8.435   1.00 0.00 ? 42  ARG A CD   2  
ATOM 2537  N NE   . ARG A 1 42  ? -5.458  -4.239  9.895   1.00 0.00 ? 42  ARG A NE   2  
ATOM 2538  C CZ   . ARG A 1 42  ? -6.462  -4.700  10.633  1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2539  N NH1  . ARG A 1 42  ? -7.527  -5.233  10.052  1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2540  N NH2  . ARG A 1 42  ? -6.400  -4.629  11.957  1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2541  H H    . ARG A 1 42  ? -1.327  -6.159  6.806   1.00 0.00 ? 42  ARG A H    2  
ATOM 2542  H HA   . ARG A 1 42  ? -4.160  -6.788  7.146   1.00 0.00 ? 42  ARG A HA   2  
ATOM 2543  H HB2  . ARG A 1 42  ? -3.182  -4.195  5.936   1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2544  H HB3  . ARG A 1 42  ? -4.856  -4.729  6.016   1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2545  H HG2  . ARG A 1 42  ? -3.334  -4.532  8.556   1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2546  H HG3  . ARG A 1 42  ? -3.845  -3.038  7.768   1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2547  H HD2  . ARG A 1 42  ? -6.078  -3.489  8.057   1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2548  H HD3  . ARG A 1 42  ? -5.828  -5.234  8.106   1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2549  H HE   . ARG A 1 42  ? -4.681  -3.850  10.345  1.00 0.00 ? 42  ARG A HE   2  
ATOM 2550  H HH11 . ARG A 1 42  ? -7.576  -5.289  9.055   1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2551  H HH12 . ARG A 1 42  ? -8.281  -5.581  10.611  1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2552  H HH21 . ARG A 1 42  ? -5.598  -4.228  12.399  1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2553  H HH22 . ARG A 1 42  ? -7.155  -4.976  12.512  1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2554  N N    . TRP A 1 43  ? -4.446  -7.180  4.612   1.00 0.00 ? 43  TRP A N    2  
ATOM 2555  C CA   . TRP A 1 43  ? -4.468  -7.754  3.271   1.00 0.00 ? 43  TRP A CA   2  
ATOM 2556  C C    . TRP A 1 43  ? -4.274  -6.673  2.213   1.00 0.00 ? 43  TRP A C    2  
ATOM 2557  O O    . TRP A 1 43  ? -5.102  -5.772  2.074   1.00 0.00 ? 43  TRP A O    2  
ATOM 2558  C CB   . TRP A 1 43  ? -5.786  -8.490  3.030   1.00 0.00 ? 43  TRP A CB   2  
ATOM 2559  C CG   . TRP A 1 43  ? -5.829  -9.219  1.721   1.00 0.00 ? 43  TRP A CG   2  
ATOM 2560  C CD1  . TRP A 1 43  ? -6.731  -9.038  0.711   1.00 0.00 ? 43  TRP A CD1  2  
ATOM 2561  C CD2  . TRP A 1 43  ? -4.933  -10.246 1.283   1.00 0.00 ? 43  TRP A CD2  2  
ATOM 2562  N NE1  . TRP A 1 43  ? -6.449  -9.891  -0.329  1.00 0.00 ? 43  TRP A NE1  2  
ATOM 2563  C CE2  . TRP A 1 43  ? -5.350  -10.642 -0.003  1.00 0.00 ? 43  TRP A CE2  2  
ATOM 2564  C CE3  . TRP A 1 43  ? -3.818  -10.868 1.850   1.00 0.00 ? 43  TRP A CE3  2  
ATOM 2565  C CZ2  . TRP A 1 43  ? -4.691  -11.631 -0.728  1.00 0.00 ? 43  TRP A CZ2  2  
ATOM 2566  C CZ3  . TRP A 1 43  ? -3.165  -11.851 1.130   1.00 0.00 ? 43  TRP A CZ3  2  
ATOM 2567  C CH2  . TRP A 1 43  ? -3.603  -12.224 -0.148  1.00 0.00 ? 43  TRP A CH2  2  
ATOM 2568  H H    . TRP A 1 43  ? -5.290  -7.074  5.100   1.00 0.00 ? 43  TRP A H    2  
ATOM 2569  H HA   . TRP A 1 43  ? -3.653  -8.460  3.200   1.00 0.00 ? 43  TRP A HA   2  
ATOM 2570  H HB2  . TRP A 1 43  ? -5.938  -9.212  3.819   1.00 0.00 ? 43  TRP A HB2  2  
ATOM 2571  H HB3  . TRP A 1 43  ? -6.596  -7.775  3.041   1.00 0.00 ? 43  TRP A HB3  2  
ATOM 2572  H HD1  . TRP A 1 43  ? -7.542  -8.327  0.741   1.00 0.00 ? 43  TRP A HD1  2  
ATOM 2573  H HE1  . TRP A 1 43  ? -6.952  -9.950  -1.168  1.00 0.00 ? 43  TRP A HE1  2  
ATOM 2574  H HE3  . TRP A 1 43  ? -3.466  -10.595 2.834   1.00 0.00 ? 43  TRP A HE3  2  
ATOM 2575  H HZ2  . TRP A 1 43  ? -5.016  -11.930 -1.714  1.00 0.00 ? 43  TRP A HZ2  2  
ATOM 2576  H HZ3  . TRP A 1 43  ? -2.302  -12.343 1.552   1.00 0.00 ? 43  TRP A HZ3  2  
ATOM 2577  H HH2  . TRP A 1 43  ? -3.063  -12.996 -0.674  1.00 0.00 ? 43  TRP A HH2  2  
ATOM 2578  N N    . PHE A 1 44  ? -3.177  -6.768  1.470   1.00 0.00 ? 44  PHE A N    2  
ATOM 2579  C CA   . PHE A 1 44  ? -2.875  -5.797  0.425   1.00 0.00 ? 44  PHE A CA   2  
ATOM 2580  C C    . PHE A 1 44  ? -3.239  -6.347  -0.951  1.00 0.00 ? 44  PHE A C    2  
ATOM 2581  O O    . PHE A 1 44  ? -2.971  -7.509  -1.258  1.00 0.00 ? 44  PHE A O    2  
ATOM 2582  C CB   . PHE A 1 44  ? -1.392  -5.421  0.461   1.00 0.00 ? 44  PHE A CB   2  
ATOM 2583  C CG   . PHE A 1 44  ? -1.088  -4.262  1.366   1.00 0.00 ? 44  PHE A CG   2  
ATOM 2584  C CD1  . PHE A 1 44  ? -1.611  -4.213  2.648   1.00 0.00 ? 44  PHE A CD1  2  
ATOM 2585  C CD2  . PHE A 1 44  ? -0.280  -3.223  0.936   1.00 0.00 ? 44  PHE A CD2  2  
ATOM 2586  C CE1  . PHE A 1 44  ? -1.334  -3.147  3.484   1.00 0.00 ? 44  PHE A CE1  2  
ATOM 2587  C CE2  . PHE A 1 44  ? 0.001   -2.154  1.767   1.00 0.00 ? 44  PHE A CE2  2  
ATOM 2588  C CZ   . PHE A 1 44  ? -0.526  -2.117  3.043   1.00 0.00 ? 44  PHE A CZ   2  
ATOM 2589  H H    . PHE A 1 44  ? -2.554  -7.508  1.629   1.00 0.00 ? 44  PHE A H    2  
ATOM 2590  H HA   . PHE A 1 44  ? -3.465  -4.913  0.613   1.00 0.00 ? 44  PHE A HA   2  
ATOM 2591  H HB2  . PHE A 1 44  ? -0.821  -6.270  0.806   1.00 0.00 ? 44  PHE A HB2  2  
ATOM 2592  H HB3  . PHE A 1 44  ? -1.070  -5.159  -0.536  1.00 0.00 ? 44  PHE A HB3  2  
ATOM 2593  H HD1  . PHE A 1 44  ? -2.242  -5.018  2.995   1.00 0.00 ? 44  PHE A HD1  2  
ATOM 2594  H HD2  . PHE A 1 44  ? 0.133   -3.251  -0.063  1.00 0.00 ? 44  PHE A HD2  2  
ATOM 2595  H HE1  . PHE A 1 44  ? -1.747  -3.120  4.481   1.00 0.00 ? 44  PHE A HE1  2  
ATOM 2596  H HE2  . PHE A 1 44  ? 0.633   -1.351  1.418   1.00 0.00 ? 44  PHE A HE2  2  
ATOM 2597  H HZ   . PHE A 1 44  ? -0.308  -1.283  3.693   1.00 0.00 ? 44  PHE A HZ   2  
ATOM 2598  N N    . VAL A 1 45  ? -3.851  -5.504  -1.776  1.00 0.00 ? 45  VAL A N    2  
ATOM 2599  C CA   . VAL A 1 45  ? -4.252  -5.905  -3.120  1.00 0.00 ? 45  VAL A CA   2  
ATOM 2600  C C    . VAL A 1 45  ? -3.939  -4.813  -4.135  1.00 0.00 ? 45  VAL A C    2  
ATOM 2601  O O    . VAL A 1 45  ? -4.295  -3.649  -3.942  1.00 0.00 ? 45  VAL A O    2  
ATOM 2602  C CB   . VAL A 1 45  ? -5.755  -6.234  -3.182  1.00 0.00 ? 45  VAL A CB   2  
ATOM 2603  C CG1  . VAL A 1 45  ? -6.148  -6.677  -4.583  1.00 0.00 ? 45  VAL A CG1  2  
ATOM 2604  C CG2  . VAL A 1 45  ? -6.110  -7.302  -2.158  1.00 0.00 ? 45  VAL A CG2  2  
ATOM 2605  H H    . VAL A 1 45  ? -4.037  -4.591  -1.475  1.00 0.00 ? 45  VAL A H    2  
ATOM 2606  H HA   . VAL A 1 45  ? -3.699  -6.796  -3.381  1.00 0.00 ? 45  VAL A HA   2  
ATOM 2607  H HB   . VAL A 1 45  ? -6.309  -5.338  -2.943  1.00 0.00 ? 45  VAL A HB   2  
ATOM 2608  H HG11 . VAL A 1 45  ? -5.759  -7.667  -4.770  1.00 0.00 ? 45  VAL A HG11 2  
ATOM 2609  H HG12 . VAL A 1 45  ? -7.224  -6.689  -4.670  1.00 0.00 ? 45  VAL A HG12 2  
ATOM 2610  H HG13 . VAL A 1 45  ? -5.736  -5.988  -5.307  1.00 0.00 ? 45  VAL A HG13 2  
ATOM 2611  H HG21 . VAL A 1 45  ? -5.213  -7.634  -1.658  1.00 0.00 ? 45  VAL A HG21 2  
ATOM 2612  H HG22 . VAL A 1 45  ? -6.796  -6.890  -1.433  1.00 0.00 ? 45  VAL A HG22 2  
ATOM 2613  H HG23 . VAL A 1 45  ? -6.575  -8.139  -2.657  1.00 0.00 ? 45  VAL A HG23 2  
ATOM 2614  N N    . LEU A 1 46  ? -3.272  -5.194  -5.219  1.00 0.00 ? 46  LEU A N    2  
ATOM 2615  C CA   . LEU A 1 46  ? -2.911  -4.246  -6.268  1.00 0.00 ? 46  LEU A CA   2  
ATOM 2616  C C    . LEU A 1 46  ? -3.830  -4.394  -7.476  1.00 0.00 ? 46  LEU A C    2  
ATOM 2617  O O    . LEU A 1 46  ? -3.814  -5.418  -8.160  1.00 0.00 ? 46  LEU A O    2  
ATOM 2618  C CB   . LEU A 1 46  ? -1.456  -4.454  -6.692  1.00 0.00 ? 46  LEU A CB   2  
ATOM 2619  C CG   . LEU A 1 46  ? -0.914  -3.477  -7.735  1.00 0.00 ? 46  LEU A CG   2  
ATOM 2620  C CD1  . LEU A 1 46  ? -0.649  -2.117  -7.107  1.00 0.00 ? 46  LEU A CD1  2  
ATOM 2621  C CD2  . LEU A 1 46  ? 0.352   -4.027  -8.375  1.00 0.00 ? 46  LEU A CD2  2  
ATOM 2622  H H    . LEU A 1 46  ? -3.016  -6.134  -5.317  1.00 0.00 ? 46  LEU A H    2  
ATOM 2623  H HA   . LEU A 1 46  ? -3.022  -3.250  -5.866  1.00 0.00 ? 46  LEU A HA   2  
ATOM 2624  H HB2  . LEU A 1 46  ? -0.840  -4.371  -5.810  1.00 0.00 ? 46  LEU A HB2  2  
ATOM 2625  H HB3  . LEU A 1 46  ? -1.370  -5.453  -7.096  1.00 0.00 ? 46  LEU A HB3  2  
ATOM 2626  H HG   . LEU A 1 46  ? -1.653  -3.345  -8.514  1.00 0.00 ? 46  LEU A HG   2  
ATOM 2627  H HD11 . LEU A 1 46  ? -0.647  -2.213  -6.031  1.00 0.00 ? 46  LEU A HD11 2  
ATOM 2628  H HD12 . LEU A 1 46  ? -1.422  -1.425  -7.405  1.00 0.00 ? 46  LEU A HD12 2  
ATOM 2629  H HD13 . LEU A 1 46  ? 0.311   -1.749  -7.438  1.00 0.00 ? 46  LEU A HD13 2  
ATOM 2630  H HD21 . LEU A 1 46  ? 0.529   -3.523  -9.314  1.00 0.00 ? 46  LEU A HD21 2  
ATOM 2631  H HD22 . LEU A 1 46  ? 0.235   -5.086  -8.551  1.00 0.00 ? 46  LEU A HD22 2  
ATOM 2632  H HD23 . LEU A 1 46  ? 1.190   -3.863  -7.713  1.00 0.00 ? 46  LEU A HD23 2  
ATOM 2633  N N    . VAL A 1 47  ? -4.630  -3.364  -7.734  1.00 0.00 ? 47  VAL A N    2  
ATOM 2634  C CA   . VAL A 1 47  ? -5.554  -3.378  -8.862  1.00 0.00 ? 47  VAL A CA   2  
ATOM 2635  C C    . VAL A 1 47  ? -5.625  -2.011  -9.532  1.00 0.00 ? 47  VAL A C    2  
ATOM 2636  O O    . VAL A 1 47  ? -5.765  -0.987  -8.862  1.00 0.00 ? 47  VAL A O    2  
ATOM 2637  C CB   . VAL A 1 47  ? -6.970  -3.796  -8.422  1.00 0.00 ? 47  VAL A CB   2  
ATOM 2638  C CG1  . VAL A 1 47  ? -7.992  -3.420  -9.484  1.00 0.00 ? 47  VAL A CG1  2  
ATOM 2639  C CG2  . VAL A 1 47  ? -7.018  -5.288  -8.129  1.00 0.00 ? 47  VAL A CG2  2  
ATOM 2640  H H    . VAL A 1 47  ? -4.597  -2.576  -7.153  1.00 0.00 ? 47  VAL A H    2  
ATOM 2641  H HA   . VAL A 1 47  ? -5.195  -4.102  -9.579  1.00 0.00 ? 47  VAL A HA   2  
ATOM 2642  H HB   . VAL A 1 47  ? -7.215  -3.264  -7.514  1.00 0.00 ? 47  VAL A HB   2  
ATOM 2643  H HG11 . VAL A 1 47  ? -8.541  -2.547  -9.161  1.00 0.00 ? 47  VAL A HG11 2  
ATOM 2644  H HG12 . VAL A 1 47  ? -7.484  -3.203  -10.413 1.00 0.00 ? 47  VAL A HG12 2  
ATOM 2645  H HG13 . VAL A 1 47  ? -8.677  -4.241  -9.631  1.00 0.00 ? 47  VAL A HG13 2  
ATOM 2646  H HG21 . VAL A 1 47  ? -6.014  -5.661  -7.994  1.00 0.00 ? 47  VAL A HG21 2  
ATOM 2647  H HG22 . VAL A 1 47  ? -7.591  -5.459  -7.230  1.00 0.00 ? 47  VAL A HG22 2  
ATOM 2648  H HG23 . VAL A 1 47  ? -7.485  -5.803  -8.957  1.00 0.00 ? 47  VAL A HG23 2  
ATOM 2649  N N    . ASP A 1 48  ? -5.527  -2.001  -10.856 1.00 0.00 ? 48  ASP A N    2  
ATOM 2650  C CA   . ASP A 1 48  ? -5.581  -0.759  -11.618 1.00 0.00 ? 48  ASP A CA   2  
ATOM 2651  C C    . ASP A 1 48  ? -4.448  0.178   -11.211 1.00 0.00 ? 48  ASP A C    2  
ATOM 2652  O O    . ASP A 1 48  ? -4.683  1.328   -10.840 1.00 0.00 ? 48  ASP A O    2  
ATOM 2653  C CB   . ASP A 1 48  ? -6.930  -0.068  -11.412 1.00 0.00 ? 48  ASP A CB   2  
ATOM 2654  C CG   . ASP A 1 48  ? -7.315  0.812   -12.585 1.00 0.00 ? 48  ASP A CG   2  
ATOM 2655  O OD1  . ASP A 1 48  ? -6.844  1.968   -12.641 1.00 0.00 ? 48  ASP A OD1  2  
ATOM 2656  O OD2  . ASP A 1 48  ? -8.087  0.345   -13.449 1.00 0.00 ? 48  ASP A OD2  2  
ATOM 2657  H H    . ASP A 1 48  ? -5.416  -2.850  -11.334 1.00 0.00 ? 48  ASP A H    2  
ATOM 2658  H HA   . ASP A 1 48  ? -5.470  -1.005  -12.663 1.00 0.00 ? 48  ASP A HA   2  
ATOM 2659  H HB2  . ASP A 1 48  ? -7.696  -0.818  -11.283 1.00 0.00 ? 48  ASP A HB2  2  
ATOM 2660  H HB3  . ASP A 1 48  ? -6.880  0.547   -10.525 1.00 0.00 ? 48  ASP A HB3  2  
ATOM 2661  N N    . ARG A 1 49  ? -3.219  -0.322  -11.283 1.00 0.00 ? 49  ARG A N    2  
ATOM 2662  C CA   . ARG A 1 49  ? -2.050  0.469   -10.920 1.00 0.00 ? 49  ARG A CA   2  
ATOM 2663  C C    . ARG A 1 49  ? -2.277  1.202   -9.600  1.00 0.00 ? 49  ARG A C    2  
ATOM 2664  O O    . ARG A 1 49  ? -1.669  2.241   -9.343  1.00 0.00 ? 49  ARG A O    2  
ATOM 2665  C CB   . ARG A 1 49  ? -1.726  1.476   -12.025 1.00 0.00 ? 49  ARG A CB   2  
ATOM 2666  C CG   . ARG A 1 49  ? -0.985  0.868   -13.205 1.00 0.00 ? 49  ARG A CG   2  
ATOM 2667  C CD   . ARG A 1 49  ? -0.218  1.924   -13.985 1.00 0.00 ? 49  ARG A CD   2  
ATOM 2668  N NE   . ARG A 1 49  ? 0.050   1.502   -15.358 1.00 0.00 ? 49  ARG A NE   2  
ATOM 2669  C CZ   . ARG A 1 49  ? -0.816  1.650   -16.354 1.00 0.00 ? 49  ARG A CZ   2  
ATOM 2670  N NH1  . ARG A 1 49  ? -1.999  2.206   -16.132 1.00 0.00 ? 49  ARG A NH1  2  
ATOM 2671  N NH2  . ARG A 1 49  ? -0.499  1.242   -17.576 1.00 0.00 ? 49  ARG A NH2  2  
ATOM 2672  H H    . ARG A 1 49  ? -3.095  -1.246  -11.586 1.00 0.00 ? 49  ARG A H    2  
ATOM 2673  H HA   . ARG A 1 49  ? -1.215  -0.206  -10.804 1.00 0.00 ? 49  ARG A HA   2  
ATOM 2674  H HB2  . ARG A 1 49  ? -2.648  1.903   -12.389 1.00 0.00 ? 49  ARG A HB2  2  
ATOM 2675  H HB3  . ARG A 1 49  ? -1.113  2.262   -11.610 1.00 0.00 ? 49  ARG A HB3  2  
ATOM 2676  H HG2  . ARG A 1 49  ? -0.287  0.129   -12.838 1.00 0.00 ? 49  ARG A HG2  2  
ATOM 2677  H HG3  . ARG A 1 49  ? -1.700  0.395   -13.861 1.00 0.00 ? 49  ARG A HG3  2  
ATOM 2678  H HD2  . ARG A 1 49  ? -0.802  2.832   -14.005 1.00 0.00 ? 49  ARG A HD2  2  
ATOM 2679  H HD3  . ARG A 1 49  ? 0.721   2.110   -13.486 1.00 0.00 ? 49  ARG A HD3  2  
ATOM 2680  H HE   . ARG A 1 49  ? 0.918   1.089   -15.544 1.00 0.00 ? 49  ARG A HE   2  
ATOM 2681  H HH11 . ARG A 1 49  ? -2.240  2.516   -15.213 1.00 0.00 ? 49  ARG A HH11 2  
ATOM 2682  H HH12 . ARG A 1 49  ? -2.648  2.317   -16.885 1.00 0.00 ? 49  ARG A HH12 2  
ATOM 2683  H HH21 . ARG A 1 49  ? 0.392   0.822   -17.748 1.00 0.00 ? 49  ARG A HH21 2  
ATOM 2684  H HH22 . ARG A 1 49  ? -1.151  1.353   -18.325 1.00 0.00 ? 49  ARG A HH22 2  
ATOM 2685  N N    . CYS A 1 50  ? -3.156  0.653   -8.769  1.00 0.00 ? 50  CYS A N    2  
ATOM 2686  C CA   . CYS A 1 50  ? -3.465  1.254   -7.477  1.00 0.00 ? 50  CYS A CA   2  
ATOM 2687  C C    . CYS A 1 50  ? -3.365  0.222   -6.359  1.00 0.00 ? 50  CYS A C    2  
ATOM 2688  O O    . CYS A 1 50  ? -3.492  -0.980  -6.596  1.00 0.00 ? 50  CYS A O    2  
ATOM 2689  C CB   . CYS A 1 50  ? -4.866  1.867   -7.498  1.00 0.00 ? 50  CYS A CB   2  
ATOM 2690  S SG   . CYS A 1 50  ? -4.986  3.401   -8.448  1.00 0.00 ? 50  CYS A SG   2  
ATOM 2691  H H    . CYS A 1 50  ? -3.608  -0.177  -9.030  1.00 0.00 ? 50  CYS A H    2  
ATOM 2692  H HA   . CYS A 1 50  ? -2.742  2.035   -7.294  1.00 0.00 ? 50  CYS A HA   2  
ATOM 2693  H HB2  . CYS A 1 50  ? -5.554  1.158   -7.933  1.00 0.00 ? 50  CYS A HB2  2  
ATOM 2694  H HB3  . CYS A 1 50  ? -5.172  2.081   -6.485  1.00 0.00 ? 50  CYS A HB3  2  
ATOM 2695  H HG   . CYS A 1 50  ? -5.792  4.224   -7.795  1.00 0.00 ? 50  CYS A HG   2  
ATOM 2696  N N    . LEU A 1 51  ? -3.135  0.698   -5.140  1.00 0.00 ? 51  LEU A N    2  
ATOM 2697  C CA   . LEU A 1 51  ? -3.017  -0.184  -3.984  1.00 0.00 ? 51  LEU A CA   2  
ATOM 2698  C C    . LEU A 1 51  ? -4.258  -0.095  -3.101  1.00 0.00 ? 51  LEU A C    2  
ATOM 2699  O O    . LEU A 1 51  ? -4.706  0.996   -2.751  1.00 0.00 ? 51  LEU A O    2  
ATOM 2700  C CB   . LEU A 1 51  ? -1.772  0.174   -3.170  1.00 0.00 ? 51  LEU A CB   2  
ATOM 2701  C CG   . LEU A 1 51  ? -1.159  -0.960  -2.348  1.00 0.00 ? 51  LEU A CG   2  
ATOM 2702  C CD1  . LEU A 1 51  ? 0.290   -0.648  -2.005  1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2703  C CD2  . LEU A 1 51  ? -1.969  -1.200  -1.082  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2704  H H    . LEU A 1 51  ? -3.043  1.665   -5.013  1.00 0.00 ? 51  LEU A H    2  
ATOM 2705  H HA   . LEU A 1 51  ? -2.920  -1.196  -4.348  1.00 0.00 ? 51  LEU A HA   2  
ATOM 2706  H HB2  . LEU A 1 51  ? -1.019  0.528   -3.857  1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2707  H HB3  . LEU A 1 51  ? -2.040  0.970   -2.490  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2708  H HG   . LEU A 1 51  ? -1.174  -1.870  -2.933  1.00 0.00 ? 51  LEU A HG   2  
ATOM 2709  H HD11 . LEU A 1 51  ? 0.439   0.421   -2.010  1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2710  H HD12 . LEU A 1 51  ? 0.939   -1.106  -2.736  1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2711  H HD13 . LEU A 1 51  ? 0.520   -1.039  -1.025  1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2712  H HD21 . LEU A 1 51  ? -2.515  -2.127  -1.174  1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2713  H HD22 . LEU A 1 51  ? -2.663  -0.385  -0.940  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2714  H HD23 . LEU A 1 51  ? -1.302  -1.256  -0.233  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2715  N N    . PHE A 1 52  ? -4.807  -1.251  -2.744  1.00 0.00 ? 52  PHE A N    2  
ATOM 2716  C CA   . PHE A 1 52  ? -5.996  -1.304  -1.901  1.00 0.00 ? 52  PHE A CA   2  
ATOM 2717  C C    . PHE A 1 52  ? -5.825  -2.328  -0.783  1.00 0.00 ? 52  PHE A C    2  
ATOM 2718  O O    . PHE A 1 52  ? -5.636  -3.518  -1.040  1.00 0.00 ? 52  PHE A O    2  
ATOM 2719  C CB   . PHE A 1 52  ? -7.228  -1.650  -2.741  1.00 0.00 ? 52  PHE A CB   2  
ATOM 2720  C CG   . PHE A 1 52  ? -7.399  -0.768  -3.944  1.00 0.00 ? 52  PHE A CG   2  
ATOM 2721  C CD1  . PHE A 1 52  ? -7.632  0.590   -3.797  1.00 0.00 ? 52  PHE A CD1  2  
ATOM 2722  C CD2  . PHE A 1 52  ? -7.329  -1.297  -5.223  1.00 0.00 ? 52  PHE A CD2  2  
ATOM 2723  C CE1  . PHE A 1 52  ? -7.790  1.404   -4.903  1.00 0.00 ? 52  PHE A CE1  2  
ATOM 2724  C CE2  . PHE A 1 52  ? -7.486  -0.488  -6.332  1.00 0.00 ? 52  PHE A CE2  2  
ATOM 2725  C CZ   . PHE A 1 52  ? -7.718  0.864   -6.172  1.00 0.00 ? 52  PHE A CZ   2  
ATOM 2726  H H    . PHE A 1 52  ? -4.404  -2.089  -3.055  1.00 0.00 ? 52  PHE A H    2  
ATOM 2727  H HA   . PHE A 1 52  ? -6.133  -0.329  -1.461  1.00 0.00 ? 52  PHE A HA   2  
ATOM 2728  H HB2  . PHE A 1 52  ? -7.144  -2.669  -3.086  1.00 0.00 ? 52  PHE A HB2  2  
ATOM 2729  H HB3  . PHE A 1 52  ? -8.111  -1.553  -2.128  1.00 0.00 ? 52  PHE A HB3  2  
ATOM 2730  H HD1  . PHE A 1 52  ? -7.689  1.013   -2.804  1.00 0.00 ? 52  PHE A HD1  2  
ATOM 2731  H HD2  . PHE A 1 52  ? -7.148  -2.355  -5.350  1.00 0.00 ? 52  PHE A HD2  2  
ATOM 2732  H HE1  . PHE A 1 52  ? -7.972  2.461   -4.774  1.00 0.00 ? 52  PHE A HE1  2  
ATOM 2733  H HE2  . PHE A 1 52  ? -7.429  -0.913  -7.323  1.00 0.00 ? 52  PHE A HE2  2  
ATOM 2734  H HZ   . PHE A 1 52  ? -7.840  1.499   -7.037  1.00 0.00 ? 52  PHE A HZ   2  
ATOM 2735  N N    . TYR A 1 53  ? -5.892  -1.858  0.457   1.00 0.00 ? 53  TYR A N    2  
ATOM 2736  C CA   . TYR A 1 53  ? -5.742  -2.731  1.615   1.00 0.00 ? 53  TYR A CA   2  
ATOM 2737  C C    . TYR A 1 53  ? -7.080  -2.943  2.316   1.00 0.00 ? 53  TYR A C    2  
ATOM 2738  O O    . TYR A 1 53  ? -7.753  -1.984  2.696   1.00 0.00 ? 53  TYR A O    2  
ATOM 2739  C CB   . TYR A 1 53  ? -4.727  -2.142  2.597   1.00 0.00 ? 53  TYR A CB   2  
ATOM 2740  C CG   . TYR A 1 53  ? -5.201  -0.872  3.268   1.00 0.00 ? 53  TYR A CG   2  
ATOM 2741  C CD1  . TYR A 1 53  ? -4.952  0.371   2.701   1.00 0.00 ? 53  TYR A CD1  2  
ATOM 2742  C CD2  . TYR A 1 53  ? -5.899  -0.917  4.469   1.00 0.00 ? 53  TYR A CD2  2  
ATOM 2743  C CE1  . TYR A 1 53  ? -5.383  1.533   3.311   1.00 0.00 ? 53  TYR A CE1  2  
ATOM 2744  C CE2  . TYR A 1 53  ? -6.334  0.239   5.085   1.00 0.00 ? 53  TYR A CE2  2  
ATOM 2745  C CZ   . TYR A 1 53  ? -6.074  1.462   4.503   1.00 0.00 ? 53  TYR A CZ   2  
ATOM 2746  O OH   . TYR A 1 53  ? -6.506  2.617   5.114   1.00 0.00 ? 53  TYR A OH   2  
ATOM 2747  H H    . TYR A 1 53  ? -6.045  -0.900  0.598   1.00 0.00 ? 53  TYR A H    2  
ATOM 2748  H HA   . TYR A 1 53  ? -5.376  -3.686  1.266   1.00 0.00 ? 53  TYR A HA   2  
ATOM 2749  H HB2  . TYR A 1 53  ? -4.520  -2.867  3.368   1.00 0.00 ? 53  TYR A HB2  2  
ATOM 2750  H HB3  . TYR A 1 53  ? -3.813  -1.916  2.067   1.00 0.00 ? 53  TYR A HB3  2  
ATOM 2751  H HD1  . TYR A 1 53  ? -4.411  0.423   1.767   1.00 0.00 ? 53  TYR A HD1  2  
ATOM 2752  H HD2  . TYR A 1 53  ? -6.101  -1.877  4.922   1.00 0.00 ? 53  TYR A HD2  2  
ATOM 2753  H HE1  . TYR A 1 53  ? -5.179  2.491   2.855   1.00 0.00 ? 53  TYR A HE1  2  
ATOM 2754  H HE2  . TYR A 1 53  ? -6.875  0.184   6.019   1.00 0.00 ? 53  TYR A HE2  2  
ATOM 2755  H HH   . TYR A 1 53  ? -5.758  3.064   5.518   1.00 0.00 ? 53  TYR A HH   2  
ATOM 2756  N N    . TYR A 1 54  ? -7.459  -4.205  2.484   1.00 0.00 ? 54  TYR A N    2  
ATOM 2757  C CA   . TYR A 1 54  ? -8.718  -4.544  3.137   1.00 0.00 ? 54  TYR A CA   2  
ATOM 2758  C C    . TYR A 1 54  ? -8.471  -5.135  4.522   1.00 0.00 ? 54  TYR A C    2  
ATOM 2759  O O    . TYR A 1 54  ? -7.513  -5.879  4.731   1.00 0.00 ? 54  TYR A O    2  
ATOM 2760  C CB   . TYR A 1 54  ? -9.510  -5.533  2.281   1.00 0.00 ? 54  TYR A CB   2  
ATOM 2761  C CG   . TYR A 1 54  ? -9.804  -5.028  0.887   1.00 0.00 ? 54  TYR A CG   2  
ATOM 2762  C CD1  . TYR A 1 54  ? -8.893  -5.213  -0.146  1.00 0.00 ? 54  TYR A CD1  2  
ATOM 2763  C CD2  . TYR A 1 54  ? -10.992 -4.366  0.602   1.00 0.00 ? 54  TYR A CD2  2  
ATOM 2764  C CE1  . TYR A 1 54  ? -9.157  -4.752  -1.422  1.00 0.00 ? 54  TYR A CE1  2  
ATOM 2765  C CE2  . TYR A 1 54  ? -11.264 -3.903  -0.670  1.00 0.00 ? 54  TYR A CE2  2  
ATOM 2766  C CZ   . TYR A 1 54  ? -10.344 -4.099  -1.679  1.00 0.00 ? 54  TYR A CZ   2  
ATOM 2767  O OH   . TYR A 1 54  ? -10.611 -3.638  -2.948  1.00 0.00 ? 54  TYR A OH   2  
ATOM 2768  H H    . TYR A 1 54  ? -6.880  -4.925  2.160   1.00 0.00 ? 54  TYR A H    2  
ATOM 2769  H HA   . TYR A 1 54  ? -9.292  -3.635  3.244   1.00 0.00 ? 54  TYR A HA   2  
ATOM 2770  H HB2  . TYR A 1 54  ? -8.949  -6.450  2.190   1.00 0.00 ? 54  TYR A HB2  2  
ATOM 2771  H HB3  . TYR A 1 54  ? -10.454 -5.742  2.765   1.00 0.00 ? 54  TYR A HB3  2  
ATOM 2772  H HD1  . TYR A 1 54  ? -7.964  -5.725  0.059   1.00 0.00 ? 54  TYR A HD1  2  
ATOM 2773  H HD2  . TYR A 1 54  ? -11.710 -4.214  1.395   1.00 0.00 ? 54  TYR A HD2  2  
ATOM 2774  H HE1  . TYR A 1 54  ? -8.437  -4.906  -2.212  1.00 0.00 ? 54  TYR A HE1  2  
ATOM 2775  H HE2  . TYR A 1 54  ? -12.194 -3.391  -0.872  1.00 0.00 ? 54  TYR A HE2  2  
ATOM 2776  H HH   . TYR A 1 54  ? -9.812  -3.265  -3.328  1.00 0.00 ? 54  TYR A HH   2  
ATOM 2777  N N    . LYS A 1 55  ? -9.344  -4.800  5.465   1.00 0.00 ? 55  LYS A N    2  
ATOM 2778  C CA   . LYS A 1 55  ? -9.225  -5.297  6.831   1.00 0.00 ? 55  LYS A CA   2  
ATOM 2779  C C    . LYS A 1 55  ? -8.891  -6.786  6.840   1.00 0.00 ? 55  LYS A C    2  
ATOM 2780  O O    . LYS A 1 55  ? -8.171  -7.264  7.717   1.00 0.00 ? 55  LYS A O    2  
ATOM 2781  C CB   . LYS A 1 55  ? -10.525 -5.051  7.601   1.00 0.00 ? 55  LYS A CB   2  
ATOM 2782  C CG   . LYS A 1 55  ? -11.719 -5.797  7.033   1.00 0.00 ? 55  LYS A CG   2  
ATOM 2783  C CD   . LYS A 1 55  ? -13.031 -5.199  7.513   1.00 0.00 ? 55  LYS A CD   2  
ATOM 2784  C CE   . LYS A 1 55  ? -14.205 -6.120  7.218   1.00 0.00 ? 55  LYS A CE   2  
ATOM 2785  N NZ   . LYS A 1 55  ? -14.440 -7.090  8.323   1.00 0.00 ? 55  LYS A NZ   2  
ATOM 2786  H H    . LYS A 1 55  ? -10.088 -4.203  5.238   1.00 0.00 ? 55  LYS A H    2  
ATOM 2787  H HA   . LYS A 1 55  ? -8.424  -4.758  7.312   1.00 0.00 ? 55  LYS A HA   2  
ATOM 2788  H HB2  . LYS A 1 55  ? -10.386 -5.362  8.626   1.00 0.00 ? 55  LYS A HB2  2  
ATOM 2789  H HB3  . LYS A 1 55  ? -10.745 -3.993  7.581   1.00 0.00 ? 55  LYS A HB3  2  
ATOM 2790  H HG2  . LYS A 1 55  ? -11.686 -5.745  5.955   1.00 0.00 ? 55  LYS A HG2  2  
ATOM 2791  H HG3  . LYS A 1 55  ? -11.669 -6.830  7.347   1.00 0.00 ? 55  LYS A HG3  2  
ATOM 2792  H HD2  . LYS A 1 55  ? -12.974 -5.037  8.579   1.00 0.00 ? 55  LYS A HD2  2  
ATOM 2793  H HD3  . LYS A 1 55  ? -13.190 -4.255  7.011   1.00 0.00 ? 55  LYS A HD3  2  
ATOM 2794  H HE2  . LYS A 1 55  ? -15.091 -5.519  7.083   1.00 0.00 ? 55  LYS A HE2  2  
ATOM 2795  H HE3  . LYS A 1 55  ? -13.998 -6.666  6.309   1.00 0.00 ? 55  LYS A HE3  2  
ATOM 2796  H HZ1  . LYS A 1 55  ? -13.566 -7.227  8.870   1.00 0.00 ? 55  LYS A HZ1  2  
ATOM 2797  H HZ2  . LYS A 1 55  ? -14.741 -8.007  7.935   1.00 0.00 ? 55  LYS A HZ2  2  
ATOM 2798  H HZ3  . LYS A 1 55  ? -15.182 -6.734  8.959   1.00 0.00 ? 55  LYS A HZ3  2  
ATOM 2799  N N    . ASP A 1 56  ? -9.417  -7.511  5.859   1.00 0.00 ? 56  ASP A N    2  
ATOM 2800  C CA   . ASP A 1 56  ? -9.172  -8.945  5.753   1.00 0.00 ? 56  ASP A CA   2  
ATOM 2801  C C    . ASP A 1 56  ? -9.041  -9.368  4.293   1.00 0.00 ? 56  ASP A C    2  
ATOM 2802  O O    . ASP A 1 56  ? -9.058  -8.530  3.392   1.00 0.00 ? 56  ASP A O    2  
ATOM 2803  C CB   . ASP A 1 56  ? -10.301 -9.728  6.425   1.00 0.00 ? 56  ASP A CB   2  
ATOM 2804  C CG   . ASP A 1 56  ? -11.656 -9.078  6.223   1.00 0.00 ? 56  ASP A CG   2  
ATOM 2805  O OD1  . ASP A 1 56  ? -11.812 -8.326  5.239   1.00 0.00 ? 56  ASP A OD1  2  
ATOM 2806  O OD2  . ASP A 1 56  ? -12.559 -9.320  7.051   1.00 0.00 ? 56  ASP A OD2  2  
ATOM 2807  H H    . ASP A 1 56  ? -9.982  -7.072  5.190   1.00 0.00 ? 56  ASP A H    2  
ATOM 2808  H HA   . ASP A 1 56  ? -8.244  -9.162  6.262   1.00 0.00 ? 56  ASP A HA   2  
ATOM 2809  H HB2  . ASP A 1 56  ? -10.336 -10.725 6.009   1.00 0.00 ? 56  ASP A HB2  2  
ATOM 2810  H HB3  . ASP A 1 56  ? -10.106 -9.791  7.485   1.00 0.00 ? 56  ASP A HB3  2  
ATOM 2811  N N    . GLU A 1 57  ? -8.910  -10.671 4.069   1.00 0.00 ? 57  GLU A N    2  
ATOM 2812  C CA   . GLU A 1 57  ? -8.774  -11.204 2.719   1.00 0.00 ? 57  GLU A CA   2  
ATOM 2813  C C    . GLU A 1 57  ? -10.141 -11.376 2.062   1.00 0.00 ? 57  GLU A C    2  
ATOM 2814  O O    . GLU A 1 57  ? -10.396 -12.372 1.384   1.00 0.00 ? 57  GLU A O    2  
ATOM 2815  C CB   . GLU A 1 57  ? -8.037  -12.544 2.746   1.00 0.00 ? 57  GLU A CB   2  
ATOM 2816  C CG   . GLU A 1 57  ? -8.734  -13.605 3.581   1.00 0.00 ? 57  GLU A CG   2  
ATOM 2817  C CD   . GLU A 1 57  ? -8.095  -14.973 3.438   1.00 0.00 ? 57  GLU A CD   2  
ATOM 2818  O OE1  . GLU A 1 57  ? -8.039  -15.485 2.300   1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2819  O OE2  . GLU A 1 57  ? -7.652  -15.532 4.463   1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2820  H H    . GLU A 1 57  ? -8.903  -11.289 4.830   1.00 0.00 ? 57  GLU A H    2  
ATOM 2821  H HA   . GLU A 1 57  ? -8.197  -10.498 2.140   1.00 0.00 ? 57  GLU A HA   2  
ATOM 2822  H HB2  . GLU A 1 57  ? -7.946  -12.913 1.735   1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2823  H HB3  . GLU A 1 57  ? -7.048  -12.388 3.153   1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2824  H HG2  . GLU A 1 57  ? -8.692  -13.313 4.620   1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2825  H HG3  . GLU A 1 57  ? -9.765  -13.671 3.268   1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2826  N N    . LYS A 1 58  ? -11.017 -10.399 2.269   1.00 0.00 ? 58  LYS A N    2  
ATOM 2827  C CA   . LYS A 1 58  ? -12.358 -10.440 1.698   1.00 0.00 ? 58  LYS A CA   2  
ATOM 2828  C C    . LYS A 1 58  ? -12.450 -9.554  0.460   1.00 0.00 ? 58  LYS A C    2  
ATOM 2829  O O    . LYS A 1 58  ? -13.209 -9.841  -0.465  1.00 0.00 ? 58  LYS A O    2  
ATOM 2830  C CB   . LYS A 1 58  ? -13.391 -9.994  2.735   1.00 0.00 ? 58  LYS A CB   2  
ATOM 2831  C CG   . LYS A 1 58  ? -13.630 -11.016 3.833   1.00 0.00 ? 58  LYS A CG   2  
ATOM 2832  C CD   . LYS A 1 58  ? -15.046 -10.928 4.378   1.00 0.00 ? 58  LYS A CD   2  
ATOM 2833  C CE   . LYS A 1 58  ? -16.063 -11.449 3.375   1.00 0.00 ? 58  LYS A CE   2  
ATOM 2834  N NZ   . LYS A 1 58  ? -17.311 -11.914 4.041   1.00 0.00 ? 58  LYS A NZ   2  
ATOM 2835  H H    . LYS A 1 58  ? -10.755 -9.631  2.818   1.00 0.00 ? 58  LYS A H    2  
ATOM 2836  H HA   . LYS A 1 58  ? -12.566 -11.460 1.411   1.00 0.00 ? 58  LYS A HA   2  
ATOM 2837  H HB2  . LYS A 1 58  ? -13.050 -9.078  3.194   1.00 0.00 ? 58  LYS A HB2  2  
ATOM 2838  H HB3  . LYS A 1 58  ? -14.330 -9.809  2.234   1.00 0.00 ? 58  LYS A HB3  2  
ATOM 2839  H HG2  . LYS A 1 58  ? -13.472 -12.006 3.432   1.00 0.00 ? 58  LYS A HG2  2  
ATOM 2840  H HG3  . LYS A 1 58  ? -12.932 -10.836 4.639   1.00 0.00 ? 58  LYS A HG3  2  
ATOM 2841  H HD2  . LYS A 1 58  ? -15.113 -11.517 5.281   1.00 0.00 ? 58  LYS A HD2  2  
ATOM 2842  H HD3  . LYS A 1 58  ? -15.272 -9.895  4.603   1.00 0.00 ? 58  LYS A HD3  2  
ATOM 2843  H HE2  . LYS A 1 58  ? -16.308 -10.657 2.685   1.00 0.00 ? 58  LYS A HE2  2  
ATOM 2844  H HE3  . LYS A 1 58  ? -15.625 -12.275 2.834   1.00 0.00 ? 58  LYS A HE3  2  
ATOM 2845  H HZ1  . LYS A 1 58  ? -17.352 -11.554 5.016   1.00 0.00 ? 58  LYS A HZ1  2  
ATOM 2846  H HZ2  . LYS A 1 58  ? -17.338 -12.953 4.065   1.00 0.00 ? 58  LYS A HZ2  2  
ATOM 2847  H HZ3  . LYS A 1 58  ? -18.143 -11.569 3.521   1.00 0.00 ? 58  LYS A HZ3  2  
ATOM 2848  N N    . GLU A 1 59  ? -11.672 -8.476  0.450   1.00 0.00 ? 59  GLU A N    2  
ATOM 2849  C CA   . GLU A 1 59  ? -11.666 -7.549  -0.675  1.00 0.00 ? 59  GLU A CA   2  
ATOM 2850  C C    . GLU A 1 59  ? -13.077 -7.052  -0.978  1.00 0.00 ? 59  GLU A C    2  
ATOM 2851  O O    . GLU A 1 59  ? -13.532 -7.106  -2.119  1.00 0.00 ? 59  GLU A O    2  
ATOM 2852  C CB   . GLU A 1 59  ? -11.072 -8.220  -1.915  1.00 0.00 ? 59  GLU A CB   2  
ATOM 2853  C CG   . GLU A 1 59  ? -9.578  -8.473  -1.814  1.00 0.00 ? 59  GLU A CG   2  
ATOM 2854  C CD   . GLU A 1 59  ? -9.035  -9.244  -3.002  1.00 0.00 ? 59  GLU A CD   2  
ATOM 2855  O OE1  . GLU A 1 59  ? -8.925  -8.650  -4.095  1.00 0.00 ? 59  GLU A OE1  2  
ATOM 2856  O OE2  . GLU A 1 59  ? -8.719  -10.441 -2.837  1.00 0.00 ? 59  GLU A OE2  2  
ATOM 2857  H H    . GLU A 1 59  ? -11.088 -8.301  1.218   1.00 0.00 ? 59  GLU A H    2  
ATOM 2858  H HA   . GLU A 1 59  ? -11.050 -6.704  -0.405  1.00 0.00 ? 59  GLU A HA   2  
ATOM 2859  H HB2  . GLU A 1 59  ? -11.568 -9.168  -2.069  1.00 0.00 ? 59  GLU A HB2  2  
ATOM 2860  H HB3  . GLU A 1 59  ? -11.252 -7.588  -2.772  1.00 0.00 ? 59  GLU A HB3  2  
ATOM 2861  H HG2  . GLU A 1 59  ? -9.068  -7.523  -1.757  1.00 0.00 ? 59  GLU A HG2  2  
ATOM 2862  H HG3  . GLU A 1 59  ? -9.381  -9.040  -0.916  1.00 0.00 ? 59  GLU A HG3  2  
ATOM 2863  N N    . GLU A 1 60  ? -13.762 -6.569  0.054   1.00 0.00 ? 60  GLU A N    2  
ATOM 2864  C CA   . GLU A 1 60  ? -15.121 -6.064  -0.102  1.00 0.00 ? 60  GLU A CA   2  
ATOM 2865  C C    . GLU A 1 60  ? -15.183 -4.568  0.193   1.00 0.00 ? 60  GLU A C    2  
ATOM 2866  O O    . GLU A 1 60  ? -15.542 -3.769  -0.671  1.00 0.00 ? 60  GLU A O    2  
ATOM 2867  C CB   . GLU A 1 60  ? -16.078 -6.818  0.824   1.00 0.00 ? 60  GLU A CB   2  
ATOM 2868  C CG   . GLU A 1 60  ? -16.090 -8.320  0.595   1.00 0.00 ? 60  GLU A CG   2  
ATOM 2869  C CD   . GLU A 1 60  ? -17.096 -8.742  -0.458  1.00 0.00 ? 60  GLU A CD   2  
ATOM 2870  O OE1  . GLU A 1 60  ? -18.311 -8.605  -0.205  1.00 0.00 ? 60  GLU A OE1  2  
ATOM 2871  O OE2  . GLU A 1 60  ? -16.668 -9.209  -1.534  1.00 0.00 ? 60  GLU A OE2  2  
ATOM 2872  H H    . GLU A 1 60  ? -13.344 -6.552  0.940   1.00 0.00 ? 60  GLU A H    2  
ATOM 2873  H HA   . GLU A 1 60  ? -15.421 -6.230  -1.125  1.00 0.00 ? 60  GLU A HA   2  
ATOM 2874  H HB2  . GLU A 1 60  ? -15.789 -6.633  1.848   1.00 0.00 ? 60  GLU A HB2  2  
ATOM 2875  H HB3  . GLU A 1 60  ? -17.079 -6.444  0.669   1.00 0.00 ? 60  GLU A HB3  2  
ATOM 2876  H HG2  . GLU A 1 60  ? -15.106 -8.630  0.276   1.00 0.00 ? 60  GLU A HG2  2  
ATOM 2877  H HG3  . GLU A 1 60  ? -16.337 -8.811  1.525   1.00 0.00 ? 60  GLU A HG3  2  
ATOM 2878  N N    . SER A 1 61  ? -14.831 -4.198  1.421   1.00 0.00 ? 61  SER A N    2  
ATOM 2879  C CA   . SER A 1 61  ? -14.850 -2.799  1.832   1.00 0.00 ? 61  SER A CA   2  
ATOM 2880  C C    . SER A 1 61  ? -13.434 -2.239  1.918   1.00 0.00 ? 61  SER A C    2  
ATOM 2881  O O    . SER A 1 61  ? -12.628 -2.683  2.735   1.00 0.00 ? 61  SER A O    2  
ATOM 2882  C CB   . SER A 1 61  ? -15.552 -2.654  3.184   1.00 0.00 ? 61  SER A CB   2  
ATOM 2883  O OG   . SER A 1 61  ? -16.133 -1.368  3.321   1.00 0.00 ? 61  SER A OG   2  
ATOM 2884  H H    . SER A 1 61  ? -14.554 -4.883  2.065   1.00 0.00 ? 61  SER A H    2  
ATOM 2885  H HA   . SER A 1 61  ? -15.401 -2.243  1.089   1.00 0.00 ? 61  SER A HA   2  
ATOM 2886  H HB2  . SER A 1 61  ? -16.329 -3.397  3.266   1.00 0.00 ? 61  SER A HB2  2  
ATOM 2887  H HB3  . SER A 1 61  ? -14.832 -2.797  3.977   1.00 0.00 ? 61  SER A HB3  2  
ATOM 2888  H HG   . SER A 1 61  ? -15.791 -0.945  4.112   1.00 0.00 ? 61  SER A HG   2  
ATOM 2889  N N    . ILE A 1 62  ? -13.140 -1.260  1.069   1.00 0.00 ? 62  ILE A N    2  
ATOM 2890  C CA   . ILE A 1 62  ? -11.822 -0.637  1.049   1.00 0.00 ? 62  ILE A CA   2  
ATOM 2891  C C    . ILE A 1 62  ? -11.675 0.375   2.180   1.00 0.00 ? 62  ILE A C    2  
ATOM 2892  O O    . ILE A 1 62  ? -12.448 1.329   2.278   1.00 0.00 ? 62  ILE A O    2  
ATOM 2893  C CB   . ILE A 1 62  ? -11.553 0.067   -0.294  1.00 0.00 ? 62  ILE A CB   2  
ATOM 2894  C CG1  . ILE A 1 62  ? -11.864 -0.874  -1.460  1.00 0.00 ? 62  ILE A CG1  2  
ATOM 2895  C CG2  . ILE A 1 62  ? -10.110 0.544   -0.362  1.00 0.00 ? 62  ILE A CG2  2  
ATOM 2896  C CD1  . ILE A 1 62  ? -11.944 -0.172  -2.797  1.00 0.00 ? 62  ILE A CD1  2  
ATOM 2897  H H    . ILE A 1 62  ? -13.825 -0.949  0.442   1.00 0.00 ? 62  ILE A H    2  
ATOM 2898  H HA   . ILE A 1 62  ? -11.084 -1.416  1.179   1.00 0.00 ? 62  ILE A HA   2  
ATOM 2899  H HB   . ILE A 1 62  ? -12.196 0.932   -0.357  1.00 0.00 ? 62  ILE A HB   2  
ATOM 2900  H HG12 . ILE A 1 62  ? -11.091 -1.623  -1.525  1.00 0.00 ? 62  ILE A HG12 2  
ATOM 2901  H HG13 . ILE A 1 62  ? -12.814 -1.356  -1.280  1.00 0.00 ? 62  ILE A HG13 2  
ATOM 2902  H HG21 . ILE A 1 62  ? -9.474  -0.155  0.162   1.00 0.00 ? 62  ILE A HG21 2  
ATOM 2903  H HG22 . ILE A 1 62  ? -9.800  0.607   -1.394  1.00 0.00 ? 62  ILE A HG22 2  
ATOM 2904  H HG23 . ILE A 1 62  ? -10.030 1.517   0.099   1.00 0.00 ? 62  ILE A HG23 2  
ATOM 2905  H HD11 . ILE A 1 62  ? -12.077 -0.905  -3.581  1.00 0.00 ? 62  ILE A HD11 2  
ATOM 2906  H HD12 . ILE A 1 62  ? -12.783 0.509   -2.797  1.00 0.00 ? 62  ILE A HD12 2  
ATOM 2907  H HD13 . ILE A 1 62  ? -11.032 0.379   -2.972  1.00 0.00 ? 62  ILE A HD13 2  
ATOM 2908  N N    . LEU A 1 63  ? -10.678 0.162   3.031   1.00 0.00 ? 63  LEU A N    2  
ATOM 2909  C CA   . LEU A 1 63  ? -10.427 1.057   4.155   1.00 0.00 ? 63  LEU A CA   2  
ATOM 2910  C C    . LEU A 1 63  ? -9.639  2.285   3.709   1.00 0.00 ? 63  LEU A C    2  
ATOM 2911  O O    . LEU A 1 63  ? -9.899  3.400   4.159   1.00 0.00 ? 63  LEU A O    2  
ATOM 2912  C CB   . LEU A 1 63  ? -9.665  0.321   5.258   1.00 0.00 ? 63  LEU A CB   2  
ATOM 2913  C CG   . LEU A 1 63  ? -10.277 -0.997  5.732   1.00 0.00 ? 63  LEU A CG   2  
ATOM 2914  C CD1  . LEU A 1 63  ? -9.321  -1.726  6.664   1.00 0.00 ? 63  LEU A CD1  2  
ATOM 2915  C CD2  . LEU A 1 63  ? -11.611 -0.749  6.421   1.00 0.00 ? 63  LEU A CD2  2  
ATOM 2916  H H    . LEU A 1 63  ? -10.095 -0.615  2.901   1.00 0.00 ? 63  LEU A H    2  
ATOM 2917  H HA   . LEU A 1 63  ? -11.382 1.379   4.542   1.00 0.00 ? 63  LEU A HA   2  
ATOM 2918  H HB2  . LEU A 1 63  ? -8.672  0.111   4.891   1.00 0.00 ? 63  LEU A HB2  2  
ATOM 2919  H HB3  . LEU A 1 63  ? -9.599  0.982   6.111   1.00 0.00 ? 63  LEU A HB3  2  
ATOM 2920  H HG   . LEU A 1 63  ? -10.456 -1.632  4.875   1.00 0.00 ? 63  LEU A HG   2  
ATOM 2921  H HD11 . LEU A 1 63  ? -8.794  -2.490  6.113   1.00 0.00 ? 63  LEU A HD11 2  
ATOM 2922  H HD12 . LEU A 1 63  ? -9.879  -2.181  7.468   1.00 0.00 ? 63  LEU A HD12 2  
ATOM 2923  H HD13 . LEU A 1 63  ? -8.611  -1.022  7.073   1.00 0.00 ? 63  LEU A HD13 2  
ATOM 2924  H HD21 . LEU A 1 63  ? -11.543 -1.052  7.456   1.00 0.00 ? 63  LEU A HD21 2  
ATOM 2925  H HD22 . LEU A 1 63  ? -12.383 -1.321  5.928   1.00 0.00 ? 63  LEU A HD22 2  
ATOM 2926  H HD23 . LEU A 1 63  ? -11.853 0.303   6.369   1.00 0.00 ? 63  LEU A HD23 2  
ATOM 2927  N N    . GLY A 1 64  ? -8.675  2.071   2.818   1.00 0.00 ? 64  GLY A N    2  
ATOM 2928  C CA   . GLY A 1 64  ? -7.865  3.169   2.324   1.00 0.00 ? 64  GLY A CA   2  
ATOM 2929  C C    . GLY A 1 64  ? -7.271  2.883   0.959   1.00 0.00 ? 64  GLY A C    2  
ATOM 2930  O O    . GLY A 1 64  ? -6.827  1.767   0.689   1.00 0.00 ? 64  GLY A O    2  
ATOM 2931  H H    . GLY A 1 64  ? -8.512  1.160   2.494   1.00 0.00 ? 64  GLY A H    2  
ATOM 2932  H HA2  . GLY A 1 64  ? -8.479  4.055   2.260   1.00 0.00 ? 64  GLY A HA2  2  
ATOM 2933  H HA3  . GLY A 1 64  ? -7.061  3.351   3.022   1.00 0.00 ? 64  GLY A HA3  2  
ATOM 2934  N N    . SER A 1 65  ? -7.265  3.893   0.095   1.00 0.00 ? 65  SER A N    2  
ATOM 2935  C CA   . SER A 1 65  ? -6.726  3.743   -1.252  1.00 0.00 ? 65  SER A CA   2  
ATOM 2936  C C    . SER A 1 65  ? -5.601  4.743   -1.502  1.00 0.00 ? 65  SER A C    2  
ATOM 2937  O O    . SER A 1 65  ? -5.651  5.880   -1.031  1.00 0.00 ? 65  SER A O    2  
ATOM 2938  C CB   . SER A 1 65  ? -7.833  3.934   -2.291  1.00 0.00 ? 65  SER A CB   2  
ATOM 2939  O OG   . SER A 1 65  ? -8.949  3.108   -2.005  1.00 0.00 ? 65  SER A OG   2  
ATOM 2940  H H    . SER A 1 65  ? -7.634  4.759   0.369   1.00 0.00 ? 65  SER A H    2  
ATOM 2941  H HA   . SER A 1 65  ? -6.330  2.743   -1.341  1.00 0.00 ? 65  SER A HA   2  
ATOM 2942  H HB2  . SER A 1 65  ? -8.153  4.965   -2.287  1.00 0.00 ? 65  SER A HB2  2  
ATOM 2943  H HB3  . SER A 1 65  ? -7.452  3.679   -3.269  1.00 0.00 ? 65  SER A HB3  2  
ATOM 2944  H HG   . SER A 1 65  ? -8.941  2.870   -1.075  1.00 0.00 ? 65  SER A HG   2  
ATOM 2945  N N    . ILE A 1 66  ? -4.588  4.310   -2.245  1.00 0.00 ? 66  ILE A N    2  
ATOM 2946  C CA   . ILE A 1 66  ? -3.451  5.167   -2.558  1.00 0.00 ? 66  ILE A CA   2  
ATOM 2947  C C    . ILE A 1 66  ? -2.996  4.970   -4.000  1.00 0.00 ? 66  ILE A C    2  
ATOM 2948  O O    . ILE A 1 66  ? -2.618  3.874   -4.414  1.00 0.00 ? 66  ILE A O    2  
ATOM 2949  C CB   . ILE A 1 66  ? -2.264  4.894   -1.615  1.00 0.00 ? 66  ILE A CB   2  
ATOM 2950  C CG1  . ILE A 1 66  ? -2.681  5.112   -0.159  1.00 0.00 ? 66  ILE A CG1  2  
ATOM 2951  C CG2  . ILE A 1 66  ? -1.086  5.787   -1.975  1.00 0.00 ? 66  ILE A CG2  2  
ATOM 2952  C CD1  . ILE A 1 66  ? -1.905  4.264   0.824   1.00 0.00 ? 66  ILE A CD1  2  
ATOM 2953  H H    . ILE A 1 66  ? -4.606  3.394   -2.591  1.00 0.00 ? 66  ILE A H    2  
ATOM 2954  H HA   . ILE A 1 66  ? -3.761  6.193   -2.426  1.00 0.00 ? 66  ILE A HA   2  
ATOM 2955  H HB   . ILE A 1 66  ? -1.959  3.867   -1.745  1.00 0.00 ? 66  ILE A HB   2  
ATOM 2956  H HG12 . ILE A 1 66  ? -2.526  6.147   0.102   1.00 0.00 ? 66  ILE A HG12 2  
ATOM 2957  H HG13 . ILE A 1 66  ? -3.729  4.871   -0.053  1.00 0.00 ? 66  ILE A HG13 2  
ATOM 2958  H HG21 . ILE A 1 66  ? -0.373  5.786   -1.163  1.00 0.00 ? 66  ILE A HG21 2  
ATOM 2959  H HG22 . ILE A 1 66  ? -0.612  5.414   -2.870  1.00 0.00 ? 66  ILE A HG22 2  
ATOM 2960  H HG23 . ILE A 1 66  ? -1.436  6.794   -2.145  1.00 0.00 ? 66  ILE A HG23 2  
ATOM 2961  H HD11 . ILE A 1 66  ? -0.985  3.931   0.365   1.00 0.00 ? 66  ILE A HD11 2  
ATOM 2962  H HD12 . ILE A 1 66  ? -1.677  4.849   1.703   1.00 0.00 ? 66  ILE A HD12 2  
ATOM 2963  H HD13 . ILE A 1 66  ? -2.497  3.406   1.106   1.00 0.00 ? 66  ILE A HD13 2  
ATOM 2964  N N    . PRO A 1 67  ? -3.030  6.058   -4.785  1.00 0.00 ? 67  PRO A N    2  
ATOM 2965  C CA   . PRO A 1 67  ? -2.622  6.031   -6.193  1.00 0.00 ? 67  PRO A CA   2  
ATOM 2966  C C    . PRO A 1 67  ? -1.118  5.839   -6.357  1.00 0.00 ? 67  PRO A C    2  
ATOM 2967  O O    . PRO A 1 67  ? -0.348  6.798   -6.282  1.00 0.00 ? 67  PRO A O    2  
ATOM 2968  C CB   . PRO A 1 67  ? -3.045  7.408   -6.710  1.00 0.00 ? 67  PRO A CB   2  
ATOM 2969  C CG   . PRO A 1 67  ? -3.056  8.280   -5.503  1.00 0.00 ? 67  PRO A CG   2  
ATOM 2970  C CD   . PRO A 1 67  ? -3.469  7.397   -4.358  1.00 0.00 ? 67  PRO A CD   2  
ATOM 2971  H HA   . PRO A 1 67  ? -3.144  5.262   -6.743  1.00 0.00 ? 67  PRO A HA   2  
ATOM 2972  H HB2  . PRO A 1 67  ? -2.330  7.755   -7.443  1.00 0.00 ? 67  PRO A HB2  2  
ATOM 2973  H HB3  . PRO A 1 67  ? -4.025  7.343   -7.159  1.00 0.00 ? 67  PRO A HB3  2  
ATOM 2974  H HG2  . PRO A 1 67  ? -2.069  8.681   -5.330  1.00 0.00 ? 67  PRO A HG2  2  
ATOM 2975  H HG3  . PRO A 1 67  ? -3.770  9.080   -5.634  1.00 0.00 ? 67  PRO A HG3  2  
ATOM 2976  H HD2  . PRO A 1 67  ? -2.966  7.696   -3.450  1.00 0.00 ? 67  PRO A HD2  2  
ATOM 2977  H HD3  . PRO A 1 67  ? -4.540  7.427   -4.225  1.00 0.00 ? 67  PRO A HD3  2  
ATOM 2978  N N    . LEU A 1 68  ? -0.706  4.597   -6.582  1.00 0.00 ? 68  LEU A N    2  
ATOM 2979  C CA   . LEU A 1 68  ? 0.707   4.279   -6.757  1.00 0.00 ? 68  LEU A CA   2  
ATOM 2980  C C    . LEU A 1 68  ? 1.242   4.877   -8.055  1.00 0.00 ? 68  LEU A C    2  
ATOM 2981  O O    . LEU A 1 68  ? 2.415   5.241   -8.146  1.00 0.00 ? 68  LEU A O    2  
ATOM 2982  C CB   . LEU A 1 68  ? 0.913   2.764   -6.757  1.00 0.00 ? 68  LEU A CB   2  
ATOM 2983  C CG   . LEU A 1 68  ? 0.653   2.051   -5.430  1.00 0.00 ? 68  LEU A CG   2  
ATOM 2984  C CD1  . LEU A 1 68  ? 0.593   0.545   -5.635  1.00 0.00 ? 68  LEU A CD1  2  
ATOM 2985  C CD2  . LEU A 1 68  ? 1.725   2.410   -4.412  1.00 0.00 ? 68  LEU A CD2  2  
ATOM 2986  H H    . LEU A 1 68  ? -1.367  3.875   -6.631  1.00 0.00 ? 68  LEU A H    2  
ATOM 2987  H HA   . LEU A 1 68  ? 1.248   4.708   -5.928  1.00 0.00 ? 68  LEU A HA   2  
ATOM 2988  H HB2  . LEU A 1 68  ? 0.250   2.340   -7.495  1.00 0.00 ? 68  LEU A HB2  2  
ATOM 2989  H HB3  . LEU A 1 68  ? 1.937   2.570   -7.042  1.00 0.00 ? 68  LEU A HB3  2  
ATOM 2990  H HG   . LEU A 1 68  ? -0.303  2.372   -5.037  1.00 0.00 ? 68  LEU A HG   2  
ATOM 2991  H HD11 . LEU A 1 68  ? 1.287   0.260   -6.411  1.00 0.00 ? 68  LEU A HD11 2  
ATOM 2992  H HD12 . LEU A 1 68  ? -0.408  0.261   -5.924  1.00 0.00 ? 68  LEU A HD12 2  
ATOM 2993  H HD13 . LEU A 1 68  ? 0.857   0.046   -4.714  1.00 0.00 ? 68  LEU A HD13 2  
ATOM 2994  H HD21 . LEU A 1 68  ? 1.411   2.091   -3.429  1.00 0.00 ? 68  LEU A HD21 2  
ATOM 2995  H HD22 . LEU A 1 68  ? 1.877   3.480   -4.412  1.00 0.00 ? 68  LEU A HD22 2  
ATOM 2996  H HD23 . LEU A 1 68  ? 2.650   1.916   -4.674  1.00 0.00 ? 68  LEU A HD23 2  
ATOM 2997  N N    . LEU A 1 69  ? 0.374   4.976   -9.056  1.00 0.00 ? 69  LEU A N    2  
ATOM 2998  C CA   . LEU A 1 69  ? 0.759   5.532   -10.349 1.00 0.00 ? 69  LEU A CA   2  
ATOM 2999  C C    . LEU A 1 69  ? 1.451   6.881   -10.178 1.00 0.00 ? 69  LEU A C    2  
ATOM 3000  O O    . LEU A 1 69  ? 2.121   7.366   -11.089 1.00 0.00 ? 69  LEU A O    2  
ATOM 3001  C CB   . LEU A 1 69  ? -0.471  5.687   -11.245 1.00 0.00 ? 69  LEU A CB   2  
ATOM 3002  C CG   . LEU A 1 69  ? -0.362  6.727   -12.361 1.00 0.00 ? 69  LEU A CG   2  
ATOM 3003  C CD1  . LEU A 1 69  ? 0.619   6.265   -13.427 1.00 0.00 ? 69  LEU A CD1  2  
ATOM 3004  C CD2  . LEU A 1 69  ? -1.729  6.999   -12.972 1.00 0.00 ? 69  LEU A CD2  2  
ATOM 3005  H H    . LEU A 1 69  ? -0.546  4.669   -8.924  1.00 0.00 ? 69  LEU A H    2  
ATOM 3006  H HA   . LEU A 1 69  ? 1.449   4.843   -10.814 1.00 0.00 ? 69  LEU A HA   2  
ATOM 3007  H HB2  . LEU A 1 69  ? -0.668  4.730   -11.704 1.00 0.00 ? 69  LEU A HB2  2  
ATOM 3008  H HB3  . LEU A 1 69  ? -1.306  5.961   -10.616 1.00 0.00 ? 69  LEU A HB3  2  
ATOM 3009  H HG   . LEU A 1 69  ? 0.010   7.654   -11.945 1.00 0.00 ? 69  LEU A HG   2  
ATOM 3010  H HD11 . LEU A 1 69  ? 0.722   7.033   -14.179 1.00 0.00 ? 69  LEU A HD11 2  
ATOM 3011  H HD12 . LEU A 1 69  ? 0.251   5.359   -13.887 1.00 0.00 ? 69  LEU A HD12 2  
ATOM 3012  H HD13 . LEU A 1 69  ? 1.580   6.073   -12.974 1.00 0.00 ? 69  LEU A HD13 2  
ATOM 3013  H HD21 . LEU A 1 69  ? -2.073  6.116   -13.490 1.00 0.00 ? 69  LEU A HD21 2  
ATOM 3014  H HD22 . LEU A 1 69  ? -1.653  7.820   -13.670 1.00 0.00 ? 69  LEU A HD22 2  
ATOM 3015  H HD23 . LEU A 1 69  ? -2.428  7.255   -12.190 1.00 0.00 ? 69  LEU A HD23 2  
ATOM 3016  N N    . SER A 1 70  ? 1.285   7.480   -9.003  1.00 0.00 ? 70  SER A N    2  
ATOM 3017  C CA   . SER A 1 70  ? 1.892   8.774   -8.713  1.00 0.00 ? 70  SER A CA   2  
ATOM 3018  C C    . SER A 1 70  ? 2.888   8.661   -7.563  1.00 0.00 ? 70  SER A C    2  
ATOM 3019  O O    . SER A 1 70  ? 2.990   9.557   -6.724  1.00 0.00 ? 70  SER A O    2  
ATOM 3020  C CB   . SER A 1 70  ? 0.813   9.802   -8.369  1.00 0.00 ? 70  SER A CB   2  
ATOM 3021  O OG   . SER A 1 70  ? -0.276  9.720   -9.272  1.00 0.00 ? 70  SER A OG   2  
ATOM 3022  H H    . SER A 1 70  ? 0.739   7.043   -8.317  1.00 0.00 ? 70  SER A H    2  
ATOM 3023  H HA   . SER A 1 70  ? 2.418   9.099   -9.598  1.00 0.00 ? 70  SER A HA   2  
ATOM 3024  H HB2  . SER A 1 70  ? 0.450   9.618   -7.369  1.00 0.00 ? 70  SER A HB2  2  
ATOM 3025  H HB3  . SER A 1 70  ? 1.235   10.795  -8.422  1.00 0.00 ? 70  SER A HB3  2  
ATOM 3026  H HG   . SER A 1 70  ? -0.253  8.875   -9.727  1.00 0.00 ? 70  SER A HG   2  
ATOM 3027  N N    . PHE A 1 71  ? 3.620   7.553   -7.530  1.00 0.00 ? 71  PHE A N    2  
ATOM 3028  C CA   . PHE A 1 71  ? 4.608   7.320   -6.482  1.00 0.00 ? 71  PHE A CA   2  
ATOM 3029  C C    . PHE A 1 71  ? 5.847   6.631   -7.046  1.00 0.00 ? 71  PHE A C    2  
ATOM 3030  O O    . PHE A 1 71  ? 5.883   6.257   -8.219  1.00 0.00 ? 71  PHE A O    2  
ATOM 3031  C CB   . PHE A 1 71  ? 4.004   6.471   -5.362  1.00 0.00 ? 71  PHE A CB   2  
ATOM 3032  C CG   . PHE A 1 71  ? 3.227   7.272   -4.356  1.00 0.00 ? 71  PHE A CG   2  
ATOM 3033  C CD1  . PHE A 1 71  ? 2.032   7.878   -4.707  1.00 0.00 ? 71  PHE A CD1  2  
ATOM 3034  C CD2  . PHE A 1 71  ? 3.692   7.418   -3.059  1.00 0.00 ? 71  PHE A CD2  2  
ATOM 3035  C CE1  . PHE A 1 71  ? 1.315   8.616   -3.784  1.00 0.00 ? 71  PHE A CE1  2  
ATOM 3036  C CE2  . PHE A 1 71  ? 2.980   8.154   -2.131  1.00 0.00 ? 71  PHE A CE2  2  
ATOM 3037  C CZ   . PHE A 1 71  ? 1.789   8.753   -2.494  1.00 0.00 ? 71  PHE A CZ   2  
ATOM 3038  H H    . PHE A 1 71  ? 3.493   6.875   -8.226  1.00 0.00 ? 71  PHE A H    2  
ATOM 3039  H HA   . PHE A 1 71  ? 4.896   8.279   -6.081  1.00 0.00 ? 71  PHE A HA   2  
ATOM 3040  H HB2  . PHE A 1 71  ? 3.335   5.742   -5.793  1.00 0.00 ? 71  PHE A HB2  2  
ATOM 3041  H HB3  . PHE A 1 71  ? 4.798   5.960   -4.839  1.00 0.00 ? 71  PHE A HB3  2  
ATOM 3042  H HD1  . PHE A 1 71  ? 1.659   7.770   -5.715  1.00 0.00 ? 71  PHE A HD1  2  
ATOM 3043  H HD2  . PHE A 1 71  ? 4.624   6.950   -2.774  1.00 0.00 ? 71  PHE A HD2  2  
ATOM 3044  H HE1  . PHE A 1 71  ? 0.385   9.082   -4.070  1.00 0.00 ? 71  PHE A HE1  2  
ATOM 3045  H HE2  . PHE A 1 71  ? 3.354   8.260   -1.123  1.00 0.00 ? 71  PHE A HE2  2  
ATOM 3046  H HZ   . PHE A 1 71  ? 1.232   9.329   -1.770  1.00 0.00 ? 71  PHE A HZ   2  
ATOM 3047  N N    . ARG A 1 72  ? 6.861   6.466   -6.203  1.00 0.00 ? 72  ARG A N    2  
ATOM 3048  C CA   . ARG A 1 72  ? 8.102   5.823   -6.617  1.00 0.00 ? 72  ARG A CA   2  
ATOM 3049  C C    . ARG A 1 72  ? 8.542   4.780   -5.594  1.00 0.00 ? 72  ARG A C    2  
ATOM 3050  O O    . ARG A 1 72  ? 9.266   5.090   -4.647  1.00 0.00 ? 72  ARG A O    2  
ATOM 3051  C CB   . ARG A 1 72  ? 9.205   6.868   -6.802  1.00 0.00 ? 72  ARG A CB   2  
ATOM 3052  C CG   . ARG A 1 72  ? 10.533  6.279   -7.248  1.00 0.00 ? 72  ARG A CG   2  
ATOM 3053  C CD   . ARG A 1 72  ? 11.675  7.262   -7.044  1.00 0.00 ? 72  ARG A CD   2  
ATOM 3054  N NE   . ARG A 1 72  ? 11.670  8.322   -8.049  1.00 0.00 ? 72  ARG A NE   2  
ATOM 3055  C CZ   . ARG A 1 72  ? 12.593  9.274   -8.117  1.00 0.00 ? 72  ARG A CZ   2  
ATOM 3056  N NH1  . ARG A 1 72  ? 13.591  9.299   -7.244  1.00 0.00 ? 72  ARG A NH1  2  
ATOM 3057  N NH2  . ARG A 1 72  ? 12.521  10.205  -9.060  1.00 0.00 ? 72  ARG A NH2  2  
ATOM 3058  H H    . ARG A 1 72  ? 6.772   6.785   -5.280  1.00 0.00 ? 72  ARG A H    2  
ATOM 3059  H HA   . ARG A 1 72  ? 7.923   5.331   -7.561  1.00 0.00 ? 72  ARG A HA   2  
ATOM 3060  H HB2  . ARG A 1 72  ? 8.886   7.583   -7.546  1.00 0.00 ? 72  ARG A HB2  2  
ATOM 3061  H HB3  . ARG A 1 72  ? 9.359   7.380   -5.864  1.00 0.00 ? 72  ARG A HB3  2  
ATOM 3062  H HG2  . ARG A 1 72  ? 10.733  5.388   -6.670  1.00 0.00 ? 72  ARG A HG2  2  
ATOM 3063  H HG3  . ARG A 1 72  ? 10.470  6.025   -8.295  1.00 0.00 ? 72  ARG A HG3  2  
ATOM 3064  H HD2  . ARG A 1 72  ? 11.579  7.707   -6.065  1.00 0.00 ? 72  ARG A HD2  2  
ATOM 3065  H HD3  . ARG A 1 72  ? 12.610  6.725   -7.105  1.00 0.00 ? 72  ARG A HD3  2  
ATOM 3066  H HE   . ARG A 1 72  ? 10.942  8.323   -8.704  1.00 0.00 ? 72  ARG A HE   2  
ATOM 3067  H HH11 . ARG A 1 72  ? 13.649  8.598   -6.533  1.00 0.00 ? 72  ARG A HH11 2  
ATOM 3068  H HH12 . ARG A 1 72  ? 14.286  10.016  -7.298  1.00 0.00 ? 72  ARG A HH12 2  
ATOM 3069  H HH21 . ARG A 1 72  ? 11.770  10.189  -9.720  1.00 0.00 ? 72  ARG A HH21 2  
ATOM 3070  H HH22 . ARG A 1 72  ? 13.216  10.921  -9.111  1.00 0.00 ? 72  ARG A HH22 2  
ATOM 3071  N N    . VAL A 1 73  ? 8.098   3.542   -5.791  1.00 0.00 ? 73  VAL A N    2  
ATOM 3072  C CA   . VAL A 1 73  ? 8.446   2.453   -4.886  1.00 0.00 ? 73  VAL A CA   2  
ATOM 3073  C C    . VAL A 1 73  ? 9.927   2.107   -4.986  1.00 0.00 ? 73  VAL A C    2  
ATOM 3074  O O    . VAL A 1 73  ? 10.496  2.079   -6.077  1.00 0.00 ? 73  VAL A O    2  
ATOM 3075  C CB   . VAL A 1 73  ? 7.614   1.191   -5.182  1.00 0.00 ? 73  VAL A CB   2  
ATOM 3076  C CG1  . VAL A 1 73  ? 7.787   0.165   -4.072  1.00 0.00 ? 73  VAL A CG1  2  
ATOM 3077  C CG2  . VAL A 1 73  ? 6.147   1.550   -5.363  1.00 0.00 ? 73  VAL A CG2  2  
ATOM 3078  H H    . VAL A 1 73  ? 7.524   3.358   -6.563  1.00 0.00 ? 73  VAL A H    2  
ATOM 3079  H HA   . VAL A 1 73  ? 8.228   2.774   -3.878  1.00 0.00 ? 73  VAL A HA   2  
ATOM 3080  H HB   . VAL A 1 73  ? 7.973   0.756   -6.103  1.00 0.00 ? 73  VAL A HB   2  
ATOM 3081  H HG11 . VAL A 1 73  ? 8.541   -0.553  -4.360  1.00 0.00 ? 73  VAL A HG11 2  
ATOM 3082  H HG12 . VAL A 1 73  ? 8.092   0.664   -3.164  1.00 0.00 ? 73  VAL A HG12 2  
ATOM 3083  H HG13 . VAL A 1 73  ? 6.850   -0.346  -3.906  1.00 0.00 ? 73  VAL A HG13 2  
ATOM 3084  H HG21 . VAL A 1 73  ? 5.999   2.593   -5.123  1.00 0.00 ? 73  VAL A HG21 2  
ATOM 3085  H HG22 . VAL A 1 73  ? 5.858   1.371   -6.388  1.00 0.00 ? 73  VAL A HG22 2  
ATOM 3086  H HG23 . VAL A 1 73  ? 5.543   0.941   -4.707  1.00 0.00 ? 73  VAL A HG23 2  
ATOM 3087  N N    . ALA A 1 74  ? 10.547  1.844   -3.840  1.00 0.00 ? 74  ALA A N    2  
ATOM 3088  C CA   . ALA A 1 74  ? 11.962  1.497   -3.798  1.00 0.00 ? 74  ALA A CA   2  
ATOM 3089  C C    . ALA A 1 74  ? 12.340  0.894   -2.450  1.00 0.00 ? 74  ALA A C    2  
ATOM 3090  O O    . ALA A 1 74  ? 11.890  1.360   -1.403  1.00 0.00 ? 74  ALA A O    2  
ATOM 3091  C CB   . ALA A 1 74  ? 12.814  2.723   -4.089  1.00 0.00 ? 74  ALA A CB   2  
ATOM 3092  H H    . ALA A 1 74  ? 10.039  1.882   -3.003  1.00 0.00 ? 74  ALA A H    2  
ATOM 3093  H HA   . ALA A 1 74  ? 12.149  0.767   -4.573  1.00 0.00 ? 74  ALA A HA   2  
ATOM 3094  H HB1  . ALA A 1 74  ? 13.498  2.503   -4.895  1.00 0.00 ? 74  ALA A HB1  2  
ATOM 3095  H HB2  . ALA A 1 74  ? 12.175  3.546   -4.373  1.00 0.00 ? 74  ALA A HB2  2  
ATOM 3096  H HB3  . ALA A 1 74  ? 13.373  2.990   -3.204  1.00 0.00 ? 74  ALA A HB3  2  
ATOM 3097  N N    . ALA A 1 75  ? 13.169  -0.144  -2.482  1.00 0.00 ? 75  ALA A N    2  
ATOM 3098  C CA   . ALA A 1 75  ? 13.608  -0.809  -1.262  1.00 0.00 ? 75  ALA A CA   2  
ATOM 3099  C C    . ALA A 1 75  ? 14.305  0.170   -0.323  1.00 0.00 ? 75  ALA A C    2  
ATOM 3100  O O    . ALA A 1 75  ? 15.047  1.048   -0.765  1.00 0.00 ? 75  ALA A O    2  
ATOM 3101  C CB   . ALA A 1 75  ? 14.532  -1.971  -1.597  1.00 0.00 ? 75  ALA A CB   2  
ATOM 3102  H H    . ALA A 1 75  ? 13.493  -0.469  -3.347  1.00 0.00 ? 75  ALA A H    2  
ATOM 3103  H HA   . ALA A 1 75  ? 12.735  -1.207  -0.766  1.00 0.00 ? 75  ALA A HA   2  
ATOM 3104  H HB1  . ALA A 1 75  ? 14.757  -1.958  -2.653  1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3105  H HB2  . ALA A 1 75  ? 15.448  -1.875  -1.032  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3106  H HB3  . ALA A 1 75  ? 14.047  -2.901  -1.343  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3107  N N    . VAL A 1 76  ? 14.062  0.014   0.974   1.00 0.00 ? 76  VAL A N    2  
ATOM 3108  C CA   . VAL A 1 76  ? 14.667  0.885   1.975   1.00 0.00 ? 76  VAL A CA   2  
ATOM 3109  C C    . VAL A 1 76  ? 16.188  0.854   1.883   1.00 0.00 ? 76  VAL A C    2  
ATOM 3110  O O    . VAL A 1 76  ? 16.753  0.203   1.005   1.00 0.00 ? 76  VAL A O    2  
ATOM 3111  C CB   . VAL A 1 76  ? 14.241  0.482   3.400   1.00 0.00 ? 76  VAL A CB   2  
ATOM 3112  C CG1  . VAL A 1 76  ? 12.803  0.899   3.665   1.00 0.00 ? 76  VAL A CG1  2  
ATOM 3113  C CG2  . VAL A 1 76  ? 14.418  -1.015  3.605   1.00 0.00 ? 76  VAL A CG2  2  
ATOM 3114  H H    . VAL A 1 76  ? 13.462  -0.704  1.265   1.00 0.00 ? 76  VAL A H    2  
ATOM 3115  H HA   . VAL A 1 76  ? 14.325  1.893   1.791   1.00 0.00 ? 76  VAL A HA   2  
ATOM 3116  H HB   . VAL A 1 76  ? 14.878  0.999   4.103   1.00 0.00 ? 76  VAL A HB   2  
ATOM 3117  H HG11 . VAL A 1 76  ? 12.153  0.428   2.943   1.00 0.00 ? 76  VAL A HG11 2  
ATOM 3118  H HG12 . VAL A 1 76  ? 12.517  0.594   4.661   1.00 0.00 ? 76  VAL A HG12 2  
ATOM 3119  H HG13 . VAL A 1 76  ? 12.718  1.973   3.579   1.00 0.00 ? 76  VAL A HG13 2  
ATOM 3120  H HG21 . VAL A 1 76  ? 14.501  -1.503  2.646   1.00 0.00 ? 76  VAL A HG21 2  
ATOM 3121  H HG22 . VAL A 1 76  ? 15.314  -1.195  4.180   1.00 0.00 ? 76  VAL A HG22 2  
ATOM 3122  H HG23 . VAL A 1 76  ? 13.564  -1.409  4.137   1.00 0.00 ? 76  VAL A HG23 2  
ATOM 3123  N N    . GLN A 1 77  ? 16.845  1.561   2.796   1.00 0.00 ? 77  GLN A N    2  
ATOM 3124  C CA   . GLN A 1 77  ? 18.302  1.615   2.818   1.00 0.00 ? 77  GLN A CA   2  
ATOM 3125  C C    . GLN A 1 77  ? 18.857  0.874   4.030   1.00 0.00 ? 77  GLN A C    2  
ATOM 3126  O O    . GLN A 1 77  ? 18.150  0.609   5.003   1.00 0.00 ? 77  GLN A O    2  
ATOM 3127  C CB   . GLN A 1 77  ? 18.781  3.068   2.831   1.00 0.00 ? 77  GLN A CB   2  
ATOM 3128  C CG   . GLN A 1 77  ? 19.021  3.642   1.444   1.00 0.00 ? 77  GLN A CG   2  
ATOM 3129  C CD   . GLN A 1 77  ? 20.459  3.487   0.989   1.00 0.00 ? 77  GLN A CD   2  
ATOM 3130  O OE1  . GLN A 1 77  ? 20.823  2.485   0.374   1.00 0.00 ? 77  GLN A OE1  2  
ATOM 3131  N NE2  . GLN A 1 77  ? 21.285  4.482   1.291   1.00 0.00 ? 77  GLN A NE2  2  
ATOM 3132  H H    . GLN A 1 77  ? 16.339  2.059   3.471   1.00 0.00 ? 77  GLN A H    2  
ATOM 3133  H HA   . GLN A 1 77  ? 18.665  1.135   1.922   1.00 0.00 ? 77  GLN A HA   2  
ATOM 3134  H HB2  . GLN A 1 77  ? 18.036  3.675   3.325   1.00 0.00 ? 77  GLN A HB2  2  
ATOM 3135  H HB3  . GLN A 1 77  ? 19.706  3.125   3.385   1.00 0.00 ? 77  GLN A HB3  2  
ATOM 3136  H HG2  . GLN A 1 77  ? 18.380  3.131   0.741   1.00 0.00 ? 77  GLN A HG2  2  
ATOM 3137  H HG3  . GLN A 1 77  ? 18.773  4.693   1.456   1.00 0.00 ? 77  GLN A HG3  2  
ATOM 3138  H HE21 . GLN A 1 77  ? 20.926  5.249   1.785   1.00 0.00 ? 77  GLN A HE21 2  
ATOM 3139  H HE22 . GLN A 1 77  ? 22.220  4.407   1.010   1.00 0.00 ? 77  GLN A HE22 2  
ATOM 3140  N N    . PRO A 1 78  ? 20.152  0.530   3.973   1.00 0.00 ? 78  PRO A N    2  
ATOM 3141  C CA   . PRO A 1 78  ? 20.830  -0.186  5.058   1.00 0.00 ? 78  PRO A CA   2  
ATOM 3142  C C    . PRO A 1 78  ? 21.014  0.682   6.298   1.00 0.00 ? 78  PRO A C    2  
ATOM 3143  O O    . PRO A 1 78  ? 21.485  0.211   7.333   1.00 0.00 ? 78  PRO A O    2  
ATOM 3144  C CB   . PRO A 1 78  ? 22.188  -0.547  4.451   1.00 0.00 ? 78  PRO A CB   2  
ATOM 3145  C CG   . PRO A 1 78  ? 22.414  0.477   3.393   1.00 0.00 ? 78  PRO A CG   2  
ATOM 3146  C CD   . PRO A 1 78  ? 21.054  0.813   2.844   1.00 0.00 ? 78  PRO A CD   2  
ATOM 3147  H HA   . PRO A 1 78  ? 20.302  -1.089  5.327   1.00 0.00 ? 78  PRO A HA   2  
ATOM 3148  H HB2  . PRO A 1 78  ? 22.950  -0.500  5.216   1.00 0.00 ? 78  PRO A HB2  2  
ATOM 3149  H HB3  . PRO A 1 78  ? 22.147  -1.542  4.035   1.00 0.00 ? 78  PRO A HB3  2  
ATOM 3150  H HG2  . PRO A 1 78  ? 22.872  1.355   3.823   1.00 0.00 ? 78  PRO A HG2  2  
ATOM 3151  H HG3  . PRO A 1 78  ? 23.041  0.068   2.615   1.00 0.00 ? 78  PRO A HG3  2  
ATOM 3152  H HD2  . PRO A 1 78  ? 21.007  1.855   2.565   1.00 0.00 ? 78  PRO A HD2  2  
ATOM 3153  H HD3  . PRO A 1 78  ? 20.823  0.183   1.999   1.00 0.00 ? 78  PRO A HD3  2  
ATOM 3154  N N    . SER A 1 79  ? 20.639  1.952   6.187   1.00 0.00 ? 79  SER A N    2  
ATOM 3155  C CA   . SER A 1 79  ? 20.766  2.887   7.299   1.00 0.00 ? 79  SER A CA   2  
ATOM 3156  C C    . SER A 1 79  ? 19.482  3.690   7.483   1.00 0.00 ? 79  SER A C    2  
ATOM 3157  O O    . SER A 1 79  ? 19.515  4.848   7.900   1.00 0.00 ? 79  SER A O    2  
ATOM 3158  C CB   . SER A 1 79  ? 21.944  3.835   7.064   1.00 0.00 ? 79  SER A CB   2  
ATOM 3159  O OG   . SER A 1 79  ? 22.167  4.660   8.194   1.00 0.00 ? 79  SER A OG   2  
ATOM 3160  H H    . SER A 1 79  ? 20.270  2.269   5.335   1.00 0.00 ? 79  SER A H    2  
ATOM 3161  H HA   . SER A 1 79  ? 20.950  2.313   8.195   1.00 0.00 ? 79  SER A HA   2  
ATOM 3162  H HB2  . SER A 1 79  ? 22.835  3.257   6.874   1.00 0.00 ? 79  SER A HB2  2  
ATOM 3163  H HB3  . SER A 1 79  ? 21.733  4.462   6.210   1.00 0.00 ? 79  SER A HB3  2  
ATOM 3164  H HG   . SER A 1 79  ? 21.749  5.513   8.055   1.00 0.00 ? 79  SER A HG   2  
ATOM 3165  N N    . ASP A 1 80  ? 18.352  3.066   7.170   1.00 0.00 ? 80  ASP A N    2  
ATOM 3166  C CA   . ASP A 1 80  ? 17.055  3.721   7.301   1.00 0.00 ? 80  ASP A CA   2  
ATOM 3167  C C    . ASP A 1 80  ? 16.467  3.487   8.689   1.00 0.00 ? 80  ASP A C    2  
ATOM 3168  O O    . ASP A 1 80  ? 16.956  2.652   9.449   1.00 0.00 ? 80  ASP A O    2  
ATOM 3169  C CB   . ASP A 1 80  ? 16.090  3.208   6.231   1.00 0.00 ? 80  ASP A CB   2  
ATOM 3170  C CG   . ASP A 1 80  ? 16.180  4.001   4.942   1.00 0.00 ? 80  ASP A CG   2  
ATOM 3171  O OD1  . ASP A 1 80  ? 17.010  4.931   4.875   1.00 0.00 ? 80  ASP A OD1  2  
ATOM 3172  O OD2  . ASP A 1 80  ? 15.420  3.692   4.001   1.00 0.00 ? 80  ASP A OD2  2  
ATOM 3173  H H    . ASP A 1 80  ? 18.390  2.143   6.843   1.00 0.00 ? 80  ASP A H    2  
ATOM 3174  H HA   . ASP A 1 80  ? 17.203  4.781   7.161   1.00 0.00 ? 80  ASP A HA   2  
ATOM 3175  H HB2  . ASP A 1 80  ? 16.320  2.175   6.014   1.00 0.00 ? 80  ASP A HB2  2  
ATOM 3176  H HB3  . ASP A 1 80  ? 15.079  3.276   6.605   1.00 0.00 ? 80  ASP A HB3  2  
ATOM 3177  N N    . ASN A 1 81  ? 15.415  4.232   9.013   1.00 0.00 ? 81  ASN A N    2  
ATOM 3178  C CA   . ASN A 1 81  ? 14.760  4.107   10.311  1.00 0.00 ? 81  ASN A CA   2  
ATOM 3179  C C    . ASN A 1 81  ? 13.734  2.978   10.296  1.00 0.00 ? 81  ASN A C    2  
ATOM 3180  O O    . ASN A 1 81  ? 12.572  3.177   10.650  1.00 0.00 ? 81  ASN A O    2  
ATOM 3181  C CB   . ASN A 1 81  ? 14.081  5.423   10.692  1.00 0.00 ? 81  ASN A CB   2  
ATOM 3182  C CG   . ASN A 1 81  ? 13.842  5.540   12.185  1.00 0.00 ? 81  ASN A CG   2  
ATOM 3183  O OD1  . ASN A 1 81  ? 14.668  6.086   12.916  1.00 0.00 ? 81  ASN A OD1  2  
ATOM 3184  N ND2  . ASN A 1 81  ? 12.707  5.026   12.644  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 3185  H H    . ASN A 1 81  ? 15.070  4.881   8.365   1.00 0.00 ? 81  ASN A H    2  
ATOM 3186  H HA   . ASN A 1 81  ? 15.519  3.878   11.044  1.00 0.00 ? 81  ASN A HA   2  
ATOM 3187  H HB2  . ASN A 1 81  ? 14.707  6.247   10.382  1.00 0.00 ? 81  ASN A HB2  2  
ATOM 3188  H HB3  . ASN A 1 81  ? 13.129  5.490   10.186  1.00 0.00 ? 81  ASN A HB3  2  
ATOM 3189  H HD21 . ASN A 1 81  ? 12.096  4.606   12.003  1.00 0.00 ? 81  ASN A HD21 2  
ATOM 3190  H HD22 . ASN A 1 81  ? 12.526  5.088   13.605  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 3191  N N    . ILE A 1 82  ? 14.172  1.793   9.884   1.00 0.00 ? 82  ILE A N    2  
ATOM 3192  C CA   . ILE A 1 82  ? 13.293  0.632   9.825   1.00 0.00 ? 82  ILE A CA   2  
ATOM 3193  C C    . ILE A 1 82  ? 13.960  -0.595  10.438  1.00 0.00 ? 82  ILE A C    2  
ATOM 3194  O O    . ILE A 1 82  ? 14.829  -1.213  9.824   1.00 0.00 ? 82  ILE A O    2  
ATOM 3195  C CB   . ILE A 1 82  ? 12.883  0.310   8.376   1.00 0.00 ? 82  ILE A CB   2  
ATOM 3196  C CG1  . ILE A 1 82  ? 12.243  1.535   7.719   1.00 0.00 ? 82  ILE A CG1  2  
ATOM 3197  C CG2  . ILE A 1 82  ? 11.927  -0.874  8.347   1.00 0.00 ? 82  ILE A CG2  2  
ATOM 3198  C CD1  . ILE A 1 82  ? 10.869  1.863   8.262   1.00 0.00 ? 82  ILE A CD1  2  
ATOM 3199  H H    . ILE A 1 82  ? 15.109  1.697   9.615   1.00 0.00 ? 82  ILE A H    2  
ATOM 3200  H HA   . ILE A 1 82  ? 12.400  0.862   10.388  1.00 0.00 ? 82  ILE A HA   2  
ATOM 3201  H HB   . ILE A 1 82  ? 13.771  0.038   7.826   1.00 0.00 ? 82  ILE A HB   2  
ATOM 3202  H HG12 . ILE A 1 82  ? 12.876  2.393   7.880   1.00 0.00 ? 82  ILE A HG12 2  
ATOM 3203  H HG13 . ILE A 1 82  ? 12.147  1.356   6.658   1.00 0.00 ? 82  ILE A HG13 2  
ATOM 3204  H HG21 . ILE A 1 82  ? 11.935  -1.319  7.362   1.00 0.00 ? 82  ILE A HG21 2  
ATOM 3205  H HG22 . ILE A 1 82  ? 12.241  -1.607  9.074   1.00 0.00 ? 82  ILE A HG22 2  
ATOM 3206  H HG23 . ILE A 1 82  ? 10.929  -0.537  8.581   1.00 0.00 ? 82  ILE A HG23 2  
ATOM 3207  H HD11 . ILE A 1 82  ? 10.722  2.933   8.244   1.00 0.00 ? 82  ILE A HD11 2  
ATOM 3208  H HD12 . ILE A 1 82  ? 10.117  1.387   7.651   1.00 0.00 ? 82  ILE A HD12 2  
ATOM 3209  H HD13 . ILE A 1 82  ? 10.788  1.506   9.278   1.00 0.00 ? 82  ILE A HD13 2  
ATOM 3210  N N    . SER A 1 83  ? 13.545  -0.943  11.651  1.00 0.00 ? 83  SER A N    2  
ATOM 3211  C CA   . SER A 1 83  ? 14.103  -2.096  12.349  1.00 0.00 ? 83  SER A CA   2  
ATOM 3212  C C    . SER A 1 83  ? 14.209  -3.297  11.414  1.00 0.00 ? 83  SER A C    2  
ATOM 3213  O O    . SER A 1 83  ? 15.238  -3.971  11.366  1.00 0.00 ? 83  SER A O    2  
ATOM 3214  C CB   . SER A 1 83  ? 13.240  -2.452  13.561  1.00 0.00 ? 83  SER A CB   2  
ATOM 3215  O OG   . SER A 1 83  ? 13.631  -3.696  14.116  1.00 0.00 ? 83  SER A OG   2  
ATOM 3216  H H    . SER A 1 83  ? 12.848  -0.410  12.089  1.00 0.00 ? 83  SER A H    2  
ATOM 3217  H HA   . SER A 1 83  ? 15.093  -1.830  12.688  1.00 0.00 ? 83  SER A HA   2  
ATOM 3218  H HB2  . SER A 1 83  ? 13.347  -1.687  14.314  1.00 0.00 ? 83  SER A HB2  2  
ATOM 3219  H HB3  . SER A 1 83  ? 12.206  -2.516  13.256  1.00 0.00 ? 83  SER A HB3  2  
ATOM 3220  H HG   . SER A 1 83  ? 14.587  -3.771  14.093  1.00 0.00 ? 83  SER A HG   2  
ATOM 3221  N N    . ARG A 1 84  ? 13.138  -3.559  10.673  1.00 0.00 ? 84  ARG A N    2  
ATOM 3222  C CA   . ARG A 1 84  ? 13.108  -4.679  9.741   1.00 0.00 ? 84  ARG A CA   2  
ATOM 3223  C C    . ARG A 1 84  ? 14.171  -4.513  8.658   1.00 0.00 ? 84  ARG A C    2  
ATOM 3224  O O    . ARG A 1 84  ? 14.856  -3.492  8.597   1.00 0.00 ? 84  ARG A O    2  
ATOM 3225  C CB   . ARG A 1 84  ? 11.725  -4.800  9.099   1.00 0.00 ? 84  ARG A CB   2  
ATOM 3226  C CG   . ARG A 1 84  ? 10.717  -5.542  9.960   1.00 0.00 ? 84  ARG A CG   2  
ATOM 3227  C CD   . ARG A 1 84  ? 9.292   -5.109  9.649   1.00 0.00 ? 84  ARG A CD   2  
ATOM 3228  N NE   . ARG A 1 84  ? 8.311   -6.094  10.096  1.00 0.00 ? 84  ARG A NE   2  
ATOM 3229  C CZ   . ARG A 1 84  ? 8.042   -6.336  11.374  1.00 0.00 ? 84  ARG A CZ   2  
ATOM 3230  N NH1  . ARG A 1 84  ? 8.678   -5.669  12.326  1.00 0.00 ? 84  ARG A NH1  2  
ATOM 3231  N NH2  . ARG A 1 84  ? 7.135   -7.248  11.701  1.00 0.00 ? 84  ARG A NH2  2  
ATOM 3232  H H    . ARG A 1 84  ? 12.347  -2.985  10.756  1.00 0.00 ? 84  ARG A H    2  
ATOM 3233  H HA   . ARG A 1 84  ? 13.317  -5.580  10.298  1.00 0.00 ? 84  ARG A HA   2  
ATOM 3234  H HB2  . ARG A 1 84  ? 11.342  -3.808  8.908   1.00 0.00 ? 84  ARG A HB2  2  
ATOM 3235  H HB3  . ARG A 1 84  ? 11.822  -5.326  8.161   1.00 0.00 ? 84  ARG A HB3  2  
ATOM 3236  H HG2  . ARG A 1 84  ? 10.807  -6.602  9.772   1.00 0.00 ? 84  ARG A HG2  2  
ATOM 3237  H HG3  . ARG A 1 84  ? 10.927  -5.339  11.000  1.00 0.00 ? 84  ARG A HG3  2  
ATOM 3238  H HD2  . ARG A 1 84  ? 9.099   -4.170  10.147  1.00 0.00 ? 84  ARG A HD2  2  
ATOM 3239  H HD3  . ARG A 1 84  ? 9.196   -4.976  8.582   1.00 0.00 ? 84  ARG A HD3  2  
ATOM 3240  H HE   . ARG A 1 84  ? 7.829   -6.598  9.408   1.00 0.00 ? 84  ARG A HE   2  
ATOM 3241  H HH11 . ARG A 1 84  ? 9.361   -4.981  12.083  1.00 0.00 ? 84  ARG A HH11 2  
ATOM 3242  H HH12 . ARG A 1 84  ? 8.473   -5.853  13.288  1.00 0.00 ? 84  ARG A HH12 2  
ATOM 3243  H HH21 . ARG A 1 84  ? 6.654   -7.753  10.985  1.00 0.00 ? 84  ARG A HH21 2  
ATOM 3244  H HH22 . ARG A 1 84  ? 6.934   -7.430  12.663  1.00 0.00 ? 84  ARG A HH22 2  
ATOM 3245  N N    . LYS A 1 85  ? 14.302  -5.524  7.806   1.00 0.00 ? 85  LYS A N    2  
ATOM 3246  C CA   . LYS A 1 85  ? 15.280  -5.491  6.725   1.00 0.00 ? 85  LYS A CA   2  
ATOM 3247  C C    . LYS A 1 85  ? 14.588  -5.434  5.367   1.00 0.00 ? 85  LYS A C    2  
ATOM 3248  O O    . LYS A 1 85  ? 14.748  -4.471  4.617   1.00 0.00 ? 85  LYS A O    2  
ATOM 3249  C CB   . LYS A 1 85  ? 16.189  -6.720  6.794   1.00 0.00 ? 85  LYS A CB   2  
ATOM 3250  C CG   . LYS A 1 85  ? 17.354  -6.561  7.756   1.00 0.00 ? 85  LYS A CG   2  
ATOM 3251  C CD   . LYS A 1 85  ? 18.227  -7.804  7.786   1.00 0.00 ? 85  LYS A CD   2  
ATOM 3252  C CE   . LYS A 1 85  ? 19.458  -7.601  8.656   1.00 0.00 ? 85  LYS A CE   2  
ATOM 3253  N NZ   . LYS A 1 85  ? 20.601  -7.047  7.878   1.00 0.00 ? 85  LYS A NZ   2  
ATOM 3254  H H    . LYS A 1 85  ? 13.727  -6.311  7.906   1.00 0.00 ? 85  LYS A H    2  
ATOM 3255  H HA   . LYS A 1 85  ? 15.880  -4.602  6.847   1.00 0.00 ? 85  LYS A HA   2  
ATOM 3256  H HB2  . LYS A 1 85  ? 15.603  -7.570  7.110   1.00 0.00 ? 85  LYS A HB2  2  
ATOM 3257  H HB3  . LYS A 1 85  ? 16.588  -6.915  5.809   1.00 0.00 ? 85  LYS A HB3  2  
ATOM 3258  H HG2  . LYS A 1 85  ? 17.956  -5.720  7.443   1.00 0.00 ? 85  LYS A HG2  2  
ATOM 3259  H HG3  . LYS A 1 85  ? 16.968  -6.379  8.749   1.00 0.00 ? 85  LYS A HG3  2  
ATOM 3260  H HD2  . LYS A 1 85  ? 17.652  -8.628  8.183   1.00 0.00 ? 85  LYS A HD2  2  
ATOM 3261  H HD3  . LYS A 1 85  ? 18.543  -8.036  6.778   1.00 0.00 ? 85  LYS A HD3  2  
ATOM 3262  H HE2  . LYS A 1 85  ? 19.210  -6.917  9.453   1.00 0.00 ? 85  LYS A HE2  2  
ATOM 3263  H HE3  . LYS A 1 85  ? 19.747  -8.553  9.076   1.00 0.00 ? 85  LYS A HE3  2  
ATOM 3264  H HZ1  . LYS A 1 85  ? 20.718  -7.574  6.990   1.00 0.00 ? 85  LYS A HZ1  2  
ATOM 3265  H HZ2  . LYS A 1 85  ? 21.478  -7.121  8.432   1.00 0.00 ? 85  LYS A HZ2  2  
ATOM 3266  H HZ3  . LYS A 1 85  ? 20.429  -6.046  7.655   1.00 0.00 ? 85  LYS A HZ3  2  
ATOM 3267  N N    . HIS A 1 86  ? 13.816  -6.472  5.057   1.00 0.00 ? 86  HIS A N    2  
ATOM 3268  C CA   . HIS A 1 86  ? 13.098  -6.538  3.789   1.00 0.00 ? 86  HIS A CA   2  
ATOM 3269  C C    . HIS A 1 86  ? 11.901  -5.592  3.793   1.00 0.00 ? 86  HIS A C    2  
ATOM 3270  O O    . HIS A 1 86  ? 10.751  -6.028  3.855   1.00 0.00 ? 86  HIS A O    2  
ATOM 3271  C CB   . HIS A 1 86  ? 12.630  -7.969  3.518   1.00 0.00 ? 86  HIS A CB   2  
ATOM 3272  C CG   . HIS A 1 86  ? 13.582  -9.014  4.015   1.00 0.00 ? 86  HIS A CG   2  
ATOM 3273  N ND1  . HIS A 1 86  ? 14.825  -9.225  3.458   1.00 0.00 ? 86  HIS A ND1  2  
ATOM 3274  C CD2  . HIS A 1 86  ? 13.466  -9.908  5.025   1.00 0.00 ? 86  HIS A CD2  2  
ATOM 3275  C CE1  . HIS A 1 86  ? 15.433  -10.206 4.103   1.00 0.00 ? 86  HIS A CE1  2  
ATOM 3276  N NE2  . HIS A 1 86  ? 14.629  -10.637 5.058   1.00 0.00 ? 86  HIS A NE2  2  
ATOM 3277  H H    . HIS A 1 86  ? 13.728  -7.209  5.696   1.00 0.00 ? 86  HIS A H    2  
ATOM 3278  H HA   . HIS A 1 86  ? 13.777  -6.237  3.007   1.00 0.00 ? 86  HIS A HA   2  
ATOM 3279  H HB2  . HIS A 1 86  ? 11.680  -8.128  4.005   1.00 0.00 ? 86  HIS A HB2  2  
ATOM 3280  H HB3  . HIS A 1 86  ? 12.512  -8.106  2.453   1.00 0.00 ? 86  HIS A HB3  2  
ATOM 3281  H HD1  . HIS A 1 86  ? 15.205  -8.732  2.702   1.00 0.00 ? 86  HIS A HD1  2  
ATOM 3282  H HD2  . HIS A 1 86  ? 12.616  -10.027 5.682   1.00 0.00 ? 86  HIS A HD2  2  
ATOM 3283  H HE1  . HIS A 1 86  ? 16.418  -10.590 3.886   1.00 0.00 ? 86  HIS A HE1  2  
ATOM 3284  H HE2  . HIS A 1 86  ? 14.799  -11.415 5.630   1.00 0.00 ? 86  HIS A HE2  2  
ATOM 3285  N N    . THR A 1 87  ? 12.179  -4.294  3.726   1.00 0.00 ? 87  THR A N    2  
ATOM 3286  C CA   . THR A 1 87  ? 11.127  -3.286  3.724   1.00 0.00 ? 87  THR A CA   2  
ATOM 3287  C C    . THR A 1 87  ? 11.298  -2.315  2.561   1.00 0.00 ? 87  THR A C    2  
ATOM 3288  O O    . THR A 1 87  ? 12.418  -2.009  2.154   1.00 0.00 ? 87  THR A O    2  
ATOM 3289  C CB   . THR A 1 87  ? 11.108  -2.490  5.043   1.00 0.00 ? 87  THR A CB   2  
ATOM 3290  O OG1  . THR A 1 87  ? 10.612  -3.313  6.104   1.00 0.00 ? 87  THR A OG1  2  
ATOM 3291  C CG2  . THR A 1 87  ? 10.241  -1.246  4.912   1.00 0.00 ? 87  THR A CG2  2  
ATOM 3292  H H    . THR A 1 87  ? 13.116  -4.008  3.678   1.00 0.00 ? 87  THR A H    2  
ATOM 3293  H HA   . THR A 1 87  ? 10.179  -3.793  3.620   1.00 0.00 ? 87  THR A HA   2  
ATOM 3294  H HB   . THR A 1 87  ? 12.118  -2.184  5.275   1.00 0.00 ? 87  THR A HB   2  
ATOM 3295  H HG1  . THR A 1 87  ? 10.788  -4.236  5.903   1.00 0.00 ? 87  THR A HG1  2  
ATOM 3296  H HG21 . THR A 1 87  ? 9.234   -1.536  4.653   1.00 0.00 ? 87  THR A HG21 2  
ATOM 3297  H HG22 . THR A 1 87  ? 10.642  -0.608  4.138   1.00 0.00 ? 87  THR A HG22 2  
ATOM 3298  H HG23 . THR A 1 87  ? 10.233  -0.713  5.851   1.00 0.00 ? 87  THR A HG23 2  
ATOM 3299  N N    . PHE A 1 88  ? 10.179  -1.833  2.029   1.00 0.00 ? 88  PHE A N    2  
ATOM 3300  C CA   . PHE A 1 88  ? 10.205  -0.897  0.912   1.00 0.00 ? 88  PHE A CA   2  
ATOM 3301  C C    . PHE A 1 88  ? 9.179   0.215   1.109   1.00 0.00 ? 88  PHE A C    2  
ATOM 3302  O O    . PHE A 1 88  ? 8.060   -0.030  1.560   1.00 0.00 ? 88  PHE A O    2  
ATOM 3303  C CB   . PHE A 1 88  ? 9.932   -1.631  -0.403  1.00 0.00 ? 88  PHE A CB   2  
ATOM 3304  C CG   . PHE A 1 88  ? 8.591   -2.306  -0.445  1.00 0.00 ? 88  PHE A CG   2  
ATOM 3305  C CD1  . PHE A 1 88  ? 8.304   -3.360  0.407   1.00 0.00 ? 88  PHE A CD1  2  
ATOM 3306  C CD2  . PHE A 1 88  ? 7.617   -1.886  -1.336  1.00 0.00 ? 88  PHE A CD2  2  
ATOM 3307  C CE1  . PHE A 1 88  ? 7.071   -3.983  0.370   1.00 0.00 ? 88  PHE A CE1  2  
ATOM 3308  C CE2  . PHE A 1 88  ? 6.382   -2.505  -1.378  1.00 0.00 ? 88  PHE A CE2  2  
ATOM 3309  C CZ   . PHE A 1 88  ? 6.108   -3.555  -0.523  1.00 0.00 ? 88  PHE A CZ   2  
ATOM 3310  H H    . PHE A 1 88  ? 9.315   -2.115  2.397   1.00 0.00 ? 88  PHE A H    2  
ATOM 3311  H HA   . PHE A 1 88  ? 11.190  -0.458  0.871   1.00 0.00 ? 88  PHE A HA   2  
ATOM 3312  H HB2  . PHE A 1 88  ? 9.972   -0.923  -1.217  1.00 0.00 ? 88  PHE A HB2  2  
ATOM 3313  H HB3  . PHE A 1 88  ? 10.690  -2.385  -0.550  1.00 0.00 ? 88  PHE A HB3  2  
ATOM 3314  H HD1  . PHE A 1 88  ? 9.056   -3.696  1.107   1.00 0.00 ? 88  PHE A HD1  2  
ATOM 3315  H HD2  . PHE A 1 88  ? 7.829   -1.064  -2.006  1.00 0.00 ? 88  PHE A HD2  2  
ATOM 3316  H HE1  . PHE A 1 88  ? 6.860   -4.804  1.040   1.00 0.00 ? 88  PHE A HE1  2  
ATOM 3317  H HE2  . PHE A 1 88  ? 5.631   -2.167  -2.077  1.00 0.00 ? 88  PHE A HE2  2  
ATOM 3318  H HZ   . PHE A 1 88  ? 5.145   -4.040  -0.554  1.00 0.00 ? 88  PHE A HZ   2  
ATOM 3319  N N    . LYS A 1 89  ? 9.569   1.439   0.770   1.00 0.00 ? 89  LYS A N    2  
ATOM 3320  C CA   . LYS A 1 89  ? 8.685   2.590   0.908   1.00 0.00 ? 89  LYS A CA   2  
ATOM 3321  C C    . LYS A 1 89  ? 8.499   3.298   -0.430  1.00 0.00 ? 89  LYS A C    2  
ATOM 3322  O O    . LYS A 1 89  ? 9.418   3.353   -1.246  1.00 0.00 ? 89  LYS A O    2  
ATOM 3323  C CB   . LYS A 1 89  ? 9.247   3.569   1.941   1.00 0.00 ? 89  LYS A CB   2  
ATOM 3324  C CG   . LYS A 1 89  ? 10.428  4.378   1.434   1.00 0.00 ? 89  LYS A CG   2  
ATOM 3325  C CD   . LYS A 1 89  ? 11.743  3.657   1.679   1.00 0.00 ? 89  LYS A CD   2  
ATOM 3326  C CE   . LYS A 1 89  ? 12.820  4.116   0.707   1.00 0.00 ? 89  LYS A CE   2  
ATOM 3327  N NZ   . LYS A 1 89  ? 13.448  5.395   1.139   1.00 0.00 ? 89  LYS A NZ   2  
ATOM 3328  H H    . LYS A 1 89  ? 10.474  1.571   0.416   1.00 0.00 ? 89  LYS A H    2  
ATOM 3329  H HA   . LYS A 1 89  ? 7.725   2.232   1.249   1.00 0.00 ? 89  LYS A HA   2  
ATOM 3330  H HB2  . LYS A 1 89  ? 8.465   4.256   2.231   1.00 0.00 ? 89  LYS A HB2  2  
ATOM 3331  H HB3  . LYS A 1 89  ? 9.565   3.013   2.811   1.00 0.00 ? 89  LYS A HB3  2  
ATOM 3332  H HG2  . LYS A 1 89  ? 10.312  4.541   0.372   1.00 0.00 ? 89  LYS A HG2  2  
ATOM 3333  H HG3  . LYS A 1 89  ? 10.448  5.329   1.946   1.00 0.00 ? 89  LYS A HG3  2  
ATOM 3334  H HD2  . LYS A 1 89  ? 12.073  3.861   2.686   1.00 0.00 ? 89  LYS A HD2  2  
ATOM 3335  H HD3  . LYS A 1 89  ? 11.590  2.594   1.557   1.00 0.00 ? 89  LYS A HD3  2  
ATOM 3336  H HE2  . LYS A 1 89  ? 13.581  3.353   0.647   1.00 0.00 ? 89  LYS A HE2  2  
ATOM 3337  H HE3  . LYS A 1 89  ? 12.372  4.255   -0.266  1.00 0.00 ? 89  LYS A HE3  2  
ATOM 3338  H HZ1  . LYS A 1 89  ? 13.268  5.558   2.150   1.00 0.00 ? 89  LYS A HZ1  2  
ATOM 3339  H HZ2  . LYS A 1 89  ? 13.053  6.189   0.595   1.00 0.00 ? 89  LYS A HZ2  2  
ATOM 3340  H HZ3  . LYS A 1 89  ? 14.475  5.359   0.982   1.00 0.00 ? 89  LYS A HZ3  2  
ATOM 3341  N N    . ALA A 1 90  ? 7.305   3.839   -0.647  1.00 0.00 ? 90  ALA A N    2  
ATOM 3342  C CA   . ALA A 1 90  ? 7.000   4.546   -1.885  1.00 0.00 ? 90  ALA A CA   2  
ATOM 3343  C C    . ALA A 1 90  ? 6.994   6.056   -1.668  1.00 0.00 ? 90  ALA A C    2  
ATOM 3344  O O    . ALA A 1 90  ? 6.328   6.558   -0.763  1.00 0.00 ? 90  ALA A O    2  
ATOM 3345  C CB   . ALA A 1 90  ? 5.661   4.086   -2.441  1.00 0.00 ? 90  ALA A CB   2  
ATOM 3346  H H    . ALA A 1 90  ? 6.613   3.762   0.042   1.00 0.00 ? 90  ALA A H    2  
ATOM 3347  H HA   . ALA A 1 90  ? 7.766   4.300   -2.607  1.00 0.00 ? 90  ALA A HA   2  
ATOM 3348  H HB1  . ALA A 1 90  ? 5.795   3.162   -2.983  1.00 0.00 ? 90  ALA A HB1  2  
ATOM 3349  H HB2  . ALA A 1 90  ? 4.969   3.928   -1.626  1.00 0.00 ? 90  ALA A HB2  2  
ATOM 3350  H HB3  . ALA A 1 90  ? 5.269   4.840   -3.106  1.00 0.00 ? 90  ALA A HB3  2  
ATOM 3351  N N    . GLU A 1 91  ? 7.740   6.773   -2.502  1.00 0.00 ? 91  GLU A N    2  
ATOM 3352  C CA   . GLU A 1 91  ? 7.821   8.225   -2.399  1.00 0.00 ? 91  GLU A CA   2  
ATOM 3353  C C    . GLU A 1 91  ? 7.312   8.890   -3.675  1.00 0.00 ? 91  GLU A C    2  
ATOM 3354  O O    . GLU A 1 91  ? 7.702   8.515   -4.781  1.00 0.00 ? 91  GLU A O    2  
ATOM 3355  C CB   . GLU A 1 91  ? 9.261   8.660   -2.123  1.00 0.00 ? 91  GLU A CB   2  
ATOM 3356  C CG   . GLU A 1 91  ? 10.065  8.938   -3.382  1.00 0.00 ? 91  GLU A CG   2  
ATOM 3357  C CD   . GLU A 1 91  ? 11.556  9.017   -3.118  1.00 0.00 ? 91  GLU A CD   2  
ATOM 3358  O OE1  . GLU A 1 91  ? 12.063  8.192   -2.329  1.00 0.00 ? 91  GLU A OE1  2  
ATOM 3359  O OE2  . GLU A 1 91  ? 12.215  9.903   -3.700  1.00 0.00 ? 91  GLU A OE2  2  
ATOM 3360  H H    . GLU A 1 91  ? 8.249   6.314   -3.204  1.00 0.00 ? 91  GLU A H    2  
ATOM 3361  H HA   . GLU A 1 91  ? 7.197   8.534   -1.574  1.00 0.00 ? 91  GLU A HA   2  
ATOM 3362  H HB2  . GLU A 1 91  ? 9.245   9.559   -1.524  1.00 0.00 ? 91  GLU A HB2  2  
ATOM 3363  H HB3  . GLU A 1 91  ? 9.760   7.878   -1.569  1.00 0.00 ? 91  GLU A HB3  2  
ATOM 3364  H HG2  . GLU A 1 91  ? 9.882   8.147   -4.093  1.00 0.00 ? 91  GLU A HG2  2  
ATOM 3365  H HG3  . GLU A 1 91  ? 9.739   9.879   -3.801  1.00 0.00 ? 91  GLU A HG3  2  
ATOM 3366  N N    . HIS A 1 92  ? 6.439   9.879   -3.512  1.00 0.00 ? 92  HIS A N    2  
ATOM 3367  C CA   . HIS A 1 92  ? 5.877   10.598  -4.650  1.00 0.00 ? 92  HIS A CA   2  
ATOM 3368  C C    . HIS A 1 92  ? 6.582   11.936  -4.850  1.00 0.00 ? 92  HIS A C    2  
ATOM 3369  O O    . HIS A 1 92  ? 6.460   12.561  -5.903  1.00 0.00 ? 92  HIS A O    2  
ATOM 3370  C CB   . HIS A 1 92  ? 4.378   10.823  -4.448  1.00 0.00 ? 92  HIS A CB   2  
ATOM 3371  C CG   . HIS A 1 92  ? 3.760   11.709  -5.485  1.00 0.00 ? 92  HIS A CG   2  
ATOM 3372  N ND1  . HIS A 1 92  ? 2.692   12.541  -5.225  1.00 0.00 ? 92  HIS A ND1  2  
ATOM 3373  C CD2  . HIS A 1 92  ? 4.068   11.891  -6.791  1.00 0.00 ? 92  HIS A CD2  2  
ATOM 3374  C CE1  . HIS A 1 92  ? 2.368   13.195  -6.326  1.00 0.00 ? 92  HIS A CE1  2  
ATOM 3375  N NE2  . HIS A 1 92  ? 3.188   12.819  -7.291  1.00 0.00 ? 92  HIS A NE2  2  
ATOM 3376  H H    . HIS A 1 92  ? 6.168   10.132  -2.605  1.00 0.00 ? 92  HIS A H    2  
ATOM 3377  H HA   . HIS A 1 92  ? 6.025   9.992   -5.531  1.00 0.00 ? 92  HIS A HA   2  
ATOM 3378  H HB2  . HIS A 1 92  ? 3.870   9.871   -4.480  1.00 0.00 ? 92  HIS A HB2  2  
ATOM 3379  H HB3  . HIS A 1 92  ? 4.217   11.279  -3.482  1.00 0.00 ? 92  HIS A HB3  2  
ATOM 3380  H HD1  . HIS A 1 92  ? 2.237   12.636  -4.363  1.00 0.00 ? 92  HIS A HD1  2  
ATOM 3381  H HD2  . HIS A 1 92  ? 4.859   11.398  -7.339  1.00 0.00 ? 92  HIS A HD2  2  
ATOM 3382  H HE1  . HIS A 1 92  ? 1.569   13.915  -6.422  1.00 0.00 ? 92  HIS A HE1  2  
ATOM 3383  H HE2  . HIS A 1 92  ? 3.114   13.087  -8.230  1.00 0.00 ? 92  HIS A HE2  2  
ATOM 3384  N N    . ALA A 1 93  ? 7.320   12.369  -3.833  1.00 0.00 ? 93  ALA A N    2  
ATOM 3385  C CA   . ALA A 1 93  ? 8.045   13.631  -3.898  1.00 0.00 ? 93  ALA A CA   2  
ATOM 3386  C C    . ALA A 1 93  ? 7.094   14.799  -4.137  1.00 0.00 ? 93  ALA A C    2  
ATOM 3387  O O    . ALA A 1 93  ? 7.393   15.707  -4.912  1.00 0.00 ? 93  ALA A O    2  
ATOM 3388  C CB   . ALA A 1 93  ? 9.102   13.577  -4.991  1.00 0.00 ? 93  ALA A CB   2  
ATOM 3389  H H    . ALA A 1 93  ? 7.378   11.825  -3.020  1.00 0.00 ? 93  ALA A H    2  
ATOM 3390  H HA   . ALA A 1 93  ? 8.547   13.777  -2.952  1.00 0.00 ? 93  ALA A HA   2  
ATOM 3391  H HB1  . ALA A 1 93  ? 9.692   12.680  -4.876  1.00 0.00 ? 93  ALA A HB1  2  
ATOM 3392  H HB2  . ALA A 1 93  ? 8.620   13.570  -5.957  1.00 0.00 ? 93  ALA A HB2  2  
ATOM 3393  H HB3  . ALA A 1 93  ? 9.744   14.442  -4.914  1.00 0.00 ? 93  ALA A HB3  2  
ATOM 3394  N N    . GLY A 1 94  ? 5.946   14.769  -3.467  1.00 0.00 ? 94  GLY A N    2  
ATOM 3395  C CA   . GLY A 1 94  ? 4.969   15.830  -3.621  1.00 0.00 ? 94  GLY A CA   2  
ATOM 3396  C C    . GLY A 1 94  ? 3.922   15.818  -2.524  1.00 0.00 ? 94  GLY A C    2  
ATOM 3397  O O    . GLY A 1 94  ? 3.426   16.869  -2.118  1.00 0.00 ? 94  GLY A O    2  
ATOM 3398  H H    . GLY A 1 94  ? 5.762   14.019  -2.862  1.00 0.00 ? 94  GLY A H    2  
ATOM 3399  H HA2  . GLY A 1 94  ? 5.480   16.781  -3.606  1.00 0.00 ? 94  GLY A HA2  2  
ATOM 3400  H HA3  . GLY A 1 94  ? 4.475   15.713  -4.575  1.00 0.00 ? 94  GLY A HA3  2  
ATOM 3401  N N    . VAL A 1 95  ? 3.584   14.626  -2.044  1.00 0.00 ? 95  VAL A N    2  
ATOM 3402  C CA   . VAL A 1 95  ? 2.589   14.482  -0.987  1.00 0.00 ? 95  VAL A CA   2  
ATOM 3403  C C    . VAL A 1 95  ? 3.202   13.863  0.264   1.00 0.00 ? 95  VAL A C    2  
ATOM 3404  O O    . VAL A 1 95  ? 3.286   14.508  1.310   1.00 0.00 ? 95  VAL A O    2  
ATOM 3405  C CB   . VAL A 1 95  ? 1.404   13.613  -1.448  1.00 0.00 ? 95  VAL A CB   2  
ATOM 3406  C CG1  . VAL A 1 95  ? 0.239   13.742  -0.479  1.00 0.00 ? 95  VAL A CG1  2  
ATOM 3407  C CG2  . VAL A 1 95  ? 0.980   13.996  -2.858  1.00 0.00 ? 95  VAL A CG2  2  
ATOM 3408  H H    . VAL A 1 95  ? 4.015   13.825  -2.407  1.00 0.00 ? 95  VAL A H    2  
ATOM 3409  H HA   . VAL A 1 95  ? 2.215   15.466  -0.745  1.00 0.00 ? 95  VAL A HA   2  
ATOM 3410  H HB   . VAL A 1 95  ? 1.722   12.581  -1.458  1.00 0.00 ? 95  VAL A HB   2  
ATOM 3411  H HG11 . VAL A 1 95  ? -0.508  12.997  -0.712  1.00 0.00 ? 95  VAL A HG11 2  
ATOM 3412  H HG12 . VAL A 1 95  ? 0.592   13.595  0.531   1.00 0.00 ? 95  VAL A HG12 2  
ATOM 3413  H HG13 . VAL A 1 95  ? -0.197  14.727  -0.569  1.00 0.00 ? 95  VAL A HG13 2  
ATOM 3414  H HG21 . VAL A 1 95  ? 1.850   14.275  -3.433  1.00 0.00 ? 95  VAL A HG21 2  
ATOM 3415  H HG22 . VAL A 1 95  ? 0.493   13.154  -3.328  1.00 0.00 ? 95  VAL A HG22 2  
ATOM 3416  H HG23 . VAL A 1 95  ? 0.294   14.830  -2.815  1.00 0.00 ? 95  VAL A HG23 2  
ATOM 3417  N N    . ARG A 1 96  ? 3.629   12.610  0.150   1.00 0.00 ? 96  ARG A N    2  
ATOM 3418  C CA   . ARG A 1 96  ? 4.234   11.904  1.272   1.00 0.00 ? 96  ARG A CA   2  
ATOM 3419  C C    . ARG A 1 96  ? 4.889   10.606  0.809   1.00 0.00 ? 96  ARG A C    2  
ATOM 3420  O O    . ARG A 1 96  ? 4.867   10.275  -0.377  1.00 0.00 ? 96  ARG A O    2  
ATOM 3421  C CB   . ARG A 1 96  ? 3.181   11.602  2.340   1.00 0.00 ? 96  ARG A CB   2  
ATOM 3422  C CG   . ARG A 1 96  ? 2.229   10.481  1.957   1.00 0.00 ? 96  ARG A CG   2  
ATOM 3423  C CD   . ARG A 1 96  ? 1.579   10.739  0.607   1.00 0.00 ? 96  ARG A CD   2  
ATOM 3424  N NE   . ARG A 1 96  ? 0.245   10.151  0.520   1.00 0.00 ? 96  ARG A NE   2  
ATOM 3425  C CZ   . ARG A 1 96  ? -0.768  10.510  1.300   1.00 0.00 ? 96  ARG A CZ   2  
ATOM 3426  N NH1  . ARG A 1 96  ? -0.601  11.450  2.220   1.00 0.00 ? 96  ARG A NH1  2  
ATOM 3427  N NH2  . ARG A 1 96  ? -1.953  9.928   1.161   1.00 0.00 ? 96  ARG A NH2  2  
ATOM 3428  H H    . ARG A 1 96  ? 3.535   12.149  -0.710  1.00 0.00 ? 96  ARG A H    2  
ATOM 3429  H HA   . ARG A 1 96  ? 4.992   12.544  1.698   1.00 0.00 ? 96  ARG A HA   2  
ATOM 3430  H HB2  . ARG A 1 96  ? 3.682   11.323  3.255   1.00 0.00 ? 96  ARG A HB2  2  
ATOM 3431  H HB3  . ARG A 1 96  ? 2.599   12.495  2.516   1.00 0.00 ? 96  ARG A HB3  2  
ATOM 3432  H HG2  . ARG A 1 96  ? 2.781   9.554   1.908   1.00 0.00 ? 96  ARG A HG2  2  
ATOM 3433  H HG3  . ARG A 1 96  ? 1.458   10.404  2.710   1.00 0.00 ? 96  ARG A HG3  2  
ATOM 3434  H HD2  . ARG A 1 96  ? 1.502   11.805  0.457   1.00 0.00 ? 96  ARG A HD2  2  
ATOM 3435  H HD3  . ARG A 1 96  ? 2.202   10.311  -0.164  1.00 0.00 ? 96  ARG A HD3  2  
ATOM 3436  H HE   . ARG A 1 96  ? 0.099   9.454   -0.152  1.00 0.00 ? 96  ARG A HE   2  
ATOM 3437  H HH11 . ARG A 1 96  ? 0.291   11.891  2.326   1.00 0.00 ? 96  ARG A HH11 2  
ATOM 3438  H HH12 . ARG A 1 96  ? -1.366  11.720  2.805   1.00 0.00 ? 96  ARG A HH12 2  
ATOM 3439  H HH21 . ARG A 1 96  ? -2.083  9.219   0.469   1.00 0.00 ? 96  ARG A HH21 2  
ATOM 3440  H HH22 . ARG A 1 96  ? -2.715  10.199  1.748   1.00 0.00 ? 96  ARG A HH22 2  
ATOM 3441  N N    . THR A 1 97  ? 5.474   9.874   1.752   1.00 0.00 ? 97  THR A N    2  
ATOM 3442  C CA   . THR A 1 97  ? 6.137   8.614   1.441   1.00 0.00 ? 97  THR A CA   2  
ATOM 3443  C C    . THR A 1 97  ? 5.607   7.483   2.316   1.00 0.00 ? 97  THR A C    2  
ATOM 3444  O O    . THR A 1 97  ? 5.815   7.475   3.529   1.00 0.00 ? 97  THR A O    2  
ATOM 3445  C CB   . THR A 1 97  ? 7.662   8.721   1.627   1.00 0.00 ? 97  THR A CB   2  
ATOM 3446  O OG1  . THR A 1 97  ? 8.174   9.814   0.856   1.00 0.00 ? 97  THR A OG1  2  
ATOM 3447  C CG2  . THR A 1 97  ? 8.350   7.431   1.207   1.00 0.00 ? 97  THR A CG2  2  
ATOM 3448  H H    . THR A 1 97  ? 5.458   10.191  2.679   1.00 0.00 ? 97  THR A H    2  
ATOM 3449  H HA   . THR A 1 97  ? 5.937   8.379   0.406   1.00 0.00 ? 97  THR A HA   2  
ATOM 3450  H HB   . THR A 1 97  ? 7.870   8.898   2.672   1.00 0.00 ? 97  THR A HB   2  
ATOM 3451  H HG1  . THR A 1 97  ? 7.630   9.937   0.075   1.00 0.00 ? 97  THR A HG1  2  
ATOM 3452  H HG21 . THR A 1 97  ? 9.237   7.285   1.805   1.00 0.00 ? 97  THR A HG21 2  
ATOM 3453  H HG22 . THR A 1 97  ? 8.626   7.493   0.164   1.00 0.00 ? 97  THR A HG22 2  
ATOM 3454  H HG23 . THR A 1 97  ? 7.676   6.600   1.352   1.00 0.00 ? 97  THR A HG23 2  
ATOM 3455  N N    . TYR A 1 98  ? 4.923   6.530   1.693   1.00 0.00 ? 98  TYR A N    2  
ATOM 3456  C CA   . TYR A 1 98  ? 4.363   5.395   2.416   1.00 0.00 ? 98  TYR A CA   2  
ATOM 3457  C C    . TYR A 1 98  ? 5.399   4.287   2.579   1.00 0.00 ? 98  TYR A C    2  
ATOM 3458  O O    . TYR A 1 98  ? 6.318   4.157   1.771   1.00 0.00 ? 98  TYR A O    2  
ATOM 3459  C CB   . TYR A 1 98  ? 3.133   4.854   1.684   1.00 0.00 ? 98  TYR A CB   2  
ATOM 3460  C CG   . TYR A 1 98  ? 1.845   5.542   2.076   1.00 0.00 ? 98  TYR A CG   2  
ATOM 3461  C CD1  . TYR A 1 98  ? 1.143   5.154   3.210   1.00 0.00 ? 98  TYR A CD1  2  
ATOM 3462  C CD2  . TYR A 1 98  ? 1.329   6.581   1.310   1.00 0.00 ? 98  TYR A CD2  2  
ATOM 3463  C CE1  . TYR A 1 98  ? -0.035  5.779   3.571   1.00 0.00 ? 98  TYR A CE1  2  
ATOM 3464  C CE2  . TYR A 1 98  ? 0.152   7.213   1.664   1.00 0.00 ? 98  TYR A CE2  2  
ATOM 3465  C CZ   . TYR A 1 98  ? -0.526  6.808   2.795   1.00 0.00 ? 98  TYR A CZ   2  
ATOM 3466  O OH   . TYR A 1 98  ? -1.698  7.434   3.151   1.00 0.00 ? 98  TYR A OH   2  
ATOM 3467  H H    . TYR A 1 98  ? 4.790   6.592   0.724   1.00 0.00 ? 98  TYR A H    2  
ATOM 3468  H HA   . TYR A 1 98  ? 4.064   5.740   3.395   1.00 0.00 ? 98  TYR A HA   2  
ATOM 3469  H HB2  . TYR A 1 98  ? 3.268   4.985   0.622   1.00 0.00 ? 98  TYR A HB2  2  
ATOM 3470  H HB3  . TYR A 1 98  ? 3.027   3.802   1.902   1.00 0.00 ? 98  TYR A HB3  2  
ATOM 3471  H HD1  . TYR A 1 98  ? 1.531   4.348   3.816   1.00 0.00 ? 98  TYR A HD1  2  
ATOM 3472  H HD2  . TYR A 1 98  ? 1.862   6.896   0.425   1.00 0.00 ? 98  TYR A HD2  2  
ATOM 3473  H HE1  . TYR A 1 98  ? -0.565  5.463   4.456   1.00 0.00 ? 98  TYR A HE1  2  
ATOM 3474  H HE2  . TYR A 1 98  ? -0.233  8.019   1.056   1.00 0.00 ? 98  TYR A HE2  2  
ATOM 3475  H HH   . TYR A 1 98  ? -1.531  8.034   3.882   1.00 0.00 ? 98  TYR A HH   2  
ATOM 3476  N N    . PHE A 1 99  ? 5.243   3.491   3.631   1.00 0.00 ? 99  PHE A N    2  
ATOM 3477  C CA   . PHE A 1 99  ? 6.165   2.393   3.903   1.00 0.00 ? 99  PHE A CA   2  
ATOM 3478  C C    . PHE A 1 99  ? 5.427   1.058   3.933   1.00 0.00 ? 99  PHE A C    2  
ATOM 3479  O O    . PHE A 1 99  ? 4.276   0.982   4.366   1.00 0.00 ? 99  PHE A O    2  
ATOM 3480  C CB   . PHE A 1 99  ? 6.885   2.621   5.233   1.00 0.00 ? 99  PHE A CB   2  
ATOM 3481  C CG   . PHE A 1 99  ? 8.119   3.468   5.109   1.00 0.00 ? 99  PHE A CG   2  
ATOM 3482  C CD1  . PHE A 1 99  ? 8.020   4.842   4.954   1.00 0.00 ? 99  PHE A CD1  2  
ATOM 3483  C CD2  . PHE A 1 99  ? 9.378   2.891   5.148   1.00 0.00 ? 99  PHE A CD2  2  
ATOM 3484  C CE1  . PHE A 1 99  ? 9.154   5.624   4.840   1.00 0.00 ? 99  PHE A CE1  2  
ATOM 3485  C CE2  . PHE A 1 99  ? 10.515  3.668   5.035   1.00 0.00 ? 99  PHE A CE2  2  
ATOM 3486  C CZ   . PHE A 1 99  ? 10.403  5.036   4.880   1.00 0.00 ? 99  PHE A CZ   2  
ATOM 3487  H H    . PHE A 1 99  ? 4.490   3.645   4.240   1.00 0.00 ? 99  PHE A H    2  
ATOM 3488  H HA   . PHE A 1 99  ? 6.894   2.370   3.108   1.00 0.00 ? 99  PHE A HA   2  
ATOM 3489  H HB2  . PHE A 1 99  ? 6.212   3.115   5.919   1.00 0.00 ? 99  PHE A HB2  2  
ATOM 3490  H HB3  . PHE A 1 99  ? 7.176   1.667   5.645   1.00 0.00 ? 99  PHE A HB3  2  
ATOM 3491  H HD1  . PHE A 1 99  ? 7.043   5.303   4.923   1.00 0.00 ? 99  PHE A HD1  2  
ATOM 3492  H HD2  . PHE A 1 99  ? 9.467   1.821   5.268   1.00 0.00 ? 99  PHE A HD2  2  
ATOM 3493  H HE1  . PHE A 1 99  ? 9.063   6.693   4.719   1.00 0.00 ? 99  PHE A HE1  2  
ATOM 3494  H HE2  . PHE A 1 99  ? 11.491  3.206   5.066   1.00 0.00 ? 99  PHE A HE2  2  
ATOM 3495  H HZ   . PHE A 1 99  ? 11.290  5.645   4.792   1.00 0.00 ? 99  PHE A HZ   2  
ATOM 3496  N N    . PHE A 1 100 ? 6.096   0.008   3.471   1.00 0.00 ? 100 PHE A N    2  
ATOM 3497  C CA   . PHE A 1 100 ? 5.505   -1.324  3.443   1.00 0.00 ? 100 PHE A CA   2  
ATOM 3498  C C    . PHE A 1 100 ? 6.569   -2.397  3.660   1.00 0.00 ? 100 PHE A C    2  
ATOM 3499  O O    . PHE A 1 100 ? 7.506   -2.525  2.872   1.00 0.00 ? 100 PHE A O    2  
ATOM 3500  C CB   . PHE A 1 100 ? 4.791   -1.561  2.110   1.00 0.00 ? 100 PHE A CB   2  
ATOM 3501  C CG   . PHE A 1 100 ? 3.867   -0.443  1.719   1.00 0.00 ? 100 PHE A CG   2  
ATOM 3502  C CD1  . PHE A 1 100 ? 2.624   -0.312  2.317   1.00 0.00 ? 100 PHE A CD1  2  
ATOM 3503  C CD2  . PHE A 1 100 ? 4.241   0.476   0.751   1.00 0.00 ? 100 PHE A CD2  2  
ATOM 3504  C CE1  . PHE A 1 100 ? 1.772   0.716   1.959   1.00 0.00 ? 100 PHE A CE1  2  
ATOM 3505  C CE2  . PHE A 1 100 ? 3.393   1.505   0.390   1.00 0.00 ? 100 PHE A CE2  2  
ATOM 3506  C CZ   . PHE A 1 100 ? 2.157   1.625   0.993   1.00 0.00 ? 100 PHE A CZ   2  
ATOM 3507  H H    . PHE A 1 100 ? 7.011   0.132   3.139   1.00 0.00 ? 100 PHE A H    2  
ATOM 3508  H HA   . PHE A 1 100 ? 4.784   -1.383  4.243   1.00 0.00 ? 100 PHE A HA   2  
ATOM 3509  H HB2  . PHE A 1 100 ? 5.528   -1.670  1.329   1.00 0.00 ? 100 PHE A HB2  2  
ATOM 3510  H HB3  . PHE A 1 100 ? 4.208   -2.467  2.179   1.00 0.00 ? 100 PHE A HB3  2  
ATOM 3511  H HD1  . PHE A 1 100 ? 2.322   -1.023  3.073   1.00 0.00 ? 100 PHE A HD1  2  
ATOM 3512  H HD2  . PHE A 1 100 ? 5.207   0.383   0.277   1.00 0.00 ? 100 PHE A HD2  2  
ATOM 3513  H HE1  . PHE A 1 100 ? 0.806   0.806   2.434   1.00 0.00 ? 100 PHE A HE1  2  
ATOM 3514  H HE2  . PHE A 1 100 ? 3.696   2.215   -0.366  1.00 0.00 ? 100 PHE A HE2  2  
ATOM 3515  H HZ   . PHE A 1 100 ? 1.493   2.429   0.713   1.00 0.00 ? 100 PHE A HZ   2  
ATOM 3516  N N    . SER A 1 101 ? 6.416   -3.164  4.734   1.00 0.00 ? 101 SER A N    2  
ATOM 3517  C CA   . SER A 1 101 ? 7.366   -4.222  5.059   1.00 0.00 ? 101 SER A CA   2  
ATOM 3518  C C    . SER A 1 101 ? 6.927   -5.551  4.449   1.00 0.00 ? 101 SER A C    2  
ATOM 3519  O O    . SER A 1 101 ? 5.786   -5.700  4.015   1.00 0.00 ? 101 SER A O    2  
ATOM 3520  C CB   . SER A 1 101 ? 7.504   -4.365  6.576   1.00 0.00 ? 101 SER A CB   2  
ATOM 3521  O OG   . SER A 1 101 ? 7.812   -5.701  6.936   1.00 0.00 ? 101 SER A OG   2  
ATOM 3522  H H    . SER A 1 101 ? 5.648   -3.013  5.324   1.00 0.00 ? 101 SER A H    2  
ATOM 3523  H HA   . SER A 1 101 ? 8.323   -3.947  4.643   1.00 0.00 ? 101 SER A HA   2  
ATOM 3524  H HB2  . SER A 1 101 ? 8.294   -3.719  6.925   1.00 0.00 ? 101 SER A HB2  2  
ATOM 3525  H HB3  . SER A 1 101 ? 6.573   -4.084  7.047   1.00 0.00 ? 101 SER A HB3  2  
ATOM 3526  H HG   . SER A 1 101 ? 7.253   -5.972  7.668   1.00 0.00 ? 101 SER A HG   2  
ATOM 3527  N N    . ALA A 1 102 ? 7.844   -6.512  4.421   1.00 0.00 ? 102 ALA A N    2  
ATOM 3528  C CA   . ALA A 1 102 ? 7.553   -7.829  3.867   1.00 0.00 ? 102 ALA A CA   2  
ATOM 3529  C C    . ALA A 1 102 ? 8.177   -8.932  4.716   1.00 0.00 ? 102 ALA A C    2  
ATOM 3530  O O    . ALA A 1 102 ? 9.352   -8.862  5.073   1.00 0.00 ? 102 ALA A O    2  
ATOM 3531  C CB   . ALA A 1 102 ? 8.051   -7.919  2.432   1.00 0.00 ? 102 ALA A CB   2  
ATOM 3532  H H    . ALA A 1 102 ? 8.737   -6.333  4.782   1.00 0.00 ? 102 ALA A H    2  
ATOM 3533  H HA   . ALA A 1 102 ? 6.480   -7.958  3.858   1.00 0.00 ? 102 ALA A HA   2  
ATOM 3534  H HB1  . ALA A 1 102 ? 8.964   -7.351  2.331   1.00 0.00 ? 102 ALA A HB1  2  
ATOM 3535  H HB2  . ALA A 1 102 ? 8.241   -8.953  2.182   1.00 0.00 ? 102 ALA A HB2  2  
ATOM 3536  H HB3  . ALA A 1 102 ? 7.302   -7.519  1.765   1.00 0.00 ? 102 ALA A HB3  2  
ATOM 3537  N N    . GLU A 1 103 ? 7.381   -9.948  5.035   1.00 0.00 ? 103 GLU A N    2  
ATOM 3538  C CA   . GLU A 1 103 ? 7.856   -11.064 5.844   1.00 0.00 ? 103 GLU A CA   2  
ATOM 3539  C C    . GLU A 1 103 ? 9.166   -11.618 5.290   1.00 0.00 ? 103 GLU A C    2  
ATOM 3540  O O    . GLU A 1 103 ? 10.153  -11.747 6.014   1.00 0.00 ? 103 GLU A O    2  
ATOM 3541  C CB   . GLU A 1 103 ? 6.801   -12.172 5.894   1.00 0.00 ? 103 GLU A CB   2  
ATOM 3542  C CG   . GLU A 1 103 ? 5.486   -11.731 6.513   1.00 0.00 ? 103 GLU A CG   2  
ATOM 3543  C CD   . GLU A 1 103 ? 5.599   -11.475 8.003   1.00 0.00 ? 103 GLU A CD   2  
ATOM 3544  O OE1  . GLU A 1 103 ? 5.578   -12.456 8.776   1.00 0.00 ? 103 GLU A OE1  2  
ATOM 3545  O OE2  . GLU A 1 103 ? 5.708   -10.295 8.397   1.00 0.00 ? 103 GLU A OE2  2  
ATOM 3546  H H    . GLU A 1 103 ? 6.453   -9.946  4.720   1.00 0.00 ? 103 GLU A H    2  
ATOM 3547  H HA   . GLU A 1 103 ? 8.029   -10.699 6.845   1.00 0.00 ? 103 GLU A HA   2  
ATOM 3548  H HB2  . GLU A 1 103 ? 6.606   -12.512 4.888   1.00 0.00 ? 103 GLU A HB2  2  
ATOM 3549  H HB3  . GLU A 1 103 ? 7.190   -12.995 6.474   1.00 0.00 ? 103 GLU A HB3  2  
ATOM 3550  H HG2  . GLU A 1 103 ? 5.162   -10.821 6.031   1.00 0.00 ? 103 GLU A HG2  2  
ATOM 3551  H HG3  . GLU A 1 103 ? 4.749   -12.505 6.351   1.00 0.00 ? 103 GLU A HG3  2  
ATOM 3552  N N    . SER A 1 104 ? 9.165   -11.946 4.002   1.00 0.00 ? 104 SER A N    2  
ATOM 3553  C CA   . SER A 1 104 ? 10.351  -12.491 3.351   1.00 0.00 ? 104 SER A CA   2  
ATOM 3554  C C    . SER A 1 104 ? 10.850  -11.552 2.257   1.00 0.00 ? 104 SER A C    2  
ATOM 3555  O O    . SER A 1 104 ? 10.116  -10.705 1.747   1.00 0.00 ? 104 SER A O    2  
ATOM 3556  C CB   . SER A 1 104 ? 10.045  -13.867 2.757   1.00 0.00 ? 104 SER A CB   2  
ATOM 3557  O OG   . SER A 1 104 ? 10.273  -14.894 3.707   1.00 0.00 ? 104 SER A OG   2  
ATOM 3558  H H    . SER A 1 104 ? 8.346   -11.820 3.477   1.00 0.00 ? 104 SER A H    2  
ATOM 3559  H HA   . SER A 1 104 ? 11.122  -12.594 4.100   1.00 0.00 ? 104 SER A HA   2  
ATOM 3560  H HB2  . SER A 1 104 ? 9.012   -13.902 2.448   1.00 0.00 ? 104 SER A HB2  2  
ATOM 3561  H HB3  . SER A 1 104 ? 10.683  -14.036 1.901   1.00 0.00 ? 104 SER A HB3  2  
ATOM 3562  H HG   . SER A 1 104 ? 10.936  -14.605 4.338   1.00 0.00 ? 104 SER A HG   2  
ATOM 3563  N N    . PRO A 1 105 ? 12.130  -11.704 1.886   1.00 0.00 ? 105 PRO A N    2  
ATOM 3564  C CA   . PRO A 1 105 ? 12.757  -10.880 0.849   1.00 0.00 ? 105 PRO A CA   2  
ATOM 3565  C C    . PRO A 1 105 ? 12.215  -11.188 -0.543  1.00 0.00 ? 105 PRO A C    2  
ATOM 3566  O O    . PRO A 1 105 ? 12.233  -10.333 -1.428  1.00 0.00 ? 105 PRO A O    2  
ATOM 3567  C CB   . PRO A 1 105 ? 14.237  -11.258 0.942   1.00 0.00 ? 105 PRO A CB   2  
ATOM 3568  C CG   . PRO A 1 105 ? 14.242  -12.632 1.519   1.00 0.00 ? 105 PRO A CG   2  
ATOM 3569  C CD   . PRO A 1 105 ? 13.063  -12.693 2.451   1.00 0.00 ? 105 PRO A CD   2  
ATOM 3570  H HA   . PRO A 1 105 ? 12.639  -9.826  1.055   1.00 0.00 ? 105 PRO A HA   2  
ATOM 3571  H HB2  . PRO A 1 105 ? 14.678  -11.241 -0.045  1.00 0.00 ? 105 PRO A HB2  2  
ATOM 3572  H HB3  . PRO A 1 105 ? 14.752  -10.559 1.584   1.00 0.00 ? 105 PRO A HB3  2  
ATOM 3573  H HG2  . PRO A 1 105 ? 14.135  -13.361 0.731   1.00 0.00 ? 105 PRO A HG2  2  
ATOM 3574  H HG3  . PRO A 1 105 ? 15.159  -12.797 2.064   1.00 0.00 ? 105 PRO A HG3  2  
ATOM 3575  H HD2  . PRO A 1 105 ? 12.628  -13.682 2.444   1.00 0.00 ? 105 PRO A HD2  2  
ATOM 3576  H HD3  . PRO A 1 105 ? 13.359  -12.416 3.452   1.00 0.00 ? 105 PRO A HD3  2  
ATOM 3577  N N    . GLU A 1 106 ? 11.734  -12.413 -0.728  1.00 0.00 ? 106 GLU A N    2  
ATOM 3578  C CA   . GLU A 1 106 ? 11.187  -12.832 -2.013  1.00 0.00 ? 106 GLU A CA   2  
ATOM 3579  C C    . GLU A 1 106 ? 9.921   -12.049 -2.347  1.00 0.00 ? 106 GLU A C    2  
ATOM 3580  O O    . GLU A 1 106 ? 9.653   -11.751 -3.511  1.00 0.00 ? 106 GLU A O    2  
ATOM 3581  C CB   . GLU A 1 106 ? 10.883  -14.332 -1.998  1.00 0.00 ? 106 GLU A CB   2  
ATOM 3582  C CG   . GLU A 1 106 ? 12.072  -15.197 -2.381  1.00 0.00 ? 106 GLU A CG   2  
ATOM 3583  C CD   . GLU A 1 106 ? 12.336  -15.197 -3.875  1.00 0.00 ? 106 GLU A CD   2  
ATOM 3584  O OE1  . GLU A 1 106 ? 12.140  -14.142 -4.513  1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3585  O OE2  . GLU A 1 106 ? 12.740  -16.253 -4.405  1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3586  H H    . GLU A 1 106 ? 11.747  -13.050 0.017   1.00 0.00 ? 106 GLU A H    2  
ATOM 3587  H HA   . GLU A 1 106 ? 11.930  -12.632 -2.770  1.00 0.00 ? 106 GLU A HA   2  
ATOM 3588  H HB2  . GLU A 1 106 ? 10.564  -14.613 -1.005  1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3589  H HB3  . GLU A 1 106 ? 10.081  -14.531 -2.694  1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3590  H HG2  . GLU A 1 106 ? 12.950  -14.825 -1.876  1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3591  H HG3  . GLU A 1 106 ? 11.879  -16.212 -2.065  1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3592  N N    . GLU A 1 107 ? 9.147   -11.719 -1.318  1.00 0.00 ? 107 GLU A N    2  
ATOM 3593  C CA   . GLU A 1 107 ? 7.908   -10.972 -1.503  1.00 0.00 ? 107 GLU A CA   2  
ATOM 3594  C C    . GLU A 1 107 ? 8.196   -9.492  -1.735  1.00 0.00 ? 107 GLU A C    2  
ATOM 3595  O O    . GLU A 1 107 ? 7.550   -8.846  -2.560  1.00 0.00 ? 107 GLU A O    2  
ATOM 3596  C CB   . GLU A 1 107 ? 6.998   -11.141 -0.285  1.00 0.00 ? 107 GLU A CB   2  
ATOM 3597  C CG   . GLU A 1 107 ? 6.119   -12.379 -0.349  1.00 0.00 ? 107 GLU A CG   2  
ATOM 3598  C CD   . GLU A 1 107 ? 5.030   -12.267 -1.399  1.00 0.00 ? 107 GLU A CD   2  
ATOM 3599  O OE1  . GLU A 1 107 ? 4.013   -11.594 -1.128  1.00 0.00 ? 107 GLU A OE1  2  
ATOM 3600  O OE2  . GLU A 1 107 ? 5.194   -12.851 -2.490  1.00 0.00 ? 107 GLU A OE2  2  
ATOM 3601  H H    . GLU A 1 107 ? 9.414   -11.986 -0.414  1.00 0.00 ? 107 GLU A H    2  
ATOM 3602  H HA   . GLU A 1 107 ? 7.408   -11.370 -2.373  1.00 0.00 ? 107 GLU A HA   2  
ATOM 3603  H HB2  . GLU A 1 107 ? 7.611   -11.206 0.602   1.00 0.00 ? 107 GLU A HB2  2  
ATOM 3604  H HB3  . GLU A 1 107 ? 6.358   -10.275 -0.206  1.00 0.00 ? 107 GLU A HB3  2  
ATOM 3605  H HG2  . GLU A 1 107 ? 6.737   -13.232 -0.584  1.00 0.00 ? 107 GLU A HG2  2  
ATOM 3606  H HG3  . GLU A 1 107 ? 5.655   -12.526 0.615   1.00 0.00 ? 107 GLU A HG3  2  
ATOM 3607  N N    . GLN A 1 108 ? 9.168   -8.961  -1.000  1.00 0.00 ? 108 GLN A N    2  
ATOM 3608  C CA   . GLN A 1 108 ? 9.540   -7.557  -1.125  1.00 0.00 ? 108 GLN A CA   2  
ATOM 3609  C C    . GLN A 1 108 ? 9.916   -7.219  -2.564  1.00 0.00 ? 108 GLN A C    2  
ATOM 3610  O O    . GLN A 1 108 ? 9.379   -6.280  -3.151  1.00 0.00 ? 108 GLN A O    2  
ATOM 3611  C CB   . GLN A 1 108 ? 10.707  -7.232  -0.191  1.00 0.00 ? 108 GLN A CB   2  
ATOM 3612  C CG   . GLN A 1 108 ? 11.275  -5.835  -0.390  1.00 0.00 ? 108 GLN A CG   2  
ATOM 3613  C CD   . GLN A 1 108 ? 12.733  -5.735  0.012   1.00 0.00 ? 108 GLN A CD   2  
ATOM 3614  O OE1  . GLN A 1 108 ? 13.532  -6.625  -0.281  1.00 0.00 ? 108 GLN A OE1  2  
ATOM 3615  N NE2  . GLN A 1 108 ? 13.088  -4.648  0.687   1.00 0.00 ? 108 GLN A NE2  2  
ATOM 3616  H H    . GLN A 1 108 ? 9.646   -9.527  -0.359  1.00 0.00 ? 108 GLN A H    2  
ATOM 3617  H HA   . GLN A 1 108 ? 8.686   -6.962  -0.840  1.00 0.00 ? 108 GLN A HA   2  
ATOM 3618  H HB2  . GLN A 1 108 ? 10.370  -7.318  0.831   1.00 0.00 ? 108 GLN A HB2  2  
ATOM 3619  H HB3  . GLN A 1 108 ? 11.499  -7.946  -0.362  1.00 0.00 ? 108 GLN A HB3  2  
ATOM 3620  H HG2  . GLN A 1 108 ? 11.186  -5.570  -1.433  1.00 0.00 ? 108 GLN A HG2  2  
ATOM 3621  H HG3  . GLN A 1 108 ? 10.703  -5.141  0.207   1.00 0.00 ? 108 GLN A HG3  2  
ATOM 3622  H HE21 . GLN A 1 108 ? 12.397  -3.981  0.886   1.00 0.00 ? 108 GLN A HE21 2  
ATOM 3623  H HE22 . GLN A 1 108 ? 14.023  -4.558  0.960   1.00 0.00 ? 108 GLN A HE22 2  
ATOM 3624  N N    . GLU A 1 109 ? 10.840  -7.991  -3.126  1.00 0.00 ? 109 GLU A N    2  
ATOM 3625  C CA   . GLU A 1 109 ? 11.288  -7.772  -4.497  1.00 0.00 ? 109 GLU A CA   2  
ATOM 3626  C C    . GLU A 1 109 ? 10.134  -7.947  -5.480  1.00 0.00 ? 109 GLU A C    2  
ATOM 3627  O O    . GLU A 1 109 ? 9.915   -7.107  -6.352  1.00 0.00 ? 109 GLU A O    2  
ATOM 3628  C CB   . GLU A 1 109 ? 12.422  -8.737  -4.847  1.00 0.00 ? 109 GLU A CB   2  
ATOM 3629  C CG   . GLU A 1 109 ? 11.939  -10.087 -5.350  1.00 0.00 ? 109 GLU A CG   2  
ATOM 3630  C CD   . GLU A 1 109 ? 13.079  -10.990 -5.781  1.00 0.00 ? 109 GLU A CD   2  
ATOM 3631  O OE1  . GLU A 1 109 ? 13.468  -10.928 -6.967  1.00 0.00 ? 109 GLU A OE1  2  
ATOM 3632  O OE2  . GLU A 1 109 ? 13.580  -11.759 -4.935  1.00 0.00 ? 109 GLU A OE2  2  
ATOM 3633  H H    . GLU A 1 109 ? 11.231  -8.725  -2.607  1.00 0.00 ? 109 GLU A H    2  
ATOM 3634  H HA   . GLU A 1 109 ? 11.654  -6.759  -4.568  1.00 0.00 ? 109 GLU A HA   2  
ATOM 3635  H HB2  . GLU A 1 109 ? 13.036  -8.288  -5.614  1.00 0.00 ? 109 GLU A HB2  2  
ATOM 3636  H HB3  . GLU A 1 109 ? 13.025  -8.899  -3.966  1.00 0.00 ? 109 GLU A HB3  2  
ATOM 3637  H HG2  . GLU A 1 109 ? 11.392  -10.577 -4.559  1.00 0.00 ? 109 GLU A HG2  2  
ATOM 3638  H HG3  . GLU A 1 109 ? 11.285  -9.929  -6.195  1.00 0.00 ? 109 GLU A HG3  2  
ATOM 3639  N N    . ALA A 1 110 ? 9.401   -9.045  -5.333  1.00 0.00 ? 110 ALA A N    2  
ATOM 3640  C CA   . ALA A 1 110 ? 8.269   -9.331  -6.206  1.00 0.00 ? 110 ALA A CA   2  
ATOM 3641  C C    . ALA A 1 110 ? 7.259   -8.189  -6.187  1.00 0.00 ? 110 ALA A C    2  
ATOM 3642  O O    . ALA A 1 110 ? 6.769   -7.764  -7.234  1.00 0.00 ? 110 ALA A O    2  
ATOM 3643  C CB   . ALA A 1 110 ? 7.602   -10.635 -5.796  1.00 0.00 ? 110 ALA A CB   2  
ATOM 3644  H H    . ALA A 1 110 ? 9.625   -9.678  -4.619  1.00 0.00 ? 110 ALA A H    2  
ATOM 3645  H HA   . ALA A 1 110 ? 8.645   -9.449  -7.212  1.00 0.00 ? 110 ALA A HA   2  
ATOM 3646  H HB1  . ALA A 1 110 ? 6.643   -10.423 -5.346  1.00 0.00 ? 110 ALA A HB1  2  
ATOM 3647  H HB2  . ALA A 1 110 ? 7.460   -11.257 -6.668  1.00 0.00 ? 110 ALA A HB2  2  
ATOM 3648  H HB3  . ALA A 1 110 ? 8.228   -11.151 -5.084  1.00 0.00 ? 110 ALA A HB3  2  
ATOM 3649  N N    . TRP A 1 111 ? 6.952   -7.697  -4.993  1.00 0.00 ? 111 TRP A N    2  
ATOM 3650  C CA   . TRP A 1 111 ? 5.999   -6.604  -4.838  1.00 0.00 ? 111 TRP A CA   2  
ATOM 3651  C C    . TRP A 1 111 ? 6.467   -5.363  -5.592  1.00 0.00 ? 111 TRP A C    2  
ATOM 3652  O O    . TRP A 1 111 ? 5.681   -4.712  -6.281  1.00 0.00 ? 111 TRP A O    2  
ATOM 3653  C CB   . TRP A 1 111 ? 5.806   -6.273  -3.358  1.00 0.00 ? 111 TRP A CB   2  
ATOM 3654  C CG   . TRP A 1 111 ? 4.695   -7.049  -2.716  1.00 0.00 ? 111 TRP A CG   2  
ATOM 3655  C CD1  . TRP A 1 111 ? 4.818   -8.027  -1.770  1.00 0.00 ? 111 TRP A CD1  2  
ATOM 3656  C CD2  . TRP A 1 111 ? 3.294   -6.912  -2.975  1.00 0.00 ? 111 TRP A CD2  2  
ATOM 3657  N NE1  . TRP A 1 111 ? 3.577   -8.506  -1.426  1.00 0.00 ? 111 TRP A NE1  2  
ATOM 3658  C CE2  . TRP A 1 111 ? 2.625   -7.839  -2.150  1.00 0.00 ? 111 TRP A CE2  2  
ATOM 3659  C CE3  . TRP A 1 111 ? 2.538   -6.097  -3.821  1.00 0.00 ? 111 TRP A CE3  2  
ATOM 3660  C CZ2  . TRP A 1 111 ? 1.239   -7.970  -2.150  1.00 0.00 ? 111 TRP A CZ2  2  
ATOM 3661  C CZ3  . TRP A 1 111 ? 1.163   -6.229  -3.821  1.00 0.00 ? 111 TRP A CZ3  2  
ATOM 3662  C CH2  . TRP A 1 111 ? 0.525   -7.159  -2.989  1.00 0.00 ? 111 TRP A CH2  2  
ATOM 3663  H H    . TRP A 1 111 ? 7.376   -8.077  -4.195  1.00 0.00 ? 111 TRP A H    2  
ATOM 3664  H HA   . TRP A 1 111 ? 5.055   -6.927  -5.252  1.00 0.00 ? 111 TRP A HA   2  
ATOM 3665  H HB2  . TRP A 1 111 ? 6.718   -6.494  -2.824  1.00 0.00 ? 111 TRP A HB2  2  
ATOM 3666  H HB3  . TRP A 1 111 ? 5.580   -5.221  -3.258  1.00 0.00 ? 111 TRP A HB3  2  
ATOM 3667  H HD1  . TRP A 1 111 ? 5.759   -8.364  -1.364  1.00 0.00 ? 111 TRP A HD1  2  
ATOM 3668  H HE1  . TRP A 1 111 ? 3.403   -9.211  -0.767  1.00 0.00 ? 111 TRP A HE1  2  
ATOM 3669  H HE3  . TRP A 1 111 ? 3.011   -5.374  -4.470  1.00 0.00 ? 111 TRP A HE3  2  
ATOM 3670  H HZ2  . TRP A 1 111 ? 0.733   -8.682  -1.515  1.00 0.00 ? 111 TRP A HZ2  2  
ATOM 3671  H HZ3  . TRP A 1 111 ? 0.562   -5.608  -4.469  1.00 0.00 ? 111 TRP A HZ3  2  
ATOM 3672  H HH2  . TRP A 1 111 ? -0.552  -7.228  -3.021  1.00 0.00 ? 111 TRP A HH2  2  
ATOM 3673  N N    . ILE A 1 112 ? 7.749   -5.042  -5.456  1.00 0.00 ? 112 ILE A N    2  
ATOM 3674  C CA   . ILE A 1 112 ? 8.320   -3.880  -6.126  1.00 0.00 ? 112 ILE A CA   2  
ATOM 3675  C C    . ILE A 1 112 ? 8.163   -3.986  -7.639  1.00 0.00 ? 112 ILE A C    2  
ATOM 3676  O O    . ILE A 1 112 ? 7.807   -3.014  -8.305  1.00 0.00 ? 112 ILE A O    2  
ATOM 3677  C CB   . ILE A 1 112 ? 9.812   -3.712  -5.786  1.00 0.00 ? 112 ILE A CB   2  
ATOM 3678  C CG1  . ILE A 1 112 ? 9.978   -3.239  -4.340  1.00 0.00 ? 112 ILE A CG1  2  
ATOM 3679  C CG2  . ILE A 1 112 ? 10.467  -2.732  -6.748  1.00 0.00 ? 112 ILE A CG2  2  
ATOM 3680  C CD1  . ILE A 1 112 ? 11.406  -3.304  -3.844  1.00 0.00 ? 112 ILE A CD1  2  
ATOM 3681  H H    . ILE A 1 112 ? 8.324   -5.600  -4.893  1.00 0.00 ? 112 ILE A H    2  
ATOM 3682  H HA   . ILE A 1 112 ? 7.791   -3.004  -5.780  1.00 0.00 ? 112 ILE A HA   2  
ATOM 3683  H HB   . ILE A 1 112 ? 10.296  -4.670  -5.902  1.00 0.00 ? 112 ILE A HB   2  
ATOM 3684  H HG12 . ILE A 1 112 ? 9.647   -2.216  -4.262  1.00 0.00 ? 112 ILE A HG12 2  
ATOM 3685  H HG13 . ILE A 1 112 ? 9.373   -3.860  -3.695  1.00 0.00 ? 112 ILE A HG13 2  
ATOM 3686  H HG21 . ILE A 1 112 ? 11.521  -2.657  -6.523  1.00 0.00 ? 112 ILE A HG21 2  
ATOM 3687  H HG22 . ILE A 1 112 ? 10.340  -3.083  -7.761  1.00 0.00 ? 112 ILE A HG22 2  
ATOM 3688  H HG23 . ILE A 1 112 ? 10.007  -1.761  -6.642  1.00 0.00 ? 112 ILE A HG23 2  
ATOM 3689  H HD11 . ILE A 1 112 ? 12.075  -2.988  -4.631  1.00 0.00 ? 112 ILE A HD11 2  
ATOM 3690  H HD12 . ILE A 1 112 ? 11.521  -2.650  -2.991  1.00 0.00 ? 112 ILE A HD12 2  
ATOM 3691  H HD13 . ILE A 1 112 ? 11.642  -4.317  -3.556  1.00 0.00 ? 112 ILE A HD13 2  
ATOM 3692  N N    . GLN A 1 113 ? 8.430   -5.173  -8.175  1.00 0.00 ? 113 GLN A N    2  
ATOM 3693  C CA   . GLN A 1 113 ? 8.318   -5.405  -9.610  1.00 0.00 ? 113 GLN A CA   2  
ATOM 3694  C C    . GLN A 1 113 ? 6.966   -4.931  -10.134 1.00 0.00 ? 113 GLN A C    2  
ATOM 3695  O O    . GLN A 1 113 ? 6.886   -4.287  -11.179 1.00 0.00 ? 113 GLN A O    2  
ATOM 3696  C CB   . GLN A 1 113 ? 8.507   -6.891  -9.923  1.00 0.00 ? 113 GLN A CB   2  
ATOM 3697  C CG   . GLN A 1 113 ? 9.853   -7.439  -9.478  1.00 0.00 ? 113 GLN A CG   2  
ATOM 3698  C CD   . GLN A 1 113 ? 10.338  -8.577  -10.355 1.00 0.00 ? 113 GLN A CD   2  
ATOM 3699  O OE1  . GLN A 1 113 ? 9.885   -9.714  -10.225 1.00 0.00 ? 113 GLN A OE1  2  
ATOM 3700  N NE2  . GLN A 1 113 ? 11.266  -8.275  -11.257 1.00 0.00 ? 113 GLN A NE2  2  
ATOM 3701  H H    . GLN A 1 113 ? 8.709   -5.909  -7.592  1.00 0.00 ? 113 GLN A H    2  
ATOM 3702  H HA   . GLN A 1 113 ? 9.097   -4.841  -10.099 1.00 0.00 ? 113 GLN A HA   2  
ATOM 3703  H HB2  . GLN A 1 113 ? 7.731   -7.453  -9.427  1.00 0.00 ? 113 GLN A HB2  2  
ATOM 3704  H HB3  . GLN A 1 113 ? 8.419   -7.035  -10.990 1.00 0.00 ? 113 GLN A HB3  2  
ATOM 3705  H HG2  . GLN A 1 113 ? 10.582  -6.643  -9.513  1.00 0.00 ? 113 GLN A HG2  2  
ATOM 3706  H HG3  . GLN A 1 113 ? 9.762   -7.800  -8.464  1.00 0.00 ? 113 GLN A HG3  2  
ATOM 3707  H HE21 . GLN A 1 113 ? 11.581  -7.348  -11.304 1.00 0.00 ? 113 GLN A HE21 2  
ATOM 3708  H HE22 . GLN A 1 113 ? 11.598  -8.991  -11.837 1.00 0.00 ? 113 GLN A HE22 2  
ATOM 3709  N N    . ALA A 1 114 ? 5.906   -5.255  -9.400  1.00 0.00 ? 114 ALA A N    2  
ATOM 3710  C CA   . ALA A 1 114 ? 4.558   -4.860  -9.790  1.00 0.00 ? 114 ALA A CA   2  
ATOM 3711  C C    . ALA A 1 114 ? 4.274   -3.415  -9.398  1.00 0.00 ? 114 ALA A C    2  
ATOM 3712  O O    . ALA A 1 114 ? 3.934   -2.588  -10.243 1.00 0.00 ? 114 ALA A O    2  
ATOM 3713  C CB   . ALA A 1 114 ? 3.533   -5.792  -9.161  1.00 0.00 ? 114 ALA A CB   2  
ATOM 3714  H H    . ALA A 1 114 ? 6.034   -5.770  -8.577  1.00 0.00 ? 114 ALA A H    2  
ATOM 3715  H HA   . ALA A 1 114 ? 4.481   -4.953  -10.864 1.00 0.00 ? 114 ALA A HA   2  
ATOM 3716  H HB1  . ALA A 1 114 ? 3.268   -6.565  -9.866  1.00 0.00 ? 114 ALA A HB1  2  
ATOM 3717  H HB2  . ALA A 1 114 ? 3.954   -6.242  -8.273  1.00 0.00 ? 114 ALA A HB2  2  
ATOM 3718  H HB3  . ALA A 1 114 ? 2.651   -5.229  -8.895  1.00 0.00 ? 114 ALA A HB3  2  
ATOM 3719  N N    . MET A 1 115 ? 4.414   -3.117  -8.110  1.00 0.00 ? 115 MET A N    2  
ATOM 3720  C CA   . MET A 1 115 ? 4.173   -1.770  -7.606  1.00 0.00 ? 115 MET A CA   2  
ATOM 3721  C C    . MET A 1 115 ? 5.050   -0.754  -8.330  1.00 0.00 ? 115 MET A C    2  
ATOM 3722  O O    . MET A 1 115 ? 4.550   0.123   -9.033  1.00 0.00 ? 115 MET A O    2  
ATOM 3723  C CB   . MET A 1 115 ? 4.438   -1.711  -6.101  1.00 0.00 ? 115 MET A CB   2  
ATOM 3724  C CG   . MET A 1 115 ? 3.230   -2.079  -5.256  1.00 0.00 ? 115 MET A CG   2  
ATOM 3725  S SD   . MET A 1 115 ? 3.374   -1.508  -3.551  1.00 0.00 ? 115 MET A SD   2  
ATOM 3726  C CE   . MET A 1 115 ? 2.907   -2.988  -2.658  1.00 0.00 ? 115 MET A CE   2  
ATOM 3727  H H    . MET A 1 115 ? 4.688   -3.820  -7.483  1.00 0.00 ? 115 MET A H    2  
ATOM 3728  H HA   . MET A 1 115 ? 3.136   -1.529  -7.790  1.00 0.00 ? 115 MET A HA   2  
ATOM 3729  H HB2  . MET A 1 115 ? 5.240   -2.393  -5.861  1.00 0.00 ? 115 MET A HB2  2  
ATOM 3730  H HB3  . MET A 1 115 ? 4.740   -0.707  -5.840  1.00 0.00 ? 115 MET A HB3  2  
ATOM 3731  H HG2  . MET A 1 115 ? 2.350   -1.634  -5.695  1.00 0.00 ? 115 MET A HG2  2  
ATOM 3732  H HG3  . MET A 1 115 ? 3.124   -3.154  -5.253  1.00 0.00 ? 115 MET A HG3  2  
ATOM 3733  H HE1  . MET A 1 115 ? 3.796   -3.488  -2.301  1.00 0.00 ? 115 MET A HE1  2  
ATOM 3734  H HE2  . MET A 1 115 ? 2.283   -2.720  -1.818  1.00 0.00 ? 115 MET A HE2  2  
ATOM 3735  H HE3  . MET A 1 115 ? 2.361   -3.648  -3.315  1.00 0.00 ? 115 MET A HE3  2  
ATOM 3736  N N    . GLY A 1 116 ? 6.362   -0.878  -8.152  1.00 0.00 ? 116 GLY A N    2  
ATOM 3737  C CA   . GLY A 1 116 ? 7.287   0.037   -8.794  1.00 0.00 ? 116 GLY A CA   2  
ATOM 3738  C C    . GLY A 1 116 ? 6.851   0.414   -10.196 1.00 0.00 ? 116 GLY A C    2  
ATOM 3739  O O    . GLY A 1 116 ? 6.742   1.596   -10.522 1.00 0.00 ? 116 GLY A O    2  
ATOM 3740  H H    . GLY A 1 116 ? 6.704   -1.597  -7.580  1.00 0.00 ? 116 GLY A H    2  
ATOM 3741  H HA2  . GLY A 1 116 ? 7.361   0.934   -8.198  1.00 0.00 ? 116 GLY A HA2  2  
ATOM 3742  H HA3  . GLY A 1 116 ? 8.260   -0.430  -8.846  1.00 0.00 ? 116 GLY A HA3  2  
ATOM 3743  N N    . GLU A 1 117 ? 6.602   -0.593  -11.028 1.00 0.00 ? 117 GLU A N    2  
ATOM 3744  C CA   . GLU A 1 117 ? 6.178   -0.359  -12.403 1.00 0.00 ? 117 GLU A CA   2  
ATOM 3745  C C    . GLU A 1 117 ? 4.808   0.312   -12.444 1.00 0.00 ? 117 GLU A C    2  
ATOM 3746  O O    . GLU A 1 117 ? 4.635   1.357   -13.070 1.00 0.00 ? 117 GLU A O    2  
ATOM 3747  C CB   . GLU A 1 117 ? 6.134   -1.678  -13.178 1.00 0.00 ? 117 GLU A CB   2  
ATOM 3748  C CG   . GLU A 1 117 ? 7.508   -2.220  -13.535 1.00 0.00 ? 117 GLU A CG   2  
ATOM 3749  C CD   . GLU A 1 117 ? 7.492   -3.072  -14.790 1.00 0.00 ? 117 GLU A CD   2  
ATOM 3750  O OE1  . GLU A 1 117 ? 7.005   -4.220  -14.719 1.00 0.00 ? 117 GLU A OE1  2  
ATOM 3751  O OE2  . GLU A 1 117 ? 7.965   -2.591  -15.841 1.00 0.00 ? 117 GLU A OE2  2  
ATOM 3752  H H    . GLU A 1 117 ? 6.707   -1.513  -10.709 1.00 0.00 ? 117 GLU A H    2  
ATOM 3753  H HA   . GLU A 1 117 ? 6.900   0.296   -12.867 1.00 0.00 ? 117 GLU A HA   2  
ATOM 3754  H HB2  . GLU A 1 117 ? 5.623   -2.417  -12.578 1.00 0.00 ? 117 GLU A HB2  2  
ATOM 3755  H HB3  . GLU A 1 117 ? 5.582   -1.526  -14.093 1.00 0.00 ? 117 GLU A HB3  2  
ATOM 3756  H HG2  . GLU A 1 117 ? 8.179   -1.388  -13.693 1.00 0.00 ? 117 GLU A HG2  2  
ATOM 3757  H HG3  . GLU A 1 117 ? 7.869   -2.821  -12.714 1.00 0.00 ? 117 GLU A HG3  2  
ATOM 3758  N N    . ALA A 1 118 ? 3.837   -0.297  -11.771 1.00 0.00 ? 118 ALA A N    2  
ATOM 3759  C CA   . ALA A 1 118 ? 2.483   0.241   -11.728 1.00 0.00 ? 118 ALA A CA   2  
ATOM 3760  C C    . ALA A 1 118 ? 2.468   1.640   -11.121 1.00 0.00 ? 118 ALA A C    2  
ATOM 3761  O O    . ALA A 1 118 ? 1.473   2.358   -11.218 1.00 0.00 ? 118 ALA A O    2  
ATOM 3762  C CB   . ALA A 1 118 ? 1.570   -0.688  -10.942 1.00 0.00 ? 118 ALA A CB   2  
ATOM 3763  H H    . ALA A 1 118 ? 4.036   -1.128  -11.291 1.00 0.00 ? 118 ALA A H    2  
ATOM 3764  H HA   . ALA A 1 118 ? 2.114   0.296   -12.742 1.00 0.00 ? 118 ALA A HA   2  
ATOM 3765  H HB1  . ALA A 1 118 ? 1.085   -1.373  -11.620 1.00 0.00 ? 118 ALA A HB1  2  
ATOM 3766  H HB2  . ALA A 1 118 ? 2.156   -1.244  -10.225 1.00 0.00 ? 118 ALA A HB2  2  
ATOM 3767  H HB3  . ALA A 1 118 ? 0.824   -0.105  -10.423 1.00 0.00 ? 118 ALA A HB3  2  
ATOM 3768  N N    . ALA A 1 119 ? 3.576   2.020   -10.494 1.00 0.00 ? 119 ALA A N    2  
ATOM 3769  C CA   . ALA A 1 119 ? 3.690   3.334   -9.872  1.00 0.00 ? 119 ALA A CA   2  
ATOM 3770  C C    . ALA A 1 119 ? 4.432   4.309   -10.780 1.00 0.00 ? 119 ALA A C    2  
ATOM 3771  O O    . ALA A 1 119 ? 4.083   5.487   -10.859 1.00 0.00 ? 119 ALA A O    2  
ATOM 3772  C CB   . ALA A 1 119 ? 4.393   3.222   -8.528  1.00 0.00 ? 119 ALA A CB   2  
ATOM 3773  H H    . ALA A 1 119 ? 4.336   1.403   -10.450 1.00 0.00 ? 119 ALA A H    2  
ATOM 3774  H HA   . ALA A 1 119 ? 2.691   3.708   -9.699  1.00 0.00 ? 119 ALA A HA   2  
ATOM 3775  H HB1  . ALA A 1 119 ? 4.765   2.217   -8.399  1.00 0.00 ? 119 ALA A HB1  2  
ATOM 3776  H HB2  . ALA A 1 119 ? 5.219   3.918   -8.496  1.00 0.00 ? 119 ALA A HB2  2  
ATOM 3777  H HB3  . ALA A 1 119 ? 3.696   3.453   -7.737  1.00 0.00 ? 119 ALA A HB3  2  
ATOM 3778  N N    . ARG A 1 120 ? 5.457   3.810   -11.464 1.00 0.00 ? 120 ARG A N    2  
ATOM 3779  C CA   . ARG A 1 120 ? 6.249   4.639   -12.365 1.00 0.00 ? 120 ARG A CA   2  
ATOM 3780  C C    . ARG A 1 120 ? 5.490   4.914   -13.659 1.00 0.00 ? 120 ARG A C    2  
ATOM 3781  O O    . ARG A 1 120 ? 4.763   4.055   -14.160 1.00 0.00 ? 120 ARG A O    2  
ATOM 3782  C CB   . ARG A 1 120 ? 7.582   3.957   -12.678 1.00 0.00 ? 120 ARG A CB   2  
ATOM 3783  C CG   . ARG A 1 120 ? 7.506   2.972   -13.833 1.00 0.00 ? 120 ARG A CG   2  
ATOM 3784  C CD   . ARG A 1 120 ? 8.855   2.325   -14.103 1.00 0.00 ? 120 ARG A CD   2  
ATOM 3785  N NE   . ARG A 1 120 ? 9.300   1.498   -12.985 1.00 0.00 ? 120 ARG A NE   2  
ATOM 3786  C CZ   . ARG A 1 120 ? 10.574  1.200   -12.752 1.00 0.00 ? 120 ARG A CZ   2  
ATOM 3787  N NH1  . ARG A 1 120 ? 11.523  1.658   -13.556 1.00 0.00 ? 120 ARG A NH1  2  
ATOM 3788  N NH2  . ARG A 1 120 ? 10.900  0.442   -11.713 1.00 0.00 ? 120 ARG A NH2  2  
ATOM 3789  H H    . ARG A 1 120 ? 5.686   2.863   -11.359 1.00 0.00 ? 120 ARG A H    2  
ATOM 3790  H HA   . ARG A 1 120 ? 6.443   5.578   -11.869 1.00 0.00 ? 120 ARG A HA   2  
ATOM 3791  H HB2  . ARG A 1 120 ? 8.311   4.715   -12.929 1.00 0.00 ? 120 ARG A HB2  2  
ATOM 3792  H HB3  . ARG A 1 120 ? 7.916   3.425   -11.800 1.00 0.00 ? 120 ARG A HB3  2  
ATOM 3793  H HG2  . ARG A 1 120 ? 6.792   2.199   -13.588 1.00 0.00 ? 120 ARG A HG2  2  
ATOM 3794  H HG3  . ARG A 1 120 ? 7.183   3.495   -14.720 1.00 0.00 ? 120 ARG A HG3  2  
ATOM 3795  H HD2  . ARG A 1 120 ? 8.773   1.706   -14.985 1.00 0.00 ? 120 ARG A HD2  2  
ATOM 3796  H HD3  . ARG A 1 120 ? 9.584   3.103   -14.277 1.00 0.00 ? 120 ARG A HD3  2  
ATOM 3797  H HE   . ARG A 1 120 ? 8.615   1.149   -12.378 1.00 0.00 ? 120 ARG A HE   2  
ATOM 3798  H HH11 . ARG A 1 120 ? 11.280  2.231   -14.339 1.00 0.00 ? 120 ARG A HH11 2  
ATOM 3799  H HH12 . ARG A 1 120 ? 12.481  1.433   -13.378 1.00 0.00 ? 120 ARG A HH12 2  
ATOM 3800  H HH21 . ARG A 1 120 ? 10.187  0.094   -11.105 1.00 0.00 ? 120 ARG A HH21 2  
ATOM 3801  H HH22 . ARG A 1 120 ? 11.858  0.218   -11.539 1.00 0.00 ? 120 ARG A HH22 2  
ATOM 3802  N N    . VAL A 1 121 ? 5.662   6.118   -14.196 1.00 0.00 ? 121 VAL A N    2  
ATOM 3803  C CA   . VAL A 1 121 ? 4.994   6.506   -15.433 1.00 0.00 ? 121 VAL A CA   2  
ATOM 3804  C C    . VAL A 1 121 ? 5.956   6.462   -16.615 1.00 0.00 ? 121 VAL A C    2  
ATOM 3805  O O    . VAL A 1 121 ? 6.534   7.480   -16.994 1.00 0.00 ? 121 VAL A O    2  
ATOM 3806  C CB   . VAL A 1 121 ? 4.394   7.921   -15.326 1.00 0.00 ? 121 VAL A CB   2  
ATOM 3807  C CG1  . VAL A 1 121 ? 3.639   8.279   -16.597 1.00 0.00 ? 121 VAL A CG1  2  
ATOM 3808  C CG2  . VAL A 1 121 ? 3.486   8.023   -14.109 1.00 0.00 ? 121 VAL A CG2  2  
ATOM 3809  H H    . VAL A 1 121 ? 6.254   6.759   -13.751 1.00 0.00 ? 121 VAL A H    2  
ATOM 3810  H HA   . VAL A 1 121 ? 4.188   5.809   -15.610 1.00 0.00 ? 121 VAL A HA   2  
ATOM 3811  H HB   . VAL A 1 121 ? 5.204   8.625   -15.204 1.00 0.00 ? 121 VAL A HB   2  
ATOM 3812  H HG11 . VAL A 1 121 ? 3.598   7.416   -17.245 1.00 0.00 ? 121 VAL A HG11 2  
ATOM 3813  H HG12 . VAL A 1 121 ? 2.636   8.590   -16.345 1.00 0.00 ? 121 VAL A HG12 2  
ATOM 3814  H HG13 . VAL A 1 121 ? 4.150   9.084   -17.103 1.00 0.00 ? 121 VAL A HG13 2  
ATOM 3815  H HG21 . VAL A 1 121 ? 2.800   7.189   -14.101 1.00 0.00 ? 121 VAL A HG21 2  
ATOM 3816  H HG22 . VAL A 1 121 ? 4.085   8.007   -13.211 1.00 0.00 ? 121 VAL A HG22 2  
ATOM 3817  H HG23 . VAL A 1 121 ? 2.928   8.947   -14.153 1.00 0.00 ? 121 VAL A HG23 2  
ATOM 3818  N N    . GLN A 1 122 ? 6.122   5.276   -17.192 1.00 0.00 ? 122 GLN A N    2  
ATOM 3819  C CA   . GLN A 1 122 ? 7.014   5.100   -18.331 1.00 0.00 ? 122 GLN A CA   2  
ATOM 3820  C C    . GLN A 1 122 ? 6.250   5.223   -19.645 1.00 0.00 ? 122 GLN A C    2  
ATOM 3821  O O    . GLN A 1 122 ? 5.062   4.908   -19.717 1.00 0.00 ? 122 GLN A O    2  
ATOM 3822  C CB   . GLN A 1 122 ? 7.708   3.739   -18.257 1.00 0.00 ? 122 GLN A CB   2  
ATOM 3823  C CG   . GLN A 1 122 ? 8.893   3.711   -17.304 1.00 0.00 ? 122 GLN A CG   2  
ATOM 3824  C CD   . GLN A 1 122 ? 9.750   2.472   -17.475 1.00 0.00 ? 122 GLN A CD   2  
ATOM 3825  O OE1  . GLN A 1 122 ? 9.270   1.347   -17.334 1.00 0.00 ? 122 GLN A OE1  2  
ATOM 3826  N NE2  . GLN A 1 122 ? 11.026  2.673   -17.782 1.00 0.00 ? 122 GLN A NE2  2  
ATOM 3827  H H    . GLN A 1 122 ? 5.633   4.503   -16.843 1.00 0.00 ? 122 GLN A H    2  
ATOM 3828  H HA   . GLN A 1 122 ? 7.762   5.877   -18.290 1.00 0.00 ? 122 GLN A HA   2  
ATOM 3829  H HB2  . GLN A 1 122 ? 6.992   3.001   -17.928 1.00 0.00 ? 122 GLN A HB2  2  
ATOM 3830  H HB3  . GLN A 1 122 ? 8.060   3.473   -19.242 1.00 0.00 ? 122 GLN A HB3  2  
ATOM 3831  H HG2  . GLN A 1 122 ? 9.505   4.581   -17.487 1.00 0.00 ? 122 GLN A HG2  2  
ATOM 3832  H HG3  . GLN A 1 122 ? 8.523   3.738   -16.290 1.00 0.00 ? 122 GLN A HG3  2  
ATOM 3833  H HE21 . GLN A 1 122 ? 11.339  3.598   -17.878 1.00 0.00 ? 122 GLN A HE21 2  
ATOM 3834  H HE22 . GLN A 1 122 ? 11.603  1.891   -17.897 1.00 0.00 ? 122 GLN A HE22 2  
ATOM 3835  N N    . GLY A 1 1   ? -12.169 -4.563  -32.702 1.00 0.00 ? 1   GLY A N    3  
ATOM 3836  C CA   . GLY A 1 1   ? -11.006 -3.930  -32.107 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3837  C C    . GLY A 1 1   ? -11.379 -2.906  -31.054 1.00 0.00 ? 1   GLY A C    3  
ATOM 3838  O O    . GLY A 1 1   ? -12.126 -3.206  -30.123 1.00 0.00 ? 1   GLY A O    3  
ATOM 3839  H H1   . GLY A 1 1   ? -12.054 -5.325  -33.308 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3840  H HA2  . GLY A 1 1   ? -10.390 -4.691  -31.652 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3841  H HA3  . GLY A 1 1   ? -10.440 -3.440  -32.885 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3842  N N    . SER A 1 2   ? -10.857 -1.692  -31.200 1.00 0.00 ? 2   SER A N    3  
ATOM 3843  C CA   . SER A 1 2   ? -11.134 -0.621  -30.250 1.00 0.00 ? 2   SER A CA   3  
ATOM 3844  C C    . SER A 1 2   ? -10.944 0.745   -30.902 1.00 0.00 ? 2   SER A C    3  
ATOM 3845  O O    . SER A 1 2   ? -10.039 0.937   -31.714 1.00 0.00 ? 2   SER A O    3  
ATOM 3846  C CB   . SER A 1 2   ? -10.224 -0.747  -29.027 1.00 0.00 ? 2   SER A CB   3  
ATOM 3847  O OG   . SER A 1 2   ? -10.601 -1.851  -28.222 1.00 0.00 ? 2   SER A OG   3  
ATOM 3848  H H    . SER A 1 2   ? -10.268 -1.514  -31.963 1.00 0.00 ? 2   SER A H    3  
ATOM 3849  H HA   . SER A 1 2   ? -12.163 -0.716  -29.935 1.00 0.00 ? 2   SER A HA   3  
ATOM 3850  H HB2  . SER A 1 2   ? -9.205  -0.885  -29.352 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3851  H HB3  . SER A 1 2   ? -10.295 0.155   -28.435 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3852  H HG   . SER A 1 2   ? -10.236 -2.658  -28.594 1.00 0.00 ? 2   SER A HG   3  
ATOM 3853  N N    . SER A 1 3   ? -11.803 1.692   -30.539 1.00 0.00 ? 3   SER A N    3  
ATOM 3854  C CA   . SER A 1 3   ? -11.733 3.040   -31.090 1.00 0.00 ? 3   SER A CA   3  
ATOM 3855  C C    . SER A 1 3   ? -12.426 4.040   -30.169 1.00 0.00 ? 3   SER A C    3  
ATOM 3856  O O    . SER A 1 3   ? -13.634 3.966   -29.950 1.00 0.00 ? 3   SER A O    3  
ATOM 3857  C CB   . SER A 1 3   ? -12.373 3.080   -32.479 1.00 0.00 ? 3   SER A CB   3  
ATOM 3858  O OG   . SER A 1 3   ? -13.674 2.519   -32.457 1.00 0.00 ? 3   SER A OG   3  
ATOM 3859  H H    . SER A 1 3   ? -12.503 1.477   -29.886 1.00 0.00 ? 3   SER A H    3  
ATOM 3860  H HA   . SER A 1 3   ? -10.691 3.310   -31.175 1.00 0.00 ? 3   SER A HA   3  
ATOM 3861  H HB2  . SER A 1 3   ? -12.442 4.105   -32.811 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3862  H HB3  . SER A 1 3   ? -11.763 2.517   -33.170 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3863  H HG   . SER A 1 3   ? -13.639 1.644   -32.064 1.00 0.00 ? 3   SER A HG   3  
ATOM 3864  N N    . GLY A 1 4   ? -11.650 4.977   -29.632 1.00 0.00 ? 4   GLY A N    3  
ATOM 3865  C CA   . GLY A 1 4   ? -12.205 5.979   -28.741 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3866  C C    . GLY A 1 4   ? -12.119 5.570   -27.283 1.00 0.00 ? 4   GLY A C    3  
ATOM 3867  O O    . GLY A 1 4   ? -12.868 4.706   -26.829 1.00 0.00 ? 4   GLY A O    3  
ATOM 3868  H H    . GLY A 1 4   ? -10.692 4.988   -29.842 1.00 0.00 ? 4   GLY A H    3  
ATOM 3869  H HA2  . GLY A 1 4   ? -11.665 6.904   -28.877 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3870  H HA3  . GLY A 1 4   ? -13.242 6.137   -28.997 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3871  N N    . SER A 1 5   ? -11.202 6.192   -26.549 1.00 0.00 ? 5   SER A N    3  
ATOM 3872  C CA   . SER A 1 5   ? -11.017 5.884   -25.136 1.00 0.00 ? 5   SER A CA   3  
ATOM 3873  C C    . SER A 1 5   ? -11.837 6.828   -24.262 1.00 0.00 ? 5   SER A C    3  
ATOM 3874  O O    . SER A 1 5   ? -11.535 8.017   -24.161 1.00 0.00 ? 5   SER A O    3  
ATOM 3875  C CB   . SER A 1 5   ? -9.536  5.980   -24.761 1.00 0.00 ? 5   SER A CB   3  
ATOM 3876  O OG   . SER A 1 5   ? -9.350  5.798   -23.368 1.00 0.00 ? 5   SER A OG   3  
ATOM 3877  H H    . SER A 1 5   ? -10.634 6.872   -26.969 1.00 0.00 ? 5   SER A H    3  
ATOM 3878  H HA   . SER A 1 5   ? -11.356 4.873   -24.970 1.00 0.00 ? 5   SER A HA   3  
ATOM 3879  H HB2  . SER A 1 5   ? -8.984  5.218   -25.288 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3880  H HB3  . SER A 1 5   ? -9.160  6.954   -25.038 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3881  H HG   . SER A 1 5   ? -9.403  6.648   -22.924 1.00 0.00 ? 5   SER A HG   3  
ATOM 3882  N N    . SER A 1 6   ? -12.876 6.289   -23.633 1.00 0.00 ? 6   SER A N    3  
ATOM 3883  C CA   . SER A 1 6   ? -13.744 7.083   -22.771 1.00 0.00 ? 6   SER A CA   3  
ATOM 3884  C C    . SER A 1 6   ? -13.174 7.168   -21.358 1.00 0.00 ? 6   SER A C    3  
ATOM 3885  O O    . SER A 1 6   ? -12.225 6.464   -21.016 1.00 0.00 ? 6   SER A O    3  
ATOM 3886  C CB   . SER A 1 6   ? -15.149 6.481   -22.732 1.00 0.00 ? 6   SER A CB   3  
ATOM 3887  O OG   . SER A 1 6   ? -15.155 5.247   -22.035 1.00 0.00 ? 6   SER A OG   3  
ATOM 3888  H H    . SER A 1 6   ? -13.066 5.335   -23.755 1.00 0.00 ? 6   SER A H    3  
ATOM 3889  H HA   . SER A 1 6   ? -13.800 8.080   -23.184 1.00 0.00 ? 6   SER A HA   3  
ATOM 3890  H HB2  . SER A 1 6   ? -15.818 7.165   -22.232 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3891  H HB3  . SER A 1 6   ? -15.494 6.313   -23.742 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3892  H HG   . SER A 1 6   ? -16.019 4.835   -22.120 1.00 0.00 ? 6   SER A HG   3  
ATOM 3893  N N    . GLY A 1 7   ? -13.762 8.036   -20.541 1.00 0.00 ? 7   GLY A N    3  
ATOM 3894  C CA   . GLY A 1 7   ? -13.301 8.198   -19.174 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3895  C C    . GLY A 1 7   ? -14.012 9.326   -18.452 1.00 0.00 ? 7   GLY A C    3  
ATOM 3896  O O    . GLY A 1 7   ? -15.172 9.622   -18.738 1.00 0.00 ? 7   GLY A O    3  
ATOM 3897  H H    . GLY A 1 7   ? -14.516 8.572   -20.868 1.00 0.00 ? 7   GLY A H    3  
ATOM 3898  H HA2  . GLY A 1 7   ? -13.471 7.277   -18.637 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3899  H HA3  . GLY A 1 7   ? -12.242 8.406   -19.186 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3900  N N    . GLY A 1 8   ? -13.316 9.957   -17.512 1.00 0.00 ? 8   GLY A N    3  
ATOM 3901  C CA   . GLY A 1 8   ? -13.904 11.050  -16.760 1.00 0.00 ? 8   GLY A CA   3  
ATOM 3902  C C    . GLY A 1 8   ? -12.917 12.168  -16.493 1.00 0.00 ? 8   GLY A C    3  
ATOM 3903  O O    . GLY A 1 8   ? -11.818 11.930  -15.992 1.00 0.00 ? 8   GLY A O    3  
ATOM 3904  H H    . GLY A 1 8   ? -12.394 9.678   -17.327 1.00 0.00 ? 8   GLY A H    3  
ATOM 3905  H HA2  . GLY A 1 8   ? -14.740 11.446  -17.317 1.00 0.00 ? 8   GLY A HA2  3  
ATOM 3906  H HA3  . GLY A 1 8   ? -14.263 10.669  -15.815 1.00 0.00 ? 8   GLY A HA3  3  
ATOM 3907  N N    . LYS A 1 9   ? -13.307 13.393  -16.830 1.00 0.00 ? 9   LYS A N    3  
ATOM 3908  C CA   . LYS A 1 9   ? -12.449 14.554  -16.625 1.00 0.00 ? 9   LYS A CA   3  
ATOM 3909  C C    . LYS A 1 9   ? -12.319 14.879  -15.141 1.00 0.00 ? 9   LYS A C    3  
ATOM 3910  O O    . LYS A 1 9   ? -11.216 15.084  -14.635 1.00 0.00 ? 9   LYS A O    3  
ATOM 3911  C CB   . LYS A 1 9   ? -13.006 15.765  -17.377 1.00 0.00 ? 9   LYS A CB   3  
ATOM 3912  C CG   . LYS A 1 9   ? -13.072 15.569  -18.882 1.00 0.00 ? 9   LYS A CG   3  
ATOM 3913  C CD   . LYS A 1 9   ? -13.822 16.704  -19.559 1.00 0.00 ? 9   LYS A CD   3  
ATOM 3914  C CE   . LYS A 1 9   ? -15.323 16.459  -19.558 1.00 0.00 ? 9   LYS A CE   3  
ATOM 3915  N NZ   . LYS A 1 9   ? -15.972 16.997  -18.330 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 3916  H H    . LYS A 1 9   ? -14.196 13.519  -17.226 1.00 0.00 ? 9   LYS A H    3  
ATOM 3917  H HA   . LYS A 1 9   ? -11.471 14.317  -17.017 1.00 0.00 ? 9   LYS A HA   3  
ATOM 3918  H HB2  . LYS A 1 9   ? -14.004 15.968  -17.017 1.00 0.00 ? 9   LYS A HB2  3  
ATOM 3919  H HB3  . LYS A 1 9   ? -12.378 16.620  -17.173 1.00 0.00 ? 9   LYS A HB3  3  
ATOM 3920  H HG2  . LYS A 1 9   ? -12.067 15.531  -19.275 1.00 0.00 ? 9   LYS A HG2  3  
ATOM 3921  H HG3  . LYS A 1 9   ? -13.579 14.638  -19.093 1.00 0.00 ? 9   LYS A HG3  3  
ATOM 3922  H HD2  . LYS A 1 9   ? -13.619 17.624  -19.032 1.00 0.00 ? 9   LYS A HD2  3  
ATOM 3923  H HD3  . LYS A 1 9   ? -13.481 16.789  -20.581 1.00 0.00 ? 9   LYS A HD3  3  
ATOM 3924  H HE2  . LYS A 1 9   ? -15.754 16.940  -20.422 1.00 0.00 ? 9   LYS A HE2  3  
ATOM 3925  H HE3  . LYS A 1 9   ? -15.501 15.395  -19.612 1.00 0.00 ? 9   LYS A HE3  3  
ATOM 3926  H HZ1  . LYS A 1 9   ? -15.566 17.923  -18.087 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 3927  H HZ2  . LYS A 1 9   ? -15.823 16.345  -17.533 1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 3928  H HZ3  . LYS A 1 9   ? -16.994 17.108  -18.485 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 3929  N N    . ARG A 1 10  ? -13.453 14.923  -14.448 1.00 0.00 ? 10  ARG A N    3  
ATOM 3930  C CA   . ARG A 1 10  ? -13.465 15.223  -13.021 1.00 0.00 ? 10  ARG A CA   3  
ATOM 3931  C C    . ARG A 1 10  ? -13.806 13.978  -12.207 1.00 0.00 ? 10  ARG A C    3  
ATOM 3932  O O    . ARG A 1 10  ? -14.973 13.613  -12.072 1.00 0.00 ? 10  ARG A O    3  
ATOM 3933  C CB   . ARG A 1 10  ? -14.473 16.334  -12.721 1.00 0.00 ? 10  ARG A CB   3  
ATOM 3934  C CG   . ARG A 1 10  ? -14.059 17.693  -13.260 1.00 0.00 ? 10  ARG A CG   3  
ATOM 3935  C CD   . ARG A 1 10  ? -14.621 18.823  -12.411 1.00 0.00 ? 10  ARG A CD   3  
ATOM 3936  N NE   . ARG A 1 10  ? -14.222 20.136  -12.913 1.00 0.00 ? 10  ARG A NE   3  
ATOM 3937  C CZ   . ARG A 1 10  ? -14.805 20.737  -13.944 1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3938  N NH1  . ARG A 1 10  ? -15.808 20.147  -14.579 1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3939  N NH2  . ARG A 1 10  ? -14.385 21.931  -14.342 1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3940  H H    . ARG A 1 10  ? -14.301 14.750  -14.907 1.00 0.00 ? 10  ARG A H    3  
ATOM 3941  H HA   . ARG A 1 10  ? -12.477 15.560  -12.745 1.00 0.00 ? 10  ARG A HA   3  
ATOM 3942  H HB2  . ARG A 1 10  ? -15.423 16.071  -13.161 1.00 0.00 ? 10  ARG A HB2  3  
ATOM 3943  H HB3  . ARG A 1 10  ? -14.591 16.416  -11.651 1.00 0.00 ? 10  ARG A HB3  3  
ATOM 3944  H HG2  . ARG A 1 10  ? -12.981 17.759  -13.257 1.00 0.00 ? 10  ARG A HG2  3  
ATOM 3945  H HG3  . ARG A 1 10  ? -14.425 17.796  -14.270 1.00 0.00 ? 10  ARG A HG3  3  
ATOM 3946  H HD2  . ARG A 1 10  ? -15.699 18.759  -12.418 1.00 0.00 ? 10  ARG A HD2  3  
ATOM 3947  H HD3  . ARG A 1 10  ? -14.260 18.710  -11.400 1.00 0.00 ? 10  ARG A HD3  3  
ATOM 3948  H HE   . ARG A 1 10  ? -13.482 20.589  -12.458 1.00 0.00 ? 10  ARG A HE   3  
ATOM 3949  H HH11 . ARG A 1 10  ? -16.127 19.247  -14.281 1.00 0.00 ? 10  ARG A HH11 3  
ATOM 3950  H HH12 . ARG A 1 10  ? -16.246 20.602  -15.354 1.00 0.00 ? 10  ARG A HH12 3  
ATOM 3951  H HH21 . ARG A 1 10  ? -13.629 22.379  -13.865 1.00 0.00 ? 10  ARG A HH21 3  
ATOM 3952  H HH22 . ARG A 1 10  ? -14.824 22.382  -15.118 1.00 0.00 ? 10  ARG A HH22 3  
ATOM 3953  N N    . SER A 1 11  ? -12.778 13.331  -11.667 1.00 0.00 ? 11  SER A N    3  
ATOM 3954  C CA   . SER A 1 11  ? -12.968 12.125  -10.870 1.00 0.00 ? 11  SER A CA   3  
ATOM 3955  C C    . SER A 1 11  ? -13.380 12.476  -9.444  1.00 0.00 ? 11  SER A C    3  
ATOM 3956  O O    . SER A 1 11  ? -12.830 13.393  -8.834  1.00 0.00 ? 11  SER A O    3  
ATOM 3957  C CB   . SER A 1 11  ? -11.684 11.292  -10.852 1.00 0.00 ? 11  SER A CB   3  
ATOM 3958  O OG   . SER A 1 11  ? -10.625 12.003  -10.235 1.00 0.00 ? 11  SER A OG   3  
ATOM 3959  H H    . SER A 1 11  ? -11.870 13.671  -11.811 1.00 0.00 ? 11  SER A H    3  
ATOM 3960  H HA   . SER A 1 11  ? -13.756 11.545  -11.328 1.00 0.00 ? 11  SER A HA   3  
ATOM 3961  H HB2  . SER A 1 11  ? -11.858 10.380  -10.302 1.00 0.00 ? 11  SER A HB2  3  
ATOM 3962  H HB3  . SER A 1 11  ? -11.400 11.053  -11.866 1.00 0.00 ? 11  SER A HB3  3  
ATOM 3963  H HG   . SER A 1 11  ? -10.602 12.901  -10.573 1.00 0.00 ? 11  SER A HG   3  
ATOM 3964  N N    . HIS A 1 12  ? -14.353 11.739  -8.917  1.00 0.00 ? 12  HIS A N    3  
ATOM 3965  C CA   . HIS A 1 12  ? -14.840 11.971  -7.562  1.00 0.00 ? 12  HIS A CA   3  
ATOM 3966  C C    . HIS A 1 12  ? -13.834 11.470  -6.530  1.00 0.00 ? 12  HIS A C    3  
ATOM 3967  O O    . HIS A 1 12  ? -13.506 12.174  -5.575  1.00 0.00 ? 12  HIS A O    3  
ATOM 3968  C CB   . HIS A 1 12  ? -16.187 11.278  -7.356  1.00 0.00 ? 12  HIS A CB   3  
ATOM 3969  C CG   . HIS A 1 12  ? -17.287 11.843  -8.201  1.00 0.00 ? 12  HIS A CG   3  
ATOM 3970  N ND1  . HIS A 1 12  ? -18.200 11.058  -8.872  1.00 0.00 ? 12  HIS A ND1  3  
ATOM 3971  C CD2  . HIS A 1 12  ? -17.618 13.125  -8.482  1.00 0.00 ? 12  HIS A CD2  3  
ATOM 3972  C CE1  . HIS A 1 12  ? -19.044 11.832  -9.530  1.00 0.00 ? 12  HIS A CE1  3  
ATOM 3973  N NE2  . HIS A 1 12  ? -18.713 13.091  -9.310  1.00 0.00 ? 12  HIS A NE2  3  
ATOM 3974  H H    . HIS A 1 12  ? -14.753 11.022  -9.452  1.00 0.00 ? 12  HIS A H    3  
ATOM 3975  H HA   . HIS A 1 12  ? -14.969 13.035  -7.433  1.00 0.00 ? 12  HIS A HA   3  
ATOM 3976  H HB2  . HIS A 1 12  ? -16.087 10.231  -7.599  1.00 0.00 ? 12  HIS A HB2  3  
ATOM 3977  H HB3  . HIS A 1 12  ? -16.481 11.376  -6.320  1.00 0.00 ? 12  HIS A HB3  3  
ATOM 3978  H HD1  . HIS A 1 12  ? -18.225 10.078  -8.868  1.00 0.00 ? 12  HIS A HD1  3  
ATOM 3979  H HD2  . HIS A 1 12  ? -17.115 14.012  -8.122  1.00 0.00 ? 12  HIS A HD2  3  
ATOM 3980  H HE1  . HIS A 1 12  ? -19.866 11.493  -10.144 1.00 0.00 ? 12  HIS A HE1  3  
ATOM 3981  H HE2  . HIS A 1 12  ? -19.123 13.867  -9.746  1.00 0.00 ? 12  HIS A HE2  3  
ATOM 3982  N N    . SER A 1 13  ? -13.348 10.249  -6.728  1.00 0.00 ? 13  SER A N    3  
ATOM 3983  C CA   . SER A 1 13  ? -12.383 9.652   -5.813  1.00 0.00 ? 13  SER A CA   3  
ATOM 3984  C C    . SER A 1 13  ? -11.875 8.318   -6.353  1.00 0.00 ? 13  SER A C    3  
ATOM 3985  O O    . SER A 1 13  ? -12.541 7.667   -7.156  1.00 0.00 ? 13  SER A O    3  
ATOM 3986  C CB   . SER A 1 13  ? -13.015 9.449   -4.434  1.00 0.00 ? 13  SER A CB   3  
ATOM 3987  O OG   . SER A 1 13  ? -12.022 9.355   -3.427  1.00 0.00 ? 13  SER A OG   3  
ATOM 3988  H H    . SER A 1 13  ? -13.649 9.736   -7.508  1.00 0.00 ? 13  SER A H    3  
ATOM 3989  H HA   . SER A 1 13  ? -11.549 10.331  -5.721  1.00 0.00 ? 13  SER A HA   3  
ATOM 3990  H HB2  . SER A 1 13  ? -13.660 10.284  -4.210  1.00 0.00 ? 13  SER A HB2  3  
ATOM 3991  H HB3  . SER A 1 13  ? -13.594 8.537   -4.437  1.00 0.00 ? 13  SER A HB3  3  
ATOM 3992  H HG   . SER A 1 13  ? -11.622 10.217  -3.291  1.00 0.00 ? 13  SER A HG   3  
ATOM 3993  N N    . MET A 1 14  ? -10.689 7.920   -5.905  1.00 0.00 ? 14  MET A N    3  
ATOM 3994  C CA   . MET A 1 14  ? -10.090 6.664   -6.342  1.00 0.00 ? 14  MET A CA   3  
ATOM 3995  C C    . MET A 1 14  ? -10.990 5.482   -5.994  1.00 0.00 ? 14  MET A C    3  
ATOM 3996  O O    . MET A 1 14  ? -11.272 5.227   -4.822  1.00 0.00 ? 14  MET A O    3  
ATOM 3997  C CB   . MET A 1 14  ? -8.714  6.479   -5.699  1.00 0.00 ? 14  MET A CB   3  
ATOM 3998  C CG   . MET A 1 14  ? -7.668  7.456   -6.210  1.00 0.00 ? 14  MET A CG   3  
ATOM 3999  S SD   . MET A 1 14  ? -7.372  7.292   -7.982  1.00 0.00 ? 14  MET A SD   3  
ATOM 4000  C CE   . MET A 1 14  ? -6.534  5.710   -8.040  1.00 0.00 ? 14  MET A CE   3  
ATOM 4001  H H    . MET A 1 14  ? -10.204 8.482   -5.265  1.00 0.00 ? 14  MET A H    3  
ATOM 4002  H HA   . MET A 1 14  ? -9.973  6.708   -7.414  1.00 0.00 ? 14  MET A HA   3  
ATOM 4003  H HB2  . MET A 1 14  ? -8.808  6.612   -4.631  1.00 0.00 ? 14  MET A HB2  3  
ATOM 4004  H HB3  . MET A 1 14  ? -8.368  5.476   -5.900  1.00 0.00 ? 14  MET A HB3  3  
ATOM 4005  H HG2  . MET A 1 14  ? -8.004  8.462   -6.008  1.00 0.00 ? 14  MET A HG2  3  
ATOM 4006  H HG3  . MET A 1 14  ? -6.741  7.276   -5.686  1.00 0.00 ? 14  MET A HG3  3  
ATOM 4007  H HE1  . MET A 1 14  ? -6.745  5.227   -8.983  1.00 0.00 ? 14  MET A HE1  3  
ATOM 4008  H HE2  . MET A 1 14  ? -5.470  5.863   -7.944  1.00 0.00 ? 14  MET A HE2  3  
ATOM 4009  H HE3  . MET A 1 14  ? -6.884  5.088   -7.230  1.00 0.00 ? 14  MET A HE3  3  
ATOM 4010  N N    . LYS A 1 15  ? -11.439 4.765   -7.017  1.00 0.00 ? 15  LYS A N    3  
ATOM 4011  C CA   . LYS A 1 15  ? -12.307 3.609   -6.820  1.00 0.00 ? 15  LYS A CA   3  
ATOM 4012  C C    . LYS A 1 15  ? -11.742 2.379   -7.524  1.00 0.00 ? 15  LYS A C    3  
ATOM 4013  O O    . LYS A 1 15  ? -10.959 2.496   -8.466  1.00 0.00 ? 15  LYS A O    3  
ATOM 4014  C CB   . LYS A 1 15  ? -13.714 3.907   -7.342  1.00 0.00 ? 15  LYS A CB   3  
ATOM 4015  C CG   . LYS A 1 15  ? -14.785 3.008   -6.750  1.00 0.00 ? 15  LYS A CG   3  
ATOM 4016  C CD   . LYS A 1 15  ? -15.061 3.352   -5.296  1.00 0.00 ? 15  LYS A CD   3  
ATOM 4017  C CE   . LYS A 1 15  ? -16.019 4.527   -5.173  1.00 0.00 ? 15  LYS A CE   3  
ATOM 4018  N NZ   . LYS A 1 15  ? -17.441 4.094   -5.251  1.00 0.00 ? 15  LYS A NZ   3  
ATOM 4019  H H    . LYS A 1 15  ? -11.180 5.018   -7.929  1.00 0.00 ? 15  LYS A H    3  
ATOM 4020  H HA   . LYS A 1 15  ? -12.359 3.411   -5.761  1.00 0.00 ? 15  LYS A HA   3  
ATOM 4021  H HB2  . LYS A 1 15  ? -13.963 4.932   -7.107  1.00 0.00 ? 15  LYS A HB2  3  
ATOM 4022  H HB3  . LYS A 1 15  ? -13.721 3.782   -8.416  1.00 0.00 ? 15  LYS A HB3  3  
ATOM 4023  H HG2  . LYS A 1 15  ? -15.697 3.129   -7.316  1.00 0.00 ? 15  LYS A HG2  3  
ATOM 4024  H HG3  . LYS A 1 15  ? -14.454 1.981   -6.812  1.00 0.00 ? 15  LYS A HG3  3  
ATOM 4025  H HD2  . LYS A 1 15  ? -15.499 2.493   -4.809  1.00 0.00 ? 15  LYS A HD2  3  
ATOM 4026  H HD3  . LYS A 1 15  ? -14.128 3.606   -4.812  1.00 0.00 ? 15  LYS A HD3  3  
ATOM 4027  H HE2  . LYS A 1 15  ? -15.851 5.014   -4.225  1.00 0.00 ? 15  LYS A HE2  3  
ATOM 4028  H HE3  . LYS A 1 15  ? -15.819 5.223   -5.975  1.00 0.00 ? 15  LYS A HE3  3  
ATOM 4029  H HZ1  . LYS A 1 15  ? -17.700 3.892   -6.237  1.00 0.00 ? 15  LYS A HZ1  3  
ATOM 4030  H HZ2  . LYS A 1 15  ? -18.063 4.844   -4.886  1.00 0.00 ? 15  LYS A HZ2  3  
ATOM 4031  H HZ3  . LYS A 1 15  ? -17.584 3.235   -4.683  1.00 0.00 ? 15  LYS A HZ3  3  
ATOM 4032  N N    . ARG A 1 16  ? -12.146 1.201   -7.060  1.00 0.00 ? 16  ARG A N    3  
ATOM 4033  C CA   . ARG A 1 16  ? -11.681 -0.051  -7.645  1.00 0.00 ? 16  ARG A CA   3  
ATOM 4034  C C    . ARG A 1 16  ? -12.843 -0.834  -8.250  1.00 0.00 ? 16  ARG A C    3  
ATOM 4035  O O    . ARG A 1 16  ? -13.958 -0.807  -7.732  1.00 0.00 ? 16  ARG A O    3  
ATOM 4036  C CB   . ARG A 1 16  ? -10.974 -0.901  -6.588  1.00 0.00 ? 16  ARG A CB   3  
ATOM 4037  C CG   . ARG A 1 16  ? -10.411 -2.204  -7.131  1.00 0.00 ? 16  ARG A CG   3  
ATOM 4038  C CD   . ARG A 1 16  ? -10.188 -3.220  -6.022  1.00 0.00 ? 16  ARG A CD   3  
ATOM 4039  N NE   . ARG A 1 16  ? -10.177 -4.590  -6.528  1.00 0.00 ? 16  ARG A NE   3  
ATOM 4040  C CZ   . ARG A 1 16  ? -11.277 -5.270  -6.832  1.00 0.00 ? 16  ARG A CZ   3  
ATOM 4041  N NH1  . ARG A 1 16  ? -12.469 -4.709  -6.682  1.00 0.00 ? 16  ARG A NH1  3  
ATOM 4042  N NH2  . ARG A 1 16  ? -11.186 -6.513  -7.288  1.00 0.00 ? 16  ARG A NH2  3  
ATOM 4043  H H    . ARG A 1 16  ? -12.772 1.172   -6.306  1.00 0.00 ? 16  ARG A H    3  
ATOM 4044  H HA   . ARG A 1 16  ? -10.978 0.190   -8.429  1.00 0.00 ? 16  ARG A HA   3  
ATOM 4045  H HB2  . ARG A 1 16  ? -10.159 -0.330  -6.169  1.00 0.00 ? 16  ARG A HB2  3  
ATOM 4046  H HB3  . ARG A 1 16  ? -11.678 -1.138  -5.805  1.00 0.00 ? 16  ARG A HB3  3  
ATOM 4047  H HG2  . ARG A 1 16  ? -11.107 -2.616  -7.847  1.00 0.00 ? 16  ARG A HG2  3  
ATOM 4048  H HG3  . ARG A 1 16  ? -9.469  -2.002  -7.618  1.00 0.00 ? 16  ARG A HG3  3  
ATOM 4049  H HD2  . ARG A 1 16  ? -9.239  -3.014  -5.549  1.00 0.00 ? 16  ARG A HD2  3  
ATOM 4050  H HD3  . ARG A 1 16  ? -10.981 -3.120  -5.296  1.00 0.00 ? 16  ARG A HD3  3  
ATOM 4051  H HE   . ARG A 1 16  ? -9.306  -5.023  -6.647  1.00 0.00 ? 16  ARG A HE   3  
ATOM 4052  H HH11 . ARG A 1 16  ? -12.541 -3.772  -6.340  1.00 0.00 ? 16  ARG A HH11 3  
ATOM 4053  H HH12 . ARG A 1 16  ? -13.296 -5.223  -6.913  1.00 0.00 ? 16  ARG A HH12 3  
ATOM 4054  H HH21 . ARG A 1 16  ? -10.289 -6.938  -7.402  1.00 0.00 ? 16  ARG A HH21 3  
ATOM 4055  H HH22 . ARG A 1 16  ? -12.014 -7.023  -7.516  1.00 0.00 ? 16  ARG A HH22 3  
ATOM 4056  N N    . ASN A 1 17  ? -12.572 -1.529  -9.350  1.00 0.00 ? 17  ASN A N    3  
ATOM 4057  C CA   . ASN A 1 17  ? -13.595 -2.319  -10.025 1.00 0.00 ? 17  ASN A CA   3  
ATOM 4058  C C    . ASN A 1 17  ? -13.344 -3.812  -9.836  1.00 0.00 ? 17  ASN A C    3  
ATOM 4059  O O    . ASN A 1 17  ? -12.205 -4.279  -9.830  1.00 0.00 ? 17  ASN A O    3  
ATOM 4060  C CB   . ASN A 1 17  ? -13.627 -1.981  -11.517 1.00 0.00 ? 17  ASN A CB   3  
ATOM 4061  C CG   . ASN A 1 17  ? -14.125 -0.573  -11.781 1.00 0.00 ? 17  ASN A CG   3  
ATOM 4062  O OD1  . ASN A 1 17  ? -15.330 -0.328  -11.830 1.00 0.00 ? 17  ASN A OD1  3  
ATOM 4063  N ND2  . ASN A 1 17  ? -13.196 0.360   -11.953 1.00 0.00 ? 17  ASN A ND2  3  
ATOM 4064  H H    . ASN A 1 17  ? -11.663 -1.511  -9.716  1.00 0.00 ? 17  ASN A H    3  
ATOM 4065  H HA   . ASN A 1 17  ? -14.550 -2.068  -9.588  1.00 0.00 ? 17  ASN A HA   3  
ATOM 4066  H HB2  . ASN A 1 17  ? -12.629 -2.071  -11.922 1.00 0.00 ? 17  ASN A HB2  3  
ATOM 4067  H HB3  . ASN A 1 17  ? -14.280 -2.676  -12.024 1.00 0.00 ? 17  ASN A HB3  3  
ATOM 4068  H HD21 . ASN A 1 17  ? -12.255 0.092   -11.900 1.00 0.00 ? 17  ASN A HD21 3  
ATOM 4069  H HD22 . ASN A 1 17  ? -13.490 1.279   -12.124 1.00 0.00 ? 17  ASN A HD22 3  
ATOM 4070  N N    . PRO A 1 18  ? -14.433 -4.579  -9.677  1.00 0.00 ? 18  PRO A N    3  
ATOM 4071  C CA   . PRO A 1 18  ? -14.357 -6.031  -9.486  1.00 0.00 ? 18  PRO A CA   3  
ATOM 4072  C C    . PRO A 1 18  ? -13.906 -6.759  -10.747 1.00 0.00 ? 18  PRO A C    3  
ATOM 4073  O O    . PRO A 1 18  ? -13.152 -7.729  -10.679 1.00 0.00 ? 18  PRO A O    3  
ATOM 4074  C CB   . PRO A 1 18  ? -15.794 -6.417  -9.130  1.00 0.00 ? 18  PRO A CB   3  
ATOM 4075  C CG   . PRO A 1 18  ? -16.636 -5.352  -9.743  1.00 0.00 ? 18  PRO A CG   3  
ATOM 4076  C CD   . PRO A 1 18  ? -15.822 -4.090  -9.674  1.00 0.00 ? 18  PRO A CD   3  
ATOM 4077  H HA   . PRO A 1 18  ? -13.700 -6.289  -8.668  1.00 0.00 ? 18  PRO A HA   3  
ATOM 4078  H HB2  . PRO A 1 18  ? -16.022 -7.389  -9.545  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 4079  H HB3  . PRO A 1 18  ? -15.909 -6.442  -8.057  1.00 0.00 ? 18  PRO A HB3  3  
ATOM 4080  H HG2  . PRO A 1 18  ? -16.854 -5.602  -10.770 1.00 0.00 ? 18  PRO A HG2  3  
ATOM 4081  H HG3  . PRO A 1 18  ? -17.551 -5.238  -9.180  1.00 0.00 ? 18  PRO A HG3  3  
ATOM 4082  H HD2  . PRO A 1 18  ? -16.014 -3.469  -10.536 1.00 0.00 ? 18  PRO A HD2  3  
ATOM 4083  H HD3  . PRO A 1 18  ? -16.037 -3.551  -8.763  1.00 0.00 ? 18  PRO A HD3  3  
ATOM 4084  N N    . ASN A 1 19  ? -14.373 -6.285  -11.898 1.00 0.00 ? 19  ASN A N    3  
ATOM 4085  C CA   . ASN A 1 19  ? -14.018 -6.892  -13.175 1.00 0.00 ? 19  ASN A CA   3  
ATOM 4086  C C    . ASN A 1 19  ? -12.513 -6.813  -13.415 1.00 0.00 ? 19  ASN A C    3  
ATOM 4087  O O    . ASN A 1 19  ? -11.904 -7.756  -13.919 1.00 0.00 ? 19  ASN A O    3  
ATOM 4088  C CB   . ASN A 1 19  ? -14.765 -6.201  -14.318 1.00 0.00 ? 19  ASN A CB   3  
ATOM 4089  C CG   . ASN A 1 19  ? -16.259 -6.457  -14.270 1.00 0.00 ? 19  ASN A CG   3  
ATOM 4090  O OD1  . ASN A 1 19  ? -16.704 -7.522  -13.843 1.00 0.00 ? 19  ASN A OD1  3  
ATOM 4091  N ND2  . ASN A 1 19  ? -17.041 -5.477  -14.709 1.00 0.00 ? 19  ASN A ND2  3  
ATOM 4092  H H    . ASN A 1 19  ? -14.971 -5.509  -11.888 1.00 0.00 ? 19  ASN A H    3  
ATOM 4093  H HA   . ASN A 1 19  ? -14.311 -7.931  -13.142 1.00 0.00 ? 19  ASN A HA   3  
ATOM 4094  H HB2  . ASN A 1 19  ? -14.600 -5.135  -14.254 1.00 0.00 ? 19  ASN A HB2  3  
ATOM 4095  H HB3  . ASN A 1 19  ? -14.386 -6.564  -15.261 1.00 0.00 ? 19  ASN A HB3  3  
ATOM 4096  H HD21 . ASN A 1 19  ? -16.617 -4.656  -15.034 1.00 0.00 ? 19  ASN A HD21 3  
ATOM 4097  H HD22 . ASN A 1 19  ? -18.011 -5.616  -14.689 1.00 0.00 ? 19  ASN A HD22 3  
ATOM 4098  N N    . ALA A 1 20  ? -11.920 -5.681  -13.050 1.00 0.00 ? 20  ALA A N    3  
ATOM 4099  C CA   . ALA A 1 20  ? -10.487 -5.479  -13.223 1.00 0.00 ? 20  ALA A CA   3  
ATOM 4100  C C    . ALA A 1 20  ? -9.694  -6.644  -12.639 1.00 0.00 ? 20  ALA A C    3  
ATOM 4101  O O    . ALA A 1 20  ? -9.947  -7.101  -11.524 1.00 0.00 ? 20  ALA A O    3  
ATOM 4102  C CB   . ALA A 1 20  ? -10.057 -4.170  -12.579 1.00 0.00 ? 20  ALA A CB   3  
ATOM 4103  H H    . ALA A 1 20  ? -12.459 -4.965  -12.654 1.00 0.00 ? 20  ALA A H    3  
ATOM 4104  H HA   . ALA A 1 20  ? -10.284 -5.415  -14.282 1.00 0.00 ? 20  ALA A HA   3  
ATOM 4105  H HB1  . ALA A 1 20  ? -9.315  -4.369  -11.820 1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4106  H HB2  . ALA A 1 20  ? -9.636  -3.520  -13.333 1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4107  H HB3  . ALA A 1 20  ? -10.914 -3.691  -12.129 1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4108  N N    . PRO A 1 21  ? -8.712  -7.137  -13.407 1.00 0.00 ? 21  PRO A N    3  
ATOM 4109  C CA   . PRO A 1 21  ? -7.862  -8.255  -12.986 1.00 0.00 ? 21  PRO A CA   3  
ATOM 4110  C C    . PRO A 1 21  ? -6.916  -7.869  -11.854 1.00 0.00 ? 21  PRO A C    3  
ATOM 4111  O O    . PRO A 1 21  ? -6.230  -6.849  -11.925 1.00 0.00 ? 21  PRO A O    3  
ATOM 4112  C CB   . PRO A 1 21  ? -7.071  -8.596  -14.252 1.00 0.00 ? 21  PRO A CB   3  
ATOM 4113  C CG   . PRO A 1 21  ? -7.050  -7.330  -15.037 1.00 0.00 ? 21  PRO A CG   3  
ATOM 4114  C CD   . PRO A 1 21  ? -8.354  -6.640  -14.747 1.00 0.00 ? 21  PRO A CD   3  
ATOM 4115  H HA   . PRO A 1 21  ? -8.451  -9.109  -12.686 1.00 0.00 ? 21  PRO A HA   3  
ATOM 4116  H HB2  . PRO A 1 21  ? -6.073  -8.910  -13.981 1.00 0.00 ? 21  PRO A HB2  3  
ATOM 4117  H HB3  . PRO A 1 21  ? -7.571  -9.386  -14.791 1.00 0.00 ? 21  PRO A HB3  3  
ATOM 4118  H HG2  . PRO A 1 21  ? -6.222  -6.715  -14.721 1.00 0.00 ? 21  PRO A HG2  3  
ATOM 4119  H HG3  . PRO A 1 21  ? -6.972  -7.554  -16.091 1.00 0.00 ? 21  PRO A HG3  3  
ATOM 4120  H HD2  . PRO A 1 21  ? -8.221  -5.569  -14.738 1.00 0.00 ? 21  PRO A HD2  3  
ATOM 4121  H HD3  . PRO A 1 21  ? -9.101  -6.924  -15.474 1.00 0.00 ? 21  PRO A HD3  3  
ATOM 4122  N N    . VAL A 1 22  ? -6.884  -8.692  -10.810 1.00 0.00 ? 22  VAL A N    3  
ATOM 4123  C CA   . VAL A 1 22  ? -6.020  -8.438  -9.663  1.00 0.00 ? 22  VAL A CA   3  
ATOM 4124  C C    . VAL A 1 22  ? -4.549  -8.563  -10.044 1.00 0.00 ? 22  VAL A C    3  
ATOM 4125  O O    . VAL A 1 22  ? -4.083  -9.639  -10.421 1.00 0.00 ? 22  VAL A O    3  
ATOM 4126  C CB   . VAL A 1 22  ? -6.324  -9.407  -8.506  1.00 0.00 ? 22  VAL A CB   3  
ATOM 4127  C CG1  . VAL A 1 22  ? -5.357  -9.183  -7.353  1.00 0.00 ? 22  VAL A CG1  3  
ATOM 4128  C CG2  . VAL A 1 22  ? -7.765  -9.249  -8.043  1.00 0.00 ? 22  VAL A CG2  3  
ATOM 4129  H H    . VAL A 1 22  ? -7.454  -9.489  -10.812 1.00 0.00 ? 22  VAL A H    3  
ATOM 4130  H HA   . VAL A 1 22  ? -6.208  -7.430  -9.320  1.00 0.00 ? 22  VAL A HA   3  
ATOM 4131  H HB   . VAL A 1 22  ? -6.193  -10.417 -8.865  1.00 0.00 ? 22  VAL A HB   3  
ATOM 4132  H HG11 . VAL A 1 22  ? -5.629  -9.823  -6.527  1.00 0.00 ? 22  VAL A HG11 3  
ATOM 4133  H HG12 . VAL A 1 22  ? -4.353  -9.415  -7.675  1.00 0.00 ? 22  VAL A HG12 3  
ATOM 4134  H HG13 . VAL A 1 22  ? -5.406  -8.151  -7.039  1.00 0.00 ? 22  VAL A HG13 3  
ATOM 4135  H HG21 . VAL A 1 22  ? -8.148  -8.297  -8.378  1.00 0.00 ? 22  VAL A HG21 3  
ATOM 4136  H HG22 . VAL A 1 22  ? -8.365  -10.045 -8.457  1.00 0.00 ? 22  VAL A HG22 3  
ATOM 4137  H HG23 . VAL A 1 22  ? -7.804  -9.293  -6.964  1.00 0.00 ? 22  VAL A HG23 3  
ATOM 4138  N N    . THR A 1 23  ? -3.820  -7.456  -9.943  1.00 0.00 ? 23  THR A N    3  
ATOM 4139  C CA   . THR A 1 23  ? -2.402  -7.441  -10.277 1.00 0.00 ? 23  THR A CA   3  
ATOM 4140  C C    . THR A 1 23  ? -1.604  -8.325  -9.325  1.00 0.00 ? 23  THR A C    3  
ATOM 4141  O O    . THR A 1 23  ? -1.010  -9.322  -9.737  1.00 0.00 ? 23  THR A O    3  
ATOM 4142  C CB   . THR A 1 23  ? -1.830  -6.012  -10.235 1.00 0.00 ? 23  THR A CB   3  
ATOM 4143  O OG1  . THR A 1 23  ? -2.647  -5.134  -11.016 1.00 0.00 ? 23  THR A OG1  3  
ATOM 4144  C CG2  . THR A 1 23  ? -0.402  -5.985  -10.760 1.00 0.00 ? 23  THR A CG2  3  
ATOM 4145  H H    . THR A 1 23  ? -4.249  -6.630  -9.636  1.00 0.00 ? 23  THR A H    3  
ATOM 4146  H HA   . THR A 1 23  ? -2.292  -7.821  -11.283 1.00 0.00 ? 23  THR A HA   3  
ATOM 4147  H HB   . THR A 1 23  ? -1.827  -5.672  -9.209  1.00 0.00 ? 23  THR A HB   3  
ATOM 4148  H HG1  . THR A 1 23  ? -2.340  -5.135  -11.926 1.00 0.00 ? 23  THR A HG1  3  
ATOM 4149  H HG21 . THR A 1 23  ? -0.413  -5.784  -11.820 1.00 0.00 ? 23  THR A HG21 3  
ATOM 4150  H HG22 . THR A 1 23  ? 0.066   -6.942  -10.580 1.00 0.00 ? 23  THR A HG22 3  
ATOM 4151  H HG23 . THR A 1 23  ? 0.154   -5.211  -10.251 1.00 0.00 ? 23  THR A HG23 3  
ATOM 4152  N N    . LYS A 1 24  ? -1.593  -7.953  -8.050  1.00 0.00 ? 24  LYS A N    3  
ATOM 4153  C CA   . LYS A 1 24  ? -0.869  -8.712  -7.037  1.00 0.00 ? 24  LYS A CA   3  
ATOM 4154  C C    . LYS A 1 24  ? -1.469  -8.484  -5.653  1.00 0.00 ? 24  LYS A C    3  
ATOM 4155  O O    . LYS A 1 24  ? -1.740  -7.349  -5.263  1.00 0.00 ? 24  LYS A O    3  
ATOM 4156  C CB   . LYS A 1 24  ? 0.610   -8.318  -7.035  1.00 0.00 ? 24  LYS A CB   3  
ATOM 4157  C CG   . LYS A 1 24  ? 1.507   -9.325  -6.336  1.00 0.00 ? 24  LYS A CG   3  
ATOM 4158  C CD   . LYS A 1 24  ? 2.880   -8.742  -6.047  1.00 0.00 ? 24  LYS A CD   3  
ATOM 4159  C CE   . LYS A 1 24  ? 3.687   -9.646  -5.127  1.00 0.00 ? 24  LYS A CE   3  
ATOM 4160  N NZ   . LYS A 1 24  ? 4.309   -10.778 -5.868  1.00 0.00 ? 24  LYS A NZ   3  
ATOM 4161  H H    . LYS A 1 24  ? -2.085  -7.148  -7.782  1.00 0.00 ? 24  LYS A H    3  
ATOM 4162  H HA   . LYS A 1 24  ? -0.953  -9.760  -7.284  1.00 0.00 ? 24  LYS A HA   3  
ATOM 4163  H HB2  . LYS A 1 24  ? 0.945   -8.217  -8.056  1.00 0.00 ? 24  LYS A HB2  3  
ATOM 4164  H HB3  . LYS A 1 24  ? 0.715   -7.366  -6.535  1.00 0.00 ? 24  LYS A HB3  3  
ATOM 4165  H HG2  . LYS A 1 24  ? 1.048   -9.616  -5.403  1.00 0.00 ? 24  LYS A HG2  3  
ATOM 4166  H HG3  . LYS A 1 24  ? 1.620   -10.193 -6.969  1.00 0.00 ? 24  LYS A HG3  3  
ATOM 4167  H HD2  . LYS A 1 24  ? 3.415   -8.625  -6.977  1.00 0.00 ? 24  LYS A HD2  3  
ATOM 4168  H HD3  . LYS A 1 24  ? 2.760   -7.777  -5.574  1.00 0.00 ? 24  LYS A HD3  3  
ATOM 4169  H HE2  . LYS A 1 24  ? 4.464   -9.061  -4.661  1.00 0.00 ? 24  LYS A HE2  3  
ATOM 4170  H HE3  . LYS A 1 24  ? 3.030   -10.042 -4.367  1.00 0.00 ? 24  LYS A HE3  3  
ATOM 4171  H HZ1  . LYS A 1 24  ? 5.344   -10.739 -5.776  1.00 0.00 ? 24  LYS A HZ1  3  
ATOM 4172  H HZ2  . LYS A 1 24  ? 4.059   -10.725 -6.876  1.00 0.00 ? 24  LYS A HZ2  3  
ATOM 4173  H HZ3  . LYS A 1 24  ? 3.971   -11.684 -5.486  1.00 0.00 ? 24  LYS A HZ3  3  
ATOM 4174  N N    . ALA A 1 25  ? -1.673  -9.570  -4.915  1.00 0.00 ? 25  ALA A N    3  
ATOM 4175  C CA   . ALA A 1 25  ? -2.238  -9.488  -3.574  1.00 0.00 ? 25  ALA A CA   3  
ATOM 4176  C C    . ALA A 1 25  ? -1.410  -10.295 -2.580  1.00 0.00 ? 25  ALA A C    3  
ATOM 4177  O O    . ALA A 1 25  ? -0.935  -11.386 -2.893  1.00 0.00 ? 25  ALA A O    3  
ATOM 4178  C CB   . ALA A 1 25  ? -3.680  -9.971  -3.578  1.00 0.00 ? 25  ALA A CB   3  
ATOM 4179  H H    . ALA A 1 25  ? -1.437  -10.448 -5.281  1.00 0.00 ? 25  ALA A H    3  
ATOM 4180  H HA   . ALA A 1 25  ? -2.232  -8.450  -3.273  1.00 0.00 ? 25  ALA A HA   3  
ATOM 4181  H HB1  . ALA A 1 25  ? -4.333  -9.156  -3.303  1.00 0.00 ? 25  ALA A HB1  3  
ATOM 4182  H HB2  . ALA A 1 25  ? -3.939  -10.322 -4.567  1.00 0.00 ? 25  ALA A HB2  3  
ATOM 4183  H HB3  . ALA A 1 25  ? -3.792  -10.777 -2.868  1.00 0.00 ? 25  ALA A HB3  3  
ATOM 4184  N N    . GLY A 1 26  ? -1.241  -9.751  -1.378  1.00 0.00 ? 26  GLY A N    3  
ATOM 4185  C CA   . GLY A 1 26  ? -0.470  -10.435 -0.356  1.00 0.00 ? 26  GLY A CA   3  
ATOM 4186  C C    . GLY A 1 26  ? -0.500  -9.710  0.975   1.00 0.00 ? 26  GLY A C    3  
ATOM 4187  O O    . GLY A 1 26  ? -0.665  -8.491  1.022   1.00 0.00 ? 26  GLY A O    3  
ATOM 4188  H H    . GLY A 1 26  ? -1.643  -8.879  -1.184  1.00 0.00 ? 26  GLY A H    3  
ATOM 4189  H HA2  . GLY A 1 26  ? -0.870  -11.428 -0.223  1.00 0.00 ? 26  GLY A HA2  3  
ATOM 4190  H HA3  . GLY A 1 26  ? 0.556   -10.512 -0.687  1.00 0.00 ? 26  GLY A HA3  3  
ATOM 4191  N N    . TRP A 1 27  ? -0.341  -10.461 2.059   1.00 0.00 ? 27  TRP A N    3  
ATOM 4192  C CA   . TRP A 1 27  ? -0.353  -9.882  3.397   1.00 0.00 ? 27  TRP A CA   3  
ATOM 4193  C C    . TRP A 1 27  ? 0.925   -9.093  3.660   1.00 0.00 ? 27  TRP A C    3  
ATOM 4194  O O    . TRP A 1 27  ? 2.011   -9.666  3.763   1.00 0.00 ? 27  TRP A O    3  
ATOM 4195  C CB   . TRP A 1 27  ? -0.514  -10.981 4.449   1.00 0.00 ? 27  TRP A CB   3  
ATOM 4196  C CG   . TRP A 1 27  ? -1.898  -11.553 4.503   1.00 0.00 ? 27  TRP A CG   3  
ATOM 4197  C CD1  . TRP A 1 27  ? -2.351  -12.666 3.854   1.00 0.00 ? 27  TRP A CD1  3  
ATOM 4198  C CD2  . TRP A 1 27  ? -3.010  -11.039 5.245   1.00 0.00 ? 27  TRP A CD2  3  
ATOM 4199  N NE1  . TRP A 1 27  ? -3.677  -12.874 4.148   1.00 0.00 ? 27  TRP A NE1  3  
ATOM 4200  C CE2  . TRP A 1 27  ? -4.104  -11.891 5.000   1.00 0.00 ? 27  TRP A CE2  3  
ATOM 4201  C CE3  . TRP A 1 27  ? -3.186  -9.943  6.094   1.00 0.00 ? 27  TRP A CE3  3  
ATOM 4202  C CZ2  . TRP A 1 27  ? -5.355  -11.678 5.572   1.00 0.00 ? 27  TRP A CZ2  3  
ATOM 4203  C CZ3  . TRP A 1 27  ? -4.428  -9.734  6.662   1.00 0.00 ? 27  TRP A CZ3  3  
ATOM 4204  C CH2  . TRP A 1 27  ? -5.500  -10.598 6.400   1.00 0.00 ? 27  TRP A CH2  3  
ATOM 4205  H H    . TRP A 1 27  ? -0.213  -11.427 1.957   1.00 0.00 ? 27  TRP A H    3  
ATOM 4206  H HA   . TRP A 1 27  ? -1.196  -9.210  3.460   1.00 0.00 ? 27  TRP A HA   3  
ATOM 4207  H HB2  . TRP A 1 27  ? 0.171   -11.786 4.228   1.00 0.00 ? 27  TRP A HB2  3  
ATOM 4208  H HB3  . TRP A 1 27  ? -0.282  -10.574 5.423   1.00 0.00 ? 27  TRP A HB3  3  
ATOM 4209  H HD1  . TRP A 1 27  ? -1.745  -13.281 3.206   1.00 0.00 ? 27  TRP A HD1  3  
ATOM 4210  H HE1  . TRP A 1 27  ? -4.227  -13.610 3.804   1.00 0.00 ? 27  TRP A HE1  3  
ATOM 4211  H HE3  . TRP A 1 27  ? -2.373  -9.266  6.308   1.00 0.00 ? 27  TRP A HE3  3  
ATOM 4212  H HZ2  . TRP A 1 27  ? -6.191  -12.336 5.381   1.00 0.00 ? 27  TRP A HZ2  3  
ATOM 4213  H HZ3  . TRP A 1 27  ? -4.584  -8.892  7.320   1.00 0.00 ? 27  TRP A HZ3  3  
ATOM 4214  H HH2  . TRP A 1 27  ? -6.452  -10.396 6.864   1.00 0.00 ? 27  TRP A HH2  3  
ATOM 4215  N N    . LEU A 1 28  ? 0.790   -7.776  3.769   1.00 0.00 ? 28  LEU A N    3  
ATOM 4216  C CA   . LEU A 1 28  ? 1.935   -6.908  4.021   1.00 0.00 ? 28  LEU A CA   3  
ATOM 4217  C C    . LEU A 1 28  ? 1.773   -6.162  5.342   1.00 0.00 ? 28  LEU A C    3  
ATOM 4218  O O    . LEU A 1 28  ? 0.720   -6.225  5.978   1.00 0.00 ? 28  LEU A O    3  
ATOM 4219  C CB   . LEU A 1 28  ? 2.104   -5.908  2.876   1.00 0.00 ? 28  LEU A CB   3  
ATOM 4220  C CG   . LEU A 1 28  ? 2.870   -6.413  1.652   1.00 0.00 ? 28  LEU A CG   3  
ATOM 4221  C CD1  . LEU A 1 28  ? 2.718   -5.444  0.490   1.00 0.00 ? 28  LEU A CD1  3  
ATOM 4222  C CD2  . LEU A 1 28  ? 4.339   -6.617  1.990   1.00 0.00 ? 28  LEU A CD2  3  
ATOM 4223  H H    . LEU A 1 28  ? -0.100  -7.377  3.679   1.00 0.00 ? 28  LEU A H    3  
ATOM 4224  H HA   . LEU A 1 28  ? 2.816   -7.530  4.078   1.00 0.00 ? 28  LEU A HA   3  
ATOM 4225  H HB2  . LEU A 1 28  ? 1.120   -5.610  2.549   1.00 0.00 ? 28  LEU A HB2  3  
ATOM 4226  H HB3  . LEU A 1 28  ? 2.629   -5.047  3.264   1.00 0.00 ? 28  LEU A HB3  3  
ATOM 4227  H HG   . LEU A 1 28  ? 2.460   -7.366  1.347   1.00 0.00 ? 28  LEU A HG   3  
ATOM 4228  H HD11 . LEU A 1 28  ? 1.671   -5.328  0.252   1.00 0.00 ? 28  LEU A HD11 3  
ATOM 4229  H HD12 . LEU A 1 28  ? 3.243   -5.829  -0.371  1.00 0.00 ? 28  LEU A HD12 3  
ATOM 4230  H HD13 . LEU A 1 28  ? 3.133   -4.485  0.765   1.00 0.00 ? 28  LEU A HD13 3  
ATOM 4231  H HD21 . LEU A 1 28  ? 4.831   -7.119  1.169   1.00 0.00 ? 28  LEU A HD21 3  
ATOM 4232  H HD22 . LEU A 1 28  ? 4.423   -7.219  2.882   1.00 0.00 ? 28  LEU A HD22 3  
ATOM 4233  H HD23 . LEU A 1 28  ? 4.807   -5.658  2.158   1.00 0.00 ? 28  LEU A HD23 3  
ATOM 4234  N N    . PHE A 1 29  ? 2.822   -5.454  5.748   1.00 0.00 ? 29  PHE A N    3  
ATOM 4235  C CA   . PHE A 1 29  ? 2.795   -4.695  6.993   1.00 0.00 ? 29  PHE A CA   3  
ATOM 4236  C C    . PHE A 1 29  ? 2.910   -3.198  6.719   1.00 0.00 ? 29  PHE A C    3  
ATOM 4237  O O    . PHE A 1 29  ? 3.934   -2.720  6.231   1.00 0.00 ? 29  PHE A O    3  
ATOM 4238  C CB   . PHE A 1 29  ? 3.932   -5.145  7.914   1.00 0.00 ? 29  PHE A CB   3  
ATOM 4239  C CG   . PHE A 1 29  ? 3.701   -6.491  8.537   1.00 0.00 ? 29  PHE A CG   3  
ATOM 4240  C CD1  . PHE A 1 29  ? 3.741   -7.642  7.767   1.00 0.00 ? 29  PHE A CD1  3  
ATOM 4241  C CD2  . PHE A 1 29  ? 3.443   -6.606  9.894   1.00 0.00 ? 29  PHE A CD2  3  
ATOM 4242  C CE1  . PHE A 1 29  ? 3.529   -8.883  8.337   1.00 0.00 ? 29  PHE A CE1  3  
ATOM 4243  C CE2  . PHE A 1 29  ? 3.231   -7.844  10.470  1.00 0.00 ? 29  PHE A CE2  3  
ATOM 4244  C CZ   . PHE A 1 29  ? 3.273   -8.984  9.691   1.00 0.00 ? 29  PHE A CZ   3  
ATOM 4245  H H    . PHE A 1 29  ? 3.633   -5.443  5.198   1.00 0.00 ? 29  PHE A H    3  
ATOM 4246  H HA   . PHE A 1 29  ? 1.852   -4.889  7.479   1.00 0.00 ? 29  PHE A HA   3  
ATOM 4247  H HB2  . PHE A 1 29  ? 4.848   -5.196  7.344   1.00 0.00 ? 29  PHE A HB2  3  
ATOM 4248  H HB3  . PHE A 1 29  ? 4.047   -4.424  8.709   1.00 0.00 ? 29  PHE A HB3  3  
ATOM 4249  H HD1  . PHE A 1 29  ? 3.941   -7.564  6.707   1.00 0.00 ? 29  PHE A HD1  3  
ATOM 4250  H HD2  . PHE A 1 29  ? 3.410   -5.716  10.504  1.00 0.00 ? 29  PHE A HD2  3  
ATOM 4251  H HE1  . PHE A 1 29  ? 3.563   -9.772  7.725   1.00 0.00 ? 29  PHE A HE1  3  
ATOM 4252  H HE2  . PHE A 1 29  ? 3.031   -7.921  11.528  1.00 0.00 ? 29  PHE A HE2  3  
ATOM 4253  H HZ   . PHE A 1 29  ? 3.108   -9.953  10.139  1.00 0.00 ? 29  PHE A HZ   3  
ATOM 4254  N N    . LYS A 1 30  ? 1.850   -2.462  7.037   1.00 0.00 ? 30  LYS A N    3  
ATOM 4255  C CA   . LYS A 1 30  ? 1.829   -1.020  6.827   1.00 0.00 ? 30  LYS A CA   3  
ATOM 4256  C C    . LYS A 1 30  ? 2.135   -0.277  8.124   1.00 0.00 ? 30  LYS A C    3  
ATOM 4257  O O    . LYS A 1 30  ? 1.315   -0.246  9.041   1.00 0.00 ? 30  LYS A O    3  
ATOM 4258  C CB   . LYS A 1 30  ? 0.466   -0.582  6.287   1.00 0.00 ? 30  LYS A CB   3  
ATOM 4259  C CG   . LYS A 1 30  ? 0.382   0.903   5.977   1.00 0.00 ? 30  LYS A CG   3  
ATOM 4260  C CD   . LYS A 1 30  ? -0.750  1.208   5.010   1.00 0.00 ? 30  LYS A CD   3  
ATOM 4261  C CE   . LYS A 1 30  ? -1.201  2.656   5.120   1.00 0.00 ? 30  LYS A CE   3  
ATOM 4262  N NZ   . LYS A 1 30  ? -1.824  2.944   6.442   1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4263  H H    . LYS A 1 30  ? 1.062   -2.901  7.424   1.00 0.00 ? 30  LYS A H    3  
ATOM 4264  H HA   . LYS A 1 30  ? 2.589   -0.779  6.100   1.00 0.00 ? 30  LYS A HA   3  
ATOM 4265  H HB2  . LYS A 1 30  ? 0.259   -1.130  5.379   1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4266  H HB3  . LYS A 1 30  ? -0.292  -0.818  7.020   1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4267  H HG2  . LYS A 1 30  ? 0.213   1.444   6.895   1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4268  H HG3  . LYS A 1 30  ? 1.316   1.222   5.536   1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4269  H HD2  . LYS A 1 30  ? -0.410  1.024   4.002   1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4270  H HD3  . LYS A 1 30  ? -1.586  0.561   5.234   1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4271  H HE2  . LYS A 1 30  ? -0.344  3.298   4.988   1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4272  H HE3  . LYS A 1 30  ? -1.923  2.854   4.341   1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4273  H HZ1  . LYS A 1 30  ? -1.114  2.864   7.197   1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4274  H HZ2  . LYS A 1 30  ? -2.592  2.268   6.630   1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4275  H HZ3  . LYS A 1 30  ? -2.216  3.907   6.450   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4276  N N    . GLN A 1 31  ? 3.320   0.322   8.192   1.00 0.00 ? 31  GLN A N    3  
ATOM 4277  C CA   . GLN A 1 31  ? 3.733   1.065   9.376   1.00 0.00 ? 31  GLN A CA   3  
ATOM 4278  C C    . GLN A 1 31  ? 2.734   2.170   9.701   1.00 0.00 ? 31  GLN A C    3  
ATOM 4279  O O    . GLN A 1 31  ? 2.355   2.953   8.831   1.00 0.00 ? 31  GLN A O    3  
ATOM 4280  C CB   . GLN A 1 31  ? 5.125   1.665   9.168   1.00 0.00 ? 31  GLN A CB   3  
ATOM 4281  C CG   . GLN A 1 31  ? 5.916   1.827   10.456  1.00 0.00 ? 31  GLN A CG   3  
ATOM 4282  C CD   . GLN A 1 31  ? 6.992   2.890   10.350  1.00 0.00 ? 31  GLN A CD   3  
ATOM 4283  O OE1  . GLN A 1 31  ? 6.954   3.900   11.054  1.00 0.00 ? 31  GLN A OE1  3  
ATOM 4284  N NE2  . GLN A 1 31  ? 7.958   2.669   9.467   1.00 0.00 ? 31  GLN A NE2  3  
ATOM 4285  H H    . GLN A 1 31  ? 3.930   0.262   7.428   1.00 0.00 ? 31  GLN A H    3  
ATOM 4286  H HA   . GLN A 1 31  ? 3.769   0.374   10.205  1.00 0.00 ? 31  GLN A HA   3  
ATOM 4287  H HB2  . GLN A 1 31  ? 5.685   1.023   8.505   1.00 0.00 ? 31  GLN A HB2  3  
ATOM 4288  H HB3  . GLN A 1 31  ? 5.020   2.638   8.711   1.00 0.00 ? 31  GLN A HB3  3  
ATOM 4289  H HG2  . GLN A 1 31  ? 5.237   2.102   11.249  1.00 0.00 ? 31  GLN A HG2  3  
ATOM 4290  H HG3  . GLN A 1 31  ? 6.385   0.884   10.696  1.00 0.00 ? 31  GLN A HG3  3  
ATOM 4291  H HE21 . GLN A 1 31  ? 7.923   1.844   8.939   1.00 0.00 ? 31  GLN A HE21 3  
ATOM 4292  H HE22 . GLN A 1 31  ? 8.666   3.340   9.377   1.00 0.00 ? 31  GLN A HE22 3  
ATOM 4293  N N    . ALA A 1 32  ? 2.311   2.227   10.960  1.00 0.00 ? 32  ALA A N    3  
ATOM 4294  C CA   . ALA A 1 32  ? 1.356   3.237   11.400  1.00 0.00 ? 32  ALA A CA   3  
ATOM 4295  C C    . ALA A 1 32  ? 2.025   4.601   11.538  1.00 0.00 ? 32  ALA A C    3  
ATOM 4296  O O    . ALA A 1 32  ? 3.217   4.692   11.830  1.00 0.00 ? 32  ALA A O    3  
ATOM 4297  C CB   . ALA A 1 32  ? 0.721   2.823   12.719  1.00 0.00 ? 32  ALA A CB   3  
ATOM 4298  H H    . ALA A 1 32  ? 2.649   1.575   11.608  1.00 0.00 ? 32  ALA A H    3  
ATOM 4299  H HA   . ALA A 1 32  ? 0.574   3.304   10.657  1.00 0.00 ? 32  ALA A HA   3  
ATOM 4300  H HB1  . ALA A 1 32  ? 1.401   3.039   13.529  1.00 0.00 ? 32  ALA A HB1  3  
ATOM 4301  H HB2  . ALA A 1 32  ? -0.198  3.374   12.863  1.00 0.00 ? 32  ALA A HB2  3  
ATOM 4302  H HB3  . ALA A 1 32  ? 0.508   1.765   12.700  1.00 0.00 ? 32  ALA A HB3  3  
ATOM 4303  N N    . SER A 1 33  ? 1.250   5.659   11.324  1.00 0.00 ? 33  SER A N    3  
ATOM 4304  C CA   . SER A 1 33  ? 1.768   7.019   11.419  1.00 0.00 ? 33  SER A CA   3  
ATOM 4305  C C    . SER A 1 33  ? 1.065   7.791   12.531  1.00 0.00 ? 33  SER A C    3  
ATOM 4306  O O    . SER A 1 33  ? 1.693   8.215   13.501  1.00 0.00 ? 33  SER A O    3  
ATOM 4307  C CB   . SER A 1 33  ? 1.594   7.749   10.086  1.00 0.00 ? 33  SER A CB   3  
ATOM 4308  O OG   . SER A 1 33  ? 1.999   9.102   10.189  1.00 0.00 ? 33  SER A OG   3  
ATOM 4309  H H    . SER A 1 33  ? 0.307   5.522   11.094  1.00 0.00 ? 33  SER A H    3  
ATOM 4310  H HA   . SER A 1 33  ? 2.821   6.956   11.651  1.00 0.00 ? 33  SER A HA   3  
ATOM 4311  H HB2  . SER A 1 33  ? 2.193   7.262   9.332   1.00 0.00 ? 33  SER A HB2  3  
ATOM 4312  H HB3  . SER A 1 33  ? 0.554   7.718   9.796   1.00 0.00 ? 33  SER A HB3  3  
ATOM 4313  H HG   . SER A 1 33  ? 2.486   9.352   9.400   1.00 0.00 ? 33  SER A HG   3  
ATOM 4314  N N    . SER A 1 34  ? -0.244  7.971   12.382  1.00 0.00 ? 34  SER A N    3  
ATOM 4315  C CA   . SER A 1 34  ? -1.033  8.696   13.371  1.00 0.00 ? 34  SER A CA   3  
ATOM 4316  C C    . SER A 1 34  ? -1.460  7.773   14.508  1.00 0.00 ? 34  SER A C    3  
ATOM 4317  O O    . SER A 1 34  ? -2.564  7.230   14.501  1.00 0.00 ? 34  SER A O    3  
ATOM 4318  C CB   . SER A 1 34  ? -2.267  9.317   12.713  1.00 0.00 ? 34  SER A CB   3  
ATOM 4319  O OG   . SER A 1 34  ? -2.747  10.417  13.466  1.00 0.00 ? 34  SER A OG   3  
ATOM 4320  H H    . SER A 1 34  ? -0.688  7.609   11.587  1.00 0.00 ? 34  SER A H    3  
ATOM 4321  H HA   . SER A 1 34  ? -0.416  9.484   13.775  1.00 0.00 ? 34  SER A HA   3  
ATOM 4322  H HB2  . SER A 1 34  ? -2.010  9.660   11.722  1.00 0.00 ? 34  SER A HB2  3  
ATOM 4323  H HB3  . SER A 1 34  ? -3.048  8.574   12.645  1.00 0.00 ? 34  SER A HB3  3  
ATOM 4324  H HG   . SER A 1 34  ? -2.012  10.848  13.908  1.00 0.00 ? 34  SER A HG   3  
ATOM 4325  N N    . GLY A 1 35  ? -0.575  7.599   15.485  1.00 0.00 ? 35  GLY A N    3  
ATOM 4326  C CA   . GLY A 1 35  ? -0.877  6.742   16.616  1.00 0.00 ? 35  GLY A CA   3  
ATOM 4327  C C    . GLY A 1 35  ? 0.362   6.090   17.197  1.00 0.00 ? 35  GLY A C    3  
ATOM 4328  O O    . GLY A 1 35  ? 1.463   6.632   17.095  1.00 0.00 ? 35  GLY A O    3  
ATOM 4329  H H    . GLY A 1 35  ? 0.290   8.057   15.437  1.00 0.00 ? 35  GLY A H    3  
ATOM 4330  H HA2  . GLY A 1 35  ? -1.354  7.332   17.384  1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4331  H HA3  . GLY A 1 35  ? -1.559  5.968   16.294  1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4332  N N    . VAL A 1 36  ? 0.184   4.924   17.809  1.00 0.00 ? 36  VAL A N    3  
ATOM 4333  C CA   . VAL A 1 36  ? 1.297   4.198   18.409  1.00 0.00 ? 36  VAL A CA   3  
ATOM 4334  C C    . VAL A 1 36  ? 2.231   3.642   17.340  1.00 0.00 ? 36  VAL A C    3  
ATOM 4335  O O    . VAL A 1 36  ? 1.783   3.123   16.317  1.00 0.00 ? 36  VAL A O    3  
ATOM 4336  C CB   . VAL A 1 36  ? 0.799   3.039   19.294  1.00 0.00 ? 36  VAL A CB   3  
ATOM 4337  C CG1  . VAL A 1 36  ? -0.054  2.076   18.482  1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4338  C CG2  . VAL A 1 36  ? 1.974   2.315   19.933  1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4339  H H    . VAL A 1 36  ? -0.717  4.542   17.858  1.00 0.00 ? 36  VAL A H    3  
ATOM 4340  H HA   . VAL A 1 36  ? 1.848   4.887   19.032  1.00 0.00 ? 36  VAL A HA   3  
ATOM 4341  H HB   . VAL A 1 36  ? 0.186   3.452   20.081  1.00 0.00 ? 36  VAL A HB   3  
ATOM 4342  H HG11 . VAL A 1 36  ? -0.196  2.472   17.487  1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4343  H HG12 . VAL A 1 36  ? 0.442   1.118   18.422  1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4344  H HG13 . VAL A 1 36  ? -1.014  1.955   18.961  1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4345  H HG21 . VAL A 1 36  ? 1.609   1.618   20.673  1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4346  H HG22 . VAL A 1 36  ? 2.522   1.778   19.173  1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4347  H HG23 . VAL A 1 36  ? 2.626   3.034   20.407  1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4348  N N    . LYS A 1 37  ? 3.532   3.752   17.584  1.00 0.00 ? 37  LYS A N    3  
ATOM 4349  C CA   . LYS A 1 37  ? 4.532   3.259   16.643  1.00 0.00 ? 37  LYS A CA   3  
ATOM 4350  C C    . LYS A 1 37  ? 4.484   1.738   16.547  1.00 0.00 ? 37  LYS A C    3  
ATOM 4351  O O    . LYS A 1 37  ? 5.057   1.036   17.380  1.00 0.00 ? 37  LYS A O    3  
ATOM 4352  C CB   . LYS A 1 37  ? 5.930   3.710   17.071  1.00 0.00 ? 37  LYS A CB   3  
ATOM 4353  C CG   . LYS A 1 37  ? 6.114   5.218   17.056  1.00 0.00 ? 37  LYS A CG   3  
ATOM 4354  C CD   . LYS A 1 37  ? 7.566   5.605   17.282  1.00 0.00 ? 37  LYS A CD   3  
ATOM 4355  C CE   . LYS A 1 37  ? 7.960   5.462   18.744  1.00 0.00 ? 37  LYS A CE   3  
ATOM 4356  N NZ   . LYS A 1 37  ? 7.673   6.700   19.519  1.00 0.00 ? 37  LYS A NZ   3  
ATOM 4357  H H    . LYS A 1 37  ? 3.828   4.175   18.417  1.00 0.00 ? 37  LYS A H    3  
ATOM 4358  H HA   . LYS A 1 37  ? 4.309   3.677   15.673  1.00 0.00 ? 37  LYS A HA   3  
ATOM 4359  H HB2  . LYS A 1 37  ? 6.119   3.355   18.073  1.00 0.00 ? 37  LYS A HB2  3  
ATOM 4360  H HB3  . LYS A 1 37  ? 6.657   3.274   16.400  1.00 0.00 ? 37  LYS A HB3  3  
ATOM 4361  H HG2  . LYS A 1 37  ? 5.795   5.601   16.098  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 4362  H HG3  . LYS A 1 37  ? 5.509   5.653   17.839  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 4363  H HD2  . LYS A 1 37  ? 8.197   4.963   16.686  1.00 0.00 ? 37  LYS A HD2  3  
ATOM 4364  H HD3  . LYS A 1 37  ? 7.706   6.633   16.979  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 4365  H HE2  . LYS A 1 37  ? 7.407   4.641   19.174  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 4366  H HE3  . LYS A 1 37  ? 9.018   5.250   18.798  1.00 0.00 ? 37  LYS A HE3  3  
ATOM 4367  H HZ1  . LYS A 1 37  ? 6.813   7.157   19.157  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 4368  H HZ2  . LYS A 1 37  ? 8.468   7.366   19.436  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 4369  H HZ3  . LYS A 1 37  ? 7.534   6.468   20.524  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 4370  N N    . GLN A 1 38  ? 3.799   1.235   15.524  1.00 0.00 ? 38  GLN A N    3  
ATOM 4371  C CA   . GLN A 1 38  ? 3.679   -0.204  15.320  1.00 0.00 ? 38  GLN A CA   3  
ATOM 4372  C C    . GLN A 1 38  ? 3.235   -0.515  13.894  1.00 0.00 ? 38  GLN A C    3  
ATOM 4373  O O    . GLN A 1 38  ? 2.769   0.366   13.173  1.00 0.00 ? 38  GLN A O    3  
ATOM 4374  C CB   . GLN A 1 38  ? 2.685   -0.800  16.318  1.00 0.00 ? 38  GLN A CB   3  
ATOM 4375  C CG   . GLN A 1 38  ? 1.243   -0.399  16.055  1.00 0.00 ? 38  GLN A CG   3  
ATOM 4376  C CD   . GLN A 1 38  ? 0.248   -1.356  16.681  1.00 0.00 ? 38  GLN A CD   3  
ATOM 4377  O OE1  . GLN A 1 38  ? 0.627   -2.379  17.251  1.00 0.00 ? 38  GLN A OE1  3  
ATOM 4378  N NE2  . GLN A 1 38  ? -1.035  -1.028  16.578  1.00 0.00 ? 38  GLN A NE2  3  
ATOM 4379  H H    . GLN A 1 38  ? 3.365   1.846   14.894  1.00 0.00 ? 38  GLN A H    3  
ATOM 4380  H HA   . GLN A 1 38  ? 4.650   -0.644  15.485  1.00 0.00 ? 38  GLN A HA   3  
ATOM 4381  H HB2  . GLN A 1 38  ? 2.751   -1.877  16.273  1.00 0.00 ? 38  GLN A HB2  3  
ATOM 4382  H HB3  . GLN A 1 38  ? 2.952   -0.473  17.312  1.00 0.00 ? 38  GLN A HB3  3  
ATOM 4383  H HG2  . GLN A 1 38  ? 1.077   0.587   16.464  1.00 0.00 ? 38  GLN A HG2  3  
ATOM 4384  H HG3  . GLN A 1 38  ? 1.078   -0.378  14.988  1.00 0.00 ? 38  GLN A HG3  3  
ATOM 4385  H HE21 . GLN A 1 38  ? -1.263  -0.198  16.108  1.00 0.00 ? 38  GLN A HE21 3  
ATOM 4386  H HE22 . GLN A 1 38  ? -1.700  -1.628  16.972  1.00 0.00 ? 38  GLN A HE22 3  
ATOM 4387  N N    . TRP A 1 39  ? 3.383   -1.773  13.496  1.00 0.00 ? 39  TRP A N    3  
ATOM 4388  C CA   . TRP A 1 39  ? 2.998   -2.201  12.156  1.00 0.00 ? 39  TRP A CA   3  
ATOM 4389  C C    . TRP A 1 39  ? 1.653   -2.920  12.180  1.00 0.00 ? 39  TRP A C    3  
ATOM 4390  O O    . TRP A 1 39  ? 1.415   -3.782  13.024  1.00 0.00 ? 39  TRP A O    3  
ATOM 4391  C CB   . TRP A 1 39  ? 4.069   -3.117  11.563  1.00 0.00 ? 39  TRP A CB   3  
ATOM 4392  C CG   . TRP A 1 39  ? 5.396   -2.443  11.386  1.00 0.00 ? 39  TRP A CG   3  
ATOM 4393  C CD1  . TRP A 1 39  ? 6.299   -2.142  12.366  1.00 0.00 ? 39  TRP A CD1  3  
ATOM 4394  C CD2  . TRP A 1 39  ? 5.968   -1.985  10.156  1.00 0.00 ? 39  TRP A CD2  3  
ATOM 4395  N NE1  . TRP A 1 39  ? 7.397   -1.524  11.818  1.00 0.00 ? 39  TRP A NE1  3  
ATOM 4396  C CE2  . TRP A 1 39  ? 7.219   -1.417  10.465  1.00 0.00 ? 39  TRP A CE2  3  
ATOM 4397  C CE3  . TRP A 1 39  ? 5.545   -2.001  8.824   1.00 0.00 ? 39  TRP A CE3  3  
ATOM 4398  C CZ2  . TRP A 1 39  ? 8.048   -0.870  9.489   1.00 0.00 ? 39  TRP A CZ2  3  
ATOM 4399  C CZ3  . TRP A 1 39  ? 6.369   -1.457  7.858   1.00 0.00 ? 39  TRP A CZ3  3  
ATOM 4400  C CH2  . TRP A 1 39  ? 7.610   -0.899  8.193   1.00 0.00 ? 39  TRP A CH2  3  
ATOM 4401  H H    . TRP A 1 39  ? 3.761   -2.431  14.118  1.00 0.00 ? 39  TRP A H    3  
ATOM 4402  H HA   . TRP A 1 39  ? 2.910   -1.318  11.540  1.00 0.00 ? 39  TRP A HA   3  
ATOM 4403  H HB2  . TRP A 1 39  ? 4.211   -3.966  12.216  1.00 0.00 ? 39  TRP A HB2  3  
ATOM 4404  H HB3  . TRP A 1 39  ? 3.739   -3.464  10.594  1.00 0.00 ? 39  TRP A HB3  3  
ATOM 4405  H HD1  . TRP A 1 39  ? 6.156   -2.362  13.413  1.00 0.00 ? 39  TRP A HD1  3  
ATOM 4406  H HE1  . TRP A 1 39  ? 8.182   -1.213  12.317  1.00 0.00 ? 39  TRP A HE1  3  
ATOM 4407  H HE3  . TRP A 1 39  ? 4.592   -2.427  8.546   1.00 0.00 ? 39  TRP A HE3  3  
ATOM 4408  H HZ2  . TRP A 1 39  ? 9.008   -0.436  9.732   1.00 0.00 ? 39  TRP A HZ2  3  
ATOM 4409  H HZ3  . TRP A 1 39  ? 6.059   -1.460  6.823   1.00 0.00 ? 39  TRP A HZ3  3  
ATOM 4410  H HH2  . TRP A 1 39  ? 8.220   -0.486  7.406   1.00 0.00 ? 39  TRP A HH2  3  
ATOM 4411  N N    . ASN A 1 40  ? 0.778   -2.559  11.247  1.00 0.00 ? 40  ASN A N    3  
ATOM 4412  C CA   . ASN A 1 40  ? -0.544  -3.170  11.162  1.00 0.00 ? 40  ASN A CA   3  
ATOM 4413  C C    . ASN A 1 40  ? -0.644  -4.083  9.944   1.00 0.00 ? 40  ASN A C    3  
ATOM 4414  O O    . ASN A 1 40  ? -0.716  -3.615  8.808   1.00 0.00 ? 40  ASN A O    3  
ATOM 4415  C CB   . ASN A 1 40  ? -1.625  -2.089  11.094  1.00 0.00 ? 40  ASN A CB   3  
ATOM 4416  C CG   . ASN A 1 40  ? -1.638  -1.205  12.326  1.00 0.00 ? 40  ASN A CG   3  
ATOM 4417  O OD1  . ASN A 1 40  ? -2.492  -1.353  13.200  1.00 0.00 ? 40  ASN A OD1  3  
ATOM 4418  N ND2  . ASN A 1 40  ? -0.688  -0.280  12.401  1.00 0.00 ? 40  ASN A ND2  3  
ATOM 4419  H H    . ASN A 1 40  ? 1.025   -1.865  10.601  1.00 0.00 ? 40  ASN A H    3  
ATOM 4420  H HA   . ASN A 1 40  ? -0.694  -3.760  12.054  1.00 0.00 ? 40  ASN A HA   3  
ATOM 4421  H HB2  . ASN A 1 40  ? -1.448  -1.466  10.229  1.00 0.00 ? 40  ASN A HB2  3  
ATOM 4422  H HB3  . ASN A 1 40  ? -2.592  -2.560  11.000  1.00 0.00 ? 40  ASN A HB3  3  
ATOM 4423  H HD21 . ASN A 1 40  ? -0.042  -0.220  11.667  1.00 0.00 ? 40  ASN A HD21 3  
ATOM 4424  H HD22 . ASN A 1 40  ? -0.673  0.304   13.187  1.00 0.00 ? 40  ASN A HD22 3  
ATOM 4425  N N    . LYS A 1 41  ? -0.648  -5.389  10.189  1.00 0.00 ? 41  LYS A N    3  
ATOM 4426  C CA   . LYS A 1 41  ? -0.741  -6.369  9.114   1.00 0.00 ? 41  LYS A CA   3  
ATOM 4427  C C    . LYS A 1 41  ? -2.145  -6.392  8.519   1.00 0.00 ? 41  LYS A C    3  
ATOM 4428  O O    . LYS A 1 41  ? -3.120  -6.669  9.217   1.00 0.00 ? 41  LYS A O    3  
ATOM 4429  C CB   . LYS A 1 41  ? -0.371  -7.761  9.632   1.00 0.00 ? 41  LYS A CB   3  
ATOM 4430  C CG   . LYS A 1 41  ? -0.209  -8.796  8.532   1.00 0.00 ? 41  LYS A CG   3  
ATOM 4431  C CD   . LYS A 1 41  ? -0.456  -10.203 9.050   1.00 0.00 ? 41  LYS A CD   3  
ATOM 4432  C CE   . LYS A 1 41  ? -0.426  -11.225 7.923   1.00 0.00 ? 41  LYS A CE   3  
ATOM 4433  N NZ   . LYS A 1 41  ? -0.405  -12.621 8.441   1.00 0.00 ? 41  LYS A NZ   3  
ATOM 4434  H H    . LYS A 1 41  ? -0.587  -5.701  11.117  1.00 0.00 ? 41  LYS A H    3  
ATOM 4435  H HA   . LYS A 1 41  ? -0.041  -6.084  8.343   1.00 0.00 ? 41  LYS A HA   3  
ATOM 4436  H HB2  . LYS A 1 41  ? 0.560   -7.695  10.175  1.00 0.00 ? 41  LYS A HB2  3  
ATOM 4437  H HB3  . LYS A 1 41  ? -1.147  -8.099  10.304  1.00 0.00 ? 41  LYS A HB3  3  
ATOM 4438  H HG2  . LYS A 1 41  ? -0.917  -8.585  7.744   1.00 0.00 ? 41  LYS A HG2  3  
ATOM 4439  H HG3  . LYS A 1 41  ? 0.796   -8.737  8.140   1.00 0.00 ? 41  LYS A HG3  3  
ATOM 4440  H HD2  . LYS A 1 41  ? 0.311   -10.453 9.767   1.00 0.00 ? 41  LYS A HD2  3  
ATOM 4441  H HD3  . LYS A 1 41  ? -1.424  -10.237 9.529   1.00 0.00 ? 41  LYS A HD3  3  
ATOM 4442  H HE2  . LYS A 1 41  ? -1.303  -11.091 7.310   1.00 0.00 ? 41  LYS A HE2  3  
ATOM 4443  H HE3  . LYS A 1 41  ? 0.459   -11.057 7.327   1.00 0.00 ? 41  LYS A HE3  3  
ATOM 4444  H HZ1  . LYS A 1 41  ? -0.199  -12.621 9.460   1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 4445  H HZ2  . LYS A 1 41  ? 0.328   -13.173 7.950   1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 4446  H HZ3  . LYS A 1 41  ? -1.327  -13.074 8.284   1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 4447  N N    . ARG A 1 42  ? -2.239  -6.102  7.225   1.00 0.00 ? 42  ARG A N    3  
ATOM 4448  C CA   . ARG A 1 42  ? -3.524  -6.090  6.537   1.00 0.00 ? 42  ARG A CA   3  
ATOM 4449  C C    . ARG A 1 42  ? -3.396  -6.679  5.135   1.00 0.00 ? 42  ARG A C    3  
ATOM 4450  O O    . ARG A 1 42  ? -2.301  -6.740  4.575   1.00 0.00 ? 42  ARG A O    3  
ATOM 4451  C CB   . ARG A 1 42  ? -4.069  -4.663  6.454   1.00 0.00 ? 42  ARG A CB   3  
ATOM 4452  C CG   . ARG A 1 42  ? -4.520  -4.104  7.793   1.00 0.00 ? 42  ARG A CG   3  
ATOM 4453  C CD   . ARG A 1 42  ? -5.985  -4.411  8.061   1.00 0.00 ? 42  ARG A CD   3  
ATOM 4454  N NE   . ARG A 1 42  ? -6.266  -4.533  9.489   1.00 0.00 ? 42  ARG A NE   3  
ATOM 4455  C CZ   . ARG A 1 42  ? -6.095  -5.655  10.179  1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4456  N NH1  . ARG A 1 42  ? -5.646  -6.747  9.575   1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4457  N NH2  . ARG A 1 42  ? -6.373  -5.687  11.476  1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4458  H H    . ARG A 1 42  ? -1.426  -5.889  6.722   1.00 0.00 ? 42  ARG A H    3  
ATOM 4459  H HA   . ARG A 1 42  ? -4.212  -6.696  7.108   1.00 0.00 ? 42  ARG A HA   3  
ATOM 4460  H HB2  . ARG A 1 42  ? -3.298  -4.018  6.060   1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4461  H HB3  . ARG A 1 42  ? -4.914  -4.652  5.781   1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4462  H HG2  . ARG A 1 42  ? -3.922  -4.546  8.577   1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4463  H HG3  . ARG A 1 42  ? -4.380  -3.033  7.791   1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4464  H HD2  . ARG A 1 42  ? -6.587  -3.614  7.653   1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4465  H HD3  . ARG A 1 42  ? -6.239  -5.340  7.573   1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4466  H HE   . ARG A 1 42  ? -6.599  -3.738  9.956   1.00 0.00 ? 42  ARG A HE   3  
ATOM 4467  H HH11 . ARG A 1 42  ? -5.434  -6.725  8.598   1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4468  H HH12 . ARG A 1 42  ? -5.517  -7.590  10.097  1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4469  H HH21 . ARG A 1 42  ? -6.712  -4.866  11.935  1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4470  H HH22 . ARG A 1 42  ? -6.244  -6.532  11.994  1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4471  N N    . TRP A 1 43  ? -4.520  -7.113  4.576   1.00 0.00 ? 43  TRP A N    3  
ATOM 4472  C CA   . TRP A 1 43  ? -4.532  -7.698  3.240   1.00 0.00 ? 43  TRP A CA   3  
ATOM 4473  C C    . TRP A 1 43  ? -4.365  -6.622  2.173   1.00 0.00 ? 43  TRP A C    3  
ATOM 4474  O O    . TRP A 1 43  ? -5.207  -5.735  2.034   1.00 0.00 ? 43  TRP A O    3  
ATOM 4475  C CB   . TRP A 1 43  ? -5.836  -8.464  3.009   1.00 0.00 ? 43  TRP A CB   3  
ATOM 4476  C CG   . TRP A 1 43  ? -5.855  -9.229  1.720   1.00 0.00 ? 43  TRP A CG   3  
ATOM 4477  C CD1  . TRP A 1 43  ? -6.792  -9.144  0.730   1.00 0.00 ? 43  TRP A CD1  3  
ATOM 4478  C CD2  . TRP A 1 43  ? -4.894  -10.196 1.283   1.00 0.00 ? 43  TRP A CD2  3  
ATOM 4479  N NE1  . TRP A 1 43  ? -6.471  -10.000 -0.295  1.00 0.00 ? 43  TRP A NE1  3  
ATOM 4480  C CE2  . TRP A 1 43  ? -5.311  -10.656 0.019   1.00 0.00 ? 43  TRP A CE2  3  
ATOM 4481  C CE3  . TRP A 1 43  ? -3.720  -10.716 1.836   1.00 0.00 ? 43  TRP A CE3  3  
ATOM 4482  C CZ2  . TRP A 1 43  ? -4.596  -11.611 -0.698  1.00 0.00 ? 43  TRP A CZ2  3  
ATOM 4483  C CZ3  . TRP A 1 43  ? -3.012  -11.664 1.123   1.00 0.00 ? 43  TRP A CZ3  3  
ATOM 4484  C CH2  . TRP A 1 43  ? -3.451  -12.104 -0.133  1.00 0.00 ? 43  TRP A CH2  3  
ATOM 4485  H H    . TRP A 1 43  ? -5.361  -7.037  5.073   1.00 0.00 ? 43  TRP A H    3  
ATOM 4486  H HA   . TRP A 1 43  ? -3.704  -8.387  3.173   1.00 0.00 ? 43  TRP A HA   3  
ATOM 4487  H HB2  . TRP A 1 43  ? -5.981  -9.167  3.816   1.00 0.00 ? 43  TRP A HB2  3  
ATOM 4488  H HB3  . TRP A 1 43  ? -6.659  -7.763  2.994   1.00 0.00 ? 43  TRP A HB3  3  
ATOM 4489  H HD1  . TRP A 1 43  ? -7.655  -8.496  0.764   1.00 0.00 ? 43  TRP A HD1  3  
ATOM 4490  H HE1  . TRP A 1 43  ? -6.989  -10.119 -1.119  1.00 0.00 ? 43  TRP A HE1  3  
ATOM 4491  H HE3  . TRP A 1 43  ? -3.366  -10.390 2.802   1.00 0.00 ? 43  TRP A HE3  3  
ATOM 4492  H HZ2  . TRP A 1 43  ? -4.921  -11.959 -1.668  1.00 0.00 ? 43  TRP A HZ2  3  
ATOM 4493  H HZ3  . TRP A 1 43  ? -2.103  -12.078 1.534   1.00 0.00 ? 43  TRP A HZ3  3  
ATOM 4494  H HH2  . TRP A 1 43  ? -2.866  -12.846 -0.654  1.00 0.00 ? 43  TRP A HH2  3  
ATOM 4495  N N    . PHE A 1 44  ? -3.272  -6.706  1.421   1.00 0.00 ? 44  PHE A N    3  
ATOM 4496  C CA   . PHE A 1 44  ? -2.994  -5.738  0.366   1.00 0.00 ? 44  PHE A CA   3  
ATOM 4497  C C    . PHE A 1 44  ? -3.336  -6.315  -1.005  1.00 0.00 ? 44  PHE A C    3  
ATOM 4498  O O    . PHE A 1 44  ? -3.048  -7.476  -1.292  1.00 0.00 ? 44  PHE A O    3  
ATOM 4499  C CB   . PHE A 1 44  ? -1.523  -5.320  0.403   1.00 0.00 ? 44  PHE A CB   3  
ATOM 4500  C CG   . PHE A 1 44  ? -1.259  -4.130  1.281   1.00 0.00 ? 44  PHE A CG   3  
ATOM 4501  C CD1  . PHE A 1 44  ? -1.744  -4.090  2.579   1.00 0.00 ? 44  PHE A CD1  3  
ATOM 4502  C CD2  . PHE A 1 44  ? -0.527  -3.053  0.809   1.00 0.00 ? 44  PHE A CD2  3  
ATOM 4503  C CE1  . PHE A 1 44  ? -1.504  -2.995  3.388   1.00 0.00 ? 44  PHE A CE1  3  
ATOM 4504  C CE2  . PHE A 1 44  ? -0.283  -1.957  1.615   1.00 0.00 ? 44  PHE A CE2  3  
ATOM 4505  C CZ   . PHE A 1 44  ? -0.771  -1.928  2.906   1.00 0.00 ? 44  PHE A CZ   3  
ATOM 4506  H H    . PHE A 1 44  ? -2.638  -7.436  1.580   1.00 0.00 ? 44  PHE A H    3  
ATOM 4507  H HA   . PHE A 1 44  ? -3.610  -4.870  0.543   1.00 0.00 ? 44  PHE A HA   3  
ATOM 4508  H HB2  . PHE A 1 44  ? -0.931  -6.143  0.775   1.00 0.00 ? 44  PHE A HB2  3  
ATOM 4509  H HB3  . PHE A 1 44  ? -1.201  -5.074  -0.597  1.00 0.00 ? 44  PHE A HB3  3  
ATOM 4510  H HD1  . PHE A 1 44  ? -2.316  -4.924  2.958   1.00 0.00 ? 44  PHE A HD1  3  
ATOM 4511  H HD2  . PHE A 1 44  ? -0.144  -3.075  -0.201  1.00 0.00 ? 44  PHE A HD2  3  
ATOM 4512  H HE1  . PHE A 1 44  ? -1.887  -2.976  4.398   1.00 0.00 ? 44  PHE A HE1  3  
ATOM 4513  H HE2  . PHE A 1 44  ? 0.290   -1.124  1.234   1.00 0.00 ? 44  PHE A HE2  3  
ATOM 4514  H HZ   . PHE A 1 44  ? -0.583  -1.072  3.537   1.00 0.00 ? 44  PHE A HZ   3  
ATOM 4515  N N    . VAL A 1 45  ? -3.954  -5.493  -1.848  1.00 0.00 ? 45  VAL A N    3  
ATOM 4516  C CA   . VAL A 1 45  ? -4.336  -5.920  -3.189  1.00 0.00 ? 45  VAL A CA   3  
ATOM 4517  C C    . VAL A 1 45  ? -4.077  -4.818  -4.210  1.00 0.00 ? 45  VAL A C    3  
ATOM 4518  O O    . VAL A 1 45  ? -4.497  -3.675  -4.027  1.00 0.00 ? 45  VAL A O    3  
ATOM 4519  C CB   . VAL A 1 45  ? -5.822  -6.321  -3.248  1.00 0.00 ? 45  VAL A CB   3  
ATOM 4520  C CG1  . VAL A 1 45  ? -6.202  -6.755  -4.656  1.00 0.00 ? 45  VAL A CG1  3  
ATOM 4521  C CG2  . VAL A 1 45  ? -6.116  -7.424  -2.243  1.00 0.00 ? 45  VAL A CG2  3  
ATOM 4522  H H    . VAL A 1 45  ? -4.158  -4.579  -1.561  1.00 0.00 ? 45  VAL A H    3  
ATOM 4523  H HA   . VAL A 1 45  ? -3.741  -6.784  -3.446  1.00 0.00 ? 45  VAL A HA   3  
ATOM 4524  H HB   . VAL A 1 45  ? -6.418  -5.458  -2.989  1.00 0.00 ? 45  VAL A HB   3  
ATOM 4525  H HG11 . VAL A 1 45  ? -5.794  -7.736  -4.852  1.00 0.00 ? 45  VAL A HG11 3  
ATOM 4526  H HG12 . VAL A 1 45  ? -7.278  -6.787  -4.745  1.00 0.00 ? 45  VAL A HG12 3  
ATOM 4527  H HG13 . VAL A 1 45  ? -5.802  -6.050  -5.370  1.00 0.00 ? 45  VAL A HG13 3  
ATOM 4528  H HG21 . VAL A 1 45  ? -5.188  -7.847  -1.890  1.00 0.00 ? 45  VAL A HG21 3  
ATOM 4529  H HG22 . VAL A 1 45  ? -6.666  -7.014  -1.409  1.00 0.00 ? 45  VAL A HG22 3  
ATOM 4530  H HG23 . VAL A 1 45  ? -6.706  -8.196  -2.717  1.00 0.00 ? 45  VAL A HG23 3  
ATOM 4531  N N    . LEU A 1 46  ? -3.384  -5.170  -5.288  1.00 0.00 ? 46  LEU A N    3  
ATOM 4532  C CA   . LEU A 1 46  ? -3.069  -4.211  -6.341  1.00 0.00 ? 46  LEU A CA   3  
ATOM 4533  C C    . LEU A 1 46  ? -3.967  -4.422  -7.556  1.00 0.00 ? 46  LEU A C    3  
ATOM 4534  O O    . LEU A 1 46  ? -3.889  -5.451  -8.227  1.00 0.00 ? 46  LEU A O    3  
ATOM 4535  C CB   . LEU A 1 46  ? -1.600  -4.337  -6.750  1.00 0.00 ? 46  LEU A CB   3  
ATOM 4536  C CG   . LEU A 1 46  ? -1.072  -3.258  -7.697  1.00 0.00 ? 46  LEU A CG   3  
ATOM 4537  C CD1  . LEU A 1 46  ? -0.858  -1.951  -6.950  1.00 0.00 ? 46  LEU A CD1  3  
ATOM 4538  C CD2  . LEU A 1 46  ? 0.220   -3.715  -8.357  1.00 0.00 ? 46  LEU A CD2  3  
ATOM 4539  H H    . LEU A 1 46  ? -3.077  -6.095  -5.378  1.00 0.00 ? 46  LEU A H    3  
ATOM 4540  H HA   . LEU A 1 46  ? -3.241  -3.219  -5.949  1.00 0.00 ? 46  LEU A HA   3  
ATOM 4541  H HB2  . LEU A 1 46  ? -1.003  -4.308  -5.851  1.00 0.00 ? 46  LEU A HB2  3  
ATOM 4542  H HB3  . LEU A 1 46  ? -1.474  -5.295  -7.234  1.00 0.00 ? 46  LEU A HB3  3  
ATOM 4543  H HG   . LEU A 1 46  ? -1.802  -3.082  -8.475  1.00 0.00 ? 46  LEU A HG   3  
ATOM 4544  H HD11 . LEU A 1 46  ? 0.019   -2.032  -6.326  1.00 0.00 ? 46  LEU A HD11 3  
ATOM 4545  H HD12 . LEU A 1 46  ? -1.721  -1.743  -6.334  1.00 0.00 ? 46  LEU A HD12 3  
ATOM 4546  H HD13 . LEU A 1 46  ? -0.722  -1.149  -7.661  1.00 0.00 ? 46  LEU A HD13 3  
ATOM 4547  H HD21 . LEU A 1 46  ? 1.062   -3.273  -7.845  1.00 0.00 ? 46  LEU A HD21 3  
ATOM 4548  H HD22 . LEU A 1 46  ? 0.225   -3.405  -9.391  1.00 0.00 ? 46  LEU A HD22 3  
ATOM 4549  H HD23 . LEU A 1 46  ? 0.291   -4.792  -8.304  1.00 0.00 ? 46  LEU A HD23 3  
ATOM 4550  N N    . VAL A 1 47  ? -4.817  -3.439  -7.834  1.00 0.00 ? 47  VAL A N    3  
ATOM 4551  C CA   . VAL A 1 47  ? -5.728  -3.515  -8.971  1.00 0.00 ? 47  VAL A CA   3  
ATOM 4552  C C    . VAL A 1 47  ? -5.858  -2.162  -9.662  1.00 0.00 ? 47  VAL A C    3  
ATOM 4553  O O    . VAL A 1 47  ? -6.057  -1.137  -9.010  1.00 0.00 ? 47  VAL A O    3  
ATOM 4554  C CB   . VAL A 1 47  ? -7.126  -3.995  -8.539  1.00 0.00 ? 47  VAL A CB   3  
ATOM 4555  C CG1  . VAL A 1 47  ? -8.156  -3.673  -9.610  1.00 0.00 ? 47  VAL A CG1  3  
ATOM 4556  C CG2  . VAL A 1 47  ? -7.107  -5.486  -8.237  1.00 0.00 ? 47  VAL A CG2  3  
ATOM 4557  H H    . VAL A 1 47  ? -4.833  -2.643  -7.262  1.00 0.00 ? 47  VAL A H    3  
ATOM 4558  H HA   . VAL A 1 47  ? -5.326  -4.230  -9.674  1.00 0.00 ? 47  VAL A HA   3  
ATOM 4559  H HB   . VAL A 1 47  ? -7.402  -3.470  -7.636  1.00 0.00 ? 47  VAL A HB   3  
ATOM 4560  H HG11 . VAL A 1 47  ? -8.796  -4.529  -9.763  1.00 0.00 ? 47  VAL A HG11 3  
ATOM 4561  H HG12 . VAL A 1 47  ? -8.752  -2.829  -9.295  1.00 0.00 ? 47  VAL A HG12 3  
ATOM 4562  H HG13 . VAL A 1 47  ? -7.651  -3.432  -10.534 1.00 0.00 ? 47  VAL A HG13 3  
ATOM 4563  H HG21 . VAL A 1 47  ? -7.628  -5.673  -7.310  1.00 0.00 ? 47  VAL A HG21 3  
ATOM 4564  H HG22 . VAL A 1 47  ? -7.595  -6.021  -9.038  1.00 0.00 ? 47  VAL A HG22 3  
ATOM 4565  H HG23 . VAL A 1 47  ? -6.084  -5.823  -8.149  1.00 0.00 ? 47  VAL A HG23 3  
ATOM 4566  N N    . ASP A 1 48  ? -5.745  -2.168  -10.986 1.00 0.00 ? 48  ASP A N    3  
ATOM 4567  C CA   . ASP A 1 48  ? -5.852  -0.941  -11.767 1.00 0.00 ? 48  ASP A CA   3  
ATOM 4568  C C    . ASP A 1 48  ? -4.730  0.029   -11.411 1.00 0.00 ? 48  ASP A C    3  
ATOM 4569  O O    . ASP A 1 48  ? -4.980  1.188   -11.079 1.00 0.00 ? 48  ASP A O    3  
ATOM 4570  C CB   . ASP A 1 48  ? -7.210  -0.278  -11.532 1.00 0.00 ? 48  ASP A CB   3  
ATOM 4571  C CG   . ASP A 1 48  ? -7.661  0.553   -12.717 1.00 0.00 ? 48  ASP A CG   3  
ATOM 4572  O OD1  . ASP A 1 48  ? -7.552  0.063   -13.860 1.00 0.00 ? 48  ASP A OD1  3  
ATOM 4573  O OD2  . ASP A 1 48  ? -8.124  1.693   -12.501 1.00 0.00 ? 48  ASP A OD2  3  
ATOM 4574  H H    . ASP A 1 48  ? -5.587  -3.017  -11.449 1.00 0.00 ? 48  ASP A H    3  
ATOM 4575  H HA   . ASP A 1 48  ? -5.766  -1.204  -12.810 1.00 0.00 ? 48  ASP A HA   3  
ATOM 4576  H HB2  . ASP A 1 48  ? -7.950  -1.043  -11.350 1.00 0.00 ? 48  ASP A HB2  3  
ATOM 4577  H HB3  . ASP A 1 48  ? -7.144  0.366   -10.668 1.00 0.00 ? 48  ASP A HB3  3  
ATOM 4578  N N    . ARG A 1 49  ? -3.493  -0.452  -11.481 1.00 0.00 ? 49  ARG A N    3  
ATOM 4579  C CA   . ARG A 1 49  ? -2.333  0.372   -11.164 1.00 0.00 ? 49  ARG A CA   3  
ATOM 4580  C C    . ARG A 1 49  ? -2.548  1.135   -9.861  1.00 0.00 ? 49  ARG A C    3  
ATOM 4581  O O    . ARG A 1 49  ? -2.008  2.226   -9.672  1.00 0.00 ? 49  ARG A O    3  
ATOM 4582  C CB   . ARG A 1 49  ? -2.052  1.354   -12.303 1.00 0.00 ? 49  ARG A CB   3  
ATOM 4583  C CG   . ARG A 1 49  ? -1.195  0.769   -13.414 1.00 0.00 ? 49  ARG A CG   3  
ATOM 4584  C CD   . ARG A 1 49  ? -0.800  1.830   -14.429 1.00 0.00 ? 49  ARG A CD   3  
ATOM 4585  N NE   . ARG A 1 49  ? -1.871  2.097   -15.386 1.00 0.00 ? 49  ARG A NE   3  
ATOM 4586  C CZ   . ARG A 1 49  ? -1.682  2.716   -16.546 1.00 0.00 ? 49  ARG A CZ   3  
ATOM 4587  N NH1  . ARG A 1 49  ? -0.471  3.130   -16.891 1.00 0.00 ? 49  ARG A NH1  3  
ATOM 4588  N NH2  . ARG A 1 49  ? -2.707  2.922   -17.364 1.00 0.00 ? 49  ARG A NH2  3  
ATOM 4589  H H    . ARG A 1 49  ? -3.358  -1.385  -11.752 1.00 0.00 ? 49  ARG A H    3  
ATOM 4590  H HA   . ARG A 1 49  ? -1.483  -0.283  -11.048 1.00 0.00 ? 49  ARG A HA   3  
ATOM 4591  H HB2  . ARG A 1 49  ? -2.992  1.669   -12.732 1.00 0.00 ? 49  ARG A HB2  3  
ATOM 4592  H HB3  . ARG A 1 49  ? -1.542  2.216   -11.900 1.00 0.00 ? 49  ARG A HB3  3  
ATOM 4593  H HG2  . ARG A 1 49  ? -0.298  0.350   -12.981 1.00 0.00 ? 49  ARG A HG2  3  
ATOM 4594  H HG3  . ARG A 1 49  ? -1.752  -0.007  -13.915 1.00 0.00 ? 49  ARG A HG3  3  
ATOM 4595  H HD2  . ARG A 1 49  ? -0.565  2.743   -13.904 1.00 0.00 ? 49  ARG A HD2  3  
ATOM 4596  H HD3  . ARG A 1 49  ? 0.073   1.489   -14.966 1.00 0.00 ? 49  ARG A HD3  3  
ATOM 4597  H HE   . ARG A 1 49  ? -2.774  1.799   -15.151 1.00 0.00 ? 49  ARG A HE   3  
ATOM 4598  H HH11 . ARG A 1 49  ? 0.303   2.975   -16.278 1.00 0.00 ? 49  ARG A HH11 3  
ATOM 4599  H HH12 . ARG A 1 49  ? -0.332  3.595   -17.766 1.00 0.00 ? 49  ARG A HH12 3  
ATOM 4600  H HH21 . ARG A 1 49  ? -3.622  2.611   -17.107 1.00 0.00 ? 49  ARG A HH21 3  
ATOM 4601  H HH22 . ARG A 1 49  ? -2.564  3.388   -18.236 1.00 0.00 ? 49  ARG A HH22 3  
ATOM 4602  N N    . CYS A 1 50  ? -3.341  0.556   -8.966  1.00 0.00 ? 50  CYS A N    3  
ATOM 4603  C CA   . CYS A 1 50  ? -3.629  1.183   -7.681  1.00 0.00 ? 50  CYS A CA   3  
ATOM 4604  C C    . CYS A 1 50  ? -3.548  0.164   -6.549  1.00 0.00 ? 50  CYS A C    3  
ATOM 4605  O O    . CYS A 1 50  ? -3.763  -1.031  -6.758  1.00 0.00 ? 50  CYS A O    3  
ATOM 4606  C CB   . CYS A 1 50  ? -5.016  1.828   -7.704  1.00 0.00 ? 50  CYS A CB   3  
ATOM 4607  S SG   . CYS A 1 50  ? -5.234  3.153   -6.494  1.00 0.00 ? 50  CYS A SG   3  
ATOM 4608  H H    . CYS A 1 50  ? -3.743  -0.313  -9.174  1.00 0.00 ? 50  CYS A H    3  
ATOM 4609  H HA   . CYS A 1 50  ? -2.888  1.949   -7.513  1.00 0.00 ? 50  CYS A HA   3  
ATOM 4610  H HB2  . CYS A 1 50  ? -5.194  2.246   -8.684  1.00 0.00 ? 50  CYS A HB2  3  
ATOM 4611  H HB3  . CYS A 1 50  ? -5.760  1.072   -7.503  1.00 0.00 ? 50  CYS A HB3  3  
ATOM 4612  H HG   . CYS A 1 50  ? -4.077  3.335   -5.875  1.00 0.00 ? 50  CYS A HG   3  
ATOM 4613  N N    . LEU A 1 51  ? -3.234  0.643   -5.350  1.00 0.00 ? 51  LEU A N    3  
ATOM 4614  C CA   . LEU A 1 51  ? -3.122  -0.226  -4.184  1.00 0.00 ? 51  LEU A CA   3  
ATOM 4615  C C    . LEU A 1 51  ? -4.391  -0.170  -3.339  1.00 0.00 ? 51  LEU A C    3  
ATOM 4616  O O    . LEU A 1 51  ? -4.955  0.902   -3.118  1.00 0.00 ? 51  LEU A O    3  
ATOM 4617  C CB   . LEU A 1 51  ? -1.914  0.176   -3.338  1.00 0.00 ? 51  LEU A CB   3  
ATOM 4618  C CG   . LEU A 1 51  ? -1.272  -0.939  -2.511  1.00 0.00 ? 51  LEU A CG   3  
ATOM 4619  C CD1  . LEU A 1 51  ? 0.211   -0.669  -2.310  1.00 0.00 ? 51  LEU A CD1  3  
ATOM 4620  C CD2  . LEU A 1 51  ? -1.976  -1.082  -1.170  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 4621  H H    . LEU A 1 51  ? -3.074  1.604   -5.246  1.00 0.00 ? 51  LEU A H    3  
ATOM 4622  H HA   . LEU A 1 51  ? -2.984  -1.238  -4.537  1.00 0.00 ? 51  LEU A HA   3  
ATOM 4623  H HB2  . LEU A 1 51  ? -1.160  0.570   -4.003  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 4624  H HB3  . LEU A 1 51  ? -2.231  0.953   -2.657  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 4625  H HG   . LEU A 1 51  ? -1.370  -1.875  -3.044  1.00 0.00 ? 51  LEU A HG   3  
ATOM 4626  H HD11 . LEU A 1 51  ? 0.433   0.349   -2.594  1.00 0.00 ? 51  LEU A HD11 3  
ATOM 4627  H HD12 . LEU A 1 51  ? 0.787   -1.347  -2.923  1.00 0.00 ? 51  LEU A HD12 3  
ATOM 4628  H HD13 . LEU A 1 51  ? 0.467   -0.818  -1.271  1.00 0.00 ? 51  LEU A HD13 3  
ATOM 4629  H HD21 . LEU A 1 51  ? -2.919  -0.557  -1.201  1.00 0.00 ? 51  LEU A HD21 3  
ATOM 4630  H HD22 . LEU A 1 51  ? -1.356  -0.664  -0.392  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 4631  H HD23 . LEU A 1 51  ? -2.152  -2.129  -0.966  1.00 0.00 ? 51  LEU A HD23 3  
ATOM 4632  N N    . PHE A 1 52  ? -4.834  -1.331  -2.867  1.00 0.00 ? 52  PHE A N    3  
ATOM 4633  C CA   . PHE A 1 52  ? -6.035  -1.413  -2.045  1.00 0.00 ? 52  PHE A CA   3  
ATOM 4634  C C    . PHE A 1 52  ? -5.839  -2.394  -0.892  1.00 0.00 ? 52  PHE A C    3  
ATOM 4635  O O    . PHE A 1 52  ? -5.593  -3.581  -1.108  1.00 0.00 ? 52  PHE A O    3  
ATOM 4636  C CB   . PHE A 1 52  ? -7.233  -1.842  -2.896  1.00 0.00 ? 52  PHE A CB   3  
ATOM 4637  C CG   . PHE A 1 52  ? -7.478  -0.949  -4.078  1.00 0.00 ? 52  PHE A CG   3  
ATOM 4638  C CD1  . PHE A 1 52  ? -7.707  0.407   -3.904  1.00 0.00 ? 52  PHE A CD1  3  
ATOM 4639  C CD2  . PHE A 1 52  ? -7.480  -1.464  -5.364  1.00 0.00 ? 52  PHE A CD2  3  
ATOM 4640  C CE1  . PHE A 1 52  ? -7.933  1.232   -4.990  1.00 0.00 ? 52  PHE A CE1  3  
ATOM 4641  C CE2  . PHE A 1 52  ? -7.705  -0.645  -6.454  1.00 0.00 ? 52  PHE A CE2  3  
ATOM 4642  C CZ   . PHE A 1 52  ? -7.933  0.705   -6.266  1.00 0.00 ? 52  PHE A CZ   3  
ATOM 4643  H H    . PHE A 1 52  ? -4.341  -2.152  -3.078  1.00 0.00 ? 52  PHE A H    3  
ATOM 4644  H HA   . PHE A 1 52  ? -6.226  -0.432  -1.638  1.00 0.00 ? 52  PHE A HA   3  
ATOM 4645  H HB2  . PHE A 1 52  ? -7.063  -2.842  -3.265  1.00 0.00 ? 52  PHE A HB2  3  
ATOM 4646  H HB3  . PHE A 1 52  ? -8.121  -1.834  -2.283  1.00 0.00 ? 52  PHE A HB3  3  
ATOM 4647  H HD1  . PHE A 1 52  ? -7.708  0.820   -2.905  1.00 0.00 ? 52  PHE A HD1  3  
ATOM 4648  H HD2  . PHE A 1 52  ? -7.303  -2.520  -5.512  1.00 0.00 ? 52  PHE A HD2  3  
ATOM 4649  H HE1  . PHE A 1 52  ? -8.111  2.286   -4.839  1.00 0.00 ? 52  PHE A HE1  3  
ATOM 4650  H HE2  . PHE A 1 52  ? -7.704  -1.059  -7.451  1.00 0.00 ? 52  PHE A HE2  3  
ATOM 4651  H HZ   . PHE A 1 52  ? -8.108  1.347   -7.116  1.00 0.00 ? 52  PHE A HZ   3  
ATOM 4652  N N    . TYR A 1 53  ? -5.949  -1.889  0.331   1.00 0.00 ? 53  TYR A N    3  
ATOM 4653  C CA   . TYR A 1 53  ? -5.781  -2.719  1.518   1.00 0.00 ? 53  TYR A CA   3  
ATOM 4654  C C    . TYR A 1 53  ? -7.122  -2.972  2.200   1.00 0.00 ? 53  TYR A C    3  
ATOM 4655  O O    . TYR A 1 53  ? -7.841  -2.035  2.550   1.00 0.00 ? 53  TYR A O    3  
ATOM 4656  C CB   . TYR A 1 53  ? -4.816  -2.052  2.500   1.00 0.00 ? 53  TYR A CB   3  
ATOM 4657  C CG   . TYR A 1 53  ? -5.438  -0.921  3.287   1.00 0.00 ? 53  TYR A CG   3  
ATOM 4658  C CD1  . TYR A 1 53  ? -6.091  -1.163  4.489   1.00 0.00 ? 53  TYR A CD1  3  
ATOM 4659  C CD2  . TYR A 1 53  ? -5.373  0.389   2.829   1.00 0.00 ? 53  TYR A CD2  3  
ATOM 4660  C CE1  . TYR A 1 53  ? -6.662  -0.133  5.212   1.00 0.00 ? 53  TYR A CE1  3  
ATOM 4661  C CE2  . TYR A 1 53  ? -5.940  1.425   3.546   1.00 0.00 ? 53  TYR A CE2  3  
ATOM 4662  C CZ   . TYR A 1 53  ? -6.583  1.159   4.736   1.00 0.00 ? 53  TYR A CZ   3  
ATOM 4663  O OH   . TYR A 1 53  ? -7.150  2.189   5.453   1.00 0.00 ? 53  TYR A OH   3  
ATOM 4664  H H    . TYR A 1 53  ? -6.147  -0.935  0.439   1.00 0.00 ? 53  TYR A H    3  
ATOM 4665  H HA   . TYR A 1 53  ? -5.365  -3.665  1.206   1.00 0.00 ? 53  TYR A HA   3  
ATOM 4666  H HB2  . TYR A 1 53  ? -4.462  -2.789  3.203   1.00 0.00 ? 53  TYR A HB2  3  
ATOM 4667  H HB3  . TYR A 1 53  ? -3.975  -1.652  1.951   1.00 0.00 ? 53  TYR A HB3  3  
ATOM 4668  H HD1  . TYR A 1 53  ? -6.152  -2.176  4.859   1.00 0.00 ? 53  TYR A HD1  3  
ATOM 4669  H HD2  . TYR A 1 53  ? -4.869  0.594   1.895   1.00 0.00 ? 53  TYR A HD2  3  
ATOM 4670  H HE1  . TYR A 1 53  ? -7.166  -0.340  6.145   1.00 0.00 ? 53  TYR A HE1  3  
ATOM 4671  H HE2  . TYR A 1 53  ? -5.878  2.437   3.173   1.00 0.00 ? 53  TYR A HE2  3  
ATOM 4672  H HH   . TYR A 1 53  ? -7.322  2.929   4.866   1.00 0.00 ? 53  TYR A HH   3  
ATOM 4673  N N    . TYR A 1 54  ? -7.453  -4.245  2.385   1.00 0.00 ? 54  TYR A N    3  
ATOM 4674  C CA   . TYR A 1 54  ? -8.708  -4.624  3.023   1.00 0.00 ? 54  TYR A CA   3  
ATOM 4675  C C    . TYR A 1 54  ? -8.472  -5.088  4.458   1.00 0.00 ? 54  TYR A C    3  
ATOM 4676  O O    . TYR A 1 54  ? -7.354  -5.443  4.832   1.00 0.00 ? 54  TYR A O    3  
ATOM 4677  C CB   . TYR A 1 54  ? -9.396  -5.732  2.224   1.00 0.00 ? 54  TYR A CB   3  
ATOM 4678  C CG   . TYR A 1 54  ? -9.707  -5.345  0.796   1.00 0.00 ? 54  TYR A CG   3  
ATOM 4679  C CD1  . TYR A 1 54  ? -8.750  -5.473  -0.203  1.00 0.00 ? 54  TYR A CD1  3  
ATOM 4680  C CD2  . TYR A 1 54  ? -10.957 -4.850  0.446   1.00 0.00 ? 54  TYR A CD2  3  
ATOM 4681  C CE1  . TYR A 1 54  ? -9.028  -5.120  -1.509  1.00 0.00 ? 54  TYR A CE1  3  
ATOM 4682  C CE2  . TYR A 1 54  ? -11.245 -4.496  -0.858  1.00 0.00 ? 54  TYR A CE2  3  
ATOM 4683  C CZ   . TYR A 1 54  ? -10.278 -4.633  -1.832  1.00 0.00 ? 54  TYR A CZ   3  
ATOM 4684  O OH   . TYR A 1 54  ? -10.560 -4.280  -3.131  1.00 0.00 ? 54  TYR A OH   3  
ATOM 4685  H H    . TYR A 1 54  ? -6.839  -4.947  2.085   1.00 0.00 ? 54  TYR A H    3  
ATOM 4686  H HA   . TYR A 1 54  ? -9.348  -3.754  3.039   1.00 0.00 ? 54  TYR A HA   3  
ATOM 4687  H HB2  . TYR A 1 54  ? -8.756  -6.600  2.200   1.00 0.00 ? 54  TYR A HB2  3  
ATOM 4688  H HB3  . TYR A 1 54  ? -10.327 -5.990  2.708   1.00 0.00 ? 54  TYR A HB3  3  
ATOM 4689  H HD1  . TYR A 1 54  ? -7.772  -5.856  0.053   1.00 0.00 ? 54  TYR A HD1  3  
ATOM 4690  H HD2  . TYR A 1 54  ? -11.712 -4.744  1.211   1.00 0.00 ? 54  TYR A HD2  3  
ATOM 4691  H HE1  . TYR A 1 54  ? -8.271  -5.227  -2.272  1.00 0.00 ? 54  TYR A HE1  3  
ATOM 4692  H HE2  . TYR A 1 54  ? -12.223 -4.114  -1.111  1.00 0.00 ? 54  TYR A HE2  3  
ATOM 4693  H HH   . TYR A 1 54  ? -11.418 -3.849  -3.167  1.00 0.00 ? 54  TYR A HH   3  
ATOM 4694  N N    . LYS A 1 55  ? -9.533  -5.082  5.256   1.00 0.00 ? 55  LYS A N    3  
ATOM 4695  C CA   . LYS A 1 55  ? -9.445  -5.503  6.650   1.00 0.00 ? 55  LYS A CA   3  
ATOM 4696  C C    . LYS A 1 55  ? -8.932  -6.936  6.754   1.00 0.00 ? 55  LYS A C    3  
ATOM 4697  O O    . LYS A 1 55  ? -8.148  -7.261  7.645   1.00 0.00 ? 55  LYS A O    3  
ATOM 4698  C CB   . LYS A 1 55  ? -10.814 -5.390  7.325   1.00 0.00 ? 55  LYS A CB   3  
ATOM 4699  C CG   . LYS A 1 55  ? -11.888 -6.241  6.670   1.00 0.00 ? 55  LYS A CG   3  
ATOM 4700  C CD   . LYS A 1 55  ? -13.275 -5.669  6.909   1.00 0.00 ? 55  LYS A CD   3  
ATOM 4701  C CE   . LYS A 1 55  ? -14.351 -6.734  6.754   1.00 0.00 ? 55  LYS A CE   3  
ATOM 4702  N NZ   . LYS A 1 55  ? -15.717 -6.175  6.956   1.00 0.00 ? 55  LYS A NZ   3  
ATOM 4703  H H    . LYS A 1 55  ? -10.398 -4.788  4.900   1.00 0.00 ? 55  LYS A H    3  
ATOM 4704  H HA   . LYS A 1 55  ? -8.751  -4.847  7.151   1.00 0.00 ? 55  LYS A HA   3  
ATOM 4705  H HB2  . LYS A 1 55  ? -10.719 -5.697  8.356   1.00 0.00 ? 55  LYS A HB2  3  
ATOM 4706  H HB3  . LYS A 1 55  ? -11.133 -4.358  7.294   1.00 0.00 ? 55  LYS A HB3  3  
ATOM 4707  H HG2  . LYS A 1 55  ? -11.705 -6.281  5.607   1.00 0.00 ? 55  LYS A HG2  3  
ATOM 4708  H HG3  . LYS A 1 55  ? -11.844 -7.240  7.083   1.00 0.00 ? 55  LYS A HG3  3  
ATOM 4709  H HD2  . LYS A 1 55  ? -13.323 -5.269  7.911   1.00 0.00 ? 55  LYS A HD2  3  
ATOM 4710  H HD3  . LYS A 1 55  ? -13.457 -4.879  6.194   1.00 0.00 ? 55  LYS A HD3  3  
ATOM 4711  H HE2  . LYS A 1 55  ? -14.285 -7.151  5.761   1.00 0.00 ? 55  LYS A HE2  3  
ATOM 4712  H HE3  . LYS A 1 55  ? -14.177 -7.511  7.484   1.00 0.00 ? 55  LYS A HE3  3  
ATOM 4713  H HZ1  . LYS A 1 55  ? -16.429 -6.926  6.852   1.00 0.00 ? 55  LYS A HZ1  3  
ATOM 4714  H HZ2  . LYS A 1 55  ? -15.906 -5.433  6.253   1.00 0.00 ? 55  LYS A HZ2  3  
ATOM 4715  H HZ3  . LYS A 1 55  ? -15.798 -5.764  7.908   1.00 0.00 ? 55  LYS A HZ3  3  
ATOM 4716  N N    . ASP A 1 56  ? -9.378  -7.787  5.837   1.00 0.00 ? 56  ASP A N    3  
ATOM 4717  C CA   . ASP A 1 56  ? -8.962  -9.184  5.824   1.00 0.00 ? 56  ASP A CA   3  
ATOM 4718  C C    . ASP A 1 56  ? -8.970  -9.741  4.403   1.00 0.00 ? 56  ASP A C    3  
ATOM 4719  O O    . ASP A 1 56  ? -9.322  -9.041  3.455   1.00 0.00 ? 56  ASP A O    3  
ATOM 4720  C CB   . ASP A 1 56  ? -9.879  -10.020 6.718   1.00 0.00 ? 56  ASP A CB   3  
ATOM 4721  C CG   . ASP A 1 56  ? -9.578  -9.833  8.192   1.00 0.00 ? 56  ASP A CG   3  
ATOM 4722  O OD1  . ASP A 1 56  ? -8.471  -10.214 8.625   1.00 0.00 ? 56  ASP A OD1  3  
ATOM 4723  O OD2  . ASP A 1 56  ? -10.450 -9.303  8.912   1.00 0.00 ? 56  ASP A OD2  3  
ATOM 4724  H H    . ASP A 1 56  ? -10.002 -7.468  5.151   1.00 0.00 ? 56  ASP A H    3  
ATOM 4725  H HA   . ASP A 1 56  ? -7.955  -9.234  6.210   1.00 0.00 ? 56  ASP A HA   3  
ATOM 4726  H HB2  . ASP A 1 56  ? -10.905 -9.733  6.539   1.00 0.00 ? 56  ASP A HB2  3  
ATOM 4727  H HB3  . ASP A 1 56  ? -9.754  -11.065 6.473   1.00 0.00 ? 56  ASP A HB3  3  
ATOM 4728  N N    . GLU A 1 57  ? -8.579  -11.004 4.266   1.00 0.00 ? 57  GLU A N    3  
ATOM 4729  C CA   . GLU A 1 57  ? -8.540  -11.653 2.961   1.00 0.00 ? 57  GLU A CA   3  
ATOM 4730  C C    . GLU A 1 57  ? -9.930  -11.699 2.334   1.00 0.00 ? 57  GLU A C    3  
ATOM 4731  O O    . GLU A 1 57  ? -10.079 -11.967 1.142   1.00 0.00 ? 57  GLU A O    3  
ATOM 4732  C CB   . GLU A 1 57  ? -7.978  -13.071 3.088   1.00 0.00 ? 57  GLU A CB   3  
ATOM 4733  C CG   . GLU A 1 57  ? -8.796  -13.970 3.999   1.00 0.00 ? 57  GLU A CG   3  
ATOM 4734  C CD   . GLU A 1 57  ? -8.596  -15.443 3.699   1.00 0.00 ? 57  GLU A CD   3  
ATOM 4735  O OE1  . GLU A 1 57  ? -8.534  -15.800 2.503   1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4736  O OE2  . GLU A 1 57  ? -8.501  -16.237 4.657   1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4737  H H    . GLU A 1 57  ? -8.309  -11.511 5.060   1.00 0.00 ? 57  GLU A H    3  
ATOM 4738  H HA   . GLU A 1 57  ? -7.890  -11.074 2.322   1.00 0.00 ? 57  GLU A HA   3  
ATOM 4739  H HB2  . GLU A 1 57  ? -7.945  -13.521 2.107   1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4740  H HB3  . GLU A 1 57  ? -6.974  -13.013 3.481   1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4741  H HG2  . GLU A 1 57  ? -8.505  -13.785 5.022   1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4742  H HG3  . GLU A 1 57  ? -9.842  -13.731 3.875   1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4743  N N    . LYS A 1 58  ? -10.948 -11.437 3.148   1.00 0.00 ? 58  LYS A N    3  
ATOM 4744  C CA   . LYS A 1 58  ? -12.328 -11.448 2.676   1.00 0.00 ? 58  LYS A CA   3  
ATOM 4745  C C    . LYS A 1 58  ? -12.563 -10.336 1.658   1.00 0.00 ? 58  LYS A C    3  
ATOM 4746  O O    . LYS A 1 58  ? -13.402 -10.466 0.768   1.00 0.00 ? 58  LYS A O    3  
ATOM 4747  C CB   . LYS A 1 58  ? -13.292 -11.289 3.853   1.00 0.00 ? 58  LYS A CB   3  
ATOM 4748  C CG   . LYS A 1 58  ? -13.511 -12.571 4.638   1.00 0.00 ? 58  LYS A CG   3  
ATOM 4749  C CD   . LYS A 1 58  ? -14.898 -12.618 5.255   1.00 0.00 ? 58  LYS A CD   3  
ATOM 4750  C CE   . LYS A 1 58  ? -14.914 -13.450 6.528   1.00 0.00 ? 58  LYS A CE   3  
ATOM 4751  N NZ   . LYS A 1 58  ? -15.121 -14.897 6.242   1.00 0.00 ? 58  LYS A NZ   3  
ATOM 4752  H H    . LYS A 1 58  ? -10.766 -11.231 4.089   1.00 0.00 ? 58  LYS A H    3  
ATOM 4753  H HA   . LYS A 1 58  ? -12.508 -12.400 2.199   1.00 0.00 ? 58  LYS A HA   3  
ATOM 4754  H HB2  . LYS A 1 58  ? -12.899 -10.542 4.527   1.00 0.00 ? 58  LYS A HB2  3  
ATOM 4755  H HB3  . LYS A 1 58  ? -14.248 -10.955 3.477   1.00 0.00 ? 58  LYS A HB3  3  
ATOM 4756  H HG2  . LYS A 1 58  ? -13.397 -13.414 3.972   1.00 0.00 ? 58  LYS A HG2  3  
ATOM 4757  H HG3  . LYS A 1 58  ? -12.773 -12.630 5.426   1.00 0.00 ? 58  LYS A HG3  3  
ATOM 4758  H HD2  . LYS A 1 58  ? -15.211 -11.612 5.493   1.00 0.00 ? 58  LYS A HD2  3  
ATOM 4759  H HD3  . LYS A 1 58  ? -15.586 -13.051 4.543   1.00 0.00 ? 58  LYS A HD3  3  
ATOM 4760  H HE2  . LYS A 1 58  ? -13.971 -13.325 7.037   1.00 0.00 ? 58  LYS A HE2  3  
ATOM 4761  H HE3  . LYS A 1 58  ? -15.715 -13.099 7.162   1.00 0.00 ? 58  LYS A HE3  3  
ATOM 4762  H HZ1  . LYS A 1 58  ? -15.006 -15.080 5.225   1.00 0.00 ? 58  LYS A HZ1  3  
ATOM 4763  H HZ2  . LYS A 1 58  ? -16.079 -15.184 6.529   1.00 0.00 ? 58  LYS A HZ2  3  
ATOM 4764  H HZ3  . LYS A 1 58  ? -14.429 -15.468 6.766   1.00 0.00 ? 58  LYS A HZ3  3  
ATOM 4765  N N    . GLU A 1 59  ? -11.816 -9.245  1.797   1.00 0.00 ? 59  GLU A N    3  
ATOM 4766  C CA   . GLU A 1 59  ? -11.945 -8.112  0.888   1.00 0.00 ? 59  GLU A CA   3  
ATOM 4767  C C    . GLU A 1 59  ? -13.398 -7.659  0.786   1.00 0.00 ? 59  GLU A C    3  
ATOM 4768  O O    . GLU A 1 59  ? -13.912 -7.434  -0.309  1.00 0.00 ? 59  GLU A O    3  
ATOM 4769  C CB   . GLU A 1 59  ? -11.414 -8.479  -0.499  1.00 0.00 ? 59  GLU A CB   3  
ATOM 4770  C CG   . GLU A 1 59  ? -9.910  -8.687  -0.540  1.00 0.00 ? 59  GLU A CG   3  
ATOM 4771  C CD   . GLU A 1 59  ? -9.458  -9.434  -1.780  1.00 0.00 ? 59  GLU A CD   3  
ATOM 4772  O OE1  . GLU A 1 59  ? -9.405  -10.681 -1.734  1.00 0.00 ? 59  GLU A OE1  3  
ATOM 4773  O OE2  . GLU A 1 59  ? -9.157  -8.773  -2.795  1.00 0.00 ? 59  GLU A OE2  3  
ATOM 4774  H H    . GLU A 1 59  ? -11.164 -9.202  2.527   1.00 0.00 ? 59  GLU A H    3  
ATOM 4775  H HA   . GLU A 1 59  ? -11.354 -7.300  1.286   1.00 0.00 ? 59  GLU A HA   3  
ATOM 4776  H HB2  . GLU A 1 59  ? -11.892 -9.392  -0.824  1.00 0.00 ? 59  GLU A HB2  3  
ATOM 4777  H HB3  . GLU A 1 59  ? -11.666 -7.687  -1.188  1.00 0.00 ? 59  GLU A HB3  3  
ATOM 4778  H HG2  . GLU A 1 59  ? -9.425  -7.722  -0.524  1.00 0.00 ? 59  GLU A HG2  3  
ATOM 4779  H HG3  . GLU A 1 59  ? -9.613  -9.253  0.331   1.00 0.00 ? 59  GLU A HG3  3  
ATOM 4780  N N    . GLU A 1 60  ? -14.054 -7.528  1.935   1.00 0.00 ? 60  GLU A N    3  
ATOM 4781  C CA   . GLU A 1 60  ? -15.448 -7.104  1.974   1.00 0.00 ? 60  GLU A CA   3  
ATOM 4782  C C    . GLU A 1 60  ? -15.606 -5.701  1.394   1.00 0.00 ? 60  GLU A C    3  
ATOM 4783  O O    . GLU A 1 60  ? -16.408 -5.480  0.487   1.00 0.00 ? 60  GLU A O    3  
ATOM 4784  C CB   . GLU A 1 60  ? -15.974 -7.136  3.411   1.00 0.00 ? 60  GLU A CB   3  
ATOM 4785  C CG   . GLU A 1 60  ? -16.257 -8.538  3.924   1.00 0.00 ? 60  GLU A CG   3  
ATOM 4786  C CD   . GLU A 1 60  ? -17.375 -8.570  4.948   1.00 0.00 ? 60  GLU A CD   3  
ATOM 4787  O OE1  . GLU A 1 60  ? -18.503 -8.155  4.609   1.00 0.00 ? 60  GLU A OE1  3  
ATOM 4788  O OE2  . GLU A 1 60  ? -17.121 -9.011  6.089   1.00 0.00 ? 60  GLU A OE2  3  
ATOM 4789  H H    . GLU A 1 60  ? -13.589 -7.723  2.776   1.00 0.00 ? 60  GLU A H    3  
ATOM 4790  H HA   . GLU A 1 60  ? -16.022 -7.795  1.375   1.00 0.00 ? 60  GLU A HA   3  
ATOM 4791  H HB2  . GLU A 1 60  ? -15.243 -6.678  4.060   1.00 0.00 ? 60  GLU A HB2  3  
ATOM 4792  H HB3  . GLU A 1 60  ? -16.891 -6.567  3.458   1.00 0.00 ? 60  GLU A HB3  3  
ATOM 4793  H HG2  . GLU A 1 60  ? -16.536 -9.164  3.089   1.00 0.00 ? 60  GLU A HG2  3  
ATOM 4794  H HG3  . GLU A 1 60  ? -15.359 -8.928  4.380   1.00 0.00 ? 60  GLU A HG3  3  
ATOM 4795  N N    . SER A 1 61  ? -14.836 -4.757  1.926   1.00 0.00 ? 61  SER A N    3  
ATOM 4796  C CA   . SER A 1 61  ? -14.893 -3.375  1.466   1.00 0.00 ? 61  SER A CA   3  
ATOM 4797  C C    . SER A 1 61  ? -13.543 -2.688  1.641   1.00 0.00 ? 61  SER A C    3  
ATOM 4798  O O    . SER A 1 61  ? -12.879 -2.852  2.665   1.00 0.00 ? 61  SER A O    3  
ATOM 4799  C CB   . SER A 1 61  ? -15.973 -2.605  2.229   1.00 0.00 ? 61  SER A CB   3  
ATOM 4800  O OG   . SER A 1 61  ? -16.413 -1.477  1.491   1.00 0.00 ? 61  SER A OG   3  
ATOM 4801  H H    . SER A 1 61  ? -14.217 -4.996  2.648   1.00 0.00 ? 61  SER A H    3  
ATOM 4802  H HA   . SER A 1 61  ? -15.145 -3.385  0.416   1.00 0.00 ? 61  SER A HA   3  
ATOM 4803  H HB2  . SER A 1 61  ? -16.816 -3.254  2.408   1.00 0.00 ? 61  SER A HB2  3  
ATOM 4804  H HB3  . SER A 1 61  ? -15.571 -2.268  3.174   1.00 0.00 ? 61  SER A HB3  3  
ATOM 4805  H HG   . SER A 1 61  ? -16.360 -1.669  0.552   1.00 0.00 ? 61  SER A HG   3  
ATOM 4806  N N    . ILE A 1 62  ? -13.142 -1.918  0.634   1.00 0.00 ? 62  ILE A N    3  
ATOM 4807  C CA   . ILE A 1 62  ? -11.872 -1.205  0.677   1.00 0.00 ? 62  ILE A CA   3  
ATOM 4808  C C    . ILE A 1 62  ? -11.869 -0.152  1.780   1.00 0.00 ? 62  ILE A C    3  
ATOM 4809  O O    . ILE A 1 62  ? -12.641 0.807   1.740   1.00 0.00 ? 62  ILE A O    3  
ATOM 4810  C CB   . ILE A 1 62  ? -11.564 -0.523  -0.669  1.00 0.00 ? 62  ILE A CB   3  
ATOM 4811  C CG1  . ILE A 1 62  ? -11.522 -1.560  -1.793  1.00 0.00 ? 62  ILE A CG1  3  
ATOM 4812  C CG2  . ILE A 1 62  ? -10.246 0.233   -0.590  1.00 0.00 ? 62  ILE A CG2  3  
ATOM 4813  C CD1  . ILE A 1 62  ? -11.538 -0.951  -3.178  1.00 0.00 ? 62  ILE A CD1  3  
ATOM 4814  H H    . ILE A 1 62  ? -13.715 -1.827  -0.155  1.00 0.00 ? 62  ILE A H    3  
ATOM 4815  H HA   . ILE A 1 62  ? -11.092 -1.925  0.880   1.00 0.00 ? 62  ILE A HA   3  
ATOM 4816  H HB   . ILE A 1 62  ? -12.348 0.189   -0.874  1.00 0.00 ? 62  ILE A HB   3  
ATOM 4817  H HG12 . ILE A 1 62  ? -10.622 -2.147  -1.700  1.00 0.00 ? 62  ILE A HG12 3  
ATOM 4818  H HG13 . ILE A 1 62  ? -12.381 -2.210  -1.705  1.00 0.00 ? 62  ILE A HG13 3  
ATOM 4819  H HG21 . ILE A 1 62  ? -10.151 0.690   0.384   1.00 0.00 ? 62  ILE A HG21 3  
ATOM 4820  H HG22 . ILE A 1 62  ? -9.427  -0.454  -0.746  1.00 0.00 ? 62  ILE A HG22 3  
ATOM 4821  H HG23 . ILE A 1 62  ? -10.224 0.999   -1.351  1.00 0.00 ? 62  ILE A HG23 3  
ATOM 4822  H HD11 . ILE A 1 62  ? -11.381 -1.727  -3.914  1.00 0.00 ? 62  ILE A HD11 3  
ATOM 4823  H HD12 . ILE A 1 62  ? -12.494 -0.480  -3.353  1.00 0.00 ? 62  ILE A HD12 3  
ATOM 4824  H HD13 . ILE A 1 62  ? -10.753 -0.216  -3.258  1.00 0.00 ? 62  ILE A HD13 3  
ATOM 4825  N N    . LEU A 1 63  ? -10.995 -0.335  2.763   1.00 0.00 ? 63  LEU A N    3  
ATOM 4826  C CA   . LEU A 1 63  ? -10.889 0.600   3.877   1.00 0.00 ? 63  LEU A CA   3  
ATOM 4827  C C    . LEU A 1 63  ? -10.225 1.900   3.436   1.00 0.00 ? 63  LEU A C    3  
ATOM 4828  O O    . LEU A 1 63  ? -10.628 2.987   3.850   1.00 0.00 ? 63  LEU A O    3  
ATOM 4829  C CB   . LEU A 1 63  ? -10.094 -0.029  5.023   1.00 0.00 ? 63  LEU A CB   3  
ATOM 4830  C CG   . LEU A 1 63  ? -10.635 -1.351  5.569   1.00 0.00 ? 63  LEU A CG   3  
ATOM 4831  C CD1  . LEU A 1 63  ? -9.757  -1.859  6.702   1.00 0.00 ? 63  LEU A CD1  3  
ATOM 4832  C CD2  . LEU A 1 63  ? -12.073 -1.185  6.039   1.00 0.00 ? 63  LEU A CD2  3  
ATOM 4833  H H    . LEU A 1 63  ? -10.406 -1.118  2.740   1.00 0.00 ? 63  LEU A H    3  
ATOM 4834  H HA   . LEU A 1 63  ? -11.889 0.819   4.222   1.00 0.00 ? 63  LEU A HA   3  
ATOM 4835  H HB2  . LEU A 1 63  ? -9.089  -0.203  4.671   1.00 0.00 ? 63  LEU A HB2  3  
ATOM 4836  H HB3  . LEU A 1 63  ? -10.071 0.682   5.837   1.00 0.00 ? 63  LEU A HB3  3  
ATOM 4837  H HG   . LEU A 1 63  ? -10.623 -2.090  4.780   1.00 0.00 ? 63  LEU A HG   3  
ATOM 4838  H HD11 . LEU A 1 63  ? -8.735  -1.555  6.530   1.00 0.00 ? 63  LEU A HD11 3  
ATOM 4839  H HD12 . LEU A 1 63  ? -9.810  -2.937  6.743   1.00 0.00 ? 63  LEU A HD12 3  
ATOM 4840  H HD13 . LEU A 1 63  ? -10.103 -1.446  7.638   1.00 0.00 ? 63  LEU A HD13 3  
ATOM 4841  H HD21 . LEU A 1 63  ? -12.379 -0.159  5.905   1.00 0.00 ? 63  LEU A HD21 3  
ATOM 4842  H HD22 . LEU A 1 63  ? -12.142 -1.448  7.084   1.00 0.00 ? 63  LEU A HD22 3  
ATOM 4843  H HD23 . LEU A 1 63  ? -12.717 -1.833  5.462   1.00 0.00 ? 63  LEU A HD23 3  
ATOM 4844  N N    . GLY A 1 64  ? -9.206  1.781   2.590   1.00 0.00 ? 64  GLY A N    3  
ATOM 4845  C CA   . GLY A 1 64  ? -8.504  2.955   2.105   1.00 0.00 ? 64  GLY A CA   3  
ATOM 4846  C C    . GLY A 1 64  ? -7.723  2.679   0.835   1.00 0.00 ? 64  GLY A C    3  
ATOM 4847  O O    . GLY A 1 64  ? -7.151  1.602   0.672   1.00 0.00 ? 64  GLY A O    3  
ATOM 4848  H H    . GLY A 1 64  ? -8.928  0.889   2.294   1.00 0.00 ? 64  GLY A H    3  
ATOM 4849  H HA2  . GLY A 1 64  ? -9.223  3.736   1.911   1.00 0.00 ? 64  GLY A HA2  3  
ATOM 4850  H HA3  . GLY A 1 64  ? -7.818  3.292   2.869   1.00 0.00 ? 64  GLY A HA3  3  
ATOM 4851  N N    . SER A 1 65  ? -7.701  3.655   -0.068  1.00 0.00 ? 65  SER A N    3  
ATOM 4852  C CA   . SER A 1 65  ? -6.990  3.510   -1.332  1.00 0.00 ? 65  SER A CA   3  
ATOM 4853  C C    . SER A 1 65  ? -5.822  4.488   -1.413  1.00 0.00 ? 65  SER A C    3  
ATOM 4854  O O    . SER A 1 65  ? -5.853  5.561   -0.809  1.00 0.00 ? 65  SER A O    3  
ATOM 4855  C CB   . SER A 1 65  ? -7.943  3.737   -2.507  1.00 0.00 ? 65  SER A CB   3  
ATOM 4856  O OG   . SER A 1 65  ? -7.234  4.126   -3.671  1.00 0.00 ? 65  SER A OG   3  
ATOM 4857  H H    . SER A 1 65  ? -8.177  4.491   0.121   1.00 0.00 ? 65  SER A H    3  
ATOM 4858  H HA   . SER A 1 65  ? -6.604  2.502   -1.382  1.00 0.00 ? 65  SER A HA   3  
ATOM 4859  H HB2  . SER A 1 65  ? -8.479  2.824   -2.715  1.00 0.00 ? 65  SER A HB2  3  
ATOM 4860  H HB3  . SER A 1 65  ? -8.646  4.517   -2.251  1.00 0.00 ? 65  SER A HB3  3  
ATOM 4861  H HG   . SER A 1 65  ? -6.783  4.957   -3.509  1.00 0.00 ? 65  SER A HG   3  
ATOM 4862  N N    . ILE A 1 66  ? -4.793  4.110   -2.164  1.00 0.00 ? 66  ILE A N    3  
ATOM 4863  C CA   . ILE A 1 66  ? -3.615  4.954   -2.326  1.00 0.00 ? 66  ILE A CA   3  
ATOM 4864  C C    . ILE A 1 66  ? -3.025  4.812   -3.725  1.00 0.00 ? 66  ILE A C    3  
ATOM 4865  O O    . ILE A 1 66  ? -2.573  3.740   -4.129  1.00 0.00 ? 66  ILE A O    3  
ATOM 4866  C CB   . ILE A 1 66  ? -2.531  4.612   -1.287  1.00 0.00 ? 66  ILE A CB   3  
ATOM 4867  C CG1  . ILE A 1 66  ? -3.075  4.800   0.131   1.00 0.00 ? 66  ILE A CG1  3  
ATOM 4868  C CG2  . ILE A 1 66  ? -1.297  5.475   -1.505  1.00 0.00 ? 66  ILE A CG2  3  
ATOM 4869  C CD1  . ILE A 1 66  ? -2.213  4.165   1.199   1.00 0.00 ? 66  ILE A CD1  3  
ATOM 4870  H H    . ILE A 1 66  ? -4.827  3.244   -2.621  1.00 0.00 ? 66  ILE A H    3  
ATOM 4871  H HA   . ILE A 1 66  ? -3.918  5.980   -2.177  1.00 0.00 ? 66  ILE A HA   3  
ATOM 4872  H HB   . ILE A 1 66  ? -2.247  3.580   -1.422  1.00 0.00 ? 66  ILE A HB   3  
ATOM 4873  H HG12 . ILE A 1 66  ? -3.145  5.855   0.346   1.00 0.00 ? 66  ILE A HG12 3  
ATOM 4874  H HG13 . ILE A 1 66  ? -4.060  4.359   0.192   1.00 0.00 ? 66  ILE A HG13 3  
ATOM 4875  H HG21 . ILE A 1 66  ? -1.065  5.511   -2.559  1.00 0.00 ? 66  ILE A HG21 3  
ATOM 4876  H HG22 . ILE A 1 66  ? -1.490  6.475   -1.146  1.00 0.00 ? 66  ILE A HG22 3  
ATOM 4877  H HG23 . ILE A 1 66  ? -0.462  5.053   -0.967  1.00 0.00 ? 66  ILE A HG23 3  
ATOM 4878  H HD11 . ILE A 1 66  ? -1.516  3.480   0.737   1.00 0.00 ? 66  ILE A HD11 3  
ATOM 4879  H HD12 . ILE A 1 66  ? -1.666  4.933   1.725   1.00 0.00 ? 66  ILE A HD12 3  
ATOM 4880  H HD13 . ILE A 1 66  ? -2.838  3.626   1.894   1.00 0.00 ? 66  ILE A HD13 3  
ATOM 4881  N N    . PRO A 1 67  ? -3.027  5.918   -4.483  1.00 0.00 ? 67  PRO A N    3  
ATOM 4882  C CA   . PRO A 1 67  ? -2.493  5.944   -5.848  1.00 0.00 ? 67  PRO A CA   3  
ATOM 4883  C C    . PRO A 1 67  ? -0.974  5.806   -5.879  1.00 0.00 ? 67  PRO A C    3  
ATOM 4884  O O    . PRO A 1 67  ? -0.257  6.597   -5.265  1.00 0.00 ? 67  PRO A O    3  
ATOM 4885  C CB   . PRO A 1 67  ? -2.916  7.319   -6.369  1.00 0.00 ? 67  PRO A CB   3  
ATOM 4886  C CG   . PRO A 1 67  ? -3.067  8.157   -5.147  1.00 0.00 ? 67  PRO A CG   3  
ATOM 4887  C CD   . PRO A 1 67  ? -3.550  7.230   -4.066  1.00 0.00 ? 67  PRO A CD   3  
ATOM 4888  H HA   . PRO A 1 67  ? -2.935  5.173   -6.462  1.00 0.00 ? 67  PRO A HA   3  
ATOM 4889  H HB2  . PRO A 1 67  ? -2.151  7.710   -7.025  1.00 0.00 ? 67  PRO A HB2  3  
ATOM 4890  H HB3  . PRO A 1 67  ? -3.849  7.233   -6.906  1.00 0.00 ? 67  PRO A HB3  3  
ATOM 4891  H HG2  . PRO A 1 67  ? -2.114  8.586   -4.875  1.00 0.00 ? 67  PRO A HG2  3  
ATOM 4892  H HG3  . PRO A 1 67  ? -3.794  8.936   -5.324  1.00 0.00 ? 67  PRO A HG3  3  
ATOM 4893  H HD2  . PRO A 1 67  ? -3.142  7.521   -3.109  1.00 0.00 ? 67  PRO A HD2  3  
ATOM 4894  H HD3  . PRO A 1 67  ? -4.629  7.221   -4.031  1.00 0.00 ? 67  PRO A HD3  3  
ATOM 4895  N N    . LEU A 1 68  ? -0.491  4.800   -6.598  1.00 0.00 ? 68  LEU A N    3  
ATOM 4896  C CA   . LEU A 1 68  ? 0.944   4.559   -6.710  1.00 0.00 ? 68  LEU A CA   3  
ATOM 4897  C C    . LEU A 1 68  ? 1.504   5.189   -7.981  1.00 0.00 ? 68  LEU A C    3  
ATOM 4898  O O    . LEU A 1 68  ? 2.696   5.488   -8.066  1.00 0.00 ? 68  LEU A O    3  
ATOM 4899  C CB   . LEU A 1 68  ? 1.231   3.057   -6.702  1.00 0.00 ? 68  LEU A CB   3  
ATOM 4900  C CG   . LEU A 1 68  ? 0.936   2.324   -5.393  1.00 0.00 ? 68  LEU A CG   3  
ATOM 4901  C CD1  . LEU A 1 68  ? 0.903   0.820   -5.618  1.00 0.00 ? 68  LEU A CD1  3  
ATOM 4902  C CD2  . LEU A 1 68  ? 1.969   2.684   -4.335  1.00 0.00 ? 68  LEU A CD2  3  
ATOM 4903  H H    . LEU A 1 68  ? -1.112  4.203   -7.065  1.00 0.00 ? 68  LEU A H    3  
ATOM 4904  H HA   . LEU A 1 68  ? 1.423   5.014   -5.856  1.00 0.00 ? 68  LEU A HA   3  
ATOM 4905  H HB2  . LEU A 1 68  ? 0.634   2.602   -7.477  1.00 0.00 ? 68  LEU A HB2  3  
ATOM 4906  H HB3  . LEU A 1 68  ? 2.279   2.920   -6.930  1.00 0.00 ? 68  LEU A HB3  3  
ATOM 4907  H HG   . LEU A 1 68  ? -0.036  2.627   -5.029  1.00 0.00 ? 68  LEU A HG   3  
ATOM 4908  H HD11 . LEU A 1 68  ? 1.366   0.321   -4.781  1.00 0.00 ? 68  LEU A HD11 3  
ATOM 4909  H HD12 . LEU A 1 68  ? 1.441   0.580   -6.524  1.00 0.00 ? 68  LEU A HD12 3  
ATOM 4910  H HD13 . LEU A 1 68  ? -0.122  0.493   -5.712  1.00 0.00 ? 68  LEU A HD13 3  
ATOM 4911  H HD21 . LEU A 1 68  ? 2.928   2.276   -4.616  1.00 0.00 ? 68  LEU A HD21 3  
ATOM 4912  H HD22 . LEU A 1 68  ? 1.667   2.273   -3.383  1.00 0.00 ? 68  LEU A HD22 3  
ATOM 4913  H HD23 . LEU A 1 68  ? 2.043   3.759   -4.256  1.00 0.00 ? 68  LEU A HD23 3  
ATOM 4914  N N    . LEU A 1 69  ? 0.637   5.389   -8.968  1.00 0.00 ? 69  LEU A N    3  
ATOM 4915  C CA   . LEU A 1 69  ? 1.044   5.986   -10.235 1.00 0.00 ? 69  LEU A CA   3  
ATOM 4916  C C    . LEU A 1 69  ? 1.753   7.317   -10.007 1.00 0.00 ? 69  LEU A C    3  
ATOM 4917  O O    . LEU A 1 69  ? 2.404   7.847   -10.907 1.00 0.00 ? 69  LEU A O    3  
ATOM 4918  C CB   . LEU A 1 69  ? -0.173  6.191   -11.139 1.00 0.00 ? 69  LEU A CB   3  
ATOM 4919  C CG   . LEU A 1 69  ? -0.047  7.290   -12.194 1.00 0.00 ? 69  LEU A CG   3  
ATOM 4920  C CD1  . LEU A 1 69  ? 1.009   6.922   -13.226 1.00 0.00 ? 69  LEU A CD1  3  
ATOM 4921  C CD2  . LEU A 1 69  ? -1.389  7.540   -12.867 1.00 0.00 ? 69  LEU A CD2  3  
ATOM 4922  H H    . LEU A 1 69  ? -0.299  5.130   -8.842  1.00 0.00 ? 69  LEU A H    3  
ATOM 4923  H HA   . LEU A 1 69  ? 1.730   5.305   -10.717 1.00 0.00 ? 69  LEU A HA   3  
ATOM 4924  H HB2  . LEU A 1 69  ? -0.364  5.261   -11.652 1.00 0.00 ? 69  LEU A HB2  3  
ATOM 4925  H HB3  . LEU A 1 69  ? -1.016  6.432   -10.507 1.00 0.00 ? 69  LEU A HB3  3  
ATOM 4926  H HG   . LEU A 1 69  ? 0.263   8.208   -11.714 1.00 0.00 ? 69  LEU A HG   3  
ATOM 4927  H HD11 . LEU A 1 69  ? 1.202   7.772   -13.862 1.00 0.00 ? 69  LEU A HD11 3  
ATOM 4928  H HD12 . LEU A 1 69  ? 0.654   6.096   -13.825 1.00 0.00 ? 69  LEU A HD12 3  
ATOM 4929  H HD13 . LEU A 1 69  ? 1.920   6.635   -12.721 1.00 0.00 ? 69  LEU A HD13 3  
ATOM 4930  H HD21 . LEU A 1 69  ? -1.317  8.411   -13.501 1.00 0.00 ? 69  LEU A HD21 3  
ATOM 4931  H HD22 . LEU A 1 69  ? -2.144  7.704   -12.113 1.00 0.00 ? 69  LEU A HD22 3  
ATOM 4932  H HD23 . LEU A 1 69  ? -1.657  6.680   -13.465 1.00 0.00 ? 69  LEU A HD23 3  
ATOM 4933  N N    . SER A 1 70  ? 1.623   7.851   -8.797  1.00 0.00 ? 70  SER A N    3  
ATOM 4934  C CA   . SER A 1 70  ? 2.250   9.121   -8.451  1.00 0.00 ? 70  SER A CA   3  
ATOM 4935  C C    . SER A 1 70  ? 3.484   8.899   -7.581  1.00 0.00 ? 70  SER A C    3  
ATOM 4936  O O    . SER A 1 70  ? 4.404   9.717   -7.569  1.00 0.00 ? 70  SER A O    3  
ATOM 4937  C CB   . SER A 1 70  ? 1.254   10.024  -7.721  1.00 0.00 ? 70  SER A CB   3  
ATOM 4938  O OG   . SER A 1 70  ? 0.437   10.729  -8.639  1.00 0.00 ? 70  SER A OG   3  
ATOM 4939  H H    . SER A 1 70  ? 1.091   7.381   -8.122  1.00 0.00 ? 70  SER A H    3  
ATOM 4940  H HA   . SER A 1 70  ? 2.553   9.603   -9.369  1.00 0.00 ? 70  SER A HA   3  
ATOM 4941  H HB2  . SER A 1 70  ? 0.623   9.420   -7.086  1.00 0.00 ? 70  SER A HB2  3  
ATOM 4942  H HB3  . SER A 1 70  ? 1.795   10.738  -7.117  1.00 0.00 ? 70  SER A HB3  3  
ATOM 4943  H HG   . SER A 1 70  ? 0.911   10.847  -9.465  1.00 0.00 ? 70  SER A HG   3  
ATOM 4944  N N    . PHE A 1 71  ? 3.496   7.786   -6.855  1.00 0.00 ? 71  PHE A N    3  
ATOM 4945  C CA   . PHE A 1 71  ? 4.615   7.455   -5.981  1.00 0.00 ? 71  PHE A CA   3  
ATOM 4946  C C    . PHE A 1 71  ? 5.707   6.718   -6.752  1.00 0.00 ? 71  PHE A C    3  
ATOM 4947  O O    . PHE A 1 71  ? 5.499   6.289   -7.887  1.00 0.00 ? 71  PHE A O    3  
ATOM 4948  C CB   . PHE A 1 71  ? 4.137   6.599   -4.807  1.00 0.00 ? 71  PHE A CB   3  
ATOM 4949  C CG   . PHE A 1 71  ? 3.383   7.377   -3.766  1.00 0.00 ? 71  PHE A CG   3  
ATOM 4950  C CD1  . PHE A 1 71  ? 2.156   7.947   -4.063  1.00 0.00 ? 71  PHE A CD1  3  
ATOM 4951  C CD2  . PHE A 1 71  ? 3.902   7.537   -2.491  1.00 0.00 ? 71  PHE A CD2  3  
ATOM 4952  C CE1  . PHE A 1 71  ? 1.460   8.663   -3.107  1.00 0.00 ? 71  PHE A CE1  3  
ATOM 4953  C CE2  . PHE A 1 71  ? 3.210   8.252   -1.531  1.00 0.00 ? 71  PHE A CE2  3  
ATOM 4954  C CZ   . PHE A 1 71  ? 1.988   8.815   -1.840  1.00 0.00 ? 71  PHE A CZ   3  
ATOM 4955  H H    . PHE A 1 71  ? 2.733   7.173   -6.908  1.00 0.00 ? 71  PHE A H    3  
ATOM 4956  H HA   . PHE A 1 71  ? 5.022   8.379   -5.600  1.00 0.00 ? 71  PHE A HA   3  
ATOM 4957  H HB2  . PHE A 1 71  ? 3.485   5.824   -5.178  1.00 0.00 ? 71  PHE A HB2  3  
ATOM 4958  H HB3  . PHE A 1 71  ? 4.993   6.146   -4.329  1.00 0.00 ? 71  PHE A HB3  3  
ATOM 4959  H HD1  . PHE A 1 71  ? 1.741   7.828   -5.053  1.00 0.00 ? 71  PHE A HD1  3  
ATOM 4960  H HD2  . PHE A 1 71  ? 4.859   7.096   -2.249  1.00 0.00 ? 71  PHE A HD2  3  
ATOM 4961  H HE1  . PHE A 1 71  ? 0.504   9.102   -3.351  1.00 0.00 ? 71  PHE A HE1  3  
ATOM 4962  H HE2  . PHE A 1 71  ? 3.626   8.369   -0.542  1.00 0.00 ? 71  PHE A HE2  3  
ATOM 4963  H HZ   . PHE A 1 71  ? 1.446   9.375   -1.092  1.00 0.00 ? 71  PHE A HZ   3  
ATOM 4964  N N    . ARG A 1 72  ? 6.871   6.575   -6.126  1.00 0.00 ? 72  ARG A N    3  
ATOM 4965  C CA   . ARG A 1 72  ? 7.996   5.892   -6.752  1.00 0.00 ? 72  ARG A CA   3  
ATOM 4966  C C    . ARG A 1 72  ? 8.584   4.841   -5.814  1.00 0.00 ? 72  ARG A C    3  
ATOM 4967  O O    . ARG A 1 72  ? 9.692   5.001   -5.302  1.00 0.00 ? 72  ARG A O    3  
ATOM 4968  C CB   . ARG A 1 72  ? 9.077   6.900   -7.147  1.00 0.00 ? 72  ARG A CB   3  
ATOM 4969  C CG   . ARG A 1 72  ? 9.364   7.937   -6.074  1.00 0.00 ? 72  ARG A CG   3  
ATOM 4970  C CD   . ARG A 1 72  ? 10.610  8.745   -6.399  1.00 0.00 ? 72  ARG A CD   3  
ATOM 4971  N NE   . ARG A 1 72  ? 10.628  10.028  -5.702  1.00 0.00 ? 72  ARG A NE   3  
ATOM 4972  C CZ   . ARG A 1 72  ? 11.457  11.020  -6.010  1.00 0.00 ? 72  ARG A CZ   3  
ATOM 4973  N NH1  . ARG A 1 72  ? 12.329  10.877  -6.998  1.00 0.00 ? 72  ARG A NH1  3  
ATOM 4974  N NH2  . ARG A 1 72  ? 11.412  12.158  -5.329  1.00 0.00 ? 72  ARG A NH2  3  
ATOM 4975  H H    . ARG A 1 72  ? 6.975   6.938   -5.221  1.00 0.00 ? 72  ARG A H    3  
ATOM 4976  H HA   . ARG A 1 72  ? 7.632   5.400   -7.642  1.00 0.00 ? 72  ARG A HA   3  
ATOM 4977  H HB2  . ARG A 1 72  ? 9.992   6.366   -7.355  1.00 0.00 ? 72  ARG A HB2  3  
ATOM 4978  H HB3  . ARG A 1 72  ? 8.760   7.416   -8.041  1.00 0.00 ? 72  ARG A HB3  3  
ATOM 4979  H HG2  . ARG A 1 72  ? 8.522   8.609   -6.000  1.00 0.00 ? 72  ARG A HG2  3  
ATOM 4980  H HG3  . ARG A 1 72  ? 9.508   7.433   -5.130  1.00 0.00 ? 72  ARG A HG3  3  
ATOM 4981  H HD2  . ARG A 1 72  ? 11.480  8.175   -6.107  1.00 0.00 ? 72  ARG A HD2  3  
ATOM 4982  H HD3  . ARG A 1 72  ? 10.639  8.923   -7.464  1.00 0.00 ? 72  ARG A HD3  3  
ATOM 4983  H HE   . ARG A 1 72  ? 9.992   10.155  -4.969  1.00 0.00 ? 72  ARG A HE   3  
ATOM 4984  H HH11 . ARG A 1 72  ? 12.364  10.021  -7.513  1.00 0.00 ? 72  ARG A HH11 3  
ATOM 4985  H HH12 . ARG A 1 72  ? 12.951  11.626  -7.228  1.00 0.00 ? 72  ARG A HH12 3  
ATOM 4986  H HH21 . ARG A 1 72  ? 10.756  12.269  -4.584  1.00 0.00 ? 72  ARG A HH21 3  
ATOM 4987  H HH22 . ARG A 1 72  ? 12.036  12.904  -5.561  1.00 0.00 ? 72  ARG A HH22 3  
ATOM 4988  N N    . VAL A 1 73  ? 7.834   3.766   -5.594  1.00 0.00 ? 73  VAL A N    3  
ATOM 4989  C CA   . VAL A 1 73  ? 8.281   2.688   -4.719  1.00 0.00 ? 73  VAL A CA   3  
ATOM 4990  C C    . VAL A 1 73  ? 9.782   2.460   -4.851  1.00 0.00 ? 73  VAL A C    3  
ATOM 4991  O O    . VAL A 1 73  ? 10.362  2.674   -5.915  1.00 0.00 ? 73  VAL A O    3  
ATOM 4992  C CB   . VAL A 1 73  ? 7.543   1.372   -5.028  1.00 0.00 ? 73  VAL A CB   3  
ATOM 4993  C CG1  . VAL A 1 73  ? 8.047   0.254   -4.128  1.00 0.00 ? 73  VAL A CG1  3  
ATOM 4994  C CG2  . VAL A 1 73  ? 6.041   1.555   -4.876  1.00 0.00 ? 73  VAL A CG2  3  
ATOM 4995  H H    . VAL A 1 73  ? 6.960   3.695   -6.031  1.00 0.00 ? 73  VAL A H    3  
ATOM 4996  H HA   . VAL A 1 73  ? 8.057   2.971   -3.700  1.00 0.00 ? 73  VAL A HA   3  
ATOM 4997  H HB   . VAL A 1 73  ? 7.750   1.100   -6.053  1.00 0.00 ? 73  VAL A HB   3  
ATOM 4998  H HG11 . VAL A 1 73  ? 9.057   -0.007  -4.409  1.00 0.00 ? 73  VAL A HG11 3  
ATOM 4999  H HG12 . VAL A 1 73  ? 8.032   0.584   -3.100  1.00 0.00 ? 73  VAL A HG12 3  
ATOM 5000  H HG13 . VAL A 1 73  ? 7.409   -0.611  -4.238  1.00 0.00 ? 73  VAL A HG13 3  
ATOM 5001  H HG21 . VAL A 1 73  ? 5.648   0.783   -4.231  1.00 0.00 ? 73  VAL A HG21 3  
ATOM 5002  H HG22 . VAL A 1 73  ? 5.839   2.524   -4.444  1.00 0.00 ? 73  VAL A HG22 3  
ATOM 5003  H HG23 . VAL A 1 73  ? 5.569   1.488   -5.845  1.00 0.00 ? 73  VAL A HG23 3  
ATOM 5004  N N    . ALA A 1 74  ? 10.407  2.024   -3.762  1.00 0.00 ? 74  ALA A N    3  
ATOM 5005  C CA   . ALA A 1 74  ? 11.841  1.764   -3.756  1.00 0.00 ? 74  ALA A CA   3  
ATOM 5006  C C    . ALA A 1 74  ? 12.284  1.159   -2.428  1.00 0.00 ? 74  ALA A C    3  
ATOM 5007  O O    . ALA A 1 74  ? 12.004  1.706   -1.362  1.00 0.00 ? 74  ALA A O    3  
ATOM 5008  C CB   . ALA A 1 74  ? 12.611  3.046   -4.037  1.00 0.00 ? 74  ALA A CB   3  
ATOM 5009  H H    . ALA A 1 74  ? 9.890   1.872   -2.943  1.00 0.00 ? 74  ALA A H    3  
ATOM 5010  H HA   . ALA A 1 74  ? 12.056  1.062   -4.549  1.00 0.00 ? 74  ALA A HA   3  
ATOM 5011  H HB1  . ALA A 1 74  ? 11.961  3.756   -4.527  1.00 0.00 ? 74  ALA A HB1  3  
ATOM 5012  H HB2  . ALA A 1 74  ? 12.965  3.464   -3.106  1.00 0.00 ? 74  ALA A HB2  3  
ATOM 5013  H HB3  . ALA A 1 74  ? 13.453  2.827   -4.677  1.00 0.00 ? 74  ALA A HB3  3  
ATOM 5014  N N    . ALA A 1 75  ? 12.977  0.027   -2.501  1.00 0.00 ? 75  ALA A N    3  
ATOM 5015  C CA   . ALA A 1 75  ? 13.459  -0.651  -1.304  1.00 0.00 ? 75  ALA A CA   3  
ATOM 5016  C C    . ALA A 1 75  ? 14.086  0.338   -0.327  1.00 0.00 ? 75  ALA A C    3  
ATOM 5017  O O    . ALA A 1 75  ? 14.696  1.327   -0.735  1.00 0.00 ? 75  ALA A O    3  
ATOM 5018  C CB   . ALA A 1 75  ? 14.462  -1.733  -1.679  1.00 0.00 ? 75  ALA A CB   3  
ATOM 5019  H H    . ALA A 1 75  ? 13.169  -0.360  -3.380  1.00 0.00 ? 75  ALA A H    3  
ATOM 5020  H HA   . ALA A 1 75  ? 12.615  -1.127  -0.827  1.00 0.00 ? 75  ALA A HA   3  
ATOM 5021  H HB1  . ALA A 1 75  ? 15.420  -1.279  -1.883  1.00 0.00 ? 75  ALA A HB1  3  
ATOM 5022  H HB2  . ALA A 1 75  ? 14.560  -2.430  -0.860  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 5023  H HB3  . ALA A 1 75  ? 14.116  -2.255  -2.558  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 5024  N N    . VAL A 1 76  ? 13.931  0.066   0.965   1.00 0.00 ? 76  VAL A N    3  
ATOM 5025  C CA   . VAL A 1 76  ? 14.482  0.932   2.000   1.00 0.00 ? 76  VAL A CA   3  
ATOM 5026  C C    . VAL A 1 76  ? 15.991  1.080   1.846   1.00 0.00 ? 76  VAL A C    3  
ATOM 5027  O O    . VAL A 1 76  ? 16.623  0.342   1.092   1.00 0.00 ? 76  VAL A O    3  
ATOM 5028  C CB   . VAL A 1 76  ? 14.171  0.391   3.408   1.00 0.00 ? 76  VAL A CB   3  
ATOM 5029  C CG1  . VAL A 1 76  ? 12.700  0.588   3.743   1.00 0.00 ? 76  VAL A CG1  3  
ATOM 5030  C CG2  . VAL A 1 76  ? 14.558  -1.076  3.513   1.00 0.00 ? 76  VAL A CG2  3  
ATOM 5031  H H    . VAL A 1 76  ? 13.435  -0.737  1.228   1.00 0.00 ? 76  VAL A H    3  
ATOM 5032  H HA   . VAL A 1 76  ? 14.022  1.905   1.901   1.00 0.00 ? 76  VAL A HA   3  
ATOM 5033  H HB   . VAL A 1 76  ? 14.757  0.948   4.124   1.00 0.00 ? 76  VAL A HB   3  
ATOM 5034  H HG11 . VAL A 1 76  ? 12.591  1.441   4.397   1.00 0.00 ? 76  VAL A HG11 3  
ATOM 5035  H HG12 . VAL A 1 76  ? 12.142  0.757   2.833   1.00 0.00 ? 76  VAL A HG12 3  
ATOM 5036  H HG13 . VAL A 1 76  ? 12.323  -0.294  4.239   1.00 0.00 ? 76  VAL A HG13 3  
ATOM 5037  H HG21 . VAL A 1 76  ? 15.529  -1.161  3.976   1.00 0.00 ? 76  VAL A HG21 3  
ATOM 5038  H HG22 . VAL A 1 76  ? 13.826  -1.599  4.110   1.00 0.00 ? 76  VAL A HG22 3  
ATOM 5039  H HG23 . VAL A 1 76  ? 14.592  -1.511  2.524   1.00 0.00 ? 76  VAL A HG23 3  
ATOM 5040  N N    . GLN A 1 77  ? 16.562  2.040   2.568   1.00 0.00 ? 77  GLN A N    3  
ATOM 5041  C CA   . GLN A 1 77  ? 17.998  2.285   2.511   1.00 0.00 ? 77  GLN A CA   3  
ATOM 5042  C C    . GLN A 1 77  ? 18.700  1.695   3.730   1.00 0.00 ? 77  GLN A C    3  
ATOM 5043  O O    . GLN A 1 77  ? 18.092  1.466   4.776   1.00 0.00 ? 77  GLN A O    3  
ATOM 5044  C CB   . GLN A 1 77  ? 18.278  3.787   2.425   1.00 0.00 ? 77  GLN A CB   3  
ATOM 5045  C CG   . GLN A 1 77  ? 18.127  4.354   1.022   1.00 0.00 ? 77  GLN A CG   3  
ATOM 5046  C CD   . GLN A 1 77  ? 18.632  5.779   0.912   1.00 0.00 ? 77  GLN A CD   3  
ATOM 5047  O OE1  . GLN A 1 77  ? 18.333  6.623   1.758   1.00 0.00 ? 77  GLN A OE1  3  
ATOM 5048  N NE2  . GLN A 1 77  ? 19.402  6.056   -0.134  1.00 0.00 ? 77  GLN A NE2  3  
ATOM 5049  H H    . GLN A 1 77  ? 16.005  2.596   3.150   1.00 0.00 ? 77  GLN A H    3  
ATOM 5050  H HA   . GLN A 1 77  ? 18.382  1.806   1.623   1.00 0.00 ? 77  GLN A HA   3  
ATOM 5051  H HB2  . GLN A 1 77  ? 17.591  4.307   3.076   1.00 0.00 ? 77  GLN A HB2  3  
ATOM 5052  H HB3  . GLN A 1 77  ? 19.288  3.972   2.758   1.00 0.00 ? 77  GLN A HB3  3  
ATOM 5053  H HG2  . GLN A 1 77  ? 18.688  3.736   0.336   1.00 0.00 ? 77  GLN A HG2  3  
ATOM 5054  H HG3  . GLN A 1 77  ? 17.082  4.335   0.750   1.00 0.00 ? 77  GLN A HG3  3  
ATOM 5055  H HE21 . GLN A 1 77  ? 19.597  5.334   -0.768  1.00 0.00 ? 77  GLN A HE21 3  
ATOM 5056  H HE22 . GLN A 1 77  ? 19.741  6.969   -0.230  1.00 0.00 ? 77  GLN A HE22 3  
ATOM 5057  N N    . PRO A 1 78  ? 20.010  1.441   3.594   1.00 0.00 ? 78  PRO A N    3  
ATOM 5058  C CA   . PRO A 1 78  ? 20.823  0.874   4.674   1.00 0.00 ? 78  PRO A CA   3  
ATOM 5059  C C    . PRO A 1 78  ? 21.032  1.858   5.820   1.00 0.00 ? 78  PRO A C    3  
ATOM 5060  O O    . PRO A 1 78  ? 21.733  1.559   6.787   1.00 0.00 ? 78  PRO A O    3  
ATOM 5061  C CB   . PRO A 1 78  ? 22.155  0.560   3.988   1.00 0.00 ? 78  PRO A CB   3  
ATOM 5062  C CG   . PRO A 1 78  ? 22.218  1.501   2.835   1.00 0.00 ? 78  PRO A CG   3  
ATOM 5063  C CD   . PRO A 1 78  ? 20.799  1.689   2.375   1.00 0.00 ? 78  PRO A CD   3  
ATOM 5064  H HA   . PRO A 1 78  ? 20.390  -0.038  5.059   1.00 0.00 ? 78  PRO A HA   3  
ATOM 5065  H HB2  . PRO A 1 78  ? 22.967  0.728   4.681   1.00 0.00 ? 78  PRO A HB2  3  
ATOM 5066  H HB3  . PRO A 1 78  ? 22.161  -0.468  3.659   1.00 0.00 ? 78  PRO A HB3  3  
ATOM 5067  H HG2  . PRO A 1 78  ? 22.637  2.444   3.153   1.00 0.00 ? 78  PRO A HG2  3  
ATOM 5068  H HG3  . PRO A 1 78  ? 22.814  1.072   2.044   1.00 0.00 ? 78  PRO A HG3  3  
ATOM 5069  H HD2  . PRO A 1 78  ? 20.648  2.696   2.017   1.00 0.00 ? 78  PRO A HD2  3  
ATOM 5070  H HD3  . PRO A 1 78  ? 20.554  0.972   1.606   1.00 0.00 ? 78  PRO A HD3  3  
ATOM 5071  N N    . SER A 1 79  ? 20.419  3.032   5.705   1.00 0.00 ? 79  SER A N    3  
ATOM 5072  C CA   . SER A 1 79  ? 20.542  4.061   6.730   1.00 0.00 ? 79  SER A CA   3  
ATOM 5073  C C    . SER A 1 79  ? 19.167  4.543   7.183   1.00 0.00 ? 79  SER A C    3  
ATOM 5074  O O    . SER A 1 79  ? 19.018  5.667   7.663   1.00 0.00 ? 79  SER A O    3  
ATOM 5075  C CB   . SER A 1 79  ? 21.360  5.242   6.203   1.00 0.00 ? 79  SER A CB   3  
ATOM 5076  O OG   . SER A 1 79  ? 22.742  5.057   6.455   1.00 0.00 ? 79  SER A OG   3  
ATOM 5077  H H    . SER A 1 79  ? 19.874  3.211   4.910   1.00 0.00 ? 79  SER A H    3  
ATOM 5078  H HA   . SER A 1 79  ? 21.055  3.628   7.576   1.00 0.00 ? 79  SER A HA   3  
ATOM 5079  H HB2  . SER A 1 79  ? 21.210  5.333   5.138   1.00 0.00 ? 79  SER A HB2  3  
ATOM 5080  H HB3  . SER A 1 79  ? 21.035  6.149   6.692   1.00 0.00 ? 79  SER A HB3  3  
ATOM 5081  H HG   . SER A 1 79  ? 22.987  4.152   6.249   1.00 0.00 ? 79  SER A HG   3  
ATOM 5082  N N    . ASP A 1 80  ? 18.165  3.685   7.027   1.00 0.00 ? 80  ASP A N    3  
ATOM 5083  C CA   . ASP A 1 80  ? 16.802  4.021   7.420   1.00 0.00 ? 80  ASP A CA   3  
ATOM 5084  C C    . ASP A 1 80  ? 16.478  3.450   8.798   1.00 0.00 ? 80  ASP A C    3  
ATOM 5085  O O    . ASP A 1 80  ? 17.152  2.540   9.278   1.00 0.00 ? 80  ASP A O    3  
ATOM 5086  C CB   . ASP A 1 80  ? 15.805  3.491   6.388   1.00 0.00 ? 80  ASP A CB   3  
ATOM 5087  C CG   . ASP A 1 80  ? 15.827  4.291   5.100   1.00 0.00 ? 80  ASP A CG   3  
ATOM 5088  O OD1  . ASP A 1 80  ? 16.722  5.147   4.949   1.00 0.00 ? 80  ASP A OD1  3  
ATOM 5089  O OD2  . ASP A 1 80  ? 14.947  4.061   4.244   1.00 0.00 ? 80  ASP A OD2  3  
ATOM 5090  H H    . ASP A 1 80  ? 18.348  2.803   6.639   1.00 0.00 ? 80  ASP A H    3  
ATOM 5091  H HA   . ASP A 1 80  ? 16.725  5.096   7.463   1.00 0.00 ? 80  ASP A HA   3  
ATOM 5092  H HB2  . ASP A 1 80  ? 16.048  2.464   6.156   1.00 0.00 ? 80  ASP A HB2  3  
ATOM 5093  H HB3  . ASP A 1 80  ? 14.809  3.536   6.803   1.00 0.00 ? 80  ASP A HB3  3  
ATOM 5094  N N    . ASN A 1 81  ? 15.441  3.993   9.428   1.00 0.00 ? 81  ASN A N    3  
ATOM 5095  C CA   . ASN A 1 81  ? 15.028  3.539   10.751  1.00 0.00 ? 81  ASN A CA   3  
ATOM 5096  C C    . ASN A 1 81  ? 14.078  2.350   10.646  1.00 0.00 ? 81  ASN A C    3  
ATOM 5097  O O    . ASN A 1 81  ? 13.114  2.244   11.406  1.00 0.00 ? 81  ASN A O    3  
ATOM 5098  C CB   . ASN A 1 81  ? 14.353  4.679   11.517  1.00 0.00 ? 81  ASN A CB   3  
ATOM 5099  C CG   . ASN A 1 81  ? 13.402  5.477   10.646  1.00 0.00 ? 81  ASN A CG   3  
ATOM 5100  O OD1  . ASN A 1 81  ? 13.827  6.303   9.838   1.00 0.00 ? 81  ASN A OD1  3  
ATOM 5101  N ND2  . ASN A 1 81  ? 12.107  5.232   10.807  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 5102  H H    . ASN A 1 81  ? 14.942  4.716   8.993   1.00 0.00 ? 81  ASN A H    3  
ATOM 5103  H HA   . ASN A 1 81  ? 15.913  3.232   11.287  1.00 0.00 ? 81  ASN A HA   3  
ATOM 5104  H HB2  . ASN A 1 81  ? 13.794  4.268   12.344  1.00 0.00 ? 81  ASN A HB2  3  
ATOM 5105  H HB3  . ASN A 1 81  ? 15.111  5.348   11.897  1.00 0.00 ? 81  ASN A HB3  3  
ATOM 5106  H HD21 . ASN A 1 81  ? 11.841  4.560   11.469  1.00 0.00 ? 81  ASN A HD21 3  
ATOM 5107  H HD22 . ASN A 1 81  ? 11.469  5.733   10.257  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 5108  N N    . ILE A 1 82  ? 14.357  1.458   9.702   1.00 0.00 ? 82  ILE A N    3  
ATOM 5109  C CA   . ILE A 1 82  ? 13.528  0.276   9.499   1.00 0.00 ? 82  ILE A CA   3  
ATOM 5110  C C    . ILE A 1 82  ? 14.283  -0.995  9.872   1.00 0.00 ? 82  ILE A C    3  
ATOM 5111  O O    . ILE A 1 82  ? 14.874  -1.653  9.015   1.00 0.00 ? 82  ILE A O    3  
ATOM 5112  C CB   . ILE A 1 82  ? 13.051  0.167   8.039   1.00 0.00 ? 82  ILE A CB   3  
ATOM 5113  C CG1  . ILE A 1 82  ? 12.151  1.352   7.683   1.00 0.00 ? 82  ILE A CG1  3  
ATOM 5114  C CG2  . ILE A 1 82  ? 12.317  -1.147  7.818   1.00 0.00 ? 82  ILE A CG2  3  
ATOM 5115  C CD1  . ILE A 1 82  ? 10.961  1.505   8.605   1.00 0.00 ? 82  ILE A CD1  3  
ATOM 5116  H H    . ILE A 1 82  ? 15.138  1.598   9.128   1.00 0.00 ? 82  ILE A H    3  
ATOM 5117  H HA   . ILE A 1 82  ? 12.659  0.366   10.135  1.00 0.00 ? 82  ILE A HA   3  
ATOM 5118  H HB   . ILE A 1 82  ? 13.919  0.178   7.398   1.00 0.00 ? 82  ILE A HB   3  
ATOM 5119  H HG12 . ILE A 1 82  ? 12.728  2.262   7.733   1.00 0.00 ? 82  ILE A HG12 3  
ATOM 5120  H HG13 . ILE A 1 82  ? 11.778  1.222   6.677   1.00 0.00 ? 82  ILE A HG13 3  
ATOM 5121  H HG21 . ILE A 1 82  ? 12.771  -1.680  6.996   1.00 0.00 ? 82  ILE A HG21 3  
ATOM 5122  H HG22 . ILE A 1 82  ? 12.380  -1.748  8.713   1.00 0.00 ? 82  ILE A HG22 3  
ATOM 5123  H HG23 . ILE A 1 82  ? 11.281  -0.948  7.590   1.00 0.00 ? 82  ILE A HG23 3  
ATOM 5124  H HD11 . ILE A 1 82  ? 10.308  2.277   8.223   1.00 0.00 ? 82  ILE A HD11 3  
ATOM 5125  H HD12 . ILE A 1 82  ? 10.422  0.571   8.655   1.00 0.00 ? 82  ILE A HD12 3  
ATOM 5126  H HD13 . ILE A 1 82  ? 11.303  1.779   9.592   1.00 0.00 ? 82  ILE A HD13 3  
ATOM 5127  N N    . SER A 1 83  ? 14.259  -1.336  11.156  1.00 0.00 ? 83  SER A N    3  
ATOM 5128  C CA   . SER A 1 83  ? 14.943  -2.528  11.644  1.00 0.00 ? 83  SER A CA   3  
ATOM 5129  C C    . SER A 1 83  ? 14.582  -3.745  10.798  1.00 0.00 ? 83  SER A C    3  
ATOM 5130  O O    . SER A 1 83  ? 15.449  -4.536  10.427  1.00 0.00 ? 83  SER A O    3  
ATOM 5131  C CB   . SER A 1 83  ? 14.583  -2.785  13.109  1.00 0.00 ? 83  SER A CB   3  
ATOM 5132  O OG   . SER A 1 83  ? 15.095  -4.031  13.548  1.00 0.00 ? 83  SER A OG   3  
ATOM 5133  H H    . SER A 1 83  ? 13.771  -0.771  11.792  1.00 0.00 ? 83  SER A H    3  
ATOM 5134  H HA   . SER A 1 83  ? 16.006  -2.354  11.569  1.00 0.00 ? 83  SER A HA   3  
ATOM 5135  H HB2  . SER A 1 83  ? 15.000  -2.002  13.722  1.00 0.00 ? 83  SER A HB2  3  
ATOM 5136  H HB3  . SER A 1 83  ? 13.508  -2.792  13.216  1.00 0.00 ? 83  SER A HB3  3  
ATOM 5137  H HG   . SER A 1 83  ? 15.000  -4.098  14.501  1.00 0.00 ? 83  SER A HG   3  
ATOM 5138  N N    . ARG A 1 84  ? 13.295  -3.889  10.499  1.00 0.00 ? 84  ARG A N    3  
ATOM 5139  C CA   . ARG A 1 84  ? 12.818  -5.011  9.698   1.00 0.00 ? 84  ARG A CA   3  
ATOM 5140  C C    . ARG A 1 84  ? 13.629  -5.146  8.413   1.00 0.00 ? 84  ARG A C    3  
ATOM 5141  O O    . ARG A 1 84  ? 14.204  -4.173  7.923   1.00 0.00 ? 84  ARG A O    3  
ATOM 5142  C CB   . ARG A 1 84  ? 11.336  -4.831  9.362   1.00 0.00 ? 84  ARG A CB   3  
ATOM 5143  C CG   . ARG A 1 84  ? 10.429  -4.841  10.581  1.00 0.00 ? 84  ARG A CG   3  
ATOM 5144  C CD   . ARG A 1 84  ? 9.110   -4.140  10.300  1.00 0.00 ? 84  ARG A CD   3  
ATOM 5145  N NE   . ARG A 1 84  ? 8.065   -4.543  11.238  1.00 0.00 ? 84  ARG A NE   3  
ATOM 5146  C CZ   . ARG A 1 84  ? 7.557   -5.769  11.289  1.00 0.00 ? 84  ARG A CZ   3  
ATOM 5147  N NH1  . ARG A 1 84  ? 7.995   -6.707  10.461  1.00 0.00 ? 84  ARG A NH1  3  
ATOM 5148  N NH2  . ARG A 1 84  ? 6.608   -6.059  12.171  1.00 0.00 ? 84  ARG A NH2  3  
ATOM 5149  H H    . ARG A 1 84  ? 12.651  -3.226  10.824  1.00 0.00 ? 84  ARG A H    3  
ATOM 5150  H HA   . ARG A 1 84  ? 12.939  -5.911  10.282  1.00 0.00 ? 84  ARG A HA   3  
ATOM 5151  H HB2  . ARG A 1 84  ? 11.207  -3.887  8.853   1.00 0.00 ? 84  ARG A HB2  3  
ATOM 5152  H HB3  . ARG A 1 84  ? 11.029  -5.630  8.705   1.00 0.00 ? 84  ARG A HB3  3  
ATOM 5153  H HG2  . ARG A 1 84  ? 10.228  -5.865  10.860  1.00 0.00 ? 84  ARG A HG2  3  
ATOM 5154  H HG3  . ARG A 1 84  ? 10.930  -4.337  11.395  1.00 0.00 ? 84  ARG A HG3  3  
ATOM 5155  H HD2  . ARG A 1 84  ? 9.260   -3.074  10.380  1.00 0.00 ? 84  ARG A HD2  3  
ATOM 5156  H HD3  . ARG A 1 84  ? 8.794   -4.385  9.297   1.00 0.00 ? 84  ARG A HD3  3  
ATOM 5157  H HE   . ARG A 1 84  ? 7.727   -3.866  11.859  1.00 0.00 ? 84  ARG A HE   3  
ATOM 5158  H HH11 . ARG A 1 84  ? 8.710   -6.492  9.796   1.00 0.00 ? 84  ARG A HH11 3  
ATOM 5159  H HH12 . ARG A 1 84  ? 7.611   -7.630  10.502  1.00 0.00 ? 84  ARG A HH12 3  
ATOM 5160  H HH21 . ARG A 1 84  ? 6.275   -5.355  12.797  1.00 0.00 ? 84  ARG A HH21 3  
ATOM 5161  H HH22 . ARG A 1 84  ? 6.226   -6.982  12.208  1.00 0.00 ? 84  ARG A HH22 3  
ATOM 5162  N N    . LYS A 1 85  ? 13.673  -6.358  7.871   1.00 0.00 ? 85  LYS A N    3  
ATOM 5163  C CA   . LYS A 1 85  ? 14.413  -6.622  6.643   1.00 0.00 ? 85  LYS A CA   3  
ATOM 5164  C C    . LYS A 1 85  ? 13.465  -6.758  5.456   1.00 0.00 ? 85  LYS A C    3  
ATOM 5165  O O    . LYS A 1 85  ? 12.260  -6.945  5.628   1.00 0.00 ? 85  LYS A O    3  
ATOM 5166  C CB   . LYS A 1 85  ? 15.249  -7.895  6.791   1.00 0.00 ? 85  LYS A CB   3  
ATOM 5167  C CG   . LYS A 1 85  ? 14.649  -8.909  7.749   1.00 0.00 ? 85  LYS A CG   3  
ATOM 5168  C CD   . LYS A 1 85  ? 15.289  -10.278 7.585   1.00 0.00 ? 85  LYS A CD   3  
ATOM 5169  C CE   . LYS A 1 85  ? 16.491  -10.445 8.501   1.00 0.00 ? 85  LYS A CE   3  
ATOM 5170  N NZ   . LYS A 1 85  ? 17.007  -11.842 8.490   1.00 0.00 ? 85  LYS A NZ   3  
ATOM 5171  H H    . LYS A 1 85  ? 13.195  -7.094  8.309   1.00 0.00 ? 85  LYS A H    3  
ATOM 5172  H HA   . LYS A 1 85  ? 15.073  -5.786  6.467   1.00 0.00 ? 85  LYS A HA   3  
ATOM 5173  H HB2  . LYS A 1 85  ? 15.348  -8.361  5.821   1.00 0.00 ? 85  LYS A HB2  3  
ATOM 5174  H HB3  . LYS A 1 85  ? 16.231  -7.626  7.153   1.00 0.00 ? 85  LYS A HB3  3  
ATOM 5175  H HG2  . LYS A 1 85  ? 14.805  -8.570  8.762   1.00 0.00 ? 85  LYS A HG2  3  
ATOM 5176  H HG3  . LYS A 1 85  ? 13.589  -8.992  7.554   1.00 0.00 ? 85  LYS A HG3  3  
ATOM 5177  H HD2  . LYS A 1 85  ? 14.560  -11.038 7.824   1.00 0.00 ? 85  LYS A HD2  3  
ATOM 5178  H HD3  . LYS A 1 85  ? 15.610  -10.395 6.559   1.00 0.00 ? 85  LYS A HD3  3  
ATOM 5179  H HE2  . LYS A 1 85  ? 17.273  -9.779  8.172   1.00 0.00 ? 85  LYS A HE2  3  
ATOM 5180  H HE3  . LYS A 1 85  ? 16.198  -10.186 9.508   1.00 0.00 ? 85  LYS A HE3  3  
ATOM 5181  H HZ1  . LYS A 1 85  ? 18.035  -11.842 8.335   1.00 0.00 ? 85  LYS A HZ1  3  
ATOM 5182  H HZ2  . LYS A 1 85  ? 16.552  -12.385 7.729   1.00 0.00 ? 85  LYS A HZ2  3  
ATOM 5183  H HZ3  . LYS A 1 85  ? 16.804  -12.304 9.399   1.00 0.00 ? 85  LYS A HZ3  3  
ATOM 5184  N N    . HIS A 1 86  ? 14.017  -6.665  4.250   1.00 0.00 ? 86  HIS A N    3  
ATOM 5185  C CA   . HIS A 1 86  ? 13.221  -6.781  3.034   1.00 0.00 ? 86  HIS A CA   3  
ATOM 5186  C C    . HIS A 1 86  ? 12.037  -5.819  3.066   1.00 0.00 ? 86  HIS A C    3  
ATOM 5187  O O    . HIS A 1 86  ? 10.894  -6.216  2.837   1.00 0.00 ? 86  HIS A O    3  
ATOM 5188  C CB   . HIS A 1 86  ? 12.722  -8.216  2.859   1.00 0.00 ? 86  HIS A CB   3  
ATOM 5189  C CG   . HIS A 1 86  ? 13.654  -9.246  3.419   1.00 0.00 ? 86  HIS A CG   3  
ATOM 5190  N ND1  . HIS A 1 86  ? 14.945  -9.418  2.966   1.00 0.00 ? 86  HIS A ND1  3  
ATOM 5191  C CD2  . HIS A 1 86  ? 13.477  -10.159 4.403   1.00 0.00 ? 86  HIS A CD2  3  
ATOM 5192  C CE1  . HIS A 1 86  ? 15.521  -10.394 3.646   1.00 0.00 ? 86  HIS A CE1  3  
ATOM 5193  N NE2  . HIS A 1 86  ? 14.651  -10.860 4.524   1.00 0.00 ? 86  HIS A NE2  3  
ATOM 5194  H H    . HIS A 1 86  ? 14.983  -6.516  4.177   1.00 0.00 ? 86  HIS A H    3  
ATOM 5195  H HA   . HIS A 1 86  ? 13.853  -6.525  2.197   1.00 0.00 ? 86  HIS A HA   3  
ATOM 5196  H HB2  . HIS A 1 86  ? 11.771  -8.323  3.359   1.00 0.00 ? 86  HIS A HB2  3  
ATOM 5197  H HB3  . HIS A 1 86  ? 12.595  -8.420  1.806   1.00 0.00 ? 86  HIS A HB3  3  
ATOM 5198  H HD1  . HIS A 1 86  ? 15.375  -8.904  2.252   1.00 0.00 ? 86  HIS A HD1  3  
ATOM 5199  H HD2  . HIS A 1 86  ? 12.578  -10.309 4.985   1.00 0.00 ? 86  HIS A HD2  3  
ATOM 5200  H HE1  . HIS A 1 86  ? 16.530  -10.751 3.507   1.00 0.00 ? 86  HIS A HE1  3  
ATOM 5201  H HE2  . HIS A 1 86  ? 14.791  -11.643 5.096   1.00 0.00 ? 86  HIS A HE2  3  
ATOM 5202  N N    . THR A 1 87  ? 12.318  -4.552  3.353   1.00 0.00 ? 87  THR A N    3  
ATOM 5203  C CA   . THR A 1 87  ? 11.277  -3.534  3.418   1.00 0.00 ? 87  THR A CA   3  
ATOM 5204  C C    . THR A 1 87  ? 11.462  -2.487  2.326   1.00 0.00 ? 87  THR A C    3  
ATOM 5205  O O    . THR A 1 87  ? 12.586  -2.195  1.916   1.00 0.00 ? 87  THR A O    3  
ATOM 5206  C CB   . THR A 1 87  ? 11.262  -2.831  4.789   1.00 0.00 ? 87  THR A CB   3  
ATOM 5207  O OG1  . THR A 1 87  ? 10.884  -3.760  5.811   1.00 0.00 ? 87  THR A OG1  3  
ATOM 5208  C CG2  . THR A 1 87  ? 10.297  -1.655  4.784   1.00 0.00 ? 87  THR A CG2  3  
ATOM 5209  H H    . THR A 1 87  ? 13.248  -4.297  3.526   1.00 0.00 ? 87  THR A H    3  
ATOM 5210  H HA   . THR A 1 87  ? 10.323  -4.022  3.277   1.00 0.00 ? 87  THR A HA   3  
ATOM 5211  H HB   . THR A 1 87  ? 12.256  -2.462  4.998   1.00 0.00 ? 87  THR A HB   3  
ATOM 5212  H HG1  . THR A 1 87  ? 11.153  -4.646  5.554   1.00 0.00 ? 87  THR A HG1  3  
ATOM 5213  H HG21 . THR A 1 87  ? 10.490  -1.036  3.921   1.00 0.00 ? 87  THR A HG21 3  
ATOM 5214  H HG22 . THR A 1 87  ? 10.435  -1.073  5.683   1.00 0.00 ? 87  THR A HG22 3  
ATOM 5215  H HG23 . THR A 1 87  ? 9.283   -2.022  4.745   1.00 0.00 ? 87  THR A HG23 3  
ATOM 5216  N N    . PHE A 1 88  ? 10.353  -1.924  1.857   1.00 0.00 ? 88  PHE A N    3  
ATOM 5217  C CA   . PHE A 1 88  ? 10.394  -0.909  0.811   1.00 0.00 ? 88  PHE A CA   3  
ATOM 5218  C C    . PHE A 1 88  ? 9.389   0.204   1.094   1.00 0.00 ? 88  PHE A C    3  
ATOM 5219  O O    . PHE A 1 88  ? 8.264   -0.053  1.522   1.00 0.00 ? 88  PHE A O    3  
ATOM 5220  C CB   . PHE A 1 88  ? 10.104  -1.539  -0.553  1.00 0.00 ? 88  PHE A CB   3  
ATOM 5221  C CG   . PHE A 1 88  ? 8.840   -2.350  -0.581  1.00 0.00 ? 88  PHE A CG   3  
ATOM 5222  C CD1  . PHE A 1 88  ? 8.712   -3.487  0.200   1.00 0.00 ? 88  PHE A CD1  3  
ATOM 5223  C CD2  . PHE A 1 88  ? 7.779   -1.974  -1.389  1.00 0.00 ? 88  PHE A CD2  3  
ATOM 5224  C CE1  . PHE A 1 88  ? 7.550   -4.235  0.174   1.00 0.00 ? 88  PHE A CE1  3  
ATOM 5225  C CE2  . PHE A 1 88  ? 6.614   -2.717  -1.418  1.00 0.00 ? 88  PHE A CE2  3  
ATOM 5226  C CZ   . PHE A 1 88  ? 6.499   -3.849  -0.635  1.00 0.00 ? 88  PHE A CZ   3  
ATOM 5227  H H    . PHE A 1 88  ? 9.486   -2.199  2.224   1.00 0.00 ? 88  PHE A H    3  
ATOM 5228  H HA   . PHE A 1 88  ? 11.387  -0.487  0.799   1.00 0.00 ? 88  PHE A HA   3  
ATOM 5229  H HB2  . PHE A 1 88  ? 10.013  -0.757  -1.291  1.00 0.00 ? 88  PHE A HB2  3  
ATOM 5230  H HB3  . PHE A 1 88  ? 10.923  -2.190  -0.822  1.00 0.00 ? 88  PHE A HB3  3  
ATOM 5231  H HD1  . PHE A 1 88  ? 9.533   -3.790  0.834   1.00 0.00 ? 88  PHE A HD1  3  
ATOM 5232  H HD2  . PHE A 1 88  ? 7.867   -1.088  -2.003  1.00 0.00 ? 88  PHE A HD2  3  
ATOM 5233  H HE1  . PHE A 1 88  ? 7.463   -5.119  0.788   1.00 0.00 ? 88  PHE A HE1  3  
ATOM 5234  H HE2  . PHE A 1 88  ? 5.794   -2.412  -2.052  1.00 0.00 ? 88  PHE A HE2  3  
ATOM 5235  H HZ   . PHE A 1 88  ? 5.590   -4.431  -0.657  1.00 0.00 ? 88  PHE A HZ   3  
ATOM 5236  N N    . LYS A 1 89  ? 9.804   1.443   0.851   1.00 0.00 ? 89  LYS A N    3  
ATOM 5237  C CA   . LYS A 1 89  ? 8.942   2.597   1.078   1.00 0.00 ? 89  LYS A CA   3  
ATOM 5238  C C    . LYS A 1 89  ? 8.702   3.360   -0.221  1.00 0.00 ? 89  LYS A C    3  
ATOM 5239  O O    . LYS A 1 89  ? 9.573   3.419   -1.087  1.00 0.00 ? 89  LYS A O    3  
ATOM 5240  C CB   . LYS A 1 89  ? 9.565   3.528   2.120   1.00 0.00 ? 89  LYS A CB   3  
ATOM 5241  C CG   . LYS A 1 89  ? 10.709  4.368   1.579   1.00 0.00 ? 89  LYS A CG   3  
ATOM 5242  C CD   . LYS A 1 89  ? 12.045  3.665   1.746   1.00 0.00 ? 89  LYS A CD   3  
ATOM 5243  C CE   . LYS A 1 89  ? 13.088  4.214   0.784   1.00 0.00 ? 89  LYS A CE   3  
ATOM 5244  N NZ   . LYS A 1 89  ? 13.546  5.575   1.179   1.00 0.00 ? 89  LYS A NZ   3  
ATOM 5245  H H    . LYS A 1 89  ? 10.713  1.584   0.510   1.00 0.00 ? 89  LYS A H    3  
ATOM 5246  H HA   . LYS A 1 89  ? 7.995   2.236   1.450   1.00 0.00 ? 89  LYS A HA   3  
ATOM 5247  H HB2  . LYS A 1 89  ? 8.801   4.194   2.493   1.00 0.00 ? 89  LYS A HB2  3  
ATOM 5248  H HB3  . LYS A 1 89  ? 9.941   2.931   2.939   1.00 0.00 ? 89  LYS A HB3  3  
ATOM 5249  H HG2  . LYS A 1 89  ? 10.541  4.555   0.529   1.00 0.00 ? 89  LYS A HG2  3  
ATOM 5250  H HG3  . LYS A 1 89  ? 10.737  5.308   2.113   1.00 0.00 ? 89  LYS A HG3  3  
ATOM 5251  H HD2  . LYS A 1 89  ? 12.395  3.810   2.757   1.00 0.00 ? 89  LYS A HD2  3  
ATOM 5252  H HD3  . LYS A 1 89  ? 11.913  2.610   1.556   1.00 0.00 ? 89  LYS A HD3  3  
ATOM 5253  H HE2  . LYS A 1 89  ? 13.936  3.547   0.773   1.00 0.00 ? 89  LYS A HE2  3  
ATOM 5254  H HE3  . LYS A 1 89  ? 12.656  4.262   -0.205  1.00 0.00 ? 89  LYS A HE3  3  
ATOM 5255  H HZ1  . LYS A 1 89  ? 12.999  6.298   0.670   1.00 0.00 ? 89  LYS A HZ1  3  
ATOM 5256  H HZ2  . LYS A 1 89  ? 14.554  5.692   0.951   1.00 0.00 ? 89  LYS A HZ2  3  
ATOM 5257  H HZ3  . LYS A 1 89  ? 13.415  5.713   2.202   1.00 0.00 ? 89  LYS A HZ3  3  
ATOM 5258  N N    . ALA A 1 90  ? 7.514   3.942   -0.348  1.00 0.00 ? 90  ALA A N    3  
ATOM 5259  C CA   . ALA A 1 90  ? 7.160   4.704   -1.540  1.00 0.00 ? 90  ALA A CA   3  
ATOM 5260  C C    . ALA A 1 90  ? 7.075   6.195   -1.232  1.00 0.00 ? 90  ALA A C    3  
ATOM 5261  O O    . ALA A 1 90  ? 6.286   6.620   -0.389  1.00 0.00 ? 90  ALA A O    3  
ATOM 5262  C CB   . ALA A 1 90  ? 5.843   4.205   -2.114  1.00 0.00 ? 90  ALA A CB   3  
ATOM 5263  H H    . ALA A 1 90  ? 6.860   3.859   0.377   1.00 0.00 ? 90  ALA A H    3  
ATOM 5264  H HA   . ALA A 1 90  ? 7.931   4.543   -2.280  1.00 0.00 ? 90  ALA A HA   3  
ATOM 5265  H HB1  . ALA A 1 90  ? 5.071   4.283   -1.363  1.00 0.00 ? 90  ALA A HB1  3  
ATOM 5266  H HB2  . ALA A 1 90  ? 5.574   4.806   -2.970  1.00 0.00 ? 90  ALA A HB2  3  
ATOM 5267  H HB3  . ALA A 1 90  ? 5.949   3.174   -2.416  1.00 0.00 ? 90  ALA A HB3  3  
ATOM 5268  N N    . GLU A 1 91  ? 7.893   6.985   -1.922  1.00 0.00 ? 91  GLU A N    3  
ATOM 5269  C CA   . GLU A 1 91  ? 7.909   8.429   -1.720  1.00 0.00 ? 91  GLU A CA   3  
ATOM 5270  C C    . GLU A 1 91  ? 7.270   9.151   -2.903  1.00 0.00 ? 91  GLU A C    3  
ATOM 5271  O O    . GLU A 1 91  ? 7.498   8.794   -4.059  1.00 0.00 ? 91  GLU A O    3  
ATOM 5272  C CB   . GLU A 1 91  ? 9.344   8.922   -1.521  1.00 0.00 ? 91  GLU A CB   3  
ATOM 5273  C CG   . GLU A 1 91  ? 10.019  9.363   -2.809  1.00 0.00 ? 91  GLU A CG   3  
ATOM 5274  C CD   . GLU A 1 91  ? 11.532  9.304   -2.724  1.00 0.00 ? 91  GLU A CD   3  
ATOM 5275  O OE1  . GLU A 1 91  ? 12.074  8.194   -2.545  1.00 0.00 ? 91  GLU A OE1  3  
ATOM 5276  O OE2  . GLU A 1 91  ? 12.174  10.370  -2.837  1.00 0.00 ? 91  GLU A OE2  3  
ATOM 5277  H H    . GLU A 1 91  ? 8.499   6.587   -2.580  1.00 0.00 ? 91  GLU A H    3  
ATOM 5278  H HA   . GLU A 1 91  ? 7.338   8.646   -0.830  1.00 0.00 ? 91  GLU A HA   3  
ATOM 5279  H HB2  . GLU A 1 91  ? 9.333   9.760   -0.839  1.00 0.00 ? 91  GLU A HB2  3  
ATOM 5280  H HB3  . GLU A 1 91  ? 9.929   8.124   -1.088  1.00 0.00 ? 91  GLU A HB3  3  
ATOM 5281  H HG2  . GLU A 1 91  ? 9.694   8.717   -3.611  1.00 0.00 ? 91  GLU A HG2  3  
ATOM 5282  H HG3  . GLU A 1 91  ? 9.725   10.379  -3.026  1.00 0.00 ? 91  GLU A HG3  3  
ATOM 5283  N N    . HIS A 1 92  ? 6.469   10.169  -2.605  1.00 0.00 ? 92  HIS A N    3  
ATOM 5284  C CA   . HIS A 1 92  ? 5.796   10.942  -3.643  1.00 0.00 ? 92  HIS A CA   3  
ATOM 5285  C C    . HIS A 1 92  ? 5.914   12.438  -3.368  1.00 0.00 ? 92  HIS A C    3  
ATOM 5286  O O    . HIS A 1 92  ? 4.973   13.065  -2.881  1.00 0.00 ? 92  HIS A O    3  
ATOM 5287  C CB   . HIS A 1 92  ? 4.323   10.542  -3.733  1.00 0.00 ? 92  HIS A CB   3  
ATOM 5288  C CG   . HIS A 1 92  ? 3.493   11.491  -4.540  1.00 0.00 ? 92  HIS A CG   3  
ATOM 5289  N ND1  . HIS A 1 92  ? 2.212   11.858  -4.187  1.00 0.00 ? 92  HIS A ND1  3  
ATOM 5290  C CD2  . HIS A 1 92  ? 3.769   12.152  -5.689  1.00 0.00 ? 92  HIS A CD2  3  
ATOM 5291  C CE1  . HIS A 1 92  ? 1.734   12.702  -5.084  1.00 0.00 ? 92  HIS A CE1  3  
ATOM 5292  N NE2  . HIS A 1 92  ? 2.660   12.897  -6.006  1.00 0.00 ? 92  HIS A NE2  3  
ATOM 5293  H H    . HIS A 1 92  ? 6.327   10.405  -1.665  1.00 0.00 ? 92  HIS A H    3  
ATOM 5294  H HA   . HIS A 1 92  ? 6.278   10.722  -4.584  1.00 0.00 ? 92  HIS A HA   3  
ATOM 5295  H HB2  . HIS A 1 92  ? 4.249   9.566   -4.190  1.00 0.00 ? 92  HIS A HB2  3  
ATOM 5296  H HB3  . HIS A 1 92  ? 3.907   10.500  -2.736  1.00 0.00 ? 92  HIS A HB3  3  
ATOM 5297  H HD1  . HIS A 1 92  ? 1.724   11.545  -3.397  1.00 0.00 ? 92  HIS A HD1  3  
ATOM 5298  H HD2  . HIS A 1 92  ? 4.690   12.102  -6.253  1.00 0.00 ? 92  HIS A HD2  3  
ATOM 5299  H HE1  . HIS A 1 92  ? 0.755   13.156  -5.067  1.00 0.00 ? 92  HIS A HE1  3  
ATOM 5300  H HE2  . HIS A 1 92  ? 2.535   13.411  -6.831  1.00 0.00 ? 92  HIS A HE2  3  
ATOM 5301  N N    . ALA A 1 93  ? 7.075   13.003  -3.682  1.00 0.00 ? 93  ALA A N    3  
ATOM 5302  C CA   . ALA A 1 93  ? 7.314   14.425  -3.471  1.00 0.00 ? 93  ALA A CA   3  
ATOM 5303  C C    . ALA A 1 93  ? 6.037   15.233  -3.676  1.00 0.00 ? 93  ALA A C    3  
ATOM 5304  O O    . ALA A 1 93  ? 5.717   15.632  -4.794  1.00 0.00 ? 93  ALA A O    3  
ATOM 5305  C CB   . ALA A 1 93  ? 8.410   14.920  -4.403  1.00 0.00 ? 93  ALA A CB   3  
ATOM 5306  H H    . ALA A 1 93  ? 7.786   12.451  -4.067  1.00 0.00 ? 93  ALA A H    3  
ATOM 5307  H HA   . ALA A 1 93  ? 7.653   14.559  -2.453  1.00 0.00 ? 93  ALA A HA   3  
ATOM 5308  H HB1  . ALA A 1 93  ? 9.361   14.881  -3.892  1.00 0.00 ? 93  ALA A HB1  3  
ATOM 5309  H HB2  . ALA A 1 93  ? 8.446   14.292  -5.280  1.00 0.00 ? 93  ALA A HB2  3  
ATOM 5310  H HB3  . ALA A 1 93  ? 8.200   15.938  -4.697  1.00 0.00 ? 93  ALA A HB3  3  
ATOM 5311  N N    . GLY A 1 94  ? 5.312   15.471  -2.587  1.00 0.00 ? 94  GLY A N    3  
ATOM 5312  C CA   . GLY A 1 94  ? 4.077   16.230  -2.670  1.00 0.00 ? 94  GLY A CA   3  
ATOM 5313  C C    . GLY A 1 94  ? 3.095   15.861  -1.576  1.00 0.00 ? 94  GLY A C    3  
ATOM 5314  O O    . GLY A 1 94  ? 2.318   16.699  -1.120  1.00 0.00 ? 94  GLY A O    3  
ATOM 5315  H H    . GLY A 1 94  ? 5.617   15.128  -1.721  1.00 0.00 ? 94  GLY A H    3  
ATOM 5316  H HA2  . GLY A 1 94  ? 4.308   17.282  -2.592  1.00 0.00 ? 94  GLY A HA2  3  
ATOM 5317  H HA3  . GLY A 1 94  ? 3.617   16.043  -3.629  1.00 0.00 ? 94  GLY A HA3  3  
ATOM 5318  N N    . VAL A 1 95  ? 3.129   14.601  -1.153  1.00 0.00 ? 95  VAL A N    3  
ATOM 5319  C CA   . VAL A 1 95  ? 2.234   14.122  -0.106  1.00 0.00 ? 95  VAL A CA   3  
ATOM 5320  C C    . VAL A 1 95  ? 3.020   13.574  1.080   1.00 0.00 ? 95  VAL A C    3  
ATOM 5321  O O    . VAL A 1 95  ? 3.116   14.219  2.124   1.00 0.00 ? 95  VAL A O    3  
ATOM 5322  C CB   . VAL A 1 95  ? 1.291   13.024  -0.633  1.00 0.00 ? 95  VAL A CB   3  
ATOM 5323  C CG1  . VAL A 1 95  ? 0.361   12.543  0.471   1.00 0.00 ? 95  VAL A CG1  3  
ATOM 5324  C CG2  . VAL A 1 95  ? 0.496   13.533  -1.826  1.00 0.00 ? 95  VAL A CG2  3  
ATOM 5325  H H    . VAL A 1 95  ? 3.771   13.979  -1.555  1.00 0.00 ? 95  VAL A H    3  
ATOM 5326  H HA   . VAL A 1 95  ? 1.633   14.955  0.226   1.00 0.00 ? 95  VAL A HA   3  
ATOM 5327  H HB   . VAL A 1 95  ? 1.891   12.187  -0.958  1.00 0.00 ? 95  VAL A HB   3  
ATOM 5328  H HG11 . VAL A 1 95  ? 0.403   11.466  0.532   1.00 0.00 ? 95  VAL A HG11 3  
ATOM 5329  H HG12 . VAL A 1 95  ? 0.671   12.971  1.414   1.00 0.00 ? 95  VAL A HG12 3  
ATOM 5330  H HG13 . VAL A 1 95  ? -0.650  12.852  0.250   1.00 0.00 ? 95  VAL A HG13 3  
ATOM 5331  H HG21 . VAL A 1 95  ? 0.539   14.611  -1.855  1.00 0.00 ? 95  VAL A HG21 3  
ATOM 5332  H HG22 . VAL A 1 95  ? 0.917   13.131  -2.736  1.00 0.00 ? 95  VAL A HG22 3  
ATOM 5333  H HG23 . VAL A 1 95  ? -0.533  13.216  -1.736  1.00 0.00 ? 95  VAL A HG23 3  
ATOM 5334  N N    . ARG A 1 96  ? 3.581   12.382  0.911   1.00 0.00 ? 96  ARG A N    3  
ATOM 5335  C CA   . ARG A 1 96  ? 4.359   11.747  1.969   1.00 0.00 ? 96  ARG A CA   3  
ATOM 5336  C C    . ARG A 1 96  ? 5.054   10.490  1.453   1.00 0.00 ? 96  ARG A C    3  
ATOM 5337  O O    . ARG A 1 96  ? 4.997   10.180  0.263   1.00 0.00 ? 96  ARG A O    3  
ATOM 5338  C CB   . ARG A 1 96  ? 3.457   11.394  3.153   1.00 0.00 ? 96  ARG A CB   3  
ATOM 5339  C CG   . ARG A 1 96  ? 2.736   10.065  2.995   1.00 0.00 ? 96  ARG A CG   3  
ATOM 5340  C CD   . ARG A 1 96  ? 1.818   9.786   4.175   1.00 0.00 ? 96  ARG A CD   3  
ATOM 5341  N NE   . ARG A 1 96  ? 2.554   9.702   5.434   1.00 0.00 ? 96  ARG A NE   3  
ATOM 5342  C CZ   . ARG A 1 96  ? 3.284   8.651   5.789   1.00 0.00 ? 96  ARG A CZ   3  
ATOM 5343  N NH1  . ARG A 1 96  ? 3.375   7.600   4.986   1.00 0.00 ? 96  ARG A NH1  3  
ATOM 5344  N NH2  . ARG A 1 96  ? 3.925   8.649   6.951   1.00 0.00 ? 96  ARG A NH2  3  
ATOM 5345  H H    . ARG A 1 96  ? 3.469   11.917  0.056   1.00 0.00 ? 96  ARG A H    3  
ATOM 5346  H HA   . ARG A 1 96  ? 5.110   12.450  2.296   1.00 0.00 ? 96  ARG A HA   3  
ATOM 5347  H HB2  . ARG A 1 96  ? 4.059   11.348  4.048   1.00 0.00 ? 96  ARG A HB2  3  
ATOM 5348  H HB3  . ARG A 1 96  ? 2.715   12.170  3.268   1.00 0.00 ? 96  ARG A HB3  3  
ATOM 5349  H HG2  . ARG A 1 96  ? 2.145   10.092  2.092   1.00 0.00 ? 96  ARG A HG2  3  
ATOM 5350  H HG3  . ARG A 1 96  ? 3.469   9.275   2.926   1.00 0.00 ? 96  ARG A HG3  3  
ATOM 5351  H HD2  . ARG A 1 96  ? 1.093   10.583  4.246   1.00 0.00 ? 96  ARG A HD2  3  
ATOM 5352  H HD3  . ARG A 1 96  ? 1.309   8.850   4.003   1.00 0.00 ? 96  ARG A HD3  3  
ATOM 5353  H HE   . ARG A 1 96  ? 2.501   10.467  6.043   1.00 0.00 ? 96  ARG A HE   3  
ATOM 5354  H HH11 . ARG A 1 96  ? 2.894   7.599   4.109   1.00 0.00 ? 96  ARG A HH11 3  
ATOM 5355  H HH12 . ARG A 1 96  ? 3.927   6.810   5.256   1.00 0.00 ? 96  ARG A HH12 3  
ATOM 5356  H HH21 . ARG A 1 96  ? 3.859   9.439   7.560   1.00 0.00 ? 96  ARG A HH21 3  
ATOM 5357  H HH22 . ARG A 1 96  ? 4.474   7.857   7.218   1.00 0.00 ? 96  ARG A HH22 3  
ATOM 5358  N N    . THR A 1 97  ? 5.710   9.769   2.357   1.00 0.00 ? 97  THR A N    3  
ATOM 5359  C CA   . THR A 1 97  ? 6.417   8.548   1.994   1.00 0.00 ? 97  THR A CA   3  
ATOM 5360  C C    . THR A 1 97  ? 5.898   7.355   2.789   1.00 0.00 ? 97  THR A C    3  
ATOM 5361  O O    . THR A 1 97  ? 6.155   7.237   3.987   1.00 0.00 ? 97  THR A O    3  
ATOM 5362  C CB   . THR A 1 97  ? 7.933   8.686   2.228   1.00 0.00 ? 97  THR A CB   3  
ATOM 5363  O OG1  . THR A 1 97  ? 8.421   9.874   1.594   1.00 0.00 ? 97  THR A OG1  3  
ATOM 5364  C CG2  . THR A 1 97  ? 8.677   7.475   1.686   1.00 0.00 ? 97  THR A CG2  3  
ATOM 5365  H H    . THR A 1 97  ? 5.719   10.069  3.290   1.00 0.00 ? 97  THR A H    3  
ATOM 5366  H HA   . THR A 1 97  ? 6.251   8.367   0.942   1.00 0.00 ? 97  THR A HA   3  
ATOM 5367  H HB   . THR A 1 97  ? 8.113   8.754   3.291   1.00 0.00 ? 97  THR A HB   3  
ATOM 5368  H HG1  . THR A 1 97  ? 8.070   9.928   0.702   1.00 0.00 ? 97  THR A HG1  3  
ATOM 5369  H HG21 . THR A 1 97  ? 8.152   6.574   1.968   1.00 0.00 ? 97  THR A HG21 3  
ATOM 5370  H HG22 . THR A 1 97  ? 9.676   7.452   2.096   1.00 0.00 ? 97  THR A HG22 3  
ATOM 5371  H HG23 . THR A 1 97  ? 8.731   7.537   0.609   1.00 0.00 ? 97  THR A HG23 3  
ATOM 5372  N N    . TYR A 1 98  ? 5.168   6.474   2.115   1.00 0.00 ? 98  TYR A N    3  
ATOM 5373  C CA   . TYR A 1 98  ? 4.612   5.290   2.760   1.00 0.00 ? 98  TYR A CA   3  
ATOM 5374  C C    . TYR A 1 98  ? 5.668   4.198   2.899   1.00 0.00 ? 98  TYR A C    3  
ATOM 5375  O O    . TYR A 1 98  ? 6.633   4.150   2.136   1.00 0.00 ? 98  TYR A O    3  
ATOM 5376  C CB   . TYR A 1 98  ? 3.419   4.762   1.961   1.00 0.00 ? 98  TYR A CB   3  
ATOM 5377  C CG   . TYR A 1 98  ? 2.123   5.481   2.262   1.00 0.00 ? 98  TYR A CG   3  
ATOM 5378  C CD1  . TYR A 1 98  ? 1.828   6.700   1.664   1.00 0.00 ? 98  TYR A CD1  3  
ATOM 5379  C CD2  . TYR A 1 98  ? 1.195   4.943   3.144   1.00 0.00 ? 98  TYR A CD2  3  
ATOM 5380  C CE1  . TYR A 1 98  ? 0.645   7.362   1.936   1.00 0.00 ? 98  TYR A CE1  3  
ATOM 5381  C CE2  . TYR A 1 98  ? 0.010   5.596   3.421   1.00 0.00 ? 98  TYR A CE2  3  
ATOM 5382  C CZ   . TYR A 1 98  ? -0.260  6.805   2.814   1.00 0.00 ? 98  TYR A CZ   3  
ATOM 5383  O OH   . TYR A 1 98  ? -1.440  7.460   3.089   1.00 0.00 ? 98  TYR A OH   3  
ATOM 5384  H H    . TYR A 1 98  ? 4.998   6.623   1.162   1.00 0.00 ? 98  TYR A H    3  
ATOM 5385  H HA   . TYR A 1 98  ? 4.274   5.577   3.745   1.00 0.00 ? 98  TYR A HA   3  
ATOM 5386  H HB2  . TYR A 1 98  ? 3.622   4.873   0.907   1.00 0.00 ? 98  TYR A HB2  3  
ATOM 5387  H HB3  . TYR A 1 98  ? 3.278   3.715   2.188   1.00 0.00 ? 98  TYR A HB3  3  
ATOM 5388  H HD1  . TYR A 1 98  ? 2.539   7.134   0.976   1.00 0.00 ? 98  TYR A HD1  3  
ATOM 5389  H HD2  . TYR A 1 98  ? 1.410   3.996   3.618   1.00 0.00 ? 98  TYR A HD2  3  
ATOM 5390  H HE1  . TYR A 1 98  ? 0.433   8.308   1.461   1.00 0.00 ? 98  TYR A HE1  3  
ATOM 5391  H HE2  . TYR A 1 98  ? -0.700  5.161   4.109   1.00 0.00 ? 98  TYR A HE2  3  
ATOM 5392  H HH   . TYR A 1 98  ? -1.899  7.007   3.800   1.00 0.00 ? 98  TYR A HH   3  
ATOM 5393  N N    . PHE A 1 99  ? 5.478   3.322   3.880   1.00 0.00 ? 99  PHE A N    3  
ATOM 5394  C CA   . PHE A 1 99  ? 6.413   2.230   4.122   1.00 0.00 ? 99  PHE A CA   3  
ATOM 5395  C C    . PHE A 1 99  ? 5.697   0.883   4.088   1.00 0.00 ? 99  PHE A C    3  
ATOM 5396  O O    . PHE A 1 99  ? 4.542   0.771   4.502   1.00 0.00 ? 99  PHE A O    3  
ATOM 5397  C CB   . PHE A 1 99  ? 7.110   2.416   5.471   1.00 0.00 ? 99  PHE A CB   3  
ATOM 5398  C CG   . PHE A 1 99  ? 8.320   3.303   5.403   1.00 0.00 ? 99  PHE A CG   3  
ATOM 5399  C CD1  . PHE A 1 99  ? 8.191   4.681   5.477   1.00 0.00 ? 99  PHE A CD1  3  
ATOM 5400  C CD2  . PHE A 1 99  ? 9.587   2.760   5.263   1.00 0.00 ? 99  PHE A CD2  3  
ATOM 5401  C CE1  . PHE A 1 99  ? 9.302   5.500   5.415   1.00 0.00 ? 99  PHE A CE1  3  
ATOM 5402  C CE2  . PHE A 1 99  ? 10.702  3.574   5.201   1.00 0.00 ? 99  PHE A CE2  3  
ATOM 5403  C CZ   . PHE A 1 99  ? 10.560  4.946   5.276   1.00 0.00 ? 99  PHE A CZ   3  
ATOM 5404  H H    . PHE A 1 99  ? 4.689   3.413   4.456   1.00 0.00 ? 99  PHE A H    3  
ATOM 5405  H HA   . PHE A 1 99  ? 7.154   2.249   3.337   1.00 0.00 ? 99  PHE A HA   3  
ATOM 5406  H HB2  . PHE A 1 99  ? 6.415   2.857   6.169   1.00 0.00 ? 99  PHE A HB2  3  
ATOM 5407  H HB3  . PHE A 1 99  ? 7.425   1.452   5.841   1.00 0.00 ? 99  PHE A HB3  3  
ATOM 5408  H HD1  . PHE A 1 99  ? 7.207   5.116   5.586   1.00 0.00 ? 99  PHE A HD1  3  
ATOM 5409  H HD2  . PHE A 1 99  ? 9.701   1.687   5.203   1.00 0.00 ? 99  PHE A HD2  3  
ATOM 5410  H HE1  . PHE A 1 99  ? 9.187   6.572   5.474   1.00 0.00 ? 99  PHE A HE1  3  
ATOM 5411  H HE2  . PHE A 1 99  ? 11.684  3.138   5.092   1.00 0.00 ? 99  PHE A HE2  3  
ATOM 5412  H HZ   . PHE A 1 99  ? 11.429  5.584   5.228   1.00 0.00 ? 99  PHE A HZ   3  
ATOM 5413  N N    . PHE A 1 100 ? 6.390   -0.137  3.593   1.00 0.00 ? 100 PHE A N    3  
ATOM 5414  C CA   . PHE A 1 100 ? 5.820   -1.476  3.503   1.00 0.00 ? 100 PHE A CA   3  
ATOM 5415  C C    . PHE A 1 100 ? 6.900   -2.540  3.684   1.00 0.00 ? 100 PHE A C    3  
ATOM 5416  O O    . PHE A 1 100 ? 7.839   -2.627  2.893   1.00 0.00 ? 100 PHE A O    3  
ATOM 5417  C CB   . PHE A 1 100 ? 5.121   -1.668  2.156   1.00 0.00 ? 100 PHE A CB   3  
ATOM 5418  C CG   . PHE A 1 100 ? 4.156   -0.567  1.820   1.00 0.00 ? 100 PHE A CG   3  
ATOM 5419  C CD1  . PHE A 1 100 ? 2.875   -0.566  2.346   1.00 0.00 ? 100 PHE A CD1  3  
ATOM 5420  C CD2  . PHE A 1 100 ? 4.530   0.467   0.976   1.00 0.00 ? 100 PHE A CD2  3  
ATOM 5421  C CE1  . PHE A 1 100 ? 1.984   0.445   2.039   1.00 0.00 ? 100 PHE A CE1  3  
ATOM 5422  C CE2  . PHE A 1 100 ? 3.644   1.481   0.666   1.00 0.00 ? 100 PHE A CE2  3  
ATOM 5423  C CZ   . PHE A 1 100 ? 2.369   1.470   1.197   1.00 0.00 ? 100 PHE A CZ   3  
ATOM 5424  H H    . PHE A 1 100 ? 7.306   0.015   3.279   1.00 0.00 ? 100 PHE A H    3  
ATOM 5425  H HA   . PHE A 1 100 ? 5.094   -1.580  4.294   1.00 0.00 ? 100 PHE A HA   3  
ATOM 5426  H HB2  . PHE A 1 100 ? 5.865   -1.706  1.374   1.00 0.00 ? 100 PHE A HB2  3  
ATOM 5427  H HB3  . PHE A 1 100 ? 4.574   -2.598  2.171   1.00 0.00 ? 100 PHE A HB3  3  
ATOM 5428  H HD1  . PHE A 1 100 ? 2.572   -1.368  3.006   1.00 0.00 ? 100 PHE A HD1  3  
ATOM 5429  H HD2  . PHE A 1 100 ? 5.526   0.476   0.559   1.00 0.00 ? 100 PHE A HD2  3  
ATOM 5430  H HE1  . PHE A 1 100 ? 0.988   0.433   2.457   1.00 0.00 ? 100 PHE A HE1  3  
ATOM 5431  H HE2  . PHE A 1 100 ? 3.948   2.281   0.007   1.00 0.00 ? 100 PHE A HE2  3  
ATOM 5432  H HZ   . PHE A 1 100 ? 1.676   2.261   0.956   1.00 0.00 ? 100 PHE A HZ   3  
ATOM 5433  N N    . SER A 1 101 ? 6.759   -3.346  4.732   1.00 0.00 ? 101 SER A N    3  
ATOM 5434  C CA   . SER A 1 101 ? 7.723   -4.400  5.020   1.00 0.00 ? 101 SER A CA   3  
ATOM 5435  C C    . SER A 1 101 ? 7.244   -5.740  4.471   1.00 0.00 ? 101 SER A C    3  
ATOM 5436  O O    . SER A 1 101 ? 6.065   -5.911  4.162   1.00 0.00 ? 101 SER A O    3  
ATOM 5437  C CB   . SER A 1 101 ? 7.957   -4.509  6.528   1.00 0.00 ? 101 SER A CB   3  
ATOM 5438  O OG   . SER A 1 101 ? 8.867   -5.552  6.830   1.00 0.00 ? 101 SER A OG   3  
ATOM 5439  H H    . SER A 1 101 ? 5.988   -3.226  5.326   1.00 0.00 ? 101 SER A H    3  
ATOM 5440  H HA   . SER A 1 101 ? 8.654   -4.139  4.539   1.00 0.00 ? 101 SER A HA   3  
ATOM 5441  H HB2  . SER A 1 101 ? 8.361   -3.578  6.896   1.00 0.00 ? 101 SER A HB2  3  
ATOM 5442  H HB3  . SER A 1 101 ? 7.017   -4.712  7.021   1.00 0.00 ? 101 SER A HB3  3  
ATOM 5443  H HG   . SER A 1 101 ? 8.858   -5.721  7.775   1.00 0.00 ? 101 SER A HG   3  
ATOM 5444  N N    . ALA A 1 102 ? 8.167   -6.688  4.352   1.00 0.00 ? 102 ALA A N    3  
ATOM 5445  C CA   . ALA A 1 102 ? 7.840   -8.014  3.842   1.00 0.00 ? 102 ALA A CA   3  
ATOM 5446  C C    . ALA A 1 102 ? 8.501   -9.103  4.680   1.00 0.00 ? 102 ALA A C    3  
ATOM 5447  O O    . ALA A 1 102 ? 9.688   -9.022  4.995   1.00 0.00 ? 102 ALA A O    3  
ATOM 5448  C CB   . ALA A 1 102 ? 8.261   -8.138  2.385   1.00 0.00 ? 102 ALA A CB   3  
ATOM 5449  H H    . ALA A 1 102 ? 9.091   -6.492  4.614   1.00 0.00 ? 102 ALA A H    3  
ATOM 5450  H HA   . ALA A 1 102 ? 6.768   -8.136  3.893   1.00 0.00 ? 102 ALA A HA   3  
ATOM 5451  H HB1  . ALA A 1 102 ? 7.385   -8.272  1.768   1.00 0.00 ? 102 ALA A HB1  3  
ATOM 5452  H HB2  . ALA A 1 102 ? 8.780   -7.239  2.084   1.00 0.00 ? 102 ALA A HB2  3  
ATOM 5453  H HB3  . ALA A 1 102 ? 8.916   -8.988  2.270   1.00 0.00 ? 102 ALA A HB3  3  
ATOM 5454  N N    . GLU A 1 103 ? 7.725   -10.121 5.037   1.00 0.00 ? 103 GLU A N    3  
ATOM 5455  C CA   . GLU A 1 103 ? 8.236   -11.226 5.840   1.00 0.00 ? 103 GLU A CA   3  
ATOM 5456  C C    . GLU A 1 103 ? 9.494   -11.819 5.211   1.00 0.00 ? 103 GLU A C    3  
ATOM 5457  O O    . GLU A 1 103 ? 10.513  -11.993 5.881   1.00 0.00 ? 103 GLU A O    3  
ATOM 5458  C CB   . GLU A 1 103 ? 7.169   -12.312 5.993   1.00 0.00 ? 103 GLU A CB   3  
ATOM 5459  C CG   . GLU A 1 103 ? 5.877   -11.811 6.616   1.00 0.00 ? 103 GLU A CG   3  
ATOM 5460  C CD   . GLU A 1 103 ? 4.826   -12.899 6.734   1.00 0.00 ? 103 GLU A CD   3  
ATOM 5461  O OE1  . GLU A 1 103 ? 4.916   -13.711 7.678   1.00 0.00 ? 103 GLU A OE1  3  
ATOM 5462  O OE2  . GLU A 1 103 ? 3.915   -12.937 5.881   1.00 0.00 ? 103 GLU A OE2  3  
ATOM 5463  H H    . GLU A 1 103 ? 6.786   -10.130 4.755   1.00 0.00 ? 103 GLU A H    3  
ATOM 5464  H HA   . GLU A 1 103 ? 8.485   -10.839 6.817   1.00 0.00 ? 103 GLU A HA   3  
ATOM 5465  H HB2  . GLU A 1 103 ? 6.942   -12.716 5.018   1.00 0.00 ? 103 GLU A HB2  3  
ATOM 5466  H HB3  . GLU A 1 103 ? 7.563   -13.100 6.617   1.00 0.00 ? 103 GLU A HB3  3  
ATOM 5467  H HG2  . GLU A 1 103 ? 6.091   -11.431 7.603   1.00 0.00 ? 103 GLU A HG2  3  
ATOM 5468  H HG3  . GLU A 1 103 ? 5.481   -11.014 6.003   1.00 0.00 ? 103 GLU A HG3  3  
ATOM 5469  N N    . SER A 1 104 ? 9.414   -12.127 3.921   1.00 0.00 ? 104 SER A N    3  
ATOM 5470  C CA   . SER A 1 104 ? 10.544  -12.705 3.202   1.00 0.00 ? 104 SER A CA   3  
ATOM 5471  C C    . SER A 1 104 ? 10.987  -11.792 2.063   1.00 0.00 ? 104 SER A C    3  
ATOM 5472  O O    . SER A 1 104 ? 10.231  -10.950 1.578   1.00 0.00 ? 104 SER A O    3  
ATOM 5473  C CB   . SER A 1 104 ? 10.174  -14.083 2.651   1.00 0.00 ? 104 SER A CB   3  
ATOM 5474  O OG   . SER A 1 104 ? 10.440  -15.100 3.601   1.00 0.00 ? 104 SER A OG   3  
ATOM 5475  H H    . SER A 1 104 ? 8.575   -11.965 3.442   1.00 0.00 ? 104 SER A H    3  
ATOM 5476  H HA   . SER A 1 104 ? 11.361  -12.813 3.900   1.00 0.00 ? 104 SER A HA   3  
ATOM 5477  H HB2  . SER A 1 104 ? 9.123   -14.101 2.408   1.00 0.00 ? 104 SER A HB2  3  
ATOM 5478  H HB3  . SER A 1 104 ? 10.753  -14.279 1.760   1.00 0.00 ? 104 SER A HB3  3  
ATOM 5479  H HG   . SER A 1 104 ? 11.279  -14.924 4.033   1.00 0.00 ? 104 SER A HG   3  
ATOM 5480  N N    . PRO A 1 105 ? 12.244  -11.960 1.626   1.00 0.00 ? 105 PRO A N    3  
ATOM 5481  C CA   . PRO A 1 105 ? 12.818  -11.161 0.539   1.00 0.00 ? 105 PRO A CA   3  
ATOM 5482  C C    . PRO A 1 105 ? 12.199  -11.493 -0.814  1.00 0.00 ? 105 PRO A C    3  
ATOM 5483  O O    . PRO A 1 105 ? 12.313  -10.720 -1.765  1.00 0.00 ? 105 PRO A O    3  
ATOM 5484  C CB   . PRO A 1 105 ? 14.299  -11.547 0.559   1.00 0.00 ? 105 PRO A CB   3  
ATOM 5485  C CG   . PRO A 1 105 ? 14.328  -12.908 1.163   1.00 0.00 ? 105 PRO A CG   3  
ATOM 5486  C CD   . PRO A 1 105 ? 13.202  -12.943 2.159   1.00 0.00 ? 105 PRO A CD   3  
ATOM 5487  H HA   . PRO A 1 105 ? 12.718  -10.102 0.730   1.00 0.00 ? 105 PRO A HA   3  
ATOM 5488  H HB2  . PRO A 1 105 ? 14.685  -11.553 -0.451  1.00 0.00 ? 105 PRO A HB2  3  
ATOM 5489  H HB3  . PRO A 1 105 ? 14.852  -10.838 1.157   1.00 0.00 ? 105 PRO A HB3  3  
ATOM 5490  H HG2  . PRO A 1 105 ? 14.174  -13.653 0.397   1.00 0.00 ? 105 PRO A HG2  3  
ATOM 5491  H HG3  . PRO A 1 105 ? 15.273  -13.069 1.660   1.00 0.00 ? 105 PRO A HG3  3  
ATOM 5492  H HD2  . PRO A 1 105 ? 12.762  -13.929 2.197   1.00 0.00 ? 105 PRO A HD2  3  
ATOM 5493  H HD3  . PRO A 1 105 ? 13.554  -12.648 3.136   1.00 0.00 ? 105 PRO A HD3  3  
ATOM 5494  N N    . GLU A 1 106 ? 11.543  -12.647 -0.892  1.00 0.00 ? 106 GLU A N    3  
ATOM 5495  C CA   . GLU A 1 106 ? 10.907  -13.080 -2.130  1.00 0.00 ? 106 GLU A CA   3  
ATOM 5496  C C    . GLU A 1 106 ? 9.668   -12.241 -2.428  1.00 0.00 ? 106 GLU A C    3  
ATOM 5497  O O    . GLU A 1 106 ? 9.369   -11.945 -3.585  1.00 0.00 ? 106 GLU A O    3  
ATOM 5498  C CB   . GLU A 1 106 ? 10.525  -14.559 -2.043  1.00 0.00 ? 106 GLU A CB   3  
ATOM 5499  C CG   . GLU A 1 106 ? 11.719  -15.491 -1.922  1.00 0.00 ? 106 GLU A CG   3  
ATOM 5500  C CD   . GLU A 1 106 ? 11.326  -16.954 -1.975  1.00 0.00 ? 106 GLU A CD   3  
ATOM 5501  O OE1  . GLU A 1 106 ? 10.501  -17.377 -1.138  1.00 0.00 ? 106 GLU A OE1  3  
ATOM 5502  O OE2  . GLU A 1 106 ? 11.843  -17.676 -2.853  1.00 0.00 ? 106 GLU A OE2  3  
ATOM 5503  H H    . GLU A 1 106 ? 11.487  -13.220 -0.099  1.00 0.00 ? 106 GLU A H    3  
ATOM 5504  H HA   . GLU A 1 106 ? 11.617  -12.949 -2.932  1.00 0.00 ? 106 GLU A HA   3  
ATOM 5505  H HB2  . GLU A 1 106 ? 9.891   -14.705 -1.180  1.00 0.00 ? 106 GLU A HB2  3  
ATOM 5506  H HB3  . GLU A 1 106 ? 9.973   -14.829 -2.932  1.00 0.00 ? 106 GLU A HB3  3  
ATOM 5507  H HG2  . GLU A 1 106 ? 12.401  -15.288 -2.734  1.00 0.00 ? 106 GLU A HG2  3  
ATOM 5508  H HG3  . GLU A 1 106 ? 12.214  -15.300 -0.981  1.00 0.00 ? 106 GLU A HG3  3  
ATOM 5509  N N    . GLU A 1 107 ? 8.950   -11.861 -1.375  1.00 0.00 ? 107 GLU A N    3  
ATOM 5510  C CA   . GLU A 1 107 ? 7.743   -11.056 -1.524  1.00 0.00 ? 107 GLU A CA   3  
ATOM 5511  C C    . GLU A 1 107 ? 8.093   -9.597  -1.802  1.00 0.00 ? 107 GLU A C    3  
ATOM 5512  O O    . GLU A 1 107 ? 7.533   -8.976  -2.705  1.00 0.00 ? 107 GLU A O    3  
ATOM 5513  C CB   . GLU A 1 107 ? 6.880   -11.154 -0.264  1.00 0.00 ? 107 GLU A CB   3  
ATOM 5514  C CG   . GLU A 1 107 ? 6.177   -12.493 -0.111  1.00 0.00 ? 107 GLU A CG   3  
ATOM 5515  C CD   . GLU A 1 107 ? 7.099   -13.580 0.408   1.00 0.00 ? 107 GLU A CD   3  
ATOM 5516  O OE1  . GLU A 1 107 ? 7.952   -14.054 -0.371  1.00 0.00 ? 107 GLU A OE1  3  
ATOM 5517  O OE2  . GLU A 1 107 ? 6.966   -13.956 1.591   1.00 0.00 ? 107 GLU A OE2  3  
ATOM 5518  H H    . GLU A 1 107 ? 9.240   -12.128 -0.478  1.00 0.00 ? 107 GLU A H    3  
ATOM 5519  H HA   . GLU A 1 107 ? 7.186   -11.447 -2.362  1.00 0.00 ? 107 GLU A HA   3  
ATOM 5520  H HB2  . GLU A 1 107 ? 7.508   -10.999 0.601   1.00 0.00 ? 107 GLU A HB2  3  
ATOM 5521  H HB3  . GLU A 1 107 ? 6.129   -10.379 -0.297  1.00 0.00 ? 107 GLU A HB3  3  
ATOM 5522  H HG2  . GLU A 1 107 ? 5.357   -12.377 0.582   1.00 0.00 ? 107 GLU A HG2  3  
ATOM 5523  H HG3  . GLU A 1 107 ? 5.793   -12.796 -1.074  1.00 0.00 ? 107 GLU A HG3  3  
ATOM 5524  N N    . GLN A 1 108 ? 9.020   -9.057  -1.018  1.00 0.00 ? 108 GLN A N    3  
ATOM 5525  C CA   . GLN A 1 108 ? 9.443   -7.671  -1.179  1.00 0.00 ? 108 GLN A CA   3  
ATOM 5526  C C    . GLN A 1 108 ? 9.820   -7.382  -2.629  1.00 0.00 ? 108 GLN A C    3  
ATOM 5527  O O    . GLN A 1 108 ? 9.186   -6.563  -3.293  1.00 0.00 ? 108 GLN A O    3  
ATOM 5528  C CB   . GLN A 1 108 ? 10.628  -7.367  -0.261  1.00 0.00 ? 108 GLN A CB   3  
ATOM 5529  C CG   . GLN A 1 108 ? 11.256  -6.005  -0.509  1.00 0.00 ? 108 GLN A CG   3  
ATOM 5530  C CD   . GLN A 1 108 ? 12.712  -5.948  -0.088  1.00 0.00 ? 108 GLN A CD   3  
ATOM 5531  O OE1  . GLN A 1 108 ? 13.398  -6.969  -0.047  1.00 0.00 ? 108 GLN A OE1  3  
ATOM 5532  N NE2  . GLN A 1 108 ? 13.191  -4.750  0.227   1.00 0.00 ? 108 GLN A NE2  3  
ATOM 5533  H H    . GLN A 1 108 ? 9.429   -9.603  -0.316  1.00 0.00 ? 108 GLN A H    3  
ATOM 5534  H HA   . GLN A 1 108 ? 8.614   -7.037  -0.903  1.00 0.00 ? 108 GLN A HA   3  
ATOM 5535  H HB2  . GLN A 1 108 ? 10.293  -7.405  0.764   1.00 0.00 ? 108 GLN A HB2  3  
ATOM 5536  H HB3  . GLN A 1 108 ? 11.387  -8.121  -0.411  1.00 0.00 ? 108 GLN A HB3  3  
ATOM 5537  H HG2  . GLN A 1 108 ? 11.193  -5.780  -1.563  1.00 0.00 ? 108 GLN A HG2  3  
ATOM 5538  H HG3  . GLN A 1 108 ? 10.706  -5.263  0.050   1.00 0.00 ? 108 GLN A HG3  3  
ATOM 5539  H HE21 . GLN A 1 108 ? 12.585  -3.981  0.172   1.00 0.00 ? 108 GLN A HE21 3  
ATOM 5540  H HE22 . GLN A 1 108 ? 14.128  -4.685  0.503   1.00 0.00 ? 108 GLN A HE22 3  
ATOM 5541  N N    . GLU A 1 109 ? 10.857  -8.059  -3.112  1.00 0.00 ? 109 GLU A N    3  
ATOM 5542  C CA   . GLU A 1 109 ? 11.318  -7.873  -4.483  1.00 0.00 ? 109 GLU A CA   3  
ATOM 5543  C C    . GLU A 1 109 ? 10.172  -8.061  -5.473  1.00 0.00 ? 109 GLU A C    3  
ATOM 5544  O O    . GLU A 1 109 ? 9.955   -7.229  -6.352  1.00 0.00 ? 109 GLU A O    3  
ATOM 5545  C CB   . GLU A 1 109 ? 12.448  -8.854  -4.802  1.00 0.00 ? 109 GLU A CB   3  
ATOM 5546  C CG   . GLU A 1 109 ? 11.961  -10.205 -5.297  1.00 0.00 ? 109 GLU A CG   3  
ATOM 5547  C CD   . GLU A 1 109 ? 13.098  -11.131 -5.681  1.00 0.00 ? 109 GLU A CD   3  
ATOM 5548  O OE1  . GLU A 1 109 ? 13.719  -11.718 -4.771  1.00 0.00 ? 109 GLU A OE1  3  
ATOM 5549  O OE2  . GLU A 1 109 ? 13.367  -11.268 -6.893  1.00 0.00 ? 109 GLU A OE2  3  
ATOM 5550  H H    . GLU A 1 109 ? 11.322  -8.699  -2.533  1.00 0.00 ? 109 GLU A H    3  
ATOM 5551  H HA   . GLU A 1 109 ? 11.693  -6.865  -4.572  1.00 0.00 ? 109 GLU A HA   3  
ATOM 5552  H HB2  . GLU A 1 109 ? 13.081  -8.421  -5.562  1.00 0.00 ? 109 GLU A HB2  3  
ATOM 5553  H HB3  . GLU A 1 109 ? 13.034  -9.012  -3.908  1.00 0.00 ? 109 GLU A HB3  3  
ATOM 5554  H HG2  . GLU A 1 109 ? 11.383  -10.674 -4.515  1.00 0.00 ? 109 GLU A HG2  3  
ATOM 5555  H HG3  . GLU A 1 109 ? 11.333  -10.051 -6.163  1.00 0.00 ? 109 GLU A HG3  3  
ATOM 5556  N N    . ALA A 1 110 ? 9.443   -9.162  -5.322  1.00 0.00 ? 110 ALA A N    3  
ATOM 5557  C CA   . ALA A 1 110 ? 8.319   -9.460  -6.201  1.00 0.00 ? 110 ALA A CA   3  
ATOM 5558  C C    . ALA A 1 110 ? 7.291   -8.333  -6.179  1.00 0.00 ? 110 ALA A C    3  
ATOM 5559  O O    . ALA A 1 110 ? 6.679   -8.019  -7.200  1.00 0.00 ? 110 ALA A O    3  
ATOM 5560  C CB   . ALA A 1 110 ? 7.670   -10.776 -5.801  1.00 0.00 ? 110 ALA A CB   3  
ATOM 5561  H H    . ALA A 1 110 ? 9.665   -9.788  -4.602  1.00 0.00 ? 110 ALA A H    3  
ATOM 5562  H HA   . ALA A 1 110 ? 8.700   -9.566  -7.207  1.00 0.00 ? 110 ALA A HA   3  
ATOM 5563  H HB1  . ALA A 1 110 ? 8.437   -11.516 -5.623  1.00 0.00 ? 110 ALA A HB1  3  
ATOM 5564  H HB2  . ALA A 1 110 ? 7.092   -10.633 -4.899  1.00 0.00 ? 110 ALA A HB2  3  
ATOM 5565  H HB3  . ALA A 1 110 ? 7.021   -11.114 -6.595  1.00 0.00 ? 110 ALA A HB3  3  
ATOM 5566  N N    . TRP A 1 111 ? 7.106   -7.731  -5.010  1.00 0.00 ? 111 TRP A N    3  
ATOM 5567  C CA   . TRP A 1 111 ? 6.152   -6.639  -4.856  1.00 0.00 ? 111 TRP A CA   3  
ATOM 5568  C C    . TRP A 1 111 ? 6.609   -5.403  -5.623  1.00 0.00 ? 111 TRP A C    3  
ATOM 5569  O O    . TRP A 1 111 ? 5.832   -4.798  -6.362  1.00 0.00 ? 111 TRP A O    3  
ATOM 5570  C CB   . TRP A 1 111 ? 5.971   -6.298  -3.376  1.00 0.00 ? 111 TRP A CB   3  
ATOM 5571  C CG   . TRP A 1 111 ? 4.866   -7.068  -2.719  1.00 0.00 ? 111 TRP A CG   3  
ATOM 5572  C CD1  . TRP A 1 111 ? 4.995   -8.021  -1.749  1.00 0.00 ? 111 TRP A CD1  3  
ATOM 5573  C CD2  . TRP A 1 111 ? 3.464   -6.953  -2.986  1.00 0.00 ? 111 TRP A CD2  3  
ATOM 5574  N NE1  . TRP A 1 111 ? 3.758   -8.505  -1.397  1.00 0.00 ? 111 TRP A NE1  3  
ATOM 5575  C CE2  . TRP A 1 111 ? 2.802   -7.865  -2.141  1.00 0.00 ? 111 TRP A CE2  3  
ATOM 5576  C CE3  . TRP A 1 111 ? 2.703   -6.166  -3.855  1.00 0.00 ? 111 TRP A CE3  3  
ATOM 5577  C CZ2  . TRP A 1 111 ? 1.418   -8.011  -2.143  1.00 0.00 ? 111 TRP A CZ2  3  
ATOM 5578  C CZ3  . TRP A 1 111 ? 1.329   -6.312  -3.856  1.00 0.00 ? 111 TRP A CZ3  3  
ATOM 5579  C CH2  . TRP A 1 111 ? 0.698   -7.228  -3.004  1.00 0.00 ? 111 TRP A CH2  3  
ATOM 5580  H H    . TRP A 1 111 ? 7.624   -8.026  -4.232  1.00 0.00 ? 111 TRP A H    3  
ATOM 5581  H HA   . TRP A 1 111 ? 5.205   -6.968  -5.258  1.00 0.00 ? 111 TRP A HA   3  
ATOM 5582  H HB2  . TRP A 1 111 ? 6.888   -6.514  -2.848  1.00 0.00 ? 111 TRP A HB2  3  
ATOM 5583  H HB3  . TRP A 1 111 ? 5.746   -5.245  -3.282  1.00 0.00 ? 111 TRP A HB3  3  
ATOM 5584  H HD1  . TRP A 1 111 ? 5.938   -8.339  -1.331  1.00 0.00 ? 111 TRP A HD1  3  
ATOM 5585  H HE1  . TRP A 1 111 ? 3.588   -9.195  -0.722  1.00 0.00 ? 111 TRP A HE1  3  
ATOM 5586  H HE3  . TRP A 1 111 ? 3.172   -5.455  -4.519  1.00 0.00 ? 111 TRP A HE3  3  
ATOM 5587  H HZ2  . TRP A 1 111 ? 0.916   -8.712  -1.491  1.00 0.00 ? 111 TRP A HZ2  3  
ATOM 5588  H HZ3  . TRP A 1 111 ? 0.725   -5.713  -4.521  1.00 0.00 ? 111 TRP A HZ3  3  
ATOM 5589  H HH2  . TRP A 1 111 ? -0.378  -7.309  -3.038  1.00 0.00 ? 111 TRP A HH2  3  
ATOM 5590  N N    . ILE A 1 112 ? 7.873   -5.035  -5.444  1.00 0.00 ? 112 ILE A N    3  
ATOM 5591  C CA   . ILE A 1 112 ? 8.432   -3.872  -6.121  1.00 0.00 ? 112 ILE A CA   3  
ATOM 5592  C C    . ILE A 1 112 ? 8.265   -3.982  -7.633  1.00 0.00 ? 112 ILE A C    3  
ATOM 5593  O O    . ILE A 1 112 ? 7.981   -2.994  -8.309  1.00 0.00 ? 112 ILE A O    3  
ATOM 5594  C CB   . ILE A 1 112 ? 9.926   -3.694  -5.793  1.00 0.00 ? 112 ILE A CB   3  
ATOM 5595  C CG1  . ILE A 1 112 ? 10.106  -3.308  -4.323  1.00 0.00 ? 112 ILE A CG1  3  
ATOM 5596  C CG2  . ILE A 1 112 ? 10.547  -2.643  -6.701  1.00 0.00 ? 112 ILE A CG2  3  
ATOM 5597  C CD1  . ILE A 1 112 ? 11.537  -3.407  -3.842  1.00 0.00 ? 112 ILE A CD1  3  
ATOM 5598  H H    . ILE A 1 112 ? 8.442   -5.558  -4.842  1.00 0.00 ? 112 ILE A H    3  
ATOM 5599  H HA   . ILE A 1 112 ? 7.901   -2.997  -5.774  1.00 0.00 ? 112 ILE A HA   3  
ATOM 5600  H HB   . ILE A 1 112 ? 10.426  -4.633  -5.975  1.00 0.00 ? 112 ILE A HB   3  
ATOM 5601  H HG12 . ILE A 1 112 ? 9.779   -2.290  -4.182  1.00 0.00 ? 112 ILE A HG12 3  
ATOM 5602  H HG13 . ILE A 1 112 ? 9.503   -3.964  -3.711  1.00 0.00 ? 112 ILE A HG13 3  
ATOM 5603  H HG21 . ILE A 1 112 ? 11.547  -2.418  -6.361  1.00 0.00 ? 112 ILE A HG21 3  
ATOM 5604  H HG22 . ILE A 1 112 ? 10.587  -3.019  -7.712  1.00 0.00 ? 112 ILE A HG22 3  
ATOM 5605  H HG23 . ILE A 1 112 ? 9.948   -1.745  -6.674  1.00 0.00 ? 112 ILE A HG23 3  
ATOM 5606  H HD11 . ILE A 1 112 ? 12.207  -3.272  -4.679  1.00 0.00 ? 112 ILE A HD11 3  
ATOM 5607  H HD12 . ILE A 1 112 ? 11.723  -2.641  -3.105  1.00 0.00 ? 112 ILE A HD12 3  
ATOM 5608  H HD13 . ILE A 1 112 ? 11.703  -4.379  -3.403  1.00 0.00 ? 112 ILE A HD13 3  
ATOM 5609  N N    . GLN A 1 113 ? 8.441   -5.192  -8.155  1.00 0.00 ? 113 GLN A N    3  
ATOM 5610  C CA   . GLN A 1 113 ? 8.308   -5.432  -9.587  1.00 0.00 ? 113 GLN A CA   3  
ATOM 5611  C C    . GLN A 1 113 ? 6.969   -4.916  -10.104 1.00 0.00 ? 113 GLN A C    3  
ATOM 5612  O O    . GLN A 1 113 ? 6.908   -4.239  -11.129 1.00 0.00 ? 113 GLN A O    3  
ATOM 5613  C CB   . GLN A 1 113 ? 8.444   -6.925  -9.890  1.00 0.00 ? 113 GLN A CB   3  
ATOM 5614  C CG   . GLN A 1 113 ? 9.786   -7.510  -9.479  1.00 0.00 ? 113 GLN A CG   3  
ATOM 5615  C CD   . GLN A 1 113 ? 10.210  -8.670  -10.358 1.00 0.00 ? 113 GLN A CD   3  
ATOM 5616  O OE1  . GLN A 1 113 ? 11.222  -8.597  -11.056 1.00 0.00 ? 113 GLN A OE1  3  
ATOM 5617  N NE2  . GLN A 1 113 ? 9.438   -9.749  -10.328 1.00 0.00 ? 113 GLN A NE2  3  
ATOM 5618  H H    . GLN A 1 113 ? 8.666   -5.940  -7.564  1.00 0.00 ? 113 GLN A H    3  
ATOM 5619  H HA   . GLN A 1 113 ? 9.103   -4.899  -10.087 1.00 0.00 ? 113 GLN A HA   3  
ATOM 5620  H HB2  . GLN A 1 113 ? 7.667   -7.459  -9.364  1.00 0.00 ? 113 GLN A HB2  3  
ATOM 5621  H HB3  . GLN A 1 113 ? 8.320   -7.078  -10.952 1.00 0.00 ? 113 GLN A HB3  3  
ATOM 5622  H HG2  . GLN A 1 113 ? 10.536  -6.736  -9.544  1.00 0.00 ? 113 GLN A HG2  3  
ATOM 5623  H HG3  . GLN A 1 113 ? 9.715   -7.857  -8.459  1.00 0.00 ? 113 GLN A HG3  3  
ATOM 5624  H HE21 . GLN A 1 113 ? 8.647   -9.736  -9.749  1.00 0.00 ? 113 GLN A HE21 3  
ATOM 5625  H HE22 . GLN A 1 113 ? 9.688   -10.514 -10.886 1.00 0.00 ? 113 GLN A HE22 3  
ATOM 5626  N N    . ALA A 1 114 ? 5.899   -5.241  -9.386  1.00 0.00 ? 114 ALA A N    3  
ATOM 5627  C CA   . ALA A 1 114 ? 4.561   -4.809  -9.772  1.00 0.00 ? 114 ALA A CA   3  
ATOM 5628  C C    . ALA A 1 114 ? 4.300   -3.372  -9.331  1.00 0.00 ? 114 ALA A C    3  
ATOM 5629  O O    . ALA A 1 114 ? 3.947   -2.519  -10.144 1.00 0.00 ? 114 ALA A O    3  
ATOM 5630  C CB   . ALA A 1 114 ? 3.515   -5.742  -9.181  1.00 0.00 ? 114 ALA A CB   3  
ATOM 5631  H H    . ALA A 1 114 ? 6.012   -5.783  -8.578  1.00 0.00 ? 114 ALA A H    3  
ATOM 5632  H HA   . ALA A 1 114 ? 4.490   -4.863  -10.848 1.00 0.00 ? 114 ALA A HA   3  
ATOM 5633  H HB1  . ALA A 1 114 ? 3.900   -6.189  -8.277  1.00 0.00 ? 114 ALA A HB1  3  
ATOM 5634  H HB2  . ALA A 1 114 ? 2.620   -5.180  -8.953  1.00 0.00 ? 114 ALA A HB2  3  
ATOM 5635  H HB3  . ALA A 1 114 ? 3.280   -6.518  -9.895  1.00 0.00 ? 114 ALA A HB3  3  
ATOM 5636  N N    . MET A 1 115 ? 4.476   -3.113  -8.040  1.00 0.00 ? 115 MET A N    3  
ATOM 5637  C CA   . MET A 1 115 ? 4.260   -1.779  -7.493  1.00 0.00 ? 115 MET A CA   3  
ATOM 5638  C C    . MET A 1 115 ? 5.158   -0.756  -8.182  1.00 0.00 ? 115 MET A C    3  
ATOM 5639  O O    . MET A 1 115 ? 4.675   0.173   -8.827  1.00 0.00 ? 115 MET A O    3  
ATOM 5640  C CB   . MET A 1 115 ? 4.524   -1.773  -5.986  1.00 0.00 ? 115 MET A CB   3  
ATOM 5641  C CG   . MET A 1 115 ? 3.299   -2.111  -5.152  1.00 0.00 ? 115 MET A CG   3  
ATOM 5642  S SD   . MET A 1 115 ? 3.382   -1.427  -3.486  1.00 0.00 ? 115 MET A SD   3  
ATOM 5643  C CE   . MET A 1 115 ? 2.969   -2.869  -2.507  1.00 0.00 ? 115 MET A CE   3  
ATOM 5644  H H    . MET A 1 115 ? 4.759   -3.835  -7.440  1.00 0.00 ? 115 MET A H    3  
ATOM 5645  H HA   . MET A 1 115 ? 3.229   -1.512  -7.669  1.00 0.00 ? 115 MET A HA   3  
ATOM 5646  H HB2  . MET A 1 115 ? 5.294   -2.497  -5.765  1.00 0.00 ? 115 MET A HB2  3  
ATOM 5647  H HB3  . MET A 1 115 ? 4.870   -0.792  -5.696  1.00 0.00 ? 115 MET A HB3  3  
ATOM 5648  H HG2  . MET A 1 115 ? 2.424   -1.714  -5.645  1.00 0.00 ? 115 MET A HG2  3  
ATOM 5649  H HG3  . MET A 1 115 ? 3.214   -3.185  -5.083  1.00 0.00 ? 115 MET A HG3  3  
ATOM 5650  H HE1  . MET A 1 115 ? 3.082   -3.758  -3.111  1.00 0.00 ? 115 MET A HE1  3  
ATOM 5651  H HE2  . MET A 1 115 ? 3.628   -2.926  -1.654  1.00 0.00 ? 115 MET A HE2  3  
ATOM 5652  H HE3  . MET A 1 115 ? 1.946   -2.792  -2.168  1.00 0.00 ? 115 MET A HE3  3  
ATOM 5653  N N    . GLY A 1 116 ? 6.468   -0.935  -8.041  1.00 0.00 ? 116 GLY A N    3  
ATOM 5654  C CA   . GLY A 1 116 ? 7.412   -0.019  -8.655  1.00 0.00 ? 116 GLY A CA   3  
ATOM 5655  C C    . GLY A 1 116 ? 6.981   0.413   -10.042 1.00 0.00 ? 116 GLY A C    3  
ATOM 5656  O O    . GLY A 1 116 ? 6.949   1.605   -10.346 1.00 0.00 ? 116 GLY A O    3  
ATOM 5657  H H    . GLY A 1 116 ? 6.796   -1.694  -7.515  1.00 0.00 ? 116 GLY A H    3  
ATOM 5658  H HA2  . GLY A 1 116 ? 7.507   0.856   -8.030  1.00 0.00 ? 116 GLY A HA2  3  
ATOM 5659  H HA3  . GLY A 1 116 ? 8.374   -0.506  -8.725  1.00 0.00 ? 116 GLY A HA3  3  
ATOM 5660  N N    . GLU A 1 117 ? 6.649   -0.558  -10.887 1.00 0.00 ? 117 GLU A N    3  
ATOM 5661  C CA   . GLU A 1 117 ? 6.221   -0.271  -12.251 1.00 0.00 ? 117 GLU A CA   3  
ATOM 5662  C C    . GLU A 1 117 ? 4.863   0.426   -12.259 1.00 0.00 ? 117 GLU A C    3  
ATOM 5663  O O    . GLU A 1 117 ? 4.719   1.522   -12.800 1.00 0.00 ? 117 GLU A O    3  
ATOM 5664  C CB   . GLU A 1 117 ? 6.149   -1.561  -13.070 1.00 0.00 ? 117 GLU A CB   3  
ATOM 5665  C CG   . GLU A 1 117 ? 7.480   -1.973  -13.675 1.00 0.00 ? 117 GLU A CG   3  
ATOM 5666  C CD   . GLU A 1 117 ? 7.352   -3.153  -14.619 1.00 0.00 ? 117 GLU A CD   3  
ATOM 5667  O OE1  . GLU A 1 117 ? 7.239   -4.295  -14.128 1.00 0.00 ? 117 GLU A OE1  3  
ATOM 5668  O OE2  . GLU A 1 117 ? 7.365   -2.933  -15.848 1.00 0.00 ? 117 GLU A OE2  3  
ATOM 5669  H H    . GLU A 1 117 ? 6.695   -1.490  -10.587 1.00 0.00 ? 117 GLU A H    3  
ATOM 5670  H HA   . GLU A 1 117 ? 6.952   0.387   -12.697 1.00 0.00 ? 117 GLU A HA   3  
ATOM 5671  H HB2  . GLU A 1 117 ? 5.805   -2.361  -12.430 1.00 0.00 ? 117 GLU A HB2  3  
ATOM 5672  H HB3  . GLU A 1 117 ? 5.440   -1.425  -13.873 1.00 0.00 ? 117 GLU A HB3  3  
ATOM 5673  H HG2  . GLU A 1 117 ? 7.887   -1.136  -14.222 1.00 0.00 ? 117 GLU A HG2  3  
ATOM 5674  H HG3  . GLU A 1 117 ? 8.156   -2.242  -12.876 1.00 0.00 ? 117 GLU A HG3  3  
ATOM 5675  N N    . ALA A 1 118 ? 3.870   -0.219  -11.655 1.00 0.00 ? 118 ALA A N    3  
ATOM 5676  C CA   . ALA A 1 118 ? 2.525   0.338   -11.591 1.00 0.00 ? 118 ALA A CA   3  
ATOM 5677  C C    . ALA A 1 118 ? 2.544   1.758   -11.036 1.00 0.00 ? 118 ALA A C    3  
ATOM 5678  O O    . ALA A 1 118 ? 1.644   2.553   -11.305 1.00 0.00 ? 118 ALA A O    3  
ATOM 5679  C CB   . ALA A 1 118 ? 1.626   -0.550  -10.744 1.00 0.00 ? 118 ALA A CB   3  
ATOM 5680  H H    . ALA A 1 118 ? 4.047   -1.089  -11.242 1.00 0.00 ? 118 ALA A H    3  
ATOM 5681  H HA   . ALA A 1 118 ? 2.125   0.361   -12.595 1.00 0.00 ? 118 ALA A HA   3  
ATOM 5682  H HB1  . ALA A 1 118 ? 2.232   -1.143  -10.076 1.00 0.00 ? 118 ALA A HB1  3  
ATOM 5683  H HB2  . ALA A 1 118 ? 0.952   0.068   -10.167 1.00 0.00 ? 118 ALA A HB2  3  
ATOM 5684  H HB3  . ALA A 1 118 ? 1.054   -1.202  -11.387 1.00 0.00 ? 118 ALA A HB3  3  
ATOM 5685  N N    . ALA A 1 119 ? 3.576   2.070   -10.259 1.00 0.00 ? 119 ALA A N    3  
ATOM 5686  C CA   . ALA A 1 119 ? 3.713   3.395   -9.666  1.00 0.00 ? 119 ALA A CA   3  
ATOM 5687  C C    . ALA A 1 119 ? 4.341   4.375   -10.652 1.00 0.00 ? 119 ALA A C    3  
ATOM 5688  O O    . ALA A 1 119 ? 3.919   5.527   -10.750 1.00 0.00 ? 119 ALA A O    3  
ATOM 5689  C CB   . ALA A 1 119 ? 4.542   3.321   -8.393  1.00 0.00 ? 119 ALA A CB   3  
ATOM 5690  H H    . ALA A 1 119 ? 4.263   1.394   -10.081 1.00 0.00 ? 119 ALA A H    3  
ATOM 5691  H HA   . ALA A 1 119 ? 2.726   3.747   -9.404  1.00 0.00 ? 119 ALA A HA   3  
ATOM 5692  H HB1  . ALA A 1 119 ? 4.003   3.791   -7.584  1.00 0.00 ? 119 ALA A HB1  3  
ATOM 5693  H HB2  . ALA A 1 119 ? 4.730   2.285   -8.146  1.00 0.00 ? 119 ALA A HB2  3  
ATOM 5694  H HB3  . ALA A 1 119 ? 5.482   3.831   -8.544  1.00 0.00 ? 119 ALA A HB3  3  
ATOM 5695  N N    . ARG A 1 120 ? 5.352   3.910   -11.378 1.00 0.00 ? 120 ARG A N    3  
ATOM 5696  C CA   . ARG A 1 120 ? 6.039   4.746   -12.355 1.00 0.00 ? 120 ARG A CA   3  
ATOM 5697  C C    . ARG A 1 120 ? 5.050   5.635   -13.102 1.00 0.00 ? 120 ARG A C    3  
ATOM 5698  O O    . ARG A 1 120 ? 3.855   5.343   -13.156 1.00 0.00 ? 120 ARG A O    3  
ATOM 5699  C CB   . ARG A 1 120 ? 6.811   3.877   -13.349 1.00 0.00 ? 120 ARG A CB   3  
ATOM 5700  C CG   . ARG A 1 120 ? 8.148   3.385   -12.819 1.00 0.00 ? 120 ARG A CG   3  
ATOM 5701  C CD   . ARG A 1 120 ? 8.815   2.426   -13.792 1.00 0.00 ? 120 ARG A CD   3  
ATOM 5702  N NE   . ARG A 1 120 ? 9.664   3.125   -14.754 1.00 0.00 ? 120 ARG A NE   3  
ATOM 5703  C CZ   . ARG A 1 120 ? 10.866  3.607   -14.459 1.00 0.00 ? 120 ARG A CZ   3  
ATOM 5704  N NH1  . ARG A 1 120 ? 11.358  3.467   -13.236 1.00 0.00 ? 120 ARG A NH1  3  
ATOM 5705  N NH2  . ARG A 1 120 ? 11.578  4.231   -15.388 1.00 0.00 ? 120 ARG A NH2  3  
ATOM 5706  H H    . ARG A 1 120 ? 5.644   2.982   -11.254 1.00 0.00 ? 120 ARG A H    3  
ATOM 5707  H HA   . ARG A 1 120 ? 6.738   5.374   -11.821 1.00 0.00 ? 120 ARG A HA   3  
ATOM 5708  H HB2  . ARG A 1 120 ? 6.210   3.015   -13.599 1.00 0.00 ? 120 ARG A HB2  3  
ATOM 5709  H HB3  . ARG A 1 120 ? 6.993   4.451   -14.245 1.00 0.00 ? 120 ARG A HB3  3  
ATOM 5710  H HG2  . ARG A 1 120 ? 8.798   4.234   -12.665 1.00 0.00 ? 120 ARG A HG2  3  
ATOM 5711  H HG3  . ARG A 1 120 ? 7.987   2.878   -11.880 1.00 0.00 ? 120 ARG A HG3  3  
ATOM 5712  H HD2  . ARG A 1 120 ? 9.421   1.729   -13.232 1.00 0.00 ? 120 ARG A HD2  3  
ATOM 5713  H HD3  . ARG A 1 120 ? 8.048   1.887   -14.328 1.00 0.00 ? 120 ARG A HD3  3  
ATOM 5714  H HE   . ARG A 1 120 ? 9.320   3.240   -15.664 1.00 0.00 ? 120 ARG A HE   3  
ATOM 5715  H HH11 . ARG A 1 120 ? 10.824  2.997   -12.534 1.00 0.00 ? 120 ARG A HH11 3  
ATOM 5716  H HH12 . ARG A 1 120 ? 12.264  3.830   -13.017 1.00 0.00 ? 120 ARG A HH12 3  
ATOM 5717  H HH21 . ARG A 1 120 ? 11.211  4.339   -16.312 1.00 0.00 ? 120 ARG A HH21 3  
ATOM 5718  H HH22 . ARG A 1 120 ? 12.483  4.594   -15.165 1.00 0.00 ? 120 ARG A HH22 3  
ATOM 5719  N N    . VAL A 1 121 ? 5.555   6.723   -13.676 1.00 0.00 ? 121 VAL A N    3  
ATOM 5720  C CA   . VAL A 1 121 ? 4.716   7.654   -14.420 1.00 0.00 ? 121 VAL A CA   3  
ATOM 5721  C C    . VAL A 1 121 ? 4.783   7.378   -15.918 1.00 0.00 ? 121 VAL A C    3  
ATOM 5722  O O    . VAL A 1 121 ? 3.933   7.836   -16.681 1.00 0.00 ? 121 VAL A O    3  
ATOM 5723  C CB   . VAL A 1 121 ? 5.131   9.114   -14.159 1.00 0.00 ? 121 VAL A CB   3  
ATOM 5724  C CG1  . VAL A 1 121 ? 4.038   10.070  -14.615 1.00 0.00 ? 121 VAL A CG1  3  
ATOM 5725  C CG2  . VAL A 1 121 ? 5.452   9.322   -12.687 1.00 0.00 ? 121 VAL A CG2  3  
ATOM 5726  H H    . VAL A 1 121 ? 6.515   6.902   -13.598 1.00 0.00 ? 121 VAL A H    3  
ATOM 5727  H HA   . VAL A 1 121 ? 3.697   7.527   -14.085 1.00 0.00 ? 121 VAL A HA   3  
ATOM 5728  H HB   . VAL A 1 121 ? 6.022   9.322   -14.733 1.00 0.00 ? 121 VAL A HB   3  
ATOM 5729  H HG11 . VAL A 1 121 ? 4.483   11.007  -14.917 1.00 0.00 ? 121 VAL A HG11 3  
ATOM 5730  H HG12 . VAL A 1 121 ? 3.506   9.637   -15.449 1.00 0.00 ? 121 VAL A HG12 3  
ATOM 5731  H HG13 . VAL A 1 121 ? 3.351   10.245  -13.800 1.00 0.00 ? 121 VAL A HG13 3  
ATOM 5732  H HG21 . VAL A 1 121 ? 5.819   10.326  -12.536 1.00 0.00 ? 121 VAL A HG21 3  
ATOM 5733  H HG22 . VAL A 1 121 ? 4.558   9.172   -12.100 1.00 0.00 ? 121 VAL A HG22 3  
ATOM 5734  H HG23 . VAL A 1 121 ? 6.207   8.613   -12.379 1.00 0.00 ? 121 VAL A HG23 3  
ATOM 5735  N N    . GLN A 1 122 ? 5.798   6.626   -16.331 1.00 0.00 ? 122 GLN A N    3  
ATOM 5736  C CA   . GLN A 1 122 ? 5.975   6.289   -17.738 1.00 0.00 ? 122 GLN A CA   3  
ATOM 5737  C C    . GLN A 1 122 ? 4.648   5.888   -18.373 1.00 0.00 ? 122 GLN A C    3  
ATOM 5738  O O    . GLN A 1 122 ? 4.308   6.344   -19.466 1.00 0.00 ? 122 GLN A O    3  
ATOM 5739  C CB   . GLN A 1 122 ? 6.989   5.154   -17.889 1.00 0.00 ? 122 GLN A CB   3  
ATOM 5740  C CG   . GLN A 1 122 ? 6.494   3.820   -17.352 1.00 0.00 ? 122 GLN A CG   3  
ATOM 5741  C CD   . GLN A 1 122 ? 7.203   2.638   -17.982 1.00 0.00 ? 122 GLN A CD   3  
ATOM 5742  O OE1  . GLN A 1 122 ? 8.351   2.746   -18.415 1.00 0.00 ? 122 GLN A OE1  3  
ATOM 5743  N NE2  . GLN A 1 122 ? 6.522   1.499   -18.037 1.00 0.00 ? 122 GLN A NE2  3  
ATOM 5744  H H    . GLN A 1 122 ? 6.442   6.291   -15.674 1.00 0.00 ? 122 GLN A H    3  
ATOM 5745  H HA   . GLN A 1 122 ? 6.352   7.165   -18.244 1.00 0.00 ? 122 GLN A HA   3  
ATOM 5746  H HB2  . GLN A 1 122 ? 7.223   5.032   -18.936 1.00 0.00 ? 122 GLN A HB2  3  
ATOM 5747  H HB3  . GLN A 1 122 ? 7.890   5.419   -17.355 1.00 0.00 ? 122 GLN A HB3  3  
ATOM 5748  H HG2  . GLN A 1 122 ? 6.659   3.792   -16.285 1.00 0.00 ? 122 GLN A HG2  3  
ATOM 5749  H HG3  . GLN A 1 122 ? 5.436   3.737   -17.554 1.00 0.00 ? 122 GLN A HG3  3  
ATOM 5750  H HE21 . GLN A 1 122 ? 5.611   1.487   -17.674 1.00 0.00 ? 122 GLN A HE21 3  
ATOM 5751  H HE22 . GLN A 1 122 ? 6.956   0.719   -18.440 1.00 0.00 ? 122 GLN A HE22 3  
ATOM 5752  N N    . GLY A 1 1   ? -19.667 -10.122 -24.610 1.00 0.00 ? 1   GLY A N    4  
ATOM 5753  C CA   . GLY A 1 1   ? -20.172 -8.908  -23.997 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5754  C C    . GLY A 1 1   ? -19.143 -7.794  -23.983 1.00 0.00 ? 1   GLY A C    4  
ATOM 5755  O O    . GLY A 1 1   ? -17.943 -8.050  -23.882 1.00 0.00 ? 1   GLY A O    4  
ATOM 5756  H H1   . GLY A 1 1   ? -20.085 -10.468 -25.426 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5757  H HA2  . GLY A 1 1   ? -21.040 -8.575  -24.545 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5758  H HA3  . GLY A 1 1   ? -20.463 -9.126  -22.980 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5759  N N    . SER A 1 2   ? -19.613 -6.555  -24.086 1.00 0.00 ? 2   SER A N    4  
ATOM 5760  C CA   . SER A 1 2   ? -18.725 -5.399  -24.091 1.00 0.00 ? 2   SER A CA   4  
ATOM 5761  C C    . SER A 1 2   ? -19.461 -4.147  -23.621 1.00 0.00 ? 2   SER A C    4  
ATOM 5762  O O    . SER A 1 2   ? -20.685 -4.144  -23.494 1.00 0.00 ? 2   SER A O    4  
ATOM 5763  C CB   . SER A 1 2   ? -18.154 -5.173  -25.492 1.00 0.00 ? 2   SER A CB   4  
ATOM 5764  O OG   . SER A 1 2   ? -17.003 -5.970  -25.708 1.00 0.00 ? 2   SER A OG   4  
ATOM 5765  H H    . SER A 1 2   ? -20.580 -6.416  -24.164 1.00 0.00 ? 2   SER A H    4  
ATOM 5766  H HA   . SER A 1 2   ? -17.913 -5.602  -23.409 1.00 0.00 ? 2   SER A HA   4  
ATOM 5767  H HB2  . SER A 1 2   ? -18.900 -5.432  -26.228 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5768  H HB3  . SER A 1 2   ? -17.884 -4.133  -25.604 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5769  H HG   . SER A 1 2   ? -16.218 -5.419  -25.658 1.00 0.00 ? 2   SER A HG   4  
ATOM 5770  N N    . SER A 1 3   ? -18.704 -3.085  -23.365 1.00 0.00 ? 3   SER A N    4  
ATOM 5771  C CA   . SER A 1 3   ? -19.282 -1.828  -22.905 1.00 0.00 ? 3   SER A CA   4  
ATOM 5772  C C    . SER A 1 3   ? -18.900 -0.682  -23.837 1.00 0.00 ? 3   SER A C    4  
ATOM 5773  O O    . SER A 1 3   ? -17.776 -0.617  -24.332 1.00 0.00 ? 3   SER A O    4  
ATOM 5774  C CB   . SER A 1 3   ? -18.817 -1.518  -21.481 1.00 0.00 ? 3   SER A CB   4  
ATOM 5775  O OG   . SER A 1 3   ? -19.641 -2.162  -20.524 1.00 0.00 ? 3   SER A OG   4  
ATOM 5776  H H    . SER A 1 3   ? -17.733 -3.150  -23.485 1.00 0.00 ? 3   SER A H    4  
ATOM 5777  H HA   . SER A 1 3   ? -20.357 -1.936  -22.908 1.00 0.00 ? 3   SER A HA   4  
ATOM 5778  H HB2  . SER A 1 3   ? -17.802 -1.862  -21.354 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5779  H HB3  . SER A 1 3   ? -18.859 -0.451  -21.315 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5780  H HG   . SER A 1 3   ? -20.564 -2.014  -20.745 1.00 0.00 ? 3   SER A HG   4  
ATOM 5781  N N    . GLY A 1 4   ? -19.847 0.222   -24.073 1.00 0.00 ? 4   GLY A N    4  
ATOM 5782  C CA   . GLY A 1 4   ? -19.592 1.354   -24.945 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5783  C C    . GLY A 1 4   ? -20.170 2.646   -24.402 1.00 0.00 ? 4   GLY A C    4  
ATOM 5784  O O    . GLY A 1 4   ? -21.059 3.240   -25.011 1.00 0.00 ? 4   GLY A O    4  
ATOM 5785  H H    . GLY A 1 4   ? -20.726 0.119   -23.651 1.00 0.00 ? 4   GLY A H    4  
ATOM 5786  H HA2  . GLY A 1 4   ? -18.525 1.470   -25.063 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5787  H HA3  . GLY A 1 4   ? -20.031 1.155   -25.911 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5788  N N    . SER A 1 5   ? -19.664 3.081   -23.252 1.00 0.00 ? 5   SER A N    4  
ATOM 5789  C CA   . SER A 1 5   ? -20.140 4.308   -22.624 1.00 0.00 ? 5   SER A CA   4  
ATOM 5790  C C    . SER A 1 5   ? -19.095 4.866   -21.662 1.00 0.00 ? 5   SER A C    4  
ATOM 5791  O O    . SER A 1 5   ? -18.770 4.243   -20.652 1.00 0.00 ? 5   SER A O    4  
ATOM 5792  C CB   . SER A 1 5   ? -21.450 4.050   -21.878 1.00 0.00 ? 5   SER A CB   4  
ATOM 5793  O OG   . SER A 1 5   ? -21.307 2.988   -20.949 1.00 0.00 ? 5   SER A OG   4  
ATOM 5794  H H    . SER A 1 5   ? -18.957 2.563   -22.815 1.00 0.00 ? 5   SER A H    4  
ATOM 5795  H HA   . SER A 1 5   ? -20.317 5.033   -23.405 1.00 0.00 ? 5   SER A HA   4  
ATOM 5796  H HB2  . SER A 1 5   ? -21.740 4.942   -21.344 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5797  H HB3  . SER A 1 5   ? -22.221 3.789   -22.589 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5798  H HG   . SER A 1 5   ? -20.885 2.241   -21.379 1.00 0.00 ? 5   SER A HG   4  
ATOM 5799  N N    . SER A 1 6   ? -18.573 6.045   -21.985 1.00 0.00 ? 6   SER A N    4  
ATOM 5800  C CA   . SER A 1 6   ? -17.562 6.687   -21.153 1.00 0.00 ? 6   SER A CA   4  
ATOM 5801  C C    . SER A 1 6   ? -17.614 8.204   -21.308 1.00 0.00 ? 6   SER A C    4  
ATOM 5802  O O    . SER A 1 6   ? -17.997 8.719   -22.357 1.00 0.00 ? 6   SER A O    4  
ATOM 5803  C CB   . SER A 1 6   ? -16.169 6.173   -21.519 1.00 0.00 ? 6   SER A CB   4  
ATOM 5804  O OG   . SER A 1 6   ? -15.197 6.635   -20.597 1.00 0.00 ? 6   SER A OG   4  
ATOM 5805  H H    . SER A 1 6   ? -18.874 6.493   -22.804 1.00 0.00 ? 6   SER A H    4  
ATOM 5806  H HA   . SER A 1 6   ? -17.771 6.435   -20.124 1.00 0.00 ? 6   SER A HA   4  
ATOM 5807  H HB2  . SER A 1 6   ? -16.172 5.094   -21.509 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5808  H HB3  . SER A 1 6   ? -15.907 6.524   -22.506 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5809  H HG   . SER A 1 6   ? -15.438 7.512   -20.290 1.00 0.00 ? 6   SER A HG   4  
ATOM 5810  N N    . GLY A 1 7   ? -17.226 8.914   -20.253 1.00 0.00 ? 7   GLY A N    4  
ATOM 5811  C CA   . GLY A 1 7   ? -17.235 10.365  -20.291 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5812  C C    . GLY A 1 7   ? -16.235 10.977  -19.330 1.00 0.00 ? 7   GLY A C    4  
ATOM 5813  O O    . GLY A 1 7   ? -15.065 11.149  -19.668 1.00 0.00 ? 7   GLY A O    4  
ATOM 5814  H H    . GLY A 1 7   ? -16.931 8.449   -19.442 1.00 0.00 ? 7   GLY A H    4  
ATOM 5815  H HA2  . GLY A 1 7   ? -17.001 10.690  -21.294 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5816  H HA3  . GLY A 1 7   ? -18.225 10.714  -20.033 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5817  N N    . GLY A 1 8   ? -16.698 11.308  -18.128 1.00 0.00 ? 8   GLY A N    4  
ATOM 5818  C CA   . GLY A 1 8   ? -15.823 11.903  -17.135 1.00 0.00 ? 8   GLY A CA   4  
ATOM 5819  C C    . GLY A 1 8   ? -16.549 12.233  -15.846 1.00 0.00 ? 8   GLY A C    4  
ATOM 5820  O O    . GLY A 1 8   ? -17.767 12.414  -15.839 1.00 0.00 ? 8   GLY A O    4  
ATOM 5821  H H    . GLY A 1 8   ? -17.641 11.147  -17.915 1.00 0.00 ? 8   GLY A H    4  
ATOM 5822  H HA2  . GLY A 1 8   ? -15.022 11.212  -16.917 1.00 0.00 ? 8   GLY A HA2  4  
ATOM 5823  H HA3  . GLY A 1 8   ? -15.402 12.811  -17.540 1.00 0.00 ? 8   GLY A HA3  4  
ATOM 5824  N N    . LYS A 1 9   ? -15.801 12.311  -14.751 1.00 0.00 ? 9   LYS A N    4  
ATOM 5825  C CA   . LYS A 1 9   ? -16.380 12.622  -13.449 1.00 0.00 ? 9   LYS A CA   4  
ATOM 5826  C C    . LYS A 1 9   ? -15.307 13.102  -12.477 1.00 0.00 ? 9   LYS A C    4  
ATOM 5827  O O    . LYS A 1 9   ? -14.195 12.575  -12.456 1.00 0.00 ? 9   LYS A O    4  
ATOM 5828  C CB   . LYS A 1 9   ? -17.089 11.392  -12.876 1.00 0.00 ? 9   LYS A CB   4  
ATOM 5829  C CG   . LYS A 1 9   ? -16.211 10.154  -12.824 1.00 0.00 ? 9   LYS A CG   4  
ATOM 5830  C CD   . LYS A 1 9   ? -16.898 9.015   -12.089 1.00 0.00 ? 9   LYS A CD   4  
ATOM 5831  C CE   . LYS A 1 9   ? -17.897 8.296   -12.983 1.00 0.00 ? 9   LYS A CE   4  
ATOM 5832  N NZ   . LYS A 1 9   ? -18.946 7.595   -12.192 1.00 0.00 ? 9   LYS A NZ   4  
ATOM 5833  H H    . LYS A 1 9   ? -14.835 12.157  -14.819 1.00 0.00 ? 9   LYS A H    4  
ATOM 5834  H HA   . LYS A 1 9   ? -17.103 13.412  -13.587 1.00 0.00 ? 9   LYS A HA   4  
ATOM 5835  H HB2  . LYS A 1 9   ? -17.420 11.617  -11.873 1.00 0.00 ? 9   LYS A HB2  4  
ATOM 5836  H HB3  . LYS A 1 9   ? -17.951 11.171  -13.489 1.00 0.00 ? 9   LYS A HB3  4  
ATOM 5837  H HG2  . LYS A 1 9   ? -15.991 9.836   -13.832 1.00 0.00 ? 9   LYS A HG2  4  
ATOM 5838  H HG3  . LYS A 1 9   ? -15.291 10.398  -12.312 1.00 0.00 ? 9   LYS A HG3  4  
ATOM 5839  H HD2  . LYS A 1 9   ? -16.151 8.307   -11.762 1.00 0.00 ? 9   LYS A HD2  4  
ATOM 5840  H HD3  . LYS A 1 9   ? -17.419 9.414   -11.230 1.00 0.00 ? 9   LYS A HD3  4  
ATOM 5841  H HE2  . LYS A 1 9   ? -18.369 9.021   -13.629 1.00 0.00 ? 9   LYS A HE2  4  
ATOM 5842  H HE3  . LYS A 1 9   ? -17.366 7.572   -13.583 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 5843  H HZ1  . LYS A 1 9   ? -18.749 7.689   -11.176 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 5844  H HZ2  . LYS A 1 9   ? -18.964 6.585   -12.440 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 5845  H HZ3  . LYS A 1 9   ? -19.879 8.007   -12.393 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 5846  N N    . ARG A 1 10  ? -15.649 14.103  -11.672 1.00 0.00 ? 10  ARG A N    4  
ATOM 5847  C CA   . ARG A 1 10  ? -14.715 14.653  -10.698 1.00 0.00 ? 10  ARG A CA   4  
ATOM 5848  C C    . ARG A 1 10  ? -14.214 13.566  -9.751  1.00 0.00 ? 10  ARG A C    4  
ATOM 5849  O O    . ARG A 1 10  ? -15.004 12.901  -9.081  1.00 0.00 ? 10  ARG A O    4  
ATOM 5850  C CB   . ARG A 1 10  ? -15.381 15.774  -9.898  1.00 0.00 ? 10  ARG A CB   4  
ATOM 5851  C CG   . ARG A 1 10  ? -15.551 17.064  -10.683 1.00 0.00 ? 10  ARG A CG   4  
ATOM 5852  C CD   . ARG A 1 10  ? -15.749 18.256  -9.760  1.00 0.00 ? 10  ARG A CD   4  
ATOM 5853  N NE   . ARG A 1 10  ? -14.484 18.745  -9.216  1.00 0.00 ? 10  ARG A NE   4  
ATOM 5854  C CZ   . ARG A 1 10  ? -14.399 19.706  -8.304  1.00 0.00 ? 10  ARG A CZ   4  
ATOM 5855  N NH1  . ARG A 1 10  ? -15.499 20.280  -7.835  1.00 0.00 ? 10  ARG A NH1  4  
ATOM 5856  N NH2  . ARG A 1 10  ? -13.211 20.096  -7.859  1.00 0.00 ? 10  ARG A NH2  4  
ATOM 5857  H H    . ARG A 1 10  ? -16.551 14.481  -11.736 1.00 0.00 ? 10  ARG A H    4  
ATOM 5858  H HA   . ARG A 1 10  ? -13.873 15.059  -11.238 1.00 0.00 ? 10  ARG A HA   4  
ATOM 5859  H HB2  . ARG A 1 10  ? -16.358 15.442  -9.578  1.00 0.00 ? 10  ARG A HB2  4  
ATOM 5860  H HB3  . ARG A 1 10  ? -14.778 15.985  -9.027  1.00 0.00 ? 10  ARG A HB3  4  
ATOM 5861  H HG2  . ARG A 1 10  ? -14.667 17.230  -11.281 1.00 0.00 ? 10  ARG A HG2  4  
ATOM 5862  H HG3  . ARG A 1 10  ? -16.412 16.972  -11.327 1.00 0.00 ? 10  ARG A HG3  4  
ATOM 5863  H HD2  . ARG A 1 10  ? -16.221 19.052  -10.317 1.00 0.00 ? 10  ARG A HD2  4  
ATOM 5864  H HD3  . ARG A 1 10  ? -16.390 17.959  -8.943  1.00 0.00 ? 10  ARG A HD3  4  
ATOM 5865  H HE   . ARG A 1 10  ? -13.659 18.335  -9.549  1.00 0.00 ? 10  ARG A HE   4  
ATOM 5866  H HH11 . ARG A 1 10  ? -16.395 19.987  -8.168  1.00 0.00 ? 10  ARG A HH11 4  
ATOM 5867  H HH12 . ARG A 1 10  ? -15.431 21.003  -7.147  1.00 0.00 ? 10  ARG A HH12 4  
ATOM 5868  H HH21 . ARG A 1 10  ? -12.380 19.666  -8.209  1.00 0.00 ? 10  ARG A HH21 4  
ATOM 5869  H HH22 . ARG A 1 10  ? -13.148 20.820  -7.172  1.00 0.00 ? 10  ARG A HH22 4  
ATOM 5870  N N    . SER A 1 11  ? -12.898 13.392  -9.702  1.00 0.00 ? 11  SER A N    4  
ATOM 5871  C CA   . SER A 1 11  ? -12.292 12.383  -8.840  1.00 0.00 ? 11  SER A CA   4  
ATOM 5872  C C    . SER A 1 11  ? -12.557 12.693  -7.370  1.00 0.00 ? 11  SER A C    4  
ATOM 5873  O O    . SER A 1 11  ? -11.912 13.561  -6.781  1.00 0.00 ? 11  SER A O    4  
ATOM 5874  C CB   . SER A 1 11  ? -10.785 12.305  -9.093  1.00 0.00 ? 11  SER A CB   4  
ATOM 5875  O OG   . SER A 1 11  ? -10.242 11.103  -8.573  1.00 0.00 ? 11  SER A OG   4  
ATOM 5876  H H    . SER A 1 11  ? -12.320 13.954  -10.260 1.00 0.00 ? 11  SER A H    4  
ATOM 5877  H HA   . SER A 1 11  ? -12.738 11.430  -9.081  1.00 0.00 ? 11  SER A HA   4  
ATOM 5878  H HB2  . SER A 1 11  ? -10.598 12.340  -10.155 1.00 0.00 ? 11  SER A HB2  4  
ATOM 5879  H HB3  . SER A 1 11  ? -10.299 13.142  -8.614  1.00 0.00 ? 11  SER A HB3  4  
ATOM 5880  H HG   . SER A 1 11  ? -9.699  10.681  -9.243  1.00 0.00 ? 11  SER A HG   4  
ATOM 5881  N N    . HIS A 1 12  ? -13.512 11.978  -6.784  1.00 0.00 ? 12  HIS A N    4  
ATOM 5882  C CA   . HIS A 1 12  ? -13.864 12.175  -5.382  1.00 0.00 ? 12  HIS A CA   4  
ATOM 5883  C C    . HIS A 1 12  ? -13.675 10.886  -4.588  1.00 0.00 ? 12  HIS A C    4  
ATOM 5884  O O    . HIS A 1 12  ? -12.941 10.856  -3.601  1.00 0.00 ? 12  HIS A O    4  
ATOM 5885  C CB   . HIS A 1 12  ? -15.310 12.657  -5.260  1.00 0.00 ? 12  HIS A CB   4  
ATOM 5886  C CG   . HIS A 1 12  ? -15.638 13.233  -3.917  1.00 0.00 ? 12  HIS A CG   4  
ATOM 5887  N ND1  . HIS A 1 12  ? -16.865 13.072  -3.309  1.00 0.00 ? 12  HIS A ND1  4  
ATOM 5888  C CD2  . HIS A 1 12  ? -14.890 13.970  -3.064  1.00 0.00 ? 12  HIS A CD2  4  
ATOM 5889  C CE1  . HIS A 1 12  ? -16.858 13.688  -2.140  1.00 0.00 ? 12  HIS A CE1  4  
ATOM 5890  N NE2  . HIS A 1 12  ? -15.671 14.240  -1.967  1.00 0.00 ? 12  HIS A NE2  4  
ATOM 5891  H H    . HIS A 1 12  ? -13.991 11.301  -7.306  1.00 0.00 ? 12  HIS A H    4  
ATOM 5892  H HA   . HIS A 1 12  ? -13.207 12.931  -4.979  1.00 0.00 ? 12  HIS A HA   4  
ATOM 5893  H HB2  . HIS A 1 12  ? -15.491 13.421  -6.002  1.00 0.00 ? 12  HIS A HB2  4  
ATOM 5894  H HB3  . HIS A 1 12  ? -15.976 11.825  -5.437  1.00 0.00 ? 12  HIS A HB3  4  
ATOM 5895  H HD1  . HIS A 1 12  ? -17.628 12.582  -3.680  1.00 0.00 ? 12  HIS A HD1  4  
ATOM 5896  H HD2  . HIS A 1 12  ? -13.868 14.289  -3.216  1.00 0.00 ? 12  HIS A HD2  4  
ATOM 5897  H HE1  . HIS A 1 12  ? -17.682 13.731  -1.444  1.00 0.00 ? 12  HIS A HE1  4  
ATOM 5898  H HE2  . HIS A 1 12  ? -15.426 14.829  -1.223  1.00 0.00 ? 12  HIS A HE2  4  
ATOM 5899  N N    . SER A 1 13  ? -14.345 9.825   -5.025  1.00 0.00 ? 13  SER A N    4  
ATOM 5900  C CA   . SER A 1 13  ? -14.255 8.534   -4.353  1.00 0.00 ? 13  SER A CA   4  
ATOM 5901  C C    . SER A 1 13  ? -13.485 7.530   -5.205  1.00 0.00 ? 13  SER A C    4  
ATOM 5902  O O    . SER A 1 13  ? -13.748 7.380   -6.397  1.00 0.00 ? 13  SER A O    4  
ATOM 5903  C CB   . SER A 1 13  ? -15.654 7.995   -4.049  1.00 0.00 ? 13  SER A CB   4  
ATOM 5904  O OG   . SER A 1 13  ? -16.286 8.759   -3.036  1.00 0.00 ? 13  SER A OG   4  
ATOM 5905  H H    . SER A 1 13  ? -14.915 9.912   -5.818  1.00 0.00 ? 13  SER A H    4  
ATOM 5906  H HA   . SER A 1 13  ? -13.725 8.681   -3.423  1.00 0.00 ? 13  SER A HA   4  
ATOM 5907  H HB2  . SER A 1 13  ? -16.256 8.037   -4.944  1.00 0.00 ? 13  SER A HB2  4  
ATOM 5908  H HB3  . SER A 1 13  ? -15.577 6.970   -3.715  1.00 0.00 ? 13  SER A HB3  4  
ATOM 5909  H HG   . SER A 1 13  ? -16.079 9.688   -3.160  1.00 0.00 ? 13  SER A HG   4  
ATOM 5910  N N    . MET A 1 14  ? -12.531 6.844   -4.582  1.00 0.00 ? 14  MET A N    4  
ATOM 5911  C CA   . MET A 1 14  ? -11.723 5.853   -5.283  1.00 0.00 ? 14  MET A CA   4  
ATOM 5912  C C    . MET A 1 14  ? -12.085 4.441   -4.834  1.00 0.00 ? 14  MET A C    4  
ATOM 5913  O O    . MET A 1 14  ? -11.910 4.085   -3.668  1.00 0.00 ? 14  MET A O    4  
ATOM 5914  C CB   . MET A 1 14  ? -10.235 6.112   -5.039  1.00 0.00 ? 14  MET A CB   4  
ATOM 5915  C CG   . MET A 1 14  ? -9.671  7.249   -5.875  1.00 0.00 ? 14  MET A CG   4  
ATOM 5916  S SD   . MET A 1 14  ? -9.324  6.756   -7.575  1.00 0.00 ? 14  MET A SD   4  
ATOM 5917  C CE   . MET A 1 14  ? -7.819  5.811   -7.352  1.00 0.00 ? 14  MET A CE   4  
ATOM 5918  H H    . MET A 1 14  ? -12.367 7.007   -3.630  1.00 0.00 ? 14  MET A H    4  
ATOM 5919  H HA   . MET A 1 14  ? -11.927 5.945   -6.339  1.00 0.00 ? 14  MET A HA   4  
ATOM 5920  H HB2  . MET A 1 14  ? -10.090 6.355   -3.997  1.00 0.00 ? 14  MET A HB2  4  
ATOM 5921  H HB3  . MET A 1 14  ? -9.682  5.215   -5.272  1.00 0.00 ? 14  MET A HB3  4  
ATOM 5922  H HG2  . MET A 1 14  ? -10.387 8.058   -5.890  1.00 0.00 ? 14  MET A HG2  4  
ATOM 5923  H HG3  . MET A 1 14  ? -8.754  7.593   -5.420  1.00 0.00 ? 14  MET A HG3  4  
ATOM 5924  H HE1  . MET A 1 14  ? -7.710  5.111   -8.168  1.00 0.00 ? 14  MET A HE1  4  
ATOM 5925  H HE2  . MET A 1 14  ? -6.972  6.481   -7.337  1.00 0.00 ? 14  MET A HE2  4  
ATOM 5926  H HE3  . MET A 1 14  ? -7.868  5.271   -6.418  1.00 0.00 ? 14  MET A HE3  4  
ATOM 5927  N N    . LYS A 1 15  ? -12.590 3.640   -5.765  1.00 0.00 ? 15  LYS A N    4  
ATOM 5928  C CA   . LYS A 1 15  ? -12.976 2.266   -5.467  1.00 0.00 ? 15  LYS A CA   4  
ATOM 5929  C C    . LYS A 1 15  ? -12.327 1.293   -6.446  1.00 0.00 ? 15  LYS A C    4  
ATOM 5930  O O    . LYS A 1 15  ? -11.891 1.686   -7.528  1.00 0.00 ? 15  LYS A O    4  
ATOM 5931  C CB   . LYS A 1 15  ? -14.499 2.119   -5.519  1.00 0.00 ? 15  LYS A CB   4  
ATOM 5932  C CG   . LYS A 1 15  ? -15.079 2.295   -6.912  1.00 0.00 ? 15  LYS A CG   4  
ATOM 5933  C CD   . LYS A 1 15  ? -16.393 1.549   -7.067  1.00 0.00 ? 15  LYS A CD   4  
ATOM 5934  C CE   . LYS A 1 15  ? -17.524 2.255   -6.334  1.00 0.00 ? 15  LYS A CE   4  
ATOM 5935  N NZ   . LYS A 1 15  ? -18.764 1.431   -6.303  1.00 0.00 ? 15  LYS A NZ   4  
ATOM 5936  H H    . LYS A 1 15  ? -12.706 3.981   -6.677  1.00 0.00 ? 15  LYS A H    4  
ATOM 5937  H HA   . LYS A 1 15  ? -12.635 2.035   -4.469  1.00 0.00 ? 15  LYS A HA   4  
ATOM 5938  H HB2  . LYS A 1 15  ? -14.766 1.135   -5.162  1.00 0.00 ? 15  LYS A HB2  4  
ATOM 5939  H HB3  . LYS A 1 15  ? -14.942 2.861   -4.871  1.00 0.00 ? 15  LYS A HB3  4  
ATOM 5940  H HG2  . LYS A 1 15  ? -15.251 3.346   -7.090  1.00 0.00 ? 15  LYS A HG2  4  
ATOM 5941  H HG3  . LYS A 1 15  ? -14.373 1.916   -7.637  1.00 0.00 ? 15  LYS A HG3  4  
ATOM 5942  H HD2  . LYS A 1 15  ? -16.642 1.488   -8.116  1.00 0.00 ? 15  LYS A HD2  4  
ATOM 5943  H HD3  . LYS A 1 15  ? -16.281 0.552   -6.663  1.00 0.00 ? 15  LYS A HD3  4  
ATOM 5944  H HE2  . LYS A 1 15  ? -17.210 2.455   -5.322  1.00 0.00 ? 15  LYS A HE2  4  
ATOM 5945  H HE3  . LYS A 1 15  ? -17.734 3.187   -6.837  1.00 0.00 ? 15  LYS A HE3  4  
ATOM 5946  H HZ1  . LYS A 1 15  ? -18.574 0.483   -6.687  1.00 0.00 ? 15  LYS A HZ1  4  
ATOM 5947  H HZ2  . LYS A 1 15  ? -19.507 1.881   -6.875  1.00 0.00 ? 15  LYS A HZ2  4  
ATOM 5948  H HZ3  . LYS A 1 15  ? -19.106 1.336   -5.326  1.00 0.00 ? 15  LYS A HZ3  4  
ATOM 5949  N N    . ARG A 1 16  ? -12.268 0.023   -6.059  1.00 0.00 ? 16  ARG A N    4  
ATOM 5950  C CA   . ARG A 1 16  ? -11.672 -1.006  -6.904  1.00 0.00 ? 16  ARG A CA   4  
ATOM 5951  C C    . ARG A 1 16  ? -12.751 -1.828  -7.603  1.00 0.00 ? 16  ARG A C    4  
ATOM 5952  O O    . ARG A 1 16  ? -13.538 -2.516  -6.955  1.00 0.00 ? 16  ARG A O    4  
ATOM 5953  C CB   . ARG A 1 16  ? -10.776 -1.924  -6.071  1.00 0.00 ? 16  ARG A CB   4  
ATOM 5954  C CG   . ARG A 1 16  ? -10.059 -2.983  -6.891  1.00 0.00 ? 16  ARG A CG   4  
ATOM 5955  C CD   . ARG A 1 16  ? -9.762  -4.224  -6.063  1.00 0.00 ? 16  ARG A CD   4  
ATOM 5956  N NE   . ARG A 1 16  ? -9.739  -5.434  -6.879  1.00 0.00 ? 16  ARG A NE   4  
ATOM 5957  C CZ   . ARG A 1 16  ? -9.894  -6.658  -6.385  1.00 0.00 ? 16  ARG A CZ   4  
ATOM 5958  N NH1  . ARG A 1 16  ? -10.084 -6.831  -5.084  1.00 0.00 ? 16  ARG A NH1  4  
ATOM 5959  N NH2  . ARG A 1 16  ? -9.860  -7.710  -7.192  1.00 0.00 ? 16  ARG A NH2  4  
ATOM 5960  H H    . ARG A 1 16  ? -12.632 -0.229  -5.185  1.00 0.00 ? 16  ARG A H    4  
ATOM 5961  H HA   . ARG A 1 16  ? -11.070 -0.513  -7.652  1.00 0.00 ? 16  ARG A HA   4  
ATOM 5962  H HB2  . ARG A 1 16  ? -10.032 -1.324  -5.569  1.00 0.00 ? 16  ARG A HB2  4  
ATOM 5963  H HB3  . ARG A 1 16  ? -11.383 -2.423  -5.330  1.00 0.00 ? 16  ARG A HB3  4  
ATOM 5964  H HG2  . ARG A 1 16  ? -10.684 -3.263  -7.726  1.00 0.00 ? 16  ARG A HG2  4  
ATOM 5965  H HG3  . ARG A 1 16  ? -9.129  -2.574  -7.256  1.00 0.00 ? 16  ARG A HG3  4  
ATOM 5966  H HD2  . ARG A 1 16  ? -8.800  -4.102  -5.589  1.00 0.00 ? 16  ARG A HD2  4  
ATOM 5967  H HD3  . ARG A 1 16  ? -10.526 -4.326  -5.306  1.00 0.00 ? 16  ARG A HD3  4  
ATOM 5968  H HE   . ARG A 1 16  ? -9.600  -5.329  -7.843  1.00 0.00 ? 16  ARG A HE   4  
ATOM 5969  H HH11 . ARG A 1 16  ? -10.110 -6.040  -4.474  1.00 0.00 ? 16  ARG A HH11 4  
ATOM 5970  H HH12 . ARG A 1 16  ? -10.201 -7.753  -4.714  1.00 0.00 ? 16  ARG A HH12 4  
ATOM 5971  H HH21 . ARG A 1 16  ? -9.718  -7.583  -8.173  1.00 0.00 ? 16  ARG A HH21 4  
ATOM 5972  H HH22 . ARG A 1 16  ? -9.977  -8.630  -6.819  1.00 0.00 ? 16  ARG A HH22 4  
ATOM 5973  N N    . ASN A 1 17  ? -12.781 -1.749  -8.929  1.00 0.00 ? 17  ASN A N    4  
ATOM 5974  C CA   . ASN A 1 17  ? -13.764 -2.484  -9.716  1.00 0.00 ? 17  ASN A CA   4  
ATOM 5975  C C    . ASN A 1 17  ? -13.520 -3.987  -9.625  1.00 0.00 ? 17  ASN A C    4  
ATOM 5976  O O    . ASN A 1 17  ? -12.382 -4.457  -9.608  1.00 0.00 ? 17  ASN A O    4  
ATOM 5977  C CB   . ASN A 1 17  ? -13.716 -2.036  -11.179 1.00 0.00 ? 17  ASN A CB   4  
ATOM 5978  C CG   . ASN A 1 17  ? -14.333 -0.666  -11.384 1.00 0.00 ? 17  ASN A CG   4  
ATOM 5979  O OD1  . ASN A 1 17  ? -15.506 -0.548  -11.737 1.00 0.00 ? 17  ASN A OD1  4  
ATOM 5980  N ND2  . ASN A 1 17  ? -13.542 0.378   -11.163 1.00 0.00 ? 17  ASN A ND2  4  
ATOM 5981  H H    . ASN A 1 17  ? -12.127 -1.183  -9.390  1.00 0.00 ? 17  ASN A H    4  
ATOM 5982  H HA   . ASN A 1 17  ? -14.742 -2.265  -9.314  1.00 0.00 ? 17  ASN A HA   4  
ATOM 5983  H HB2  . ASN A 1 17  ? -12.686 -1.999  -11.503 1.00 0.00 ? 17  ASN A HB2  4  
ATOM 5984  H HB3  . ASN A 1 17  ? -14.255 -2.748  -11.785 1.00 0.00 ? 17  ASN A HB3  4  
ATOM 5985  H HD21 . ASN A 1 17  ? -12.618 0.208   -10.884 1.00 0.00 ? 17  ASN A HD21 4  
ATOM 5986  H HD22 . ASN A 1 17  ? -13.915 1.275   -11.288 1.00 0.00 ? 17  ASN A HD22 4  
ATOM 5987  N N    . PRO A 1 18  ? -14.613 -4.762  -9.566  1.00 0.00 ? 18  PRO A N    4  
ATOM 5988  C CA   . PRO A 1 18  ? -14.544 -6.224  -9.476  1.00 0.00 ? 18  PRO A CA   4  
ATOM 5989  C C    . PRO A 1 18  ? -14.043 -6.860  -10.768 1.00 0.00 ? 18  PRO A C    4  
ATOM 5990  O O    . PRO A 1 18  ? -13.258 -7.807  -10.741 1.00 0.00 ? 18  PRO A O    4  
ATOM 5991  C CB   . PRO A 1 18  ? -15.995 -6.632  -9.206  1.00 0.00 ? 18  PRO A CB   4  
ATOM 5992  C CG   . PRO A 1 18  ? -16.812 -5.523  -9.774  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5993  C CD   . PRO A 1 18  ? -16.002 -4.271  -9.582  1.00 0.00 ? 18  PRO A CD   4  
ATOM 5994  H HA   . PRO A 1 18  ? -13.920 -6.542  -8.654  1.00 0.00 ? 18  PRO A HA   4  
ATOM 5995  H HB2  . PRO A 1 18  ? -16.205 -7.571  -9.699  1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5996  H HB3  . PRO A 1 18  ? -16.152 -6.733  -8.143  1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5997  H HG2  . PRO A 1 18  ? -16.989 -5.698  -10.824 1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5998  H HG3  . PRO A 1 18  ? -17.748 -5.448  -9.241  1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5999  H HD2  . PRO A 1 18  ? -16.160 -3.589  -10.404 1.00 0.00 ? 18  PRO A HD2  4  
ATOM 6000  H HD3  . PRO A 1 18  ? -16.254 -3.798  -8.644  1.00 0.00 ? 18  PRO A HD3  4  
ATOM 6001  N N    . ASN A 1 19  ? -14.503 -6.334  -11.899 1.00 0.00 ? 19  ASN A N    4  
ATOM 6002  C CA   . ASN A 1 19  ? -14.101 -6.851  -13.202 1.00 0.00 ? 19  ASN A CA   4  
ATOM 6003  C C    . ASN A 1 19  ? -12.592 -6.731  -13.393 1.00 0.00 ? 19  ASN A C    4  
ATOM 6004  O O    . ASN A 1 19  ? -11.949 -7.637  -13.924 1.00 0.00 ? 19  ASN A O    4  
ATOM 6005  C CB   . ASN A 1 19  ? -14.829 -6.101  -14.319 1.00 0.00 ? 19  ASN A CB   4  
ATOM 6006  C CG   . ASN A 1 19  ? -16.319 -6.379  -14.326 1.00 0.00 ? 19  ASN A CG   4  
ATOM 6007  O OD1  . ASN A 1 19  ? -16.756 -7.472  -14.688 1.00 0.00 ? 19  ASN A OD1  4  
ATOM 6008  N ND2  . ASN A 1 19  ? -17.109 -5.389  -13.927 1.00 0.00 ? 19  ASN A ND2  4  
ATOM 6009  H H    . ASN A 1 19  ? -15.127 -5.579  -11.857 1.00 0.00 ? 19  ASN A H    4  
ATOM 6010  H HA   . ASN A 1 19  ? -14.375 -7.894  -13.243 1.00 0.00 ? 19  ASN A HA   4  
ATOM 6011  H HB2  . ASN A 1 19  ? -14.682 -5.038  -14.186 1.00 0.00 ? 19  ASN A HB2  4  
ATOM 6012  H HB3  . ASN A 1 19  ? -14.420 -6.400  -15.272 1.00 0.00 ? 19  ASN A HB3  4  
ATOM 6013  H HD21 . ASN A 1 19  ? -16.691 -4.545  -13.653 1.00 0.00 ? 19  ASN A HD21 4  
ATOM 6014  H HD22 . ASN A 1 19  ? -18.076 -5.542  -13.921 1.00 0.00 ? 19  ASN A HD22 4  
ATOM 6015  N N    . ALA A 1 20  ? -12.033 -5.607  -12.956 1.00 0.00 ? 20  ALA A N    4  
ATOM 6016  C CA   . ALA A 1 20  ? -10.600 -5.370  -13.076 1.00 0.00 ? 20  ALA A CA   4  
ATOM 6017  C C    . ALA A 1 20  ? -9.800  -6.531  -12.496 1.00 0.00 ? 20  ALA A C    4  
ATOM 6018  O O    . ALA A 1 20  ? -10.024 -6.967  -11.366 1.00 0.00 ? 20  ALA A O    4  
ATOM 6019  C CB   . ALA A 1 20  ? -10.221 -4.068  -12.386 1.00 0.00 ? 20  ALA A CB   4  
ATOM 6020  H H    . ALA A 1 20  ? -12.598 -4.923  -12.542 1.00 0.00 ? 20  ALA A H    4  
ATOM 6021  H HA   . ALA A 1 20  ? -10.365 -5.273  -14.127 1.00 0.00 ? 20  ALA A HA   4  
ATOM 6022  H HB1  . ALA A 1 20  ? -11.116 -3.562  -12.056 1.00 0.00 ? 20  ALA A HB1  4  
ATOM 6023  H HB2  . ALA A 1 20  ? -9.594  -4.284  -11.532 1.00 0.00 ? 20  ALA A HB2  4  
ATOM 6024  H HB3  . ALA A 1 20  ? -9.684  -3.437  -13.078 1.00 0.00 ? 20  ALA A HB3  4  
ATOM 6025  N N    . PRO A 1 21  ? -8.845  -7.046  -13.284 1.00 0.00 ? 21  PRO A N    4  
ATOM 6026  C CA   . PRO A 1 21  ? -7.993  -8.164  -12.869 1.00 0.00 ? 21  PRO A CA   4  
ATOM 6027  C C    . PRO A 1 21  ? -7.011  -7.768  -11.772 1.00 0.00 ? 21  PRO A C    4  
ATOM 6028  O O    . PRO A 1 21  ? -6.322  -6.754  -11.879 1.00 0.00 ? 21  PRO A O    4  
ATOM 6029  C CB   . PRO A 1 21  ? -7.243  -8.533  -14.151 1.00 0.00 ? 21  PRO A CB   4  
ATOM 6030  C CG   . PRO A 1 21  ? -7.234  -7.282  -14.959 1.00 0.00 ? 21  PRO A CG   4  
ATOM 6031  C CD   . PRO A 1 21  ? -8.523  -6.576  -14.642 1.00 0.00 ? 21  PRO A CD   4  
ATOM 6032  H HA   . PRO A 1 21  ? -8.580  -9.008  -12.538 1.00 0.00 ? 21  PRO A HA   4  
ATOM 6033  H HB2  . PRO A 1 21  ? -6.240  -8.853  -13.905 1.00 0.00 ? 21  PRO A HB2  4  
ATOM 6034  H HB3  . PRO A 1 21  ? -7.765  -9.329  -14.662 1.00 0.00 ? 21  PRO A HB3  4  
ATOM 6035  H HG2  . PRO A 1 21  ? -6.392  -6.669  -14.677 1.00 0.00 ? 21  PRO A HG2  4  
ATOM 6036  H HG3  . PRO A 1 21  ? -7.189  -7.524  -16.010 1.00 0.00 ? 21  PRO A HG3  4  
ATOM 6037  H HD2  . PRO A 1 21  ? -8.381  -5.505  -14.656 1.00 0.00 ? 21  PRO A HD2  4  
ATOM 6038  H HD3  . PRO A 1 21  ? -9.294  -6.864  -15.342 1.00 0.00 ? 21  PRO A HD3  4  
ATOM 6039  N N    . VAL A 1 22  ? -6.951  -8.575  -10.718 1.00 0.00 ? 22  VAL A N    4  
ATOM 6040  C CA   . VAL A 1 22  ? -6.052  -8.310  -9.601  1.00 0.00 ? 22  VAL A CA   4  
ATOM 6041  C C    . VAL A 1 22  ? -4.596  -8.502  -10.011 1.00 0.00 ? 22  VAL A C    4  
ATOM 6042  O O    . VAL A 1 22  ? -4.167  -9.615  -10.319 1.00 0.00 ? 22  VAL A O    4  
ATOM 6043  C CB   . VAL A 1 22  ? -6.361  -9.224  -8.401  1.00 0.00 ? 22  VAL A CB   4  
ATOM 6044  C CG1  . VAL A 1 22  ? -6.292  -10.687 -8.813  1.00 0.00 ? 22  VAL A CG1  4  
ATOM 6045  C CG2  . VAL A 1 22  ? -5.404  -8.939  -7.254  1.00 0.00 ? 22  VAL A CG2  4  
ATOM 6046  H H    . VAL A 1 22  ? -7.526  -9.369  -10.690 1.00 0.00 ? 22  VAL A H    4  
ATOM 6047  H HA   . VAL A 1 22  ? -6.196  -7.285  -9.293  1.00 0.00 ? 22  VAL A HA   4  
ATOM 6048  H HB   . VAL A 1 22  ? -7.366  -9.015  -8.065  1.00 0.00 ? 22  VAL A HB   4  
ATOM 6049  H HG11 . VAL A 1 22  ? -5.506  -11.180 -8.260  1.00 0.00 ? 22  VAL A HG11 4  
ATOM 6050  H HG12 . VAL A 1 22  ? -7.237  -11.166 -8.602  1.00 0.00 ? 22  VAL A HG12 4  
ATOM 6051  H HG13 . VAL A 1 22  ? -6.083  -10.754 -9.870  1.00 0.00 ? 22  VAL A HG13 4  
ATOM 6052  H HG21 . VAL A 1 22  ? -5.705  -9.505  -6.385  1.00 0.00 ? 22  VAL A HG21 4  
ATOM 6053  H HG22 . VAL A 1 22  ? -4.403  -9.225  -7.542  1.00 0.00 ? 22  VAL A HG22 4  
ATOM 6054  H HG23 . VAL A 1 22  ? -5.424  -7.884  -7.021  1.00 0.00 ? 22  VAL A HG23 4  
ATOM 6055  N N    . THR A 1 23  ? -3.838  -7.410  -10.012 1.00 0.00 ? 23  THR A N    4  
ATOM 6056  C CA   . THR A 1 23  ? -2.429  -7.458  -10.384 1.00 0.00 ? 23  THR A CA   4  
ATOM 6057  C C    . THR A 1 23  ? -1.648  -8.388  -9.463  1.00 0.00 ? 23  THR A C    4  
ATOM 6058  O O    . THR A 1 23  ? -1.112  -9.406  -9.900  1.00 0.00 ? 23  THR A O    4  
ATOM 6059  C CB   . THR A 1 23  ? -1.790  -6.057  -10.343 1.00 0.00 ? 23  THR A CB   4  
ATOM 6060  O OG1  . THR A 1 23  ? -2.677  -5.097  -10.927 1.00 0.00 ? 23  THR A OG1  4  
ATOM 6061  C CG2  . THR A 1 23  ? -0.462  -6.047  -11.086 1.00 0.00 ? 23  THR A CG2  4  
ATOM 6062  H H    . THR A 1 23  ? -4.237  -6.553  -9.757  1.00 0.00 ? 23  THR A H    4  
ATOM 6063  H HA   . THR A 1 23  ? -2.364  -7.831  -11.396 1.00 0.00 ? 23  THR A HA   4  
ATOM 6064  H HB   . THR A 1 23  ? -1.610  -5.790  -9.312  1.00 0.00 ? 23  THR A HB   4  
ATOM 6065  H HG1  . THR A 1 23  ? -2.773  -4.348  -10.334 1.00 0.00 ? 23  THR A HG1  4  
ATOM 6066  H HG21 . THR A 1 23  ? 0.036   -5.104  -10.918 1.00 0.00 ? 23  THR A HG21 4  
ATOM 6067  H HG22 . THR A 1 23  ? -0.640  -6.176  -12.144 1.00 0.00 ? 23  THR A HG22 4  
ATOM 6068  H HG23 . THR A 1 23  ? 0.159   -6.853  -10.724 1.00 0.00 ? 23  THR A HG23 4  
ATOM 6069  N N    . LYS A 1 24  ? -1.589  -8.032  -8.184  1.00 0.00 ? 24  LYS A N    4  
ATOM 6070  C CA   . LYS A 1 24  ? -0.875  -8.836  -7.198  1.00 0.00 ? 24  LYS A CA   4  
ATOM 6071  C C    . LYS A 1 24  ? -1.566  -8.771  -5.840  1.00 0.00 ? 24  LYS A C    4  
ATOM 6072  O O    . LYS A 1 24  ? -2.120  -7.739  -5.463  1.00 0.00 ? 24  LYS A O    4  
ATOM 6073  C CB   . LYS A 1 24  ? 0.572   -8.355  -7.070  1.00 0.00 ? 24  LYS A CB   4  
ATOM 6074  C CG   . LYS A 1 24  ? 1.527   -9.424  -6.568  1.00 0.00 ? 24  LYS A CG   4  
ATOM 6075  C CD   . LYS A 1 24  ? 2.693   -8.818  -5.805  1.00 0.00 ? 24  LYS A CD   4  
ATOM 6076  C CE   . LYS A 1 24  ? 3.218   -9.770  -4.741  1.00 0.00 ? 24  LYS A CE   4  
ATOM 6077  N NZ   . LYS A 1 24  ? 2.140   -10.213 -3.813  1.00 0.00 ? 24  LYS A NZ   4  
ATOM 6078  H H    . LYS A 1 24  ? -2.037  -7.209  -7.895  1.00 0.00 ? 24  LYS A H    4  
ATOM 6079  H HA   . LYS A 1 24  ? -0.876  -9.859  -7.541  1.00 0.00 ? 24  LYS A HA   4  
ATOM 6080  H HB2  . LYS A 1 24  ? 0.916   -8.021  -8.038  1.00 0.00 ? 24  LYS A HB2  4  
ATOM 6081  H HB3  . LYS A 1 24  ? 0.603   -7.523  -6.380  1.00 0.00 ? 24  LYS A HB3  4  
ATOM 6082  H HG2  . LYS A 1 24  ? 0.990   -10.094 -5.911  1.00 0.00 ? 24  LYS A HG2  4  
ATOM 6083  H HG3  . LYS A 1 24  ? 1.910   -9.977  -7.414  1.00 0.00 ? 24  LYS A HG3  4  
ATOM 6084  H HD2  . LYS A 1 24  ? 3.490   -8.597  -6.499  1.00 0.00 ? 24  LYS A HD2  4  
ATOM 6085  H HD3  . LYS A 1 24  ? 2.364   -7.905  -5.329  1.00 0.00 ? 24  LYS A HD3  4  
ATOM 6086  H HE2  . LYS A 1 24  ? 3.640   -10.635 -5.227  1.00 0.00 ? 24  LYS A HE2  4  
ATOM 6087  H HE3  . LYS A 1 24  ? 3.985   -9.265  -4.173  1.00 0.00 ? 24  LYS A HE3  4  
ATOM 6088  H HZ1  . LYS A 1 24  ? 1.253   -9.716  -4.032  1.00 0.00 ? 24  LYS A HZ1  4  
ATOM 6089  H HZ2  . LYS A 1 24  ? 2.408   -10.005 -2.829  1.00 0.00 ? 24  LYS A HZ2  4  
ATOM 6090  H HZ3  . LYS A 1 24  ? 1.985   -11.237 -3.909  1.00 0.00 ? 24  LYS A HZ3  4  
ATOM 6091  N N    . ALA A 1 25  ? -1.527  -9.880  -5.109  1.00 0.00 ? 25  ALA A N    4  
ATOM 6092  C CA   . ALA A 1 25  ? -2.147  -9.948  -3.791  1.00 0.00 ? 25  ALA A CA   4  
ATOM 6093  C C    . ALA A 1 25  ? -1.210  -10.595 -2.777  1.00 0.00 ? 25  ALA A C    4  
ATOM 6094  O O    . ALA A 1 25  ? -0.539  -11.581 -3.078  1.00 0.00 ? 25  ALA A O    4  
ATOM 6095  C CB   . ALA A 1 25  ? -3.460  -10.714 -3.864  1.00 0.00 ? 25  ALA A CB   4  
ATOM 6096  H H    . ALA A 1 25  ? -1.071  -10.671 -5.463  1.00 0.00 ? 25  ALA A H    4  
ATOM 6097  H HA   . ALA A 1 25  ? -2.364  -8.939  -3.472  1.00 0.00 ? 25  ALA A HA   4  
ATOM 6098  H HB1  . ALA A 1 25  ? -3.517  -11.241 -4.804  1.00 0.00 ? 25  ALA A HB1  4  
ATOM 6099  H HB2  . ALA A 1 25  ? -3.507  -11.423 -3.050  1.00 0.00 ? 25  ALA A HB2  4  
ATOM 6100  H HB3  . ALA A 1 25  ? -4.285  -10.021 -3.787  1.00 0.00 ? 25  ALA A HB3  4  
ATOM 6101  N N    . GLY A 1 26  ? -1.170  -10.033 -1.572  1.00 0.00 ? 26  GLY A N    4  
ATOM 6102  C CA   . GLY A 1 26  ? -0.311  -10.569 -0.532  1.00 0.00 ? 26  GLY A CA   4  
ATOM 6103  C C    . GLY A 1 26  ? -0.434  -9.806  0.772   1.00 0.00 ? 26  GLY A C    4  
ATOM 6104  O O    . GLY A 1 26  ? -0.571  -8.582  0.772   1.00 0.00 ? 26  GLY A O    4  
ATOM 6105  H H    . GLY A 1 26  ? -1.727  -9.248  -1.389  1.00 0.00 ? 26  GLY A H    4  
ATOM 6106  H HA2  . GLY A 1 26  ? -0.575  -11.602 -0.359  1.00 0.00 ? 26  GLY A HA2  4  
ATOM 6107  H HA3  . GLY A 1 26  ? 0.715   -10.521 -0.868  1.00 0.00 ? 26  GLY A HA3  4  
ATOM 6108  N N    . TRP A 1 27  ? -0.388  -10.529 1.885   1.00 0.00 ? 27  TRP A N    4  
ATOM 6109  C CA   . TRP A 1 27  ? -0.498  -9.912  3.202   1.00 0.00 ? 27  TRP A CA   4  
ATOM 6110  C C    . TRP A 1 27  ? 0.764   -9.124  3.541   1.00 0.00 ? 27  TRP A C    4  
ATOM 6111  O O    . TRP A 1 27  ? 1.814   -9.705  3.816   1.00 0.00 ? 27  TRP A O    4  
ATOM 6112  C CB   . TRP A 1 27  ? -0.750  -10.978 4.268   1.00 0.00 ? 27  TRP A CB   4  
ATOM 6113  C CG   . TRP A 1 27  ? -2.183  -11.409 4.351   1.00 0.00 ? 27  TRP A CG   4  
ATOM 6114  C CD1  . TRP A 1 27  ? -2.775  -12.423 3.653   1.00 0.00 ? 27  TRP A CD1  4  
ATOM 6115  C CD2  . TRP A 1 27  ? -3.203  -10.837 5.176   1.00 0.00 ? 27  TRP A CD2  4  
ATOM 6116  N NE1  . TRP A 1 27  ? -4.103  -12.515 3.995   1.00 0.00 ? 27  TRP A NE1  4  
ATOM 6117  C CE2  . TRP A 1 27  ? -4.390  -11.554 4.928   1.00 0.00 ? 27  TRP A CE2  4  
ATOM 6118  C CE3  . TRP A 1 27  ? -3.230  -9.791  6.102   1.00 0.00 ? 27  TRP A CE3  4  
ATOM 6119  C CZ2  . TRP A 1 27  ? -5.588  -11.256 5.572   1.00 0.00 ? 27  TRP A CZ2  4  
ATOM 6120  C CZ3  . TRP A 1 27  ? -4.420  -9.496  6.740   1.00 0.00 ? 27  TRP A CZ3  4  
ATOM 6121  C CH2  . TRP A 1 27  ? -5.585  -10.227 6.473   1.00 0.00 ? 27  TRP A CH2  4  
ATOM 6122  H H    . TRP A 1 27  ? -0.278  -11.501 1.820   1.00 0.00 ? 27  TRP A H    4  
ATOM 6123  H HA   . TRP A 1 27  ? -1.337  -9.232  3.180   1.00 0.00 ? 27  TRP A HA   4  
ATOM 6124  H HB2  . TRP A 1 27  ? -0.152  -11.850 4.045   1.00 0.00 ? 27  TRP A HB2  4  
ATOM 6125  H HB3  . TRP A 1 27  ? -0.463  -10.587 5.234   1.00 0.00 ? 27  TRP A HB3  4  
ATOM 6126  H HD1  . TRP A 1 27  ? -2.264  -13.050 2.939   1.00 0.00 ? 27  TRP A HD1  4  
ATOM 6127  H HE1  . TRP A 1 27  ? -4.740  -13.165 3.630   1.00 0.00 ? 27  TRP A HE1  4  
ATOM 6128  H HE3  . TRP A 1 27  ? -2.342  -9.216  6.321   1.00 0.00 ? 27  TRP A HE3  4  
ATOM 6129  H HZ2  . TRP A 1 27  ? -6.495  -11.810 5.378   1.00 0.00 ? 27  TRP A HZ2  4  
ATOM 6130  H HZ3  . TRP A 1 27  ? -4.460  -8.690  7.458   1.00 0.00 ? 27  TRP A HZ3  4  
ATOM 6131  H HH2  . TRP A 1 27  ? -6.492  -9.961  6.995   1.00 0.00 ? 27  TRP A HH2  4  
ATOM 6132  N N    . LEU A 1 28  ? 0.653   -7.801  3.519   1.00 0.00 ? 28  LEU A N    4  
ATOM 6133  C CA   . LEU A 1 28  ? 1.786   -6.933  3.825   1.00 0.00 ? 28  LEU A CA   4  
ATOM 6134  C C    . LEU A 1 28  ? 1.541   -6.152  5.112   1.00 0.00 ? 28  LEU A C    4  
ATOM 6135  O O    . LEU A 1 28  ? 0.486   -6.274  5.734   1.00 0.00 ? 28  LEU A O    4  
ATOM 6136  C CB   . LEU A 1 28  ? 2.039   -5.966  2.667   1.00 0.00 ? 28  LEU A CB   4  
ATOM 6137  C CG   . LEU A 1 28  ? 2.635   -6.578  1.399   1.00 0.00 ? 28  LEU A CG   4  
ATOM 6138  C CD1  . LEU A 1 28  ? 2.433   -5.649  0.212   1.00 0.00 ? 28  LEU A CD1  4  
ATOM 6139  C CD2  . LEU A 1 28  ? 4.113   -6.881  1.596   1.00 0.00 ? 28  LEU A CD2  4  
ATOM 6140  H H    . LEU A 1 28  ? -0.210  -7.396  3.293   1.00 0.00 ? 28  LEU A H    4  
ATOM 6141  H HA   . LEU A 1 28  ? 2.656   -7.559  3.957   1.00 0.00 ? 28  LEU A HA   4  
ATOM 6142  H HB2  . LEU A 1 28  ? 1.097   -5.512  2.404   1.00 0.00 ? 28  LEU A HB2  4  
ATOM 6143  H HB3  . LEU A 1 28  ? 2.719   -5.203  3.018   1.00 0.00 ? 28  LEU A HB3  4  
ATOM 6144  H HG   . LEU A 1 28  ? 2.128   -7.509  1.184   1.00 0.00 ? 28  LEU A HG   4  
ATOM 6145  H HD11 . LEU A 1 28  ? 2.688   -4.640  0.498   1.00 0.00 ? 28  LEU A HD11 4  
ATOM 6146  H HD12 . LEU A 1 28  ? 1.400   -5.684  -0.101  1.00 0.00 ? 28  LEU A HD12 4  
ATOM 6147  H HD13 . LEU A 1 28  ? 3.067   -5.965  -0.604  1.00 0.00 ? 28  LEU A HD13 4  
ATOM 6148  H HD21 . LEU A 1 28  ? 4.321   -7.889  1.269   1.00 0.00 ? 28  LEU A HD21 4  
ATOM 6149  H HD22 . LEU A 1 28  ? 4.364   -6.782  2.642   1.00 0.00 ? 28  LEU A HD22 4  
ATOM 6150  H HD23 . LEU A 1 28  ? 4.703   -6.185  1.018   1.00 0.00 ? 28  LEU A HD23 4  
ATOM 6151  N N    . PHE A 1 29  ? 2.523   -5.347  5.505   1.00 0.00 ? 29  PHE A N    4  
ATOM 6152  C CA   . PHE A 1 29  ? 2.415   -4.544  6.717   1.00 0.00 ? 29  PHE A CA   4  
ATOM 6153  C C    . PHE A 1 29  ? 2.539   -3.057  6.397   1.00 0.00 ? 29  PHE A C    4  
ATOM 6154  O O    . PHE A 1 29  ? 3.392   -2.649  5.609   1.00 0.00 ? 29  PHE A O    4  
ATOM 6155  C CB   . PHE A 1 29  ? 3.492   -4.953  7.723   1.00 0.00 ? 29  PHE A CB   4  
ATOM 6156  C CG   . PHE A 1 29  ? 3.341   -6.360  8.225   1.00 0.00 ? 29  PHE A CG   4  
ATOM 6157  C CD1  . PHE A 1 29  ? 3.572   -7.438  7.385   1.00 0.00 ? 29  PHE A CD1  4  
ATOM 6158  C CD2  . PHE A 1 29  ? 2.967   -6.606  9.536   1.00 0.00 ? 29  PHE A CD2  4  
ATOM 6159  C CE1  . PHE A 1 29  ? 3.434   -8.735  7.844   1.00 0.00 ? 29  PHE A CE1  4  
ATOM 6160  C CE2  . PHE A 1 29  ? 2.828   -7.900  10.001  1.00 0.00 ? 29  PHE A CE2  4  
ATOM 6161  C CZ   . PHE A 1 29  ? 3.061   -8.966  9.154   1.00 0.00 ? 29  PHE A CZ   4  
ATOM 6162  H H    . PHE A 1 29  ? 3.341   -5.293  4.966   1.00 0.00 ? 29  PHE A H    4  
ATOM 6163  H HA   . PHE A 1 29  ? 1.443   -4.727  7.149   1.00 0.00 ? 29  PHE A HA   4  
ATOM 6164  H HB2  . PHE A 1 29  ? 4.462   -4.871  7.255   1.00 0.00 ? 29  PHE A HB2  4  
ATOM 6165  H HB3  . PHE A 1 29  ? 3.450   -4.289  8.574   1.00 0.00 ? 29  PHE A HB3  4  
ATOM 6166  H HD1  . PHE A 1 29  ? 3.864   -7.258  6.360   1.00 0.00 ? 29  PHE A HD1  4  
ATOM 6167  H HD2  . PHE A 1 29  ? 2.784   -5.774  10.200  1.00 0.00 ? 29  PHE A HD2  4  
ATOM 6168  H HE1  . PHE A 1 29  ? 3.617   -9.565  7.179   1.00 0.00 ? 29  PHE A HE1  4  
ATOM 6169  H HE2  . PHE A 1 29  ? 2.535   -8.078  11.025  1.00 0.00 ? 29  PHE A HE2  4  
ATOM 6170  H HZ   . PHE A 1 29  ? 2.953   -9.978  9.514   1.00 0.00 ? 29  PHE A HZ   4  
ATOM 6171  N N    . LYS A 1 30  ? 1.681   -2.252  7.014   1.00 0.00 ? 30  LYS A N    4  
ATOM 6172  C CA   . LYS A 1 30  ? 1.693   -0.810  6.798   1.00 0.00 ? 30  LYS A CA   4  
ATOM 6173  C C    . LYS A 1 30  ? 2.099   -0.072  8.069   1.00 0.00 ? 30  LYS A C    4  
ATOM 6174  O O    . LYS A 1 30  ? 1.454   -0.207  9.108   1.00 0.00 ? 30  LYS A O    4  
ATOM 6175  C CB   . LYS A 1 30  ? 0.314   -0.331  6.336   1.00 0.00 ? 30  LYS A CB   4  
ATOM 6176  C CG   . LYS A 1 30  ? 0.328   1.056   5.719   1.00 0.00 ? 30  LYS A CG   4  
ATOM 6177  C CD   . LYS A 1 30  ? -0.943  1.329   4.932   1.00 0.00 ? 30  LYS A CD   4  
ATOM 6178  C CE   . LYS A 1 30  ? -1.247  2.817   4.862   1.00 0.00 ? 30  LYS A CE   4  
ATOM 6179  N NZ   . LYS A 1 30  ? -2.681  3.077   4.554   1.00 0.00 ? 30  LYS A NZ   4  
ATOM 6180  H H    . LYS A 1 30  ? 1.023   -2.637  7.631   1.00 0.00 ? 30  LYS A H    4  
ATOM 6181  H HA   . LYS A 1 30  ? 2.416   -0.597  6.025   1.00 0.00 ? 30  LYS A HA   4  
ATOM 6182  H HB2  . LYS A 1 30  ? -0.067  -1.026  5.602   1.00 0.00 ? 30  LYS A HB2  4  
ATOM 6183  H HB3  . LYS A 1 30  ? -0.352  -0.318  7.187   1.00 0.00 ? 30  LYS A HB3  4  
ATOM 6184  H HG2  . LYS A 1 30  ? 0.415   1.790   6.506   1.00 0.00 ? 30  LYS A HG2  4  
ATOM 6185  H HG3  . LYS A 1 30  ? 1.176   1.136   5.054   1.00 0.00 ? 30  LYS A HG3  4  
ATOM 6186  H HD2  . LYS A 1 30  ? -0.823  0.950   3.928   1.00 0.00 ? 30  LYS A HD2  4  
ATOM 6187  H HD3  . LYS A 1 30  ? -1.769  0.823   5.412   1.00 0.00 ? 30  LYS A HD3  4  
ATOM 6188  H HE2  . LYS A 1 30  ? -1.005  3.266   5.813   1.00 0.00 ? 30  LYS A HE2  4  
ATOM 6189  H HE3  . LYS A 1 30  ? -0.636  3.260   4.089   1.00 0.00 ? 30  LYS A HE3  4  
ATOM 6190  H HZ1  . LYS A 1 30  ? -3.013  2.422   3.818   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 6191  H HZ2  . LYS A 1 30  ? -2.803  4.053   4.216   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 6192  H HZ3  . LYS A 1 30  ? -3.259  2.944   5.408   1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 6193  N N    . GLN A 1 31  ? 3.172   0.708   7.978   1.00 0.00 ? 31  GLN A N    4  
ATOM 6194  C CA   . GLN A 1 31  ? 3.662   1.467   9.122   1.00 0.00 ? 31  GLN A CA   4  
ATOM 6195  C C    . GLN A 1 31  ? 2.678   2.566   9.509   1.00 0.00 ? 31  GLN A C    4  
ATOM 6196  O O    . GLN A 1 31  ? 2.106   3.231   8.647   1.00 0.00 ? 31  GLN A O    4  
ATOM 6197  C CB   . GLN A 1 31  ? 5.029   2.078   8.807   1.00 0.00 ? 31  GLN A CB   4  
ATOM 6198  C CG   . GLN A 1 31  ? 5.921   2.235   10.028  1.00 0.00 ? 31  GLN A CG   4  
ATOM 6199  C CD   . GLN A 1 31  ? 6.871   3.411   9.909   1.00 0.00 ? 31  GLN A CD   4  
ATOM 6200  O OE1  . GLN A 1 31  ? 6.538   4.534   10.288  1.00 0.00 ? 31  GLN A OE1  4  
ATOM 6201  N NE2  . GLN A 1 31  ? 8.063   3.158   9.380   1.00 0.00 ? 31  GLN A NE2  4  
ATOM 6202  H H    . GLN A 1 31  ? 3.644   0.773   7.123   1.00 0.00 ? 31  GLN A H    4  
ATOM 6203  H HA   . GLN A 1 31  ? 3.766   0.785   9.953   1.00 0.00 ? 31  GLN A HA   4  
ATOM 6204  H HB2  . GLN A 1 31  ? 5.538   1.445   8.095   1.00 0.00 ? 31  GLN A HB2  4  
ATOM 6205  H HB3  . GLN A 1 31  ? 4.881   3.053   8.368   1.00 0.00 ? 31  GLN A HB3  4  
ATOM 6206  H HG2  . GLN A 1 31  ? 5.297   2.384   10.897  1.00 0.00 ? 31  GLN A HG2  4  
ATOM 6207  H HG3  . GLN A 1 31  ? 6.501   1.333   10.153  1.00 0.00 ? 31  GLN A HG3  4  
ATOM 6208  H HE21 . GLN A 1 31  ? 8.258   2.239   9.099   1.00 0.00 ? 31  GLN A HE21 4  
ATOM 6209  H HE22 . GLN A 1 31  ? 8.696   3.899   9.291   1.00 0.00 ? 31  GLN A HE22 4  
ATOM 6210  N N    . ALA A 1 32  ? 2.486   2.749   10.811  1.00 0.00 ? 32  ALA A N    4  
ATOM 6211  C CA   . ALA A 1 32  ? 1.572   3.768   11.312  1.00 0.00 ? 32  ALA A CA   4  
ATOM 6212  C C    . ALA A 1 32  ? 2.128   5.168   11.076  1.00 0.00 ? 32  ALA A C    4  
ATOM 6213  O O    . ALA A 1 32  ? 1.671   5.887   10.188  1.00 0.00 ? 32  ALA A O    4  
ATOM 6214  C CB   . ALA A 1 32  ? 1.298   3.550   12.793  1.00 0.00 ? 32  ALA A CB   4  
ATOM 6215  H H    . ALA A 1 32  ? 2.971   2.187   11.450  1.00 0.00 ? 32  ALA A H    4  
ATOM 6216  H HA   . ALA A 1 32  ? 0.637   3.669   10.780  1.00 0.00 ? 32  ALA A HA   4  
ATOM 6217  H HB1  . ALA A 1 32  ? 2.235   3.493   13.327  1.00 0.00 ? 32  ALA A HB1  4  
ATOM 6218  H HB2  . ALA A 1 32  ? 0.714   4.374   13.176  1.00 0.00 ? 32  ALA A HB2  4  
ATOM 6219  H HB3  . ALA A 1 32  ? 0.751   2.628   12.925  1.00 0.00 ? 32  ALA A HB3  4  
ATOM 6220  N N    . SER A 1 33  ? 3.117   5.550   11.878  1.00 0.00 ? 33  SER A N    4  
ATOM 6221  C CA   . SER A 1 33  ? 3.733   6.867   11.759  1.00 0.00 ? 33  SER A CA   4  
ATOM 6222  C C    . SER A 1 33  ? 5.003   6.951   12.601  1.00 0.00 ? 33  SER A C    4  
ATOM 6223  O O    . SER A 1 33  ? 5.422   5.968   13.211  1.00 0.00 ? 33  SER A O    4  
ATOM 6224  C CB   . SER A 1 33  ? 2.748   7.955   12.192  1.00 0.00 ? 33  SER A CB   4  
ATOM 6225  O OG   . SER A 1 33  ? 3.138   9.223   11.694  1.00 0.00 ? 33  SER A OG   4  
ATOM 6226  H H    . SER A 1 33  ? 3.439   4.932   12.568  1.00 0.00 ? 33  SER A H    4  
ATOM 6227  H HA   . SER A 1 33  ? 3.992   7.019   10.722  1.00 0.00 ? 33  SER A HA   4  
ATOM 6228  H HB2  . SER A 1 33  ? 1.766   7.719   11.812  1.00 0.00 ? 33  SER A HB2  4  
ATOM 6229  H HB3  . SER A 1 33  ? 2.716   7.999   13.271  1.00 0.00 ? 33  SER A HB3  4  
ATOM 6230  H HG   . SER A 1 33  ? 2.437   9.580   11.144  1.00 0.00 ? 33  SER A HG   4  
ATOM 6231  N N    . SER A 1 34  ? 5.610   8.132   12.627  1.00 0.00 ? 34  SER A N    4  
ATOM 6232  C CA   . SER A 1 34  ? 6.835   8.346   13.390  1.00 0.00 ? 34  SER A CA   4  
ATOM 6233  C C    . SER A 1 34  ? 6.649   7.925   14.845  1.00 0.00 ? 34  SER A C    4  
ATOM 6234  O O    . SER A 1 34  ? 7.568   7.404   15.475  1.00 0.00 ? 34  SER A O    4  
ATOM 6235  C CB   . SER A 1 34  ? 7.254   9.815   13.322  1.00 0.00 ? 34  SER A CB   4  
ATOM 6236  O OG   . SER A 1 34  ? 6.319   10.644  13.990  1.00 0.00 ? 34  SER A OG   4  
ATOM 6237  H H    . SER A 1 34  ? 5.227   8.878   12.119  1.00 0.00 ? 34  SER A H    4  
ATOM 6238  H HA   . SER A 1 34  ? 7.611   7.738   12.948  1.00 0.00 ? 34  SER A HA   4  
ATOM 6239  H HB2  . SER A 1 34  ? 8.220   9.934   13.789  1.00 0.00 ? 34  SER A HB2  4  
ATOM 6240  H HB3  . SER A 1 34  ? 7.315   10.122  12.288  1.00 0.00 ? 34  SER A HB3  4  
ATOM 6241  H HG   . SER A 1 34  ? 6.244   11.481  13.526  1.00 0.00 ? 34  SER A HG   4  
ATOM 6242  N N    . GLY A 1 35  ? 5.450   8.156   15.372  1.00 0.00 ? 35  GLY A N    4  
ATOM 6243  C CA   . GLY A 1 35  ? 5.164   7.795   16.748  1.00 0.00 ? 35  GLY A CA   4  
ATOM 6244  C C    . GLY A 1 35  ? 5.893   6.539   17.183  1.00 0.00 ? 35  GLY A C    4  
ATOM 6245  O O    . GLY A 1 35  ? 7.021   6.605   17.670  1.00 0.00 ? 35  GLY A O    4  
ATOM 6246  H H    . GLY A 1 35  ? 4.755   8.574   14.822  1.00 0.00 ? 35  GLY A H    4  
ATOM 6247  H HA2  . GLY A 1 35  ? 5.459   8.611   17.391  1.00 0.00 ? 35  GLY A HA2  4  
ATOM 6248  H HA3  . GLY A 1 35  ? 4.101   7.634   16.852  1.00 0.00 ? 35  GLY A HA3  4  
ATOM 6249  N N    . VAL A 1 36  ? 5.246   5.391   17.008  1.00 0.00 ? 36  VAL A N    4  
ATOM 6250  C CA   . VAL A 1 36  ? 5.840   4.114   17.386  1.00 0.00 ? 36  VAL A CA   4  
ATOM 6251  C C    . VAL A 1 36  ? 6.158   3.271   16.156  1.00 0.00 ? 36  VAL A C    4  
ATOM 6252  O O    . VAL A 1 36  ? 6.508   2.096   16.269  1.00 0.00 ? 36  VAL A O    4  
ATOM 6253  C CB   . VAL A 1 36  ? 4.908   3.315   18.316  1.00 0.00 ? 36  VAL A CB   4  
ATOM 6254  C CG1  . VAL A 1 36  ? 4.681   4.066   19.619  1.00 0.00 ? 36  VAL A CG1  4  
ATOM 6255  C CG2  . VAL A 1 36  ? 3.586   3.024   17.622  1.00 0.00 ? 36  VAL A CG2  4  
ATOM 6256  H H    . VAL A 1 36  ? 4.349   5.403   16.615  1.00 0.00 ? 36  VAL A H    4  
ATOM 6257  H HA   . VAL A 1 36  ? 6.758   4.317   17.919  1.00 0.00 ? 36  VAL A HA   4  
ATOM 6258  H HB   . VAL A 1 36  ? 5.384   2.374   18.547  1.00 0.00 ? 36  VAL A HB   4  
ATOM 6259  H HG11 . VAL A 1 36  ? 4.153   4.987   19.416  1.00 0.00 ? 36  VAL A HG11 4  
ATOM 6260  H HG12 . VAL A 1 36  ? 4.097   3.455   20.291  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 6261  H HG13 . VAL A 1 36  ? 5.635   4.293   20.074  1.00 0.00 ? 36  VAL A HG13 4  
ATOM 6262  H HG21 . VAL A 1 36  ? 3.749   2.931   16.559  1.00 0.00 ? 36  VAL A HG21 4  
ATOM 6263  H HG22 . VAL A 1 36  ? 3.174   2.102   18.005  1.00 0.00 ? 36  VAL A HG22 4  
ATOM 6264  H HG23 . VAL A 1 36  ? 2.894   3.832   17.811  1.00 0.00 ? 36  VAL A HG23 4  
ATOM 6265  N N    . LYS A 1 37  ? 6.035   3.878   14.981  1.00 0.00 ? 37  LYS A N    4  
ATOM 6266  C CA   . LYS A 1 37  ? 6.310   3.185   13.728  1.00 0.00 ? 37  LYS A CA   4  
ATOM 6267  C C    . LYS A 1 37  ? 5.946   1.707   13.833  1.00 0.00 ? 37  LYS A C    4  
ATOM 6268  O O    . LYS A 1 37  ? 6.770   0.835   13.558  1.00 0.00 ? 37  LYS A O    4  
ATOM 6269  C CB   . LYS A 1 37  ? 7.787   3.331   13.355  1.00 0.00 ? 37  LYS A CB   4  
ATOM 6270  C CG   . LYS A 1 37  ? 8.736   2.739   14.382  1.00 0.00 ? 37  LYS A CG   4  
ATOM 6271  C CD   . LYS A 1 37  ? 10.118  3.364   14.291  1.00 0.00 ? 37  LYS A CD   4  
ATOM 6272  C CE   . LYS A 1 37  ? 10.242  4.577   15.200  1.00 0.00 ? 37  LYS A CE   4  
ATOM 6273  N NZ   . LYS A 1 37  ? 11.449  5.389   14.880  1.00 0.00 ? 37  LYS A NZ   4  
ATOM 6274  H H    . LYS A 1 37  ? 5.752   4.816   14.956  1.00 0.00 ? 37  LYS A H    4  
ATOM 6275  H HA   . LYS A 1 37  ? 5.706   3.639   12.958  1.00 0.00 ? 37  LYS A HA   4  
ATOM 6276  H HB2  . LYS A 1 37  ? 7.958   2.836   12.410  1.00 0.00 ? 37  LYS A HB2  4  
ATOM 6277  H HB3  . LYS A 1 37  ? 8.016   4.382   13.248  1.00 0.00 ? 37  LYS A HB3  4  
ATOM 6278  H HG2  . LYS A 1 37  ? 8.338   2.915   15.371  1.00 0.00 ? 37  LYS A HG2  4  
ATOM 6279  H HG3  . LYS A 1 37  ? 8.820   1.675   14.210  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 6280  H HD2  . LYS A 1 37  ? 10.855  2.632   14.584  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 6281  H HD3  . LYS A 1 37  ? 10.298  3.670   13.270  1.00 0.00 ? 37  LYS A HD3  4  
ATOM 6282  H HE2  . LYS A 1 37  ? 9.363   5.192   15.080  1.00 0.00 ? 37  LYS A HE2  4  
ATOM 6283  H HE3  . LYS A 1 37  ? 10.308  4.238   16.223  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 6284  H HZ1  . LYS A 1 37  ? 11.589  6.122   15.604  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 6285  H HZ2  . LYS A 1 37  ? 11.334  5.849   13.953  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 6286  H HZ3  . LYS A 1 37  ? 12.291  4.781   14.850  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 6287  N N    . GLN A 1 38  ? 4.707   1.434   14.229  1.00 0.00 ? 38  GLN A N    4  
ATOM 6288  C CA   . GLN A 1 38  ? 4.234   0.062   14.368  1.00 0.00 ? 38  GLN A CA   4  
ATOM 6289  C C    . GLN A 1 38  ? 3.978   -0.566  13.003  1.00 0.00 ? 38  GLN A C    4  
ATOM 6290  O O    . GLN A 1 38  ? 4.258   0.039   11.968  1.00 0.00 ? 38  GLN A O    4  
ATOM 6291  C CB   . GLN A 1 38  ? 2.957   0.023   15.209  1.00 0.00 ? 38  GLN A CB   4  
ATOM 6292  C CG   . GLN A 1 38  ? 1.691   0.265   14.403  1.00 0.00 ? 38  GLN A CG   4  
ATOM 6293  C CD   . GLN A 1 38  ? 0.444   0.281   15.266  1.00 0.00 ? 38  GLN A CD   4  
ATOM 6294  O OE1  . GLN A 1 38  ? 0.359   -0.431  16.267  1.00 0.00 ? 38  GLN A OE1  4  
ATOM 6295  N NE2  . GLN A 1 38  ? -0.531  1.097   14.882  1.00 0.00 ? 38  GLN A NE2  4  
ATOM 6296  H H    . GLN A 1 38  ? 4.097   2.173   14.433  1.00 0.00 ? 38  GLN A H    4  
ATOM 6297  H HA   . GLN A 1 38  ? 5.003   -0.504  14.872  1.00 0.00 ? 38  GLN A HA   4  
ATOM 6298  H HB2  . GLN A 1 38  ? 2.879   -0.946  15.679  1.00 0.00 ? 38  GLN A HB2  4  
ATOM 6299  H HB3  . GLN A 1 38  ? 3.021   0.782   15.975  1.00 0.00 ? 38  GLN A HB3  4  
ATOM 6300  H HG2  . GLN A 1 38  ? 1.775   1.217   13.902  1.00 0.00 ? 38  GLN A HG2  4  
ATOM 6301  H HG3  . GLN A 1 38  ? 1.592   -0.520  13.668  1.00 0.00 ? 38  GLN A HG3  4  
ATOM 6302  H HE21 . GLN A 1 38  ? -0.393  1.634   14.073  1.00 0.00 ? 38  GLN A HE21 4  
ATOM 6303  H HE22 . GLN A 1 38  ? -1.348  1.127   15.421  1.00 0.00 ? 38  GLN A HE22 4  
ATOM 6304  N N    . TRP A 1 39  ? 3.445   -1.783  13.008  1.00 0.00 ? 39  TRP A N    4  
ATOM 6305  C CA   . TRP A 1 39  ? 3.151   -2.493  11.768  1.00 0.00 ? 39  TRP A CA   4  
ATOM 6306  C C    . TRP A 1 39  ? 1.869   -3.309  11.899  1.00 0.00 ? 39  TRP A C    4  
ATOM 6307  O O    . TRP A 1 39  ? 1.854   -4.359  12.540  1.00 0.00 ? 39  TRP A O    4  
ATOM 6308  C CB   . TRP A 1 39  ? 4.317   -3.409  11.393  1.00 0.00 ? 39  TRP A CB   4  
ATOM 6309  C CG   . TRP A 1 39  ? 5.594   -2.669  11.132  1.00 0.00 ? 39  TRP A CG   4  
ATOM 6310  C CD1  . TRP A 1 39  ? 6.550   -2.336  12.048  1.00 0.00 ? 39  TRP A CD1  4  
ATOM 6311  C CD2  . TRP A 1 39  ? 6.052   -2.168  9.871   1.00 0.00 ? 39  TRP A CD2  4  
ATOM 6312  N NE1  . TRP A 1 39  ? 7.575   -1.658  11.433  1.00 0.00 ? 39  TRP A NE1  4  
ATOM 6313  C CE2  . TRP A 1 39  ? 7.294   -1.543  10.097  1.00 0.00 ? 39  TRP A CE2  4  
ATOM 6314  C CE3  . TRP A 1 39  ? 5.535   -2.189  8.573   1.00 0.00 ? 39  TRP A CE3  4  
ATOM 6315  C CZ2  . TRP A 1 39  ? 8.023   -0.945  9.073   1.00 0.00 ? 39  TRP A CZ2  4  
ATOM 6316  C CZ3  . TRP A 1 39  ? 6.260   -1.594  7.558   1.00 0.00 ? 39  TRP A CZ3  4  
ATOM 6317  C CH2  . TRP A 1 39  ? 7.493   -0.980  7.812   1.00 0.00 ? 39  TRP A CH2  4  
ATOM 6318  H H    . TRP A 1 39  ? 3.244   -2.214  13.865  1.00 0.00 ? 39  TRP A H    4  
ATOM 6319  H HA   . TRP A 1 39  ? 3.018   -1.757  10.989  1.00 0.00 ? 39  TRP A HA   4  
ATOM 6320  H HB2  . TRP A 1 39  ? 4.494   -4.105  12.199  1.00 0.00 ? 39  TRP A HB2  4  
ATOM 6321  H HB3  . TRP A 1 39  ? 4.060   -3.958  10.498  1.00 0.00 ? 39  TRP A HB3  4  
ATOM 6322  H HD1  . TRP A 1 39  ? 6.494   -2.574  13.099  1.00 0.00 ? 39  TRP A HD1  4  
ATOM 6323  H HE1  . TRP A 1 39  ? 8.378   -1.314  11.879  1.00 0.00 ? 39  TRP A HE1  4  
ATOM 6324  H HE3  . TRP A 1 39  ? 4.586   -2.658  8.357   1.00 0.00 ? 39  TRP A HE3  4  
ATOM 6325  H HZ2  . TRP A 1 39  ? 8.975   -0.467  9.253   1.00 0.00 ? 39  TRP A HZ2  4  
ATOM 6326  H HZ3  . TRP A 1 39  ? 5.876   -1.600  6.548   1.00 0.00 ? 39  TRP A HZ3  4  
ATOM 6327  H HH2  . TRP A 1 39  ? 8.024   -0.528  6.989   1.00 0.00 ? 39  TRP A HH2  4  
ATOM 6328  N N    . ASN A 1 40  ? 0.796   -2.819  11.287  1.00 0.00 ? 40  ASN A N    4  
ATOM 6329  C CA   . ASN A 1 40  ? -0.491  -3.504  11.336  1.00 0.00 ? 40  ASN A CA   4  
ATOM 6330  C C    . ASN A 1 40  ? -0.683  -4.389  10.108  1.00 0.00 ? 40  ASN A C    4  
ATOM 6331  O O    . ASN A 1 40  ? -0.929  -3.898  9.006   1.00 0.00 ? 40  ASN A O    4  
ATOM 6332  C CB   . ASN A 1 40  ? -1.630  -2.487  11.428  1.00 0.00 ? 40  ASN A CB   4  
ATOM 6333  C CG   . ASN A 1 40  ? -1.412  -1.474  12.536  1.00 0.00 ? 40  ASN A CG   4  
ATOM 6334  O OD1  . ASN A 1 40  ? -1.533  -1.795  13.718  1.00 0.00 ? 40  ASN A OD1  4  
ATOM 6335  N ND2  . ASN A 1 40  ? -1.090  -0.243  12.156  1.00 0.00 ? 40  ASN A ND2  4  
ATOM 6336  H H    . ASN A 1 40  ? 0.871   -1.978  10.790  1.00 0.00 ? 40  ASN A H    4  
ATOM 6337  H HA   . ASN A 1 40  ? -0.502  -4.125  12.218  1.00 0.00 ? 40  ASN A HA   4  
ATOM 6338  H HB2  . ASN A 1 40  ? -1.706  -1.955  10.491  1.00 0.00 ? 40  ASN A HB2  4  
ATOM 6339  H HB3  . ASN A 1 40  ? -2.556  -3.008  11.618  1.00 0.00 ? 40  ASN A HB3  4  
ATOM 6340  H HD21 . ASN A 1 40  ? -1.011  -0.059  11.196  1.00 0.00 ? 40  ASN A HD21 4  
ATOM 6341  H HD22 . ASN A 1 40  ? -0.943  0.432   12.852  1.00 0.00 ? 40  ASN A HD22 4  
ATOM 6342  N N    . LYS A 1 41  ? -0.569  -5.698  10.306  1.00 0.00 ? 41  LYS A N    4  
ATOM 6343  C CA   . LYS A 1 41  ? -0.732  -6.654  9.217   1.00 0.00 ? 41  LYS A CA   4  
ATOM 6344  C C    . LYS A 1 41  ? -2.120  -6.539  8.595   1.00 0.00 ? 41  LYS A C    4  
ATOM 6345  O O    . LYS A 1 41  ? -3.132  -6.659  9.285   1.00 0.00 ? 41  LYS A O    4  
ATOM 6346  C CB   . LYS A 1 41  ? -0.507  -8.080  9.725   1.00 0.00 ? 41  LYS A CB   4  
ATOM 6347  C CG   . LYS A 1 41  ? -0.236  -9.084  8.617   1.00 0.00 ? 41  LYS A CG   4  
ATOM 6348  C CD   . LYS A 1 41  ? -0.534  -10.505 9.068   1.00 0.00 ? 41  LYS A CD   4  
ATOM 6349  C CE   . LYS A 1 41  ? 0.190   -11.526 8.204   1.00 0.00 ? 41  LYS A CE   4  
ATOM 6350  N NZ   . LYS A 1 41  ? 0.140   -12.890 8.800   1.00 0.00 ? 41  LYS A NZ   4  
ATOM 6351  H H    . LYS A 1 41  ? -0.372  -6.030  11.208  1.00 0.00 ? 41  LYS A H    4  
ATOM 6352  H HA   . LYS A 1 41  ? 0.007   -6.428  8.464   1.00 0.00 ? 41  LYS A HA   4  
ATOM 6353  H HB2  . LYS A 1 41  ? 0.339   -8.081  10.397  1.00 0.00 ? 41  LYS A HB2  4  
ATOM 6354  H HB3  . LYS A 1 41  ? -1.385  -8.400  10.265  1.00 0.00 ? 41  LYS A HB3  4  
ATOM 6355  H HG2  . LYS A 1 41  ? -0.862  -8.849  7.769   1.00 0.00 ? 41  LYS A HG2  4  
ATOM 6356  H HG3  . LYS A 1 41  ? 0.803   -9.018  8.329   1.00 0.00 ? 41  LYS A HG3  4  
ATOM 6357  H HD2  . LYS A 1 41  ? -0.212  -10.623 10.092  1.00 0.00 ? 41  LYS A HD2  4  
ATOM 6358  H HD3  . LYS A 1 41  ? -1.599  -10.679 9.001   1.00 0.00 ? 41  LYS A HD3  4  
ATOM 6359  H HE2  . LYS A 1 41  ? -0.276  -11.551 7.231   1.00 0.00 ? 41  LYS A HE2  4  
ATOM 6360  H HE3  . LYS A 1 41  ? 1.222   -11.225 8.102   1.00 0.00 ? 41  LYS A HE3  4  
ATOM 6361  H HZ1  . LYS A 1 41  ? 0.641   -12.902 9.711   1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 6362  H HZ2  . LYS A 1 41  ? 0.590   -13.576 8.160   1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 6363  H HZ3  . LYS A 1 41  ? -0.848  -13.176 8.956   1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 6364  N N    . ARG A 1 42  ? -2.160  -6.306  7.287   1.00 0.00 ? 42  ARG A N    4  
ATOM 6365  C CA   . ARG A 1 42  ? -3.424  -6.175  6.572   1.00 0.00 ? 42  ARG A CA   4  
ATOM 6366  C C    . ARG A 1 42  ? -3.315  -6.754  5.165   1.00 0.00 ? 42  ARG A C    4  
ATOM 6367  O O    . ARG A 1 42  ? -2.228  -6.811  4.588   1.00 0.00 ? 42  ARG A O    4  
ATOM 6368  C CB   . ARG A 1 42  ? -3.842  -4.705  6.499   1.00 0.00 ? 42  ARG A CB   4  
ATOM 6369  C CG   . ARG A 1 42  ? -4.078  -4.071  7.860   1.00 0.00 ? 42  ARG A CG   4  
ATOM 6370  C CD   . ARG A 1 42  ? -5.453  -4.421  8.407   1.00 0.00 ? 42  ARG A CD   4  
ATOM 6371  N NE   . ARG A 1 42  ? -5.525  -4.249  9.856   1.00 0.00 ? 42  ARG A NE   4  
ATOM 6372  C CZ   . ARG A 1 42  ? -5.733  -3.078  10.448  1.00 0.00 ? 42  ARG A CZ   4  
ATOM 6373  N NH1  . ARG A 1 42  ? -5.888  -1.981  9.718   1.00 0.00 ? 42  ARG A NH1  4  
ATOM 6374  N NH2  . ARG A 1 42  ? -5.786  -3.002  11.771  1.00 0.00 ? 42  ARG A NH2  4  
ATOM 6375  H H    . ARG A 1 42  ? -1.319  -6.220  6.791   1.00 0.00 ? 42  ARG A H    4  
ATOM 6376  H HA   . ARG A 1 42  ? -4.173  -6.727  7.119   1.00 0.00 ? 42  ARG A HA   4  
ATOM 6377  H HB2  . ARG A 1 42  ? -3.067  -4.147  5.995   1.00 0.00 ? 42  ARG A HB2  4  
ATOM 6378  H HB3  . ARG A 1 42  ? -4.756  -4.632  5.929   1.00 0.00 ? 42  ARG A HB3  4  
ATOM 6379  H HG2  . ARG A 1 42  ? -3.327  -4.429  8.549   1.00 0.00 ? 42  ARG A HG2  4  
ATOM 6380  H HG3  . ARG A 1 42  ? -4.000  -2.998  7.765   1.00 0.00 ? 42  ARG A HG3  4  
ATOM 6381  H HD2  . ARG A 1 42  ? -6.185  -3.779  7.942   1.00 0.00 ? 42  ARG A HD2  4  
ATOM 6382  H HD3  . ARG A 1 42  ? -5.670  -5.450  8.165   1.00 0.00 ? 42  ARG A HD3  4  
ATOM 6383  H HE   . ARG A 1 42  ? -5.413  -5.046  10.414  1.00 0.00 ? 42  ARG A HE   4  
ATOM 6384  H HH11 . ARG A 1 42  ? -5.850  -2.036  8.721   1.00 0.00 ? 42  ARG A HH11 4  
ATOM 6385  H HH12 . ARG A 1 42  ? -6.046  -1.101  10.166  1.00 0.00 ? 42  ARG A HH12 4  
ATOM 6386  H HH21 . ARG A 1 42  ? -5.669  -3.826  12.324  1.00 0.00 ? 42  ARG A HH21 4  
ATOM 6387  H HH22 . ARG A 1 42  ? -5.942  -2.120  12.215  1.00 0.00 ? 42  ARG A HH22 4  
ATOM 6388  N N    . TRP A 1 43  ? -4.447  -7.183  4.618   1.00 0.00 ? 43  TRP A N    4  
ATOM 6389  C CA   . TRP A 1 43  ? -4.478  -7.759  3.279   1.00 0.00 ? 43  TRP A CA   4  
ATOM 6390  C C    . TRP A 1 43  ? -4.287  -6.681  2.218   1.00 0.00 ? 43  TRP A C    4  
ATOM 6391  O O    . TRP A 1 43  ? -5.065  -5.730  2.138   1.00 0.00 ? 43  TRP A O    4  
ATOM 6392  C CB   . TRP A 1 43  ? -5.802  -8.490  3.047   1.00 0.00 ? 43  TRP A CB   4  
ATOM 6393  C CG   . TRP A 1 43  ? -5.909  -9.108  1.685   1.00 0.00 ? 43  TRP A CG   4  
ATOM 6394  C CD1  . TRP A 1 43  ? -6.886  -8.884  0.758   1.00 0.00 ? 43  TRP A CD1  4  
ATOM 6395  C CD2  . TRP A 1 43  ? -5.006  -10.052 1.100   1.00 0.00 ? 43  TRP A CD2  4  
ATOM 6396  N NE1  . TRP A 1 43  ? -6.645  -9.632  -0.369  1.00 0.00 ? 43  TRP A NE1  4  
ATOM 6397  C CE2  . TRP A 1 43  ? -5.497  -10.357 -0.185  1.00 0.00 ? 43  TRP A CE2  4  
ATOM 6398  C CE3  . TRP A 1 43  ? -3.829  -10.669 1.534   1.00 0.00 ? 43  TRP A CE3  4  
ATOM 6399  C CZ2  . TRP A 1 43  ? -4.853  -11.251 -1.036  1.00 0.00 ? 43  TRP A CZ2  4  
ATOM 6400  C CZ3  . TRP A 1 43  ? -3.191  -11.556 0.689   1.00 0.00 ? 43  TRP A CZ3  4  
ATOM 6401  C CH2  . TRP A 1 43  ? -3.703  -11.840 -0.585  1.00 0.00 ? 43  TRP A CH2  4  
ATOM 6402  H H    . TRP A 1 43  ? -5.281  -7.111  5.128   1.00 0.00 ? 43  TRP A H    4  
ATOM 6403  H HA   . TRP A 1 43  ? -3.668  -8.469  3.205   1.00 0.00 ? 43  TRP A HA   4  
ATOM 6404  H HB2  . TRP A 1 43  ? -5.904  -9.278  3.779   1.00 0.00 ? 43  TRP A HB2  4  
ATOM 6405  H HB3  . TRP A 1 43  ? -6.616  -7.790  3.161   1.00 0.00 ? 43  TRP A HB3  4  
ATOM 6406  H HD1  . TRP A 1 43  ? -7.721  -8.215  0.904   1.00 0.00 ? 43  TRP A HD1  4  
ATOM 6407  H HE1  . TRP A 1 43  ? -7.204  -9.643  -1.174  1.00 0.00 ? 43  TRP A HE1  4  
ATOM 6408  H HE3  . TRP A 1 43  ? -3.419  -10.463 2.512   1.00 0.00 ? 43  TRP A HE3  4  
ATOM 6409  H HZ2  . TRP A 1 43  ? -5.234  -11.480 -2.020  1.00 0.00 ? 43  TRP A HZ2  4  
ATOM 6410  H HZ3  . TRP A 1 43  ? -2.281  -12.043 1.007   1.00 0.00 ? 43  TRP A HZ3  4  
ATOM 6411  H HH2  . TRP A 1 43  ? -3.172  -12.540 -1.211  1.00 0.00 ? 43  TRP A HH2  4  
ATOM 6412  N N    . PHE A 1 44  ? -3.247  -6.835  1.405   1.00 0.00 ? 44  PHE A N    4  
ATOM 6413  C CA   . PHE A 1 44  ? -2.953  -5.873  0.349   1.00 0.00 ? 44  PHE A CA   4  
ATOM 6414  C C    . PHE A 1 44  ? -3.365  -6.420  -1.015  1.00 0.00 ? 44  PHE A C    4  
ATOM 6415  O O    . PHE A 1 44  ? -3.278  -7.622  -1.266  1.00 0.00 ? 44  PHE A O    4  
ATOM 6416  C CB   . PHE A 1 44  ? -1.462  -5.528  0.344   1.00 0.00 ? 44  PHE A CB   4  
ATOM 6417  C CG   . PHE A 1 44  ? -1.105  -4.399  1.267   1.00 0.00 ? 44  PHE A CG   4  
ATOM 6418  C CD1  . PHE A 1 44  ? -1.666  -4.316  2.531   1.00 0.00 ? 44  PHE A CD1  4  
ATOM 6419  C CD2  . PHE A 1 44  ? -0.208  -3.420  0.871   1.00 0.00 ? 44  PHE A CD2  4  
ATOM 6420  C CE1  . PHE A 1 44  ? -1.339  -3.277  3.382   1.00 0.00 ? 44  PHE A CE1  4  
ATOM 6421  C CE2  . PHE A 1 44  ? 0.122   -2.378  1.717   1.00 0.00 ? 44  PHE A CE2  4  
ATOM 6422  C CZ   . PHE A 1 44  ? -0.443  -2.308  2.975   1.00 0.00 ? 44  PHE A CZ   4  
ATOM 6423  H H    . PHE A 1 44  ? -2.663  -7.614  1.518   1.00 0.00 ? 44  PHE A H    4  
ATOM 6424  H HA   . PHE A 1 44  ? -3.520  -4.977  0.550   1.00 0.00 ? 44  PHE A HA   4  
ATOM 6425  H HB2  . PHE A 1 44  ? -0.898  -6.397  0.650   1.00 0.00 ? 44  PHE A HB2  4  
ATOM 6426  H HB3  . PHE A 1 44  ? -1.168  -5.248  -0.656  1.00 0.00 ? 44  PHE A HB3  4  
ATOM 6427  H HD1  . PHE A 1 44  ? -2.366  -5.073  2.852   1.00 0.00 ? 44  PHE A HD1  4  
ATOM 6428  H HD2  . PHE A 1 44  ? 0.235   -3.475  -0.114  1.00 0.00 ? 44  PHE A HD2  4  
ATOM 6429  H HE1  . PHE A 1 44  ? -1.783  -3.224  4.365   1.00 0.00 ? 44  PHE A HE1  4  
ATOM 6430  H HE2  . PHE A 1 44  ? 0.823   -1.623  1.396   1.00 0.00 ? 44  PHE A HE2  4  
ATOM 6431  H HZ   . PHE A 1 44  ? -0.187  -1.495  3.638   1.00 0.00 ? 44  PHE A HZ   4  
ATOM 6432  N N    . VAL A 1 45  ? -3.813  -5.528  -1.892  1.00 0.00 ? 45  VAL A N    4  
ATOM 6433  C CA   . VAL A 1 45  ? -4.238  -5.920  -3.231  1.00 0.00 ? 45  VAL A CA   4  
ATOM 6434  C C    . VAL A 1 45  ? -3.951  -4.816  -4.243  1.00 0.00 ? 45  VAL A C    4  
ATOM 6435  O O    . VAL A 1 45  ? -4.327  -3.661  -4.042  1.00 0.00 ? 45  VAL A O    4  
ATOM 6436  C CB   . VAL A 1 45  ? -5.741  -6.256  -3.267  1.00 0.00 ? 45  VAL A CB   4  
ATOM 6437  C CG1  . VAL A 1 45  ? -6.156  -6.697  -4.662  1.00 0.00 ? 45  VAL A CG1  4  
ATOM 6438  C CG2  . VAL A 1 45  ? -6.071  -7.329  -2.240  1.00 0.00 ? 45  VAL A CG2  4  
ATOM 6439  H H    . VAL A 1 45  ? -3.859  -4.584  -1.634  1.00 0.00 ? 45  VAL A H    4  
ATOM 6440  H HA   . VAL A 1 45  ? -3.686  -6.805  -3.511  1.00 0.00 ? 45  VAL A HA   4  
ATOM 6441  H HB   . VAL A 1 45  ? -6.295  -5.364  -3.015  1.00 0.00 ? 45  VAL A HB   4  
ATOM 6442  H HG11 . VAL A 1 45  ? -7.232  -6.780  -4.708  1.00 0.00 ? 45  VAL A HG11 4  
ATOM 6443  H HG12 . VAL A 1 45  ? -5.819  -5.969  -5.385  1.00 0.00 ? 45  VAL A HG12 4  
ATOM 6444  H HG13 . VAL A 1 45  ? -5.712  -7.657  -4.883  1.00 0.00 ? 45  VAL A HG13 4  
ATOM 6445  H HG21 . VAL A 1 45  ? -5.584  -8.253  -2.515  1.00 0.00 ? 45  VAL A HG21 4  
ATOM 6446  H HG22 . VAL A 1 45  ? -5.723  -7.014  -1.267  1.00 0.00 ? 45  VAL A HG22 4  
ATOM 6447  H HG23 . VAL A 1 45  ? -7.140  -7.481  -2.208  1.00 0.00 ? 45  VAL A HG23 4  
ATOM 6448  N N    . LEU A 1 46  ? -3.285  -5.180  -5.333  1.00 0.00 ? 46  LEU A N    4  
ATOM 6449  C CA   . LEU A 1 46  ? -2.947  -4.221  -6.379  1.00 0.00 ? 46  LEU A CA   4  
ATOM 6450  C C    . LEU A 1 46  ? -3.874  -4.378  -7.581  1.00 0.00 ? 46  LEU A C    4  
ATOM 6451  O O    . LEU A 1 46  ? -3.839  -5.393  -8.276  1.00 0.00 ? 46  LEU A O    4  
ATOM 6452  C CB   . LEU A 1 46  ? -1.492  -4.403  -6.815  1.00 0.00 ? 46  LEU A CB   4  
ATOM 6453  C CG   . LEU A 1 46  ? -0.915  -3.301  -7.705  1.00 0.00 ? 46  LEU A CG   4  
ATOM 6454  C CD1  . LEU A 1 46  ? -0.841  -1.986  -6.944  1.00 0.00 ? 46  LEU A CD1  4  
ATOM 6455  C CD2  . LEU A 1 46  ? 0.459   -3.698  -8.222  1.00 0.00 ? 46  LEU A CD2  4  
ATOM 6456  H H    . LEU A 1 46  ? -3.012  -6.115  -5.438  1.00 0.00 ? 46  LEU A H    4  
ATOM 6457  H HA   . LEU A 1 46  ? -3.071  -3.229  -5.972  1.00 0.00 ? 46  LEU A HA   4  
ATOM 6458  H HB2  . LEU A 1 46  ? -0.885  -4.461  -5.925  1.00 0.00 ? 46  LEU A HB2  4  
ATOM 6459  H HB3  . LEU A 1 46  ? -1.424  -5.336  -7.357  1.00 0.00 ? 46  LEU A HB3  4  
ATOM 6460  H HG   . LEU A 1 46  ? -1.566  -3.157  -8.556  1.00 0.00 ? 46  LEU A HG   4  
ATOM 6461  H HD11 . LEU A 1 46  ? -0.113  -2.069  -6.152  1.00 0.00 ? 46  LEU A HD11 4  
ATOM 6462  H HD12 . LEU A 1 46  ? -1.809  -1.759  -6.522  1.00 0.00 ? 46  LEU A HD12 4  
ATOM 6463  H HD13 . LEU A 1 46  ? -0.549  -1.195  -7.620  1.00 0.00 ? 46  LEU A HD13 4  
ATOM 6464  H HD21 . LEU A 1 46  ? 1.033   -2.810  -8.440  1.00 0.00 ? 46  LEU A HD21 4  
ATOM 6465  H HD22 . LEU A 1 46  ? 0.348   -4.285  -9.123  1.00 0.00 ? 46  LEU A HD22 4  
ATOM 6466  H HD23 . LEU A 1 46  ? 0.971   -4.284  -7.472  1.00 0.00 ? 46  LEU A HD23 4  
ATOM 6467  N N    . VAL A 1 47  ? -4.699  -3.364  -7.821  1.00 0.00 ? 47  VAL A N    4  
ATOM 6468  C CA   . VAL A 1 47  ? -5.633  -3.388  -8.941  1.00 0.00 ? 47  VAL A CA   4  
ATOM 6469  C C    . VAL A 1 47  ? -5.743  -2.014  -9.594  1.00 0.00 ? 47  VAL A C    4  
ATOM 6470  O O    . VAL A 1 47  ? -5.882  -1.000  -8.909  1.00 0.00 ? 47  VAL A O    4  
ATOM 6471  C CB   . VAL A 1 47  ? -7.034  -3.846  -8.495  1.00 0.00 ? 47  VAL A CB   4  
ATOM 6472  C CG1  . VAL A 1 47  ? -8.066  -3.530  -9.566  1.00 0.00 ? 47  VAL A CG1  4  
ATOM 6473  C CG2  . VAL A 1 47  ? -7.029  -5.332  -8.168  1.00 0.00 ? 47  VAL A CG2  4  
ATOM 6474  H H    . VAL A 1 47  ? -4.680  -2.582  -7.232  1.00 0.00 ? 47  VAL A H    4  
ATOM 6475  H HA   . VAL A 1 47  ? -5.262  -4.093  -9.671  1.00 0.00 ? 47  VAL A HA   4  
ATOM 6476  H HB   . VAL A 1 47  ? -7.300  -3.303  -7.599  1.00 0.00 ? 47  VAL A HB   4  
ATOM 6477  H HG11 . VAL A 1 47  ? -7.563  -3.208  -10.466 1.00 0.00 ? 47  VAL A HG11 4  
ATOM 6478  H HG12 . VAL A 1 47  ? -8.650  -4.414  -9.775  1.00 0.00 ? 47  VAL A HG12 4  
ATOM 6479  H HG13 . VAL A 1 47  ? -8.717  -2.742  -9.218  1.00 0.00 ? 47  VAL A HG13 4  
ATOM 6480  H HG21 . VAL A 1 47  ? -6.011  -5.686  -8.117  1.00 0.00 ? 47  VAL A HG21 4  
ATOM 6481  H HG22 . VAL A 1 47  ? -7.516  -5.492  -7.218  1.00 0.00 ? 47  VAL A HG22 4  
ATOM 6482  H HG23 . VAL A 1 47  ? -7.559  -5.872  -8.939  1.00 0.00 ? 47  VAL A HG23 4  
ATOM 6483  N N    . ASP A 1 48  ? -5.682  -1.989  -10.920 1.00 0.00 ? 48  ASP A N    4  
ATOM 6484  C CA   . ASP A 1 48  ? -5.776  -0.740  -11.666 1.00 0.00 ? 48  ASP A CA   4  
ATOM 6485  C C    . ASP A 1 48  ? -4.687  0.236   -11.232 1.00 0.00 ? 48  ASP A C    4  
ATOM 6486  O O    . ASP A 1 48  ? -4.973  1.369   -10.846 1.00 0.00 ? 48  ASP A O    4  
ATOM 6487  C CB   . ASP A 1 48  ? -7.154  -0.106  -11.469 1.00 0.00 ? 48  ASP A CB   4  
ATOM 6488  C CG   . ASP A 1 48  ? -7.536  0.815   -12.611 1.00 0.00 ? 48  ASP A CG   4  
ATOM 6489  O OD1  . ASP A 1 48  ? -7.470  0.374   -13.777 1.00 0.00 ? 48  ASP A OD1  4  
ATOM 6490  O OD2  . ASP A 1 48  ? -7.901  1.979   -12.338 1.00 0.00 ? 48  ASP A OD2  4  
ATOM 6491  H H    . ASP A 1 48  ? -5.570  -2.831  -11.410 1.00 0.00 ? 48  ASP A H    4  
ATOM 6492  H HA   . ASP A 1 48  ? -5.641  -0.968  -12.713 1.00 0.00 ? 48  ASP A HA   4  
ATOM 6493  H HB2  . ASP A 1 48  ? -7.896  -0.888  -11.399 1.00 0.00 ? 48  ASP A HB2  4  
ATOM 6494  H HB3  . ASP A 1 48  ? -7.152  0.466   -10.553 1.00 0.00 ? 48  ASP A HB3  4  
ATOM 6495  N N    . ARG A 1 49  ? -3.437  -0.212  -11.298 1.00 0.00 ? 49  ARG A N    4  
ATOM 6496  C CA   . ARG A 1 49  ? -2.306  0.621   -10.910 1.00 0.00 ? 49  ARG A CA   4  
ATOM 6497  C C    . ARG A 1 49  ? -2.581  1.330   -9.587  1.00 0.00 ? 49  ARG A C    4  
ATOM 6498  O O    . ARG A 1 49  ? -2.053  2.413   -9.330  1.00 0.00 ? 49  ARG A O    4  
ATOM 6499  C CB   . ARG A 1 49  ? -2.005  1.651   -12.000 1.00 0.00 ? 49  ARG A CB   4  
ATOM 6500  C CG   . ARG A 1 49  ? -1.414  1.046   -13.263 1.00 0.00 ? 49  ARG A CG   4  
ATOM 6501  C CD   . ARG A 1 49  ? -0.873  2.120   -14.194 1.00 0.00 ? 49  ARG A CD   4  
ATOM 6502  N NE   . ARG A 1 49  ? -0.851  1.677   -15.586 1.00 0.00 ? 49  ARG A NE   4  
ATOM 6503  C CZ   . ARG A 1 49  ? 0.090   0.886   -16.090 1.00 0.00 ? 49  ARG A CZ   4  
ATOM 6504  N NH1  . ARG A 1 49  ? 1.080   0.454   -15.322 1.00 0.00 ? 49  ARG A NH1  4  
ATOM 6505  N NH2  . ARG A 1 49  ? 0.041   0.526   -17.367 1.00 0.00 ? 49  ARG A NH2  4  
ATOM 6506  H H    . ARG A 1 49  ? -3.273  -1.125  -11.615 1.00 0.00 ? 49  ARG A H    4  
ATOM 6507  H HA   . ARG A 1 49  ? -1.447  -0.022  -10.788 1.00 0.00 ? 49  ARG A HA   4  
ATOM 6508  H HB2  . ARG A 1 49  ? -2.923  2.156   -12.265 1.00 0.00 ? 49  ARG A HB2  4  
ATOM 6509  H HB3  . ARG A 1 49  ? -1.305  2.375   -11.611 1.00 0.00 ? 49  ARG A HB3  4  
ATOM 6510  H HG2  . ARG A 1 49  ? -0.606  0.383   -12.989 1.00 0.00 ? 49  ARG A HG2  4  
ATOM 6511  H HG3  . ARG A 1 49  ? -2.182  0.489   -13.778 1.00 0.00 ? 49  ARG A HG3  4  
ATOM 6512  H HD2  . ARG A 1 49  ? -1.501  2.995   -14.116 1.00 0.00 ? 49  ARG A HD2  4  
ATOM 6513  H HD3  . ARG A 1 49  ? 0.132   2.369   -13.889 1.00 0.00 ? 49  ARG A HD3  4  
ATOM 6514  H HE   . ARG A 1 49  ? -1.573  1.985   -16.172 1.00 0.00 ? 49  ARG A HE   4  
ATOM 6515  H HH11 . ARG A 1 49  ? 1.118   0.723   -14.359 1.00 0.00 ? 49  ARG A HH11 4  
ATOM 6516  H HH12 . ARG A 1 49  ? 1.786   -0.142  -15.704 1.00 0.00 ? 49  ARG A HH12 4  
ATOM 6517  H HH21 . ARG A 1 49  ? -0.704  0.850   -17.949 1.00 0.00 ? 49  ARG A HH21 4  
ATOM 6518  H HH22 . ARG A 1 49  ? 0.750   -0.068  -17.745 1.00 0.00 ? 49  ARG A HH22 4  
ATOM 6519  N N    . CYS A 1 50  ? -3.411  0.714   -8.753  1.00 0.00 ? 50  CYS A N    4  
ATOM 6520  C CA   . CYS A 1 50  ? -3.758  1.287   -7.457  1.00 0.00 ? 50  CYS A CA   4  
ATOM 6521  C C    . CYS A 1 50  ? -3.648  0.240   -6.353  1.00 0.00 ? 50  CYS A C    4  
ATOM 6522  O O    . CYS A 1 50  ? -3.867  -0.949  -6.587  1.00 0.00 ? 50  CYS A O    4  
ATOM 6523  C CB   . CYS A 1 50  ? -5.175  1.861   -7.493  1.00 0.00 ? 50  CYS A CB   4  
ATOM 6524  S SG   . CYS A 1 50  ? -5.309  3.442   -8.361  1.00 0.00 ? 50  CYS A SG   4  
ATOM 6525  H H    . CYS A 1 50  ? -3.801  -0.147  -9.014  1.00 0.00 ? 50  CYS A H    4  
ATOM 6526  H HA   . CYS A 1 50  ? -3.061  2.084   -7.251  1.00 0.00 ? 50  CYS A HA   4  
ATOM 6527  H HB2  . CYS A 1 50  ? -5.828  1.158   -7.990  1.00 0.00 ? 50  CYS A HB2  4  
ATOM 6528  H HB3  . CYS A 1 50  ? -5.521  2.009   -6.481  1.00 0.00 ? 50  CYS A HB3  4  
ATOM 6529  H HG   . CYS A 1 50  ? -6.168  3.290   -9.357  1.00 0.00 ? 50  CYS A HG   4  
ATOM 6530  N N    . LEU A 1 51  ? -3.307  0.690   -5.151  1.00 0.00 ? 51  LEU A N    4  
ATOM 6531  C CA   . LEU A 1 51  ? -3.166  -0.207  -4.010  1.00 0.00 ? 51  LEU A CA   4  
ATOM 6532  C C    . LEU A 1 51  ? -4.394  -0.137  -3.107  1.00 0.00 ? 51  LEU A C    4  
ATOM 6533  O O    . LEU A 1 51  ? -4.825  0.946   -2.711  1.00 0.00 ? 51  LEU A O    4  
ATOM 6534  C CB   . LEU A 1 51  ? -1.911  0.145   -3.210  1.00 0.00 ? 51  LEU A CB   4  
ATOM 6535  C CG   . LEU A 1 51  ? -1.295  -0.991  -2.392  1.00 0.00 ? 51  LEU A CG   4  
ATOM 6536  C CD1  . LEU A 1 51  ? 0.152   -0.675  -2.045  1.00 0.00 ? 51  LEU A CD1  4  
ATOM 6537  C CD2  . LEU A 1 51  ? -2.107  -1.238  -1.128  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 6538  H H    . LEU A 1 51  ? -3.146  1.648   -5.026  1.00 0.00 ? 51  LEU A H    4  
ATOM 6539  H HA   . LEU A 1 51  ? -3.071  -1.214  -4.390  1.00 0.00 ? 51  LEU A HA   4  
ATOM 6540  H HB2  . LEU A 1 51  ? -1.163  0.493   -3.906  1.00 0.00 ? 51  LEU A HB2  4  
ATOM 6541  H HB3  . LEU A 1 51  ? -2.167  0.944   -2.529  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 6542  H HG   . LEU A 1 51  ? -1.307  -1.897  -2.981  1.00 0.00 ? 51  LEU A HG   4  
ATOM 6543  H HD11 . LEU A 1 51  ? 0.365   -1.019  -1.044  1.00 0.00 ? 51  LEU A HD11 4  
ATOM 6544  H HD12 . LEU A 1 51  ? 0.311   0.391   -2.102  1.00 0.00 ? 51  LEU A HD12 4  
ATOM 6545  H HD13 . LEU A 1 51  ? 0.806   -1.174  -2.745  1.00 0.00 ? 51  LEU A HD13 4  
ATOM 6546  H HD21 . LEU A 1 51  ? -3.160  -1.202  -1.364  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 6547  H HD22 . LEU A 1 51  ? -1.875  -0.477  -0.398  1.00 0.00 ? 51  LEU A HD22 4  
ATOM 6548  H HD23 . LEU A 1 51  ? -1.860  -2.210  -0.727  1.00 0.00 ? 51  LEU A HD23 4  
ATOM 6549  N N    . PHE A 1 52  ? -4.951  -1.300  -2.784  1.00 0.00 ? 52  PHE A N    4  
ATOM 6550  C CA   . PHE A 1 52  ? -6.129  -1.370  -1.926  1.00 0.00 ? 52  PHE A CA   4  
ATOM 6551  C C    . PHE A 1 52  ? -5.928  -2.391  -0.810  1.00 0.00 ? 52  PHE A C    4  
ATOM 6552  O O    . PHE A 1 52  ? -5.720  -3.577  -1.068  1.00 0.00 ? 52  PHE A O    4  
ATOM 6553  C CB   . PHE A 1 52  ? -7.365  -1.736  -2.751  1.00 0.00 ? 52  PHE A CB   4  
ATOM 6554  C CG   . PHE A 1 52  ? -7.579  -0.843  -3.939  1.00 0.00 ? 52  PHE A CG   4  
ATOM 6555  C CD1  . PHE A 1 52  ? -7.697  0.528   -3.779  1.00 0.00 ? 52  PHE A CD1  4  
ATOM 6556  C CD2  . PHE A 1 52  ? -7.662  -1.374  -5.216  1.00 0.00 ? 52  PHE A CD2  4  
ATOM 6557  C CE1  . PHE A 1 52  ? -7.894  1.354   -4.870  1.00 0.00 ? 52  PHE A CE1  4  
ATOM 6558  C CE2  . PHE A 1 52  ? -7.858  -0.554  -6.311  1.00 0.00 ? 52  PHE A CE2  4  
ATOM 6559  C CZ   . PHE A 1 52  ? -7.975  0.811   -6.138  1.00 0.00 ? 52  PHE A CZ   4  
ATOM 6560  H H    . PHE A 1 52  ? -4.562  -2.130  -3.131  1.00 0.00 ? 52  PHE A H    4  
ATOM 6561  H HA   . PHE A 1 52  ? -6.276  -0.397  -1.485  1.00 0.00 ? 52  PHE A HA   4  
ATOM 6562  H HB2  . PHE A 1 52  ? -7.261  -2.748  -3.112  1.00 0.00 ? 52  PHE A HB2  4  
ATOM 6563  H HB3  . PHE A 1 52  ? -8.240  -1.670  -2.122  1.00 0.00 ? 52  PHE A HB3  4  
ATOM 6564  H HD1  . PHE A 1 52  ? -7.634  0.954   -2.787  1.00 0.00 ? 52  PHE A HD1  4  
ATOM 6565  H HD2  . PHE A 1 52  ? -7.572  -2.442  -5.353  1.00 0.00 ? 52  PHE A HD2  4  
ATOM 6566  H HE1  . PHE A 1 52  ? -7.985  2.421   -4.731  1.00 0.00 ? 52  PHE A HE1  4  
ATOM 6567  H HE2  . PHE A 1 52  ? -7.922  -0.980  -7.301  1.00 0.00 ? 52  PHE A HE2  4  
ATOM 6568  H HZ   . PHE A 1 52  ? -8.128  1.454   -6.992  1.00 0.00 ? 52  PHE A HZ   4  
ATOM 6569  N N    . TYR A 1 53  ? -5.991  -1.921  0.431   1.00 0.00 ? 53  TYR A N    4  
ATOM 6570  C CA   . TYR A 1 53  ? -5.813  -2.792  1.588   1.00 0.00 ? 53  TYR A CA   4  
ATOM 6571  C C    . TYR A 1 53  ? -7.143  -3.040  2.292   1.00 0.00 ? 53  TYR A C    4  
ATOM 6572  O O    . TYR A 1 53  ? -7.846  -2.100  2.665   1.00 0.00 ? 53  TYR A O    4  
ATOM 6573  C CB   . TYR A 1 53  ? -4.812  -2.175  2.566   1.00 0.00 ? 53  TYR A CB   4  
ATOM 6574  C CG   . TYR A 1 53  ? -5.346  -0.963  3.295   1.00 0.00 ? 53  TYR A CG   4  
ATOM 6575  C CD1  . TYR A 1 53  ? -5.212  0.311   2.756   1.00 0.00 ? 53  TYR A CD1  4  
ATOM 6576  C CD2  . TYR A 1 53  ? -5.984  -1.091  4.522   1.00 0.00 ? 53  TYR A CD2  4  
ATOM 6577  C CE1  . TYR A 1 53  ? -5.697  1.421   3.419   1.00 0.00 ? 53  TYR A CE1  4  
ATOM 6578  C CE2  . TYR A 1 53  ? -6.474  0.014   5.191   1.00 0.00 ? 53  TYR A CE2  4  
ATOM 6579  C CZ   . TYR A 1 53  ? -6.328  1.268   4.636   1.00 0.00 ? 53  TYR A CZ   4  
ATOM 6580  O OH   . TYR A 1 53  ? -6.814  2.372   5.298   1.00 0.00 ? 53  TYR A OH   4  
ATOM 6581  H H    . TYR A 1 53  ? -6.159  -0.967  0.573   1.00 0.00 ? 53  TYR A H    4  
ATOM 6582  H HA   . TYR A 1 53  ? -5.423  -3.735  1.236   1.00 0.00 ? 53  TYR A HA   4  
ATOM 6583  H HB2  . TYR A 1 53  ? -4.541  -2.913  3.306   1.00 0.00 ? 53  TYR A HB2  4  
ATOM 6584  H HB3  . TYR A 1 53  ? -3.927  -1.875  2.024   1.00 0.00 ? 53  TYR A HB3  4  
ATOM 6585  H HD1  . TYR A 1 53  ? -4.718  0.427   1.802   1.00 0.00 ? 53  TYR A HD1  4  
ATOM 6586  H HD2  . TYR A 1 53  ? -6.098  -2.074  4.955   1.00 0.00 ? 53  TYR A HD2  4  
ATOM 6587  H HE1  . TYR A 1 53  ? -5.583  2.403   2.983   1.00 0.00 ? 53  TYR A HE1  4  
ATOM 6588  H HE2  . TYR A 1 53  ? -6.968  -0.105  6.145   1.00 0.00 ? 53  TYR A HE2  4  
ATOM 6589  H HH   . TYR A 1 53  ? -7.039  2.130   6.200   1.00 0.00 ? 53  TYR A HH   4  
ATOM 6590  N N    . TYR A 1 54  ? -7.482  -4.312  2.471   1.00 0.00 ? 54  TYR A N    4  
ATOM 6591  C CA   . TYR A 1 54  ? -8.728  -4.686  3.129   1.00 0.00 ? 54  TYR A CA   4  
ATOM 6592  C C    . TYR A 1 54  ? -8.457  -5.313  4.493   1.00 0.00 ? 54  TYR A C    4  
ATOM 6593  O O    . TYR A 1 54  ? -7.447  -5.989  4.690   1.00 0.00 ? 54  TYR A O    4  
ATOM 6594  C CB   . TYR A 1 54  ? -9.518  -5.661  2.255   1.00 0.00 ? 54  TYR A CB   4  
ATOM 6595  C CG   . TYR A 1 54  ? -9.975  -5.064  0.943   1.00 0.00 ? 54  TYR A CG   4  
ATOM 6596  C CD1  . TYR A 1 54  ? -9.159  -5.102  -0.182  1.00 0.00 ? 54  TYR A CD1  4  
ATOM 6597  C CD2  . TYR A 1 54  ? -11.222 -4.462  0.827   1.00 0.00 ? 54  TYR A CD2  4  
ATOM 6598  C CE1  . TYR A 1 54  ? -9.572  -4.557  -1.382  1.00 0.00 ? 54  TYR A CE1  4  
ATOM 6599  C CE2  . TYR A 1 54  ? -11.643 -3.916  -0.370  1.00 0.00 ? 54  TYR A CE2  4  
ATOM 6600  C CZ   . TYR A 1 54  ? -10.815 -3.966  -1.471  1.00 0.00 ? 54  TYR A CZ   4  
ATOM 6601  O OH   . TYR A 1 54  ? -11.231 -3.422  -2.665  1.00 0.00 ? 54  TYR A OH   4  
ATOM 6602  H H    . TYR A 1 54  ? -6.880  -5.016  2.152   1.00 0.00 ? 54  TYR A H    4  
ATOM 6603  H HA   . TYR A 1 54  ? -9.312  -3.788  3.268   1.00 0.00 ? 54  TYR A HA   4  
ATOM 6604  H HB2  . TYR A 1 54  ? -8.899  -6.516  2.031   1.00 0.00 ? 54  TYR A HB2  4  
ATOM 6605  H HB3  . TYR A 1 54  ? -10.395 -5.988  2.794   1.00 0.00 ? 54  TYR A HB3  4  
ATOM 6606  H HD1  . TYR A 1 54  ? -8.186  -5.565  -0.109  1.00 0.00 ? 54  TYR A HD1  4  
ATOM 6607  H HD2  . TYR A 1 54  ? -11.868 -4.424  1.692   1.00 0.00 ? 54  TYR A HD2  4  
ATOM 6608  H HE1  . TYR A 1 54  ? -8.924  -4.596  -2.245  1.00 0.00 ? 54  TYR A HE1  4  
ATOM 6609  H HE2  . TYR A 1 54  ? -12.616 -3.453  -0.439  1.00 0.00 ? 54  TYR A HE2  4  
ATOM 6610  H HH   . TYR A 1 54  ? -10.980 -4.004  -3.386  1.00 0.00 ? 54  TYR A HH   4  
ATOM 6611  N N    . LYS A 1 55  ? -9.368  -5.085  5.433   1.00 0.00 ? 55  LYS A N    4  
ATOM 6612  C CA   . LYS A 1 55  ? -9.231  -5.628  6.779   1.00 0.00 ? 55  LYS A CA   4  
ATOM 6613  C C    . LYS A 1 55  ? -9.037  -7.141  6.739   1.00 0.00 ? 55  LYS A C    4  
ATOM 6614  O O    . LYS A 1 55  ? -8.396  -7.718  7.617   1.00 0.00 ? 55  LYS A O    4  
ATOM 6615  C CB   . LYS A 1 55  ? -10.464 -5.284  7.618   1.00 0.00 ? 55  LYS A CB   4  
ATOM 6616  C CG   . LYS A 1 55  ? -11.688 -6.112  7.268   1.00 0.00 ? 55  LYS A CG   4  
ATOM 6617  C CD   . LYS A 1 55  ? -12.535 -5.434  6.204   1.00 0.00 ? 55  LYS A CD   4  
ATOM 6618  C CE   . LYS A 1 55  ? -14.005 -5.793  6.349   1.00 0.00 ? 55  LYS A CE   4  
ATOM 6619  N NZ   . LYS A 1 55  ? -14.893 -4.722  5.820   1.00 0.00 ? 55  LYS A NZ   4  
ATOM 6620  H H    . LYS A 1 55  ? -10.152 -4.539  5.216   1.00 0.00 ? 55  LYS A H    4  
ATOM 6621  H HA   . LYS A 1 55  ? -8.361  -5.178  7.232   1.00 0.00 ? 55  LYS A HA   4  
ATOM 6622  H HB2  . LYS A 1 55  ? -10.232 -5.446  8.660   1.00 0.00 ? 55  LYS A HB2  4  
ATOM 6623  H HB3  . LYS A 1 55  ? -10.706 -4.242  7.469   1.00 0.00 ? 55  LYS A HB3  4  
ATOM 6624  H HG2  . LYS A 1 55  ? -11.367 -7.074  6.898   1.00 0.00 ? 55  LYS A HG2  4  
ATOM 6625  H HG3  . LYS A 1 55  ? -12.286 -6.248  8.158   1.00 0.00 ? 55  LYS A HG3  4  
ATOM 6626  H HD2  . LYS A 1 55  ? -12.427 -4.364  6.299   1.00 0.00 ? 55  LYS A HD2  4  
ATOM 6627  H HD3  . LYS A 1 55  ? -12.191 -5.748  5.229   1.00 0.00 ? 55  LYS A HD3  4  
ATOM 6628  H HE2  . LYS A 1 55  ? -14.195 -6.707  5.806   1.00 0.00 ? 55  LYS A HE2  4  
ATOM 6629  H HE3  . LYS A 1 55  ? -14.224 -5.946  7.396   1.00 0.00 ? 55  LYS A HE3  4  
ATOM 6630  H HZ1  . LYS A 1 55  ? -15.851 -4.823  6.213   1.00 0.00 ? 55  LYS A HZ1  4  
ATOM 6631  H HZ2  . LYS A 1 55  ? -14.948 -4.783  4.783   1.00 0.00 ? 55  LYS A HZ2  4  
ATOM 6632  H HZ3  . LYS A 1 55  ? -14.520 -3.787  6.081   1.00 0.00 ? 55  LYS A HZ3  4  
ATOM 6633  N N    . ASP A 1 56  ? -9.593  -7.777  5.713   1.00 0.00 ? 56  ASP A N    4  
ATOM 6634  C CA   . ASP A 1 56  ? -9.478  -9.222  5.557   1.00 0.00 ? 56  ASP A CA   4  
ATOM 6635  C C    . ASP A 1 56  ? -9.418  -9.606  4.082   1.00 0.00 ? 56  ASP A C    4  
ATOM 6636  O O    . ASP A 1 56  ? -9.697  -8.788  3.206   1.00 0.00 ? 56  ASP A O    4  
ATOM 6637  C CB   . ASP A 1 56  ? -10.657 -9.924  6.232   1.00 0.00 ? 56  ASP A CB   4  
ATOM 6638  C CG   . ASP A 1 56  ? -11.975 -9.221  5.974   1.00 0.00 ? 56  ASP A CG   4  
ATOM 6639  O OD1  . ASP A 1 56  ? -12.138 -8.653  4.874   1.00 0.00 ? 56  ASP A OD1  4  
ATOM 6640  O OD2  . ASP A 1 56  ? -12.843 -9.238  6.872   1.00 0.00 ? 56  ASP A OD2  4  
ATOM 6641  H H    . ASP A 1 56  ? -10.092 -7.261  5.045   1.00 0.00 ? 56  ASP A H    4  
ATOM 6642  H HA   . ASP A 1 56  ? -8.563  -9.536  6.035   1.00 0.00 ? 56  ASP A HA   4  
ATOM 6643  H HB2  . ASP A 1 56  ? -10.730 -10.934 5.856   1.00 0.00 ? 56  ASP A HB2  4  
ATOM 6644  H HB3  . ASP A 1 56  ? -10.488 -9.953  7.298   1.00 0.00 ? 56  ASP A HB3  4  
ATOM 6645  N N    . GLU A 1 57  ? -9.052  -10.856 3.815   1.00 0.00 ? 57  GLU A N    4  
ATOM 6646  C CA   . GLU A 1 57  ? -8.954  -11.347 2.446   1.00 0.00 ? 57  GLU A CA   4  
ATOM 6647  C C    . GLU A 1 57  ? -10.321 -11.344 1.767   1.00 0.00 ? 57  GLU A C    4  
ATOM 6648  O O    . GLU A 1 57  ? -10.423 -11.493 0.550   1.00 0.00 ? 57  GLU A O    4  
ATOM 6649  C CB   . GLU A 1 57  ? -8.366  -12.759 2.428   1.00 0.00 ? 57  GLU A CB   4  
ATOM 6650  C CG   . GLU A 1 57  ? -9.144  -13.753 3.274   1.00 0.00 ? 57  GLU A CG   4  
ATOM 6651  C CD   . GLU A 1 57  ? -8.381  -15.042 3.509   1.00 0.00 ? 57  GLU A CD   4  
ATOM 6652  O OE1  . GLU A 1 57  ? -8.442  -15.935 2.637   1.00 0.00 ? 57  GLU A OE1  4  
ATOM 6653  O OE2  . GLU A 1 57  ? -7.723  -15.159 4.564   1.00 0.00 ? 57  GLU A OE2  4  
ATOM 6654  H H    . GLU A 1 57  ? -8.843  -11.462 4.557   1.00 0.00 ? 57  GLU A H    4  
ATOM 6655  H HA   . GLU A 1 57  ? -8.295  -10.686 1.903   1.00 0.00 ? 57  GLU A HA   4  
ATOM 6656  H HB2  . GLU A 1 57  ? -8.352  -13.118 1.409   1.00 0.00 ? 57  GLU A HB2  4  
ATOM 6657  H HB3  . GLU A 1 57  ? -7.352  -12.719 2.799   1.00 0.00 ? 57  GLU A HB3  4  
ATOM 6658  H HG2  . GLU A 1 57  ? -9.360  -13.301 4.230   1.00 0.00 ? 57  GLU A HG2  4  
ATOM 6659  H HG3  . GLU A 1 57  ? -10.071 -13.987 2.770   1.00 0.00 ? 57  GLU A HG3  4  
ATOM 6660  N N    . LYS A 1 58  ? -11.370 -11.174 2.565   1.00 0.00 ? 58  LYS A N    4  
ATOM 6661  C CA   . LYS A 1 58  ? -12.731 -11.151 2.044   1.00 0.00 ? 58  LYS A CA   4  
ATOM 6662  C C    . LYS A 1 58  ? -12.902 -10.036 1.017   1.00 0.00 ? 58  LYS A C    4  
ATOM 6663  O O    . LYS A 1 58  ? -13.611 -10.199 0.024   1.00 0.00 ? 58  LYS A O    4  
ATOM 6664  C CB   . LYS A 1 58  ? -13.733 -10.964 3.186   1.00 0.00 ? 58  LYS A CB   4  
ATOM 6665  C CG   . LYS A 1 58  ? -13.972 -12.226 3.998   1.00 0.00 ? 58  LYS A CG   4  
ATOM 6666  C CD   . LYS A 1 58  ? -15.290 -12.163 4.751   1.00 0.00 ? 58  LYS A CD   4  
ATOM 6667  C CE   . LYS A 1 58  ? -15.212 -11.207 5.932   1.00 0.00 ? 58  LYS A CE   4  
ATOM 6668  N NZ   . LYS A 1 58  ? -14.347 -11.739 7.020   1.00 0.00 ? 58  LYS A NZ   4  
ATOM 6669  H H    . LYS A 1 58  ? -11.224 -11.060 3.528   1.00 0.00 ? 58  LYS A H    4  
ATOM 6670  H HA   . LYS A 1 58  ? -12.919 -12.099 1.563   1.00 0.00 ? 58  LYS A HA   4  
ATOM 6671  H HB2  . LYS A 1 58  ? -13.364 -10.198 3.851   1.00 0.00 ? 58  LYS A HB2  4  
ATOM 6672  H HB3  . LYS A 1 58  ? -14.678 -10.645 2.771   1.00 0.00 ? 58  LYS A HB3  4  
ATOM 6673  H HG2  . LYS A 1 58  ? -13.991 -13.074 3.330   1.00 0.00 ? 58  LYS A HG2  4  
ATOM 6674  H HG3  . LYS A 1 58  ? -13.166 -12.343 4.709   1.00 0.00 ? 58  LYS A HG3  4  
ATOM 6675  H HD2  . LYS A 1 58  ? -16.063 -11.824 4.078   1.00 0.00 ? 58  LYS A HD2  4  
ATOM 6676  H HD3  . LYS A 1 58  ? -15.534 -13.151 5.115   1.00 0.00 ? 58  LYS A HD3  4  
ATOM 6677  H HE2  . LYS A 1 58  ? -14.809 -10.266 5.590   1.00 0.00 ? 58  LYS A HE2  4  
ATOM 6678  H HE3  . LYS A 1 58  ? -16.209 -11.052 6.318   1.00 0.00 ? 58  LYS A HE3  4  
ATOM 6679  H HZ1  . LYS A 1 58  ? -14.706 -11.430 7.946   1.00 0.00 ? 58  LYS A HZ1  4  
ATOM 6680  H HZ2  . LYS A 1 58  ? -13.373 -11.392 6.904   1.00 0.00 ? 58  LYS A HZ2  4  
ATOM 6681  H HZ3  . LYS A 1 58  ? -14.337 -12.779 6.993   1.00 0.00 ? 58  LYS A HZ3  4  
ATOM 6682  N N    . GLU A 1 59  ? -12.247 -8.906  1.262   1.00 0.00 ? 59  GLU A N    4  
ATOM 6683  C CA   . GLU A 1 59  ? -12.327 -7.766  0.357   1.00 0.00 ? 59  GLU A CA   4  
ATOM 6684  C C    . GLU A 1 59  ? -13.764 -7.267  0.236   1.00 0.00 ? 59  GLU A C    4  
ATOM 6685  O O    . GLU A 1 59  ? -14.286 -7.112  -0.868  1.00 0.00 ? 59  GLU A O    4  
ATOM 6686  C CB   . GLU A 1 59  ? -11.788 -8.144  -1.025  1.00 0.00 ? 59  GLU A CB   4  
ATOM 6687  C CG   . GLU A 1 59  ? -10.290 -8.397  -1.046  1.00 0.00 ? 59  GLU A CG   4  
ATOM 6688  C CD   . GLU A 1 59  ? -9.870  -9.319  -2.174  1.00 0.00 ? 59  GLU A CD   4  
ATOM 6689  O OE1  . GLU A 1 59  ? -9.637  -8.820  -3.294  1.00 0.00 ? 59  GLU A OE1  4  
ATOM 6690  O OE2  . GLU A 1 59  ? -9.773  -10.541 -1.935  1.00 0.00 ? 59  GLU A OE2  4  
ATOM 6691  H H    . GLU A 1 59  ? -11.697 -8.838  2.070   1.00 0.00 ? 59  GLU A H    4  
ATOM 6692  H HA   . GLU A 1 59  ? -11.717 -6.974  0.766   1.00 0.00 ? 59  GLU A HA   4  
ATOM 6693  H HB2  . GLU A 1 59  ? -12.289 -9.041  -1.360  1.00 0.00 ? 59  GLU A HB2  4  
ATOM 6694  H HB3  . GLU A 1 59  ? -12.007 -7.342  -1.714  1.00 0.00 ? 59  GLU A HB3  4  
ATOM 6695  H HG2  . GLU A 1 59  ? -9.780  -7.452  -1.166  1.00 0.00 ? 59  GLU A HG2  4  
ATOM 6696  H HG3  . GLU A 1 59  ? -10.000 -8.845  -0.107  1.00 0.00 ? 59  GLU A HG3  4  
ATOM 6697  N N    . GLU A 1 60  ? -14.396 -7.018  1.378   1.00 0.00 ? 60  GLU A N    4  
ATOM 6698  C CA   . GLU A 1 60  ? -15.773 -6.538  1.400   1.00 0.00 ? 60  GLU A CA   4  
ATOM 6699  C C    . GLU A 1 60  ? -15.835 -5.049  1.074   1.00 0.00 ? 60  GLU A C    4  
ATOM 6700  O O    . GLU A 1 60  ? -16.612 -4.621  0.221   1.00 0.00 ? 60  GLU A O    4  
ATOM 6701  C CB   . GLU A 1 60  ? -16.406 -6.799  2.768   1.00 0.00 ? 60  GLU A CB   4  
ATOM 6702  C CG   . GLU A 1 60  ? -16.554 -8.275  3.098   1.00 0.00 ? 60  GLU A CG   4  
ATOM 6703  C CD   . GLU A 1 60  ? -17.302 -8.510  4.396   1.00 0.00 ? 60  GLU A CD   4  
ATOM 6704  O OE1  . GLU A 1 60  ? -18.546 -8.615  4.354   1.00 0.00 ? 60  GLU A OE1  4  
ATOM 6705  O OE2  . GLU A 1 60  ? -16.643 -8.590  5.454   1.00 0.00 ? 60  GLU A OE2  4  
ATOM 6706  H H    . GLU A 1 60  ? -13.926 -7.161  2.226   1.00 0.00 ? 60  GLU A H    4  
ATOM 6707  H HA   . GLU A 1 60  ? -16.325 -7.082  0.648   1.00 0.00 ? 60  GLU A HA   4  
ATOM 6708  H HB2  . GLU A 1 60  ? -15.791 -6.341  3.529   1.00 0.00 ? 60  GLU A HB2  4  
ATOM 6709  H HB3  . GLU A 1 60  ? -17.386 -6.347  2.789   1.00 0.00 ? 60  GLU A HB3  4  
ATOM 6710  H HG2  . GLU A 1 60  ? -17.094 -8.758  2.297   1.00 0.00 ? 60  GLU A HG2  4  
ATOM 6711  H HG3  . GLU A 1 60  ? -15.570 -8.713  3.183   1.00 0.00 ? 60  GLU A HG3  4  
ATOM 6712  N N    . SER A 1 61  ? -15.011 -4.264  1.761   1.00 0.00 ? 61  SER A N    4  
ATOM 6713  C CA   . SER A 1 61  ? -14.974 -2.822  1.549   1.00 0.00 ? 61  SER A CA   4  
ATOM 6714  C C    . SER A 1 61  ? -13.559 -2.281  1.730   1.00 0.00 ? 61  SER A C    4  
ATOM 6715  O O    . SER A 1 61  ? -12.844 -2.678  2.650   1.00 0.00 ? 61  SER A O    4  
ATOM 6716  C CB   . SER A 1 61  ? -15.928 -2.119  2.517   1.00 0.00 ? 61  SER A CB   4  
ATOM 6717  O OG   . SER A 1 61  ? -16.396 -0.896  1.974   1.00 0.00 ? 61  SER A OG   4  
ATOM 6718  H H    . SER A 1 61  ? -14.414 -4.665  2.428   1.00 0.00 ? 61  SER A H    4  
ATOM 6719  H HA   . SER A 1 61  ? -15.295 -2.627  0.537   1.00 0.00 ? 61  SER A HA   4  
ATOM 6720  H HB2  . SER A 1 61  ? -16.774 -2.759  2.714   1.00 0.00 ? 61  SER A HB2  4  
ATOM 6721  H HB3  . SER A 1 61  ? -15.410 -1.913  3.443   1.00 0.00 ? 61  SER A HB3  4  
ATOM 6722  H HG   . SER A 1 61  ? -15.759 -0.564  1.337   1.00 0.00 ? 61  SER A HG   4  
ATOM 6723  N N    . ILE A 1 62  ? -13.161 -1.374  0.844   1.00 0.00 ? 62  ILE A N    4  
ATOM 6724  C CA   . ILE A 1 62  ? -11.833 -0.779  0.905   1.00 0.00 ? 62  ILE A CA   4  
ATOM 6725  C C    . ILE A 1 62  ? -11.719 0.193   2.075   1.00 0.00 ? 62  ILE A C    4  
ATOM 6726  O O    . ILE A 1 62  ? -12.439 1.191   2.139   1.00 0.00 ? 62  ILE A O    4  
ATOM 6727  C CB   . ILE A 1 62  ? -11.488 -0.037  -0.400  1.00 0.00 ? 62  ILE A CB   4  
ATOM 6728  C CG1  . ILE A 1 62  ? -11.445 -1.017  -1.574  1.00 0.00 ? 62  ILE A CG1  4  
ATOM 6729  C CG2  . ILE A 1 62  ? -10.158 0.689   -0.260  1.00 0.00 ? 62  ILE A CG2  4  
ATOM 6730  C CD1  . ILE A 1 62  ? -11.597 -0.351  -2.923  1.00 0.00 ? 62  ILE A CD1  4  
ATOM 6731  H H    . ILE A 1 62  ? -13.777 -1.099  0.133   1.00 0.00 ? 62  ILE A H    4  
ATOM 6732  H HA   . ILE A 1 62  ? -11.116 -1.576  1.043   1.00 0.00 ? 62  ILE A HA   4  
ATOM 6733  H HB   . ILE A 1 62  ? -12.255 0.700   -0.583  1.00 0.00 ? 62  ILE A HB   4  
ATOM 6734  H HG12 . ILE A 1 62  ? -10.500 -1.538  -1.566  1.00 0.00 ? 62  ILE A HG12 4  
ATOM 6735  H HG13 . ILE A 1 62  ? -12.247 -1.733  -1.464  1.00 0.00 ? 62  ILE A HG13 4  
ATOM 6736  H HG21 . ILE A 1 62  ? -9.832  1.032   -1.231  1.00 0.00 ? 62  ILE A HG21 4  
ATOM 6737  H HG22 . ILE A 1 62  ? -10.278 1.537   0.398   1.00 0.00 ? 62  ILE A HG22 4  
ATOM 6738  H HG23 . ILE A 1 62  ? -9.421  0.016   0.150   1.00 0.00 ? 62  ILE A HG23 4  
ATOM 6739  H HD11 . ILE A 1 62  ? -12.589 0.068   -3.008  1.00 0.00 ? 62  ILE A HD11 4  
ATOM 6740  H HD12 . ILE A 1 62  ? -10.865 0.438   -3.020  1.00 0.00 ? 62  ILE A HD12 4  
ATOM 6741  H HD13 . ILE A 1 62  ? -11.447 -1.080  -3.704  1.00 0.00 ? 62  ILE A HD13 4  
ATOM 6742  N N    . LEU A 1 63  ? -10.810 -0.103  2.997   1.00 0.00 ? 63  LEU A N    4  
ATOM 6743  C CA   . LEU A 1 63  ? -10.600 0.746   4.165   1.00 0.00 ? 63  LEU A CA   4  
ATOM 6744  C C    . LEU A 1 63  ? -9.890  2.039   3.778   1.00 0.00 ? 63  LEU A C    4  
ATOM 6745  O O    . LEU A 1 63  ? -10.266 3.123   4.222   1.00 0.00 ? 63  LEU A O    4  
ATOM 6746  C CB   . LEU A 1 63  ? -9.785  -0.001  5.222   1.00 0.00 ? 63  LEU A CB   4  
ATOM 6747  C CG   . LEU A 1 63  ? -10.328 -1.365  5.648   1.00 0.00 ? 63  LEU A CG   4  
ATOM 6748  C CD1  . LEU A 1 63  ? -9.392  -2.023  6.650   1.00 0.00 ? 63  LEU A CD1  4  
ATOM 6749  C CD2  . LEU A 1 63  ? -11.725 -1.225  6.233   1.00 0.00 ? 63  LEU A CD2  4  
ATOM 6750  H H    . LEU A 1 63  ? -10.267 -0.911  2.891   1.00 0.00 ? 63  LEU A H    4  
ATOM 6751  H HA   . LEU A 1 63  ? -11.569 0.990   4.575   1.00 0.00 ? 63  LEU A HA   4  
ATOM 6752  H HB2  . LEU A 1 63  ? -8.791  -0.148  4.830   1.00 0.00 ? 63  LEU A HB2  4  
ATOM 6753  H HB3  . LEU A 1 63  ? -9.734  0.625   6.102   1.00 0.00 ? 63  LEU A HB3  4  
ATOM 6754  H HG   . LEU A 1 63  ? -10.390 -2.008  4.780   1.00 0.00 ? 63  LEU A HG   4  
ATOM 6755  H HD11 . LEU A 1 63  ? -8.502  -1.421  6.760   1.00 0.00 ? 63  LEU A HD11 4  
ATOM 6756  H HD12 . LEU A 1 63  ? -9.120  -3.007  6.298   1.00 0.00 ? 63  LEU A HD12 4  
ATOM 6757  H HD13 . LEU A 1 63  ? -9.890  -2.108  7.605   1.00 0.00 ? 63  LEU A HD13 4  
ATOM 6758  H HD21 . LEU A 1 63  ? -11.786 -0.311  6.805   1.00 0.00 ? 63  LEU A HD21 4  
ATOM 6759  H HD22 . LEU A 1 63  ? -11.932 -2.067  6.877   1.00 0.00 ? 63  LEU A HD22 4  
ATOM 6760  H HD23 . LEU A 1 63  ? -12.450 -1.199  5.432   1.00 0.00 ? 63  LEU A HD23 4  
ATOM 6761  N N    . GLY A 1 64  ? -8.861  1.916   2.944   1.00 0.00 ? 64  GLY A N    4  
ATOM 6762  C CA   . GLY A 1 64  ? -8.116  3.083   2.509   1.00 0.00 ? 64  GLY A CA   4  
ATOM 6763  C C    . GLY A 1 64  ? -7.429  2.868   1.175   1.00 0.00 ? 64  GLY A C    4  
ATOM 6764  O O    . GLY A 1 64  ? -6.665  1.917   1.008   1.00 0.00 ? 64  GLY A O    4  
ATOM 6765  H H    . GLY A 1 64  ? -8.606  1.026   2.622   1.00 0.00 ? 64  GLY A H    4  
ATOM 6766  H HA2  . GLY A 1 64  ? -8.794  3.918   2.423   1.00 0.00 ? 64  GLY A HA2  4  
ATOM 6767  H HA3  . GLY A 1 64  ? -7.367  3.315   3.253   1.00 0.00 ? 64  GLY A HA3  4  
ATOM 6768  N N    . SER A 1 65  ? -7.703  3.752   0.221   1.00 0.00 ? 65  SER A N    4  
ATOM 6769  C CA   . SER A 1 65  ? -7.110  3.651   -1.108  1.00 0.00 ? 65  SER A CA   4  
ATOM 6770  C C    . SER A 1 65  ? -5.919  4.594   -1.244  1.00 0.00 ? 65  SER A C    4  
ATOM 6771  O O    . SER A 1 65  ? -5.950  5.726   -0.759  1.00 0.00 ? 65  SER A O    4  
ATOM 6772  C CB   . SER A 1 65  ? -8.153  3.971   -2.180  1.00 0.00 ? 65  SER A CB   4  
ATOM 6773  O OG   . SER A 1 65  ? -8.793  5.207   -1.916  1.00 0.00 ? 65  SER A OG   4  
ATOM 6774  H H    . SER A 1 65  ? -8.321  4.488   0.415   1.00 0.00 ? 65  SER A H    4  
ATOM 6775  H HA   . SER A 1 65  ? -6.768  2.636   -1.242  1.00 0.00 ? 65  SER A HA   4  
ATOM 6776  H HB2  . SER A 1 65  ? -7.670  4.028   -3.143  1.00 0.00 ? 65  SER A HB2  4  
ATOM 6777  H HB3  . SER A 1 65  ? -8.899  3.189   -2.197  1.00 0.00 ? 65  SER A HB3  4  
ATOM 6778  H HG   . SER A 1 65  ? -8.137  5.859   -1.659  1.00 0.00 ? 65  SER A HG   4  
ATOM 6779  N N    . ILE A 1 66  ? -4.869  4.120   -1.906  1.00 0.00 ? 66  ILE A N    4  
ATOM 6780  C CA   . ILE A 1 66  ? -3.668  4.920   -2.107  1.00 0.00 ? 66  ILE A CA   4  
ATOM 6781  C C    . ILE A 1 66  ? -3.124  4.749   -3.522  1.00 0.00 ? 66  ILE A C    4  
ATOM 6782  O O    . ILE A 1 66  ? -2.741  3.656   -3.939  1.00 0.00 ? 66  ILE A O    4  
ATOM 6783  C CB   . ILE A 1 66  ? -2.566  4.546   -1.098  1.00 0.00 ? 66  ILE A CB   4  
ATOM 6784  C CG1  . ILE A 1 66  ? -3.058  4.772   0.334   1.00 0.00 ? 66  ILE A CG1  4  
ATOM 6785  C CG2  . ILE A 1 66  ? -1.306  5.355   -1.365  1.00 0.00 ? 66  ILE A CG2  4  
ATOM 6786  C CD1  . ILE A 1 66  ? -2.178  4.131   1.383   1.00 0.00 ? 66  ILE A CD1  4  
ATOM 6787  H H    . ILE A 1 66  ? -4.904  3.210   -2.269  1.00 0.00 ? 66  ILE A H    4  
ATOM 6788  H HA   . ILE A 1 66  ? -3.929  5.957   -1.956  1.00 0.00 ? 66  ILE A HA   4  
ATOM 6789  H HB   . ILE A 1 66  ? -2.329  3.501   -1.228  1.00 0.00 ? 66  ILE A HB   4  
ATOM 6790  H HG12 . ILE A 1 66  ? -3.092  5.831   0.533   1.00 0.00 ? 66  ILE A HG12 4  
ATOM 6791  H HG13 . ILE A 1 66  ? -4.051  4.359   0.434   1.00 0.00 ? 66  ILE A HG13 4  
ATOM 6792  H HG21 . ILE A 1 66  ? -0.572  4.728   -1.849  1.00 0.00 ? 66  ILE A HG21 4  
ATOM 6793  H HG22 . ILE A 1 66  ? -1.544  6.190   -2.006  1.00 0.00 ? 66  ILE A HG22 4  
ATOM 6794  H HG23 . ILE A 1 66  ? -0.907  5.720   -0.430  1.00 0.00 ? 66  ILE A HG23 4  
ATOM 6795  H HD11 . ILE A 1 66  ? -2.788  3.802   2.213   1.00 0.00 ? 66  ILE A HD11 4  
ATOM 6796  H HD12 . ILE A 1 66  ? -1.667  3.280   0.955   1.00 0.00 ? 66  ILE A HD12 4  
ATOM 6797  H HD13 . ILE A 1 66  ? -1.452  4.849   1.733   1.00 0.00 ? 66  ILE A HD13 4  
ATOM 6798  N N    . PRO A 1 67  ? -3.088  5.856   -4.279  1.00 0.00 ? 67  PRO A N    4  
ATOM 6799  C CA   . PRO A 1 67  ? -2.590  5.856   -5.658  1.00 0.00 ? 67  PRO A CA   4  
ATOM 6800  C C    . PRO A 1 67  ? -1.083  5.638   -5.730  1.00 0.00 ? 67  PRO A C    4  
ATOM 6801  O O    . PRO A 1 67  ? -0.310  6.357   -5.096  1.00 0.00 ? 67  PRO A O    4  
ATOM 6802  C CB   . PRO A 1 67  ? -2.954  7.253   -6.167  1.00 0.00 ? 67  PRO A CB   4  
ATOM 6803  C CG   . PRO A 1 67  ? -3.027  8.095   -4.940  1.00 0.00 ? 67  PRO A CG   4  
ATOM 6804  C CD   . PRO A 1 67  ? -3.528  7.193   -3.847  1.00 0.00 ? 67  PRO A CD   4  
ATOM 6805  H HA   . PRO A 1 67  ? -3.090  5.110   -6.260  1.00 0.00 ? 67  PRO A HA   4  
ATOM 6806  H HB2  . PRO A 1 67  ? -2.187  7.603   -6.843  1.00 0.00 ? 67  PRO A HB2  4  
ATOM 6807  H HB3  . PRO A 1 67  ? -3.904  7.218   -6.678  1.00 0.00 ? 67  PRO A HB3  4  
ATOM 6808  H HG2  . PRO A 1 67  ? -2.045  8.472   -4.695  1.00 0.00 ? 67  PRO A HG2  4  
ATOM 6809  H HG3  . PRO A 1 67  ? -3.716  8.912   -5.097  1.00 0.00 ? 67  PRO A HG3  4  
ATOM 6810  H HD2  . PRO A 1 67  ? -3.080  7.460   -2.902  1.00 0.00 ? 67  PRO A HD2  4  
ATOM 6811  H HD3  . PRO A 1 67  ? -4.606  7.241   -3.783  1.00 0.00 ? 67  PRO A HD3  4  
ATOM 6812  N N    . LEU A 1 68  ? -0.670  4.643   -6.507  1.00 0.00 ? 68  LEU A N    4  
ATOM 6813  C CA   . LEU A 1 68  ? 0.746   4.331   -6.664  1.00 0.00 ? 68  LEU A CA   4  
ATOM 6814  C C    . LEU A 1 68  ? 1.283   4.880   -7.981  1.00 0.00 ? 68  LEU A C    4  
ATOM 6815  O O    . LEU A 1 68  ? 2.484   5.113   -8.126  1.00 0.00 ? 68  LEU A O    4  
ATOM 6816  C CB   . LEU A 1 68  ? 0.965   2.818   -6.601  1.00 0.00 ? 68  LEU A CB   4  
ATOM 6817  C CG   . LEU A 1 68  ? 0.770   2.167   -5.232  1.00 0.00 ? 68  LEU A CG   4  
ATOM 6818  C CD1  . LEU A 1 68  ? 0.739   0.652   -5.360  1.00 0.00 ? 68  LEU A CD1  4  
ATOM 6819  C CD2  . LEU A 1 68  ? 1.869   2.601   -4.273  1.00 0.00 ? 68  LEU A CD2  4  
ATOM 6820  H H    . LEU A 1 68  ? -1.333  4.105   -6.988  1.00 0.00 ? 68  LEU A H    4  
ATOM 6821  H HA   . LEU A 1 68  ? 1.280   4.797   -5.849  1.00 0.00 ? 68  LEU A HA   4  
ATOM 6822  H HB2  . LEU A 1 68  ? 0.274   2.355   -7.289  1.00 0.00 ? 68  LEU A HB2  4  
ATOM 6823  H HB3  . LEU A 1 68  ? 1.978   2.618   -6.922  1.00 0.00 ? 68  LEU A HB3  4  
ATOM 6824  H HG   . LEU A 1 68  ? -0.179  2.486   -4.821  1.00 0.00 ? 68  LEU A HG   4  
ATOM 6825  H HD11 . LEU A 1 68  ? 0.771   0.207   -4.377  1.00 0.00 ? 68  LEU A HD11 4  
ATOM 6826  H HD12 . LEU A 1 68  ? 1.594   0.322   -5.932  1.00 0.00 ? 68  LEU A HD12 4  
ATOM 6827  H HD13 . LEU A 1 68  ? -0.168  0.352   -5.863  1.00 0.00 ? 68  LEU A HD13 4  
ATOM 6828  H HD21 . LEU A 1 68  ? 1.844   3.674   -4.159  1.00 0.00 ? 68  LEU A HD21 4  
ATOM 6829  H HD22 . LEU A 1 68  ? 2.829   2.302   -4.668  1.00 0.00 ? 68  LEU A HD22 4  
ATOM 6830  H HD23 . LEU A 1 68  ? 1.714   2.133   -3.312  1.00 0.00 ? 68  LEU A HD23 4  
ATOM 6831  N N    . LEU A 1 69  ? 0.386   5.086   -8.939  1.00 0.00 ? 69  LEU A N    4  
ATOM 6832  C CA   . LEU A 1 69  ? 0.769   5.611   -10.246 1.00 0.00 ? 69  LEU A CA   4  
ATOM 6833  C C    . LEU A 1 69  ? 1.482   6.952   -10.106 1.00 0.00 ? 69  LEU A C    4  
ATOM 6834  O O    . LEU A 1 69  ? 2.079   7.451   -11.060 1.00 0.00 ? 69  LEU A O    4  
ATOM 6835  C CB   . LEU A 1 69  ? -0.465  5.767   -11.136 1.00 0.00 ? 69  LEU A CB   4  
ATOM 6836  C CG   . LEU A 1 69  ? -0.382  6.846   -12.216 1.00 0.00 ? 69  LEU A CG   4  
ATOM 6837  C CD1  . LEU A 1 69  ? 0.625   6.453   -13.286 1.00 0.00 ? 69  LEU A CD1  4  
ATOM 6838  C CD2  . LEU A 1 69  ? -1.751  7.089   -12.834 1.00 0.00 ? 69  LEU A CD2  4  
ATOM 6839  H H    . LEU A 1 69  ? -0.556  4.882   -8.765  1.00 0.00 ? 69  LEU A H    4  
ATOM 6840  H HA   . LEU A 1 69  ? 1.445   4.903   -10.702 1.00 0.00 ? 69  LEU A HA   4  
ATOM 6841  H HB2  . LEU A 1 69  ? -0.641  4.821   -11.626 1.00 0.00 ? 69  LEU A HB2  4  
ATOM 6842  H HB3  . LEU A 1 69  ? -1.305  6.001   -10.497 1.00 0.00 ? 69  LEU A HB3  4  
ATOM 6843  H HG   . LEU A 1 69  ? -0.047  7.771   -11.767 1.00 0.00 ? 69  LEU A HG   4  
ATOM 6844  H HD11 . LEU A 1 69  ? 1.577   6.239   -12.823 1.00 0.00 ? 69  LEU A HD11 4  
ATOM 6845  H HD12 . LEU A 1 69  ? 0.741   7.266   -13.988 1.00 0.00 ? 69  LEU A HD12 4  
ATOM 6846  H HD13 . LEU A 1 69  ? 0.273   5.575   -13.808 1.00 0.00 ? 69  LEU A HD13 4  
ATOM 6847  H HD21 . LEU A 1 69  ? -2.069  6.204   -13.364 1.00 0.00 ? 69  LEU A HD21 4  
ATOM 6848  H HD22 . LEU A 1 69  ? -1.692  7.920   -13.522 1.00 0.00 ? 69  LEU A HD22 4  
ATOM 6849  H HD23 . LEU A 1 69  ? -2.462  7.317   -12.053 1.00 0.00 ? 69  LEU A HD23 4  
ATOM 6850  N N    . SER A 1 70  ? 1.416   7.530   -8.911  1.00 0.00 ? 70  SER A N    4  
ATOM 6851  C CA   . SER A 1 70  ? 2.054   8.814   -8.646  1.00 0.00 ? 70  SER A CA   4  
ATOM 6852  C C    . SER A 1 70  ? 3.094   8.687   -7.537  1.00 0.00 ? 70  SER A C    4  
ATOM 6853  O O    . SER A 1 70  ? 3.291   9.609   -6.746  1.00 0.00 ? 70  SER A O    4  
ATOM 6854  C CB   . SER A 1 70  ? 1.005   9.859   -8.260  1.00 0.00 ? 70  SER A CB   4  
ATOM 6855  O OG   . SER A 1 70  ? -0.015  9.943   -9.240  1.00 0.00 ? 70  SER A OG   4  
ATOM 6856  H H    . SER A 1 70  ? 0.925   7.082   -8.190  1.00 0.00 ? 70  SER A H    4  
ATOM 6857  H HA   . SER A 1 70  ? 2.549   9.131   -9.552  1.00 0.00 ? 70  SER A HA   4  
ATOM 6858  H HB2  . SER A 1 70  ? 0.559   9.586   -7.316  1.00 0.00 ? 70  SER A HB2  4  
ATOM 6859  H HB3  . SER A 1 70  ? 1.480   10.825  -8.168  1.00 0.00 ? 70  SER A HB3  4  
ATOM 6860  H HG   . SER A 1 70  ? 0.380   10.090  -10.102 1.00 0.00 ? 70  SER A HG   4  
ATOM 6861  N N    . PHE A 1 71  ? 3.756   7.536   -7.485  1.00 0.00 ? 71  PHE A N    4  
ATOM 6862  C CA   . PHE A 1 71  ? 4.775   7.285   -6.473  1.00 0.00 ? 71  PHE A CA   4  
ATOM 6863  C C    . PHE A 1 71  ? 5.987   6.586   -7.082  1.00 0.00 ? 71  PHE A C    4  
ATOM 6864  O O    . PHE A 1 71  ? 5.983   6.227   -8.260  1.00 0.00 ? 71  PHE A O    4  
ATOM 6865  C CB   . PHE A 1 71  ? 4.199   6.436   -5.338  1.00 0.00 ? 71  PHE A CB   4  
ATOM 6866  C CG   . PHE A 1 71  ? 3.550   7.246   -4.253  1.00 0.00 ? 71  PHE A CG   4  
ATOM 6867  C CD1  . PHE A 1 71  ? 2.436   8.024   -4.524  1.00 0.00 ? 71  PHE A CD1  4  
ATOM 6868  C CD2  . PHE A 1 71  ? 4.053   7.229   -2.962  1.00 0.00 ? 71  PHE A CD2  4  
ATOM 6869  C CE1  . PHE A 1 71  ? 1.837   8.771   -3.527  1.00 0.00 ? 71  PHE A CE1  4  
ATOM 6870  C CE2  . PHE A 1 71  ? 3.457   7.973   -1.961  1.00 0.00 ? 71  PHE A CE2  4  
ATOM 6871  C CZ   . PHE A 1 71  ? 2.347   8.745   -2.244  1.00 0.00 ? 71  PHE A CZ   4  
ATOM 6872  H H    . PHE A 1 71  ? 3.555   6.838   -8.144  1.00 0.00 ? 71  PHE A H    4  
ATOM 6873  H HA   . PHE A 1 71  ? 5.087   8.238   -6.075  1.00 0.00 ? 71  PHE A HA   4  
ATOM 6874  H HB2  . PHE A 1 71  ? 3.455   5.766   -5.742  1.00 0.00 ? 71  PHE A HB2  4  
ATOM 6875  H HB3  . PHE A 1 71  ? 4.994   5.857   -4.892  1.00 0.00 ? 71  PHE A HB3  4  
ATOM 6876  H HD1  . PHE A 1 71  ? 2.034   8.045   -5.526  1.00 0.00 ? 71  PHE A HD1  4  
ATOM 6877  H HD2  . PHE A 1 71  ? 4.921   6.625   -2.740  1.00 0.00 ? 71  PHE A HD2  4  
ATOM 6878  H HE1  . PHE A 1 71  ? 0.968   9.373   -3.751  1.00 0.00 ? 71  PHE A HE1  4  
ATOM 6879  H HE2  . PHE A 1 71  ? 3.860   7.950   -0.959  1.00 0.00 ? 71  PHE A HE2  4  
ATOM 6880  H HZ   . PHE A 1 71  ? 1.881   9.328   -1.464  1.00 0.00 ? 71  PHE A HZ   4  
ATOM 6881  N N    . ARG A 1 72  ? 7.023   6.397   -6.271  1.00 0.00 ? 72  ARG A N    4  
ATOM 6882  C CA   . ARG A 1 72  ? 8.243   5.742   -6.730  1.00 0.00 ? 72  ARG A CA   4  
ATOM 6883  C C    . ARG A 1 72  ? 8.723   4.712   -5.711  1.00 0.00 ? 72  ARG A C    4  
ATOM 6884  O O    . ARG A 1 72  ? 9.570   5.006   -4.868  1.00 0.00 ? 72  ARG A O    4  
ATOM 6885  C CB   . ARG A 1 72  ? 9.340   6.779   -6.979  1.00 0.00 ? 72  ARG A CB   4  
ATOM 6886  C CG   . ARG A 1 72  ? 10.641  6.178   -7.486  1.00 0.00 ? 72  ARG A CG   4  
ATOM 6887  C CD   . ARG A 1 72  ? 11.730  7.232   -7.611  1.00 0.00 ? 72  ARG A CD   4  
ATOM 6888  N NE   . ARG A 1 72  ? 11.433  8.204   -8.660  1.00 0.00 ? 72  ARG A NE   4  
ATOM 6889  C CZ   . ARG A 1 72  ? 11.659  7.985   -9.950  1.00 0.00 ? 72  ARG A CZ   4  
ATOM 6890  N NH1  . ARG A 1 72  ? 12.180  6.833   -10.349 1.00 0.00 ? 72  ARG A NH1  4  
ATOM 6891  N NH2  . ARG A 1 72  ? 11.363  8.918   -10.845 1.00 0.00 ? 72  ARG A NH2  4  
ATOM 6892  H H    . ARG A 1 72  ? 6.966   6.705   -5.342  1.00 0.00 ? 72  ARG A H    4  
ATOM 6893  H HA   . ARG A 1 72  ? 8.019   5.237   -7.657  1.00 0.00 ? 72  ARG A HA   4  
ATOM 6894  H HB2  . ARG A 1 72  ? 8.988   7.490   -7.712  1.00 0.00 ? 72  ARG A HB2  4  
ATOM 6895  H HB3  . ARG A 1 72  ? 9.544   7.298   -6.055  1.00 0.00 ? 72  ARG A HB3  4  
ATOM 6896  H HG2  . ARG A 1 72  ? 10.969  5.417   -6.794  1.00 0.00 ? 72  ARG A HG2  4  
ATOM 6897  H HG3  . ARG A 1 72  ? 10.468  5.735   -8.456  1.00 0.00 ? 72  ARG A HG3  4  
ATOM 6898  H HD2  . ARG A 1 72  ? 11.819  7.751   -6.668  1.00 0.00 ? 72  ARG A HD2  4  
ATOM 6899  H HD3  . ARG A 1 72  ? 12.663  6.741   -7.841  1.00 0.00 ? 72  ARG A HD3  4  
ATOM 6900  H HE   . ARG A 1 72  ? 11.047  9.063   -8.387  1.00 0.00 ? 72  ARG A HE   4  
ATOM 6901  H HH11 . ARG A 1 72  ? 12.404  6.127   -9.677  1.00 0.00 ? 72  ARG A HH11 4  
ATOM 6902  H HH12 . ARG A 1 72  ? 12.348  6.669   -11.321 1.00 0.00 ? 72  ARG A HH12 4  
ATOM 6903  H HH21 . ARG A 1 72  ? 10.969  9.788   -10.549 1.00 0.00 ? 72  ARG A HH21 4  
ATOM 6904  H HH22 . ARG A 1 72  ? 11.533  8.752   -11.816 1.00 0.00 ? 72  ARG A HH22 4  
ATOM 6905  N N    . VAL A 1 73  ? 8.175   3.504   -5.796  1.00 0.00 ? 73  VAL A N    4  
ATOM 6906  C CA   . VAL A 1 73  ? 8.548   2.430   -4.883  1.00 0.00 ? 73  VAL A CA   4  
ATOM 6907  C C    . VAL A 1 73  ? 10.050  2.170   -4.924  1.00 0.00 ? 73  VAL A C    4  
ATOM 6908  O O    . VAL A 1 73  ? 10.677  2.261   -5.979  1.00 0.00 ? 73  VAL A O    4  
ATOM 6909  C CB   . VAL A 1 73  ? 7.803   1.124   -5.219  1.00 0.00 ? 73  VAL A CB   4  
ATOM 6910  C CG1  . VAL A 1 73  ? 8.144   0.040   -4.208  1.00 0.00 ? 73  VAL A CG1  4  
ATOM 6911  C CG2  . VAL A 1 73  ? 6.302   1.366   -5.268  1.00 0.00 ? 73  VAL A CG2  4  
ATOM 6912  H H    . VAL A 1 73  ? 7.505   3.330   -6.490  1.00 0.00 ? 73  VAL A H    4  
ATOM 6913  H HA   . VAL A 1 73  ? 8.271   2.731   -3.883  1.00 0.00 ? 73  VAL A HA   4  
ATOM 6914  H HB   . VAL A 1 73  ? 8.125   0.790   -6.194  1.00 0.00 ? 73  VAL A HB   4  
ATOM 6915  H HG11 . VAL A 1 73  ? 9.213   -0.108  -4.186  1.00 0.00 ? 73  VAL A HG11 4  
ATOM 6916  H HG12 . VAL A 1 73  ? 7.801   0.340   -3.228  1.00 0.00 ? 73  VAL A HG12 4  
ATOM 6917  H HG13 . VAL A 1 73  ? 7.659   -0.882  -4.492  1.00 0.00 ? 73  VAL A HG13 4  
ATOM 6918  H HG21 . VAL A 1 73  ? 5.923   1.078   -6.238  1.00 0.00 ? 73  VAL A HG21 4  
ATOM 6919  H HG22 . VAL A 1 73  ? 5.818   0.778   -4.503  1.00 0.00 ? 73  VAL A HG22 4  
ATOM 6920  H HG23 . VAL A 1 73  ? 6.099   2.413   -5.099  1.00 0.00 ? 73  VAL A HG23 4  
ATOM 6921  N N    . ALA A 1 74  ? 10.620  1.847   -3.768  1.00 0.00 ? 74  ALA A N    4  
ATOM 6922  C CA   . ALA A 1 74  ? 12.048  1.571   -3.672  1.00 0.00 ? 74  ALA A CA   4  
ATOM 6923  C C    . ALA A 1 74  ? 12.398  0.952   -2.322  1.00 0.00 ? 74  ALA A C    4  
ATOM 6924  O O    . ALA A 1 74  ? 11.930  1.409   -1.280  1.00 0.00 ? 74  ALA A O    4  
ATOM 6925  C CB   . ALA A 1 74  ? 12.848  2.846   -3.893  1.00 0.00 ? 74  ALA A CB   4  
ATOM 6926  H H    . ALA A 1 74  ? 10.067  1.790   -2.961  1.00 0.00 ? 74  ALA A H    4  
ATOM 6927  H HA   . ALA A 1 74  ? 12.307  0.873   -4.455  1.00 0.00 ? 74  ALA A HA   4  
ATOM 6928  H HB1  . ALA A 1 74  ? 13.767  2.610   -4.408  1.00 0.00 ? 74  ALA A HB1  4  
ATOM 6929  H HB2  . ALA A 1 74  ? 12.267  3.535   -4.489  1.00 0.00 ? 74  ALA A HB2  4  
ATOM 6930  H HB3  . ALA A 1 74  ? 13.075  3.298   -2.939  1.00 0.00 ? 74  ALA A HB3  4  
ATOM 6931  N N    . ALA A 1 75  ? 13.223  -0.089  -2.351  1.00 0.00 ? 75  ALA A N    4  
ATOM 6932  C CA   . ALA A 1 75  ? 13.636  -0.770  -1.129  1.00 0.00 ? 75  ALA A CA   4  
ATOM 6933  C C    . ALA A 1 75  ? 14.323  0.195   -0.169  1.00 0.00 ? 75  ALA A C    4  
ATOM 6934  O O    . ALA A 1 75  ? 15.136  1.023   -0.580  1.00 0.00 ? 75  ALA A O    4  
ATOM 6935  C CB   . ALA A 1 75  ? 14.558  -1.934  -1.460  1.00 0.00 ? 75  ALA A CB   4  
ATOM 6936  H H    . ALA A 1 75  ? 13.563  -0.407  -3.213  1.00 0.00 ? 75  ALA A H    4  
ATOM 6937  H HA   . ALA A 1 75  ? 12.751  -1.167  -0.653  1.00 0.00 ? 75  ALA A HA   4  
ATOM 6938  H HB1  . ALA A 1 75  ? 15.321  -2.016  -0.700  1.00 0.00 ? 75  ALA A HB1  4  
ATOM 6939  H HB2  . ALA A 1 75  ? 13.984  -2.848  -1.494  1.00 0.00 ? 75  ALA A HB2  4  
ATOM 6940  H HB3  . ALA A 1 75  ? 15.023  -1.764  -2.420  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 6941  N N    . VAL A 1 76  ? 13.990  0.084   1.113   1.00 0.00 ? 76  VAL A N    4  
ATOM 6942  C CA   . VAL A 1 76  ? 14.576  0.947   2.133   1.00 0.00 ? 76  VAL A CA   4  
ATOM 6943  C C    . VAL A 1 76  ? 16.088  1.042   1.969   1.00 0.00 ? 76  VAL A C    4  
ATOM 6944  O O    . VAL A 1 76  ? 16.722  0.134   1.432   1.00 0.00 ? 76  VAL A O    4  
ATOM 6945  C CB   . VAL A 1 76  ? 14.255  0.438   3.550   1.00 0.00 ? 76  VAL A CB   4  
ATOM 6946  C CG1  . VAL A 1 76  ? 12.804  0.727   3.906   1.00 0.00 ? 76  VAL A CG1  4  
ATOM 6947  C CG2  . VAL A 1 76  ? 14.553  -1.049  3.662   1.00 0.00 ? 76  VAL A CG2  4  
ATOM 6948  H H    . VAL A 1 76  ? 13.336  -0.595  1.380   1.00 0.00 ? 76  VAL A H    4  
ATOM 6949  H HA   . VAL A 1 76  ? 14.148  1.933   2.021   1.00 0.00 ? 76  VAL A HA   4  
ATOM 6950  H HB   . VAL A 1 76  ? 14.886  0.964   4.251   1.00 0.00 ? 76  VAL A HB   4  
ATOM 6951  H HG11 . VAL A 1 76  ? 12.745  1.665   4.439   1.00 0.00 ? 76  VAL A HG11 4  
ATOM 6952  H HG12 . VAL A 1 76  ? 12.216  0.788   3.002   1.00 0.00 ? 76  VAL A HG12 4  
ATOM 6953  H HG13 . VAL A 1 76  ? 12.422  -0.066  4.531   1.00 0.00 ? 76  VAL A HG13 4  
ATOM 6954  H HG21 . VAL A 1 76  ? 14.083  -1.446  4.550   1.00 0.00 ? 76  VAL A HG21 4  
ATOM 6955  H HG22 . VAL A 1 76  ? 14.168  -1.560  2.792   1.00 0.00 ? 76  VAL A HG22 4  
ATOM 6956  H HG23 . VAL A 1 76  ? 15.622  -1.199  3.724   1.00 0.00 ? 76  VAL A HG23 4  
ATOM 6957  N N    . GLN A 1 77  ? 16.660  2.148   2.436   1.00 0.00 ? 77  GLN A N    4  
ATOM 6958  C CA   . GLN A 1 77  ? 18.099  2.362   2.341   1.00 0.00 ? 77  GLN A CA   4  
ATOM 6959  C C    . GLN A 1 77  ? 18.820  1.752   3.539   1.00 0.00 ? 77  GLN A C    4  
ATOM 6960  O O    . GLN A 1 77  ? 18.236  1.534   4.601   1.00 0.00 ? 77  GLN A O    4  
ATOM 6961  C CB   . GLN A 1 77  ? 18.409  3.857   2.251   1.00 0.00 ? 77  GLN A CB   4  
ATOM 6962  C CG   . GLN A 1 77  ? 18.215  4.436   0.859   1.00 0.00 ? 77  GLN A CG   4  
ATOM 6963  C CD   . GLN A 1 77  ? 18.643  5.887   0.766   1.00 0.00 ? 77  GLN A CD   4  
ATOM 6964  O OE1  . GLN A 1 77  ? 19.146  6.461   1.732   1.00 0.00 ? 77  GLN A OE1  4  
ATOM 6965  N NE2  . GLN A 1 77  ? 18.446  6.489   -0.402  1.00 0.00 ? 77  GLN A NE2  4  
ATOM 6966  H H    . GLN A 1 77  ? 16.101  2.835   2.854   1.00 0.00 ? 77  GLN A H    4  
ATOM 6967  H HA   . GLN A 1 77  ? 18.448  1.876   1.442   1.00 0.00 ? 77  GLN A HA   4  
ATOM 6968  H HB2  . GLN A 1 77  ? 17.761  4.388   2.932   1.00 0.00 ? 77  GLN A HB2  4  
ATOM 6969  H HB3  . GLN A 1 77  ? 19.436  4.018   2.545   1.00 0.00 ? 77  GLN A HB3  4  
ATOM 6970  H HG2  . GLN A 1 77  ? 18.800  3.858   0.158   1.00 0.00 ? 77  GLN A HG2  4  
ATOM 6971  H HG3  . GLN A 1 77  ? 17.170  4.366   0.597   1.00 0.00 ? 77  GLN A HG3  4  
ATOM 6972  H HE21 . GLN A 1 77  ? 18.039  5.969   -1.127  1.00 0.00 ? 77  GLN A HE21 4  
ATOM 6973  H HE22 . GLN A 1 77  ? 18.713  7.426   -0.490  1.00 0.00 ? 77  GLN A HE22 4  
ATOM 6974  N N    . PRO A 1 78  ? 20.120  1.470   3.367   1.00 0.00 ? 78  PRO A N    4  
ATOM 6975  C CA   . PRO A 1 78  ? 20.949  0.881   4.423   1.00 0.00 ? 78  PRO A CA   4  
ATOM 6976  C C    . PRO A 1 78  ? 21.211  1.857   5.565   1.00 0.00 ? 78  PRO A C    4  
ATOM 6977  O O    . PRO A 1 78  ? 21.923  1.537   6.517   1.00 0.00 ? 78  PRO A O    4  
ATOM 6978  C CB   . PRO A 1 78  ? 22.255  0.540   3.701   1.00 0.00 ? 78  PRO A CB   4  
ATOM 6979  C CG   . PRO A 1 78  ? 22.308  1.483   2.549   1.00 0.00 ? 78  PRO A CG   4  
ATOM 6980  C CD   . PRO A 1 78  ? 20.881  1.704   2.128   1.00 0.00 ? 78  PRO A CD   4  
ATOM 6981  H HA   . PRO A 1 78  ? 20.507  -0.022  4.817   1.00 0.00 ? 78  PRO A HA   4  
ATOM 6982  H HB2  . PRO A 1 78  ? 23.089  0.687   4.372   1.00 0.00 ? 78  PRO A HB2  4  
ATOM 6983  H HB3  . PRO A 1 78  ? 22.229  -0.487  3.369   1.00 0.00 ? 78  PRO A HB3  4  
ATOM 6984  H HG2  . PRO A 1 78  ? 22.756  2.415   2.857   1.00 0.00 ? 78  PRO A HG2  4  
ATOM 6985  H HG3  . PRO A 1 78  ? 22.872  1.043   1.740   1.00 0.00 ? 78  PRO A HG3  4  
ATOM 6986  H HD2  . PRO A 1 78  ? 20.743  2.715   1.776   1.00 0.00 ? 78  PRO A HD2  4  
ATOM 6987  H HD3  . PRO A 1 78  ? 20.599  0.995   1.364   1.00 0.00 ? 78  PRO A HD3  4  
ATOM 6988  N N    . SER A 1 79  ? 20.631  3.049   5.464   1.00 0.00 ? 79  SER A N    4  
ATOM 6989  C CA   . SER A 1 79  ? 20.805  4.073   6.488   1.00 0.00 ? 79  SER A CA   4  
ATOM 6990  C C    . SER A 1 79  ? 19.516  4.276   7.278   1.00 0.00 ? 79  SER A C    4  
ATOM 6991  O O    . SER A 1 79  ? 19.525  4.855   8.364   1.00 0.00 ? 79  SER A O    4  
ATOM 6992  C CB   . SER A 1 79  ? 21.240  5.393   5.849   1.00 0.00 ? 79  SER A CB   4  
ATOM 6993  O OG   . SER A 1 79  ? 20.162  6.008   5.165   1.00 0.00 ? 79  SER A OG   4  
ATOM 6994  H H    . SER A 1 79  ? 20.075  3.245   4.681   1.00 0.00 ? 79  SER A H    4  
ATOM 6995  H HA   . SER A 1 79  ? 21.578  3.738   7.164   1.00 0.00 ? 79  SER A HA   4  
ATOM 6996  H HB2  . SER A 1 79  ? 21.591  6.064   6.619   1.00 0.00 ? 79  SER A HB2  4  
ATOM 6997  H HB3  . SER A 1 79  ? 22.037  5.204   5.145   1.00 0.00 ? 79  SER A HB3  4  
ATOM 6998  H HG   . SER A 1 79  ? 20.465  6.328   4.312   1.00 0.00 ? 79  SER A HG   4  
ATOM 6999  N N    . ASP A 1 80  ? 18.408  3.797   6.723   1.00 0.00 ? 80  ASP A N    4  
ATOM 7000  C CA   . ASP A 1 80  ? 17.110  3.925   7.374   1.00 0.00 ? 80  ASP A CA   4  
ATOM 7001  C C    . ASP A 1 80  ? 17.159  3.377   8.797   1.00 0.00 ? 80  ASP A C    4  
ATOM 7002  O O    . ASP A 1 80  ? 18.129  2.730   9.190   1.00 0.00 ? 80  ASP A O    4  
ATOM 7003  C CB   . ASP A 1 80  ? 16.037  3.191   6.568   1.00 0.00 ? 80  ASP A CB   4  
ATOM 7004  C CG   . ASP A 1 80  ? 15.981  1.711   6.892   1.00 0.00 ? 80  ASP A CG   4  
ATOM 7005  O OD1  . ASP A 1 80  ? 16.985  1.179   7.410   1.00 0.00 ? 80  ASP A OD1  4  
ATOM 7006  O OD2  . ASP A 1 80  ? 14.933  1.085   6.627   1.00 0.00 ? 80  ASP A OD2  4  
ATOM 7007  H H    . ASP A 1 80  ? 18.465  3.346   5.854   1.00 0.00 ? 80  ASP A H    4  
ATOM 7008  H HA   . ASP A 1 80  ? 16.861  4.975   7.415   1.00 0.00 ? 80  ASP A HA   4  
ATOM 7009  H HB2  . ASP A 1 80  ? 15.072  3.625   6.787   1.00 0.00 ? 80  ASP A HB2  4  
ATOM 7010  H HB3  . ASP A 1 80  ? 16.247  3.304   5.515   1.00 0.00 ? 80  ASP A HB3  4  
ATOM 7011  N N    . ASN A 1 81  ? 16.107  3.640   9.564   1.00 0.00 ? 81  ASN A N    4  
ATOM 7012  C CA   . ASN A 1 81  ? 16.031  3.175   10.944  1.00 0.00 ? 81  ASN A CA   4  
ATOM 7013  C C    . ASN A 1 81  ? 14.919  2.143   11.110  1.00 0.00 ? 81  ASN A C    4  
ATOM 7014  O O    . ASN A 1 81  ? 14.276  2.072   12.158  1.00 0.00 ? 81  ASN A O    4  
ATOM 7015  C CB   . ASN A 1 81  ? 15.793  4.354   11.890  1.00 0.00 ? 81  ASN A CB   4  
ATOM 7016  C CG   . ASN A 1 81  ? 14.387  4.910   11.779  1.00 0.00 ? 81  ASN A CG   4  
ATOM 7017  O OD1  . ASN A 1 81  ? 13.452  4.390   12.388  1.00 0.00 ? 81  ASN A OD1  4  
ATOM 7018  N ND2  . ASN A 1 81  ? 14.231  5.972   10.997  1.00 0.00 ? 81  ASN A ND2  4  
ATOM 7019  H H    . ASN A 1 81  ? 15.363  4.161   9.194   1.00 0.00 ? 81  ASN A H    4  
ATOM 7020  H HA   . ASN A 1 81  ? 16.975  2.712   11.190  1.00 0.00 ? 81  ASN A HA   4  
ATOM 7021  H HB2  . ASN A 1 81  ? 15.951  4.028   12.908  1.00 0.00 ? 81  ASN A HB2  4  
ATOM 7022  H HB3  . ASN A 1 81  ? 16.492  5.142   11.656  1.00 0.00 ? 81  ASN A HB3  4  
ATOM 7023  H HD21 . ASN A 1 81  ? 15.021  6.333   10.543  1.00 0.00 ? 81  ASN A HD21 4  
ATOM 7024  H HD22 . ASN A 1 81  ? 13.332  6.352   10.908  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 7025  N N    . ILE A 1 82  ? 14.700  1.346   10.070  1.00 0.00 ? 82  ILE A N    4  
ATOM 7026  C CA   . ILE A 1 82  ? 13.667  0.317   10.101  1.00 0.00 ? 82  ILE A CA   4  
ATOM 7027  C C    . ILE A 1 82  ? 14.215  -0.995  10.653  1.00 0.00 ? 82  ILE A C    4  
ATOM 7028  O O    . ILE A 1 82  ? 14.925  -1.723  9.960   1.00 0.00 ? 82  ILE A O    4  
ATOM 7029  C CB   . ILE A 1 82  ? 13.080  0.066   8.699   1.00 0.00 ? 82  ILE A CB   4  
ATOM 7030  C CG1  . ILE A 1 82  ? 12.554  1.373   8.102   1.00 0.00 ? 82  ILE A CG1  4  
ATOM 7031  C CG2  . ILE A 1 82  ? 11.974  -0.975  8.767   1.00 0.00 ? 82  ILE A CG2  4  
ATOM 7032  C CD1  . ILE A 1 82  ? 11.237  1.821   8.695   1.00 0.00 ? 82  ILE A CD1  4  
ATOM 7033  H H    . ILE A 1 82  ? 15.245  1.451   9.263   1.00 0.00 ? 82  ILE A H    4  
ATOM 7034  H HA   . ILE A 1 82  ? 12.872  0.663   10.746  1.00 0.00 ? 82  ILE A HA   4  
ATOM 7035  H HB   . ILE A 1 82  ? 13.866  -0.319  8.068   1.00 0.00 ? 82  ILE A HB   4  
ATOM 7036  H HG12 . ILE A 1 82  ? 13.276  2.155   8.270   1.00 0.00 ? 82  ILE A HG12 4  
ATOM 7037  H HG13 . ILE A 1 82  ? 12.413  1.242   7.038   1.00 0.00 ? 82  ILE A HG13 4  
ATOM 7038  H HG21 . ILE A 1 82  ? 12.324  -1.837  9.317   1.00 0.00 ? 82  ILE A HG21 4  
ATOM 7039  H HG22 . ILE A 1 82  ? 11.115  -0.555  9.269   1.00 0.00 ? 82  ILE A HG22 4  
ATOM 7040  H HG23 . ILE A 1 82  ? 11.697  -1.274  7.767   1.00 0.00 ? 82  ILE A HG23 4  
ATOM 7041  H HD11 . ILE A 1 82  ? 11.314  1.836   9.773   1.00 0.00 ? 82  ILE A HD11 4  
ATOM 7042  H HD12 . ILE A 1 82  ? 11.000  2.813   8.338   1.00 0.00 ? 82  ILE A HD12 4  
ATOM 7043  H HD13 . ILE A 1 82  ? 10.457  1.135   8.400   1.00 0.00 ? 82  ILE A HD13 4  
ATOM 7044  N N    . SER A 1 83  ? 13.878  -1.290  11.904  1.00 0.00 ? 83  SER A N    4  
ATOM 7045  C CA   . SER A 1 83  ? 14.338  -2.514  12.551  1.00 0.00 ? 83  SER A CA   4  
ATOM 7046  C C    . SER A 1 83  ? 14.285  -3.692  11.583  1.00 0.00 ? 83  SER A C    4  
ATOM 7047  O O    . SER A 1 83  ? 15.180  -4.538  11.569  1.00 0.00 ? 83  SER A O    4  
ATOM 7048  C CB   . SER A 1 83  ? 13.486  -2.814  13.785  1.00 0.00 ? 83  SER A CB   4  
ATOM 7049  O OG   . SER A 1 83  ? 13.679  -1.834  14.790  1.00 0.00 ? 83  SER A OG   4  
ATOM 7050  H H    . SER A 1 83  ? 13.309  -0.669  12.405  1.00 0.00 ? 83  SER A H    4  
ATOM 7051  H HA   . SER A 1 83  ? 15.362  -2.361  12.859  1.00 0.00 ? 83  SER A HA   4  
ATOM 7052  H HB2  . SER A 1 83  ? 12.443  -2.825  13.506  1.00 0.00 ? 83  SER A HB2  4  
ATOM 7053  H HB3  . SER A 1 83  ? 13.762  -3.780  14.184  1.00 0.00 ? 83  SER A HB3  4  
ATOM 7054  H HG   . SER A 1 83  ? 14.280  -1.158  14.467  1.00 0.00 ? 83  SER A HG   4  
ATOM 7055  N N    . ARG A 1 84  ? 13.230  -3.740  10.776  1.00 0.00 ? 84  ARG A N    4  
ATOM 7056  C CA   . ARG A 1 84  ? 13.059  -4.815  9.806   1.00 0.00 ? 84  ARG A CA   4  
ATOM 7057  C C    . ARG A 1 84  ? 14.186  -4.803  8.777   1.00 0.00 ? 84  ARG A C    4  
ATOM 7058  O O    . ARG A 1 84  ? 15.064  -3.940  8.811   1.00 0.00 ? 84  ARG A O    4  
ATOM 7059  C CB   . ARG A 1 84  ? 11.708  -4.683  9.100   1.00 0.00 ? 84  ARG A CB   4  
ATOM 7060  C CG   . ARG A 1 84  ? 10.517  -4.889  10.022  1.00 0.00 ? 84  ARG A CG   4  
ATOM 7061  C CD   . ARG A 1 84  ? 9.313   -4.080  9.565   1.00 0.00 ? 84  ARG A CD   4  
ATOM 7062  N NE   . ARG A 1 84  ? 8.054   -4.686  9.990   1.00 0.00 ? 84  ARG A NE   4  
ATOM 7063  C CZ   . ARG A 1 84  ? 7.664   -4.758  11.257  1.00 0.00 ? 84  ARG A CZ   4  
ATOM 7064  N NH1  . ARG A 1 84  ? 8.432   -4.265  12.219  1.00 0.00 ? 84  ARG A NH1  4  
ATOM 7065  N NH2  . ARG A 1 84  ? 6.504   -5.325  11.565  1.00 0.00 ? 84  ARG A NH2  4  
ATOM 7066  H H    . ARG A 1 84  ? 12.551  -3.037  10.835  1.00 0.00 ? 84  ARG A H    4  
ATOM 7067  H HA   . ARG A 1 84  ? 13.086  -5.752  10.341  1.00 0.00 ? 84  ARG A HA   4  
ATOM 7068  H HB2  . ARG A 1 84  ? 11.635  -3.696  8.669   1.00 0.00 ? 84  ARG A HB2  4  
ATOM 7069  H HB3  . ARG A 1 84  ? 11.656  -5.417  8.310   1.00 0.00 ? 84  ARG A HB3  4  
ATOM 7070  H HG2  . ARG A 1 84  ? 10.253  -5.936  10.026  1.00 0.00 ? 84  ARG A HG2  4  
ATOM 7071  H HG3  . ARG A 1 84  ? 10.789  -4.580  11.020  1.00 0.00 ? 84  ARG A HG3  4  
ATOM 7072  H HD2  . ARG A 1 84  ? 9.383   -3.087  9.983   1.00 0.00 ? 84  ARG A HD2  4  
ATOM 7073  H HD3  . ARG A 1 84  ? 9.327   -4.018  8.487   1.00 0.00 ? 84  ARG A HD3  4  
ATOM 7074  H HE   . ARG A 1 84  ? 7.472   -5.057  9.295   1.00 0.00 ? 84  ARG A HE   4  
ATOM 7075  H HH11 . ARG A 1 84  ? 9.305   -3.836  11.991  1.00 0.00 ? 84  ARG A HH11 4  
ATOM 7076  H HH12 . ARG A 1 84  ? 8.135   -4.319  13.173  1.00 0.00 ? 84  ARG A HH12 4  
ATOM 7077  H HH21 . ARG A 1 84  ? 5.923   -5.698  10.842  1.00 0.00 ? 84  ARG A HH21 4  
ATOM 7078  H HH22 . ARG A 1 84  ? 6.212   -5.379  12.519  1.00 0.00 ? 84  ARG A HH22 4  
ATOM 7079  N N    . LYS A 1 85  ? 14.155  -5.766  7.862   1.00 0.00 ? 85  LYS A N    4  
ATOM 7080  C CA   . LYS A 1 85  ? 15.172  -5.867  6.822   1.00 0.00 ? 85  LYS A CA   4  
ATOM 7081  C C    . LYS A 1 85  ? 14.548  -5.740  5.436   1.00 0.00 ? 85  LYS A C    4  
ATOM 7082  O O    . LYS A 1 85  ? 14.820  -4.785  4.707   1.00 0.00 ? 85  LYS A O    4  
ATOM 7083  C CB   . LYS A 1 85  ? 15.918  -7.199  6.937   1.00 0.00 ? 85  LYS A CB   4  
ATOM 7084  C CG   . LYS A 1 85  ? 17.136  -7.137  7.842   1.00 0.00 ? 85  LYS A CG   4  
ATOM 7085  C CD   . LYS A 1 85  ? 18.074  -8.308  7.594   1.00 0.00 ? 85  LYS A CD   4  
ATOM 7086  C CE   . LYS A 1 85  ? 17.728  -9.495  8.480   1.00 0.00 ? 85  LYS A CE   4  
ATOM 7087  N NZ   . LYS A 1 85  ? 16.696  -10.370 7.857   1.00 0.00 ? 85  LYS A NZ   4  
ATOM 7088  H H    . LYS A 1 85  ? 13.430  -6.425  7.887   1.00 0.00 ? 85  LYS A H    4  
ATOM 7089  H HA   . LYS A 1 85  ? 15.873  -5.058  6.964   1.00 0.00 ? 85  LYS A HA   4  
ATOM 7090  H HB2  . LYS A 1 85  ? 15.241  -7.944  7.329   1.00 0.00 ? 85  LYS A HB2  4  
ATOM 7091  H HB3  . LYS A 1 85  ? 16.242  -7.502  5.952   1.00 0.00 ? 85  LYS A HB3  4  
ATOM 7092  H HG2  . LYS A 1 85  ? 17.669  -6.217  7.651   1.00 0.00 ? 85  LYS A HG2  4  
ATOM 7093  H HG3  . LYS A 1 85  ? 16.810  -7.160  8.872   1.00 0.00 ? 85  LYS A HG3  4  
ATOM 7094  H HD2  . LYS A 1 85  ? 17.994  -8.609  6.560   1.00 0.00 ? 85  LYS A HD2  4  
ATOM 7095  H HD3  . LYS A 1 85  ? 19.087  -7.996  7.804   1.00 0.00 ? 85  LYS A HD3  4  
ATOM 7096  H HE2  . LYS A 1 85  ? 18.624  -10.073 8.649   1.00 0.00 ? 85  LYS A HE2  4  
ATOM 7097  H HE3  . LYS A 1 85  ? 17.354  -9.126  9.424   1.00 0.00 ? 85  LYS A HE3  4  
ATOM 7098  H HZ1  . LYS A 1 85  ? 16.290  -9.904  7.021   1.00 0.00 ? 85  LYS A HZ1  4  
ATOM 7099  H HZ2  . LYS A 1 85  ? 15.934  -10.562 8.538   1.00 0.00 ? 85  LYS A HZ2  4  
ATOM 7100  H HZ3  . LYS A 1 85  ? 17.122  -11.272 7.566   1.00 0.00 ? 85  LYS A HZ3  4  
ATOM 7101  N N    . HIS A 1 86  ? 13.709  -6.707  5.079   1.00 0.00 ? 86  HIS A N    4  
ATOM 7102  C CA   . HIS A 1 86  ? 13.044  -6.701  3.781   1.00 0.00 ? 86  HIS A CA   4  
ATOM 7103  C C    . HIS A 1 86  ? 11.883  -5.711  3.769   1.00 0.00 ? 86  HIS A C    4  
ATOM 7104  O O    . HIS A 1 86  ? 10.724  -6.094  3.937   1.00 0.00 ? 86  HIS A O    4  
ATOM 7105  C CB   . HIS A 1 86  ? 12.538  -8.102  3.437   1.00 0.00 ? 86  HIS A CB   4  
ATOM 7106  C CG   . HIS A 1 86  ? 13.370  -9.200  4.026   1.00 0.00 ? 86  HIS A CG   4  
ATOM 7107  N ND1  . HIS A 1 86  ? 14.696  -9.397  3.701   1.00 0.00 ? 86  HIS A ND1  4  
ATOM 7108  C CD2  . HIS A 1 86  ? 13.058  -10.163 4.925   1.00 0.00 ? 86  HIS A CD2  4  
ATOM 7109  C CE1  . HIS A 1 86  ? 15.162  -10.434 4.373   1.00 0.00 ? 86  HIS A CE1  4  
ATOM 7110  N NE2  . HIS A 1 86  ? 14.188  -10.916 5.124   1.00 0.00 ? 86  HIS A NE2  4  
ATOM 7111  H H    . HIS A 1 86  ? 13.532  -7.441  5.703   1.00 0.00 ? 86  HIS A H    4  
ATOM 7112  H HA   . HIS A 1 86  ? 13.767  -6.397  3.039   1.00 0.00 ? 86  HIS A HA   4  
ATOM 7113  H HB2  . HIS A 1 86  ? 11.530  -8.215  3.808   1.00 0.00 ? 86  HIS A HB2  4  
ATOM 7114  H HB3  . HIS A 1 86  ? 12.538  -8.225  2.363   1.00 0.00 ? 86  HIS A HB3  4  
ATOM 7115  H HD1  . HIS A 1 86  ? 15.216  -8.858  3.070   1.00 0.00 ? 86  HIS A HD1  4  
ATOM 7116  H HD2  . HIS A 1 86  ? 12.097  -10.311 5.398   1.00 0.00 ? 86  HIS A HD2  4  
ATOM 7117  H HE1  . HIS A 1 86  ? 16.168  -10.822 4.320   1.00 0.00 ? 86  HIS A HE1  4  
ATOM 7118  H HE2  . HIS A 1 86  ? 14.240  -11.736 5.657   1.00 0.00 ? 86  HIS A HE2  4  
ATOM 7119  N N    . THR A 1 87  ? 12.201  -4.436  3.571   1.00 0.00 ? 87  THR A N    4  
ATOM 7120  C CA   . THR A 1 87  ? 11.185  -3.391  3.540   1.00 0.00 ? 87  THR A CA   4  
ATOM 7121  C C    . THR A 1 87  ? 11.352  -2.498  2.316   1.00 0.00 ? 87  THR A C    4  
ATOM 7122  O O    . THR A 1 87  ? 12.437  -2.415  1.739   1.00 0.00 ? 87  THR A O    4  
ATOM 7123  C CB   . THR A 1 87  ? 11.237  -2.519  4.808   1.00 0.00 ? 87  THR A CB   4  
ATOM 7124  O OG1  . THR A 1 87  ? 10.910  -3.307  5.958   1.00 0.00 ? 87  THR A OG1  4  
ATOM 7125  C CG2  . THR A 1 87  ? 10.272  -1.348  4.700   1.00 0.00 ? 87  THR A CG2  4  
ATOM 7126  H H    . THR A 1 87  ? 13.141  -4.193  3.444   1.00 0.00 ? 87  THR A H    4  
ATOM 7127  H HA   . THR A 1 87  ? 10.217  -3.869  3.496   1.00 0.00 ? 87  THR A HA   4  
ATOM 7128  H HB   . THR A 1 87  ? 12.239  -2.131  4.920   1.00 0.00 ? 87  THR A HB   4  
ATOM 7129  H HG1  . THR A 1 87  ? 10.663  -4.192  5.680   1.00 0.00 ? 87  THR A HG1  4  
ATOM 7130  H HG21 . THR A 1 87  ? 10.309  -0.766  5.608   1.00 0.00 ? 87  THR A HG21 4  
ATOM 7131  H HG22 . THR A 1 87  ? 9.269   -1.720  4.552   1.00 0.00 ? 87  THR A HG22 4  
ATOM 7132  H HG23 . THR A 1 87  ? 10.552  -0.727  3.862   1.00 0.00 ? 87  THR A HG23 4  
ATOM 7133  N N    . PHE A 1 88  ? 10.272  -1.831  1.924   1.00 0.00 ? 88  PHE A N    4  
ATOM 7134  C CA   . PHE A 1 88  ? 10.299  -0.943  0.767   1.00 0.00 ? 88  PHE A CA   4  
ATOM 7135  C C    . PHE A 1 88  ? 9.394   0.265   0.987   1.00 0.00 ? 88  PHE A C    4  
ATOM 7136  O O    . PHE A 1 88  ? 8.239   0.126   1.389   1.00 0.00 ? 88  PHE A O    4  
ATOM 7137  C CB   . PHE A 1 88  ? 9.864   -1.697  -0.491  1.00 0.00 ? 88  PHE A CB   4  
ATOM 7138  C CG   . PHE A 1 88  ? 8.510   -2.335  -0.370  1.00 0.00 ? 88  PHE A CG   4  
ATOM 7139  C CD1  . PHE A 1 88  ? 8.305   -3.397  0.496   1.00 0.00 ? 88  PHE A CD1  4  
ATOM 7140  C CD2  . PHE A 1 88  ? 7.442   -1.872  -1.122  1.00 0.00 ? 88  PHE A CD2  4  
ATOM 7141  C CE1  . PHE A 1 88  ? 7.059   -3.986  0.608   1.00 0.00 ? 88  PHE A CE1  4  
ATOM 7142  C CE2  . PHE A 1 88  ? 6.194   -2.457  -1.013  1.00 0.00 ? 88  PHE A CE2  4  
ATOM 7143  C CZ   . PHE A 1 88  ? 6.003   -3.515  -0.146  1.00 0.00 ? 88  PHE A CZ   4  
ATOM 7144  H H    . PHE A 1 88  ? 9.436   -1.939  2.424   1.00 0.00 ? 88  PHE A H    4  
ATOM 7145  H HA   . PHE A 1 88  ? 11.314  -0.600  0.638   1.00 0.00 ? 88  PHE A HA   4  
ATOM 7146  H HB2  . PHE A 1 88  ? 9.833   -1.009  -1.322  1.00 0.00 ? 88  PHE A HB2  4  
ATOM 7147  H HB3  . PHE A 1 88  ? 10.582  -2.476  -0.701  1.00 0.00 ? 88  PHE A HB3  4  
ATOM 7148  H HD1  . PHE A 1 88  ? 9.130   -3.766  1.087   1.00 0.00 ? 88  PHE A HD1  4  
ATOM 7149  H HD2  . PHE A 1 88  ? 7.591   -1.044  -1.801  1.00 0.00 ? 88  PHE A HD2  4  
ATOM 7150  H HE1  . PHE A 1 88  ? 6.912   -4.813  1.287   1.00 0.00 ? 88  PHE A HE1  4  
ATOM 7151  H HE2  . PHE A 1 88  ? 5.370   -2.086  -1.604  1.00 0.00 ? 88  PHE A HE2  4  
ATOM 7152  H HZ   . PHE A 1 88  ? 5.029   -3.973  -0.060  1.00 0.00 ? 88  PHE A HZ   4  
ATOM 7153  N N    . LYS A 1 89  ? 9.928   1.453   0.722   1.00 0.00 ? 89  LYS A N    4  
ATOM 7154  C CA   . LYS A 1 89  ? 9.171   2.688   0.890   1.00 0.00 ? 89  LYS A CA   4  
ATOM 7155  C C    . LYS A 1 89  ? 8.907   3.351   -0.458  1.00 0.00 ? 89  LYS A C    4  
ATOM 7156  O O    . LYS A 1 89  ? 9.793   3.423   -1.309  1.00 0.00 ? 89  LYS A O    4  
ATOM 7157  C CB   . LYS A 1 89  ? 9.927   3.653   1.806   1.00 0.00 ? 89  LYS A CB   4  
ATOM 7158  C CG   . LYS A 1 89  ? 11.227  4.164   1.211   1.00 0.00 ? 89  LYS A CG   4  
ATOM 7159  C CD   . LYS A 1 89  ? 12.261  4.446   2.288   1.00 0.00 ? 89  LYS A CD   4  
ATOM 7160  C CE   . LYS A 1 89  ? 13.459  5.198   1.728   1.00 0.00 ? 89  LYS A CE   4  
ATOM 7161  N NZ   . LYS A 1 89  ? 14.284  5.808   2.807   1.00 0.00 ? 89  LYS A NZ   4  
ATOM 7162  H H    . LYS A 1 89  ? 10.855  1.500   0.404   1.00 0.00 ? 89  LYS A H    4  
ATOM 7163  H HA   . LYS A 1 89  ? 8.226   2.438   1.346   1.00 0.00 ? 89  LYS A HA   4  
ATOM 7164  H HB2  . LYS A 1 89  ? 9.293   4.502   2.016   1.00 0.00 ? 89  LYS A HB2  4  
ATOM 7165  H HB3  . LYS A 1 89  ? 10.155  3.146   2.733   1.00 0.00 ? 89  LYS A HB3  4  
ATOM 7166  H HG2  . LYS A 1 89  ? 11.621  3.419   0.535   1.00 0.00 ? 89  LYS A HG2  4  
ATOM 7167  H HG3  . LYS A 1 89  ? 11.029  5.077   0.667   1.00 0.00 ? 89  LYS A HG3  4  
ATOM 7168  H HD2  . LYS A 1 89  ? 11.806  5.043   3.064   1.00 0.00 ? 89  LYS A HD2  4  
ATOM 7169  H HD3  . LYS A 1 89  ? 12.599  3.507   2.705   1.00 0.00 ? 89  LYS A HD3  4  
ATOM 7170  H HE2  . LYS A 1 89  ? 14.070  4.508   1.166   1.00 0.00 ? 89  LYS A HE2  4  
ATOM 7171  H HE3  . LYS A 1 89  ? 13.103  5.979   1.073   1.00 0.00 ? 89  LYS A HE3  4  
ATOM 7172  H HZ1  . LYS A 1 89  ? 14.086  5.343   3.716   1.00 0.00 ? 89  LYS A HZ1  4  
ATOM 7173  H HZ2  . LYS A 1 89  ? 14.066  6.821   2.894   1.00 0.00 ? 89  LYS A HZ2  4  
ATOM 7174  H HZ3  . LYS A 1 89  ? 15.295  5.701   2.588   1.00 0.00 ? 89  LYS A HZ3  4  
ATOM 7175  N N    . ALA A 1 90  ? 7.684   3.836   -0.644  1.00 0.00 ? 90  ALA A N    4  
ATOM 7176  C CA   . ALA A 1 90  ? 7.304   4.497   -1.887  1.00 0.00 ? 90  ALA A CA   4  
ATOM 7177  C C    . ALA A 1 90  ? 7.222   6.008   -1.702  1.00 0.00 ? 90  ALA A C    4  
ATOM 7178  O O    . ALA A 1 90  ? 6.472   6.499   -0.859  1.00 0.00 ? 90  ALA A O    4  
ATOM 7179  C CB   . ALA A 1 90  ? 5.976   3.952   -2.390  1.00 0.00 ? 90  ALA A CB   4  
ATOM 7180  H H    . ALA A 1 90  ? 7.021   3.748   0.072   1.00 0.00 ? 90  ALA A H    4  
ATOM 7181  H HA   . ALA A 1 90  ? 8.060   4.275   -2.626  1.00 0.00 ? 90  ALA A HA   4  
ATOM 7182  H HB1  . ALA A 1 90  ? 5.998   3.890   -3.468  1.00 0.00 ? 90  ALA A HB1  4  
ATOM 7183  H HB2  . ALA A 1 90  ? 5.812   2.967   -1.977  1.00 0.00 ? 90  ALA A HB2  4  
ATOM 7184  H HB3  . ALA A 1 90  ? 5.177   4.609   -2.082  1.00 0.00 ? 90  ALA A HB3  4  
ATOM 7185  N N    . GLU A 1 91  ? 7.999   6.740   -2.494  1.00 0.00 ? 91  GLU A N    4  
ATOM 7186  C CA   . GLU A 1 91  ? 8.014   8.196   -2.416  1.00 0.00 ? 91  GLU A CA   4  
ATOM 7187  C C    . GLU A 1 91  ? 7.569   8.817   -3.737  1.00 0.00 ? 91  GLU A C    4  
ATOM 7188  O O    . GLU A 1 91  ? 7.751   8.230   -4.804  1.00 0.00 ? 91  GLU A O    4  
ATOM 7189  C CB   . GLU A 1 91  ? 9.414   8.695   -2.051  1.00 0.00 ? 91  GLU A CB   4  
ATOM 7190  C CG   . GLU A 1 91  ? 10.276  9.023   -3.258  1.00 0.00 ? 91  GLU A CG   4  
ATOM 7191  C CD   . GLU A 1 91  ? 11.759  9.002   -2.939  1.00 0.00 ? 91  GLU A CD   4  
ATOM 7192  O OE1  . GLU A 1 91  ? 12.157  9.629   -1.935  1.00 0.00 ? 91  GLU A OE1  4  
ATOM 7193  O OE2  . GLU A 1 91  ? 12.520  8.360   -3.692  1.00 0.00 ? 91  GLU A OE2  4  
ATOM 7194  H H    . GLU A 1 91  ? 8.576   6.290   -3.147  1.00 0.00 ? 91  GLU A H    4  
ATOM 7195  H HA   . GLU A 1 91  ? 7.323   8.493   -1.641  1.00 0.00 ? 91  GLU A HA   4  
ATOM 7196  H HB2  . GLU A 1 91  ? 9.320   9.586   -1.448  1.00 0.00 ? 91  GLU A HB2  4  
ATOM 7197  H HB3  . GLU A 1 91  ? 9.915   7.932   -1.474  1.00 0.00 ? 91  GLU A HB3  4  
ATOM 7198  H HG2  . GLU A 1 91  ? 10.081  8.297   -4.033  1.00 0.00 ? 91  GLU A HG2  4  
ATOM 7199  H HG3  . GLU A 1 91  ? 10.013  10.008  -3.615  1.00 0.00 ? 91  GLU A HG3  4  
ATOM 7200  N N    . HIS A 1 92  ? 6.983   10.007  -3.656  1.00 0.00 ? 92  HIS A N    4  
ATOM 7201  C CA   . HIS A 1 92  ? 6.511   10.709  -4.845  1.00 0.00 ? 92  HIS A CA   4  
ATOM 7202  C C    . HIS A 1 92  ? 7.190   12.068  -4.979  1.00 0.00 ? 92  HIS A C    4  
ATOM 7203  O O    . HIS A 1 92  ? 6.905   12.827  -5.905  1.00 0.00 ? 92  HIS A O    4  
ATOM 7204  C CB   . HIS A 1 92  ? 4.993   10.887  -4.789  1.00 0.00 ? 92  HIS A CB   4  
ATOM 7205  C CG   . HIS A 1 92  ? 4.463   11.832  -5.822  1.00 0.00 ? 92  HIS A CG   4  
ATOM 7206  N ND1  . HIS A 1 92  ? 3.767   12.980  -5.506  1.00 0.00 ? 92  HIS A ND1  4  
ATOM 7207  C CD2  . HIS A 1 92  ? 4.531   11.797  -7.174  1.00 0.00 ? 92  HIS A CD2  4  
ATOM 7208  C CE1  . HIS A 1 92  ? 3.429   13.608  -6.618  1.00 0.00 ? 92  HIS A CE1  4  
ATOM 7209  N NE2  . HIS A 1 92  ? 3.881   12.911  -7.644  1.00 0.00 ? 92  HIS A NE2  4  
ATOM 7210  H H    . HIS A 1 92  ? 6.865   10.424  -2.778  1.00 0.00 ? 92  HIS A H    4  
ATOM 7211  H HA   . HIS A 1 92  ? 6.763   10.108  -5.706  1.00 0.00 ? 92  HIS A HA   4  
ATOM 7212  H HB2  . HIS A 1 92  ? 4.519   9.929   -4.943  1.00 0.00 ? 92  HIS A HB2  4  
ATOM 7213  H HB3  . HIS A 1 92  ? 4.718   11.268  -3.817  1.00 0.00 ? 92  HIS A HB3  4  
ATOM 7214  H HD1  . HIS A 1 92  ? 3.552   13.287  -4.601  1.00 0.00 ? 92  HIS A HD1  4  
ATOM 7215  H HD2  . HIS A 1 92  ? 5.008   11.033  -7.772  1.00 0.00 ? 92  HIS A HD2  4  
ATOM 7216  H HE1  . HIS A 1 92  ? 2.877   14.534  -6.678  1.00 0.00 ? 92  HIS A HE1  4  
ATOM 7217  H HE2  . HIS A 1 92  ? 3.695   13.108  -8.586  1.00 0.00 ? 92  HIS A HE2  4  
ATOM 7218  N N    . ALA A 1 93  ? 8.089   12.370  -4.048  1.00 0.00 ? 93  ALA A N    4  
ATOM 7219  C CA   . ALA A 1 93  ? 8.809   13.637  -4.063  1.00 0.00 ? 93  ALA A CA   4  
ATOM 7220  C C    . ALA A 1 93  ? 7.863   14.803  -4.332  1.00 0.00 ? 93  ALA A C    4  
ATOM 7221  O O    . ALA A 1 93  ? 8.143   15.661  -5.169  1.00 0.00 ? 93  ALA A O    4  
ATOM 7222  C CB   . ALA A 1 93  ? 9.917   13.602  -5.104  1.00 0.00 ? 93  ALA A CB   4  
ATOM 7223  H H    . ALA A 1 93  ? 8.273   11.724  -3.334  1.00 0.00 ? 93  ALA A H    4  
ATOM 7224  H HA   . ALA A 1 93  ? 9.265   13.773  -3.092  1.00 0.00 ? 93  ALA A HA   4  
ATOM 7225  H HB1  . ALA A 1 93  ? 9.664   12.889  -5.875  1.00 0.00 ? 93  ALA A HB1  4  
ATOM 7226  H HB2  . ALA A 1 93  ? 10.028  14.583  -5.544  1.00 0.00 ? 93  ALA A HB2  4  
ATOM 7227  H HB3  . ALA A 1 93  ? 10.844  13.311  -4.634  1.00 0.00 ? 93  ALA A HB3  4  
ATOM 7228  N N    . GLY A 1 94  ? 6.742   14.826  -3.619  1.00 0.00 ? 94  GLY A N    4  
ATOM 7229  C CA   . GLY A 1 94  ? 5.772   15.891  -3.797  1.00 0.00 ? 94  GLY A CA   4  
ATOM 7230  C C    . GLY A 1 94  ? 4.535   15.698  -2.941  1.00 0.00 ? 94  GLY A C    4  
ATOM 7231  O O    . GLY A 1 94  ? 3.899   16.668  -2.528  1.00 0.00 ? 94  GLY A O    4  
ATOM 7232  H H    . GLY A 1 94  ? 6.572   14.115  -2.966  1.00 0.00 ? 94  GLY A H    4  
ATOM 7233  H HA2  . GLY A 1 94  ? 6.234   16.831  -3.536  1.00 0.00 ? 94  GLY A HA2  4  
ATOM 7234  H HA3  . GLY A 1 94  ? 5.475   15.922  -4.835  1.00 0.00 ? 94  GLY A HA3  4  
ATOM 7235  N N    . VAL A 1 95  ? 4.192   14.441  -2.676  1.00 0.00 ? 95  VAL A N    4  
ATOM 7236  C CA   . VAL A 1 95  ? 3.023   14.124  -1.864  1.00 0.00 ? 95  VAL A CA   4  
ATOM 7237  C C    . VAL A 1 95  ? 3.432   13.581  -0.500  1.00 0.00 ? 95  VAL A C    4  
ATOM 7238  O O    . VAL A 1 95  ? 3.262   14.248  0.521   1.00 0.00 ? 95  VAL A O    4  
ATOM 7239  C CB   . VAL A 1 95  ? 2.117   13.093  -2.564  1.00 0.00 ? 95  VAL A CB   4  
ATOM 7240  C CG1  . VAL A 1 95  ? 1.136   12.485  -1.574  1.00 0.00 ? 95  VAL A CG1  4  
ATOM 7241  C CG2  . VAL A 1 95  ? 1.381   13.736  -3.730  1.00 0.00 ? 95  VAL A CG2  4  
ATOM 7242  H H    . VAL A 1 95  ? 4.738   13.711  -3.033  1.00 0.00 ? 95  VAL A H    4  
ATOM 7243  H HA   . VAL A 1 95  ? 2.456   15.033  -1.724  1.00 0.00 ? 95  VAL A HA   4  
ATOM 7244  H HB   . VAL A 1 95  ? 2.740   12.301  -2.952  1.00 0.00 ? 95  VAL A HB   4  
ATOM 7245  H HG11 . VAL A 1 95  ? 0.144   12.488  -2.002  1.00 0.00 ? 95  VAL A HG11 4  
ATOM 7246  H HG12 . VAL A 1 95  ? 1.430   11.469  -1.352  1.00 0.00 ? 95  VAL A HG12 4  
ATOM 7247  H HG13 . VAL A 1 95  ? 1.135   13.067  -0.664  1.00 0.00 ? 95  VAL A HG13 4  
ATOM 7248  H HG21 . VAL A 1 95  ? 0.529   14.286  -3.360  1.00 0.00 ? 95  VAL A HG21 4  
ATOM 7249  H HG22 . VAL A 1 95  ? 2.048   14.409  -4.248  1.00 0.00 ? 95  VAL A HG22 4  
ATOM 7250  H HG23 . VAL A 1 95  ? 1.045   12.968  -4.412  1.00 0.00 ? 95  VAL A HG23 4  
ATOM 7251  N N    . ARG A 1 96  ? 3.972   12.367  -0.490  1.00 0.00 ? 96  ARG A N    4  
ATOM 7252  C CA   . ARG A 1 96  ? 4.405   11.733  0.750   1.00 0.00 ? 96  ARG A CA   4  
ATOM 7253  C C    . ARG A 1 96  ? 5.153   10.434  0.464   1.00 0.00 ? 96  ARG A C    4  
ATOM 7254  O O    . ARG A 1 96  ? 5.096   9.903   -0.645  1.00 0.00 ? 96  ARG A O    4  
ATOM 7255  C CB   . ARG A 1 96  ? 3.202   11.454  1.652   1.00 0.00 ? 96  ARG A CB   4  
ATOM 7256  C CG   . ARG A 1 96  ? 3.444   10.347  2.666   1.00 0.00 ? 96  ARG A CG   4  
ATOM 7257  C CD   . ARG A 1 96  ? 2.202   10.072  3.498   1.00 0.00 ? 96  ARG A CD   4  
ATOM 7258  N NE   . ARG A 1 96  ? 2.128   10.937  4.673   1.00 0.00 ? 96  ARG A NE   4  
ATOM 7259  C CZ   . ARG A 1 96  ? 1.304   10.723  5.693   1.00 0.00 ? 96  ARG A CZ   4  
ATOM 7260  N NH1  . ARG A 1 96  ? 0.490   9.677   5.683   1.00 0.00 ? 96  ARG A NH1  4  
ATOM 7261  N NH2  . ARG A 1 96  ? 1.295   11.556  6.726   1.00 0.00 ? 96  ARG A NH2  4  
ATOM 7262  H H    . ARG A 1 96  ? 4.081   11.885  -1.336  1.00 0.00 ? 96  ARG A H    4  
ATOM 7263  H HA   . ARG A 1 96  ? 5.072   12.415  1.256   1.00 0.00 ? 96  ARG A HA   4  
ATOM 7264  H HB2  . ARG A 1 96  ? 2.953   12.356  2.191   1.00 0.00 ? 96  ARG A HB2  4  
ATOM 7265  H HB3  . ARG A 1 96  ? 2.363   11.169  1.035   1.00 0.00 ? 96  ARG A HB3  4  
ATOM 7266  H HG2  . ARG A 1 96  ? 3.718   9.444   2.140   1.00 0.00 ? 96  ARG A HG2  4  
ATOM 7267  H HG3  . ARG A 1 96  ? 4.249   10.643  3.322   1.00 0.00 ? 96  ARG A HG3  4  
ATOM 7268  H HD2  . ARG A 1 96  ? 1.329   10.239  2.885   1.00 0.00 ? 96  ARG A HD2  4  
ATOM 7269  H HD3  . ARG A 1 96  ? 2.223   9.042   3.822   1.00 0.00 ? 96  ARG A HD3  4  
ATOM 7270  H HE   . ARG A 1 96  ? 2.721   11.716  4.701   1.00 0.00 ? 96  ARG A HE   4  
ATOM 7271  H HH11 . ARG A 1 96  ? 0.495   9.047   4.906   1.00 0.00 ? 96  ARG A HH11 4  
ATOM 7272  H HH12 . ARG A 1 96  ? -0.128  9.517   6.453   1.00 0.00 ? 96  ARG A HH12 4  
ATOM 7273  H HH21 . ARG A 1 96  ? 1.908   12.345  6.737   1.00 0.00 ? 96  ARG A HH21 4  
ATOM 7274  H HH22 . ARG A 1 96  ? 0.675   11.393  7.493   1.00 0.00 ? 96  ARG A HH22 4  
ATOM 7275  N N    . THR A 1 97  ? 5.854   9.927   1.474   1.00 0.00 ? 97  THR A N    4  
ATOM 7276  C CA   . THR A 1 97  ? 6.614   8.692   1.331   1.00 0.00 ? 97  THR A CA   4  
ATOM 7277  C C    . THR A 1 97  ? 6.068   7.601   2.245   1.00 0.00 ? 97  THR A C    4  
ATOM 7278  O O    . THR A 1 97  ? 6.265   7.639   3.460   1.00 0.00 ? 97  THR A O    4  
ATOM 7279  C CB   . THR A 1 97  ? 8.106   8.911   1.647   1.00 0.00 ? 97  THR A CB   4  
ATOM 7280  O OG1  . THR A 1 97  ? 8.614   10.006  0.877   1.00 0.00 ? 97  THR A OG1  4  
ATOM 7281  C CG2  . THR A 1 97  ? 8.912   7.656   1.346   1.00 0.00 ? 97  THR A CG2  4  
ATOM 7282  H H    . THR A 1 97  ? 5.860   10.396  2.334   1.00 0.00 ? 97  THR A H    4  
ATOM 7283  H HA   . THR A 1 97  ? 6.529   8.364   0.305   1.00 0.00 ? 97  THR A HA   4  
ATOM 7284  H HB   . THR A 1 97  ? 8.206   9.142   2.698   1.00 0.00 ? 97  THR A HB   4  
ATOM 7285  H HG1  . THR A 1 97  ? 8.092   10.104  0.077   1.00 0.00 ? 97  THR A HG1  4  
ATOM 7286  H HG21 . THR A 1 97  ? 9.925   7.788   1.696   1.00 0.00 ? 97  THR A HG21 4  
ATOM 7287  H HG22 . THR A 1 97  ? 8.920   7.479   0.281   1.00 0.00 ? 97  THR A HG22 4  
ATOM 7288  H HG23 . THR A 1 97  ? 8.465   6.812   1.848   1.00 0.00 ? 97  THR A HG23 4  
ATOM 7289  N N    . TYR A 1 98  ? 5.382   6.629   1.654   1.00 0.00 ? 98  TYR A N    4  
ATOM 7290  C CA   . TYR A 1 98  ? 4.805   5.528   2.417   1.00 0.00 ? 98  TYR A CA   4  
ATOM 7291  C C    . TYR A 1 98  ? 5.818   4.402   2.598   1.00 0.00 ? 98  TYR A C    4  
ATOM 7292  O O    . TYR A 1 98  ? 6.832   4.345   1.902   1.00 0.00 ? 98  TYR A O    4  
ATOM 7293  C CB   . TYR A 1 98  ? 3.554   4.996   1.716   1.00 0.00 ? 98  TYR A CB   4  
ATOM 7294  C CG   . TYR A 1 98  ? 2.300   5.777   2.039   1.00 0.00 ? 98  TYR A CG   4  
ATOM 7295  C CD1  . TYR A 1 98  ? 1.499   5.429   3.119   1.00 0.00 ? 98  TYR A CD1  4  
ATOM 7296  C CD2  . TYR A 1 98  ? 1.917   6.864   1.263   1.00 0.00 ? 98  TYR A CD2  4  
ATOM 7297  C CE1  . TYR A 1 98  ? 0.353   6.139   3.417   1.00 0.00 ? 98  TYR A CE1  4  
ATOM 7298  C CE2  . TYR A 1 98  ? 0.773   7.582   1.555   1.00 0.00 ? 98  TYR A CE2  4  
ATOM 7299  C CZ   . TYR A 1 98  ? -0.006  7.215   2.632   1.00 0.00 ? 98  TYR A CZ   4  
ATOM 7300  O OH   . TYR A 1 98  ? -1.146  7.927   2.926   1.00 0.00 ? 98  TYR A OH   4  
ATOM 7301  H H    . TYR A 1 98  ? 5.258   6.653   0.682   1.00 0.00 ? 98  TYR A H    4  
ATOM 7302  H HA   . TYR A 1 98  ? 4.527   5.908   3.389   1.00 0.00 ? 98  TYR A HA   4  
ATOM 7303  H HB2  . TYR A 1 98  ? 3.703   5.035   0.648   1.00 0.00 ? 98  TYR A HB2  4  
ATOM 7304  H HB3  . TYR A 1 98  ? 3.392   3.970   2.014   1.00 0.00 ? 98  TYR A HB3  4  
ATOM 7305  H HD1  . TYR A 1 98  ? 1.784   4.586   3.732   1.00 0.00 ? 98  TYR A HD1  4  
ATOM 7306  H HD2  . TYR A 1 98  ? 2.530   7.149   0.420   1.00 0.00 ? 98  TYR A HD2  4  
ATOM 7307  H HE1  . TYR A 1 98  ? -0.257  5.853   4.261   1.00 0.00 ? 98  TYR A HE1  4  
ATOM 7308  H HE2  . TYR A 1 98  ? 0.492   8.424   0.940   1.00 0.00 ? 98  TYR A HE2  4  
ATOM 7309  H HH   . TYR A 1 98  ? -1.296  8.586   2.245   1.00 0.00 ? 98  TYR A HH   4  
ATOM 7310  N N    . PHE A 1 99  ? 5.536   3.507   3.539   1.00 0.00 ? 99  PHE A N    4  
ATOM 7311  C CA   . PHE A 1 99  ? 6.421   2.382   3.814   1.00 0.00 ? 99  PHE A CA   4  
ATOM 7312  C C    . PHE A 1 99  ? 5.653   1.064   3.779   1.00 0.00 ? 99  PHE A C    4  
ATOM 7313  O O    . PHE A 1 99  ? 4.447   1.028   4.027   1.00 0.00 ? 99  PHE A O    4  
ATOM 7314  C CB   . PHE A 1 99  ? 7.094   2.556   5.177   1.00 0.00 ? 99  PHE A CB   4  
ATOM 7315  C CG   . PHE A 1 99  ? 8.300   3.452   5.140   1.00 0.00 ? 99  PHE A CG   4  
ATOM 7316  C CD1  . PHE A 1 99  ? 8.161   4.827   5.235   1.00 0.00 ? 99  PHE A CD1  4  
ATOM 7317  C CD2  . PHE A 1 99  ? 9.572   2.918   5.010   1.00 0.00 ? 99  PHE A CD2  4  
ATOM 7318  C CE1  . PHE A 1 99  ? 9.268   5.654   5.201   1.00 0.00 ? 99  PHE A CE1  4  
ATOM 7319  C CE2  . PHE A 1 99  ? 10.683  3.740   4.976   1.00 0.00 ? 99  PHE A CE2  4  
ATOM 7320  C CZ   . PHE A 1 99  ? 10.530  5.109   5.071   1.00 0.00 ? 99  PHE A CZ   4  
ATOM 7321  H H    . PHE A 1 99  ? 4.712   3.606   4.062   1.00 0.00 ? 99  PHE A H    4  
ATOM 7322  H HA   . PHE A 1 99  ? 7.180   2.363   3.047   1.00 0.00 ? 99  PHE A HA   4  
ATOM 7323  H HB2  . PHE A 1 99  ? 6.385   2.984   5.869   1.00 0.00 ? 99  PHE A HB2  4  
ATOM 7324  H HB3  . PHE A 1 99  ? 7.408   1.590   5.542   1.00 0.00 ? 99  PHE A HB3  4  
ATOM 7325  H HD1  . PHE A 1 99  ? 7.173   5.254   5.337   1.00 0.00 ? 99  PHE A HD1  4  
ATOM 7326  H HD2  . PHE A 1 99  ? 9.693   1.847   4.935   1.00 0.00 ? 99  PHE A HD2  4  
ATOM 7327  H HE1  . PHE A 1 99  ? 9.145   6.724   5.276   1.00 0.00 ? 99  PHE A HE1  4  
ATOM 7328  H HE2  . PHE A 1 99  ? 11.669  3.312   4.874   1.00 0.00 ? 99  PHE A HE2  4  
ATOM 7329  H HZ   . PHE A 1 99  ? 11.397  5.753   5.045   1.00 0.00 ? 99  PHE A HZ   4  
ATOM 7330  N N    . PHE A 1 100 ? 6.360   -0.018  3.468   1.00 0.00 ? 100 PHE A N    4  
ATOM 7331  C CA   . PHE A 1 100 ? 5.745   -1.339  3.399   1.00 0.00 ? 100 PHE A CA   4  
ATOM 7332  C C    . PHE A 1 100 ? 6.782   -2.434  3.628   1.00 0.00 ? 100 PHE A C    4  
ATOM 7333  O O    . PHE A 1 100 ? 7.778   -2.520  2.910   1.00 0.00 ? 100 PHE A O    4  
ATOM 7334  C CB   . PHE A 1 100 ? 5.067   -1.538  2.041   1.00 0.00 ? 100 PHE A CB   4  
ATOM 7335  C CG   . PHE A 1 100 ? 4.015   -0.510  1.740   1.00 0.00 ? 100 PHE A CG   4  
ATOM 7336  C CD1  . PHE A 1 100 ? 2.791   -0.541  2.388   1.00 0.00 ? 100 PHE A CD1  4  
ATOM 7337  C CD2  . PHE A 1 100 ? 4.250   0.488   0.807   1.00 0.00 ? 100 PHE A CD2  4  
ATOM 7338  C CE1  . PHE A 1 100 ? 1.821   0.405   2.113   1.00 0.00 ? 100 PHE A CE1  4  
ATOM 7339  C CE2  . PHE A 1 100 ? 3.284   1.436   0.528   1.00 0.00 ? 100 PHE A CE2  4  
ATOM 7340  C CZ   . PHE A 1 100 ? 2.067   1.394   1.181   1.00 0.00 ? 100 PHE A CZ   4  
ATOM 7341  H H    . PHE A 1 100 ? 7.317   0.074   3.281   1.00 0.00 ? 100 PHE A H    4  
ATOM 7342  H HA   . PHE A 1 100 ? 4.999   -1.397  4.176   1.00 0.00 ? 100 PHE A HA   4  
ATOM 7343  H HB2  . PHE A 1 100 ? 5.814   -1.486  1.263   1.00 0.00 ? 100 PHE A HB2  4  
ATOM 7344  H HB3  . PHE A 1 100 ? 4.599   -2.510  2.021   1.00 0.00 ? 100 PHE A HB3  4  
ATOM 7345  H HD1  . PHE A 1 100 ? 2.597   -1.315  3.117   1.00 0.00 ? 100 PHE A HD1  4  
ATOM 7346  H HD2  . PHE A 1 100 ? 5.201   0.522   0.295   1.00 0.00 ? 100 PHE A HD2  4  
ATOM 7347  H HE1  . PHE A 1 100 ? 0.871   0.368   2.625   1.00 0.00 ? 100 PHE A HE1  4  
ATOM 7348  H HE2  . PHE A 1 100 ? 3.479   2.208   -0.201  1.00 0.00 ? 100 PHE A HE2  4  
ATOM 7349  H HZ   . PHE A 1 100 ? 1.311   2.133   0.965   1.00 0.00 ? 100 PHE A HZ   4  
ATOM 7350  N N    . SER A 1 101 ? 6.540   -3.268  4.634   1.00 0.00 ? 101 SER A N    4  
ATOM 7351  C CA   . SER A 1 101 ? 7.455   -4.356  4.962   1.00 0.00 ? 101 SER A CA   4  
ATOM 7352  C C    . SER A 1 101 ? 6.968   -5.673  4.366   1.00 0.00 ? 101 SER A C    4  
ATOM 7353  O O    . SER A 1 101 ? 5.790   -5.822  4.041   1.00 0.00 ? 101 SER A O    4  
ATOM 7354  C CB   . SER A 1 101 ? 7.597   -4.491  6.479   1.00 0.00 ? 101 SER A CB   4  
ATOM 7355  O OG   . SER A 1 101 ? 8.183   -5.733  6.828   1.00 0.00 ? 101 SER A OG   4  
ATOM 7356  H H    . SER A 1 101 ? 5.728   -3.148  5.170   1.00 0.00 ? 101 SER A H    4  
ATOM 7357  H HA   . SER A 1 101 ? 8.419   -4.117  4.538   1.00 0.00 ? 101 SER A HA   4  
ATOM 7358  H HB2  . SER A 1 101 ? 8.223   -3.694  6.852   1.00 0.00 ? 101 SER A HB2  4  
ATOM 7359  H HB3  . SER A 1 101 ? 6.621   -4.426  6.937   1.00 0.00 ? 101 SER A HB3  4  
ATOM 7360  H HG   . SER A 1 101 ? 8.527   -5.685  7.723   1.00 0.00 ? 101 SER A HG   4  
ATOM 7361  N N    . ALA A 1 102 ? 7.883   -6.627  4.227   1.00 0.00 ? 102 ALA A N    4  
ATOM 7362  C CA   . ALA A 1 102 ? 7.548   -7.932  3.672   1.00 0.00 ? 102 ALA A CA   4  
ATOM 7363  C C    . ALA A 1 102 ? 8.136   -9.056  4.520   1.00 0.00 ? 102 ALA A C    4  
ATOM 7364  O O    . ALA A 1 102 ? 9.349   -9.132  4.709   1.00 0.00 ? 102 ALA A O    4  
ATOM 7365  C CB   . ALA A 1 102 ? 8.040   -8.039  2.237   1.00 0.00 ? 102 ALA A CB   4  
ATOM 7366  H H    . ALA A 1 102 ? 8.806   -6.448  4.504   1.00 0.00 ? 102 ALA A H    4  
ATOM 7367  H HA   . ALA A 1 102 ? 6.471   -8.026  3.665   1.00 0.00 ? 102 ALA A HA   4  
ATOM 7368  H HB1  . ALA A 1 102 ? 8.268   -7.052  1.860   1.00 0.00 ? 102 ALA A HB1  4  
ATOM 7369  H HB2  . ALA A 1 102 ? 8.931   -8.649  2.207   1.00 0.00 ? 102 ALA A HB2  4  
ATOM 7370  H HB3  . ALA A 1 102 ? 7.273   -8.490  1.626   1.00 0.00 ? 102 ALA A HB3  4  
ATOM 7371  N N    . GLU A 1 103 ? 7.267   -9.925  5.027   1.00 0.00 ? 103 GLU A N    4  
ATOM 7372  C CA   . GLU A 1 103 ? 7.702   -11.043 5.855   1.00 0.00 ? 103 GLU A CA   4  
ATOM 7373  C C    . GLU A 1 103 ? 8.988   -11.657 5.310   1.00 0.00 ? 103 GLU A C    4  
ATOM 7374  O O    . GLU A 1 103 ? 9.957   -11.850 6.045   1.00 0.00 ? 103 GLU A O    4  
ATOM 7375  C CB   . GLU A 1 103 ? 6.606   -12.109 5.929   1.00 0.00 ? 103 GLU A CB   4  
ATOM 7376  C CG   . GLU A 1 103 ? 5.369   -11.659 6.686   1.00 0.00 ? 103 GLU A CG   4  
ATOM 7377  C CD   . GLU A 1 103 ? 4.279   -12.713 6.703   1.00 0.00 ? 103 GLU A CD   4  
ATOM 7378  O OE1  . GLU A 1 103 ? 4.227   -13.526 5.756   1.00 0.00 ? 103 GLU A OE1  4  
ATOM 7379  O OE2  . GLU A 1 103 ? 3.479   -12.725 7.661   1.00 0.00 ? 103 GLU A OE2  4  
ATOM 7380  H H    . GLU A 1 103 ? 6.312   -9.811  4.840   1.00 0.00 ? 103 GLU A H    4  
ATOM 7381  H HA   . GLU A 1 103 ? 7.891   -10.666 6.849   1.00 0.00 ? 103 GLU A HA   4  
ATOM 7382  H HB2  . GLU A 1 103 ? 6.312   -12.375 4.924   1.00 0.00 ? 103 GLU A HB2  4  
ATOM 7383  H HB3  . GLU A 1 103 ? 7.005   -12.984 6.420   1.00 0.00 ? 103 GLU A HB3  4  
ATOM 7384  H HG2  . GLU A 1 103 ? 5.647   -11.435 7.705   1.00 0.00 ? 103 GLU A HG2  4  
ATOM 7385  H HG3  . GLU A 1 103 ? 4.979   -10.767 6.217   1.00 0.00 ? 103 GLU A HG3  4  
ATOM 7386  N N    . SER A 1 104 ? 8.989   -11.962 4.016   1.00 0.00 ? 104 SER A N    4  
ATOM 7387  C CA   . SER A 1 104 ? 10.154  -12.557 3.372   1.00 0.00 ? 104 SER A CA   4  
ATOM 7388  C C    . SER A 1 104 ? 10.728  -11.620 2.314   1.00 0.00 ? 104 SER A C    4  
ATOM 7389  O O    . SER A 1 104 ? 10.042  -10.745 1.785   1.00 0.00 ? 104 SER A O    4  
ATOM 7390  C CB   . SER A 1 104 ? 9.780   -13.897 2.734   1.00 0.00 ? 104 SER A CB   4  
ATOM 7391  O OG   . SER A 1 104 ? 9.920   -14.960 3.662   1.00 0.00 ? 104 SER A OG   4  
ATOM 7392  H H    . SER A 1 104 ? 8.186   -11.784 3.483   1.00 0.00 ? 104 SER A H    4  
ATOM 7393  H HA   . SER A 1 104 ? 10.903  -12.726 4.131   1.00 0.00 ? 104 SER A HA   4  
ATOM 7394  H HB2  . SER A 1 104 ? 8.755   -13.860 2.400   1.00 0.00 ? 104 SER A HB2  4  
ATOM 7395  H HB3  . SER A 1 104 ? 10.429  -14.084 1.890   1.00 0.00 ? 104 SER A HB3  4  
ATOM 7396  H HG   . SER A 1 104 ? 10.605  -15.561 3.359   1.00 0.00 ? 104 SER A HG   4  
ATOM 7397  N N    . PRO A 1 105 ? 12.018  -11.807 1.997   1.00 0.00 ? 105 PRO A N    4  
ATOM 7398  C CA   . PRO A 1 105 ? 12.714  -10.989 0.999   1.00 0.00 ? 105 PRO A CA   4  
ATOM 7399  C C    . PRO A 1 105 ? 12.225  -11.263 -0.419  1.00 0.00 ? 105 PRO A C    4  
ATOM 7400  O O    . PRO A 1 105 ? 12.414  -10.445 -1.319  1.00 0.00 ? 105 PRO A O    4  
ATOM 7401  C CB   . PRO A 1 105 ? 14.177  -11.414 1.151   1.00 0.00 ? 105 PRO A CB   4  
ATOM 7402  C CG   . PRO A 1 105 ? 14.115  -12.794 1.708   1.00 0.00 ? 105 PRO A CG   4  
ATOM 7403  C CD   . PRO A 1 105 ? 12.896  -12.831 2.587   1.00 0.00 ? 105 PRO A CD   4  
ATOM 7404  H HA   . PRO A 1 105 ? 12.619  -9.935  1.214   1.00 0.00 ? 105 PRO A HA   4  
ATOM 7405  H HB2  . PRO A 1 105 ? 14.661  -11.398 0.184   1.00 0.00 ? 105 PRO A HB2  4  
ATOM 7406  H HB3  . PRO A 1 105 ? 14.684  -10.739 1.824   1.00 0.00 ? 105 PRO A HB3  4  
ATOM 7407  H HG2  . PRO A 1 105 ? 14.021  -13.510 0.906   1.00 0.00 ? 105 PRO A HG2  4  
ATOM 7408  H HG3  . PRO A 1 105 ? 15.002  -12.995 2.290   1.00 0.00 ? 105 PRO A HG3  4  
ATOM 7409  H HD2  . PRO A 1 105 ? 12.432  -13.806 2.548   1.00 0.00 ? 105 PRO A HD2  4  
ATOM 7410  H HD3  . PRO A 1 105 ? 13.156  -12.576 3.604   1.00 0.00 ? 105 PRO A HD3  4  
ATOM 7411  N N    . GLU A 1 106 ? 11.594  -12.417 -0.610  1.00 0.00 ? 106 GLU A N    4  
ATOM 7412  C CA   . GLU A 1 106 ? 11.078  -12.797 -1.920  1.00 0.00 ? 106 GLU A CA   4  
ATOM 7413  C C    . GLU A 1 106 ? 9.810   -12.015 -2.253  1.00 0.00 ? 106 GLU A C    4  
ATOM 7414  O O    . GLU A 1 106 ? 9.552   -11.697 -3.413  1.00 0.00 ? 106 GLU A O    4  
ATOM 7415  C CB   . GLU A 1 106 ? 10.790  -14.299 -1.963  1.00 0.00 ? 106 GLU A CB   4  
ATOM 7416  C CG   . GLU A 1 106 ? 12.027  -15.150 -2.193  1.00 0.00 ? 106 GLU A CG   4  
ATOM 7417  C CD   . GLU A 1 106 ? 12.616  -14.960 -3.578  1.00 0.00 ? 106 GLU A CD   4  
ATOM 7418  O OE1  . GLU A 1 106 ? 11.975  -15.392 -4.559  1.00 0.00 ? 106 GLU A OE1  4  
ATOM 7419  O OE2  . GLU A 1 106 ? 13.718  -14.381 -3.681  1.00 0.00 ? 106 GLU A OE2  4  
ATOM 7420  H H    . GLU A 1 106 ? 11.474  -13.028 0.147   1.00 0.00 ? 106 GLU A H    4  
ATOM 7421  H HA   . GLU A 1 106 ? 11.833  -12.564 -2.654  1.00 0.00 ? 106 GLU A HA   4  
ATOM 7422  H HB2  . GLU A 1 106 ? 10.344  -14.595 -1.025  1.00 0.00 ? 106 GLU A HB2  4  
ATOM 7423  H HB3  . GLU A 1 106 ? 10.090  -14.496 -2.762  1.00 0.00 ? 106 GLU A HB3  4  
ATOM 7424  H HG2  . GLU A 1 106 ? 12.775  -14.882 -1.462  1.00 0.00 ? 106 GLU A HG2  4  
ATOM 7425  H HG3  . GLU A 1 106 ? 11.762  -16.190 -2.070  1.00 0.00 ? 106 GLU A HG3  4  
ATOM 7426  N N    . GLU A 1 107 ? 9.023   -11.711 -1.226  1.00 0.00 ? 107 GLU A N    4  
ATOM 7427  C CA   . GLU A 1 107 ? 7.782   -10.968 -1.410  1.00 0.00 ? 107 GLU A CA   4  
ATOM 7428  C C    . GLU A 1 107 ? 8.067   -9.503  -1.730  1.00 0.00 ? 107 GLU A C    4  
ATOM 7429  O O    . GLU A 1 107 ? 7.512   -8.945  -2.676  1.00 0.00 ? 107 GLU A O    4  
ATOM 7430  C CB   . GLU A 1 107 ? 6.912   -11.067 -0.155  1.00 0.00 ? 107 GLU A CB   4  
ATOM 7431  C CG   . GLU A 1 107 ? 6.135   -12.368 -0.054  1.00 0.00 ? 107 GLU A CG   4  
ATOM 7432  C CD   . GLU A 1 107 ? 4.891   -12.241 0.804   1.00 0.00 ? 107 GLU A CD   4  
ATOM 7433  O OE1  . GLU A 1 107 ? 4.059   -11.354 0.516   1.00 0.00 ? 107 GLU A OE1  4  
ATOM 7434  O OE2  . GLU A 1 107 ? 4.749   -13.028 1.763   1.00 0.00 ? 107 GLU A OE2  4  
ATOM 7435  H H    . GLU A 1 107 ? 9.283   -11.992 -0.324  1.00 0.00 ? 107 GLU A H    4  
ATOM 7436  H HA   . GLU A 1 107 ? 7.251   -11.409 -2.240  1.00 0.00 ? 107 GLU A HA   4  
ATOM 7437  H HB2  . GLU A 1 107 ? 7.545   -10.981 0.716   1.00 0.00 ? 107 GLU A HB2  4  
ATOM 7438  H HB3  . GLU A 1 107 ? 6.205   -10.250 -0.157  1.00 0.00 ? 107 GLU A HB3  4  
ATOM 7439  H HG2  . GLU A 1 107 ? 5.838   -12.674 -1.047  1.00 0.00 ? 107 GLU A HG2  4  
ATOM 7440  H HG3  . GLU A 1 107 ? 6.776   -13.123 0.377   1.00 0.00 ? 107 GLU A HG3  4  
ATOM 7441  N N    . GLN A 1 108 ? 8.935   -8.888  -0.934  1.00 0.00 ? 108 GLN A N    4  
ATOM 7442  C CA   . GLN A 1 108 ? 9.293   -7.488  -1.132  1.00 0.00 ? 108 GLN A CA   4  
ATOM 7443  C C    . GLN A 1 108 ? 9.722   -7.234  -2.574  1.00 0.00 ? 108 GLN A C    4  
ATOM 7444  O O    . GLN A 1 108 ? 9.132   -6.409  -3.270  1.00 0.00 ? 108 GLN A O    4  
ATOM 7445  C CB   . GLN A 1 108 ? 10.417  -7.087  -0.175  1.00 0.00 ? 108 GLN A CB   4  
ATOM 7446  C CG   . GLN A 1 108 ? 11.000  -5.712  -0.463  1.00 0.00 ? 108 GLN A CG   4  
ATOM 7447  C CD   . GLN A 1 108 ? 12.435  -5.577  0.006   1.00 0.00 ? 108 GLN A CD   4  
ATOM 7448  O OE1  . GLN A 1 108 ? 13.161  -6.565  0.112   1.00 0.00 ? 108 GLN A OE1  4  
ATOM 7449  N NE2  . GLN A 1 108 ? 12.852  -4.349  0.289   1.00 0.00 ? 108 GLN A NE2  4  
ATOM 7450  H H    . GLN A 1 108 ? 9.345   -9.386  -0.197  1.00 0.00 ? 108 GLN A H    4  
ATOM 7451  H HA   . GLN A 1 108 ? 8.420   -6.890  -0.919  1.00 0.00 ? 108 GLN A HA   4  
ATOM 7452  H HB2  . GLN A 1 108 ? 10.032  -7.087  0.834   1.00 0.00 ? 108 GLN A HB2  4  
ATOM 7453  H HB3  . GLN A 1 108 ? 11.212  -7.813  -0.248  1.00 0.00 ? 108 GLN A HB3  4  
ATOM 7454  H HG2  . GLN A 1 108 ? 10.968  -5.538  -1.529  1.00 0.00 ? 108 GLN A HG2  4  
ATOM 7455  H HG3  . GLN A 1 108 ? 10.400  -4.969  0.040   1.00 0.00 ? 108 GLN A HG3  4  
ATOM 7456  H HE21 . GLN A 1 108 ? 12.217  -3.609  0.183   1.00 0.00 ? 108 GLN A HE21 4  
ATOM 7457  H HE22 . GLN A 1 108 ? 13.774  -4.232  0.595   1.00 0.00 ? 108 GLN A HE22 4  
ATOM 7458  N N    . GLU A 1 109 ? 10.752  -7.950  -3.014  1.00 0.00 ? 109 GLU A N    4  
ATOM 7459  C CA   . GLU A 1 109 ? 11.260  -7.800  -4.373  1.00 0.00 ? 109 GLU A CA   4  
ATOM 7460  C C    . GLU A 1 109 ? 10.151  -8.028  -5.396  1.00 0.00 ? 109 GLU A C    4  
ATOM 7461  O O    . GLU A 1 109 ? 9.955   -7.222  -6.305  1.00 0.00 ? 109 GLU A O    4  
ATOM 7462  C CB   . GLU A 1 109 ? 12.408  -8.780  -4.623  1.00 0.00 ? 109 GLU A CB   4  
ATOM 7463  C CG   . GLU A 1 109 ? 11.947  -10.157 -5.070  1.00 0.00 ? 109 GLU A CG   4  
ATOM 7464  C CD   . GLU A 1 109 ? 13.104  -11.091 -5.368  1.00 0.00 ? 109 GLU A CD   4  
ATOM 7465  O OE1  . GLU A 1 109 ? 13.721  -11.597 -4.407  1.00 0.00 ? 109 GLU A OE1  4  
ATOM 7466  O OE2  . GLU A 1 109 ? 13.392  -11.316 -6.562  1.00 0.00 ? 109 GLU A OE2  4  
ATOM 7467  H H    . GLU A 1 109 ? 11.181  -8.592  -2.412  1.00 0.00 ? 109 GLU A H    4  
ATOM 7468  H HA   . GLU A 1 109 ? 11.629  -6.792  -4.480  1.00 0.00 ? 109 GLU A HA   4  
ATOM 7469  H HB2  . GLU A 1 109 ? 13.053  -8.372  -5.387  1.00 0.00 ? 109 GLU A HB2  4  
ATOM 7470  H HB3  . GLU A 1 109 ? 12.974  -8.892  -3.710  1.00 0.00 ? 109 GLU A HB3  4  
ATOM 7471  H HG2  . GLU A 1 109 ? 11.345  -10.593 -4.287  1.00 0.00 ? 109 GLU A HG2  4  
ATOM 7472  H HG3  . GLU A 1 109 ? 11.351  -10.050 -5.964  1.00 0.00 ? 109 GLU A HG3  4  
ATOM 7473  N N    . ALA A 1 110 ? 9.428   -9.133  -5.241  1.00 0.00 ? 110 ALA A N    4  
ATOM 7474  C CA   . ALA A 1 110 ? 8.338   -9.467  -6.150  1.00 0.00 ? 110 ALA A CA   4  
ATOM 7475  C C    . ALA A 1 110 ? 7.328   -8.328  -6.237  1.00 0.00 ? 110 ALA A C    4  
ATOM 7476  O O    . ALA A 1 110 ? 6.871   -7.974  -7.324  1.00 0.00 ? 110 ALA A O    4  
ATOM 7477  C CB   . ALA A 1 110 ? 7.653   -10.749 -5.702  1.00 0.00 ? 110 ALA A CB   4  
ATOM 7478  H H    . ALA A 1 110 ? 9.632   -9.736  -4.497  1.00 0.00 ? 110 ALA A H    4  
ATOM 7479  H HA   . ALA A 1 110 ? 8.761   -9.636  -7.130  1.00 0.00 ? 110 ALA A HA   4  
ATOM 7480  H HB1  . ALA A 1 110 ? 7.172   -11.215 -6.550  1.00 0.00 ? 110 ALA A HB1  4  
ATOM 7481  H HB2  . ALA A 1 110 ? 8.388   -11.424 -5.290  1.00 0.00 ? 110 ALA A HB2  4  
ATOM 7482  H HB3  . ALA A 1 110 ? 6.913   -10.519 -4.950  1.00 0.00 ? 110 ALA A HB3  4  
ATOM 7483  N N    . TRP A 1 111 ? 6.984   -7.759  -5.088  1.00 0.00 ? 111 TRP A N    4  
ATOM 7484  C CA   . TRP A 1 111 ? 6.027   -6.660  -5.036  1.00 0.00 ? 111 TRP A CA   4  
ATOM 7485  C C    . TRP A 1 111 ? 6.534   -5.458  -5.825  1.00 0.00 ? 111 TRP A C    4  
ATOM 7486  O O    . TRP A 1 111 ? 5.878   -4.996  -6.759  1.00 0.00 ? 111 TRP A O    4  
ATOM 7487  C CB   . TRP A 1 111 ? 5.760   -6.256  -3.584  1.00 0.00 ? 111 TRP A CB   4  
ATOM 7488  C CG   . TRP A 1 111 ? 4.621   -7.004  -2.960  1.00 0.00 ? 111 TRP A CG   4  
ATOM 7489  C CD1  . TRP A 1 111 ? 4.707   -8.008  -2.038  1.00 0.00 ? 111 TRP A CD1  4  
ATOM 7490  C CD2  . TRP A 1 111 ? 3.226   -6.808  -3.214  1.00 0.00 ? 111 TRP A CD2  4  
ATOM 7491  N NE1  . TRP A 1 111 ? 3.449   -8.447  -1.703  1.00 0.00 ? 111 TRP A NE1  4  
ATOM 7492  C CE2  . TRP A 1 111 ? 2.523   -7.727  -2.410  1.00 0.00 ? 111 TRP A CE2  4  
ATOM 7493  C CE3  . TRP A 1 111 ? 2.502   -5.944  -4.040  1.00 0.00 ? 111 TRP A CE3  4  
ATOM 7494  C CZ2  . TRP A 1 111 ? 1.133   -7.805  -2.411  1.00 0.00 ? 111 TRP A CZ2  4  
ATOM 7495  C CZ3  . TRP A 1 111 ? 1.122   -6.023  -4.040  1.00 0.00 ? 111 TRP A CZ3  4  
ATOM 7496  C CH2  . TRP A 1 111 ? 0.449   -6.948  -3.230  1.00 0.00 ? 111 TRP A CH2  4  
ATOM 7497  H H    . TRP A 1 111 ? 7.383   -8.085  -4.254  1.00 0.00 ? 111 TRP A H    4  
ATOM 7498  H HA   . TRP A 1 111 ? 5.104   -7.004  -5.479  1.00 0.00 ? 111 TRP A HA   4  
ATOM 7499  H HB2  . TRP A 1 111 ? 6.646   -6.446  -2.996  1.00 0.00 ? 111 TRP A HB2  4  
ATOM 7500  H HB3  . TRP A 1 111 ? 5.528   -5.202  -3.548  1.00 0.00 ? 111 TRP A HB3  4  
ATOM 7501  H HD1  . TRP A 1 111 ? 5.635   -8.391  -1.640  1.00 0.00 ? 111 TRP A HD1  4  
ATOM 7502  H HE1  . TRP A 1 111 ? 3.248   -9.160  -1.061  1.00 0.00 ? 111 TRP A HE1  4  
ATOM 7503  H HE3  . TRP A 1 111 ? 3.002   -5.225  -4.671  1.00 0.00 ? 111 TRP A HE3  4  
ATOM 7504  H HZ2  . TRP A 1 111 ? 0.600   -8.512  -1.792  1.00 0.00 ? 111 TRP A HZ2  4  
ATOM 7505  H HZ3  . TRP A 1 111 ? 0.546   -5.364  -4.672  1.00 0.00 ? 111 TRP A HZ3  4  
ATOM 7506  H HH2  . TRP A 1 111 ? -0.629  -6.975  -3.262  1.00 0.00 ? 111 TRP A HH2  4  
ATOM 7507  N N    . ILE A 1 112 ? 7.704   -4.956  -5.444  1.00 0.00 ? 112 ILE A N    4  
ATOM 7508  C CA   . ILE A 1 112 ? 8.299   -3.809  -6.119  1.00 0.00 ? 112 ILE A CA   4  
ATOM 7509  C C    . ILE A 1 112 ? 8.134   -3.914  -7.631  1.00 0.00 ? 112 ILE A C    4  
ATOM 7510  O O    . ILE A 1 112 ? 7.888   -2.917  -8.309  1.00 0.00 ? 112 ILE A O    4  
ATOM 7511  C CB   . ILE A 1 112 ? 9.796   -3.674  -5.785  1.00 0.00 ? 112 ILE A CB   4  
ATOM 7512  C CG1  . ILE A 1 112 ? 9.985   -3.387  -4.294  1.00 0.00 ? 112 ILE A CG1  4  
ATOM 7513  C CG2  . ILE A 1 112 ? 10.429  -2.575  -6.626  1.00 0.00 ? 112 ILE A CG2  4  
ATOM 7514  C CD1  . ILE A 1 112 ? 11.406  -3.586  -3.815  1.00 0.00 ? 112 ILE A CD1  4  
ATOM 7515  H H    . ILE A 1 112 ? 8.179   -5.368  -4.693  1.00 0.00 ? 112 ILE A H    4  
ATOM 7516  H HA   . ILE A 1 112 ? 7.791   -2.920  -5.773  1.00 0.00 ? 112 ILE A HA   4  
ATOM 7517  H HB   . ILE A 1 112 ? 10.282  -4.606  -6.029  1.00 0.00 ? 112 ILE A HB   4  
ATOM 7518  H HG12 . ILE A 1 112 ? 9.708   -2.364  -4.093  1.00 0.00 ? 112 ILE A HG12 4  
ATOM 7519  H HG13 . ILE A 1 112 ? 9.346   -4.047  -3.725  1.00 0.00 ? 112 ILE A HG13 4  
ATOM 7520  H HG21 . ILE A 1 112 ? 9.757   -1.731  -6.680  1.00 0.00 ? 112 ILE A HG21 4  
ATOM 7521  H HG22 . ILE A 1 112 ? 11.358  -2.265  -6.172  1.00 0.00 ? 112 ILE A HG22 4  
ATOM 7522  H HG23 . ILE A 1 112 ? 10.620  -2.947  -7.621  1.00 0.00 ? 112 ILE A HG23 4  
ATOM 7523  H HD11 . ILE A 1 112 ? 11.620  -4.643  -3.754  1.00 0.00 ? 112 ILE A HD11 4  
ATOM 7524  H HD12 . ILE A 1 112 ? 12.089  -3.121  -4.511  1.00 0.00 ? 112 ILE A HD12 4  
ATOM 7525  H HD13 . ILE A 1 112 ? 11.524  -3.138  -2.840  1.00 0.00 ? 112 ILE A HD13 4  
ATOM 7526  N N    . GLN A 1 113 ? 8.269   -5.129  -8.153  1.00 0.00 ? 113 GLN A N    4  
ATOM 7527  C CA   . GLN A 1 113 ? 8.134   -5.364  -9.585  1.00 0.00 ? 113 GLN A CA   4  
ATOM 7528  C C    . GLN A 1 113 ? 6.785   -4.867  -10.094 1.00 0.00 ? 113 GLN A C    4  
ATOM 7529  O O    . GLN A 1 113 ? 6.705   -4.213  -11.134 1.00 0.00 ? 113 GLN A O    4  
ATOM 7530  C CB   . GLN A 1 113 ? 8.291   -6.854  -9.896  1.00 0.00 ? 113 GLN A CB   4  
ATOM 7531  C CG   . GLN A 1 113 ? 9.654   -7.413  -9.522  1.00 0.00 ? 113 GLN A CG   4  
ATOM 7532  C CD   . GLN A 1 113 ? 10.009  -8.661  -10.306 1.00 0.00 ? 113 GLN A CD   4  
ATOM 7533  O OE1  . GLN A 1 113 ? 9.263   -9.641  -10.306 1.00 0.00 ? 113 GLN A OE1  4  
ATOM 7534  N NE2  . GLN A 1 113 ? 11.152  -8.632  -10.981 1.00 0.00 ? 113 GLN A NE2  4  
ATOM 7535  H H    . GLN A 1 113 ? 8.464   -5.884  -7.560  1.00 0.00 ? 113 GLN A H    4  
ATOM 7536  H HA   . GLN A 1 113 ? 8.917   -4.817  -10.086 1.00 0.00 ? 113 GLN A HA   4  
ATOM 7537  H HB2  . GLN A 1 113 ? 7.538   -7.405  -9.352  1.00 0.00 ? 113 GLN A HB2  4  
ATOM 7538  H HB3  . GLN A 1 113 ? 8.142   -7.006  -10.955 1.00 0.00 ? 113 GLN A HB3  4  
ATOM 7539  H HG2  . GLN A 1 113 ? 10.404  -6.660  -9.716  1.00 0.00 ? 113 GLN A HG2  4  
ATOM 7540  H HG3  . GLN A 1 113 ? 9.653   -7.655  -8.469  1.00 0.00 ? 113 GLN A HG3  4  
ATOM 7541  H HE21 . GLN A 1 113 ? 11.696  -7.817  -10.933 1.00 0.00 ? 113 GLN A HE21 4  
ATOM 7542  H HE22 . GLN A 1 113 ? 11.406  -9.425  -11.495 1.00 0.00 ? 113 GLN A HE22 4  
ATOM 7543  N N    . ALA A 1 114 ? 5.727   -5.180  -9.353  1.00 0.00 ? 114 ALA A N    4  
ATOM 7544  C CA   . ALA A 1 114 ? 4.381   -4.763  -9.729  1.00 0.00 ? 114 ALA A CA   4  
ATOM 7545  C C    . ALA A 1 114 ? 4.120   -3.318  -9.317  1.00 0.00 ? 114 ALA A C    4  
ATOM 7546  O O    . ALA A 1 114 ? 3.612   -2.521  -10.106 1.00 0.00 ? 114 ALA A O    4  
ATOM 7547  C CB   . ALA A 1 114 ? 3.348   -5.688  -9.102  1.00 0.00 ? 114 ALA A CB   4  
ATOM 7548  H H    . ALA A 1 114 ? 5.854   -5.703  -8.535  1.00 0.00 ? 114 ALA A H    4  
ATOM 7549  H HA   . ALA A 1 114 ? 4.295   -4.842  -10.803 1.00 0.00 ? 114 ALA A HA   4  
ATOM 7550  H HB1  . ALA A 1 114 ? 2.632   -5.102  -8.545  1.00 0.00 ? 114 ALA A HB1  4  
ATOM 7551  H HB2  . ALA A 1 114 ? 2.837   -6.236  -9.880  1.00 0.00 ? 114 ALA A HB2  4  
ATOM 7552  H HB3  . ALA A 1 114 ? 3.842   -6.381  -8.437  1.00 0.00 ? 114 ALA A HB3  4  
ATOM 7553  N N    . MET A 1 115 ? 4.469   -2.988  -8.078  1.00 0.00 ? 115 MET A N    4  
ATOM 7554  C CA   . MET A 1 115 ? 4.271   -1.638  -7.563  1.00 0.00 ? 115 MET A CA   4  
ATOM 7555  C C    . MET A 1 115 ? 5.207   -0.651  -8.254  1.00 0.00 ? 115 MET A C    4  
ATOM 7556  O O    . MET A 1 115 ? 4.760   0.269   -8.937  1.00 0.00 ? 115 MET A O    4  
ATOM 7557  C CB   . MET A 1 115 ? 4.504   -1.607  -6.051  1.00 0.00 ? 115 MET A CB   4  
ATOM 7558  C CG   . MET A 1 115 ? 3.321   -2.117  -5.244  1.00 0.00 ? 115 MET A CG   4  
ATOM 7559  S SD   . MET A 1 115 ? 3.316   -1.496  -3.551  1.00 0.00 ? 115 MET A SD   4  
ATOM 7560  C CE   . MET A 1 115 ? 2.780   -2.953  -2.658  1.00 0.00 ? 115 MET A CE   4  
ATOM 7561  H H    . MET A 1 115 ? 4.869   -3.668  -7.496  1.00 0.00 ? 115 MET A H    4  
ATOM 7562  H HA   . MET A 1 115 ? 3.251   -1.352  -7.767  1.00 0.00 ? 115 MET A HA   4  
ATOM 7563  H HB2  . MET A 1 115 ? 5.362   -2.220  -5.818  1.00 0.00 ? 115 MET A HB2  4  
ATOM 7564  H HB3  . MET A 1 115 ? 4.705   -0.590  -5.751  1.00 0.00 ? 115 MET A HB3  4  
ATOM 7565  H HG2  . MET A 1 115 ? 2.409   -1.803  -5.729  1.00 0.00 ? 115 MET A HG2  4  
ATOM 7566  H HG3  . MET A 1 115 ? 3.359   -3.195  -5.218  1.00 0.00 ? 115 MET A HG3  4  
ATOM 7567  H HE1  . MET A 1 115 ? 2.431   -3.697  -3.360  1.00 0.00 ? 115 MET A HE1  4  
ATOM 7568  H HE2  . MET A 1 115 ? 3.608   -3.353  -2.092  1.00 0.00 ? 115 MET A HE2  4  
ATOM 7569  H HE3  . MET A 1 115 ? 1.978   -2.687  -1.985  1.00 0.00 ? 115 MET A HE3  4  
ATOM 7570  N N    . GLY A 1 116 ? 6.509   -0.848  -8.070  1.00 0.00 ? 116 GLY A N    4  
ATOM 7571  C CA   . GLY A 1 116 ? 7.487   0.033   -8.682  1.00 0.00 ? 116 GLY A CA   4  
ATOM 7572  C C    . GLY A 1 116 ? 7.144   0.370   -10.119 1.00 0.00 ? 116 GLY A C    4  
ATOM 7573  O O    . GLY A 1 116 ? 7.238   1.526   -10.531 1.00 0.00 ? 116 GLY A O    4  
ATOM 7574  H H    . GLY A 1 116 ? 6.808   -1.599  -7.515  1.00 0.00 ? 116 GLY A H    4  
ATOM 7575  H HA2  . GLY A 1 116 ? 7.537   0.948   -8.110  1.00 0.00 ? 116 GLY A HA2  4  
ATOM 7576  H HA3  . GLY A 1 116 ? 8.453   -0.449  -8.658  1.00 0.00 ? 116 GLY A HA3  4  
ATOM 7577  N N    . GLU A 1 117 ? 6.748   -0.642  -10.885 1.00 0.00 ? 117 GLU A N    4  
ATOM 7578  C CA   . GLU A 1 117 ? 6.393   -0.446  -12.285 1.00 0.00 ? 117 GLU A CA   4  
ATOM 7579  C C    . GLU A 1 117 ? 5.047   0.262   -12.412 1.00 0.00 ? 117 GLU A C    4  
ATOM 7580  O O    . GLU A 1 117 ? 4.962   1.363   -12.955 1.00 0.00 ? 117 GLU A O    4  
ATOM 7581  C CB   . GLU A 1 117 ? 6.345   -1.791  -13.015 1.00 0.00 ? 117 GLU A CB   4  
ATOM 7582  C CG   . GLU A 1 117 ? 7.711   -2.297  -13.448 1.00 0.00 ? 117 GLU A CG   4  
ATOM 7583  C CD   . GLU A 1 117 ? 8.541   -1.226  -14.129 1.00 0.00 ? 117 GLU A CD   4  
ATOM 7584  O OE1  . GLU A 1 117 ? 8.230   -0.883  -15.289 1.00 0.00 ? 117 GLU A OE1  4  
ATOM 7585  O OE2  . GLU A 1 117 ? 9.501   -0.731  -13.502 1.00 0.00 ? 117 GLU A OE2  4  
ATOM 7586  H H    . GLU A 1 117 ? 6.693   -1.541  -10.498 1.00 0.00 ? 117 GLU A H    4  
ATOM 7587  H HA   . GLU A 1 117 ? 7.155   0.171   -12.737 1.00 0.00 ? 117 GLU A HA   4  
ATOM 7588  H HB2  . GLU A 1 117 ? 5.902   -2.526  -12.360 1.00 0.00 ? 117 GLU A HB2  4  
ATOM 7589  H HB3  . GLU A 1 117 ? 5.727   -1.687  -13.895 1.00 0.00 ? 117 GLU A HB3  4  
ATOM 7590  H HG2  . GLU A 1 117 ? 8.245   -2.645  -12.577 1.00 0.00 ? 117 GLU A HG2  4  
ATOM 7591  H HG3  . GLU A 1 117 ? 7.574   -3.118  -14.137 1.00 0.00 ? 117 GLU A HG3  4  
ATOM 7592  N N    . ALA A 1 118 ? 3.998   -0.379  -11.907 1.00 0.00 ? 118 ALA A N    4  
ATOM 7593  C CA   . ALA A 1 118 ? 2.657   0.189   -11.962 1.00 0.00 ? 118 ALA A CA   4  
ATOM 7594  C C    . ALA A 1 118 ? 2.660   1.647   -11.517 1.00 0.00 ? 118 ALA A C    4  
ATOM 7595  O O    . ALA A 1 118 ? 1.840   2.446   -11.969 1.00 0.00 ? 118 ALA A O    4  
ATOM 7596  C CB   . ALA A 1 118 ? 1.703   -0.626  -11.101 1.00 0.00 ? 118 ALA A CB   4  
ATOM 7597  H H    . ALA A 1 118 ? 4.130   -1.254  -11.486 1.00 0.00 ? 118 ALA A H    4  
ATOM 7598  H HA   . ALA A 1 118 ? 2.313   0.136   -12.985 1.00 0.00 ? 118 ALA A HA   4  
ATOM 7599  H HB1  . ALA A 1 118 ? 1.903   -1.678  -11.239 1.00 0.00 ? 118 ALA A HB1  4  
ATOM 7600  H HB2  . ALA A 1 118 ? 1.846   -0.366  -10.062 1.00 0.00 ? 118 ALA A HB2  4  
ATOM 7601  H HB3  . ALA A 1 118 ? 0.685   -0.411  -11.389 1.00 0.00 ? 118 ALA A HB3  4  
ATOM 7602  N N    . ALA A 1 119 ? 3.586   1.988   -10.627 1.00 0.00 ? 119 ALA A N    4  
ATOM 7603  C CA   . ALA A 1 119 ? 3.696   3.351   -10.122 1.00 0.00 ? 119 ALA A CA   4  
ATOM 7604  C C    . ALA A 1 119 ? 4.117   4.314   -11.227 1.00 0.00 ? 119 ALA A C    4  
ATOM 7605  O O    . ALA A 1 119 ? 3.550   5.398   -11.367 1.00 0.00 ? 119 ALA A O    4  
ATOM 7606  C CB   . ALA A 1 119 ? 4.684   3.407   -8.966  1.00 0.00 ? 119 ALA A CB   4  
ATOM 7607  H H    . ALA A 1 119 ? 4.212   1.307   -10.304 1.00 0.00 ? 119 ALA A H    4  
ATOM 7608  H HA   . ALA A 1 119 ? 2.726   3.648   -9.749  1.00 0.00 ? 119 ALA A HA   4  
ATOM 7609  H HB1  . ALA A 1 119 ? 5.455   4.130   -9.187  1.00 0.00 ? 119 ALA A HB1  4  
ATOM 7610  H HB2  . ALA A 1 119 ? 4.165   3.699   -8.064  1.00 0.00 ? 119 ALA A HB2  4  
ATOM 7611  H HB3  . ALA A 1 119 ? 5.131   2.434   -8.827  1.00 0.00 ? 119 ALA A HB3  4  
ATOM 7612  N N    . ARG A 1 120 ? 5.113   3.911   -12.009 1.00 0.00 ? 120 ARG A N    4  
ATOM 7613  C CA   . ARG A 1 120 ? 5.610   4.739   -13.101 1.00 0.00 ? 120 ARG A CA   4  
ATOM 7614  C C    . ARG A 1 120 ? 4.476   5.534   -13.741 1.00 0.00 ? 120 ARG A C    4  
ATOM 7615  O O    . ARG A 1 120 ? 3.438   4.976   -14.098 1.00 0.00 ? 120 ARG A O    4  
ATOM 7616  C CB   . ARG A 1 120 ? 6.298   3.871   -14.156 1.00 0.00 ? 120 ARG A CB   4  
ATOM 7617  C CG   . ARG A 1 120 ? 7.720   3.479   -13.790 1.00 0.00 ? 120 ARG A CG   4  
ATOM 7618  C CD   . ARG A 1 120 ? 8.100   2.134   -14.390 1.00 0.00 ? 120 ARG A CD   4  
ATOM 7619  N NE   . ARG A 1 120 ? 8.579   2.264   -15.763 1.00 0.00 ? 120 ARG A NE   4  
ATOM 7620  C CZ   . ARG A 1 120 ? 9.811   2.645   -16.079 1.00 0.00 ? 120 ARG A CZ   4  
ATOM 7621  N NH1  . ARG A 1 120 ? 10.685  2.933   -15.124 1.00 0.00 ? 120 ARG A NH1  4  
ATOM 7622  N NH2  . ARG A 1 120 ? 10.173  2.739   -17.352 1.00 0.00 ? 120 ARG A NH2  4  
ATOM 7623  H H    . ARG A 1 120 ? 5.524   3.036   -11.847 1.00 0.00 ? 120 ARG A H    4  
ATOM 7624  H HA   . ARG A 1 120 ? 6.331   5.431   -12.691 1.00 0.00 ? 120 ARG A HA   4  
ATOM 7625  H HB2  . ARG A 1 120 ? 5.723   2.967   -14.292 1.00 0.00 ? 120 ARG A HB2  4  
ATOM 7626  H HB3  . ARG A 1 120 ? 6.326   4.414   -15.088 1.00 0.00 ? 120 ARG A HB3  4  
ATOM 7627  H HG2  . ARG A 1 120 ? 8.399   4.232   -14.163 1.00 0.00 ? 120 ARG A HG2  4  
ATOM 7628  H HG3  . ARG A 1 120 ? 7.802   3.420   -12.714 1.00 0.00 ? 120 ARG A HG3  4  
ATOM 7629  H HD2  . ARG A 1 120 ? 8.879   1.693   -13.787 1.00 0.00 ? 120 ARG A HD2  4  
ATOM 7630  H HD3  . ARG A 1 120 ? 7.231   1.493   -14.380 1.00 0.00 ? 120 ARG A HD3  4  
ATOM 7631  H HE   . ARG A 1 120 ? 7.950   2.056   -16.485 1.00 0.00 ? 120 ARG A HE   4  
ATOM 7632  H HH11 . ARG A 1 120 ? 10.415  2.863   -14.163 1.00 0.00 ? 120 ARG A HH11 4  
ATOM 7633  H HH12 . ARG A 1 120 ? 11.613  3.219   -15.364 1.00 0.00 ? 120 ARG A HH12 4  
ATOM 7634  H HH21 . ARG A 1 120 ? 9.517   2.522   -18.075 1.00 0.00 ? 120 ARG A HH21 4  
ATOM 7635  H HH22 . ARG A 1 120 ? 11.100  3.026   -17.589 1.00 0.00 ? 120 ARG A HH22 4  
ATOM 7636  N N    . VAL A 1 121 ? 4.680   6.840   -13.882 1.00 0.00 ? 121 VAL A N    4  
ATOM 7637  C CA   . VAL A 1 121 ? 3.675   7.711   -14.479 1.00 0.00 ? 121 VAL A CA   4  
ATOM 7638  C C    . VAL A 1 121 ? 3.939   7.915   -15.967 1.00 0.00 ? 121 VAL A C    4  
ATOM 7639  O O    . VAL A 1 121 ? 3.078   8.401   -16.698 1.00 0.00 ? 121 VAL A O    4  
ATOM 7640  C CB   . VAL A 1 121 ? 3.638   9.084   -13.782 1.00 0.00 ? 121 VAL A CB   4  
ATOM 7641  C CG1  . VAL A 1 121 ? 4.944   9.831   -14.003 1.00 0.00 ? 121 VAL A CG1  4  
ATOM 7642  C CG2  . VAL A 1 121 ? 2.455   9.901   -14.281 1.00 0.00 ? 121 VAL A CG2  4  
ATOM 7643  H H    . VAL A 1 121 ? 5.528   7.226   -13.578 1.00 0.00 ? 121 VAL A H    4  
ATOM 7644  H HA   . VAL A 1 121 ? 2.710   7.241   -14.355 1.00 0.00 ? 121 VAL A HA   4  
ATOM 7645  H HB   . VAL A 1 121 ? 3.516   8.923   -12.721 1.00 0.00 ? 121 VAL A HB   4  
ATOM 7646  H HG11 . VAL A 1 121 ? 5.455   9.417   -14.860 1.00 0.00 ? 121 VAL A HG11 4  
ATOM 7647  H HG12 . VAL A 1 121 ? 4.736   10.877  -14.178 1.00 0.00 ? 121 VAL A HG12 4  
ATOM 7648  H HG13 . VAL A 1 121 ? 5.569   9.729   -13.129 1.00 0.00 ? 121 VAL A HG13 4  
ATOM 7649  H HG21 . VAL A 1 121 ? 1.810   10.146  -13.450 1.00 0.00 ? 121 VAL A HG21 4  
ATOM 7650  H HG22 . VAL A 1 121 ? 2.815   10.811  -14.738 1.00 0.00 ? 121 VAL A HG22 4  
ATOM 7651  H HG23 . VAL A 1 121 ? 1.902   9.327   -15.010 1.00 0.00 ? 121 VAL A HG23 4  
ATOM 7652  N N    . GLN A 1 122 ? 5.136   7.539   -16.407 1.00 0.00 ? 122 GLN A N    4  
ATOM 7653  C CA   . GLN A 1 122 ? 5.513   7.681   -17.808 1.00 0.00 ? 122 GLN A CA   4  
ATOM 7654  C C    . GLN A 1 122 ? 5.285   6.379   -18.568 1.00 0.00 ? 122 GLN A C    4  
ATOM 7655  O O    . GLN A 1 122 ? 4.911   6.390   -19.741 1.00 0.00 ? 122 GLN A O    4  
ATOM 7656  C CB   . GLN A 1 122 ? 6.979   8.103   -17.923 1.00 0.00 ? 122 GLN A CB   4  
ATOM 7657  C CG   . GLN A 1 122 ? 7.464   8.233   -19.358 1.00 0.00 ? 122 GLN A CG   4  
ATOM 7658  C CD   . GLN A 1 122 ? 6.547   9.090   -20.209 1.00 0.00 ? 122 GLN A CD   4  
ATOM 7659  O OE1  . GLN A 1 122 ? 6.372   10.281  -19.947 1.00 0.00 ? 122 GLN A OE1  4  
ATOM 7660  N NE2  . GLN A 1 122 ? 5.956   8.489   -21.235 1.00 0.00 ? 122 GLN A NE2  4  
ATOM 7661  H H    . GLN A 1 122 ? 5.780   7.158   -15.775 1.00 0.00 ? 122 GLN A H    4  
ATOM 7662  H HA   . GLN A 1 122 ? 4.891   8.450   -18.242 1.00 0.00 ? 122 GLN A HA   4  
ATOM 7663  H HB2  . GLN A 1 122 ? 7.106   9.058   -17.435 1.00 0.00 ? 122 GLN A HB2  4  
ATOM 7664  H HB3  . GLN A 1 122 ? 7.593   7.368   -17.424 1.00 0.00 ? 122 GLN A HB3  4  
ATOM 7665  H HG2  . GLN A 1 122 ? 8.447   8.680   -19.354 1.00 0.00 ? 122 GLN A HG2  4  
ATOM 7666  H HG3  . GLN A 1 122 ? 7.519   7.247   -19.796 1.00 0.00 ? 122 GLN A HG3  4  
ATOM 7667  H HE21 . GLN A 1 122 ? 6.142   7.537   -21.382 1.00 0.00 ? 122 GLN A HE21 4  
ATOM 7668  H HE22 . GLN A 1 122 ? 5.358   9.019   -21.800 1.00 0.00 ? 122 GLN A HE22 4  
ATOM 7669  N N    . GLY A 1 1   ? -35.099 30.001  1.233   1.00 0.00 ? 1   GLY A N    5  
ATOM 7670  C CA   . GLY A 1 1   ? -34.002 29.415  1.980   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7671  C C    . GLY A 1 1   ? -34.335 28.037  2.515   1.00 0.00 ? 1   GLY A C    5  
ATOM 7672  O O    . GLY A 1 1   ? -35.492 27.617  2.489   1.00 0.00 ? 1   GLY A O    5  
ATOM 7673  H H1   . GLY A 1 1   ? -35.237 29.755  0.294   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7674  H HA2  . GLY A 1 1   ? -33.140 29.340  1.333   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7675  H HA3  . GLY A 1 1   ? -33.761 30.062  2.811   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7676  N N    . SER A 1 2   ? -33.320 27.330  3.001   1.00 0.00 ? 2   SER A N    5  
ATOM 7677  C CA   . SER A 1 2   ? -33.510 25.989  3.539   1.00 0.00 ? 2   SER A CA   5  
ATOM 7678  C C    . SER A 1 2   ? -32.466 25.679  4.607   1.00 0.00 ? 2   SER A C    5  
ATOM 7679  O O    . SER A 1 2   ? -31.531 26.451  4.820   1.00 0.00 ? 2   SER A O    5  
ATOM 7680  C CB   . SER A 1 2   ? -33.433 24.951  2.418   1.00 0.00 ? 2   SER A CB   5  
ATOM 7681  O OG   . SER A 1 2   ? -32.113 24.840  1.916   1.00 0.00 ? 2   SER A OG   5  
ATOM 7682  H H    . SER A 1 2   ? -32.420 27.720  2.994   1.00 0.00 ? 2   SER A H    5  
ATOM 7683  H HA   . SER A 1 2   ? -34.491 25.948  3.989   1.00 0.00 ? 2   SER A HA   5  
ATOM 7684  H HB2  . SER A 1 2   ? -33.742 23.989  2.799   1.00 0.00 ? 2   SER A HB2  5  
ATOM 7685  H HB3  . SER A 1 2   ? -34.089 25.246  1.612   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7686  H HG   . SER A 1 2   ? -32.040 24.046  1.380   1.00 0.00 ? 2   SER A HG   5  
ATOM 7687  N N    . SER A 1 3   ? -32.632 24.543  5.277   1.00 0.00 ? 3   SER A N    5  
ATOM 7688  C CA   . SER A 1 3   ? -31.707 24.131  6.326   1.00 0.00 ? 3   SER A CA   5  
ATOM 7689  C C    . SER A 1 3   ? -30.429 23.552  5.727   1.00 0.00 ? 3   SER A C    5  
ATOM 7690  O O    . SER A 1 3   ? -30.472 22.617  4.928   1.00 0.00 ? 3   SER A O    5  
ATOM 7691  C CB   . SER A 1 3   ? -32.367 23.099  7.242   1.00 0.00 ? 3   SER A CB   5  
ATOM 7692  O OG   . SER A 1 3   ? -31.526 22.775  8.335   1.00 0.00 ? 3   SER A OG   5  
ATOM 7693  H H    . SER A 1 3   ? -33.397 23.969  5.061   1.00 0.00 ? 3   SER A H    5  
ATOM 7694  H HA   . SER A 1 3   ? -31.454 25.005  6.907   1.00 0.00 ? 3   SER A HA   5  
ATOM 7695  H HB2  . SER A 1 3   ? -33.294 23.499  7.622   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7696  H HB3  . SER A 1 3   ? -32.568 22.198  6.678   1.00 0.00 ? 3   SER A HB3  5  
ATOM 7697  H HG   . SER A 1 3   ? -31.965 23.007  9.157   1.00 0.00 ? 3   SER A HG   5  
ATOM 7698  N N    . GLY A 1 4   ? -29.290 24.116  6.118   1.00 0.00 ? 4   GLY A N    5  
ATOM 7699  C CA   . GLY A 1 4   ? -28.015 23.644  5.611   1.00 0.00 ? 4   GLY A CA   5  
ATOM 7700  C C    . GLY A 1 4   ? -27.279 24.705  4.817   1.00 0.00 ? 4   GLY A C    5  
ATOM 7701  O O    . GLY A 1 4   ? -27.897 25.514  4.126   1.00 0.00 ? 4   GLY A O    5  
ATOM 7702  H H    . GLY A 1 4   ? -29.316 24.859  6.757   1.00 0.00 ? 4   GLY A H    5  
ATOM 7703  H HA2  . GLY A 1 4   ? -27.399 23.340  6.443   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7704  H HA3  . GLY A 1 4   ? -28.189 22.790  4.973   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7705  N N    . SER A 1 5   ? -25.953 24.703  4.917   1.00 0.00 ? 5   SER A N    5  
ATOM 7706  C CA   . SER A 1 5   ? -25.132 25.676  4.207   1.00 0.00 ? 5   SER A CA   5  
ATOM 7707  C C    . SER A 1 5   ? -24.877 25.228  2.771   1.00 0.00 ? 5   SER A C    5  
ATOM 7708  O O    . SER A 1 5   ? -25.102 24.069  2.422   1.00 0.00 ? 5   SER A O    5  
ATOM 7709  C CB   . SER A 1 5   ? -23.800 25.878  4.933   1.00 0.00 ? 5   SER A CB   5  
ATOM 7710  O OG   . SER A 1 5   ? -23.265 27.164  4.669   1.00 0.00 ? 5   SER A OG   5  
ATOM 7711  H H    . SER A 1 5   ? -25.518 24.032  5.484   1.00 0.00 ? 5   SER A H    5  
ATOM 7712  H HA   . SER A 1 5   ? -25.668 26.613  4.189   1.00 0.00 ? 5   SER A HA   5  
ATOM 7713  H HB2  . SER A 1 5   ? -23.955 25.777  5.997   1.00 0.00 ? 5   SER A HB2  5  
ATOM 7714  H HB3  . SER A 1 5   ? -23.094 25.132  4.599   1.00 0.00 ? 5   SER A HB3  5  
ATOM 7715  H HG   . SER A 1 5   ? -22.532 27.086  4.055   1.00 0.00 ? 5   SER A HG   5  
ATOM 7716  N N    . SER A 1 6   ? -24.406 26.155  1.943   1.00 0.00 ? 6   SER A N    5  
ATOM 7717  C CA   . SER A 1 6   ? -24.124 25.857  0.543   1.00 0.00 ? 6   SER A CA   5  
ATOM 7718  C C    . SER A 1 6   ? -22.638 25.585  0.334   1.00 0.00 ? 6   SER A C    5  
ATOM 7719  O O    . SER A 1 6   ? -21.785 26.336  0.807   1.00 0.00 ? 6   SER A O    5  
ATOM 7720  C CB   . SER A 1 6   ? -24.572 27.018  -0.347  1.00 0.00 ? 6   SER A CB   5  
ATOM 7721  O OG   . SER A 1 6   ? -25.958 26.939  -0.630  1.00 0.00 ? 6   SER A OG   5  
ATOM 7722  H H    . SER A 1 6   ? -24.247 27.061  2.281   1.00 0.00 ? 6   SER A H    5  
ATOM 7723  H HA   . SER A 1 6   ? -24.682 24.972  0.274   1.00 0.00 ? 6   SER A HA   5  
ATOM 7724  H HB2  . SER A 1 6   ? -24.372 27.952  0.156   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7725  H HB3  . SER A 1 6   ? -24.024 26.986  -1.278  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7726  H HG   . SER A 1 6   ? -26.206 27.656  -1.218  1.00 0.00 ? 6   SER A HG   5  
ATOM 7727  N N    . GLY A 1 7   ? -22.335 24.504  -0.378  1.00 0.00 ? 7   GLY A N    5  
ATOM 7728  C CA   . GLY A 1 7   ? -20.951 24.150  -0.637  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7729  C C    . GLY A 1 7   ? -20.798 23.264  -1.858  1.00 0.00 ? 7   GLY A C    5  
ATOM 7730  O O    . GLY A 1 7   ? -20.782 23.750  -2.988  1.00 0.00 ? 7   GLY A O    5  
ATOM 7731  H H    . GLY A 1 7   ? -23.056 23.942  -0.730  1.00 0.00 ? 7   GLY A H    5  
ATOM 7732  H HA2  . GLY A 1 7   ? -20.382 25.055  -0.788  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7733  H HA3  . GLY A 1 7   ? -20.558 23.629  0.223   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7734  N N    . GLY A 1 8   ? -20.685 21.959  -1.630  1.00 0.00 ? 8   GLY A N    5  
ATOM 7735  C CA   . GLY A 1 8   ? -20.532 21.025  -2.729  1.00 0.00 ? 8   GLY A CA   5  
ATOM 7736  C C    . GLY A 1 8   ? -20.240 19.615  -2.256  1.00 0.00 ? 8   GLY A C    5  
ATOM 7737  O O    . GLY A 1 8   ? -19.632 19.418  -1.203  1.00 0.00 ? 8   GLY A O    5  
ATOM 7738  H H    . GLY A 1 8   ? -20.705 21.629  -0.707  1.00 0.00 ? 8   GLY A H    5  
ATOM 7739  H HA2  . GLY A 1 8   ? -21.442 21.017  -3.310  1.00 0.00 ? 8   GLY A HA2  5  
ATOM 7740  H HA3  . GLY A 1 8   ? -19.718 21.356  -3.358  1.00 0.00 ? 8   GLY A HA3  5  
ATOM 7741  N N    . LYS A 1 9   ? -20.676 18.629  -3.033  1.00 0.00 ? 9   LYS A N    5  
ATOM 7742  C CA   . LYS A 1 9   ? -20.460 17.229  -2.688  1.00 0.00 ? 9   LYS A CA   5  
ATOM 7743  C C    . LYS A 1 9   ? -18.975 16.883  -2.725  1.00 0.00 ? 9   LYS A C    5  
ATOM 7744  O O    . LYS A 1 9   ? -18.151 17.686  -3.164  1.00 0.00 ? 9   LYS A O    5  
ATOM 7745  C CB   . LYS A 1 9   ? -21.230 16.321  -3.648  1.00 0.00 ? 9   LYS A CB   5  
ATOM 7746  C CG   . LYS A 1 9   ? -20.822 16.487  -5.102  1.00 0.00 ? 9   LYS A CG   5  
ATOM 7747  C CD   . LYS A 1 9   ? -21.463 15.430  -5.986  1.00 0.00 ? 9   LYS A CD   5  
ATOM 7748  C CE   . LYS A 1 9   ? -22.834 15.871  -6.476  1.00 0.00 ? 9   LYS A CE   5  
ATOM 7749  N NZ   . LYS A 1 9   ? -23.788 16.069  -5.350  1.00 0.00 ? 9   LYS A NZ   5  
ATOM 7750  H H    . LYS A 1 9   ? -21.155 18.849  -3.860  1.00 0.00 ? 9   LYS A H    5  
ATOM 7751  H HA   . LYS A 1 9   ? -20.828 17.074  -1.685  1.00 0.00 ? 9   LYS A HA   5  
ATOM 7752  H HB2  . LYS A 1 9   ? -21.063 15.292  -3.364  1.00 0.00 ? 9   LYS A HB2  5  
ATOM 7753  H HB3  . LYS A 1 9   ? -22.285 16.541  -3.565  1.00 0.00 ? 9   LYS A HB3  5  
ATOM 7754  H HG2  . LYS A 1 9   ? -21.131 17.463  -5.444  1.00 0.00 ? 9   LYS A HG2  5  
ATOM 7755  H HG3  . LYS A 1 9   ? -19.747 16.401  -5.176  1.00 0.00 ? 9   LYS A HG3  5  
ATOM 7756  H HD2  . LYS A 1 9   ? -20.828 15.254  -6.841  1.00 0.00 ? 9   LYS A HD2  5  
ATOM 7757  H HD3  . LYS A 1 9   ? -21.570 14.516  -5.419  1.00 0.00 ? 9   LYS A HD3  5  
ATOM 7758  H HE2  . LYS A 1 9   ? -22.728 16.801  -7.014  1.00 0.00 ? 9   LYS A HE2  5  
ATOM 7759  H HE3  . LYS A 1 9   ? -23.225 15.114  -7.139  1.00 0.00 ? 9   LYS A HE3  5  
ATOM 7760  H HZ1  . LYS A 1 9   ? -23.660 15.323  -4.637  1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 7761  H HZ2  . LYS A 1 9   ? -24.767 16.035  -5.701  1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 7762  H HZ3  . LYS A 1 9   ? -23.626 16.993  -4.902  1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 7763  N N    . ARG A 1 10  ? -18.640 15.683  -2.263  1.00 0.00 ? 10  ARG A N    5  
ATOM 7764  C CA   . ARG A 1 10  ? -17.254 15.231  -2.244  1.00 0.00 ? 10  ARG A CA   5  
ATOM 7765  C C    . ARG A 1 10  ? -16.495 15.753  -3.461  1.00 0.00 ? 10  ARG A C    5  
ATOM 7766  O O    . ARG A 1 10  ? -17.061 15.891  -4.545  1.00 0.00 ? 10  ARG A O    5  
ATOM 7767  C CB   . ARG A 1 10  ? -17.193 13.703  -2.209  1.00 0.00 ? 10  ARG A CB   5  
ATOM 7768  C CG   . ARG A 1 10  ? -17.657 13.105  -0.891  1.00 0.00 ? 10  ARG A CG   5  
ATOM 7769  C CD   . ARG A 1 10  ? -17.833 11.598  -0.994  1.00 0.00 ? 10  ARG A CD   5  
ATOM 7770  N NE   . ARG A 1 10  ? -17.954 10.970  0.319   1.00 0.00 ? 10  ARG A NE   5  
ATOM 7771  C CZ   . ARG A 1 10  ? -17.986 9.655   0.505   1.00 0.00 ? 10  ARG A CZ   5  
ATOM 7772  N NH1  . ARG A 1 10  ? -17.907 8.834   -0.533  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 7773  N NH2  . ARG A 1 10  ? -18.097 9.159   1.731   1.00 0.00 ? 10  ARG A NH2  5  
ATOM 7774  H H    . ARG A 1 10  ? -19.341 15.087  -1.926  1.00 0.00 ? 10  ARG A H    5  
ATOM 7775  H HA   . ARG A 1 10  ? -16.789 15.621  -1.350  1.00 0.00 ? 10  ARG A HA   5  
ATOM 7776  H HB2  . ARG A 1 10  ? -17.820 13.311  -2.996  1.00 0.00 ? 10  ARG A HB2  5  
ATOM 7777  H HB3  . ARG A 1 10  ? -16.174 13.391  -2.383  1.00 0.00 ? 10  ARG A HB3  5  
ATOM 7778  H HG2  . ARG A 1 10  ? -16.920 13.319  -0.130  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 7779  H HG3  . ARG A 1 10  ? -18.600 13.552  -0.616  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 7780  H HD2  . ARG A 1 10  ? -18.726 11.392  -1.564  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 7781  H HD3  . ARG A 1 10  ? -16.977 11.183  -1.504  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 7782  H HE   . ARG A 1 10  ? -18.014 11.559  1.100   1.00 0.00 ? 10  ARG A HE   5  
ATOM 7783  H HH11 . ARG A 1 10  ? -17.822 9.205   -1.458  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 7784  H HH12 . ARG A 1 10  ? -17.930 7.844   -0.390  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 7785  H HH21 . ARG A 1 10  ? -18.157 9.775   2.515   1.00 0.00 ? 10  ARG A HH21 5  
ATOM 7786  H HH22 . ARG A 1 10  ? -18.122 8.170   1.869   1.00 0.00 ? 10  ARG A HH22 5  
ATOM 7787  N N    . SER A 1 11  ? -15.211 16.042  -3.272  1.00 0.00 ? 11  SER A N    5  
ATOM 7788  C CA   . SER A 1 11  ? -14.376 16.553  -4.353  1.00 0.00 ? 11  SER A CA   5  
ATOM 7789  C C    . SER A 1 11  ? -13.835 15.411  -5.208  1.00 0.00 ? 11  SER A C    5  
ATOM 7790  O O    . SER A 1 11  ? -14.067 15.361  -6.416  1.00 0.00 ? 11  SER A O    5  
ATOM 7791  C CB   . SER A 1 11  ? -13.216 17.373  -3.785  1.00 0.00 ? 11  SER A CB   5  
ATOM 7792  O OG   . SER A 1 11  ? -12.257 17.661  -4.787  1.00 0.00 ? 11  SER A OG   5  
ATOM 7793  H H    . SER A 1 11  ? -14.817 15.910  -2.384  1.00 0.00 ? 11  SER A H    5  
ATOM 7794  H HA   . SER A 1 11  ? -14.988 17.191  -4.971  1.00 0.00 ? 11  SER A HA   5  
ATOM 7795  H HB2  . SER A 1 11  ? -13.596 18.302  -3.389  1.00 0.00 ? 11  SER A HB2  5  
ATOM 7796  H HB3  . SER A 1 11  ? -12.736 16.813  -2.994  1.00 0.00 ? 11  SER A HB3  5  
ATOM 7797  H HG   . SER A 1 11  ? -11.381 17.689  -4.395  1.00 0.00 ? 11  SER A HG   5  
ATOM 7798  N N    . HIS A 1 12  ? -13.113 14.494  -4.572  1.00 0.00 ? 12  HIS A N    5  
ATOM 7799  C CA   . HIS A 1 12  ? -12.539 13.351  -5.273  1.00 0.00 ? 12  HIS A CA   5  
ATOM 7800  C C    . HIS A 1 12  ? -12.609 12.094  -4.411  1.00 0.00 ? 12  HIS A C    5  
ATOM 7801  O O    . HIS A 1 12  ? -12.233 12.111  -3.240  1.00 0.00 ? 12  HIS A O    5  
ATOM 7802  C CB   . HIS A 1 12  ? -11.088 13.639  -5.659  1.00 0.00 ? 12  HIS A CB   5  
ATOM 7803  C CG   . HIS A 1 12  ? -10.176 13.802  -4.482  1.00 0.00 ? 12  HIS A CG   5  
ATOM 7804  N ND1  . HIS A 1 12  ? -9.105  12.968  -4.237  1.00 0.00 ? 12  HIS A ND1  5  
ATOM 7805  C CD2  . HIS A 1 12  ? -10.179 14.711  -3.479  1.00 0.00 ? 12  HIS A CD2  5  
ATOM 7806  C CE1  . HIS A 1 12  ? -8.490  13.356  -3.134  1.00 0.00 ? 12  HIS A CE1  5  
ATOM 7807  N NE2  . HIS A 1 12  ? -9.122  14.412  -2.655  1.00 0.00 ? 12  HIS A NE2  5  
ATOM 7808  H H    . HIS A 1 12  ? -12.962 14.588  -3.608  1.00 0.00 ? 12  HIS A H    5  
ATOM 7809  H HA   . HIS A 1 12  ? -13.115 13.189  -6.171  1.00 0.00 ? 12  HIS A HA   5  
ATOM 7810  H HB2  . HIS A 1 12  ? -10.712 12.822  -6.257  1.00 0.00 ? 12  HIS A HB2  5  
ATOM 7811  H HB3  . HIS A 1 12  ? -11.049 14.550  -6.238  1.00 0.00 ? 12  HIS A HB3  5  
ATOM 7812  H HD1  . HIS A 1 12  ? -8.838  12.204  -4.789  1.00 0.00 ? 12  HIS A HD1  5  
ATOM 7813  H HD2  . HIS A 1 12  ? -10.883 15.522  -3.349  1.00 0.00 ? 12  HIS A HD2  5  
ATOM 7814  H HE1  . HIS A 1 12  ? -7.619  12.890  -2.699  1.00 0.00 ? 12  HIS A HE1  5  
ATOM 7815  H HE2  . HIS A 1 12  ? -8.925  14.847  -1.799  1.00 0.00 ? 12  HIS A HE2  5  
ATOM 7816  N N    . SER A 1 13  ? -13.094 11.005  -5.000  1.00 0.00 ? 13  SER A N    5  
ATOM 7817  C CA   . SER A 1 13  ? -13.218 9.740   -4.285  1.00 0.00 ? 13  SER A CA   5  
ATOM 7818  C C    . SER A 1 13  ? -12.919 8.563   -5.208  1.00 0.00 ? 13  SER A C    5  
ATOM 7819  O O    . SER A 1 13  ? -13.705 8.244   -6.100  1.00 0.00 ? 13  SER A O    5  
ATOM 7820  C CB   . SER A 1 13  ? -14.623 9.598   -3.697  1.00 0.00 ? 13  SER A CB   5  
ATOM 7821  O OG   . SER A 1 13  ? -14.719 8.445   -2.879  1.00 0.00 ? 13  SER A OG   5  
ATOM 7822  H H    . SER A 1 13  ? -13.377 11.055  -5.937  1.00 0.00 ? 13  SER A H    5  
ATOM 7823  H HA   . SER A 1 13  ? -12.498 9.743   -3.480  1.00 0.00 ? 13  SER A HA   5  
ATOM 7824  H HB2  . SER A 1 13  ? -14.850 10.468  -3.101  1.00 0.00 ? 13  SER A HB2  5  
ATOM 7825  H HB3  . SER A 1 13  ? -15.340 9.515   -4.501  1.00 0.00 ? 13  SER A HB3  5  
ATOM 7826  H HG   . SER A 1 13  ? -15.211 8.658   -2.082  1.00 0.00 ? 13  SER A HG   5  
ATOM 7827  N N    . MET A 1 14  ? -11.776 7.921   -4.987  1.00 0.00 ? 14  MET A N    5  
ATOM 7828  C CA   . MET A 1 14  ? -11.373 6.778   -5.797  1.00 0.00 ? 14  MET A CA   5  
ATOM 7829  C C    . MET A 1 14  ? -12.034 5.497   -5.298  1.00 0.00 ? 14  MET A C    5  
ATOM 7830  O O    . MET A 1 14  ? -12.634 5.474   -4.223  1.00 0.00 ? 14  MET A O    5  
ATOM 7831  C CB   . MET A 1 14  ? -9.851  6.622   -5.776  1.00 0.00 ? 14  MET A CB   5  
ATOM 7832  C CG   . MET A 1 14  ? -9.118  7.709   -6.546  1.00 0.00 ? 14  MET A CG   5  
ATOM 7833  S SD   . MET A 1 14  ? -9.252  7.507   -8.332  1.00 0.00 ? 14  MET A SD   5  
ATOM 7834  C CE   . MET A 1 14  ? -7.923  6.347   -8.642  1.00 0.00 ? 14  MET A CE   5  
ATOM 7835  H H    . MET A 1 14  ? -11.190 8.222   -4.261  1.00 0.00 ? 14  MET A H    5  
ATOM 7836  H HA   . MET A 1 14  ? -11.693 6.962   -6.812  1.00 0.00 ? 14  MET A HA   5  
ATOM 7837  H HB2  . MET A 1 14  ? -9.513  6.646   -4.751  1.00 0.00 ? 14  MET A HB2  5  
ATOM 7838  H HB3  . MET A 1 14  ? -9.592  5.668   -6.210  1.00 0.00 ? 14  MET A HB3  5  
ATOM 7839  H HG2  . MET A 1 14  ? -9.535  8.668   -6.274  1.00 0.00 ? 14  MET A HG2  5  
ATOM 7840  H HG3  . MET A 1 14  ? -8.074  7.683   -6.271  1.00 0.00 ? 14  MET A HG3  5  
ATOM 7841  H HE1  . MET A 1 14  ? -7.207  6.794   -9.318  1.00 0.00 ? 14  MET A HE1  5  
ATOM 7842  H HE2  . MET A 1 14  ? -7.435  6.102   -7.711  1.00 0.00 ? 14  MET A HE2  5  
ATOM 7843  H HE3  . MET A 1 14  ? -8.325  5.449   -9.086  1.00 0.00 ? 14  MET A HE3  5  
ATOM 7844  N N    . LYS A 1 15  ? -11.919 4.432   -6.084  1.00 0.00 ? 15  LYS A N    5  
ATOM 7845  C CA   . LYS A 1 15  ? -12.505 3.147   -5.722  1.00 0.00 ? 15  LYS A CA   5  
ATOM 7846  C C    . LYS A 1 15  ? -12.100 2.065   -6.718  1.00 0.00 ? 15  LYS A C    5  
ATOM 7847  O O    . LYS A 1 15  ? -11.695 2.363   -7.842  1.00 0.00 ? 15  LYS A O    5  
ATOM 7848  C CB   . LYS A 1 15  ? -14.030 3.256   -5.663  1.00 0.00 ? 15  LYS A CB   5  
ATOM 7849  C CG   . LYS A 1 15  ? -14.681 2.204   -4.782  1.00 0.00 ? 15  LYS A CG   5  
ATOM 7850  C CD   . LYS A 1 15  ? -16.188 2.388   -4.715  1.00 0.00 ? 15  LYS A CD   5  
ATOM 7851  C CE   . LYS A 1 15  ? -16.583 3.351   -3.606  1.00 0.00 ? 15  LYS A CE   5  
ATOM 7852  N NZ   . LYS A 1 15  ? -17.931 3.039   -3.054  1.00 0.00 ? 15  LYS A NZ   5  
ATOM 7853  H H    . LYS A 1 15  ? -11.428 4.513   -6.929  1.00 0.00 ? 15  LYS A H    5  
ATOM 7854  H HA   . LYS A 1 15  ? -12.133 2.876   -4.745  1.00 0.00 ? 15  LYS A HA   5  
ATOM 7855  H HB2  . LYS A 1 15  ? -14.294 4.230   -5.279  1.00 0.00 ? 15  LYS A HB2  5  
ATOM 7856  H HB3  . LYS A 1 15  ? -14.425 3.153   -6.663  1.00 0.00 ? 15  LYS A HB3  5  
ATOM 7857  H HG2  . LYS A 1 15  ? -14.467 1.226   -5.186  1.00 0.00 ? 15  LYS A HG2  5  
ATOM 7858  H HG3  . LYS A 1 15  ? -14.273 2.281   -3.784  1.00 0.00 ? 15  LYS A HG3  5  
ATOM 7859  H HD2  . LYS A 1 15  ? -16.537 2.781   -5.658  1.00 0.00 ? 15  LYS A HD2  5  
ATOM 7860  H HD3  . LYS A 1 15  ? -16.651 1.429   -4.528  1.00 0.00 ? 15  LYS A HD3  5  
ATOM 7861  H HE2  . LYS A 1 15  ? -15.854 3.285   -2.813  1.00 0.00 ? 15  LYS A HE2  5  
ATOM 7862  H HE3  . LYS A 1 15  ? -16.590 4.355   -4.005  1.00 0.00 ? 15  LYS A HE3  5  
ATOM 7863  H HZ1  . LYS A 1 15  ? -18.138 2.027   -3.168  1.00 0.00 ? 15  LYS A HZ1  5  
ATOM 7864  H HZ2  . LYS A 1 15  ? -18.657 3.590   -3.554  1.00 0.00 ? 15  LYS A HZ2  5  
ATOM 7865  H HZ3  . LYS A 1 15  ? -17.966 3.278   -2.043  1.00 0.00 ? 15  LYS A HZ3  5  
ATOM 7866  N N    . ARG A 1 16  ? -12.215 0.809   -6.300  1.00 0.00 ? 16  ARG A N    5  
ATOM 7867  C CA   . ARG A 1 16  ? -11.862 -0.317  -7.156  1.00 0.00 ? 16  ARG A CA   5  
ATOM 7868  C C    . ARG A 1 16  ? -13.064 -0.775  -7.977  1.00 0.00 ? 16  ARG A C    5  
ATOM 7869  O O    . ARG A 1 16  ? -14.189 -0.811  -7.480  1.00 0.00 ? 16  ARG A O    5  
ATOM 7870  C CB   . ARG A 1 16  ? -11.333 -1.480  -6.314  1.00 0.00 ? 16  ARG A CB   5  
ATOM 7871  C CG   . ARG A 1 16  ? -11.184 -2.777  -7.092  1.00 0.00 ? 16  ARG A CG   5  
ATOM 7872  C CD   . ARG A 1 16  ? -10.228 -3.735  -6.400  1.00 0.00 ? 16  ARG A CD   5  
ATOM 7873  N NE   . ARG A 1 16  ? -10.280 -5.075  -6.979  1.00 0.00 ? 16  ARG A NE   5  
ATOM 7874  C CZ   . ARG A 1 16  ? -11.304 -5.906  -6.816  1.00 0.00 ? 16  ARG A CZ   5  
ATOM 7875  N NH1  . ARG A 1 16  ? -12.354 -5.537  -6.096  1.00 0.00 ? 16  ARG A NH1  5  
ATOM 7876  N NH2  . ARG A 1 16  ? -11.278 -7.109  -7.375  1.00 0.00 ? 16  ARG A NH2  5  
ATOM 7877  H H    . ARG A 1 16  ? -12.544 0.634   -5.394  1.00 0.00 ? 16  ARG A H    5  
ATOM 7878  H HA   . ARG A 1 16  ? -11.085 0.010   -7.831  1.00 0.00 ? 16  ARG A HA   5  
ATOM 7879  H HB2  . ARG A 1 16  ? -10.365 -1.211  -5.917  1.00 0.00 ? 16  ARG A HB2  5  
ATOM 7880  H HB3  . ARG A 1 16  ? -12.014 -1.653  -5.494  1.00 0.00 ? 16  ARG A HB3  5  
ATOM 7881  H HG2  . ARG A 1 16  ? -12.152 -3.250  -7.175  1.00 0.00 ? 16  ARG A HG2  5  
ATOM 7882  H HG3  . ARG A 1 16  ? -10.805 -2.553  -8.078  1.00 0.00 ? 16  ARG A HG3  5  
ATOM 7883  H HD2  . ARG A 1 16  ? -9.223  -3.352  -6.496  1.00 0.00 ? 16  ARG A HD2  5  
ATOM 7884  H HD3  . ARG A 1 16  ? -10.492 -3.794  -5.355  1.00 0.00 ? 16  ARG A HD3  5  
ATOM 7885  H HE   . ARG A 1 16  ? -9.515  -5.368  -7.515  1.00 0.00 ? 16  ARG A HE   5  
ATOM 7886  H HH11 . ARG A 1 16  ? -12.377 -4.630  -5.675  1.00 0.00 ? 16  ARG A HH11 5  
ATOM 7887  H HH12 . ARG A 1 16  ? -13.124 -6.164  -5.976  1.00 0.00 ? 16  ARG A HH12 5  
ATOM 7888  H HH21 . ARG A 1 16  ? -10.488 -7.391  -7.918  1.00 0.00 ? 16  ARG A HH21 5  
ATOM 7889  H HH22 . ARG A 1 16  ? -12.049 -7.734  -7.251  1.00 0.00 ? 16  ARG A HH22 5  
ATOM 7890  N N    . ASN A 1 17  ? -12.818 -1.123  -9.235  1.00 0.00 ? 17  ASN A N    5  
ATOM 7891  C CA   . ASN A 1 17  ? -13.880 -1.577  -10.125 1.00 0.00 ? 17  ASN A CA   5  
ATOM 7892  C C    . ASN A 1 17  ? -14.230 -3.037  -9.854  1.00 0.00 ? 17  ASN A C    5  
ATOM 7893  O O    . ASN A 1 17  ? -13.395 -3.831  -9.418  1.00 0.00 ? 17  ASN A O    5  
ATOM 7894  C CB   . ASN A 1 17  ? -13.460 -1.405  -11.586 1.00 0.00 ? 17  ASN A CB   5  
ATOM 7895  C CG   . ASN A 1 17  ? -13.545 0.038   -12.045 1.00 0.00 ? 17  ASN A CG   5  
ATOM 7896  O OD1  . ASN A 1 17  ? -14.145 0.880   -11.377 1.00 0.00 ? 17  ASN A OD1  5  
ATOM 7897  N ND2  . ASN A 1 17  ? -12.943 0.330   -13.192 1.00 0.00 ? 17  ASN A ND2  5  
ATOM 7898  H H    . ASN A 1 17  ? -11.900 -1.073  -9.574  1.00 0.00 ? 17  ASN A H    5  
ATOM 7899  H HA   . ASN A 1 17  ? -14.753 -0.970  -9.937  1.00 0.00 ? 17  ASN A HA   5  
ATOM 7900  H HB2  . ASN A 1 17  ? -12.439 -1.739  -11.702 1.00 0.00 ? 17  ASN A HB2  5  
ATOM 7901  H HB3  . ASN A 1 17  ? -14.104 -2.002  -12.213 1.00 0.00 ? 17  ASN A HB3  5  
ATOM 7902  H HD21 . ASN A 1 17  ? -12.484 -0.392  -13.671 1.00 0.00 ? 17  ASN A HD21 5  
ATOM 7903  H HD22 . ASN A 1 17  ? -12.981 1.255   -13.513 1.00 0.00 ? 17  ASN A HD22 5  
ATOM 7904  N N    . PRO A 1 18  ? -15.493 -3.402  -10.118 1.00 0.00 ? 18  PRO A N    5  
ATOM 7905  C CA   . PRO A 1 18  ? -15.982 -4.769  -9.911  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7906  C C    . PRO A 1 18  ? -15.385 -5.755  -10.909 1.00 0.00 ? 18  PRO A C    5  
ATOM 7907  O O    . PRO A 1 18  ? -15.051 -6.885  -10.555 1.00 0.00 ? 18  PRO A O    5  
ATOM 7908  C CB   . PRO A 1 18  ? -17.493 -4.641  -10.124 1.00 0.00 ? 18  PRO A CB   5  
ATOM 7909  C CG   . PRO A 1 18  ? -17.651 -3.454  -11.009 1.00 0.00 ? 18  PRO A CG   5  
ATOM 7910  C CD   . PRO A 1 18  ? -16.542 -2.509  -10.639 1.00 0.00 ? 18  PRO A CD   5  
ATOM 7911  H HA   . PRO A 1 18  ? -15.786 -5.112  -8.906  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7912  H HB2  . PRO A 1 18  ? -17.870 -5.539  -10.593 1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7913  H HB3  . PRO A 1 18  ? -17.982 -4.493  -9.173  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7914  H HG2  . PRO A 1 18  ? -17.561 -3.752  -12.043 1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7915  H HG3  . PRO A 1 18  ? -18.611 -2.991  -10.833 1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7916  H HD2  . PRO A 1 18  ? -16.195 -1.974  -11.510 1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7917  H HD3  . PRO A 1 18  ? -16.873 -1.819  -9.877  1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7918  N N    . ASN A 1 19  ? -15.254 -5.320  -12.158 1.00 0.00 ? 19  ASN A N    5  
ATOM 7919  C CA   . ASN A 1 19  ? -14.697 -6.166  -13.207 1.00 0.00 ? 19  ASN A CA   5  
ATOM 7920  C C    . ASN A 1 19  ? -13.216 -5.865  -13.420 1.00 0.00 ? 19  ASN A C    5  
ATOM 7921  O O    . ASN A 1 19  ? -12.739 -5.815  -14.553 1.00 0.00 ? 19  ASN A O    5  
ATOM 7922  C CB   . ASN A 1 19  ? -15.463 -5.962  -14.516 1.00 0.00 ? 19  ASN A CB   5  
ATOM 7923  C CG   . ASN A 1 19  ? -16.723 -6.804  -14.586 1.00 0.00 ? 19  ASN A CG   5  
ATOM 7924  O OD1  . ASN A 1 19  ? -16.659 -8.031  -14.651 1.00 0.00 ? 19  ASN A OD1  5  
ATOM 7925  N ND2  . ASN A 1 19  ? -17.876 -6.145  -14.572 1.00 0.00 ? 19  ASN A ND2  5  
ATOM 7926  H H    . ASN A 1 19  ? -15.539 -4.409  -12.379 1.00 0.00 ? 19  ASN A H    5  
ATOM 7927  H HA   . ASN A 1 19  ? -14.802 -7.194  -12.895 1.00 0.00 ? 19  ASN A HA   5  
ATOM 7928  H HB2  . ASN A 1 19  ? -15.744 -4.922  -14.603 1.00 0.00 ? 19  ASN A HB2  5  
ATOM 7929  H HB3  . ASN A 1 19  ? -14.826 -6.230  -15.345 1.00 0.00 ? 19  ASN A HB3  5  
ATOM 7930  H HD21 . ASN A 1 19  ? -17.850 -5.167  -14.519 1.00 0.00 ? 19  ASN A HD21 5  
ATOM 7931  H HD22 . ASN A 1 19  ? -18.706 -6.665  -14.615 1.00 0.00 ? 19  ASN A HD22 5  
ATOM 7932  N N    . ALA A 1 20  ? -12.495 -5.666  -12.322 1.00 0.00 ? 20  ALA A N    5  
ATOM 7933  C CA   . ALA A 1 20  ? -11.069 -5.372  -12.387 1.00 0.00 ? 20  ALA A CA   5  
ATOM 7934  C C    . ALA A 1 20  ? -10.242 -6.552  -11.887 1.00 0.00 ? 20  ALA A C    5  
ATOM 7935  O O    . ALA A 1 20  ? -10.403 -7.020  -10.760 1.00 0.00 ? 20  ALA A O    5  
ATOM 7936  C CB   . ALA A 1 20  ? -10.749 -4.122  -11.581 1.00 0.00 ? 20  ALA A CB   5  
ATOM 7937  H H    . ALA A 1 20  ? -12.932 -5.719  -11.447 1.00 0.00 ? 20  ALA A H    5  
ATOM 7938  H HA   . ALA A 1 20  ? -10.815 -5.180  -13.420 1.00 0.00 ? 20  ALA A HA   5  
ATOM 7939  H HB1  . ALA A 1 20  ? -10.034 -3.519  -12.121 1.00 0.00 ? 20  ALA A HB1  5  
ATOM 7940  H HB2  . ALA A 1 20  ? -11.655 -3.554  -11.426 1.00 0.00 ? 20  ALA A HB2  5  
ATOM 7941  H HB3  . ALA A 1 20  ? -10.334 -4.406  -10.626 1.00 0.00 ? 20  ALA A HB3  5  
ATOM 7942  N N    . PRO A 1 21  ? -9.336  -7.047  -12.744 1.00 0.00 ? 21  PRO A N    5  
ATOM 7943  C CA   . PRO A 1 21  ? -8.467  -8.179  -12.410 1.00 0.00 ? 21  PRO A CA   5  
ATOM 7944  C C    . PRO A 1 21  ? -7.421  -7.817  -11.361 1.00 0.00 ? 21  PRO A C    5  
ATOM 7945  O O    . PRO A 1 21  ? -6.736  -6.801  -11.477 1.00 0.00 ? 21  PRO A O    5  
ATOM 7946  C CB   . PRO A 1 21  ? -7.793  -8.513  -13.743 1.00 0.00 ? 21  PRO A CB   5  
ATOM 7947  C CG   . PRO A 1 21  ? -7.825  -7.239  -14.514 1.00 0.00 ? 21  PRO A CG   5  
ATOM 7948  C CD   . PRO A 1 21  ? -9.091  -6.539  -14.104 1.00 0.00 ? 21  PRO A CD   5  
ATOM 7949  H HA   . PRO A 1 21  ? -9.037  -9.031  -12.070 1.00 0.00 ? 21  PRO A HA   5  
ATOM 7950  H HB2  . PRO A 1 21  ? -6.779  -8.842  -13.564 1.00 0.00 ? 21  PRO A HB2  5  
ATOM 7951  H HB3  . PRO A 1 21  ? -8.347  -9.292  -14.245 1.00 0.00 ? 21  PRO A HB3  5  
ATOM 7952  H HG2  . PRO A 1 21  ? -6.965  -6.637  -14.264 1.00 0.00 ? 21  PRO A HG2  5  
ATOM 7953  H HG3  . PRO A 1 21  ? -7.841  -7.452  -15.573 1.00 0.00 ? 21  PRO A HG3  5  
ATOM 7954  H HD2  . PRO A 1 21  ? -8.944  -5.469  -14.095 1.00 0.00 ? 21  PRO A HD2  5  
ATOM 7955  H HD3  . PRO A 1 21  ? -9.901  -6.805  -14.766 1.00 0.00 ? 21  PRO A HD3  5  
ATOM 7956  N N    . VAL A 1 22  ? -7.303  -8.656  -10.336 1.00 0.00 ? 22  VAL A N    5  
ATOM 7957  C CA   . VAL A 1 22  ? -6.340  -8.425  -9.267  1.00 0.00 ? 22  VAL A CA   5  
ATOM 7958  C C    . VAL A 1 22  ? -4.910  -8.576  -9.773  1.00 0.00 ? 22  VAL A C    5  
ATOM 7959  O O    . VAL A 1 22  ? -4.489  -9.665  -10.165 1.00 0.00 ? 22  VAL A O    5  
ATOM 7960  C CB   . VAL A 1 22  ? -6.561  -9.397  -8.092  1.00 0.00 ? 22  VAL A CB   5  
ATOM 7961  C CG1  . VAL A 1 22  ? -6.500  -10.838 -8.573  1.00 0.00 ? 22  VAL A CG1  5  
ATOM 7962  C CG2  . VAL A 1 22  ? -5.538  -9.148  -6.995  1.00 0.00 ? 22  VAL A CG2  5  
ATOM 7963  H H    . VAL A 1 22  ? -7.877  -9.449  -10.299 1.00 0.00 ? 22  VAL A H    5  
ATOM 7964  H HA   . VAL A 1 22  ? -6.478  -7.417  -8.904  1.00 0.00 ? 22  VAL A HA   5  
ATOM 7965  H HB   . VAL A 1 22  ? -7.546  -9.218  -7.685  1.00 0.00 ? 22  VAL A HB   5  
ATOM 7966  H HG11 . VAL A 1 22  ? -6.879  -10.897 -9.583  1.00 0.00 ? 22  VAL A HG11 5  
ATOM 7967  H HG12 . VAL A 1 22  ? -5.476  -11.183 -8.550  1.00 0.00 ? 22  VAL A HG12 5  
ATOM 7968  H HG13 . VAL A 1 22  ? -7.103  -11.459 -7.926  1.00 0.00 ? 22  VAL A HG13 5  
ATOM 7969  H HG21 . VAL A 1 22  ? -4.562  -9.459  -7.335  1.00 0.00 ? 22  VAL A HG21 5  
ATOM 7970  H HG22 . VAL A 1 22  ? -5.517  -8.095  -6.755  1.00 0.00 ? 22  VAL A HG22 5  
ATOM 7971  H HG23 . VAL A 1 22  ? -5.809  -9.712  -6.114  1.00 0.00 ? 22  VAL A HG23 5  
ATOM 7972  N N    . THR A 1 23  ? -4.165  -7.475  -9.763  1.00 0.00 ? 23  THR A N    5  
ATOM 7973  C CA   . THR A 1 23  ? -2.781  -7.483  -10.221 1.00 0.00 ? 23  THR A CA   5  
ATOM 7974  C C    . THR A 1 23  ? -1.912  -8.362  -9.330  1.00 0.00 ? 23  THR A C    5  
ATOM 7975  O O    . THR A 1 23  ? -1.258  -9.292  -9.804  1.00 0.00 ? 23  THR A O    5  
ATOM 7976  C CB   . THR A 1 23  ? -2.191  -6.061  -10.253 1.00 0.00 ? 23  THR A CB   5  
ATOM 7977  O OG1  . THR A 1 23  ? -3.084  -5.175  -10.938 1.00 0.00 ? 23  THR A OG1  5  
ATOM 7978  C CG2  . THR A 1 23  ? -0.834  -6.053  -10.941 1.00 0.00 ? 23  THR A CG2  5  
ATOM 7979  H H    . THR A 1 23  ? -4.556  -6.637  -9.439  1.00 0.00 ? 23  THR A H    5  
ATOM 7980  H HA   . THR A 1 23  ? -2.766  -7.880  -11.226 1.00 0.00 ? 23  THR A HA   5  
ATOM 7981  H HB   . THR A 1 23  ? -2.065  -5.717  -9.237  1.00 0.00 ? 23  THR A HB   5  
ATOM 7982  H HG1  . THR A 1 23  ? -3.910  -5.115  -10.452 1.00 0.00 ? 23  THR A HG1  5  
ATOM 7983  H HG21 . THR A 1 23  ? -0.931  -6.472  -11.931 1.00 0.00 ? 23  THR A HG21 5  
ATOM 7984  H HG22 . THR A 1 23  ? -0.136  -6.644  -10.367 1.00 0.00 ? 23  THR A HG22 5  
ATOM 7985  H HG23 . THR A 1 23  ? -0.473  -5.038  -11.013 1.00 0.00 ? 23  THR A HG23 5  
ATOM 7986  N N    . LYS A 1 24  ? -1.908  -8.063  -8.035  1.00 0.00 ? 24  LYS A N    5  
ATOM 7987  C CA   . LYS A 1 24  ? -1.120  -8.827  -7.075  1.00 0.00 ? 24  LYS A CA   5  
ATOM 7988  C C    . LYS A 1 24  ? -1.715  -8.719  -5.675  1.00 0.00 ? 24  LYS A C    5  
ATOM 7989  O O    . LYS A 1 24  ? -2.037  -7.627  -5.209  1.00 0.00 ? 24  LYS A O    5  
ATOM 7990  C CB   . LYS A 1 24  ? 0.328   -8.332  -7.064  1.00 0.00 ? 24  LYS A CB   5  
ATOM 7991  C CG   . LYS A 1 24  ? 1.298   -9.303  -6.413  1.00 0.00 ? 24  LYS A CG   5  
ATOM 7992  C CD   . LYS A 1 24  ? 2.613   -8.628  -6.065  1.00 0.00 ? 24  LYS A CD   5  
ATOM 7993  C CE   . LYS A 1 24  ? 3.505   -9.539  -5.236  1.00 0.00 ? 24  LYS A CE   5  
ATOM 7994  N NZ   . LYS A 1 24  ? 3.881   -10.774 -5.979  1.00 0.00 ? 24  LYS A NZ   5  
ATOM 7995  H H    . LYS A 1 24  ? -2.450  -7.310  -7.717  1.00 0.00 ? 24  LYS A H    5  
ATOM 7996  H HA   . LYS A 1 24  ? -1.136  -9.862  -7.382  1.00 0.00 ? 24  LYS A HA   5  
ATOM 7997  H HB2  . LYS A 1 24  ? 0.647   -8.167  -8.083  1.00 0.00 ? 24  LYS A HB2  5  
ATOM 7998  H HB3  . LYS A 1 24  ? 0.372   -7.397  -6.526  1.00 0.00 ? 24  LYS A HB3  5  
ATOM 7999  H HG2  . LYS A 1 24  ? 0.853   -9.689  -5.508  1.00 0.00 ? 24  LYS A HG2  5  
ATOM 8000  H HG3  . LYS A 1 24  ? 1.491   -10.118 -7.097  1.00 0.00 ? 24  LYS A HG3  5  
ATOM 8001  H HD2  . LYS A 1 24  ? 3.130   -8.372  -6.978  1.00 0.00 ? 24  LYS A HD2  5  
ATOM 8002  H HD3  . LYS A 1 24  ? 2.408   -7.729  -5.500  1.00 0.00 ? 24  LYS A HD3  5  
ATOM 8003  H HE2  . LYS A 1 24  ? 4.403   -9.001  -4.972  1.00 0.00 ? 24  LYS A HE2  5  
ATOM 8004  H HE3  . LYS A 1 24  ? 2.976   -9.818  -4.336  1.00 0.00 ? 24  LYS A HE3  5  
ATOM 8005  H HZ1  . LYS A 1 24  ? 3.118   -11.044 -6.632  1.00 0.00 ? 24  LYS A HZ1  5  
ATOM 8006  H HZ2  . LYS A 1 24  ? 4.046   -11.555 -5.313  1.00 0.00 ? 24  LYS A HZ2  5  
ATOM 8007  H HZ3  . LYS A 1 24  ? 4.750   -10.611 -6.526  1.00 0.00 ? 24  LYS A HZ3  5  
ATOM 8008  N N    . ALA A 1 25  ? -1.858  -9.860  -5.008  1.00 0.00 ? 25  ALA A N    5  
ATOM 8009  C CA   . ALA A 1 25  ? -2.411  -9.893  -3.660  1.00 0.00 ? 25  ALA A CA   5  
ATOM 8010  C C    . ALA A 1 25  ? -1.451  -10.573 -2.689  1.00 0.00 ? 25  ALA A C    5  
ATOM 8011  O O    . ALA A 1 25  ? -0.766  -11.530 -3.046  1.00 0.00 ? 25  ALA A O    5  
ATOM 8012  C CB   . ALA A 1 25  ? -3.756  -10.604 -3.659  1.00 0.00 ? 25  ALA A CB   5  
ATOM 8013  H H    . ALA A 1 25  ? -1.583  -10.699 -5.433  1.00 0.00 ? 25  ALA A H    5  
ATOM 8014  H HA   . ALA A 1 25  ? -2.570  -8.874  -3.339  1.00 0.00 ? 25  ALA A HA   5  
ATOM 8015  H HB1  . ALA A 1 25  ? -4.507  -9.951  -3.239  1.00 0.00 ? 25  ALA A HB1  5  
ATOM 8016  H HB2  . ALA A 1 25  ? -4.028  -10.860 -4.672  1.00 0.00 ? 25  ALA A HB2  5  
ATOM 8017  H HB3  . ALA A 1 25  ? -3.688  -11.503 -3.065  1.00 0.00 ? 25  ALA A HB3  5  
ATOM 8018  N N    . GLY A 1 26  ? -1.406  -10.070 -1.459  1.00 0.00 ? 26  GLY A N    5  
ATOM 8019  C CA   . GLY A 1 26  ? -0.525  -10.640 -0.456  1.00 0.00 ? 26  GLY A CA   5  
ATOM 8020  C C    . GLY A 1 26  ? -0.553  -9.867  0.847   1.00 0.00 ? 26  GLY A C    5  
ATOM 8021  O O    . GLY A 1 26  ? -0.609  -8.638  0.846   1.00 0.00 ? 26  GLY A O    5  
ATOM 8022  H H    . GLY A 1 26  ? -1.975  -9.305  -1.231  1.00 0.00 ? 26  GLY A H    5  
ATOM 8023  H HA2  . GLY A 1 26  ? -0.828  -11.659 -0.266  1.00 0.00 ? 26  GLY A HA2  5  
ATOM 8024  H HA3  . GLY A 1 26  ? 0.485   -10.641 -0.839  1.00 0.00 ? 26  GLY A HA3  5  
ATOM 8025  N N    . TRP A 1 27  ? -0.516  -10.589 1.961   1.00 0.00 ? 27  TRP A N    5  
ATOM 8026  C CA   . TRP A 1 27  ? -0.540  -9.962  3.278   1.00 0.00 ? 27  TRP A CA   5  
ATOM 8027  C C    . TRP A 1 27  ? 0.778   -9.252  3.567   1.00 0.00 ? 27  TRP A C    5  
ATOM 8028  O O    . TRP A 1 27  ? 1.819   -9.892  3.722   1.00 0.00 ? 27  TRP A O    5  
ATOM 8029  C CB   . TRP A 1 27  ? -0.816  -11.009 4.359   1.00 0.00 ? 27  TRP A CB   5  
ATOM 8030  C CG   . TRP A 1 27  ? -2.260  -11.401 4.451   1.00 0.00 ? 27  TRP A CG   5  
ATOM 8031  C CD1  . TRP A 1 27  ? -2.883  -12.402 3.762   1.00 0.00 ? 27  TRP A CD1  5  
ATOM 8032  C CD2  . TRP A 1 27  ? -3.261  -10.797 5.278   1.00 0.00 ? 27  TRP A CD2  5  
ATOM 8033  N NE1  . TRP A 1 27  ? -4.211  -12.457 4.110   1.00 0.00 ? 27  TRP A NE1  5  
ATOM 8034  C CE2  . TRP A 1 27  ? -4.467  -11.484 5.039   1.00 0.00 ? 27  TRP A CE2  5  
ATOM 8035  C CE3  . TRP A 1 27  ? -3.255  -9.745  6.197   1.00 0.00 ? 27  TRP A CE3  5  
ATOM 8036  C CZ2  . TRP A 1 27  ? -5.654  -11.150 5.687   1.00 0.00 ? 27  TRP A CZ2  5  
ATOM 8037  C CZ3  . TRP A 1 27  ? -4.433  -9.415  6.839   1.00 0.00 ? 27  TRP A CZ3  5  
ATOM 8038  C CH2  . TRP A 1 27  ? -5.619  -10.116 6.583   1.00 0.00 ? 27  TRP A CH2  5  
ATOM 8039  H H    . TRP A 1 27  ? -0.472  -11.566 1.898   1.00 0.00 ? 27  TRP A H    5  
ATOM 8040  H HA   . TRP A 1 27  ? -1.337  -9.233  3.284   1.00 0.00 ? 27  TRP A HA   5  
ATOM 8041  H HB2  . TRP A 1 27  ? -0.242  -11.898 4.145   1.00 0.00 ? 27  TRP A HB2  5  
ATOM 8042  H HB3  . TRP A 1 27  ? -0.516  -10.613 5.318   1.00 0.00 ? 27  TRP A HB3  5  
ATOM 8043  H HD1  . TRP A 1 27  ? -2.391  -13.046 3.049   1.00 0.00 ? 27  TRP A HD1  5  
ATOM 8044  H HE1  . TRP A 1 27  ? -4.866  -13.092 3.753   1.00 0.00 ? 27  TRP A HE1  5  
ATOM 8045  H HE3  . TRP A 1 27  ? -2.351  -9.193  6.409   1.00 0.00 ? 27  TRP A HE3  5  
ATOM 8046  H HZ2  . TRP A 1 27  ? -6.576  -11.681 5.501   1.00 0.00 ? 27  TRP A HZ2  5  
ATOM 8047  H HZ3  . TRP A 1 27  ? -4.448  -8.605  7.553   1.00 0.00 ? 27  TRP A HZ3  5  
ATOM 8048  H HH2  . TRP A 1 27  ? -6.516  -9.824  7.107   1.00 0.00 ? 27  TRP A HH2  5  
ATOM 8049  N N    . LEU A 1 28  ? 0.728   -7.926  3.637   1.00 0.00 ? 28  LEU A N    5  
ATOM 8050  C CA   . LEU A 1 28  ? 1.919   -7.129  3.907   1.00 0.00 ? 28  LEU A CA   5  
ATOM 8051  C C    . LEU A 1 28  ? 1.768   -6.347  5.208   1.00 0.00 ? 28  LEU A C    5  
ATOM 8052  O O    . LEU A 1 28  ? 0.701   -6.346  5.824   1.00 0.00 ? 28  LEU A O    5  
ATOM 8053  C CB   . LEU A 1 28  ? 2.186   -6.166  2.749   1.00 0.00 ? 28  LEU A CB   5  
ATOM 8054  C CG   . LEU A 1 28  ? 3.020   -6.721  1.594   1.00 0.00 ? 28  LEU A CG   5  
ATOM 8055  C CD1  . LEU A 1 28  ? 2.925   -5.810  0.380   1.00 0.00 ? 28  LEU A CD1  5  
ATOM 8056  C CD2  . LEU A 1 28  ? 4.471   -6.896  2.019   1.00 0.00 ? 28  LEU A CD2  5  
ATOM 8057  H H    . LEU A 1 28  ? -0.130  -7.472  3.504   1.00 0.00 ? 28  LEU A H    5  
ATOM 8058  H HA   . LEU A 1 28  ? 2.756   -7.805  4.003   1.00 0.00 ? 28  LEU A HA   5  
ATOM 8059  H HB2  . LEU A 1 28  ? 1.233   -5.857  2.349   1.00 0.00 ? 28  LEU A HB2  5  
ATOM 8060  H HB3  . LEU A 1 28  ? 2.703   -5.305  3.148   1.00 0.00 ? 28  LEU A HB3  5  
ATOM 8061  H HG   . LEU A 1 28  ? 2.634   -7.692  1.313   1.00 0.00 ? 28  LEU A HG   5  
ATOM 8062  H HD11 . LEU A 1 28  ? 3.685   -6.083  -0.336  1.00 0.00 ? 28  LEU A HD11 5  
ATOM 8063  H HD12 . LEU A 1 28  ? 3.071   -4.785  0.687   1.00 0.00 ? 28  LEU A HD12 5  
ATOM 8064  H HD13 . LEU A 1 28  ? 1.949   -5.914  -0.072  1.00 0.00 ? 28  LEU A HD13 5  
ATOM 8065  H HD21 . LEU A 1 28  ? 4.928   -7.674  1.427   1.00 0.00 ? 28  LEU A HD21 5  
ATOM 8066  H HD22 . LEU A 1 28  ? 4.509   -7.168  3.063   1.00 0.00 ? 28  LEU A HD22 5  
ATOM 8067  H HD23 . LEU A 1 28  ? 5.004   -5.968  1.869   1.00 0.00 ? 28  LEU A HD23 5  
ATOM 8068  N N    . PHE A 1 29  ? 2.841   -5.681  5.621   1.00 0.00 ? 29  PHE A N    5  
ATOM 8069  C CA   . PHE A 1 29  ? 2.827   -4.893  6.848   1.00 0.00 ? 29  PHE A CA   5  
ATOM 8070  C C    . PHE A 1 29  ? 2.878   -3.400  6.537   1.00 0.00 ? 29  PHE A C    5  
ATOM 8071  O O    . PHE A 1 29  ? 3.751   -2.937  5.803   1.00 0.00 ? 29  PHE A O    5  
ATOM 8072  C CB   . PHE A 1 29  ? 4.007   -5.281  7.741   1.00 0.00 ? 29  PHE A CB   5  
ATOM 8073  C CG   . PHE A 1 29  ? 3.825   -6.599  8.438   1.00 0.00 ? 29  PHE A CG   5  
ATOM 8074  C CD1  . PHE A 1 29  ? 4.009   -7.790  7.755   1.00 0.00 ? 29  PHE A CD1  5  
ATOM 8075  C CD2  . PHE A 1 29  ? 3.468   -6.647  9.776   1.00 0.00 ? 29  PHE A CD2  5  
ATOM 8076  C CE1  . PHE A 1 29  ? 3.842   -9.005  8.393   1.00 0.00 ? 29  PHE A CE1  5  
ATOM 8077  C CE2  . PHE A 1 29  ? 3.300   -7.858  10.419  1.00 0.00 ? 29  PHE A CE2  5  
ATOM 8078  C CZ   . PHE A 1 29  ? 3.486   -9.039  9.727   1.00 0.00 ? 29  PHE A CZ   5  
ATOM 8079  H H    . PHE A 1 29  ? 3.662   -5.720  5.087   1.00 0.00 ? 29  PHE A H    5  
ATOM 8080  H HA   . PHE A 1 29  ? 1.907   -5.109  7.369   1.00 0.00 ? 29  PHE A HA   5  
ATOM 8081  H HB2  . PHE A 1 29  ? 4.900   -5.346  7.137   1.00 0.00 ? 29  PHE A HB2  5  
ATOM 8082  H HB3  . PHE A 1 29  ? 4.143   -4.521  8.496   1.00 0.00 ? 29  PHE A HB3  5  
ATOM 8083  H HD1  . PHE A 1 29  ? 4.288   -7.765  6.710   1.00 0.00 ? 29  PHE A HD1  5  
ATOM 8084  H HD2  . PHE A 1 29  ? 3.321   -5.724  10.319  1.00 0.00 ? 29  PHE A HD2  5  
ATOM 8085  H HE1  . PHE A 1 29  ? 3.989   -9.926  7.848   1.00 0.00 ? 29  PHE A HE1  5  
ATOM 8086  H HE2  . PHE A 1 29  ? 3.022   -7.882  11.462  1.00 0.00 ? 29  PHE A HE2  5  
ATOM 8087  H HZ   . PHE A 1 29  ? 3.356   -9.986  10.227  1.00 0.00 ? 29  PHE A HZ   5  
ATOM 8088  N N    . LYS A 1 30  ? 1.936   -2.652  7.101   1.00 0.00 ? 30  LYS A N    5  
ATOM 8089  C CA   . LYS A 1 30  ? 1.872   -1.211  6.886   1.00 0.00 ? 30  LYS A CA   5  
ATOM 8090  C C    . LYS A 1 30  ? 2.403   -0.456  8.101   1.00 0.00 ? 30  LYS A C    5  
ATOM 8091  O O    . LYS A 1 30  ? 1.764   -0.427  9.152   1.00 0.00 ? 30  LYS A O    5  
ATOM 8092  C CB   . LYS A 1 30  ? 0.433   -0.782  6.594   1.00 0.00 ? 30  LYS A CB   5  
ATOM 8093  C CG   . LYS A 1 30  ? 0.326   0.594   5.959   1.00 0.00 ? 30  LYS A CG   5  
ATOM 8094  C CD   . LYS A 1 30  ? -1.108  0.921   5.576   1.00 0.00 ? 30  LYS A CD   5  
ATOM 8095  C CE   . LYS A 1 30  ? -1.243  2.357   5.095   1.00 0.00 ? 30  LYS A CE   5  
ATOM 8096  N NZ   . LYS A 1 30  ? -1.024  2.474   3.627   1.00 0.00 ? 30  LYS A NZ   5  
ATOM 8097  H H    . LYS A 1 30  ? 1.267   -3.080  7.677   1.00 0.00 ? 30  LYS A H    5  
ATOM 8098  H HA   . LYS A 1 30  ? 2.490   -0.975  6.033   1.00 0.00 ? 30  LYS A HA   5  
ATOM 8099  H HB2  . LYS A 1 30  ? -0.016  -1.501  5.925   1.00 0.00 ? 30  LYS A HB2  5  
ATOM 8100  H HB3  . LYS A 1 30  ? -0.122  -0.771  7.522   1.00 0.00 ? 30  LYS A HB3  5  
ATOM 8101  H HG2  . LYS A 1 30  ? 0.677   1.334   6.662   1.00 0.00 ? 30  LYS A HG2  5  
ATOM 8102  H HG3  . LYS A 1 30  ? 0.940   0.618   5.070   1.00 0.00 ? 30  LYS A HG3  5  
ATOM 8103  H HD2  . LYS A 1 30  ? -1.421  0.257   4.784   1.00 0.00 ? 30  LYS A HD2  5  
ATOM 8104  H HD3  . LYS A 1 30  ? -1.743  0.778   6.439   1.00 0.00 ? 30  LYS A HD3  5  
ATOM 8105  H HE2  . LYS A 1 30  ? -2.234  2.711   5.332   1.00 0.00 ? 30  LYS A HE2  5  
ATOM 8106  H HE3  . LYS A 1 30  ? -0.512  2.965   5.609   1.00 0.00 ? 30  LYS A HE3  5  
ATOM 8107  H HZ1  . LYS A 1 30  ? -0.113  2.045   3.366   1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 8108  H HZ2  . LYS A 1 30  ? -1.018  3.475   3.345   1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 8109  H HZ3  . LYS A 1 30  ? -1.784  1.985   3.113   1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 8110  N N    . GLN A 1 31  ? 3.574   0.154   7.947   1.00 0.00 ? 31  GLN A N    5  
ATOM 8111  C CA   . GLN A 1 31  ? 4.189   0.910   9.032   1.00 0.00 ? 31  GLN A CA   5  
ATOM 8112  C C    . GLN A 1 31  ? 3.237   1.977   9.560   1.00 0.00 ? 31  GLN A C    5  
ATOM 8113  O O    . GLN A 1 31  ? 2.532   2.630   8.790   1.00 0.00 ? 31  GLN A O    5  
ATOM 8114  C CB   . GLN A 1 31  ? 5.489   1.559   8.556   1.00 0.00 ? 31  GLN A CB   5  
ATOM 8115  C CG   . GLN A 1 31  ? 6.524   1.729   9.657   1.00 0.00 ? 31  GLN A CG   5  
ATOM 8116  C CD   . GLN A 1 31  ? 7.514   2.838   9.362   1.00 0.00 ? 31  GLN A CD   5  
ATOM 8117  O OE1  . GLN A 1 31  ? 7.127   3.973   9.083   1.00 0.00 ? 31  GLN A OE1  5  
ATOM 8118  N NE2  . GLN A 1 31  ? 8.800   2.515   9.422   1.00 0.00 ? 31  GLN A NE2  5  
ATOM 8119  H H    . GLN A 1 31  ? 4.035   0.094   7.085   1.00 0.00 ? 31  GLN A H    5  
ATOM 8120  H HA   . GLN A 1 31  ? 4.414   0.219   9.831   1.00 0.00 ? 31  GLN A HA   5  
ATOM 8121  H HB2  . GLN A 1 31  ? 5.920   0.947   7.778   1.00 0.00 ? 31  GLN A HB2  5  
ATOM 8122  H HB3  . GLN A 1 31  ? 5.263   2.535   8.151   1.00 0.00 ? 31  GLN A HB3  5  
ATOM 8123  H HG2  . GLN A 1 31  ? 6.013   1.960   10.580  1.00 0.00 ? 31  GLN A HG2  5  
ATOM 8124  H HG3  . GLN A 1 31  ? 7.066   0.802   9.768   1.00 0.00 ? 31  GLN A HG3  5  
ATOM 8125  H HE21 . GLN A 1 31  ? 9.035   1.591   9.649   1.00 0.00 ? 31  GLN A HE21 5  
ATOM 8126  H HE22 . GLN A 1 31  ? 9.462   3.212   9.235   1.00 0.00 ? 31  GLN A HE22 5  
ATOM 8127  N N    . ALA A 1 32  ? 3.220   2.150   10.877  1.00 0.00 ? 32  ALA A N    5  
ATOM 8128  C CA   . ALA A 1 32  ? 2.355   3.139   11.508  1.00 0.00 ? 32  ALA A CA   5  
ATOM 8129  C C    . ALA A 1 32  ? 2.797   4.556   11.159  1.00 0.00 ? 32  ALA A C    5  
ATOM 8130  O O    . ALA A 1 32  ? 3.835   4.755   10.527  1.00 0.00 ? 32  ALA A O    5  
ATOM 8131  C CB   . ALA A 1 32  ? 2.343   2.945   13.017  1.00 0.00 ? 32  ALA A CB   5  
ATOM 8132  H H    . ALA A 1 32  ? 3.805   1.599   11.439  1.00 0.00 ? 32  ALA A H    5  
ATOM 8133  H HA   . ALA A 1 32  ? 1.350   2.986   11.142  1.00 0.00 ? 32  ALA A HA   5  
ATOM 8134  H HB1  . ALA A 1 32  ? 3.354   2.800   13.369  1.00 0.00 ? 32  ALA A HB1  5  
ATOM 8135  H HB2  . ALA A 1 32  ? 1.919   3.819   13.488  1.00 0.00 ? 32  ALA A HB2  5  
ATOM 8136  H HB3  . ALA A 1 32  ? 1.748   2.078   13.263  1.00 0.00 ? 32  ALA A HB3  5  
ATOM 8137  N N    . SER A 1 33  ? 2.003   5.538   11.573  1.00 0.00 ? 33  SER A N    5  
ATOM 8138  C CA   . SER A 1 33  ? 2.310   6.937   11.300  1.00 0.00 ? 33  SER A CA   5  
ATOM 8139  C C    . SER A 1 33  ? 3.339   7.471   12.291  1.00 0.00 ? 33  SER A C    5  
ATOM 8140  O O    . SER A 1 33  ? 3.659   6.816   13.283  1.00 0.00 ? 33  SER A O    5  
ATOM 8141  C CB   . SER A 1 33  ? 1.037   7.783   11.364  1.00 0.00 ? 33  SER A CB   5  
ATOM 8142  O OG   . SER A 1 33  ? 0.498   7.795   12.674  1.00 0.00 ? 33  SER A OG   5  
ATOM 8143  H H    . SER A 1 33  ? 1.189   5.316   12.072  1.00 0.00 ? 33  SER A H    5  
ATOM 8144  H HA   . SER A 1 33  ? 2.722   6.997   10.303  1.00 0.00 ? 33  SER A HA   5  
ATOM 8145  H HB2  . SER A 1 33  ? 1.266   8.797   11.073  1.00 0.00 ? 33  SER A HB2  5  
ATOM 8146  H HB3  . SER A 1 33  ? 0.301   7.372   10.688  1.00 0.00 ? 33  SER A HB3  5  
ATOM 8147  H HG   . SER A 1 33  ? 0.962   7.154   13.217  1.00 0.00 ? 33  SER A HG   5  
ATOM 8148  N N    . SER A 1 34  ? 3.853   8.665   12.015  1.00 0.00 ? 34  SER A N    5  
ATOM 8149  C CA   . SER A 1 34  ? 4.849   9.287   12.880  1.00 0.00 ? 34  SER A CA   5  
ATOM 8150  C C    . SER A 1 34  ? 4.416   9.222   14.342  1.00 0.00 ? 34  SER A C    5  
ATOM 8151  O O    . SER A 1 34  ? 3.237   9.370   14.658  1.00 0.00 ? 34  SER A O    5  
ATOM 8152  C CB   . SER A 1 34  ? 5.076   10.742  12.468  1.00 0.00 ? 34  SER A CB   5  
ATOM 8153  O OG   . SER A 1 34  ? 6.085   10.840  11.478  1.00 0.00 ? 34  SER A OG   5  
ATOM 8154  H H    . SER A 1 34  ? 3.558   9.138   11.209  1.00 0.00 ? 34  SER A H    5  
ATOM 8155  H HA   . SER A 1 34  ? 5.774   8.741   12.767  1.00 0.00 ? 34  SER A HA   5  
ATOM 8156  H HB2  . SER A 1 34  ? 4.159   11.149  12.071  1.00 0.00 ? 34  SER A HB2  5  
ATOM 8157  H HB3  . SER A 1 34  ? 5.380   11.315  13.332  1.00 0.00 ? 34  SER A HB3  5  
ATOM 8158  H HG   . SER A 1 34  ? 5.913   11.602  10.919  1.00 0.00 ? 34  SER A HG   5  
ATOM 8159  N N    . GLY A 1 35  ? 5.381   8.999   15.229  1.00 0.00 ? 35  GLY A N    5  
ATOM 8160  C CA   . GLY A 1 35  ? 5.080   8.918   16.647  1.00 0.00 ? 35  GLY A CA   5  
ATOM 8161  C C    . GLY A 1 35  ? 5.305   7.528   17.209  1.00 0.00 ? 35  GLY A C    5  
ATOM 8162  O O    . GLY A 1 35  ? 6.256   7.299   17.956  1.00 0.00 ? 35  GLY A O    5  
ATOM 8163  H H    . GLY A 1 35  ? 6.304   8.888   14.919  1.00 0.00 ? 35  GLY A H    5  
ATOM 8164  H HA2  . GLY A 1 35  ? 5.710   9.616   17.178  1.00 0.00 ? 35  GLY A HA2  5  
ATOM 8165  H HA3  . GLY A 1 35  ? 4.047   9.192   16.800  1.00 0.00 ? 35  GLY A HA3  5  
ATOM 8166  N N    . VAL A 1 36  ? 4.427   6.597   16.849  1.00 0.00 ? 36  VAL A N    5  
ATOM 8167  C CA   . VAL A 1 36  ? 4.534   5.222   17.323  1.00 0.00 ? 36  VAL A CA   5  
ATOM 8168  C C    . VAL A 1 36  ? 5.264   4.347   16.311  1.00 0.00 ? 36  VAL A C    5  
ATOM 8169  O O    . VAL A 1 36  ? 5.121   4.526   15.101  1.00 0.00 ? 36  VAL A O    5  
ATOM 8170  C CB   . VAL A 1 36  ? 3.146   4.615   17.603  1.00 0.00 ? 36  VAL A CB   5  
ATOM 8171  C CG1  . VAL A 1 36  ? 2.382   4.409   16.304  1.00 0.00 ? 36  VAL A CG1  5  
ATOM 8172  C CG2  . VAL A 1 36  ? 3.282   3.306   18.366  1.00 0.00 ? 36  VAL A CG2  5  
ATOM 8173  H H    . VAL A 1 36  ? 3.691   6.840   16.251  1.00 0.00 ? 36  VAL A H    5  
ATOM 8174  H HA   . VAL A 1 36  ? 5.093   5.230   18.247  1.00 0.00 ? 36  VAL A HA   5  
ATOM 8175  H HB   . VAL A 1 36  ? 2.590   5.309   18.216  1.00 0.00 ? 36  VAL A HB   5  
ATOM 8176  H HG11 . VAL A 1 36  ? 2.711   5.134   15.574  1.00 0.00 ? 36  VAL A HG11 5  
ATOM 8177  H HG12 . VAL A 1 36  ? 2.566   3.412   15.932  1.00 0.00 ? 36  VAL A HG12 5  
ATOM 8178  H HG13 . VAL A 1 36  ? 1.325   4.536   16.485  1.00 0.00 ? 36  VAL A HG13 5  
ATOM 8179  H HG21 . VAL A 1 36  ? 2.340   3.063   18.834  1.00 0.00 ? 36  VAL A HG21 5  
ATOM 8180  H HG22 . VAL A 1 36  ? 3.558   2.518   17.681  1.00 0.00 ? 36  VAL A HG22 5  
ATOM 8181  H HG23 . VAL A 1 36  ? 4.045   3.408   19.124  1.00 0.00 ? 36  VAL A HG23 5  
ATOM 8182  N N    . LYS A 1 37  ? 6.049   3.399   16.813  1.00 0.00 ? 37  LYS A N    5  
ATOM 8183  C CA   . LYS A 1 37  ? 6.801   2.494   15.953  1.00 0.00 ? 37  LYS A CA   5  
ATOM 8184  C C    . LYS A 1 37  ? 6.195   1.094   15.974  1.00 0.00 ? 37  LYS A C    5  
ATOM 8185  O O    . LYS A 1 37  ? 6.560   0.263   16.805  1.00 0.00 ? 37  LYS A O    5  
ATOM 8186  C CB   . LYS A 1 37  ? 8.265   2.434   16.398  1.00 0.00 ? 37  LYS A CB   5  
ATOM 8187  C CG   . LYS A 1 37  ? 9.138   3.500   15.760  1.00 0.00 ? 37  LYS A CG   5  
ATOM 8188  C CD   . LYS A 1 37  ? 8.816   4.882   16.303  1.00 0.00 ? 37  LYS A CD   5  
ATOM 8189  C CE   . LYS A 1 37  ? 9.562   5.968   15.542  1.00 0.00 ? 37  LYS A CE   5  
ATOM 8190  N NZ   . LYS A 1 37  ? 9.011   6.164   14.173  1.00 0.00 ? 37  LYS A NZ   5  
ATOM 8191  H H    . LYS A 1 37  ? 6.122   3.306   17.786  1.00 0.00 ? 37  LYS A H    5  
ATOM 8192  H HA   . LYS A 1 37  ? 6.756   2.878   14.945  1.00 0.00 ? 37  LYS A HA   5  
ATOM 8193  H HB2  . LYS A 1 37  ? 8.308   2.556   17.470  1.00 0.00 ? 37  LYS A HB2  5  
ATOM 8194  H HB3  . LYS A 1 37  ? 8.668   1.465   16.138  1.00 0.00 ? 37  LYS A HB3  5  
ATOM 8195  H HG2  . LYS A 1 37  ? 10.174  3.276   15.968  1.00 0.00 ? 37  LYS A HG2  5  
ATOM 8196  H HG3  . LYS A 1 37  ? 8.974   3.496   14.692  1.00 0.00 ? 37  LYS A HG3  5  
ATOM 8197  H HD2  . LYS A 1 37  ? 7.755   5.058   16.210  1.00 0.00 ? 37  LYS A HD2  5  
ATOM 8198  H HD3  . LYS A 1 37  ? 9.100   4.925   17.345  1.00 0.00 ? 37  LYS A HD3  5  
ATOM 8199  H HE2  . LYS A 1 37  ? 9.481   6.894   16.090  1.00 0.00 ? 37  LYS A HE2  5  
ATOM 8200  H HE3  . LYS A 1 37  ? 10.602  5.685   15.465  1.00 0.00 ? 37  LYS A HE3  5  
ATOM 8201  H HZ1  . LYS A 1 37  ? 9.112   5.291   13.618  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 8202  H HZ2  . LYS A 1 37  ? 9.521   6.931   13.689  1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 8203  H HZ3  . LYS A 1 37  ? 8.003   6.413   14.226  1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 8204  N N    . GLN A 1 38  ? 5.269   0.842   15.054  1.00 0.00 ? 38  GLN A N    5  
ATOM 8205  C CA   . GLN A 1 38  ? 4.614   -0.458  14.968  1.00 0.00 ? 38  GLN A CA   5  
ATOM 8206  C C    . GLN A 1 38  ? 4.187   -0.758  13.535  1.00 0.00 ? 38  GLN A C    5  
ATOM 8207  O O    . GLN A 1 38  ? 4.032   0.151   12.720  1.00 0.00 ? 38  GLN A O    5  
ATOM 8208  C CB   . GLN A 1 38  ? 3.398   -0.502  15.895  1.00 0.00 ? 38  GLN A CB   5  
ATOM 8209  C CG   . GLN A 1 38  ? 2.195   0.258   15.358  1.00 0.00 ? 38  GLN A CG   5  
ATOM 8210  C CD   . GLN A 1 38  ? 0.894   -0.178  16.002  1.00 0.00 ? 38  GLN A CD   5  
ATOM 8211  O OE1  . GLN A 1 38  ? 0.031   -0.765  15.350  1.00 0.00 ? 38  GLN A OE1  5  
ATOM 8212  N NE2  . GLN A 1 38  ? 0.747   0.109   17.290  1.00 0.00 ? 38  GLN A NE2  5  
ATOM 8213  H H    . GLN A 1 38  ? 5.021   1.545   14.420  1.00 0.00 ? 38  GLN A H    5  
ATOM 8214  H HA   . GLN A 1 38  ? 5.323   -1.208  15.284  1.00 0.00 ? 38  GLN A HA   5  
ATOM 8215  H HB2  . GLN A 1 38  ? 3.109   -1.532  16.042  1.00 0.00 ? 38  GLN A HB2  5  
ATOM 8216  H HB3  . GLN A 1 38  ? 3.670   -0.073  16.848  1.00 0.00 ? 38  GLN A HB3  5  
ATOM 8217  H HG2  . GLN A 1 38  ? 2.338   1.311   15.547  1.00 0.00 ? 38  GLN A HG2  5  
ATOM 8218  H HG3  . GLN A 1 38  ? 2.127   0.090   14.293  1.00 0.00 ? 38  GLN A HG3  5  
ATOM 8219  H HE21 . GLN A 1 38  ? 1.476   0.580   17.746  1.00 0.00 ? 38  GLN A HE21 5  
ATOM 8220  H HE22 . GLN A 1 38  ? -0.085  -0.160  17.732  1.00 0.00 ? 38  GLN A HE22 5  
ATOM 8221  N N    . TRP A 1 39  ? 3.999   -2.038  13.235  1.00 0.00 ? 39  TRP A N    5  
ATOM 8222  C CA   . TRP A 1 39  ? 3.590   -2.458  11.899  1.00 0.00 ? 39  TRP A CA   5  
ATOM 8223  C C    . TRP A 1 39  ? 2.232   -3.150  11.938  1.00 0.00 ? 39  TRP A C    5  
ATOM 8224  O O    . TRP A 1 39  ? 2.030   -4.099  12.693  1.00 0.00 ? 39  TRP A O    5  
ATOM 8225  C CB   . TRP A 1 39  ? 4.636   -3.395  11.294  1.00 0.00 ? 39  TRP A CB   5  
ATOM 8226  C CG   . TRP A 1 39  ? 5.975   -2.748  11.105  1.00 0.00 ? 39  TRP A CG   5  
ATOM 8227  C CD1  . TRP A 1 39  ? 6.955   -2.601  12.044  1.00 0.00 ? 39  TRP A CD1  5  
ATOM 8228  C CD2  . TRP A 1 39  ? 6.478   -2.157  9.901   1.00 0.00 ? 39  TRP A CD2  5  
ATOM 8229  N NE1  . TRP A 1 39  ? 8.038   -1.956  11.497  1.00 0.00 ? 39  TRP A NE1  5  
ATOM 8230  C CE2  . TRP A 1 39  ? 7.771   -1.673  10.184  1.00 0.00 ? 39  TRP A CE2  5  
ATOM 8231  C CE3  . TRP A 1 39  ? 5.964   -1.992  8.612   1.00 0.00 ? 39  TRP A CE3  5  
ATOM 8232  C CZ2  . TRP A 1 39  ? 8.553   -1.036  9.225   1.00 0.00 ? 39  TRP A CZ2  5  
ATOM 8233  C CZ3  . TRP A 1 39  ? 6.742   -1.359  7.661   1.00 0.00 ? 39  TRP A CZ3  5  
ATOM 8234  C CH2  . TRP A 1 39  ? 8.024   -0.887  7.971   1.00 0.00 ? 39  TRP A CH2  5  
ATOM 8235  H H    . TRP A 1 39  ? 4.138   -2.718  13.928  1.00 0.00 ? 39  TRP A H    5  
ATOM 8236  H HA   . TRP A 1 39  ? 3.513   -1.574  11.284  1.00 0.00 ? 39  TRP A HA   5  
ATOM 8237  H HB2  . TRP A 1 39  ? 4.767   -4.246  11.945  1.00 0.00 ? 39  TRP A HB2  5  
ATOM 8238  H HB3  . TRP A 1 39  ? 4.290   -3.734  10.329  1.00 0.00 ? 39  TRP A HB3  5  
ATOM 8239  H HD1  . TRP A 1 39  ? 6.876   -2.946  13.064  1.00 0.00 ? 39  TRP A HD1  5  
ATOM 8240  H HE1  . TRP A 1 39  ? 8.867   -1.735  11.971  1.00 0.00 ? 39  TRP A HE1  5  
ATOM 8241  H HE3  . TRP A 1 39  ? 4.978   -2.348  8.355   1.00 0.00 ? 39  TRP A HE3  5  
ATOM 8242  H HZ2  . TRP A 1 39  ? 9.544   -0.667  9.447   1.00 0.00 ? 39  TRP A HZ2  5  
ATOM 8243  H HZ3  . TRP A 1 39  ? 6.361   -1.222  6.660   1.00 0.00 ? 39  TRP A HZ3  5  
ATOM 8244  H HH2  . TRP A 1 39  ? 8.596   -0.399  7.197   1.00 0.00 ? 39  TRP A HH2  5  
ATOM 8245  N N    . ASN A 1 40  ? 1.303   -2.667  11.118  1.00 0.00 ? 40  ASN A N    5  
ATOM 8246  C CA   . ASN A 1 40  ? -0.037  -3.240  11.060  1.00 0.00 ? 40  ASN A CA   5  
ATOM 8247  C C    . ASN A 1 40  ? -0.175  -4.180  9.866   1.00 0.00 ? 40  ASN A C    5  
ATOM 8248  O O    . ASN A 1 40  ? -0.083  -3.756  8.714   1.00 0.00 ? 40  ASN A O    5  
ATOM 8249  C CB   . ASN A 1 40  ? -1.086  -2.129  10.973  1.00 0.00 ? 40  ASN A CB   5  
ATOM 8250  C CG   . ASN A 1 40  ? -1.453  -1.574  12.336  1.00 0.00 ? 40  ASN A CG   5  
ATOM 8251  O OD1  . ASN A 1 40  ? -2.290  -2.136  13.042  1.00 0.00 ? 40  ASN A OD1  5  
ATOM 8252  N ND2  . ASN A 1 40  ? -0.828  -0.464  12.710  1.00 0.00 ? 40  ASN A ND2  5  
ATOM 8253  H H    . ASN A 1 40  ? 1.524   -1.908  10.540  1.00 0.00 ? 40  ASN A H    5  
ATOM 8254  H HA   . ASN A 1 40  ? -0.196  -3.803  11.967  1.00 0.00 ? 40  ASN A HA   5  
ATOM 8255  H HB2  . ASN A 1 40  ? -0.697  -1.322  10.370  1.00 0.00 ? 40  ASN A HB2  5  
ATOM 8256  H HB3  . ASN A 1 40  ? -1.979  -2.521  10.511  1.00 0.00 ? 40  ASN A HB3  5  
ATOM 8257  H HD21 . ASN A 1 40  ? -0.173  -0.071  12.096  1.00 0.00 ? 40  ASN A HD21 5  
ATOM 8258  H HD22 . ASN A 1 40  ? -1.046  -0.084  13.587  1.00 0.00 ? 40  ASN A HD22 5  
ATOM 8259  N N    . LYS A 1 41  ? -0.397  -5.459  10.149  1.00 0.00 ? 41  LYS A N    5  
ATOM 8260  C CA   . LYS A 1 41  ? -0.550  -6.460  9.100   1.00 0.00 ? 41  LYS A CA   5  
ATOM 8261  C C    . LYS A 1 41  ? -1.966  -6.440  8.532   1.00 0.00 ? 41  LYS A C    5  
ATOM 8262  O O    . LYS A 1 41  ? -2.934  -6.707  9.244   1.00 0.00 ? 41  LYS A O    5  
ATOM 8263  C CB   . LYS A 1 41  ? -0.228  -7.853  9.645   1.00 0.00 ? 41  LYS A CB   5  
ATOM 8264  C CG   . LYS A 1 41  ? -0.039  -8.901  8.562   1.00 0.00 ? 41  LYS A CG   5  
ATOM 8265  C CD   . LYS A 1 41  ? -0.230  -10.307 9.107   1.00 0.00 ? 41  LYS A CD   5  
ATOM 8266  C CE   . LYS A 1 41  ? -0.329  -11.330 7.987   1.00 0.00 ? 41  LYS A CE   5  
ATOM 8267  N NZ   . LYS A 1 41  ? 0.989   -11.568 7.335   1.00 0.00 ? 41  LYS A NZ   5  
ATOM 8268  H H    . LYS A 1 41  ? -0.460  -5.736  11.088  1.00 0.00 ? 41  LYS A H    5  
ATOM 8269  H HA   . LYS A 1 41  ? 0.145   -6.222  8.310   1.00 0.00 ? 41  LYS A HA   5  
ATOM 8270  H HB2  . LYS A 1 41  ? 0.682   -7.798  10.226  1.00 0.00 ? 41  LYS A HB2  5  
ATOM 8271  H HB3  . LYS A 1 41  ? -1.036  -8.171  10.288  1.00 0.00 ? 41  LYS A HB3  5  
ATOM 8272  H HG2  . LYS A 1 41  ? -0.761  -8.730  7.778   1.00 0.00 ? 41  LYS A HG2  5  
ATOM 8273  H HG3  . LYS A 1 41  ? 0.960   -8.814  8.159   1.00 0.00 ? 41  LYS A HG3  5  
ATOM 8274  H HD2  . LYS A 1 41  ? 0.612   -10.558 9.735   1.00 0.00 ? 41  LYS A HD2  5  
ATOM 8275  H HD3  . LYS A 1 41  ? -1.139  -10.336 9.691   1.00 0.00 ? 41  LYS A HD3  5  
ATOM 8276  H HE2  . LYS A 1 41  ? -0.690  -12.260 8.397   1.00 0.00 ? 41  LYS A HE2  5  
ATOM 8277  H HE3  . LYS A 1 41  ? -1.027  -10.968 7.246   1.00 0.00 ? 41  LYS A HE3  5  
ATOM 8278  H HZ1  . LYS A 1 41  ? 0.875   -12.202 6.518   1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 8279  H HZ2  . LYS A 1 41  ? 1.648   -12.006 8.011   1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 8280  H HZ3  . LYS A 1 41  ? 1.394   -10.668 7.008   1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 8281  N N    . ARG A 1 42  ? -2.078  -6.123  7.246   1.00 0.00 ? 42  ARG A N    5  
ATOM 8282  C CA   . ARG A 1 42  ? -3.375  -6.069  6.583   1.00 0.00 ? 42  ARG A CA   5  
ATOM 8283  C C    . ARG A 1 42  ? -3.298  -6.681  5.187   1.00 0.00 ? 42  ARG A C    5  
ATOM 8284  O O    . ARG A 1 42  ? -2.213  -6.839  4.627   1.00 0.00 ? 42  ARG A O    5  
ATOM 8285  C CB   . ARG A 1 42  ? -3.865  -4.623  6.491   1.00 0.00 ? 42  ARG A CB   5  
ATOM 8286  C CG   . ARG A 1 42  ? -4.109  -3.976  7.845   1.00 0.00 ? 42  ARG A CG   5  
ATOM 8287  C CD   . ARG A 1 42  ? -5.497  -4.301  8.375   1.00 0.00 ? 42  ARG A CD   5  
ATOM 8288  N NE   . ARG A 1 42  ? -5.538  -4.303  9.835   1.00 0.00 ? 42  ARG A NE   5  
ATOM 8289  C CZ   . ARG A 1 42  ? -6.646  -4.506  10.539  1.00 0.00 ? 42  ARG A CZ   5  
ATOM 8290  N NH1  . ARG A 1 42  ? -7.798  -4.724  9.919   1.00 0.00 ? 42  ARG A NH1  5  
ATOM 8291  N NH2  . ARG A 1 42  ? -6.604  -4.492  11.865  1.00 0.00 ? 42  ARG A NH2  5  
ATOM 8292  H H    . ARG A 1 42  ? -1.269  -5.920  6.731   1.00 0.00 ? 42  ARG A H    5  
ATOM 8293  H HA   . ARG A 1 42  ? -4.074  -6.640  7.175   1.00 0.00 ? 42  ARG A HA   5  
ATOM 8294  H HB2  . ARG A 1 42  ? -3.125  -4.037  5.965   1.00 0.00 ? 42  ARG A HB2  5  
ATOM 8295  H HB3  . ARG A 1 42  ? -4.790  -4.604  5.935   1.00 0.00 ? 42  ARG A HB3  5  
ATOM 8296  H HG2  . ARG A 1 42  ? -3.373  -4.341  8.546   1.00 0.00 ? 42  ARG A HG2  5  
ATOM 8297  H HG3  . ARG A 1 42  ? -4.014  -2.905  7.744   1.00 0.00 ? 42  ARG A HG3  5  
ATOM 8298  H HD2  . ARG A 1 42  ? -6.192  -3.562  8.006   1.00 0.00 ? 42  ARG A HD2  5  
ATOM 8299  H HD3  . ARG A 1 42  ? -5.785  -5.278  8.015   1.00 0.00 ? 42  ARG A HD3  5  
ATOM 8300  H HE   . ARG A 1 42  ? -4.698  -4.143  10.313  1.00 0.00 ? 42  ARG A HE   5  
ATOM 8301  H HH11 . ARG A 1 42  ? -7.833  -4.736  8.920   1.00 0.00 ? 42  ARG A HH11 5  
ATOM 8302  H HH12 . ARG A 1 42  ? -8.631  -4.878  10.452  1.00 0.00 ? 42  ARG A HH12 5  
ATOM 8303  H HH21 . ARG A 1 42  ? -5.737  -4.328  12.335  1.00 0.00 ? 42  ARG A HH21 5  
ATOM 8304  H HH22 . ARG A 1 42  ? -7.438  -4.645  12.393  1.00 0.00 ? 42  ARG A HH22 5  
ATOM 8305  N N    . TRP A 1 43  ? -4.455  -7.023  4.632   1.00 0.00 ? 43  TRP A N    5  
ATOM 8306  C CA   . TRP A 1 43  ? -4.518  -7.618  3.302   1.00 0.00 ? 43  TRP A CA   5  
ATOM 8307  C C    . TRP A 1 43  ? -4.286  -6.565  2.223   1.00 0.00 ? 43  TRP A C    5  
ATOM 8308  O O    . TRP A 1 43  ? -5.078  -5.635  2.070   1.00 0.00 ? 43  TRP A O    5  
ATOM 8309  C CB   . TRP A 1 43  ? -5.872  -8.296  3.088   1.00 0.00 ? 43  TRP A CB   5  
ATOM 8310  C CG   . TRP A 1 43  ? -6.011  -8.931  1.737   1.00 0.00 ? 43  TRP A CG   5  
ATOM 8311  C CD1  . TRP A 1 43  ? -6.986  -8.687  0.813   1.00 0.00 ? 43  TRP A CD1  5  
ATOM 8312  C CD2  . TRP A 1 43  ? -5.148  -9.918  1.161   1.00 0.00 ? 43  TRP A CD2  5  
ATOM 8313  N NE1  . TRP A 1 43  ? -6.781  -9.462  -0.303  1.00 0.00 ? 43  TRP A NE1  5  
ATOM 8314  C CE2  . TRP A 1 43  ? -5.659  -10.225 -0.115  1.00 0.00 ? 43  TRP A CE2  5  
ATOM 8315  C CE3  . TRP A 1 43  ? -3.992  -10.570 1.598   1.00 0.00 ? 43  TRP A CE3  5  
ATOM 8316  C CZ2  . TRP A 1 43  ? -5.054  -11.156 -0.955  1.00 0.00 ? 43  TRP A CZ2  5  
ATOM 8317  C CZ3  . TRP A 1 43  ? -3.392  -11.494 0.763   1.00 0.00 ? 43  TRP A CZ3  5  
ATOM 8318  C CH2  . TRP A 1 43  ? -3.924  -11.779 -0.501  1.00 0.00 ? 43  TRP A CH2  5  
ATOM 8319  H H    . TRP A 1 43  ? -5.287  -6.872  5.128   1.00 0.00 ? 43  TRP A H    5  
ATOM 8320  H HA   . TRP A 1 43  ? -3.738  -8.362  3.235   1.00 0.00 ? 43  TRP A HA   5  
ATOM 8321  H HB2  . TRP A 1 43  ? -6.004  -9.066  3.833   1.00 0.00 ? 43  TRP A HB2  5  
ATOM 8322  H HB3  . TRP A 1 43  ? -6.655  -7.560  3.193   1.00 0.00 ? 43  TRP A HB3  5  
ATOM 8323  H HD1  . TRP A 1 43  ? -7.795  -7.986  0.953   1.00 0.00 ? 43  TRP A HD1  5  
ATOM 8324  H HE1  . TRP A 1 43  ? -7.346  -9.465  -1.104  1.00 0.00 ? 43  TRP A HE1  5  
ATOM 8325  H HE3  . TRP A 1 43  ? -3.567  -10.363 2.569   1.00 0.00 ? 43  TRP A HE3  5  
ATOM 8326  H HZ2  . TRP A 1 43  ? -5.451  -11.386 -1.933  1.00 0.00 ? 43  TRP A HZ2  5  
ATOM 8327  H HZ3  . TRP A 1 43  ? -2.498  -12.008 1.084   1.00 0.00 ? 43  TRP A HZ3  5  
ATOM 8328  H HH2  . TRP A 1 43  ? -3.423  -12.508 -1.120  1.00 0.00 ? 43  TRP A HH2  5  
ATOM 8329  N N    . PHE A 1 44  ? -3.197  -6.717  1.478   1.00 0.00 ? 44  PHE A N    5  
ATOM 8330  C CA   . PHE A 1 44  ? -2.861  -5.779  0.414   1.00 0.00 ? 44  PHE A CA   5  
ATOM 8331  C C    . PHE A 1 44  ? -3.218  -6.356  -0.953  1.00 0.00 ? 44  PHE A C    5  
ATOM 8332  O O    . PHE A 1 44  ? -2.922  -7.514  -1.247  1.00 0.00 ? 44  PHE A O    5  
ATOM 8333  C CB   . PHE A 1 44  ? -1.372  -5.433  0.460   1.00 0.00 ? 44  PHE A CB   5  
ATOM 8334  C CG   . PHE A 1 44  ? -1.054  -4.269  1.355   1.00 0.00 ? 44  PHE A CG   5  
ATOM 8335  C CD1  . PHE A 1 44  ? -1.630  -4.167  2.611   1.00 0.00 ? 44  PHE A CD1  5  
ATOM 8336  C CD2  . PHE A 1 44  ? -0.180  -3.277  0.941   1.00 0.00 ? 44  PHE A CD2  5  
ATOM 8337  C CE1  . PHE A 1 44  ? -1.341  -3.096  3.436   1.00 0.00 ? 44  PHE A CE1  5  
ATOM 8338  C CE2  . PHE A 1 44  ? 0.114   -2.205  1.762   1.00 0.00 ? 44  PHE A CE2  5  
ATOM 8339  C CZ   . PHE A 1 44  ? -0.466  -2.115  3.012   1.00 0.00 ? 44  PHE A CZ   5  
ATOM 8340  H H    . PHE A 1 44  ? -2.604  -7.479  1.648   1.00 0.00 ? 44  PHE A H    5  
ATOM 8341  H HA   . PHE A 1 44  ? -3.436  -4.879  0.572   1.00 0.00 ? 44  PHE A HA   5  
ATOM 8342  H HB2  . PHE A 1 44  ? -0.822  -6.288  0.823   1.00 0.00 ? 44  PHE A HB2  5  
ATOM 8343  H HB3  . PHE A 1 44  ? -1.035  -5.189  -0.536  1.00 0.00 ? 44  PHE A HB3  5  
ATOM 8344  H HD1  . PHE A 1 44  ? -2.313  -4.934  2.946   1.00 0.00 ? 44  PHE A HD1  5  
ATOM 8345  H HD2  . PHE A 1 44  ? 0.275   -3.347  -0.037  1.00 0.00 ? 44  PHE A HD2  5  
ATOM 8346  H HE1  . PHE A 1 44  ? -1.795  -3.028  4.413   1.00 0.00 ? 44  PHE A HE1  5  
ATOM 8347  H HE2  . PHE A 1 44  ? 0.798   -1.439  1.426   1.00 0.00 ? 44  PHE A HE2  5  
ATOM 8348  H HZ   . PHE A 1 44  ? -0.239  -1.277  3.654   1.00 0.00 ? 44  PHE A HZ   5  
ATOM 8349  N N    . VAL A 1 45  ? -3.857  -5.539  -1.785  1.00 0.00 ? 45  VAL A N    5  
ATOM 8350  C CA   . VAL A 1 45  ? -4.254  -5.967  -3.121  1.00 0.00 ? 45  VAL A CA   5  
ATOM 8351  C C    . VAL A 1 45  ? -4.002  -4.869  -4.148  1.00 0.00 ? 45  VAL A C    5  
ATOM 8352  O O    . VAL A 1 45  ? -4.385  -3.715  -3.946  1.00 0.00 ? 45  VAL A O    5  
ATOM 8353  C CB   . VAL A 1 45  ? -5.742  -6.363  -3.164  1.00 0.00 ? 45  VAL A CB   5  
ATOM 8354  C CG1  . VAL A 1 45  ? -6.104  -6.934  -4.527  1.00 0.00 ? 45  VAL A CG1  5  
ATOM 8355  C CG2  . VAL A 1 45  ? -6.060  -7.359  -2.059  1.00 0.00 ? 45  VAL A CG2  5  
ATOM 8356  H H    . VAL A 1 45  ? -4.065  -4.627  -1.494  1.00 0.00 ? 45  VAL A H    5  
ATOM 8357  H HA   . VAL A 1 45  ? -3.665  -6.834  -3.384  1.00 0.00 ? 45  VAL A HA   5  
ATOM 8358  H HB   . VAL A 1 45  ? -6.335  -5.475  -3.002  1.00 0.00 ? 45  VAL A HB   5  
ATOM 8359  H HG11 . VAL A 1 45  ? -5.704  -7.933  -4.617  1.00 0.00 ? 45  VAL A HG11 5  
ATOM 8360  H HG12 . VAL A 1 45  ? -7.178  -6.964  -4.632  1.00 0.00 ? 45  VAL A HG12 5  
ATOM 8361  H HG13 . VAL A 1 45  ? -5.684  -6.308  -5.302  1.00 0.00 ? 45  VAL A HG13 5  
ATOM 8362  H HG21 . VAL A 1 45  ? -5.153  -7.615  -1.532  1.00 0.00 ? 45  VAL A HG21 5  
ATOM 8363  H HG22 . VAL A 1 45  ? -6.765  -6.918  -1.370  1.00 0.00 ? 45  VAL A HG22 5  
ATOM 8364  H HG23 . VAL A 1 45  ? -6.489  -8.252  -2.491  1.00 0.00 ? 45  VAL A HG23 5  
ATOM 8365  N N    . LEU A 1 46  ? -3.357  -5.233  -5.250  1.00 0.00 ? 46  LEU A N    5  
ATOM 8366  C CA   . LEU A 1 46  ? -3.053  -4.278  -6.310  1.00 0.00 ? 46  LEU A CA   5  
ATOM 8367  C C    . LEU A 1 46  ? -4.004  -4.455  -7.490  1.00 0.00 ? 46  LEU A C    5  
ATOM 8368  O O    . LEU A 1 46  ? -3.975  -5.477  -8.177  1.00 0.00 ? 46  LEU A O    5  
ATOM 8369  C CB   . LEU A 1 46  ? -1.606  -4.447  -6.777  1.00 0.00 ? 46  LEU A CB   5  
ATOM 8370  C CG   . LEU A 1 46  ? -1.093  -3.398  -7.764  1.00 0.00 ? 46  LEU A CG   5  
ATOM 8371  C CD1  . LEU A 1 46  ? -0.885  -2.064  -7.064  1.00 0.00 ? 46  LEU A CD1  5  
ATOM 8372  C CD2  . LEU A 1 46  ? 0.200   -3.867  -8.416  1.00 0.00 ? 46  LEU A CD2  5  
ATOM 8373  H H    . LEU A 1 46  ? -3.077  -6.166  -5.354  1.00 0.00 ? 46  LEU A H    5  
ATOM 8374  H HA   . LEU A 1 46  ? -3.180  -3.285  -5.907  1.00 0.00 ? 46  LEU A HA   5  
ATOM 8375  H HB2  . LEU A 1 46  ? -0.972  -4.418  -5.904  1.00 0.00 ? 46  LEU A HB2  5  
ATOM 8376  H HB3  . LEU A 1 46  ? -1.522  -5.416  -7.249  1.00 0.00 ? 46  LEU A HB3  5  
ATOM 8377  H HG   . LEU A 1 46  ? -1.829  -3.255  -8.543  1.00 0.00 ? 46  LEU A HG   5  
ATOM 8378  H HD11 . LEU A 1 46  ? 0.107   -1.696  -7.278  1.00 0.00 ? 46  LEU A HD11 5  
ATOM 8379  H HD12 . LEU A 1 46  ? -0.998  -2.195  -5.998  1.00 0.00 ? 46  LEU A HD12 5  
ATOM 8380  H HD13 . LEU A 1 46  ? -1.617  -1.353  -7.419  1.00 0.00 ? 46  LEU A HD13 5  
ATOM 8381  H HD21 . LEU A 1 46  ? 0.501   -3.155  -9.170  1.00 0.00 ? 46  LEU A HD21 5  
ATOM 8382  H HD22 . LEU A 1 46  ? 0.041   -4.832  -8.875  1.00 0.00 ? 46  LEU A HD22 5  
ATOM 8383  H HD23 . LEU A 1 46  ? 0.973   -3.948  -7.666  1.00 0.00 ? 46  LEU A HD23 5  
ATOM 8384  N N    . VAL A 1 47  ? -4.844  -3.452  -7.722  1.00 0.00 ? 47  VAL A N    5  
ATOM 8385  C CA   . VAL A 1 47  ? -5.801  -3.494  -8.821  1.00 0.00 ? 47  VAL A CA   5  
ATOM 8386  C C    . VAL A 1 47  ? -5.921  -2.134  -9.498  1.00 0.00 ? 47  VAL A C    5  
ATOM 8387  O O    . VAL A 1 47  ? -6.001  -1.102  -8.832  1.00 0.00 ? 47  VAL A O    5  
ATOM 8388  C CB   . VAL A 1 47  ? -7.194  -3.938  -8.336  1.00 0.00 ? 47  VAL A CB   5  
ATOM 8389  C CG1  . VAL A 1 47  ? -8.219  -3.793  -9.450  1.00 0.00 ? 47  VAL A CG1  5  
ATOM 8390  C CG2  . VAL A 1 47  ? -7.149  -5.370  -7.825  1.00 0.00 ? 47  VAL A CG2  5  
ATOM 8391  H H    . VAL A 1 47  ? -4.820  -2.664  -7.140  1.00 0.00 ? 47  VAL A H    5  
ATOM 8392  H HA   . VAL A 1 47  ? -5.448  -4.216  -9.543  1.00 0.00 ? 47  VAL A HA   5  
ATOM 8393  H HB   . VAL A 1 47  ? -7.490  -3.296  -7.518  1.00 0.00 ? 47  VAL A HB   5  
ATOM 8394  H HG11 . VAL A 1 47  ? -8.598  -4.768  -9.719  1.00 0.00 ? 47  VAL A HG11 5  
ATOM 8395  H HG12 . VAL A 1 47  ? -9.034  -3.170  -9.110  1.00 0.00 ? 47  VAL A HG12 5  
ATOM 8396  H HG13 . VAL A 1 47  ? -7.753  -3.338  -10.311 1.00 0.00 ? 47  VAL A HG13 5  
ATOM 8397  H HG21 . VAL A 1 47  ? -6.136  -5.741  -7.881  1.00 0.00 ? 47  VAL A HG21 5  
ATOM 8398  H HG22 . VAL A 1 47  ? -7.486  -5.397  -6.800  1.00 0.00 ? 47  VAL A HG22 5  
ATOM 8399  H HG23 . VAL A 1 47  ? -7.792  -5.990  -8.433  1.00 0.00 ? 47  VAL A HG23 5  
ATOM 8400  N N    . ASP A 1 48  ? -5.933  -2.140  -10.827 1.00 0.00 ? 48  ASP A N    5  
ATOM 8401  C CA   . ASP A 1 48  ? -6.044  -0.906  -11.596 1.00 0.00 ? 48  ASP A CA   5  
ATOM 8402  C C    . ASP A 1 48  ? -4.879  0.031   -11.293 1.00 0.00 ? 48  ASP A C    5  
ATOM 8403  O O    . ASP A 1 48  ? -5.079  1.194   -10.942 1.00 0.00 ? 48  ASP A O    5  
ATOM 8404  C CB   . ASP A 1 48  ? -7.370  -0.206  -11.289 1.00 0.00 ? 48  ASP A CB   5  
ATOM 8405  C CG   . ASP A 1 48  ? -7.790  0.746   -12.391 1.00 0.00 ? 48  ASP A CG   5  
ATOM 8406  O OD1  . ASP A 1 48  ? -7.118  1.784   -12.567 1.00 0.00 ? 48  ASP A OD1  5  
ATOM 8407  O OD2  . ASP A 1 48  ? -8.791  0.453   -13.078 1.00 0.00 ? 48  ASP A OD2  5  
ATOM 8408  H H    . ASP A 1 48  ? -5.865  -2.995  -11.302 1.00 0.00 ? 48  ASP A H    5  
ATOM 8409  H HA   . ASP A 1 48  ? -6.019  -1.164  -12.644 1.00 0.00 ? 48  ASP A HA   5  
ATOM 8410  H HB2  . ASP A 1 48  ? -8.143  -0.951  -11.168 1.00 0.00 ? 48  ASP A HB2  5  
ATOM 8411  H HB3  . ASP A 1 48  ? -7.269  0.354   -10.371 1.00 0.00 ? 48  ASP A HB3  5  
ATOM 8412  N N    . ARG A 1 49  ? -3.661  -0.484  -11.430 1.00 0.00 ? 49  ARG A N    5  
ATOM 8413  C CA   . ARG A 1 49  ? -2.464  0.305   -11.169 1.00 0.00 ? 49  ARG A CA   5  
ATOM 8414  C C    . ARG A 1 49  ? -2.605  1.093   -9.870  1.00 0.00 ? 49  ARG A C    5  
ATOM 8415  O O    . ARG A 1 49  ? -2.058  2.188   -9.734  1.00 0.00 ? 49  ARG A O    5  
ATOM 8416  C CB   . ARG A 1 49  ? -2.195  1.262   -12.332 1.00 0.00 ? 49  ARG A CB   5  
ATOM 8417  C CG   . ARG A 1 49  ? -0.739  1.685   -12.448 1.00 0.00 ? 49  ARG A CG   5  
ATOM 8418  C CD   . ARG A 1 49  ? -0.398  2.122   -13.864 1.00 0.00 ? 49  ARG A CD   5  
ATOM 8419  N NE   . ARG A 1 49  ? -1.157  3.301   -14.271 1.00 0.00 ? 49  ARG A NE   5  
ATOM 8420  C CZ   . ARG A 1 49  ? -1.207  3.747   -15.521 1.00 0.00 ? 49  ARG A CZ   5  
ATOM 8421  N NH1  . ARG A 1 49  ? -0.546  3.115   -16.481 1.00 0.00 ? 49  ARG A NH1  5  
ATOM 8422  N NH2  . ARG A 1 49  ? -1.920  4.827   -15.814 1.00 0.00 ? 49  ARG A NH2  5  
ATOM 8423  H H    . ARG A 1 49  ? -3.566  -1.418  -11.713 1.00 0.00 ? 49  ARG A H    5  
ATOM 8424  H HA   . ARG A 1 49  ? -1.631  -0.376  -11.075 1.00 0.00 ? 49  ARG A HA   5  
ATOM 8425  H HB2  . ARG A 1 49  ? -2.481  0.779   -13.254 1.00 0.00 ? 49  ARG A HB2  5  
ATOM 8426  H HB3  . ARG A 1 49  ? -2.795  2.149   -12.198 1.00 0.00 ? 49  ARG A HB3  5  
ATOM 8427  H HG2  . ARG A 1 49  ? -0.559  2.510   -11.775 1.00 0.00 ? 49  ARG A HG2  5  
ATOM 8428  H HG3  . ARG A 1 49  ? -0.109  0.851   -12.176 1.00 0.00 ? 49  ARG A HG3  5  
ATOM 8429  H HD2  . ARG A 1 49  ? 0.657   2.351   -13.911 1.00 0.00 ? 49  ARG A HD2  5  
ATOM 8430  H HD3  . ARG A 1 49  ? -0.620  1.310   -14.540 1.00 0.00 ? 49  ARG A HD3  5  
ATOM 8431  H HE   . ARG A 1 49  ? -1.653  3.783   -13.578 1.00 0.00 ? 49  ARG A HE   5  
ATOM 8432  H HH11 . ARG A 1 49  ? -0.008  2.301   -16.264 1.00 0.00 ? 49  ARG A HH11 5  
ATOM 8433  H HH12 . ARG A 1 49  ? -0.586  3.453   -17.422 1.00 0.00 ? 49  ARG A HH12 5  
ATOM 8434  H HH21 . ARG A 1 49  ? -2.421  5.306   -15.093 1.00 0.00 ? 49  ARG A HH21 5  
ATOM 8435  H HH22 . ARG A 1 49  ? -1.957  5.162   -16.755 1.00 0.00 ? 49  ARG A HH22 5  
ATOM 8436  N N    . CYS A 1 50  ? -3.341  0.528   -8.919  1.00 0.00 ? 50  CYS A N    5  
ATOM 8437  C CA   . CYS A 1 50  ? -3.555  1.178   -7.631  1.00 0.00 ? 50  CYS A CA   5  
ATOM 8438  C C    . CYS A 1 50  ? -3.460  0.169   -6.491  1.00 0.00 ? 50  CYS A C    5  
ATOM 8439  O O    . CYS A 1 50  ? -3.683  -1.026  -6.685  1.00 0.00 ? 50  CYS A O    5  
ATOM 8440  C CB   . CYS A 1 50  ? -4.919  1.869   -7.605  1.00 0.00 ? 50  CYS A CB   5  
ATOM 8441  S SG   . CYS A 1 50  ? -4.927  3.514   -8.356  1.00 0.00 ? 50  CYS A SG   5  
ATOM 8442  H H    . CYS A 1 50  ? -3.751  -0.346  -9.087  1.00 0.00 ? 50  CYS A H    5  
ATOM 8443  H HA   . CYS A 1 50  ? -2.782  1.921   -7.503  1.00 0.00 ? 50  CYS A HA   5  
ATOM 8444  H HB2  . CYS A 1 50  ? -5.632  1.261   -8.141  1.00 0.00 ? 50  CYS A HB2  5  
ATOM 8445  H HB3  . CYS A 1 50  ? -5.242  1.973   -6.580  1.00 0.00 ? 50  CYS A HB3  5  
ATOM 8446  H HG   . CYS A 1 50  ? -4.299  3.435   -9.519  1.00 0.00 ? 50  CYS A HG   5  
ATOM 8447  N N    . LEU A 1 51  ? -3.128  0.658   -5.301  1.00 0.00 ? 51  LEU A N    5  
ATOM 8448  C CA   . LEU A 1 51  ? -3.003  -0.200  -4.129  1.00 0.00 ? 51  LEU A CA   5  
ATOM 8449  C C    . LEU A 1 51  ? -4.246  -0.107  -3.250  1.00 0.00 ? 51  LEU A C    5  
ATOM 8450  O O    . LEU A 1 51  ? -4.711  0.986   -2.927  1.00 0.00 ? 51  LEU A O    5  
ATOM 8451  C CB   . LEU A 1 51  ? -1.763  0.185   -3.320  1.00 0.00 ? 51  LEU A CB   5  
ATOM 8452  C CG   . LEU A 1 51  ? -1.157  -0.920  -2.453  1.00 0.00 ? 51  LEU A CG   5  
ATOM 8453  C CD1  . LEU A 1 51  ? 0.300   -0.615  -2.142  1.00 0.00 ? 51  LEU A CD1  5  
ATOM 8454  C CD2  . LEU A 1 51  ? -1.955  -1.087  -1.168  1.00 0.00 ? 51  LEU A CD2  5  
ATOM 8455  H H    . LEU A 1 51  ? -2.964  1.620   -5.208  1.00 0.00 ? 51  LEU A H    5  
ATOM 8456  H HA   . LEU A 1 51  ? -2.896  -1.218  -4.473  1.00 0.00 ? 51  LEU A HA   5  
ATOM 8457  H HB2  . LEU A 1 51  ? -1.005  0.513   -4.014  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 8458  H HB3  . LEU A 1 51  ? -2.034  1.005   -2.671  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 8459  H HG   . LEU A 1 51  ? -1.193  -1.855  -2.995  1.00 0.00 ? 51  LEU A HG   5  
ATOM 8460  H HD11 . LEU A 1 51  ? 0.357   0.242   -1.487  1.00 0.00 ? 51  LEU A HD11 5  
ATOM 8461  H HD12 . LEU A 1 51  ? 0.828   -0.402  -3.060  1.00 0.00 ? 51  LEU A HD12 5  
ATOM 8462  H HD13 . LEU A 1 51  ? 0.751   -1.469  -1.658  1.00 0.00 ? 51  LEU A HD13 5  
ATOM 8463  H HD21 . LEU A 1 51  ? -3.010  -1.074  -1.396  1.00 0.00 ? 51  LEU A HD21 5  
ATOM 8464  H HD22 . LEU A 1 51  ? -1.722  -0.278  -0.492  1.00 0.00 ? 51  LEU A HD22 5  
ATOM 8465  H HD23 . LEU A 1 51  ? -1.697  -2.029  -0.705  1.00 0.00 ? 51  LEU A HD23 5  
ATOM 8466  N N    . PHE A 1 52  ? -4.779  -1.262  -2.863  1.00 0.00 ? 52  PHE A N    5  
ATOM 8467  C CA   . PHE A 1 52  ? -5.968  -1.311  -2.020  1.00 0.00 ? 52  PHE A CA   5  
ATOM 8468  C C    . PHE A 1 52  ? -5.764  -2.265  -0.847  1.00 0.00 ? 52  PHE A C    5  
ATOM 8469  O O    . PHE A 1 52  ? -5.530  -3.459  -1.038  1.00 0.00 ? 52  PHE A O    5  
ATOM 8470  C CB   . PHE A 1 52  ? -7.184  -1.746  -2.841  1.00 0.00 ? 52  PHE A CB   5  
ATOM 8471  C CG   . PHE A 1 52  ? -7.397  -0.922  -4.079  1.00 0.00 ? 52  PHE A CG   5  
ATOM 8472  C CD1  . PHE A 1 52  ? -7.483  0.458   -4.003  1.00 0.00 ? 52  PHE A CD1  5  
ATOM 8473  C CD2  . PHE A 1 52  ? -7.512  -1.529  -5.319  1.00 0.00 ? 52  PHE A CD2  5  
ATOM 8474  C CE1  . PHE A 1 52  ? -7.679  1.219   -5.140  1.00 0.00 ? 52  PHE A CE1  5  
ATOM 8475  C CE2  . PHE A 1 52  ? -7.708  -0.774  -6.460  1.00 0.00 ? 52  PHE A CE2  5  
ATOM 8476  C CZ   . PHE A 1 52  ? -7.792  0.602   -6.370  1.00 0.00 ? 52  PHE A CZ   5  
ATOM 8477  H H    . PHE A 1 52  ? -4.363  -2.101  -3.153  1.00 0.00 ? 52  PHE A H    5  
ATOM 8478  H HA   . PHE A 1 52  ? -6.141  -0.318  -1.635  1.00 0.00 ? 52  PHE A HA   5  
ATOM 8479  H HB2  . PHE A 1 52  ? -7.055  -2.774  -3.145  1.00 0.00 ? 52  PHE A HB2  5  
ATOM 8480  H HB3  . PHE A 1 52  ? -8.070  -1.664  -2.230  1.00 0.00 ? 52  PHE A HB3  5  
ATOM 8481  H HD1  . PHE A 1 52  ? -7.395  0.942   -3.040  1.00 0.00 ? 52  PHE A HD1  5  
ATOM 8482  H HD2  . PHE A 1 52  ? -7.447  -2.605  -5.391  1.00 0.00 ? 52  PHE A HD2  5  
ATOM 8483  H HE1  . PHE A 1 52  ? -7.745  2.294   -5.066  1.00 0.00 ? 52  PHE A HE1  5  
ATOM 8484  H HE2  . PHE A 1 52  ? -7.796  -1.259  -7.421  1.00 0.00 ? 52  PHE A HE2  5  
ATOM 8485  H HZ   . PHE A 1 52  ? -7.945  1.194   -7.260  1.00 0.00 ? 52  PHE A HZ   5  
ATOM 8486  N N    . TYR A 1 53  ? -5.853  -1.730  0.365   1.00 0.00 ? 53  TYR A N    5  
ATOM 8487  C CA   . TYR A 1 53  ? -5.676  -2.532  1.570   1.00 0.00 ? 53  TYR A CA   5  
ATOM 8488  C C    . TYR A 1 53  ? -7.013  -2.781  2.261   1.00 0.00 ? 53  TYR A C    5  
ATOM 8489  O O    . TYR A 1 53  ? -7.727  -1.841  2.613   1.00 0.00 ? 53  TYR A O    5  
ATOM 8490  C CB   . TYR A 1 53  ? -4.712  -1.838  2.533   1.00 0.00 ? 53  TYR A CB   5  
ATOM 8491  C CG   . TYR A 1 53  ? -5.287  -0.595  3.173   1.00 0.00 ? 53  TYR A CG   5  
ATOM 8492  C CD1  . TYR A 1 53  ? -5.167  0.646   2.559   1.00 0.00 ? 53  TYR A CD1  5  
ATOM 8493  C CD2  . TYR A 1 53  ? -5.952  -0.661  4.391   1.00 0.00 ? 53  TYR A CD2  5  
ATOM 8494  C CE1  . TYR A 1 53  ? -5.690  1.785   3.141   1.00 0.00 ? 53  TYR A CE1  5  
ATOM 8495  C CE2  . TYR A 1 53  ? -6.480  0.472   4.980   1.00 0.00 ? 53  TYR A CE2  5  
ATOM 8496  C CZ   . TYR A 1 53  ? -6.346  1.692   4.351   1.00 0.00 ? 53  TYR A CZ   5  
ATOM 8497  O OH   . TYR A 1 53  ? -6.870  2.824   4.933   1.00 0.00 ? 53  TYR A OH   5  
ATOM 8498  H H    . TYR A 1 53  ? -6.042  -0.773  0.453   1.00 0.00 ? 53  TYR A H    5  
ATOM 8499  H HA   . TYR A 1 53  ? -5.253  -3.482  1.276   1.00 0.00 ? 53  TYR A HA   5  
ATOM 8500  H HB2  . TYR A 1 53  ? -4.446  -2.524  3.322   1.00 0.00 ? 53  TYR A HB2  5  
ATOM 8501  H HB3  . TYR A 1 53  ? -3.820  -1.552  1.995   1.00 0.00 ? 53  TYR A HB3  5  
ATOM 8502  H HD1  . TYR A 1 53  ? -4.653  0.714   1.611   1.00 0.00 ? 53  TYR A HD1  5  
ATOM 8503  H HD2  . TYR A 1 53  ? -6.055  -1.618  4.882   1.00 0.00 ? 53  TYR A HD2  5  
ATOM 8504  H HE1  . TYR A 1 53  ? -5.586  2.740   2.649   1.00 0.00 ? 53  TYR A HE1  5  
ATOM 8505  H HE2  . TYR A 1 53  ? -6.993  0.401   5.928   1.00 0.00 ? 53  TYR A HE2  5  
ATOM 8506  H HH   . TYR A 1 53  ? -7.829  2.786   4.901   1.00 0.00 ? 53  TYR A HH   5  
ATOM 8507  N N    . TYR A 1 54  ? -7.345  -4.052  2.452   1.00 0.00 ? 54  TYR A N    5  
ATOM 8508  C CA   . TYR A 1 54  ? -8.597  -4.426  3.100   1.00 0.00 ? 54  TYR A CA   5  
ATOM 8509  C C    . TYR A 1 54  ? -8.340  -5.012  4.485   1.00 0.00 ? 54  TYR A C    5  
ATOM 8510  O O    . TYR A 1 54  ? -7.214  -5.384  4.816   1.00 0.00 ? 54  TYR A O    5  
ATOM 8511  C CB   . TYR A 1 54  ? -9.358  -5.437  2.240   1.00 0.00 ? 54  TYR A CB   5  
ATOM 8512  C CG   . TYR A 1 54  ? -9.682  -4.929  0.853   1.00 0.00 ? 54  TYR A CG   5  
ATOM 8513  C CD1  . TYR A 1 54  ? -8.768  -5.057  -0.186  1.00 0.00 ? 54  TYR A CD1  5  
ATOM 8514  C CD2  . TYR A 1 54  ? -10.901 -4.321  0.581   1.00 0.00 ? 54  TYR A CD2  5  
ATOM 8515  C CE1  . TYR A 1 54  ? -9.060  -4.594  -1.455  1.00 0.00 ? 54  TYR A CE1  5  
ATOM 8516  C CE2  . TYR A 1 54  ? -11.202 -3.856  -0.684  1.00 0.00 ? 54  TYR A CE2  5  
ATOM 8517  C CZ   . TYR A 1 54  ? -10.278 -3.995  -1.699  1.00 0.00 ? 54  TYR A CZ   5  
ATOM 8518  O OH   . TYR A 1 54  ? -10.572 -3.533  -2.961  1.00 0.00 ? 54  TYR A OH   5  
ATOM 8519  H H    . TYR A 1 54  ? -6.735  -4.757  2.150   1.00 0.00 ? 54  TYR A H    5  
ATOM 8520  H HA   . TYR A 1 54  ? -9.196  -3.534  3.204   1.00 0.00 ? 54  TYR A HA   5  
ATOM 8521  H HB2  . TYR A 1 54  ? -8.763  -6.330  2.134   1.00 0.00 ? 54  TYR A HB2  5  
ATOM 8522  H HB3  . TYR A 1 54  ? -10.289 -5.686  2.728   1.00 0.00 ? 54  TYR A HB3  5  
ATOM 8523  H HD1  . TYR A 1 54  ? -7.815  -5.527  0.009   1.00 0.00 ? 54  TYR A HD1  5  
ATOM 8524  H HD2  . TYR A 1 54  ? -11.623 -4.213  1.379   1.00 0.00 ? 54  TYR A HD2  5  
ATOM 8525  H HE1  . TYR A 1 54  ? -8.336  -4.703  -2.249  1.00 0.00 ? 54  TYR A HE1  5  
ATOM 8526  H HE2  . TYR A 1 54  ? -12.155 -3.387  -0.876  1.00 0.00 ? 54  TYR A HE2  5  
ATOM 8527  H HH   . TYR A 1 54  ? -11.451 -3.145  -2.962  1.00 0.00 ? 54  TYR A HH   5  
ATOM 8528  N N    . LYS A 1 55  ? -9.394  -5.091  5.291   1.00 0.00 ? 55  LYS A N    5  
ATOM 8529  C CA   . LYS A 1 55  ? -9.286  -5.632  6.640   1.00 0.00 ? 55  LYS A CA   5  
ATOM 8530  C C    . LYS A 1 55  ? -8.876  -7.101  6.606   1.00 0.00 ? 55  LYS A C    5  
ATOM 8531  O O    . LYS A 1 55  ? -8.139  -7.570  7.474   1.00 0.00 ? 55  LYS A O    5  
ATOM 8532  C CB   . LYS A 1 55  ? -10.617 -5.480  7.381   1.00 0.00 ? 55  LYS A CB   5  
ATOM 8533  C CG   . LYS A 1 55  ? -11.777 -6.183  6.698   1.00 0.00 ? 55  LYS A CG   5  
ATOM 8534  C CD   . LYS A 1 55  ? -13.115 -5.683  7.216   1.00 0.00 ? 55  LYS A CD   5  
ATOM 8535  C CE   . LYS A 1 55  ? -14.251 -6.608  6.808   1.00 0.00 ? 55  LYS A CE   5  
ATOM 8536  N NZ   . LYS A 1 55  ? -15.552 -6.181  7.393   1.00 0.00 ? 55  LYS A NZ   5  
ATOM 8537  H H    . LYS A 1 55  ? -10.266 -4.778  4.970   1.00 0.00 ? 55  LYS A H    5  
ATOM 8538  H HA   . LYS A 1 55  ? -8.526  -5.071  7.164   1.00 0.00 ? 55  LYS A HA   5  
ATOM 8539  H HB2  . LYS A 1 55  ? -10.510 -5.888  8.375   1.00 0.00 ? 55  LYS A HB2  5  
ATOM 8540  H HB3  . LYS A 1 55  ? -10.854 -4.429  7.456   1.00 0.00 ? 55  LYS A HB3  5  
ATOM 8541  H HG2  . LYS A 1 55  ? -11.723 -5.998  5.635   1.00 0.00 ? 55  LYS A HG2  5  
ATOM 8542  H HG3  . LYS A 1 55  ? -11.702 -7.245  6.885   1.00 0.00 ? 55  LYS A HG3  5  
ATOM 8543  H HD2  . LYS A 1 55  ? -13.077 -5.631  8.294   1.00 0.00 ? 55  LYS A HD2  5  
ATOM 8544  H HD3  . LYS A 1 55  ? -13.302 -4.698  6.812   1.00 0.00 ? 55  LYS A HD3  5  
ATOM 8545  H HE2  . LYS A 1 55  ? -14.332 -6.605  5.732   1.00 0.00 ? 55  LYS A HE2  5  
ATOM 8546  H HE3  . LYS A 1 55  ? -14.024 -7.608  7.149   1.00 0.00 ? 55  LYS A HE3  5  
ATOM 8547  H HZ1  . LYS A 1 55  ? -16.237 -5.984  6.637   1.00 0.00 ? 55  LYS A HZ1  5  
ATOM 8548  H HZ2  . LYS A 1 55  ? -15.422 -5.319  7.961   1.00 0.00 ? 55  LYS A HZ2  5  
ATOM 8549  H HZ3  . LYS A 1 55  ? -15.932 -6.931  8.005   1.00 0.00 ? 55  LYS A HZ3  5  
ATOM 8550  N N    . ASP A 1 56  ? -9.357  -7.821  5.599   1.00 0.00 ? 56  ASP A N    5  
ATOM 8551  C CA   . ASP A 1 56  ? -9.039  -9.237  5.450   1.00 0.00 ? 56  ASP A CA   5  
ATOM 8552  C C    . ASP A 1 56  ? -9.137  -9.665  3.990   1.00 0.00 ? 56  ASP A C    5  
ATOM 8553  O O    . ASP A 1 56  ? -9.407  -8.848  3.110   1.00 0.00 ? 56  ASP A O    5  
ATOM 8554  C CB   . ASP A 1 56  ? -9.979  -10.086 6.308   1.00 0.00 ? 56  ASP A CB   5  
ATOM 8555  C CG   . ASP A 1 56  ? -9.332  -11.375 6.773   1.00 0.00 ? 56  ASP A CG   5  
ATOM 8556  O OD1  . ASP A 1 56  ? -8.226  -11.309 7.349   1.00 0.00 ? 56  ASP A OD1  5  
ATOM 8557  O OD2  . ASP A 1 56  ? -9.931  -12.451 6.561   1.00 0.00 ? 56  ASP A OD2  5  
ATOM 8558  H H    . ASP A 1 56  ? -9.940  -7.391  4.939   1.00 0.00 ? 56  ASP A H    5  
ATOM 8559  H HA   . ASP A 1 56  ? -8.025  -9.386  5.789   1.00 0.00 ? 56  ASP A HA   5  
ATOM 8560  H HB2  . ASP A 1 56  ? -10.273 -9.518  7.179   1.00 0.00 ? 56  ASP A HB2  5  
ATOM 8561  H HB3  . ASP A 1 56  ? -10.858 -10.332 5.731   1.00 0.00 ? 56  ASP A HB3  5  
ATOM 8562  N N    . GLU A 1 57  ? -8.914  -10.952 3.739   1.00 0.00 ? 57  GLU A N    5  
ATOM 8563  C CA   . GLU A 1 57  ? -8.975  -11.488 2.385   1.00 0.00 ? 57  GLU A CA   5  
ATOM 8564  C C    . GLU A 1 57  ? -10.388 -11.376 1.819   1.00 0.00 ? 57  GLU A C    5  
ATOM 8565  O O    . GLU A 1 57  ? -10.594 -11.470 0.609   1.00 0.00 ? 57  GLU A O    5  
ATOM 8566  C CB   . GLU A 1 57  ? -8.521  -12.949 2.369   1.00 0.00 ? 57  GLU A CB   5  
ATOM 8567  C CG   . GLU A 1 57  ? -7.278  -13.209 3.203   1.00 0.00 ? 57  GLU A CG   5  
ATOM 8568  C CD   . GLU A 1 57  ? -6.655  -14.561 2.915   1.00 0.00 ? 57  GLU A CD   5  
ATOM 8569  O OE1  . GLU A 1 57  ? -6.487  -14.896 1.724   1.00 0.00 ? 57  GLU A OE1  5  
ATOM 8570  O OE2  . GLU A 1 57  ? -6.335  -15.284 3.882   1.00 0.00 ? 57  GLU A OE2  5  
ATOM 8571  H H    . GLU A 1 57  ? -8.702  -11.554 4.483   1.00 0.00 ? 57  GLU A H    5  
ATOM 8572  H HA   . GLU A 1 57  ? -8.306  -10.907 1.768   1.00 0.00 ? 57  GLU A HA   5  
ATOM 8573  H HB2  . GLU A 1 57  ? -9.321  -13.566 2.751   1.00 0.00 ? 57  GLU A HB2  5  
ATOM 8574  H HB3  . GLU A 1 57  ? -8.312  -13.237 1.350   1.00 0.00 ? 57  GLU A HB3  5  
ATOM 8575  H HG2  . GLU A 1 57  ? -6.549  -12.442 2.988   1.00 0.00 ? 57  GLU A HG2  5  
ATOM 8576  H HG3  . GLU A 1 57  ? -7.545  -13.168 4.248   1.00 0.00 ? 57  GLU A HG3  5  
ATOM 8577  N N    . LYS A 1 58  ? -11.359 -11.176 2.703   1.00 0.00 ? 58  LYS A N    5  
ATOM 8578  C CA   . LYS A 1 58  ? -12.753 -11.051 2.295   1.00 0.00 ? 58  LYS A CA   5  
ATOM 8579  C C    . LYS A 1 58  ? -12.931 -9.894  1.317   1.00 0.00 ? 58  LYS A C    5  
ATOM 8580  O O    . LYS A 1 58  ? -13.703 -9.989  0.364   1.00 0.00 ? 58  LYS A O    5  
ATOM 8581  C CB   . LYS A 1 58  ? -13.647 -10.841 3.519   1.00 0.00 ? 58  LYS A CB   5  
ATOM 8582  C CG   . LYS A 1 58  ? -13.732 -12.057 4.426   1.00 0.00 ? 58  LYS A CG   5  
ATOM 8583  C CD   . LYS A 1 58  ? -14.666 -13.112 3.858   1.00 0.00 ? 58  LYS A CD   5  
ATOM 8584  C CE   . LYS A 1 58  ? -14.507 -14.443 4.578   1.00 0.00 ? 58  LYS A CE   5  
ATOM 8585  N NZ   . LYS A 1 58  ? -13.184 -15.068 4.301   1.00 0.00 ? 58  LYS A NZ   5  
ATOM 8586  H H    . LYS A 1 58  ? -11.132 -11.110 3.655   1.00 0.00 ? 58  LYS A H    5  
ATOM 8587  H HA   . LYS A 1 58  ? -13.038 -11.969 1.804   1.00 0.00 ? 58  LYS A HA   5  
ATOM 8588  H HB2  . LYS A 1 58  ? -13.260 -10.014 4.095   1.00 0.00 ? 58  LYS A HB2  5  
ATOM 8589  H HB3  . LYS A 1 58  ? -14.645 -10.599 3.183   1.00 0.00 ? 58  LYS A HB3  5  
ATOM 8590  H HG2  . LYS A 1 58  ? -12.746 -12.484 4.533   1.00 0.00 ? 58  LYS A HG2  5  
ATOM 8591  H HG3  . LYS A 1 58  ? -14.099 -11.747 5.394   1.00 0.00 ? 58  LYS A HG3  5  
ATOM 8592  H HD2  . LYS A 1 58  ? -15.686 -12.775 3.970   1.00 0.00 ? 58  LYS A HD2  5  
ATOM 8593  H HD3  . LYS A 1 58  ? -14.444 -13.251 2.809   1.00 0.00 ? 58  LYS A HD3  5  
ATOM 8594  H HE2  . LYS A 1 58  ? -14.601 -14.276 5.640   1.00 0.00 ? 58  LYS A HE2  5  
ATOM 8595  H HE3  . LYS A 1 58  ? -15.288 -15.111 4.247   1.00 0.00 ? 58  LYS A HE3  5  
ATOM 8596  H HZ1  . LYS A 1 58  ? -12.429 -14.358 4.384   1.00 0.00 ? 58  LYS A HZ1  5  
ATOM 8597  H HZ2  . LYS A 1 58  ? -13.170 -15.463 3.339   1.00 0.00 ? 58  LYS A HZ2  5  
ATOM 8598  H HZ3  . LYS A 1 58  ? -13.002 -15.834 4.980   1.00 0.00 ? 58  LYS A HZ3  5  
ATOM 8599  N N    . GLU A 1 59  ? -12.212 -8.803  1.560   1.00 0.00 ? 59  GLU A N    5  
ATOM 8600  C CA   . GLU A 1 59  ? -12.292 -7.628  0.700   1.00 0.00 ? 59  GLU A CA   5  
ATOM 8601  C C    . GLU A 1 59  ? -13.727 -7.119  0.606   1.00 0.00 ? 59  GLU A C    5  
ATOM 8602  O O    . GLU A 1 59  ? -14.242 -6.883  -0.486  1.00 0.00 ? 59  GLU A O    5  
ATOM 8603  C CB   . GLU A 1 59  ? -11.762 -7.956  -0.698  1.00 0.00 ? 59  GLU A CB   5  
ATOM 8604  C CG   . GLU A 1 59  ? -10.287 -8.321  -0.720  1.00 0.00 ? 59  GLU A CG   5  
ATOM 8605  C CD   . GLU A 1 59  ? -9.882  -9.033  -1.996  1.00 0.00 ? 59  GLU A CD   5  
ATOM 8606  O OE1  . GLU A 1 59  ? -9.538  -8.343  -2.978  1.00 0.00 ? 59  GLU A OE1  5  
ATOM 8607  O OE2  . GLU A 1 59  ? -9.909  -10.282 -2.011  1.00 0.00 ? 59  GLU A OE2  5  
ATOM 8608  H H    . GLU A 1 59  ? -11.614 -8.787  2.337   1.00 0.00 ? 59  GLU A H    5  
ATOM 8609  H HA   . GLU A 1 59  ? -11.676 -6.856  1.136   1.00 0.00 ? 59  GLU A HA   5  
ATOM 8610  H HB2  . GLU A 1 59  ? -12.324 -8.787  -1.097  1.00 0.00 ? 59  GLU A HB2  5  
ATOM 8611  H HB3  . GLU A 1 59  ? -11.908 -7.096  -1.335  1.00 0.00 ? 59  GLU A HB3  5  
ATOM 8612  H HG2  . GLU A 1 59  ? -9.705  -7.416  -0.631  1.00 0.00 ? 59  GLU A HG2  5  
ATOM 8613  H HG3  . GLU A 1 59  ? -10.077 -8.968  0.119   1.00 0.00 ? 59  GLU A HG3  5  
ATOM 8614  N N    . GLU A 1 60  ? -14.367 -6.954  1.759   1.00 0.00 ? 60  GLU A N    5  
ATOM 8615  C CA   . GLU A 1 60  ? -15.743 -6.475  1.807   1.00 0.00 ? 60  GLU A CA   5  
ATOM 8616  C C    . GLU A 1 60  ? -15.836 -5.036  1.306   1.00 0.00 ? 60  GLU A C    5  
ATOM 8617  O O    . GLU A 1 60  ? -16.724 -4.695  0.525   1.00 0.00 ? 60  GLU A O    5  
ATOM 8618  C CB   . GLU A 1 60  ? -16.290 -6.566  3.233   1.00 0.00 ? 60  GLU A CB   5  
ATOM 8619  C CG   . GLU A 1 60  ? -16.780 -7.954  3.609   1.00 0.00 ? 60  GLU A CG   5  
ATOM 8620  C CD   . GLU A 1 60  ? -18.196 -8.221  3.138   1.00 0.00 ? 60  GLU A CD   5  
ATOM 8621  O OE1  . GLU A 1 60  ? -19.137 -7.670  3.748   1.00 0.00 ? 60  GLU A OE1  5  
ATOM 8622  O OE2  . GLU A 1 60  ? -18.364 -8.980  2.161   1.00 0.00 ? 60  GLU A OE2  5  
ATOM 8623  H H    . GLU A 1 60  ? -13.903 -7.160  2.598   1.00 0.00 ? 60  GLU A H    5  
ATOM 8624  H HA   . GLU A 1 60  ? -16.337 -7.106  1.163   1.00 0.00 ? 60  GLU A HA   5  
ATOM 8625  H HB2  . GLU A 1 60  ? -15.509 -6.282  3.924   1.00 0.00 ? 60  GLU A HB2  5  
ATOM 8626  H HB3  . GLU A 1 60  ? -17.115 -5.877  3.334   1.00 0.00 ? 60  GLU A HB3  5  
ATOM 8627  H HG2  . GLU A 1 60  ? -16.125 -8.687  3.162   1.00 0.00 ? 60  GLU A HG2  5  
ATOM 8628  H HG3  . GLU A 1 60  ? -16.749 -8.054  4.684   1.00 0.00 ? 60  GLU A HG3  5  
ATOM 8629  N N    . SER A 1 61  ? -14.912 -4.196  1.762   1.00 0.00 ? 61  SER A N    5  
ATOM 8630  C CA   . SER A 1 61  ? -14.891 -2.794  1.365   1.00 0.00 ? 61  SER A CA   5  
ATOM 8631  C C    . SER A 1 61  ? -13.486 -2.214  1.491   1.00 0.00 ? 61  SER A C    5  
ATOM 8632  O O    . SER A 1 61  ? -12.724 -2.593  2.381   1.00 0.00 ? 61  SER A O    5  
ATOM 8633  C CB   . SER A 1 61  ? -15.868 -1.985  2.221   1.00 0.00 ? 61  SER A CB   5  
ATOM 8634  O OG   . SER A 1 61  ? -17.184 -2.498  2.117   1.00 0.00 ? 61  SER A OG   5  
ATOM 8635  H H    . SER A 1 61  ? -14.229 -4.528  2.383   1.00 0.00 ? 61  SER A H    5  
ATOM 8636  H HA   . SER A 1 61  ? -15.200 -2.737  0.332   1.00 0.00 ? 61  SER A HA   5  
ATOM 8637  H HB2  . SER A 1 61  ? -15.558 -2.028  3.254   1.00 0.00 ? 61  SER A HB2  5  
ATOM 8638  H HB3  . SER A 1 61  ? -15.867 -0.957  1.888   1.00 0.00 ? 61  SER A HB3  5  
ATOM 8639  H HG   . SER A 1 61  ? -17.648 -2.048  1.407   1.00 0.00 ? 61  SER A HG   5  
ATOM 8640  N N    . ILE A 1 62  ? -13.149 -1.293  0.595   1.00 0.00 ? 62  ILE A N    5  
ATOM 8641  C CA   . ILE A 1 62  ? -11.837 -0.660  0.606   1.00 0.00 ? 62  ILE A CA   5  
ATOM 8642  C C    . ILE A 1 62  ? -11.712 0.327   1.762   1.00 0.00 ? 62  ILE A C    5  
ATOM 8643  O O    . ILE A 1 62  ? -12.413 1.339   1.807   1.00 0.00 ? 62  ILE A O    5  
ATOM 8644  C CB   . ILE A 1 62  ? -11.556 0.078   -0.717  1.00 0.00 ? 62  ILE A CB   5  
ATOM 8645  C CG1  . ILE A 1 62  ? -11.624 -0.897  -1.894  1.00 0.00 ? 62  ILE A CG1  5  
ATOM 8646  C CG2  . ILE A 1 62  ? -10.197 0.760   -0.665  1.00 0.00 ? 62  ILE A CG2  5  
ATOM 8647  C CD1  . ILE A 1 62  ? -11.771 -0.215  -3.236  1.00 0.00 ? 62  ILE A CD1  5  
ATOM 8648  H H    . ILE A 1 62  ? -13.800 -1.032  -0.090  1.00 0.00 ? 62  ILE A H    5  
ATOM 8649  H HA   . ILE A 1 62  ? -11.094 -1.435  0.727   1.00 0.00 ? 62  ILE A HA   5  
ATOM 8650  H HB   . ILE A 1 62  ? -12.310 0.839   -0.845  1.00 0.00 ? 62  ILE A HB   5  
ATOM 8651  H HG12 . ILE A 1 62  ? -10.720 -1.485  -1.919  1.00 0.00 ? 62  ILE A HG12 5  
ATOM 8652  H HG13 . ILE A 1 62  ? -12.471 -1.553  -1.759  1.00 0.00 ? 62  ILE A HG13 5  
ATOM 8653  H HG21 . ILE A 1 62  ? -10.035 1.164   0.324   1.00 0.00 ? 62  ILE A HG21 5  
ATOM 8654  H HG22 . ILE A 1 62  ? -9.425  0.041   -0.889  1.00 0.00 ? 62  ILE A HG22 5  
ATOM 8655  H HG23 . ILE A 1 62  ? -10.167 1.560   -1.390  1.00 0.00 ? 62  ILE A HG23 5  
ATOM 8656  H HD11 . ILE A 1 62  ? -12.047 0.819   -3.085  1.00 0.00 ? 62  ILE A HD11 5  
ATOM 8657  H HD12 . ILE A 1 62  ? -10.834 -0.262  -3.769  1.00 0.00 ? 62  ILE A HD12 5  
ATOM 8658  H HD13 . ILE A 1 62  ? -12.539 -0.711  -3.810  1.00 0.00 ? 62  ILE A HD13 5  
ATOM 8659  N N    . LEU A 1 63  ? -10.814 0.028   2.694   1.00 0.00 ? 63  LEU A N    5  
ATOM 8660  C CA   . LEU A 1 63  ? -10.595 0.889   3.850   1.00 0.00 ? 63  LEU A CA   5  
ATOM 8661  C C    . LEU A 1 63  ? -9.867  2.168   3.447   1.00 0.00 ? 63  LEU A C    5  
ATOM 8662  O O    . LEU A 1 63  ? -10.126 3.240   3.992   1.00 0.00 ? 63  LEU A O    5  
ATOM 8663  C CB   . LEU A 1 63  ? -9.792  0.147   4.920   1.00 0.00 ? 63  LEU A CB   5  
ATOM 8664  C CG   . LEU A 1 63  ? -10.257 -1.273  5.244   1.00 0.00 ? 63  LEU A CG   5  
ATOM 8665  C CD1  . LEU A 1 63  ? -9.242  -1.978  6.129   1.00 0.00 ? 63  LEU A CD1  5  
ATOM 8666  C CD2  . LEU A 1 63  ? -11.624 -1.246  5.914   1.00 0.00 ? 63  LEU A CD2  5  
ATOM 8667  H H    . LEU A 1 63  ? -10.286 -0.792  2.603   1.00 0.00 ? 63  LEU A H    5  
ATOM 8668  H HA   . LEU A 1 63  ? -11.561 1.152   4.255   1.00 0.00 ? 63  LEU A HA   5  
ATOM 8669  H HB2  . LEU A 1 63  ? -8.768  0.090   4.583   1.00 0.00 ? 63  LEU A HB2  5  
ATOM 8670  H HB3  . LEU A 1 63  ? -9.838  0.728   5.830   1.00 0.00 ? 63  LEU A HB3  5  
ATOM 8671  H HG   . LEU A 1 63  ? -10.346 -1.835  4.325   1.00 0.00 ? 63  LEU A HG   5  
ATOM 8672  H HD11 . LEU A 1 63  ? -8.695  -2.701  5.544   1.00 0.00 ? 63  LEU A HD11 5  
ATOM 8673  H HD12 . LEU A 1 63  ? -9.755  -2.482  6.935   1.00 0.00 ? 63  LEU A HD12 5  
ATOM 8674  H HD13 . LEU A 1 63  ? -8.555  -1.252  6.539   1.00 0.00 ? 63  LEU A HD13 5  
ATOM 8675  H HD21 . LEU A 1 63  ? -12.206 -2.091  5.578   1.00 0.00 ? 63  LEU A HD21 5  
ATOM 8676  H HD22 . LEU A 1 63  ? -12.134 -0.331  5.653   1.00 0.00 ? 63  LEU A HD22 5  
ATOM 8677  H HD23 . LEU A 1 63  ? -11.500 -1.296  6.986   1.00 0.00 ? 63  LEU A HD23 5  
ATOM 8678  N N    . GLY A 1 64  ? -8.956  2.046   2.486   1.00 0.00 ? 64  GLY A N    5  
ATOM 8679  C CA   . GLY A 1 64  ? -8.206  3.199   2.024   1.00 0.00 ? 64  GLY A CA   5  
ATOM 8680  C C    . GLY A 1 64  ? -7.475  2.932   0.724   1.00 0.00 ? 64  GLY A C    5  
ATOM 8681  O O    . GLY A 1 64  ? -6.770  1.932   0.594   1.00 0.00 ? 64  GLY A O    5  
ATOM 8682  H H    . GLY A 1 64  ? -8.792  1.165   2.088   1.00 0.00 ? 64  GLY A H    5  
ATOM 8683  H HA2  . GLY A 1 64  ? -8.888  4.024   1.879   1.00 0.00 ? 64  GLY A HA2  5  
ATOM 8684  H HA3  . GLY A 1 64  ? -7.484  3.471   2.780   1.00 0.00 ? 64  GLY A HA3  5  
ATOM 8685  N N    . SER A 1 65  ? -7.644  3.829   -0.243  1.00 0.00 ? 65  SER A N    5  
ATOM 8686  C CA   . SER A 1 65  ? -6.999  3.682   -1.542  1.00 0.00 ? 65  SER A CA   5  
ATOM 8687  C C    . SER A 1 65  ? -5.802  4.621   -1.663  1.00 0.00 ? 65  SER A C    5  
ATOM 8688  O O    . SER A 1 65  ? -5.778  5.694   -1.061  1.00 0.00 ? 65  SER A O    5  
ATOM 8689  C CB   . SER A 1 65  ? -7.998  3.964   -2.666  1.00 0.00 ? 65  SER A CB   5  
ATOM 8690  O OG   . SER A 1 65  ? -8.332  5.341   -2.719  1.00 0.00 ? 65  SER A OG   5  
ATOM 8691  H H    . SER A 1 65  ? -8.219  4.606   -0.079  1.00 0.00 ? 65  SER A H    5  
ATOM 8692  H HA   . SER A 1 65  ? -6.653  2.663   -1.628  1.00 0.00 ? 65  SER A HA   5  
ATOM 8693  H HB2  . SER A 1 65  ? -7.564  3.676   -3.611  1.00 0.00 ? 65  SER A HB2  5  
ATOM 8694  H HB3  . SER A 1 65  ? -8.899  3.394   -2.495  1.00 0.00 ? 65  SER A HB3  5  
ATOM 8695  H HG   . SER A 1 65  ? -8.291  5.714   -1.835  1.00 0.00 ? 65  SER A HG   5  
ATOM 8696  N N    . ILE A 1 66  ? -4.811  4.207   -2.445  1.00 0.00 ? 66  ILE A N    5  
ATOM 8697  C CA   . ILE A 1 66  ? -3.611  5.010   -2.647  1.00 0.00 ? 66  ILE A CA   5  
ATOM 8698  C C    . ILE A 1 66  ? -3.045  4.811   -4.048  1.00 0.00 ? 66  ILE A C    5  
ATOM 8699  O O    . ILE A 1 66  ? -2.603  3.722   -4.417  1.00 0.00 ? 66  ILE A O    5  
ATOM 8700  C CB   . ILE A 1 66  ? -2.523  4.666   -1.612  1.00 0.00 ? 66  ILE A CB   5  
ATOM 8701  C CG1  . ILE A 1 66  ? -3.047  4.895   -0.193  1.00 0.00 ? 66  ILE A CG1  5  
ATOM 8702  C CG2  . ILE A 1 66  ? -1.273  5.496   -1.862  1.00 0.00 ? 66  ILE A CG2  5  
ATOM 8703  C CD1  . ILE A 1 66  ? -2.191  4.258   0.878   1.00 0.00 ? 66  ILE A CD1  5  
ATOM 8704  H H    . ILE A 1 66  ? -4.888  3.342   -2.898  1.00 0.00 ? 66  ILE A H    5  
ATOM 8705  H HA   . ILE A 1 66  ? -3.881  6.049   -2.523  1.00 0.00 ? 66  ILE A HA   5  
ATOM 8706  H HB   . ILE A 1 66  ? -2.264  3.625   -1.728  1.00 0.00 ? 66  ILE A HB   5  
ATOM 8707  H HG12 . ILE A 1 66  ? -3.087  5.955   0.002   1.00 0.00 ? 66  ILE A HG12 5  
ATOM 8708  H HG13 . ILE A 1 66  ? -4.042  4.481   -0.114  1.00 0.00 ? 66  ILE A HG13 5  
ATOM 8709  H HG21 . ILE A 1 66  ? -1.484  6.249   -2.607  1.00 0.00 ? 66  ILE A HG21 5  
ATOM 8710  H HG22 . ILE A 1 66  ? -0.971  5.976   -0.943  1.00 0.00 ? 66  ILE A HG22 5  
ATOM 8711  H HG23 . ILE A 1 66  ? -0.478  4.855   -2.212  1.00 0.00 ? 66  ILE A HG23 5  
ATOM 8712  H HD11 . ILE A 1 66  ? -1.260  4.800   0.965   1.00 0.00 ? 66  ILE A HD11 5  
ATOM 8713  H HD12 . ILE A 1 66  ? -2.713  4.288   1.823   1.00 0.00 ? 66  ILE A HD12 5  
ATOM 8714  H HD13 . ILE A 1 66  ? -1.985  3.232   0.612   1.00 0.00 ? 66  ILE A HD13 5  
ATOM 8715  N N    . PRO A 1 67  ? -3.056  5.887   -4.849  1.00 0.00 ? 67  PRO A N    5  
ATOM 8716  C CA   . PRO A 1 67  ? -2.544  5.856   -6.223  1.00 0.00 ? 67  PRO A CA   5  
ATOM 8717  C C    . PRO A 1 67  ? -1.027  5.712   -6.274  1.00 0.00 ? 67  PRO A C    5  
ATOM 8718  O O    . PRO A 1 67  ? -0.295  6.582   -5.800  1.00 0.00 ? 67  PRO A O    5  
ATOM 8719  C CB   . PRO A 1 67  ? -2.972  7.212   -6.791  1.00 0.00 ? 67  PRO A CB   5  
ATOM 8720  C CG   . PRO A 1 67  ? -3.100  8.098   -5.600  1.00 0.00 ? 67  PRO A CG   5  
ATOM 8721  C CD   . PRO A 1 67  ? -3.567  7.216   -4.475  1.00 0.00 ? 67  PRO A CD   5  
ATOM 8722  H HA   . PRO A 1 67  ? -3.000  5.063   -6.798  1.00 0.00 ? 67  PRO A HA   5  
ATOM 8723  H HB2  . PRO A 1 67  ? -2.217  7.573   -7.474  1.00 0.00 ? 67  PRO A HB2  5  
ATOM 8724  H HB3  . PRO A 1 67  ? -3.914  7.108   -7.308  1.00 0.00 ? 67  PRO A HB3  5  
ATOM 8725  H HG2  . PRO A 1 67  ? -2.141  8.533   -5.362  1.00 0.00 ? 67  PRO A HG2  5  
ATOM 8726  H HG3  . PRO A 1 67  ? -3.827  8.872   -5.795  1.00 0.00 ? 67  PRO A HG3  5  
ATOM 8727  H HD2  . PRO A 1 67  ? -3.143  7.543   -3.538  1.00 0.00 ? 67  PRO A HD2  5  
ATOM 8728  H HD3  . PRO A 1 67  ? -4.646  7.212   -4.423  1.00 0.00 ? 67  PRO A HD3  5  
ATOM 8729  N N    . LEU A 1 68  ? -0.561  4.610   -6.850  1.00 0.00 ? 68  LEU A N    5  
ATOM 8730  C CA   . LEU A 1 68  ? 0.870   4.352   -6.964  1.00 0.00 ? 68  LEU A CA   5  
ATOM 8731  C C    . LEU A 1 68  ? 1.442   5.001   -8.220  1.00 0.00 ? 68  LEU A C    5  
ATOM 8732  O O    . LEU A 1 68  ? 2.622   5.350   -8.269  1.00 0.00 ? 68  LEU A O    5  
ATOM 8733  C CB   . LEU A 1 68  ? 1.137   2.846   -6.987  1.00 0.00 ? 68  LEU A CB   5  
ATOM 8734  C CG   . LEU A 1 68  ? 0.890   2.100   -5.675  1.00 0.00 ? 68  LEU A CG   5  
ATOM 8735  C CD1  . LEU A 1 68  ? 0.698   0.614   -5.934  1.00 0.00 ? 68  LEU A CD1  5  
ATOM 8736  C CD2  . LEU A 1 68  ? 2.040   2.331   -4.706  1.00 0.00 ? 68  LEU A CD2  5  
ATOM 8737  H H    . LEU A 1 68  ? -1.194  3.953   -7.209  1.00 0.00 ? 68  LEU A H    5  
ATOM 8738  H HA   . LEU A 1 68  ? 1.353   4.782   -6.099  1.00 0.00 ? 68  LEU A HA   5  
ATOM 8739  H HB2  . LEU A 1 68  ? 0.499   2.409   -7.740  1.00 0.00 ? 68  LEU A HB2  5  
ATOM 8740  H HB3  . LEU A 1 68  ? 2.171   2.698   -7.263  1.00 0.00 ? 68  LEU A HB3  5  
ATOM 8741  H HG   . LEU A 1 68  ? -0.014  2.478   -5.218  1.00 0.00 ? 68  LEU A HG   5  
ATOM 8742  H HD11 . LEU A 1 68  ? -0.238  0.456   -6.447  1.00 0.00 ? 68  LEU A HD11 5  
ATOM 8743  H HD12 . LEU A 1 68  ? 0.687   0.083   -4.993  1.00 0.00 ? 68  LEU A HD12 5  
ATOM 8744  H HD13 . LEU A 1 68  ? 1.511   0.247   -6.543  1.00 0.00 ? 68  LEU A HD13 5  
ATOM 8745  H HD21 . LEU A 1 68  ? 2.945   1.906   -5.114  1.00 0.00 ? 68  LEU A HD21 5  
ATOM 8746  H HD22 . LEU A 1 68  ? 1.815   1.858   -3.761  1.00 0.00 ? 68  LEU A HD22 5  
ATOM 8747  H HD23 . LEU A 1 68  ? 2.176   3.392   -4.554  1.00 0.00 ? 68  LEU A HD23 5  
ATOM 8748  N N    . LEU A 1 69  ? 0.599   5.160   -9.234  1.00 0.00 ? 69  LEU A N    5  
ATOM 8749  C CA   . LEU A 1 69  ? 1.020   5.769   -10.491 1.00 0.00 ? 69  LEU A CA   5  
ATOM 8750  C C    . LEU A 1 69  ? 1.735   7.093   -10.241 1.00 0.00 ? 69  LEU A C    5  
ATOM 8751  O O    . LEU A 1 69  ? 2.432   7.608   -11.116 1.00 0.00 ? 69  LEU A O    5  
ATOM 8752  C CB   . LEU A 1 69  ? -0.189  5.993   -11.402 1.00 0.00 ? 69  LEU A CB   5  
ATOM 8753  C CG   . LEU A 1 69  ? -0.045  7.099   -12.448 1.00 0.00 ? 69  LEU A CG   5  
ATOM 8754  C CD1  . LEU A 1 69  ? 0.949   6.690   -13.524 1.00 0.00 ? 69  LEU A CD1  5  
ATOM 8755  C CD2  . LEU A 1 69  ? -1.396  7.429   -13.064 1.00 0.00 ? 69  LEU A CD2  5  
ATOM 8756  H H    . LEU A 1 69  ? -0.329  4.862   -9.136  1.00 0.00 ? 69  LEU A H    5  
ATOM 8757  H HA   . LEU A 1 69  ? 1.705   5.090   -10.975 1.00 0.00 ? 69  LEU A HA   5  
ATOM 8758  H HB2  . LEU A 1 69  ? -0.385  5.069   -11.923 1.00 0.00 ? 69  LEU A HB2  5  
ATOM 8759  H HB3  . LEU A 1 69  ? -1.034  6.238   -10.774 1.00 0.00 ? 69  LEU A HB3  5  
ATOM 8760  H HG   . LEU A 1 69  ? 0.332   7.992   -11.969 1.00 0.00 ? 69  LEU A HG   5  
ATOM 8761  H HD11 . LEU A 1 69  ? 1.154   7.535   -14.164 1.00 0.00 ? 69  LEU A HD11 5  
ATOM 8762  H HD12 . LEU A 1 69  ? 0.531   5.886   -14.112 1.00 0.00 ? 69  LEU A HD12 5  
ATOM 8763  H HD13 . LEU A 1 69  ? 1.866   6.358   -13.060 1.00 0.00 ? 69  LEU A HD13 5  
ATOM 8764  H HD21 . LEU A 1 69  ? -1.801  6.547   -13.537 1.00 0.00 ? 69  LEU A HD21 5  
ATOM 8765  H HD22 . LEU A 1 69  ? -1.274  8.209   -13.801 1.00 0.00 ? 69  LEU A HD22 5  
ATOM 8766  H HD23 . LEU A 1 69  ? -2.072  7.767   -12.291 1.00 0.00 ? 69  LEU A HD23 5  
ATOM 8767  N N    . SER A 1 70  ? 1.559   7.639   -9.042  1.00 0.00 ? 70  SER A N    5  
ATOM 8768  C CA   . SER A 1 70  ? 2.187   8.903   -8.677  1.00 0.00 ? 70  SER A CA   5  
ATOM 8769  C C    . SER A 1 70  ? 3.369   8.673   -7.741  1.00 0.00 ? 70  SER A C    5  
ATOM 8770  O O    . SER A 1 70  ? 4.275   9.502   -7.652  1.00 0.00 ? 70  SER A O    5  
ATOM 8771  C CB   . SER A 1 70  ? 1.167   9.830   -8.012  1.00 0.00 ? 70  SER A CB   5  
ATOM 8772  O OG   . SER A 1 70  ? 0.455   9.154   -6.990  1.00 0.00 ? 70  SER A OG   5  
ATOM 8773  H H    . SER A 1 70  ? 0.992   7.180   -8.387  1.00 0.00 ? 70  SER A H    5  
ATOM 8774  H HA   . SER A 1 70  ? 2.545   9.368   -9.583  1.00 0.00 ? 70  SER A HA   5  
ATOM 8775  H HB2  . SER A 1 70  ? 1.681   10.674  -7.579  1.00 0.00 ? 70  SER A HB2  5  
ATOM 8776  H HB3  . SER A 1 70  ? 0.464   10.179  -8.755  1.00 0.00 ? 70  SER A HB3  5  
ATOM 8777  H HG   . SER A 1 70  ? 0.655   9.555   -6.141  1.00 0.00 ? 70  SER A HG   5  
ATOM 8778  N N    . PHE A 1 71  ? 3.352   7.542   -7.043  1.00 0.00 ? 71  PHE A N    5  
ATOM 8779  C CA   . PHE A 1 71  ? 4.421   7.202   -6.112  1.00 0.00 ? 71  PHE A CA   5  
ATOM 8780  C C    . PHE A 1 71  ? 5.552   6.469   -6.826  1.00 0.00 ? 71  PHE A C    5  
ATOM 8781  O O    . PHE A 1 71  ? 5.377   5.970   -7.938  1.00 0.00 ? 71  PHE A O    5  
ATOM 8782  C CB   . PHE A 1 71  ? 3.877   6.338   -4.972  1.00 0.00 ? 71  PHE A CB   5  
ATOM 8783  C CG   . PHE A 1 71  ? 3.126   7.120   -3.933  1.00 0.00 ? 71  PHE A CG   5  
ATOM 8784  C CD1  . PHE A 1 71  ? 1.931   7.746   -4.248  1.00 0.00 ? 71  PHE A CD1  5  
ATOM 8785  C CD2  . PHE A 1 71  ? 3.614   7.228   -2.641  1.00 0.00 ? 71  PHE A CD2  5  
ATOM 8786  C CE1  . PHE A 1 71  ? 1.238   8.467   -3.294  1.00 0.00 ? 71  PHE A CE1  5  
ATOM 8787  C CE2  . PHE A 1 71  ? 2.925   7.948   -1.682  1.00 0.00 ? 71  PHE A CE2  5  
ATOM 8788  C CZ   . PHE A 1 71  ? 1.735   8.567   -2.009  1.00 0.00 ? 71  PHE A CZ   5  
ATOM 8789  H H    . PHE A 1 71  ? 2.601   6.922   -7.158  1.00 0.00 ? 71  PHE A H    5  
ATOM 8790  H HA   . PHE A 1 71  ? 4.807   8.123   -5.702  1.00 0.00 ? 71  PHE A HA   5  
ATOM 8791  H HB2  . PHE A 1 71  ? 3.205   5.598   -5.380  1.00 0.00 ? 71  PHE A HB2  5  
ATOM 8792  H HB3  . PHE A 1 71  ? 4.701   5.840   -4.483  1.00 0.00 ? 71  PHE A HB3  5  
ATOM 8793  H HD1  . PHE A 1 71  ? 1.540   7.668   -5.252  1.00 0.00 ? 71  PHE A HD1  5  
ATOM 8794  H HD2  . PHE A 1 71  ? 4.546   6.744   -2.384  1.00 0.00 ? 71  PHE A HD2  5  
ATOM 8795  H HE1  . PHE A 1 71  ? 0.307   8.950   -3.552  1.00 0.00 ? 71  PHE A HE1  5  
ATOM 8796  H HE2  . PHE A 1 71  ? 3.317   8.023   -0.679  1.00 0.00 ? 71  PHE A HE2  5  
ATOM 8797  H HZ   . PHE A 1 71  ? 1.196   9.129   -1.262  1.00 0.00 ? 71  PHE A HZ   5  
ATOM 8798  N N    . ARG A 1 72  ? 6.711   6.409   -6.180  1.00 0.00 ? 72  ARG A N    5  
ATOM 8799  C CA   . ARG A 1 72  ? 7.872   5.738   -6.754  1.00 0.00 ? 72  ARG A CA   5  
ATOM 8800  C C    . ARG A 1 72  ? 8.461   4.733   -5.768  1.00 0.00 ? 72  ARG A C    5  
ATOM 8801  O O    . ARG A 1 72  ? 9.544   4.945   -5.222  1.00 0.00 ? 72  ARG A O    5  
ATOM 8802  C CB   . ARG A 1 72  ? 8.936   6.764   -7.150  1.00 0.00 ? 72  ARG A CB   5  
ATOM 8803  C CG   . ARG A 1 72  ? 9.198   7.813   -6.082  1.00 0.00 ? 72  ARG A CG   5  
ATOM 8804  C CD   . ARG A 1 72  ? 9.753   9.094   -6.685  1.00 0.00 ? 72  ARG A CD   5  
ATOM 8805  N NE   . ARG A 1 72  ? 11.164  8.966   -7.039  1.00 0.00 ? 72  ARG A NE   5  
ATOM 8806  C CZ   . ARG A 1 72  ? 12.158  9.159   -6.179  1.00 0.00 ? 72  ARG A CZ   5  
ATOM 8807  N NH1  . ARG A 1 72  ? 11.896  9.488   -4.921  1.00 0.00 ? 72  ARG A NH1  5  
ATOM 8808  N NH2  . ARG A 1 72  ? 13.416  9.024   -6.576  1.00 0.00 ? 72  ARG A NH2  5  
ATOM 8809  H H    . ARG A 1 72  ? 6.789   6.826   -5.296  1.00 0.00 ? 72  ARG A H    5  
ATOM 8810  H HA   . ARG A 1 72  ? 7.547   5.210   -7.637  1.00 0.00 ? 72  ARG A HA   5  
ATOM 8811  H HB2  . ARG A 1 72  ? 9.862   6.246   -7.349  1.00 0.00 ? 72  ARG A HB2  5  
ATOM 8812  H HB3  . ARG A 1 72  ? 8.615   7.268   -8.049  1.00 0.00 ? 72  ARG A HB3  5  
ATOM 8813  H HG2  . ARG A 1 72  ? 8.270   8.039   -5.577  1.00 0.00 ? 72  ARG A HG2  5  
ATOM 8814  H HG3  . ARG A 1 72  ? 9.911   7.421   -5.372  1.00 0.00 ? 72  ARG A HG3  5  
ATOM 8815  H HD2  . ARG A 1 72  ? 9.189   9.332   -7.575  1.00 0.00 ? 72  ARG A HD2  5  
ATOM 8816  H HD3  . ARG A 1 72  ? 9.642   9.892   -5.965  1.00 0.00 ? 72  ARG A HD3  5  
ATOM 8817  H HE   . ARG A 1 72  ? 11.380  8.725   -7.963  1.00 0.00 ? 72  ARG A HE   5  
ATOM 8818  H HH11 . ARG A 1 72  ? 10.948  9.589   -4.618  1.00 0.00 ? 72  ARG A HH11 5  
ATOM 8819  H HH12 . ARG A 1 72  ? 12.646  9.631   -4.275  1.00 0.00 ? 72  ARG A HH12 5  
ATOM 8820  H HH21 . ARG A 1 72  ? 13.618  8.777   -7.523  1.00 0.00 ? 72  ARG A HH21 5  
ATOM 8821  H HH22 . ARG A 1 72  ? 14.163  9.170   -5.928  1.00 0.00 ? 72  ARG A HH22 5  
ATOM 8822  N N    . VAL A 1 73  ? 7.741   3.638   -5.545  1.00 0.00 ? 73  VAL A N    5  
ATOM 8823  C CA   . VAL A 1 73  ? 8.192   2.600   -4.627  1.00 0.00 ? 73  VAL A CA   5  
ATOM 8824  C C    . VAL A 1 73  ? 9.692   2.362   -4.761  1.00 0.00 ? 73  VAL A C    5  
ATOM 8825  O O    . VAL A 1 73  ? 10.250  2.451   -5.854  1.00 0.00 ? 73  VAL A O    5  
ATOM 8826  C CB   . VAL A 1 73  ? 7.449   1.273   -4.870  1.00 0.00 ? 73  VAL A CB   5  
ATOM 8827  C CG1  . VAL A 1 73  ? 7.892   0.220   -3.866  1.00 0.00 ? 73  VAL A CG1  5  
ATOM 8828  C CG2  . VAL A 1 73  ? 5.944   1.486   -4.803  1.00 0.00 ? 73  VAL A CG2  5  
ATOM 8829  H H    . VAL A 1 73  ? 6.886   3.526   -6.011  1.00 0.00 ? 73  VAL A H    5  
ATOM 8830  H HA   . VAL A 1 73  ? 7.978   2.929   -3.620  1.00 0.00 ? 73  VAL A HA   5  
ATOM 8831  H HB   . VAL A 1 73  ? 7.698   0.921   -5.861  1.00 0.00 ? 73  VAL A HB   5  
ATOM 8832  H HG11 . VAL A 1 73  ? 7.288   -0.667  -3.985  1.00 0.00 ? 73  VAL A HG11 5  
ATOM 8833  H HG12 . VAL A 1 73  ? 8.931   -0.024  -4.035  1.00 0.00 ? 73  VAL A HG12 5  
ATOM 8834  H HG13 . VAL A 1 73  ? 7.771   0.605   -2.864  1.00 0.00 ? 73  VAL A HG13 5  
ATOM 8835  H HG21 . VAL A 1 73  ? 5.506   1.268   -5.766  1.00 0.00 ? 73  VAL A HG21 5  
ATOM 8836  H HG22 . VAL A 1 73  ? 5.522   0.829   -4.057  1.00 0.00 ? 73  VAL A HG22 5  
ATOM 8837  H HG23 . VAL A 1 73  ? 5.737   2.513   -4.538  1.00 0.00 ? 73  VAL A HG23 5  
ATOM 8838  N N    . ALA A 1 74  ? 10.340  2.057   -3.641  1.00 0.00 ? 74  ALA A N    5  
ATOM 8839  C CA   . ALA A 1 74  ? 11.775  1.803   -3.633  1.00 0.00 ? 74  ALA A CA   5  
ATOM 8840  C C    . ALA A 1 74  ? 12.230  1.263   -2.281  1.00 0.00 ? 74  ALA A C    5  
ATOM 8841  O O    . ALA A 1 74  ? 11.900  1.823   -1.236  1.00 0.00 ? 74  ALA A O    5  
ATOM 8842  C CB   . ALA A 1 74  ? 12.538  3.074   -3.980  1.00 0.00 ? 74  ALA A CB   5  
ATOM 8843  H H    . ALA A 1 74  ? 9.840   2.001   -2.800  1.00 0.00 ? 74  ALA A H    5  
ATOM 8844  H HA   . ALA A 1 74  ? 11.987  1.066   -4.394  1.00 0.00 ? 74  ALA A HA   5  
ATOM 8845  H HB1  . ALA A 1 74  ? 12.867  3.554   -3.071  1.00 0.00 ? 74  ALA A HB1  5  
ATOM 8846  H HB2  . ALA A 1 74  ? 13.395  2.823   -4.587  1.00 0.00 ? 74  ALA A HB2  5  
ATOM 8847  H HB3  . ALA A 1 74  ? 11.891  3.743   -4.528  1.00 0.00 ? 74  ALA A HB3  5  
ATOM 8848  N N    . ALA A 1 75  ? 12.988  0.172   -2.310  1.00 0.00 ? 75  ALA A N    5  
ATOM 8849  C CA   . ALA A 1 75  ? 13.489  -0.442  -1.087  1.00 0.00 ? 75  ALA A CA   5  
ATOM 8850  C C    . ALA A 1 75  ? 14.013  0.612   -0.117  1.00 0.00 ? 75  ALA A C    5  
ATOM 8851  O O    . ALA A 1 75  ? 14.192  1.773   -0.485  1.00 0.00 ? 75  ALA A O    5  
ATOM 8852  C CB   . ALA A 1 75  ? 14.579  -1.452  -1.411  1.00 0.00 ? 75  ALA A CB   5  
ATOM 8853  H H    . ALA A 1 75  ? 13.217  -0.228  -3.174  1.00 0.00 ? 75  ALA A H    5  
ATOM 8854  H HA   . ALA A 1 75  ? 12.670  -0.971  -0.619  1.00 0.00 ? 75  ALA A HA   5  
ATOM 8855  H HB1  . ALA A 1 75  ? 14.682  -2.147  -0.592  1.00 0.00 ? 75  ALA A HB1  5  
ATOM 8856  H HB2  . ALA A 1 75  ? 14.314  -1.991  -2.310  1.00 0.00 ? 75  ALA A HB2  5  
ATOM 8857  H HB3  . ALA A 1 75  ? 15.515  -0.935  -1.565  1.00 0.00 ? 75  ALA A HB3  5  
ATOM 8858  N N    . VAL A 1 76  ? 14.257  0.200   1.123   1.00 0.00 ? 76  VAL A N    5  
ATOM 8859  C CA   . VAL A 1 76  ? 14.762  1.110   2.145   1.00 0.00 ? 76  VAL A CA   5  
ATOM 8860  C C    . VAL A 1 76  ? 16.285  1.159   2.133   1.00 0.00 ? 76  VAL A C    5  
ATOM 8861  O O    . VAL A 1 76  ? 16.928  0.556   1.274   1.00 0.00 ? 76  VAL A O    5  
ATOM 8862  C CB   . VAL A 1 76  ? 14.283  0.696   3.549   1.00 0.00 ? 76  VAL A CB   5  
ATOM 8863  C CG1  . VAL A 1 76  ? 12.962  1.372   3.884   1.00 0.00 ? 76  VAL A CG1  5  
ATOM 8864  C CG2  . VAL A 1 76  ? 14.157  -0.817  3.645   1.00 0.00 ? 76  VAL A CG2  5  
ATOM 8865  H H    . VAL A 1 76  ? 14.095  -0.737  1.355   1.00 0.00 ? 76  VAL A H    5  
ATOM 8866  H HA   . VAL A 1 76  ? 14.377  2.097   1.933   1.00 0.00 ? 76  VAL A HA   5  
ATOM 8867  H HB   . VAL A 1 76  ? 15.020  1.021   4.269   1.00 0.00 ? 76  VAL A HB   5  
ATOM 8868  H HG11 . VAL A 1 76  ? 13.152  2.276   4.444   1.00 0.00 ? 76  VAL A HG11 5  
ATOM 8869  H HG12 . VAL A 1 76  ? 12.441  1.616   2.970   1.00 0.00 ? 76  VAL A HG12 5  
ATOM 8870  H HG13 . VAL A 1 76  ? 12.356  0.703   4.477   1.00 0.00 ? 76  VAL A HG13 5  
ATOM 8871  H HG21 . VAL A 1 76  ? 14.331  -1.130  4.663   1.00 0.00 ? 76  VAL A HG21 5  
ATOM 8872  H HG22 . VAL A 1 76  ? 13.164  -1.114  3.341   1.00 0.00 ? 76  VAL A HG22 5  
ATOM 8873  H HG23 . VAL A 1 76  ? 14.885  -1.281  2.996   1.00 0.00 ? 76  VAL A HG23 5  
ATOM 8874  N N    . GLN A 1 77  ? 16.856  1.880   3.093   1.00 0.00 ? 77  GLN A N    5  
ATOM 8875  C CA   . GLN A 1 77  ? 18.305  2.008   3.192   1.00 0.00 ? 77  GLN A CA   5  
ATOM 8876  C C    . GLN A 1 77  ? 18.794  1.595   4.577   1.00 0.00 ? 77  GLN A C    5  
ATOM 8877  O O    . GLN A 1 77  ? 18.060  1.653   5.564   1.00 0.00 ? 77  GLN A O    5  
ATOM 8878  C CB   . GLN A 1 77  ? 18.733  3.446   2.895   1.00 0.00 ? 77  GLN A CB   5  
ATOM 8879  C CG   . GLN A 1 77  ? 18.531  3.853   1.444   1.00 0.00 ? 77  GLN A CG   5  
ATOM 8880  C CD   . GLN A 1 77  ? 17.167  4.466   1.195   1.00 0.00 ? 77  GLN A CD   5  
ATOM 8881  O OE1  . GLN A 1 77  ? 16.613  5.149   2.058   1.00 0.00 ? 77  GLN A OE1  5  
ATOM 8882  N NE2  . GLN A 1 77  ? 16.616  4.225   0.011   1.00 0.00 ? 77  GLN A NE2  5  
ATOM 8883  H H    . GLN A 1 77  ? 16.290  2.337   3.748   1.00 0.00 ? 77  GLN A H    5  
ATOM 8884  H HA   . GLN A 1 77  ? 18.747  1.351   2.458   1.00 0.00 ? 77  GLN A HA   5  
ATOM 8885  H HB2  . GLN A 1 77  ? 18.160  4.116   3.518   1.00 0.00 ? 77  GLN A HB2  5  
ATOM 8886  H HB3  . GLN A 1 77  ? 19.781  3.553   3.133   1.00 0.00 ? 77  GLN A HB3  5  
ATOM 8887  H HG2  . GLN A 1 77  ? 19.287  4.577   1.178   1.00 0.00 ? 77  GLN A HG2  5  
ATOM 8888  H HG3  . GLN A 1 77  ? 18.636  2.978   0.820   1.00 0.00 ? 77  GLN A HG3  5  
ATOM 8889  H HE21 . GLN A 1 77  ? 17.115  3.671   -0.626  1.00 0.00 ? 77  GLN A HE21 5  
ATOM 8890  H HE22 . GLN A 1 77  ? 15.735  4.607   -0.176  1.00 0.00 ? 77  GLN A HE22 5  
ATOM 8891  N N    . PRO A 1 78  ? 20.063  1.168   4.654   1.00 0.00 ? 78  PRO A N    5  
ATOM 8892  C CA   . PRO A 1 78  ? 20.679  0.737   5.912   1.00 0.00 ? 78  PRO A CA   5  
ATOM 8893  C C    . PRO A 1 78  ? 20.908  1.899   6.873   1.00 0.00 ? 78  PRO A C    5  
ATOM 8894  O O    . PRO A 1 78  ? 21.426  1.714   7.974   1.00 0.00 ? 78  PRO A O    5  
ATOM 8895  C CB   . PRO A 1 78  ? 22.015  0.139   5.467   1.00 0.00 ? 78  PRO A CB   5  
ATOM 8896  C CG   . PRO A 1 78  ? 22.322  0.817   4.176   1.00 0.00 ? 78  PRO A CG   5  
ATOM 8897  C CD   . PRO A 1 78  ? 20.995  1.073   3.518   1.00 0.00 ? 78  PRO A CD   5  
ATOM 8898  H HA   . PRO A 1 78  ? 20.088  -0.023  6.403   1.00 0.00 ? 78  PRO A HA   5  
ATOM 8899  H HB2  . PRO A 1 78  ? 22.771  0.346   6.212   1.00 0.00 ? 78  PRO A HB2  5  
ATOM 8900  H HB3  . PRO A 1 78  ? 21.912  -0.928  5.338   1.00 0.00 ? 78  PRO A HB3  5  
ATOM 8901  H HG2  . PRO A 1 78  ? 22.835  1.748   4.363   1.00 0.00 ? 78  PRO A HG2  5  
ATOM 8902  H HG3  . PRO A 1 78  ? 22.929  0.171   3.558   1.00 0.00 ? 78  PRO A HG3  5  
ATOM 8903  H HD2  . PRO A 1 78  ? 21.022  1.999   2.962   1.00 0.00 ? 78  PRO A HD2  5  
ATOM 8904  H HD3  . PRO A 1 78  ? 20.730  0.250   2.870   1.00 0.00 ? 78  PRO A HD3  5  
ATOM 8905  N N    . SER A 1 79  ? 20.520  3.097   6.448   1.00 0.00 ? 79  SER A N    5  
ATOM 8906  C CA   . SER A 1 79  ? 20.686  4.291   7.270   1.00 0.00 ? 79  SER A CA   5  
ATOM 8907  C C    . SER A 1 79  ? 19.347  4.750   7.838   1.00 0.00 ? 79  SER A C    5  
ATOM 8908  O O    . SER A 1 79  ? 19.282  5.717   8.598   1.00 0.00 ? 79  SER A O    5  
ATOM 8909  C CB   . SER A 1 79  ? 21.319  5.416   6.449   1.00 0.00 ? 79  SER A CB   5  
ATOM 8910  O OG   . SER A 1 79  ? 22.588  5.033   5.950   1.00 0.00 ? 79  SER A OG   5  
ATOM 8911  H H    . SER A 1 79  ? 20.113  3.181   5.560   1.00 0.00 ? 79  SER A H    5  
ATOM 8912  H HA   . SER A 1 79  ? 21.345  4.040   8.088   1.00 0.00 ? 79  SER A HA   5  
ATOM 8913  H HB2  . SER A 1 79  ? 20.675  5.656   5.616   1.00 0.00 ? 79  SER A HB2  5  
ATOM 8914  H HB3  . SER A 1 79  ? 21.439  6.289   7.074   1.00 0.00 ? 79  SER A HB3  5  
ATOM 8915  H HG   . SER A 1 79  ? 22.475  4.531   5.139   1.00 0.00 ? 79  SER A HG   5  
ATOM 8916  N N    . ASP A 1 80  ? 18.282  4.051   7.464   1.00 0.00 ? 80  ASP A N    5  
ATOM 8917  C CA   . ASP A 1 80  ? 16.943  4.386   7.936   1.00 0.00 ? 80  ASP A CA   5  
ATOM 8918  C C    . ASP A 1 80  ? 16.633  3.666   9.245   1.00 0.00 ? 80  ASP A C    5  
ATOM 8919  O O    . ASP A 1 80  ? 17.334  2.732   9.632   1.00 0.00 ? 80  ASP A O    5  
ATOM 8920  C CB   . ASP A 1 80  ? 15.900  4.020   6.879   1.00 0.00 ? 80  ASP A CB   5  
ATOM 8921  C CG   . ASP A 1 80  ? 15.624  5.160   5.919   1.00 0.00 ? 80  ASP A CG   5  
ATOM 8922  O OD1  . ASP A 1 80  ? 16.596  5.790   5.452   1.00 0.00 ? 80  ASP A OD1  5  
ATOM 8923  O OD2  . ASP A 1 80  ? 14.437  5.423   5.635   1.00 0.00 ? 80  ASP A OD2  5  
ATOM 8924  H H    . ASP A 1 80  ? 18.398  3.291   6.856   1.00 0.00 ? 80  ASP A H    5  
ATOM 8925  H HA   . ASP A 1 80  ? 16.909  5.451   8.109   1.00 0.00 ? 80  ASP A HA   5  
ATOM 8926  H HB2  . ASP A 1 80  ? 16.255  3.173   6.310   1.00 0.00 ? 80  ASP A HB2  5  
ATOM 8927  H HB3  . ASP A 1 80  ? 14.976  3.755   7.371   1.00 0.00 ? 80  ASP A HB3  5  
ATOM 8928  N N    . ASN A 1 81  ? 15.579  4.109   9.923   1.00 0.00 ? 81  ASN A N    5  
ATOM 8929  C CA   . ASN A 1 81  ? 15.177  3.508   11.190  1.00 0.00 ? 81  ASN A CA   5  
ATOM 8930  C C    . ASN A 1 81  ? 14.226  2.338   10.959  1.00 0.00 ? 81  ASN A C    5  
ATOM 8931  O O    . ASN A 1 81  ? 13.175  2.245   11.595  1.00 0.00 ? 81  ASN A O    5  
ATOM 8932  C CB   . ASN A 1 81  ? 14.510  4.554   12.085  1.00 0.00 ? 81  ASN A CB   5  
ATOM 8933  C CG   . ASN A 1 81  ? 15.513  5.506   12.709  1.00 0.00 ? 81  ASN A CG   5  
ATOM 8934  O OD1  . ASN A 1 81  ? 15.843  5.391   13.890  1.00 0.00 ? 81  ASN A OD1  5  
ATOM 8935  N ND2  . ASN A 1 81  ? 16.003  6.452   11.916  1.00 0.00 ? 81  ASN A ND2  5  
ATOM 8936  H H    . ASN A 1 81  ? 15.059  4.858   9.563   1.00 0.00 ? 81  ASN A H    5  
ATOM 8937  H HA   . ASN A 1 81  ? 16.067  3.143   11.680  1.00 0.00 ? 81  ASN A HA   5  
ATOM 8938  H HB2  . ASN A 1 81  ? 13.814  5.133   11.495  1.00 0.00 ? 81  ASN A HB2  5  
ATOM 8939  H HB3  . ASN A 1 81  ? 13.975  4.053   12.878  1.00 0.00 ? 81  ASN A HB3  5  
ATOM 8940  H HD21 . ASN A 1 81  ? 15.695  6.483   10.986  1.00 0.00 ? 81  ASN A HD21 5  
ATOM 8941  H HD22 . ASN A 1 81  ? 16.654  7.080   12.294  1.00 0.00 ? 81  ASN A HD22 5  
ATOM 8942  N N    . ILE A 1 82  ? 14.601  1.449   10.047  1.00 0.00 ? 82  ILE A N    5  
ATOM 8943  C CA   . ILE A 1 82  ? 13.782  0.284   9.734   1.00 0.00 ? 82  ILE A CA   5  
ATOM 8944  C C    . ILE A 1 82  ? 14.224  -0.932  10.541  1.00 0.00 ? 82  ILE A C    5  
ATOM 8945  O O    . ILE A 1 82  ? 15.406  -1.273  10.572  1.00 0.00 ? 82  ILE A O    5  
ATOM 8946  C CB   . ILE A 1 82  ? 13.843  -0.060  8.234   1.00 0.00 ? 82  ILE A CB   5  
ATOM 8947  C CG1  . ILE A 1 82  ? 13.437  1.152   7.393   1.00 0.00 ? 82  ILE A CG1  5  
ATOM 8948  C CG2  . ILE A 1 82  ? 12.944  -1.249  7.927   1.00 0.00 ? 82  ILE A CG2  5  
ATOM 8949  C CD1  . ILE A 1 82  ? 11.982  1.535   7.548   1.00 0.00 ? 82  ILE A CD1  5  
ATOM 8950  H H    . ILE A 1 82  ? 15.449  1.578   9.573   1.00 0.00 ? 82  ILE A H    5  
ATOM 8951  H HA   . ILE A 1 82  ? 12.758  0.519   9.988   1.00 0.00 ? 82  ILE A HA   5  
ATOM 8952  H HB   . ILE A 1 82  ? 14.858  -0.334  7.991   1.00 0.00 ? 82  ILE A HB   5  
ATOM 8953  H HG12 . ILE A 1 82  ? 14.036  2.001   7.684   1.00 0.00 ? 82  ILE A HG12 5  
ATOM 8954  H HG13 . ILE A 1 82  ? 13.614  0.933   6.350   1.00 0.00 ? 82  ILE A HG13 5  
ATOM 8955  H HG21 . ILE A 1 82  ? 11.995  -0.896  7.553   1.00 0.00 ? 82  ILE A HG21 5  
ATOM 8956  H HG22 . ILE A 1 82  ? 13.414  -1.871  7.180   1.00 0.00 ? 82  ILE A HG22 5  
ATOM 8957  H HG23 . ILE A 1 82  ? 12.786  -1.823  8.827   1.00 0.00 ? 82  ILE A HG23 5  
ATOM 8958  H HD11 . ILE A 1 82  ? 11.903  2.606   7.676   1.00 0.00 ? 82  ILE A HD11 5  
ATOM 8959  H HD12 . ILE A 1 82  ? 11.435  1.238   6.666   1.00 0.00 ? 82  ILE A HD12 5  
ATOM 8960  H HD13 . ILE A 1 82  ? 11.569  1.039   8.413   1.00 0.00 ? 82  ILE A HD13 5  
ATOM 8961  N N    . SER A 1 83  ? 13.265  -1.583  11.192  1.00 0.00 ? 83  SER A N    5  
ATOM 8962  C CA   . SER A 1 83  ? 13.555  -2.761  12.002  1.00 0.00 ? 83  SER A CA   5  
ATOM 8963  C C    . SER A 1 83  ? 13.692  -4.002  11.126  1.00 0.00 ? 83  SER A C    5  
ATOM 8964  O O    . SER A 1 83  ? 14.532  -4.866  11.381  1.00 0.00 ? 83  SER A O    5  
ATOM 8965  C CB   . SER A 1 83  ? 12.454  -2.975  13.041  1.00 0.00 ? 83  SER A CB   5  
ATOM 8966  O OG   . SER A 1 83  ? 12.479  -1.959  14.029  1.00 0.00 ? 83  SER A OG   5  
ATOM 8967  H H    . SER A 1 83  ? 12.341  -1.262  11.128  1.00 0.00 ? 83  SER A H    5  
ATOM 8968  H HA   . SER A 1 83  ? 14.492  -2.589  12.512  1.00 0.00 ? 83  SER A HA   5  
ATOM 8969  H HB2  . SER A 1 83  ? 11.492  -2.959  12.552  1.00 0.00 ? 83  SER A HB2  5  
ATOM 8970  H HB3  . SER A 1 83  ? 12.597  -3.932  13.522  1.00 0.00 ? 83  SER A HB3  5  
ATOM 8971  H HG   . SER A 1 83  ? 11.633  -1.507  14.046  1.00 0.00 ? 83  SER A HG   5  
ATOM 8972  N N    . ARG A 1 84  ? 12.861  -4.083  10.092  1.00 0.00 ? 84  ARG A N    5  
ATOM 8973  C CA   . ARG A 1 84  ? 12.887  -5.219  9.178   1.00 0.00 ? 84  ARG A CA   5  
ATOM 8974  C C    . ARG A 1 84  ? 13.950  -5.026  8.101   1.00 0.00 ? 84  ARG A C    5  
ATOM 8975  O O    . ARG A 1 84  ? 14.309  -3.898  7.763   1.00 0.00 ? 84  ARG A O    5  
ATOM 8976  C CB   . ARG A 1 84  ? 11.516  -5.409  8.528   1.00 0.00 ? 84  ARG A CB   5  
ATOM 8977  C CG   . ARG A 1 84  ? 10.422  -5.790  9.513   1.00 0.00 ? 84  ARG A CG   5  
ATOM 8978  C CD   . ARG A 1 84  ? 9.732   -4.560  10.082  1.00 0.00 ? 84  ARG A CD   5  
ATOM 8979  N NE   . ARG A 1 84  ? 8.768   -4.905  11.122  1.00 0.00 ? 84  ARG A NE   5  
ATOM 8980  C CZ   . ARG A 1 84  ? 9.104   -5.147  12.385  1.00 0.00 ? 84  ARG A CZ   5  
ATOM 8981  N NH1  . ARG A 1 84  ? 10.373  -5.080  12.761  1.00 0.00 ? 84  ARG A NH1  5  
ATOM 8982  N NH2  . ARG A 1 84  ? 8.168   -5.455  13.274  1.00 0.00 ? 84  ARG A NH2  5  
ATOM 8983  H H    . ARG A 1 84  ? 12.214  -3.363  9.941   1.00 0.00 ? 84  ARG A H    5  
ATOM 8984  H HA   . ARG A 1 84  ? 13.129  -6.101  9.752   1.00 0.00 ? 84  ARG A HA   5  
ATOM 8985  H HB2  . ARG A 1 84  ? 11.228  -4.487  8.044   1.00 0.00 ? 84  ARG A HB2  5  
ATOM 8986  H HB3  . ARG A 1 84  ? 11.588  -6.189  7.785   1.00 0.00 ? 84  ARG A HB3  5  
ATOM 8987  H HG2  . ARG A 1 84  ? 9.688   -6.397  9.004   1.00 0.00 ? 84  ARG A HG2  5  
ATOM 8988  H HG3  . ARG A 1 84  ? 10.860  -6.353  10.323  1.00 0.00 ? 84  ARG A HG3  5  
ATOM 8989  H HD2  . ARG A 1 84  ? 10.481  -3.905  10.502  1.00 0.00 ? 84  ARG A HD2  5  
ATOM 8990  H HD3  . ARG A 1 84  ? 9.217   -4.050  9.281   1.00 0.00 ? 84  ARG A HD3  5  
ATOM 8991  H HE   . ARG A 1 84  ? 7.824   -4.960  10.866  1.00 0.00 ? 84  ARG A HE   5  
ATOM 8992  H HH11 . ARG A 1 84  ? 11.080  -4.847  12.093  1.00 0.00 ? 84  ARG A HH11 5  
ATOM 8993  H HH12 . ARG A 1 84  ? 10.623  -5.261  13.712  1.00 0.00 ? 84  ARG A HH12 5  
ATOM 8994  H HH21 . ARG A 1 84  ? 7.210   -5.506  12.994  1.00 0.00 ? 84  ARG A HH21 5  
ATOM 8995  H HH22 . ARG A 1 84  ? 8.422   -5.637  14.223  1.00 0.00 ? 84  ARG A HH22 5  
ATOM 8996  N N    . LYS A 1 85  ? 14.451  -6.134  7.566   1.00 0.00 ? 85  LYS A N    5  
ATOM 8997  C CA   . LYS A 1 85  ? 15.473  -6.088  6.526   1.00 0.00 ? 85  LYS A CA   5  
ATOM 8998  C C    . LYS A 1 85  ? 14.847  -5.833  5.159   1.00 0.00 ? 85  LYS A C    5  
ATOM 8999  O O    . LYS A 1 85  ? 15.103  -4.806  4.530   1.00 0.00 ? 85  LYS A O    5  
ATOM 9000  C CB   . LYS A 1 85  ? 16.263  -7.398  6.501   1.00 0.00 ? 85  LYS A CB   5  
ATOM 9001  C CG   . LYS A 1 85  ? 17.484  -7.390  7.404   1.00 0.00 ? 85  LYS A CG   5  
ATOM 9002  C CD   . LYS A 1 85  ? 18.582  -8.293  6.866   1.00 0.00 ? 85  LYS A CD   5  
ATOM 9003  C CE   . LYS A 1 85  ? 19.519  -7.537  5.937   1.00 0.00 ? 85  LYS A CE   5  
ATOM 9004  N NZ   . LYS A 1 85  ? 20.329  -6.524  6.669   1.00 0.00 ? 85  LYS A NZ   5  
ATOM 9005  H H    . LYS A 1 85  ? 14.125  -7.005  7.877   1.00 0.00 ? 85  LYS A H    5  
ATOM 9006  H HA   . LYS A 1 85  ? 16.146  -5.276  6.758   1.00 0.00 ? 85  LYS A HA   5  
ATOM 9007  H HB2  . LYS A 1 85  ? 15.614  -8.202  6.815   1.00 0.00 ? 85  LYS A HB2  5  
ATOM 9008  H HB3  . LYS A 1 85  ? 16.591  -7.587  5.489   1.00 0.00 ? 85  LYS A HB3  5  
ATOM 9009  H HG2  . LYS A 1 85  ? 17.863  -6.382  7.473   1.00 0.00 ? 85  LYS A HG2  5  
ATOM 9010  H HG3  . LYS A 1 85  ? 17.195  -7.736  8.387   1.00 0.00 ? 85  LYS A HG3  5  
ATOM 9011  H HD2  . LYS A 1 85  ? 19.153  -8.684  7.695   1.00 0.00 ? 85  LYS A HD2  5  
ATOM 9012  H HD3  . LYS A 1 85  ? 18.129  -9.109  6.321   1.00 0.00 ? 85  LYS A HD3  5  
ATOM 9013  H HE2  . LYS A 1 85  ? 20.184  -8.243  5.464   1.00 0.00 ? 85  LYS A HE2  5  
ATOM 9014  H HE3  . LYS A 1 85  ? 18.930  -7.037  5.182   1.00 0.00 ? 85  LYS A HE3  5  
ATOM 9015  H HZ1  . LYS A 1 85  ? 21.341  -6.739  6.574   1.00 0.00 ? 85  LYS A HZ1  5  
ATOM 9016  H HZ2  . LYS A 1 85  ? 20.077  -6.528  7.679   1.00 0.00 ? 85  LYS A HZ2  5  
ATOM 9017  H HZ3  . LYS A 1 85  ? 20.149  -5.575  6.283   1.00 0.00 ? 85  LYS A HZ3  5  
ATOM 9018  N N    . HIS A 1 86  ? 14.023  -6.772  4.705   1.00 0.00 ? 86  HIS A N    5  
ATOM 9019  C CA   . HIS A 1 86  ? 13.359  -6.648  3.413   1.00 0.00 ? 86  HIS A CA   5  
ATOM 9020  C C    . HIS A 1 86  ? 12.157  -5.713  3.508   1.00 0.00 ? 86  HIS A C    5  
ATOM 9021  O O    . HIS A 1 86  ? 11.024  -6.158  3.694   1.00 0.00 ? 86  HIS A O    5  
ATOM 9022  C CB   . HIS A 1 86  ? 12.913  -8.021  2.910   1.00 0.00 ? 86  HIS A CB   5  
ATOM 9023  C CG   . HIS A 1 86  ? 13.780  -9.145  3.390   1.00 0.00 ? 86  HIS A CG   5  
ATOM 9024  N ND1  . HIS A 1 86  ? 15.055  -9.367  2.915   1.00 0.00 ? 86  HIS A ND1  5  
ATOM 9025  C CD2  . HIS A 1 86  ? 13.548  -10.111 4.309   1.00 0.00 ? 86  HIS A CD2  5  
ATOM 9026  C CE1  . HIS A 1 86  ? 15.570  -10.422 3.520   1.00 0.00 ? 86  HIS A CE1  5  
ATOM 9027  N NE2  . HIS A 1 86  ? 14.675  -10.892 4.371   1.00 0.00 ? 86  HIS A NE2  5  
ATOM 9028  H H    . HIS A 1 86  ? 13.859  -7.568  5.253   1.00 0.00 ? 86  HIS A H    5  
ATOM 9029  H HA   . HIS A 1 86  ? 14.068  -6.231  2.714   1.00 0.00 ? 86  HIS A HA   5  
ATOM 9030  H HB2  . HIS A 1 86  ? 11.906  -8.212  3.250   1.00 0.00 ? 86  HIS A HB2  5  
ATOM 9031  H HB3  . HIS A 1 86  ? 12.931  -8.025  1.830   1.00 0.00 ? 86  HIS A HB3  5  
ATOM 9032  H HD1  . HIS A 1 86  ? 15.514  -8.832  2.235   1.00 0.00 ? 86  HIS A HD1  5  
ATOM 9033  H HD2  . HIS A 1 86  ? 12.644  -10.244 4.886   1.00 0.00 ? 86  HIS A HD2  5  
ATOM 9034  H HE1  . HIS A 1 86  ? 16.554  -10.832 3.349   1.00 0.00 ? 86  HIS A HE1  5  
ATOM 9035  H HE2  . HIS A 1 86  ? 14.768  -11.720 4.886   1.00 0.00 ? 86  HIS A HE2  5  
ATOM 9036  N N    . THR A 1 87  ? 12.411  -4.414  3.380   1.00 0.00 ? 87  THR A N    5  
ATOM 9037  C CA   . THR A 1 87  ? 11.351  -3.417  3.453   1.00 0.00 ? 87  THR A CA   5  
ATOM 9038  C C    . THR A 1 87  ? 11.421  -2.452  2.275   1.00 0.00 ? 87  THR A C    5  
ATOM 9039  O O    . THR A 1 87  ? 12.464  -2.311  1.636   1.00 0.00 ? 87  THR A O    5  
ATOM 9040  C CB   . THR A 1 87  ? 11.426  -2.613  4.765   1.00 0.00 ? 87  THR A CB   5  
ATOM 9041  O OG1  . THR A 1 87  ? 11.091  -3.453  5.875   1.00 0.00 ? 87  THR A OG1  5  
ATOM 9042  C CG2  . THR A 1 87  ? 10.484  -1.419  4.723   1.00 0.00 ? 87  THR A CG2  5  
ATOM 9043  H H    . THR A 1 87  ? 13.335  -4.122  3.233   1.00 0.00 ? 87  THR A H    5  
ATOM 9044  H HA   . THR A 1 87  ? 10.404  -3.935  3.427   1.00 0.00 ? 87  THR A HA   5  
ATOM 9045  H HB   . THR A 1 87  ? 12.437  -2.251  4.890   1.00 0.00 ? 87  THR A HB   5  
ATOM 9046  H HG1  . THR A 1 87  ? 11.681  -4.210  5.893   1.00 0.00 ? 87  THR A HG1  5  
ATOM 9047  H HG21 . THR A 1 87  ? 9.482   -1.759  4.508   1.00 0.00 ? 87  THR A HG21 5  
ATOM 9048  H HG22 . THR A 1 87  ? 10.805  -0.734  3.951   1.00 0.00 ? 87  THR A HG22 5  
ATOM 9049  H HG23 . THR A 1 87  ? 10.497  -0.917  5.678   1.00 0.00 ? 87  THR A HG23 5  
ATOM 9050  N N    . PHE A 1 88  ? 10.305  -1.790  1.991   1.00 0.00 ? 88  PHE A N    5  
ATOM 9051  C CA   . PHE A 1 88  ? 10.239  -0.838  0.888   1.00 0.00 ? 88  PHE A CA   5  
ATOM 9052  C C    . PHE A 1 88  ? 9.171   0.221   1.146   1.00 0.00 ? 88  PHE A C    5  
ATOM 9053  O O    . PHE A 1 88  ? 8.045   -0.097  1.528   1.00 0.00 ? 88  PHE A O    5  
ATOM 9054  C CB   . PHE A 1 88  ? 9.946   -1.566  -0.425  1.00 0.00 ? 88  PHE A CB   5  
ATOM 9055  C CG   . PHE A 1 88  ? 8.672   -2.362  -0.397  1.00 0.00 ? 88  PHE A CG   5  
ATOM 9056  C CD1  . PHE A 1 88  ? 8.539   -3.452  0.449   1.00 0.00 ? 88  PHE A CD1  5  
ATOM 9057  C CD2  . PHE A 1 88  ? 7.608   -2.021  -1.216  1.00 0.00 ? 88  PHE A CD2  5  
ATOM 9058  C CE1  . PHE A 1 88  ? 7.369   -4.186  0.476   1.00 0.00 ? 88  PHE A CE1  5  
ATOM 9059  C CE2  . PHE A 1 88  ? 6.435   -2.751  -1.193  1.00 0.00 ? 88  PHE A CE2  5  
ATOM 9060  C CZ   . PHE A 1 88  ? 6.315   -3.835  -0.345  1.00 0.00 ? 88  PHE A CZ   5  
ATOM 9061  H H    . PHE A 1 88  ? 9.505   -1.945  2.537   1.00 0.00 ? 88  PHE A H    5  
ATOM 9062  H HA   . PHE A 1 88  ? 11.200  -0.352  0.814   1.00 0.00 ? 88  PHE A HA   5  
ATOM 9063  H HB2  . PHE A 1 88  ? 9.865   -0.841  -1.220  1.00 0.00 ? 88  PHE A HB2  5  
ATOM 9064  H HB3  . PHE A 1 88  ? 10.758  -2.244  -0.642  1.00 0.00 ? 88  PHE A HB3  5  
ATOM 9065  H HD1  . PHE A 1 88  ? 9.362   -3.727  1.092   1.00 0.00 ? 88  PHE A HD1  5  
ATOM 9066  H HD2  . PHE A 1 88  ? 7.701   -1.172  -1.880  1.00 0.00 ? 88  PHE A HD2  5  
ATOM 9067  H HE1  . PHE A 1 88  ? 7.277   -5.033  1.140   1.00 0.00 ? 88  PHE A HE1  5  
ATOM 9068  H HE2  . PHE A 1 88  ? 5.613   -2.474  -1.836  1.00 0.00 ? 88  PHE A HE2  5  
ATOM 9069  H HZ   . PHE A 1 88  ? 5.400   -4.408  -0.326  1.00 0.00 ? 88  PHE A HZ   5  
ATOM 9070  N N    . LYS A 1 89  ? 9.533   1.482   0.935   1.00 0.00 ? 89  LYS A N    5  
ATOM 9071  C CA   . LYS A 1 89  ? 8.608   2.589   1.143   1.00 0.00 ? 89  LYS A CA   5  
ATOM 9072  C C    . LYS A 1 89  ? 8.348   3.333   -0.163  1.00 0.00 ? 89  LYS A C    5  
ATOM 9073  O O    . LYS A 1 89  ? 9.232   3.445   -1.011  1.00 0.00 ? 89  LYS A O    5  
ATOM 9074  C CB   . LYS A 1 89  ? 9.164   3.556   2.191   1.00 0.00 ? 89  LYS A CB   5  
ATOM 9075  C CG   . LYS A 1 89  ? 10.285  4.439   1.670   1.00 0.00 ? 89  LYS A CG   5  
ATOM 9076  C CD   . LYS A 1 89  ? 11.648  3.817   1.924   1.00 0.00 ? 89  LYS A CD   5  
ATOM 9077  C CE   . LYS A 1 89  ? 12.751  4.583   1.209   1.00 0.00 ? 89  LYS A CE   5  
ATOM 9078  N NZ   . LYS A 1 89  ? 14.066  4.427   1.891   1.00 0.00 ? 89  LYS A NZ   5  
ATOM 9079  H H    . LYS A 1 89  ? 10.446  1.672   0.631   1.00 0.00 ? 89  LYS A H    5  
ATOM 9080  H HA   . LYS A 1 89  ? 7.676   2.180   1.502   1.00 0.00 ? 89  LYS A HA   5  
ATOM 9081  H HB2  . LYS A 1 89  ? 8.364   4.193   2.537   1.00 0.00 ? 89  LYS A HB2  5  
ATOM 9082  H HB3  . LYS A 1 89  ? 9.544   2.984   3.026   1.00 0.00 ? 89  LYS A HB3  5  
ATOM 9083  H HG2  . LYS A 1 89  ? 10.157  4.577   0.607   1.00 0.00 ? 89  LYS A HG2  5  
ATOM 9084  H HG3  . LYS A 1 89  ? 10.237  5.397   2.168   1.00 0.00 ? 89  LYS A HG3  5  
ATOM 9085  H HD2  . LYS A 1 89  ? 11.848  3.829   2.985   1.00 0.00 ? 89  LYS A HD2  5  
ATOM 9086  H HD3  . LYS A 1 89  ? 11.641  2.797   1.568   1.00 0.00 ? 89  LYS A HD3  5  
ATOM 9087  H HE2  . LYS A 1 89  ? 12.833  4.210   0.199   1.00 0.00 ? 89  LYS A HE2  5  
ATOM 9088  H HE3  . LYS A 1 89  ? 12.488  5.630   1.186   1.00 0.00 ? 89  LYS A HE3  5  
ATOM 9089  H HZ1  . LYS A 1 89  ? 14.725  3.900   1.283   1.00 0.00 ? 89  LYS A HZ1  5  
ATOM 9090  H HZ2  . LYS A 1 89  ? 13.945  3.909   2.785   1.00 0.00 ? 89  LYS A HZ2  5  
ATOM 9091  H HZ3  . LYS A 1 89  ? 14.474  5.361   2.098   1.00 0.00 ? 89  LYS A HZ3  5  
ATOM 9092  N N    . ALA A 1 90  ? 7.129   3.841   -0.316  1.00 0.00 ? 90  ALA A N    5  
ATOM 9093  C CA   . ALA A 1 90  ? 6.754   4.577   -1.517  1.00 0.00 ? 90  ALA A CA   5  
ATOM 9094  C C    . ALA A 1 90  ? 6.547   6.057   -1.212  1.00 0.00 ? 90  ALA A C    5  
ATOM 9095  O O    . ALA A 1 90  ? 5.976   6.412   -0.181  1.00 0.00 ? 90  ALA A O    5  
ATOM 9096  C CB   . ALA A 1 90  ? 5.496   3.981   -2.130  1.00 0.00 ? 90  ALA A CB   5  
ATOM 9097  H H    . ALA A 1 90  ? 6.467   3.718   0.395   1.00 0.00 ? 90  ALA A H    5  
ATOM 9098  H HA   . ALA A 1 90  ? 7.556   4.477   -2.234  1.00 0.00 ? 90  ALA A HA   5  
ATOM 9099  H HB1  . ALA A 1 90  ? 5.202   4.566   -2.989  1.00 0.00 ? 90  ALA A HB1  5  
ATOM 9100  H HB2  . ALA A 1 90  ? 5.693   2.964   -2.437  1.00 0.00 ? 90  ALA A HB2  5  
ATOM 9101  H HB3  . ALA A 1 90  ? 4.701   3.989   -1.399  1.00 0.00 ? 90  ALA A HB3  5  
ATOM 9102  N N    . GLU A 1 91  ? 7.014   6.914   -2.114  1.00 0.00 ? 91  GLU A N    5  
ATOM 9103  C CA   . GLU A 1 91  ? 6.880   8.355   -1.938  1.00 0.00 ? 91  GLU A CA   5  
ATOM 9104  C C    . GLU A 1 91  ? 6.341   9.010   -3.206  1.00 0.00 ? 91  GLU A C    5  
ATOM 9105  O O    . GLU A 1 91  ? 6.470   8.465   -4.303  1.00 0.00 ? 91  GLU A O    5  
ATOM 9106  C CB   . GLU A 1 91  ? 8.230   8.973   -1.566  1.00 0.00 ? 91  GLU A CB   5  
ATOM 9107  C CG   . GLU A 1 91  ? 9.201   9.061   -2.730  1.00 0.00 ? 91  GLU A CG   5  
ATOM 9108  C CD   . GLU A 1 91  ? 10.021  7.798   -2.903  1.00 0.00 ? 91  GLU A CD   5  
ATOM 9109  O OE1  . GLU A 1 91  ? 9.435   6.697   -2.843  1.00 0.00 ? 91  GLU A OE1  5  
ATOM 9110  O OE2  . GLU A 1 91  ? 11.250  7.910   -3.098  1.00 0.00 ? 91  GLU A OE2  5  
ATOM 9111  H H    . GLU A 1 91  ? 7.460   6.569   -2.915  1.00 0.00 ? 91  GLU A H    5  
ATOM 9112  H HA   . GLU A 1 91  ? 6.182   8.528   -1.133  1.00 0.00 ? 91  GLU A HA   5  
ATOM 9113  H HB2  . GLU A 1 91  ? 8.063   9.971   -1.186  1.00 0.00 ? 91  GLU A HB2  5  
ATOM 9114  H HB3  . GLU A 1 91  ? 8.684   8.375   -0.790  1.00 0.00 ? 91  GLU A HB3  5  
ATOM 9115  H HG2  . GLU A 1 91  ? 8.641   9.235   -3.637  1.00 0.00 ? 91  GLU A HG2  5  
ATOM 9116  H HG3  . GLU A 1 91  ? 9.874   9.889   -2.560  1.00 0.00 ? 91  GLU A HG3  5  
ATOM 9117  N N    . HIS A 1 92  ? 5.736   10.183  -3.049  1.00 0.00 ? 92  HIS A N    5  
ATOM 9118  C CA   . HIS A 1 92  ? 5.176   10.913  -4.181  1.00 0.00 ? 92  HIS A CA   5  
ATOM 9119  C C    . HIS A 1 92  ? 5.887   12.250  -4.369  1.00 0.00 ? 92  HIS A C    5  
ATOM 9120  O O    . HIS A 1 92  ? 5.563   13.013  -5.278  1.00 0.00 ? 92  HIS A O    5  
ATOM 9121  C CB   . HIS A 1 92  ? 3.679   11.143  -3.976  1.00 0.00 ? 92  HIS A CB   5  
ATOM 9122  C CG   . HIS A 1 92  ? 3.019   11.844  -5.124  1.00 0.00 ? 92  HIS A CG   5  
ATOM 9123  N ND1  . HIS A 1 92  ? 1.752   12.383  -5.048  1.00 0.00 ? 92  HIS A ND1  5  
ATOM 9124  C CD2  . HIS A 1 92  ? 3.458   12.094  -6.379  1.00 0.00 ? 92  HIS A CD2  5  
ATOM 9125  C CE1  . HIS A 1 92  ? 1.439   12.933  -6.208  1.00 0.00 ? 92  HIS A CE1  5  
ATOM 9126  N NE2  . HIS A 1 92  ? 2.458   12.772  -7.033  1.00 0.00 ? 92  HIS A NE2  5  
ATOM 9127  H H    . HIS A 1 92  ? 5.664   10.566  -2.150  1.00 0.00 ? 92  HIS A H    5  
ATOM 9128  H HA   . HIS A 1 92  ? 5.322   10.314  -5.066  1.00 0.00 ? 92  HIS A HA   5  
ATOM 9129  H HB2  . HIS A 1 92  ? 3.189   10.189  -3.845  1.00 0.00 ? 92  HIS A HB2  5  
ATOM 9130  H HB3  . HIS A 1 92  ? 3.531   11.743  -3.090  1.00 0.00 ? 92  HIS A HB3  5  
ATOM 9131  H HD1  . HIS A 1 92  ? 1.167   12.363  -4.262  1.00 0.00 ? 92  HIS A HD1  5  
ATOM 9132  H HD2  . HIS A 1 92  ? 4.417   11.814  -6.792  1.00 0.00 ? 92  HIS A HD2  5  
ATOM 9133  H HE1  . HIS A 1 92  ? 0.510   13.430  -6.442  1.00 0.00 ? 92  HIS A HE1  5  
ATOM 9134  H HE2  . HIS A 1 92  ? 2.458   13.010  -7.983  1.00 0.00 ? 92  HIS A HE2  5  
ATOM 9135  N N    . ALA A 1 93  ? 6.858   12.526  -3.504  1.00 0.00 ? 93  ALA A N    5  
ATOM 9136  C CA   . ALA A 1 93  ? 7.615   13.769  -3.577  1.00 0.00 ? 93  ALA A CA   5  
ATOM 9137  C C    . ALA A 1 93  ? 6.687   14.979  -3.558  1.00 0.00 ? 93  ALA A C    5  
ATOM 9138  O O    . ALA A 1 93  ? 6.805   15.878  -4.389  1.00 0.00 ? 93  ALA A O    5  
ATOM 9139  C CB   . ALA A 1 93  ? 8.482   13.787  -4.827  1.00 0.00 ? 93  ALA A CB   5  
ATOM 9140  H H    . ALA A 1 93  ? 7.070   11.877  -2.802  1.00 0.00 ? 93  ALA A H    5  
ATOM 9141  H HA   . ALA A 1 93  ? 8.266   13.814  -2.716  1.00 0.00 ? 93  ALA A HA   5  
ATOM 9142  H HB1  . ALA A 1 93  ? 7.851   13.829  -5.702  1.00 0.00 ? 93  ALA A HB1  5  
ATOM 9143  H HB2  . ALA A 1 93  ? 9.126   14.654  -4.805  1.00 0.00 ? 93  ALA A HB2  5  
ATOM 9144  H HB3  . ALA A 1 93  ? 9.085   12.891  -4.859  1.00 0.00 ? 93  ALA A HB3  5  
ATOM 9145  N N    . GLY A 1 94  ? 5.761   14.994  -2.604  1.00 0.00 ? 94  GLY A N    5  
ATOM 9146  C CA   . GLY A 1 94  ? 4.825   16.098  -2.495  1.00 0.00 ? 94  GLY A CA   5  
ATOM 9147  C C    . GLY A 1 94  ? 3.717   15.824  -1.498  1.00 0.00 ? 94  GLY A C    5  
ATOM 9148  O O    . GLY A 1 94  ? 3.332   16.704  -0.729  1.00 0.00 ? 94  GLY A O    5  
ATOM 9149  H H    . GLY A 1 94  ? 5.713   14.250  -1.968  1.00 0.00 ? 94  GLY A H    5  
ATOM 9150  H HA2  . GLY A 1 94  ? 5.363   16.982  -2.186  1.00 0.00 ? 94  GLY A HA2  5  
ATOM 9151  H HA3  . GLY A 1 94  ? 4.384   16.278  -3.465  1.00 0.00 ? 94  GLY A HA3  5  
ATOM 9152  N N    . VAL A 1 95  ? 3.201   14.599  -1.512  1.00 0.00 ? 95  VAL A N    5  
ATOM 9153  C CA   . VAL A 1 95  ? 2.130   14.210  -0.602  1.00 0.00 ? 95  VAL A CA   5  
ATOM 9154  C C    . VAL A 1 95  ? 2.690   13.602  0.679   1.00 0.00 ? 95  VAL A C    5  
ATOM 9155  O O    . VAL A 1 95  ? 2.681   14.235  1.735   1.00 0.00 ? 95  VAL A O    5  
ATOM 9156  C CB   . VAL A 1 95  ? 1.173   13.200  -1.261  1.00 0.00 ? 95  VAL A CB   5  
ATOM 9157  C CG1  . VAL A 1 95  ? 0.071   12.797  -0.293  1.00 0.00 ? 95  VAL A CG1  5  
ATOM 9158  C CG2  . VAL A 1 95  ? 0.585   13.779  -2.539  1.00 0.00 ? 95  VAL A CG2  5  
ATOM 9159  H H    . VAL A 1 95  ? 3.550   13.940  -2.148  1.00 0.00 ? 95  VAL A H    5  
ATOM 9160  H HA   . VAL A 1 95  ? 1.567   15.097  -0.351  1.00 0.00 ? 95  VAL A HA   5  
ATOM 9161  H HB   . VAL A 1 95  ? 1.736   12.315  -1.518  1.00 0.00 ? 95  VAL A HB   5  
ATOM 9162  H HG11 . VAL A 1 95  ? -0.845  12.629  -0.840  1.00 0.00 ? 95  VAL A HG11 5  
ATOM 9163  H HG12 . VAL A 1 95  ? 0.357   11.891  0.222   1.00 0.00 ? 95  VAL A HG12 5  
ATOM 9164  H HG13 . VAL A 1 95  ? -0.081  13.588  0.427   1.00 0.00 ? 95  VAL A HG13 5  
ATOM 9165  H HG21 . VAL A 1 95  ? 0.078   14.706  -2.315  1.00 0.00 ? 95  VAL A HG21 5  
ATOM 9166  H HG22 . VAL A 1 95  ? 1.378   13.965  -3.248  1.00 0.00 ? 95  VAL A HG22 5  
ATOM 9167  H HG23 . VAL A 1 95  ? -0.119  13.077  -2.963  1.00 0.00 ? 95  VAL A HG23 5  
ATOM 9168  N N    . ARG A 1 96  ? 3.178   12.370  0.578   1.00 0.00 ? 96  ARG A N    5  
ATOM 9169  C CA   . ARG A 1 96  ? 3.742   11.674  1.728   1.00 0.00 ? 96  ARG A CA   5  
ATOM 9170  C C    . ARG A 1 96  ? 4.538   10.449  1.287   1.00 0.00 ? 96  ARG A C    5  
ATOM 9171  O O    . ARG A 1 96  ? 4.678   10.183  0.093   1.00 0.00 ? 96  ARG A O    5  
ATOM 9172  C CB   . ARG A 1 96  ? 2.631   11.255  2.693   1.00 0.00 ? 96  ARG A CB   5  
ATOM 9173  C CG   . ARG A 1 96  ? 1.913   9.981   2.277   1.00 0.00 ? 96  ARG A CG   5  
ATOM 9174  C CD   . ARG A 1 96  ? 0.689   9.724   3.142   1.00 0.00 ? 96  ARG A CD   5  
ATOM 9175  N NE   . ARG A 1 96  ? -0.396  10.655  2.846   1.00 0.00 ? 96  ARG A NE   5  
ATOM 9176  C CZ   . ARG A 1 96  ? -1.468  10.803  3.617   1.00 0.00 ? 96  ARG A CZ   5  
ATOM 9177  N NH1  . ARG A 1 96  ? -1.597  10.085  4.724   1.00 0.00 ? 96  ARG A NH1  5  
ATOM 9178  N NH2  . ARG A 1 96  ? -2.413  11.671  3.281   1.00 0.00 ? 96  ARG A NH2  5  
ATOM 9179  H H    . ARG A 1 96  ? 3.157   11.917  -0.291  1.00 0.00 ? 96  ARG A H    5  
ATOM 9180  H HA   . ARG A 1 96  ? 4.407   12.357  2.235   1.00 0.00 ? 96  ARG A HA   5  
ATOM 9181  H HB2  . ARG A 1 96  ? 3.060   11.096  3.671   1.00 0.00 ? 96  ARG A HB2  5  
ATOM 9182  H HB3  . ARG A 1 96  ? 1.904   12.050  2.752   1.00 0.00 ? 96  ARG A HB3  5  
ATOM 9183  H HG2  . ARG A 1 96  ? 1.599   10.076  1.248   1.00 0.00 ? 96  ARG A HG2  5  
ATOM 9184  H HG3  . ARG A 1 96  ? 2.593   9.148   2.373   1.00 0.00 ? 96  ARG A HG3  5  
ATOM 9185  H HD2  . ARG A 1 96  ? 0.345   8.716   2.965   1.00 0.00 ? 96  ARG A HD2  5  
ATOM 9186  H HD3  . ARG A 1 96  ? 0.970   9.830   4.179   1.00 0.00 ? 96  ARG A HD3  5  
ATOM 9187  H HE   . ARG A 1 96  ? -0.321  11.196  2.033   1.00 0.00 ? 96  ARG A HE   5  
ATOM 9188  H HH11 . ARG A 1 96  ? -0.885  9.431   4.981   1.00 0.00 ? 96  ARG A HH11 5  
ATOM 9189  H HH12 . ARG A 1 96  ? -2.404  10.200  5.303   1.00 0.00 ? 96  ARG A HH12 5  
ATOM 9190  H HH21 . ARG A 1 96  ? -2.319  12.215  2.447   1.00 0.00 ? 96  ARG A HH21 5  
ATOM 9191  H HH22 . ARG A 1 96  ? -3.219  11.782  3.861   1.00 0.00 ? 96  ARG A HH22 5  
ATOM 9192  N N    . THR A 1 97  ? 5.057   9.706   2.259   1.00 0.00 ? 97  THR A N    5  
ATOM 9193  C CA   . THR A 1 97  ? 5.839   8.510   1.972   1.00 0.00 ? 97  THR A CA   5  
ATOM 9194  C C    . THR A 1 97  ? 5.346   7.321   2.788   1.00 0.00 ? 97  THR A C    5  
ATOM 9195  O O    . THR A 1 97  ? 5.534   7.269   4.004   1.00 0.00 ? 97  THR A O    5  
ATOM 9196  C CB   . THR A 1 97  ? 7.335   8.734   2.264   1.00 0.00 ? 97  THR A CB   5  
ATOM 9197  O OG1  . THR A 1 97  ? 7.804   9.890   1.562   1.00 0.00 ? 97  THR A OG1  5  
ATOM 9198  C CG2  . THR A 1 97  ? 8.154   7.519   1.856   1.00 0.00 ? 97  THR A CG2  5  
ATOM 9199  H H    . THR A 1 97  ? 4.910   9.969   3.192   1.00 0.00 ? 97  THR A H    5  
ATOM 9200  H HA   . THR A 1 97  ? 5.729   8.284   0.921   1.00 0.00 ? 97  THR A HA   5  
ATOM 9201  H HB   . THR A 1 97  ? 7.459   8.892   3.326   1.00 0.00 ? 97  THR A HB   5  
ATOM 9202  H HG1  . THR A 1 97  ? 7.267   10.027  0.777   1.00 0.00 ? 97  THR A HG1  5  
ATOM 9203  H HG21 . THR A 1 97  ? 9.198   7.704   2.058   1.00 0.00 ? 97  THR A HG21 5  
ATOM 9204  H HG22 . THR A 1 97  ? 8.020   7.332   0.801   1.00 0.00 ? 97  THR A HG22 5  
ATOM 9205  H HG23 . THR A 1 97  ? 7.825   6.658   2.419   1.00 0.00 ? 97  THR A HG23 5  
ATOM 9206  N N    . TYR A 1 98  ? 4.715   6.367   2.113   1.00 0.00 ? 98  TYR A N    5  
ATOM 9207  C CA   . TYR A 1 98  ? 4.192   5.179   2.776   1.00 0.00 ? 98  TYR A CA   5  
ATOM 9208  C C    . TYR A 1 98  ? 5.274   4.111   2.913   1.00 0.00 ? 98  TYR A C    5  
ATOM 9209  O O    . TYR A 1 98  ? 6.221   4.067   2.128   1.00 0.00 ? 98  TYR A O    5  
ATOM 9210  C CB   . TYR A 1 98  ? 3.001   4.617   1.999   1.00 0.00 ? 98  TYR A CB   5  
ATOM 9211  C CG   . TYR A 1 98  ? 1.690   5.296   2.325   1.00 0.00 ? 98  TYR A CG   5  
ATOM 9212  C CD1  . TYR A 1 98  ? 1.056   5.079   3.542   1.00 0.00 ? 98  TYR A CD1  5  
ATOM 9213  C CD2  . TYR A 1 98  ? 1.087   6.157   1.417   1.00 0.00 ? 98  TYR A CD2  5  
ATOM 9214  C CE1  . TYR A 1 98  ? -0.142  5.697   3.844   1.00 0.00 ? 98  TYR A CE1  5  
ATOM 9215  C CE2  . TYR A 1 98  ? -0.110  6.781   1.711   1.00 0.00 ? 98  TYR A CE2  5  
ATOM 9216  C CZ   . TYR A 1 98  ? -0.721  6.547   2.925   1.00 0.00 ? 98  TYR A CZ   5  
ATOM 9217  O OH   . TYR A 1 98  ? -1.914  7.166   3.222   1.00 0.00 ? 98  TYR A OH   5  
ATOM 9218  H H    . TYR A 1 98  ? 4.595   6.465   1.145   1.00 0.00 ? 98  TYR A H    5  
ATOM 9219  H HA   . TYR A 1 98  ? 3.862   5.468   3.763   1.00 0.00 ? 98  TYR A HA   5  
ATOM 9220  H HB2  . TYR A 1 98  ? 3.181   4.736   0.942   1.00 0.00 ? 98  TYR A HB2  5  
ATOM 9221  H HB3  . TYR A 1 98  ? 2.895   3.566   2.225   1.00 0.00 ? 98  TYR A HB3  5  
ATOM 9222  H HD1  . TYR A 1 98  ? 1.512   4.412   4.260   1.00 0.00 ? 98  TYR A HD1  5  
ATOM 9223  H HD2  . TYR A 1 98  ? 1.567   6.338   0.466   1.00 0.00 ? 98  TYR A HD2  5  
ATOM 9224  H HE1  . TYR A 1 98  ? -0.620  5.514   4.795   1.00 0.00 ? 98  TYR A HE1  5  
ATOM 9225  H HE2  . TYR A 1 98  ? -0.564  7.447   0.991   1.00 0.00 ? 98  TYR A HE2  5  
ATOM 9226  H HH   . TYR A 1 98  ? -1.760  8.102   3.372   1.00 0.00 ? 98  TYR A HH   5  
ATOM 9227  N N    . PHE A 1 99  ? 5.125   3.252   3.915   1.00 0.00 ? 99  PHE A N    5  
ATOM 9228  C CA   . PHE A 1 99  ? 6.088   2.184   4.156   1.00 0.00 ? 99  PHE A CA   5  
ATOM 9229  C C    . PHE A 1 99  ? 5.415   0.817   4.078   1.00 0.00 ? 99  PHE A C    5  
ATOM 9230  O O    . PHE A 1 99  ? 4.229   0.678   4.376   1.00 0.00 ? 99  PHE A O    5  
ATOM 9231  C CB   . PHE A 1 99  ? 6.748   2.362   5.525   1.00 0.00 ? 99  PHE A CB   5  
ATOM 9232  C CG   . PHE A 1 99  ? 7.887   3.342   5.519   1.00 0.00 ? 99  PHE A CG   5  
ATOM 9233  C CD1  . PHE A 1 99  ? 7.649   4.701   5.639   1.00 0.00 ? 99  PHE A CD1  5  
ATOM 9234  C CD2  . PHE A 1 99  ? 9.195   2.902   5.392   1.00 0.00 ? 99  PHE A CD2  5  
ATOM 9235  C CE1  . PHE A 1 99  ? 8.695   5.605   5.634   1.00 0.00 ? 99  PHE A CE1  5  
ATOM 9236  C CE2  . PHE A 1 99  ? 10.244  3.801   5.386   1.00 0.00 ? 99  PHE A CE2  5  
ATOM 9237  C CZ   . PHE A 1 99  ? 9.994   5.154   5.506   1.00 0.00 ? 99  PHE A CZ   5  
ATOM 9238  H H    . PHE A 1 99  ? 4.348   3.338   4.508   1.00 0.00 ? 99  PHE A H    5  
ATOM 9239  H HA   . PHE A 1 99  ? 6.846   2.243   3.390   1.00 0.00 ? 99  PHE A HA   5  
ATOM 9240  H HB2  . PHE A 1 99  ? 6.010   2.717   6.229   1.00 0.00 ? 99  PHE A HB2  5  
ATOM 9241  H HB3  . PHE A 1 99  ? 7.129   1.410   5.860   1.00 0.00 ? 99  PHE A HB3  5  
ATOM 9242  H HD1  . PHE A 1 99  ? 6.633   5.055   5.739   1.00 0.00 ? 99  PHE A HD1  5  
ATOM 9243  H HD2  . PHE A 1 99  ? 9.392   1.845   5.296   1.00 0.00 ? 99  PHE A HD2  5  
ATOM 9244  H HE1  . PHE A 1 99  ? 8.496   6.662   5.728   1.00 0.00 ? 99  PHE A HE1  5  
ATOM 9245  H HE2  . PHE A 1 99  ? 11.259  3.446   5.286   1.00 0.00 ? 99  PHE A HE2  5  
ATOM 9246  H HZ   . PHE A 1 99  ? 10.813  5.858   5.503   1.00 0.00 ? 99  PHE A HZ   5  
ATOM 9247  N N    . PHE A 1 100 ? 6.181   -0.191  3.673   1.00 0.00 ? 100 PHE A N    5  
ATOM 9248  C CA   . PHE A 1 100 ? 5.660   -1.548  3.554   1.00 0.00 ? 100 PHE A CA   5  
ATOM 9249  C C    . PHE A 1 100 ? 6.778   -2.575  3.703   1.00 0.00 ? 100 PHE A C    5  
ATOM 9250  O O    . PHE A 1 100 ? 7.701   -2.627  2.889   1.00 0.00 ? 100 PHE A O    5  
ATOM 9251  C CB   . PHE A 1 100 ? 4.961   -1.731  2.205   1.00 0.00 ? 100 PHE A CB   5  
ATOM 9252  C CG   . PHE A 1 100 ? 3.982   -0.638  1.884   1.00 0.00 ? 100 PHE A CG   5  
ATOM 9253  C CD1  . PHE A 1 100 ? 2.800   -0.517  2.597   1.00 0.00 ? 100 PHE A CD1  5  
ATOM 9254  C CD2  . PHE A 1 100 ? 4.243   0.268   0.869   1.00 0.00 ? 100 PHE A CD2  5  
ATOM 9255  C CE1  . PHE A 1 100 ? 1.897   0.488   2.305   1.00 0.00 ? 100 PHE A CE1  5  
ATOM 9256  C CE2  . PHE A 1 100 ? 3.344   1.275   0.573   1.00 0.00 ? 100 PHE A CE2  5  
ATOM 9257  C CZ   . PHE A 1 100 ? 2.169   1.385   1.291   1.00 0.00 ? 100 PHE A CZ   5  
ATOM 9258  H H    . PHE A 1 100 ? 7.120   -0.018  3.450   1.00 0.00 ? 100 PHE A H    5  
ATOM 9259  H HA   . PHE A 1 100 ? 4.942   -1.697  4.345   1.00 0.00 ? 100 PHE A HA   5  
ATOM 9260  H HB2  . PHE A 1 100 ? 5.703   -1.750  1.422   1.00 0.00 ? 100 PHE A HB2  5  
ATOM 9261  H HB3  . PHE A 1 100 ? 4.424   -2.668  2.211   1.00 0.00 ? 100 PHE A HB3  5  
ATOM 9262  H HD1  . PHE A 1 100 ? 2.586   -1.218  3.392   1.00 0.00 ? 100 PHE A HD1  5  
ATOM 9263  H HD2  . PHE A 1 100 ? 5.161   0.184   0.306   1.00 0.00 ? 100 PHE A HD2  5  
ATOM 9264  H HE1  . PHE A 1 100 ? 0.979   0.570   2.868   1.00 0.00 ? 100 PHE A HE1  5  
ATOM 9265  H HE2  . PHE A 1 100 ? 3.559   1.975   -0.221  1.00 0.00 ? 100 PHE A HE2  5  
ATOM 9266  H HZ   . PHE A 1 100 ? 1.466   2.171   1.061   1.00 0.00 ? 100 PHE A HZ   5  
ATOM 9267  N N    . SER A 1 101 ? 6.689   -3.390  4.749   1.00 0.00 ? 101 SER A N    5  
ATOM 9268  C CA   . SER A 1 101 ? 7.695   -4.414  5.009   1.00 0.00 ? 101 SER A CA   5  
ATOM 9269  C C    . SER A 1 101 ? 7.174   -5.796  4.627   1.00 0.00 ? 101 SER A C    5  
ATOM 9270  O O    . SER A 1 101 ? 5.966   -6.020  4.559   1.00 0.00 ? 101 SER A O    5  
ATOM 9271  C CB   . SER A 1 101 ? 8.099   -4.399  6.484   1.00 0.00 ? 101 SER A CB   5  
ATOM 9272  O OG   . SER A 1 101 ? 9.117   -5.350  6.744   1.00 0.00 ? 101 SER A OG   5  
ATOM 9273  H H    . SER A 1 101 ? 5.930   -3.299  5.362   1.00 0.00 ? 101 SER A H    5  
ATOM 9274  H HA   . SER A 1 101 ? 8.561   -4.188  4.405   1.00 0.00 ? 101 SER A HA   5  
ATOM 9275  H HB2  . SER A 1 101 ? 8.466   -3.417  6.744   1.00 0.00 ? 101 SER A HB2  5  
ATOM 9276  H HB3  . SER A 1 101 ? 7.239   -4.635  7.093   1.00 0.00 ? 101 SER A HB3  5  
ATOM 9277  H HG   . SER A 1 101 ? 8.793   -6.230  6.540   1.00 0.00 ? 101 SER A HG   5  
ATOM 9278  N N    . ALA A 1 102 ? 8.096   -6.721  4.378   1.00 0.00 ? 102 ALA A N    5  
ATOM 9279  C CA   . ALA A 1 102 ? 7.732   -8.082  4.005   1.00 0.00 ? 102 ALA A CA   5  
ATOM 9280  C C    . ALA A 1 102 ? 8.458   -9.102  4.874   1.00 0.00 ? 102 ALA A C    5  
ATOM 9281  O O    . ALA A 1 102 ? 9.589   -8.874  5.301   1.00 0.00 ? 102 ALA A O    5  
ATOM 9282  C CB   . ALA A 1 102 ? 8.038   -8.325  2.534   1.00 0.00 ? 102 ALA A CB   5  
ATOM 9283  H H    . ALA A 1 102 ? 9.044   -6.482  4.449   1.00 0.00 ? 102 ALA A H    5  
ATOM 9284  H HA   . ALA A 1 102 ? 6.667   -8.194  4.149   1.00 0.00 ? 102 ALA A HA   5  
ATOM 9285  H HB1  . ALA A 1 102 ? 8.416   -9.329  2.407   1.00 0.00 ? 102 ALA A HB1  5  
ATOM 9286  H HB2  . ALA A 1 102 ? 7.134   -8.204  1.955   1.00 0.00 ? 102 ALA A HB2  5  
ATOM 9287  H HB3  . ALA A 1 102 ? 8.779   -7.616  2.199   1.00 0.00 ? 102 ALA A HB3  5  
ATOM 9288  N N    . GLU A 1 103 ? 7.799   -10.228 5.133   1.00 0.00 ? 103 GLU A N    5  
ATOM 9289  C CA   . GLU A 1 103 ? 8.383   -11.282 5.954   1.00 0.00 ? 103 GLU A CA   5  
ATOM 9290  C C    . GLU A 1 103 ? 9.572   -11.926 5.247   1.00 0.00 ? 103 GLU A C    5  
ATOM 9291  O O    . GLU A 1 103 ? 10.603  -12.195 5.863   1.00 0.00 ? 103 GLU A O    5  
ATOM 9292  C CB   . GLU A 1 103 ? 7.333   -12.346 6.280   1.00 0.00 ? 103 GLU A CB   5  
ATOM 9293  C CG   . GLU A 1 103 ? 6.035   -11.773 6.825   1.00 0.00 ? 103 GLU A CG   5  
ATOM 9294  C CD   . GLU A 1 103 ? 5.070   -11.368 5.728   1.00 0.00 ? 103 GLU A CD   5  
ATOM 9295  O OE1  . GLU A 1 103 ? 4.415   -12.262 5.154   1.00 0.00 ? 103 GLU A OE1  5  
ATOM 9296  O OE2  . GLU A 1 103 ? 4.970   -10.155 5.445   1.00 0.00 ? 103 GLU A OE2  5  
ATOM 9297  H H    . GLU A 1 103 ? 6.900   -10.351 4.765   1.00 0.00 ? 103 GLU A H    5  
ATOM 9298  H HA   . GLU A 1 103 ? 8.726   -10.835 6.874   1.00 0.00 ? 103 GLU A HA   5  
ATOM 9299  H HB2  . GLU A 1 103 ? 7.108   -12.900 5.381   1.00 0.00 ? 103 GLU A HB2  5  
ATOM 9300  H HB3  . GLU A 1 103 ? 7.740   -13.022 7.017   1.00 0.00 ? 103 GLU A HB3  5  
ATOM 9301  H HG2  . GLU A 1 103 ? 5.559   -12.518 7.445   1.00 0.00 ? 103 GLU A HG2  5  
ATOM 9302  H HG3  . GLU A 1 103 ? 6.264   -10.902 7.423   1.00 0.00 ? 103 GLU A HG3  5  
ATOM 9303  N N    . SER A 1 104 ? 9.420   -12.172 3.950   1.00 0.00 ? 104 SER A N    5  
ATOM 9304  C CA   . SER A 1 104 ? 10.479  -12.788 3.159   1.00 0.00 ? 104 SER A CA   5  
ATOM 9305  C C    . SER A 1 104 ? 10.932  -11.857 2.039   1.00 0.00 ? 104 SER A C    5  
ATOM 9306  O O    . SER A 1 104 ? 10.178  -11.013 1.554   1.00 0.00 ? 104 SER A O    5  
ATOM 9307  C CB   . SER A 1 104 ? 9.997   -14.116 2.570   1.00 0.00 ? 104 SER A CB   5  
ATOM 9308  O OG   . SER A 1 104 ? 9.700   -15.050 3.594   1.00 0.00 ? 104 SER A OG   5  
ATOM 9309  H H    . SER A 1 104 ? 8.574   -11.934 3.515   1.00 0.00 ? 104 SER A H    5  
ATOM 9310  H HA   . SER A 1 104 ? 11.315  -12.977 3.815   1.00 0.00 ? 104 SER A HA   5  
ATOM 9311  H HB2  . SER A 1 104 ? 9.106   -13.945 1.985   1.00 0.00 ? 104 SER A HB2  5  
ATOM 9312  H HB3  . SER A 1 104 ? 10.770  -14.527 1.937   1.00 0.00 ? 104 SER A HB3  5  
ATOM 9313  H HG   . SER A 1 104 ? 9.467   -14.580 4.398   1.00 0.00 ? 104 SER A HG   5  
ATOM 9314  N N    . PRO A 1 105 ? 12.196  -12.013 1.617   1.00 0.00 ? 105 PRO A N    5  
ATOM 9315  C CA   . PRO A 1 105 ? 12.780  -11.196 0.549   1.00 0.00 ? 105 PRO A CA   5  
ATOM 9316  C C    . PRO A 1 105 ? 12.181  -11.513 -0.817  1.00 0.00 ? 105 PRO A C    5  
ATOM 9317  O O    . PRO A 1 105 ? 12.246  -10.698 -1.737  1.00 0.00 ? 105 PRO A O    5  
ATOM 9318  C CB   . PRO A 1 105 ? 14.263  -11.574 0.583   1.00 0.00 ? 105 PRO A CB   5  
ATOM 9319  C CG   . PRO A 1 105 ? 14.291  -12.944 1.169   1.00 0.00 ? 105 PRO A CG   5  
ATOM 9320  C CD   . PRO A 1 105 ? 13.152  -12.999 2.149   1.00 0.00 ? 105 PRO A CD   5  
ATOM 9321  H HA   . PRO A 1 105 ? 12.672  -10.140 0.752   1.00 0.00 ? 105 PRO A HA   5  
ATOM 9322  H HB2  . PRO A 1 105 ? 14.663  -11.565 -0.421  1.00 0.00 ? 105 PRO A HB2  5  
ATOM 9323  H HB3  . PRO A 1 105 ? 14.804  -10.871 1.199   1.00 0.00 ? 105 PRO A HB3  5  
ATOM 9324  H HG2  . PRO A 1 105 ? 14.151  -13.679 0.391   1.00 0.00 ? 105 PRO A HG2  5  
ATOM 9325  H HG3  . PRO A 1 105 ? 15.230  -13.107 1.677   1.00 0.00 ? 105 PRO A HG3  5  
ATOM 9326  H HD2  . PRO A 1 105 ? 12.716  -13.987 2.167   1.00 0.00 ? 105 PRO A HD2  5  
ATOM 9327  H HD3  . PRO A 1 105 ? 13.488  -12.714 3.135   1.00 0.00 ? 105 PRO A HD3  5  
ATOM 9328  N N    . GLU A 1 106 ? 11.598  -12.701 -0.941  1.00 0.00 ? 106 GLU A N    5  
ATOM 9329  C CA   . GLU A 1 106 ? 10.988  -13.124 -2.196  1.00 0.00 ? 106 GLU A CA   5  
ATOM 9330  C C    . GLU A 1 106 ? 9.688   -12.367 -2.452  1.00 0.00 ? 106 GLU A C    5  
ATOM 9331  O O    . GLU A 1 106 ? 9.183   -12.342 -3.573  1.00 0.00 ? 106 GLU A O    5  
ATOM 9332  C CB   . GLU A 1 106 ? 10.718  -14.630 -2.176  1.00 0.00 ? 106 GLU A CB   5  
ATOM 9333  C CG   . GLU A 1 106 ? 11.954  -15.473 -2.442  1.00 0.00 ? 106 GLU A CG   5  
ATOM 9334  C CD   . GLU A 1 106 ? 11.619  -16.827 -3.038  1.00 0.00 ? 106 GLU A CD   5  
ATOM 9335  O OE1  . GLU A 1 106 ? 11.084  -16.863 -4.166  1.00 0.00 ? 106 GLU A OE1  5  
ATOM 9336  O OE2  . GLU A 1 106 ? 11.894  -17.850 -2.377  1.00 0.00 ? 106 GLU A OE2  5  
ATOM 9337  H H    . GLU A 1 106 ? 11.578  -13.307 -0.171  1.00 0.00 ? 106 GLU A H    5  
ATOM 9338  H HA   . GLU A 1 106 ? 11.681  -12.903 -2.993  1.00 0.00 ? 106 GLU A HA   5  
ATOM 9339  H HB2  . GLU A 1 106 ? 10.325  -14.900 -1.207  1.00 0.00 ? 106 GLU A HB2  5  
ATOM 9340  H HB3  . GLU A 1 106 ? 9.981   -14.862 -2.930  1.00 0.00 ? 106 GLU A HB3  5  
ATOM 9341  H HG2  . GLU A 1 106 ? 12.595  -14.943 -3.129  1.00 0.00 ? 106 GLU A HG2  5  
ATOM 9342  H HG3  . GLU A 1 106 ? 12.477  -15.627 -1.509  1.00 0.00 ? 106 GLU A HG3  5  
ATOM 9343  N N    . GLU A 1 107 ? 9.152   -11.752 -1.402  1.00 0.00 ? 107 GLU A N    5  
ATOM 9344  C CA   . GLU A 1 107 ? 7.910   -10.995 -1.513  1.00 0.00 ? 107 GLU A CA   5  
ATOM 9345  C C    . GLU A 1 107 ? 8.193   -9.525  -1.805  1.00 0.00 ? 107 GLU A C    5  
ATOM 9346  O O    . GLU A 1 107 ? 7.629   -8.947  -2.733  1.00 0.00 ? 107 GLU A O    5  
ATOM 9347  C CB   . GLU A 1 107 ? 7.093   -11.123 -0.225  1.00 0.00 ? 107 GLU A CB   5  
ATOM 9348  C CG   . GLU A 1 107 ? 6.223   -12.368 -0.178  1.00 0.00 ? 107 GLU A CG   5  
ATOM 9349  C CD   . GLU A 1 107 ? 5.191   -12.317 0.933   1.00 0.00 ? 107 GLU A CD   5  
ATOM 9350  O OE1  . GLU A 1 107 ? 4.259   -11.491 0.840   1.00 0.00 ? 107 GLU A OE1  5  
ATOM 9351  O OE2  . GLU A 1 107 ? 5.317   -13.103 1.895   1.00 0.00 ? 107 GLU A OE2  5  
ATOM 9352  H H    . GLU A 1 107 ? 9.602   -11.808 -0.533  1.00 0.00 ? 107 GLU A H    5  
ATOM 9353  H HA   . GLU A 1 107 ? 7.341   -11.409 -2.331  1.00 0.00 ? 107 GLU A HA   5  
ATOM 9354  H HB2  . GLU A 1 107 ? 7.770   -11.150 0.616   1.00 0.00 ? 107 GLU A HB2  5  
ATOM 9355  H HB3  . GLU A 1 107 ? 6.453   -10.259 -0.133  1.00 0.00 ? 107 GLU A HB3  5  
ATOM 9356  H HG2  . GLU A 1 107 ? 5.708   -12.468 -1.122  1.00 0.00 ? 107 GLU A HG2  5  
ATOM 9357  H HG3  . GLU A 1 107 ? 6.856   -13.229 -0.021  1.00 0.00 ? 107 GLU A HG3  5  
ATOM 9358  N N    . GLN A 1 108 ? 9.070   -8.927  -1.004  1.00 0.00 ? 108 GLN A N    5  
ATOM 9359  C CA   . GLN A 1 108 ? 9.427   -7.523  -1.176  1.00 0.00 ? 108 GLN A CA   5  
ATOM 9360  C C    . GLN A 1 108 ? 9.812   -7.233  -2.623  1.00 0.00 ? 108 GLN A C    5  
ATOM 9361  O O    . GLN A 1 108 ? 9.258   -6.333  -3.253  1.00 0.00 ? 108 GLN A O    5  
ATOM 9362  C CB   . GLN A 1 108 ? 10.581  -7.151  -0.244  1.00 0.00 ? 108 GLN A CB   5  
ATOM 9363  C CG   . GLN A 1 108 ? 11.167  -5.776  -0.520  1.00 0.00 ? 108 GLN A CG   5  
ATOM 9364  C CD   . GLN A 1 108 ? 12.604  -5.650  -0.056  1.00 0.00 ? 108 GLN A CD   5  
ATOM 9365  O OE1  . GLN A 1 108 ? 13.349  -6.631  -0.030  1.00 0.00 ? 108 GLN A OE1  5  
ATOM 9366  N NE2  . GLN A 1 108 ? 13.004  -4.439  0.314   1.00 0.00 ? 108 GLN A NE2  5  
ATOM 9367  H H    . GLN A 1 108 ? 9.486   -9.441  -0.282  1.00 0.00 ? 108 GLN A H    5  
ATOM 9368  H HA   . GLN A 1 108 ? 8.563   -6.928  -0.920  1.00 0.00 ? 108 GLN A HA   5  
ATOM 9369  H HB2  . GLN A 1 108 ? 10.224  -7.168  0.776   1.00 0.00 ? 108 GLN A HB2  5  
ATOM 9370  H HB3  . GLN A 1 108 ? 11.367  -7.882  -0.354  1.00 0.00 ? 108 GLN A HB3  5  
ATOM 9371  H HG2  . GLN A 1 108 ? 11.131  -5.591  -1.584  1.00 0.00 ? 108 GLN A HG2  5  
ATOM 9372  H HG3  . GLN A 1 108 ? 10.572  -5.035  -0.007  1.00 0.00 ? 108 GLN A HG3  5  
ATOM 9373  H HE21 . GLN A 1 108 ? 12.355  -3.704  0.268   1.00 0.00 ? 108 GLN A HE21 5  
ATOM 9374  H HE22 . GLN A 1 108 ? 13.927  -4.329  0.619   1.00 0.00 ? 108 GLN A HE22 5  
ATOM 9375  N N    . GLU A 1 109 ? 10.765  -8.000  -3.142  1.00 0.00 ? 109 GLU A N    5  
ATOM 9376  C CA   . GLU A 1 109 ? 11.225  -7.823  -4.514  1.00 0.00 ? 109 GLU A CA   5  
ATOM 9377  C C    . GLU A 1 109 ? 10.073  -7.996  -5.500  1.00 0.00 ? 109 GLU A C    5  
ATOM 9378  O O    . GLU A 1 109 ? 9.860   -7.157  -6.375  1.00 0.00 ? 109 GLU A O    5  
ATOM 9379  C CB   . GLU A 1 109 ? 12.340  -8.821  -4.835  1.00 0.00 ? 109 GLU A CB   5  
ATOM 9380  C CG   . GLU A 1 109 ? 11.832  -10.150 -5.367  1.00 0.00 ? 109 GLU A CG   5  
ATOM 9381  C CD   . GLU A 1 109 ? 12.956  -11.092 -5.754  1.00 0.00 ? 109 GLU A CD   5  
ATOM 9382  O OE1  . GLU A 1 109 ? 13.626  -11.623 -4.843  1.00 0.00 ? 109 GLU A OE1  5  
ATOM 9383  O OE2  . GLU A 1 109 ? 13.166  -11.297 -6.968  1.00 0.00 ? 109 GLU A OE2  5  
ATOM 9384  H H    . GLU A 1 109 ? 11.169  -8.701  -2.589  1.00 0.00 ? 109 GLU A H    5  
ATOM 9385  H HA   . GLU A 1 109 ? 11.614  -6.821  -4.607  1.00 0.00 ? 109 GLU A HA   5  
ATOM 9386  H HB2  . GLU A 1 109 ? 12.994  -8.386  -5.576  1.00 0.00 ? 109 GLU A HB2  5  
ATOM 9387  H HB3  . GLU A 1 109 ? 12.906  -9.010  -3.935  1.00 0.00 ? 109 GLU A HB3  5  
ATOM 9388  H HG2  . GLU A 1 109 ? 11.234  -10.624 -4.604  1.00 0.00 ? 109 GLU A HG2  5  
ATOM 9389  H HG3  . GLU A 1 109 ? 11.221  -9.965  -6.238  1.00 0.00 ? 109 GLU A HG3  5  
ATOM 9390  N N    . ALA A 1 110 ? 9.334   -9.091  -5.352  1.00 0.00 ? 110 ALA A N    5  
ATOM 9391  C CA   . ALA A 1 110 ? 8.204   -9.374  -6.228  1.00 0.00 ? 110 ALA A CA   5  
ATOM 9392  C C    . ALA A 1 110 ? 7.177   -8.248  -6.179  1.00 0.00 ? 110 ALA A C    5  
ATOM 9393  O O    . ALA A 1 110 ? 6.544   -7.930  -7.186  1.00 0.00 ? 110 ALA A O    5  
ATOM 9394  C CB   . ALA A 1 110 ? 7.558   -10.697 -5.844  1.00 0.00 ? 110 ALA A CB   5  
ATOM 9395  H H    . ALA A 1 110 ? 9.554   -9.722  -4.636  1.00 0.00 ? 110 ALA A H    5  
ATOM 9396  H HA   . ALA A 1 110 ? 8.578   -9.463  -7.237  1.00 0.00 ? 110 ALA A HA   5  
ATOM 9397  H HB1  . ALA A 1 110 ? 6.760   -10.517 -5.140  1.00 0.00 ? 110 ALA A HB1  5  
ATOM 9398  H HB2  . ALA A 1 110 ? 7.158   -11.171 -6.729  1.00 0.00 ? 110 ALA A HB2  5  
ATOM 9399  H HB3  . ALA A 1 110 ? 8.298   -11.341 -5.393  1.00 0.00 ? 110 ALA A HB3  5  
ATOM 9400  N N    . TRP A 1 111 ? 7.017   -7.650  -5.005  1.00 0.00 ? 111 TRP A N    5  
ATOM 9401  C CA   . TRP A 1 111 ? 6.065   -6.559  -4.826  1.00 0.00 ? 111 TRP A CA   5  
ATOM 9402  C C    . TRP A 1 111 ? 6.546   -5.295  -5.531  1.00 0.00 ? 111 TRP A C    5  
ATOM 9403  O O    . TRP A 1 111 ? 5.763   -4.594  -6.171  1.00 0.00 ? 111 TRP A O    5  
ATOM 9404  C CB   . TRP A 1 111 ? 5.853   -6.279  -3.338  1.00 0.00 ? 111 TRP A CB   5  
ATOM 9405  C CG   . TRP A 1 111 ? 4.734   -7.074  -2.737  1.00 0.00 ? 111 TRP A CG   5  
ATOM 9406  C CD1  . TRP A 1 111 ? 4.845   -8.094  -1.835  1.00 0.00 ? 111 TRP A CD1  5  
ATOM 9407  C CD2  . TRP A 1 111 ? 3.334   -6.917  -2.997  1.00 0.00 ? 111 TRP A CD2  5  
ATOM 9408  N NE1  . TRP A 1 111 ? 3.599   -8.580  -1.519  1.00 0.00 ? 111 TRP A NE1  5  
ATOM 9409  C CE2  . TRP A 1 111 ? 2.656   -7.874  -2.217  1.00 0.00 ? 111 TRP A CE2  5  
ATOM 9410  C CE3  . TRP A 1 111 ? 2.589   -6.059  -3.810  1.00 0.00 ? 111 TRP A CE3  5  
ATOM 9411  C CZ2  . TRP A 1 111 ? 1.269   -7.996  -2.230  1.00 0.00 ? 111 TRP A CZ2  5  
ATOM 9412  C CZ3  . TRP A 1 111 ? 1.213   -6.182  -3.821  1.00 0.00 ? 111 TRP A CZ3  5  
ATOM 9413  C CH2  . TRP A 1 111 ? 0.564   -7.143  -3.035  1.00 0.00 ? 111 TRP A CH2  5  
ATOM 9414  H H    . TRP A 1 111 ? 7.551   -7.948  -4.239  1.00 0.00 ? 111 TRP A H    5  
ATOM 9415  H HA   . TRP A 1 111 ? 5.126   -6.865  -5.263  1.00 0.00 ? 111 TRP A HA   5  
ATOM 9416  H HB2  . TRP A 1 111 ? 6.758   -6.518  -2.800  1.00 0.00 ? 111 TRP A HB2  5  
ATOM 9417  H HB3  . TRP A 1 111 ? 5.626   -5.230  -3.205  1.00 0.00 ? 111 TRP A HB3  5  
ATOM 9418  H HD1  . TRP A 1 111 ? 5.782   -8.456  -1.440  1.00 0.00 ? 111 TRP A HD1  5  
ATOM 9419  H HE1  . TRP A 1 111 ? 3.417   -9.312  -0.893  1.00 0.00 ? 111 TRP A HE1  5  
ATOM 9420  H HE3  . TRP A 1 111 ? 3.070   -5.311  -4.422  1.00 0.00 ? 111 TRP A HE3  5  
ATOM 9421  H HZ2  . TRP A 1 111 ? 0.754   -8.732  -1.629  1.00 0.00 ? 111 TRP A HZ2  5  
ATOM 9422  H HZ3  . TRP A 1 111 ? 0.620   -5.528  -4.444  1.00 0.00 ? 111 TRP A HZ3  5  
ATOM 9423  H HH2  . TRP A 1 111 ? -0.513  -7.203  -3.076  1.00 0.00 ? 111 TRP A HH2  5  
ATOM 9424  N N    . ILE A 1 112 ? 7.839   -5.011  -5.409  1.00 0.00 ? 112 ILE A N    5  
ATOM 9425  C CA   . ILE A 1 112 ? 8.423   -3.832  -6.035  1.00 0.00 ? 112 ILE A CA   5  
ATOM 9426  C C    . ILE A 1 112 ? 8.277   -3.886  -7.552  1.00 0.00 ? 112 ILE A C    5  
ATOM 9427  O O    . ILE A 1 112 ? 7.988   -2.876  -8.194  1.00 0.00 ? 112 ILE A O    5  
ATOM 9428  C CB   . ILE A 1 112 ? 9.915   -3.687  -5.680  1.00 0.00 ? 112 ILE A CB   5  
ATOM 9429  C CG1  . ILE A 1 112 ? 10.078  -3.357  -4.195  1.00 0.00 ? 112 ILE A CG1  5  
ATOM 9430  C CG2  . ILE A 1 112 ? 10.562  -2.612  -6.541  1.00 0.00 ? 112 ILE A CG2  5  
ATOM 9431  C CD1  . ILE A 1 112 ? 11.514  -3.400  -3.720  1.00 0.00 ? 112 ILE A CD1  5  
ATOM 9432  H H    . ILE A 1 112 ? 8.412   -5.609  -4.885  1.00 0.00 ? 112 ILE A H    5  
ATOM 9433  H HA   . ILE A 1 112 ? 7.899   -2.963  -5.664  1.00 0.00 ? 112 ILE A HA   5  
ATOM 9434  H HB   . ILE A 1 112 ? 10.405  -4.626  -5.889  1.00 0.00 ? 112 ILE A HB   5  
ATOM 9435  H HG12 . ILE A 1 112 ? 9.697   -2.366  -4.008  1.00 0.00 ? 112 ILE A HG12 5  
ATOM 9436  H HG13 . ILE A 1 112 ? 9.514   -4.071  -3.611  1.00 0.00 ? 112 ILE A HG13 5  
ATOM 9437  H HG21 . ILE A 1 112 ? 10.384  -2.831  -7.583  1.00 0.00 ? 112 ILE A HG21 5  
ATOM 9438  H HG22 . ILE A 1 112 ? 10.135  -1.651  -6.297  1.00 0.00 ? 112 ILE A HG22 5  
ATOM 9439  H HG23 . ILE A 1 112 ? 11.625  -2.593  -6.354  1.00 0.00 ? 112 ILE A HG23 5  
ATOM 9440  H HD11 . ILE A 1 112 ? 12.142  -2.878  -4.428  1.00 0.00 ? 112 ILE A HD11 5  
ATOM 9441  H HD12 . ILE A 1 112 ? 11.588  -2.923  -2.754  1.00 0.00 ? 112 ILE A HD12 5  
ATOM 9442  H HD13 . ILE A 1 112 ? 11.837  -4.427  -3.642  1.00 0.00 ? 112 ILE A HD13 5  
ATOM 9443  N N    . GLN A 1 113 ? 8.476   -5.072  -8.119  1.00 0.00 ? 113 GLN A N    5  
ATOM 9444  C CA   . GLN A 1 113 ? 8.364   -5.258  -9.560  1.00 0.00 ? 113 GLN A CA   5  
ATOM 9445  C C    . GLN A 1 113 ? 7.021   -4.749  -10.073 1.00 0.00 ? 113 GLN A C    5  
ATOM 9446  O O    . GLN A 1 113 ? 6.957   -4.035  -11.073 1.00 0.00 ? 113 GLN A O    5  
ATOM 9447  C CB   . GLN A 1 113 ? 8.534   -6.735  -9.920  1.00 0.00 ? 113 GLN A CB   5  
ATOM 9448  C CG   . GLN A 1 113 ? 9.886   -7.306  -9.523  1.00 0.00 ? 113 GLN A CG   5  
ATOM 9449  C CD   . GLN A 1 113 ? 10.339  -8.425  -10.440 1.00 0.00 ? 113 GLN A CD   5  
ATOM 9450  O OE1  . GLN A 1 113 ? 11.285  -8.265  -11.212 1.00 0.00 ? 113 GLN A OE1  5  
ATOM 9451  N NE2  . GLN A 1 113 ? 9.666   -9.566  -10.359 1.00 0.00 ? 113 GLN A NE2  5  
ATOM 9452  H H    . GLN A 1 113 ? 8.703   -5.840  -7.554  1.00 0.00 ? 113 GLN A H    5  
ATOM 9453  H HA   . GLN A 1 113 ? 9.153   -4.689  -10.030 1.00 0.00 ? 113 GLN A HA   5  
ATOM 9454  H HB2  . GLN A 1 113 ? 7.765   -7.306  -9.422  1.00 0.00 ? 113 GLN A HB2  5  
ATOM 9455  H HB3  . GLN A 1 113 ? 8.421   -6.848  -10.988 1.00 0.00 ? 113 GLN A HB3  5  
ATOM 9456  H HG2  . GLN A 1 113 ? 10.620  -6.515  -9.555  1.00 0.00 ? 113 GLN A HG2  5  
ATOM 9457  H HG3  . GLN A 1 113 ? 9.817   -7.691  -8.516  1.00 0.00 ? 113 GLN A HG3  5  
ATOM 9458  H HE21 . GLN A 1 113 ? 8.923   -9.621  -9.722  1.00 0.00 ? 113 GLN A HE21 5  
ATOM 9459  H HE22 . GLN A 1 113 ? 9.937   -10.306 -10.941 1.00 0.00 ? 113 GLN A HE22 5  
ATOM 9460  N N    . ALA A 1 114 ? 5.949   -5.123  -9.381  1.00 0.00 ? 114 ALA A N    5  
ATOM 9461  C CA   . ALA A 1 114 ? 4.607   -4.703  -9.765  1.00 0.00 ? 114 ALA A CA   5  
ATOM 9462  C C    . ALA A 1 114 ? 4.336   -3.266  -9.331  1.00 0.00 ? 114 ALA A C    5  
ATOM 9463  O O    . ALA A 1 114 ? 3.934   -2.430  -10.138 1.00 0.00 ? 114 ALA A O    5  
ATOM 9464  C CB   . ALA A 1 114 ? 3.569   -5.642  -9.167  1.00 0.00 ? 114 ALA A CB   5  
ATOM 9465  H H    . ALA A 1 114 ? 6.064   -5.693  -8.592  1.00 0.00 ? 114 ALA A H    5  
ATOM 9466  H HA   . ALA A 1 114 ? 4.534   -4.763  -10.841 1.00 0.00 ? 114 ALA A HA   5  
ATOM 9467  H HB1  . ALA A 1 114 ? 3.176   -6.282  -9.942  1.00 0.00 ? 114 ALA A HB1  5  
ATOM 9468  H HB2  . ALA A 1 114 ? 4.031   -6.246  -8.400  1.00 0.00 ? 114 ALA A HB2  5  
ATOM 9469  H HB3  . ALA A 1 114 ? 2.767   -5.063  -8.736  1.00 0.00 ? 114 ALA A HB3  5  
ATOM 9470  N N    . MET A 1 115 ? 4.559   -2.988  -8.050  1.00 0.00 ? 115 MET A N    5  
ATOM 9471  C CA   . MET A 1 115 ? 4.339   -1.652  -7.510  1.00 0.00 ? 115 MET A CA   5  
ATOM 9472  C C    . MET A 1 115 ? 5.275   -0.640  -8.164  1.00 0.00 ? 115 MET A C    5  
ATOM 9473  O O    . MET A 1 115 ? 4.827   0.308   -8.808  1.00 0.00 ? 115 MET A O    5  
ATOM 9474  C CB   . MET A 1 115 ? 4.546   -1.651  -5.994  1.00 0.00 ? 115 MET A CB   5  
ATOM 9475  C CG   . MET A 1 115 ? 3.320   -2.094  -5.213  1.00 0.00 ? 115 MET A CG   5  
ATOM 9476  S SD   . MET A 1 115 ? 3.331   -1.502  -3.509  1.00 0.00 ? 115 MET A SD   5  
ATOM 9477  C CE   . MET A 1 115 ? 2.901   -3.001  -2.628  1.00 0.00 ? 115 MET A CE   5  
ATOM 9478  H H    . MET A 1 115 ? 4.880   -3.697  -7.455  1.00 0.00 ? 115 MET A H    5  
ATOM 9479  H HA   . MET A 1 115 ? 3.318   -1.372  -7.725  1.00 0.00 ? 115 MET A HA   5  
ATOM 9480  H HB2  . MET A 1 115 ? 5.361   -2.318  -5.754  1.00 0.00 ? 115 MET A HB2  5  
ATOM 9481  H HB3  . MET A 1 115 ? 4.805   -0.651  -5.678  1.00 0.00 ? 115 MET A HB3  5  
ATOM 9482  H HG2  . MET A 1 115 ? 2.438   -1.713  -5.705  1.00 0.00 ? 115 MET A HG2  5  
ATOM 9483  H HG3  . MET A 1 115 ? 3.287   -3.173  -5.205  1.00 0.00 ? 115 MET A HG3  5  
ATOM 9484  H HE1  . MET A 1 115 ? 1.842   -3.187  -2.730  1.00 0.00 ? 115 MET A HE1  5  
ATOM 9485  H HE2  . MET A 1 115 ? 3.454   -3.832  -3.039  1.00 0.00 ? 115 MET A HE2  5  
ATOM 9486  H HE3  . MET A 1 115 ? 3.147   -2.887  -1.582  1.00 0.00 ? 115 MET A HE3  5  
ATOM 9487  N N    . GLY A 1 116 ? 6.577   -0.847  -7.992  1.00 0.00 ? 116 GLY A N    5  
ATOM 9488  C CA   . GLY A 1 116 ? 7.554   0.055   -8.571  1.00 0.00 ? 116 GLY A CA   5  
ATOM 9489  C C    . GLY A 1 116 ? 7.237   0.408   -10.011 1.00 0.00 ? 116 GLY A C    5  
ATOM 9490  O O    . GLY A 1 116 ? 7.221   1.581   -10.380 1.00 0.00 ? 116 GLY A O    5  
ATOM 9491  H H    . GLY A 1 116 ? 6.876   -1.620  -7.468  1.00 0.00 ? 116 GLY A H    5  
ATOM 9492  H HA2  . GLY A 1 116 ? 7.581   0.963   -7.987  1.00 0.00 ? 116 GLY A HA2  5  
ATOM 9493  H HA3  . GLY A 1 116 ? 8.527   -0.414  -8.534  1.00 0.00 ? 116 GLY A HA3  5  
ATOM 9494  N N    . GLU A 1 117 ? 6.985   -0.612  -10.827 1.00 0.00 ? 117 GLU A N    5  
ATOM 9495  C CA   . GLU A 1 117 ? 6.669   -0.403  -12.235 1.00 0.00 ? 117 GLU A CA   5  
ATOM 9496  C C    . GLU A 1 117 ? 5.322   0.296   -12.392 1.00 0.00 ? 117 GLU A C    5  
ATOM 9497  O O    . GLU A 1 117 ? 5.215   1.314   -13.074 1.00 0.00 ? 117 GLU A O    5  
ATOM 9498  C CB   . GLU A 1 117 ? 6.654   -1.739  -12.981 1.00 0.00 ? 117 GLU A CB   5  
ATOM 9499  C CG   . GLU A 1 117 ? 8.040   -2.278  -13.291 1.00 0.00 ? 117 GLU A CG   5  
ATOM 9500  C CD   . GLU A 1 117 ? 8.012   -3.418  -14.290 1.00 0.00 ? 117 GLU A CD   5  
ATOM 9501  O OE1  . GLU A 1 117 ? 7.393   -4.459  -13.985 1.00 0.00 ? 117 GLU A OE1  5  
ATOM 9502  O OE2  . GLU A 1 117 ? 8.609   -3.270  -15.377 1.00 0.00 ? 117 GLU A OE2  5  
ATOM 9503  H H    . GLU A 1 117 ? 7.013   -1.525  -10.473 1.00 0.00 ? 117 GLU A H    5  
ATOM 9504  H HA   . GLU A 1 117 ? 7.438   0.226   -12.657 1.00 0.00 ? 117 GLU A HA   5  
ATOM 9505  H HB2  . GLU A 1 117 ? 6.132   -2.468  -12.378 1.00 0.00 ? 117 GLU A HB2  5  
ATOM 9506  H HB3  . GLU A 1 117 ? 6.124   -1.610  -13.913 1.00 0.00 ? 117 GLU A HB3  5  
ATOM 9507  H HG2  . GLU A 1 117 ? 8.641   -1.479  -13.697 1.00 0.00 ? 117 GLU A HG2  5  
ATOM 9508  H HG3  . GLU A 1 117 ? 8.487   -2.634  -12.374 1.00 0.00 ? 117 GLU A HG3  5  
ATOM 9509  N N    . ALA A 1 118 ? 4.296   -0.261  -11.757 1.00 0.00 ? 118 ALA A N    5  
ATOM 9510  C CA   . ALA A 1 118 ? 2.955   0.308   -11.825 1.00 0.00 ? 118 ALA A CA   5  
ATOM 9511  C C    . ALA A 1 118 ? 2.950   1.758   -11.351 1.00 0.00 ? 118 ALA A C    5  
ATOM 9512  O O    . ALA A 1 118 ? 2.070   2.537   -11.716 1.00 0.00 ? 118 ALA A O    5  
ATOM 9513  C CB   . ALA A 1 118 ? 1.986   -0.523  -10.997 1.00 0.00 ? 118 ALA A CB   5  
ATOM 9514  H H    . ALA A 1 118 ? 4.444   -1.073  -11.229 1.00 0.00 ? 118 ALA A H    5  
ATOM 9515  H HA   . ALA A 1 118 ? 2.631   0.276   -12.855 1.00 0.00 ? 118 ALA A HA   5  
ATOM 9516  H HB1  . ALA A 1 118 ? 1.719   -1.414  -11.545 1.00 0.00 ? 118 ALA A HB1  5  
ATOM 9517  H HB2  . ALA A 1 118 ? 2.457   -0.801  -10.065 1.00 0.00 ? 118 ALA A HB2  5  
ATOM 9518  H HB3  . ALA A 1 118 ? 1.098   0.056   -10.794 1.00 0.00 ? 118 ALA A HB3  5  
ATOM 9519  N N    . ALA A 1 119 ? 3.937   2.113   -10.535 1.00 0.00 ? 119 ALA A N    5  
ATOM 9520  C CA   . ALA A 1 119 ? 4.046   3.469   -10.012 1.00 0.00 ? 119 ALA A CA   5  
ATOM 9521  C C    . ALA A 1 119 ? 4.679   4.403   -11.038 1.00 0.00 ? 119 ALA A C    5  
ATOM 9522  O O    . ALA A 1 119 ? 4.348   5.587   -11.100 1.00 0.00 ? 119 ALA A O    5  
ATOM 9523  C CB   . ALA A 1 119 ? 4.853   3.474   -8.723  1.00 0.00 ? 119 ALA A CB   5  
ATOM 9524  H H    . ALA A 1 119 ? 4.609   1.446   -10.279 1.00 0.00 ? 119 ALA A H    5  
ATOM 9525  H HA   . ALA A 1 119 ? 3.050   3.821   -9.786  1.00 0.00 ? 119 ALA A HA   5  
ATOM 9526  H HB1  . ALA A 1 119 ? 5.082   2.458   -8.437  1.00 0.00 ? 119 ALA A HB1  5  
ATOM 9527  H HB2  . ALA A 1 119 ? 5.773   4.020   -8.877  1.00 0.00 ? 119 ALA A HB2  5  
ATOM 9528  H HB3  . ALA A 1 119 ? 4.279   3.948   -7.941  1.00 0.00 ? 119 ALA A HB3  5  
ATOM 9529  N N    . ARG A 1 120 ? 5.590   3.863   -11.841 1.00 0.00 ? 120 ARG A N    5  
ATOM 9530  C CA   . ARG A 1 120 ? 6.270   4.650   -12.863 1.00 0.00 ? 120 ARG A CA   5  
ATOM 9531  C C    . ARG A 1 120 ? 5.285   5.554   -13.598 1.00 0.00 ? 120 ARG A C    5  
ATOM 9532  O O    . ARG A 1 120 ? 4.194   5.124   -13.976 1.00 0.00 ? 120 ARG A O    5  
ATOM 9533  C CB   . ARG A 1 120 ? 6.976   3.729   -13.860 1.00 0.00 ? 120 ARG A CB   5  
ATOM 9534  C CG   . ARG A 1 120 ? 6.085   3.275   -15.005 1.00 0.00 ? 120 ARG A CG   5  
ATOM 9535  C CD   . ARG A 1 120 ? 6.671   2.068   -15.721 1.00 0.00 ? 120 ARG A CD   5  
ATOM 9536  N NE   . ARG A 1 120 ? 5.828   1.627   -16.830 1.00 0.00 ? 120 ARG A NE   5  
ATOM 9537  C CZ   . ARG A 1 120 ? 5.975   0.460   -17.446 1.00 0.00 ? 120 ARG A CZ   5  
ATOM 9538  N NH1  . ARG A 1 120 ? 6.926   -0.381  -17.062 1.00 0.00 ? 120 ARG A NH1  5  
ATOM 9539  N NH2  . ARG A 1 120 ? 5.169   0.130   -18.447 1.00 0.00 ? 120 ARG A NH2  5  
ATOM 9540  H H    . ARG A 1 120 ? 5.811   2.913   -11.743 1.00 0.00 ? 120 ARG A H    5  
ATOM 9541  H HA   . ARG A 1 120 ? 7.008   5.266   -12.371 1.00 0.00 ? 120 ARG A HA   5  
ATOM 9542  H HB2  . ARG A 1 120 ? 7.823   4.252   -14.278 1.00 0.00 ? 120 ARG A HB2  5  
ATOM 9543  H HB3  . ARG A 1 120 ? 7.326   2.852   -13.336 1.00 0.00 ? 120 ARG A HB3  5  
ATOM 9544  H HG2  . ARG A 1 120 ? 5.115   3.010   -14.612 1.00 0.00 ? 120 ARG A HG2  5  
ATOM 9545  H HG3  . ARG A 1 120 ? 5.981   4.086   -15.711 1.00 0.00 ? 120 ARG A HG3  5  
ATOM 9546  H HD2  . ARG A 1 120 ? 7.645   2.331   -16.104 1.00 0.00 ? 120 ARG A HD2  5  
ATOM 9547  H HD3  . ARG A 1 120 ? 6.769   1.259   -15.012 1.00 0.00 ? 120 ARG A HD3  5  
ATOM 9548  H HE   . ARG A 1 120 ? 5.119   2.233   -17.130 1.00 0.00 ? 120 ARG A HE   5  
ATOM 9549  H HH11 . ARG A 1 120 ? 7.534   -0.136  -16.307 1.00 0.00 ? 120 ARG A HH11 5  
ATOM 9550  H HH12 . ARG A 1 120 ? 7.033   -1.261  -17.526 1.00 0.00 ? 120 ARG A HH12 5  
ATOM 9551  H HH21 . ARG A 1 120 ? 4.451   0.761   -18.739 1.00 0.00 ? 120 ARG A HH21 5  
ATOM 9552  H HH22 . ARG A 1 120 ? 5.280   -0.749  -18.909 1.00 0.00 ? 120 ARG A HH22 5  
ATOM 9553  N N    . VAL A 1 121 ? 5.676   6.808   -13.798 1.00 0.00 ? 121 VAL A N    5  
ATOM 9554  C CA   . VAL A 1 121 ? 4.829   7.773   -14.488 1.00 0.00 ? 121 VAL A CA   5  
ATOM 9555  C C    . VAL A 1 121 ? 5.501   8.287   -15.756 1.00 0.00 ? 121 VAL A C    5  
ATOM 9556  O O    . VAL A 1 121 ? 4.860   8.915   -16.599 1.00 0.00 ? 121 VAL A O    5  
ATOM 9557  C CB   . VAL A 1 121 ? 4.486   8.969   -13.581 1.00 0.00 ? 121 VAL A CB   5  
ATOM 9558  C CG1  . VAL A 1 121 ? 5.733   9.785   -13.279 1.00 0.00 ? 121 VAL A CG1  5  
ATOM 9559  C CG2  . VAL A 1 121 ? 3.414   9.836   -14.225 1.00 0.00 ? 121 VAL A CG2  5  
ATOM 9560  H H    . VAL A 1 121 ? 6.557   7.092   -13.474 1.00 0.00 ? 121 VAL A H    5  
ATOM 9561  H HA   . VAL A 1 121 ? 3.907   7.276   -14.757 1.00 0.00 ? 121 VAL A HA   5  
ATOM 9562  H HB   . VAL A 1 121 ? 4.098   8.588   -12.648 1.00 0.00 ? 121 VAL A HB   5  
ATOM 9563  H HG11 . VAL A 1 121 ? 5.541   10.439  -12.441 1.00 0.00 ? 121 VAL A HG11 5  
ATOM 9564  H HG12 . VAL A 1 121 ? 6.550   9.120   -13.040 1.00 0.00 ? 121 VAL A HG12 5  
ATOM 9565  H HG13 . VAL A 1 121 ? 5.993   10.378  -14.144 1.00 0.00 ? 121 VAL A HG13 5  
ATOM 9566  H HG21 . VAL A 1 121 ? 3.883   10.603  -14.823 1.00 0.00 ? 121 VAL A HG21 5  
ATOM 9567  H HG22 . VAL A 1 121 ? 2.786   9.223   -14.853 1.00 0.00 ? 121 VAL A HG22 5  
ATOM 9568  H HG23 . VAL A 1 121 ? 2.813   10.298  -13.455 1.00 0.00 ? 121 VAL A HG23 5  
ATOM 9569  N N    . GLN A 1 122 ? 6.796   8.015   -15.885 1.00 0.00 ? 122 GLN A N    5  
ATOM 9570  C CA   . GLN A 1 122 ? 7.555   8.451   -17.051 1.00 0.00 ? 122 GLN A CA   5  
ATOM 9571  C C    . GLN A 1 122 ? 7.550   7.379   -18.135 1.00 0.00 ? 122 GLN A C    5  
ATOM 9572  O O    . GLN A 1 122 ? 8.477   7.292   -18.941 1.00 0.00 ? 122 GLN A O    5  
ATOM 9573  C CB   . GLN A 1 122 ? 8.994   8.784   -16.653 1.00 0.00 ? 122 GLN A CB   5  
ATOM 9574  C CG   . GLN A 1 122 ? 9.718   9.657   -17.665 1.00 0.00 ? 122 GLN A CG   5  
ATOM 9575  C CD   . GLN A 1 122 ? 9.474   11.136  -17.441 1.00 0.00 ? 122 GLN A CD   5  
ATOM 9576  O OE1  . GLN A 1 122 ? 9.264   11.578  -16.311 1.00 0.00 ? 122 GLN A OE1  5  
ATOM 9577  N NE2  . GLN A 1 122 ? 9.501   11.912  -18.519 1.00 0.00 ? 122 GLN A NE2  5  
ATOM 9578  H H    . GLN A 1 122 ? 7.250   7.511   -15.179 1.00 0.00 ? 122 GLN A H    5  
ATOM 9579  H HA   . GLN A 1 122 ? 7.084   9.341   -17.440 1.00 0.00 ? 122 GLN A HA   5  
ATOM 9580  H HB2  . GLN A 1 122 ? 8.982   9.302   -15.706 1.00 0.00 ? 122 GLN A HB2  5  
ATOM 9581  H HB3  . GLN A 1 122 ? 9.547   7.863   -16.544 1.00 0.00 ? 122 GLN A HB3  5  
ATOM 9582  H HG2  . GLN A 1 122 ? 10.779  9.468   -17.591 1.00 0.00 ? 122 GLN A HG2  5  
ATOM 9583  H HG3  . GLN A 1 122 ? 9.376   9.397   -18.656 1.00 0.00 ? 122 GLN A HG3  5  
ATOM 9584  H HE21 . GLN A 1 122 ? 9.673   11.490  -19.387 1.00 0.00 ? 122 GLN A HE21 5  
ATOM 9585  H HE22 . GLN A 1 122 ? 9.345   12.871  -18.403 1.00 0.00 ? 122 GLN A HE22 5  
ATOM 9586  N N    . GLY A 1 1   ? 10.310  36.899  -8.876  1.00 0.00 ? 1   GLY A N    6  
ATOM 9587  C CA   . GLY A 1 1   ? 9.189   35.986  -9.003  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9588  C C    . GLY A 1 1   ? 7.976   36.444  -8.217  1.00 0.00 ? 1   GLY A C    6  
ATOM 9589  O O    . GLY A 1 1   ? 7.811   36.084  -7.052  1.00 0.00 ? 1   GLY A O    6  
ATOM 9590  H H1   . GLY A 1 1   ? 10.153  37.867  -8.873  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9591  H HA2  . GLY A 1 1   ? 8.921   35.905  -10.046 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9592  H HA3  . GLY A 1 1   ? 9.490   35.013  -8.643  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9593  N N    . SER A 1 2   ? 7.126   37.241  -8.856  1.00 0.00 ? 2   SER A N    6  
ATOM 9594  C CA   . SER A 1 2   ? 5.925   37.754  -8.208  1.00 0.00 ? 2   SER A CA   6  
ATOM 9595  C C    . SER A 1 2   ? 4.680   37.403  -9.016  1.00 0.00 ? 2   SER A C    6  
ATOM 9596  O O    . SER A 1 2   ? 4.219   38.192  -9.842  1.00 0.00 ? 2   SER A O    6  
ATOM 9597  C CB   . SER A 1 2   ? 6.022   39.271  -8.032  1.00 0.00 ? 2   SER A CB   6  
ATOM 9598  O OG   . SER A 1 2   ? 4.868   39.785  -7.391  1.00 0.00 ? 2   SER A OG   6  
ATOM 9599  H H    . SER A 1 2   ? 7.313   37.493  -9.785  1.00 0.00 ? 2   SER A H    6  
ATOM 9600  H HA   . SER A 1 2   ? 5.850   37.292  -7.235  1.00 0.00 ? 2   SER A HA   6  
ATOM 9601  H HB2  . SER A 1 2   ? 6.888   39.506  -7.431  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9602  H HB3  . SER A 1 2   ? 6.120   39.737  -9.002  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9603  H HG   . SER A 1 2   ? 4.610   39.199  -6.676  1.00 0.00 ? 2   SER A HG   6  
ATOM 9604  N N    . SER A 1 3   ? 4.139   36.214  -8.772  1.00 0.00 ? 3   SER A N    6  
ATOM 9605  C CA   . SER A 1 3   ? 2.949   35.755  -9.480  1.00 0.00 ? 3   SER A CA   6  
ATOM 9606  C C    . SER A 1 3   ? 2.270   34.619  -8.721  1.00 0.00 ? 3   SER A C    6  
ATOM 9607  O O    . SER A 1 3   ? 2.913   33.890  -7.967  1.00 0.00 ? 3   SER A O    6  
ATOM 9608  C CB   . SER A 1 3   ? 3.316   35.294  -10.892 1.00 0.00 ? 3   SER A CB   6  
ATOM 9609  O OG   . SER A 1 3   ? 2.191   35.345  -11.752 1.00 0.00 ? 3   SER A OG   6  
ATOM 9610  H H    . SER A 1 3   ? 4.552   35.630  -8.102  1.00 0.00 ? 3   SER A H    6  
ATOM 9611  H HA   . SER A 1 3   ? 2.264   36.587  -9.548  1.00 0.00 ? 3   SER A HA   6  
ATOM 9612  H HB2  . SER A 1 3   ? 4.087   35.936  -11.289 1.00 0.00 ? 3   SER A HB2  6  
ATOM 9613  H HB3  . SER A 1 3   ? 3.678   34.277  -10.852 1.00 0.00 ? 3   SER A HB3  6  
ATOM 9614  H HG   . SER A 1 3   ? 1.387   35.257  -11.235 1.00 0.00 ? 3   SER A HG   6  
ATOM 9615  N N    . GLY A 1 4   ? 0.965   34.475  -8.927  1.00 0.00 ? 4   GLY A N    6  
ATOM 9616  C CA   . GLY A 1 4   ? 0.219   33.426  -8.256  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9617  C C    . GLY A 1 4   ? 0.183   32.139  -9.056  1.00 0.00 ? 4   GLY A C    6  
ATOM 9618  O O    . GLY A 1 4   ? 0.823   32.031  -10.101 1.00 0.00 ? 4   GLY A O    6  
ATOM 9619  H H    . GLY A 1 4   ? 0.504   35.086  -9.540  1.00 0.00 ? 4   GLY A H    6  
ATOM 9620  H HA2  . GLY A 1 4   ? 0.677   33.230  -7.298  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9621  H HA3  . GLY A 1 4   ? -0.794  33.766  -8.097  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9622  N N    . SER A 1 5   ? -0.567  31.159  -8.562  1.00 0.00 ? 5   SER A N    6  
ATOM 9623  C CA   . SER A 1 5   ? -0.680  29.870  -9.235  1.00 0.00 ? 5   SER A CA   6  
ATOM 9624  C C    . SER A 1 5   ? -2.084  29.295  -9.075  1.00 0.00 ? 5   SER A C    6  
ATOM 9625  O O    . SER A 1 5   ? -2.598  29.181  -7.962  1.00 0.00 ? 5   SER A O    6  
ATOM 9626  C CB   . SER A 1 5   ? 0.352   28.887  -8.677  1.00 0.00 ? 5   SER A CB   6  
ATOM 9627  O OG   . SER A 1 5   ? 0.192   28.720  -7.279  1.00 0.00 ? 5   SER A OG   6  
ATOM 9628  H H    . SER A 1 5   ? -1.054  31.305  -7.724  1.00 0.00 ? 5   SER A H    6  
ATOM 9629  H HA   . SER A 1 5   ? -0.485  30.026  -10.285 1.00 0.00 ? 5   SER A HA   6  
ATOM 9630  H HB2  . SER A 1 5   ? 0.229   27.929  -9.158  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9631  H HB3  . SER A 1 5   ? 1.345   29.264  -8.872  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9632  H HG   . SER A 1 5   ? -0.208  29.509  -6.905  1.00 0.00 ? 5   SER A HG   6  
ATOM 9633  N N    . SER A 1 6   ? -2.700  28.934  -10.197 1.00 0.00 ? 6   SER A N    6  
ATOM 9634  C CA   . SER A 1 6   ? -4.047  28.374  -10.183 1.00 0.00 ? 6   SER A CA   6  
ATOM 9635  C C    . SER A 1 6   ? -4.054  26.992  -9.537  1.00 0.00 ? 6   SER A C    6  
ATOM 9636  O O    . SER A 1 6   ? -3.390  26.070  -10.009 1.00 0.00 ? 6   SER A O    6  
ATOM 9637  C CB   . SER A 1 6   ? -4.600  28.287  -11.607 1.00 0.00 ? 6   SER A CB   6  
ATOM 9638  O OG   . SER A 1 6   ? -5.076  29.547  -12.047 1.00 0.00 ? 6   SER A OG   6  
ATOM 9639  H H    . SER A 1 6   ? -2.238  29.050  -11.054 1.00 0.00 ? 6   SER A H    6  
ATOM 9640  H HA   . SER A 1 6   ? -4.674  29.034  -9.603  1.00 0.00 ? 6   SER A HA   6  
ATOM 9641  H HB2  . SER A 1 6   ? -3.818  27.959  -12.275 1.00 0.00 ? 6   SER A HB2  6  
ATOM 9642  H HB3  . SER A 1 6   ? -5.415  27.578  -11.631 1.00 0.00 ? 6   SER A HB3  6  
ATOM 9643  H HG   . SER A 1 6   ? -4.566  29.834  -12.808 1.00 0.00 ? 6   SER A HG   6  
ATOM 9644  N N    . GLY A 1 7   ? -4.811  26.857  -8.452  1.00 0.00 ? 7   GLY A N    6  
ATOM 9645  C CA   . GLY A 1 7   ? -4.892  25.586  -7.758  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9646  C C    . GLY A 1 7   ? -5.711  24.561  -8.517  1.00 0.00 ? 7   GLY A C    6  
ATOM 9647  O O    . GLY A 1 7   ? -6.681  24.907  -9.191  1.00 0.00 ? 7   GLY A O    6  
ATOM 9648  H H    . GLY A 1 7   ? -5.319  27.627  -8.121  1.00 0.00 ? 7   GLY A H    6  
ATOM 9649  H HA2  . GLY A 1 7   ? -3.893  25.200  -7.618  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9650  H HA3  . GLY A 1 7   ? -5.345  25.745  -6.790  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9651  N N    . GLY A 1 8   ? -5.320  23.295  -8.410  1.00 0.00 ? 8   GLY A N    6  
ATOM 9652  C CA   . GLY A 1 8   ? -6.035  22.236  -9.098  1.00 0.00 ? 8   GLY A CA   6  
ATOM 9653  C C    . GLY A 1 8   ? -6.957  21.464  -8.176  1.00 0.00 ? 8   GLY A C    6  
ATOM 9654  O O    . GLY A 1 8   ? -8.171  21.439  -8.377  1.00 0.00 ? 8   GLY A O    6  
ATOM 9655  H H    . GLY A 1 8   ? -4.540  23.078  -7.858  1.00 0.00 ? 8   GLY A H    6  
ATOM 9656  H HA2  . GLY A 1 8   ? -6.621  22.671  -9.895  1.00 0.00 ? 8   GLY A HA2  6  
ATOM 9657  H HA3  . GLY A 1 8   ? -5.317  21.552  -9.526  1.00 0.00 ? 8   GLY A HA3  6  
ATOM 9658  N N    . LYS A 1 9   ? -6.380  20.829  -7.162  1.00 0.00 ? 9   LYS A N    6  
ATOM 9659  C CA   . LYS A 1 9   ? -7.157  20.051  -6.204  1.00 0.00 ? 9   LYS A CA   6  
ATOM 9660  C C    . LYS A 1 9   ? -6.303  19.657  -5.003  1.00 0.00 ? 9   LYS A C    6  
ATOM 9661  O O    . LYS A 1 9   ? -5.080  19.560  -5.104  1.00 0.00 ? 9   LYS A O    6  
ATOM 9662  C CB   . LYS A 1 9   ? -7.722  18.796  -6.874  1.00 0.00 ? 9   LYS A CB   6  
ATOM 9663  C CG   . LYS A 1 9   ? -6.654  17.863  -7.417  1.00 0.00 ? 9   LYS A CG   6  
ATOM 9664  C CD   . LYS A 1 9   ? -6.274  18.219  -8.844  1.00 0.00 ? 9   LYS A CD   6  
ATOM 9665  C CE   . LYS A 1 9   ? -5.073  17.415  -9.318  1.00 0.00 ? 9   LYS A CE   6  
ATOM 9666  N NZ   . LYS A 1 9   ? -5.469  16.073  -9.828  1.00 0.00 ? 9   LYS A NZ   6  
ATOM 9667  H H    . LYS A 1 9   ? -5.407  20.886  -7.054  1.00 0.00 ? 9   LYS A H    6  
ATOM 9668  H HA   . LYS A 1 9   ? -7.975  20.666  -5.863  1.00 0.00 ? 9   LYS A HA   6  
ATOM 9669  H HB2  . LYS A 1 9   ? -8.314  18.252  -6.153  1.00 0.00 ? 9   LYS A HB2  6  
ATOM 9670  H HB3  . LYS A 1 9   ? -8.358  19.097  -7.695  1.00 0.00 ? 9   LYS A HB3  6  
ATOM 9671  H HG2  . LYS A 1 9   ? -5.775  17.935  -6.793  1.00 0.00 ? 9   LYS A HG2  6  
ATOM 9672  H HG3  . LYS A 1 9   ? -7.030  16.849  -7.396  1.00 0.00 ? 9   LYS A HG3  6  
ATOM 9673  H HD2  . LYS A 1 9   ? -7.111  18.010  -9.493  1.00 0.00 ? 9   LYS A HD2  6  
ATOM 9674  H HD3  . LYS A 1 9   ? -6.033  19.272  -8.891  1.00 0.00 ? 9   LYS A HD3  6  
ATOM 9675  H HE2  . LYS A 1 9   ? -4.581  17.960  -10.110 1.00 0.00 ? 9   LYS A HE2  6  
ATOM 9676  H HE3  . LYS A 1 9   ? -4.391  17.290  -8.490  1.00 0.00 ? 9   LYS A HE3  6  
ATOM 9677  H HZ1  . LYS A 1 9   ? -5.150  15.333  -9.171  1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 9678  H HZ2  . LYS A 1 9   ? -5.041  15.904  -10.760 1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 9679  H HZ3  . LYS A 1 9   ? -6.504  16.017  -9.919  1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 9680  N N    . ARG A 1 10  ? -6.956  19.430  -3.868  1.00 0.00 ? 10  ARG A N    6  
ATOM 9681  C CA   . ARG A 1 10  ? -6.257  19.047  -2.647  1.00 0.00 ? 10  ARG A CA   6  
ATOM 9682  C C    . ARG A 1 10  ? -6.046  17.537  -2.593  1.00 0.00 ? 10  ARG A C    6  
ATOM 9683  O O    . ARG A 1 10  ? -4.912  17.058  -2.562  1.00 0.00 ? 10  ARG A O    6  
ATOM 9684  C CB   . ARG A 1 10  ? -7.041  19.508  -1.418  1.00 0.00 ? 10  ARG A CB   6  
ATOM 9685  C CG   . ARG A 1 10  ? -6.963  21.006  -1.172  1.00 0.00 ? 10  ARG A CG   6  
ATOM 9686  C CD   . ARG A 1 10  ? -7.784  21.415  0.041   1.00 0.00 ? 10  ARG A CD   6  
ATOM 9687  N NE   . ARG A 1 10  ? -8.020  22.855  0.082   1.00 0.00 ? 10  ARG A NE   6  
ATOM 9688  C CZ   . ARG A 1 10  ? -7.067  23.750  0.316   1.00 0.00 ? 10  ARG A CZ   6  
ATOM 9689  N NH1  . ARG A 1 10  ? -5.820  23.354  0.529   1.00 0.00 ? 10  ARG A NH1  6  
ATOM 9690  N NH2  . ARG A 1 10  ? -7.360  25.044  0.337   1.00 0.00 ? 10  ARG A NH2  6  
ATOM 9691  H H    . ARG A 1 10  ? -7.932  19.524  -3.850  1.00 0.00 ? 10  ARG A H    6  
ATOM 9692  H HA   . ARG A 1 10  ? -5.292  19.533  -2.651  1.00 0.00 ? 10  ARG A HA   6  
ATOM 9693  H HB2  . ARG A 1 10  ? -8.080  19.240  -1.547  1.00 0.00 ? 10  ARG A HB2  6  
ATOM 9694  H HB3  . ARG A 1 10  ? -6.653  19.001  -0.547  1.00 0.00 ? 10  ARG A HB3  6  
ATOM 9695  H HG2  . ARG A 1 10  ? -5.932  21.281  -1.004  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 9696  H HG3  . ARG A 1 10  ? -7.339  21.524  -2.042  1.00 0.00 ? 10  ARG A HG3  6  
ATOM 9697  H HD2  . ARG A 1 10  ? -8.735  20.905  0.004   1.00 0.00 ? 10  ARG A HD2  6  
ATOM 9698  H HD3  . ARG A 1 10  ? -7.253  21.121  0.934   1.00 0.00 ? 10  ARG A HD3  6  
ATOM 9699  H HE   . ARG A 1 10  ? -8.935  23.170  -0.073  1.00 0.00 ? 10  ARG A HE   6  
ATOM 9700  H HH11 . ARG A 1 10  ? -5.595  22.380  0.513   1.00 0.00 ? 10  ARG A HH11 6  
ATOM 9701  H HH12 . ARG A 1 10  ? -5.103  24.030  0.704   1.00 0.00 ? 10  ARG A HH12 6  
ATOM 9702  H HH21 . ARG A 1 10  ? -8.299  25.346  0.177   1.00 0.00 ? 10  ARG A HH21 6  
ATOM 9703  H HH22 . ARG A 1 10  ? -6.642  25.716  0.514   1.00 0.00 ? 10  ARG A HH22 6  
ATOM 9704  N N    . SER A 1 11  ? -7.147  16.791  -2.582  1.00 0.00 ? 11  SER A N    6  
ATOM 9705  C CA   . SER A 1 11  ? -7.083  15.335  -2.526  1.00 0.00 ? 11  SER A CA   6  
ATOM 9706  C C    . SER A 1 11  ? -8.443  14.720  -2.844  1.00 0.00 ? 11  SER A C    6  
ATOM 9707  O O    . SER A 1 11  ? -9.416  14.927  -2.118  1.00 0.00 ? 11  SER A O    6  
ATOM 9708  C CB   . SER A 1 11  ? -6.613  14.876  -1.145  1.00 0.00 ? 11  SER A CB   6  
ATOM 9709  O OG   . SER A 1 11  ? -7.572  15.188  -0.150  1.00 0.00 ? 11  SER A OG   6  
ATOM 9710  H H    . SER A 1 11  ? -8.022  17.231  -2.608  1.00 0.00 ? 11  SER A H    6  
ATOM 9711  H HA   . SER A 1 11  ? -6.370  15.006  -3.268  1.00 0.00 ? 11  SER A HA   6  
ATOM 9712  H HB2  . SER A 1 11  ? -6.459  13.808  -1.157  1.00 0.00 ? 11  SER A HB2  6  
ATOM 9713  H HB3  . SER A 1 11  ? -5.684  15.371  -0.901  1.00 0.00 ? 11  SER A HB3  6  
ATOM 9714  H HG   . SER A 1 11  ? -8.367  15.530  -0.567  1.00 0.00 ? 11  SER A HG   6  
ATOM 9715  N N    . HIS A 1 12  ? -8.502  13.961  -3.934  1.00 0.00 ? 12  HIS A N    6  
ATOM 9716  C CA   . HIS A 1 12  ? -9.742  13.314  -4.348  1.00 0.00 ? 12  HIS A CA   6  
ATOM 9717  C C    . HIS A 1 12  ? -9.705  11.821  -4.039  1.00 0.00 ? 12  HIS A C    6  
ATOM 9718  O O    . HIS A 1 12  ? -8.646  11.193  -4.085  1.00 0.00 ? 12  HIS A O    6  
ATOM 9719  C CB   . HIS A 1 12  ? -9.980  13.532  -5.843  1.00 0.00 ? 12  HIS A CB   6  
ATOM 9720  C CG   . HIS A 1 12  ? -10.726 14.793  -6.153  1.00 0.00 ? 12  HIS A CG   6  
ATOM 9721  N ND1  . HIS A 1 12  ? -10.101 15.968  -6.514  1.00 0.00 ? 12  HIS A ND1  6  
ATOM 9722  C CD2  . HIS A 1 12  ? -12.054 15.058  -6.156  1.00 0.00 ? 12  HIS A CD2  6  
ATOM 9723  C CE1  . HIS A 1 12  ? -11.012 16.902  -6.724  1.00 0.00 ? 12  HIS A CE1  6  
ATOM 9724  N NE2  . HIS A 1 12  ? -12.205 16.375  -6.514  1.00 0.00 ? 12  HIS A NE2  6  
ATOM 9725  H H    . HIS A 1 12  ? -7.693  13.833  -4.471  1.00 0.00 ? 12  HIS A H    6  
ATOM 9726  H HA   . HIS A 1 12  ? -10.552 13.764  -3.794  1.00 0.00 ? 12  HIS A HA   6  
ATOM 9727  H HB2  . HIS A 1 12  ? -9.028  13.577  -6.350  1.00 0.00 ? 12  HIS A HB2  6  
ATOM 9728  H HB3  . HIS A 1 12  ? -10.552 12.702  -6.234  1.00 0.00 ? 12  HIS A HB3  6  
ATOM 9729  H HD1  . HIS A 1 12  ? -9.135  16.098  -6.601  1.00 0.00 ? 12  HIS A HD1  6  
ATOM 9730  H HD2  . HIS A 1 12  ? -12.848 14.363  -5.921  1.00 0.00 ? 12  HIS A HD2  6  
ATOM 9731  H HE1  . HIS A 1 12  ? -10.815 17.922  -7.018  1.00 0.00 ? 12  HIS A HE1  6  
ATOM 9732  H HE2  . HIS A 1 12  ? -13.049 16.872  -6.517  1.00 0.00 ? 12  HIS A HE2  6  
ATOM 9733  N N    . SER A 1 13  ? -10.867 11.257  -3.724  1.00 0.00 ? 13  SER A N    6  
ATOM 9734  C CA   . SER A 1 13  ? -10.966 9.839   -3.403  1.00 0.00 ? 13  SER A CA   6  
ATOM 9735  C C    . SER A 1 13  ? -11.000 8.995   -4.673  1.00 0.00 ? 13  SER A C    6  
ATOM 9736  O O    . SER A 1 13  ? -11.454 9.451   -5.722  1.00 0.00 ? 13  SER A O    6  
ATOM 9737  C CB   . SER A 1 13  ? -12.218 9.570   -2.565  1.00 0.00 ? 13  SER A CB   6  
ATOM 9738  O OG   . SER A 1 13  ? -13.382 10.039  -3.224  1.00 0.00 ? 13  SER A OG   6  
ATOM 9739  H H    . SER A 1 13  ? -11.676 11.810  -3.705  1.00 0.00 ? 13  SER A H    6  
ATOM 9740  H HA   . SER A 1 13  ? -10.094 9.567   -2.827  1.00 0.00 ? 13  SER A HA   6  
ATOM 9741  H HB2  . SER A 1 13  ? -12.316 8.508   -2.399  1.00 0.00 ? 13  SER A HB2  6  
ATOM 9742  H HB3  . SER A 1 13  ? -12.128 10.076  -1.615  1.00 0.00 ? 13  SER A HB3  6  
ATOM 9743  H HG   . SER A 1 13  ? -13.625 9.425   -3.921  1.00 0.00 ? 13  SER A HG   6  
ATOM 9744  N N    . MET A 1 14  ? -10.516 7.761   -4.570  1.00 0.00 ? 14  MET A N    6  
ATOM 9745  C CA   . MET A 1 14  ? -10.491 6.853   -5.711  1.00 0.00 ? 14  MET A CA   6  
ATOM 9746  C C    . MET A 1 14  ? -11.452 5.687   -5.498  1.00 0.00 ? 14  MET A C    6  
ATOM 9747  O O    . MET A 1 14  ? -12.031 5.535   -4.421  1.00 0.00 ? 14  MET A O    6  
ATOM 9748  C CB   . MET A 1 14  ? -9.074  6.325   -5.939  1.00 0.00 ? 14  MET A CB   6  
ATOM 9749  C CG   . MET A 1 14  ? -8.102  7.386   -6.430  1.00 0.00 ? 14  MET A CG   6  
ATOM 9750  S SD   . MET A 1 14  ? -6.725  6.689   -7.362  1.00 0.00 ? 14  MET A SD   6  
ATOM 9751  C CE   . MET A 1 14  ? -5.805  5.882   -6.054  1.00 0.00 ? 14  MET A CE   6  
ATOM 9752  H H    . MET A 1 14  ? -10.168 7.454   -3.707  1.00 0.00 ? 14  MET A H    6  
ATOM 9753  H HA   . MET A 1 14  ? -10.804 7.407   -6.582  1.00 0.00 ? 14  MET A HA   6  
ATOM 9754  H HB2  . MET A 1 14  ? -8.697  5.925   -5.010  1.00 0.00 ? 14  MET A HB2  6  
ATOM 9755  H HB3  . MET A 1 14  ? -9.110  5.535   -6.674  1.00 0.00 ? 14  MET A HB3  6  
ATOM 9756  H HG2  . MET A 1 14  ? -8.635  8.077   -7.066  1.00 0.00 ? 14  MET A HG2  6  
ATOM 9757  H HG3  . MET A 1 14  ? -7.709  7.917   -5.575  1.00 0.00 ? 14  MET A HG3  6  
ATOM 9758  H HE1  . MET A 1 14  ? -6.025  6.362   -5.111  1.00 0.00 ? 14  MET A HE1  6  
ATOM 9759  H HE2  . MET A 1 14  ? -6.088  4.842   -6.004  1.00 0.00 ? 14  MET A HE2  6  
ATOM 9760  H HE3  . MET A 1 14  ? -4.747  5.958   -6.259  1.00 0.00 ? 14  MET A HE3  6  
ATOM 9761  N N    . LYS A 1 15  ? -11.618 4.867   -6.529  1.00 0.00 ? 15  LYS A N    6  
ATOM 9762  C CA   . LYS A 1 15  ? -12.508 3.714   -6.456  1.00 0.00 ? 15  LYS A CA   6  
ATOM 9763  C C    . LYS A 1 15  ? -11.934 2.534   -7.233  1.00 0.00 ? 15  LYS A C    6  
ATOM 9764  O O    . LYS A 1 15  ? -11.238 2.716   -8.232  1.00 0.00 ? 15  LYS A O    6  
ATOM 9765  C CB   . LYS A 1 15  ? -13.890 4.075   -7.003  1.00 0.00 ? 15  LYS A CB   6  
ATOM 9766  C CG   . LYS A 1 15  ? -14.906 2.952   -6.880  1.00 0.00 ? 15  LYS A CG   6  
ATOM 9767  C CD   . LYS A 1 15  ? -15.689 3.048   -5.582  1.00 0.00 ? 15  LYS A CD   6  
ATOM 9768  C CE   . LYS A 1 15  ? -15.003 2.286   -4.458  1.00 0.00 ? 15  LYS A CE   6  
ATOM 9769  N NZ   . LYS A 1 15  ? -14.074 3.157   -3.685  1.00 0.00 ? 15  LYS A NZ   6  
ATOM 9770  H H    . LYS A 1 15  ? -11.129 5.041   -7.361  1.00 0.00 ? 15  LYS A H    6  
ATOM 9771  H HA   . LYS A 1 15  ? -12.602 3.434   -5.418  1.00 0.00 ? 15  LYS A HA   6  
ATOM 9772  H HB2  . LYS A 1 15  ? -14.265 4.932   -6.462  1.00 0.00 ? 15  LYS A HB2  6  
ATOM 9773  H HB3  . LYS A 1 15  ? -13.795 4.333   -8.048  1.00 0.00 ? 15  LYS A HB3  6  
ATOM 9774  H HG2  . LYS A 1 15  ? -15.595 3.010   -7.709  1.00 0.00 ? 15  LYS A HG2  6  
ATOM 9775  H HG3  . LYS A 1 15  ? -14.386 2.005   -6.907  1.00 0.00 ? 15  LYS A HG3  6  
ATOM 9776  H HD2  . LYS A 1 15  ? -15.774 4.087   -5.298  1.00 0.00 ? 15  LYS A HD2  6  
ATOM 9777  H HD3  . LYS A 1 15  ? -16.676 2.634   -5.735  1.00 0.00 ? 15  LYS A HD3  6  
ATOM 9778  H HE2  . LYS A 1 15  ? -15.757 1.897   -3.792  1.00 0.00 ? 15  LYS A HE2  6  
ATOM 9779  H HE3  . LYS A 1 15  ? -14.443 1.468   -4.886  1.00 0.00 ? 15  LYS A HE3  6  
ATOM 9780  H HZ1  . LYS A 1 15  ? -13.916 4.050   -4.192  1.00 0.00 ? 15  LYS A HZ1  6  
ATOM 9781  H HZ2  . LYS A 1 15  ? -13.161 2.677   -3.555  1.00 0.00 ? 15  LYS A HZ2  6  
ATOM 9782  H HZ3  . LYS A 1 15  ? -14.478 3.368   -2.750  1.00 0.00 ? 15  LYS A HZ3  6  
ATOM 9783  N N    . ARG A 1 16  ? -12.232 1.324   -6.770  1.00 0.00 ? 16  ARG A N    6  
ATOM 9784  C CA   . ARG A 1 16  ? -11.747 0.115   -7.422  1.00 0.00 ? 16  ARG A CA   6  
ATOM 9785  C C    . ARG A 1 16  ? -12.889 -0.630  -8.107  1.00 0.00 ? 16  ARG A C    6  
ATOM 9786  O O    . ARG A 1 16  ? -14.017 -0.642  -7.617  1.00 0.00 ? 16  ARG A O    6  
ATOM 9787  C CB   . ARG A 1 16  ? -11.065 -0.801  -6.404  1.00 0.00 ? 16  ARG A CB   6  
ATOM 9788  C CG   . ARG A 1 16  ? -10.527 -2.089  -7.007  1.00 0.00 ? 16  ARG A CG   6  
ATOM 9789  C CD   . ARG A 1 16  ? -10.263 -3.137  -5.937  1.00 0.00 ? 16  ARG A CD   6  
ATOM 9790  N NE   . ARG A 1 16  ? -10.214 -4.486  -6.493  1.00 0.00 ? 16  ARG A NE   6  
ATOM 9791  C CZ   . ARG A 1 16  ? -11.292 -5.232  -6.708  1.00 0.00 ? 16  ARG A CZ   6  
ATOM 9792  N NH1  . ARG A 1 16  ? -12.497 -4.762  -6.416  1.00 0.00 ? 16  ARG A NH1  6  
ATOM 9793  N NH2  . ARG A 1 16  ? -11.167 -6.451  -7.218  1.00 0.00 ? 16  ARG A NH2  6  
ATOM 9794  H H    . ARG A 1 16  ? -12.792 1.244   -5.969  1.00 0.00 ? 16  ARG A H    6  
ATOM 9795  H HA   . ARG A 1 16  ? -11.025 0.408   -8.170  1.00 0.00 ? 16  ARG A HA   6  
ATOM 9796  H HB2  . ARG A 1 16  ? -10.239 -0.269  -5.955  1.00 0.00 ? 16  ARG A HB2  6  
ATOM 9797  H HB3  . ARG A 1 16  ? -11.778 -1.059  -5.636  1.00 0.00 ? 16  ARG A HB3  6  
ATOM 9798  H HG2  . ARG A 1 16  ? -11.253 -2.479  -7.706  1.00 0.00 ? 16  ARG A HG2  6  
ATOM 9799  H HG3  . ARG A 1 16  ? -9.605  -1.875  -7.526  1.00 0.00 ? 16  ARG A HG3  6  
ATOM 9800  H HD2  . ARG A 1 16  ? -9.317  -2.919  -5.464  1.00 0.00 ? 16  ARG A HD2  6  
ATOM 9801  H HD3  . ARG A 1 16  ? -11.052 -3.088  -5.202  1.00 0.00 ? 16  ARG A HD3  6  
ATOM 9802  H HE   . ARG A 1 16  ? -9.334  -4.854  -6.717  1.00 0.00 ? 16  ARG A HE   6  
ATOM 9803  H HH11 . ARG A 1 16  ? -12.595 -3.843  -6.033  1.00 0.00 ? 16  ARG A HH11 6  
ATOM 9804  H HH12 . ARG A 1 16  ? -13.307 -5.325  -6.579  1.00 0.00 ? 16  ARG A HH12 6  
ATOM 9805  H HH21 . ARG A 1 16  ? -10.260 -6.809  -7.440  1.00 0.00 ? 16  ARG A HH21 6  
ATOM 9806  H HH22 . ARG A 1 16  ? -11.978 -7.011  -7.379  1.00 0.00 ? 16  ARG A HH22 6  
ATOM 9807  N N    . ASN A 1 17  ? -12.588 -1.250  -9.243  1.00 0.00 ? 17  ASN A N    6  
ATOM 9808  C CA   . ASN A 1 17  ? -13.590 -1.996  -9.996  1.00 0.00 ? 17  ASN A CA   6  
ATOM 9809  C C    . ASN A 1 17  ? -13.396 -3.499  -9.818  1.00 0.00 ? 17  ASN A C    6  
ATOM 9810  O O    . ASN A 1 17  ? -12.274 -4.004  -9.771  1.00 0.00 ? 17  ASN A O    6  
ATOM 9811  C CB   . ASN A 1 17  ? -13.517 -1.634  -11.480 1.00 0.00 ? 17  ASN A CB   6  
ATOM 9812  C CG   . ASN A 1 17  ? -13.946 -0.204  -11.748 1.00 0.00 ? 17  ASN A CG   6  
ATOM 9813  O OD1  . ASN A 1 17  ? -15.071 0.049   -12.177 1.00 0.00 ? 17  ASN A OD1  6  
ATOM 9814  N ND2  . ASN A 1 17  ? -13.047 0.741   -11.494 1.00 0.00 ? 17  ASN A ND2  6  
ATOM 9815  H H    . ASN A 1 17  ? -11.670 -1.205  -9.584  1.00 0.00 ? 17  ASN A H    6  
ATOM 9816  H HA   . ASN A 1 17  ? -14.562 -1.723  -9.615  1.00 0.00 ? 17  ASN A HA   6  
ATOM 9817  H HB2  . ASN A 1 17  ? -12.500 -1.754  -11.825 1.00 0.00 ? 17  ASN A HB2  6  
ATOM 9818  H HB3  . ASN A 1 17  ? -14.163 -2.294  -12.039 1.00 0.00 ? 17  ASN A HB3  6  
ATOM 9819  H HD21 . ASN A 1 17  ? -12.170 0.466   -11.153 1.00 0.00 ? 17  ASN A HD21 6  
ATOM 9820  H HD22 . ASN A 1 17  ? -13.298 1.674   -11.657 1.00 0.00 ? 17  ASN A HD22 6  
ATOM 9821  N N    . PRO A 1 18  ? -14.514 -4.232  -9.718  1.00 0.00 ? 18  PRO A N    6  
ATOM 9822  C CA   . PRO A 1 18  ? -14.494 -5.688  -9.545  1.00 0.00 ? 18  PRO A CA   6  
ATOM 9823  C C    . PRO A 1 18  ? -14.014 -6.414  -10.797 1.00 0.00 ? 18  PRO A C    6  
ATOM 9824  O O    . PRO A 1 18  ? -13.243 -7.368  -10.715 1.00 0.00 ? 18  PRO A O    6  
ATOM 9825  C CB   . PRO A 1 18  ? -15.958 -6.031  -9.256  1.00 0.00 ? 18  PRO A CB   6  
ATOM 9826  C CG   . PRO A 1 18  ? -16.737 -4.930  -9.887  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9827  C CD   . PRO A 1 18  ? -15.885 -3.697  -9.765  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9828  H HA   . PRO A 1 18  ? -13.881 -5.979  -8.704  1.00 0.00 ? 18  PRO A HA   6  
ATOM 9829  H HB2  . PRO A 1 18  ? -16.199 -6.989  -9.694  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9830  H HB3  . PRO A 1 18  ? -16.119 -6.067  -8.189  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9831  H HG2  . PRO A 1 18  ? -16.919 -5.158  -10.926 1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9832  H HG3  . PRO A 1 18  ? -17.671 -4.793  -9.362  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9833  H HD2  . PRO A 1 18  ? -16.020 -3.058  -10.626 1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9834  H HD3  . PRO A 1 18  ? -16.122 -3.163  -8.856  1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9835  N N    . ASN A 1 19  ? -14.476 -5.954  -11.955 1.00 0.00 ? 19  ASN A N    6  
ATOM 9836  C CA   . ASN A 1 19  ? -14.093 -6.560  -13.225 1.00 0.00 ? 19  ASN A CA   6  
ATOM 9837  C C    . ASN A 1 19  ? -12.580 -6.517  -13.415 1.00 0.00 ? 19  ASN A C    6  
ATOM 9838  O O    . ASN A 1 19  ? -11.977 -7.476  -13.896 1.00 0.00 ? 19  ASN A O    6  
ATOM 9839  C CB   . ASN A 1 19  ? -14.784 -5.842  -14.386 1.00 0.00 ? 19  ASN A CB   6  
ATOM 9840  C CG   . ASN A 1 19  ? -16.268 -5.643  -14.142 1.00 0.00 ? 19  ASN A CG   6  
ATOM 9841  O OD1  . ASN A 1 19  ? -16.989 -6.590  -13.829 1.00 0.00 ? 19  ASN A OD1  6  
ATOM 9842  N ND2  . ASN A 1 19  ? -16.730 -4.407  -14.285 1.00 0.00 ? 19  ASN A ND2  6  
ATOM 9843  H H    . ASN A 1 19  ? -15.089 -5.189  -11.957 1.00 0.00 ? 19  ASN A H    6  
ATOM 9844  H HA   . ASN A 1 19  ? -14.413 -7.591  -13.210 1.00 0.00 ? 19  ASN A HA   6  
ATOM 9845  H HB2  . ASN A 1 19  ? -14.329 -4.872  -14.523 1.00 0.00 ? 19  ASN A HB2  6  
ATOM 9846  H HB3  . ASN A 1 19  ? -14.661 -6.424  -15.287 1.00 0.00 ? 19  ASN A HB3  6  
ATOM 9847  H HD21 . ASN A 1 19  ? -16.098 -3.701  -14.537 1.00 0.00 ? 19  ASN A HD21 6  
ATOM 9848  H HD22 . ASN A 1 19  ? -17.686 -4.250  -14.133 1.00 0.00 ? 19  ASN A HD22 6  
ATOM 9849  N N    . ALA A 1 20  ? -11.973 -5.399  -13.031 1.00 0.00 ? 20  ALA A N    6  
ATOM 9850  C CA   . ALA A 1 20  ? -10.530 -5.232  -13.156 1.00 0.00 ? 20  ALA A CA   6  
ATOM 9851  C C    . ALA A 1 20  ? -9.787  -6.430  -12.577 1.00 0.00 ? 20  ALA A C    6  
ATOM 9852  O O    . ALA A 1 20  ? -10.051 -6.875  -11.460 1.00 0.00 ? 20  ALA A O    6  
ATOM 9853  C CB   . ALA A 1 20  ? -10.086 -3.950  -12.468 1.00 0.00 ? 20  ALA A CB   6  
ATOM 9854  H H    . ALA A 1 20  ? -12.508 -4.670  -12.655 1.00 0.00 ? 20  ALA A H    6  
ATOM 9855  H HA   . ALA A 1 20  ? -10.294 -5.147  -14.207 1.00 0.00 ? 20  ALA A HA   6  
ATOM 9856  H HB1  . ALA A 1 20  ? -9.335  -4.181  -11.727 1.00 0.00 ? 20  ALA A HB1  6  
ATOM 9857  H HB2  . ALA A 1 20  ? -9.673  -3.273  -13.201 1.00 0.00 ? 20  ALA A HB2  6  
ATOM 9858  H HB3  . ALA A 1 20  ? -10.935 -3.486  -11.988 1.00 0.00 ? 20  ALA A HB3  6  
ATOM 9859  N N    . PRO A 1 21  ? -8.834  -6.968  -13.354 1.00 0.00 ? 21  PRO A N    6  
ATOM 9860  C CA   . PRO A 1 21  ? -8.033  -8.123  -12.938 1.00 0.00 ? 21  PRO A CA   6  
ATOM 9861  C C    . PRO A 1 21  ? -7.061  -7.780  -11.815 1.00 0.00 ? 21  PRO A C    6  
ATOM 9862  O O    . PRO A 1 21  ? -6.372  -6.761  -11.865 1.00 0.00 ? 21  PRO A O    6  
ATOM 9863  C CB   . PRO A 1 21  ? -7.269  -8.501  -14.210 1.00 0.00 ? 21  PRO A CB   6  
ATOM 9864  C CG   . PRO A 1 21  ? -7.197  -7.238  -14.997 1.00 0.00 ? 21  PRO A CG   6  
ATOM 9865  C CD   . PRO A 1 21  ? -8.466  -6.490  -14.697 1.00 0.00 ? 21  PRO A CD   6  
ATOM 9866  H HA   . PRO A 1 21  ? -8.657  -8.950  -12.632 1.00 0.00 ? 21  PRO A HA   6  
ATOM 9867  H HB2  . PRO A 1 21  ? -6.284  -8.861  -13.947 1.00 0.00 ? 21  PRO A HB2  6  
ATOM 9868  H HB3  . PRO A 1 21  ? -7.808  -9.269  -14.743 1.00 0.00 ? 21  PRO A HB3  6  
ATOM 9869  H HG2  . PRO A 1 21  ? -6.339  -6.661  -14.688 1.00 0.00 ? 21  PRO A HG2  6  
ATOM 9870  H HG3  . PRO A 1 21  ? -7.138  -7.467  -16.051 1.00 0.00 ? 21  PRO A HG3  6  
ATOM 9871  H HD2  . PRO A 1 21  ? -8.284  -5.425  -14.691 1.00 0.00 ? 21  PRO A HD2  6  
ATOM 9872  H HD3  . PRO A 1 21  ? -9.231  -6.739  -15.417 1.00 0.00 ? 21  PRO A HD3  6  
ATOM 9873  N N    . VAL A 1 22  ? -7.009  -8.638  -10.801 1.00 0.00 ? 22  VAL A N    6  
ATOM 9874  C CA   . VAL A 1 22  ? -6.119  -8.426  -9.665  1.00 0.00 ? 22  VAL A CA   6  
ATOM 9875  C C    . VAL A 1 22  ? -4.659  -8.590  -10.072 1.00 0.00 ? 22  VAL A C    6  
ATOM 9876  O O    . VAL A 1 22  ? -4.230  -9.675  -10.465 1.00 0.00 ? 22  VAL A O    6  
ATOM 9877  C CB   . VAL A 1 22  ? -6.433  -9.404  -8.517  1.00 0.00 ? 22  VAL A CB   6  
ATOM 9878  C CG1  . VAL A 1 22  ? -5.422  -9.247  -7.391  1.00 0.00 ? 22  VAL A CG1  6  
ATOM 9879  C CG2  . VAL A 1 22  ? -7.849  -9.189  -8.006  1.00 0.00 ? 22  VAL A CG2  6  
ATOM 9880  H H    . VAL A 1 22  ? -7.582  -9.433  -10.817 1.00 0.00 ? 22  VAL A H    6  
ATOM 9881  H HA   . VAL A 1 22  ? -6.272  -7.420  -9.304  1.00 0.00 ? 22  VAL A HA   6  
ATOM 9882  H HB   . VAL A 1 22  ? -6.359  -10.412 -8.898  1.00 0.00 ? 22  VAL A HB   6  
ATOM 9883  H HG11 . VAL A 1 22  ? -4.457  -9.604  -7.721  1.00 0.00 ? 22  VAL A HG11 6  
ATOM 9884  H HG12 . VAL A 1 22  ? -5.347  -8.205  -7.116  1.00 0.00 ? 22  VAL A HG12 6  
ATOM 9885  H HG13 . VAL A 1 22  ? -5.744  -9.823  -6.535  1.00 0.00 ? 22  VAL A HG13 6  
ATOM 9886  H HG21 . VAL A 1 22  ? -8.287  -8.337  -8.506  1.00 0.00 ? 22  VAL A HG21 6  
ATOM 9887  H HG22 . VAL A 1 22  ? -8.441  -10.069 -8.208  1.00 0.00 ? 22  VAL A HG22 6  
ATOM 9888  H HG23 . VAL A 1 22  ? -7.825  -9.007  -6.941  1.00 0.00 ? 22  VAL A HG23 6  
ATOM 9889  N N    . THR A 1 23  ? -3.898  -7.504  -9.976  1.00 0.00 ? 23  THR A N    6  
ATOM 9890  C CA   . THR A 1 23  ? -2.486  -7.526  -10.336 1.00 0.00 ? 23  THR A CA   6  
ATOM 9891  C C    . THR A 1 23  ? -1.689  -8.402  -9.377  1.00 0.00 ? 23  THR A C    6  
ATOM 9892  O O    . THR A 1 23  ? -1.072  -9.387  -9.786  1.00 0.00 ? 23  THR A O    6  
ATOM 9893  C CB   . THR A 1 23  ? -1.885  -6.108  -10.337 1.00 0.00 ? 23  THR A CB   6  
ATOM 9894  O OG1  . THR A 1 23  ? -2.804  -5.186  -10.934 1.00 0.00 ? 23  THR A OG1  6  
ATOM 9895  C CG2  . THR A 1 23  ? -0.566  -6.080  -11.095 1.00 0.00 ? 23  THR A CG2  6  
ATOM 9896  H H    . THR A 1 23  ? -4.298  -6.668  -9.657  1.00 0.00 ? 23  THR A H    6  
ATOM 9897  H HA   . THR A 1 23  ? -2.402  -7.931  -11.334 1.00 0.00 ? 23  THR A HA   6  
ATOM 9898  H HB   . THR A 1 23  ? -1.701  -5.810  -9.315  1.00 0.00 ? 23  THR A HB   6  
ATOM 9899  H HG1  . THR A 1 23  ? -2.318  -4.454  -11.321 1.00 0.00 ? 23  THR A HG1  6  
ATOM 9900  H HG21 . THR A 1 23  ? -0.759  -6.166  -12.154 1.00 0.00 ? 23  THR A HG21 6  
ATOM 9901  H HG22 . THR A 1 23  ? 0.052   -6.905  -10.774 1.00 0.00 ? 23  THR A HG22 6  
ATOM 9902  H HG23 . THR A 1 23  ? -0.057  -5.149  -10.897 1.00 0.00 ? 23  THR A HG23 6  
ATOM 9903  N N    . LYS A 1 24  ? -1.705  -8.040  -8.099  1.00 0.00 ? 24  LYS A N    6  
ATOM 9904  C CA   . LYS A 1 24  ? -0.985  -8.795  -7.080  1.00 0.00 ? 24  LYS A CA   6  
ATOM 9905  C C    . LYS A 1 24  ? -1.723  -8.749  -5.746  1.00 0.00 ? 24  LYS A C    6  
ATOM 9906  O O    . LYS A 1 24  ? -2.349  -7.745  -5.406  1.00 0.00 ? 24  LYS A O    6  
ATOM 9907  C CB   . LYS A 1 24  ? 0.432   -8.240  -6.911  1.00 0.00 ? 24  LYS A CB   6  
ATOM 9908  C CG   . LYS A 1 24  ? 1.371   -9.183  -6.180  1.00 0.00 ? 24  LYS A CG   6  
ATOM 9909  C CD   . LYS A 1 24  ? 2.764   -8.591  -6.046  1.00 0.00 ? 24  LYS A CD   6  
ATOM 9910  C CE   . LYS A 1 24  ? 3.625   -9.401  -5.089  1.00 0.00 ? 24  LYS A CE   6  
ATOM 9911  N NZ   . LYS A 1 24  ? 4.051   -10.697 -5.687  1.00 0.00 ? 24  LYS A NZ   6  
ATOM 9912  H H    . LYS A 1 24  ? -2.215  -7.246  -7.834  1.00 0.00 ? 24  LYS A H    6  
ATOM 9913  H HA   . LYS A 1 24  ? -0.924  -9.821  -7.408  1.00 0.00 ? 24  LYS A HA   6  
ATOM 9914  H HB2  . LYS A 1 24  ? 0.845   -8.039  -7.888  1.00 0.00 ? 24  LYS A HB2  6  
ATOM 9915  H HB3  . LYS A 1 24  ? 0.379   -7.315  -6.355  1.00 0.00 ? 24  LYS A HB3  6  
ATOM 9916  H HG2  . LYS A 1 24  ? 0.977   -9.375  -5.192  1.00 0.00 ? 24  LYS A HG2  6  
ATOM 9917  H HG3  . LYS A 1 24  ? 1.435   -10.111 -6.730  1.00 0.00 ? 24  LYS A HG3  6  
ATOM 9918  H HD2  . LYS A 1 24  ? 3.236   -8.582  -7.017  1.00 0.00 ? 24  LYS A HD2  6  
ATOM 9919  H HD3  . LYS A 1 24  ? 2.681   -7.579  -5.674  1.00 0.00 ? 24  LYS A HD3  6  
ATOM 9920  H HE2  . LYS A 1 24  ? 4.502   -8.824  -4.839  1.00 0.00 ? 24  LYS A HE2  6  
ATOM 9921  H HE3  . LYS A 1 24  ? 3.056   -9.598  -4.193  1.00 0.00 ? 24  LYS A HE3  6  
ATOM 9922  H HZ1  . LYS A 1 24  ? 4.042   -11.444 -4.965  1.00 0.00 ? 24  LYS A HZ1  6  
ATOM 9923  H HZ2  . LYS A 1 24  ? 5.013   -10.613 -6.073  1.00 0.00 ? 24  LYS A HZ2  6  
ATOM 9924  H HZ3  . LYS A 1 24  ? 3.404   -10.965 -6.456  1.00 0.00 ? 24  LYS A HZ3  6  
ATOM 9925  N N    . ALA A 1 25  ? -1.643  -9.841  -4.992  1.00 0.00 ? 25  ALA A N    6  
ATOM 9926  C CA   . ALA A 1 25  ? -2.300  -9.923  -3.694  1.00 0.00 ? 25  ALA A CA   6  
ATOM 9927  C C    . ALA A 1 25  ? -1.418  -10.639 -2.677  1.00 0.00 ? 25  ALA A C    6  
ATOM 9928  O O    . ALA A 1 25  ? -0.935  -11.742 -2.926  1.00 0.00 ? 25  ALA A O    6  
ATOM 9929  C CB   . ALA A 1 25  ? -3.640  -10.631 -3.825  1.00 0.00 ? 25  ALA A CB   6  
ATOM 9930  H H    . ALA A 1 25  ? -1.128  -10.609 -5.317  1.00 0.00 ? 25  ALA A H    6  
ATOM 9931  H HA   . ALA A 1 25  ? -2.485  -8.916  -3.349  1.00 0.00 ? 25  ALA A HA   6  
ATOM 9932  H HB1  . ALA A 1 25  ? -4.192  -10.208 -4.650  1.00 0.00 ? 25  ALA A HB1  6  
ATOM 9933  H HB2  . ALA A 1 25  ? -3.474  -11.684 -4.005  1.00 0.00 ? 25  ALA A HB2  6  
ATOM 9934  H HB3  . ALA A 1 25  ? -4.204  -10.507 -2.912  1.00 0.00 ? 25  ALA A HB3  6  
ATOM 9935  N N    . GLY A 1 26  ? -1.211  -10.002 -1.528  1.00 0.00 ? 26  GLY A N    6  
ATOM 9936  C CA   . GLY A 1 26  ? -0.386  -10.593 -0.490  1.00 0.00 ? 26  GLY A CA   6  
ATOM 9937  C C    . GLY A 1 26  ? -0.448  -9.818  0.811   1.00 0.00 ? 26  GLY A C    6  
ATOM 9938  O O    . GLY A 1 26  ? -0.609  -8.598  0.807   1.00 0.00 ? 26  GLY A O    6  
ATOM 9939  H H    . GLY A 1 26  ? -1.621  -9.123  -1.384  1.00 0.00 ? 26  GLY A H    6  
ATOM 9940  H HA2  . GLY A 1 26  ? -0.721  -11.604 -0.312  1.00 0.00 ? 26  GLY A HA2  6  
ATOM 9941  H HA3  . GLY A 1 26  ? 0.638   -10.619 -0.832  1.00 0.00 ? 26  GLY A HA3  6  
ATOM 9942  N N    . TRP A 1 27  ? -0.321  -10.527 1.927   1.00 0.00 ? 27  TRP A N    6  
ATOM 9943  C CA   . TRP A 1 27  ? -0.364  -9.898  3.242   1.00 0.00 ? 27  TRP A CA   6  
ATOM 9944  C C    . TRP A 1 27  ? 0.906   -9.098  3.505   1.00 0.00 ? 27  TRP A C    6  
ATOM 9945  O O    . TRP A 1 27  ? 1.994   -9.662  3.625   1.00 0.00 ? 27  TRP A O    6  
ATOM 9946  C CB   . TRP A 1 27  ? -0.550  -10.956 4.330   1.00 0.00 ? 27  TRP A CB   6  
ATOM 9947  C CG   . TRP A 1 27  ? -1.967  -11.423 4.470   1.00 0.00 ? 27  TRP A CG   6  
ATOM 9948  C CD1  . TRP A 1 27  ? -2.545  -12.488 3.840   1.00 0.00 ? 27  TRP A CD1  6  
ATOM 9949  C CD2  . TRP A 1 27  ? -2.985  -10.839 5.289   1.00 0.00 ? 27  TRP A CD2  6  
ATOM 9950  N NE1  . TRP A 1 27  ? -3.861  -12.601 4.219   1.00 0.00 ? 27  TRP A NE1  6  
ATOM 9951  C CE2  . TRP A 1 27  ? -4.155  -11.602 5.108   1.00 0.00 ? 27  TRP A CE2  6  
ATOM 9952  C CE3  . TRP A 1 27  ? -3.021  -9.747  6.161   1.00 0.00 ? 27  TRP A CE3  6  
ATOM 9953  C CZ2  . TRP A 1 27  ? -5.346  -11.305 5.765   1.00 0.00 ? 27  TRP A CZ2  6  
ATOM 9954  C CZ3  . TRP A 1 27  ? -4.205  -9.453  6.812   1.00 0.00 ? 27  TRP A CZ3  6  
ATOM 9955  C CH2  . TRP A 1 27  ? -5.354  -10.230 6.612   1.00 0.00 ? 27  TRP A CH2  6  
ATOM 9956  H H    . TRP A 1 27  ? -0.194  -11.498 1.865   1.00 0.00 ? 27  TRP A H    6  
ATOM 9957  H HA   . TRP A 1 27  ? -1.210  -9.226  3.258   1.00 0.00 ? 27  TRP A HA   6  
ATOM 9958  H HB2  . TRP A 1 27  ? 0.062   -11.815 4.097   1.00 0.00 ? 27  TRP A HB2  6  
ATOM 9959  H HB3  . TRP A 1 27  ? -0.239  -10.544 5.279   1.00 0.00 ? 27  TRP A HB3  6  
ATOM 9960  H HD1  . TRP A 1 27  ? -2.031  -13.137 3.146   1.00 0.00 ? 27  TRP A HD1  6  
ATOM 9961  H HE1  . TRP A 1 27  ? -4.486  -13.287 3.904   1.00 0.00 ? 27  TRP A HE1  6  
ATOM 9962  H HE3  . TRP A 1 27  ? -2.146  -9.136  6.328   1.00 0.00 ? 27  TRP A HE3  6  
ATOM 9963  H HZ2  . TRP A 1 27  ? -6.240  -11.894 5.622   1.00 0.00 ? 27  TRP A HZ2  6  
ATOM 9964  H HZ3  . TRP A 1 27  ? -4.252  -8.613  7.489   1.00 0.00 ? 27  TRP A HZ3  6  
ATOM 9965  H HH2  . TRP A 1 27  ? -6.255  -9.964  7.141   1.00 0.00 ? 27  TRP A HH2  6  
ATOM 9966  N N    . LEU A 1 28  ? 0.762   -7.780  3.593   1.00 0.00 ? 28  LEU A N    6  
ATOM 9967  C CA   . LEU A 1 28  ? 1.900   -6.901  3.842   1.00 0.00 ? 28  LEU A CA   6  
ATOM 9968  C C    . LEU A 1 28  ? 1.748   -6.179  5.177   1.00 0.00 ? 28  LEU A C    6  
ATOM 9969  O O    . LEU A 1 28  ? 0.700   -6.253  5.819   1.00 0.00 ? 28  LEU A O    6  
ATOM 9970  C CB   . LEU A 1 28  ? 2.039   -5.881  2.711   1.00 0.00 ? 28  LEU A CB   6  
ATOM 9971  C CG   . LEU A 1 28  ? 2.787   -6.358  1.466   1.00 0.00 ? 28  LEU A CG   6  
ATOM 9972  C CD1  . LEU A 1 28  ? 2.653   -5.342  0.341   1.00 0.00 ? 28  LEU A CD1  6  
ATOM 9973  C CD2  . LEU A 1 28  ? 4.253   -6.609  1.788   1.00 0.00 ? 28  LEU A CD2  6  
ATOM 9974  H H    . LEU A 1 28  ? -0.129  -7.388  3.488   1.00 0.00 ? 28  LEU A H    6  
ATOM 9975  H HA   . LEU A 1 28  ? 2.789   -7.512  3.876   1.00 0.00 ? 28  LEU A HA   6  
ATOM 9976  H HB2  . LEU A 1 28  ? 1.046   -5.586  2.408   1.00 0.00 ? 28  LEU A HB2  6  
ATOM 9977  H HB3  . LEU A 1 28  ? 2.563   -5.021  3.104   1.00 0.00 ? 28  LEU A HB3  6  
ATOM 9978  H HG   . LEU A 1 28  ? 2.353   -7.289  1.127   1.00 0.00 ? 28  LEU A HG   6  
ATOM 9979  H HD11 . LEU A 1 28  ? 1.738   -5.525  -0.202  1.00 0.00 ? 28  LEU A HD11 6  
ATOM 9980  H HD12 . LEU A 1 28  ? 3.494   -5.435  -0.330  1.00 0.00 ? 28  LEU A HD12 6  
ATOM 9981  H HD13 . LEU A 1 28  ? 2.633   -4.346  0.757   1.00 0.00 ? 28  LEU A HD13 6  
ATOM 9982  H HD21 . LEU A 1 28  ? 4.856   -5.826  1.353   1.00 0.00 ? 28  LEU A HD21 6  
ATOM 9983  H HD22 . LEU A 1 28  ? 4.552   -7.564  1.379   1.00 0.00 ? 28  LEU A HD22 6  
ATOM 9984  H HD23 . LEU A 1 28  ? 4.389   -6.618  2.859   1.00 0.00 ? 28  LEU A HD23 6  
ATOM 9985  N N    . PHE A 1 29  ? 2.799   -5.479  5.589   1.00 0.00 ? 29  PHE A N    6  
ATOM 9986  C CA   . PHE A 1 29  ? 2.783   -4.743  6.847   1.00 0.00 ? 29  PHE A CA   6  
ATOM 9987  C C    . PHE A 1 29  ? 2.941   -3.245  6.603   1.00 0.00 ? 29  PHE A C    6  
ATOM 9988  O O    . PHE A 1 29  ? 3.927   -2.800  6.015   1.00 0.00 ? 29  PHE A O    6  
ATOM 9989  C CB   . PHE A 1 29  ? 3.898   -5.240  7.769   1.00 0.00 ? 29  PHE A CB   6  
ATOM 9990  C CG   . PHE A 1 29  ? 3.815   -6.709  8.071   1.00 0.00 ? 29  PHE A CG   6  
ATOM 9991  C CD1  . PHE A 1 29  ? 4.149   -7.648  7.108   1.00 0.00 ? 29  PHE A CD1  6  
ATOM 9992  C CD2  . PHE A 1 29  ? 3.403   -7.152  9.317   1.00 0.00 ? 29  PHE A CD2  6  
ATOM 9993  C CE1  . PHE A 1 29  ? 4.075   -9.001  7.382   1.00 0.00 ? 29  PHE A CE1  6  
ATOM 9994  C CE2  . PHE A 1 29  ? 3.327   -8.503  9.598   1.00 0.00 ? 29  PHE A CE2  6  
ATOM 9995  C CZ   . PHE A 1 29  ? 3.662   -9.429  8.628   1.00 0.00 ? 29  PHE A CZ   6  
ATOM 9996  H H    . PHE A 1 29  ? 3.607   -5.459  5.033   1.00 0.00 ? 29  PHE A H    6  
ATOM 9997  H HA   . PHE A 1 29  ? 1.830   -4.919  7.321   1.00 0.00 ? 29  PHE A HA   6  
ATOM 9998  H HB2  . PHE A 1 29  ? 4.853   -5.052  7.302   1.00 0.00 ? 29  PHE A HB2  6  
ATOM 9999  H HB3  . PHE A 1 29  ? 3.847   -4.705  8.705   1.00 0.00 ? 29  PHE A HB3  6  
ATOM 10000 H HD1  . PHE A 1 29  ? 4.472   -7.314  6.132   1.00 0.00 ? 29  PHE A HD1  6  
ATOM 10001 H HD2  . PHE A 1 29  ? 3.139   -6.430  10.076  1.00 0.00 ? 29  PHE A HD2  6  
ATOM 10002 H HE1  . PHE A 1 29  ? 4.337   -9.721  6.622   1.00 0.00 ? 29  PHE A HE1  6  
ATOM 10003 H HE2  . PHE A 1 29  ? 3.003   -8.835  10.573  1.00 0.00 ? 29  PHE A HE2  6  
ATOM 10004 H HZ   . PHE A 1 29  ? 3.603   -10.485 8.845   1.00 0.00 ? 29  PHE A HZ   6  
ATOM 10005 N N    . LYS A 1 30  ? 1.961   -2.471  7.057   1.00 0.00 ? 30  LYS A N    6  
ATOM 10006 C CA   . LYS A 1 30  ? 1.989   -1.023  6.889   1.00 0.00 ? 30  LYS A CA   6  
ATOM 10007 C C    . LYS A 1 30  ? 2.266   -0.326  8.218   1.00 0.00 ? 30  LYS A C    6  
ATOM 10008 O O    . LYS A 1 30  ? 1.454   -0.386  9.141   1.00 0.00 ? 30  LYS A O    6  
ATOM 10009 C CB   . LYS A 1 30  ? 0.661   -0.530  6.311   1.00 0.00 ? 30  LYS A CB   6  
ATOM 10010 C CG   . LYS A 1 30  ? 0.672   0.940   5.928   1.00 0.00 ? 30  LYS A CG   6  
ATOM 10011 C CD   . LYS A 1 30  ? -0.727  1.447   5.621   1.00 0.00 ? 30  LYS A CD   6  
ATOM 10012 C CE   . LYS A 1 30  ? -0.858  2.934   5.914   1.00 0.00 ? 30  LYS A CE   6  
ATOM 10013 N NZ   . LYS A 1 30  ? -0.670  3.233   7.361   1.00 0.00 ? 30  LYS A NZ   6  
ATOM 10014 H H    . LYS A 1 30  ? 1.200   -2.884  7.518   1.00 0.00 ? 30  LYS A H    6  
ATOM 10015 H HA   . LYS A 1 30  ? 2.783   -0.784  6.199   1.00 0.00 ? 30  LYS A HA   6  
ATOM 10016 H HB2  . LYS A 1 30  ? 0.429   -1.109  5.429   1.00 0.00 ? 30  LYS A HB2  6  
ATOM 10017 H HB3  . LYS A 1 30  ? -0.117  -0.683  7.045   1.00 0.00 ? 30  LYS A HB3  6  
ATOM 10018 H HG2  . LYS A 1 30  ? 1.079   1.513   6.747   1.00 0.00 ? 30  LYS A HG2  6  
ATOM 10019 H HG3  . LYS A 1 30  ? 1.292   1.069   5.052   1.00 0.00 ? 30  LYS A HG3  6  
ATOM 10020 H HD2  . LYS A 1 30  ? -0.942  1.278   4.576   1.00 0.00 ? 30  LYS A HD2  6  
ATOM 10021 H HD3  . LYS A 1 30  ? -1.438  0.906   6.229   1.00 0.00 ? 30  LYS A HD3  6  
ATOM 10022 H HE2  . LYS A 1 30  ? -0.111  3.466   5.345   1.00 0.00 ? 30  LYS A HE2  6  
ATOM 10023 H HE3  . LYS A 1 30  ? -1.841  3.262   5.612   1.00 0.00 ? 30  LYS A HE3  6  
ATOM 10024 H HZ1  . LYS A 1 30  ? -0.037  4.050   7.478   1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 10025 H HZ2  . LYS A 1 30  ? -0.252  2.412   7.843   1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 10026 H HZ3  . LYS A 1 30  ? -1.586  3.451   7.802   1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 10027 N N    . GLN A 1 31  ? 3.416   0.334   8.306   1.00 0.00 ? 31  GLN A N    6  
ATOM 10028 C CA   . GLN A 1 31  ? 3.799   1.042   9.522   1.00 0.00 ? 31  GLN A CA   6  
ATOM 10029 C C    . GLN A 1 31  ? 2.734   2.060   9.917   1.00 0.00 ? 31  GLN A C    6  
ATOM 10030 O O    . GLN A 1 31  ? 2.053   2.624   9.061   1.00 0.00 ? 31  GLN A O    6  
ATOM 10031 C CB   . GLN A 1 31  ? 5.144   1.743   9.327   1.00 0.00 ? 31  GLN A CB   6  
ATOM 10032 C CG   . GLN A 1 31  ? 5.944   1.892   10.611  1.00 0.00 ? 31  GLN A CG   6  
ATOM 10033 C CD   . GLN A 1 31  ? 6.831   3.122   10.607  1.00 0.00 ? 31  GLN A CD   6  
ATOM 10034 O OE1  . GLN A 1 31  ? 6.475   4.160   11.167  1.00 0.00 ? 31  GLN A OE1  6  
ATOM 10035 N NE2  . GLN A 1 31  ? 7.993   3.012   9.974   1.00 0.00 ? 31  GLN A NE2  6  
ATOM 10036 H H    . GLN A 1 31  ? 4.022   0.345   7.536   1.00 0.00 ? 31  GLN A H    6  
ATOM 10037 H HA   . GLN A 1 31  ? 3.894   0.314   10.313  1.00 0.00 ? 31  GLN A HA   6  
ATOM 10038 H HB2  . GLN A 1 31  ? 5.735   1.175   8.624   1.00 0.00 ? 31  GLN A HB2  6  
ATOM 10039 H HB3  . GLN A 1 31  ? 4.968   2.729   8.922   1.00 0.00 ? 31  GLN A HB3  6  
ATOM 10040 H HG2  . GLN A 1 31  ? 5.257   1.966   11.442  1.00 0.00 ? 31  GLN A HG2  6  
ATOM 10041 H HG3  . GLN A 1 31  ? 6.566   1.018   10.736  1.00 0.00 ? 31  GLN A HG3  6  
ATOM 10042 H HE21 . GLN A 1 31  ? 8.209   2.155   9.549   1.00 0.00 ? 31  GLN A HE21 6  
ATOM 10043 H HE22 . GLN A 1 31  ? 8.585   3.792   9.954   1.00 0.00 ? 31  GLN A HE22 6  
ATOM 10044 N N    . ALA A 1 32  ? 2.595   2.288   11.219  1.00 0.00 ? 32  ALA A N    6  
ATOM 10045 C CA   . ALA A 1 32  ? 1.614   3.239   11.727  1.00 0.00 ? 32  ALA A CA   6  
ATOM 10046 C C    . ALA A 1 32  ? 2.257   4.593   12.010  1.00 0.00 ? 32  ALA A C    6  
ATOM 10047 O O    . ALA A 1 32  ? 2.935   4.770   13.022  1.00 0.00 ? 32  ALA A O    6  
ATOM 10048 C CB   . ALA A 1 32  ? 0.953   2.694   12.985  1.00 0.00 ? 32  ALA A CB   6  
ATOM 10049 H H    . ALA A 1 32  ? 3.167   1.807   11.852  1.00 0.00 ? 32  ALA A H    6  
ATOM 10050 H HA   . ALA A 1 32  ? 0.850   3.365   10.974  1.00 0.00 ? 32  ALA A HA   6  
ATOM 10051 H HB1  . ALA A 1 32  ? 1.415   3.136   13.854  1.00 0.00 ? 32  ALA A HB1  6  
ATOM 10052 H HB2  . ALA A 1 32  ? -0.099  2.939   12.972  1.00 0.00 ? 32  ALA A HB2  6  
ATOM 10053 H HB3  . ALA A 1 32  ? 1.073   1.622   13.018  1.00 0.00 ? 32  ALA A HB3  6  
ATOM 10054 N N    . SER A 1 33  ? 2.041   5.545   11.108  1.00 0.00 ? 33  SER A N    6  
ATOM 10055 C CA   . SER A 1 33  ? 2.603   6.882   11.259  1.00 0.00 ? 33  SER A CA   6  
ATOM 10056 C C    . SER A 1 33  ? 1.904   7.643   12.381  1.00 0.00 ? 33  SER A C    6  
ATOM 10057 O O    . SER A 1 33  ? 2.551   8.182   13.278  1.00 0.00 ? 33  SER A O    6  
ATOM 10058 C CB   . SER A 1 33  ? 2.482   7.660   9.947   1.00 0.00 ? 33  SER A CB   6  
ATOM 10059 O OG   . SER A 1 33  ? 3.305   7.095   8.941   1.00 0.00 ? 33  SER A OG   6  
ATOM 10060 H H    . SER A 1 33  ? 1.492   5.343   10.322  1.00 0.00 ? 33  SER A H    6  
ATOM 10061 H HA   . SER A 1 33  ? 3.649   6.776   11.509  1.00 0.00 ? 33  SER A HA   6  
ATOM 10062 H HB2  . SER A 1 33  ? 1.456   7.637   9.612   1.00 0.00 ? 33  SER A HB2  6  
ATOM 10063 H HB3  . SER A 1 33  ? 2.785   8.685   10.110  1.00 0.00 ? 33  SER A HB3  6  
ATOM 10064 H HG   . SER A 1 33  ? 4.139   7.568   8.907   1.00 0.00 ? 33  SER A HG   6  
ATOM 10065 N N    . SER A 1 34  ? 0.576   7.682   12.323  1.00 0.00 ? 34  SER A N    6  
ATOM 10066 C CA   . SER A 1 34  ? -0.213  8.379   13.332  1.00 0.00 ? 34  SER A CA   6  
ATOM 10067 C C    . SER A 1 34  ? -0.460  7.484   14.542  1.00 0.00 ? 34  SER A C    6  
ATOM 10068 O O    . SER A 1 34  ? -0.304  6.266   14.470  1.00 0.00 ? 34  SER A O    6  
ATOM 10069 C CB   . SER A 1 34  ? -1.547  8.836   12.739  1.00 0.00 ? 34  SER A CB   6  
ATOM 10070 O OG   . SER A 1 34  ? -1.378  9.985   11.927  1.00 0.00 ? 34  SER A OG   6  
ATOM 10071 H H    . SER A 1 34  ? 0.117   7.232   11.583  1.00 0.00 ? 34  SER A H    6  
ATOM 10072 H HA   . SER A 1 34  ? 0.347   9.246   13.649  1.00 0.00 ? 34  SER A HA   6  
ATOM 10073 H HB2  . SER A 1 34  ? -1.962  8.042   12.137  1.00 0.00 ? 34  SER A HB2  6  
ATOM 10074 H HB3  . SER A 1 34  ? -2.231  9.074   13.541  1.00 0.00 ? 34  SER A HB3  6  
ATOM 10075 H HG   . SER A 1 34  ? -1.066  10.715  12.466  1.00 0.00 ? 34  SER A HG   6  
ATOM 10076 N N    . GLY A 1 35  ? -0.849  8.099   15.655  1.00 0.00 ? 35  GLY A N    6  
ATOM 10077 C CA   . GLY A 1 35  ? -1.112  7.344   16.866  1.00 0.00 ? 35  GLY A CA   6  
ATOM 10078 C C    . GLY A 1 35  ? 0.046   6.446   17.253  1.00 0.00 ? 35  GLY A C    6  
ATOM 10079 O O    . GLY A 1 35  ? 1.209   6.832   17.130  1.00 0.00 ? 35  GLY A O    6  
ATOM 10080 H H    . GLY A 1 35  ? -0.957  9.073   15.654  1.00 0.00 ? 35  GLY A H    6  
ATOM 10081 H HA2  . GLY A 1 35  ? -1.304  8.034   17.674  1.00 0.00 ? 35  GLY A HA2  6  
ATOM 10082 H HA3  . GLY A 1 35  ? -1.990  6.733   16.713  1.00 0.00 ? 35  GLY A HA3  6  
ATOM 10083 N N    . VAL A 1 36  ? -0.270  5.244   17.725  1.00 0.00 ? 36  VAL A N    6  
ATOM 10084 C CA   . VAL A 1 36  ? 0.753   4.289   18.132  1.00 0.00 ? 36  VAL A CA   6  
ATOM 10085 C C    . VAL A 1 36  ? 1.687   3.956   16.974  1.00 0.00 ? 36  VAL A C    6  
ATOM 10086 O O    . VAL A 1 36  ? 1.349   4.169   15.809  1.00 0.00 ? 36  VAL A O    6  
ATOM 10087 C CB   . VAL A 1 36  ? 0.125   2.985   18.662  1.00 0.00 ? 36  VAL A CB   6  
ATOM 10088 C CG1  . VAL A 1 36  ? -0.577  2.236   17.540  1.00 0.00 ? 36  VAL A CG1  6  
ATOM 10089 C CG2  . VAL A 1 36  ? 1.185   2.112   19.316  1.00 0.00 ? 36  VAL A CG2  6  
ATOM 10090 H H    . VAL A 1 36  ? -1.215  4.994   17.800  1.00 0.00 ? 36  VAL A H    6  
ATOM 10091 H HA   . VAL A 1 36  ? 1.329   4.736   18.929  1.00 0.00 ? 36  VAL A HA   6  
ATOM 10092 H HB   . VAL A 1 36  ? -0.611  3.242   19.409  1.00 0.00 ? 36  VAL A HB   6  
ATOM 10093 H HG11 . VAL A 1 36  ? -0.017  2.354   16.623  1.00 0.00 ? 36  VAL A HG11 6  
ATOM 10094 H HG12 . VAL A 1 36  ? -0.642  1.188   17.791  1.00 0.00 ? 36  VAL A HG12 6  
ATOM 10095 H HG13 . VAL A 1 36  ? -1.571  2.637   17.407  1.00 0.00 ? 36  VAL A HG13 6  
ATOM 10096 H HG21 . VAL A 1 36  ? 1.594   1.432   18.583  1.00 0.00 ? 36  VAL A HG21 6  
ATOM 10097 H HG22 . VAL A 1 36  ? 1.974   2.736   19.708  1.00 0.00 ? 36  VAL A HG22 6  
ATOM 10098 H HG23 . VAL A 1 36  ? 0.739   1.546   20.122  1.00 0.00 ? 36  VAL A HG23 6  
ATOM 10099 N N    . LYS A 1 37  ? 2.863   3.432   17.301  1.00 0.00 ? 37  LYS A N    6  
ATOM 10100 C CA   . LYS A 1 37  ? 3.847   3.068   16.288  1.00 0.00 ? 37  LYS A CA   6  
ATOM 10101 C C    . LYS A 1 37  ? 4.074   1.559   16.269  1.00 0.00 ? 37  LYS A C    6  
ATOM 10102 O O    . LYS A 1 37  ? 4.843   1.028   17.069  1.00 0.00 ? 37  LYS A O    6  
ATOM 10103 C CB   . LYS A 1 37  ? 5.170   3.790   16.550  1.00 0.00 ? 37  LYS A CB   6  
ATOM 10104 C CG   . LYS A 1 37  ? 5.753   3.512   17.925  1.00 0.00 ? 37  LYS A CG   6  
ATOM 10105 C CD   . LYS A 1 37  ? 6.633   4.656   18.400  1.00 0.00 ? 37  LYS A CD   6  
ATOM 10106 C CE   . LYS A 1 37  ? 7.322   4.321   19.714  1.00 0.00 ? 37  LYS A CE   6  
ATOM 10107 N NZ   . LYS A 1 37  ? 8.276   3.188   19.567  1.00 0.00 ? 37  LYS A NZ   6  
ATOM 10108 H H    . LYS A 1 37  ? 3.074   3.286   18.247  1.00 0.00 ? 37  LYS A H    6  
ATOM 10109 H HA   . LYS A 1 37  ? 3.463   3.374   15.327  1.00 0.00 ? 37  LYS A HA   6  
ATOM 10110 H HB2  . LYS A 1 37  ? 5.890   3.478   15.808  1.00 0.00 ? 37  LYS A HB2  6  
ATOM 10111 H HB3  . LYS A 1 37  ? 5.010   4.854   16.459  1.00 0.00 ? 37  LYS A HB3  6  
ATOM 10112 H HG2  . LYS A 1 37  ? 4.945   3.378   18.629  1.00 0.00 ? 37  LYS A HG2  6  
ATOM 10113 H HG3  . LYS A 1 37  ? 6.346   2.609   17.879  1.00 0.00 ? 37  LYS A HG3  6  
ATOM 10114 H HD2  . LYS A 1 37  ? 7.386   4.854   17.652  1.00 0.00 ? 37  LYS A HD2  6  
ATOM 10115 H HD3  . LYS A 1 37  ? 6.020   5.536   18.538  1.00 0.00 ? 37  LYS A HD3  6  
ATOM 10116 H HE2  . LYS A 1 37  ? 7.861   5.192   20.055  1.00 0.00 ? 37  LYS A HE2  6  
ATOM 10117 H HE3  . LYS A 1 37  ? 6.570   4.056   20.442  1.00 0.00 ? 37  LYS A HE3  6  
ATOM 10118 H HZ1  . LYS A 1 37  ? 9.044   3.449   18.916  1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 10119 H HZ2  . LYS A 1 37  ? 7.784   2.353   19.189  1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 10120 H HZ3  . LYS A 1 37  ? 8.687   2.945   20.490  1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 10121 N N    . GLN A 1 38  ? 3.400   0.876   15.349  1.00 0.00 ? 38  GLN A N    6  
ATOM 10122 C CA   . GLN A 1 38  ? 3.530   -0.571  15.225  1.00 0.00 ? 38  GLN A CA   6  
ATOM 10123 C C    . GLN A 1 38  ? 3.046   -1.046  13.860  1.00 0.00 ? 38  GLN A C    6  
ATOM 10124 O O    . GLN A 1 38  ? 1.970   -0.660  13.403  1.00 0.00 ? 38  GLN A O    6  
ATOM 10125 C CB   . GLN A 1 38  ? 2.740   -1.271  16.332  1.00 0.00 ? 38  GLN A CB   6  
ATOM 10126 C CG   . GLN A 1 38  ? 1.237   -1.264  16.104  1.00 0.00 ? 38  GLN A CG   6  
ATOM 10127 C CD   . GLN A 1 38  ? 0.476   -1.976  17.205  1.00 0.00 ? 38  GLN A CD   6  
ATOM 10128 O OE1  . GLN A 1 38  ? 0.126   -3.150  17.075  1.00 0.00 ? 38  GLN A OE1  6  
ATOM 10129 N NE2  . GLN A 1 38  ? 0.216   -1.269  18.299  1.00 0.00 ? 38  GLN A NE2  6  
ATOM 10130 H H    . GLN A 1 38  ? 2.802   1.356   14.740  1.00 0.00 ? 38  GLN A H    6  
ATOM 10131 H HA   . GLN A 1 38  ? 4.575   -0.820  15.330  1.00 0.00 ? 38  GLN A HA   6  
ATOM 10132 H HB2  . GLN A 1 38  ? 3.067   -2.298  16.398  1.00 0.00 ? 38  GLN A HB2  6  
ATOM 10133 H HB3  . GLN A 1 38  ? 2.942   -0.777  17.271  1.00 0.00 ? 38  GLN A HB3  6  
ATOM 10134 H HG2  . GLN A 1 38  ? 0.897   -0.240  16.059  1.00 0.00 ? 38  GLN A HG2  6  
ATOM 10135 H HG3  . GLN A 1 38  ? 1.026   -1.754  15.165  1.00 0.00 ? 38  GLN A HG3  6  
ATOM 10136 H HE21 . GLN A 1 38  ? 0.524   -0.339  18.332  1.00 0.00 ? 38  GLN A HE21 6  
ATOM 10137 H HE22 . GLN A 1 38  ? -0.275  -1.704  19.026  1.00 0.00 ? 38  GLN A HE22 6  
ATOM 10138 N N    . TRP A 1 39  ? 3.847   -1.885  13.213  1.00 0.00 ? 39  TRP A N    6  
ATOM 10139 C CA   . TRP A 1 39  ? 3.500   -2.413  11.898  1.00 0.00 ? 39  TRP A CA   6  
ATOM 10140 C C    . TRP A 1 39  ? 2.177   -3.170  11.948  1.00 0.00 ? 39  TRP A C    6  
ATOM 10141 O O    . TRP A 1 39  ? 2.060   -4.191  12.623  1.00 0.00 ? 39  TRP A O    6  
ATOM 10142 C CB   . TRP A 1 39  ? 4.609   -3.333  11.386  1.00 0.00 ? 39  TRP A CB   6  
ATOM 10143 C CG   . TRP A 1 39  ? 5.915   -2.629  11.177  1.00 0.00 ? 39  TRP A CG   6  
ATOM 10144 C CD1  . TRP A 1 39  ? 6.870   -2.375  12.120  1.00 0.00 ? 39  TRP A CD1  6  
ATOM 10145 C CD2  . TRP A 1 39  ? 6.410   -2.088  9.947   1.00 0.00 ? 39  TRP A CD2  6  
ATOM 10146 N NE1  . TRP A 1 39  ? 7.928   -1.708  11.551  1.00 0.00 ? 39  TRP A NE1  6  
ATOM 10147 C CE2  . TRP A 1 39  ? 7.670   -1.520  10.219  1.00 0.00 ? 39  TRP A CE2  6  
ATOM 10148 C CE3  . TRP A 1 39  ? 5.911   -2.028  8.643   1.00 0.00 ? 39  TRP A CE3  6  
ATOM 10149 C CZ2  . TRP A 1 39  ? 8.435   -0.902  9.233   1.00 0.00 ? 39  TRP A CZ2  6  
ATOM 10150 C CZ3  . TRP A 1 39  ? 6.672   -1.414  7.667   1.00 0.00 ? 39  TRP A CZ3  6  
ATOM 10151 C CH2  . TRP A 1 39  ? 7.923   -0.858  7.965   1.00 0.00 ? 39  TRP A CH2  6  
ATOM 10152 H H    . TRP A 1 39  ? 4.692   -2.156  13.629  1.00 0.00 ? 39  TRP A H    6  
ATOM 10153 H HA   . TRP A 1 39  ? 3.398   -1.577  11.223  1.00 0.00 ? 39  TRP A HA   6  
ATOM 10154 H HB2  . TRP A 1 39  ? 4.769   -4.127  12.101  1.00 0.00 ? 39  TRP A HB2  6  
ATOM 10155 H HB3  . TRP A 1 39  ? 4.304   -3.760  10.442  1.00 0.00 ? 39  TRP A HB3  6  
ATOM 10156 H HD1  . TRP A 1 39  ? 6.790   -2.661  13.158  1.00 0.00 ? 39  TRP A HD1  6  
ATOM 10157 H HE1  . TRP A 1 39  ? 8.736   -1.416  12.023  1.00 0.00 ? 39  TRP A HE1  6  
ATOM 10158 H HE3  . TRP A 1 39  ? 4.949   -2.451  8.393   1.00 0.00 ? 39  TRP A HE3  6  
ATOM 10159 H HZ2  . TRP A 1 39  ? 9.402   -0.469  9.448   1.00 0.00 ? 39  TRP A HZ2  6  
ATOM 10160 H HZ3  . TRP A 1 39  ? 6.303   -1.358  6.653   1.00 0.00 ? 39  TRP A HZ3  6  
ATOM 10161 H HH2  . TRP A 1 39  ? 8.482   -0.388  7.171   1.00 0.00 ? 39  TRP A HH2  6  
ATOM 10162 N N    . ASN A 1 40  ? 1.182   -2.662  11.227  1.00 0.00 ? 40  ASN A N    6  
ATOM 10163 C CA   . ASN A 1 40  ? -0.133  -3.290  11.189  1.00 0.00 ? 40  ASN A CA   6  
ATOM 10164 C C    . ASN A 1 40  ? -0.258  -4.218  9.985   1.00 0.00 ? 40  ASN A C    6  
ATOM 10165 O O    . ASN A 1 40  ? -0.189  -3.777  8.837   1.00 0.00 ? 40  ASN A O    6  
ATOM 10166 C CB   . ASN A 1 40  ? -1.230  -2.225  11.143  1.00 0.00 ? 40  ASN A CB   6  
ATOM 10167 C CG   . ASN A 1 40  ? -0.904  -1.021  12.007  1.00 0.00 ? 40  ASN A CG   6  
ATOM 10168 O OD1  . ASN A 1 40  ? -0.381  -0.018  11.521  1.00 0.00 ? 40  ASN A OD1  6  
ATOM 10169 N ND2  . ASN A 1 40  ? -1.211  -1.118  13.295  1.00 0.00 ? 40  ASN A ND2  6  
ATOM 10170 H H    . ASN A 1 40  ? 1.336   -1.844  10.708  1.00 0.00 ? 40  ASN A H    6  
ATOM 10171 H HA   . ASN A 1 40  ? -0.248  -3.873  12.091  1.00 0.00 ? 40  ASN A HA   6  
ATOM 10172 H HB2  . ASN A 1 40  ? -1.353  -1.888  10.123  1.00 0.00 ? 40  ASN A HB2  6  
ATOM 10173 H HB3  . ASN A 1 40  ? -2.157  -2.654  11.491  1.00 0.00 ? 40  ASN A HB3  6  
ATOM 10174 H HD21 . ASN A 1 40  ? -1.625  -1.948  13.612  1.00 0.00 ? 40  ASN A HD21 6  
ATOM 10175 H HD22 . ASN A 1 40  ? -1.012  -0.354  13.876  1.00 0.00 ? 40  ASN A HD22 6  
ATOM 10176 N N    . LYS A 1 41  ? -0.444  -5.506  10.253  1.00 0.00 ? 41  LYS A N    6  
ATOM 10177 C CA   . LYS A 1 41  ? -0.581  -6.497  9.193   1.00 0.00 ? 41  LYS A CA   6  
ATOM 10178 C C    . LYS A 1 41  ? -1.981  -6.458  8.589   1.00 0.00 ? 41  LYS A C    6  
ATOM 10179 O O    . LYS A 1 41  ? -2.965  -6.773  9.258   1.00 0.00 ? 41  LYS A O    6  
ATOM 10180 C CB   . LYS A 1 41  ? -0.287  -7.898  9.735   1.00 0.00 ? 41  LYS A CB   6  
ATOM 10181 C CG   . LYS A 1 41  ? -0.217  -8.965  8.656   1.00 0.00 ? 41  LYS A CG   6  
ATOM 10182 C CD   . LYS A 1 41  ? -0.345  -10.361 9.244   1.00 0.00 ? 41  LYS A CD   6  
ATOM 10183 C CE   . LYS A 1 41  ? 0.074   -11.427 8.244   1.00 0.00 ? 41  LYS A CE   6  
ATOM 10184 N NZ   . LYS A 1 41  ? -0.084  -12.800 8.798   1.00 0.00 ? 41  LYS A NZ   6  
ATOM 10185 H H    . LYS A 1 41  ? -0.490  -5.797  11.189  1.00 0.00 ? 41  LYS A H    6  
ATOM 10186 H HA   . LYS A 1 41  ? 0.137   -6.261  8.423   1.00 0.00 ? 41  LYS A HA   6  
ATOM 10187 H HB2  . LYS A 1 41  ? 0.659   -7.879  10.255  1.00 0.00 ? 41  LYS A HB2  6  
ATOM 10188 H HB3  . LYS A 1 41  ? -1.066  -8.171  10.433  1.00 0.00 ? 41  LYS A HB3  6  
ATOM 10189 H HG2  . LYS A 1 41  ? -1.022  -8.807  7.953   1.00 0.00 ? 41  LYS A HG2  6  
ATOM 10190 H HG3  . LYS A 1 41  ? 0.731   -8.885  8.145   1.00 0.00 ? 41  LYS A HG3  6  
ATOM 10191 H HD2  . LYS A 1 41  ? 0.286   -10.434 10.117  1.00 0.00 ? 41  LYS A HD2  6  
ATOM 10192 H HD3  . LYS A 1 41  ? -1.375  -10.530 9.526   1.00 0.00 ? 41  LYS A HD3  6  
ATOM 10193 H HE2  . LYS A 1 41  ? -0.536  -11.333 7.359   1.00 0.00 ? 41  LYS A HE2  6  
ATOM 10194 H HE3  . LYS A 1 41  ? 1.111   -11.270 7.984   1.00 0.00 ? 41  LYS A HE3  6  
ATOM 10195 H HZ1  . LYS A 1 41  ? -0.698  -13.367 8.179   1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 10196 H HZ2  . LYS A 1 41  ? -0.510  -12.756 9.746   1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 10197 H HZ3  . LYS A 1 41  ? 0.844   -13.266 8.869   1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 10198 N N    . ARG A 1 42  ? -2.063  -6.070  7.321   1.00 0.00 ? 42  ARG A N    6  
ATOM 10199 C CA   . ARG A 1 42  ? -3.343  -5.990  6.627   1.00 0.00 ? 42  ARG A CA   6  
ATOM 10200 C C    . ARG A 1 42  ? -3.249  -6.618  5.239   1.00 0.00 ? 42  ARG A C    6  
ATOM 10201 O O    . ARG A 1 42  ? -2.159  -6.772  4.689   1.00 0.00 ? 42  ARG A O    6  
ATOM 10202 C CB   . ARG A 1 42  ? -3.793  -4.533  6.510   1.00 0.00 ? 42  ARG A CB   6  
ATOM 10203 C CG   . ARG A 1 42  ? -4.019  -3.855  7.851   1.00 0.00 ? 42  ARG A CG   6  
ATOM 10204 C CD   . ARG A 1 42  ? -5.437  -4.076  8.354   1.00 0.00 ? 42  ARG A CD   6  
ATOM 10205 N NE   . ARG A 1 42  ? -5.543  -3.879  9.798   1.00 0.00 ? 42  ARG A NE   6  
ATOM 10206 C CZ   . ARG A 1 42  ? -6.688  -3.629  10.424  1.00 0.00 ? 42  ARG A CZ   6  
ATOM 10207 N NH1  . ARG A 1 42  ? -7.818  -3.547  9.736   1.00 0.00 ? 42  ARG A NH1  6  
ATOM 10208 N NH2  . ARG A 1 42  ? -6.703  -3.462  11.740  1.00 0.00 ? 42  ARG A NH2  6  
ATOM 10209 H H    . ARG A 1 42  ? -1.243  -5.831  6.840   1.00 0.00 ? 42  ARG A H    6  
ATOM 10210 H HA   . ARG A 1 42  ? -4.070  -6.536  7.208   1.00 0.00 ? 42  ARG A HA   6  
ATOM 10211 H HB2  . ARG A 1 42  ? -3.038  -3.977  5.974   1.00 0.00 ? 42  ARG A HB2  6  
ATOM 10212 H HB3  . ARG A 1 42  ? -4.717  -4.498  5.953   1.00 0.00 ? 42  ARG A HB3  6  
ATOM 10213 H HG2  . ARG A 1 42  ? -3.326  -4.264  8.572   1.00 0.00 ? 42  ARG A HG2  6  
ATOM 10214 H HG3  . ARG A 1 42  ? -3.846  -2.795  7.742   1.00 0.00 ? 42  ARG A HG3  6  
ATOM 10215 H HD2  . ARG A 1 42  ? -6.094  -3.378  7.857   1.00 0.00 ? 42  ARG A HD2  6  
ATOM 10216 H HD3  . ARG A 1 42  ? -5.737  -5.085  8.115   1.00 0.00 ? 42  ARG A HD3  6  
ATOM 10217 H HE   . ARG A 1 42  ? -4.719  -3.935  10.325  1.00 0.00 ? 42  ARG A HE   6  
ATOM 10218 H HH11 . ARG A 1 42  ? -7.810  -3.674  8.745   1.00 0.00 ? 42  ARG A HH11 6  
ATOM 10219 H HH12 . ARG A 1 42  ? -8.679  -3.360  10.210  1.00 0.00 ? 42  ARG A HH12 6  
ATOM 10220 H HH21 . ARG A 1 42  ? -5.852  -3.523  12.261  1.00 0.00 ? 42  ARG A HH21 6  
ATOM 10221 H HH22 . ARG A 1 42  ? -7.565  -3.274  12.210  1.00 0.00 ? 42  ARG A HH22 6  
ATOM 10222 N N    . TRP A 1 43  ? -4.399  -6.978  4.681   1.00 0.00 ? 43  TRP A N    6  
ATOM 10223 C CA   . TRP A 1 43  ? -4.447  -7.590  3.357   1.00 0.00 ? 43  TRP A CA   6  
ATOM 10224 C C    . TRP A 1 43  ? -4.282  -6.539  2.265   1.00 0.00 ? 43  TRP A C    6  
ATOM 10225 O O    . TRP A 1 43  ? -5.118  -5.647  2.118   1.00 0.00 ? 43  TRP A O    6  
ATOM 10226 C CB   . TRP A 1 43  ? -5.767  -8.339  3.167   1.00 0.00 ? 43  TRP A CB   6  
ATOM 10227 C CG   . TRP A 1 43  ? -5.845  -9.082  1.868   1.00 0.00 ? 43  TRP A CG   6  
ATOM 10228 C CD1  . TRP A 1 43  ? -6.816  -8.965  0.914   1.00 0.00 ? 43  TRP A CD1  6  
ATOM 10229 C CD2  . TRP A 1 43  ? -4.918  -10.059 1.381   1.00 0.00 ? 43  TRP A CD2  6  
ATOM 10230 N NE1  . TRP A 1 43  ? -6.547  -9.810  -0.136  1.00 0.00 ? 43  TRP A NE1  6  
ATOM 10231 C CE2  . TRP A 1 43  ? -5.388  -10.491 0.126   1.00 0.00 ? 43  TRP A CE2  6  
ATOM 10232 C CE3  . TRP A 1 43  ? -3.735  -10.608 1.883   1.00 0.00 ? 43  TRP A CE3  6  
ATOM 10233 C CZ2  . TRP A 1 43  ? -4.717  -11.447 -0.632  1.00 0.00 ? 43  TRP A CZ2  6  
ATOM 10234 C CZ3  . TRP A 1 43  ? -3.070  -11.557 1.130   1.00 0.00 ? 43  TRP A CZ3  6  
ATOM 10235 C CH2  . TRP A 1 43  ? -3.561  -11.968 -0.116  1.00 0.00 ? 43  TRP A CH2  6  
ATOM 10236 H H    . TRP A 1 43  ? -5.236  -6.830  5.169   1.00 0.00 ? 43  TRP A H    6  
ATOM 10237 H HA   . TRP A 1 43  ? -3.630  -8.294  3.289   1.00 0.00 ? 43  TRP A HA   6  
ATOM 10238 H HB2  . TRP A 1 43  ? -5.887  -9.054  3.967   1.00 0.00 ? 43  TRP A HB2  6  
ATOM 10239 H HB3  . TRP A 1 43  ? -6.581  -7.630  3.196   1.00 0.00 ? 43  TRP A HB3  6  
ATOM 10240 H HD1  . TRP A 1 43  ? -7.665  -8.303  0.989   1.00 0.00 ? 43  TRP A HD1  6  
ATOM 10241 H HE1  . TRP A 1 43  ? -7.097  -9.907  -0.943  1.00 0.00 ? 43  TRP A HE1  6  
ATOM 10242 H HE3  . TRP A 1 43  ? -3.340  -10.304 2.841   1.00 0.00 ? 43  TRP A HE3  6  
ATOM 10243 H HZ2  . TRP A 1 43  ? -5.082  -11.774 -1.594  1.00 0.00 ? 43  TRP A HZ2  6  
ATOM 10244 H HZ3  . TRP A 1 43  ? -2.154  -11.994 1.502   1.00 0.00 ? 43  TRP A HZ3  6  
ATOM 10245 H HH2  . TRP A 1 43  ? -3.009  -12.712 -0.670  1.00 0.00 ? 43  TRP A HH2  6  
ATOM 10246 N N    . PHE A 1 44  ? -3.200  -6.650  1.502   1.00 0.00 ? 44  PHE A N    6  
ATOM 10247 C CA   . PHE A 1 44  ? -2.926  -5.708  0.423   1.00 0.00 ? 44  PHE A CA   6  
ATOM 10248 C C    . PHE A 1 44  ? -3.316  -6.299  -0.928  1.00 0.00 ? 44  PHE A C    6  
ATOM 10249 O O    . PHE A 1 44  ? -3.219  -7.508  -1.140  1.00 0.00 ? 44  PHE A O    6  
ATOM 10250 C CB   . PHE A 1 44  ? -1.444  -5.325  0.416   1.00 0.00 ? 44  PHE A CB   6  
ATOM 10251 C CG   . PHE A 1 44  ? -1.125  -4.150  1.296   1.00 0.00 ? 44  PHE A CG   6  
ATOM 10252 C CD1  . PHE A 1 44  ? -1.621  -4.080  2.588   1.00 0.00 ? 44  PHE A CD1  6  
ATOM 10253 C CD2  . PHE A 1 44  ? -0.328  -3.116  0.831   1.00 0.00 ? 44  PHE A CD2  6  
ATOM 10254 C CE1  . PHE A 1 44  ? -1.329  -2.999  3.399   1.00 0.00 ? 44  PHE A CE1  6  
ATOM 10255 C CE2  . PHE A 1 44  ? -0.032  -2.033  1.638   1.00 0.00 ? 44  PHE A CE2  6  
ATOM 10256 C CZ   . PHE A 1 44  ? -0.532  -1.976  2.924   1.00 0.00 ? 44  PHE A CZ   6  
ATOM 10257 H H    . PHE A 1 44  ? -2.570  -7.383  1.669   1.00 0.00 ? 44  PHE A H    6  
ATOM 10258 H HA   . PHE A 1 44  ? -3.517  -4.822  0.599   1.00 0.00 ? 44  PHE A HA   6  
ATOM 10259 H HB2  . PHE A 1 44  ? -0.861  -6.165  0.761   1.00 0.00 ? 44  PHE A HB2  6  
ATOM 10260 H HB3  . PHE A 1 44  ? -1.149  -5.076  -0.592  1.00 0.00 ? 44  PHE A HB3  6  
ATOM 10261 H HD1  . PHE A 1 44  ? -2.243  -4.880  2.961   1.00 0.00 ? 44  PHE A HD1  6  
ATOM 10262 H HD2  . PHE A 1 44  ? 0.065   -3.160  -0.175  1.00 0.00 ? 44  PHE A HD2  6  
ATOM 10263 H HE1  . PHE A 1 44  ? -1.721  -2.957  4.404   1.00 0.00 ? 44  PHE A HE1  6  
ATOM 10264 H HE2  . PHE A 1 44  ? 0.591   -1.235  1.263   1.00 0.00 ? 44  PHE A HE2  6  
ATOM 10265 H HZ   . PHE A 1 44  ? -0.303  -1.130  3.556   1.00 0.00 ? 44  PHE A HZ   6  
ATOM 10266 N N    . VAL A 1 45  ? -3.758  -5.438  -1.839  1.00 0.00 ? 45  VAL A N    6  
ATOM 10267 C CA   . VAL A 1 45  ? -4.163  -5.874  -3.170  1.00 0.00 ? 45  VAL A CA   6  
ATOM 10268 C C    . VAL A 1 45  ? -3.882  -4.796  -4.211  1.00 0.00 ? 45  VAL A C    6  
ATOM 10269 O O    . VAL A 1 45  ? -4.117  -3.611  -3.972  1.00 0.00 ? 45  VAL A O    6  
ATOM 10270 C CB   . VAL A 1 45  ? -5.660  -6.234  -3.212  1.00 0.00 ? 45  VAL A CB   6  
ATOM 10271 C CG1  . VAL A 1 45  ? -6.047  -6.751  -4.589  1.00 0.00 ? 45  VAL A CG1  6  
ATOM 10272 C CG2  . VAL A 1 45  ? -5.991  -7.259  -2.137  1.00 0.00 ? 45  VAL A CG2  6  
ATOM 10273 H H    . VAL A 1 45  ? -3.813  -4.487  -1.610  1.00 0.00 ? 45  VAL A H    6  
ATOM 10274 H HA   . VAL A 1 45  ? -3.594  -6.759  -3.419  1.00 0.00 ? 45  VAL A HA   6  
ATOM 10275 H HB   . VAL A 1 45  ? -6.231  -5.339  -3.014  1.00 0.00 ? 45  VAL A HB   6  
ATOM 10276 H HG11 . VAL A 1 45  ? -5.782  -6.017  -5.336  1.00 0.00 ? 45  VAL A HG11 6  
ATOM 10277 H HG12 . VAL A 1 45  ? -5.524  -7.674  -4.788  1.00 0.00 ? 45  VAL A HG12 6  
ATOM 10278 H HG13 . VAL A 1 45  ? -7.112  -6.926  -4.621  1.00 0.00 ? 45  VAL A HG13 6  
ATOM 10279 H HG21 . VAL A 1 45  ? -6.977  -7.661  -2.314  1.00 0.00 ? 45  VAL A HG21 6  
ATOM 10280 H HG22 . VAL A 1 45  ? -5.265  -8.057  -2.166  1.00 0.00 ? 45  VAL A HG22 6  
ATOM 10281 H HG23 . VAL A 1 45  ? -5.965  -6.784  -1.166  1.00 0.00 ? 45  VAL A HG23 6  
ATOM 10282 N N    . LEU A 1 46  ? -3.377  -5.214  -5.366  1.00 0.00 ? 46  LEU A N    6  
ATOM 10283 C CA   . LEU A 1 46  ? -3.063  -4.284  -6.445  1.00 0.00 ? 46  LEU A CA   6  
ATOM 10284 C C    . LEU A 1 46  ? -4.017  -4.474  -7.621  1.00 0.00 ? 46  LEU A C    6  
ATOM 10285 O O    . LEU A 1 46  ? -3.999  -5.508  -8.288  1.00 0.00 ? 46  LEU A O    6  
ATOM 10286 C CB   . LEU A 1 46  ? -1.619  -4.479  -6.909  1.00 0.00 ? 46  LEU A CB   6  
ATOM 10287 C CG   . LEU A 1 46  ? -1.098  -3.462  -7.925  1.00 0.00 ? 46  LEU A CG   6  
ATOM 10288 C CD1  . LEU A 1 46  ? -0.867  -2.114  -7.262  1.00 0.00 ? 46  LEU A CD1  6  
ATOM 10289 C CD2  . LEU A 1 46  ? 0.184   -3.966  -8.574  1.00 0.00 ? 46  LEU A CD2  6  
ATOM 10290 H H    . LEU A 1 46  ? -3.211  -6.171  -5.497  1.00 0.00 ? 46  LEU A H    6  
ATOM 10291 H HA   . LEU A 1 46  ? -3.178  -3.281  -6.062  1.00 0.00 ? 46  LEU A HA   6  
ATOM 10292 H HB2  . LEU A 1 46  ? -0.983  -4.431  -6.038  1.00 0.00 ? 46  LEU A HB2  6  
ATOM 10293 H HB3  . LEU A 1 46  ? -1.544  -5.461  -7.354  1.00 0.00 ? 46  LEU A HB3  6  
ATOM 10294 H HG   . LEU A 1 46  ? -1.837  -3.329  -8.703  1.00 0.00 ? 46  LEU A HG   6  
ATOM 10295 H HD11 . LEU A 1 46  ? -1.612  -1.412  -7.604  1.00 0.00 ? 46  LEU A HD11 6  
ATOM 10296 H HD12 . LEU A 1 46  ? 0.117   -1.749  -7.519  1.00 0.00 ? 46  LEU A HD12 6  
ATOM 10297 H HD13 . LEU A 1 46  ? -0.940  -2.223  -6.189  1.00 0.00 ? 46  LEU A HD13 6  
ATOM 10298 H HD21 . LEU A 1 46  ? 0.073   -5.010  -8.826  1.00 0.00 ? 46  LEU A HD21 6  
ATOM 10299 H HD22 . LEU A 1 46  ? 1.007   -3.846  -7.885  1.00 0.00 ? 46  LEU A HD22 6  
ATOM 10300 H HD23 . LEU A 1 46  ? 0.380   -3.397  -9.472  1.00 0.00 ? 46  LEU A HD23 6  
ATOM 10301 N N    . VAL A 1 47  ? -4.847  -3.466  -7.871  1.00 0.00 ? 47  VAL A N    6  
ATOM 10302 C CA   . VAL A 1 47  ? -5.805  -3.520  -8.969  1.00 0.00 ? 47  VAL A CA   6  
ATOM 10303 C C    . VAL A 1 47  ? -5.946  -2.159  -9.642  1.00 0.00 ? 47  VAL A C    6  
ATOM 10304 O O    . VAL A 1 47  ? -6.029  -1.129  -8.972  1.00 0.00 ? 47  VAL A O    6  
ATOM 10305 C CB   . VAL A 1 47  ? -7.190  -3.986  -8.482  1.00 0.00 ? 47  VAL A CB   6  
ATOM 10306 C CG1  . VAL A 1 47  ? -8.264  -3.616  -9.494  1.00 0.00 ? 47  VAL A CG1  6  
ATOM 10307 C CG2  . VAL A 1 47  ? -7.186  -5.484  -8.220  1.00 0.00 ? 47  VAL A CG2  6  
ATOM 10308 H H    . VAL A 1 47  ? -4.813  -2.667  -7.304  1.00 0.00 ? 47  VAL A H    6  
ATOM 10309 H HA   . VAL A 1 47  ? -5.443  -4.234  -9.694  1.00 0.00 ? 47  VAL A HA   6  
ATOM 10310 H HB   . VAL A 1 47  ? -7.412  -3.479  -7.554  1.00 0.00 ? 47  VAL A HB   6  
ATOM 10311 H HG11 . VAL A 1 47  ? -8.806  -2.750  -9.144  1.00 0.00 ? 47  VAL A HG11 6  
ATOM 10312 H HG12 . VAL A 1 47  ? -7.802  -3.393  -10.445 1.00 0.00 ? 47  VAL A HG12 6  
ATOM 10313 H HG13 . VAL A 1 47  ? -8.948  -4.444  -9.612  1.00 0.00 ? 47  VAL A HG13 6  
ATOM 10314 H HG21 . VAL A 1 47  ? -7.648  -5.997  -9.050  1.00 0.00 ? 47  VAL A HG21 6  
ATOM 10315 H HG22 . VAL A 1 47  ? -6.168  -5.826  -8.106  1.00 0.00 ? 47  VAL A HG22 6  
ATOM 10316 H HG23 . VAL A 1 47  ? -7.739  -5.693  -7.315  1.00 0.00 ? 47  VAL A HG23 6  
ATOM 10317 N N    . ASP A 1 48  ? -5.974  -2.163  -10.970 1.00 0.00 ? 48  ASP A N    6  
ATOM 10318 C CA   . ASP A 1 48  ? -6.107  -0.928  -11.735 1.00 0.00 ? 48  ASP A CA   6  
ATOM 10319 C C    . ASP A 1 48  ? -4.985  0.047   -11.393 1.00 0.00 ? 48  ASP A C    6  
ATOM 10320 O O    . ASP A 1 48  ? -5.237  1.198   -11.036 1.00 0.00 ? 48  ASP A O    6  
ATOM 10321 C CB   . ASP A 1 48  ? -7.465  -0.279  -11.464 1.00 0.00 ? 48  ASP A CB   6  
ATOM 10322 C CG   . ASP A 1 48  ? -7.933  0.587   -12.617 1.00 0.00 ? 48  ASP A CG   6  
ATOM 10323 O OD1  . ASP A 1 48  ? -7.845  0.130   -13.775 1.00 0.00 ? 48  ASP A OD1  6  
ATOM 10324 O OD2  . ASP A 1 48  ? -8.387  1.722   -12.361 1.00 0.00 ? 48  ASP A OD2  6  
ATOM 10325 H H    . ASP A 1 48  ? -5.904  -3.016  -11.447 1.00 0.00 ? 48  ASP A H    6  
ATOM 10326 H HA   . ASP A 1 48  ? -6.042  -1.179  -12.783 1.00 0.00 ? 48  ASP A HA   6  
ATOM 10327 H HB2  . ASP A 1 48  ? -8.200  -1.052  -11.297 1.00 0.00 ? 48  ASP A HB2  6  
ATOM 10328 H HB3  . ASP A 1 48  ? -7.391  0.338   -10.580 1.00 0.00 ? 48  ASP A HB3  6  
ATOM 10329 N N    . ARG A 1 49  ? -3.746  -0.422  -11.504 1.00 0.00 ? 49  ARG A N    6  
ATOM 10330 C CA   . ARG A 1 49  ? -2.586  0.408   -11.204 1.00 0.00 ? 49  ARG A CA   6  
ATOM 10331 C C    . ARG A 1 49  ? -2.785  1.169   -9.896  1.00 0.00 ? 49  ARG A C    6  
ATOM 10332 O O    . ARG A 1 49  ? -2.222  2.247   -9.703  1.00 0.00 ? 49  ARG A O    6  
ATOM 10333 C CB   . ARG A 1 49  ? -2.327  1.392   -12.345 1.00 0.00 ? 49  ARG A CB   6  
ATOM 10334 C CG   . ARG A 1 49  ? -0.917  1.959   -12.354 1.00 0.00 ? 49  ARG A CG   6  
ATOM 10335 C CD   . ARG A 1 49  ? -0.499  2.393   -13.750 1.00 0.00 ? 49  ARG A CD   6  
ATOM 10336 N NE   . ARG A 1 49  ? -0.538  1.286   -14.702 1.00 0.00 ? 49  ARG A NE   6  
ATOM 10337 C CZ   . ARG A 1 49  ? 0.068   1.311   -15.883 1.00 0.00 ? 49  ARG A CZ   6  
ATOM 10338 N NH1  . ARG A 1 49  ? 0.758   2.380   -16.256 1.00 0.00 ? 49  ARG A NH1  6  
ATOM 10339 N NH2  . ARG A 1 49  ? -0.014  0.264   -16.695 1.00 0.00 ? 49  ARG A NH2  6  
ATOM 10340 H H    . ARG A 1 49  ? -3.609  -1.349  -11.793 1.00 0.00 ? 49  ARG A H    6  
ATOM 10341 H HA   . ARG A 1 49  ? -1.730  -0.243  -11.100 1.00 0.00 ? 49  ARG A HA   6  
ATOM 10342 H HB2  . ARG A 1 49  ? -2.494  0.887   -13.286 1.00 0.00 ? 49  ARG A HB2  6  
ATOM 10343 H HB3  . ARG A 1 49  ? -3.021  2.214   -12.260 1.00 0.00 ? 49  ARG A HB3  6  
ATOM 10344 H HG2  . ARG A 1 49  ? -0.878  2.815   -11.696 1.00 0.00 ? 49  ARG A HG2  6  
ATOM 10345 H HG3  . ARG A 1 49  ? -0.233  1.201   -12.001 1.00 0.00 ? 49  ARG A HG3  6  
ATOM 10346 H HD2  . ARG A 1 49  ? -1.169  3.169   -14.087 1.00 0.00 ? 49  ARG A HD2  6  
ATOM 10347 H HD3  . ARG A 1 49  ? 0.508   2.781   -13.705 1.00 0.00 ? 49  ARG A HD3  6  
ATOM 10348 H HE   . ARG A 1 49  ? -1.043  0.486   -14.447 1.00 0.00 ? 49  ARG A HE   6  
ATOM 10349 H HH11 . ARG A 1 49  ? 0.822   3.170   -15.646 1.00 0.00 ? 49  ARG A HH11 6  
ATOM 10350 H HH12 . ARG A 1 49  ? 1.215   2.396   -17.146 1.00 0.00 ? 49  ARG A HH12 6  
ATOM 10351 H HH21 . ARG A 1 49  ? -0.533  -0.544  -16.417 1.00 0.00 ? 49  ARG A HH21 6  
ATOM 10352 H HH22 . ARG A 1 49  ? 0.442   0.284   -17.584 1.00 0.00 ? 49  ARG A HH22 6  
ATOM 10353 N N    . CYS A 1 50  ? -3.589  0.602   -9.004  1.00 0.00 ? 50  CYS A N    6  
ATOM 10354 C CA   . CYS A 1 50  ? -3.864  1.228   -7.715  1.00 0.00 ? 50  CYS A CA   6  
ATOM 10355 C C    . CYS A 1 50  ? -3.758  0.211   -6.584  1.00 0.00 ? 50  CYS A C    6  
ATOM 10356 O O    . CYS A 1 50  ? -4.026  -0.976  -6.774  1.00 0.00 ? 50  CYS A O    6  
ATOM 10357 C CB   . CYS A 1 50  ? -5.255  1.862   -7.720  1.00 0.00 ? 50  CYS A CB   6  
ATOM 10358 S SG   . CYS A 1 50  ? -5.494  3.110   -9.006  1.00 0.00 ? 50  CYS A SG   6  
ATOM 10359 H H    . CYS A 1 50  ? -4.008  -0.258  -9.216  1.00 0.00 ? 50  CYS A H    6  
ATOM 10360 H HA   . CYS A 1 50  ? -3.126  2.000   -7.559  1.00 0.00 ? 50  CYS A HA   6  
ATOM 10361 H HB2  . CYS A 1 50  ? -5.994  1.089   -7.872  1.00 0.00 ? 50  CYS A HB2  6  
ATOM 10362 H HB3  . CYS A 1 50  ? -5.430  2.334   -6.765  1.00 0.00 ? 50  CYS A HB3  6  
ATOM 10363 H HG   . CYS A 1 50  ? -6.191  4.107   -8.483  1.00 0.00 ? 50  CYS A HG   6  
ATOM 10364 N N    . LEU A 1 51  ? -3.365  0.683   -5.406  1.00 0.00 ? 51  LEU A N    6  
ATOM 10365 C CA   . LEU A 1 51  ? -3.223  -0.185  -4.242  1.00 0.00 ? 51  LEU A CA   6  
ATOM 10366 C C    . LEU A 1 51  ? -4.450  -0.095  -3.341  1.00 0.00 ? 51  LEU A C    6  
ATOM 10367 O O    . LEU A 1 51  ? -4.970  0.993   -3.090  1.00 0.00 ? 51  LEU A O    6  
ATOM 10368 C CB   . LEU A 1 51  ? -1.967  0.189   -3.453  1.00 0.00 ? 51  LEU A CB   6  
ATOM 10369 C CG   . LEU A 1 51  ? -1.350  -0.924  -2.605  1.00 0.00 ? 51  LEU A CG   6  
ATOM 10370 C CD1  . LEU A 1 51  ? 0.103   -0.608  -2.285  1.00 0.00 ? 51  LEU A CD1  6  
ATOM 10371 C CD2  . LEU A 1 51  ? -2.149  -1.125  -1.326  1.00 0.00 ? 51  LEU A CD2  6  
ATOM 10372 H H    . LEU A 1 51  ? -3.166  1.638   -5.315  1.00 0.00 ? 51  LEU A H    6  
ATOM 10373 H HA   . LEU A 1 51  ? -3.125  -1.201  -4.597  1.00 0.00 ? 51  LEU A HA   6  
ATOM 10374 H HB2  . LEU A 1 51  ? -1.220  0.521   -4.157  1.00 0.00 ? 51  LEU A HB2  6  
ATOM 10375 H HB3  . LEU A 1 51  ? -2.224  1.006   -2.792  1.00 0.00 ? 51  LEU A HB3  6  
ATOM 10376 H HG   . LEU A 1 51  ? -1.374  -1.849  -3.165  1.00 0.00 ? 51  LEU A HG   6  
ATOM 10377 H HD11 . LEU A 1 51  ? 0.737   -1.382  -2.689  1.00 0.00 ? 51  LEU A HD11 6  
ATOM 10378 H HD12 . LEU A 1 51  ? 0.232   -0.559  -1.214  1.00 0.00 ? 51  LEU A HD12 6  
ATOM 10379 H HD13 . LEU A 1 51  ? 0.369   0.343   -2.723  1.00 0.00 ? 51  LEU A HD13 6  
ATOM 10380 H HD21 . LEU A 1 51  ? -3.092  -1.594  -1.560  1.00 0.00 ? 51  LEU A HD21 6  
ATOM 10381 H HD22 . LEU A 1 51  ? -2.329  -0.167  -0.860  1.00 0.00 ? 51  LEU A HD22 6  
ATOM 10382 H HD23 . LEU A 1 51  ? -1.591  -1.755  -0.648  1.00 0.00 ? 51  LEU A HD23 6  
ATOM 10383 N N    . PHE A 1 52  ? -4.907  -1.244  -2.856  1.00 0.00 ? 52  PHE A N    6  
ATOM 10384 C CA   . PHE A 1 52  ? -6.073  -1.294  -1.981  1.00 0.00 ? 52  PHE A CA   6  
ATOM 10385 C C    . PHE A 1 52  ? -5.848  -2.270  -0.830  1.00 0.00 ? 52  PHE A C    6  
ATOM 10386 O O    . PHE A 1 52  ? -5.626  -3.462  -1.047  1.00 0.00 ? 52  PHE A O    6  
ATOM 10387 C CB   . PHE A 1 52  ? -7.316  -1.703  -2.775  1.00 0.00 ? 52  PHE A CB   6  
ATOM 10388 C CG   . PHE A 1 52  ? -7.570  -0.838  -3.977  1.00 0.00 ? 52  PHE A CG   6  
ATOM 10389 C CD1  . PHE A 1 52  ? -7.826  0.516   -3.831  1.00 0.00 ? 52  PHE A CD1  6  
ATOM 10390 C CD2  . PHE A 1 52  ? -7.554  -1.380  -5.252  1.00 0.00 ? 52  PHE A CD2  6  
ATOM 10391 C CE1  . PHE A 1 52  ? -8.060  1.314   -4.935  1.00 0.00 ? 52  PHE A CE1  6  
ATOM 10392 C CE2  . PHE A 1 52  ? -7.787  -0.586  -6.359  1.00 0.00 ? 52  PHE A CE2  6  
ATOM 10393 C CZ   . PHE A 1 52  ? -8.041  0.762   -6.200  1.00 0.00 ? 52  PHE A CZ   6  
ATOM 10394 H H    . PHE A 1 52  ? -4.450  -2.078  -3.092  1.00 0.00 ? 52  PHE A H    6  
ATOM 10395 H HA   . PHE A 1 52  ? -6.224  -0.306  -1.575  1.00 0.00 ? 52  PHE A HA   6  
ATOM 10396 H HB2  . PHE A 1 52  ? -7.197  -2.719  -3.118  1.00 0.00 ? 52  PHE A HB2  6  
ATOM 10397 H HB3  . PHE A 1 52  ? -8.181  -1.642  -2.132  1.00 0.00 ? 52  PHE A HB3  6  
ATOM 10398 H HD1  . PHE A 1 52  ? -7.841  0.949   -2.840  1.00 0.00 ? 52  PHE A HD1  6  
ATOM 10399 H HD2  . PHE A 1 52  ? -7.356  -2.434  -5.378  1.00 0.00 ? 52  PHE A HD2  6  
ATOM 10400 H HE1  . PHE A 1 52  ? -8.259  2.368   -4.807  1.00 0.00 ? 52  PHE A HE1  6  
ATOM 10401 H HE2  . PHE A 1 52  ? -7.772  -1.020  -7.348  1.00 0.00 ? 52  PHE A HE2  6  
ATOM 10402 H HZ   . PHE A 1 52  ? -8.223  1.384   -7.064  1.00 0.00 ? 52  PHE A HZ   6  
ATOM 10403 N N    . TYR A 1 53  ? -5.905  -1.756  0.393   1.00 0.00 ? 53  TYR A N    6  
ATOM 10404 C CA   . TYR A 1 53  ? -5.704  -2.581  1.579   1.00 0.00 ? 53  TYR A CA   6  
ATOM 10405 C C    . TYR A 1 53  ? -7.031  -2.861  2.279   1.00 0.00 ? 53  TYR A C    6  
ATOM 10406 O O    . TYR A 1 53  ? -7.741  -1.939  2.680   1.00 0.00 ? 53  TYR A O    6  
ATOM 10407 C CB   . TYR A 1 53  ? -4.740  -1.893  2.547   1.00 0.00 ? 53  TYR A CB   6  
ATOM 10408 C CG   . TYR A 1 53  ? -5.334  -0.688  3.240   1.00 0.00 ? 53  TYR A CG   6  
ATOM 10409 C CD1  . TYR A 1 53  ? -6.019  -0.821  4.442   1.00 0.00 ? 53  TYR A CD1  6  
ATOM 10410 C CD2  . TYR A 1 53  ? -5.211  0.583   2.693   1.00 0.00 ? 53  TYR A CD2  6  
ATOM 10411 C CE1  . TYR A 1 53  ? -6.564  0.277   5.078   1.00 0.00 ? 53  TYR A CE1  6  
ATOM 10412 C CE2  . TYR A 1 53  ? -5.752  1.687   3.323   1.00 0.00 ? 53  TYR A CE2  6  
ATOM 10413 C CZ   . TYR A 1 53  ? -6.428  1.529   4.515   1.00 0.00 ? 53  TYR A CZ   6  
ATOM 10414 O OH   . TYR A 1 53  ? -6.969  2.626   5.146   1.00 0.00 ? 53  TYR A OH   6  
ATOM 10415 H H    . TYR A 1 53  ? -6.085  -0.799  0.502   1.00 0.00 ? 53  TYR A H    6  
ATOM 10416 H HA   . TYR A 1 53  ? -5.273  -3.519  1.262   1.00 0.00 ? 53  TYR A HA   6  
ATOM 10417 H HB2  . TYR A 1 53  ? -4.440  -2.598  3.307   1.00 0.00 ? 53  TYR A HB2  6  
ATOM 10418 H HB3  . TYR A 1 53  ? -3.866  -1.566  2.002   1.00 0.00 ? 53  TYR A HB3  6  
ATOM 10419 H HD1  . TYR A 1 53  ? -6.124  -1.803  4.880   1.00 0.00 ? 53  TYR A HD1  6  
ATOM 10420 H HD2  . TYR A 1 53  ? -4.682  0.703   1.759   1.00 0.00 ? 53  TYR A HD2  6  
ATOM 10421 H HE1  . TYR A 1 53  ? -7.093  0.154   6.012   1.00 0.00 ? 53  TYR A HE1  6  
ATOM 10422 H HE2  . TYR A 1 53  ? -5.646  2.667   2.882   1.00 0.00 ? 53  TYR A HE2  6  
ATOM 10423 H HH   . TYR A 1 53  ? -7.363  2.355   5.978   1.00 0.00 ? 53  TYR A HH   6  
ATOM 10424 N N    . TYR A 1 54  ? -7.358  -4.140  2.422   1.00 0.00 ? 54  TYR A N    6  
ATOM 10425 C CA   . TYR A 1 54  ? -8.599  -4.544  3.071   1.00 0.00 ? 54  TYR A CA   6  
ATOM 10426 C C    . TYR A 1 54  ? -8.335  -5.049  4.486   1.00 0.00 ? 54  TYR A C    6  
ATOM 10427 O O    . TYR A 1 54  ? -7.199  -5.364  4.844   1.00 0.00 ? 54  TYR A O    6  
ATOM 10428 C CB   . TYR A 1 54  ? -9.298  -5.630  2.252   1.00 0.00 ? 54  TYR A CB   6  
ATOM 10429 C CG   . TYR A 1 54  ? -9.638  -5.201  0.842   1.00 0.00 ? 54  TYR A CG   6  
ATOM 10430 C CD1  . TYR A 1 54  ? -8.702  -5.303  -0.180  1.00 0.00 ? 54  TYR A CD1  6  
ATOM 10431 C CD2  . TYR A 1 54  ? -10.893 -4.694  0.533   1.00 0.00 ? 54  TYR A CD2  6  
ATOM 10432 C CE1  . TYR A 1 54  ? -9.007  -4.912  -1.469  1.00 0.00 ? 54  TYR A CE1  6  
ATOM 10433 C CE2  . TYR A 1 54  ? -11.208 -4.302  -0.754  1.00 0.00 ? 54  TYR A CE2  6  
ATOM 10434 C CZ   . TYR A 1 54  ? -10.261 -4.412  -1.751  1.00 0.00 ? 54  TYR A CZ   6  
ATOM 10435 O OH   . TYR A 1 54  ? -10.570 -4.021  -3.034  1.00 0.00 ? 54  TYR A OH   6  
ATOM 10436 H H    . TYR A 1 54  ? -6.751  -4.830  2.081   1.00 0.00 ? 54  TYR A H    6  
ATOM 10437 H HA   . TYR A 1 54  ? -9.242  -3.678  3.125   1.00 0.00 ? 54  TYR A HA   6  
ATOM 10438 H HB2  . TYR A 1 54  ? -8.655  -6.494  2.189   1.00 0.00 ? 54  TYR A HB2  6  
ATOM 10439 H HB3  . TYR A 1 54  ? -10.218 -5.907  2.745   1.00 0.00 ? 54  TYR A HB3  6  
ATOM 10440 H HD1  . TYR A 1 54  ? -7.720  -5.695  0.044   1.00 0.00 ? 54  TYR A HD1  6  
ATOM 10441 H HD2  . TYR A 1 54  ? -11.632 -4.608  1.316   1.00 0.00 ? 54  TYR A HD2  6  
ATOM 10442 H HE1  . TYR A 1 54  ? -8.266  -4.998  -2.251  1.00 0.00 ? 54  TYR A HE1  6  
ATOM 10443 H HE2  . TYR A 1 54  ? -12.190 -3.910  -0.975  1.00 0.00 ? 54  TYR A HE2  6  
ATOM 10444 H HH   . TYR A 1 54  ? -11.495 -4.207  -3.211  1.00 0.00 ? 54  TYR A HH   6  
ATOM 10445 N N    . LYS A 1 55  ? -9.392  -5.126  5.287   1.00 0.00 ? 55  LYS A N    6  
ATOM 10446 C CA   . LYS A 1 55  ? -9.278  -5.595  6.663   1.00 0.00 ? 55  LYS A CA   6  
ATOM 10447 C C    . LYS A 1 55  ? -8.766  -7.031  6.708   1.00 0.00 ? 55  LYS A C    6  
ATOM 10448 O O    . LYS A 1 55  ? -8.064  -7.421  7.640   1.00 0.00 ? 55  LYS A O    6  
ATOM 10449 C CB   . LYS A 1 55  ? -10.632 -5.502  7.370   1.00 0.00 ? 55  LYS A CB   6  
ATOM 10450 C CG   . LYS A 1 55  ? -11.703 -6.383  6.750   1.00 0.00 ? 55  LYS A CG   6  
ATOM 10451 C CD   . LYS A 1 55  ? -12.967 -6.400  7.593   1.00 0.00 ? 55  LYS A CD   6  
ATOM 10452 C CE   . LYS A 1 55  ? -14.080 -7.183  6.912   1.00 0.00 ? 55  LYS A CE   6  
ATOM 10453 N NZ   . LYS A 1 55  ? -13.949 -8.648  7.142   1.00 0.00 ? 55  LYS A NZ   6  
ATOM 10454 H H    . LYS A 1 55  ? -10.272 -4.861  4.944   1.00 0.00 ? 55  LYS A H    6  
ATOM 10455 H HA   . LYS A 1 55  ? -8.571  -4.958  7.173   1.00 0.00 ? 55  LYS A HA   6  
ATOM 10456 H HB2  . LYS A 1 55  ? -10.507 -5.795  8.402   1.00 0.00 ? 55  LYS A HB2  6  
ATOM 10457 H HB3  . LYS A 1 55  ? -10.974 -4.477  7.334   1.00 0.00 ? 55  LYS A HB3  6  
ATOM 10458 H HG2  . LYS A 1 55  ? -11.943 -6.005  5.767   1.00 0.00 ? 55  LYS A HG2  6  
ATOM 10459 H HG3  . LYS A 1 55  ? -11.322 -7.391  6.667   1.00 0.00 ? 55  LYS A HG3  6  
ATOM 10460 H HD2  . LYS A 1 55  ? -12.749 -6.861  8.545   1.00 0.00 ? 55  LYS A HD2  6  
ATOM 10461 H HD3  . LYS A 1 55  ? -13.298 -5.384  7.750   1.00 0.00 ? 55  LYS A HD3  6  
ATOM 10462 H HE2  . LYS A 1 55  ? -15.028 -6.849  7.304   1.00 0.00 ? 55  LYS A HE2  6  
ATOM 10463 H HE3  . LYS A 1 55  ? -14.041 -6.989  5.850   1.00 0.00 ? 55  LYS A HE3  6  
ATOM 10464 H HZ1  . LYS A 1 55  ? -14.380 -8.907  8.052   1.00 0.00 ? 55  LYS A HZ1  6  
ATOM 10465 H HZ2  . LYS A 1 55  ? -12.945 -8.919  7.156   1.00 0.00 ? 55  LYS A HZ2  6  
ATOM 10466 H HZ3  . LYS A 1 55  ? -14.427 -9.173  6.382   1.00 0.00 ? 55  LYS A HZ3  6  
ATOM 10467 N N    . ASP A 1 56  ? -9.123  -7.813  5.694   1.00 0.00 ? 56  ASP A N    6  
ATOM 10468 C CA   . ASP A 1 56  ? -8.698  -9.205  5.617   1.00 0.00 ? 56  ASP A CA   6  
ATOM 10469 C C    . ASP A 1 56  ? -8.852  -9.743  4.197   1.00 0.00 ? 56  ASP A C    6  
ATOM 10470 O O    . ASP A 1 56  ? -9.220  -9.007  3.282   1.00 0.00 ? 56  ASP A O    6  
ATOM 10471 C CB   . ASP A 1 56  ? -9.507  -10.063 6.591   1.00 0.00 ? 56  ASP A CB   6  
ATOM 10472 C CG   . ASP A 1 56  ? -8.725  -11.259 7.096   1.00 0.00 ? 56  ASP A CG   6  
ATOM 10473 O OD1  . ASP A 1 56  ? -7.965  -11.101 8.075   1.00 0.00 ? 56  ASP A OD1  6  
ATOM 10474 O OD2  . ASP A 1 56  ? -8.872  -12.354 6.513   1.00 0.00 ? 56  ASP A OD2  6  
ATOM 10475 H H    . ASP A 1 56  ? -9.684  -7.444  4.981   1.00 0.00 ? 56  ASP A H    6  
ATOM 10476 H HA   . ASP A 1 56  ? -7.655  -9.250  5.893   1.00 0.00 ? 56  ASP A HA   6  
ATOM 10477 H HB2  . ASP A 1 56  ? -9.793  -9.459  7.440   1.00 0.00 ? 56  ASP A HB2  6  
ATOM 10478 H HB3  . ASP A 1 56  ? -10.396 -10.420 6.093   1.00 0.00 ? 56  ASP A HB3  6  
ATOM 10479 N N    . GLU A 1 57  ? -8.569  -11.030 4.023   1.00 0.00 ? 57  GLU A N    6  
ATOM 10480 C CA   . GLU A 1 57  ? -8.675  -11.664 2.714   1.00 0.00 ? 57  GLU A CA   6  
ATOM 10481 C C    . GLU A 1 57  ? -10.097 -11.554 2.170   1.00 0.00 ? 57  GLU A C    6  
ATOM 10482 O O    . GLU A 1 57  ? -10.308 -11.494 0.959   1.00 0.00 ? 57  GLU A O    6  
ATOM 10483 C CB   . GLU A 1 57  ? -8.263  -13.135 2.800   1.00 0.00 ? 57  GLU A CB   6  
ATOM 10484 C CG   . GLU A 1 57  ? -9.147  -13.962 3.718   1.00 0.00 ? 57  GLU A CG   6  
ATOM 10485 C CD   . GLU A 1 57  ? -9.092  -15.444 3.400   1.00 0.00 ? 57  GLU A CD   6  
ATOM 10486 O OE1  . GLU A 1 57  ? -7.975  -15.970 3.212   1.00 0.00 ? 57  GLU A OE1  6  
ATOM 10487 O OE2  . GLU A 1 57  ? -10.167 -16.078 3.340   1.00 0.00 ? 57  GLU A OE2  6  
ATOM 10488 H H    . GLU A 1 57  ? -8.281  -11.565 4.792   1.00 0.00 ? 57  GLU A H    6  
ATOM 10489 H HA   . GLU A 1 57  ? -8.005  -11.151 2.041   1.00 0.00 ? 57  GLU A HA   6  
ATOM 10490 H HB2  . GLU A 1 57  ? -8.301  -13.566 1.811   1.00 0.00 ? 57  GLU A HB2  6  
ATOM 10491 H HB3  . GLU A 1 57  ? -7.248  -13.190 3.168   1.00 0.00 ? 57  GLU A HB3  6  
ATOM 10492 H HG2  . GLU A 1 57  ? -8.824  -13.816 4.737   1.00 0.00 ? 57  GLU A HG2  6  
ATOM 10493 H HG3  . GLU A 1 57  ? -10.168 -13.625 3.613   1.00 0.00 ? 57  GLU A HG3  6  
ATOM 10494 N N    . LYS A 1 58  ? -11.070 -11.529 3.075   1.00 0.00 ? 58  LYS A N    6  
ATOM 10495 C CA   . LYS A 1 58  ? -12.472 -11.427 2.688   1.00 0.00 ? 58  LYS A CA   6  
ATOM 10496 C C    . LYS A 1 58  ? -12.672 -10.323 1.655   1.00 0.00 ? 58  LYS A C    6  
ATOM 10497 O O    . LYS A 1 58  ? -13.517 -10.437 0.768   1.00 0.00 ? 58  LYS A O    6  
ATOM 10498 C CB   . LYS A 1 58  ? -13.342 -11.153 3.917   1.00 0.00 ? 58  LYS A CB   6  
ATOM 10499 C CG   . LYS A 1 58  ? -13.426 -12.327 4.877   1.00 0.00 ? 58  LYS A CG   6  
ATOM 10500 C CD   . LYS A 1 58  ? -14.521 -13.300 4.473   1.00 0.00 ? 58  LYS A CD   6  
ATOM 10501 C CE   . LYS A 1 58  ? -14.939 -14.184 5.638   1.00 0.00 ? 58  LYS A CE   6  
ATOM 10502 N NZ   . LYS A 1 58  ? -16.272 -14.807 5.411   1.00 0.00 ? 58  LYS A NZ   6  
ATOM 10503 H H    . LYS A 1 58  ? -10.839 -11.581 4.026   1.00 0.00 ? 58  LYS A H    6  
ATOM 10504 H HA   . LYS A 1 58  ? -12.766 -12.369 2.252   1.00 0.00 ? 58  LYS A HA   6  
ATOM 10505 H HB2  . LYS A 1 58  ? -12.934 -10.307 4.451   1.00 0.00 ? 58  LYS A HB2  6  
ATOM 10506 H HB3  . LYS A 1 58  ? -14.343 -10.912 3.588   1.00 0.00 ? 58  LYS A HB3  6  
ATOM 10507 H HG2  . LYS A 1 58  ? -12.480 -12.847 4.879   1.00 0.00 ? 58  LYS A HG2  6  
ATOM 10508 H HG3  . LYS A 1 58  ? -13.636 -11.955 5.870   1.00 0.00 ? 58  LYS A HG3  6  
ATOM 10509 H HD2  . LYS A 1 58  ? -15.380 -12.741 4.134   1.00 0.00 ? 58  LYS A HD2  6  
ATOM 10510 H HD3  . LYS A 1 58  ? -14.156 -13.926 3.671   1.00 0.00 ? 58  LYS A HD3  6  
ATOM 10511 H HE2  . LYS A 1 58  ? -14.203 -14.963 5.764   1.00 0.00 ? 58  LYS A HE2  6  
ATOM 10512 H HE3  . LYS A 1 58  ? -14.980 -13.581 6.533   1.00 0.00 ? 58  LYS A HE3  6  
ATOM 10513 H HZ1  . LYS A 1 58  ? -16.276 -15.783 5.772   1.00 0.00 ? 58  LYS A HZ1  6  
ATOM 10514 H HZ2  . LYS A 1 58  ? -16.490 -14.823 4.394   1.00 0.00 ? 58  LYS A HZ2  6  
ATOM 10515 H HZ3  . LYS A 1 58  ? -17.009 -14.264 5.904   1.00 0.00 ? 58  LYS A HZ3  6  
ATOM 10516 N N    . GLU A 1 59  ? -11.888 -9.256  1.775   1.00 0.00 ? 59  GLU A N    6  
ATOM 10517 C CA   . GLU A 1 59  ? -11.980 -8.133  0.850   1.00 0.00 ? 59  GLU A CA   6  
ATOM 10518 C C    . GLU A 1 59  ? -13.411 -7.611  0.769   1.00 0.00 ? 59  GLU A C    6  
ATOM 10519 O O    . GLU A 1 59  ? -13.934 -7.372  -0.319  1.00 0.00 ? 59  GLU A O    6  
ATOM 10520 C CB   . GLU A 1 59  ? -11.497 -8.548  -0.541  1.00 0.00 ? 59  GLU A CB   6  
ATOM 10521 C CG   . GLU A 1 59  ? -9.985  -8.527  -0.692  1.00 0.00 ? 59  GLU A CG   6  
ATOM 10522 C CD   . GLU A 1 59  ? -9.529  -8.987  -2.063  1.00 0.00 ? 59  GLU A CD   6  
ATOM 10523 O OE1  . GLU A 1 59  ? -9.639  -10.197 -2.349  1.00 0.00 ? 59  GLU A OE1  6  
ATOM 10524 O OE2  . GLU A 1 59  ? -9.063  -8.136  -2.850  1.00 0.00 ? 59  GLU A OE2  6  
ATOM 10525 H H    . GLU A 1 59  ? -11.233 -9.223  2.504   1.00 0.00 ? 59  GLU A H    6  
ATOM 10526 H HA   . GLU A 1 59  ? -11.343 -7.344  1.221   1.00 0.00 ? 59  GLU A HA   6  
ATOM 10527 H HB2  . GLU A 1 59  ? -11.845 -9.550  -0.745  1.00 0.00 ? 59  GLU A HB2  6  
ATOM 10528 H HB3  . GLU A 1 59  ? -11.920 -7.874  -1.271  1.00 0.00 ? 59  GLU A HB3  6  
ATOM 10529 H HG2  . GLU A 1 59  ? -9.634  -7.518  -0.533  1.00 0.00 ? 59  GLU A HG2  6  
ATOM 10530 H HG3  . GLU A 1 59  ? -9.553  -9.179  0.052   1.00 0.00 ? 59  GLU A HG3  6  
ATOM 10531 N N    . GLU A 1 60  ? -14.039 -7.437  1.928   1.00 0.00 ? 60  GLU A N    6  
ATOM 10532 C CA   . GLU A 1 60  ? -15.410 -6.945  1.988   1.00 0.00 ? 60  GLU A CA   6  
ATOM 10533 C C    . GLU A 1 60  ? -15.518 -5.559  1.359   1.00 0.00 ? 60  GLU A C    6  
ATOM 10534 O O    . GLU A 1 60  ? -16.253 -5.360  0.391   1.00 0.00 ? 60  GLU A O    6  
ATOM 10535 C CB   . GLU A 1 60  ? -15.896 -6.899  3.438   1.00 0.00 ? 60  GLU A CB   6  
ATOM 10536 C CG   . GLU A 1 60  ? -16.361 -8.245  3.967   1.00 0.00 ? 60  GLU A CG   6  
ATOM 10537 C CD   . GLU A 1 60  ? -17.585 -8.767  3.240   1.00 0.00 ? 60  GLU A CD   6  
ATOM 10538 O OE1  . GLU A 1 60  ? -18.710 -8.372  3.614   1.00 0.00 ? 60  GLU A OE1  6  
ATOM 10539 O OE2  . GLU A 1 60  ? -17.420 -9.569  2.298   1.00 0.00 ? 60  GLU A OE2  6  
ATOM 10540 H H    . GLU A 1 60  ? -13.569 -7.645  2.762   1.00 0.00 ? 60  GLU A H    6  
ATOM 10541 H HA   . GLU A 1 60  ? -16.032 -7.629  1.431   1.00 0.00 ? 60  GLU A HA   6  
ATOM 10542 H HB2  . GLU A 1 60  ? -15.090 -6.547  4.064   1.00 0.00 ? 60  GLU A HB2  6  
ATOM 10543 H HB3  . GLU A 1 60  ? -16.721 -6.205  3.505   1.00 0.00 ? 60  GLU A HB3  6  
ATOM 10544 H HG2  . GLU A 1 60  ? -15.560 -8.959  3.850   1.00 0.00 ? 60  GLU A HG2  6  
ATOM 10545 H HG3  . GLU A 1 60  ? -16.599 -8.142  5.016   1.00 0.00 ? 60  GLU A HG3  6  
ATOM 10546 N N    . SER A 1 61  ? -14.782 -4.603  1.916   1.00 0.00 ? 61  SER A N    6  
ATOM 10547 C CA   . SER A 1 61  ? -14.798 -3.234  1.414   1.00 0.00 ? 61  SER A CA   6  
ATOM 10548 C C    . SER A 1 61  ? -13.444 -2.563  1.622   1.00 0.00 ? 61  SER A C    6  
ATOM 10549 O O    . SER A 1 61  ? -12.788 -2.768  2.644   1.00 0.00 ? 61  SER A O    6  
ATOM 10550 C CB   . SER A 1 61  ? -15.893 -2.425  2.111   1.00 0.00 ? 61  SER A CB   6  
ATOM 10551 O OG   . SER A 1 61  ? -16.235 -1.275  1.359   1.00 0.00 ? 61  SER A OG   6  
ATOM 10552 H H    . SER A 1 61  ? -14.217 -4.824  2.686   1.00 0.00 ? 61  SER A H    6  
ATOM 10553 H HA   . SER A 1 61  ? -15.009 -3.272  0.356   1.00 0.00 ? 61  SER A HA   6  
ATOM 10554 H HB2  . SER A 1 61  ? -16.773 -3.040  2.226   1.00 0.00 ? 61  SER A HB2  6  
ATOM 10555 H HB3  . SER A 1 61  ? -15.542 -2.113  3.084   1.00 0.00 ? 61  SER A HB3  6  
ATOM 10556 H HG   . SER A 1 61  ? -16.611 -1.542  0.517   1.00 0.00 ? 61  SER A HG   6  
ATOM 10557 N N    . ILE A 1 62  ? -13.031 -1.762  0.645   1.00 0.00 ? 62  ILE A N    6  
ATOM 10558 C CA   . ILE A 1 62  ? -11.756 -1.060  0.721   1.00 0.00 ? 62  ILE A CA   6  
ATOM 10559 C C    . ILE A 1 62  ? -11.769 -0.017  1.833   1.00 0.00 ? 62  ILE A C    6  
ATOM 10560 O O    . ILE A 1 62  ? -12.652 0.840   1.885   1.00 0.00 ? 62  ILE A O    6  
ATOM 10561 C CB   . ILE A 1 62  ? -11.414 -0.370  -0.612  1.00 0.00 ? 62  ILE A CB   6  
ATOM 10562 C CG1  . ILE A 1 62  ? -11.215 -1.412  -1.715  1.00 0.00 ? 62  ILE A CG1  6  
ATOM 10563 C CG2  . ILE A 1 62  ? -10.168 0.491   -0.458  1.00 0.00 ? 62  ILE A CG2  6  
ATOM 10564 C CD1  . ILE A 1 62  ? -11.044 -0.809  -3.092  1.00 0.00 ? 62  ILE A CD1  6  
ATOM 10565 H H    . ILE A 1 62  ? -13.598 -1.640  -0.144  1.00 0.00 ? 62  ILE A H    6  
ATOM 10566 H HA   . ILE A 1 62  ? -10.987 -1.789  0.934   1.00 0.00 ? 62  ILE A HA   6  
ATOM 10567 H HB   . ILE A 1 62  ? -12.237 0.275   -0.880  1.00 0.00 ? 62  ILE A HB   6  
ATOM 10568 H HG12 . ILE A 1 62  ? -10.334 -1.994  -1.497  1.00 0.00 ? 62  ILE A HG12 6  
ATOM 10569 H HG13 . ILE A 1 62  ? -12.075 -2.065  -1.742  1.00 0.00 ? 62  ILE A HG13 6  
ATOM 10570 H HG21 . ILE A 1 62  ? -9.338  -0.129  -0.153  1.00 0.00 ? 62  ILE A HG21 6  
ATOM 10571 H HG22 . ILE A 1 62  ? -9.937  0.961   -1.402  1.00 0.00 ? 62  ILE A HG22 6  
ATOM 10572 H HG23 . ILE A 1 62  ? -10.345 1.249   0.289   1.00 0.00 ? 62  ILE A HG23 6  
ATOM 10573 H HD11 . ILE A 1 62  ? -11.091 -1.592  -3.835  1.00 0.00 ? 62  ILE A HD11 6  
ATOM 10574 H HD12 . ILE A 1 62  ? -11.834 -0.095  -3.273  1.00 0.00 ? 62  ILE A HD12 6  
ATOM 10575 H HD13 . ILE A 1 62  ? -10.088 -0.313  -3.152  1.00 0.00 ? 62  ILE A HD13 6  
ATOM 10576 N N    . LEU A 1 63  ? -10.782 -0.093  2.719   1.00 0.00 ? 63  LEU A N    6  
ATOM 10577 C CA   . LEU A 1 63  ? -10.677 0.847   3.830   1.00 0.00 ? 63  LEU A CA   6  
ATOM 10578 C C    . LEU A 1 63  ? -10.007 2.143   3.386   1.00 0.00 ? 63  LEU A C    6  
ATOM 10579 O O    . LEU A 1 63  ? -10.396 3.231   3.808   1.00 0.00 ? 63  LEU A O    6  
ATOM 10580 C CB   . LEU A 1 63  ? -9.888  0.220   4.981   1.00 0.00 ? 63  LEU A CB   6  
ATOM 10581 C CG   . LEU A 1 63  ? -10.407 -1.122  5.497   1.00 0.00 ? 63  LEU A CG   6  
ATOM 10582 C CD1  . LEU A 1 63  ? -9.449  -1.705  6.525   1.00 0.00 ? 63  LEU A CD1  6  
ATOM 10583 C CD2  . LEU A 1 63  ? -11.799 -0.964  6.092   1.00 0.00 ? 63  LEU A CD2  6  
ATOM 10584 H H    . LEU A 1 63  ? -10.108 -0.797  2.625   1.00 0.00 ? 63  LEU A H    6  
ATOM 10585 H HA   . LEU A 1 63  ? -11.678 1.071   4.170   1.00 0.00 ? 63  LEU A HA   6  
ATOM 10586 H HB2  . LEU A 1 63  ? -8.873  0.076   4.646   1.00 0.00 ? 63  LEU A HB2  6  
ATOM 10587 H HB3  . LEU A 1 63  ? -9.897  0.919   5.806   1.00 0.00 ? 63  LEU A HB3  6  
ATOM 10588 H HG   . LEU A 1 63  ? -10.472 -1.817  4.672   1.00 0.00 ? 63  LEU A HG   6  
ATOM 10589 H HD11 . LEU A 1 63  ? -9.354  -2.768  6.367   1.00 0.00 ? 63  LEU A HD11 6  
ATOM 10590 H HD12 . LEU A 1 63  ? -9.832  -1.522  7.518   1.00 0.00 ? 63  LEU A HD12 6  
ATOM 10591 H HD13 . LEU A 1 63  ? -8.481  -1.236  6.422   1.00 0.00 ? 63  LEU A HD13 6  
ATOM 10592 H HD21 . LEU A 1 63  ? -11.804 -0.130  6.778   1.00 0.00 ? 63  LEU A HD21 6  
ATOM 10593 H HD22 . LEU A 1 63  ? -12.069 -1.867  6.620   1.00 0.00 ? 63  LEU A HD22 6  
ATOM 10594 H HD23 . LEU A 1 63  ? -12.510 -0.784  5.299   1.00 0.00 ? 63  LEU A HD23 6  
ATOM 10595 N N    . GLY A 1 64  ? -8.999  2.018   2.528   1.00 0.00 ? 64  GLY A N    6  
ATOM 10596 C CA   . GLY A 1 64  ? -8.292  3.188   2.039   1.00 0.00 ? 64  GLY A CA   6  
ATOM 10597 C C    . GLY A 1 64  ? -7.577  2.926   0.728   1.00 0.00 ? 64  GLY A C    6  
ATOM 10598 O O    . GLY A 1 64  ? -6.989  1.862   0.535   1.00 0.00 ? 64  GLY A O    6  
ATOM 10599 H H    . GLY A 1 64  ? -8.733  1.125   2.225   1.00 0.00 ? 64  GLY A H    6  
ATOM 10600 H HA2  . GLY A 1 64  ? -9.001  3.990   1.896   1.00 0.00 ? 64  GLY A HA2  6  
ATOM 10601 H HA3  . GLY A 1 64  ? -7.565  3.490   2.778   1.00 0.00 ? 64  GLY A HA3  6  
ATOM 10602 N N    . SER A 1 65  ? -7.627  3.899   -0.176  1.00 0.00 ? 65  SER A N    6  
ATOM 10603 C CA   . SER A 1 65  ? -6.983  3.767   -1.478  1.00 0.00 ? 65  SER A CA   6  
ATOM 10604 C C    . SER A 1 65  ? -5.837  4.764   -1.621  1.00 0.00 ? 65  SER A C    6  
ATOM 10605 O O    . SER A 1 65  ? -5.933  5.906   -1.169  1.00 0.00 ? 65  SER A O    6  
ATOM 10606 C CB   . SER A 1 65  ? -8.002  3.981   -2.599  1.00 0.00 ? 65  SER A CB   6  
ATOM 10607 O OG   . SER A 1 65  ? -8.674  5.219   -2.448  1.00 0.00 ? 65  SER A OG   6  
ATOM 10608 H H    . SER A 1 65  ? -8.111  4.725   0.037   1.00 0.00 ? 65  SER A H    6  
ATOM 10609 H HA   . SER A 1 65  ? -6.585  2.766   -1.551  1.00 0.00 ? 65  SER A HA   6  
ATOM 10610 H HB2  . SER A 1 65  ? -7.493  3.974   -3.550  1.00 0.00 ? 65  SER A HB2  6  
ATOM 10611 H HB3  . SER A 1 65  ? -8.731  3.184   -2.575  1.00 0.00 ? 65  SER A HB3  6  
ATOM 10612 H HG   . SER A 1 65  ? -8.111  5.833   -1.971  1.00 0.00 ? 65  SER A HG   6  
ATOM 10613 N N    . ILE A 1 66  ? -4.754  4.324   -2.252  1.00 0.00 ? 66  ILE A N    6  
ATOM 10614 C CA   . ILE A 1 66  ? -3.589  5.177   -2.456  1.00 0.00 ? 66  ILE A CA   6  
ATOM 10615 C C    . ILE A 1 66  ? -2.995  4.973   -3.845  1.00 0.00 ? 66  ILE A C    6  
ATOM 10616 O O    . ILE A 1 66  ? -2.612  3.867   -4.227  1.00 0.00 ? 66  ILE A O    6  
ATOM 10617 C CB   . ILE A 1 66  ? -2.502  4.907   -1.399  1.00 0.00 ? 66  ILE A CB   6  
ATOM 10618 C CG1  . ILE A 1 66  ? -3.063  5.118   0.008   1.00 0.00 ? 66  ILE A CG1  6  
ATOM 10619 C CG2  . ILE A 1 66  ? -1.298  5.807   -1.636  1.00 0.00 ? 66  ILE A CG2  6  
ATOM 10620 C CD1  . ILE A 1 66  ? -2.305  4.367   1.080   1.00 0.00 ? 66  ILE A CD1  6  
ATOM 10621 H H    . ILE A 1 66  ? -4.737  3.404   -2.589  1.00 0.00 ? 66  ILE A H    6  
ATOM 10622 H HA   . ILE A 1 66  ? -3.909  6.205   -2.360  1.00 0.00 ? 66  ILE A HA   6  
ATOM 10623 H HB   . ILE A 1 66  ? -2.180  3.882   -1.501  1.00 0.00 ? 66  ILE A HB   6  
ATOM 10624 H HG12 . ILE A 1 66  ? -3.025  6.169   0.250   1.00 0.00 ? 66  ILE A HG12 6  
ATOM 10625 H HG13 . ILE A 1 66  ? -4.090  4.785   0.032   1.00 0.00 ? 66  ILE A HG13 6  
ATOM 10626 H HG21 . ILE A 1 66  ? -0.432  5.385   -1.148  1.00 0.00 ? 66  ILE A HG21 6  
ATOM 10627 H HG22 . ILE A 1 66  ? -1.111  5.885   -2.697  1.00 0.00 ? 66  ILE A HG22 6  
ATOM 10628 H HG23 . ILE A 1 66  ? -1.497  6.788   -1.232  1.00 0.00 ? 66  ILE A HG23 6  
ATOM 10629 H HD11 . ILE A 1 66  ? -2.217  3.328   0.797   1.00 0.00 ? 66  ILE A HD11 6  
ATOM 10630 H HD12 . ILE A 1 66  ? -1.319  4.794   1.190   1.00 0.00 ? 66  ILE A HD12 6  
ATOM 10631 H HD13 . ILE A 1 66  ? -2.837  4.441   2.017   1.00 0.00 ? 66  ILE A HD13 6  
ATOM 10632 N N    . PRO A 1 67  ? -2.913  6.065   -4.620  1.00 0.00 ? 67  PRO A N    6  
ATOM 10633 C CA   . PRO A 1 67  ? -2.363  6.033   -5.978  1.00 0.00 ? 67  PRO A CA   6  
ATOM 10634 C C    . PRO A 1 67  ? -0.858  5.792   -5.989  1.00 0.00 ? 67  PRO A C    6  
ATOM 10635 O O    . PRO A 1 67  ? -0.097  6.527   -5.358  1.00 0.00 ? 67  PRO A O    6  
ATOM 10636 C CB   . PRO A 1 67  ? -2.687  7.425   -6.525  1.00 0.00 ? 67  PRO A CB   6  
ATOM 10637 C CG   . PRO A 1 67  ? -2.793  8.291   -5.317  1.00 0.00 ? 67  PRO A CG   6  
ATOM 10638 C CD   . PRO A 1 67  ? -3.350  7.416   -4.228  1.00 0.00 ? 67  PRO A CD   6  
ATOM 10639 H HA   . PRO A 1 67  ? -2.851  5.284   -6.585  1.00 0.00 ? 67  PRO A HA   6  
ATOM 10640 H HB2  . PRO A 1 67  ? -1.889  7.753   -7.177  1.00 0.00 ? 67  PRO A HB2  6  
ATOM 10641 H HB3  . PRO A 1 67  ? -3.617  7.395   -7.072  1.00 0.00 ? 67  PRO A HB3  6  
ATOM 10642 H HG2  . PRO A 1 67  ? -1.817  8.658   -5.041  1.00 0.00 ? 67  PRO A HG2  6  
ATOM 10643 H HG3  . PRO A 1 67  ? -3.464  9.115   -5.515  1.00 0.00 ? 67  PRO A HG3  6  
ATOM 10644 H HD2  . PRO A 1 67  ? -2.934  7.694   -3.271  1.00 0.00 ? 67  PRO A HD2  6  
ATOM 10645 H HD3  . PRO A 1 67  ? -4.428  7.480   -4.207  1.00 0.00 ? 67  PRO A HD3  6  
ATOM 10646 N N    . LEU A 1 68  ? -0.433  4.760   -6.709  1.00 0.00 ? 68  LEU A N    6  
ATOM 10647 C CA   . LEU A 1 68  ? 0.983   4.423   -6.803  1.00 0.00 ? 68  LEU A CA   6  
ATOM 10648 C C    . LEU A 1 68  ? 1.611   5.049   -8.044  1.00 0.00 ? 68  LEU A C    6  
ATOM 10649 O O    . LEU A 1 68  ? 2.817   5.298   -8.085  1.00 0.00 ? 68  LEU A O    6  
ATOM 10650 C CB   . LEU A 1 68  ? 1.165   2.905   -6.836  1.00 0.00 ? 68  LEU A CB   6  
ATOM 10651 C CG   . LEU A 1 68  ? 1.093   2.190   -5.486  1.00 0.00 ? 68  LEU A CG   6  
ATOM 10652 C CD1  . LEU A 1 68  ? 0.933   0.691   -5.683  1.00 0.00 ? 68  LEU A CD1  6  
ATOM 10653 C CD2  . LEU A 1 68  ? 2.333   2.492   -4.656  1.00 0.00 ? 68  LEU A CD2  6  
ATOM 10654 H H    . LEU A 1 68  ? -1.087  4.211   -7.190  1.00 0.00 ? 68  LEU A H    6  
ATOM 10655 H HA   . LEU A 1 68  ? 1.476   4.818   -5.927  1.00 0.00 ? 68  LEU A HA   6  
ATOM 10656 H HB2  . LEU A 1 68  ? 0.394   2.493   -7.469  1.00 0.00 ? 68  LEU A HB2  6  
ATOM 10657 H HB3  . LEU A 1 68  ? 2.133   2.698   -7.270  1.00 0.00 ? 68  LEU A HB3  6  
ATOM 10658 H HG   . LEU A 1 68  ? 0.230   2.549   -4.941  1.00 0.00 ? 68  LEU A HG   6  
ATOM 10659 H HD11 . LEU A 1 68  ? 1.096   0.185   -4.743  1.00 0.00 ? 68  LEU A HD11 6  
ATOM 10660 H HD12 . LEU A 1 68  ? 1.654   0.344   -6.409  1.00 0.00 ? 68  LEU A HD12 6  
ATOM 10661 H HD13 . LEU A 1 68  ? -0.065  0.480   -6.038  1.00 0.00 ? 68  LEU A HD13 6  
ATOM 10662 H HD21 . LEU A 1 68  ? 2.460   3.561   -4.573  1.00 0.00 ? 68  LEU A HD21 6  
ATOM 10663 H HD22 . LEU A 1 68  ? 3.200   2.062   -5.137  1.00 0.00 ? 68  LEU A HD22 6  
ATOM 10664 H HD23 . LEU A 1 68  ? 2.219   2.064   -3.671  1.00 0.00 ? 68  LEU A HD23 6  
ATOM 10665 N N    . LEU A 1 69  ? 0.786   5.304   -9.053  1.00 0.00 ? 69  LEU A N    6  
ATOM 10666 C CA   . LEU A 1 69  ? 1.260   5.904   -10.296 1.00 0.00 ? 69  LEU A CA   6  
ATOM 10667 C C    . LEU A 1 69  ? 1.907   7.260   -10.034 1.00 0.00 ? 69  LEU A C    6  
ATOM 10668 O O    . LEU A 1 69  ? 2.530   7.843   -10.921 1.00 0.00 ? 69  LEU A O    6  
ATOM 10669 C CB   . LEU A 1 69  ? 0.102   6.060   -11.284 1.00 0.00 ? 69  LEU A CB   6  
ATOM 10670 C CG   . LEU A 1 69  ? -0.659  7.385   -11.220 1.00 0.00 ? 69  LEU A CG   6  
ATOM 10671 C CD1  . LEU A 1 69  ? -1.882  7.341   -12.124 1.00 0.00 ? 69  LEU A CD1  6  
ATOM 10672 C CD2  . LEU A 1 69  ? -1.064  7.699   -9.788  1.00 0.00 ? 69  LEU A CD2  6  
ATOM 10673 H H    . LEU A 1 69  ? -0.164  5.084   -8.962  1.00 0.00 ? 69  LEU A H    6  
ATOM 10674 H HA   . LEU A 1 69  ? 1.999   5.242   -10.722 1.00 0.00 ? 69  LEU A HA   6  
ATOM 10675 H HB2  . LEU A 1 69  ? 0.502   5.956   -12.281 1.00 0.00 ? 69  LEU A HB2  6  
ATOM 10676 H HB3  . LEU A 1 69  ? -0.602  5.263   -11.095 1.00 0.00 ? 69  LEU A HB3  6  
ATOM 10677 H HG   . LEU A 1 69  ? -0.015  8.180   -11.569 1.00 0.00 ? 69  LEU A HG   6  
ATOM 10678 H HD11 . LEU A 1 69  ? -1.842  6.456   -12.741 1.00 0.00 ? 69  LEU A HD11 6  
ATOM 10679 H HD12 . LEU A 1 69  ? -1.896  8.219   -12.753 1.00 0.00 ? 69  LEU A HD12 6  
ATOM 10680 H HD13 . LEU A 1 69  ? -2.776  7.318   -11.519 1.00 0.00 ? 69  LEU A HD13 6  
ATOM 10681 H HD21 . LEU A 1 69  ? -0.395  7.196   -9.106  1.00 0.00 ? 69  LEU A HD21 6  
ATOM 10682 H HD22 . LEU A 1 69  ? -2.075  7.360   -9.617  1.00 0.00 ? 69  LEU A HD22 6  
ATOM 10683 H HD23 . LEU A 1 69  ? -1.010  8.766   -9.625  1.00 0.00 ? 69  LEU A HD23 6  
ATOM 10684 N N    . SER A 1 70  ? 1.756   7.755   -8.810  1.00 0.00 ? 70  SER A N    6  
ATOM 10685 C CA   . SER A 1 70  ? 2.323   9.044   -8.431  1.00 0.00 ? 70  SER A CA   6  
ATOM 10686 C C    . SER A 1 70  ? 3.349   8.878   -7.314  1.00 0.00 ? 70  SER A C    6  
ATOM 10687 O O    . SER A 1 70  ? 3.594   9.802   -6.538  1.00 0.00 ? 70  SER A O    6  
ATOM 10688 C CB   . SER A 1 70  ? 1.217   10.002  -7.985  1.00 0.00 ? 70  SER A CB   6  
ATOM 10689 O OG   . SER A 1 70  ? 1.598   11.351  -8.188  1.00 0.00 ? 70  SER A OG   6  
ATOM 10690 H H    . SER A 1 70  ? 1.247   7.243   -8.146  1.00 0.00 ? 70  SER A H    6  
ATOM 10691 H HA   . SER A 1 70  ? 2.817   9.456   -9.298  1.00 0.00 ? 70  SER A HA   6  
ATOM 10692 H HB2  . SER A 1 70  ? 0.322   9.803   -8.554  1.00 0.00 ? 70  SER A HB2  6  
ATOM 10693 H HB3  . SER A 1 70  ? 1.016   9.851   -6.934  1.00 0.00 ? 70  SER A HB3  6  
ATOM 10694 H HG   . SER A 1 70  ? 0.966   11.931  -7.757  1.00 0.00 ? 70  SER A HG   6  
ATOM 10695 N N    . PHE A 1 71  ? 3.946   7.693   -7.238  1.00 0.00 ? 71  PHE A N    6  
ATOM 10696 C CA   . PHE A 1 71  ? 4.945   7.404   -6.215  1.00 0.00 ? 71  PHE A CA   6  
ATOM 10697 C C    . PHE A 1 71  ? 6.121   6.633   -6.807  1.00 0.00 ? 71  PHE A C    6  
ATOM 10698 O O    . PHE A 1 71  ? 6.000   6.006   -7.860  1.00 0.00 ? 71  PHE A O    6  
ATOM 10699 C CB   . PHE A 1 71  ? 4.318   6.603   -5.072  1.00 0.00 ? 71  PHE A CB   6  
ATOM 10700 C CG   . PHE A 1 71  ? 3.521   7.445   -4.117  1.00 0.00 ? 71  PHE A CG   6  
ATOM 10701 C CD1  . PHE A 1 71  ? 2.290   7.962   -4.490  1.00 0.00 ? 71  PHE A CD1  6  
ATOM 10702 C CD2  . PHE A 1 71  ? 4.001   7.719   -2.847  1.00 0.00 ? 71  PHE A CD2  6  
ATOM 10703 C CE1  . PHE A 1 71  ? 1.555   8.737   -3.613  1.00 0.00 ? 71  PHE A CE1  6  
ATOM 10704 C CE2  . PHE A 1 71  ? 3.271   8.493   -1.966  1.00 0.00 ? 71  PHE A CE2  6  
ATOM 10705 C CZ   . PHE A 1 71  ? 2.045   9.002   -2.349  1.00 0.00 ? 71  PHE A CZ   6  
ATOM 10706 H H    . PHE A 1 71  ? 3.708   6.996   -7.885  1.00 0.00 ? 71  PHE A H    6  
ATOM 10707 H HA   . PHE A 1 71  ? 5.304   8.345   -5.829  1.00 0.00 ? 71  PHE A HA   6  
ATOM 10708 H HB2  . PHE A 1 71  ? 3.657   5.856   -5.485  1.00 0.00 ? 71  PHE A HB2  6  
ATOM 10709 H HB3  . PHE A 1 71  ? 5.101   6.115   -4.512  1.00 0.00 ? 71  PHE A HB3  6  
ATOM 10710 H HD1  . PHE A 1 71  ? 1.905   7.754   -5.477  1.00 0.00 ? 71  PHE A HD1  6  
ATOM 10711 H HD2  . PHE A 1 71  ? 4.960   7.320   -2.546  1.00 0.00 ? 71  PHE A HD2  6  
ATOM 10712 H HE1  . PHE A 1 71  ? 0.597   9.134   -3.915  1.00 0.00 ? 71  PHE A HE1  6  
ATOM 10713 H HE2  . PHE A 1 71  ? 3.657   8.698   -0.978  1.00 0.00 ? 71  PHE A HE2  6  
ATOM 10714 H HZ   . PHE A 1 71  ? 1.473   9.608   -1.663  1.00 0.00 ? 71  PHE A HZ   6  
ATOM 10715 N N    . ARG A 1 72  ? 7.258   6.684   -6.122  1.00 0.00 ? 72  ARG A N    6  
ATOM 10716 C CA   . ARG A 1 72  ? 8.457   5.992   -6.579  1.00 0.00 ? 72  ARG A CA   6  
ATOM 10717 C C    . ARG A 1 72  ? 8.867   4.902   -5.592  1.00 0.00 ? 72  ARG A C    6  
ATOM 10718 O O    . ARG A 1 72  ? 9.816   5.068   -4.827  1.00 0.00 ? 72  ARG A O    6  
ATOM 10719 C CB   . ARG A 1 72  ? 9.606   6.985   -6.764  1.00 0.00 ? 72  ARG A CB   6  
ATOM 10720 C CG   . ARG A 1 72  ? 9.816   7.902   -5.570  1.00 0.00 ? 72  ARG A CG   6  
ATOM 10721 C CD   . ARG A 1 72  ? 11.050  8.773   -5.747  1.00 0.00 ? 72  ARG A CD   6  
ATOM 10722 N NE   . ARG A 1 72  ? 11.627  9.172   -4.466  1.00 0.00 ? 72  ARG A NE   6  
ATOM 10723 C CZ   . ARG A 1 72  ? 12.893  9.545   -4.314  1.00 0.00 ? 72  ARG A CZ   6  
ATOM 10724 N NH1  . ARG A 1 72  ? 13.710  9.571   -5.358  1.00 0.00 ? 72  ARG A NH1  6  
ATOM 10725 N NH2  . ARG A 1 72  ? 13.344  9.894   -3.116  1.00 0.00 ? 72  ARG A NH2  6  
ATOM 10726 H H    . ARG A 1 72  ? 7.293   7.199   -5.289  1.00 0.00 ? 72  ARG A H    6  
ATOM 10727 H HA   . ARG A 1 72  ? 8.233   5.533   -7.531  1.00 0.00 ? 72  ARG A HA   6  
ATOM 10728 H HB2  . ARG A 1 72  ? 10.520  6.434   -6.932  1.00 0.00 ? 72  ARG A HB2  6  
ATOM 10729 H HB3  . ARG A 1 72  ? 9.400   7.597   -7.629  1.00 0.00 ? 72  ARG A HB3  6  
ATOM 10730 H HG2  . ARG A 1 72  ? 8.952   8.540   -5.462  1.00 0.00 ? 72  ARG A HG2  6  
ATOM 10731 H HG3  . ARG A 1 72  ? 9.936   7.299   -4.682  1.00 0.00 ? 72  ARG A HG3  6  
ATOM 10732 H HD2  . ARG A 1 72  ? 11.789  8.218   -6.306  1.00 0.00 ? 72  ARG A HD2  6  
ATOM 10733 H HD3  . ARG A 1 72  ? 10.773  9.659   -6.298  1.00 0.00 ? 72  ARG A HD3  6  
ATOM 10734 H HE   . ARG A 1 72  ? 11.041  9.160   -3.681  1.00 0.00 ? 72  ARG A HE   6  
ATOM 10735 H HH11 . ARG A 1 72  ? 13.372  9.309   -6.262  1.00 0.00 ? 72  ARG A HH11 6  
ATOM 10736 H HH12 . ARG A 1 72  ? 14.662  9.853   -5.241  1.00 0.00 ? 72  ARG A HH12 6  
ATOM 10737 H HH21 . ARG A 1 72  ? 12.731  9.876   -2.327  1.00 0.00 ? 72  ARG A HH21 6  
ATOM 10738 H HH22 . ARG A 1 72  ? 14.296  10.175  -3.003  1.00 0.00 ? 72  ARG A HH22 6  
ATOM 10739 N N    . VAL A 1 73  ? 8.143   3.788   -5.615  1.00 0.00 ? 73  VAL A N    6  
ATOM 10740 C CA   . VAL A 1 73  ? 8.430   2.671   -4.723  1.00 0.00 ? 73  VAL A CA   6  
ATOM 10741 C C    . VAL A 1 73  ? 9.911   2.311   -4.753  1.00 0.00 ? 73  VAL A C    6  
ATOM 10742 O O    . VAL A 1 73  ? 10.568  2.427   -5.787  1.00 0.00 ? 73  VAL A O    6  
ATOM 10743 C CB   . VAL A 1 73  ? 7.603   1.427   -5.097  1.00 0.00 ? 73  VAL A CB   6  
ATOM 10744 C CG1  . VAL A 1 73  ? 7.960   0.256   -4.193  1.00 0.00 ? 73  VAL A CG1  6  
ATOM 10745 C CG2  . VAL A 1 73  ? 6.115   1.734   -5.023  1.00 0.00 ? 73  VAL A CG2  6  
ATOM 10746 H H    . VAL A 1 73  ? 7.398   3.715   -6.247  1.00 0.00 ? 73  VAL A H    6  
ATOM 10747 H HA   . VAL A 1 73  ? 8.162   2.967   -3.719  1.00 0.00 ? 73  VAL A HA   6  
ATOM 10748 H HB   . VAL A 1 73  ? 7.843   1.153   -6.114  1.00 0.00 ? 73  VAL A HB   6  
ATOM 10749 H HG11 . VAL A 1 73  ? 8.877   -0.199  -4.539  1.00 0.00 ? 73  VAL A HG11 6  
ATOM 10750 H HG12 . VAL A 1 73  ? 8.092   0.610   -3.181  1.00 0.00 ? 73  VAL A HG12 6  
ATOM 10751 H HG13 . VAL A 1 73  ? 7.164   -0.474  -4.219  1.00 0.00 ? 73  VAL A HG13 6  
ATOM 10752 H HG21 . VAL A 1 73  ? 5.914   2.667   -5.527  1.00 0.00 ? 73  VAL A HG21 6  
ATOM 10753 H HG22 . VAL A 1 73  ? 5.560   0.940   -5.499  1.00 0.00 ? 73  VAL A HG22 6  
ATOM 10754 H HG23 . VAL A 1 73  ? 5.815   1.812   -3.988  1.00 0.00 ? 73  VAL A HG23 6  
ATOM 10755 N N    . ALA A 1 74  ? 10.431  1.874   -3.610  1.00 0.00 ? 74  ALA A N    6  
ATOM 10756 C CA   . ALA A 1 74  ? 11.835  1.495   -3.506  1.00 0.00 ? 74  ALA A CA   6  
ATOM 10757 C C    . ALA A 1 74  ? 12.142  0.899   -2.136  1.00 0.00 ? 74  ALA A C    6  
ATOM 10758 O O    . ALA A 1 74  ? 11.436  1.161   -1.163  1.00 0.00 ? 74  ALA A O    6  
ATOM 10759 C CB   . ALA A 1 74  ? 12.728  2.697   -3.773  1.00 0.00 ? 74  ALA A CB   6  
ATOM 10760 H H    . ALA A 1 74  ? 9.857   1.804   -2.820  1.00 0.00 ? 74  ALA A H    6  
ATOM 10761 H HA   . ALA A 1 74  ? 12.037  0.751   -4.264  1.00 0.00 ? 74  ALA A HA   6  
ATOM 10762 H HB1  . ALA A 1 74  ? 12.990  3.166   -2.837  1.00 0.00 ? 74  ALA A HB1  6  
ATOM 10763 H HB2  . ALA A 1 74  ? 13.627  2.372   -4.277  1.00 0.00 ? 74  ALA A HB2  6  
ATOM 10764 H HB3  . ALA A 1 74  ? 12.202  3.405   -4.396  1.00 0.00 ? 74  ALA A HB3  6  
ATOM 10765 N N    . ALA A 1 75  ? 13.200  0.097   -2.068  1.00 0.00 ? 75  ALA A N    6  
ATOM 10766 C CA   . ALA A 1 75  ? 13.601  -0.534  -0.817  1.00 0.00 ? 75  ALA A CA   6  
ATOM 10767 C C    . ALA A 1 75  ? 14.095  0.502   0.187   1.00 0.00 ? 75  ALA A C    6  
ATOM 10768 O O    . ALA A 1 75  ? 14.404  1.637   -0.178  1.00 0.00 ? 75  ALA A O    6  
ATOM 10769 C CB   . ALA A 1 75  ? 14.677  -1.578  -1.074  1.00 0.00 ? 75  ALA A CB   6  
ATOM 10770 H H    . ALA A 1 75  ? 13.723  -0.073  -2.879  1.00 0.00 ? 75  ALA A H    6  
ATOM 10771 H HA   . ALA A 1 75  ? 12.737  -1.036  -0.405  1.00 0.00 ? 75  ALA A HA   6  
ATOM 10772 H HB1  . ALA A 1 75  ? 15.273  -1.279  -1.923  1.00 0.00 ? 75  ALA A HB1  6  
ATOM 10773 H HB2  . ALA A 1 75  ? 15.310  -1.664  -0.202  1.00 0.00 ? 75  ALA A HB2  6  
ATOM 10774 H HB3  . ALA A 1 75  ? 14.212  -2.531  -1.277  1.00 0.00 ? 75  ALA A HB3  6  
ATOM 10775 N N    . VAL A 1 76  ? 14.166  0.105   1.454   1.00 0.00 ? 76  VAL A N    6  
ATOM 10776 C CA   . VAL A 1 76  ? 14.623  1.000   2.510   1.00 0.00 ? 76  VAL A CA   6  
ATOM 10777 C C    . VAL A 1 76  ? 16.142  1.126   2.505   1.00 0.00 ? 76  VAL A C    6  
ATOM 10778 O O    . VAL A 1 76  ? 16.836  0.358   1.839   1.00 0.00 ? 76  VAL A O    6  
ATOM 10779 C CB   . VAL A 1 76  ? 14.165  0.510   3.897   1.00 0.00 ? 76  VAL A CB   6  
ATOM 10780 C CG1  . VAL A 1 76  ? 12.726  0.929   4.163   1.00 0.00 ? 76  VAL A CG1  6  
ATOM 10781 C CG2  . VAL A 1 76  ? 14.318  -0.999  4.007   1.00 0.00 ? 76  VAL A CG2  6  
ATOM 10782 H H    . VAL A 1 76  ? 13.905  -0.811  1.683   1.00 0.00 ? 76  VAL A H    6  
ATOM 10783 H HA   . VAL A 1 76  ? 14.190  1.974   2.334   1.00 0.00 ? 76  VAL A HA   6  
ATOM 10784 H HB   . VAL A 1 76  ? 14.794  0.971   4.645   1.00 0.00 ? 76  VAL A HB   6  
ATOM 10785 H HG11 . VAL A 1 76  ? 12.714  1.921   4.588   1.00 0.00 ? 76  VAL A HG11 6  
ATOM 10786 H HG12 . VAL A 1 76  ? 12.173  0.926   3.235   1.00 0.00 ? 76  VAL A HG12 6  
ATOM 10787 H HG13 . VAL A 1 76  ? 12.272  0.235   4.855   1.00 0.00 ? 76  VAL A HG13 6  
ATOM 10788 H HG21 . VAL A 1 76  ? 15.248  -1.301  3.547   1.00 0.00 ? 76  VAL A HG21 6  
ATOM 10789 H HG22 . VAL A 1 76  ? 14.321  -1.285  5.048   1.00 0.00 ? 76  VAL A HG22 6  
ATOM 10790 H HG23 . VAL A 1 76  ? 13.494  -1.483  3.502   1.00 0.00 ? 76  VAL A HG23 6  
ATOM 10791 N N    . GLN A 1 77  ? 16.653  2.100   3.252   1.00 0.00 ? 77  GLN A N    6  
ATOM 10792 C CA   . GLN A 1 77  ? 18.091  2.326   3.332   1.00 0.00 ? 77  GLN A CA   6  
ATOM 10793 C C    . GLN A 1 77  ? 18.610  2.036   4.737   1.00 0.00 ? 77  GLN A C    6  
ATOM 10794 O O    . GLN A 1 77  ? 17.859  2.030   5.713   1.00 0.00 ? 77  GLN A O    6  
ATOM 10795 C CB   . GLN A 1 77  ? 18.424  3.767   2.940   1.00 0.00 ? 77  GLN A CB   6  
ATOM 10796 C CG   . GLN A 1 77  ? 18.573  3.970   1.441   1.00 0.00 ? 77  GLN A CG   6  
ATOM 10797 C CD   . GLN A 1 77  ? 19.055  5.362   1.085   1.00 0.00 ? 77  GLN A CD   6  
ATOM 10798 O OE1  . GLN A 1 77  ? 18.257  6.254   0.798   1.00 0.00 ? 77  GLN A OE1  6  
ATOM 10799 N NE2  . GLN A 1 77  ? 20.369  5.556   1.103   1.00 0.00 ? 77  GLN A NE2  6  
ATOM 10800 H H    . GLN A 1 77  ? 16.048  2.679   3.760   1.00 0.00 ? 77  GLN A H    6  
ATOM 10801 H HA   . GLN A 1 77  ? 18.571  1.653   2.639   1.00 0.00 ? 77  GLN A HA   6  
ATOM 10802 H HB2  . GLN A 1 77  ? 17.636  4.415   3.293   1.00 0.00 ? 77  GLN A HB2  6  
ATOM 10803 H HB3  . GLN A 1 77  ? 19.353  4.050   3.413   1.00 0.00 ? 77  GLN A HB3  6  
ATOM 10804 H HG2  . GLN A 1 77  ? 19.285  3.251   1.062   1.00 0.00 ? 77  GLN A HG2  6  
ATOM 10805 H HG3  . GLN A 1 77  ? 17.614  3.806   0.972   1.00 0.00 ? 77  GLN A HG3  6  
ATOM 10806 H HE21 . GLN A 1 77  ? 20.945  4.799   1.341   1.00 0.00 ? 77  GLN A HE21 6  
ATOM 10807 H HE22 . GLN A 1 77  ? 20.709  6.446   0.877   1.00 0.00 ? 77  GLN A HE22 6  
ATOM 10808 N N    . PRO A 1 78  ? 19.924  1.791   4.844   1.00 0.00 ? 78  PRO A N    6  
ATOM 10809 C CA   . PRO A 1 78  ? 20.572  1.496   6.125   1.00 0.00 ? 78  PRO A CA   6  
ATOM 10810 C C    . PRO A 1 78  ? 20.626  2.713   7.041   1.00 0.00 ? 78  PRO A C    6  
ATOM 10811 O O    . PRO A 1 78  ? 21.067  2.620   8.187   1.00 0.00 ? 78  PRO A O    6  
ATOM 10812 C CB   . PRO A 1 78  ? 21.985  1.070   5.717   1.00 0.00 ? 78  PRO A CB   6  
ATOM 10813 C CG   . PRO A 1 78  ? 22.217  1.735   4.404   1.00 0.00 ? 78  PRO A CG   6  
ATOM 10814 C CD   . PRO A 1 78  ? 20.878  1.782   3.722   1.00 0.00 ? 78  PRO A CD   6  
ATOM 10815 H HA   . PRO A 1 78  ? 20.083  0.681   6.639   1.00 0.00 ? 78  PRO A HA   6  
ATOM 10816 H HB2  . PRO A 1 78  ? 22.694  1.406   6.462   1.00 0.00 ? 78  PRO A HB2  6  
ATOM 10817 H HB3  . PRO A 1 78  ? 22.030  -0.005  5.629   1.00 0.00 ? 78  PRO A HB3  6  
ATOM 10818 H HG2  . PRO A 1 78  ? 22.594  2.734   4.560   1.00 0.00 ? 78  PRO A HG2  6  
ATOM 10819 H HG3  . PRO A 1 78  ? 22.915  1.155   3.818   1.00 0.00 ? 78  PRO A HG3  6  
ATOM 10820 H HD2  . PRO A 1 78  ? 20.787  2.682   3.132   1.00 0.00 ? 78  PRO A HD2  6  
ATOM 10821 H HD3  . PRO A 1 78  ? 20.738  0.907   3.104   1.00 0.00 ? 78  PRO A HD3  6  
ATOM 10822 N N    . SER A 1 79  ? 20.174  3.854   6.530   1.00 0.00 ? 79  SER A N    6  
ATOM 10823 C CA   . SER A 1 79  ? 20.174  5.091   7.302   1.00 0.00 ? 79  SER A CA   6  
ATOM 10824 C C    . SER A 1 79  ? 18.765  5.438   7.771   1.00 0.00 ? 79  SER A C    6  
ATOM 10825 O O    . SER A 1 79  ? 18.582  6.261   8.669   1.00 0.00 ? 79  SER A O    6  
ATOM 10826 C CB   . SER A 1 79  ? 20.743  6.239   6.465   1.00 0.00 ? 79  SER A CB   6  
ATOM 10827 O OG   . SER A 1 79  ? 19.943  6.481   5.321   1.00 0.00 ? 79  SER A OG   6  
ATOM 10828 H H    . SER A 1 79  ? 19.835  3.863   5.610   1.00 0.00 ? 79  SER A H    6  
ATOM 10829 H HA   . SER A 1 79  ? 20.803  4.941   8.167   1.00 0.00 ? 79  SER A HA   6  
ATOM 10830 H HB2  . SER A 1 79  ? 20.774  7.136   7.064   1.00 0.00 ? 79  SER A HB2  6  
ATOM 10831 H HB3  . SER A 1 79  ? 21.743  5.985   6.144   1.00 0.00 ? 79  SER A HB3  6  
ATOM 10832 H HG   . SER A 1 79  ? 20.478  6.388   4.530   1.00 0.00 ? 79  SER A HG   6  
ATOM 10833 N N    . ASP A 1 80  ? 17.771  4.805   7.157   1.00 0.00 ? 80  ASP A N    6  
ATOM 10834 C CA   . ASP A 1 80  ? 16.377  5.045   7.512   1.00 0.00 ? 80  ASP A CA   6  
ATOM 10835 C C    . ASP A 1 80  ? 16.055  4.454   8.881   1.00 0.00 ? 80  ASP A C    6  
ATOM 10836 O O    . ASP A 1 80  ? 16.810  3.639   9.410   1.00 0.00 ? 80  ASP A O    6  
ATOM 10837 C CB   . ASP A 1 80  ? 15.449  4.446   6.454   1.00 0.00 ? 80  ASP A CB   6  
ATOM 10838 C CG   . ASP A 1 80  ? 15.152  5.418   5.328   1.00 0.00 ? 80  ASP A CG   6  
ATOM 10839 O OD1  . ASP A 1 80  ? 16.113  5.950   4.736   1.00 0.00 ? 80  ASP A OD1  6  
ATOM 10840 O OD2  . ASP A 1 80  ? 13.958  5.646   5.041   1.00 0.00 ? 80  ASP A OD2  6  
ATOM 10841 H H    . ASP A 1 80  ? 17.980  4.160   6.449   1.00 0.00 ? 80  ASP A H    6  
ATOM 10842 H HA   . ASP A 1 80  ? 16.223  6.113   7.550   1.00 0.00 ? 80  ASP A HA   6  
ATOM 10843 H HB2  . ASP A 1 80  ? 15.914  3.567   6.032   1.00 0.00 ? 80  ASP A HB2  6  
ATOM 10844 H HB3  . ASP A 1 80  ? 14.516  4.166   6.920   1.00 0.00 ? 80  ASP A HB3  6  
ATOM 10845 N N    . ASN A 1 81  ? 14.929  4.872   9.451   1.00 0.00 ? 81  ASN A N    6  
ATOM 10846 C CA   . ASN A 1 81  ? 14.508  4.386   10.759  1.00 0.00 ? 81  ASN A CA   6  
ATOM 10847 C C    . ASN A 1 81  ? 13.767  3.058   10.634  1.00 0.00 ? 81  ASN A C    6  
ATOM 10848 O O    . ASN A 1 81  ? 12.698  2.875   11.218  1.00 0.00 ? 81  ASN A O    6  
ATOM 10849 C CB   . ASN A 1 81  ? 13.614  5.419   11.447  1.00 0.00 ? 81  ASN A CB   6  
ATOM 10850 C CG   . ASN A 1 81  ? 13.712  5.354   12.959  1.00 0.00 ? 81  ASN A CG   6  
ATOM 10851 O OD1  . ASN A 1 81  ? 12.747  5.010   13.641  1.00 0.00 ? 81  ASN A OD1  6  
ATOM 10852 N ND2  . ASN A 1 81  ? 14.884  5.685   13.490  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 10853 H H    . ASN A 1 81  ? 14.368  5.523   8.980   1.00 0.00 ? 81  ASN A H    6  
ATOM 10854 H HA   . ASN A 1 81  ? 15.394  4.234   11.357  1.00 0.00 ? 81  ASN A HA   6  
ATOM 10855 H HB2  . ASN A 1 81  ? 13.908  6.409   11.129  1.00 0.00 ? 81  ASN A HB2  6  
ATOM 10856 H HB3  . ASN A 1 81  ? 12.587  5.244   11.164  1.00 0.00 ? 81  ASN A HB3  6  
ATOM 10857 H HD21 . ASN A 1 81  ? 15.609  5.949   12.886  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 10858 H HD22 . ASN A 1 81  ? 14.975  5.651   14.465  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 10859 N N    . ILE A 1 82  ? 14.341  2.136   9.869   1.00 0.00 ? 82  ILE A N    6  
ATOM 10860 C CA   . ILE A 1 82  ? 13.736  0.825   9.668   1.00 0.00 ? 82  ILE A CA   6  
ATOM 10861 C C    . ILE A 1 82  ? 14.677  -0.289  10.113  1.00 0.00 ? 82  ILE A C    6  
ATOM 10862 O O    . ILE A 1 82  ? 15.712  -0.527  9.490   1.00 0.00 ? 82  ILE A O    6  
ATOM 10863 C CB   . ILE A 1 82  ? 13.354  0.602   8.193   1.00 0.00 ? 82  ILE A CB   6  
ATOM 10864 C CG1  . ILE A 1 82  ? 12.421  1.714   7.710   1.00 0.00 ? 82  ILE A CG1  6  
ATOM 10865 C CG2  . ILE A 1 82  ? 12.699  -0.760  8.016   1.00 0.00 ? 82  ILE A CG2  6  
ATOM 10866 C CD1  . ILE A 1 82  ? 11.123  1.792   8.484   1.00 0.00 ? 82  ILE A CD1  6  
ATOM 10867 H H    . ILE A 1 82  ? 15.192  2.342   9.430   1.00 0.00 ? 82  ILE A H    6  
ATOM 10868 H HA   . ILE A 1 82  ? 12.835  0.780   10.263  1.00 0.00 ? 82  ILE A HA   6  
ATOM 10869 H HB   . ILE A 1 82  ? 14.258  0.619   7.604   1.00 0.00 ? 82  ILE A HB   6  
ATOM 10870 H HG12 . ILE A 1 82  ? 12.922  2.664   7.809   1.00 0.00 ? 82  ILE A HG12 6  
ATOM 10871 H HG13 . ILE A 1 82  ? 12.179  1.545   6.671   1.00 0.00 ? 82  ILE A HG13 6  
ATOM 10872 H HG21 . ILE A 1 82  ? 11.916  -0.881  8.751   1.00 0.00 ? 82  ILE A HG21 6  
ATOM 10873 H HG22 . ILE A 1 82  ? 12.276  -0.830  7.025   1.00 0.00 ? 82  ILE A HG22 6  
ATOM 10874 H HG23 . ILE A 1 82  ? 13.439  -1.535  8.147   1.00 0.00 ? 82  ILE A HG23 6  
ATOM 10875 H HD11 . ILE A 1 82  ? 10.773  0.793   8.701   1.00 0.00 ? 82  ILE A HD11 6  
ATOM 10876 H HD12 . ILE A 1 82  ? 11.286  2.324   9.409   1.00 0.00 ? 82  ILE A HD12 6  
ATOM 10877 H HD13 . ILE A 1 82  ? 10.383  2.311   7.894   1.00 0.00 ? 82  ILE A HD13 6  
ATOM 10878 N N    . SER A 1 83  ? 14.309  -0.971  11.193  1.00 0.00 ? 83  SER A N    6  
ATOM 10879 C CA   . SER A 1 83  ? 15.122  -2.059  11.723  1.00 0.00 ? 83  SER A CA   6  
ATOM 10880 C C    . SER A 1 83  ? 15.077  -3.271  10.797  1.00 0.00 ? 83  SER A C    6  
ATOM 10881 O O    . SER A 1 83  ? 16.092  -3.928  10.567  1.00 0.00 ? 83  SER A O    6  
ATOM 10882 C CB   . SER A 1 83  ? 14.637  -2.453  13.120  1.00 0.00 ? 83  SER A CB   6  
ATOM 10883 O OG   . SER A 1 83  ? 14.609  -1.330  13.984  1.00 0.00 ? 83  SER A OG   6  
ATOM 10884 H H    . SER A 1 83  ? 13.473  -0.734  11.646  1.00 0.00 ? 83  SER A H    6  
ATOM 10885 H HA   . SER A 1 83  ? 16.141  -1.710  11.790  1.00 0.00 ? 83  SER A HA   6  
ATOM 10886 H HB2  . SER A 1 83  ? 13.642  -2.863  13.050  1.00 0.00 ? 83  SER A HB2  6  
ATOM 10887 H HB3  . SER A 1 83  ? 15.305  -3.194  13.534  1.00 0.00 ? 83  SER A HB3  6  
ATOM 10888 H HG   . SER A 1 83  ? 15.249  -0.680  13.686  1.00 0.00 ? 83  SER A HG   6  
ATOM 10889 N N    . ARG A 1 84  ? 13.892  -3.560  10.269  1.00 0.00 ? 84  ARG A N    6  
ATOM 10890 C CA   . ARG A 1 84  ? 13.713  -4.693  9.369   1.00 0.00 ? 84  ARG A CA   6  
ATOM 10891 C C    . ARG A 1 84  ? 14.759  -4.676  8.258   1.00 0.00 ? 84  ARG A C    6  
ATOM 10892 O O    . ARG A 1 84  ? 15.594  -3.774  8.190   1.00 0.00 ? 84  ARG A O    6  
ATOM 10893 C CB   . ARG A 1 84  ? 12.309  -4.673  8.762   1.00 0.00 ? 84  ARG A CB   6  
ATOM 10894 C CG   . ARG A 1 84  ? 11.208  -4.974  9.766   1.00 0.00 ? 84  ARG A CG   6  
ATOM 10895 C CD   . ARG A 1 84  ? 9.901   -4.300  9.378   1.00 0.00 ? 84  ARG A CD   6  
ATOM 10896 N NE   . ARG A 1 84  ? 8.738   -5.051  9.844   1.00 0.00 ? 84  ARG A NE   6  
ATOM 10897 C CZ   . ARG A 1 84  ? 8.309   -5.036  11.101  1.00 0.00 ? 84  ARG A CZ   6  
ATOM 10898 N NH1  . ARG A 1 84  ? 8.943   -4.312  12.013  1.00 0.00 ? 84  ARG A NH1  6  
ATOM 10899 N NH2  . ARG A 1 84  ? 7.243   -5.746  11.447  1.00 0.00 ? 84  ARG A NH2  6  
ATOM 10900 H H    . ARG A 1 84  ? 13.120  -2.999  10.490  1.00 0.00 ? 84  ARG A H    6  
ATOM 10901 H HA   . ARG A 1 84  ? 13.834  -5.598  9.946   1.00 0.00 ? 84  ARG A HA   6  
ATOM 10902 H HB2  . ARG A 1 84  ? 12.125  -3.696  8.342   1.00 0.00 ? 84  ARG A HB2  6  
ATOM 10903 H HB3  . ARG A 1 84  ? 12.259  -5.410  7.975   1.00 0.00 ? 84  ARG A HB3  6  
ATOM 10904 H HG2  . ARG A 1 84  ? 11.051  -6.042  9.805   1.00 0.00 ? 84  ARG A HG2  6  
ATOM 10905 H HG3  . ARG A 1 84  ? 11.512  -4.617  10.738  1.00 0.00 ? 84  ARG A HG3  6  
ATOM 10906 H HD2  . ARG A 1 84  ? 9.877   -3.312  9.814   1.00 0.00 ? 84  ARG A HD2  6  
ATOM 10907 H HD3  . ARG A 1 84  ? 9.859   -4.220  8.302   1.00 0.00 ? 84  ARG A HD3  6  
ATOM 10908 H HE   . ARG A 1 84  ? 8.255   -5.593  9.186   1.00 0.00 ? 84  ARG A HE   6  
ATOM 10909 H HH11 . ARG A 1 84  ? 9.746   -3.776  11.754  1.00 0.00 ? 84  ARG A HH11 6  
ATOM 10910 H HH12 . ARG A 1 84  ? 8.617   -4.302  12.958  1.00 0.00 ? 84  ARG A HH12 6  
ATOM 10911 H HH21 . ARG A 1 84  ? 6.762   -6.293  10.763  1.00 0.00 ? 84  ARG A HH21 6  
ATOM 10912 H HH22 . ARG A 1 84  ? 6.921   -5.735  12.394  1.00 0.00 ? 84  ARG A HH22 6  
ATOM 10913 N N    . LYS A 1 85  ? 14.707  -5.679  7.388   1.00 0.00 ? 85  LYS A N    6  
ATOM 10914 C CA   . LYS A 1 85  ? 15.649  -5.779  6.279   1.00 0.00 ? 85  LYS A CA   6  
ATOM 10915 C C    . LYS A 1 85  ? 14.925  -5.675  4.940   1.00 0.00 ? 85  LYS A C    6  
ATOM 10916 O O    . LYS A 1 85  ? 15.076  -4.690  4.216   1.00 0.00 ? 85  LYS A O    6  
ATOM 10917 C CB   . LYS A 1 85  ? 16.417  -7.101  6.354   1.00 0.00 ? 85  LYS A CB   6  
ATOM 10918 C CG   . LYS A 1 85  ? 17.563  -7.082  7.351   1.00 0.00 ? 85  LYS A CG   6  
ATOM 10919 C CD   . LYS A 1 85  ? 18.462  -8.296  7.190   1.00 0.00 ? 85  LYS A CD   6  
ATOM 10920 C CE   . LYS A 1 85  ? 19.683  -8.208  8.092   1.00 0.00 ? 85  LYS A CE   6  
ATOM 10921 N NZ   . LYS A 1 85  ? 19.351  -8.532  9.508   1.00 0.00 ? 85  LYS A NZ   6  
ATOM 10922 H H    . LYS A 1 85  ? 14.018  -6.368  7.494   1.00 0.00 ? 85  LYS A H    6  
ATOM 10923 H HA   . LYS A 1 85  ? 16.347  -4.961  6.361   1.00 0.00 ? 85  LYS A HA   6  
ATOM 10924 H HB2  . LYS A 1 85  ? 15.733  -7.886  6.638   1.00 0.00 ? 85  LYS A HB2  6  
ATOM 10925 H HB3  . LYS A 1 85  ? 16.822  -7.324  5.377   1.00 0.00 ? 85  LYS A HB3  6  
ATOM 10926 H HG2  . LYS A 1 85  ? 18.150  -6.189  7.195   1.00 0.00 ? 85  LYS A HG2  6  
ATOM 10927 H HG3  . LYS A 1 85  ? 17.156  -7.077  8.352   1.00 0.00 ? 85  LYS A HG3  6  
ATOM 10928 H HD2  . LYS A 1 85  ? 17.904  -9.184  7.444   1.00 0.00 ? 85  LYS A HD2  6  
ATOM 10929 H HD3  . LYS A 1 85  ? 18.789  -8.357  6.161   1.00 0.00 ? 85  LYS A HD3  6  
ATOM 10930 H HE2  . LYS A 1 85  ? 20.428  -8.905  7.738   1.00 0.00 ? 85  LYS A HE2  6  
ATOM 10931 H HE3  . LYS A 1 85  ? 20.079  -7.204  8.045   1.00 0.00 ? 85  LYS A HE3  6  
ATOM 10932 H HZ1  . LYS A 1 85  ? 18.566  -9.213  9.544   1.00 0.00 ? 85  LYS A HZ1  6  
ATOM 10933 H HZ2  . LYS A 1 85  ? 19.071  -7.668  10.015  1.00 0.00 ? 85  LYS A HZ2  6  
ATOM 10934 H HZ3  . LYS A 1 85  ? 20.178  -8.947  9.983   1.00 0.00 ? 85  LYS A HZ3  6  
ATOM 10935 N N    . HIS A 1 86  ? 14.138  -6.697  4.617   1.00 0.00 ? 86  HIS A N    6  
ATOM 10936 C CA   . HIS A 1 86  ? 13.389  -6.719  3.365   1.00 0.00 ? 86  HIS A CA   6  
ATOM 10937 C C    . HIS A 1 86  ? 12.179  -5.792  3.440   1.00 0.00 ? 86  HIS A C    6  
ATOM 10938 O O    . HIS A 1 86  ? 11.038  -6.249  3.519   1.00 0.00 ? 86  HIS A O    6  
ATOM 10939 C CB   . HIS A 1 86  ? 12.937  -8.143  3.042   1.00 0.00 ? 86  HIS A CB   6  
ATOM 10940 C CG   . HIS A 1 86  ? 13.864  -9.198  3.561   1.00 0.00 ? 86  HIS A CG   6  
ATOM 10941 N ND1  . HIS A 1 86  ? 15.121  -9.419  3.040   1.00 0.00 ? 86  HIS A ND1  6  
ATOM 10942 C CD2  . HIS A 1 86  ? 13.711  -10.095 4.563   1.00 0.00 ? 86  HIS A CD2  6  
ATOM 10943 C CE1  . HIS A 1 86  ? 15.701  -10.407 3.697   1.00 0.00 ? 86  HIS A CE1  6  
ATOM 10944 N NE2  . HIS A 1 86  ? 14.867  -10.835 4.627   1.00 0.00 ? 86  HIS A NE2  6  
ATOM 10945 H H    . HIS A 1 86  ? 14.059  -7.453  5.235   1.00 0.00 ? 86  HIS A H    6  
ATOM 10946 H HA   . HIS A 1 86  ? 14.044  -6.371  2.581   1.00 0.00 ? 86  HIS A HA   6  
ATOM 10947 H HB2  . HIS A 1 86  ? 11.964  -8.312  3.479   1.00 0.00 ? 86  HIS A HB2  6  
ATOM 10948 H HB3  . HIS A 1 86  ? 12.869  -8.258  1.970   1.00 0.00 ? 86  HIS A HB3  6  
ATOM 10949 H HD1  . HIS A 1 86  ? 15.527  -8.925  2.297   1.00 0.00 ? 86  HIS A HD1  6  
ATOM 10950 H HD2  . HIS A 1 86  ? 12.842  -10.210 5.196   1.00 0.00 ? 86  HIS A HD2  6  
ATOM 10951 H HE1  . HIS A 1 86  ? 16.689  -10.799 3.507   1.00 0.00 ? 86  HIS A HE1  6  
ATOM 10952 H HE2  . HIS A 1 86  ? 15.013  -11.616 5.200   1.00 0.00 ? 86  HIS A HE2  6  
ATOM 10953 N N    . THR A 1 87  ? 12.435  -4.488  3.415   1.00 0.00 ? 87  THR A N    6  
ATOM 10954 C CA   . THR A 1 87  ? 11.368  -3.498  3.482   1.00 0.00 ? 87  THR A CA   6  
ATOM 10955 C C    . THR A 1 87  ? 11.459  -2.512  2.323   1.00 0.00 ? 87  THR A C    6  
ATOM 10956 O O    . THR A 1 87  ? 12.522  -2.336  1.726   1.00 0.00 ? 87  THR A O    6  
ATOM 10957 C CB   . THR A 1 87  ? 11.408  -2.717  4.809   1.00 0.00 ? 87  THR A CB   6  
ATOM 10958 O OG1  . THR A 1 87  ? 11.084  -3.587  5.899   1.00 0.00 ? 87  THR A OG1  6  
ATOM 10959 C CG2  . THR A 1 87  ? 10.435  -1.548  4.779   1.00 0.00 ? 87  THR A CG2  6  
ATOM 10960 H H    . THR A 1 87  ? 13.365  -4.186  3.351   1.00 0.00 ? 87  THR A H    6  
ATOM 10961 H HA   . THR A 1 87  ? 10.424  -4.021  3.424   1.00 0.00 ? 87  THR A HA   6  
ATOM 10962 H HB   . THR A 1 87  ? 12.408  -2.331  4.952   1.00 0.00 ? 87  THR A HB   6  
ATOM 10963 H HG1  . THR A 1 87  ? 10.862  -4.457  5.559   1.00 0.00 ? 87  THR A HG1  6  
ATOM 10964 H HG21 . THR A 1 87  ? 10.716  -0.867  3.991   1.00 0.00 ? 87  THR A HG21 6  
ATOM 10965 H HG22 . THR A 1 87  ? 10.463  -1.033  5.727   1.00 0.00 ? 87  THR A HG22 6  
ATOM 10966 H HG23 . THR A 1 87  ? 9.436   -1.917  4.598   1.00 0.00 ? 87  THR A HG23 6  
ATOM 10967 N N    . PHE A 1 88  ? 10.339  -1.871  2.008   1.00 0.00 ? 88  PHE A N    6  
ATOM 10968 C CA   . PHE A 1 88  ? 10.292  -0.902  0.919   1.00 0.00 ? 88  PHE A CA   6  
ATOM 10969 C C    . PHE A 1 88  ? 9.230   0.162   1.182   1.00 0.00 ? 88  PHE A C    6  
ATOM 10970 O O    . PHE A 1 88  ? 8.093   -0.154  1.532   1.00 0.00 ? 88  PHE A O    6  
ATOM 10971 C CB   . PHE A 1 88  ? 10.006  -1.608  -0.408  1.00 0.00 ? 88  PHE A CB   6  
ATOM 10972 C CG   . PHE A 1 88  ? 8.715   -2.376  -0.412  1.00 0.00 ? 88  PHE A CG   6  
ATOM 10973 C CD1  . PHE A 1 88  ? 8.538   -3.463  0.428   1.00 0.00 ? 88  PHE A CD1  6  
ATOM 10974 C CD2  . PHE A 1 88  ? 7.679   -2.009  -1.256  1.00 0.00 ? 88  PHE A CD2  6  
ATOM 10975 C CE1  . PHE A 1 88  ? 7.352   -4.172  0.425   1.00 0.00 ? 88  PHE A CE1  6  
ATOM 10976 C CE2  . PHE A 1 88  ? 6.490   -2.714  -1.263  1.00 0.00 ? 88  PHE A CE2  6  
ATOM 10977 C CZ   . PHE A 1 88  ? 6.326   -3.796  -0.420  1.00 0.00 ? 88  PHE A CZ   6  
ATOM 10978 H H    . PHE A 1 88  ? 9.523   -2.054  2.521   1.00 0.00 ? 88  PHE A H    6  
ATOM 10979 H HA   . PHE A 1 88  ? 11.258  -0.423  0.862   1.00 0.00 ? 88  PHE A HA   6  
ATOM 10980 H HB2  . PHE A 1 88  ? 9.956   -0.871  -1.196  1.00 0.00 ? 88  PHE A HB2  6  
ATOM 10981 H HB3  . PHE A 1 88  ? 10.807  -2.300  -0.619  1.00 0.00 ? 88  PHE A HB3  6  
ATOM 10982 H HD1  . PHE A 1 88  ? 9.339   -3.757  1.090   1.00 0.00 ? 88  PHE A HD1  6  
ATOM 10983 H HD2  . PHE A 1 88  ? 7.807   -1.162  -1.916  1.00 0.00 ? 88  PHE A HD2  6  
ATOM 10984 H HE1  . PHE A 1 88  ? 7.225   -5.017  1.085   1.00 0.00 ? 88  PHE A HE1  6  
ATOM 10985 H HE2  . PHE A 1 88  ? 5.690   -2.418  -1.925  1.00 0.00 ? 88  PHE A HE2  6  
ATOM 10986 H HZ   . PHE A 1 88  ? 5.398   -4.348  -0.424  1.00 0.00 ? 88  PHE A HZ   6  
ATOM 10987 N N    . LYS A 1 89  ? 9.610   1.423   1.011   1.00 0.00 ? 89  LYS A N    6  
ATOM 10988 C CA   . LYS A 1 89  ? 8.692   2.535   1.228   1.00 0.00 ? 89  LYS A CA   6  
ATOM 10989 C C    . LYS A 1 89  ? 8.474   3.321   -0.061  1.00 0.00 ? 89  LYS A C    6  
ATOM 10990 O O    . LYS A 1 89  ? 9.380   3.444   -0.884  1.00 0.00 ? 89  LYS A O    6  
ATOM 10991 C CB   . LYS A 1 89  ? 9.231   3.463   2.319   1.00 0.00 ? 89  LYS A CB   6  
ATOM 10992 C CG   . LYS A 1 89  ? 10.382  4.341   1.856   1.00 0.00 ? 89  LYS A CG   6  
ATOM 10993 C CD   . LYS A 1 89  ? 11.725  3.672   2.097   1.00 0.00 ? 89  LYS A CD   6  
ATOM 10994 C CE   . LYS A 1 89  ? 12.770  4.145   1.098   1.00 0.00 ? 89  LYS A CE   6  
ATOM 10995 N NZ   . LYS A 1 89  ? 12.477  3.665   -0.281  1.00 0.00 ? 89  LYS A NZ   6  
ATOM 10996 H H    . LYS A 1 89  ? 10.530  1.612   0.731   1.00 0.00 ? 89  LYS A H    6  
ATOM 10997 H HA   . LYS A 1 89  ? 7.746   2.126   1.551   1.00 0.00 ? 89  LYS A HA   6  
ATOM 10998 H HB2  . LYS A 1 89  ? 8.431   4.104   2.658   1.00 0.00 ? 89  LYS A HB2  6  
ATOM 10999 H HB3  . LYS A 1 89  ? 9.576   2.862   3.148   1.00 0.00 ? 89  LYS A HB3  6  
ATOM 11000 H HG2  . LYS A 1 89  ? 10.273  4.535   0.799   1.00 0.00 ? 89  LYS A HG2  6  
ATOM 11001 H HG3  . LYS A 1 89  ? 10.352  5.274   2.400   1.00 0.00 ? 89  LYS A HG3  6  
ATOM 11002 H HD2  . LYS A 1 89  ? 12.063  3.911   3.094   1.00 0.00 ? 89  LYS A HD2  6  
ATOM 11003 H HD3  . LYS A 1 89  ? 11.606  2.602   2.001   1.00 0.00 ? 89  LYS A HD3  6  
ATOM 11004 H HE2  . LYS A 1 89  ? 12.787  5.224   1.098   1.00 0.00 ? 89  LYS A HE2  6  
ATOM 11005 H HE3  . LYS A 1 89  ? 13.736  3.770   1.403   1.00 0.00 ? 89  LYS A HE3  6  
ATOM 11006 H HZ1  . LYS A 1 89  ? 11.455  3.715   -0.467  1.00 0.00 ? 89  LYS A HZ1  6  
ATOM 11007 H HZ2  . LYS A 1 89  ? 12.790  2.679   -0.390  1.00 0.00 ? 89  LYS A HZ2  6  
ATOM 11008 H HZ3  . LYS A 1 89  ? 12.975  4.254   -0.978  1.00 0.00 ? 89  LYS A HZ3  6  
ATOM 11009 N N    . ALA A 1 90  ? 7.267   3.851   -0.228  1.00 0.00 ? 90  ALA A N    6  
ATOM 11010 C CA   . ALA A 1 90  ? 6.932   4.628   -1.416  1.00 0.00 ? 90  ALA A CA   6  
ATOM 11011 C C    . ALA A 1 90  ? 6.830   6.114   -1.089  1.00 0.00 ? 90  ALA A C    6  
ATOM 11012 O O    . ALA A 1 90  ? 6.449   6.490   0.019   1.00 0.00 ? 90  ALA A O    6  
ATOM 11013 C CB   . ALA A 1 90  ? 5.628   4.129   -2.022  1.00 0.00 ? 90  ALA A CB   6  
ATOM 11014 H H    . ALA A 1 90  ? 6.586   3.718   0.463   1.00 0.00 ? 90  ALA A H    6  
ATOM 11015 H HA   . ALA A 1 90  ? 7.717   4.482   -2.143  1.00 0.00 ? 90  ALA A HA   6  
ATOM 11016 H HB1  . ALA A 1 90  ? 5.071   4.966   -2.414  1.00 0.00 ? 90  ALA A HB1  6  
ATOM 11017 H HB2  . ALA A 1 90  ? 5.847   3.435   -2.821  1.00 0.00 ? 90  ALA A HB2  6  
ATOM 11018 H HB3  . ALA A 1 90  ? 5.045   3.631   -1.262  1.00 0.00 ? 90  ALA A HB3  6  
ATOM 11019 N N    . GLU A 1 91  ? 7.175   6.953   -2.060  1.00 0.00 ? 91  GLU A N    6  
ATOM 11020 C CA   . GLU A 1 91  ? 7.124   8.399   -1.874  1.00 0.00 ? 91  GLU A CA   6  
ATOM 11021 C C    . GLU A 1 91  ? 6.657   9.096   -3.148  1.00 0.00 ? 91  GLU A C    6  
ATOM 11022 O O    . GLU A 1 91  ? 6.884   8.607   -4.255  1.00 0.00 ? 91  GLU A O    6  
ATOM 11023 C CB   . GLU A 1 91  ? 8.498   8.931   -1.463  1.00 0.00 ? 91  GLU A CB   6  
ATOM 11024 C CG   . GLU A 1 91  ? 8.824   10.294  -2.050  1.00 0.00 ? 91  GLU A CG   6  
ATOM 11025 C CD   . GLU A 1 91  ? 9.976   10.976  -1.338  1.00 0.00 ? 91  GLU A CD   6  
ATOM 11026 O OE1  . GLU A 1 91  ? 11.012  10.316  -1.117  1.00 0.00 ? 91  GLU A OE1  6  
ATOM 11027 O OE2  . GLU A 1 91  ? 9.840   12.171  -1.002  1.00 0.00 ? 91  GLU A OE2  6  
ATOM 11028 H H    . GLU A 1 91  ? 7.471   6.592   -2.922  1.00 0.00 ? 91  GLU A H    6  
ATOM 11029 H HA   . GLU A 1 91  ? 6.417   8.606   -1.085  1.00 0.00 ? 91  GLU A HA   6  
ATOM 11030 H HB2  . GLU A 1 91  ? 8.534   9.008   -0.386  1.00 0.00 ? 91  GLU A HB2  6  
ATOM 11031 H HB3  . GLU A 1 91  ? 9.254   8.232   -1.790  1.00 0.00 ? 91  GLU A HB3  6  
ATOM 11032 H HG2  . GLU A 1 91  ? 9.087   10.170  -3.090  1.00 0.00 ? 91  GLU A HG2  6  
ATOM 11033 H HG3  . GLU A 1 91  ? 7.949   10.923  -1.973  1.00 0.00 ? 91  GLU A HG3  6  
ATOM 11034 N N    . HIS A 1 92  ? 6.002   10.241  -2.984  1.00 0.00 ? 92  HIS A N    6  
ATOM 11035 C CA   . HIS A 1 92  ? 5.503   11.006  -4.120  1.00 0.00 ? 92  HIS A CA   6  
ATOM 11036 C C    . HIS A 1 92  ? 6.192   12.364  -4.206  1.00 0.00 ? 92  HIS A C    6  
ATOM 11037 O O    . HIS A 1 92  ? 6.236   12.983  -5.269  1.00 0.00 ? 92  HIS A O    6  
ATOM 11038 C CB   . HIS A 1 92  ? 3.990   11.195  -4.010  1.00 0.00 ? 92  HIS A CB   6  
ATOM 11039 C CG   . HIS A 1 92  ? 3.478   12.387  -4.759  1.00 0.00 ? 92  HIS A CG   6  
ATOM 11040 N ND1  . HIS A 1 92  ? 2.843   13.446  -4.145  1.00 0.00 ? 92  HIS A ND1  6  
ATOM 11041 C CD2  . HIS A 1 92  ? 3.512   12.684  -6.079  1.00 0.00 ? 92  HIS A CD2  6  
ATOM 11042 C CE1  . HIS A 1 92  ? 2.508   14.343  -5.055  1.00 0.00 ? 92  HIS A CE1  6  
ATOM 11043 N NE2  . HIS A 1 92  ? 2.903   13.905  -6.237  1.00 0.00 ? 92  HIS A NE2  6  
ATOM 11044 H H    . HIS A 1 92  ? 5.852   10.579  -2.076  1.00 0.00 ? 92  HIS A H    6  
ATOM 11045 H HA   . HIS A 1 92  ? 5.722   10.448  -5.018  1.00 0.00 ? 92  HIS A HA   6  
ATOM 11046 H HB2  . HIS A 1 92  ? 3.494   10.319  -4.403  1.00 0.00 ? 92  HIS A HB2  6  
ATOM 11047 H HB3  . HIS A 1 92  ? 3.724   11.316  -2.969  1.00 0.00 ? 92  HIS A HB3  6  
ATOM 11048 H HD1  . HIS A 1 92  ? 2.664   13.527  -3.185  1.00 0.00 ? 92  HIS A HD1  6  
ATOM 11049 H HD2  . HIS A 1 92  ? 3.939   12.075  -6.863  1.00 0.00 ? 92  HIS A HD2  6  
ATOM 11050 H HE1  . HIS A 1 92  ? 1.998   15.275  -4.866  1.00 0.00 ? 92  HIS A HE1  6  
ATOM 11051 H HE2  . HIS A 1 92  ? 2.703   14.335  -7.094  1.00 0.00 ? 92  HIS A HE2  6  
ATOM 11052 N N    . ALA A 1 93  ? 6.727   12.823  -3.079  1.00 0.00 ? 93  ALA A N    6  
ATOM 11053 C CA   . ALA A 1 93  ? 7.415   14.107  -3.028  1.00 0.00 ? 93  ALA A CA   6  
ATOM 11054 C C    . ALA A 1 93  ? 6.422   15.264  -3.064  1.00 0.00 ? 93  ALA A C    6  
ATOM 11055 O O    . ALA A 1 93  ? 6.568   16.196  -3.854  1.00 0.00 ? 93  ALA A O    6  
ATOM 11056 C CB   . ALA A 1 93  ? 8.405   14.222  -4.177  1.00 0.00 ? 93  ALA A CB   6  
ATOM 11057 H H    . ALA A 1 93  ? 6.659   12.284  -2.264  1.00 0.00 ? 93  ALA A H    6  
ATOM 11058 H HA   . ALA A 1 93  ? 7.970   14.152  -2.101  1.00 0.00 ? 93  ALA A HA   6  
ATOM 11059 H HB1  . ALA A 1 93  ? 8.794   13.244  -4.417  1.00 0.00 ? 93  ALA A HB1  6  
ATOM 11060 H HB2  . ALA A 1 93  ? 7.904   14.633  -5.042  1.00 0.00 ? 93  ALA A HB2  6  
ATOM 11061 H HB3  . ALA A 1 93  ? 9.217   14.872  -3.889  1.00 0.00 ? 93  ALA A HB3  6  
ATOM 11062 N N    . GLY A 1 94  ? 5.410   15.196  -2.205  1.00 0.00 ? 94  GLY A N    6  
ATOM 11063 C CA   . GLY A 1 94  ? 4.407   16.244  -2.156  1.00 0.00 ? 94  GLY A CA   6  
ATOM 11064 C C    . GLY A 1 94  ? 3.287   15.930  -1.183  1.00 0.00 ? 94  GLY A C    6  
ATOM 11065 O O    . GLY A 1 94  ? 2.647   16.836  -0.650  1.00 0.00 ? 94  GLY A O    6  
ATOM 11066 H H    . GLY A 1 94  ? 5.344   14.429  -1.598  1.00 0.00 ? 94  GLY A H    6  
ATOM 11067 H HA2  . GLY A 1 94  ? 4.880   17.167  -1.859  1.00 0.00 ? 94  GLY A HA2  6  
ATOM 11068 H HA3  . GLY A 1 94  ? 3.985   16.369  -3.143  1.00 0.00 ? 94  GLY A HA3  6  
ATOM 11069 N N    . VAL A 1 95  ? 3.050   14.643  -0.952  1.00 0.00 ? 95  VAL A N    6  
ATOM 11070 C CA   . VAL A 1 95  ? 2.000   14.212  -0.037  1.00 0.00 ? 95  VAL A CA   6  
ATOM 11071 C C    . VAL A 1 95  ? 2.589   13.536  1.196   1.00 0.00 ? 95  VAL A C    6  
ATOM 11072 O O    . VAL A 1 95  ? 2.487   14.054  2.309   1.00 0.00 ? 95  VAL A O    6  
ATOM 11073 C CB   . VAL A 1 95  ? 1.021   13.241  -0.723  1.00 0.00 ? 95  VAL A CB   6  
ATOM 11074 C CG1  . VAL A 1 95  ? -0.097  12.846  0.230   1.00 0.00 ? 95  VAL A CG1  6  
ATOM 11075 C CG2  . VAL A 1 95  ? 0.457   13.861  -1.992  1.00 0.00 ? 95  VAL A CG2  6  
ATOM 11076 H H    . VAL A 1 95  ? 3.594   13.967  -1.407  1.00 0.00 ? 95  VAL A H    6  
ATOM 11077 H HA   . VAL A 1 95  ? 1.447   15.087  0.274   1.00 0.00 ? 95  VAL A HA   6  
ATOM 11078 H HB   . VAL A 1 95  ? 1.564   12.347  -0.995  1.00 0.00 ? 95  VAL A HB   6  
ATOM 11079 H HG11 . VAL A 1 95  ? -0.142  11.770  0.305   1.00 0.00 ? 95  VAL A HG11 6  
ATOM 11080 H HG12 . VAL A 1 95  ? 0.096   13.269  1.206   1.00 0.00 ? 95  VAL A HG12 6  
ATOM 11081 H HG13 . VAL A 1 95  ? -1.038  13.220  -0.145  1.00 0.00 ? 95  VAL A HG13 6  
ATOM 11082 H HG21 . VAL A 1 95  ? 0.406   13.113  -2.768  1.00 0.00 ? 95  VAL A HG21 6  
ATOM 11083 H HG22 . VAL A 1 95  ? -0.534  14.244  -1.795  1.00 0.00 ? 95  VAL A HG22 6  
ATOM 11084 H HG23 . VAL A 1 95  ? 1.097   14.670  -2.313  1.00 0.00 ? 95  VAL A HG23 6  
ATOM 11085 N N    . ARG A 1 96  ? 3.205   12.377  0.991   1.00 0.00 ? 96  ARG A N    6  
ATOM 11086 C CA   . ARG A 1 96  ? 3.810   11.629  2.087   1.00 0.00 ? 96  ARG A CA   6  
ATOM 11087 C C    . ARG A 1 96  ? 4.568   10.413  1.562   1.00 0.00 ? 96  ARG A C    6  
ATOM 11088 O O    . ARG A 1 96  ? 4.607   10.165  0.356   1.00 0.00 ? 96  ARG A O    6  
ATOM 11089 C CB   . ARG A 1 96  ? 2.737   11.184  3.083   1.00 0.00 ? 96  ARG A CB   6  
ATOM 11090 C CG   . ARG A 1 96  ? 1.933   9.982   2.615   1.00 0.00 ? 96  ARG A CG   6  
ATOM 11091 C CD   . ARG A 1 96  ? 0.638   9.838   3.399   1.00 0.00 ? 96  ARG A CD   6  
ATOM 11092 N NE   . ARG A 1 96  ? 0.876   9.748   4.837   1.00 0.00 ? 96  ARG A NE   6  
ATOM 11093 C CZ   . ARG A 1 96  ? 1.193   8.618   5.460   1.00 0.00 ? 96  ARG A CZ   6  
ATOM 11094 N NH1  . ARG A 1 96  ? 1.309   7.489   4.774   1.00 0.00 ? 96  ARG A NH1  6  
ATOM 11095 N NH2  . ARG A 1 96  ? 1.394   8.616   6.771   1.00 0.00 ? 96  ARG A NH2  6  
ATOM 11096 H H    . ARG A 1 96  ? 3.253   12.015  0.082   1.00 0.00 ? 96  ARG A H    6  
ATOM 11097 H HA   . ARG A 1 96  ? 4.506   12.282  2.590   1.00 0.00 ? 96  ARG A HA   6  
ATOM 11098 H HB2  . ARG A 1 96  ? 3.214   10.928  4.017   1.00 0.00 ? 96  ARG A HB2  6  
ATOM 11099 H HB3  . ARG A 1 96  ? 2.055   12.003  3.248   1.00 0.00 ? 96  ARG A HB3  6  
ATOM 11100 H HG2  . ARG A 1 96  ? 1.695   10.104  1.568   1.00 0.00 ? 96  ARG A HG2  6  
ATOM 11101 H HG3  . ARG A 1 96  ? 2.526   9.089   2.749   1.00 0.00 ? 96  ARG A HG3  6  
ATOM 11102 H HD2  . ARG A 1 96  ? 0.015   10.698  3.200   1.00 0.00 ? 96  ARG A HD2  6  
ATOM 11103 H HD3  . ARG A 1 96  ? 0.131   8.943   3.070   1.00 0.00 ? 96  ARG A HD3  6  
ATOM 11104 H HE   . ARG A 1 96  ? 0.795   10.570  5.363   1.00 0.00 ? 96  ARG A HE   6  
ATOM 11105 H HH11 . ARG A 1 96  ? 1.159   7.488   3.786   1.00 0.00 ? 96  ARG A HH11 6  
ATOM 11106 H HH12 . ARG A 1 96  ? 1.549   6.640   5.245   1.00 0.00 ? 96  ARG A HH12 6  
ATOM 11107 H HH21 . ARG A 1 96  ? 1.308   9.465   7.291   1.00 0.00 ? 96  ARG A HH21 6  
ATOM 11108 H HH22 . ARG A 1 96  ? 1.632   7.766   7.239   1.00 0.00 ? 96  ARG A HH22 6  
ATOM 11109 N N    . THR A 1 97  ? 5.169   9.657   2.475   1.00 0.00 ? 97  THR A N    6  
ATOM 11110 C CA   . THR A 1 97  ? 5.927   8.468   2.105   1.00 0.00 ? 97  THR A CA   6  
ATOM 11111 C C    . THR A 1 97  ? 5.445   7.246   2.878   1.00 0.00 ? 97  THR A C    6  
ATOM 11112 O O    . THR A 1 97  ? 5.708   7.113   4.073   1.00 0.00 ? 97  THR A O    6  
ATOM 11113 C CB   . THR A 1 97  ? 7.434   8.661   2.359   1.00 0.00 ? 97  THR A CB   6  
ATOM 11114 O OG1  . THR A 1 97  ? 7.910   9.803   1.638   1.00 0.00 ? 97  THR A OG1  6  
ATOM 11115 C CG2  . THR A 1 97  ? 8.216   7.426   1.938   1.00 0.00 ? 97  THR A CG2  6  
ATOM 11116 H H    . THR A 1 97  ? 5.101   9.906   3.420   1.00 0.00 ? 97  THR A H    6  
ATOM 11117 H HA   . THR A 1 97  ? 5.781   8.295   1.049   1.00 0.00 ? 97  THR A HA   6  
ATOM 11118 H HB   . THR A 1 97  ? 7.587   8.823   3.416   1.00 0.00 ? 97  THR A HB   6  
ATOM 11119 H HG1  . THR A 1 97  ? 7.267   10.050  0.968   1.00 0.00 ? 97  THR A HG1  6  
ATOM 11120 H HG21 . THR A 1 97  ? 8.439   7.484   0.883   1.00 0.00 ? 97  THR A HG21 6  
ATOM 11121 H HG22 . THR A 1 97  ? 7.627   6.543   2.133   1.00 0.00 ? 97  THR A HG22 6  
ATOM 11122 H HG23 . THR A 1 97  ? 9.138   7.376   2.498   1.00 0.00 ? 97  THR A HG23 6  
ATOM 11123 N N    . TYR A 1 98  ? 4.740   6.356   2.188   1.00 0.00 ? 98  TYR A N    6  
ATOM 11124 C CA   . TYR A 1 98  ? 4.220   5.145   2.811   1.00 0.00 ? 98  TYR A CA   6  
ATOM 11125 C C    . TYR A 1 98  ? 5.315   4.091   2.951   1.00 0.00 ? 98  TYR A C    6  
ATOM 11126 O O    . TYR A 1 98  ? 6.289   4.087   2.198   1.00 0.00 ? 98  TYR A O    6  
ATOM 11127 C CB   . TYR A 1 98  ? 3.058   4.583   1.991   1.00 0.00 ? 98  TYR A CB   6  
ATOM 11128 C CG   . TYR A 1 98  ? 1.756   5.323   2.199   1.00 0.00 ? 98  TYR A CG   6  
ATOM 11129 C CD1  . TYR A 1 98  ? 0.893   4.974   3.231   1.00 0.00 ? 98  TYR A CD1  6  
ATOM 11130 C CD2  . TYR A 1 98  ? 1.389   6.372   1.365   1.00 0.00 ? 98  TYR A CD2  6  
ATOM 11131 C CE1  . TYR A 1 98  ? -0.298  5.647   3.424   1.00 0.00 ? 98  TYR A CE1  6  
ATOM 11132 C CE2  . TYR A 1 98  ? 0.201   7.051   1.552   1.00 0.00 ? 98  TYR A CE2  6  
ATOM 11133 C CZ   . TYR A 1 98  ? -0.639  6.685   2.582   1.00 0.00 ? 98  TYR A CZ   6  
ATOM 11134 O OH   . TYR A 1 98  ? -1.824  7.359   2.773   1.00 0.00 ? 98  TYR A OH   6  
ATOM 11135 H H    . TYR A 1 98  ? 4.564   6.518   1.238   1.00 0.00 ? 98  TYR A H    6  
ATOM 11136 H HA   . TYR A 1 98  ? 3.860   5.406   3.795   1.00 0.00 ? 98  TYR A HA   6  
ATOM 11137 H HB2  . TYR A 1 98  ? 3.306   4.639   0.942   1.00 0.00 ? 98  TYR A HB2  6  
ATOM 11138 H HB3  . TYR A 1 98  ? 2.900   3.550   2.264   1.00 0.00 ? 98  TYR A HB3  6  
ATOM 11139 H HD1  . TYR A 1 98  ? 1.164   4.161   3.889   1.00 0.00 ? 98  TYR A HD1  6  
ATOM 11140 H HD2  . TYR A 1 98  ? 2.049   6.656   0.558   1.00 0.00 ? 98  TYR A HD2  6  
ATOM 11141 H HE1  . TYR A 1 98  ? -0.955  5.361   4.232   1.00 0.00 ? 98  TYR A HE1  6  
ATOM 11142 H HE2  . TYR A 1 98  ? -0.067  7.864   0.892   1.00 0.00 ? 98  TYR A HE2  6  
ATOM 11143 H HH   . TYR A 1 98  ? -1.908  7.602   3.698   1.00 0.00 ? 98  TYR A HH   6  
ATOM 11144 N N    . PHE A 1 99  ? 5.146   3.198   3.921   1.00 0.00 ? 99  PHE A N    6  
ATOM 11145 C CA   . PHE A 1 99  ? 6.119   2.139   4.162   1.00 0.00 ? 99  PHE A CA   6  
ATOM 11146 C C    . PHE A 1 99  ? 5.460   0.765   4.074   1.00 0.00 ? 99  PHE A C    6  
ATOM 11147 O O    . PHE A 1 99  ? 4.268   0.618   4.342   1.00 0.00 ? 99  PHE A O    6  
ATOM 11148 C CB   . PHE A 1 99  ? 6.770   2.318   5.535   1.00 0.00 ? 99  PHE A CB   6  
ATOM 11149 C CG   . PHE A 1 99  ? 7.882   3.328   5.544   1.00 0.00 ? 99  PHE A CG   6  
ATOM 11150 C CD1  . PHE A 1 99  ? 7.605   4.682   5.628   1.00 0.00 ? 99  PHE A CD1  6  
ATOM 11151 C CD2  . PHE A 1 99  ? 9.205   2.922   5.467   1.00 0.00 ? 99  PHE A CD2  6  
ATOM 11152 C CE1  . PHE A 1 99  ? 8.625   5.614   5.637   1.00 0.00 ? 99  PHE A CE1  6  
ATOM 11153 C CE2  . PHE A 1 99  ? 10.230  3.849   5.476   1.00 0.00 ? 99  PHE A CE2  6  
ATOM 11154 C CZ   . PHE A 1 99  ? 9.940   5.197   5.560   1.00 0.00 ? 99  PHE A CZ   6  
ATOM 11155 H H    . PHE A 1 99  ? 4.349   3.254   4.489   1.00 0.00 ? 99  PHE A H    6  
ATOM 11156 H HA   . PHE A 1 99  ? 6.880   2.209   3.400   1.00 0.00 ? 99  PHE A HA   6  
ATOM 11157 H HB2  . PHE A 1 99  ? 6.022   2.643   6.241   1.00 0.00 ? 99  PHE A HB2  6  
ATOM 11158 H HB3  . PHE A 1 99  ? 7.177   1.371   5.858   1.00 0.00 ? 99  PHE A HB3  6  
ATOM 11159 H HD1  . PHE A 1 99  ? 6.576   5.010   5.688   1.00 0.00 ? 99  PHE A HD1  6  
ATOM 11160 H HD2  . PHE A 1 99  ? 9.433   1.869   5.401   1.00 0.00 ? 99  PHE A HD2  6  
ATOM 11161 H HE1  . PHE A 1 99  ? 8.395   6.667   5.703   1.00 0.00 ? 99  PHE A HE1  6  
ATOM 11162 H HE2  . PHE A 1 99  ? 11.256  3.521   5.416   1.00 0.00 ? 99  PHE A HE2  6  
ATOM 11163 H HZ   . PHE A 1 99  ? 10.738  5.923   5.568   1.00 0.00 ? 99  PHE A HZ   6  
ATOM 11164 N N    . PHE A 1 100 ? 6.245   -0.238  3.696   1.00 0.00 ? 100 PHE A N    6  
ATOM 11165 C CA   . PHE A 1 100 ? 5.739   -1.600  3.571   1.00 0.00 ? 100 PHE A CA   6  
ATOM 11166 C C    . PHE A 1 100 ? 6.854   -2.617  3.794   1.00 0.00 ? 100 PHE A C    6  
ATOM 11167 O O    . PHE A 1 100 ? 7.843   -2.641  3.060   1.00 0.00 ? 100 PHE A O    6  
ATOM 11168 C CB   . PHE A 1 100 ? 5.111   -1.808  2.192   1.00 0.00 ? 100 PHE A CB   6  
ATOM 11169 C CG   . PHE A 1 100 ? 4.134   -0.733  1.809   1.00 0.00 ? 100 PHE A CG   6  
ATOM 11170 C CD1  . PHE A 1 100 ? 2.949   -0.574  2.509   1.00 0.00 ? 100 PHE A CD1  6  
ATOM 11171 C CD2  . PHE A 1 100 ? 4.402   0.119   0.749   1.00 0.00 ? 100 PHE A CD2  6  
ATOM 11172 C CE1  . PHE A 1 100 ? 2.048   0.414   2.159   1.00 0.00 ? 100 PHE A CE1  6  
ATOM 11173 C CE2  . PHE A 1 100 ? 3.505   1.109   0.396   1.00 0.00 ? 100 PHE A CE2  6  
ATOM 11174 C CZ   . PHE A 1 100 ? 2.327   1.257   1.101   1.00 0.00 ? 100 PHE A CZ   6  
ATOM 11175 H H    . PHE A 1 100 ? 7.188   -0.058  3.496   1.00 0.00 ? 100 PHE A H    6  
ATOM 11176 H HA   . PHE A 1 100 ? 4.982   -1.742  4.327   1.00 0.00 ? 100 PHE A HA   6  
ATOM 11177 H HB2  . PHE A 1 100 ? 5.892   -1.826  1.447   1.00 0.00 ? 100 PHE A HB2  6  
ATOM 11178 H HB3  . PHE A 1 100 ? 4.588   -2.752  2.182   1.00 0.00 ? 100 PHE A HB3  6  
ATOM 11179 H HD1  . PHE A 1 100 ? 2.730   -1.233  3.337   1.00 0.00 ? 100 PHE A HD1  6  
ATOM 11180 H HD2  . PHE A 1 100 ? 5.322   0.004   0.196   1.00 0.00 ? 100 PHE A HD2  6  
ATOM 11181 H HE1  . PHE A 1 100 ? 1.128   0.527   2.713   1.00 0.00 ? 100 PHE A HE1  6  
ATOM 11182 H HE2  . PHE A 1 100 ? 3.725   1.766   -0.433  1.00 0.00 ? 100 PHE A HE2  6  
ATOM 11183 H HZ   . PHE A 1 100 ? 1.625   2.030   0.827   1.00 0.00 ? 100 PHE A HZ   6  
ATOM 11184 N N    . SER A 1 101 ? 6.688   -3.456  4.811   1.00 0.00 ? 101 SER A N    6  
ATOM 11185 C CA   . SER A 1 101 ? 7.681   -4.473  5.134   1.00 0.00 ? 101 SER A CA   6  
ATOM 11186 C C    . SER A 1 101 ? 7.207   -5.855  4.696   1.00 0.00 ? 101 SER A C    6  
ATOM 11187 O O    . SER A 1 101 ? 6.025   -6.181  4.805   1.00 0.00 ? 101 SER A O    6  
ATOM 11188 C CB   . SER A 1 101 ? 7.972   -4.474  6.636   1.00 0.00 ? 101 SER A CB   6  
ATOM 11189 O OG   . SER A 1 101 ? 8.652   -5.655  7.023   1.00 0.00 ? 101 SER A OG   6  
ATOM 11190 H H    . SER A 1 101 ? 5.878   -3.387  5.360   1.00 0.00 ? 101 SER A H    6  
ATOM 11191 H HA   . SER A 1 101 ? 8.589   -4.231  4.601   1.00 0.00 ? 101 SER A HA   6  
ATOM 11192 H HB2  . SER A 1 101 ? 8.587   -3.622  6.882   1.00 0.00 ? 101 SER A HB2  6  
ATOM 11193 H HB3  . SER A 1 101 ? 7.040   -4.415  7.180   1.00 0.00 ? 101 SER A HB3  6  
ATOM 11194 H HG   . SER A 1 101 ? 9.149   -5.998  6.277   1.00 0.00 ? 101 SER A HG   6  
ATOM 11195 N N    . ALA A 1 102 ? 8.137   -6.663  4.198   1.00 0.00 ? 102 ALA A N    6  
ATOM 11196 C CA   . ALA A 1 102 ? 7.816   -8.010  3.744   1.00 0.00 ? 102 ALA A CA   6  
ATOM 11197 C C    . ALA A 1 102 ? 8.543   -9.059  4.579   1.00 0.00 ? 102 ALA A C    6  
ATOM 11198 O O    . ALA A 1 102 ? 9.738   -8.936  4.842   1.00 0.00 ? 102 ALA A O    6  
ATOM 11199 C CB   . ALA A 1 102 ? 8.166   -8.169  2.272   1.00 0.00 ? 102 ALA A CB   6  
ATOM 11200 H H    . ALA A 1 102 ? 9.062   -6.346  4.136   1.00 0.00 ? 102 ALA A H    6  
ATOM 11201 H HA   . ALA A 1 102 ? 6.750   -8.154  3.853   1.00 0.00 ? 102 ALA A HA   6  
ATOM 11202 H HB1  . ALA A 1 102 ? 7.271   -8.394  1.711   1.00 0.00 ? 102 ALA A HB1  6  
ATOM 11203 H HB2  . ALA A 1 102 ? 8.601   -7.250  1.905   1.00 0.00 ? 102 ALA A HB2  6  
ATOM 11204 H HB3  . ALA A 1 102 ? 8.876   -8.975  2.156   1.00 0.00 ? 102 ALA A HB3  6  
ATOM 11205 N N    . GLU A 1 103 ? 7.812   -10.089 4.994   1.00 0.00 ? 103 GLU A N    6  
ATOM 11206 C CA   . GLU A 1 103 ? 8.388   -11.158 5.801   1.00 0.00 ? 103 GLU A CA   6  
ATOM 11207 C C    . GLU A 1 103 ? 9.646   -11.719 5.142   1.00 0.00 ? 103 GLU A C    6  
ATOM 11208 O O    . GLU A 1 103 ? 10.709  -11.776 5.759   1.00 0.00 ? 103 GLU A O    6  
ATOM 11209 C CB   . GLU A 1 103 ? 7.366   -12.277 6.010   1.00 0.00 ? 103 GLU A CB   6  
ATOM 11210 C CG   . GLU A 1 103 ? 6.282   -11.931 7.016   1.00 0.00 ? 103 GLU A CG   6  
ATOM 11211 C CD   . GLU A 1 103 ? 5.091   -12.866 6.937   1.00 0.00 ? 103 GLU A CD   6  
ATOM 11212 O OE1  . GLU A 1 103 ? 5.294   -14.061 6.635   1.00 0.00 ? 103 GLU A OE1  6  
ATOM 11213 O OE2  . GLU A 1 103 ? 3.956   -12.403 7.176   1.00 0.00 ? 103 GLU A OE2  6  
ATOM 11214 H H    . GLU A 1 103 ? 6.863   -10.131 4.751   1.00 0.00 ? 103 GLU A H    6  
ATOM 11215 H HA   . GLU A 1 103 ? 8.655   -10.742 6.761   1.00 0.00 ? 103 GLU A HA   6  
ATOM 11216 H HB2  . GLU A 1 103 ? 6.894   -12.499 5.064   1.00 0.00 ? 103 GLU A HB2  6  
ATOM 11217 H HB3  . GLU A 1 103 ? 7.883   -13.159 6.360   1.00 0.00 ? 103 GLU A HB3  6  
ATOM 11218 H HG2  . GLU A 1 103 ? 6.699   -11.988 8.010   1.00 0.00 ? 103 GLU A HG2  6  
ATOM 11219 H HG3  . GLU A 1 103 ? 5.942   -10.923 6.827   1.00 0.00 ? 103 GLU A HG3  6  
ATOM 11220 N N    . SER A 1 104 ? 9.514   -12.133 3.886   1.00 0.00 ? 104 SER A N    6  
ATOM 11221 C CA   . SER A 1 104 ? 10.637  -12.694 3.145   1.00 0.00 ? 104 SER A CA   6  
ATOM 11222 C C    . SER A 1 104 ? 11.083  -11.747 2.034   1.00 0.00 ? 104 SER A C    6  
ATOM 11223 O O    . SER A 1 104 ? 10.325  -10.896 1.569   1.00 0.00 ? 104 SER A O    6  
ATOM 11224 C CB   . SER A 1 104 ? 10.257  -14.052 2.551   1.00 0.00 ? 104 SER A CB   6  
ATOM 11225 O OG   . SER A 1 104 ? 10.324  -15.074 3.530   1.00 0.00 ? 104 SER A OG   6  
ATOM 11226 H H    . SER A 1 104 ? 8.640   -12.062 3.449   1.00 0.00 ? 104 SER A H    6  
ATOM 11227 H HA   . SER A 1 104 ? 11.456  -12.830 3.836   1.00 0.00 ? 104 SER A HA   6  
ATOM 11228 H HB2  . SER A 1 104 ? 9.249   -14.004 2.166   1.00 0.00 ? 104 SER A HB2  6  
ATOM 11229 H HB3  . SER A 1 104 ? 10.938  -14.294 1.747   1.00 0.00 ? 104 SER A HB3  6  
ATOM 11230 H HG   . SER A 1 104 ? 11.013  -15.699 3.293   1.00 0.00 ? 104 SER A HG   6  
ATOM 11231 N N    . PRO A 1 105 ? 12.342  -11.898 1.599   1.00 0.00 ? 105 PRO A N    6  
ATOM 11232 C CA   . PRO A 1 105 ? 12.918  -11.066 0.538   1.00 0.00 ? 105 PRO A CA   6  
ATOM 11233 C C    . PRO A 1 105 ? 12.307  -11.363 -0.827  1.00 0.00 ? 105 PRO A C    6  
ATOM 11234 O O    . PRO A 1 105 ? 12.412  -10.558 -1.752  1.00 0.00 ? 105 PRO A O    6  
ATOM 11235 C CB   . PRO A 1 105 ? 14.401  -11.447 0.555   1.00 0.00 ? 105 PRO A CB   6  
ATOM 11236 C CG   . PRO A 1 105 ? 14.432  -12.825 1.120   1.00 0.00 ? 105 PRO A CG   6  
ATOM 11237 C CD   . PRO A 1 105 ? 13.301  -12.892 2.109   1.00 0.00 ? 105 PRO A CD   6  
ATOM 11238 H HA   . PRO A 1 105 ? 12.812  -10.014 0.758   1.00 0.00 ? 105 PRO A HA   6  
ATOM 11239 H HB2  . PRO A 1 105 ? 14.792  -11.423 -0.453  1.00 0.00 ? 105 PRO A HB2  6  
ATOM 11240 H HB3  . PRO A 1 105 ? 14.947  -10.753 1.176   1.00 0.00 ? 105 PRO A HB3  6  
ATOM 11241 H HG2  . PRO A 1 105 ? 14.285  -13.548 0.332   1.00 0.00 ? 105 PRO A HG2  6  
ATOM 11242 H HG3  . PRO A 1 105 ? 15.375  -12.996 1.617   1.00 0.00 ? 105 PRO A HG3  6  
ATOM 11243 H HD2  . PRO A 1 105 ? 12.865  -13.880 2.117   1.00 0.00 ? 105 PRO A HD2  6  
ATOM 11244 H HD3  . PRO A 1 105 ? 13.647  -12.623 3.096   1.00 0.00 ? 105 PRO A HD3  6  
ATOM 11245 N N    . GLU A 1 106 ? 11.669  -12.523 -0.945  1.00 0.00 ? 106 GLU A N    6  
ATOM 11246 C CA   . GLU A 1 106 ? 11.042  -12.925 -2.199  1.00 0.00 ? 106 GLU A CA   6  
ATOM 11247 C C    . GLU A 1 106 ? 9.781   -12.106 -2.463  1.00 0.00 ? 106 GLU A C    6  
ATOM 11248 O O    . GLU A 1 106 ? 9.491   -11.746 -3.603  1.00 0.00 ? 106 GLU A O    6  
ATOM 11249 C CB   . GLU A 1 106 ? 10.698  -14.416 -2.168  1.00 0.00 ? 106 GLU A CB   6  
ATOM 11250 C CG   . GLU A 1 106 ? 11.897  -15.312 -1.907  1.00 0.00 ? 106 GLU A CG   6  
ATOM 11251 C CD   . GLU A 1 106 ? 11.560  -16.785 -2.022  1.00 0.00 ? 106 GLU A CD   6  
ATOM 11252 O OE1  . GLU A 1 106 ? 11.168  -17.221 -3.124  1.00 0.00 ? 106 GLU A OE1  6  
ATOM 11253 O OE2  . GLU A 1 106 ? 11.688  -17.503 -1.008  1.00 0.00 ? 106 GLU A OE2  6  
ATOM 11254 H H    . GLU A 1 106 ? 11.619  -13.123 -0.172  1.00 0.00 ? 106 GLU A H    6  
ATOM 11255 H HA   . GLU A 1 106 ? 11.747  -12.744 -2.996  1.00 0.00 ? 106 GLU A HA   6  
ATOM 11256 H HB2  . GLU A 1 106 ? 9.969   -14.589 -1.390  1.00 0.00 ? 106 GLU A HB2  6  
ATOM 11257 H HB3  . GLU A 1 106 ? 10.268  -14.693 -3.119  1.00 0.00 ? 106 GLU A HB3  6  
ATOM 11258 H HG2  . GLU A 1 106 ? 12.668  -15.078 -2.626  1.00 0.00 ? 106 GLU A HG2  6  
ATOM 11259 H HG3  . GLU A 1 106 ? 12.265  -15.118 -0.911  1.00 0.00 ? 106 GLU A HG3  6  
ATOM 11260 N N    . GLU A 1 107 ? 9.036   -11.817 -1.401  1.00 0.00 ? 107 GLU A N    6  
ATOM 11261 C CA   . GLU A 1 107 ? 7.807   -11.043 -1.518  1.00 0.00 ? 107 GLU A CA   6  
ATOM 11262 C C    . GLU A 1 107 ? 8.113   -9.560  -1.708  1.00 0.00 ? 107 GLU A C    6  
ATOM 11263 O O    . GLU A 1 107 ? 7.436   -8.868  -2.467  1.00 0.00 ? 107 GLU A O    6  
ATOM 11264 C CB   . GLU A 1 107 ? 6.933   -11.240 -0.278  1.00 0.00 ? 107 GLU A CB   6  
ATOM 11265 C CG   . GLU A 1 107 ? 6.122   -12.524 -0.301  1.00 0.00 ? 107 GLU A CG   6  
ATOM 11266 C CD   . GLU A 1 107 ? 4.827   -12.382 -1.076  1.00 0.00 ? 107 GLU A CD   6  
ATOM 11267 O OE1  . GLU A 1 107 ? 4.863   -11.838 -2.199  1.00 0.00 ? 107 GLU A OE1  6  
ATOM 11268 O OE2  . GLU A 1 107 ? 3.776   -12.816 -0.559  1.00 0.00 ? 107 GLU A OE2  6  
ATOM 11269 H H    . GLU A 1 107 ? 9.320   -12.133 -0.517  1.00 0.00 ? 107 GLU A H    6  
ATOM 11270 H HA   . GLU A 1 107 ? 7.271   -11.401 -2.384  1.00 0.00 ? 107 GLU A HA   6  
ATOM 11271 H HB2  . GLU A 1 107 ? 7.568   -11.254 0.596   1.00 0.00 ? 107 GLU A HB2  6  
ATOM 11272 H HB3  . GLU A 1 107 ? 6.248   -10.408 -0.200  1.00 0.00 ? 107 GLU A HB3  6  
ATOM 11273 H HG2  . GLU A 1 107 ? 6.715   -13.301 -0.761  1.00 0.00 ? 107 GLU A HG2  6  
ATOM 11274 H HG3  . GLU A 1 107 ? 5.888   -12.806 0.715   1.00 0.00 ? 107 GLU A HG3  6  
ATOM 11275 N N    . GLN A 1 108 ? 9.139   -9.081  -1.012  1.00 0.00 ? 108 GLN A N    6  
ATOM 11276 C CA   . GLN A 1 108 ? 9.535   -7.680  -1.103  1.00 0.00 ? 108 GLN A CA   6  
ATOM 11277 C C    . GLN A 1 108 ? 9.916   -7.314  -2.533  1.00 0.00 ? 108 GLN A C    6  
ATOM 11278 O O    . GLN A 1 108 ? 9.342   -6.399  -3.123  1.00 0.00 ? 108 GLN A O    6  
ATOM 11279 C CB   . GLN A 1 108 ? 10.707  -7.397  -0.161  1.00 0.00 ? 108 GLN A CB   6  
ATOM 11280 C CG   . GLN A 1 108 ? 11.315  -6.016  -0.344  1.00 0.00 ? 108 GLN A CG   6  
ATOM 11281 C CD   . GLN A 1 108 ? 12.771  -5.959  0.075   1.00 0.00 ? 108 GLN A CD   6  
ATOM 11282 O OE1  . GLN A 1 108 ? 13.446  -6.985  0.157   1.00 0.00 ? 108 GLN A OE1  6  
ATOM 11283 N NE2  . GLN A 1 108 ? 13.262  -4.755  0.344   1.00 0.00 ? 108 GLN A NE2  6  
ATOM 11284 H H    . GLN A 1 108 ? 9.641   -9.682  -0.424  1.00 0.00 ? 108 GLN A H    6  
ATOM 11285 H HA   . GLN A 1 108 ? 8.691   -7.077  -0.803  1.00 0.00 ? 108 GLN A HA   6  
ATOM 11286 H HB2  . GLN A 1 108 ? 10.363  -7.484  0.859   1.00 0.00 ? 108 GLN A HB2  6  
ATOM 11287 H HB3  . GLN A 1 108 ? 11.479  -8.132  -0.336  1.00 0.00 ? 108 GLN A HB3  6  
ATOM 11288 H HG2  . GLN A 1 108 ? 11.246  -5.742  -1.387  1.00 0.00 ? 108 GLN A HG2  6  
ATOM 11289 H HG3  . GLN A 1 108 ? 10.756  -5.310  0.250   1.00 0.00 ? 108 GLN A HG3  6  
ATOM 11290 H HE21 . GLN A 1 108 ? 12.665  -3.982  0.259   1.00 0.00 ? 108 GLN A HE21 6  
ATOM 11291 H HE22 . GLN A 1 108 ? 14.200  -4.689  0.619   1.00 0.00 ? 108 GLN A HE22 6  
ATOM 11292 N N    . GLU A 1 109 ? 10.889  -8.034  -3.084  1.00 0.00 ? 109 GLU A N    6  
ATOM 11293 C CA   . GLU A 1 109 ? 11.347  -7.783  -4.445  1.00 0.00 ? 109 GLU A CA   6  
ATOM 11294 C C    . GLU A 1 109 ? 10.193  -7.897  -5.438  1.00 0.00 ? 109 GLU A C    6  
ATOM 11295 O O    . GLU A 1 109 ? 10.007  -7.032  -6.292  1.00 0.00 ? 109 GLU A O    6  
ATOM 11296 C CB   . GLU A 1 109 ? 12.458  -8.765  -4.823  1.00 0.00 ? 109 GLU A CB   6  
ATOM 11297 C CG   . GLU A 1 109 ? 11.943  -10.105 -5.320  1.00 0.00 ? 109 GLU A CG   6  
ATOM 11298 C CD   . GLU A 1 109 ? 13.059  -11.036 -5.751  1.00 0.00 ? 109 GLU A CD   6  
ATOM 11299 O OE1  . GLU A 1 109 ? 13.483  -10.950 -6.923  1.00 0.00 ? 109 GLU A OE1  6  
ATOM 11300 O OE2  . GLU A 1 109 ? 13.510  -11.849 -4.917  1.00 0.00 ? 109 GLU A OE2  6  
ATOM 11301 H H    . GLU A 1 109 ? 11.308  -8.750  -2.563  1.00 0.00 ? 109 GLU A H    6  
ATOM 11302 H HA   . GLU A 1 109 ? 11.739  -6.778  -4.483  1.00 0.00 ? 109 GLU A HA   6  
ATOM 11303 H HB2  . GLU A 1 109 ? 13.063  -8.323  -5.601  1.00 0.00 ? 109 GLU A HB2  6  
ATOM 11304 H HB3  . GLU A 1 109 ? 13.076  -8.940  -3.955  1.00 0.00 ? 109 GLU A HB3  6  
ATOM 11305 H HG2  . GLU A 1 109 ? 11.386  -10.579 -4.526  1.00 0.00 ? 109 GLU A HG2  6  
ATOM 11306 H HG3  . GLU A 1 109 ? 11.290  -9.935  -6.163  1.00 0.00 ? 109 GLU A HG3  6  
ATOM 11307 N N    . ALA A 1 110 ? 9.421   -8.972  -5.317  1.00 0.00 ? 110 ALA A N    6  
ATOM 11308 C CA   . ALA A 1 110 ? 8.285   -9.200  -6.201  1.00 0.00 ? 110 ALA A CA   6  
ATOM 11309 C C    . ALA A 1 110 ? 7.307   -8.032  -6.151  1.00 0.00 ? 110 ALA A C    6  
ATOM 11310 O O    . ALA A 1 110 ? 6.931   -7.479  -7.185  1.00 0.00 ? 110 ALA A O    6  
ATOM 11311 C CB   . ALA A 1 110 ? 7.581   -10.498 -5.832  1.00 0.00 ? 110 ALA A CB   6  
ATOM 11312 H H    . ALA A 1 110 ? 9.620   -9.627  -4.616  1.00 0.00 ? 110 ALA A H    6  
ATOM 11313 H HA   . ALA A 1 110 ? 8.662   -9.298  -7.210  1.00 0.00 ? 110 ALA A HA   6  
ATOM 11314 H HB1  . ALA A 1 110 ? 7.199   -10.967 -6.727  1.00 0.00 ? 110 ALA A HB1  6  
ATOM 11315 H HB2  . ALA A 1 110 ? 8.282   -11.162 -5.348  1.00 0.00 ? 110 ALA A HB2  6  
ATOM 11316 H HB3  . ALA A 1 110 ? 6.763   -10.284 -5.160  1.00 0.00 ? 110 ALA A HB3  6  
ATOM 11317 N N    . TRP A 1 111 ? 6.897   -7.662  -4.943  1.00 0.00 ? 111 TRP A N    6  
ATOM 11318 C CA   . TRP A 1 111 ? 5.961   -6.559  -4.758  1.00 0.00 ? 111 TRP A CA   6  
ATOM 11319 C C    . TRP A 1 111 ? 6.434   -5.314  -5.501  1.00 0.00 ? 111 TRP A C    6  
ATOM 11320 O O    . TRP A 1 111 ? 5.644   -4.636  -6.159  1.00 0.00 ? 111 TRP A O    6  
ATOM 11321 C CB   . TRP A 1 111 ? 5.795   -6.247  -3.270  1.00 0.00 ? 111 TRP A CB   6  
ATOM 11322 C CG   . TRP A 1 111 ? 4.680   -7.013  -2.624  1.00 0.00 ? 111 TRP A CG   6  
ATOM 11323 C CD1  . TRP A 1 111 ? 4.794   -7.948  -1.635  1.00 0.00 ? 111 TRP A CD1  6  
ATOM 11324 C CD2  . TRP A 1 111 ? 3.284   -6.910  -2.923  1.00 0.00 ? 111 TRP A CD2  6  
ATOM 11325 N NE1  . TRP A 1 111 ? 3.552   -8.433  -1.301  1.00 0.00 ? 111 TRP A NE1  6  
ATOM 11326 C CE2  . TRP A 1 111 ? 2.609   -7.811  -2.076  1.00 0.00 ? 111 TRP A CE2  6  
ATOM 11327 C CE3  . TRP A 1 111 ? 2.538   -6.142  -3.821  1.00 0.00 ? 111 TRP A CE3  6  
ATOM 11328 C CZ2  . TRP A 1 111 ? 1.226   -7.965  -2.105  1.00 0.00 ? 111 TRP A CZ2  6  
ATOM 11329 C CZ3  . TRP A 1 111 ? 1.165   -6.296  -3.848  1.00 0.00 ? 111 TRP A CZ3  6  
ATOM 11330 C CH2  . TRP A 1 111 ? 0.520   -7.201  -2.994  1.00 0.00 ? 111 TRP A CH2  6  
ATOM 11331 H H    . TRP A 1 111 ? 7.232   -8.141  -4.156  1.00 0.00 ? 111 TRP A H    6  
ATOM 11332 H HA   . TRP A 1 111 ? 5.007   -6.864  -5.161  1.00 0.00 ? 111 TRP A HA   6  
ATOM 11333 H HB2  . TRP A 1 111 ? 6.711   -6.492  -2.753  1.00 0.00 ? 111 TRP A HB2  6  
ATOM 11334 H HB3  . TRP A 1 111 ? 5.589   -5.193  -3.151  1.00 0.00 ? 111 TRP A HB3  6  
ATOM 11335 H HD1  . TRP A 1 111 ? 5.729   -8.253  -1.191  1.00 0.00 ? 111 TRP A HD1  6  
ATOM 11336 H HE1  . TRP A 1 111 ? 3.372   -9.112  -0.618  1.00 0.00 ? 111 TRP A HE1  6  
ATOM 11337 H HE3  . TRP A 1 111 ? 3.017   -5.440  -4.487  1.00 0.00 ? 111 TRP A HE3  6  
ATOM 11338 H HZ2  . TRP A 1 111 ? 0.714   -8.657  -1.452  1.00 0.00 ? 111 TRP A HZ2  6  
ATOM 11339 H HZ3  . TRP A 1 111 ? 0.572   -5.712  -4.537  1.00 0.00 ? 111 TRP A HZ3  6  
ATOM 11340 H HH2  . TRP A 1 111 ? -0.554  -7.288  -3.050  1.00 0.00 ? 111 TRP A HH2  6  
ATOM 11341 N N    . ILE A 1 112 ? 7.724   -5.018  -5.391  1.00 0.00 ? 112 ILE A N    6  
ATOM 11342 C CA   . ILE A 1 112 ? 8.301   -3.855  -6.054  1.00 0.00 ? 112 ILE A CA   6  
ATOM 11343 C C    . ILE A 1 112 ? 8.173   -3.967  -7.569  1.00 0.00 ? 112 ILE A C    6  
ATOM 11344 O O    . ILE A 1 112 ? 7.922   -2.976  -8.255  1.00 0.00 ? 112 ILE A O    6  
ATOM 11345 C CB   . ILE A 1 112 ? 9.786   -3.677  -5.687  1.00 0.00 ? 112 ILE A CB   6  
ATOM 11346 C CG1  . ILE A 1 112 ? 9.924   -3.234  -4.229  1.00 0.00 ? 112 ILE A CG1  6  
ATOM 11347 C CG2  . ILE A 1 112 ? 10.443  -2.668  -6.618  1.00 0.00 ? 112 ILE A CG2  6  
ATOM 11348 C CD1  . ILE A 1 112 ? 11.351  -3.241  -3.728  1.00 0.00 ? 112 ILE A CD1  6  
ATOM 11349 H H    . ILE A 1 112 ? 8.303   -5.597  -4.852  1.00 0.00 ? 112 ILE A H    6  
ATOM 11350 H HA   . ILE A 1 112 ? 7.761   -2.981  -5.721  1.00 0.00 ? 112 ILE A HA   6  
ATOM 11351 H HB   . ILE A 1 112 ? 10.282  -4.626  -5.816  1.00 0.00 ? 112 ILE A HB   6  
ATOM 11352 H HG12 . ILE A 1 112 ? 9.542   -2.230  -4.127  1.00 0.00 ? 112 ILE A HG12 6  
ATOM 11353 H HG13 . ILE A 1 112 ? 9.348   -3.899  -3.603  1.00 0.00 ? 112 ILE A HG13 6  
ATOM 11354 H HG21 . ILE A 1 112 ? 10.345  -3.004  -7.640  1.00 0.00 ? 112 ILE A HG21 6  
ATOM 11355 H HG22 . ILE A 1 112 ? 9.961   -1.709  -6.507  1.00 0.00 ? 112 ILE A HG22 6  
ATOM 11356 H HG23 . ILE A 1 112 ? 11.490  -2.576  -6.368  1.00 0.00 ? 112 ILE A HG23 6  
ATOM 11357 H HD11 . ILE A 1 112 ? 11.689  -4.262  -3.620  1.00 0.00 ? 112 ILE A HD11 6  
ATOM 11358 H HD12 . ILE A 1 112 ? 11.985  -2.727  -4.436  1.00 0.00 ? 112 ILE A HD12 6  
ATOM 11359 H HD13 . ILE A 1 112 ? 11.400  -2.743  -2.772  1.00 0.00 ? 112 ILE A HD13 6  
ATOM 11360 N N    . GLN A 1 113 ? 8.345   -5.180  -8.085  1.00 0.00 ? 113 GLN A N    6  
ATOM 11361 C CA   . GLN A 1 113 ? 8.247   -5.420  -9.520  1.00 0.00 ? 113 GLN A CA   6  
ATOM 11362 C C    . GLN A 1 113 ? 6.896   -4.962  -10.058 1.00 0.00 ? 113 GLN A C    6  
ATOM 11363 O O    . GLN A 1 113 ? 6.824   -4.266  -11.071 1.00 0.00 ? 113 GLN A O    6  
ATOM 11364 C CB   . GLN A 1 113 ? 8.454   -6.905  -9.824  1.00 0.00 ? 113 GLN A CB   6  
ATOM 11365 C CG   . GLN A 1 113 ? 9.801   -7.439  -9.365  1.00 0.00 ? 113 GLN A CG   6  
ATOM 11366 C CD   . GLN A 1 113 ? 10.304  -8.577  -10.232 1.00 0.00 ? 113 GLN A CD   6  
ATOM 11367 O OE1  . GLN A 1 113 ? 9.784   -8.819  -11.322 1.00 0.00 ? 113 GLN A OE1  6  
ATOM 11368 N NE2  . GLN A 1 113 ? 11.321  -9.282  -9.752  1.00 0.00 ? 113 GLN A NE2  6  
ATOM 11369 H H    . GLN A 1 113 ? 8.543   -5.929  -7.487  1.00 0.00 ? 113 GLN A H    6  
ATOM 11370 H HA   . GLN A 1 113 ? 9.026   -4.851  -10.005 1.00 0.00 ? 113 GLN A HA   6  
ATOM 11371 H HB2  . GLN A 1 113 ? 7.679   -7.473  -9.331  1.00 0.00 ? 113 GLN A HB2  6  
ATOM 11372 H HB3  . GLN A 1 113 ? 8.376   -7.056  -10.891 1.00 0.00 ? 113 GLN A HB3  6  
ATOM 11373 H HG2  . GLN A 1 113 ? 10.522  -6.636  -9.399  1.00 0.00 ? 113 GLN A HG2  6  
ATOM 11374 H HG3  . GLN A 1 113 ? 9.706   -7.794  -8.350  1.00 0.00 ? 113 GLN A HG3  6  
ATOM 11375 H HE21 . GLN A 1 113 ? 11.684  -9.033  -8.875  1.00 0.00 ? 113 GLN A HE21 6  
ATOM 11376 H HE22 . GLN A 1 113 ? 11.665  -10.024 -10.290 1.00 0.00 ? 113 GLN A HE22 6  
ATOM 11377 N N    . ALA A 1 114 ? 5.827   -5.356  -9.373  1.00 0.00 ? 114 ALA A N    6  
ATOM 11378 C CA   . ALA A 1 114 ? 4.479   -4.984  -9.782  1.00 0.00 ? 114 ALA A CA   6  
ATOM 11379 C C    . ALA A 1 114 ? 4.170   -3.539  -9.405  1.00 0.00 ? 114 ALA A C    6  
ATOM 11380 O O    . ALA A 1 114 ? 3.735   -2.749  -10.243 1.00 0.00 ? 114 ALA A O    6  
ATOM 11381 C CB   . ALA A 1 114 ? 3.459   -5.924  -9.156  1.00 0.00 ? 114 ALA A CB   6  
ATOM 11382 H H    . ALA A 1 114 ? 5.949   -5.909  -8.574  1.00 0.00 ? 114 ALA A H    6  
ATOM 11383 H HA   . ALA A 1 114 ? 4.415   -5.087  -10.856 1.00 0.00 ? 114 ALA A HA   6  
ATOM 11384 H HB1  . ALA A 1 114 ? 2.513   -5.413  -9.055  1.00 0.00 ? 114 ALA A HB1  6  
ATOM 11385 H HB2  . ALA A 1 114 ? 3.335   -6.791  -9.787  1.00 0.00 ? 114 ALA A HB2  6  
ATOM 11386 H HB3  . ALA A 1 114 ? 3.807   -6.234  -8.182  1.00 0.00 ? 114 ALA A HB3  6  
ATOM 11387 N N    . MET A 1 115 ? 4.398   -3.200  -8.141  1.00 0.00 ? 115 MET A N    6  
ATOM 11388 C CA   . MET A 1 115 ? 4.144   -1.849  -7.654  1.00 0.00 ? 115 MET A CA   6  
ATOM 11389 C C    . MET A 1 115 ? 5.055   -0.841  -8.348  1.00 0.00 ? 115 MET A C    6  
ATOM 11390 O O    . MET A 1 115 ? 4.586   0.064   -9.036  1.00 0.00 ? 115 MET A O    6  
ATOM 11391 C CB   . MET A 1 115 ? 4.350   -1.782  -6.140  1.00 0.00 ? 115 MET A CB   6  
ATOM 11392 C CG   . MET A 1 115 ? 3.122   -2.188  -5.341  1.00 0.00 ? 115 MET A CG   6  
ATOM 11393 S SD   . MET A 1 115 ? 3.144   -1.543  -3.657  1.00 0.00 ? 115 MET A SD   6  
ATOM 11394 C CE   . MET A 1 115 ? 2.724   -3.014  -2.726  1.00 0.00 ? 115 MET A CE   6  
ATOM 11395 H H    . MET A 1 115 ? 4.746   -3.874  -7.520  1.00 0.00 ? 115 MET A H    6  
ATOM 11396 H HA   . MET A 1 115 ? 3.117   -1.603  -7.880  1.00 0.00 ? 115 MET A HA   6  
ATOM 11397 H HB2  . MET A 1 115 ? 5.162   -2.440  -5.869  1.00 0.00 ? 115 MET A HB2  6  
ATOM 11398 H HB3  . MET A 1 115 ? 4.611   -0.770  -5.868  1.00 0.00 ? 115 MET A HB3  6  
ATOM 11399 H HG2  . MET A 1 115 ? 2.242   -1.813  -5.842  1.00 0.00 ? 115 MET A HG2  6  
ATOM 11400 H HG3  . MET A 1 115 ? 3.078   -3.266  -5.299  1.00 0.00 ? 115 MET A HG3  6  
ATOM 11401 H HE1  . MET A 1 115 ? 2.316   -3.759  -3.394  1.00 0.00 ? 115 MET A HE1  6  
ATOM 11402 H HE2  . MET A 1 115 ? 3.611   -3.405  -2.250  1.00 0.00 ? 115 MET A HE2  6  
ATOM 11403 H HE3  . MET A 1 115 ? 1.991   -2.765  -1.973  1.00 0.00 ? 115 MET A HE3  6  
ATOM 11404 N N    . GLY A 1 116 ? 6.362   -1.005  -8.162  1.00 0.00 ? 116 GLY A N    6  
ATOM 11405 C CA   . GLY A 1 116 ? 7.317   -0.102  -8.776  1.00 0.00 ? 116 GLY A CA   6  
ATOM 11406 C C    . GLY A 1 116 ? 6.924   0.286   -10.188 1.00 0.00 ? 116 GLY A C    6  
ATOM 11407 O O    . GLY A 1 116 ? 6.889   1.469   -10.526 1.00 0.00 ? 116 GLY A O    6  
ATOM 11408 H H    . GLY A 1 116 ? 6.679   -1.745  -7.603  1.00 0.00 ? 116 GLY A H    6  
ATOM 11409 H HA2  . GLY A 1 116 ? 7.389   0.792   -8.175  1.00 0.00 ? 116 GLY A HA2  6  
ATOM 11410 H HA3  . GLY A 1 116 ? 8.284   -0.584  -8.804  1.00 0.00 ? 116 GLY A HA3  6  
ATOM 11411 N N    . GLU A 1 117 ? 6.629   -0.713  -11.014 1.00 0.00 ? 117 GLU A N    6  
ATOM 11412 C CA   . GLU A 1 117 ? 6.238   -0.469  -12.397 1.00 0.00 ? 117 GLU A CA   6  
ATOM 11413 C C    . GLU A 1 117 ? 4.940   0.330   -12.464 1.00 0.00 ? 117 GLU A C    6  
ATOM 11414 O O    . GLU A 1 117 ? 4.907   1.438   -12.999 1.00 0.00 ? 117 GLU A O    6  
ATOM 11415 C CB   . GLU A 1 117 ? 6.074   -1.793  -13.146 1.00 0.00 ? 117 GLU A CB   6  
ATOM 11416 C CG   . GLU A 1 117 ? 7.393   -2.446  -13.524 1.00 0.00 ? 117 GLU A CG   6  
ATOM 11417 C CD   . GLU A 1 117 ? 7.213   -3.617  -14.470 1.00 0.00 ? 117 GLU A CD   6  
ATOM 11418 O OE1  . GLU A 1 117 ? 7.160   -3.388  -15.697 1.00 0.00 ? 117 GLU A OE1  6  
ATOM 11419 O OE2  . GLU A 1 117 ? 7.127   -4.764  -13.984 1.00 0.00 ? 117 GLU A OE2  6  
ATOM 11420 H H    . GLU A 1 117 ? 6.675   -1.635  -10.685 1.00 0.00 ? 117 GLU A H    6  
ATOM 11421 H HA   . GLU A 1 117 ? 7.024   0.104   -12.867 1.00 0.00 ? 117 GLU A HA   6  
ATOM 11422 H HB2  . GLU A 1 117 ? 5.522   -2.480  -12.521 1.00 0.00 ? 117 GLU A HB2  6  
ATOM 11423 H HB3  . GLU A 1 117 ? 5.513   -1.614  -14.051 1.00 0.00 ? 117 GLU A HB3  6  
ATOM 11424 H HG2  . GLU A 1 117 ? 8.020   -1.709  -14.003 1.00 0.00 ? 117 GLU A HG2  6  
ATOM 11425 H HG3  . GLU A 1 117 ? 7.877   -2.799  -12.625 1.00 0.00 ? 117 GLU A HG3  6  
ATOM 11426 N N    . ALA A 1 118 ? 3.872   -0.241  -11.916 1.00 0.00 ? 118 ALA A N    6  
ATOM 11427 C CA   . ALA A 1 118 ? 2.572   0.417   -11.911 1.00 0.00 ? 118 ALA A CA   6  
ATOM 11428 C C    . ALA A 1 118 ? 2.680   1.842   -11.378 1.00 0.00 ? 118 ALA A C    6  
ATOM 11429 O O    . ALA A 1 118 ? 1.863   2.702   -11.709 1.00 0.00 ? 118 ALA A O    6  
ATOM 11430 C CB   . ALA A 1 118 ? 1.578   -0.384  -11.084 1.00 0.00 ? 118 ALA A CB   6  
ATOM 11431 H H    . ALA A 1 118 ? 3.962   -1.125  -11.504 1.00 0.00 ? 118 ALA A H    6  
ATOM 11432 H HA   . ALA A 1 118 ? 2.211   0.451   -12.929 1.00 0.00 ? 118 ALA A HA   6  
ATOM 11433 H HB1  . ALA A 1 118 ? 0.938   -0.953  -11.741 1.00 0.00 ? 118 ALA A HB1  6  
ATOM 11434 H HB2  . ALA A 1 118 ? 2.114   -1.058  -10.431 1.00 0.00 ? 118 ALA A HB2  6  
ATOM 11435 H HB3  . ALA A 1 118 ? 0.977   0.290   -10.491 1.00 0.00 ? 118 ALA A HB3  6  
ATOM 11436 N N    . ALA A 1 119 ? 3.691   2.085   -10.552 1.00 0.00 ? 119 ALA A N    6  
ATOM 11437 C CA   . ALA A 1 119 ? 3.906   3.406   -9.974  1.00 0.00 ? 119 ALA A CA   6  
ATOM 11438 C C    . ALA A 1 119 ? 4.567   4.343   -10.979 1.00 0.00 ? 119 ALA A C    6  
ATOM 11439 O O    . ALA A 1 119 ? 4.144   5.487   -11.147 1.00 0.00 ? 119 ALA A O    6  
ATOM 11440 C CB   . ALA A 1 119 ? 4.751   3.300   -8.714  1.00 0.00 ? 119 ALA A CB   6  
ATOM 11441 H H    . ALA A 1 119 ? 4.309   1.358   -10.326 1.00 0.00 ? 119 ALA A H    6  
ATOM 11442 H HA   . ALA A 1 119 ? 2.943   3.811   -9.700  1.00 0.00 ? 119 ALA A HA   6  
ATOM 11443 H HB1  . ALA A 1 119 ? 5.597   3.966   -8.790  1.00 0.00 ? 119 ALA A HB1  6  
ATOM 11444 H HB2  . ALA A 1 119 ? 4.153   3.574   -7.857  1.00 0.00 ? 119 ALA A HB2  6  
ATOM 11445 H HB3  . ALA A 1 119 ? 5.101   2.285   -8.599  1.00 0.00 ? 119 ALA A HB3  6  
ATOM 11446 N N    . ARG A 1 120 ? 5.607   3.852   -11.645 1.00 0.00 ? 120 ARG A N    6  
ATOM 11447 C CA   . ARG A 1 120 ? 6.328   4.647   -12.632 1.00 0.00 ? 120 ARG A CA   6  
ATOM 11448 C C    . ARG A 1 120 ? 5.360   5.459   -13.487 1.00 0.00 ? 120 ARG A C    6  
ATOM 11449 O O    . ARG A 1 120 ? 4.176   5.137   -13.579 1.00 0.00 ? 120 ARG A O    6  
ATOM 11450 C CB   . ARG A 1 120 ? 7.178   3.741   -13.525 1.00 0.00 ? 120 ARG A CB   6  
ATOM 11451 C CG   . ARG A 1 120 ? 8.587   3.518   -13.001 1.00 0.00 ? 120 ARG A CG   6  
ATOM 11452 C CD   . ARG A 1 120 ? 9.209   2.262   -13.592 1.00 0.00 ? 120 ARG A CD   6  
ATOM 11453 N NE   . ARG A 1 120 ? 10.668  2.324   -13.598 1.00 0.00 ? 120 ARG A NE   6  
ATOM 11454 C CZ   . ARG A 1 120 ? 11.438  1.452   -14.240 1.00 0.00 ? 120 ARG A CZ   6  
ATOM 11455 N NH1  . ARG A 1 120 ? 10.890  0.457   -14.923 1.00 0.00 ? 120 ARG A NH1  6  
ATOM 11456 N NH2  . ARG A 1 120 ? 12.758  1.575   -14.199 1.00 0.00 ? 120 ARG A NH2  6  
ATOM 11457 H H    . ARG A 1 120 ? 5.898   2.932   -11.467 1.00 0.00 ? 120 ARG A H    6  
ATOM 11458 H HA   . ARG A 1 120 ? 6.978   5.326   -12.100 1.00 0.00 ? 120 ARG A HA   6  
ATOM 11459 H HB2  . ARG A 1 120 ? 6.693   2.780   -13.609 1.00 0.00 ? 120 ARG A HB2  6  
ATOM 11460 H HB3  . ARG A 1 120 ? 7.248   4.187   -14.506 1.00 0.00 ? 120 ARG A HB3  6  
ATOM 11461 H HG2  . ARG A 1 120 ? 9.199   4.368   -13.267 1.00 0.00 ? 120 ARG A HG2  6  
ATOM 11462 H HG3  . ARG A 1 120 ? 8.550   3.420   -11.927 1.00 0.00 ? 120 ARG A HG3  6  
ATOM 11463 H HD2  . ARG A 1 120 ? 8.897   1.412   -13.003 1.00 0.00 ? 120 ARG A HD2  6  
ATOM 11464 H HD3  . ARG A 1 120 ? 8.858   2.146   -14.606 1.00 0.00 ? 120 ARG A HD3  6  
ATOM 11465 H HE   . ARG A 1 120 ? 11.093  3.052   -13.099 1.00 0.00 ? 120 ARG A HE   6  
ATOM 11466 H HH11 . ARG A 1 120 ? 9.895   0.362   -14.957 1.00 0.00 ? 120 ARG A HH11 6  
ATOM 11467 H HH12 . ARG A 1 120 ? 11.472  -0.197  -15.407 1.00 0.00 ? 120 ARG A HH12 6  
ATOM 11468 H HH21 . ARG A 1 120 ? 13.174  2.325   -13.684 1.00 0.00 ? 120 ARG A HH21 6  
ATOM 11469 H HH22 . ARG A 1 120 ? 13.336  0.919   -14.682 1.00 0.00 ? 120 ARG A HH22 6  
ATOM 11470 N N    . VAL A 1 121 ? 5.873   6.516   -14.110 1.00 0.00 ? 121 VAL A N    6  
ATOM 11471 C CA   . VAL A 1 121 ? 5.055   7.374   -14.958 1.00 0.00 ? 121 VAL A CA   6  
ATOM 11472 C C    . VAL A 1 121 ? 5.753   7.667   -16.281 1.00 0.00 ? 121 VAL A C    6  
ATOM 11473 O O    . VAL A 1 121 ? 5.785   8.809   -16.738 1.00 0.00 ? 121 VAL A O    6  
ATOM 11474 C CB   . VAL A 1 121 ? 4.727   8.706   -14.257 1.00 0.00 ? 121 VAL A CB   6  
ATOM 11475 C CG1  . VAL A 1 121 ? 3.726   9.508   -15.076 1.00 0.00 ? 121 VAL A CG1  6  
ATOM 11476 C CG2  . VAL A 1 121 ? 4.198   8.454   -12.854 1.00 0.00 ? 121 VAL A CG2  6  
ATOM 11477 H H    . VAL A 1 121 ? 6.824   6.722   -13.997 1.00 0.00 ? 121 VAL A H    6  
ATOM 11478 H HA   . VAL A 1 121 ? 4.126   6.859   -15.158 1.00 0.00 ? 121 VAL A HA   6  
ATOM 11479 H HB   . VAL A 1 121 ? 5.637   9.282   -14.179 1.00 0.00 ? 121 VAL A HB   6  
ATOM 11480 H HG11 . VAL A 1 121 ? 2.743   9.410   -14.639 1.00 0.00 ? 121 VAL A HG11 6  
ATOM 11481 H HG12 . VAL A 1 121 ? 4.017   10.549  -15.082 1.00 0.00 ? 121 VAL A HG12 6  
ATOM 11482 H HG13 . VAL A 1 121 ? 3.708   9.133   -16.089 1.00 0.00 ? 121 VAL A HG13 6  
ATOM 11483 H HG21 . VAL A 1 121 ? 4.213   7.394   -12.648 1.00 0.00 ? 121 VAL A HG21 6  
ATOM 11484 H HG22 . VAL A 1 121 ? 4.821   8.969   -12.137 1.00 0.00 ? 121 VAL A HG22 6  
ATOM 11485 H HG23 . VAL A 1 121 ? 3.185   8.820   -12.778 1.00 0.00 ? 121 VAL A HG23 6  
ATOM 11486 N N    . GLN A 1 122 ? 6.313   6.627   -16.891 1.00 0.00 ? 122 GLN A N    6  
ATOM 11487 C CA   . GLN A 1 122 ? 7.012   6.773   -18.162 1.00 0.00 ? 122 GLN A CA   6  
ATOM 11488 C C    . GLN A 1 122 ? 6.057   7.237   -19.258 1.00 0.00 ? 122 GLN A C    6  
ATOM 11489 O O    . GLN A 1 122 ? 5.074   6.562   -19.565 1.00 0.00 ? 122 GLN A O    6  
ATOM 11490 C CB   . GLN A 1 122 ? 7.665   5.450   -18.565 1.00 0.00 ? 122 GLN A CB   6  
ATOM 11491 C CG   . GLN A 1 122 ? 8.907   5.114   -17.756 1.00 0.00 ? 122 GLN A CG   6  
ATOM 11492 C CD   . GLN A 1 122 ? 9.897   6.261   -17.704 1.00 0.00 ? 122 GLN A CD   6  
ATOM 11493 O OE1  . GLN A 1 122 ? 10.735  6.414   -18.594 1.00 0.00 ? 122 GLN A OE1  6  
ATOM 11494 N NE2  . GLN A 1 122 ? 9.807   7.075   -16.659 1.00 0.00 ? 122 GLN A NE2  6  
ATOM 11495 H H    . GLN A 1 122 ? 6.254   5.742   -16.477 1.00 0.00 ? 122 GLN A H    6  
ATOM 11496 H HA   . GLN A 1 122 ? 7.781   7.519   -18.033 1.00 0.00 ? 122 GLN A HA   6  
ATOM 11497 H HB2  . GLN A 1 122 ? 6.948   4.653   -18.431 1.00 0.00 ? 122 GLN A HB2  6  
ATOM 11498 H HB3  . GLN A 1 122 ? 7.943   5.501   -19.607 1.00 0.00 ? 122 GLN A HB3  6  
ATOM 11499 H HG2  . GLN A 1 122 ? 8.610   4.870   -16.747 1.00 0.00 ? 122 GLN A HG2  6  
ATOM 11500 H HG3  . GLN A 1 122 ? 9.392   4.259   -18.204 1.00 0.00 ? 122 GLN A HG3  6  
ATOM 11501 H HE21 . GLN A 1 122 ? 9.116   6.891   -15.988 1.00 0.00 ? 122 GLN A HE21 6  
ATOM 11502 H HE22 . GLN A 1 122 ? 10.435  7.824   -16.600 1.00 0.00 ? 122 GLN A HE22 6  
ATOM 11503 N N    . GLY A 1 1   ? -30.089 -3.731  -24.187 1.00 0.00 ? 1   GLY A N    7  
ATOM 11504 C CA   . GLY A 1 1   ? -29.881 -2.549  -23.371 1.00 0.00 ? 1   GLY A CA   7  
ATOM 11505 C C    . GLY A 1 1   ? -28.825 -2.760  -22.305 1.00 0.00 ? 1   GLY A C    7  
ATOM 11506 O O    . GLY A 1 1   ? -28.620 -3.880  -21.837 1.00 0.00 ? 1   GLY A O    7  
ATOM 11507 H H1   . GLY A 1 1   ? -29.363 -4.068  -24.752 1.00 0.00 ? 1   GLY A H1   7  
ATOM 11508 H HA2  . GLY A 1 1   ? -29.575 -1.733  -24.010 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11509 H HA3  . GLY A 1 1   ? -30.813 -2.288  -22.892 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11510 N N    . SER A 1 2   ? -28.151 -1.681  -21.920 1.00 0.00 ? 2   SER A N    7  
ATOM 11511 C CA   . SER A 1 2   ? -27.106 -1.754  -20.905 1.00 0.00 ? 2   SER A CA   7  
ATOM 11512 C C    . SER A 1 2   ? -26.849 -0.382  -20.290 1.00 0.00 ? 2   SER A C    7  
ATOM 11513 O O    . SER A 1 2   ? -27.384 0.627   -20.750 1.00 0.00 ? 2   SER A O    7  
ATOM 11514 C CB   . SER A 1 2   ? -25.813 -2.302  -21.513 1.00 0.00 ? 2   SER A CB   7  
ATOM 11515 O OG   . SER A 1 2   ? -26.039 -3.545  -22.156 1.00 0.00 ? 2   SER A OG   7  
ATOM 11516 H H    . SER A 1 2   ? -28.360 -0.815  -22.330 1.00 0.00 ? 2   SER A H    7  
ATOM 11517 H HA   . SER A 1 2   ? -27.443 -2.426  -20.130 1.00 0.00 ? 2   SER A HA   7  
ATOM 11518 H HB2  . SER A 1 2   ? -25.433 -1.599  -22.238 1.00 0.00 ? 2   SER A HB2  7  
ATOM 11519 H HB3  . SER A 1 2   ? -25.082 -2.443  -20.730 1.00 0.00 ? 2   SER A HB3  7  
ATOM 11520 H HG   . SER A 1 2   ? -26.564 -3.405  -22.947 1.00 0.00 ? 2   SER A HG   7  
ATOM 11521 N N    . SER A 1 3   ? -26.028 -0.353  -19.245 1.00 0.00 ? 3   SER A N    7  
ATOM 11522 C CA   . SER A 1 3   ? -25.703 0.894   -18.563 1.00 0.00 ? 3   SER A CA   7  
ATOM 11523 C C    . SER A 1 3   ? -24.496 1.568   -19.208 1.00 0.00 ? 3   SER A C    7  
ATOM 11524 O O    . SER A 1 3   ? -23.351 1.275   -18.867 1.00 0.00 ? 3   SER A O    7  
ATOM 11525 C CB   . SER A 1 3   ? -25.423 0.632   -17.082 1.00 0.00 ? 3   SER A CB   7  
ATOM 11526 O OG   . SER A 1 3   ? -26.629 0.465   -16.357 1.00 0.00 ? 3   SER A OG   7  
ATOM 11527 H H    . SER A 1 3   ? -25.633 -1.191  -18.925 1.00 0.00 ? 3   SER A H    7  
ATOM 11528 H HA   . SER A 1 3   ? -26.555 1.551   -18.648 1.00 0.00 ? 3   SER A HA   7  
ATOM 11529 H HB2  . SER A 1 3   ? -24.831 -0.265  -16.983 1.00 0.00 ? 3   SER A HB2  7  
ATOM 11530 H HB3  . SER A 1 3   ? -24.880 1.469   -16.667 1.00 0.00 ? 3   SER A HB3  7  
ATOM 11531 H HG   . SER A 1 3   ? -26.784 -0.469  -16.203 1.00 0.00 ? 3   SER A HG   7  
ATOM 11532 N N    . GLY A 1 4   ? -24.762 2.474   -20.145 1.00 0.00 ? 4   GLY A N    7  
ATOM 11533 C CA   . GLY A 1 4   ? -23.689 3.175   -20.825 1.00 0.00 ? 4   GLY A CA   7  
ATOM 11534 C C    . GLY A 1 4   ? -23.703 4.665   -20.546 1.00 0.00 ? 4   GLY A C    7  
ATOM 11535 O O    . GLY A 1 4   ? -23.618 5.089   -19.394 1.00 0.00 ? 4   GLY A O    7  
ATOM 11536 H H    . GLY A 1 4   ? -25.695 2.666   -20.377 1.00 0.00 ? 4   GLY A H    7  
ATOM 11537 H HA2  . GLY A 1 4   ? -22.743 2.768   -20.499 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11538 H HA3  . GLY A 1 4   ? -23.789 3.019   -21.889 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11539 N N    . SER A 1 5   ? -23.809 5.463   -21.604 1.00 0.00 ? 5   SER A N    7  
ATOM 11540 C CA   . SER A 1 5   ? -23.828 6.915   -21.469 1.00 0.00 ? 5   SER A CA   7  
ATOM 11541 C C    . SER A 1 5   ? -24.701 7.339   -20.292 1.00 0.00 ? 5   SER A C    7  
ATOM 11542 O O    . SER A 1 5   ? -25.908 7.096   -20.281 1.00 0.00 ? 5   SER A O