data_2YRZ
# 
_entry.id   2YRZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YRZ         
RCSB  RCSB027059   
WWPDB D_1000027059 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso002002365.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2YRZ 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Abe, H.'                                                1 
'Sasagawa, A.'                                           2 
'Tochio, N.'                                             3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Kigawa, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the fibronectin type III domain of human Integrin beta-4' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Abe, H.'      1 
primary 'Sasagawa, A.' 2 
primary 'Tochio, N.'   3 
primary 'Koshiba, S.'  4 
primary 'Inoue, M.'    5 
primary 'Kigawa, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Integrin beta-4' 
_entity.formula_weight             12786.035 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              fn3 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GP150, CD104 antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDL
LPNHSYVFRVRAQSQEGWGREREGVITIESQVSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDL
LPNHSYVFRVRAQSQEGWGREREGVITIESQVSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso002002365.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   SER n 
1 9   HIS n 
1 10  ASP n 
1 11  SER n 
1 12  ARG n 
1 13  LEU n 
1 14  THR n 
1 15  ALA n 
1 16  GLY n 
1 17  VAL n 
1 18  PRO n 
1 19  ASP n 
1 20  THR n 
1 21  PRO n 
1 22  THR n 
1 23  ARG n 
1 24  LEU n 
1 25  VAL n 
1 26  PHE n 
1 27  SER n 
1 28  ALA n 
1 29  LEU n 
1 30  GLY n 
1 31  PRO n 
1 32  THR n 
1 33  SER n 
1 34  LEU n 
1 35  ARG n 
1 36  VAL n 
1 37  SER n 
1 38  TRP n 
1 39  GLN n 
1 40  GLU n 
1 41  PRO n 
1 42  ARG n 
1 43  CYS n 
1 44  GLU n 
1 45  ARG n 
1 46  PRO n 
1 47  LEU n 
1 48  GLN n 
1 49  GLY n 
1 50  TYR n 
1 51  SER n 
1 52  VAL n 
1 53  GLU n 
1 54  TYR n 
1 55  GLN n 
1 56  LEU n 
1 57  LEU n 
1 58  ASN n 
1 59  GLY n 
1 60  GLY n 
1 61  GLU n 
1 62  LEU n 
1 63  HIS n 
1 64  ARG n 
1 65  LEU n 
1 66  ASN n 
1 67  ILE n 
1 68  PRO n 
1 69  ASN n 
1 70  PRO n 
1 71  ALA n 
1 72  GLN n 
1 73  THR n 
1 74  SER n 
1 75  VAL n 
1 76  VAL n 
1 77  VAL n 
1 78  GLU n 
1 79  ASP n 
1 80  LEU n 
1 81  LEU n 
1 82  PRO n 
1 83  ASN n 
1 84  HIS n 
1 85  SER n 
1 86  TYR n 
1 87  VAL n 
1 88  PHE n 
1 89  ARG n 
1 90  VAL n 
1 91  ARG n 
1 92  ALA n 
1 93  GLN n 
1 94  SER n 
1 95  GLN n 
1 96  GLU n 
1 97  GLY n 
1 98  TRP n 
1 99  GLY n 
1 100 ARG n 
1 101 GLU n 
1 102 ARG n 
1 103 GLU n 
1 104 GLY n 
1 105 VAL n 
1 106 ILE n 
1 107 THR n 
1 108 ILE n 
1 109 GLU n 
1 110 SER n 
1 111 GLN n 
1 112 VAL n 
1 113 SER n 
1 114 GLY n 
1 115 PRO n 
1 116 SER n 
1 117 SER n 
1 118 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ITGB4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050322-10 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITB4_HUMAN 
_struct_ref.pdbx_db_accession          P16144 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYV
FRVRAQSQEGWGREREGVITIESQV
;
_struct_ref.pdbx_align_begin           1518 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2YRZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 112 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16144 
_struct_ref_seq.db_align_beg                  1518 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1622 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       112 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YRZ GLY A 1   ? UNP P16144 ? ? 'EXPRESSION TAG' 1   1  
1 2YRZ SER A 2   ? UNP P16144 ? ? 'EXPRESSION TAG' 2   2  
1 2YRZ SER A 3   ? UNP P16144 ? ? 'EXPRESSION TAG' 3   3  
1 2YRZ GLY A 4   ? UNP P16144 ? ? 'EXPRESSION TAG' 4   4  
1 2YRZ SER A 5   ? UNP P16144 ? ? 'EXPRESSION TAG' 5   5  
1 2YRZ SER A 6   ? UNP P16144 ? ? 'EXPRESSION TAG' 6   6  
1 2YRZ GLY A 7   ? UNP P16144 ? ? 'EXPRESSION TAG' 7   7  
1 2YRZ SER A 113 ? UNP P16144 ? ? 'EXPRESSION TAG' 113 8  
1 2YRZ GLY A 114 ? UNP P16144 ? ? 'EXPRESSION TAG' 114 9  
1 2YRZ PRO A 115 ? UNP P16144 ? ? 'EXPRESSION TAG' 115 10 
1 2YRZ SER A 116 ? UNP P16144 ? ? 'EXPRESSION TAG' 116 11 
1 2YRZ SER A 117 ? UNP P16144 ? ? 'EXPRESSION TAG' 117 12 
1 2YRZ GLY A 118 ? UNP P16144 ? ? 'EXPRESSION TAG' 118 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.21mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2YRZ 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.entry_id                                      2YRZ 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2YRZ 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRVIEW 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9820   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.method            'SOLUTION NMR' 
_exptl.entry_id          2YRZ 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2YRZ 
_struct.title                     'Solution structure of the fibronectin type III domain of human Integrin beta-4' 
_struct.pdbx_descriptor           'Integrin beta-4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YRZ 
_struct_keywords.text            
;GP150, CD104 antigen, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
;
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 25 ? PHE A 26  ? VAL A 25 PHE A 26  
A 2 SER A 33 ? SER A 37  ? SER A 33 SER A 37  
A 3 SER A 74 ? GLU A 78  ? SER A 74 GLU A 78  
B 1 LEU A 62 ? ILE A 67  ? LEU A 62 ILE A 67  
B 2 LEU A 47 ? GLN A 55  ? LEU A 47 GLN A 55  
B 3 SER A 85 ? SER A 94  ? SER A 85 SER A 94  
B 4 TRP A 98 ? THR A 107 ? TRP A 98 THR A 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 25 ? N VAL A 25 O SER A 37  ? O SER A 37  
A 2 3 N VAL A 36 ? N VAL A 36 O VAL A 75  ? O VAL A 75  
B 1 2 O LEU A 65 ? O LEU A 65 N VAL A 52  ? N VAL A 52  
B 2 3 N GLU A 53 ? N GLU A 53 O ARG A 89  ? O ARG A 89  
B 3 4 N PHE A 88 ? N PHE A 88 O GLY A 104 ? O GLY A 104 
# 
_atom_sites.entry_id                    2YRZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 17.649  38.268  7.297   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 18.889  38.949  7.618   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 19.943  38.772  6.543   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 19.618  38.574  5.372   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 17.110  37.870  8.013   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 18.688  40.002  7.741   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 19.272  38.555  8.549   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 21.209  38.844  6.940   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 22.315  38.696  6.001   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 22.199  37.386  5.227   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 21.584  36.428  5.696   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 23.652  38.747  6.742   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 24.707  39.104  5.866   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 21.405  39.004  7.887   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 22.269  39.518  5.302   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 23.595  39.479  7.533   1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 23.863  37.775  7.164   1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 24.473  39.905  5.391   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 22.793  37.353  4.039   1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 22.754  36.163  3.197   1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 24.141  35.542  3.070   1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 25.150  36.184  3.357   1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 22.209  36.512  1.810   1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 22.937  37.581  1.230   1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 23.267  38.150  3.719   1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 22.093  35.448  3.664   1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 22.289  35.648  1.168   1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 21.172  36.802  1.896   1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 23.450  37.253  0.488   1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 24.183  34.285  2.636   1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 25.450  33.597  2.478   1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 25.540  32.345  3.329   1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 25.397  32.405  4.550   1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 23.346  33.822  2.422   1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 25.572  33.324  1.441   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 26.249  34.267  2.760   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 25.775  31.208  2.683   1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 25.878  29.935  3.388   1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 26.945  29.048  2.753   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 27.440  29.335  1.664   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 24.529  29.214  3.381   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 24.128  28.893  2.061   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 25.880  31.225  1.708   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 26.161  30.144  4.409   1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 24.609  28.302  3.952   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 23.781  29.854  3.827   1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 23.525  28.147  2.081   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 27.294  27.967  3.444   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 28.305  27.039  2.952   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 27.976  25.608  3.367   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 27.533  25.361  4.488   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 29.687  27.430  3.478   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 30.277  28.431  2.667   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 26.863  27.792  4.307   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 28.310  27.096  1.873   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 29.592  27.808  4.484   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 30.328  26.560  3.479   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 29.597  28.859  2.141   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 28.197  24.667  2.453   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 27.919  23.273  2.742   1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 27.494  22.499  1.510   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 27.322  23.075  0.436   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 28.552  24.923  1.576   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 28.809  22.817  3.152   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 27.129  23.220  3.477   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . SER A 1 8   ? 27.327  21.189  1.664   1.00 0.00 ? 8   SER A N    1  
ATOM 67    C CA   . SER A 1 8   ? 26.925  20.334  0.554   1.00 0.00 ? 8   SER A CA   1  
ATOM 68    C C    . SER A 1 8   ? 25.818  20.991  -0.265  1.00 0.00 ? 8   SER A C    1  
ATOM 69    O O    . SER A 1 8   ? 25.202  21.964  0.171   1.00 0.00 ? 8   SER A O    1  
ATOM 70    C CB   . SER A 1 8   ? 26.453  18.975  1.074   1.00 0.00 ? 8   SER A CB   1  
ATOM 71    O OG   . SER A 1 8   ? 27.536  18.227  1.600   1.00 0.00 ? 8   SER A OG   1  
ATOM 72    H H    . SER A 1 8   ? 27.480  20.788  2.546   1.00 0.00 ? 8   SER A H    1  
ATOM 73    H HA   . SER A 1 8   ? 27.787  20.188  -0.081  1.00 0.00 ? 8   SER A HA   1  
ATOM 74    H HB2  . SER A 1 8   ? 25.722  19.125  1.853   1.00 0.00 ? 8   SER A HB2  1  
ATOM 75    H HB3  . SER A 1 8   ? 26.007  18.418  0.263   1.00 0.00 ? 8   SER A HB3  1  
ATOM 76    H HG   . SER A 1 8   ? 27.303  17.295  1.617   1.00 0.00 ? 8   SER A HG   1  
ATOM 77    N N    . HIS A 1 9   ? 25.570  20.451  -1.454  1.00 0.00 ? 9   HIS A N    1  
ATOM 78    C CA   . HIS A 1 9   ? 24.536  20.983  -2.334  1.00 0.00 ? 9   HIS A CA   1  
ATOM 79    C C    . HIS A 1 9   ? 23.244  20.182  -2.202  1.00 0.00 ? 9   HIS A C    1  
ATOM 80    O O    . HIS A 1 9   ? 22.599  19.857  -3.199  1.00 0.00 ? 9   HIS A O    1  
ATOM 81    C CB   . HIS A 1 9   ? 25.014  20.966  -3.786  1.00 0.00 ? 9   HIS A CB   1  
ATOM 82    C CG   . HIS A 1 9   ? 25.721  22.220  -4.199  1.00 0.00 ? 9   HIS A CG   1  
ATOM 83    N ND1  . HIS A 1 9   ? 26.702  22.246  -5.168  1.00 0.00 ? 9   HIS A ND1  1  
ATOM 84    C CD2  . HIS A 1 9   ? 25.584  23.496  -3.770  1.00 0.00 ? 9   HIS A CD2  1  
ATOM 85    C CE1  . HIS A 1 9   ? 27.139  23.484  -5.315  1.00 0.00 ? 9   HIS A CE1  1  
ATOM 86    N NE2  . HIS A 1 9   ? 26.476  24.262  -4.479  1.00 0.00 ? 9   HIS A NE2  1  
ATOM 87    H H    . HIS A 1 9   ? 26.094  19.677  -1.746  1.00 0.00 ? 9   HIS A H    1  
ATOM 88    H HA   . HIS A 1 9   ? 24.343  22.004  -2.040  1.00 0.00 ? 9   HIS A HA   1  
ATOM 89    H HB2  . HIS A 1 9   ? 25.696  20.140  -3.924  1.00 0.00 ? 9   HIS A HB2  1  
ATOM 90    H HB3  . HIS A 1 9   ? 24.162  20.835  -4.438  1.00 0.00 ? 9   HIS A HB3  1  
ATOM 91    H HD2  . HIS A 1 9   ? 24.900  23.847  -3.010  1.00 0.00 ? 9   HIS A HD2  1  
ATOM 92    H HE1  . HIS A 1 9   ? 27.907  23.806  -6.003  1.00 0.00 ? 9   HIS A HE1  1  
ATOM 93    H HE2  . HIS A 1 9   ? 26.663  25.211  -4.322  1.00 0.00 ? 9   HIS A HE2  1  
ATOM 94    N N    . ASP A 1 10  ? 22.873  19.867  -0.966  1.00 0.00 ? 10  ASP A N    1  
ATOM 95    C CA   . ASP A 1 10  ? 21.658  19.105  -0.703  1.00 0.00 ? 10  ASP A CA   1  
ATOM 96    C C    . ASP A 1 10  ? 20.448  20.028  -0.598  1.00 0.00 ? 10  ASP A C    1  
ATOM 97    O O    . ASP A 1 10  ? 20.095  20.484  0.489   1.00 0.00 ? 10  ASP A O    1  
ATOM 98    C CB   . ASP A 1 10  ? 21.809  18.293  0.585   1.00 0.00 ? 10  ASP A CB   1  
ATOM 99    C CG   . ASP A 1 10  ? 22.075  19.169  1.793   1.00 0.00 ? 10  ASP A CG   1  
ATOM 100   O OD1  . ASP A 1 10  ? 23.044  19.955  1.753   1.00 0.00 ? 10  ASP A OD1  1  
ATOM 101   O OD2  . ASP A 1 10  ? 21.316  19.066  2.780   1.00 0.00 ? 10  ASP A OD2  1  
ATOM 102   H H    . ASP A 1 10  ? 23.429  20.156  -0.212  1.00 0.00 ? 10  ASP A H    1  
ATOM 103   H HA   . ASP A 1 10  ? 21.507  18.427  -1.529  1.00 0.00 ? 10  ASP A HA   1  
ATOM 104   H HB2  . ASP A 1 10  ? 20.899  17.736  0.760   1.00 0.00 ? 10  ASP A HB2  1  
ATOM 105   H HB3  . ASP A 1 10  ? 22.632  17.603  0.473   1.00 0.00 ? 10  ASP A HB3  1  
ATOM 106   N N    . SER A 1 11  ? 19.818  20.301  -1.736  1.00 0.00 ? 11  SER A N    1  
ATOM 107   C CA   . SER A 1 11  ? 18.651  21.174  -1.773  1.00 0.00 ? 11  SER A CA   1  
ATOM 108   C C    . SER A 1 11  ? 17.542  20.562  -2.624  1.00 0.00 ? 11  SER A C    1  
ATOM 109   O O    . SER A 1 11  ? 16.357  20.727  -2.331  1.00 0.00 ? 11  SER A O    1  
ATOM 110   C CB   . SER A 1 11  ? 19.033  22.548  -2.326  1.00 0.00 ? 11  SER A CB   1  
ATOM 111   O OG   . SER A 1 11  ? 19.712  22.429  -3.564  1.00 0.00 ? 11  SER A OG   1  
ATOM 112   H H    . SER A 1 11  ? 20.148  19.907  -2.571  1.00 0.00 ? 11  SER A H    1  
ATOM 113   H HA   . SER A 1 11  ? 18.291  21.289  -0.762  1.00 0.00 ? 11  SER A HA   1  
ATOM 114   H HB2  . SER A 1 11  ? 18.140  23.135  -2.474  1.00 0.00 ? 11  SER A HB2  1  
ATOM 115   H HB3  . SER A 1 11  ? 19.680  23.049  -1.620  1.00 0.00 ? 11  SER A HB3  1  
ATOM 116   H HG   . SER A 1 11  ? 19.551  23.214  -4.094  1.00 0.00 ? 11  SER A HG   1  
ATOM 117   N N    . ARG A 1 12  ? 17.935  19.855  -3.678  1.00 0.00 ? 12  ARG A N    1  
ATOM 118   C CA   . ARG A 1 12  ? 16.975  19.219  -4.572  1.00 0.00 ? 12  ARG A CA   1  
ATOM 119   C C    . ARG A 1 12  ? 16.488  17.893  -3.994  1.00 0.00 ? 12  ARG A C    1  
ATOM 120   O O    . ARG A 1 12  ? 15.678  17.196  -4.606  1.00 0.00 ? 12  ARG A O    1  
ATOM 121   C CB   . ARG A 1 12  ? 17.603  18.987  -5.948  1.00 0.00 ? 12  ARG A CB   1  
ATOM 122   C CG   . ARG A 1 12  ? 17.696  20.246  -6.794  1.00 0.00 ? 12  ARG A CG   1  
ATOM 123   C CD   . ARG A 1 12  ? 16.377  20.550  -7.487  1.00 0.00 ? 12  ARG A CD   1  
ATOM 124   N NE   . ARG A 1 12  ? 15.497  21.366  -6.655  1.00 0.00 ? 12  ARG A NE   1  
ATOM 125   C CZ   . ARG A 1 12  ? 14.204  21.542  -6.904  1.00 0.00 ? 12  ARG A CZ   1  
ATOM 126   N NH1  . ARG A 1 12  ? 13.644  20.962  -7.957  1.00 0.00 ? 12  ARG A NH1  1  
ATOM 127   N NH2  . ARG A 1 12  ? 13.469  22.299  -6.100  1.00 0.00 ? 12  ARG A NH2  1  
ATOM 128   H H    . ARG A 1 12  ? 18.893  19.759  -3.859  1.00 0.00 ? 12  ARG A H    1  
ATOM 129   H HA   . ARG A 1 12  ? 16.130  19.883  -4.679  1.00 0.00 ? 12  ARG A HA   1  
ATOM 130   H HB2  . ARG A 1 12  ? 18.600  18.596  -5.814  1.00 0.00 ? 12  ARG A HB2  1  
ATOM 131   H HB3  . ARG A 1 12  ? 17.009  18.262  -6.484  1.00 0.00 ? 12  ARG A HB3  1  
ATOM 132   H HG2  . ARG A 1 12  ? 17.956  21.079  -6.158  1.00 0.00 ? 12  ARG A HG2  1  
ATOM 133   H HG3  . ARG A 1 12  ? 18.463  20.110  -7.542  1.00 0.00 ? 12  ARG A HG3  1  
ATOM 134   H HD2  . ARG A 1 12  ? 16.582  21.081  -8.405  1.00 0.00 ? 12  ARG A HD2  1  
ATOM 135   H HD3  . ARG A 1 12  ? 15.881  19.618  -7.713  1.00 0.00 ? 12  ARG A HD3  1  
ATOM 136   H HE   . ARG A 1 12  ? 15.890  21.804  -5.871  1.00 0.00 ? 12  ARG A HE   1  
ATOM 137   H HH11 . ARG A 1 12  ? 14.195  20.390  -8.564  1.00 0.00 ? 12  ARG A HH11 1  
ATOM 138   H HH12 . ARG A 1 12  ? 12.670  21.095  -8.142  1.00 0.00 ? 12  ARG A HH12 1  
ATOM 139   H HH21 . ARG A 1 12  ? 13.887  22.737  -5.305  1.00 0.00 ? 12  ARG A HH21 1  
ATOM 140   H HH22 . ARG A 1 12  ? 12.496  22.430  -6.288  1.00 0.00 ? 12  ARG A HH22 1  
ATOM 141   N N    . LEU A 1 13  ? 16.987  17.551  -2.811  1.00 0.00 ? 13  LEU A N    1  
ATOM 142   C CA   . LEU A 1 13  ? 16.604  16.309  -2.149  1.00 0.00 ? 13  LEU A CA   1  
ATOM 143   C C    . LEU A 1 13  ? 15.095  16.099  -2.216  1.00 0.00 ? 13  LEU A C    1  
ATOM 144   O O    . LEU A 1 13  ? 14.326  17.058  -2.290  1.00 0.00 ? 13  LEU A O    1  
ATOM 145   C CB   . LEU A 1 13  ? 17.065  16.322  -0.691  1.00 0.00 ? 13  LEU A CB   1  
ATOM 146   C CG   . LEU A 1 13  ? 18.470  15.781  -0.426  1.00 0.00 ? 13  LEU A CG   1  
ATOM 147   C CD1  . LEU A 1 13  ? 18.419  14.295  -0.103  1.00 0.00 ? 13  LEU A CD1  1  
ATOM 148   C CD2  . LEU A 1 13  ? 19.375  16.037  -1.622  1.00 0.00 ? 13  LEU A CD2  1  
ATOM 149   H H    . LEU A 1 13  ? 17.629  18.147  -2.372  1.00 0.00 ? 13  LEU A H    1  
ATOM 150   H HA   . LEU A 1 13  ? 17.092  15.495  -2.665  1.00 0.00 ? 13  LEU A HA   1  
ATOM 151   H HB2  . LEU A 1 13  ? 17.033  17.343  -0.343  1.00 0.00 ? 13  LEU A HB2  1  
ATOM 152   H HB3  . LEU A 1 13  ? 16.367  15.727  -0.119  1.00 0.00 ? 13  LEU A HB3  1  
ATOM 153   H HG   . LEU A 1 13  ? 18.891  16.293  0.429   1.00 0.00 ? 13  LEU A HG   1  
ATOM 154   H HD11 . LEU A 1 13  ? 18.554  13.725  -1.010  1.00 0.00 ? 13  LEU A HD11 1  
ATOM 155   H HD12 . LEU A 1 13  ? 17.460  14.055  0.333   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 156   H HD13 . LEU A 1 13  ? 19.204  14.052  0.597   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 157   H HD21 . LEU A 1 13  ? 19.293  15.216  -2.318  1.00 0.00 ? 13  LEU A HD21 1  
ATOM 158   H HD22 . LEU A 1 13  ? 20.398  16.125  -1.287  1.00 0.00 ? 13  LEU A HD22 1  
ATOM 159   H HD23 . LEU A 1 13  ? 19.076  16.954  -2.109  1.00 0.00 ? 13  LEU A HD23 1  
ATOM 160   N N    . THR A 1 14  ? 14.676  14.838  -2.187  1.00 0.00 ? 14  THR A N    1  
ATOM 161   C CA   . THR A 1 14  ? 13.259  14.502  -2.243  1.00 0.00 ? 14  THR A CA   1  
ATOM 162   C C    . THR A 1 14  ? 12.502  15.113  -1.069  1.00 0.00 ? 14  THR A C    1  
ATOM 163   O O    . THR A 1 14  ? 12.600  14.634  0.061   1.00 0.00 ? 14  THR A O    1  
ATOM 164   C CB   . THR A 1 14  ? 13.043  12.977  -2.241  1.00 0.00 ? 14  THR A CB   1  
ATOM 165   O OG1  . THR A 1 14  ? 13.642  12.398  -1.077  1.00 0.00 ? 14  THR A OG1  1  
ATOM 166   C CG2  . THR A 1 14  ? 13.636  12.345  -3.491  1.00 0.00 ? 14  THR A CG2  1  
ATOM 167   H H    . THR A 1 14  ? 15.337  14.117  -2.127  1.00 0.00 ? 14  THR A H    1  
ATOM 168   H HA   . THR A 1 14  ? 12.858  14.900  -3.164  1.00 0.00 ? 14  THR A HA   1  
ATOM 169   H HB   . THR A 1 14  ? 11.980  12.779  -2.225  1.00 0.00 ? 14  THR A HB   1  
ATOM 170   H HG1  . THR A 1 14  ? 14.467  12.851  -0.883  1.00 0.00 ? 14  THR A HG1  1  
ATOM 171   H HG21 . THR A 1 14  ? 12.845  12.114  -4.188  1.00 0.00 ? 14  THR A HG21 1  
ATOM 172   H HG22 . THR A 1 14  ? 14.155  11.436  -3.223  1.00 0.00 ? 14  THR A HG22 1  
ATOM 173   H HG23 . THR A 1 14  ? 14.330  13.034  -3.948  1.00 0.00 ? 14  THR A HG23 1  
ATOM 174   N N    . ALA A 1 15  ? 11.747  16.171  -1.344  1.00 0.00 ? 15  ALA A N    1  
ATOM 175   C CA   . ALA A 1 15  ? 10.972  16.845  -0.310  1.00 0.00 ? 15  ALA A CA   1  
ATOM 176   C C    . ALA A 1 15  ? 9.480   16.801  -0.626  1.00 0.00 ? 15  ALA A C    1  
ATOM 177   O O    . ALA A 1 15  ? 8.647   16.722  0.276   1.00 0.00 ? 15  ALA A O    1  
ATOM 178   C CB   . ALA A 1 15  ? 11.438  18.286  -0.155  1.00 0.00 ? 15  ALA A CB   1  
ATOM 179   H H    . ALA A 1 15  ? 11.710  16.506  -2.264  1.00 0.00 ? 15  ALA A H    1  
ATOM 180   H HA   . ALA A 1 15  ? 11.147  16.334  0.626   1.00 0.00 ? 15  ALA A HA   1  
ATOM 181   H HB1  . ALA A 1 15  ? 11.629  18.492  0.887   1.00 0.00 ? 15  ALA A HB1  1  
ATOM 182   H HB2  . ALA A 1 15  ? 12.344  18.433  -0.724  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 183   H HB3  . ALA A 1 15  ? 10.671  18.953  -0.520  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 184   N N    . GLY A 1 16  ? 9.151   16.853  -1.913  1.00 0.00 ? 16  GLY A N    1  
ATOM 185   C CA   . GLY A 1 16  ? 7.760   16.818  -2.324  1.00 0.00 ? 16  GLY A CA   1  
ATOM 186   C C    . GLY A 1 16  ? 7.219   15.406  -2.421  1.00 0.00 ? 16  GLY A C    1  
ATOM 187   O O    . GLY A 1 16  ? 6.244   15.153  -3.129  1.00 0.00 ? 16  GLY A O    1  
ATOM 188   H H    . GLY A 1 16  ? 9.858   16.916  -2.589  1.00 0.00 ? 16  GLY A H    1  
ATOM 189   H HA2  . GLY A 1 16  ? 7.170   17.370  -1.608  1.00 0.00 ? 16  GLY A HA2  1  
ATOM 190   H HA3  . GLY A 1 16  ? 7.670   17.292  -3.291  1.00 0.00 ? 16  GLY A HA3  1  
ATOM 191   N N    . VAL A 1 17  ? 7.853   14.480  -1.708  1.00 0.00 ? 17  VAL A N    1  
ATOM 192   C CA   . VAL A 1 17  ? 7.431   13.085  -1.717  1.00 0.00 ? 17  VAL A CA   1  
ATOM 193   C C    . VAL A 1 17  ? 6.183   12.884  -0.865  1.00 0.00 ? 17  VAL A C    1  
ATOM 194   O O    . VAL A 1 17  ? 5.940   13.603  0.104   1.00 0.00 ? 17  VAL A O    1  
ATOM 195   C CB   . VAL A 1 17  ? 8.546   12.157  -1.201  1.00 0.00 ? 17  VAL A CB   1  
ATOM 196   C CG1  . VAL A 1 17  ? 9.647   12.016  -2.241  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 197   C CG2  . VAL A 1 17  ? 9.107   12.679  0.114   1.00 0.00 ? 17  VAL A CG2  1  
ATOM 198   H H    . VAL A 1 17  ? 8.624   14.743  -1.163  1.00 0.00 ? 17  VAL A H    1  
ATOM 199   H HA   . VAL A 1 17  ? 7.206   12.811  -2.738  1.00 0.00 ? 17  VAL A HA   1  
ATOM 200   H HB   . VAL A 1 17  ? 8.121   11.180  -1.024  1.00 0.00 ? 17  VAL A HB   1  
ATOM 201   H HG11 . VAL A 1 17  ? 9.995   12.996  -2.532  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 202   H HG12 . VAL A 1 17  ? 10.468  11.451  -1.823  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 203   H HG13 . VAL A 1 17  ? 9.260   11.501  -3.108  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 204   H HG21 . VAL A 1 17  ? 9.702   13.560  -0.073  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 205   H HG22 . VAL A 1 17  ? 8.293   12.928  0.778   1.00 0.00 ? 17  VAL A HG22 1  
ATOM 206   H HG23 . VAL A 1 17  ? 9.724   11.918  0.570   1.00 0.00 ? 17  VAL A HG23 1  
ATOM 207   N N    . PRO A 1 18  ? 5.370   11.882  -1.233  1.00 0.00 ? 18  PRO A N    1  
ATOM 208   C CA   . PRO A 1 18  ? 4.133   11.561  -0.515  1.00 0.00 ? 18  PRO A CA   1  
ATOM 209   C C    . PRO A 1 18  ? 4.401   10.968  0.864   1.00 0.00 ? 18  PRO A C    1  
ATOM 210   O O    . PRO A 1 18  ? 5.122   9.979   0.996   1.00 0.00 ? 18  PRO A O    1  
ATOM 211   C CB   . PRO A 1 18  ? 3.456   10.528  -1.419  1.00 0.00 ? 18  PRO A CB   1  
ATOM 212   C CG   . PRO A 1 18  ? 4.573   9.902   -2.181  1.00 0.00 ? 18  PRO A CG   1  
ATOM 213   C CD   . PRO A 1 18  ? 5.598   10.984  -2.378  1.00 0.00 ? 18  PRO A CD   1  
ATOM 214   H HA   . PRO A 1 18  ? 3.496   12.428  -0.416  1.00 0.00 ? 18  PRO A HA   1  
ATOM 215   H HB2  . PRO A 1 18  ? 2.935   9.801   -0.811  1.00 0.00 ? 18  PRO A HB2  1  
ATOM 216   H HB3  . PRO A 1 18  ? 2.758   11.022  -2.077  1.00 0.00 ? 18  PRO A HB3  1  
ATOM 217   H HG2  . PRO A 1 18  ? 4.993   9.086   -1.613  1.00 0.00 ? 18  PRO A HG2  1  
ATOM 218   H HG3  . PRO A 1 18  ? 4.212   9.549   -3.136  1.00 0.00 ? 18  PRO A HG3  1  
ATOM 219   H HD2  . PRO A 1 18  ? 6.594   10.569  -2.351  1.00 0.00 ? 18  PRO A HD2  1  
ATOM 220   H HD3  . PRO A 1 18  ? 5.427   11.500  -3.311  1.00 0.00 ? 18  PRO A HD3  1  
ATOM 221   N N    . ASP A 1 19  ? 3.815   11.579  1.889   1.00 0.00 ? 19  ASP A N    1  
ATOM 222   C CA   . ASP A 1 19  ? 3.989   11.110  3.259   1.00 0.00 ? 19  ASP A CA   1  
ATOM 223   C C    . ASP A 1 19  ? 3.293   9.769   3.467   1.00 0.00 ? 19  ASP A C    1  
ATOM 224   O O    . ASP A 1 19  ? 2.367   9.418   2.736   1.00 0.00 ? 19  ASP A O    1  
ATOM 225   C CB   . ASP A 1 19  ? 3.442   12.142  4.247   1.00 0.00 ? 19  ASP A CB   1  
ATOM 226   C CG   . ASP A 1 19  ? 4.179   12.123  5.571   1.00 0.00 ? 19  ASP A CG   1  
ATOM 227   O OD1  . ASP A 1 19  ? 5.413   11.926  5.561   1.00 0.00 ? 19  ASP A OD1  1  
ATOM 228   O OD2  . ASP A 1 19  ? 3.523   12.307  6.617   1.00 0.00 ? 19  ASP A OD2  1  
ATOM 229   H H    . ASP A 1 19  ? 3.252   12.363  1.719   1.00 0.00 ? 19  ASP A H    1  
ATOM 230   H HA   . ASP A 1 19  ? 5.047   10.984  3.434   1.00 0.00 ? 19  ASP A HA   1  
ATOM 231   H HB2  . ASP A 1 19  ? 3.537   13.129  3.817   1.00 0.00 ? 19  ASP A HB2  1  
ATOM 232   H HB3  . ASP A 1 19  ? 2.399   11.934  4.433   1.00 0.00 ? 19  ASP A HB3  1  
ATOM 233   N N    . THR A 1 20  ? 3.746   9.022   4.469   1.00 0.00 ? 20  THR A N    1  
ATOM 234   C CA   . THR A 1 20  ? 3.169   7.719   4.772   1.00 0.00 ? 20  THR A CA   1  
ATOM 235   C C    . THR A 1 20  ? 1.646   7.774   4.751   1.00 0.00 ? 20  THR A C    1  
ATOM 236   O O    . THR A 1 20  ? 1.020   8.592   5.426   1.00 0.00 ? 20  THR A O    1  
ATOM 237   C CB   . THR A 1 20  ? 3.633   7.205   6.148   1.00 0.00 ? 20  THR A CB   1  
ATOM 238   O OG1  . THR A 1 20  ? 4.996   7.581   6.377   1.00 0.00 ? 20  THR A OG1  1  
ATOM 239   C CG2  . THR A 1 20  ? 3.498   5.692   6.235   1.00 0.00 ? 20  THR A CG2  1  
ATOM 240   H H    . THR A 1 20  ? 4.487   9.357   5.016   1.00 0.00 ? 20  THR A H    1  
ATOM 241   H HA   . THR A 1 20  ? 3.505   7.022   4.019   1.00 0.00 ? 20  THR A HA   1  
ATOM 242   H HB   . THR A 1 20  ? 3.012   7.652   6.911   1.00 0.00 ? 20  THR A HB   1  
ATOM 243   H HG1  . THR A 1 20  ? 5.321   7.142   7.167   1.00 0.00 ? 20  THR A HG1  1  
ATOM 244   H HG21 . THR A 1 20  ? 2.471   5.412   6.055   1.00 0.00 ? 20  THR A HG21 1  
ATOM 245   H HG22 . THR A 1 20  ? 3.794   5.360   7.219   1.00 0.00 ? 20  THR A HG22 1  
ATOM 246   H HG23 . THR A 1 20  ? 4.133   5.231   5.493   1.00 0.00 ? 20  THR A HG23 1  
ATOM 247   N N    . PRO A 1 21  ? 1.032   6.882   3.958   1.00 0.00 ? 21  PRO A N    1  
ATOM 248   C CA   . PRO A 1 21  ? -0.427  6.809   3.831   1.00 0.00 ? 21  PRO A CA   1  
ATOM 249   C C    . PRO A 1 21  ? -1.094  6.287   5.100   1.00 0.00 ? 21  PRO A C    1  
ATOM 250   O O    . PRO A 1 21  ? -0.435  5.719   5.971   1.00 0.00 ? 21  PRO A O    1  
ATOM 251   C CB   . PRO A 1 21  ? -0.633  5.826   2.676   1.00 0.00 ? 21  PRO A CB   1  
ATOM 252   C CG   . PRO A 1 21  ? 0.595   4.982   2.673   1.00 0.00 ? 21  PRO A CG   1  
ATOM 253   C CD   . PRO A 1 21  ? 1.714   5.878   3.126   1.00 0.00 ? 21  PRO A CD   1  
ATOM 254   H HA   . PRO A 1 21  ? -0.851  7.767   3.571   1.00 0.00 ? 21  PRO A HA   1  
ATOM 255   H HB2  . PRO A 1 21  ? -1.519  5.235   2.857   1.00 0.00 ? 21  PRO A HB2  1  
ATOM 256   H HB3  . PRO A 1 21  ? -0.739  6.371   1.750   1.00 0.00 ? 21  PRO A HB3  1  
ATOM 257   H HG2  . PRO A 1 21  ? 0.474   4.156   3.358   1.00 0.00 ? 21  PRO A HG2  1  
ATOM 258   H HG3  . PRO A 1 21  ? 0.787   4.618   1.675   1.00 0.00 ? 21  PRO A HG3  1  
ATOM 259   H HD2  . PRO A 1 21  ? 2.433   5.319   3.707   1.00 0.00 ? 21  PRO A HD2  1  
ATOM 260   H HD3  . PRO A 1 21  ? 2.193   6.342   2.277   1.00 0.00 ? 21  PRO A HD3  1  
ATOM 261   N N    . THR A 1 22  ? -2.405  6.483   5.197   1.00 0.00 ? 22  THR A N    1  
ATOM 262   C CA   . THR A 1 22  ? -3.161  6.034   6.359   1.00 0.00 ? 22  THR A CA   1  
ATOM 263   C C    . THR A 1 22  ? -3.415  4.532   6.302   1.00 0.00 ? 22  THR A C    1  
ATOM 264   O O    . THR A 1 22  ? -3.162  3.888   5.283   1.00 0.00 ? 22  THR A O    1  
ATOM 265   C CB   . THR A 1 22  ? -4.511  6.768   6.470   1.00 0.00 ? 22  THR A CB   1  
ATOM 266   O OG1  . THR A 1 22  ? -4.400  8.083   5.914   1.00 0.00 ? 22  THR A OG1  1  
ATOM 267   C CG2  . THR A 1 22  ? -4.959  6.861   7.920   1.00 0.00 ? 22  THR A CG2  1  
ATOM 268   H H    . THR A 1 22  ? -2.874  6.943   4.469   1.00 0.00 ? 22  THR A H    1  
ATOM 269   H HA   . THR A 1 22  ? -2.580  6.257   7.242   1.00 0.00 ? 22  THR A HA   1  
ATOM 270   H HB   . THR A 1 22  ? -5.252  6.211   5.914   1.00 0.00 ? 22  THR A HB   1  
ATOM 271   H HG1  . THR A 1 22  ? -5.062  8.655   6.311   1.00 0.00 ? 22  THR A HG1  1  
ATOM 272   H HG21 . THR A 1 22  ? -5.087  7.898   8.191   1.00 0.00 ? 22  THR A HG21 1  
ATOM 273   H HG22 . THR A 1 22  ? -4.211  6.412   8.558   1.00 0.00 ? 22  THR A HG22 1  
ATOM 274   H HG23 . THR A 1 22  ? -5.896  6.338   8.042   1.00 0.00 ? 22  THR A HG23 1  
ATOM 275   N N    . ARG A 1 23  ? -3.918  3.979   7.401   1.00 0.00 ? 23  ARG A N    1  
ATOM 276   C CA   . ARG A 1 23  ? -4.206  2.552   7.475   1.00 0.00 ? 23  ARG A CA   1  
ATOM 277   C C    . ARG A 1 23  ? -4.885  2.067   6.197   1.00 0.00 ? 23  ARG A C    1  
ATOM 278   O O    . ARG A 1 23  ? -5.449  2.860   5.442   1.00 0.00 ? 23  ARG A O    1  
ATOM 279   C CB   . ARG A 1 23  ? -5.096  2.252   8.683   1.00 0.00 ? 23  ARG A CB   1  
ATOM 280   C CG   . ARG A 1 23  ? -4.544  2.788   9.994   1.00 0.00 ? 23  ARG A CG   1  
ATOM 281   C CD   . ARG A 1 23  ? -5.278  2.200   11.189  1.00 0.00 ? 23  ARG A CD   1  
ATOM 282   N NE   . ARG A 1 23  ? -6.566  2.850   11.414  1.00 0.00 ? 23  ARG A NE   1  
ATOM 283   C CZ   . ARG A 1 23  ? -7.422  2.478   12.359  1.00 0.00 ? 23  ARG A CZ   1  
ATOM 284   N NH1  . ARG A 1 23  ? -7.127  1.466   13.164  1.00 0.00 ? 23  ARG A NH1  1  
ATOM 285   N NH2  . ARG A 1 23  ? -8.575  3.118   12.502  1.00 0.00 ? 23  ARG A NH2  1  
ATOM 286   H H    . ARG A 1 23  ? -4.099  4.544   8.181   1.00 0.00 ? 23  ARG A H    1  
ATOM 287   H HA   . ARG A 1 23  ? -3.269  2.030   7.591   1.00 0.00 ? 23  ARG A HA   1  
ATOM 288   H HB2  . ARG A 1 23  ? -6.067  2.694   8.519   1.00 0.00 ? 23  ARG A HB2  1  
ATOM 289   H HB3  . ARG A 1 23  ? -5.207  1.182   8.775   1.00 0.00 ? 23  ARG A HB3  1  
ATOM 290   H HG2  . ARG A 1 23  ? -3.498  2.530   10.066  1.00 0.00 ? 23  ARG A HG2  1  
ATOM 291   H HG3  . ARG A 1 23  ? -4.654  3.862   10.007  1.00 0.00 ? 23  ARG A HG3  1  
ATOM 292   H HD2  . ARG A 1 23  ? -5.442  1.148   11.012  1.00 0.00 ? 23  ARG A HD2  1  
ATOM 293   H HD3  . ARG A 1 23  ? -4.663  2.326   12.068  1.00 0.00 ? 23  ARG A HD3  1  
ATOM 294   H HE   . ARG A 1 23  ? -6.804  3.600   10.830  1.00 0.00 ? 23  ARG A HE   1  
ATOM 295   H HH11 . ARG A 1 23  ? -6.258  0.982   13.060  1.00 0.00 ? 23  ARG A HH11 1  
ATOM 296   H HH12 . ARG A 1 23  ? -7.772  1.189   13.876  1.00 0.00 ? 23  ARG A HH12 1  
ATOM 297   H HH21 . ARG A 1 23  ? -8.801  3.881   11.897  1.00 0.00 ? 23  ARG A HH21 1  
ATOM 298   H HH22 . ARG A 1 23  ? -9.218  2.837   13.213  1.00 0.00 ? 23  ARG A HH22 1  
ATOM 299   N N    . LEU A 1 24  ? -4.826  0.761   5.961   1.00 0.00 ? 24  LEU A N    1  
ATOM 300   C CA   . LEU A 1 24  ? -5.435  0.170   4.774   1.00 0.00 ? 24  LEU A CA   1  
ATOM 301   C C    . LEU A 1 24  ? -6.794  -0.439  5.105   1.00 0.00 ? 24  LEU A C    1  
ATOM 302   O O    . LEU A 1 24  ? -7.105  -0.694  6.268   1.00 0.00 ? 24  LEU A O    1  
ATOM 303   C CB   . LEU A 1 24  ? -4.514  -0.900  4.184   1.00 0.00 ? 24  LEU A CB   1  
ATOM 304   C CG   . LEU A 1 24  ? -3.013  -0.668  4.365   1.00 0.00 ? 24  LEU A CG   1  
ATOM 305   C CD1  . LEU A 1 24  ? -2.221  -1.837  3.802   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 306   C CD2  . LEU A 1 24  ? -2.591  0.634   3.699   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 307   H H    . LEU A 1 24  ? -4.363  0.180   6.599   1.00 0.00 ? 24  LEU A H    1  
ATOM 308   H HA   . LEU A 1 24  ? -5.573  0.956   4.047   1.00 0.00 ? 24  LEU A HA   1  
ATOM 309   H HB2  . LEU A 1 24  ? -4.761  -1.842  4.650   1.00 0.00 ? 24  LEU A HB2  1  
ATOM 310   H HB3  . LEU A 1 24  ? -4.716  -0.960  3.124   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 311   H HG   . LEU A 1 24  ? -2.791  -0.592  5.420   1.00 0.00 ? 24  LEU A HG   1  
ATOM 312   H HD11 . LEU A 1 24  ? -2.583  -2.075  2.814   1.00 0.00 ? 24  LEU A HD11 1  
ATOM 313   H HD12 . LEU A 1 24  ? -2.341  -2.696  4.446   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 314   H HD13 . LEU A 1 24  ? -1.175  -1.571  3.749   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 315   H HD21 . LEU A 1 24  ? -1.897  1.157   4.339   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 316   H HD22 . LEU A 1 24  ? -3.462  1.251   3.531   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 317   H HD23 . LEU A 1 24  ? -2.117  0.417   2.753   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 318   N N    . VAL A 1 25  ? -7.599  -0.670  4.073   1.00 0.00 ? 25  VAL A N    1  
ATOM 319   C CA   . VAL A 1 25  ? -8.924  -1.252  4.254   1.00 0.00 ? 25  VAL A CA   1  
ATOM 320   C C    . VAL A 1 25  ? -9.082  -2.525  3.429   1.00 0.00 ? 25  VAL A C    1  
ATOM 321   O O    . VAL A 1 25  ? -9.064  -2.487  2.199   1.00 0.00 ? 25  VAL A O    1  
ATOM 322   C CB   . VAL A 1 25  ? -10.032 -0.258  3.859   1.00 0.00 ? 25  VAL A CB   1  
ATOM 323   C CG1  . VAL A 1 25  ? -11.402 -0.906  3.989   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 324   C CG2  . VAL A 1 25  ? -9.946  1.000   4.710   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 325   H H    . VAL A 1 25  ? -7.295  -0.446  3.169   1.00 0.00 ? 25  VAL A H    1  
ATOM 326   H HA   . VAL A 1 25  ? -9.042  -1.495  5.300   1.00 0.00 ? 25  VAL A HA   1  
ATOM 327   H HB   . VAL A 1 25  ? -9.887  0.021   2.826   1.00 0.00 ? 25  VAL A HB   1  
ATOM 328   H HG11 . VAL A 1 25  ? -12.033 -0.578  3.177   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 329   H HG12 . VAL A 1 25  ? -11.297 -1.981  3.954   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 330   H HG13 . VAL A 1 25  ? -11.848 -0.618  4.930   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 331   H HG21 . VAL A 1 25  ? -9.587  1.820   4.106   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 332   H HG22 . VAL A 1 25  ? -10.924 1.240   5.098   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 333   H HG23 . VAL A 1 25  ? -9.264  0.834   5.532   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 334   N N    . PHE A 1 26  ? -9.237  -3.653  4.116   1.00 0.00 ? 26  PHE A N    1  
ATOM 335   C CA   . PHE A 1 26  ? -9.398  -4.939  3.447   1.00 0.00 ? 26  PHE A CA   1  
ATOM 336   C C    . PHE A 1 26  ? -10.867 -5.345  3.397   1.00 0.00 ? 26  PHE A C    1  
ATOM 337   O O    . PHE A 1 26  ? -11.581 -5.258  4.396   1.00 0.00 ? 26  PHE A O    1  
ATOM 338   C CB   . PHE A 1 26  ? -8.583  -6.016  4.166   1.00 0.00 ? 26  PHE A CB   1  
ATOM 339   C CG   . PHE A 1 26  ? -7.157  -5.619  4.421   1.00 0.00 ? 26  PHE A CG   1  
ATOM 340   C CD1  . PHE A 1 26  ? -6.811  -4.927  5.570   1.00 0.00 ? 26  PHE A CD1  1  
ATOM 341   C CD2  . PHE A 1 26  ? -6.162  -5.938  3.511   1.00 0.00 ? 26  PHE A CD2  1  
ATOM 342   C CE1  . PHE A 1 26  ? -5.500  -4.560  5.808   1.00 0.00 ? 26  PHE A CE1  1  
ATOM 343   C CE2  . PHE A 1 26  ? -4.849  -5.574  3.743   1.00 0.00 ? 26  PHE A CE2  1  
ATOM 344   C CZ   . PHE A 1 26  ? -4.518  -4.884  4.893   1.00 0.00 ? 26  PHE A CZ   1  
ATOM 345   H H    . PHE A 1 26  ? -9.243  -3.619  5.096   1.00 0.00 ? 26  PHE A H    1  
ATOM 346   H HA   . PHE A 1 26  ? -9.030  -4.835  2.438   1.00 0.00 ? 26  PHE A HA   1  
ATOM 347   H HB2  . PHE A 1 26  ? -9.043  -6.229  5.119   1.00 0.00 ? 26  PHE A HB2  1  
ATOM 348   H HB3  . PHE A 1 26  ? -8.577  -6.913  3.565   1.00 0.00 ? 26  PHE A HB3  1  
ATOM 349   H HD1  . PHE A 1 26  ? -7.580  -4.673  6.287   1.00 0.00 ? 26  PHE A HD1  1  
ATOM 350   H HD2  . PHE A 1 26  ? -6.419  -6.477  2.611   1.00 0.00 ? 26  PHE A HD2  1  
ATOM 351   H HE1  . PHE A 1 26  ? -5.245  -4.020  6.708   1.00 0.00 ? 26  PHE A HE1  1  
ATOM 352   H HE2  . PHE A 1 26  ? -4.083  -5.828  3.026   1.00 0.00 ? 26  PHE A HE2  1  
ATOM 353   H HZ   . PHE A 1 26  ? -3.493  -4.599  5.077   1.00 0.00 ? 26  PHE A HZ   1  
ATOM 354   N N    . SER A 1 27  ? -11.313 -5.790  2.226   1.00 0.00 ? 27  SER A N    1  
ATOM 355   C CA   . SER A 1 27  ? -12.698 -6.206  2.043   1.00 0.00 ? 27  SER A CA   1  
ATOM 356   C C    . SER A 1 27  ? -12.833 -7.720  2.178   1.00 0.00 ? 27  SER A C    1  
ATOM 357   O O    . SER A 1 27  ? -13.791 -8.218  2.768   1.00 0.00 ? 27  SER A O    1  
ATOM 358   C CB   . SER A 1 27  ? -13.211 -5.757  0.673   1.00 0.00 ? 27  SER A CB   1  
ATOM 359   O OG   . SER A 1 27  ? -14.608 -5.965  0.558   1.00 0.00 ? 27  SER A OG   1  
ATOM 360   H H    . SER A 1 27  ? -10.695 -5.836  1.466   1.00 0.00 ? 27  SER A H    1  
ATOM 361   H HA   . SER A 1 27  ? -13.291 -5.733  2.812   1.00 0.00 ? 27  SER A HA   1  
ATOM 362   H HB2  . SER A 1 27  ? -13.003 -4.706  0.540   1.00 0.00 ? 27  SER A HB2  1  
ATOM 363   H HB3  . SER A 1 27  ? -12.710 -6.324  -0.099  1.00 0.00 ? 27  SER A HB3  1  
ATOM 364   H HG   . SER A 1 27  ? -15.075 -5.263  1.018   1.00 0.00 ? 27  SER A HG   1  
ATOM 365   N N    . ALA A 1 28  ? -11.865 -8.445  1.628   1.00 0.00 ? 28  ALA A N    1  
ATOM 366   C CA   . ALA A 1 28  ? -11.874 -9.901  1.688   1.00 0.00 ? 28  ALA A CA   1  
ATOM 367   C C    . ALA A 1 28  ? -13.085 -10.474 0.959   1.00 0.00 ? 28  ALA A C    1  
ATOM 368   O O    . ALA A 1 28  ? -13.820 -11.297 1.507   1.00 0.00 ? 28  ALA A O    1  
ATOM 369   C CB   . ALA A 1 28  ? -11.856 -10.370 3.135   1.00 0.00 ? 28  ALA A CB   1  
ATOM 370   H H    . ALA A 1 28  ? -11.127 -7.990  1.171   1.00 0.00 ? 28  ALA A H    1  
ATOM 371   H HA   . ALA A 1 28  ? -10.974 -10.261 1.208   1.00 0.00 ? 28  ALA A HA   1  
ATOM 372   H HB1  . ALA A 1 28  ? -12.111 -11.418 3.177   1.00 0.00 ? 28  ALA A HB1  1  
ATOM 373   H HB2  . ALA A 1 28  ? -10.869 -10.223 3.548   1.00 0.00 ? 28  ALA A HB2  1  
ATOM 374   H HB3  . ALA A 1 28  ? -12.574 -9.800  3.706   1.00 0.00 ? 28  ALA A HB3  1  
ATOM 375   N N    . LEU A 1 29  ? -13.287 -10.034 -0.278  1.00 0.00 ? 29  LEU A N    1  
ATOM 376   C CA   . LEU A 1 29  ? -14.411 -10.503 -1.082  1.00 0.00 ? 29  LEU A CA   1  
ATOM 377   C C    . LEU A 1 29  ? -14.608 -12.006 -0.917  1.00 0.00 ? 29  LEU A C    1  
ATOM 378   O O    . LEU A 1 29  ? -15.705 -12.524 -1.123  1.00 0.00 ? 29  LEU A O    1  
ATOM 379   C CB   . LEU A 1 29  ? -14.184 -10.165 -2.557  1.00 0.00 ? 29  LEU A CB   1  
ATOM 380   C CG   . LEU A 1 29  ? -14.001 -8.683  -2.885  1.00 0.00 ? 29  LEU A CG   1  
ATOM 381   C CD1  . LEU A 1 29  ? -14.762 -7.818  -1.892  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 382   C CD2  . LEU A 1 29  ? -12.524 -8.316  -2.892  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 383   H H    . LEU A 1 29  ? -12.668 -9.379  -0.660  1.00 0.00 ? 29  LEU A H    1  
ATOM 384   H HA   . LEU A 1 29  ? -15.299 -9.995  -0.737  1.00 0.00 ? 29  LEU A HA   1  
ATOM 385   H HB2  . LEU A 1 29  ? -13.297 -10.688 -2.883  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 386   H HB3  . LEU A 1 29  ? -15.037 -10.526 -3.113  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 387   H HG   . LEU A 1 29  ? -14.399 -8.488  -3.871  1.00 0.00 ? 29  LEU A HG   1  
ATOM 388   H HD11 . LEU A 1 29  ? -15.823 -7.949  -2.041  1.00 0.00 ? 29  LEU A HD11 1  
ATOM 389   H HD12 . LEU A 1 29  ? -14.502 -6.781  -2.045  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 390   H HD13 . LEU A 1 29  ? -14.499 -8.110  -0.886  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 391   H HD21 . LEU A 1 29  ? -12.183 -8.217  -3.912  1.00 0.00 ? 29  LEU A HD21 1  
ATOM 392   H HD22 . LEU A 1 29  ? -11.959 -9.092  -2.398  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 393   H HD23 . LEU A 1 29  ? -12.383 -7.381  -2.371  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 394   N N    . GLY A 1 30  ? -13.539 -12.701 -0.542  1.00 0.00 ? 30  GLY A N    1  
ATOM 395   C CA   . GLY A 1 30  ? -13.616 -14.138 -0.354  1.00 0.00 ? 30  GLY A CA   1  
ATOM 396   C C    . GLY A 1 30  ? -12.342 -14.716 0.230   1.00 0.00 ? 30  GLY A C    1  
ATOM 397   O O    . GLY A 1 30  ? -11.464 -13.991 0.699   1.00 0.00 ? 30  GLY A O    1  
ATOM 398   H H    . GLY A 1 30  ? -12.690 -12.234 -0.392  1.00 0.00 ? 30  GLY A H    1  
ATOM 399   H HA2  . GLY A 1 30  ? -14.438 -14.359 0.311   1.00 0.00 ? 30  GLY A HA2  1  
ATOM 400   H HA3  . GLY A 1 30  ? -13.805 -14.605 -1.310  1.00 0.00 ? 30  GLY A HA3  1  
ATOM 401   N N    . PRO A 1 31  ? -12.230 -16.052 0.207   1.00 0.00 ? 31  PRO A N    1  
ATOM 402   C CA   . PRO A 1 31  ? -11.058 -16.757 0.736   1.00 0.00 ? 31  PRO A CA   1  
ATOM 403   C C    . PRO A 1 31  ? -9.815  -16.540 -0.122  1.00 0.00 ? 31  PRO A C    1  
ATOM 404   O O    . PRO A 1 31  ? -8.689  -16.591 0.374   1.00 0.00 ? 31  PRO A O    1  
ATOM 405   C CB   . PRO A 1 31  ? -11.482 -18.227 0.700   1.00 0.00 ? 31  PRO A CB   1  
ATOM 406   C CG   . PRO A 1 31  ? -12.516 -18.297 -0.371  1.00 0.00 ? 31  PRO A CG   1  
ATOM 407   C CD   . PRO A 1 31  ? -13.237 -16.978 -0.336  1.00 0.00 ? 31  PRO A CD   1  
ATOM 408   H HA   . PRO A 1 31  ? -10.846 -16.466 1.754   1.00 0.00 ? 31  PRO A HA   1  
ATOM 409   H HB2  . PRO A 1 31  ? -10.626 -18.845 0.465   1.00 0.00 ? 31  PRO A HB2  1  
ATOM 410   H HB3  . PRO A 1 31  ? -11.887 -18.512 1.659   1.00 0.00 ? 31  PRO A HB3  1  
ATOM 411   H HG2  . PRO A 1 31  ? -12.042 -18.441 -1.330  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 412   H HG3  . PRO A 1 31  ? -13.202 -19.105 -0.165  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 413   H HD2  . PRO A 1 31  ? -13.534 -16.685 -1.332  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 414   H HD3  . PRO A 1 31  ? -14.098 -17.036 0.314   1.00 0.00 ? 31  PRO A HD3  1  
ATOM 415   N N    . THR A 1 32  ? -10.027 -16.296 -1.411  1.00 0.00 ? 32  THR A N    1  
ATOM 416   C CA   . THR A 1 32  ? -8.925  -16.072 -2.338  1.00 0.00 ? 32  THR A CA   1  
ATOM 417   C C    . THR A 1 32  ? -9.038  -14.707 -3.007  1.00 0.00 ? 32  THR A C    1  
ATOM 418   O O    . THR A 1 32  ? -8.453  -14.473 -4.064  1.00 0.00 ? 32  THR A O    1  
ATOM 419   C CB   . THR A 1 32  ? -8.874  -17.161 -3.425  1.00 0.00 ? 32  THR A CB   1  
ATOM 420   O OG1  . THR A 1 32  ? -10.172 -17.338 -4.003  1.00 0.00 ? 32  THR A OG1  1  
ATOM 421   C CG2  . THR A 1 32  ? -8.388  -18.481 -2.846  1.00 0.00 ? 32  THR A CG2  1  
ATOM 422   H H    . THR A 1 32  ? -10.948 -16.268 -1.747  1.00 0.00 ? 32  THR A H    1  
ATOM 423   H HA   . THR A 1 32  ? -8.003  -16.110 -1.775  1.00 0.00 ? 32  THR A HA   1  
ATOM 424   H HB   . THR A 1 32  ? -8.185  -16.848 -4.196  1.00 0.00 ? 32  THR A HB   1  
ATOM 425   H HG1  . THR A 1 32  ? -10.621 -18.065 -3.566  1.00 0.00 ? 32  THR A HG1  1  
ATOM 426   H HG21 . THR A 1 32  ? -7.310  -18.520 -2.896  1.00 0.00 ? 32  THR A HG21 1  
ATOM 427   H HG22 . THR A 1 32  ? -8.803  -19.299 -3.416  1.00 0.00 ? 32  THR A HG22 1  
ATOM 428   H HG23 . THR A 1 32  ? -8.704  -18.561 -1.817  1.00 0.00 ? 32  THR A HG23 1  
ATOM 429   N N    . SER A 1 33  ? -9.795  -13.809 -2.385  1.00 0.00 ? 33  SER A N    1  
ATOM 430   C CA   . SER A 1 33  ? -9.987  -12.467 -2.923  1.00 0.00 ? 33  SER A CA   1  
ATOM 431   C C    . SER A 1 33  ? -9.929  -11.423 -1.812  1.00 0.00 ? 33  SER A C    1  
ATOM 432   O O    . SER A 1 33  ? -10.310 -11.690 -0.671  1.00 0.00 ? 33  SER A O    1  
ATOM 433   C CB   . SER A 1 33  ? -11.328 -12.375 -3.654  1.00 0.00 ? 33  SER A CB   1  
ATOM 434   O OG   . SER A 1 33  ? -12.339 -13.081 -2.956  1.00 0.00 ? 33  SER A OG   1  
ATOM 435   H H    . SER A 1 33  ? -10.236 -14.055 -1.545  1.00 0.00 ? 33  SER A H    1  
ATOM 436   H HA   . SER A 1 33  ? -9.190  -12.274 -3.625  1.00 0.00 ? 33  SER A HA   1  
ATOM 437   H HB2  . SER A 1 33  ? -11.621 -11.339 -3.736  1.00 0.00 ? 33  SER A HB2  1  
ATOM 438   H HB3  . SER A 1 33  ? -11.226 -12.800 -4.642  1.00 0.00 ? 33  SER A HB3  1  
ATOM 439   H HG   . SER A 1 33  ? -12.771 -13.696 -3.553  1.00 0.00 ? 33  SER A HG   1  
ATOM 440   N N    . LEU A 1 34  ? -9.448  -10.232 -2.153  1.00 0.00 ? 34  LEU A N    1  
ATOM 441   C CA   . LEU A 1 34  ? -9.339  -9.146  -1.185  1.00 0.00 ? 34  LEU A CA   1  
ATOM 442   C C    . LEU A 1 34  ? -9.354  -7.790  -1.885  1.00 0.00 ? 34  LEU A C    1  
ATOM 443   O O    . LEU A 1 34  ? -9.222  -7.709  -3.106  1.00 0.00 ? 34  LEU A O    1  
ATOM 444   C CB   . LEU A 1 34  ? -8.056  -9.295  -0.364  1.00 0.00 ? 34  LEU A CB   1  
ATOM 445   C CG   . LEU A 1 34  ? -8.180  -10.090 0.936   1.00 0.00 ? 34  LEU A CG   1  
ATOM 446   C CD1  . LEU A 1 34  ? -6.876  -10.808 1.249   1.00 0.00 ? 34  LEU A CD1  1  
ATOM 447   C CD2  . LEU A 1 34  ? -8.577  -9.175  2.085   1.00 0.00 ? 34  LEU A CD2  1  
ATOM 448   H H    . LEU A 1 34  ? -9.160  -10.079 -3.076  1.00 0.00 ? 34  LEU A H    1  
ATOM 449   H HA   . LEU A 1 34  ? -10.189 -9.205  -0.523  1.00 0.00 ? 34  LEU A HA   1  
ATOM 450   H HB2  . LEU A 1 34  ? -7.322  -9.787  -0.984  1.00 0.00 ? 34  LEU A HB2  1  
ATOM 451   H HB3  . LEU A 1 34  ? -7.707  -8.303  -0.115  1.00 0.00 ? 34  LEU A HB3  1  
ATOM 452   H HG   . LEU A 1 34  ? -8.953  -10.838 0.820   1.00 0.00 ? 34  LEU A HG   1  
ATOM 453   H HD11 . LEU A 1 34  ? -6.873  -11.112 2.284   1.00 0.00 ? 34  LEU A HD11 1  
ATOM 454   H HD12 . LEU A 1 34  ? -6.046  -10.142 1.066   1.00 0.00 ? 34  LEU A HD12 1  
ATOM 455   H HD13 . LEU A 1 34  ? -6.784  -11.679 0.617   1.00 0.00 ? 34  LEU A HD13 1  
ATOM 456   H HD21 . LEU A 1 34  ? -8.010  -9.437  2.966   1.00 0.00 ? 34  LEU A HD21 1  
ATOM 457   H HD22 . LEU A 1 34  ? -9.632  -9.290  2.288   1.00 0.00 ? 34  LEU A HD22 1  
ATOM 458   H HD23 . LEU A 1 34  ? -8.372  -8.149  1.815   1.00 0.00 ? 34  LEU A HD23 1  
ATOM 459   N N    . ARG A 1 35  ? -9.512  -6.728  -1.102  1.00 0.00 ? 35  ARG A N    1  
ATOM 460   C CA   . ARG A 1 35  ? -9.543  -5.376  -1.646  1.00 0.00 ? 35  ARG A CA   1  
ATOM 461   C C    . ARG A 1 35  ? -8.914  -4.384  -0.673  1.00 0.00 ? 35  ARG A C    1  
ATOM 462   O O    . ARG A 1 35  ? -9.515  -4.024  0.339   1.00 0.00 ? 35  ARG A O    1  
ATOM 463   C CB   . ARG A 1 35  ? -10.983 -4.960  -1.955  1.00 0.00 ? 35  ARG A CB   1  
ATOM 464   C CG   . ARG A 1 35  ? -11.099 -3.568  -2.553  1.00 0.00 ? 35  ARG A CG   1  
ATOM 465   C CD   . ARG A 1 35  ? -12.525 -3.044  -2.469  1.00 0.00 ? 35  ARG A CD   1  
ATOM 466   N NE   . ARG A 1 35  ? -12.656 -1.718  -3.067  1.00 0.00 ? 35  ARG A NE   1  
ATOM 467   C CZ   . ARG A 1 35  ? -13.815 -1.200  -3.461  1.00 0.00 ? 35  ARG A CZ   1  
ATOM 468   N NH1  . ARG A 1 35  ? -14.936 -1.894  -3.319  1.00 0.00 ? 35  ARG A NH1  1  
ATOM 469   N NH2  . ARG A 1 35  ? -13.853 0.013   -3.996  1.00 0.00 ? 35  ARG A NH2  1  
ATOM 470   H H    . ARG A 1 35  ? -9.612  -6.857  -0.135  1.00 0.00 ? 35  ARG A H    1  
ATOM 471   H HA   . ARG A 1 35  ? -8.973  -5.374  -2.563  1.00 0.00 ? 35  ARG A HA   1  
ATOM 472   H HB2  . ARG A 1 35  ? -11.406 -5.665  -2.655  1.00 0.00 ? 35  ARG A HB2  1  
ATOM 473   H HB3  . ARG A 1 35  ? -11.556 -4.985  -1.040  1.00 0.00 ? 35  ARG A HB3  1  
ATOM 474   H HG2  . ARG A 1 35  ? -10.449 -2.897  -2.010  1.00 0.00 ? 35  ARG A HG2  1  
ATOM 475   H HG3  . ARG A 1 35  ? -10.799 -3.605  -3.589  1.00 0.00 ? 35  ARG A HG3  1  
ATOM 476   H HD2  . ARG A 1 35  ? -13.177 -3.729  -2.989  1.00 0.00 ? 35  ARG A HD2  1  
ATOM 477   H HD3  . ARG A 1 35  ? -12.814 -2.990  -1.430  1.00 0.00 ? 35  ARG A HD3  1  
ATOM 478   H HE   . ARG A 1 35  ? -11.840 -1.188  -3.181  1.00 0.00 ? 35  ARG A HE   1  
ATOM 479   H HH11 . ARG A 1 35  ? -14.910 -2.808  -2.915  1.00 0.00 ? 35  ARG A HH11 1  
ATOM 480   H HH12 . ARG A 1 35  ? -15.807 -1.502  -3.615  1.00 0.00 ? 35  ARG A HH12 1  
ATOM 481   H HH21 . ARG A 1 35  ? -13.010 0.539   -4.104  1.00 0.00 ? 35  ARG A HH21 1  
ATOM 482   H HH22 . ARG A 1 35  ? -14.725 0.401   -4.292  1.00 0.00 ? 35  ARG A HH22 1  
ATOM 483   N N    . VAL A 1 36  ? -7.698  -3.945  -0.985  1.00 0.00 ? 36  VAL A N    1  
ATOM 484   C CA   . VAL A 1 36  ? -6.987  -2.994  -0.139  1.00 0.00 ? 36  VAL A CA   1  
ATOM 485   C C    . VAL A 1 36  ? -7.229  -1.561  -0.599  1.00 0.00 ? 36  VAL A C    1  
ATOM 486   O O    . VAL A 1 36  ? -7.063  -1.240  -1.776  1.00 0.00 ? 36  VAL A O    1  
ATOM 487   C CB   . VAL A 1 36  ? -5.472  -3.271  -0.135  1.00 0.00 ? 36  VAL A CB   1  
ATOM 488   C CG1  . VAL A 1 36  ? -4.708  -2.051  0.356   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 489   C CG2  . VAL A 1 36  ? -5.156  -4.488  0.722   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 490   H H    . VAL A 1 36  ? -7.270  -4.269  -1.805  1.00 0.00 ? 36  VAL A H    1  
ATOM 491   H HA   . VAL A 1 36  ? -7.355  -3.106  0.870   1.00 0.00 ? 36  VAL A HA   1  
ATOM 492   H HB   . VAL A 1 36  ? -5.161  -3.480  -1.148  1.00 0.00 ? 36  VAL A HB   1  
ATOM 493   H HG11 . VAL A 1 36  ? -3.655  -2.285  0.413   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 494   H HG12 . VAL A 1 36  ? -4.859  -1.231  -0.331  1.00 0.00 ? 36  VAL A HG12 1  
ATOM 495   H HG13 . VAL A 1 36  ? -5.067  -1.772  1.336   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 496   H HG21 . VAL A 1 36  ? -5.273  -4.236  1.765   1.00 0.00 ? 36  VAL A HG21 1  
ATOM 497   H HG22 . VAL A 1 36  ? -5.831  -5.292  0.467   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 498   H HG23 . VAL A 1 36  ? -4.138  -4.803  0.540   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 499   N N    . SER A 1 37  ? -7.623  -0.704  0.337   1.00 0.00 ? 37  SER A N    1  
ATOM 500   C CA   . SER A 1 37  ? -7.892  0.696   0.028   1.00 0.00 ? 37  SER A CA   1  
ATOM 501   C C    . SER A 1 37  ? -7.174  1.617   1.009   1.00 0.00 ? 37  SER A C    1  
ATOM 502   O O    . SER A 1 37  ? -7.301  1.466   2.225   1.00 0.00 ? 37  SER A O    1  
ATOM 503   C CB   . SER A 1 37  ? -9.397  0.968   0.063   1.00 0.00 ? 37  SER A CB   1  
ATOM 504   O OG   . SER A 1 37  ? -9.662  2.344   0.271   1.00 0.00 ? 37  SER A OG   1  
ATOM 505   H H    . SER A 1 37  ? -7.738  -1.021  1.258   1.00 0.00 ? 37  SER A H    1  
ATOM 506   H HA   . SER A 1 37  ? -7.522  0.892   -0.968  1.00 0.00 ? 37  SER A HA   1  
ATOM 507   H HB2  . SER A 1 37  ? -9.836  0.667   -0.876  1.00 0.00 ? 37  SER A HB2  1  
ATOM 508   H HB3  . SER A 1 37  ? -9.844  0.401   0.867   1.00 0.00 ? 37  SER A HB3  1  
ATOM 509   H HG   . SER A 1 37  ? -9.275  2.856   -0.442  1.00 0.00 ? 37  SER A HG   1  
ATOM 510   N N    . TRP A 1 38  ? -6.421  2.570   0.473   1.00 0.00 ? 38  TRP A N    1  
ATOM 511   C CA   . TRP A 1 38  ? -5.682  3.516   1.302   1.00 0.00 ? 38  TRP A CA   1  
ATOM 512   C C    . TRP A 1 38  ? -6.260  4.921   1.171   1.00 0.00 ? 38  TRP A C    1  
ATOM 513   O O    . TRP A 1 38  ? -7.282  5.122   0.515   1.00 0.00 ? 38  TRP A O    1  
ATOM 514   C CB   . TRP A 1 38  ? -4.203  3.522   0.910   1.00 0.00 ? 38  TRP A CB   1  
ATOM 515   C CG   . TRP A 1 38  ? -3.981  3.614   -0.569  1.00 0.00 ? 38  TRP A CG   1  
ATOM 516   C CD1  . TRP A 1 38  ? -3.606  4.722   -1.275  1.00 0.00 ? 38  TRP A CD1  1  
ATOM 517   C CD2  . TRP A 1 38  ? -4.121  2.556   -1.524  1.00 0.00 ? 38  TRP A CD2  1  
ATOM 518   N NE1  . TRP A 1 38  ? -3.505  4.416   -2.611  1.00 0.00 ? 38  TRP A NE1  1  
ATOM 519   C CE2  . TRP A 1 38  ? -3.815  3.094   -2.790  1.00 0.00 ? 38  TRP A CE2  1  
ATOM 520   C CE3  . TRP A 1 38  ? -4.474  1.207   -1.433  1.00 0.00 ? 38  TRP A CE3  1  
ATOM 521   C CZ2  . TRP A 1 38  ? -3.853  2.329   -3.952  1.00 0.00 ? 38  TRP A CZ2  1  
ATOM 522   C CZ3  . TRP A 1 38  ? -4.511  0.449   -2.588  1.00 0.00 ? 38  TRP A CZ3  1  
ATOM 523   C CH2  . TRP A 1 38  ? -4.202  1.011   -3.834  1.00 0.00 ? 38  TRP A CH2  1  
ATOM 524   H H    . TRP A 1 38  ? -6.359  2.639   -0.503  1.00 0.00 ? 38  TRP A H    1  
ATOM 525   H HA   . TRP A 1 38  ? -5.771  3.196   2.329   1.00 0.00 ? 38  TRP A HA   1  
ATOM 526   H HB2  . TRP A 1 38  ? -3.718  4.368   1.373   1.00 0.00 ? 38  TRP A HB2  1  
ATOM 527   H HB3  . TRP A 1 38  ? -3.742  2.610   1.261   1.00 0.00 ? 38  TRP A HB3  1  
ATOM 528   H HD1  . TRP A 1 38  ? -3.422  5.689   -0.834  1.00 0.00 ? 38  TRP A HD1  1  
ATOM 529   H HE1  . TRP A 1 38  ? -3.251  5.044   -3.320  1.00 0.00 ? 38  TRP A HE1  1  
ATOM 530   H HE3  . TRP A 1 38  ? -4.716  0.756   -0.482  1.00 0.00 ? 38  TRP A HE3  1  
ATOM 531   H HZ2  . TRP A 1 38  ? -3.617  2.748   -4.920  1.00 0.00 ? 38  TRP A HZ2  1  
ATOM 532   H HZ3  . TRP A 1 38  ? -4.782  -0.595  -2.538  1.00 0.00 ? 38  TRP A HZ3  1  
ATOM 533   H HH2  . TRP A 1 38  ? -4.244  0.382   -4.710  1.00 0.00 ? 38  TRP A HH2  1  
ATOM 534   N N    . GLN A 1 39  ? -5.601  5.888   1.800   1.00 0.00 ? 39  GLN A N    1  
ATOM 535   C CA   . GLN A 1 39  ? -6.052  7.274   1.754   1.00 0.00 ? 39  GLN A CA   1  
ATOM 536   C C    . GLN A 1 39  ? -4.974  8.178   1.164   1.00 0.00 ? 39  GLN A C    1  
ATOM 537   O O    . GLN A 1 39  ? -3.851  8.227   1.664   1.00 0.00 ? 39  GLN A O    1  
ATOM 538   C CB   . GLN A 1 39  ? -6.428  7.757   3.156   1.00 0.00 ? 39  GLN A CB   1  
ATOM 539   C CG   . GLN A 1 39  ? -7.137  9.102   3.166   1.00 0.00 ? 39  GLN A CG   1  
ATOM 540   C CD   . GLN A 1 39  ? -8.642  8.970   3.045   1.00 0.00 ? 39  GLN A CD   1  
ATOM 541   O OE1  . GLN A 1 39  ? -9.217  7.943   3.404   1.00 0.00 ? 39  GLN A OE1  1  
ATOM 542   N NE2  . GLN A 1 39  ? -9.289  10.012  2.536   1.00 0.00 ? 39  GLN A NE2  1  
ATOM 543   H H    . GLN A 1 39  ? -4.794  5.665   2.308   1.00 0.00 ? 39  GLN A H    1  
ATOM 544   H HA   . GLN A 1 39  ? -6.926  7.317   1.122   1.00 0.00 ? 39  GLN A HA   1  
ATOM 545   H HB2  . GLN A 1 39  ? -7.080  7.028   3.613   1.00 0.00 ? 39  GLN A HB2  1  
ATOM 546   H HB3  . GLN A 1 39  ? -5.528  7.845   3.747   1.00 0.00 ? 39  GLN A HB3  1  
ATOM 547   H HG2  . GLN A 1 39  ? -6.909  9.608   4.093   1.00 0.00 ? 39  GLN A HG2  1  
ATOM 548   H HG3  . GLN A 1 39  ? -6.773  9.692   2.338   1.00 0.00 ? 39  GLN A HG3  1  
ATOM 549   H HE21 . GLN A 1 39  ? -8.765  10.797  2.270   1.00 0.00 ? 39  GLN A HE21 1  
ATOM 550   H HE22 . GLN A 1 39  ? -10.262 9.954   2.445   1.00 0.00 ? 39  GLN A HE22 1  
ATOM 551   N N    . GLU A 1 40  ? -5.325  8.891   0.098   1.00 0.00 ? 40  GLU A N    1  
ATOM 552   C CA   . GLU A 1 40  ? -4.387  9.792   -0.560  1.00 0.00 ? 40  GLU A CA   1  
ATOM 553   C C    . GLU A 1 40  ? -3.639  10.642  0.464   1.00 0.00 ? 40  GLU A C    1  
ATOM 554   O O    . GLU A 1 40  ? -4.178  11.593  1.031   1.00 0.00 ? 40  GLU A O    1  
ATOM 555   C CB   . GLU A 1 40  ? -5.123  10.697  -1.550  1.00 0.00 ? 40  GLU A CB   1  
ATOM 556   C CG   . GLU A 1 40  ? -4.204  11.630  -2.321  1.00 0.00 ? 40  GLU A CG   1  
ATOM 557   C CD   . GLU A 1 40  ? -4.902  12.304  -3.486  1.00 0.00 ? 40  GLU A CD   1  
ATOM 558   O OE1  . GLU A 1 40  ? -5.840  13.091  -3.241  1.00 0.00 ? 40  GLU A OE1  1  
ATOM 559   O OE2  . GLU A 1 40  ? -4.511  12.044  -4.643  1.00 0.00 ? 40  GLU A OE2  1  
ATOM 560   H H    . GLU A 1 40  ? -6.236  8.809   -0.253  1.00 0.00 ? 40  GLU A H    1  
ATOM 561   H HA   . GLU A 1 40  ? -3.672  9.190   -1.100  1.00 0.00 ? 40  GLU A HA   1  
ATOM 562   H HB2  . GLU A 1 40  ? -5.652  10.078  -2.260  1.00 0.00 ? 40  GLU A HB2  1  
ATOM 563   H HB3  . GLU A 1 40  ? -5.838  11.298  -1.007  1.00 0.00 ? 40  GLU A HB3  1  
ATOM 564   H HG2  . GLU A 1 40  ? -3.841  12.393  -1.649  1.00 0.00 ? 40  GLU A HG2  1  
ATOM 565   H HG3  . GLU A 1 40  ? -3.369  11.060  -2.701  1.00 0.00 ? 40  GLU A HG3  1  
ATOM 566   N N    . PRO A 1 41  ? -2.368  10.291  0.708   1.00 0.00 ? 41  PRO A N    1  
ATOM 567   C CA   . PRO A 1 41  ? -1.519  11.008  1.664   1.00 0.00 ? 41  PRO A CA   1  
ATOM 568   C C    . PRO A 1 41  ? -1.143  12.402  1.174   1.00 0.00 ? 41  PRO A C    1  
ATOM 569   O O    . PRO A 1 41  ? -1.391  12.753  0.020   1.00 0.00 ? 41  PRO A O    1  
ATOM 570   C CB   . PRO A 1 41  ? -0.273  10.123  1.765   1.00 0.00 ? 41  PRO A CB   1  
ATOM 571   C CG   . PRO A 1 41  ? -0.229  9.383   0.473   1.00 0.00 ? 41  PRO A CG   1  
ATOM 572   C CD   . PRO A 1 41  ? -1.661  9.168   0.069   1.00 0.00 ? 41  PRO A CD   1  
ATOM 573   H HA   . PRO A 1 41  ? -1.989  11.083  2.633   1.00 0.00 ? 41  PRO A HA   1  
ATOM 574   H HB2  . PRO A 1 41  ? 0.602   10.744  1.896   1.00 0.00 ? 41  PRO A HB2  1  
ATOM 575   H HB3  . PRO A 1 41  ? -0.373  9.449   2.602   1.00 0.00 ? 41  PRO A HB3  1  
ATOM 576   H HG2  . PRO A 1 41  ? 0.286   9.973   -0.270  1.00 0.00 ? 41  PRO A HG2  1  
ATOM 577   H HG3  . PRO A 1 41  ? 0.268   8.434   0.611   1.00 0.00 ? 41  PRO A HG3  1  
ATOM 578   H HD2  . PRO A 1 41  ? -1.761  9.211   -1.006  1.00 0.00 ? 41  PRO A HD2  1  
ATOM 579   H HD3  . PRO A 1 41  ? -2.022  8.223   0.446   1.00 0.00 ? 41  PRO A HD3  1  
ATOM 580   N N    . ARG A 1 42  ? -0.543  13.193  2.057   1.00 0.00 ? 42  ARG A N    1  
ATOM 581   C CA   . ARG A 1 42  ? -0.134  14.550  1.714   1.00 0.00 ? 42  ARG A CA   1  
ATOM 582   C C    . ARG A 1 42  ? 1.065   14.534  0.770   1.00 0.00 ? 42  ARG A C    1  
ATOM 583   O O    . ARG A 1 42  ? 1.979   13.723  0.926   1.00 0.00 ? 42  ARG A O    1  
ATOM 584   C CB   . ARG A 1 42  ? 0.209   15.338  2.980   1.00 0.00 ? 42  ARG A CB   1  
ATOM 585   C CG   . ARG A 1 42  ? 1.525   14.921  3.618   1.00 0.00 ? 42  ARG A CG   1  
ATOM 586   C CD   . ARG A 1 42  ? 1.935   15.880  4.724   1.00 0.00 ? 42  ARG A CD   1  
ATOM 587   N NE   . ARG A 1 42  ? 3.361   15.789  5.026   1.00 0.00 ? 42  ARG A NE   1  
ATOM 588   C CZ   . ARG A 1 42  ? 3.942   16.436  6.031   1.00 0.00 ? 42  ARG A CZ   1  
ATOM 589   N NH1  . ARG A 1 42  ? 3.223   17.216  6.826   1.00 0.00 ? 42  ARG A NH1  1  
ATOM 590   N NH2  . ARG A 1 42  ? 5.246   16.302  6.241   1.00 0.00 ? 42  ARG A NH2  1  
ATOM 591   H H    . ARG A 1 42  ? -0.372  12.857  2.962   1.00 0.00 ? 42  ARG A H    1  
ATOM 592   H HA   . ARG A 1 42  ? -0.963  15.031  1.216   1.00 0.00 ? 42  ARG A HA   1  
ATOM 593   H HB2  . ARG A 1 42  ? 0.272   16.387  2.731   1.00 0.00 ? 42  ARG A HB2  1  
ATOM 594   H HB3  . ARG A 1 42  ? -0.578  15.194  3.703   1.00 0.00 ? 42  ARG A HB3  1  
ATOM 595   H HG2  . ARG A 1 42  ? 1.413   13.932  4.037   1.00 0.00 ? 42  ARG A HG2  1  
ATOM 596   H HG3  . ARG A 1 42  ? 2.294   14.909  2.860   1.00 0.00 ? 42  ARG A HG3  1  
ATOM 597   H HD2  . ARG A 1 42  ? 1.707   16.888  4.412   1.00 0.00 ? 42  ARG A HD2  1  
ATOM 598   H HD3  . ARG A 1 42  ? 1.372   15.643  5.615   1.00 0.00 ? 42  ARG A HD3  1  
ATOM 599   H HE   . ARG A 1 42  ? 3.911   15.218  4.451   1.00 0.00 ? 42  ARG A HE   1  
ATOM 600   H HH11 . ARG A 1 42  ? 2.241   17.317  6.670   1.00 0.00 ? 42  ARG A HH11 1  
ATOM 601   H HH12 . ARG A 1 42  ? 3.663   17.700  7.582   1.00 0.00 ? 42  ARG A HH12 1  
ATOM 602   H HH21 . ARG A 1 42  ? 5.791   15.715  5.644   1.00 0.00 ? 42  ARG A HH21 1  
ATOM 603   H HH22 . ARG A 1 42  ? 5.682   16.789  6.997   1.00 0.00 ? 42  ARG A HH22 1  
ATOM 604   N N    . CYS A 1 43  ? 1.054   15.434  -0.206  1.00 0.00 ? 43  CYS A N    1  
ATOM 605   C CA   . CYS A 1 43  ? 2.141   15.523  -1.176  1.00 0.00 ? 43  CYS A CA   1  
ATOM 606   C C    . CYS A 1 43  ? 2.064   16.828  -1.960  1.00 0.00 ? 43  CYS A C    1  
ATOM 607   O O    . CYS A 1 43  ? 1.106   17.067  -2.695  1.00 0.00 ? 43  CYS A O    1  
ATOM 608   C CB   . CYS A 1 43  ? 2.093   14.333  -2.136  1.00 0.00 ? 43  CYS A CB   1  
ATOM 609   S SG   . CYS A 1 43  ? 0.563   14.218  -3.094  1.00 0.00 ? 43  CYS A SG   1  
ATOM 610   H H    . CYS A 1 43  ? 0.298   16.053  -0.278  1.00 0.00 ? 43  CYS A H    1  
ATOM 611   H HA   . CYS A 1 43  ? 3.072   15.498  -0.632  1.00 0.00 ? 43  CYS A HA   1  
ATOM 612   H HB2  . CYS A 1 43  ? 2.912   14.412  -2.836  1.00 0.00 ? 43  CYS A HB2  1  
ATOM 613   H HB3  . CYS A 1 43  ? 2.198   13.419  -1.571  1.00 0.00 ? 43  CYS A HB3  1  
ATOM 614   H HG   . CYS A 1 43  ? -0.381  13.739  -2.299  1.00 0.00 ? 43  CYS A HG   1  
ATOM 615   N N    . GLU A 1 44  ? 3.079   17.671  -1.797  1.00 0.00 ? 44  GLU A N    1  
ATOM 616   C CA   . GLU A 1 44  ? 3.125   18.954  -2.488  1.00 0.00 ? 44  GLU A CA   1  
ATOM 617   C C    . GLU A 1 44  ? 3.039   18.762  -3.999  1.00 0.00 ? 44  GLU A C    1  
ATOM 618   O O    . GLU A 1 44  ? 2.579   19.645  -4.723  1.00 0.00 ? 44  GLU A O    1  
ATOM 619   C CB   . GLU A 1 44  ? 4.408   19.706  -2.130  1.00 0.00 ? 44  GLU A CB   1  
ATOM 620   C CG   . GLU A 1 44  ? 4.392   20.310  -0.736  1.00 0.00 ? 44  GLU A CG   1  
ATOM 621   C CD   . GLU A 1 44  ? 5.782   20.463  -0.150  1.00 0.00 ? 44  GLU A CD   1  
ATOM 622   O OE1  . GLU A 1 44  ? 6.510   21.382  -0.579  1.00 0.00 ? 44  GLU A OE1  1  
ATOM 623   O OE2  . GLU A 1 44  ? 6.141   19.662  0.739   1.00 0.00 ? 44  GLU A OE2  1  
ATOM 624   H H    . GLU A 1 44  ? 3.814   17.425  -1.197  1.00 0.00 ? 44  GLU A H    1  
ATOM 625   H HA   . GLU A 1 44  ? 2.275   19.536  -2.163  1.00 0.00 ? 44  GLU A HA   1  
ATOM 626   H HB2  . GLU A 1 44  ? 5.242   19.022  -2.195  1.00 0.00 ? 44  GLU A HB2  1  
ATOM 627   H HB3  . GLU A 1 44  ? 4.554   20.504  -2.843  1.00 0.00 ? 44  GLU A HB3  1  
ATOM 628   H HG2  . GLU A 1 44  ? 3.930   21.285  -0.785  1.00 0.00 ? 44  GLU A HG2  1  
ATOM 629   H HG3  . GLU A 1 44  ? 3.812   19.670  -0.088  1.00 0.00 ? 44  GLU A HG3  1  
ATOM 630   N N    . ARG A 1 45  ? 3.487   17.601  -4.468  1.00 0.00 ? 45  ARG A N    1  
ATOM 631   C CA   . ARG A 1 45  ? 3.463   17.292  -5.893  1.00 0.00 ? 45  ARG A CA   1  
ATOM 632   C C    . ARG A 1 45  ? 2.372   16.274  -6.210  1.00 0.00 ? 45  ARG A C    1  
ATOM 633   O O    . ARG A 1 45  ? 1.978   15.467  -5.368  1.00 0.00 ? 45  ARG A O    1  
ATOM 634   C CB   . ARG A 1 45  ? 4.823   16.755  -6.342  1.00 0.00 ? 45  ARG A CB   1  
ATOM 635   C CG   . ARG A 1 45  ? 5.966   17.733  -6.126  1.00 0.00 ? 45  ARG A CG   1  
ATOM 636   C CD   . ARG A 1 45  ? 5.851   18.938  -7.048  1.00 0.00 ? 45  ARG A CD   1  
ATOM 637   N NE   . ARG A 1 45  ? 7.086   19.715  -7.090  1.00 0.00 ? 45  ARG A NE   1  
ATOM 638   C CZ   . ARG A 1 45  ? 7.232   20.825  -7.805  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 639   N NH1  . ARG A 1 45  ? 6.224   21.287  -8.532  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 640   N NH2  . ARG A 1 45  ? 8.388   21.477  -7.792  1.00 0.00 ? 45  ARG A NH2  1  
ATOM 641   H H    . ARG A 1 45  ? 3.842   16.937  -3.841  1.00 0.00 ? 45  ARG A H    1  
ATOM 642   H HA   . ARG A 1 45  ? 3.253   18.207  -6.427  1.00 0.00 ? 45  ARG A HA   1  
ATOM 643   H HB2  . ARG A 1 45  ? 5.041   15.853  -5.790  1.00 0.00 ? 45  ARG A HB2  1  
ATOM 644   H HB3  . ARG A 1 45  ? 4.773   16.520  -7.395  1.00 0.00 ? 45  ARG A HB3  1  
ATOM 645   H HG2  . ARG A 1 45  ? 5.946   18.075  -5.102  1.00 0.00 ? 45  ARG A HG2  1  
ATOM 646   H HG3  . ARG A 1 45  ? 6.901   17.229  -6.322  1.00 0.00 ? 45  ARG A HG3  1  
ATOM 647   H HD2  . ARG A 1 45  ? 5.620   18.591  -8.044  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 648   H HD3  . ARG A 1 45  ? 5.051   19.570  -6.693  1.00 0.00 ? 45  ARG A HD3  1  
ATOM 649   H HE   . ARG A 1 45  ? 7.844   19.391  -6.560  1.00 0.00 ? 45  ARG A HE   1  
ATOM 650   H HH11 . ARG A 1 45  ? 5.352   20.798  -8.542  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 651   H HH12 . ARG A 1 45  ? 6.336   22.124  -9.068  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 652   H HH21 . ARG A 1 45  ? 9.150   21.132  -7.245  1.00 0.00 ? 45  ARG A HH21 1  
ATOM 653   H HH22 . ARG A 1 45  ? 8.497   22.312  -8.330  1.00 0.00 ? 45  ARG A HH22 1  
ATOM 654   N N    . PRO A 1 46  ? 1.871   16.312  -7.454  1.00 0.00 ? 46  PRO A N    1  
ATOM 655   C CA   . PRO A 1 46  ? 0.818   15.400  -7.911  1.00 0.00 ? 46  PRO A CA   1  
ATOM 656   C C    . PRO A 1 46  ? 1.315   13.965  -8.050  1.00 0.00 ? 46  PRO A C    1  
ATOM 657   O O    . PRO A 1 46  ? 2.290   13.700  -8.754  1.00 0.00 ? 46  PRO A O    1  
ATOM 658   C CB   . PRO A 1 46  ? 0.429   15.965  -9.280  1.00 0.00 ? 46  PRO A CB   1  
ATOM 659   C CG   . PRO A 1 46  ? 1.641   16.696  -9.746  1.00 0.00 ? 46  PRO A CG   1  
ATOM 660   C CD   . PRO A 1 46  ? 2.293   17.248  -8.509  1.00 0.00 ? 46  PRO A CD   1  
ATOM 661   H HA   . PRO A 1 46  ? -0.039  15.421  -7.254  1.00 0.00 ? 46  PRO A HA   1  
ATOM 662   H HB2  . PRO A 1 46  ? 0.174   15.155  -9.947  1.00 0.00 ? 46  PRO A HB2  1  
ATOM 663   H HB3  . PRO A 1 46  ? -0.415  16.630  -9.172  1.00 0.00 ? 46  PRO A HB3  1  
ATOM 664   H HG2  . PRO A 1 46  ? 2.309   16.014  -10.251 1.00 0.00 ? 46  PRO A HG2  1  
ATOM 665   H HG3  . PRO A 1 46  ? 1.352   17.499  -10.408 1.00 0.00 ? 46  PRO A HG3  1  
ATOM 666   H HD2  . PRO A 1 46  ? 3.368   17.247  -8.618  1.00 0.00 ? 46  PRO A HD2  1  
ATOM 667   H HD3  . PRO A 1 46  ? 1.933   18.246  -8.306  1.00 0.00 ? 46  PRO A HD3  1  
ATOM 668   N N    . LEU A 1 47  ? 0.638   13.042  -7.375  1.00 0.00 ? 47  LEU A N    1  
ATOM 669   C CA   . LEU A 1 47  ? 1.011   11.632  -7.423  1.00 0.00 ? 47  LEU A CA   1  
ATOM 670   C C    . LEU A 1 47  ? 0.852   11.075  -8.834  1.00 0.00 ? 47  LEU A C    1  
ATOM 671   O O    . LEU A 1 47  ? -0.038  11.487  -9.577  1.00 0.00 ? 47  LEU A O    1  
ATOM 672   C CB   . LEU A 1 47  ? 0.156   10.825  -6.445  1.00 0.00 ? 47  LEU A CB   1  
ATOM 673   C CG   . LEU A 1 47  ? 0.084   11.362  -5.015  1.00 0.00 ? 47  LEU A CG   1  
ATOM 674   C CD1  . LEU A 1 47  ? -1.151  10.828  -4.306  1.00 0.00 ? 47  LEU A CD1  1  
ATOM 675   C CD2  . LEU A 1 47  ? 1.344   10.995  -4.244  1.00 0.00 ? 47  LEU A CD2  1  
ATOM 676   H H    . LEU A 1 47  ? -0.130  13.314  -6.831  1.00 0.00 ? 47  LEU A H    1  
ATOM 677   H HA   . LEU A 1 47  ? 2.048   11.554  -7.132  1.00 0.00 ? 47  LEU A HA   1  
ATOM 678   H HB2  . LEU A 1 47  ? -0.850  10.790  -6.836  1.00 0.00 ? 47  LEU A HB2  1  
ATOM 679   H HB3  . LEU A 1 47  ? 0.559   9.823   -6.404  1.00 0.00 ? 47  LEU A HB3  1  
ATOM 680   H HG   . LEU A 1 47  ? 0.011   12.440  -5.045  1.00 0.00 ? 47  LEU A HG   1  
ATOM 681   H HD11 . LEU A 1 47  ? -1.318  9.802   -4.597  1.00 0.00 ? 47  LEU A HD11 1  
ATOM 682   H HD12 . LEU A 1 47  ? -2.009  11.424  -4.580  1.00 0.00 ? 47  LEU A HD12 1  
ATOM 683   H HD13 . LEU A 1 47  ? -1.003  10.881  -3.237  1.00 0.00 ? 47  LEU A HD13 1  
ATOM 684   H HD21 . LEU A 1 47  ? 1.071   10.509  -3.319  1.00 0.00 ? 47  LEU A HD21 1  
ATOM 685   H HD22 . LEU A 1 47  ? 1.907   11.891  -4.029  1.00 0.00 ? 47  LEU A HD22 1  
ATOM 686   H HD23 . LEU A 1 47  ? 1.948   10.325  -4.839  1.00 0.00 ? 47  LEU A HD23 1  
ATOM 687   N N    . GLN A 1 48  ? 1.721   10.137  -9.195  1.00 0.00 ? 48  GLN A N    1  
ATOM 688   C CA   . GLN A 1 48  ? 1.676   9.522   -10.517 1.00 0.00 ? 48  GLN A CA   1  
ATOM 689   C C    . GLN A 1 48  ? 1.004   8.154   -10.459 1.00 0.00 ? 48  GLN A C    1  
ATOM 690   O O    . GLN A 1 48  ? 0.498   7.657   -11.464 1.00 0.00 ? 48  GLN A O    1  
ATOM 691   C CB   . GLN A 1 48  ? 3.089   9.386   -11.088 1.00 0.00 ? 48  GLN A CB   1  
ATOM 692   C CG   . GLN A 1 48  ? 3.853   10.699  -11.140 1.00 0.00 ? 48  GLN A CG   1  
ATOM 693   C CD   . GLN A 1 48  ? 3.656   11.438  -12.449 1.00 0.00 ? 48  GLN A CD   1  
ATOM 694   O OE1  . GLN A 1 48  ? 2.585   11.989  -12.709 1.00 0.00 ? 48  GLN A OE1  1  
ATOM 695   N NE2  . GLN A 1 48  ? 4.689   11.453  -13.282 1.00 0.00 ? 48  GLN A NE2  1  
ATOM 696   H H    . GLN A 1 48  ? 2.409   9.851   -8.559  1.00 0.00 ? 48  GLN A H    1  
ATOM 697   H HA   . GLN A 1 48  ? 1.098   10.166  -11.162 1.00 0.00 ? 48  GLN A HA   1  
ATOM 698   H HB2  . GLN A 1 48  ? 3.647   8.694   -10.475 1.00 0.00 ? 48  GLN A HB2  1  
ATOM 699   H HB3  . GLN A 1 48  ? 3.023   8.993   -12.092 1.00 0.00 ? 48  GLN A HB3  1  
ATOM 700   H HG2  . GLN A 1 48  ? 3.513   11.331  -10.333 1.00 0.00 ? 48  GLN A HG2  1  
ATOM 701   H HG3  . GLN A 1 48  ? 4.906   10.493  -11.015 1.00 0.00 ? 48  GLN A HG3  1  
ATOM 702   H HE21 . GLN A 1 48  ? 5.511   10.992  -13.009 1.00 0.00 ? 48  GLN A HE21 1  
ATOM 703   H HE22 . GLN A 1 48  ? 4.589   11.923  -14.136 1.00 0.00 ? 48  GLN A HE22 1  
ATOM 704   N N    . GLY A 1 49  ? 1.004   7.550   -9.274  1.00 0.00 ? 49  GLY A N    1  
ATOM 705   C CA   . GLY A 1 49  ? 0.392   6.245   -9.108  1.00 0.00 ? 49  GLY A CA   1  
ATOM 706   C C    . GLY A 1 49  ? 0.554   5.704   -7.701  1.00 0.00 ? 49  GLY A C    1  
ATOM 707   O O    . GLY A 1 49  ? 0.752   6.467   -6.754  1.00 0.00 ? 49  GLY A O    1  
ATOM 708   H H    . GLY A 1 49  ? 1.423   7.994   -8.508  1.00 0.00 ? 49  GLY A H    1  
ATOM 709   H HA2  . GLY A 1 49  ? -0.660  6.322   -9.334  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 710   H HA3  . GLY A 1 49  ? 0.850   5.554   -9.801  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 711   N N    . TYR A 1 50  ? 0.468   4.386   -7.562  1.00 0.00 ? 50  TYR A N    1  
ATOM 712   C CA   . TYR A 1 50  ? 0.602   3.745   -6.259  1.00 0.00 ? 50  TYR A CA   1  
ATOM 713   C C    . TYR A 1 50  ? 1.199   2.348   -6.399  1.00 0.00 ? 50  TYR A C    1  
ATOM 714   O O    . TYR A 1 50  ? 1.239   1.784   -7.492  1.00 0.00 ? 50  TYR A O    1  
ATOM 715   C CB   . TYR A 1 50  ? -0.759  3.662   -5.566  1.00 0.00 ? 50  TYR A CB   1  
ATOM 716   C CG   . TYR A 1 50  ? -1.177  4.953   -4.898  1.00 0.00 ? 50  TYR A CG   1  
ATOM 717   C CD1  . TYR A 1 50  ? -0.808  5.231   -3.588  1.00 0.00 ? 50  TYR A CD1  1  
ATOM 718   C CD2  . TYR A 1 50  ? -1.943  5.893   -5.577  1.00 0.00 ? 50  TYR A CD2  1  
ATOM 719   C CE1  . TYR A 1 50  ? -1.189  6.409   -2.974  1.00 0.00 ? 50  TYR A CE1  1  
ATOM 720   C CE2  . TYR A 1 50  ? -2.327  7.073   -4.971  1.00 0.00 ? 50  TYR A CE2  1  
ATOM 721   C CZ   . TYR A 1 50  ? -1.947  7.327   -3.670  1.00 0.00 ? 50  TYR A CZ   1  
ATOM 722   O OH   . TYR A 1 50  ? -2.329  8.501   -3.062  1.00 0.00 ? 50  TYR A OH   1  
ATOM 723   H H    . TYR A 1 50  ? 0.309   3.831   -8.354  1.00 0.00 ? 50  TYR A H    1  
ATOM 724   H HA   . TYR A 1 50  ? 1.265   4.349   -5.658  1.00 0.00 ? 50  TYR A HA   1  
ATOM 725   H HB2  . TYR A 1 50  ? -1.512  3.407   -6.295  1.00 0.00 ? 50  TYR A HB2  1  
ATOM 726   H HB3  . TYR A 1 50  ? -0.723  2.893   -4.808  1.00 0.00 ? 50  TYR A HB3  1  
ATOM 727   H HD1  . TYR A 1 50  ? -0.214  4.511   -3.045  1.00 0.00 ? 50  TYR A HD1  1  
ATOM 728   H HD2  . TYR A 1 50  ? -2.238  5.691   -6.597  1.00 0.00 ? 50  TYR A HD2  1  
ATOM 729   H HE1  . TYR A 1 50  ? -0.892  6.608   -1.955  1.00 0.00 ? 50  TYR A HE1  1  
ATOM 730   H HE2  . TYR A 1 50  ? -2.921  7.792   -5.516  1.00 0.00 ? 50  TYR A HE2  1  
ATOM 731   H HH   . TYR A 1 50  ? -3.200  8.755   -3.376  1.00 0.00 ? 50  TYR A HH   1  
ATOM 732   N N    . SER A 1 51  ? 1.664   1.795   -5.283  1.00 0.00 ? 51  SER A N    1  
ATOM 733   C CA   . SER A 1 51  ? 2.263   0.466   -5.279  1.00 0.00 ? 51  SER A CA   1  
ATOM 734   C C    . SER A 1 51  ? 1.755   -0.356  -4.098  1.00 0.00 ? 51  SER A C    1  
ATOM 735   O O    . SER A 1 51  ? 1.872   0.057   -2.944  1.00 0.00 ? 51  SER A O    1  
ATOM 736   C CB   . SER A 1 51  ? 3.788   0.571   -5.224  1.00 0.00 ? 51  SER A CB   1  
ATOM 737   O OG   . SER A 1 51  ? 4.396   -0.675  -5.518  1.00 0.00 ? 51  SER A OG   1  
ATOM 738   H H    . SER A 1 51  ? 1.604   2.296   -4.442  1.00 0.00 ? 51  SER A H    1  
ATOM 739   H HA   . SER A 1 51  ? 1.977   -0.029  -6.196  1.00 0.00 ? 51  SER A HA   1  
ATOM 740   H HB2  . SER A 1 51  ? 4.123   1.300   -5.946  1.00 0.00 ? 51  SER A HB2  1  
ATOM 741   H HB3  . SER A 1 51  ? 4.089   0.880   -4.234  1.00 0.00 ? 51  SER A HB3  1  
ATOM 742   H HG   . SER A 1 51  ? 4.602   -0.718  -6.454  1.00 0.00 ? 51  SER A HG   1  
ATOM 743   N N    . VAL A 1 52  ? 1.190   -1.521  -4.396  1.00 0.00 ? 52  VAL A N    1  
ATOM 744   C CA   . VAL A 1 52  ? 0.664   -2.403  -3.360  1.00 0.00 ? 52  VAL A CA   1  
ATOM 745   C C    . VAL A 1 52  ? 1.421   -3.726  -3.328  1.00 0.00 ? 52  VAL A C    1  
ATOM 746   O O    . VAL A 1 52  ? 1.140   -4.632  -4.111  1.00 0.00 ? 52  VAL A O    1  
ATOM 747   C CB   . VAL A 1 52  ? -0.835  -2.687  -3.572  1.00 0.00 ? 52  VAL A CB   1  
ATOM 748   C CG1  . VAL A 1 52  ? -1.379  -3.553  -2.447  1.00 0.00 ? 52  VAL A CG1  1  
ATOM 749   C CG2  . VAL A 1 52  ? -1.614  -1.385  -3.678  1.00 0.00 ? 52  VAL A CG2  1  
ATOM 750   H H    . VAL A 1 52  ? 1.125   -1.796  -5.335  1.00 0.00 ? 52  VAL A H    1  
ATOM 751   H HA   . VAL A 1 52  ? 0.784   -1.907  -2.408  1.00 0.00 ? 52  VAL A HA   1  
ATOM 752   H HB   . VAL A 1 52  ? -0.950  -3.228  -4.500  1.00 0.00 ? 52  VAL A HB   1  
ATOM 753   H HG11 . VAL A 1 52  ? -0.556  -3.967  -1.882  1.00 0.00 ? 52  VAL A HG11 1  
ATOM 754   H HG12 . VAL A 1 52  ? -1.998  -2.952  -1.797  1.00 0.00 ? 52  VAL A HG12 1  
ATOM 755   H HG13 . VAL A 1 52  ? -1.968  -4.357  -2.864  1.00 0.00 ? 52  VAL A HG13 1  
ATOM 756   H HG21 . VAL A 1 52  ? -0.986  -0.563  -3.368  1.00 0.00 ? 52  VAL A HG21 1  
ATOM 757   H HG22 . VAL A 1 52  ? -1.925  -1.235  -4.701  1.00 0.00 ? 52  VAL A HG22 1  
ATOM 758   H HG23 . VAL A 1 52  ? -2.485  -1.433  -3.041  1.00 0.00 ? 52  VAL A HG23 1  
ATOM 759   N N    . GLU A 1 53  ? 2.384   -3.828  -2.417  1.00 0.00 ? 53  GLU A N    1  
ATOM 760   C CA   . GLU A 1 53  ? 3.182   -5.041  -2.283  1.00 0.00 ? 53  GLU A CA   1  
ATOM 761   C C    . GLU A 1 53  ? 2.626   -5.941  -1.183  1.00 0.00 ? 53  GLU A C    1  
ATOM 762   O O    . GLU A 1 53  ? 2.401   -5.496  -0.057  1.00 0.00 ? 53  GLU A O    1  
ATOM 763   C CB   . GLU A 1 53  ? 4.640   -4.688  -1.980  1.00 0.00 ? 53  GLU A CB   1  
ATOM 764   C CG   . GLU A 1 53  ? 5.496   -4.517  -3.223  1.00 0.00 ? 53  GLU A CG   1  
ATOM 765   C CD   . GLU A 1 53  ? 6.685   -3.604  -2.992  1.00 0.00 ? 53  GLU A CD   1  
ATOM 766   O OE1  . GLU A 1 53  ? 7.522   -3.928  -2.124  1.00 0.00 ? 53  GLU A OE1  1  
ATOM 767   O OE2  . GLU A 1 53  ? 6.777   -2.565  -3.679  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 768   H H    . GLU A 1 53  ? 2.561   -3.071  -1.821  1.00 0.00 ? 53  GLU A H    1  
ATOM 769   H HA   . GLU A 1 53  ? 3.138   -5.572  -3.222  1.00 0.00 ? 53  GLU A HA   1  
ATOM 770   H HB2  . GLU A 1 53  ? 4.665   -3.765  -1.420  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 771   H HB3  . GLU A 1 53  ? 5.070   -5.475  -1.378  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 772   H HG2  . GLU A 1 53  ? 5.861   -5.486  -3.530  1.00 0.00 ? 53  GLU A HG2  1  
ATOM 773   H HG3  . GLU A 1 53  ? 4.886   -4.098  -4.010  1.00 0.00 ? 53  GLU A HG3  1  
ATOM 774   N N    . TYR A 1 54  ? 2.405   -7.207  -1.518  1.00 0.00 ? 54  TYR A N    1  
ATOM 775   C CA   . TYR A 1 54  ? 1.872   -8.169  -0.561  1.00 0.00 ? 54  TYR A CA   1  
ATOM 776   C C    . TYR A 1 54  ? 2.639   -9.486  -0.627  1.00 0.00 ? 54  TYR A C    1  
ATOM 777   O O    . TYR A 1 54  ? 3.101   -9.894  -1.693  1.00 0.00 ? 54  TYR A O    1  
ATOM 778   C CB   . TYR A 1 54  ? 0.386   -8.417  -0.828  1.00 0.00 ? 54  TYR A CB   1  
ATOM 779   C CG   . TYR A 1 54  ? 0.126   -9.294  -2.032  1.00 0.00 ? 54  TYR A CG   1  
ATOM 780   C CD1  . TYR A 1 54  ? 0.342   -10.665 -1.976  1.00 0.00 ? 54  TYR A CD1  1  
ATOM 781   C CD2  . TYR A 1 54  ? -0.335  -8.752  -3.225  1.00 0.00 ? 54  TYR A CD2  1  
ATOM 782   C CE1  . TYR A 1 54  ? 0.107   -11.471 -3.073  1.00 0.00 ? 54  TYR A CE1  1  
ATOM 783   C CE2  . TYR A 1 54  ? -0.575  -9.550  -4.327  1.00 0.00 ? 54  TYR A CE2  1  
ATOM 784   C CZ   . TYR A 1 54  ? -0.352  -10.909 -4.246  1.00 0.00 ? 54  TYR A CZ   1  
ATOM 785   O OH   . TYR A 1 54  ? -0.589  -11.707 -5.342  1.00 0.00 ? 54  TYR A OH   1  
ATOM 786   H H    . TYR A 1 54  ? 2.604   -7.502  -2.431  1.00 0.00 ? 54  TYR A H    1  
ATOM 787   H HA   . TYR A 1 54  ? 1.984   -7.749  0.428   1.00 0.00 ? 54  TYR A HA   1  
ATOM 788   H HB2  . TYR A 1 54  ? -0.052  -8.897  0.032   1.00 0.00 ? 54  TYR A HB2  1  
ATOM 789   H HB3  . TYR A 1 54  ? -0.105  -7.469  -0.995  1.00 0.00 ? 54  TYR A HB3  1  
ATOM 790   H HD1  . TYR A 1 54  ? 0.702   -11.103 -1.056  1.00 0.00 ? 54  TYR A HD1  1  
ATOM 791   H HD2  . TYR A 1 54  ? -0.508  -7.687  -3.285  1.00 0.00 ? 54  TYR A HD2  1  
ATOM 792   H HE1  . TYR A 1 54  ? 0.281   -12.535 -3.011  1.00 0.00 ? 54  TYR A HE1  1  
ATOM 793   H HE2  . TYR A 1 54  ? -0.934  -9.109  -5.245  1.00 0.00 ? 54  TYR A HE2  1  
ATOM 794   H HH   . TYR A 1 54  ? -0.757  -12.606 -5.052  1.00 0.00 ? 54  TYR A HH   1  
ATOM 795   N N    . GLN A 1 55  ? 2.769   -10.146 0.519   1.00 0.00 ? 55  GLN A N    1  
ATOM 796   C CA   . GLN A 1 55  ? 3.479   -11.417 0.591   1.00 0.00 ? 55  GLN A CA   1  
ATOM 797   C C    . GLN A 1 55  ? 3.199   -12.123 1.914   1.00 0.00 ? 55  GLN A C    1  
ATOM 798   O O    . GLN A 1 55  ? 2.905   -11.480 2.923   1.00 0.00 ? 55  GLN A O    1  
ATOM 799   C CB   . GLN A 1 55  ? 4.984   -11.195 0.428   1.00 0.00 ? 55  GLN A CB   1  
ATOM 800   C CG   . GLN A 1 55  ? 5.693   -10.848 1.728   1.00 0.00 ? 55  GLN A CG   1  
ATOM 801   C CD   . GLN A 1 55  ? 7.106   -10.347 1.506   1.00 0.00 ? 55  GLN A CD   1  
ATOM 802   O OE1  . GLN A 1 55  ? 7.486   -9.287  2.006   1.00 0.00 ? 55  GLN A OE1  1  
ATOM 803   N NE2  . GLN A 1 55  ? 7.893   -11.107 0.754   1.00 0.00 ? 55  GLN A NE2  1  
ATOM 804   H H    . GLN A 1 55  ? 2.378   -9.769  1.334   1.00 0.00 ? 55  GLN A H    1  
ATOM 805   H HA   . GLN A 1 55  ? 3.127   -12.040 -0.217  1.00 0.00 ? 55  GLN A HA   1  
ATOM 806   H HB2  . GLN A 1 55  ? 5.428   -12.094 0.029   1.00 0.00 ? 55  GLN A HB2  1  
ATOM 807   H HB3  . GLN A 1 55  ? 5.142   -10.385 -0.269  1.00 0.00 ? 55  GLN A HB3  1  
ATOM 808   H HG2  . GLN A 1 55  ? 5.130   -10.080 2.236   1.00 0.00 ? 55  GLN A HG2  1  
ATOM 809   H HG3  . GLN A 1 55  ? 5.733   -11.732 2.347   1.00 0.00 ? 55  GLN A HG3  1  
ATOM 810   H HE21 . GLN A 1 55  ? 7.522   -11.937 0.388   1.00 0.00 ? 55  GLN A HE21 1  
ATOM 811   H HE22 . GLN A 1 55  ? 8.811   -10.806 0.593   1.00 0.00 ? 55  GLN A HE22 1  
ATOM 812   N N    . LEU A 1 56  ? 3.291   -13.448 1.903   1.00 0.00 ? 56  LEU A N    1  
ATOM 813   C CA   . LEU A 1 56  ? 3.047   -14.242 3.102   1.00 0.00 ? 56  LEU A CA   1  
ATOM 814   C C    . LEU A 1 56  ? 3.758   -13.640 4.309   1.00 0.00 ? 56  LEU A C    1  
ATOM 815   O O    . LEU A 1 56  ? 4.986   -13.538 4.332   1.00 0.00 ? 56  LEU A O    1  
ATOM 816   C CB   . LEU A 1 56  ? 3.513   -15.683 2.887   1.00 0.00 ? 56  LEU A CB   1  
ATOM 817   C CG   . LEU A 1 56  ? 2.578   -16.577 2.072   1.00 0.00 ? 56  LEU A CG   1  
ATOM 818   C CD1  . LEU A 1 56  ? 3.264   -17.889 1.723   1.00 0.00 ? 56  LEU A CD1  1  
ATOM 819   C CD2  . LEU A 1 56  ? 1.287   -16.835 2.835   1.00 0.00 ? 56  LEU A CD2  1  
ATOM 820   H H    . LEU A 1 56  ? 3.529   -13.904 1.069   1.00 0.00 ? 56  LEU A H    1  
ATOM 821   H HA   . LEU A 1 56  ? 1.983   -14.241 3.289   1.00 0.00 ? 56  LEU A HA   1  
ATOM 822   H HB2  . LEU A 1 56  ? 4.465   -15.650 2.379   1.00 0.00 ? 56  LEU A HB2  1  
ATOM 823   H HB3  . LEU A 1 56  ? 3.642   -16.137 3.859   1.00 0.00 ? 56  LEU A HB3  1  
ATOM 824   H HG   . LEU A 1 56  ? 2.327   -16.076 1.147   1.00 0.00 ? 56  LEU A HG   1  
ATOM 825   H HD11 . LEU A 1 56  ? 2.539   -18.576 1.313   1.00 0.00 ? 56  LEU A HD11 1  
ATOM 826   H HD12 . LEU A 1 56  ? 3.700   -18.315 2.614   1.00 0.00 ? 56  LEU A HD12 1  
ATOM 827   H HD13 . LEU A 1 56  ? 4.040   -17.707 0.994   1.00 0.00 ? 56  LEU A HD13 1  
ATOM 828   H HD21 . LEU A 1 56  ? 0.810   -15.893 3.064   1.00 0.00 ? 56  LEU A HD21 1  
ATOM 829   H HD22 . LEU A 1 56  ? 1.510   -17.358 3.753   1.00 0.00 ? 56  LEU A HD22 1  
ATOM 830   H HD23 . LEU A 1 56  ? 0.625   -17.437 2.230   1.00 0.00 ? 56  LEU A HD23 1  
ATOM 831   N N    . LEU A 1 57  ? 2.981   -13.244 5.310   1.00 0.00 ? 57  LEU A N    1  
ATOM 832   C CA   . LEU A 1 57  ? 3.537   -12.653 6.523   1.00 0.00 ? 57  LEU A CA   1  
ATOM 833   C C    . LEU A 1 57  ? 4.791   -13.400 6.967   1.00 0.00 ? 57  LEU A C    1  
ATOM 834   O O    . LEU A 1 57  ? 5.836   -12.794 7.198   1.00 0.00 ? 57  LEU A O    1  
ATOM 835   C CB   . LEU A 1 57  ? 2.497   -12.668 7.644   1.00 0.00 ? 57  LEU A CB   1  
ATOM 836   C CG   . LEU A 1 57  ? 2.649   -11.588 8.716   1.00 0.00 ? 57  LEU A CG   1  
ATOM 837   C CD1  . LEU A 1 57  ? 2.508   -10.204 8.101   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 838   C CD2  . LEU A 1 57  ? 1.626   -11.788 9.824   1.00 0.00 ? 57  LEU A CD2  1  
ATOM 839   H H    . LEU A 1 57  ? 2.010   -13.351 5.234   1.00 0.00 ? 57  LEU A H    1  
ATOM 840   H HA   . LEU A 1 57  ? 3.801   -11.630 6.302   1.00 0.00 ? 57  LEU A HA   1  
ATOM 841   H HB2  . LEU A 1 57  ? 1.523   -12.552 7.194   1.00 0.00 ? 57  LEU A HB2  1  
ATOM 842   H HB3  . LEU A 1 57  ? 2.553   -13.631 8.133   1.00 0.00 ? 57  LEU A HB3  1  
ATOM 843   H HG   . LEU A 1 57  ? 3.635   -11.659 9.153   1.00 0.00 ? 57  LEU A HG   1  
ATOM 844   H HD11 . LEU A 1 57  ? 1.804   -10.243 7.284   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 845   H HD12 . LEU A 1 57  ? 3.468   -9.874  7.734   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 846   H HD13 . LEU A 1 57  ? 2.153   -9.512  8.851   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 847   H HD21 . LEU A 1 57  ? 2.098   -12.273 10.666  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 848   H HD22 . LEU A 1 57  ? 0.817   -12.404 9.460   1.00 0.00 ? 57  LEU A HD22 1  
ATOM 849   H HD23 . LEU A 1 57  ? 1.237   -10.828 10.132  1.00 0.00 ? 57  LEU A HD23 1  
ATOM 850   N N    . ASN A 1 58  ? 4.679   -14.719 7.081   1.00 0.00 ? 58  ASN A N    1  
ATOM 851   C CA   . ASN A 1 58  ? 5.804   -15.549 7.495   1.00 0.00 ? 58  ASN A CA   1  
ATOM 852   C C    . ASN A 1 58  ? 6.992   -15.364 6.555   1.00 0.00 ? 58  ASN A C    1  
ATOM 853   O O    . ASN A 1 58  ? 8.128   -15.203 6.998   1.00 0.00 ? 58  ASN A O    1  
ATOM 854   C CB   . ASN A 1 58  ? 5.393   -17.022 7.531   1.00 0.00 ? 58  ASN A CB   1  
ATOM 855   C CG   . ASN A 1 58  ? 4.855   -17.505 6.198   1.00 0.00 ? 58  ASN A CG   1  
ATOM 856   O OD1  . ASN A 1 58  ? 5.609   -17.972 5.344   1.00 0.00 ? 58  ASN A OD1  1  
ATOM 857   N ND2  . ASN A 1 58  ? 3.545   -17.394 6.013   1.00 0.00 ? 58  ASN A ND2  1  
ATOM 858   H H    . ASN A 1 58  ? 3.819   -15.145 6.883   1.00 0.00 ? 58  ASN A H    1  
ATOM 859   H HA   . ASN A 1 58  ? 6.095   -15.241 8.489   1.00 0.00 ? 58  ASN A HA   1  
ATOM 860   H HB2  . ASN A 1 58  ? 6.252   -17.623 7.790   1.00 0.00 ? 58  ASN A HB2  1  
ATOM 861   H HB3  . ASN A 1 58  ? 4.626   -17.158 8.279   1.00 0.00 ? 58  ASN A HB3  1  
ATOM 862   H HD21 . ASN A 1 58  ? 3.006   -17.012 6.737   1.00 0.00 ? 58  ASN A HD21 1  
ATOM 863   H HD22 . ASN A 1 58  ? 3.170   -17.699 5.161   1.00 0.00 ? 58  ASN A HD22 1  
ATOM 864   N N    . GLY A 1 59  ? 6.719   -15.387 5.254   1.00 0.00 ? 59  GLY A N    1  
ATOM 865   C CA   . GLY A 1 59  ? 7.774   -15.220 4.272   1.00 0.00 ? 59  GLY A CA   1  
ATOM 866   C C    . GLY A 1 59  ? 7.626   -16.165 3.096   1.00 0.00 ? 59  GLY A C    1  
ATOM 867   O O    . GLY A 1 59  ? 7.940   -17.350 3.200   1.00 0.00 ? 59  GLY A O    1  
ATOM 868   H H    . GLY A 1 59  ? 5.793   -15.518 4.959   1.00 0.00 ? 59  GLY A H    1  
ATOM 869   H HA2  . GLY A 1 59  ? 7.755   -14.204 3.908   1.00 0.00 ? 59  GLY A HA2  1  
ATOM 870   H HA3  . GLY A 1 59  ? 8.726   -15.403 4.749   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 871   N N    . GLY A 1 60  ? 7.145   -15.640 1.973   1.00 0.00 ? 60  GLY A N    1  
ATOM 872   C CA   . GLY A 1 60  ? 6.962   -16.460 0.790   1.00 0.00 ? 60  GLY A CA   1  
ATOM 873   C C    . GLY A 1 60  ? 7.213   -15.691 -0.492  1.00 0.00 ? 60  GLY A C    1  
ATOM 874   O O    . GLY A 1 60  ? 8.324   -15.219 -0.732  1.00 0.00 ? 60  GLY A O    1  
ATOM 875   H H    . GLY A 1 60  ? 6.911   -14.689 1.949   1.00 0.00 ? 60  GLY A H    1  
ATOM 876   H HA2  . GLY A 1 60  ? 7.645   -17.296 0.836   1.00 0.00 ? 60  GLY A HA2  1  
ATOM 877   H HA3  . GLY A 1 60  ? 5.950   -16.835 0.779   1.00 0.00 ? 60  GLY A HA3  1  
ATOM 878   N N    . GLU A 1 61  ? 6.179   -15.567 -1.318  1.00 0.00 ? 61  GLU A N    1  
ATOM 879   C CA   . GLU A 1 61  ? 6.294   -14.852 -2.583  1.00 0.00 ? 61  GLU A CA   1  
ATOM 880   C C    . GLU A 1 61  ? 5.791   -13.418 -2.446  1.00 0.00 ? 61  GLU A C    1  
ATOM 881   O O    . GLU A 1 61  ? 4.730   -13.172 -1.872  1.00 0.00 ? 61  GLU A O    1  
ATOM 882   C CB   . GLU A 1 61  ? 5.507   -15.577 -3.678  1.00 0.00 ? 61  GLU A CB   1  
ATOM 883   C CG   . GLU A 1 61  ? 5.805   -15.070 -5.079  1.00 0.00 ? 61  GLU A CG   1  
ATOM 884   C CD   . GLU A 1 61  ? 5.468   -16.087 -6.151  1.00 0.00 ? 61  GLU A CD   1  
ATOM 885   O OE1  . GLU A 1 61  ? 6.144   -17.136 -6.208  1.00 0.00 ? 61  GLU A OE1  1  
ATOM 886   O OE2  . GLU A 1 61  ? 4.528   -15.835 -6.934  1.00 0.00 ? 61  GLU A OE2  1  
ATOM 887   H H    . GLU A 1 61  ? 5.318   -15.966 -1.070  1.00 0.00 ? 61  GLU A H    1  
ATOM 888   H HA   . GLU A 1 61  ? 7.338   -14.830 -2.858  1.00 0.00 ? 61  GLU A HA   1  
ATOM 889   H HB2  . GLU A 1 61  ? 5.746   -16.629 -3.639  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 890   H HB3  . GLU A 1 61  ? 4.452   -15.450 -3.489  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 891   H HG2  . GLU A 1 61  ? 5.225   -14.177 -5.256  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 892   H HG3  . GLU A 1 61  ? 6.857   -14.833 -5.146  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 893   N N    . LEU A 1 62  ? 6.562   -12.474 -2.975  1.00 0.00 ? 62  LEU A N    1  
ATOM 894   C CA   . LEU A 1 62  ? 6.196   -11.063 -2.912  1.00 0.00 ? 62  LEU A CA   1  
ATOM 895   C C    . LEU A 1 62  ? 5.670   -10.576 -4.258  1.00 0.00 ? 62  LEU A C    1  
ATOM 896   O O    . LEU A 1 62  ? 6.373   -10.630 -5.268  1.00 0.00 ? 62  LEU A O    1  
ATOM 897   C CB   . LEU A 1 62  ? 7.402   -10.222 -2.488  1.00 0.00 ? 62  LEU A CB   1  
ATOM 898   C CG   . LEU A 1 62  ? 7.238   -8.707  -2.605  1.00 0.00 ? 62  LEU A CG   1  
ATOM 899   C CD1  . LEU A 1 62  ? 7.319   -8.272  -4.060  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 900   C CD2  . LEU A 1 62  ? 5.919   -8.264  -1.987  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 901   H H    . LEU A 1 62  ? 7.396   -12.731 -3.420  1.00 0.00 ? 62  LEU A H    1  
ATOM 902   H HA   . LEU A 1 62  ? 5.416   -10.956 -2.174  1.00 0.00 ? 62  LEU A HA   1  
ATOM 903   H HB2  . LEU A 1 62  ? 7.619   -10.452 -1.456  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 904   H HB3  . LEU A 1 62  ? 8.241   -10.514 -3.104  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 905   H HG   . LEU A 1 62  ? 8.040   -8.221  -2.067  1.00 0.00 ? 62  LEU A HG   1  
ATOM 906   H HD11 . LEU A 1 62  ? 7.835   -9.027  -4.633  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 907   H HD12 . LEU A 1 62  ? 7.858   -7.338  -4.127  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 908   H HD13 . LEU A 1 62  ? 6.321   -8.139  -4.452  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 909   H HD21 . LEU A 1 62  ? 5.101   -8.752  -2.495  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 910   H HD22 . LEU A 1 62  ? 5.818   -7.193  -2.086  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 911   H HD23 . LEU A 1 62  ? 5.905   -8.531  -0.940  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 912   N N    . HIS A 1 63  ? 4.430   -10.098 -4.265  1.00 0.00 ? 63  HIS A N    1  
ATOM 913   C CA   . HIS A 1 63  ? 3.810   -9.598  -5.487  1.00 0.00 ? 63  HIS A CA   1  
ATOM 914   C C    . HIS A 1 63  ? 3.638   -8.083  -5.429  1.00 0.00 ? 63  HIS A C    1  
ATOM 915   O O    . HIS A 1 63  ? 2.946   -7.560  -4.555  1.00 0.00 ? 63  HIS A O    1  
ATOM 916   C CB   . HIS A 1 63  ? 2.454   -10.268 -5.708  1.00 0.00 ? 63  HIS A CB   1  
ATOM 917   C CG   . HIS A 1 63  ? 2.546   -11.746 -5.930  1.00 0.00 ? 63  HIS A CG   1  
ATOM 918   N ND1  . HIS A 1 63  ? 2.237   -12.347 -7.132  1.00 0.00 ? 63  HIS A ND1  1  
ATOM 919   C CD2  . HIS A 1 63  ? 2.917   -12.746 -5.096  1.00 0.00 ? 63  HIS A CD2  1  
ATOM 920   C CE1  . HIS A 1 63  ? 2.412   -13.653 -7.027  1.00 0.00 ? 63  HIS A CE1  1  
ATOM 921   N NE2  . HIS A 1 63  ? 2.825   -13.920 -5.801  1.00 0.00 ? 63  HIS A NE2  1  
ATOM 922   H H    . HIS A 1 63  ? 3.920   -10.080 -3.429  1.00 0.00 ? 63  HIS A H    1  
ATOM 923   H HA   . HIS A 1 63  ? 4.461   -9.842  -6.313  1.00 0.00 ? 63  HIS A HA   1  
ATOM 924   H HB2  . HIS A 1 63  ? 1.832   -10.102 -4.841  1.00 0.00 ? 63  HIS A HB2  1  
ATOM 925   H HB3  . HIS A 1 63  ? 1.980   -9.830  -6.575  1.00 0.00 ? 63  HIS A HB3  1  
ATOM 926   H HD2  . HIS A 1 63  ? 3.227   -12.640 -4.066  1.00 0.00 ? 63  HIS A HD2  1  
ATOM 927   H HE1  . HIS A 1 63  ? 2.247   -14.378 -7.810  1.00 0.00 ? 63  HIS A HE1  1  
ATOM 928   H HE2  . HIS A 1 63  ? 2.948   -14.819 -5.431  1.00 0.00 ? 63  HIS A HE2  1  
ATOM 929   N N    . ARG A 1 64  ? 4.274   -7.383  -6.363  1.00 0.00 ? 64  ARG A N    1  
ATOM 930   C CA   . ARG A 1 64  ? 4.193   -5.929  -6.416  1.00 0.00 ? 64  ARG A CA   1  
ATOM 931   C C    . ARG A 1 64  ? 3.140   -5.479  -7.425  1.00 0.00 ? 64  ARG A C    1  
ATOM 932   O O    . ARG A 1 64  ? 3.208   -5.824  -8.605  1.00 0.00 ? 64  ARG A O    1  
ATOM 933   C CB   . ARG A 1 64  ? 5.553   -5.334  -6.784  1.00 0.00 ? 64  ARG A CB   1  
ATOM 934   C CG   . ARG A 1 64  ? 5.559   -3.815  -6.840  1.00 0.00 ? 64  ARG A CG   1  
ATOM 935   C CD   . ARG A 1 64  ? 6.721   -3.292  -7.670  1.00 0.00 ? 64  ARG A CD   1  
ATOM 936   N NE   . ARG A 1 64  ? 7.053   -1.909  -7.338  1.00 0.00 ? 64  ARG A NE   1  
ATOM 937   C CZ   . ARG A 1 64  ? 7.856   -1.149  -8.073  1.00 0.00 ? 64  ARG A CZ   1  
ATOM 938   N NH1  . ARG A 1 64  ? 8.406   -1.635  -9.178  1.00 0.00 ? 64  ARG A NH1  1  
ATOM 939   N NH2  . ARG A 1 64  ? 8.110   0.100   -7.705  1.00 0.00 ? 64  ARG A NH2  1  
ATOM 940   H H    . ARG A 1 64  ? 4.811   -7.856  -7.032  1.00 0.00 ? 64  ARG A H    1  
ATOM 941   H HA   . ARG A 1 64  ? 3.909   -5.576  -5.436  1.00 0.00 ? 64  ARG A HA   1  
ATOM 942   H HB2  . ARG A 1 64  ? 6.281   -5.647  -6.049  1.00 0.00 ? 64  ARG A HB2  1  
ATOM 943   H HB3  . ARG A 1 64  ? 5.847   -5.709  -7.752  1.00 0.00 ? 64  ARG A HB3  1  
ATOM 944   H HG2  . ARG A 1 64  ? 4.634   -3.477  -7.284  1.00 0.00 ? 64  ARG A HG2  1  
ATOM 945   H HG3  . ARG A 1 64  ? 5.641   -3.427  -5.836  1.00 0.00 ? 64  ARG A HG3  1  
ATOM 946   H HD2  . ARG A 1 64  ? 7.585   -3.913  -7.486  1.00 0.00 ? 64  ARG A HD2  1  
ATOM 947   H HD3  . ARG A 1 64  ? 6.454   -3.348  -8.715  1.00 0.00 ? 64  ARG A HD3  1  
ATOM 948   H HE   . ARG A 1 64  ? 6.657   -1.530  -6.526  1.00 0.00 ? 64  ARG A HE   1  
ATOM 949   H HH11 . ARG A 1 64  ? 8.216   -2.575  -9.458  1.00 0.00 ? 64  ARG A HH11 1  
ATOM 950   H HH12 . ARG A 1 64  ? 9.009   -1.060  -9.731  1.00 0.00 ? 64  ARG A HH12 1  
ATOM 951   H HH21 . ARG A 1 64  ? 7.697   0.470   -6.873  1.00 0.00 ? 64  ARG A HH21 1  
ATOM 952   H HH22 . ARG A 1 64  ? 8.714   0.672   -8.259  1.00 0.00 ? 64  ARG A HH22 1  
ATOM 953   N N    . LEU A 1 65  ? 2.167   -4.708  -6.952  1.00 0.00 ? 65  LEU A N    1  
ATOM 954   C CA   . LEU A 1 65  ? 1.098   -4.211  -7.812  1.00 0.00 ? 65  LEU A CA   1  
ATOM 955   C C    . LEU A 1 65  ? 1.251   -2.714  -8.061  1.00 0.00 ? 65  LEU A C    1  
ATOM 956   O O    . LEU A 1 65  ? 1.275   -1.919  -7.123  1.00 0.00 ? 65  LEU A O    1  
ATOM 957   C CB   . LEU A 1 65  ? -0.266  -4.499  -7.182  1.00 0.00 ? 65  LEU A CB   1  
ATOM 958   C CG   . LEU A 1 65  ? -0.545  -5.959  -6.823  1.00 0.00 ? 65  LEU A CG   1  
ATOM 959   C CD1  . LEU A 1 65  ? -1.774  -6.064  -5.934  1.00 0.00 ? 65  LEU A CD1  1  
ATOM 960   C CD2  . LEU A 1 65  ? -0.723  -6.794  -8.083  1.00 0.00 ? 65  LEU A CD2  1  
ATOM 961   H H    . LEU A 1 65  ? 2.166   -4.467  -6.003  1.00 0.00 ? 65  LEU A H    1  
ATOM 962   H HA   . LEU A 1 65  ? 1.166   -4.730  -8.757  1.00 0.00 ? 65  LEU A HA   1  
ATOM 963   H HB2  . LEU A 1 65  ? -0.342  -3.916  -6.278  1.00 0.00 ? 65  LEU A HB2  1  
ATOM 964   H HB3  . LEU A 1 65  ? -1.026  -4.178  -7.881  1.00 0.00 ? 65  LEU A HB3  1  
ATOM 965   H HG   . LEU A 1 65  ? 0.299   -6.356  -6.275  1.00 0.00 ? 65  LEU A HG   1  
ATOM 966   H HD11 . LEU A 1 65  ? -1.466  -6.144  -4.902  1.00 0.00 ? 65  LEU A HD11 1  
ATOM 967   H HD12 . LEU A 1 65  ? -2.343  -6.940  -6.208  1.00 0.00 ? 65  LEU A HD12 1  
ATOM 968   H HD13 . LEU A 1 65  ? -2.386  -5.184  -6.060  1.00 0.00 ? 65  LEU A HD13 1  
ATOM 969   H HD21 . LEU A 1 65  ? -1.230  -7.714  -7.837  1.00 0.00 ? 65  LEU A HD21 1  
ATOM 970   H HD22 . LEU A 1 65  ? 0.245   -7.018  -8.506  1.00 0.00 ? 65  LEU A HD22 1  
ATOM 971   H HD23 . LEU A 1 65  ? -1.310  -6.239  -8.802  1.00 0.00 ? 65  LEU A HD23 1  
ATOM 972   N N    . ASN A 1 66  ? 1.352   -2.338  -9.331  1.00 0.00 ? 66  ASN A N    1  
ATOM 973   C CA   . ASN A 1 66  ? 1.500   -0.935  -9.704  1.00 0.00 ? 66  ASN A CA   1  
ATOM 974   C C    . ASN A 1 66  ? 0.157   -0.335  -10.109 1.00 0.00 ? 66  ASN A C    1  
ATOM 975   O O    . ASN A 1 66  ? -0.664  -0.997  -10.744 1.00 0.00 ? 66  ASN A O    1  
ATOM 976   C CB   . ASN A 1 66  ? 2.502   -0.794  -10.851 1.00 0.00 ? 66  ASN A CB   1  
ATOM 977   C CG   . ASN A 1 66  ? 3.931   -1.030  -10.404 1.00 0.00 ? 66  ASN A CG   1  
ATOM 978   O OD1  . ASN A 1 66  ? 4.433   -0.350  -9.508  1.00 0.00 ? 66  ASN A OD1  1  
ATOM 979   N ND2  . ASN A 1 66  ? 4.594   -1.997  -11.027 1.00 0.00 ? 66  ASN A ND2  1  
ATOM 980   H H    . ASN A 1 66  ? 1.326   -3.019  -10.036 1.00 0.00 ? 66  ASN A H    1  
ATOM 981   H HA   . ASN A 1 66  ? 1.875   -0.402  -8.843  1.00 0.00 ? 66  ASN A HA   1  
ATOM 982   H HB2  . ASN A 1 66  ? 2.263   -1.514  -11.620 1.00 0.00 ? 66  ASN A HB2  1  
ATOM 983   H HB3  . ASN A 1 66  ? 2.432   0.202   -11.262 1.00 0.00 ? 66  ASN A HB3  1  
ATOM 984   H HD21 . ASN A 1 66  ? 4.131   -2.497  -11.731 1.00 0.00 ? 66  ASN A HD21 1  
ATOM 985   H HD22 . ASN A 1 66  ? 5.520   -2.171  -10.757 1.00 0.00 ? 66  ASN A HD22 1  
ATOM 986   N N    . ILE A 1 67  ? -0.059  0.922   -9.737  1.00 0.00 ? 67  ILE A N    1  
ATOM 987   C CA   . ILE A 1 67  ? -1.300  1.612   -10.064 1.00 0.00 ? 67  ILE A CA   1  
ATOM 988   C C    . ILE A 1 67  ? -1.054  2.756   -11.042 1.00 0.00 ? 67  ILE A C    1  
ATOM 989   O O    . ILE A 1 67  ? -0.530  3.811   -10.683 1.00 0.00 ? 67  ILE A O    1  
ATOM 990   C CB   . ILE A 1 67  ? -1.983  2.170   -8.801  1.00 0.00 ? 67  ILE A CB   1  
ATOM 991   C CG1  . ILE A 1 67  ? -1.928  1.143   -7.669  1.00 0.00 ? 67  ILE A CG1  1  
ATOM 992   C CG2  . ILE A 1 67  ? -3.423  2.557   -9.104  1.00 0.00 ? 67  ILE A CG2  1  
ATOM 993   C CD1  . ILE A 1 67  ? -2.798  -0.071  -7.911  1.00 0.00 ? 67  ILE A CD1  1  
ATOM 994   H H    . ILE A 1 67  ? 0.634   1.398   -9.233  1.00 0.00 ? 67  ILE A H    1  
ATOM 995   H HA   . ILE A 1 67  ? -1.968  0.897   -10.523 1.00 0.00 ? 67  ILE A HA   1  
ATOM 996   H HB   . ILE A 1 67  ? -1.453  3.060   -8.496  1.00 0.00 ? 67  ILE A HB   1  
ATOM 997   H HG12 . ILE A 1 67  ? -0.912  0.802   -7.548  1.00 0.00 ? 67  ILE A HG12 1  
ATOM 998   H HG13 . ILE A 1 67  ? -2.258  1.610   -6.752  1.00 0.00 ? 67  ILE A HG13 1  
ATOM 999   H HG21 . ILE A 1 67  ? -3.654  3.493   -8.618  1.00 0.00 ? 67  ILE A HG21 1  
ATOM 1000  H HG22 . ILE A 1 67  ? -3.549  2.665   -10.170 1.00 0.00 ? 67  ILE A HG22 1  
ATOM 1001  H HG23 . ILE A 1 67  ? -4.087  1.788   -8.738  1.00 0.00 ? 67  ILE A HG23 1  
ATOM 1002  H HD11 . ILE A 1 67  ? -3.673  -0.018  -7.279  1.00 0.00 ? 67  ILE A HD11 1  
ATOM 1003  H HD12 . ILE A 1 67  ? -3.105  -0.093  -8.947  1.00 0.00 ? 67  ILE A HD12 1  
ATOM 1004  H HD13 . ILE A 1 67  ? -2.241  -0.966  -7.681  1.00 0.00 ? 67  ILE A HD13 1  
ATOM 1005  N N    . PRO A 1 68  ? -1.440  2.544   -12.309 1.00 0.00 ? 68  PRO A N    1  
ATOM 1006  C CA   . PRO A 1 68  ? -1.273  3.547   -13.365 1.00 0.00 ? 68  PRO A CA   1  
ATOM 1007  C C    . PRO A 1 68  ? -2.198  4.744   -13.179 1.00 0.00 ? 68  PRO A C    1  
ATOM 1008  O O    . PRO A 1 68  ? -2.226  5.654   -14.008 1.00 0.00 ? 68  PRO A O    1  
ATOM 1009  C CB   . PRO A 1 68  ? -1.637  2.783   -14.640 1.00 0.00 ? 68  PRO A CB   1  
ATOM 1010  C CG   . PRO A 1 68  ? -2.543  1.692   -14.183 1.00 0.00 ? 68  PRO A CG   1  
ATOM 1011  C CD   . PRO A 1 68  ? -2.070  1.311   -12.808 1.00 0.00 ? 68  PRO A CD   1  
ATOM 1012  H HA   . PRO A 1 68  ? -0.251  3.890   -13.428 1.00 0.00 ? 68  PRO A HA   1  
ATOM 1013  H HB2  . PRO A 1 68  ? -2.135  3.448   -15.332 1.00 0.00 ? 68  PRO A HB2  1  
ATOM 1014  H HB3  . PRO A 1 68  ? -0.741  2.387   -15.095 1.00 0.00 ? 68  PRO A HB3  1  
ATOM 1015  H HG2  . PRO A 1 68  ? -3.560  2.052   -14.143 1.00 0.00 ? 68  PRO A HG2  1  
ATOM 1016  H HG3  . PRO A 1 68  ? -2.468  0.848   -14.852 1.00 0.00 ? 68  PRO A HG3  1  
ATOM 1017  H HD2  . PRO A 1 68  ? -2.907  1.026   -12.186 1.00 0.00 ? 68  PRO A HD2  1  
ATOM 1018  H HD3  . PRO A 1 68  ? -1.351  0.507   -12.865 1.00 0.00 ? 68  PRO A HD3  1  
ATOM 1019  N N    . ASN A 1 69  ? -2.954  4.738   -12.086 1.00 0.00 ? 69  ASN A N    1  
ATOM 1020  C CA   . ASN A 1 69  ? -3.882  5.825   -11.792 1.00 0.00 ? 69  ASN A CA   1  
ATOM 1021  C C    . ASN A 1 69  ? -3.656  6.366   -10.384 1.00 0.00 ? 69  ASN A C    1  
ATOM 1022  O O    . ASN A 1 69  ? -3.876  5.680   -9.385  1.00 0.00 ? 69  ASN A O    1  
ATOM 1023  C CB   . ASN A 1 69  ? -5.327  5.344   -11.940 1.00 0.00 ? 69  ASN A CB   1  
ATOM 1024  C CG   . ASN A 1 69  ? -6.317  6.492   -11.979 1.00 0.00 ? 69  ASN A CG   1  
ATOM 1025  O OD1  . ASN A 1 69  ? -6.024  7.561   -12.515 1.00 0.00 ? 69  ASN A OD1  1  
ATOM 1026  N ND2  . ASN A 1 69  ? -7.497  6.275   -11.409 1.00 0.00 ? 69  ASN A ND2  1  
ATOM 1027  H H    . ASN A 1 69  ? -2.888  3.985   -11.463 1.00 0.00 ? 69  ASN A H    1  
ATOM 1028  H HA   . ASN A 1 69  ? -3.701  6.617   -12.503 1.00 0.00 ? 69  ASN A HA   1  
ATOM 1029  H HB2  . ASN A 1 69  ? -5.420  4.782   -12.858 1.00 0.00 ? 69  ASN A HB2  1  
ATOM 1030  H HB3  . ASN A 1 69  ? -5.575  4.706   -11.105 1.00 0.00 ? 69  ASN A HB3  1  
ATOM 1031  H HD21 . ASN A 1 69  ? -7.660  5.399   -11.001 1.00 0.00 ? 69  ASN A HD21 1  
ATOM 1032  H HD22 . ASN A 1 69  ? -8.156  7.000   -11.421 1.00 0.00 ? 69  ASN A HD22 1  
ATOM 1033  N N    . PRO A 1 70  ? -3.207  7.628   -10.300 1.00 0.00 ? 70  PRO A N    1  
ATOM 1034  C CA   . PRO A 1 70  ? -2.942  8.290   -9.019  1.00 0.00 ? 70  PRO A CA   1  
ATOM 1035  C C    . PRO A 1 70  ? -4.222  8.591   -8.247  1.00 0.00 ? 70  PRO A C    1  
ATOM 1036  O O    . PRO A 1 70  ? -4.176  9.037   -7.101  1.00 0.00 ? 70  PRO A O    1  
ATOM 1037  C CB   . PRO A 1 70  ? -2.247  9.591   -9.429  1.00 0.00 ? 70  PRO A CB   1  
ATOM 1038  C CG   . PRO A 1 70  ? -2.723  9.854   -10.816 1.00 0.00 ? 70  PRO A CG   1  
ATOM 1039  C CD   . PRO A 1 70  ? -2.923  8.504   -11.449 1.00 0.00 ? 70  PRO A CD   1  
ATOM 1040  H HA   . PRO A 1 70  ? -2.278  7.705   -8.399  1.00 0.00 ? 70  PRO A HA   1  
ATOM 1041  H HB2  . PRO A 1 70  ? -2.535  10.384  -8.755  1.00 0.00 ? 70  PRO A HB2  1  
ATOM 1042  H HB3  . PRO A 1 70  ? -1.176  9.456   -9.399  1.00 0.00 ? 70  PRO A HB3  1  
ATOM 1043  H HG2  . PRO A 1 70  ? -3.656  10.396  -10.788 1.00 0.00 ? 70  PRO A HG2  1  
ATOM 1044  H HG3  . PRO A 1 70  ? -1.978  10.415  -11.360 1.00 0.00 ? 70  PRO A HG3  1  
ATOM 1045  H HD2  . PRO A 1 70  ? -3.759  8.527   -12.132 1.00 0.00 ? 70  PRO A HD2  1  
ATOM 1046  H HD3  . PRO A 1 70  ? -2.024  8.190   -11.959 1.00 0.00 ? 70  PRO A HD3  1  
ATOM 1047  N N    . ALA A 1 71  ? -5.363  8.344   -8.882  1.00 0.00 ? 71  ALA A N    1  
ATOM 1048  C CA   . ALA A 1 71  ? -6.655  8.586   -8.253  1.00 0.00 ? 71  ALA A CA   1  
ATOM 1049  C C    . ALA A 1 71  ? -7.212  7.309   -7.633  1.00 0.00 ? 71  ALA A C    1  
ATOM 1050  O O    . ALA A 1 71  ? -7.975  7.358   -6.669  1.00 0.00 ? 71  ALA A O    1  
ATOM 1051  C CB   . ALA A 1 71  ? -7.637  9.154   -9.267  1.00 0.00 ? 71  ALA A CB   1  
ATOM 1052  H H    . ALA A 1 71  ? -5.334  7.989   -9.795  1.00 0.00 ? 71  ALA A H    1  
ATOM 1053  H HA   . ALA A 1 71  ? -6.515  9.321   -7.474  1.00 0.00 ? 71  ALA A HA   1  
ATOM 1054  H HB1  . ALA A 1 71  ? -8.006  10.106  -8.916  1.00 0.00 ? 71  ALA A HB1  1  
ATOM 1055  H HB2  . ALA A 1 71  ? -7.137  9.289   -10.215 1.00 0.00 ? 71  ALA A HB2  1  
ATOM 1056  H HB3  . ALA A 1 71  ? -8.464  8.470   -9.390  1.00 0.00 ? 71  ALA A HB3  1  
ATOM 1057  N N    . GLN A 1 72  ? -6.825  6.167   -8.193  1.00 0.00 ? 72  GLN A N    1  
ATOM 1058  C CA   . GLN A 1 72  ? -7.288  4.877   -7.695  1.00 0.00 ? 72  GLN A CA   1  
ATOM 1059  C C    . GLN A 1 72  ? -6.607  4.527   -6.376  1.00 0.00 ? 72  GLN A C    1  
ATOM 1060  O O    . GLN A 1 72  ? -5.467  4.061   -6.358  1.00 0.00 ? 72  GLN A O    1  
ATOM 1061  C CB   . GLN A 1 72  ? -7.019  3.782   -8.728  1.00 0.00 ? 72  GLN A CB   1  
ATOM 1062  C CG   . GLN A 1 72  ? -7.206  2.374   -8.185  1.00 0.00 ? 72  GLN A CG   1  
ATOM 1063  C CD   . GLN A 1 72  ? -6.593  1.316   -9.081  1.00 0.00 ? 72  GLN A CD   1  
ATOM 1064  O OE1  . GLN A 1 72  ? -6.426  1.525   -10.283 1.00 0.00 ? 72  GLN A OE1  1  
ATOM 1065  N NE2  . GLN A 1 72  ? -6.252  0.172   -8.499  1.00 0.00 ? 72  GLN A NE2  1  
ATOM 1066  H H    . GLN A 1 72  ? -6.216  6.193   -8.959  1.00 0.00 ? 72  GLN A H    1  
ATOM 1067  H HA   . GLN A 1 72  ? -8.352  4.949   -7.528  1.00 0.00 ? 72  GLN A HA   1  
ATOM 1068  H HB2  . GLN A 1 72  ? -7.693  3.915   -9.561  1.00 0.00 ? 72  GLN A HB2  1  
ATOM 1069  H HB3  . GLN A 1 72  ? -6.002  3.876   -9.079  1.00 0.00 ? 72  GLN A HB3  1  
ATOM 1070  H HG2  . GLN A 1 72  ? -6.741  2.313   -7.212  1.00 0.00 ? 72  GLN A HG2  1  
ATOM 1071  H HG3  . GLN A 1 72  ? -8.264  2.176   -8.090  1.00 0.00 ? 72  GLN A HG3  1  
ATOM 1072  H HE21 . GLN A 1 72  ? -6.415  0.076   -7.537  1.00 0.00 ? 72  GLN A HE21 1  
ATOM 1073  H HE22 . GLN A 1 72  ? -5.854  -0.529  -9.055  1.00 0.00 ? 72  GLN A HE22 1  
ATOM 1074  N N    . THR A 1 73  ? -7.312  4.755   -5.272  1.00 0.00 ? 73  THR A N    1  
ATOM 1075  C CA   . THR A 1 73  ? -6.775  4.465   -3.949  1.00 0.00 ? 73  THR A CA   1  
ATOM 1076  C C    . THR A 1 73  ? -7.316  3.144   -3.413  1.00 0.00 ? 73  THR A C    1  
ATOM 1077  O O    . THR A 1 73  ? -7.495  2.979   -2.207  1.00 0.00 ? 73  THR A O    1  
ATOM 1078  C CB   . THR A 1 73  ? -7.111  5.587   -2.948  1.00 0.00 ? 73  THR A CB   1  
ATOM 1079  O OG1  . THR A 1 73  ? -8.530  5.702   -2.800  1.00 0.00 ? 73  THR A OG1  1  
ATOM 1080  C CG2  . THR A 1 73  ? -6.535  6.916   -3.413  1.00 0.00 ? 73  THR A CG2  1  
ATOM 1081  H H    . THR A 1 73  ? -8.215  5.128   -5.352  1.00 0.00 ? 73  THR A H    1  
ATOM 1082  H HA   . THR A 1 73  ? -5.700  4.396   -4.033  1.00 0.00 ? 73  THR A HA   1  
ATOM 1083  H HB   . THR A 1 73  ? -6.675  5.338   -1.991  1.00 0.00 ? 73  THR A HB   1  
ATOM 1084  H HG1  . THR A 1 73  ? -8.741  6.538   -2.376  1.00 0.00 ? 73  THR A HG1  1  
ATOM 1085  H HG21 . THR A 1 73  ? -7.027  7.723   -2.890  1.00 0.00 ? 73  THR A HG21 1  
ATOM 1086  H HG22 . THR A 1 73  ? -6.694  7.026   -4.475  1.00 0.00 ? 73  THR A HG22 1  
ATOM 1087  H HG23 . THR A 1 73  ? -5.476  6.943   -3.203  1.00 0.00 ? 73  THR A HG23 1  
ATOM 1088  N N    . SER A 1 74  ? -7.572  2.205   -4.318  1.00 0.00 ? 74  SER A N    1  
ATOM 1089  C CA   . SER A 1 74  ? -8.095  0.898   -3.936  1.00 0.00 ? 74  SER A CA   1  
ATOM 1090  C C    . SER A 1 74  ? -7.802  -0.141  -5.015  1.00 0.00 ? 74  SER A C    1  
ATOM 1091  O O    . SER A 1 74  ? -8.000  0.110   -6.204  1.00 0.00 ? 74  SER A O    1  
ATOM 1092  C CB   . SER A 1 74  ? -9.603  0.981   -3.689  1.00 0.00 ? 74  SER A CB   1  
ATOM 1093  O OG   . SER A 1 74  ? -10.263 1.618   -4.769  1.00 0.00 ? 74  SER A OG   1  
ATOM 1094  H H    . SER A 1 74  ? -7.408  2.396   -5.265  1.00 0.00 ? 74  SER A H    1  
ATOM 1095  H HA   . SER A 1 74  ? -7.605  0.599   -3.022  1.00 0.00 ? 74  SER A HA   1  
ATOM 1096  H HB2  . SER A 1 74  ? -10.002 -0.015  -3.575  1.00 0.00 ? 74  SER A HB2  1  
ATOM 1097  H HB3  . SER A 1 74  ? -9.785  1.548   -2.787  1.00 0.00 ? 74  SER A HB3  1  
ATOM 1098  H HG   . SER A 1 74  ? -9.636  2.161   -5.252  1.00 0.00 ? 74  SER A HG   1  
ATOM 1099  N N    . VAL A 1 75  ? -7.330  -1.308  -4.590  1.00 0.00 ? 75  VAL A N    1  
ATOM 1100  C CA   . VAL A 1 75  ? -7.010  -2.386  -5.518  1.00 0.00 ? 75  VAL A CA   1  
ATOM 1101  C C    . VAL A 1 75  ? -7.494  -3.731  -4.986  1.00 0.00 ? 75  VAL A C    1  
ATOM 1102  O O    . VAL A 1 75  ? -7.460  -3.983  -3.782  1.00 0.00 ? 75  VAL A O    1  
ATOM 1103  C CB   . VAL A 1 75  ? -5.495  -2.468  -5.784  1.00 0.00 ? 75  VAL A CB   1  
ATOM 1104  C CG1  . VAL A 1 75  ? -4.749  -2.839  -4.511  1.00 0.00 ? 75  VAL A CG1  1  
ATOM 1105  C CG2  . VAL A 1 75  ? -5.202  -3.465  -6.894  1.00 0.00 ? 75  VAL A CG2  1  
ATOM 1106  H H    . VAL A 1 75  ? -7.194  -1.448  -3.630  1.00 0.00 ? 75  VAL A H    1  
ATOM 1107  H HA   . VAL A 1 75  ? -7.508  -2.180  -6.454  1.00 0.00 ? 75  VAL A HA   1  
ATOM 1108  H HB   . VAL A 1 75  ? -5.153  -1.494  -6.104  1.00 0.00 ? 75  VAL A HB   1  
ATOM 1109  H HG11 . VAL A 1 75  ? -3.766  -2.391  -4.527  1.00 0.00 ? 75  VAL A HG11 1  
ATOM 1110  H HG12 . VAL A 1 75  ? -5.297  -2.478  -3.654  1.00 0.00 ? 75  VAL A HG12 1  
ATOM 1111  H HG13 . VAL A 1 75  ? -4.652  -3.913  -4.452  1.00 0.00 ? 75  VAL A HG13 1  
ATOM 1112  H HG21 . VAL A 1 75  ? -5.301  -2.977  -7.852  1.00 0.00 ? 75  VAL A HG21 1  
ATOM 1113  H HG22 . VAL A 1 75  ? -4.196  -3.840  -6.783  1.00 0.00 ? 75  VAL A HG22 1  
ATOM 1114  H HG23 . VAL A 1 75  ? -5.901  -4.287  -6.835  1.00 0.00 ? 75  VAL A HG23 1  
ATOM 1115  N N    . VAL A 1 76  ? -7.945  -4.592  -5.893  1.00 0.00 ? 76  VAL A N    1  
ATOM 1116  C CA   . VAL A 1 76  ? -8.436  -5.912  -5.516  1.00 0.00 ? 76  VAL A CA   1  
ATOM 1117  C C    . VAL A 1 76  ? -7.348  -6.969  -5.676  1.00 0.00 ? 76  VAL A C    1  
ATOM 1118  O O    . VAL A 1 76  ? -6.826  -7.176  -6.771  1.00 0.00 ? 76  VAL A O    1  
ATOM 1119  C CB   . VAL A 1 76  ? -9.659  -6.319  -6.358  1.00 0.00 ? 76  VAL A CB   1  
ATOM 1120  C CG1  . VAL A 1 76  ? -10.058 -7.756  -6.062  1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1121  C CG2  . VAL A 1 76  ? -10.821 -5.371  -6.102  1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1122  H H    . VAL A 1 76  ? -7.948  -4.333  -6.838  1.00 0.00 ? 76  VAL A H    1  
ATOM 1123  H HA   . VAL A 1 76  ? -8.736  -5.873  -4.478  1.00 0.00 ? 76  VAL A HA   1  
ATOM 1124  H HB   . VAL A 1 76  ? -9.390  -6.250  -7.402  1.00 0.00 ? 76  VAL A HB   1  
ATOM 1125  H HG11 . VAL A 1 76  ? -10.513 -7.809  -5.084  1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1126  H HG12 . VAL A 1 76  ? -10.762 -8.096  -6.808  1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1127  H HG13 . VAL A 1 76  ? -9.180  -8.385  -6.084  1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1128  H HG21 . VAL A 1 76  ? -11.595 -5.889  -5.555  1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1129  H HG22 . VAL A 1 76  ? -10.475 -4.526  -5.524  1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1130  H HG23 . VAL A 1 76  ? -11.218 -5.023  -7.045  1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1131  N N    . VAL A 1 77  ? -7.011  -7.635  -4.576  1.00 0.00 ? 77  VAL A N    1  
ATOM 1132  C CA   . VAL A 1 77  ? -5.987  -8.672  -4.594  1.00 0.00 ? 77  VAL A CA   1  
ATOM 1133  C C    . VAL A 1 77  ? -6.612  -10.062 -4.573  1.00 0.00 ? 77  VAL A C    1  
ATOM 1134  O O    . VAL A 1 77  ? -7.358  -10.404 -3.656  1.00 0.00 ? 77  VAL A O    1  
ATOM 1135  C CB   . VAL A 1 77  ? -5.027  -8.534  -3.397  1.00 0.00 ? 77  VAL A CB   1  
ATOM 1136  C CG1  . VAL A 1 77  ? -3.947  -9.603  -3.453  1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1137  C CG2  . VAL A 1 77  ? -4.412  -7.144  -3.365  1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1138  H H    . VAL A 1 77  ? -7.463  -7.425  -3.733  1.00 0.00 ? 77  VAL A H    1  
ATOM 1139  H HA   . VAL A 1 77  ? -5.413  -8.559  -5.503  1.00 0.00 ? 77  VAL A HA   1  
ATOM 1140  H HB   . VAL A 1 77  ? -5.595  -8.675  -2.489  1.00 0.00 ? 77  VAL A HB   1  
ATOM 1141  H HG11 . VAL A 1 77  ? -3.497  -9.711  -2.477  1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1142  H HG12 . VAL A 1 77  ? -4.385  -10.543 -3.754  1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1143  H HG13 . VAL A 1 77  ? -3.190  -9.313  -4.167  1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1144  H HG21 . VAL A 1 77  ? -4.825  -6.548  -4.166  1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1145  H HG22 . VAL A 1 77  ? -4.632  -6.675  -2.418  1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1146  H HG23 . VAL A 1 77  ? -3.341  -7.220  -3.489  1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1147  N N    . GLU A 1 78  ? -6.301  -10.860 -5.590  1.00 0.00 ? 78  GLU A N    1  
ATOM 1148  C CA   . GLU A 1 78  ? -6.833  -12.214 -5.688  1.00 0.00 ? 78  GLU A CA   1  
ATOM 1149  C C    . GLU A 1 78  ? -5.710  -13.226 -5.898  1.00 0.00 ? 78  GLU A C    1  
ATOM 1150  O O    . GLU A 1 78  ? -4.536  -12.862 -5.961  1.00 0.00 ? 78  GLU A O    1  
ATOM 1151  C CB   . GLU A 1 78  ? -7.840  -12.309 -6.836  1.00 0.00 ? 78  GLU A CB   1  
ATOM 1152  C CG   . GLU A 1 78  ? -9.020  -11.362 -6.690  1.00 0.00 ? 78  GLU A CG   1  
ATOM 1153  C CD   . GLU A 1 78  ? -10.193 -11.753 -7.568  1.00 0.00 ? 78  GLU A CD   1  
ATOM 1154  O OE1  . GLU A 1 78  ? -10.955 -12.659 -7.170  1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1155  O OE2  . GLU A 1 78  ? -10.350 -11.153 -8.652  1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1156  H H    . GLU A 1 78  ? -5.701  -10.530 -6.291  1.00 0.00 ? 78  GLU A H    1  
ATOM 1157  H HA   . GLU A 1 78  ? -7.337  -12.441 -4.761  1.00 0.00 ? 78  GLU A HA   1  
ATOM 1158  H HB2  . GLU A 1 78  ? -7.334  -12.081 -7.763  1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1159  H HB3  . GLU A 1 78  ? -8.220  -13.319 -6.883  1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1160  H HG2  . GLU A 1 78  ? -9.343  -11.366 -5.660  1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1161  H HG3  . GLU A 1 78  ? -8.702  -10.366 -6.962  1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1162  N N    . ASP A 1 79  ? -6.080  -14.498 -6.003  1.00 0.00 ? 79  ASP A N    1  
ATOM 1163  C CA   . ASP A 1 79  ? -5.106  -15.563 -6.206  1.00 0.00 ? 79  ASP A CA   1  
ATOM 1164  C C    . ASP A 1 79  ? -4.250  -15.762 -4.959  1.00 0.00 ? 79  ASP A C    1  
ATOM 1165  O O    . ASP A 1 79  ? -3.043  -15.988 -5.051  1.00 0.00 ? 79  ASP A O    1  
ATOM 1166  C CB   . ASP A 1 79  ? -4.213  -15.246 -7.407  1.00 0.00 ? 79  ASP A CB   1  
ATOM 1167  C CG   . ASP A 1 79  ? -5.012  -14.852 -8.634  1.00 0.00 ? 79  ASP A CG   1  
ATOM 1168  O OD1  . ASP A 1 79  ? -6.182  -15.274 -8.741  1.00 0.00 ? 79  ASP A OD1  1  
ATOM 1169  O OD2  . ASP A 1 79  ? -4.466  -14.121 -9.487  1.00 0.00 ? 79  ASP A OD2  1  
ATOM 1170  H H    . ASP A 1 79  ? -7.032  -14.725 -5.945  1.00 0.00 ? 79  ASP A H    1  
ATOM 1171  H HA   . ASP A 1 79  ? -5.648  -16.476 -6.404  1.00 0.00 ? 79  ASP A HA   1  
ATOM 1172  H HB2  . ASP A 1 79  ? -3.554  -14.428 -7.151  1.00 0.00 ? 79  ASP A HB2  1  
ATOM 1173  H HB3  . ASP A 1 79  ? -3.622  -16.117 -7.648  1.00 0.00 ? 79  ASP A HB3  1  
ATOM 1174  N N    . LEU A 1 80  ? -4.882  -15.675 -3.794  1.00 0.00 ? 80  LEU A N    1  
ATOM 1175  C CA   . LEU A 1 80  ? -4.179  -15.843 -2.527  1.00 0.00 ? 80  LEU A CA   1  
ATOM 1176  C C    . LEU A 1 80  ? -4.446  -17.224 -1.936  1.00 0.00 ? 80  LEU A C    1  
ATOM 1177  O O    . LEU A 1 80  ? -5.209  -18.013 -2.494  1.00 0.00 ? 80  LEU A O    1  
ATOM 1178  C CB   . LEU A 1 80  ? -4.607  -14.760 -1.535  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1179  C CG   . LEU A 1 80  ? -4.495  -13.317 -2.029  1.00 0.00 ? 80  LEU A CG   1  
ATOM 1180  C CD1  . LEU A 1 80  ? -5.548  -12.443 -1.366  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1181  C CD2  . LEU A 1 80  ? -3.101  -12.769 -1.764  1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1182  H H    . LEU A 1 80  ? -5.845  -15.493 -3.784  1.00 0.00 ? 80  LEU A H    1  
ATOM 1183  H HA   . LEU A 1 80  ? -3.121  -15.746 -2.720  1.00 0.00 ? 80  LEU A HA   1  
ATOM 1184  H HB2  . LEU A 1 80  ? -5.638  -14.940 -1.273  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1185  H HB3  . LEU A 1 80  ? -3.990  -14.858 -0.654  1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1186  H HG   . LEU A 1 80  ? -4.667  -13.294 -3.096  1.00 0.00 ? 80  LEU A HG   1  
ATOM 1187  H HD11 . LEU A 1 80  ? -5.137  -11.999 -0.472  1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1188  H HD12 . LEU A 1 80  ? -6.406  -13.047 -1.106  1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1189  H HD13 . LEU A 1 80  ? -5.852  -11.663 -2.049  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1190  H HD21 . LEU A 1 80  ? -2.933  -11.897 -2.379  1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1191  H HD22 . LEU A 1 80  ? -2.366  -13.524 -2.001  1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1192  H HD23 . LEU A 1 80  ? -3.013  -12.497 -0.721  1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1193  N N    . LEU A 1 81  ? -3.816  -17.508 -0.801  1.00 0.00 ? 81  LEU A N    1  
ATOM 1194  C CA   . LEU A 1 81  ? -3.987  -18.793 -0.132  1.00 0.00 ? 81  LEU A CA   1  
ATOM 1195  C C    . LEU A 1 81  ? -4.872  -18.650 1.102   1.00 0.00 ? 81  LEU A C    1  
ATOM 1196  O O    . LEU A 1 81  ? -4.777  -17.682 1.856   1.00 0.00 ? 81  LEU A O    1  
ATOM 1197  C CB   . LEU A 1 81  ? -2.626  -19.368 0.266   1.00 0.00 ? 81  LEU A CB   1  
ATOM 1198  C CG   . LEU A 1 81  ? -1.746  -19.865 -0.881  1.00 0.00 ? 81  LEU A CG   1  
ATOM 1199  C CD1  . LEU A 1 81  ? -0.294  -19.956 -0.439  1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1200  C CD2  . LEU A 1 81  ? -2.238  -21.215 -1.383  1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1201  H H    . LEU A 1 81  ? -3.221  -16.839 -0.404  1.00 0.00 ? 81  LEU A H    1  
ATOM 1202  H HA   . LEU A 1 81  ? -4.464  -19.467 -0.827  1.00 0.00 ? 81  LEU A HA   1  
ATOM 1203  H HB2  . LEU A 1 81  ? -2.082  -18.597 0.790   1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1204  H HB3  . LEU A 1 81  ? -2.802  -20.199 0.934   1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1205  H HG   . LEU A 1 81  ? -1.802  -19.162 -1.700  1.00 0.00 ? 81  LEU A HG   1  
ATOM 1206  H HD11 . LEU A 1 81  ? 0.230   -19.062 -0.740  1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1207  H HD12 . LEU A 1 81  ? 0.169   -20.817 -0.898  1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1208  H HD13 . LEU A 1 81  ? -0.251  -20.055 0.636   1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1209  H HD21 . LEU A 1 81  ? -2.811  -21.701 -0.608  1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1210  H HD22 . LEU A 1 81  ? -1.391  -21.831 -1.645  1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1211  H HD23 . LEU A 1 81  ? -2.860  -21.069 -2.255  1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1212  N N    . PRO A 1 82  ? -5.754  -19.638 1.315   1.00 0.00 ? 82  PRO A N    1  
ATOM 1213  C CA   . PRO A 1 82  ? -6.672  -19.647 2.458   1.00 0.00 ? 82  PRO A CA   1  
ATOM 1214  C C    . PRO A 1 82  ? -5.948  -19.875 3.781   1.00 0.00 ? 82  PRO A C    1  
ATOM 1215  O O    . PRO A 1 82  ? -4.948  -20.589 3.837   1.00 0.00 ? 82  PRO A O    1  
ATOM 1216  C CB   . PRO A 1 82  ? -7.608  -20.818 2.152   1.00 0.00 ? 82  PRO A CB   1  
ATOM 1217  C CG   . PRO A 1 82  ? -6.812  -21.720 1.273   1.00 0.00 ? 82  PRO A CG   1  
ATOM 1218  C CD   . PRO A 1 82  ? -5.923  -20.823 0.457   1.00 0.00 ? 82  PRO A CD   1  
ATOM 1219  H HA   . PRO A 1 82  ? -7.244  -18.732 2.515   1.00 0.00 ? 82  PRO A HA   1  
ATOM 1220  H HB2  . PRO A 1 82  ? -7.887  -21.310 3.074   1.00 0.00 ? 82  PRO A HB2  1  
ATOM 1221  H HB3  . PRO A 1 82  ? -8.492  -20.456 1.649   1.00 0.00 ? 82  PRO A HB3  1  
ATOM 1222  H HG2  . PRO A 1 82  ? -6.218  -22.390 1.875   1.00 0.00 ? 82  PRO A HG2  1  
ATOM 1223  H HG3  . PRO A 1 82  ? -7.473  -22.279 0.627   1.00 0.00 ? 82  PRO A HG3  1  
ATOM 1224  H HD2  . PRO A 1 82  ? -4.973  -21.302 0.270   1.00 0.00 ? 82  PRO A HD2  1  
ATOM 1225  H HD3  . PRO A 1 82  ? -6.404  -20.559 -0.473  1.00 0.00 ? 82  PRO A HD3  1  
ATOM 1226  N N    . ASN A 1 83  ? -6.461  -19.263 4.844   1.00 0.00 ? 83  ASN A N    1  
ATOM 1227  C CA   . ASN A 1 83  ? -5.862  -19.400 6.167   1.00 0.00 ? 83  ASN A CA   1  
ATOM 1228  C C    . ASN A 1 83  ? -4.384  -19.023 6.137   1.00 0.00 ? 83  ASN A C    1  
ATOM 1229  O O    . ASN A 1 83  ? -3.548  -19.700 6.736   1.00 0.00 ? 83  ASN A O    1  
ATOM 1230  C CB   . ASN A 1 83  ? -6.025  -20.833 6.677   1.00 0.00 ? 83  ASN A CB   1  
ATOM 1231  C CG   . ASN A 1 83  ? -7.456  -21.150 7.065   1.00 0.00 ? 83  ASN A CG   1  
ATOM 1232  O OD1  . ASN A 1 83  ? -7.724  -21.600 8.179   1.00 0.00 ? 83  ASN A OD1  1  
ATOM 1233  N ND2  . ASN A 1 83  ? -8.384  -20.917 6.143   1.00 0.00 ? 83  ASN A ND2  1  
ATOM 1234  H H    . ASN A 1 83  ? -7.260  -18.707 4.736   1.00 0.00 ? 83  ASN A H    1  
ATOM 1235  H HA   . ASN A 1 83  ? -6.380  -18.729 6.835   1.00 0.00 ? 83  ASN A HA   1  
ATOM 1236  H HB2  . ASN A 1 83  ? -5.721  -21.521 5.902   1.00 0.00 ? 83  ASN A HB2  1  
ATOM 1237  H HB3  . ASN A 1 83  ? -5.396  -20.974 7.544   1.00 0.00 ? 83  ASN A HB3  1  
ATOM 1238  H HD21 . ASN A 1 83  ? -8.097  -20.558 5.278   1.00 0.00 ? 83  ASN A HD21 1  
ATOM 1239  H HD22 . ASN A 1 83  ? -9.317  -21.112 6.368   1.00 0.00 ? 83  ASN A HD22 1  
ATOM 1240  N N    . HIS A 1 84  ? -4.070  -17.938 5.436   1.00 0.00 ? 84  HIS A N    1  
ATOM 1241  C CA   . HIS A 1 84  ? -2.693  -17.470 5.329   1.00 0.00 ? 84  HIS A CA   1  
ATOM 1242  C C    . HIS A 1 84  ? -2.622  -15.953 5.476   1.00 0.00 ? 84  HIS A C    1  
ATOM 1243  O O    . HIS A 1 84  ? -3.429  -15.225 4.898   1.00 0.00 ? 84  HIS A O    1  
ATOM 1244  C CB   . HIS A 1 84  ? -2.091  -17.893 3.989   1.00 0.00 ? 84  HIS A CB   1  
ATOM 1245  C CG   . HIS A 1 84  ? -1.545  -19.288 3.991   1.00 0.00 ? 84  HIS A CG   1  
ATOM 1246  N ND1  . HIS A 1 84  ? -2.336  -20.405 4.156   1.00 0.00 ? 84  HIS A ND1  1  
ATOM 1247  C CD2  . HIS A 1 84  ? -0.278  -19.743 3.846   1.00 0.00 ? 84  HIS A CD2  1  
ATOM 1248  C CE1  . HIS A 1 84  ? -1.579  -21.487 4.113   1.00 0.00 ? 84  HIS A CE1  1  
ATOM 1249  N NE2  . HIS A 1 84  ? -0.327  -21.113 3.926   1.00 0.00 ? 84  HIS A NE2  1  
ATOM 1250  H H    . HIS A 1 84  ? -4.781  -17.440 4.981   1.00 0.00 ? 84  HIS A H    1  
ATOM 1251  H HA   . HIS A 1 84  ? -2.125  -17.923 6.128   1.00 0.00 ? 84  HIS A HA   1  
ATOM 1252  H HB2  . HIS A 1 84  ? -2.853  -17.837 3.226   1.00 0.00 ? 84  HIS A HB2  1  
ATOM 1253  H HB3  . HIS A 1 84  ? -1.284  -17.220 3.736   1.00 0.00 ? 84  HIS A HB3  1  
ATOM 1254  H HD2  . HIS A 1 84  ? 0.607   -19.141 3.696   1.00 0.00 ? 84  HIS A HD2  1  
ATOM 1255  H HE1  . HIS A 1 84  ? -1.925  -22.505 4.214   1.00 0.00 ? 84  HIS A HE1  1  
ATOM 1256  H HE2  . HIS A 1 84  ? 0.449   -21.711 3.942   1.00 0.00 ? 84  HIS A HE2  1  
ATOM 1257  N N    . SER A 1 85  ? -1.651  -15.483 6.253   1.00 0.00 ? 85  SER A N    1  
ATOM 1258  C CA   . SER A 1 85  ? -1.478  -14.053 6.479   1.00 0.00 ? 85  SER A CA   1  
ATOM 1259  C C    . SER A 1 85  ? -0.625  -13.428 5.379   1.00 0.00 ? 85  SER A C    1  
ATOM 1260  O O    . SER A 1 85  ? 0.332   -14.036 4.899   1.00 0.00 ? 85  SER A O    1  
ATOM 1261  C CB   . SER A 1 85  ? -0.830  -13.806 7.843   1.00 0.00 ? 85  SER A CB   1  
ATOM 1262  O OG   . SER A 1 85  ? 0.330   -14.601 8.009   1.00 0.00 ? 85  SER A OG   1  
ATOM 1263  H H    . SER A 1 85  ? -1.038  -16.114 6.686   1.00 0.00 ? 85  SER A H    1  
ATOM 1264  H HA   . SER A 1 85  ? -2.455  -13.594 6.465   1.00 0.00 ? 85  SER A HA   1  
ATOM 1265  H HB2  . SER A 1 85  ? -0.554  -12.765 7.924   1.00 0.00 ? 85  SER A HB2  1  
ATOM 1266  H HB3  . SER A 1 85  ? -1.536  -14.052 8.623   1.00 0.00 ? 85  SER A HB3  1  
ATOM 1267  H HG   . SER A 1 85  ? 0.421   -14.848 8.932   1.00 0.00 ? 85  SER A HG   1  
ATOM 1268  N N    . TYR A 1 86  ? -0.981  -12.211 4.984   1.00 0.00 ? 86  TYR A N    1  
ATOM 1269  C CA   . TYR A 1 86  ? -0.251  -11.503 3.938   1.00 0.00 ? 86  TYR A CA   1  
ATOM 1270  C C    . TYR A 1 86  ? -0.022  -10.045 4.325   1.00 0.00 ? 86  TYR A C    1  
ATOM 1271  O O    . TYR A 1 86  ? -0.969  -9.306  4.596   1.00 0.00 ? 86  TYR A O    1  
ATOM 1272  C CB   . TYR A 1 86  ? -1.015  -11.577 2.615   1.00 0.00 ? 86  TYR A CB   1  
ATOM 1273  C CG   . TYR A 1 86  ? -0.882  -12.910 1.913   1.00 0.00 ? 86  TYR A CG   1  
ATOM 1274  C CD1  . TYR A 1 86  ? 0.244   -13.212 1.158   1.00 0.00 ? 86  TYR A CD1  1  
ATOM 1275  C CD2  . TYR A 1 86  ? -1.884  -13.869 2.007   1.00 0.00 ? 86  TYR A CD2  1  
ATOM 1276  C CE1  . TYR A 1 86  ? 0.368   -14.428 0.515   1.00 0.00 ? 86  TYR A CE1  1  
ATOM 1277  C CE2  . TYR A 1 86  ? -1.768  -15.088 1.369   1.00 0.00 ? 86  TYR A CE2  1  
ATOM 1278  C CZ   . TYR A 1 86  ? -0.640  -15.363 0.624   1.00 0.00 ? 86  TYR A CZ   1  
ATOM 1279  O OH   . TYR A 1 86  ? -0.519  -16.576 -0.014  1.00 0.00 ? 86  TYR A OH   1  
ATOM 1280  H H    . TYR A 1 86  ? -1.753  -11.778 5.404   1.00 0.00 ? 86  TYR A H    1  
ATOM 1281  H HA   . TYR A 1 86  ? 0.707   -11.986 3.817   1.00 0.00 ? 86  TYR A HA   1  
ATOM 1282  H HB2  . TYR A 1 86  ? -2.063  -11.404 2.802   1.00 0.00 ? 86  TYR A HB2  1  
ATOM 1283  H HB3  . TYR A 1 86  ? -0.642  -10.813 1.948   1.00 0.00 ? 86  TYR A HB3  1  
ATOM 1284  H HD1  . TYR A 1 86  ? 1.032   -12.477 1.076   1.00 0.00 ? 86  TYR A HD1  1  
ATOM 1285  H HD2  . TYR A 1 86  ? -2.766  -13.651 2.592   1.00 0.00 ? 86  TYR A HD2  1  
ATOM 1286  H HE1  . TYR A 1 86  ? 1.251   -14.644 -0.068  1.00 0.00 ? 86  TYR A HE1  1  
ATOM 1287  H HE2  . TYR A 1 86  ? -2.557  -15.821 1.453   1.00 0.00 ? 86  TYR A HE2  1  
ATOM 1288  H HH   . TYR A 1 86  ? -0.582  -17.285 0.631   1.00 0.00 ? 86  TYR A HH   1  
ATOM 1289  N N    . VAL A 1 87  ? 1.243   -9.638  4.347   1.00 0.00 ? 87  VAL A N    1  
ATOM 1290  C CA   . VAL A 1 87  ? 1.599   -8.268  4.699   1.00 0.00 ? 87  VAL A CA   1  
ATOM 1291  C C    . VAL A 1 87  ? 1.416   -7.330  3.510   1.00 0.00 ? 87  VAL A C    1  
ATOM 1292  O O    . VAL A 1 87  ? 2.238   -7.304  2.594   1.00 0.00 ? 87  VAL A O    1  
ATOM 1293  C CB   . VAL A 1 87  ? 3.055   -8.175  5.192   1.00 0.00 ? 87  VAL A CB   1  
ATOM 1294  C CG1  . VAL A 1 87  ? 4.011   -8.712  4.137   1.00 0.00 ? 87  VAL A CG1  1  
ATOM 1295  C CG2  . VAL A 1 87  ? 3.403   -6.740  5.557   1.00 0.00 ? 87  VAL A CG2  1  
ATOM 1296  H H    . VAL A 1 87  ? 1.954   -10.273 4.121   1.00 0.00 ? 87  VAL A H    1  
ATOM 1297  H HA   . VAL A 1 87  ? 0.949   -7.949  5.500   1.00 0.00 ? 87  VAL A HA   1  
ATOM 1298  H HB   . VAL A 1 87  ? 3.153   -8.784  6.078   1.00 0.00 ? 87  VAL A HB   1  
ATOM 1299  H HG11 . VAL A 1 87  ? 4.571   -7.894  3.709   1.00 0.00 ? 87  VAL A HG11 1  
ATOM 1300  H HG12 . VAL A 1 87  ? 4.692   -9.416  4.593   1.00 0.00 ? 87  VAL A HG12 1  
ATOM 1301  H HG13 . VAL A 1 87  ? 3.448   -9.208  3.360   1.00 0.00 ? 87  VAL A HG13 1  
ATOM 1302  H HG21 . VAL A 1 87  ? 3.026   -6.073  4.796   1.00 0.00 ? 87  VAL A HG21 1  
ATOM 1303  H HG22 . VAL A 1 87  ? 2.955   -6.493  6.508   1.00 0.00 ? 87  VAL A HG22 1  
ATOM 1304  H HG23 . VAL A 1 87  ? 4.476   -6.636  5.627   1.00 0.00 ? 87  VAL A HG23 1  
ATOM 1305  N N    . PHE A 1 88  ? 0.332   -6.562  3.532   1.00 0.00 ? 88  PHE A N    1  
ATOM 1306  C CA   . PHE A 1 88  ? 0.039   -5.622  2.456   1.00 0.00 ? 88  PHE A CA   1  
ATOM 1307  C C    . PHE A 1 88  ? 0.624   -4.246  2.762   1.00 0.00 ? 88  PHE A C    1  
ATOM 1308  O O    . PHE A 1 88  ? 0.098   -3.507  3.594   1.00 0.00 ? 88  PHE A O    1  
ATOM 1309  C CB   . PHE A 1 88  ? -1.472  -5.511  2.244   1.00 0.00 ? 88  PHE A CB   1  
ATOM 1310  C CG   . PHE A 1 88  ? -2.063  -6.684  1.517   1.00 0.00 ? 88  PHE A CG   1  
ATOM 1311  C CD1  . PHE A 1 88  ? -2.483  -7.807  2.212   1.00 0.00 ? 88  PHE A CD1  1  
ATOM 1312  C CD2  . PHE A 1 88  ? -2.200  -6.665  0.138   1.00 0.00 ? 88  PHE A CD2  1  
ATOM 1313  C CE1  . PHE A 1 88  ? -3.026  -8.889  1.545   1.00 0.00 ? 88  PHE A CE1  1  
ATOM 1314  C CE2  . PHE A 1 88  ? -2.743  -7.743  -0.534  1.00 0.00 ? 88  PHE A CE2  1  
ATOM 1315  C CZ   . PHE A 1 88  ? -3.158  -8.856  0.171   1.00 0.00 ? 88  PHE A CZ   1  
ATOM 1316  H H    . PHE A 1 88  ? -0.287  -6.629  4.290   1.00 0.00 ? 88  PHE A H    1  
ATOM 1317  H HA   . PHE A 1 88  ? 0.494   -6.001  1.554   1.00 0.00 ? 88  PHE A HA   1  
ATOM 1318  H HB2  . PHE A 1 88  ? -1.959  -5.437  3.205   1.00 0.00 ? 88  PHE A HB2  1  
ATOM 1319  H HB3  . PHE A 1 88  ? -1.683  -4.622  1.669   1.00 0.00 ? 88  PHE A HB3  1  
ATOM 1320  H HD1  . PHE A 1 88  ? -2.382  -7.834  3.287   1.00 0.00 ? 88  PHE A HD1  1  
ATOM 1321  H HD2  . PHE A 1 88  ? -1.876  -5.794  -0.414  1.00 0.00 ? 88  PHE A HD2  1  
ATOM 1322  H HE1  . PHE A 1 88  ? -3.350  -9.758  2.098   1.00 0.00 ? 88  PHE A HE1  1  
ATOM 1323  H HE2  . PHE A 1 88  ? -2.845  -7.714  -1.609  1.00 0.00 ? 88  PHE A HE2  1  
ATOM 1324  H HZ   . PHE A 1 88  ? -3.582  -9.700  -0.353  1.00 0.00 ? 88  PHE A HZ   1  
ATOM 1325  N N    . ARG A 1 89  ? 1.716   -3.909  2.083   1.00 0.00 ? 89  ARG A N    1  
ATOM 1326  C CA   . ARG A 1 89  ? 2.373   -2.624  2.283   1.00 0.00 ? 89  ARG A CA   1  
ATOM 1327  C C    . ARG A 1 89  ? 2.106   -1.688  1.108   1.00 0.00 ? 89  ARG A C    1  
ATOM 1328  O O    . ARG A 1 89  ? 2.710   -1.822  0.043   1.00 0.00 ? 89  ARG A O    1  
ATOM 1329  C CB   . ARG A 1 89  ? 3.880   -2.820  2.459   1.00 0.00 ? 89  ARG A CB   1  
ATOM 1330  C CG   . ARG A 1 89  ? 4.249   -3.631  3.691   1.00 0.00 ? 89  ARG A CG   1  
ATOM 1331  C CD   . ARG A 1 89  ? 5.620   -3.245  4.222   1.00 0.00 ? 89  ARG A CD   1  
ATOM 1332  N NE   . ARG A 1 89  ? 6.188   -4.283  5.077   1.00 0.00 ? 89  ARG A NE   1  
ATOM 1333  C CZ   . ARG A 1 89  ? 6.748   -5.394  4.611   1.00 0.00 ? 89  ARG A CZ   1  
ATOM 1334  N NH1  . ARG A 1 89  ? 6.815   -5.609  3.305   1.00 0.00 ? 89  ARG A NH1  1  
ATOM 1335  N NH2  . ARG A 1 89  ? 7.243   -6.293  5.453   1.00 0.00 ? 89  ARG A NH2  1  
ATOM 1336  H H    . ARG A 1 89  ? 2.088   -4.541  1.433   1.00 0.00 ? 89  ARG A H    1  
ATOM 1337  H HA   . ARG A 1 89  ? 1.969   -2.180  3.180   1.00 0.00 ? 89  ARG A HA   1  
ATOM 1338  H HB2  . ARG A 1 89  ? 4.270   -3.330  1.590   1.00 0.00 ? 89  ARG A HB2  1  
ATOM 1339  H HB3  . ARG A 1 89  ? 4.350   -1.851  2.539   1.00 0.00 ? 89  ARG A HB3  1  
ATOM 1340  H HG2  . ARG A 1 89  ? 3.513   -3.452  4.461   1.00 0.00 ? 89  ARG A HG2  1  
ATOM 1341  H HG3  . ARG A 1 89  ? 4.255   -4.679  3.431   1.00 0.00 ? 89  ARG A HG3  1  
ATOM 1342  H HD2  . ARG A 1 89  ? 6.282   -3.079  3.385   1.00 0.00 ? 89  ARG A HD2  1  
ATOM 1343  H HD3  . ARG A 1 89  ? 5.527   -2.333  4.792   1.00 0.00 ? 89  ARG A HD3  1  
ATOM 1344  H HE   . ARG A 1 89  ? 6.149   -4.145  6.046   1.00 0.00 ? 89  ARG A HE   1  
ATOM 1345  H HH11 . ARG A 1 89  ? 6.444   -4.933  2.668   1.00 0.00 ? 89  ARG A HH11 1  
ATOM 1346  H HH12 . ARG A 1 89  ? 7.239   -6.446  2.956   1.00 0.00 ? 89  ARG A HH12 1  
ATOM 1347  H HH21 . ARG A 1 89  ? 7.195   -6.134  6.439   1.00 0.00 ? 89  ARG A HH21 1  
ATOM 1348  H HH22 . ARG A 1 89  ? 7.664   -7.128  5.102   1.00 0.00 ? 89  ARG A HH22 1  
ATOM 1349  N N    . VAL A 1 90  ? 1.195   -0.740  1.308   1.00 0.00 ? 90  VAL A N    1  
ATOM 1350  C CA   . VAL A 1 90  ? 0.848   0.219   0.266   1.00 0.00 ? 90  VAL A CA   1  
ATOM 1351  C C    . VAL A 1 90  ? 1.802   1.408   0.272   1.00 0.00 ? 90  VAL A C    1  
ATOM 1352  O O    . VAL A 1 90  ? 2.165   1.919   1.332   1.00 0.00 ? 90  VAL A O    1  
ATOM 1353  C CB   . VAL A 1 90  ? -0.595  0.731   0.434   1.00 0.00 ? 90  VAL A CB   1  
ATOM 1354  C CG1  . VAL A 1 90  ? -0.892  1.830   -0.575  1.00 0.00 ? 90  VAL A CG1  1  
ATOM 1355  C CG2  . VAL A 1 90  ? -1.587  -0.414  0.295   1.00 0.00 ? 90  VAL A CG2  1  
ATOM 1356  H H    . VAL A 1 90  ? 0.748   -0.684  2.178   1.00 0.00 ? 90  VAL A H    1  
ATOM 1357  H HA   . VAL A 1 90  ? 0.920   -0.284  -0.688  1.00 0.00 ? 90  VAL A HA   1  
ATOM 1358  H HB   . VAL A 1 90  ? -0.695  1.148   1.426   1.00 0.00 ? 90  VAL A HB   1  
ATOM 1359  H HG11 . VAL A 1 90  ? -1.961  1.924   -0.700  1.00 0.00 ? 90  VAL A HG11 1  
ATOM 1360  H HG12 . VAL A 1 90  ? -0.486  2.765   -0.219  1.00 0.00 ? 90  VAL A HG12 1  
ATOM 1361  H HG13 . VAL A 1 90  ? -0.441  1.579   -1.524  1.00 0.00 ? 90  VAL A HG13 1  
ATOM 1362  H HG21 . VAL A 1 90  ? -2.589  -0.017  0.231   1.00 0.00 ? 90  VAL A HG21 1  
ATOM 1363  H HG22 . VAL A 1 90  ? -1.363  -0.976  -0.599  1.00 0.00 ? 90  VAL A HG22 1  
ATOM 1364  H HG23 . VAL A 1 90  ? -1.511  -1.063  1.156   1.00 0.00 ? 90  VAL A HG23 1  
ATOM 1365  N N    . ARG A 1 91  ? 2.204   1.843   -0.917  1.00 0.00 ? 91  ARG A N    1  
ATOM 1366  C CA   . ARG A 1 91  ? 3.117   2.972   -1.049  1.00 0.00 ? 91  ARG A CA   1  
ATOM 1367  C C    . ARG A 1 91  ? 2.638   3.935   -2.131  1.00 0.00 ? 91  ARG A C    1  
ATOM 1368  O O    . ARG A 1 91  ? 1.876   3.556   -3.020  1.00 0.00 ? 91  ARG A O    1  
ATOM 1369  C CB   . ARG A 1 91  ? 4.527   2.479   -1.377  1.00 0.00 ? 91  ARG A CB   1  
ATOM 1370  C CG   . ARG A 1 91  ? 5.600   3.542   -1.204  1.00 0.00 ? 91  ARG A CG   1  
ATOM 1371  C CD   . ARG A 1 91  ? 6.995   2.948   -1.313  1.00 0.00 ? 91  ARG A CD   1  
ATOM 1372  N NE   . ARG A 1 91  ? 7.170   2.184   -2.546  1.00 0.00 ? 91  ARG A NE   1  
ATOM 1373  C CZ   . ARG A 1 91  ? 8.152   1.310   -2.736  1.00 0.00 ? 91  ARG A CZ   1  
ATOM 1374  N NH1  . ARG A 1 91  ? 9.044   1.092   -1.779  1.00 0.00 ? 91  ARG A NH1  1  
ATOM 1375  N NH2  . ARG A 1 91  ? 8.244   0.653   -3.885  1.00 0.00 ? 91  ARG A NH2  1  
ATOM 1376  H H    . ARG A 1 91  ? 1.879   1.394   -1.726  1.00 0.00 ? 91  ARG A H    1  
ATOM 1377  H HA   . ARG A 1 91  ? 3.138   3.493   -0.104  1.00 0.00 ? 91  ARG A HA   1  
ATOM 1378  H HB2  . ARG A 1 91  ? 4.766   1.649   -0.729  1.00 0.00 ? 91  ARG A HB2  1  
ATOM 1379  H HB3  . ARG A 1 91  ? 4.548   2.142   -2.403  1.00 0.00 ? 91  ARG A HB3  1  
ATOM 1380  H HG2  . ARG A 1 91  ? 5.478   4.292   -1.971  1.00 0.00 ? 91  ARG A HG2  1  
ATOM 1381  H HG3  . ARG A 1 91  ? 5.487   3.998   -0.231  1.00 0.00 ? 91  ARG A HG3  1  
ATOM 1382  H HD2  . ARG A 1 91  ? 7.717   3.751   -1.295  1.00 0.00 ? 91  ARG A HD2  1  
ATOM 1383  H HD3  . ARG A 1 91  ? 7.162   2.296   -0.469  1.00 0.00 ? 91  ARG A HD3  1  
ATOM 1384  H HE   . ARG A 1 91  ? 6.522   2.330   -3.266  1.00 0.00 ? 91  ARG A HE   1  
ATOM 1385  H HH11 . ARG A 1 91  ? 8.976   1.585   -0.912  1.00 0.00 ? 91  ARG A HH11 1  
ATOM 1386  H HH12 . ARG A 1 91  ? 9.782   0.433   -1.925  1.00 0.00 ? 91  ARG A HH12 1  
ATOM 1387  H HH21 . ARG A 1 91  ? 7.574   0.815   -4.608  1.00 0.00 ? 91  ARG A HH21 1  
ATOM 1388  H HH22 . ARG A 1 91  ? 8.984   -0.004  -4.027  1.00 0.00 ? 91  ARG A HH22 1  
ATOM 1389  N N    . ALA A 1 92  ? 3.090   5.182   -2.048  1.00 0.00 ? 92  ALA A N    1  
ATOM 1390  C CA   . ALA A 1 92  ? 2.709   6.199   -3.021  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1391  C C    . ALA A 1 92  ? 3.928   6.725   -3.771  1.00 0.00 ? 92  ALA A C    1  
ATOM 1392  O O    . ALA A 1 92  ? 5.045   6.692   -3.256  1.00 0.00 ? 92  ALA A O    1  
ATOM 1393  C CB   . ALA A 1 92  ? 1.977   7.341   -2.332  1.00 0.00 ? 92  ALA A CB   1  
ATOM 1394  H H    . ALA A 1 92  ? 3.695   5.424   -1.316  1.00 0.00 ? 92  ALA A H    1  
ATOM 1395  H HA   . ALA A 1 92  ? 2.031   5.745   -3.730  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1396  H HB1  . ALA A 1 92  ? 2.645   8.182   -2.221  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1397  H HB2  . ALA A 1 92  ? 1.125   7.633   -2.928  1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1398  H HB3  . ALA A 1 92  ? 1.641   7.017   -1.358  1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1399  N N    . GLN A 1 93  ? 3.704   7.210   -4.988  1.00 0.00 ? 93  GLN A N    1  
ATOM 1400  C CA   . GLN A 1 93  ? 4.786   7.742   -5.808  1.00 0.00 ? 93  GLN A CA   1  
ATOM 1401  C C    . GLN A 1 93  ? 4.382   9.065   -6.450  1.00 0.00 ? 93  GLN A C    1  
ATOM 1402  O O    . GLN A 1 93  ? 3.285   9.194   -6.993  1.00 0.00 ? 93  GLN A O    1  
ATOM 1403  C CB   . GLN A 1 93  ? 5.176   6.735   -6.891  1.00 0.00 ? 93  GLN A CB   1  
ATOM 1404  C CG   . GLN A 1 93  ? 6.249   7.246   -7.840  1.00 0.00 ? 93  GLN A CG   1  
ATOM 1405  C CD   . GLN A 1 93  ? 6.173   6.599   -9.209  1.00 0.00 ? 93  GLN A CD   1  
ATOM 1406  O OE1  . GLN A 1 93  ? 5.283   6.903   -10.003 1.00 0.00 ? 93  GLN A OE1  1  
ATOM 1407  N NE2  . GLN A 1 93  ? 7.109   5.702   -9.493  1.00 0.00 ? 93  GLN A NE2  1  
ATOM 1408  H H    . GLN A 1 93  ? 2.792   7.209   -5.342  1.00 0.00 ? 93  GLN A H    1  
ATOM 1409  H HA   . GLN A 1 93  ? 5.636   7.913   -5.165  1.00 0.00 ? 93  GLN A HA   1  
ATOM 1410  H HB2  . GLN A 1 93  ? 5.544   5.838   -6.416  1.00 0.00 ? 93  GLN A HB2  1  
ATOM 1411  H HB3  . GLN A 1 93  ? 4.299   6.491   -7.472  1.00 0.00 ? 93  GLN A HB3  1  
ATOM 1412  H HG2  . GLN A 1 93  ? 6.130   8.313   -7.956  1.00 0.00 ? 93  GLN A HG2  1  
ATOM 1413  H HG3  . GLN A 1 93  ? 7.218   7.037   -7.412  1.00 0.00 ? 93  GLN A HG3  1  
ATOM 1414  H HE21 . GLN A 1 93  ? 7.787   5.509   -8.810  1.00 0.00 ? 93  GLN A HE21 1  
ATOM 1415  H HE22 . GLN A 1 93  ? 7.084   5.268   -10.370 1.00 0.00 ? 93  GLN A HE22 1  
ATOM 1416  N N    . SER A 1 94  ? 5.276   10.047  -6.383  1.00 0.00 ? 94  SER A N    1  
ATOM 1417  C CA   . SER A 1 94  ? 5.011   11.362  -6.954  1.00 0.00 ? 94  SER A CA   1  
ATOM 1418  C C    . SER A 1 94  ? 6.176   11.820  -7.827  1.00 0.00 ? 94  SER A C    1  
ATOM 1419  O O    . SER A 1 94  ? 7.249   11.218  -7.813  1.00 0.00 ? 94  SER A O    1  
ATOM 1420  C CB   . SER A 1 94  ? 4.761   12.383  -5.842  1.00 0.00 ? 94  SER A CB   1  
ATOM 1421  O OG   . SER A 1 94  ? 5.975   12.963  -5.399  1.00 0.00 ? 94  SER A OG   1  
ATOM 1422  H H    . SER A 1 94  ? 6.134   9.883   -5.937  1.00 0.00 ? 94  SER A H    1  
ATOM 1423  H HA   . SER A 1 94  ? 4.126   11.285  -7.567  1.00 0.00 ? 94  SER A HA   1  
ATOM 1424  H HB2  . SER A 1 94  ? 4.117   13.166  -6.214  1.00 0.00 ? 94  SER A HB2  1  
ATOM 1425  H HB3  . SER A 1 94  ? 4.284   11.891  -5.007  1.00 0.00 ? 94  SER A HB3  1  
ATOM 1426  H HG   . SER A 1 94  ? 6.434   12.346  -4.823  1.00 0.00 ? 94  SER A HG   1  
ATOM 1427  N N    . GLN A 1 95  ? 5.954   12.889  -8.585  1.00 0.00 ? 95  GLN A N    1  
ATOM 1428  C CA   . GLN A 1 95  ? 6.984   13.427  -9.466  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1429  C C    . GLN A 1 95  ? 8.356   13.364  -8.802  1.00 0.00 ? 95  GLN A C    1  
ATOM 1430  O O    . GLN A 1 95  ? 9.378   13.260  -9.478  1.00 0.00 ? 95  GLN A O    1  
ATOM 1431  C CB   . GLN A 1 95  ? 6.655   14.872  -9.847  1.00 0.00 ? 95  GLN A CB   1  
ATOM 1432  C CG   . GLN A 1 95  ? 7.788   15.584  -10.569 1.00 0.00 ? 95  GLN A CG   1  
ATOM 1433  C CD   . GLN A 1 95  ? 7.384   16.951  -11.084 1.00 0.00 ? 95  GLN A CD   1  
ATOM 1434  O OE1  . GLN A 1 95  ? 6.501   17.602  -10.524 1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1435  N NE2  . GLN A 1 95  ? 8.029   17.395  -12.156 1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1436  H H    . GLN A 1 95  ? 5.078   13.325  -8.552  1.00 0.00 ? 95  GLN A H    1  
ATOM 1437  H HA   . GLN A 1 95  ? 7.003   12.824  -10.361 1.00 0.00 ? 95  GLN A HA   1  
ATOM 1438  H HB2  . GLN A 1 95  ? 5.789   14.874  -10.491 1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1439  H HB3  . GLN A 1 95  ? 6.427   15.425  -8.948  1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1440  H HG2  . GLN A 1 95  ? 8.615   15.704  -9.884  1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1441  H HG3  . GLN A 1 95  ? 8.101   14.977  -11.406 1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1442  H HE21 . GLN A 1 95  ? 8.720   16.821  -12.550 1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1443  H HE22 . GLN A 1 95  ? 7.788   18.274  -12.511 1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1444  N N    . GLU A 1 96  ? 8.368   13.427  -7.474  1.00 0.00 ? 96  GLU A N    1  
ATOM 1445  C CA   . GLU A 1 96  ? 9.615   13.378  -6.719  1.00 0.00 ? 96  GLU A CA   1  
ATOM 1446  C C    . GLU A 1 96  ? 10.155  11.952  -6.653  1.00 0.00 ? 96  GLU A C    1  
ATOM 1447  O O    . GLU A 1 96  ? 11.186  11.639  -7.245  1.00 0.00 ? 96  GLU A O    1  
ATOM 1448  C CB   . GLU A 1 96  ? 9.403   13.921  -5.305  1.00 0.00 ? 96  GLU A CB   1  
ATOM 1449  C CG   . GLU A 1 96  ? 9.377   15.439  -5.233  1.00 0.00 ? 96  GLU A CG   1  
ATOM 1450  C CD   . GLU A 1 96  ? 10.682  16.066  -5.685  1.00 0.00 ? 96  GLU A CD   1  
ATOM 1451  O OE1  . GLU A 1 96  ? 10.901  16.160  -6.911  1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1452  O OE2  . GLU A 1 96  ? 11.483  16.463  -4.813  1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1453  H H    . GLU A 1 96  ? 7.520   13.510  -6.991  1.00 0.00 ? 96  GLU A H    1  
ATOM 1454  H HA   . GLU A 1 96  ? 10.336  13.999  -7.229  1.00 0.00 ? 96  GLU A HA   1  
ATOM 1455  H HB2  . GLU A 1 96  ? 8.463   13.547  -4.926  1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1456  H HB3  . GLU A 1 96  ? 10.202  13.566  -4.672  1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1457  H HG2  . GLU A 1 96  ? 8.582   15.803  -5.866  1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1458  H HG3  . GLU A 1 96  ? 9.187   15.735  -4.212  1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1459  N N    . GLY A 1 97  ? 9.449   11.092  -5.925  1.00 0.00 ? 97  GLY A N    1  
ATOM 1460  C CA   . GLY A 1 97  ? 9.872   9.710   -5.793  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1461  C C    . GLY A 1 97  ? 9.000   8.926   -4.832  1.00 0.00 ? 97  GLY A C    1  
ATOM 1462  O O    . GLY A 1 97  ? 7.952   9.406   -4.402  1.00 0.00 ? 97  GLY A O    1  
ATOM 1463  H H    . GLY A 1 97  ? 8.634   11.398  -5.475  1.00 0.00 ? 97  GLY A H    1  
ATOM 1464  H HA2  . GLY A 1 97  ? 9.834   9.239   -6.764  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1465  H HA3  . GLY A 1 97  ? 10.891  9.690   -5.435  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1466  N N    . TRP A 1 98  ? 9.433   7.716   -4.497  1.00 0.00 ? 98  TRP A N    1  
ATOM 1467  C CA   . TRP A 1 98  ? 8.683   6.863   -3.581  1.00 0.00 ? 98  TRP A CA   1  
ATOM 1468  C C    . TRP A 1 98  ? 8.847   7.334   -2.141  1.00 0.00 ? 98  TRP A C    1  
ATOM 1469  O O    . TRP A 1 98  ? 9.963   7.433   -1.633  1.00 0.00 ? 98  TRP A O    1  
ATOM 1470  C CB   . TRP A 1 98  ? 9.145   5.411   -3.712  1.00 0.00 ? 98  TRP A CB   1  
ATOM 1471  C CG   . TRP A 1 98  ? 8.809   4.797   -5.037  1.00 0.00 ? 98  TRP A CG   1  
ATOM 1472  C CD1  . TRP A 1 98  ? 9.659   4.596   -6.087  1.00 0.00 ? 98  TRP A CD1  1  
ATOM 1473  C CD2  . TRP A 1 98  ? 7.530   4.307   -5.455  1.00 0.00 ? 98  TRP A CD2  1  
ATOM 1474  N NE1  . TRP A 1 98  ? 8.986   4.010   -7.132  1.00 0.00 ? 98  TRP A NE1  1  
ATOM 1475  C CE2  . TRP A 1 98  ? 7.679   3.822   -6.769  1.00 0.00 ? 98  TRP A CE2  1  
ATOM 1476  C CE3  . TRP A 1 98  ? 6.275   4.228   -4.846  1.00 0.00 ? 98  TRP A CE3  1  
ATOM 1477  C CZ2  . TRP A 1 98  ? 6.619   3.268   -7.482  1.00 0.00 ? 98  TRP A CZ2  1  
ATOM 1478  C CZ3  . TRP A 1 98  ? 5.224   3.679   -5.556  1.00 0.00 ? 98  TRP A CZ3  1  
ATOM 1479  C CH2  . TRP A 1 98  ? 5.401   3.204   -6.862  1.00 0.00 ? 98  TRP A CH2  1  
ATOM 1480  H H    . TRP A 1 98  ? 10.277  7.388   -4.873  1.00 0.00 ? 98  TRP A H    1  
ATOM 1481  H HA   . TRP A 1 98  ? 7.640   6.925   -3.852  1.00 0.00 ? 98  TRP A HA   1  
ATOM 1482  H HB2  . TRP A 1 98  ? 10.217  5.367   -3.587  1.00 0.00 ? 98  TRP A HB2  1  
ATOM 1483  H HB3  . TRP A 1 98  ? 8.672   4.820   -2.940  1.00 0.00 ? 98  TRP A HB3  1  
ATOM 1484  H HD1  . TRP A 1 98  ? 10.704  4.865   -6.082  1.00 0.00 ? 98  TRP A HD1  1  
ATOM 1485  H HE1  . TRP A 1 98  ? 9.380   3.766   -7.996  1.00 0.00 ? 98  TRP A HE1  1  
ATOM 1486  H HE3  . TRP A 1 98  ? 6.118   4.589   -3.840  1.00 0.00 ? 98  TRP A HE3  1  
ATOM 1487  H HZ2  . TRP A 1 98  ? 6.740   2.897   -8.490  1.00 0.00 ? 98  TRP A HZ2  1  
ATOM 1488  H HZ3  . TRP A 1 98  ? 4.246   3.611   -5.102  1.00 0.00 ? 98  TRP A HZ3  1  
ATOM 1489  H HH2  . TRP A 1 98  ? 4.552   2.784   -7.378  1.00 0.00 ? 98  TRP A HH2  1  
ATOM 1490  N N    . GLY A 1 99  ? 7.726   7.624   -1.486  1.00 0.00 ? 99  GLY A N    1  
ATOM 1491  C CA   . GLY A 1 99  ? 7.768   8.081   -0.110  1.00 0.00 ? 99  GLY A CA   1  
ATOM 1492  C C    . GLY A 1 99  ? 7.703   6.938   0.883   1.00 0.00 ? 99  GLY A C    1  
ATOM 1493  O O    . GLY A 1 99  ? 8.462   5.974   0.781   1.00 0.00 ? 99  GLY A O    1  
ATOM 1494  H H    . GLY A 1 99  ? 6.864   7.527   -1.942  1.00 0.00 ? 99  GLY A H    1  
ATOM 1495  H HA2  . GLY A 1 99  ? 8.685   8.630   0.048   1.00 0.00 ? 99  GLY A HA2  1  
ATOM 1496  H HA3  . GLY A 1 99  ? 6.931   8.742   0.064   1.00 0.00 ? 99  GLY A HA3  1  
ATOM 1497  N N    . ARG A 1 100 ? 6.795   7.045   1.848   1.00 0.00 ? 100 ARG A N    1  
ATOM 1498  C CA   . ARG A 1 100 ? 6.635   6.013   2.865   1.00 0.00 ? 100 ARG A CA   1  
ATOM 1499  C C    . ARG A 1 100 ? 5.515   5.047   2.489   1.00 0.00 ? 100 ARG A C    1  
ATOM 1500  O O    . ARG A 1 100 ? 4.752   5.300   1.558   1.00 0.00 ? 100 ARG A O    1  
ATOM 1501  C CB   . ARG A 1 100 ? 6.341   6.649   4.225   1.00 0.00 ? 100 ARG A CB   1  
ATOM 1502  C CG   . ARG A 1 100 ? 7.571   7.226   4.907   1.00 0.00 ? 100 ARG A CG   1  
ATOM 1503  C CD   . ARG A 1 100 ? 8.472   6.128   5.451   1.00 0.00 ? 100 ARG A CD   1  
ATOM 1504  N NE   . ARG A 1 100 ? 9.850   6.584   5.617   1.00 0.00 ? 100 ARG A NE   1  
ATOM 1505  C CZ   . ARG A 1 100 ? 10.726  6.651   4.621   1.00 0.00 ? 100 ARG A CZ   1  
ATOM 1506  N NH1  . ARG A 1 100 ? 10.370  6.294   3.395   1.00 0.00 ? 100 ARG A NH1  1  
ATOM 1507  N NH2  . ARG A 1 100 ? 11.962  7.076   4.851   1.00 0.00 ? 100 ARG A NH2  1  
ATOM 1508  H H    . ARG A 1 100 ? 6.218   7.837   1.876   1.00 0.00 ? 100 ARG A H    1  
ATOM 1509  H HA   . ARG A 1 100 ? 7.562   5.463   2.928   1.00 0.00 ? 100 ARG A HA   1  
ATOM 1510  H HB2  . ARG A 1 100 ? 5.624   7.446   4.089   1.00 0.00 ? 100 ARG A HB2  1  
ATOM 1511  H HB3  . ARG A 1 100 ? 5.914   5.899   4.874   1.00 0.00 ? 100 ARG A HB3  1  
ATOM 1512  H HG2  . ARG A 1 100 ? 8.127   7.811   4.190   1.00 0.00 ? 100 ARG A HG2  1  
ATOM 1513  H HG3  . ARG A 1 100 ? 7.254   7.858   5.723   1.00 0.00 ? 100 ARG A HG3  1  
ATOM 1514  H HD2  . ARG A 1 100 ? 8.091   5.810   6.410   1.00 0.00 ? 100 ARG A HD2  1  
ATOM 1515  H HD3  . ARG A 1 100 ? 8.458   5.296   4.764   1.00 0.00 ? 100 ARG A HD3  1  
ATOM 1516  H HE   . ARG A 1 100 ? 10.134  6.853   6.515   1.00 0.00 ? 100 ARG A HE   1  
ATOM 1517  H HH11 . ARG A 1 100 ? 9.440   5.974   3.219   1.00 0.00 ? 100 ARG A HH11 1  
ATOM 1518  H HH12 . ARG A 1 100 ? 11.032  6.347   2.647   1.00 0.00 ? 100 ARG A HH12 1  
ATOM 1519  H HH21 . ARG A 1 100 ? 12.234  7.346   5.774   1.00 0.00 ? 100 ARG A HH21 1  
ATOM 1520  H HH22 . ARG A 1 100 ? 12.621  7.126   4.102   1.00 0.00 ? 100 ARG A HH22 1  
ATOM 1521  N N    . GLU A 1 101 ? 5.424   3.941   3.221   1.00 0.00 ? 101 GLU A N    1  
ATOM 1522  C CA   . GLU A 1 101 ? 4.398   2.938   2.963   1.00 0.00 ? 101 GLU A CA   1  
ATOM 1523  C C    . GLU A 1 101 ? 3.790   2.433   4.268   1.00 0.00 ? 101 GLU A C    1  
ATOM 1524  O O    . GLU A 1 101 ? 4.491   2.256   5.264   1.00 0.00 ? 101 GLU A O    1  
ATOM 1525  C CB   . GLU A 1 101 ? 4.986   1.766   2.175   1.00 0.00 ? 101 GLU A CB   1  
ATOM 1526  C CG   . GLU A 1 101 ? 5.906   0.879   2.998   1.00 0.00 ? 101 GLU A CG   1  
ATOM 1527  C CD   . GLU A 1 101 ? 6.770   -0.022  2.138   1.00 0.00 ? 101 GLU A CD   1  
ATOM 1528  O OE1  . GLU A 1 101 ? 6.210   -0.742  1.284   1.00 0.00 ? 101 GLU A OE1  1  
ATOM 1529  O OE2  . GLU A 1 101 ? 8.005   -0.010  2.318   1.00 0.00 ? 101 GLU A OE2  1  
ATOM 1530  H H    . GLU A 1 101 ? 6.062   3.796   3.950   1.00 0.00 ? 101 GLU A H    1  
ATOM 1531  H HA   . GLU A 1 101 ? 3.621   3.402   2.374   1.00 0.00 ? 101 GLU A HA   1  
ATOM 1532  H HB2  . GLU A 1 101 ? 4.176   1.158   1.798   1.00 0.00 ? 101 GLU A HB2  1  
ATOM 1533  H HB3  . GLU A 1 101 ? 5.549   2.156   1.340   1.00 0.00 ? 101 GLU A HB3  1  
ATOM 1534  H HG2  . GLU A 1 101 ? 6.551   1.507   3.594   1.00 0.00 ? 101 GLU A HG2  1  
ATOM 1535  H HG3  . GLU A 1 101 ? 5.304   0.263   3.648   1.00 0.00 ? 101 GLU A HG3  1  
ATOM 1536  N N    . ARG A 1 102 ? 2.481   2.204   4.254   1.00 0.00 ? 102 ARG A N    1  
ATOM 1537  C CA   . ARG A 1 102 ? 1.777   1.722   5.437   1.00 0.00 ? 102 ARG A CA   1  
ATOM 1538  C C    . ARG A 1 102 ? 1.713   0.197   5.447   1.00 0.00 ? 102 ARG A C    1  
ATOM 1539  O O    . ARG A 1 102 ? 1.474   -0.430  4.416   1.00 0.00 ? 102 ARG A O    1  
ATOM 1540  C CB   . ARG A 1 102 ? 0.363   2.303   5.488   1.00 0.00 ? 102 ARG A CB   1  
ATOM 1541  C CG   . ARG A 1 102 ? -0.483  1.750   6.623   1.00 0.00 ? 102 ARG A CG   1  
ATOM 1542  C CD   . ARG A 1 102 ? -0.022  2.282   7.971   1.00 0.00 ? 102 ARG A CD   1  
ATOM 1543  N NE   . ARG A 1 102 ? -0.514  3.634   8.223   1.00 0.00 ? 102 ARG A NE   1  
ATOM 1544  C CZ   . ARG A 1 102 ? -0.491  4.213   9.418   1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1545  N NH1  . ARG A 1 102 ? -0.002  3.562   10.465  1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1546  N NH2  . ARG A 1 102 ? -0.957  5.446   9.568   1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1547  H H    . ARG A 1 102 ? 1.976   2.364   3.430   1.00 0.00 ? 102 ARG A H    1  
ATOM 1548  H HA   . ARG A 1 102 ? 2.324   2.053   6.307   1.00 0.00 ? 102 ARG A HA   1  
ATOM 1549  H HB2  . ARG A 1 102 ? 0.430   3.374   5.608   1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1550  H HB3  . ARG A 1 102 ? -0.137  2.084   4.556   1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1551  H HG2  . ARG A 1 102 ? -1.512  2.039   6.467   1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1552  H HG3  . ARG A 1 102 ? -0.405  0.673   6.625   1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1553  H HD2  . ARG A 1 102 ? -0.388  1.626   8.746   1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1554  H HD3  . ARG A 1 102 ? 1.058   2.292   7.989   1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1555  H HE   . ARG A 1 102 ? -0.879  4.133   7.463   1.00 0.00 ? 102 ARG A HE   1  
ATOM 1556  H HH11 . ARG A 1 102 ? 0.350   2.633   10.355  1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1557  H HH12 . ARG A 1 102 ? 0.015   4.001   11.363  1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1558  H HH21 . ARG A 1 102 ? -1.325  5.940   8.781   1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1559  H HH22 . ARG A 1 102 ? -0.939  5.882   10.467  1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1560  N N    . GLU A 1 103 ? 1.928   -0.391  6.620   1.00 0.00 ? 103 GLU A N    1  
ATOM 1561  C CA   . GLU A 1 103 ? 1.895   -1.842  6.763   1.00 0.00 ? 103 GLU A CA   1  
ATOM 1562  C C    . GLU A 1 103 ? 0.513   -2.314  7.206   1.00 0.00 ? 103 GLU A C    1  
ATOM 1563  O O    . GLU A 1 103 ? -0.101  -1.724  8.094   1.00 0.00 ? 103 GLU A O    1  
ATOM 1564  C CB   . GLU A 1 103 ? 2.951   -2.301  7.770   1.00 0.00 ? 103 GLU A CB   1  
ATOM 1565  C CG   . GLU A 1 103 ? 3.333   -3.765  7.627   1.00 0.00 ? 103 GLU A CG   1  
ATOM 1566  C CD   . GLU A 1 103 ? 3.787   -4.380  8.937   1.00 0.00 ? 103 GLU A CD   1  
ATOM 1567  O OE1  . GLU A 1 103 ? 3.135   -4.121  9.970   1.00 0.00 ? 103 GLU A OE1  1  
ATOM 1568  O OE2  . GLU A 1 103 ? 4.793   -5.119  8.928   1.00 0.00 ? 103 GLU A OE2  1  
ATOM 1569  H H    . GLU A 1 103 ? 2.113   0.163   7.406   1.00 0.00 ? 103 GLU A H    1  
ATOM 1570  H HA   . GLU A 1 103 ? 2.118   -2.275  5.799   1.00 0.00 ? 103 GLU A HA   1  
ATOM 1571  H HB2  . GLU A 1 103 ? 3.841   -1.703  7.639   1.00 0.00 ? 103 GLU A HB2  1  
ATOM 1572  H HB3  . GLU A 1 103 ? 2.569   -2.147  8.769   1.00 0.00 ? 103 GLU A HB3  1  
ATOM 1573  H HG2  . GLU A 1 103 ? 2.477   -4.314  7.267   1.00 0.00 ? 103 GLU A HG2  1  
ATOM 1574  H HG3  . GLU A 1 103 ? 4.138   -3.845  6.911   1.00 0.00 ? 103 GLU A HG3  1  
ATOM 1575  N N    . GLY A 1 104 ? 0.030   -3.383  6.580   1.00 0.00 ? 104 GLY A N    1  
ATOM 1576  C CA   . GLY A 1 104 ? -1.275  -3.916  6.923   1.00 0.00 ? 104 GLY A CA   1  
ATOM 1577  C C    . GLY A 1 104 ? -1.426  -5.374  6.536   1.00 0.00 ? 104 GLY A C    1  
ATOM 1578  O O    . GLY A 1 104 ? -1.613  -5.697  5.362   1.00 0.00 ? 104 GLY A O    1  
ATOM 1579  H H    . GLY A 1 104 ? 0.565   -3.813  5.880   1.00 0.00 ? 104 GLY A H    1  
ATOM 1580  H HA2  . GLY A 1 104 ? -1.423  -3.820  7.988   1.00 0.00 ? 104 GLY A HA2  1  
ATOM 1581  H HA3  . GLY A 1 104 ? -2.032  -3.340  6.411   1.00 0.00 ? 104 GLY A HA3  1  
ATOM 1582  N N    . VAL A 1 105 ? -1.342  -6.259  7.524   1.00 0.00 ? 105 VAL A N    1  
ATOM 1583  C CA   . VAL A 1 105 ? -1.470  -7.691  7.281   1.00 0.00 ? 105 VAL A CA   1  
ATOM 1584  C C    . VAL A 1 105 ? -2.899  -8.164  7.520   1.00 0.00 ? 105 VAL A C    1  
ATOM 1585  O O    . VAL A 1 105 ? -3.581  -7.679  8.424   1.00 0.00 ? 105 VAL A O    1  
ATOM 1586  C CB   . VAL A 1 105 ? -0.516  -8.500  8.180   1.00 0.00 ? 105 VAL A CB   1  
ATOM 1587  C CG1  . VAL A 1 105 ? -0.716  -8.129  9.642   1.00 0.00 ? 105 VAL A CG1  1  
ATOM 1588  C CG2  . VAL A 1 105 ? -0.722  -9.992  7.968   1.00 0.00 ? 105 VAL A CG2  1  
ATOM 1589  H H    . VAL A 1 105 ? -1.192  -5.941  8.439   1.00 0.00 ? 105 VAL A H    1  
ATOM 1590  H HA   . VAL A 1 105 ? -1.206  -7.880  6.251   1.00 0.00 ? 105 VAL A HA   1  
ATOM 1591  H HB   . VAL A 1 105 ? 0.499   -8.255  7.906   1.00 0.00 ? 105 VAL A HB   1  
ATOM 1592  H HG11 . VAL A 1 105 ? -1.756  -8.257  9.906   1.00 0.00 ? 105 VAL A HG11 1  
ATOM 1593  H HG12 . VAL A 1 105 ? -0.104  -8.766  10.263  1.00 0.00 ? 105 VAL A HG12 1  
ATOM 1594  H HG13 . VAL A 1 105 ? -0.432  -7.098  9.793   1.00 0.00 ? 105 VAL A HG13 1  
ATOM 1595  H HG21 . VAL A 1 105 ? -0.168  -10.542 8.714   1.00 0.00 ? 105 VAL A HG21 1  
ATOM 1596  H HG22 . VAL A 1 105 ? -1.773  -10.226 8.054   1.00 0.00 ? 105 VAL A HG22 1  
ATOM 1597  H HG23 . VAL A 1 105 ? -0.372  -10.268 6.984   1.00 0.00 ? 105 VAL A HG23 1  
ATOM 1598  N N    . ILE A 1 106 ? -3.347  -9.113  6.706   1.00 0.00 ? 106 ILE A N    1  
ATOM 1599  C CA   . ILE A 1 106 ? -4.695  -9.653  6.830   1.00 0.00 ? 106 ILE A CA   1  
ATOM 1600  C C    . ILE A 1 106 ? -4.667  -11.167 7.011   1.00 0.00 ? 106 ILE A C    1  
ATOM 1601  O O    . ILE A 1 106 ? -3.799  -11.853 6.469   1.00 0.00 ? 106 ILE A O    1  
ATOM 1602  C CB   . ILE A 1 106 ? -5.554  -9.311  5.599   1.00 0.00 ? 106 ILE A CB   1  
ATOM 1603  C CG1  . ILE A 1 106 ? -7.008  -9.727  5.832   1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1604  C CG2  . ILE A 1 106 ? -4.996  -9.990  4.357   1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1605  C CD1  . ILE A 1 106 ? -7.787  -8.749  6.684   1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1606  H H    . ILE A 1 106 ? -2.756  -9.460  6.005   1.00 0.00 ? 106 ILE A H    1  
ATOM 1607  H HA   . ILE A 1 106 ? -5.154  -9.206  7.700   1.00 0.00 ? 106 ILE A HA   1  
ATOM 1608  H HB   . ILE A 1 106 ? -5.513  -8.243  5.444   1.00 0.00 ? 106 ILE A HB   1  
ATOM 1609  H HG12 . ILE A 1 106 ? -7.509  -9.810  4.881   1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1610  H HG13 . ILE A 1 106 ? -7.024  -10.687 6.328   1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1611  H HG21 . ILE A 1 106 ? -5.413  -9.528  3.475   1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1612  H HG22 . ILE A 1 106 ? -3.921  -9.886  4.343   1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1613  H HG23 . ILE A 1 106 ? -5.256  -11.038 4.372   1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1614  H HD11 . ILE A 1 106 ? -8.647  -8.397  6.132   1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1615  H HD12 . ILE A 1 106 ? -8.117  -9.241  7.587   1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1616  H HD13 . ILE A 1 106 ? -7.157  -7.911  6.939   1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1617  N N    . THR A 1 107 ? -5.624  -11.684 7.776   1.00 0.00 ? 107 THR A N    1  
ATOM 1618  C CA   . THR A 1 107 ? -5.709  -13.117 8.028   1.00 0.00 ? 107 THR A CA   1  
ATOM 1619  C C    . THR A 1 107 ? -6.956  -13.715 7.385   1.00 0.00 ? 107 THR A C    1  
ATOM 1620  O O    . THR A 1 107 ? -8.066  -13.548 7.890   1.00 0.00 ? 107 THR A O    1  
ATOM 1621  C CB   . THR A 1 107 ? -5.728  -13.421 9.538   1.00 0.00 ? 107 THR A CB   1  
ATOM 1622  O OG1  . THR A 1 107 ? -4.485  -13.030 10.132  1.00 0.00 ? 107 THR A OG1  1  
ATOM 1623  C CG2  . THR A 1 107 ? -5.972  -14.902 9.788   1.00 0.00 ? 107 THR A CG2  1  
ATOM 1624  H H    . THR A 1 107 ? -6.286  -11.086 8.180   1.00 0.00 ? 107 THR A H    1  
ATOM 1625  H HA   . THR A 1 107 ? -4.835  -13.584 7.599   1.00 0.00 ? 107 THR A HA   1  
ATOM 1626  H HB   . THR A 1 107 ? -6.530  -12.857 9.993   1.00 0.00 ? 107 THR A HB   1  
ATOM 1627  H HG1  . THR A 1 107 ? -4.098  -12.315 9.622   1.00 0.00 ? 107 THR A HG1  1  
ATOM 1628  H HG21 . THR A 1 107 ? -5.603  -15.166 10.768  1.00 0.00 ? 107 THR A HG21 1  
ATOM 1629  H HG22 . THR A 1 107 ? -5.454  -15.484 9.040   1.00 0.00 ? 107 THR A HG22 1  
ATOM 1630  H HG23 . THR A 1 107 ? -7.031  -15.106 9.735   1.00 0.00 ? 107 THR A HG23 1  
ATOM 1631  N N    . ILE A 1 108 ? -6.764  -14.412 6.271   1.00 0.00 ? 108 ILE A N    1  
ATOM 1632  C CA   . ILE A 1 108 ? -7.873  -15.036 5.560   1.00 0.00 ? 108 ILE A CA   1  
ATOM 1633  C C    . ILE A 1 108 ? -8.683  -15.937 6.487   1.00 0.00 ? 108 ILE A C    1  
ATOM 1634  O O    . ILE A 1 108 ? -8.190  -16.962 6.957   1.00 0.00 ? 108 ILE A O    1  
ATOM 1635  C CB   . ILE A 1 108 ? -7.379  -15.865 4.361   1.00 0.00 ? 108 ILE A CB   1  
ATOM 1636  C CG1  . ILE A 1 108 ? -6.524  -15.000 3.432   1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1637  C CG2  . ILE A 1 108 ? -8.558  -16.458 3.604   1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1638  C CD1  . ILE A 1 108 ? -7.323  -13.982 2.650   1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1639  H H    . ILE A 1 108 ? -5.855  -14.510 5.918   1.00 0.00 ? 108 ILE A H    1  
ATOM 1640  H HA   . ILE A 1 108 ? -8.515  -14.250 5.189   1.00 0.00 ? 108 ILE A HA   1  
ATOM 1641  H HB   . ILE A 1 108 ? -6.778  -16.679 4.737   1.00 0.00 ? 108 ILE A HB   1  
ATOM 1642  H HG12 . ILE A 1 108 ? -5.793  -14.467 4.019   1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1643  H HG13 . ILE A 1 108 ? -6.015  -15.639 2.725   1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1644  H HG21 . ILE A 1 108 ? -9.421  -15.821 3.726   1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1645  H HG22 . ILE A 1 108 ? -8.312  -16.533 2.555   1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1646  H HG23 . ILE A 1 108 ? -8.778  -17.441 3.993   1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1647  H HD11 . ILE A 1 108 ? -7.914  -13.388 3.331   1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1648  H HD12 . ILE A 1 108 ? -6.650  -13.338 2.103   1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1649  H HD13 . ILE A 1 108 ? -7.977  -14.491 1.957   1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1650  N N    . GLU A 1 109 ? -9.927  -15.547 6.745   1.00 0.00 ? 109 GLU A N    1  
ATOM 1651  C CA   . GLU A 1 109 ? -10.805 -16.320 7.615   1.00 0.00 ? 109 GLU A CA   1  
ATOM 1652  C C    . GLU A 1 109 ? -12.067 -16.749 6.873   1.00 0.00 ? 109 GLU A C    1  
ATOM 1653  O O    . GLU A 1 109 ? -12.938 -15.930 6.582   1.00 0.00 ? 109 GLU A O    1  
ATOM 1654  C CB   . GLU A 1 109 ? -11.181 -15.503 8.853   1.00 0.00 ? 109 GLU A CB   1  
ATOM 1655  C CG   . GLU A 1 109 ? -10.068 -15.410 9.883   1.00 0.00 ? 109 GLU A CG   1  
ATOM 1656  C CD   . GLU A 1 109 ? -10.565 -14.949 11.239  1.00 0.00 ? 109 GLU A CD   1  
ATOM 1657  O OE1  . GLU A 1 109 ? -11.296 -13.938 11.290  1.00 0.00 ? 109 GLU A OE1  1  
ATOM 1658  O OE2  . GLU A 1 109 ? -10.223 -15.599 12.249  1.00 0.00 ? 109 GLU A OE2  1  
ATOM 1659  H H    . GLU A 1 109 ? -10.262 -14.719 6.341   1.00 0.00 ? 109 GLU A H    1  
ATOM 1660  H HA   . GLU A 1 109 ? -10.268 -17.203 7.928   1.00 0.00 ? 109 GLU A HA   1  
ATOM 1661  H HB2  . GLU A 1 109 ? -11.442 -14.502 8.543   1.00 0.00 ? 109 GLU A HB2  1  
ATOM 1662  H HB3  . GLU A 1 109 ? -12.040 -15.960 9.323   1.00 0.00 ? 109 GLU A HB3  1  
ATOM 1663  H HG2  . GLU A 1 109 ? -9.616  -16.384 9.995   1.00 0.00 ? 109 GLU A HG2  1  
ATOM 1664  H HG3  . GLU A 1 109 ? -9.326  -14.709 9.530   1.00 0.00 ? 109 GLU A HG3  1  
ATOM 1665  N N    . SER A 1 110 ? -12.157 -18.040 6.568   1.00 0.00 ? 110 SER A N    1  
ATOM 1666  C CA   . SER A 1 110 ? -13.309 -18.579 5.856   1.00 0.00 ? 110 SER A CA   1  
ATOM 1667  C C    . SER A 1 110 ? -14.244 -19.315 6.812   1.00 0.00 ? 110 SER A C    1  
ATOM 1668  O O    . SER A 1 110 ? -13.851 -19.684 7.918   1.00 0.00 ? 110 SER A O    1  
ATOM 1669  C CB   . SER A 1 110 ? -12.852 -19.524 4.743   1.00 0.00 ? 110 SER A CB   1  
ATOM 1670  O OG   . SER A 1 110 ? -13.897 -19.766 3.818   1.00 0.00 ? 110 SER A OG   1  
ATOM 1671  H H    . SER A 1 110 ? -11.429 -18.644 6.828   1.00 0.00 ? 110 SER A H    1  
ATOM 1672  H HA   . SER A 1 110 ? -13.844 -17.750 5.415   1.00 0.00 ? 110 SER A HA   1  
ATOM 1673  H HB2  . SER A 1 110 ? -12.018 -19.082 4.219   1.00 0.00 ? 110 SER A HB2  1  
ATOM 1674  H HB3  . SER A 1 110 ? -12.546 -20.465 5.177   1.00 0.00 ? 110 SER A HB3  1  
ATOM 1675  H HG   . SER A 1 110 ? -13.772 -20.627 3.411   1.00 0.00 ? 110 SER A HG   1  
ATOM 1676  N N    . GLN A 1 111 ? -15.481 -19.524 6.375   1.00 0.00 ? 111 GLN A N    1  
ATOM 1677  C CA   . GLN A 1 111 ? -16.472 -20.215 7.191   1.00 0.00 ? 111 GLN A CA   1  
ATOM 1678  C C    . GLN A 1 111 ? -16.803 -19.410 8.443   1.00 0.00 ? 111 GLN A C    1  
ATOM 1679  O O    . GLN A 1 111 ? -16.851 -19.951 9.548   1.00 0.00 ? 111 GLN A O    1  
ATOM 1680  C CB   . GLN A 1 111 ? -15.963 -21.603 7.583   1.00 0.00 ? 111 GLN A CB   1  
ATOM 1681  C CG   . GLN A 1 111 ? -17.058 -22.539 8.068   1.00 0.00 ? 111 GLN A CG   1  
ATOM 1682  C CD   . GLN A 1 111 ? -16.514 -23.854 8.591   1.00 0.00 ? 111 GLN A CD   1  
ATOM 1683  O OE1  . GLN A 1 111 ? -16.288 -24.793 7.827   1.00 0.00 ? 111 GLN A OE1  1  
ATOM 1684  N NE2  . GLN A 1 111 ? -16.300 -23.928 9.899   1.00 0.00 ? 111 GLN A NE2  1  
ATOM 1685  H H    . GLN A 1 111 ? -15.734 -19.207 5.484   1.00 0.00 ? 111 GLN A H    1  
ATOM 1686  H HA   . GLN A 1 111 ? -17.369 -20.325 6.601   1.00 0.00 ? 111 GLN A HA   1  
ATOM 1687  H HB2  . GLN A 1 111 ? -15.486 -22.054 6.726   1.00 0.00 ? 111 GLN A HB2  1  
ATOM 1688  H HB3  . GLN A 1 111 ? -15.235 -21.496 8.374   1.00 0.00 ? 111 GLN A HB3  1  
ATOM 1689  H HG2  . GLN A 1 111 ? -17.605 -22.053 8.862   1.00 0.00 ? 111 GLN A HG2  1  
ATOM 1690  H HG3  . GLN A 1 111 ? -17.728 -22.745 7.246   1.00 0.00 ? 111 GLN A HG3  1  
ATOM 1691  H HE21 . GLN A 1 111 ? -16.504 -23.140 10.446  1.00 0.00 ? 111 GLN A HE21 1  
ATOM 1692  H HE22 . GLN A 1 111 ? -15.949 -24.766 10.264  1.00 0.00 ? 111 GLN A HE22 1  
ATOM 1693  N N    . VAL A 1 112 ? -17.031 -18.113 8.264   1.00 0.00 ? 112 VAL A N    1  
ATOM 1694  C CA   . VAL A 1 112 ? -17.359 -17.232 9.379   1.00 0.00 ? 112 VAL A CA   1  
ATOM 1695  C C    . VAL A 1 112 ? -18.537 -16.328 9.037   1.00 0.00 ? 112 VAL A C    1  
ATOM 1696  O O    . VAL A 1 112 ? -18.447 -15.484 8.146   1.00 0.00 ? 112 VAL A O    1  
ATOM 1697  C CB   . VAL A 1 112 ? -16.154 -16.359 9.777   1.00 0.00 ? 112 VAL A CB   1  
ATOM 1698  C CG1  . VAL A 1 112 ? -16.525 -15.426 10.919  1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1699  C CG2  . VAL A 1 112 ? -14.966 -17.231 10.154  1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1700  H H    . VAL A 1 112 ? -16.979 -17.739 7.359   1.00 0.00 ? 112 VAL A H    1  
ATOM 1701  H HA   . VAL A 1 112 ? -17.624 -17.849 10.225  1.00 0.00 ? 112 VAL A HA   1  
ATOM 1702  H HB   . VAL A 1 112 ? -15.875 -15.756 8.925   1.00 0.00 ? 112 VAL A HB   1  
ATOM 1703  H HG11 . VAL A 1 112 ? -17.455 -15.751 11.362  1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1704  H HG12 . VAL A 1 112 ? -15.744 -15.442 11.665  1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1705  H HG13 . VAL A 1 112 ? -16.640 -14.421 10.540  1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1706  H HG21 . VAL A 1 112 ? -14.317 -17.346 9.298   1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1707  H HG22 . VAL A 1 112 ? -14.420 -16.765 10.960  1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1708  H HG23 . VAL A 1 112 ? -15.318 -18.202 10.472  1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1709  N N    . SER A 1 113 ? -19.643 -16.510 9.752   1.00 0.00 ? 113 SER A N    1  
ATOM 1710  C CA   . SER A 1 113 ? -20.842 -15.712 9.523   1.00 0.00 ? 113 SER A CA   1  
ATOM 1711  C C    . SER A 1 113 ? -21.071 -14.734 10.671  1.00 0.00 ? 113 SER A C    1  
ATOM 1712  O O    . SER A 1 113 ? -22.197 -14.556 11.134  1.00 0.00 ? 113 SER A O    1  
ATOM 1713  C CB   . SER A 1 113 ? -22.061 -16.621 9.360   1.00 0.00 ? 113 SER A CB   1  
ATOM 1714  O OG   . SER A 1 113 ? -22.174 -17.522 10.448  1.00 0.00 ? 113 SER A OG   1  
ATOM 1715  H H    . SER A 1 113 ? -19.653 -17.199 10.449  1.00 0.00 ? 113 SER A H    1  
ATOM 1716  H HA   . SER A 1 113 ? -20.697 -15.151 8.612   1.00 0.00 ? 113 SER A HA   1  
ATOM 1717  H HB2  . SER A 1 113 ? -22.954 -16.017 9.315   1.00 0.00 ? 113 SER A HB2  1  
ATOM 1718  H HB3  . SER A 1 113 ? -21.964 -17.189 8.446   1.00 0.00 ? 113 SER A HB3  1  
ATOM 1719  H HG   . SER A 1 113 ? -22.123 -18.425 10.123  1.00 0.00 ? 113 SER A HG   1  
ATOM 1720  N N    . GLY A 1 114 ? -19.994 -14.102 11.127  1.00 0.00 ? 114 GLY A N    1  
ATOM 1721  C CA   . GLY A 1 114 ? -20.098 -13.150 12.217  1.00 0.00 ? 114 GLY A CA   1  
ATOM 1722  C C    . GLY A 1 114 ? -20.761 -13.744 13.444  1.00 0.00 ? 114 GLY A C    1  
ATOM 1723  O O    . GLY A 1 114 ? -20.789 -14.960 13.633  1.00 0.00 ? 114 GLY A O    1  
ATOM 1724  H H    . GLY A 1 114 ? -19.121 -14.284 10.719  1.00 0.00 ? 114 GLY A H    1  
ATOM 1725  H HA2  . GLY A 1 114 ? -19.107 -12.814 12.483  1.00 0.00 ? 114 GLY A HA2  1  
ATOM 1726  H HA3  . GLY A 1 114 ? -20.678 -12.301 11.884  1.00 0.00 ? 114 GLY A HA3  1  
ATOM 1727  N N    . PRO A 1 115 ? -21.308 -12.874 14.306  1.00 0.00 ? 115 PRO A N    1  
ATOM 1728  C CA   . PRO A 1 115 ? -21.982 -13.296 15.537  1.00 0.00 ? 115 PRO A CA   1  
ATOM 1729  C C    . PRO A 1 115 ? -23.304 -14.004 15.260  1.00 0.00 ? 115 PRO A C    1  
ATOM 1730  O O    . PRO A 1 115 ? -23.694 -14.183 14.106  1.00 0.00 ? 115 PRO A O    1  
ATOM 1731  C CB   . PRO A 1 115 ? -22.225 -11.980 16.278  1.00 0.00 ? 115 PRO A CB   1  
ATOM 1732  C CG   . PRO A 1 115 ? -22.266 -10.944 15.208  1.00 0.00 ? 115 PRO A CG   1  
ATOM 1733  C CD   . PRO A 1 115 ? -21.311 -11.410 14.144  1.00 0.00 ? 115 PRO A CD   1  
ATOM 1734  H HA   . PRO A 1 115 ? -21.351 -13.937 16.135  1.00 0.00 ? 115 PRO A HA   1  
ATOM 1735  H HB2  . PRO A 1 115 ? -23.163 -12.033 16.814  1.00 0.00 ? 115 PRO A HB2  1  
ATOM 1736  H HB3  . PRO A 1 115 ? -21.418 -11.798 16.972  1.00 0.00 ? 115 PRO A HB3  1  
ATOM 1737  H HG2  . PRO A 1 115 ? -23.266 -10.869 14.807  1.00 0.00 ? 115 PRO A HG2  1  
ATOM 1738  H HG3  . PRO A 1 115 ? -21.948 -9.992  15.606  1.00 0.00 ? 115 PRO A HG3  1  
ATOM 1739  H HD2  . PRO A 1 115 ? -21.671 -11.131 13.165  1.00 0.00 ? 115 PRO A HD2  1  
ATOM 1740  H HD3  . PRO A 1 115 ? -20.326 -11.002 14.317  1.00 0.00 ? 115 PRO A HD3  1  
ATOM 1741  N N    . SER A 1 116 ? -23.990 -14.404 16.326  1.00 0.00 ? 116 SER A N    1  
ATOM 1742  C CA   . SER A 1 116 ? -25.268 -15.095 16.197  1.00 0.00 ? 116 SER A CA   1  
ATOM 1743  C C    . SER A 1 116 ? -26.247 -14.633 17.272  1.00 0.00 ? 116 SER A C    1  
ATOM 1744  O O    . SER A 1 116 ? -26.093 -14.960 18.449  1.00 0.00 ? 116 SER A O    1  
ATOM 1745  C CB   . SER A 1 116 ? -25.065 -16.609 16.293  1.00 0.00 ? 116 SER A CB   1  
ATOM 1746  O OG   . SER A 1 116 ? -26.304 -17.294 16.242  1.00 0.00 ? 116 SER A OG   1  
ATOM 1747  H H    . SER A 1 116 ? -23.627 -14.232 17.220  1.00 0.00 ? 116 SER A H    1  
ATOM 1748  H HA   . SER A 1 116 ? -25.678 -14.856 15.227  1.00 0.00 ? 116 SER A HA   1  
ATOM 1749  H HB2  . SER A 1 116 ? -24.450 -16.940 15.469  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1750  H HB3  . SER A 1 116 ? -24.574 -16.845 17.226  1.00 0.00 ? 116 SER A HB3  1  
ATOM 1751  H HG   . SER A 1 116 ? -26.305 -17.901 15.498  1.00 0.00 ? 116 SER A HG   1  
ATOM 1752  N N    . SER A 1 117 ? -27.253 -13.870 16.858  1.00 0.00 ? 117 SER A N    1  
ATOM 1753  C CA   . SER A 1 117 ? -28.256 -13.359 17.786  1.00 0.00 ? 117 SER A CA   1  
ATOM 1754  C C    . SER A 1 117 ? -29.086 -14.497 18.370  1.00 0.00 ? 117 SER A C    1  
ATOM 1755  O O    . SER A 1 117 ? -29.497 -15.411 17.656  1.00 0.00 ? 117 SER A O    1  
ATOM 1756  C CB   . SER A 1 117 ? -29.171 -12.356 17.079  1.00 0.00 ? 117 SER A CB   1  
ATOM 1757  O OG   . SER A 1 117 ? -30.110 -11.799 17.982  1.00 0.00 ? 117 SER A OG   1  
ATOM 1758  H H    . SER A 1 117 ? -27.322 -13.644 15.907  1.00 0.00 ? 117 SER A H    1  
ATOM 1759  H HA   . SER A 1 117 ? -27.739 -12.857 18.589  1.00 0.00 ? 117 SER A HA   1  
ATOM 1760  H HB2  . SER A 1 117 ? -28.573 -11.560 16.662  1.00 0.00 ? 117 SER A HB2  1  
ATOM 1761  H HB3  . SER A 1 117 ? -29.705 -12.858 16.285  1.00 0.00 ? 117 SER A HB3  1  
ATOM 1762  H HG   . SER A 1 117 ? -29.737 -11.787 18.866  1.00 0.00 ? 117 SER A HG   1  
ATOM 1763  N N    . GLY A 1 118 ? -29.329 -14.434 19.676  1.00 0.00 ? 118 GLY A N    1  
ATOM 1764  C CA   . GLY A 1 118 ? -30.109 -15.465 20.336  1.00 0.00 ? 118 GLY A CA   1  
ATOM 1765  C C    . GLY A 1 118 ? -30.538 -15.063 21.733  1.00 0.00 ? 118 GLY A C    1  
ATOM 1766  O O    . GLY A 1 118 ? -31.581 -15.500 22.219  1.00 0.00 ? 118 GLY A O    1  
ATOM 1767  H H    . GLY A 1 118 ? -28.977 -13.682 20.195  1.00 0.00 ? 118 GLY A H    1  
ATOM 1768  H HA2  . GLY A 1 118 ? -30.989 -15.669 19.745  1.00 0.00 ? 118 GLY A HA2  1  
ATOM 1769  H HA3  . GLY A 1 118 ? -29.514 -16.365 20.400  1.00 0.00 ? 118 GLY A HA3  1  
ATOM 1770  N N    . GLY A 1 1   ? 30.773  29.968  8.533   1.00 0.00 ? 1   GLY A N    2  
ATOM 1771  C CA   . GLY A 1 1   ? 30.336  29.841  9.911   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1772  C C    . GLY A 1 1   ? 29.150  28.908  10.058  1.00 0.00 ? 1   GLY A C    2  
ATOM 1773  O O    . GLY A 1 1   ? 28.269  28.873  9.200   1.00 0.00 ? 1   GLY A O    2  
ATOM 1774  H H1   . GLY A 1 1   ? 30.541  30.770  8.020   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1775  H HA2  . GLY A 1 1   ? 31.155  29.462  10.504  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1776  H HA3  . GLY A 1 1   ? 30.059  30.817  10.280  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1777  N N    . SER A 1 2   ? 29.128  28.149  11.149  1.00 0.00 ? 2   SER A N    2  
ATOM 1778  C CA   . SER A 1 2   ? 28.045  27.206  11.403  1.00 0.00 ? 2   SER A CA   2  
ATOM 1779  C C    . SER A 1 2   ? 26.687  27.882  11.235  1.00 0.00 ? 2   SER A C    2  
ATOM 1780  O O    . SER A 1 2   ? 25.792  27.347  10.580  1.00 0.00 ? 2   SER A O    2  
ATOM 1781  C CB   . SER A 1 2   ? 28.167  26.625  12.813  1.00 0.00 ? 2   SER A CB   2  
ATOM 1782  O OG   . SER A 1 2   ? 29.055  25.522  12.835  1.00 0.00 ? 2   SER A OG   2  
ATOM 1783  H H    . SER A 1 2   ? 29.860  28.222  11.797  1.00 0.00 ? 2   SER A H    2  
ATOM 1784  H HA   . SER A 1 2   ? 28.127  26.405  10.684  1.00 0.00 ? 2   SER A HA   2  
ATOM 1785  H HB2  . SER A 1 2   ? 28.539  27.385  13.482  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1786  H HB3  . SER A 1 2   ? 27.194  26.296  13.149  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1787  H HG   . SER A 1 2   ? 29.959  25.837  12.768  1.00 0.00 ? 2   SER A HG   2  
ATOM 1788  N N    . SER A 1 3   ? 26.542  29.061  11.831  1.00 0.00 ? 3   SER A N    2  
ATOM 1789  C CA   . SER A 1 3   ? 25.293  29.809  11.751  1.00 0.00 ? 3   SER A CA   2  
ATOM 1790  C C    . SER A 1 3   ? 24.092  28.871  11.822  1.00 0.00 ? 3   SER A C    2  
ATOM 1791  O O    . SER A 1 3   ? 23.120  29.031  11.085  1.00 0.00 ? 3   SER A O    2  
ATOM 1792  C CB   . SER A 1 3   ? 25.243  30.623  10.456  1.00 0.00 ? 3   SER A CB   2  
ATOM 1793  O OG   . SER A 1 3   ? 25.108  29.777  9.327   1.00 0.00 ? 3   SER A OG   2  
ATOM 1794  H H    . SER A 1 3   ? 27.292  29.435  12.338  1.00 0.00 ? 3   SER A H    2  
ATOM 1795  H HA   . SER A 1 3   ? 25.257  30.485  12.592  1.00 0.00 ? 3   SER A HA   2  
ATOM 1796  H HB2  . SER A 1 3   ? 24.400  31.296  10.489  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1797  H HB3  . SER A 1 3   ? 26.156  31.193  10.357  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1798  H HG   . SER A 1 3   ? 24.482  30.164  8.710   1.00 0.00 ? 3   SER A HG   2  
ATOM 1799  N N    . GLY A 1 4   ? 24.168  27.889  12.716  1.00 0.00 ? 4   GLY A N    2  
ATOM 1800  C CA   . GLY A 1 4   ? 23.082  26.938  12.867  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1801  C C    . GLY A 1 4   ? 22.596  26.397  11.538  1.00 0.00 ? 4   GLY A C    2  
ATOM 1802  O O    . GLY A 1 4   ? 21.470  26.671  11.123  1.00 0.00 ? 4   GLY A O    2  
ATOM 1803  H H    . GLY A 1 4   ? 24.968  27.810  13.276  1.00 0.00 ? 4   GLY A H    2  
ATOM 1804  H HA2  . GLY A 1 4   ? 23.422  26.115  13.477  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1805  H HA3  . GLY A 1 4   ? 22.258  27.427  13.366  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1806  N N    . SER A 1 5   ? 23.447  25.627  10.867  1.00 0.00 ? 5   SER A N    2  
ATOM 1807  C CA   . SER A 1 5   ? 23.099  25.050  9.574   1.00 0.00 ? 5   SER A CA   2  
ATOM 1808  C C    . SER A 1 5   ? 22.942  23.536  9.679   1.00 0.00 ? 5   SER A C    2  
ATOM 1809  O O    . SER A 1 5   ? 21.993  22.961  9.147   1.00 0.00 ? 5   SER A O    2  
ATOM 1810  C CB   . SER A 1 5   ? 24.170  25.392  8.535   1.00 0.00 ? 5   SER A CB   2  
ATOM 1811  O OG   . SER A 1 5   ? 25.431  24.867  8.911   1.00 0.00 ? 5   SER A OG   2  
ATOM 1812  H H    . SER A 1 5   ? 24.330  25.445  11.251  1.00 0.00 ? 5   SER A H    2  
ATOM 1813  H HA   . SER A 1 5   ? 22.158  25.477  9.262   1.00 0.00 ? 5   SER A HA   2  
ATOM 1814  H HB2  . SER A 1 5   ? 23.888  24.973  7.581   1.00 0.00 ? 5   SER A HB2  2  
ATOM 1815  H HB3  . SER A 1 5   ? 24.251  26.466  8.447   1.00 0.00 ? 5   SER A HB3  2  
ATOM 1816  H HG   . SER A 1 5   ? 25.562  24.014  8.489   1.00 0.00 ? 5   SER A HG   2  
ATOM 1817  N N    . SER A 1 6   ? 23.881  22.896  10.370  1.00 0.00 ? 6   SER A N    2  
ATOM 1818  C CA   . SER A 1 6   ? 23.850  21.449  10.542  1.00 0.00 ? 6   SER A CA   2  
ATOM 1819  C C    . SER A 1 6   ? 23.028  21.066  11.769  1.00 0.00 ? 6   SER A C    2  
ATOM 1820  O O    . SER A 1 6   ? 23.460  21.259  12.905  1.00 0.00 ? 6   SER A O    2  
ATOM 1821  C CB   . SER A 1 6   ? 25.271  20.899  10.675  1.00 0.00 ? 6   SER A CB   2  
ATOM 1822  O OG   . SER A 1 6   ? 25.280  19.484  10.600  1.00 0.00 ? 6   SER A OG   2  
ATOM 1823  H H    . SER A 1 6   ? 24.613  23.411  10.770  1.00 0.00 ? 6   SER A H    2  
ATOM 1824  H HA   . SER A 1 6   ? 23.387  21.020  9.666   1.00 0.00 ? 6   SER A HA   2  
ATOM 1825  H HB2  . SER A 1 6   ? 25.882  21.293  9.877   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1826  H HB3  . SER A 1 6   ? 25.684  21.200  11.627  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1827  H HG   . SER A 1 6   ? 25.147  19.116  11.476  1.00 0.00 ? 6   SER A HG   2  
ATOM 1828  N N    . GLY A 1 7   ? 21.839  20.520  11.531  1.00 0.00 ? 7   GLY A N    2  
ATOM 1829  C CA   . GLY A 1 7   ? 20.975  20.118  12.625  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1830  C C    . GLY A 1 7   ? 19.701  19.453  12.144  1.00 0.00 ? 7   GLY A C    2  
ATOM 1831  O O    . GLY A 1 7   ? 19.682  18.251  11.879  1.00 0.00 ? 7   GLY A O    2  
ATOM 1832  H H    . GLY A 1 7   ? 21.546  20.390  10.605  1.00 0.00 ? 7   GLY A H    2  
ATOM 1833  H HA2  . GLY A 1 7   ? 21.511  19.428  13.259  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1834  H HA3  . GLY A 1 7   ? 20.714  20.993  13.203  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1835  N N    . SER A 1 8   ? 18.632  20.236  12.031  1.00 0.00 ? 8   SER A N    2  
ATOM 1836  C CA   . SER A 1 8   ? 17.346  19.714  11.583  1.00 0.00 ? 8   SER A CA   2  
ATOM 1837  C C    . SER A 1 8   ? 16.955  20.317  10.237  1.00 0.00 ? 8   SER A C    2  
ATOM 1838  O O    . SER A 1 8   ? 16.239  21.317  10.176  1.00 0.00 ? 8   SER A O    2  
ATOM 1839  C CB   . SER A 1 8   ? 16.262  20.010  12.621  1.00 0.00 ? 8   SER A CB   2  
ATOM 1840  O OG   . SER A 1 8   ? 15.033  19.404  12.262  1.00 0.00 ? 8   SER A OG   2  
ATOM 1841  H H    . SER A 1 8   ? 18.711  21.187  12.257  1.00 0.00 ? 8   SER A H    2  
ATOM 1842  H HA   . SER A 1 8   ? 17.443  18.645  11.471  1.00 0.00 ? 8   SER A HA   2  
ATOM 1843  H HB2  . SER A 1 8   ? 16.572  19.625  13.581  1.00 0.00 ? 8   SER A HB2  2  
ATOM 1844  H HB3  . SER A 1 8   ? 16.117  21.078  12.692  1.00 0.00 ? 8   SER A HB3  2  
ATOM 1845  H HG   . SER A 1 8   ? 15.065  18.467  12.468  1.00 0.00 ? 8   SER A HG   2  
ATOM 1846  N N    . HIS A 1 9   ? 17.430  19.701  9.159   1.00 0.00 ? 9   HIS A N    2  
ATOM 1847  C CA   . HIS A 1 9   ? 17.130  20.175  7.813   1.00 0.00 ? 9   HIS A CA   2  
ATOM 1848  C C    . HIS A 1 9   ? 17.228  19.037  6.802   1.00 0.00 ? 9   HIS A C    2  
ATOM 1849  O O    . HIS A 1 9   ? 18.022  18.111  6.969   1.00 0.00 ? 9   HIS A O    2  
ATOM 1850  C CB   . HIS A 1 9   ? 18.085  21.303  7.422   1.00 0.00 ? 9   HIS A CB   2  
ATOM 1851  C CG   . HIS A 1 9   ? 17.557  22.184  6.332   1.00 0.00 ? 9   HIS A CG   2  
ATOM 1852  N ND1  . HIS A 1 9   ? 16.278  22.073  5.827   1.00 0.00 ? 9   HIS A ND1  2  
ATOM 1853  C CD2  . HIS A 1 9   ? 18.142  23.197  5.651   1.00 0.00 ? 9   HIS A CD2  2  
ATOM 1854  C CE1  . HIS A 1 9   ? 16.100  22.978  4.882   1.00 0.00 ? 9   HIS A CE1  2  
ATOM 1855  N NE2  . HIS A 1 9   ? 17.216  23.674  4.755   1.00 0.00 ? 9   HIS A NE2  2  
ATOM 1856  H H    . HIS A 1 9   ? 17.995  18.908  9.272   1.00 0.00 ? 9   HIS A H    2  
ATOM 1857  H HA   . HIS A 1 9   ? 16.119  20.554  7.812   1.00 0.00 ? 9   HIS A HA   2  
ATOM 1858  H HB2  . HIS A 1 9   ? 18.273  21.922  8.287   1.00 0.00 ? 9   HIS A HB2  2  
ATOM 1859  H HB3  . HIS A 1 9   ? 19.017  20.876  7.082   1.00 0.00 ? 9   HIS A HB3  2  
ATOM 1860  H HD2  . HIS A 1 9   ? 19.150  23.563  5.786   1.00 0.00 ? 9   HIS A HD2  2  
ATOM 1861  H HE1  . HIS A 1 9   ? 15.197  23.125  4.309   1.00 0.00 ? 9   HIS A HE1  2  
ATOM 1862  H HE2  . HIS A 1 9   ? 17.384  24.350  4.067   1.00 0.00 ? 9   HIS A HE2  2  
ATOM 1863  N N    . ASP A 1 10  ? 16.415  19.111  5.754   1.00 0.00 ? 10  ASP A N    2  
ATOM 1864  C CA   . ASP A 1 10  ? 16.410  18.088  4.715   1.00 0.00 ? 10  ASP A CA   2  
ATOM 1865  C C    . ASP A 1 10  ? 16.948  18.644  3.401   1.00 0.00 ? 10  ASP A C    2  
ATOM 1866  O O    . ASP A 1 10  ? 16.253  18.646  2.385   1.00 0.00 ? 10  ASP A O    2  
ATOM 1867  C CB   . ASP A 1 10  ? 14.995  17.544  4.512   1.00 0.00 ? 10  ASP A CB   2  
ATOM 1868  C CG   . ASP A 1 10  ? 13.984  18.644  4.254   1.00 0.00 ? 10  ASP A CG   2  
ATOM 1869  O OD1  . ASP A 1 10  ? 14.050  19.271  3.175   1.00 0.00 ? 10  ASP A OD1  2  
ATOM 1870  O OD2  . ASP A 1 10  ? 13.125  18.877  5.129   1.00 0.00 ? 10  ASP A OD2  2  
ATOM 1871  H H    . ASP A 1 10  ? 15.804  19.874  5.676   1.00 0.00 ? 10  ASP A H    2  
ATOM 1872  H HA   . ASP A 1 10  ? 17.051  17.282  5.040   1.00 0.00 ? 10  ASP A HA   2  
ATOM 1873  H HB2  . ASP A 1 10  ? 14.992  16.873  3.665   1.00 0.00 ? 10  ASP A HB2  2  
ATOM 1874  H HB3  . ASP A 1 10  ? 14.693  17.003  5.396   1.00 0.00 ? 10  ASP A HB3  2  
ATOM 1875  N N    . SER A 1 11  ? 18.190  19.116  3.429   1.00 0.00 ? 11  SER A N    2  
ATOM 1876  C CA   . SER A 1 11  ? 18.820  19.680  2.241   1.00 0.00 ? 11  SER A CA   2  
ATOM 1877  C C    . SER A 1 11  ? 19.145  18.587  1.227   1.00 0.00 ? 11  SER A C    2  
ATOM 1878  O O    . SER A 1 11  ? 18.509  18.490  0.178   1.00 0.00 ? 11  SER A O    2  
ATOM 1879  C CB   . SER A 1 11  ? 20.097  20.433  2.623   1.00 0.00 ? 11  SER A CB   2  
ATOM 1880  O OG   . SER A 1 11  ? 20.672  21.067  1.494   1.00 0.00 ? 11  SER A OG   2  
ATOM 1881  H H    . SER A 1 11  ? 18.694  19.087  4.269   1.00 0.00 ? 11  SER A H    2  
ATOM 1882  H HA   . SER A 1 11  ? 18.124  20.374  1.794   1.00 0.00 ? 11  SER A HA   2  
ATOM 1883  H HB2  . SER A 1 11  ? 19.861  21.184  3.362   1.00 0.00 ? 11  SER A HB2  2  
ATOM 1884  H HB3  . SER A 1 11  ? 20.813  19.736  3.034   1.00 0.00 ? 11  SER A HB3  2  
ATOM 1885  H HG   . SER A 1 11  ? 20.810  20.420  0.799   1.00 0.00 ? 11  SER A HG   2  
ATOM 1886  N N    . ARG A 1 12  ? 20.140  17.767  1.550   1.00 0.00 ? 12  ARG A N    2  
ATOM 1887  C CA   . ARG A 1 12  ? 20.551  16.681  0.668   1.00 0.00 ? 12  ARG A CA   2  
ATOM 1888  C C    . ARG A 1 12  ? 19.639  15.470  0.835   1.00 0.00 ? 12  ARG A C    2  
ATOM 1889  O O    . ARG A 1 12  ? 20.107  14.334  0.923   1.00 0.00 ? 12  ARG A O    2  
ATOM 1890  C CB   . ARG A 1 12  ? 22.001  16.284  0.954   1.00 0.00 ? 12  ARG A CB   2  
ATOM 1891  C CG   . ARG A 1 12  ? 22.620  15.416  -0.129  1.00 0.00 ? 12  ARG A CG   2  
ATOM 1892  C CD   . ARG A 1 12  ? 23.289  16.259  -1.204  1.00 0.00 ? 12  ARG A CD   2  
ATOM 1893  N NE   . ARG A 1 12  ? 23.408  15.539  -2.469  1.00 0.00 ? 12  ARG A NE   2  
ATOM 1894  C CZ   . ARG A 1 12  ? 22.427  15.453  -3.361  1.00 0.00 ? 12  ARG A CZ   2  
ATOM 1895  N NH1  . ARG A 1 12  ? 21.261  16.039  -3.127  1.00 0.00 ? 12  ARG A NH1  2  
ATOM 1896  N NH2  . ARG A 1 12  ? 22.611  14.779  -4.489  1.00 0.00 ? 12  ARG A NH2  2  
ATOM 1897  H H    . ARG A 1 12  ? 20.609  17.895  2.401   1.00 0.00 ? 12  ARG A H    2  
ATOM 1898  H HA   . ARG A 1 12  ? 20.478  17.034  -0.350  1.00 0.00 ? 12  ARG A HA   2  
ATOM 1899  H HB2  . ARG A 1 12  ? 22.595  17.181  1.049   1.00 0.00 ? 12  ARG A HB2  2  
ATOM 1900  H HB3  . ARG A 1 12  ? 22.035  15.739  1.885   1.00 0.00 ? 12  ARG A HB3  2  
ATOM 1901  H HG2  . ARG A 1 12  ? 23.360  14.771  0.319   1.00 0.00 ? 12  ARG A HG2  2  
ATOM 1902  H HG3  . ARG A 1 12  ? 21.845  14.817  -0.584  1.00 0.00 ? 12  ARG A HG3  2  
ATOM 1903  H HD2  . ARG A 1 12  ? 22.700  17.150  -1.362  1.00 0.00 ? 12  ARG A HD2  2  
ATOM 1904  H HD3  . ARG A 1 12  ? 24.275  16.535  -0.863  1.00 0.00 ? 12  ARG A HD3  2  
ATOM 1905  H HE   . ARG A 1 12  ? 24.261  15.098  -2.662  1.00 0.00 ? 12  ARG A HE   2  
ATOM 1906  H HH11 . ARG A 1 12  ? 21.119  16.548  -2.278  1.00 0.00 ? 12  ARG A HH11 2  
ATOM 1907  H HH12 . ARG A 1 12  ? 20.524  15.974  -3.801  1.00 0.00 ? 12  ARG A HH12 2  
ATOM 1908  H HH21 . ARG A 1 12  ? 23.489  14.336  -4.669  1.00 0.00 ? 12  ARG A HH21 2  
ATOM 1909  H HH22 . ARG A 1 12  ? 21.873  14.715  -5.159  1.00 0.00 ? 12  ARG A HH22 2  
ATOM 1910  N N    . LEU A 1 13  ? 18.335  15.719  0.880   1.00 0.00 ? 13  LEU A N    2  
ATOM 1911  C CA   . LEU A 1 13  ? 17.356  14.650  1.037   1.00 0.00 ? 13  LEU A CA   2  
ATOM 1912  C C    . LEU A 1 13  ? 16.070  14.973  0.283   1.00 0.00 ? 13  LEU A C    2  
ATOM 1913  O O    . LEU A 1 13  ? 15.925  16.056  -0.286  1.00 0.00 ? 13  LEU A O    2  
ATOM 1914  C CB   . LEU A 1 13  ? 17.049  14.426  2.519   1.00 0.00 ? 13  LEU A CB   2  
ATOM 1915  C CG   . LEU A 1 13  ? 18.228  13.996  3.391   1.00 0.00 ? 13  LEU A CG   2  
ATOM 1916  C CD1  . LEU A 1 13  ? 17.844  14.027  4.862   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 1917  C CD2  . LEU A 1 13  ? 18.707  12.607  2.993   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 1918  H H    . LEU A 1 13  ? 18.022  16.645  0.805   1.00 0.00 ? 13  LEU A H    2  
ATOM 1919  H HA   . LEU A 1 13  ? 17.782  13.747  0.626   1.00 0.00 ? 13  LEU A HA   2  
ATOM 1920  H HB2  . LEU A 1 13  ? 16.662  15.350  2.919   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 1921  H HB3  . LEU A 1 13  ? 16.289  13.660  2.586   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 1922  H HG   . LEU A 1 13  ? 19.047  14.687  3.245   1.00 0.00 ? 13  LEU A HG   2  
ATOM 1923  H HD11 . LEU A 1 13  ? 18.722  13.857  5.467   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 1924  H HD12 . LEU A 1 13  ? 17.115  13.255  5.060   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 1925  H HD13 . LEU A 1 13  ? 17.421  14.992  5.103   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 1926  H HD21 . LEU A 1 13  ? 19.477  12.282  3.677   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 1927  H HD22 . LEU A 1 13  ? 19.106  12.639  1.990   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 1928  H HD23 . LEU A 1 13  ? 17.877  11.916  3.028   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 1929  N N    . THR A 1 14  ? 15.135  14.027  0.283   1.00 0.00 ? 14  THR A N    2  
ATOM 1930  C CA   . THR A 1 14  ? 13.861  14.211  -0.400  1.00 0.00 ? 14  THR A CA   2  
ATOM 1931  C C    . THR A 1 14  ? 12.871  14.967  0.479   1.00 0.00 ? 14  THR A C    2  
ATOM 1932  O O    . THR A 1 14  ? 12.770  14.711  1.678   1.00 0.00 ? 14  THR A O    2  
ATOM 1933  C CB   . THR A 1 14  ? 13.242  12.860  -0.807  1.00 0.00 ? 14  THR A CB   2  
ATOM 1934  O OG1  . THR A 1 14  ? 13.197  11.982  0.323   1.00 0.00 ? 14  THR A OG1  2  
ATOM 1935  C CG2  . THR A 1 14  ? 14.042  12.214  -1.927  1.00 0.00 ? 14  THR A CG2  2  
ATOM 1936  H H    . THR A 1 14  ? 15.309  13.185  0.754   1.00 0.00 ? 14  THR A H    2  
ATOM 1937  H HA   . THR A 1 14  ? 14.043  14.785  -1.297  1.00 0.00 ? 14  THR A HA   2  
ATOM 1938  H HB   . THR A 1 14  ? 12.235  13.035  -1.158  1.00 0.00 ? 14  THR A HB   2  
ATOM 1939  H HG1  . THR A 1 14  ? 12.348  12.070  0.764   1.00 0.00 ? 14  THR A HG1  2  
ATOM 1940  H HG21 . THR A 1 14  ? 14.748  11.514  -1.507  1.00 0.00 ? 14  THR A HG21 2  
ATOM 1941  H HG22 . THR A 1 14  ? 14.575  12.977  -2.475  1.00 0.00 ? 14  THR A HG22 2  
ATOM 1942  H HG23 . THR A 1 14  ? 13.372  11.693  -2.594  1.00 0.00 ? 14  THR A HG23 2  
ATOM 1943  N N    . ALA A 1 15  ? 12.142  15.899  -0.127  1.00 0.00 ? 15  ALA A N    2  
ATOM 1944  C CA   . ALA A 1 15  ? 11.157  16.690  0.600   1.00 0.00 ? 15  ALA A CA   2  
ATOM 1945  C C    . ALA A 1 15  ? 9.785   16.600  -0.059  1.00 0.00 ? 15  ALA A C    2  
ATOM 1946  O O    . ALA A 1 15  ? 8.775   16.393  0.613   1.00 0.00 ? 15  ALA A O    2  
ATOM 1947  C CB   . ALA A 1 15  ? 11.607  18.141  0.689   1.00 0.00 ? 15  ALA A CB   2  
ATOM 1948  H H    . ALA A 1 15  ? 12.268  16.056  -1.085  1.00 0.00 ? 15  ALA A H    2  
ATOM 1949  H HA   . ALA A 1 15  ? 11.089  16.297  1.605   1.00 0.00 ? 15  ALA A HA   2  
ATOM 1950  H HB1  . ALA A 1 15  ? 12.514  18.271  0.118   1.00 0.00 ? 15  ALA A HB1  2  
ATOM 1951  H HB2  . ALA A 1 15  ? 10.835  18.782  0.290   1.00 0.00 ? 15  ALA A HB2  2  
ATOM 1952  H HB3  . ALA A 1 15  ? 11.791  18.397  1.722   1.00 0.00 ? 15  ALA A HB3  2  
ATOM 1953  N N    . GLY A 1 16  ? 9.756   16.757  -1.379  1.00 0.00 ? 16  GLY A N    2  
ATOM 1954  C CA   . GLY A 1 16  ? 8.502   16.691  -2.106  1.00 0.00 ? 16  GLY A CA   2  
ATOM 1955  C C    . GLY A 1 16  ? 8.026   15.266  -2.314  1.00 0.00 ? 16  GLY A C    2  
ATOM 1956  O O    . GLY A 1 16  ? 7.580   14.905  -3.403  1.00 0.00 ? 16  GLY A O    2  
ATOM 1957  H H    . GLY A 1 16  ? 10.593  16.920  -1.862  1.00 0.00 ? 16  GLY A H    2  
ATOM 1958  H HA2  . GLY A 1 16  ? 7.749   17.234  -1.555  1.00 0.00 ? 16  GLY A HA2  2  
ATOM 1959  H HA3  . GLY A 1 16  ? 8.634   17.158  -3.071  1.00 0.00 ? 16  GLY A HA3  2  
ATOM 1960  N N    . VAL A 1 17  ? 8.124   14.453  -1.267  1.00 0.00 ? 17  VAL A N    2  
ATOM 1961  C CA   . VAL A 1 17  ? 7.701   13.060  -1.339  1.00 0.00 ? 17  VAL A CA   2  
ATOM 1962  C C    . VAL A 1 17  ? 6.409   12.837  -0.559  1.00 0.00 ? 17  VAL A C    2  
ATOM 1963  O O    . VAL A 1 17  ? 6.142   13.492  0.448   1.00 0.00 ? 17  VAL A O    2  
ATOM 1964  C CB   . VAL A 1 17  ? 8.787   12.115  -0.792  1.00 0.00 ? 17  VAL A CB   2  
ATOM 1965  C CG1  . VAL A 1 17  ? 9.964   12.041  -1.754  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1966  C CG2  . VAL A 1 17  ? 9.242   12.567  0.587   1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1967  H H    . VAL A 1 17  ? 8.488   14.799  -0.425  1.00 0.00 ? 17  VAL A H    2  
ATOM 1968  H HA   . VAL A 1 17  ? 7.530   12.816  -2.377  1.00 0.00 ? 17  VAL A HA   2  
ATOM 1969  H HB   . VAL A 1 17  ? 8.363   11.126  -0.702  1.00 0.00 ? 17  VAL A HB   2  
ATOM 1970  H HG11 . VAL A 1 17  ? 10.370  13.031  -1.901  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1971  H HG12 . VAL A 1 17  ? 10.725  11.395  -1.342  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1972  H HG13 . VAL A 1 17  ? 9.629   11.645  -2.702  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1973  H HG21 . VAL A 1 17  ? 8.624   13.387  0.919   1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1974  H HG22 . VAL A 1 17  ? 9.155   11.745  1.281   1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1975  H HG23 . VAL A 1 17  ? 10.272  12.890  0.539   1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1976  N N    . PRO A 1 18  ? 5.588   11.889  -1.035  1.00 0.00 ? 18  PRO A N    2  
ATOM 1977  C CA   . PRO A 1 18  ? 4.311   11.556  -0.397  1.00 0.00 ? 18  PRO A CA   2  
ATOM 1978  C C    . PRO A 1 18  ? 4.498   10.858  0.946   1.00 0.00 ? 18  PRO A C    2  
ATOM 1979  O O    . PRO A 1 18  ? 5.029   9.750   1.011   1.00 0.00 ? 18  PRO A O    2  
ATOM 1980  C CB   . PRO A 1 18  ? 3.648   10.611  -1.403  1.00 0.00 ? 18  PRO A CB   2  
ATOM 1981  C CG   . PRO A 1 18  ? 4.780   10.008  -2.159  1.00 0.00 ? 18  PRO A CG   2  
ATOM 1982  C CD   . PRO A 1 18  ? 5.843   11.069  -2.231  1.00 0.00 ? 18  PRO A CD   2  
ATOM 1983  H HA   . PRO A 1 18  ? 3.694   12.433  -0.263  1.00 0.00 ? 18  PRO A HA   2  
ATOM 1984  H HB2  . PRO A 1 18  ? 3.079   9.860   -0.874  1.00 0.00 ? 18  PRO A HB2  2  
ATOM 1985  H HB3  . PRO A 1 18  ? 2.994   11.173  -2.053  1.00 0.00 ? 18  PRO A HB3  2  
ATOM 1986  H HG2  . PRO A 1 18  ? 5.152   9.141   -1.634  1.00 0.00 ? 18  PRO A HG2  2  
ATOM 1987  H HG3  . PRO A 1 18  ? 4.455   9.735   -3.152  1.00 0.00 ? 18  PRO A HG3  2  
ATOM 1988  H HD2  . PRO A 1 18  ? 6.825   10.623  -2.191  1.00 0.00 ? 18  PRO A HD2  2  
ATOM 1989  H HD3  . PRO A 1 18  ? 5.729   11.656  -3.131  1.00 0.00 ? 18  PRO A HD3  2  
ATOM 1990  N N    . ASP A 1 19  ? 4.057   11.514  2.014   1.00 0.00 ? 19  ASP A N    2  
ATOM 1991  C CA   . ASP A 1 19  ? 4.175   10.955  3.356   1.00 0.00 ? 19  ASP A CA   2  
ATOM 1992  C C    . ASP A 1 19  ? 3.581   9.552   3.414   1.00 0.00 ? 19  ASP A C    2  
ATOM 1993  O O    . ASP A 1 19  ? 2.993   9.073   2.443   1.00 0.00 ? 19  ASP A O    2  
ATOM 1994  C CB   . ASP A 1 19  ? 3.477   11.861  4.371   1.00 0.00 ? 19  ASP A CB   2  
ATOM 1995  C CG   . ASP A 1 19  ? 4.022   11.686  5.775   1.00 0.00 ? 19  ASP A CG   2  
ATOM 1996  O OD1  . ASP A 1 19  ? 5.177   11.229  5.910   1.00 0.00 ? 19  ASP A OD1  2  
ATOM 1997  O OD2  . ASP A 1 19  ? 3.295   12.006  6.738   1.00 0.00 ? 19  ASP A OD2  2  
ATOM 1998  H H    . ASP A 1 19  ? 3.643   12.394  1.897   1.00 0.00 ? 19  ASP A H    2  
ATOM 1999  H HA   . ASP A 1 19  ? 5.225   10.898  3.601   1.00 0.00 ? 19  ASP A HA   2  
ATOM 2000  H HB2  . ASP A 1 19  ? 3.613   12.892  4.079   1.00 0.00 ? 19  ASP A HB2  2  
ATOM 2001  H HB3  . ASP A 1 19  ? 2.421   11.631  4.383   1.00 0.00 ? 19  ASP A HB3  2  
ATOM 2002  N N    . THR A 1 20  ? 3.738   8.895   4.560   1.00 0.00 ? 20  THR A N    2  
ATOM 2003  C CA   . THR A 1 20  ? 3.219   7.545   4.744   1.00 0.00 ? 20  THR A CA   2  
ATOM 2004  C C    . THR A 1 20  ? 1.700   7.518   4.615   1.00 0.00 ? 20  THR A C    2  
ATOM 2005  O O    . THR A 1 20  ? 0.988   8.335   5.199   1.00 0.00 ? 20  THR A O    2  
ATOM 2006  C CB   . THR A 1 20  ? 3.616   6.974   6.119   1.00 0.00 ? 20  THR A CB   2  
ATOM 2007  O OG1  . THR A 1 20  ? 5.021   7.147   6.333   1.00 0.00 ? 20  THR A OG1  2  
ATOM 2008  C CG2  . THR A 1 20  ? 3.261   5.498   6.214   1.00 0.00 ? 20  THR A CG2  2  
ATOM 2009  H H    . THR A 1 20  ? 4.215   9.330   5.297   1.00 0.00 ? 20  THR A H    2  
ATOM 2010  H HA   . THR A 1 20  ? 3.647   6.916   3.978   1.00 0.00 ? 20  THR A HA   2  
ATOM 2011  H HB   . THR A 1 20  ? 3.074   7.510   6.885   1.00 0.00 ? 20  THR A HB   2  
ATOM 2012  H HG1  . THR A 1 20  ? 5.238   8.082   6.296   1.00 0.00 ? 20  THR A HG1  2  
ATOM 2013  H HG21 . THR A 1 20  ? 3.393   5.162   7.231   1.00 0.00 ? 20  THR A HG21 2  
ATOM 2014  H HG22 . THR A 1 20  ? 3.907   4.929   5.561   1.00 0.00 ? 20  THR A HG22 2  
ATOM 2015  H HG23 . THR A 1 20  ? 2.233   5.355   5.917   1.00 0.00 ? 20  THR A HG23 2  
ATOM 2016  N N    . PRO A 1 21  ? 1.190   6.556   3.832   1.00 0.00 ? 21  PRO A N    2  
ATOM 2017  C CA   . PRO A 1 21  ? -0.251  6.398   3.609   1.00 0.00 ? 21  PRO A CA   2  
ATOM 2018  C C    . PRO A 1 21  ? -0.980  5.907   4.855   1.00 0.00 ? 21  PRO A C    2  
ATOM 2019  O O    . PRO A 1 21  ? -0.509  5.004   5.548   1.00 0.00 ? 21  PRO A O    2  
ATOM 2020  C CB   . PRO A 1 21  ? -0.324  5.348   2.498   1.00 0.00 ? 21  PRO A CB   2  
ATOM 2021  C CG   . PRO A 1 21  ? 0.941   4.571   2.625   1.00 0.00 ? 21  PRO A CG   2  
ATOM 2022  C CD   . PRO A 1 21  ? 1.979   5.548   3.105   1.00 0.00 ? 21  PRO A CD   2  
ATOM 2023  H HA   . PRO A 1 21  ? -0.702  7.318   3.268   1.00 0.00 ? 21  PRO A HA   2  
ATOM 2024  H HB2  . PRO A 1 21  ? -1.191  4.720   2.649   1.00 0.00 ? 21  PRO A HB2  2  
ATOM 2025  H HB3  . PRO A 1 21  ? -0.391  5.838   1.538   1.00 0.00 ? 21  PRO A HB3  2  
ATOM 2026  H HG2  . PRO A 1 21  ? 0.813   3.777   3.345   1.00 0.00 ? 21  PRO A HG2  2  
ATOM 2027  H HG3  . PRO A 1 21  ? 1.222   4.168   1.664   1.00 0.00 ? 21  PRO A HG3  2  
ATOM 2028  H HD2  . PRO A 1 21  ? 2.681   5.059   3.764   1.00 0.00 ? 21  PRO A HD2  2  
ATOM 2029  H HD3  . PRO A 1 21  ? 2.493   5.993   2.266   1.00 0.00 ? 21  PRO A HD3  2  
ATOM 2030  N N    . THR A 1 22  ? -2.133  6.506   5.135   1.00 0.00 ? 22  THR A N    2  
ATOM 2031  C CA   . THR A 1 22  ? -2.927  6.131   6.298   1.00 0.00 ? 22  THR A CA   2  
ATOM 2032  C C    . THR A 1 22  ? -3.259  4.643   6.280   1.00 0.00 ? 22  THR A C    2  
ATOM 2033  O O    . THR A 1 22  ? -2.981  3.947   5.303   1.00 0.00 ? 22  THR A O    2  
ATOM 2034  C CB   . THR A 1 22  ? -4.238  6.936   6.367   1.00 0.00 ? 22  THR A CB   2  
ATOM 2035  O OG1  . THR A 1 22  ? -4.030  8.255   5.850   1.00 0.00 ? 22  THR A OG1  2  
ATOM 2036  C CG2  . THR A 1 22  ? -4.745  7.022   7.799   1.00 0.00 ? 22  THR A CG2  2  
ATOM 2037  H H    . THR A 1 22  ? -2.456  7.219   4.545   1.00 0.00 ? 22  THR A H    2  
ATOM 2038  H HA   . THR A 1 22  ? -2.347  6.350   7.183   1.00 0.00 ? 22  THR A HA   2  
ATOM 2039  H HB   . THR A 1 22  ? -4.983  6.435   5.766   1.00 0.00 ? 22  THR A HB   2  
ATOM 2040  H HG1  . THR A 1 22  ? -4.601  8.874   6.312   1.00 0.00 ? 22  THR A HG1  2  
ATOM 2041  H HG21 . THR A 1 22  ? -5.346  7.912   7.915   1.00 0.00 ? 22  THR A HG21 2  
ATOM 2042  H HG22 . THR A 1 22  ? -3.905  7.065   8.477   1.00 0.00 ? 22  THR A HG22 2  
ATOM 2043  H HG23 . THR A 1 22  ? -5.344  6.152   8.021   1.00 0.00 ? 22  THR A HG23 2  
ATOM 2044  N N    . ARG A 1 23  ? -3.855  4.161   7.365   1.00 0.00 ? 23  ARG A N    2  
ATOM 2045  C CA   . ARG A 1 23  ? -4.224  2.755   7.474   1.00 0.00 ? 23  ARG A CA   2  
ATOM 2046  C C    . ARG A 1 23  ? -4.876  2.263   6.184   1.00 0.00 ? 23  ARG A C    2  
ATOM 2047  O O    . ARG A 1 23  ? -5.348  3.059   5.372   1.00 0.00 ? 23  ARG A O    2  
ATOM 2048  C CB   . ARG A 1 23  ? -5.177  2.545   8.652   1.00 0.00 ? 23  ARG A CB   2  
ATOM 2049  C CG   . ARG A 1 23  ? -6.586  3.053   8.393   1.00 0.00 ? 23  ARG A CG   2  
ATOM 2050  C CD   . ARG A 1 23  ? -7.440  2.991   9.650   1.00 0.00 ? 23  ARG A CD   2  
ATOM 2051  N NE   . ARG A 1 23  ? -8.853  3.220   9.363   1.00 0.00 ? 23  ARG A NE   2  
ATOM 2052  C CZ   . ARG A 1 23  ? -9.359  4.412   9.064   1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2053  N NH1  . ARG A 1 23  ? -8.570  5.476   9.012   1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2054  N NH2  . ARG A 1 23  ? -10.656 4.540   8.815   1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2055  H H    . ARG A 1 23  ? -4.050  4.765   8.112   1.00 0.00 ? 23  ARG A H    2  
ATOM 2056  H HA   . ARG A 1 23  ? -3.322  2.187   7.646   1.00 0.00 ? 23  ARG A HA   2  
ATOM 2057  H HB2  . ARG A 1 23  ? -5.234  1.489   8.870   1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2058  H HB3  . ARG A 1 23  ? -4.784  3.062   9.514   1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2059  H HG2  . ARG A 1 23  ? -6.533  4.079   8.058   1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2060  H HG3  . ARG A 1 23  ? -7.043  2.445   7.627   1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2061  H HD2  . ARG A 1 23  ? -7.327  2.015   10.098  1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2062  H HD3  . ARG A 1 23  ? -7.095  3.746   10.341  1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2063  H HE   . ARG A 1 23  ? -9.454  2.447   9.396   1.00 0.00 ? 23  ARG A HE   2  
ATOM 2064  H HH11 . ARG A 1 23  ? -7.592  5.382   9.198   1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2065  H HH12 . ARG A 1 23  ? -8.953  6.372   8.785   1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2066  H HH21 . ARG A 1 23  ? -11.254 3.740   8.853   1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2067  H HH22 . ARG A 1 23  ? -11.035 5.437   8.590   1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2068  N N    . LEU A 1 24  ? -4.897  0.947   6.003   1.00 0.00 ? 24  LEU A N    2  
ATOM 2069  C CA   . LEU A 1 24  ? -5.490  0.348   4.813   1.00 0.00 ? 24  LEU A CA   2  
ATOM 2070  C C    . LEU A 1 24  ? -6.862  -0.242  5.125   1.00 0.00 ? 24  LEU A C    2  
ATOM 2071  O O    . LEU A 1 24  ? -7.253  -0.348  6.288   1.00 0.00 ? 24  LEU A O    2  
ATOM 2072  C CB   . LEU A 1 24  ? -4.571  -0.738  4.252   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2073  C CG   . LEU A 1 24  ? -3.073  -0.532  4.478   1.00 0.00 ? 24  LEU A CG   2  
ATOM 2074  C CD1  . LEU A 1 24  ? -2.285  -1.720  3.950   1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2075  C CD2  . LEU A 1 24  ? -2.606  0.756   3.818   1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2076  H H    . LEU A 1 24  ? -4.505  0.364   6.685   1.00 0.00 ? 24  LEU A H    2  
ATOM 2077  H HA   . LEU A 1 24  ? -5.607  1.127   4.073   1.00 0.00 ? 24  LEU A HA   2  
ATOM 2078  H HB2  . LEU A 1 24  ? -4.849  -1.675  4.710   1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2079  H HB3  . LEU A 1 24  ? -4.740  -0.796  3.186   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2080  H HG   . LEU A 1 24  ? -2.883  -0.453  5.540   1.00 0.00 ? 24  LEU A HG   2  
ATOM 2081  H HD11 . LEU A 1 24  ? -2.102  -2.418  4.753   1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2082  H HD12 . LEU A 1 24  ? -1.342  -1.378  3.550   1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2083  H HD13 . LEU A 1 24  ? -2.850  -2.209  3.169   1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2084  H HD21 . LEU A 1 24  ? -2.908  0.760   2.781   1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2085  H HD22 . LEU A 1 24  ? -1.529  0.822   3.879   1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2086  H HD23 . LEU A 1 24  ? -3.047  1.602   4.326   1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2087  N N    . VAL A 1 25  ? -7.587  -0.627  4.080   1.00 0.00 ? 25  VAL A N    2  
ATOM 2088  C CA   . VAL A 1 25  ? -8.913  -1.209  4.243   1.00 0.00 ? 25  VAL A CA   2  
ATOM 2089  C C    . VAL A 1 25  ? -9.056  -2.488  3.425   1.00 0.00 ? 25  VAL A C    2  
ATOM 2090  O O    . VAL A 1 25  ? -9.000  -2.461  2.195   1.00 0.00 ? 25  VAL A O    2  
ATOM 2091  C CB   . VAL A 1 25  ? -10.017 -0.219  3.825   1.00 0.00 ? 25  VAL A CB   2  
ATOM 2092  C CG1  . VAL A 1 25  ? -11.331 -0.950  3.595   1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2093  C CG2  . VAL A 1 25  ? -10.179 0.871   4.873   1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2094  H H    . VAL A 1 25  ? -7.221  -0.517  3.178   1.00 0.00 ? 25  VAL A H    2  
ATOM 2095  H HA   . VAL A 1 25  ? -9.048  -1.445  5.289   1.00 0.00 ? 25  VAL A HA   2  
ATOM 2096  H HB   . VAL A 1 25  ? -9.722  0.245   2.895   1.00 0.00 ? 25  VAL A HB   2  
ATOM 2097  H HG11 . VAL A 1 25  ? -12.129 -0.419  4.094   1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2098  H HG12 . VAL A 1 25  ? -11.536 -0.999  2.536   1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2099  H HG13 . VAL A 1 25  ? -11.261 -1.951  3.995   1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2100  H HG21 . VAL A 1 25  ? -10.697 1.714   4.439   1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2101  H HG22 . VAL A 1 25  ? -10.750 0.487   5.705   1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2102  H HG23 . VAL A 1 25  ? -9.205  1.186   5.219   1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2103  N N    . PHE A 1 26  ? -9.242  -3.608  4.116   1.00 0.00 ? 26  PHE A N    2  
ATOM 2104  C CA   . PHE A 1 26  ? -9.393  -4.898  3.453   1.00 0.00 ? 26  PHE A CA   2  
ATOM 2105  C C    . PHE A 1 26  ? -10.861 -5.308  3.389   1.00 0.00 ? 26  PHE A C    2  
ATOM 2106  O O    . PHE A 1 26  ? -11.587 -5.216  4.379   1.00 0.00 ? 26  PHE A O    2  
ATOM 2107  C CB   . PHE A 1 26  ? -8.585  -5.970  4.188   1.00 0.00 ? 26  PHE A CB   2  
ATOM 2108  C CG   . PHE A 1 26  ? -7.171  -5.557  4.482   1.00 0.00 ? 26  PHE A CG   2  
ATOM 2109  C CD1  . PHE A 1 26  ? -6.179  -5.705  3.526   1.00 0.00 ? 26  PHE A CD1  2  
ATOM 2110  C CD2  . PHE A 1 26  ? -6.833  -5.022  5.714   1.00 0.00 ? 26  PHE A CD2  2  
ATOM 2111  C CE1  . PHE A 1 26  ? -4.877  -5.327  3.794   1.00 0.00 ? 26  PHE A CE1  2  
ATOM 2112  C CE2  . PHE A 1 26  ? -5.533  -4.641  5.988   1.00 0.00 ? 26  PHE A CE2  2  
ATOM 2113  C CZ   . PHE A 1 26  ? -4.554  -4.794  5.026   1.00 0.00 ? 26  PHE A CZ   2  
ATOM 2114  H H    . PHE A 1 26  ? -9.278  -3.566  5.094   1.00 0.00 ? 26  PHE A H    2  
ATOM 2115  H HA   . PHE A 1 26  ? -9.014  -4.800  2.448   1.00 0.00 ? 26  PHE A HA   2  
ATOM 2116  H HB2  . PHE A 1 26  ? -9.067  -6.193  5.128   1.00 0.00 ? 26  PHE A HB2  2  
ATOM 2117  H HB3  . PHE A 1 26  ? -8.552  -6.863  3.583   1.00 0.00 ? 26  PHE A HB3  2  
ATOM 2118  H HD1  . PHE A 1 26  ? -6.430  -6.122  2.561   1.00 0.00 ? 26  PHE A HD1  2  
ATOM 2119  H HD2  . PHE A 1 26  ? -7.599  -4.902  6.468   1.00 0.00 ? 26  PHE A HD2  2  
ATOM 2120  H HE1  . PHE A 1 26  ? -4.113  -5.447  3.040   1.00 0.00 ? 26  PHE A HE1  2  
ATOM 2121  H HE2  . PHE A 1 26  ? -5.284  -4.224  6.953   1.00 0.00 ? 26  PHE A HE2  2  
ATOM 2122  H HZ   . PHE A 1 26  ? -3.537  -4.498  5.239   1.00 0.00 ? 26  PHE A HZ   2  
ATOM 2123  N N    . SER A 1 27  ? -11.292 -5.761  2.216   1.00 0.00 ? 27  SER A N    2  
ATOM 2124  C CA   . SER A 1 27  ? -12.675 -6.181  2.019   1.00 0.00 ? 27  SER A CA   2  
ATOM 2125  C C    . SER A 1 27  ? -12.799 -7.699  2.112   1.00 0.00 ? 27  SER A C    2  
ATOM 2126  O O    . SER A 1 27  ? -13.769 -8.221  2.661   1.00 0.00 ? 27  SER A O    2  
ATOM 2127  C CB   . SER A 1 27  ? -13.189 -5.698  0.662   1.00 0.00 ? 27  SER A CB   2  
ATOM 2128  O OG   . SER A 1 27  ? -14.599 -5.815  0.579   1.00 0.00 ? 27  SER A OG   2  
ATOM 2129  H H    . SER A 1 27  ? -10.665 -5.811  1.464   1.00 0.00 ? 27  SER A H    2  
ATOM 2130  H HA   . SER A 1 27  ? -13.271 -5.734  2.801   1.00 0.00 ? 27  SER A HA   2  
ATOM 2131  H HB2  . SER A 1 27  ? -12.918 -4.662  0.525   1.00 0.00 ? 27  SER A HB2  2  
ATOM 2132  H HB3  . SER A 1 27  ? -12.743 -6.293  -0.122  1.00 0.00 ? 27  SER A HB3  2  
ATOM 2133  H HG   . SER A 1 27  ? -14.828 -6.431  -0.120  1.00 0.00 ? 27  SER A HG   2  
ATOM 2134  N N    . ALA A 1 28  ? -11.810 -8.402  1.571   1.00 0.00 ? 28  ALA A N    2  
ATOM 2135  C CA   . ALA A 1 28  ? -11.807 -9.859  1.593   1.00 0.00 ? 28  ALA A CA   2  
ATOM 2136  C C    . ALA A 1 28  ? -12.986 -10.423 0.808   1.00 0.00 ? 28  ALA A C    2  
ATOM 2137  O O    . ALA A 1 28  ? -13.775 -11.210 1.333   1.00 0.00 ? 28  ALA A O    2  
ATOM 2138  C CB   . ALA A 1 28  ? -11.835 -10.365 3.028   1.00 0.00 ? 28  ALA A CB   2  
ATOM 2139  H H    . ALA A 1 28  ? -11.064 -7.929  1.147   1.00 0.00 ? 28  ALA A H    2  
ATOM 2140  H HA   . ALA A 1 28  ? -10.888 -10.198 1.136   1.00 0.00 ? 28  ALA A HA   2  
ATOM 2141  H HB1  . ALA A 1 28  ? -10.863 -10.226 3.477   1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2142  H HB2  . ALA A 1 28  ? -12.574 -9.811  3.589   1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2143  H HB3  . ALA A 1 28  ? -12.089 -11.414 3.035   1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2144  N N    . LEU A 1 29  ? -13.102 -10.016 -0.451  1.00 0.00 ? 29  LEU A N    2  
ATOM 2145  C CA   . LEU A 1 29  ? -14.186 -10.480 -1.309  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2146  C C    . LEU A 1 29  ? -14.430 -11.974 -1.119  1.00 0.00 ? 29  LEU A C    2  
ATOM 2147  O O    . LEU A 1 29  ? -15.557 -12.451 -1.247  1.00 0.00 ? 29  LEU A O    2  
ATOM 2148  C CB   . LEU A 1 29  ? -13.864 -10.187 -2.775  1.00 0.00 ? 29  LEU A CB   2  
ATOM 2149  C CG   . LEU A 1 29  ? -13.704 -8.712  -3.146  1.00 0.00 ? 29  LEU A CG   2  
ATOM 2150  C CD1  . LEU A 1 29  ? -14.568 -7.840  -2.248  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2151  C CD2  . LEU A 1 29  ? -12.243 -8.295  -3.052  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2152  H H    . LEU A 1 29  ? -12.443 -9.388  -0.813  1.00 0.00 ? 29  LEU A H    2  
ATOM 2153  H HA   . LEU A 1 29  ? -15.081 -9.943  -1.031  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2154  H HB2  . LEU A 1 29  ? -12.941 -10.691 -3.018  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2155  H HB3  . LEU A 1 29  ? -14.664 -10.595 -3.377  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2156  H HG   . LEU A 1 29  ? -14.030 -8.566  -4.166  1.00 0.00 ? 29  LEU A HG   2  
ATOM 2157  H HD11 . LEU A 1 29  ? -15.608 -8.087  -2.399  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2158  H HD12 . LEU A 1 29  ? -14.405 -6.800  -2.493  1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2159  H HD13 . LEU A 1 29  ? -14.302 -8.012  -1.215  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2160  H HD21 . LEU A 1 29  ? -11.662 -9.108  -2.643  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2161  H HD22 . LEU A 1 29  ? -12.157 -7.431  -2.410  1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2162  H HD23 . LEU A 1 29  ? -11.876 -8.049  -4.038  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2163  N N    . GLY A 1 30  ? -13.365 -12.707 -0.809  1.00 0.00 ? 30  GLY A N    2  
ATOM 2164  C CA   . GLY A 1 30  ? -13.485 -14.139 -0.604  1.00 0.00 ? 30  GLY A CA   2  
ATOM 2165  C C    . GLY A 1 30  ? -12.244 -14.740 0.027   1.00 0.00 ? 30  GLY A C    2  
ATOM 2166  O O    . GLY A 1 30  ? -11.381 -14.032 0.547   1.00 0.00 ? 30  GLY A O    2  
ATOM 2167  H H    . GLY A 1 30  ? -12.491 -12.273 -0.720  1.00 0.00 ? 30  GLY A H    2  
ATOM 2168  H HA2  . GLY A 1 30  ? -14.331 -14.330 0.038   1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2169  H HA3  . GLY A 1 30  ? -13.655 -14.615 -1.559  1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2170  N N    . PRO A 1 31  ? -12.143 -16.077 -0.014  1.00 0.00 ? 31  PRO A N    2  
ATOM 2171  C CA   . PRO A 1 31  ? -11.003 -16.802 0.554   1.00 0.00 ? 31  PRO A CA   2  
ATOM 2172  C C    . PRO A 1 31  ? -9.721  -16.583 -0.242  1.00 0.00 ? 31  PRO A C    2  
ATOM 2173  O O    . PRO A 1 31  ? -8.619  -16.648 0.304   1.00 0.00 ? 31  PRO A O    2  
ATOM 2174  C CB   . PRO A 1 31  ? -11.439 -18.267 0.474   1.00 0.00 ? 31  PRO A CB   2  
ATOM 2175  C CG   . PRO A 1 31  ? -12.424 -18.309 -0.643  1.00 0.00 ? 31  PRO A CG   2  
ATOM 2176  C CD   . PRO A 1 31  ? -13.134 -16.983 -0.619  1.00 0.00 ? 31  PRO A CD   2  
ATOM 2177  H HA   . PRO A 1 31  ? -10.835 -16.531 1.587   1.00 0.00 ? 31  PRO A HA   2  
ATOM 2178  H HB2  . PRO A 1 31  ? -10.580 -18.890 0.267   1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2179  H HB3  . PRO A 1 31  ? -11.890 -18.565 1.408   1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2180  H HG2  . PRO A 1 31  ? -11.908 -18.441 -1.583  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2181  H HG3  . PRO A 1 31  ? -13.127 -19.113 -0.483  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2182  H HD2  . PRO A 1 31  ? -13.382 -16.669 -1.622  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2183  H HD3  . PRO A 1 31  ? -14.023 -17.043 -0.009  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2184  N N    . THR A 1 32  ? -9.871  -16.322 -1.537  1.00 0.00 ? 32  THR A N    2  
ATOM 2185  C CA   . THR A 1 32  ? -8.726  -16.094 -2.408  1.00 0.00 ? 32  THR A CA   2  
ATOM 2186  C C    . THR A 1 32  ? -8.816  -14.734 -3.091  1.00 0.00 ? 32  THR A C    2  
ATOM 2187  O O    . THR A 1 32  ? -8.246  -14.527 -4.162  1.00 0.00 ? 32  THR A O    2  
ATOM 2188  C CB   . THR A 1 32  ? -8.613  -17.190 -3.486  1.00 0.00 ? 32  THR A CB   2  
ATOM 2189  O OG1  . THR A 1 32  ? -9.852  -17.313 -4.191  1.00 0.00 ? 32  THR A OG1  2  
ATOM 2190  C CG2  . THR A 1 32  ? -8.244  -18.527 -2.861  1.00 0.00 ? 32  THR A CG2  2  
ATOM 2191  H H    . THR A 1 32  ? -10.775 -16.284 -1.914  1.00 0.00 ? 32  THR A H    2  
ATOM 2192  H HA   . THR A 1 32  ? -7.833  -16.123 -1.800  1.00 0.00 ? 32  THR A HA   2  
ATOM 2193  H HB   . THR A 1 32  ? -7.836  -16.909 -4.183  1.00 0.00 ? 32  THR A HB   2  
ATOM 2194  H HG1  . THR A 1 32  ? -9.939  -18.206 -4.532  1.00 0.00 ? 32  THR A HG1  2  
ATOM 2195  H HG21 . THR A 1 32  ? -8.632  -18.573 -1.855  1.00 0.00 ? 32  THR A HG21 2  
ATOM 2196  H HG22 . THR A 1 32  ? -7.169  -18.629 -2.836  1.00 0.00 ? 32  THR A HG22 2  
ATOM 2197  H HG23 . THR A 1 32  ? -8.668  -19.328 -3.448  1.00 0.00 ? 32  THR A HG23 2  
ATOM 2198  N N    . SER A 1 33  ? -9.535  -13.809 -2.463  1.00 0.00 ? 33  SER A N    2  
ATOM 2199  C CA   . SER A 1 33  ? -9.703  -12.469 -3.012  1.00 0.00 ? 33  SER A CA   2  
ATOM 2200  C C    . SER A 1 33  ? -9.695  -11.422 -1.901  1.00 0.00 ? 33  SER A C    2  
ATOM 2201  O O    . SER A 1 33  ? -10.098 -11.697 -0.771  1.00 0.00 ? 33  SER A O    2  
ATOM 2202  C CB   . SER A 1 33  ? -11.008 -12.378 -3.804  1.00 0.00 ? 33  SER A CB   2  
ATOM 2203  O OG   . SER A 1 33  ? -12.058 -13.057 -3.137  1.00 0.00 ? 33  SER A OG   2  
ATOM 2204  H H    . SER A 1 33  ? -9.966  -14.035 -1.612  1.00 0.00 ? 33  SER A H    2  
ATOM 2205  H HA   . SER A 1 33  ? -8.874  -12.277 -3.677  1.00 0.00 ? 33  SER A HA   2  
ATOM 2206  H HB2  . SER A 1 33  ? -11.284 -11.341 -3.921  1.00 0.00 ? 33  SER A HB2  2  
ATOM 2207  H HB3  . SER A 1 33  ? -10.867 -12.825 -4.777  1.00 0.00 ? 33  SER A HB3  2  
ATOM 2208  H HG   . SER A 1 33  ? -11.691 -13.760 -2.595  1.00 0.00 ? 33  SER A HG   2  
ATOM 2209  N N    . LEU A 1 34  ? -9.232  -10.222 -2.232  1.00 0.00 ? 34  LEU A N    2  
ATOM 2210  C CA   . LEU A 1 34  ? -9.170  -9.132  -1.264  1.00 0.00 ? 34  LEU A CA   2  
ATOM 2211  C C    . LEU A 1 34  ? -9.205  -7.778  -1.965  1.00 0.00 ? 34  LEU A C    2  
ATOM 2212  O O    . LEU A 1 34  ? -9.049  -7.695  -3.184  1.00 0.00 ? 34  LEU A O    2  
ATOM 2213  C CB   . LEU A 1 34  ? -7.903  -9.248  -0.416  1.00 0.00 ? 34  LEU A CB   2  
ATOM 2214  C CG   . LEU A 1 34  ? -8.034  -10.044 0.883   1.00 0.00 ? 34  LEU A CG   2  
ATOM 2215  C CD1  . LEU A 1 34  ? -6.718  -10.724 1.228   1.00 0.00 ? 34  LEU A CD1  2  
ATOM 2216  C CD2  . LEU A 1 34  ? -8.483  -9.139  2.020   1.00 0.00 ? 34  LEU A CD2  2  
ATOM 2217  H H    . LEU A 1 34  ? -8.924  -10.063 -3.149  1.00 0.00 ? 34  LEU A H    2  
ATOM 2218  H HA   . LEU A 1 34  ? -10.033 -9.212  -0.620  1.00 0.00 ? 34  LEU A HA   2  
ATOM 2219  H HB2  . LEU A 1 34  ? -7.144  -9.722  -1.019  1.00 0.00 ? 34  LEU A HB2  2  
ATOM 2220  H HB3  . LEU A 1 34  ? -7.584  -8.247  -0.161  1.00 0.00 ? 34  LEU A HB3  2  
ATOM 2221  H HG   . LEU A 1 34  ? -8.782  -10.814 0.751   1.00 0.00 ? 34  LEU A HG   2  
ATOM 2222  H HD11 . LEU A 1 34  ? -6.136  -10.077 1.867   1.00 0.00 ? 34  LEU A HD11 2  
ATOM 2223  H HD12 . LEU A 1 34  ? -6.168  -10.924 0.320   1.00 0.00 ? 34  LEU A HD12 2  
ATOM 2224  H HD13 . LEU A 1 34  ? -6.917  -11.654 1.740   1.00 0.00 ? 34  LEU A HD13 2  
ATOM 2225  H HD21 . LEU A 1 34  ? -8.426  -8.108  1.704   1.00 0.00 ? 34  LEU A HD21 2  
ATOM 2226  H HD22 . LEU A 1 34  ? -7.841  -9.290  2.875   1.00 0.00 ? 34  LEU A HD22 2  
ATOM 2227  H HD23 . LEU A 1 34  ? -9.502  -9.378  2.289   1.00 0.00 ? 34  LEU A HD23 2  
ATOM 2228  N N    . ARG A 1 35  ? -9.408  -6.720  -1.188  1.00 0.00 ? 35  ARG A N    2  
ATOM 2229  C CA   . ARG A 1 35  ? -9.461  -5.369  -1.734  1.00 0.00 ? 35  ARG A CA   2  
ATOM 2230  C C    . ARG A 1 35  ? -8.870  -4.361  -0.753  1.00 0.00 ? 35  ARG A C    2  
ATOM 2231  O O    . ARG A 1 35  ? -9.495  -4.014  0.249   1.00 0.00 ? 35  ARG A O    2  
ATOM 2232  C CB   . ARG A 1 35  ? -10.905 -4.987  -2.065  1.00 0.00 ? 35  ARG A CB   2  
ATOM 2233  C CG   . ARG A 1 35  ? -11.051 -3.579  -2.620  1.00 0.00 ? 35  ARG A CG   2  
ATOM 2234  C CD   . ARG A 1 35  ? -12.494 -3.104  -2.561  1.00 0.00 ? 35  ARG A CD   2  
ATOM 2235  N NE   . ARG A 1 35  ? -12.666 -1.799  -3.194  1.00 0.00 ? 35  ARG A NE   2  
ATOM 2236  C CZ   . ARG A 1 35  ? -13.821 -1.370  -3.691  1.00 0.00 ? 35  ARG A CZ   2  
ATOM 2237  N NH1  . ARG A 1 35  ? -14.900 -2.138  -3.628  1.00 0.00 ? 35  ARG A NH1  2  
ATOM 2238  N NH2  . ARG A 1 35  ? -13.899 -0.170  -4.251  1.00 0.00 ? 35  ARG A NH2  2  
ATOM 2239  H H    . ARG A 1 35  ? -9.525  -6.850  -0.223  1.00 0.00 ? 35  ARG A H    2  
ATOM 2240  H HA   . ARG A 1 35  ? -8.877  -5.355  -2.642  1.00 0.00 ? 35  ARG A HA   2  
ATOM 2241  H HB2  . ARG A 1 35  ? -11.290 -5.680  -2.799  1.00 0.00 ? 35  ARG A HB2  2  
ATOM 2242  H HB3  . ARG A 1 35  ? -11.499 -5.060  -1.167  1.00 0.00 ? 35  ARG A HB3  2  
ATOM 2243  H HG2  . ARG A 1 35  ? -10.438 -2.907  -2.037  1.00 0.00 ? 35  ARG A HG2  2  
ATOM 2244  H HG3  . ARG A 1 35  ? -10.719 -3.571  -3.648  1.00 0.00 ? 35  ARG A HG3  2  
ATOM 2245  H HD2  . ARG A 1 35  ? -13.117 -3.824  -3.069  1.00 0.00 ? 35  ARG A HD2  2  
ATOM 2246  H HD3  . ARG A 1 35  ? -12.794 -3.035  -1.526  1.00 0.00 ? 35  ARG A HD3  2  
ATOM 2247  H HE   . ARG A 1 35  ? -11.882 -1.215  -3.251  1.00 0.00 ? 35  ARG A HE   2  
ATOM 2248  H HH11 . ARG A 1 35  ? -14.845 -3.043  -3.205  1.00 0.00 ? 35  ARG A HH11 2  
ATOM 2249  H HH12 . ARG A 1 35  ? -15.769 -1.812  -4.001  1.00 0.00 ? 35  ARG A HH12 2  
ATOM 2250  H HH21 . ARG A 1 35  ? -13.088 0.413   -4.300  1.00 0.00 ? 35  ARG A HH21 2  
ATOM 2251  H HH22 . ARG A 1 35  ? -14.768 0.152   -4.624  1.00 0.00 ? 35  ARG A HH22 2  
ATOM 2252  N N    . VAL A 1 36  ? -7.660  -3.896  -1.048  1.00 0.00 ? 36  VAL A N    2  
ATOM 2253  C CA   . VAL A 1 36  ? -6.984  -2.928  -0.192  1.00 0.00 ? 36  VAL A CA   2  
ATOM 2254  C C    . VAL A 1 36  ? -7.197  -1.505  -0.697  1.00 0.00 ? 36  VAL A C    2  
ATOM 2255  O O    . VAL A 1 36  ? -6.993  -1.217  -1.876  1.00 0.00 ? 36  VAL A O    2  
ATOM 2256  C CB   . VAL A 1 36  ? -5.472  -3.211  -0.111  1.00 0.00 ? 36  VAL A CB   2  
ATOM 2257  C CG1  . VAL A 1 36  ? -4.729  -1.996  0.423   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2258  C CG2  . VAL A 1 36  ? -5.205  -4.432  0.756   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2259  H H    . VAL A 1 36  ? -7.212  -4.210  -1.861  1.00 0.00 ? 36  VAL A H    2  
ATOM 2260  H HA   . VAL A 1 36  ? -7.399  -3.013  0.802   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2261  H HB   . VAL A 1 36  ? -5.110  -3.417  -1.108  1.00 0.00 ? 36  VAL A HB   2  
ATOM 2262  H HG11 . VAL A 1 36  ? -3.669  -2.200  0.438   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2263  H HG12 . VAL A 1 36  ? -4.924  -1.145  -0.213  1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2264  H HG13 . VAL A 1 36  ? -5.067  -1.780  1.426   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2265  H HG21 . VAL A 1 36  ? -4.240  -4.848  0.505   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2266  H HG22 . VAL A 1 36  ? -5.214  -4.144  1.796   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2267  H HG23 . VAL A 1 36  ? -5.972  -5.173  0.581   1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2268  N N    . SER A 1 37  ? -7.608  -0.619  0.205   1.00 0.00 ? 37  SER A N    2  
ATOM 2269  C CA   . SER A 1 37  ? -7.853  0.774   -0.150  1.00 0.00 ? 37  SER A CA   2  
ATOM 2270  C C    . SER A 1 37  ? -7.180  1.714   0.847   1.00 0.00 ? 37  SER A C    2  
ATOM 2271  O O    . SER A 1 37  ? -7.421  1.635   2.051   1.00 0.00 ? 37  SER A O    2  
ATOM 2272  C CB   . SER A 1 37  ? -9.356  1.054   -0.197  1.00 0.00 ? 37  SER A CB   2  
ATOM 2273  O OG   . SER A 1 37  ? -9.829  1.515   1.057   1.00 0.00 ? 37  SER A OG   2  
ATOM 2274  H H    . SER A 1 37  ? -7.753  -0.910  1.129   1.00 0.00 ? 37  SER A H    2  
ATOM 2275  H HA   . SER A 1 37  ? -7.432  0.946   -1.129  1.00 0.00 ? 37  SER A HA   2  
ATOM 2276  H HB2  . SER A 1 37  ? -9.555  1.809   -0.943  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2277  H HB3  . SER A 1 37  ? -9.880  0.146   -0.455  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2278  H HG   . SER A 1 37  ? -10.786 1.443   1.084   1.00 0.00 ? 37  SER A HG   2  
ATOM 2279  N N    . TRP A 1 38  ? -6.336  2.602   0.335   1.00 0.00 ? 38  TRP A N    2  
ATOM 2280  C CA   . TRP A 1 38  ? -5.628  3.558   1.179   1.00 0.00 ? 38  TRP A CA   2  
ATOM 2281  C C    . TRP A 1 38  ? -6.171  4.969   0.978   1.00 0.00 ? 38  TRP A C    2  
ATOM 2282  O O    . TRP A 1 38  ? -7.149  5.169   0.258   1.00 0.00 ? 38  TRP A O    2  
ATOM 2283  C CB   . TRP A 1 38  ? -4.130  3.527   0.873   1.00 0.00 ? 38  TRP A CB   2  
ATOM 2284  C CG   . TRP A 1 38  ? -3.821  3.566   -0.593  1.00 0.00 ? 38  TRP A CG   2  
ATOM 2285  C CD1  . TRP A 1 38  ? -3.285  4.611   -1.290  1.00 0.00 ? 38  TRP A CD1  2  
ATOM 2286  C CD2  . TRP A 1 38  ? -4.033  2.515   -1.542  1.00 0.00 ? 38  TRP A CD2  2  
ATOM 2287  N NE1  . TRP A 1 38  ? -3.151  4.273   -2.615  1.00 0.00 ? 38  TRP A NE1  2  
ATOM 2288  C CE2  . TRP A 1 38  ? -3.602  2.992   -2.795  1.00 0.00 ? 38  TRP A CE2  2  
ATOM 2289  C CE3  . TRP A 1 38  ? -4.543  1.217   -1.454  1.00 0.00 ? 38  TRP A CE3  2  
ATOM 2290  C CZ2  . TRP A 1 38  ? -3.667  2.216   -3.949  1.00 0.00 ? 38  TRP A CZ2  2  
ATOM 2291  C CZ3  . TRP A 1 38  ? -4.608  0.448   -2.600  1.00 0.00 ? 38  TRP A CZ3  2  
ATOM 2292  C CH2  . TRP A 1 38  ? -4.171  0.949   -3.834  1.00 0.00 ? 38  TRP A CH2  2  
ATOM 2293  H H    . TRP A 1 38  ? -6.185  2.616   -0.634  1.00 0.00 ? 38  TRP A H    2  
ATOM 2294  H HA   . TRP A 1 38  ? -5.782  3.268   2.208   1.00 0.00 ? 38  TRP A HA   2  
ATOM 2295  H HB2  . TRP A 1 38  ? -3.656  4.380   1.336   1.00 0.00 ? 38  TRP A HB2  2  
ATOM 2296  H HB3  . TRP A 1 38  ? -3.706  2.620   1.280   1.00 0.00 ? 38  TRP A HB3  2  
ATOM 2297  H HD1  . TRP A 1 38  ? -3.013  5.559   -0.851  1.00 0.00 ? 38  TRP A HD1  2  
ATOM 2298  H HE1  . TRP A 1 38  ? -2.789  4.854   -3.317  1.00 0.00 ? 38  TRP A HE1  2  
ATOM 2299  H HE3  . TRP A 1 38  ? -4.885  0.814   -0.512  1.00 0.00 ? 38  TRP A HE3  2  
ATOM 2300  H HZ2  . TRP A 1 38  ? -3.334  2.587   -4.907  1.00 0.00 ? 38  TRP A HZ2  2  
ATOM 2301  H HZ3  . TRP A 1 38  ? -5.000  -0.557  -2.552  1.00 0.00 ? 38  TRP A HZ3  2  
ATOM 2302  H HH2  . TRP A 1 38  ? -4.240  0.313   -4.703  1.00 0.00 ? 38  TRP A HH2  2  
ATOM 2303  N N    . GLN A 1 39  ? -5.531  5.941   1.619   1.00 0.00 ? 39  GLN A N    2  
ATOM 2304  C CA   . GLN A 1 39  ? -5.952  7.333   1.511   1.00 0.00 ? 39  GLN A CA   2  
ATOM 2305  C C    . GLN A 1 39  ? -4.839  8.194   0.922   1.00 0.00 ? 39  GLN A C    2  
ATOM 2306  O O    . GLN A 1 39  ? -3.699  8.151   1.384   1.00 0.00 ? 39  GLN A O    2  
ATOM 2307  C CB   . GLN A 1 39  ? -6.360  7.873   2.882   1.00 0.00 ? 39  GLN A CB   2  
ATOM 2308  C CG   . GLN A 1 39  ? -7.167  9.160   2.814   1.00 0.00 ? 39  GLN A CG   2  
ATOM 2309  C CD   . GLN A 1 39  ? -8.658  8.909   2.706   1.00 0.00 ? 39  GLN A CD   2  
ATOM 2310  O OE1  . GLN A 1 39  ? -9.294  8.456   3.658   1.00 0.00 ? 39  GLN A OE1  2  
ATOM 2311  N NE2  . GLN A 1 39  ? -9.225  9.203   1.542   1.00 0.00 ? 39  GLN A NE2  2  
ATOM 2312  H H    . GLN A 1 39  ? -4.759  5.718   2.179   1.00 0.00 ? 39  GLN A H    2  
ATOM 2313  H HA   . GLN A 1 39  ? -6.806  7.370   0.851   1.00 0.00 ? 39  GLN A HA   2  
ATOM 2314  H HB2  . GLN A 1 39  ? -6.955  7.127   3.387   1.00 0.00 ? 39  GLN A HB2  2  
ATOM 2315  H HB3  . GLN A 1 39  ? -5.468  8.063   3.461   1.00 0.00 ? 39  GLN A HB3  2  
ATOM 2316  H HG2  . GLN A 1 39  ? -6.978  9.736   3.708   1.00 0.00 ? 39  GLN A HG2  2  
ATOM 2317  H HG3  . GLN A 1 39  ? -6.848  9.724   1.950   1.00 0.00 ? 39  GLN A HG3  2  
ATOM 2318  H HE21 . GLN A 1 39  ? -8.656  9.560   0.827   1.00 0.00 ? 39  GLN A HE21 2  
ATOM 2319  H HE22 . GLN A 1 39  ? -10.187 9.050   1.444   1.00 0.00 ? 39  GLN A HE22 2  
ATOM 2320  N N    . GLU A 1 40  ? -5.178  8.975   -0.099  1.00 0.00 ? 40  GLU A N    2  
ATOM 2321  C CA   . GLU A 1 40  ? -4.206  9.845   -0.750  1.00 0.00 ? 40  GLU A CA   2  
ATOM 2322  C C    . GLU A 1 40  ? -3.421  10.651  0.281   1.00 0.00 ? 40  GLU A C    2  
ATOM 2323  O O    . GLU A 1 40  ? -3.928  11.600  0.881   1.00 0.00 ? 40  GLU A O    2  
ATOM 2324  C CB   . GLU A 1 40  ? -4.908  10.790  -1.727  1.00 0.00 ? 40  GLU A CB   2  
ATOM 2325  C CG   . GLU A 1 40  ? -3.952  11.572  -2.612  1.00 0.00 ? 40  GLU A CG   2  
ATOM 2326  C CD   . GLU A 1 40  ? -4.508  12.921  -3.024  1.00 0.00 ? 40  GLU A CD   2  
ATOM 2327  O OE1  . GLU A 1 40  ? -5.725  13.005  -3.292  1.00 0.00 ? 40  GLU A OE1  2  
ATOM 2328  O OE2  . GLU A 1 40  ? -3.726  13.893  -3.077  1.00 0.00 ? 40  GLU A OE2  2  
ATOM 2329  H H    . GLU A 1 40  ? -6.103  8.965   -0.422  1.00 0.00 ? 40  GLU A H    2  
ATOM 2330  H HA   . GLU A 1 40  ? -3.518  9.220   -1.300  1.00 0.00 ? 40  GLU A HA   2  
ATOM 2331  H HB2  . GLU A 1 40  ? -5.563  10.212  -2.361  1.00 0.00 ? 40  GLU A HB2  2  
ATOM 2332  H HB3  . GLU A 1 40  ? -5.501  11.496  -1.162  1.00 0.00 ? 40  GLU A HB3  2  
ATOM 2333  H HG2  . GLU A 1 40  ? -3.030  11.729  -2.073  1.00 0.00 ? 40  GLU A HG2  2  
ATOM 2334  H HG3  . GLU A 1 40  ? -3.752  10.994  -3.502  1.00 0.00 ? 40  GLU A HG3  2  
ATOM 2335  N N    . PRO A 1 41  ? -2.154  10.266  0.493   1.00 0.00 ? 41  PRO A N    2  
ATOM 2336  C CA   . PRO A 1 41  ? -1.272  10.940  1.450   1.00 0.00 ? 41  PRO A CA   2  
ATOM 2337  C C    . PRO A 1 41  ? -0.873  12.337  0.988   1.00 0.00 ? 41  PRO A C    2  
ATOM 2338  O O    . PRO A 1 41  ? -1.113  12.713  -0.159  1.00 0.00 ? 41  PRO A O    2  
ATOM 2339  C CB   . PRO A 1 41  ? -0.046  10.025  1.507   1.00 0.00 ? 41  PRO A CB   2  
ATOM 2340  C CG   . PRO A 1 41  ? -0.041  9.317   0.196   1.00 0.00 ? 41  PRO A CG   2  
ATOM 2341  C CD   . PRO A 1 41  ? -1.485  9.145   -0.187  1.00 0.00 ? 41  PRO A CD   2  
ATOM 2342  H HA   . PRO A 1 41  ? -1.723  11.001  2.430   1.00 0.00 ? 41  PRO A HA   2  
ATOM 2343  H HB2  . PRO A 1 41  ? 0.846   10.622  1.638   1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2344  H HB3  . PRO A 1 41  ? -0.146  9.333   2.329   1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2345  H HG2  . PRO A 1 41  ? 0.474   9.913   -0.542  1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2346  H HG3  . PRO A 1 41  ? 0.436   8.354   0.302   1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2347  H HD2  . PRO A 1 41  ? -1.602  9.217   -1.258  1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2348  H HD3  . PRO A 1 41  ? -1.860  8.198   0.173   1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2349  N N    . ARG A 1 42  ? -0.264  13.102  1.888   1.00 0.00 ? 42  ARG A N    2  
ATOM 2350  C CA   . ARG A 1 42  ? 0.167   14.458  1.572   1.00 0.00 ? 42  ARG A CA   2  
ATOM 2351  C C    . ARG A 1 42  ? 1.423   14.441  0.706   1.00 0.00 ? 42  ARG A C    2  
ATOM 2352  O O    . ARG A 1 42  ? 2.355   13.677  0.960   1.00 0.00 ? 42  ARG A O    2  
ATOM 2353  C CB   . ARG A 1 42  ? 0.432   15.244  2.858   1.00 0.00 ? 42  ARG A CB   2  
ATOM 2354  C CG   . ARG A 1 42  ? 1.514   14.634  3.733   1.00 0.00 ? 42  ARG A CG   2  
ATOM 2355  C CD   . ARG A 1 42  ? 2.073   15.650  4.717   1.00 0.00 ? 42  ARG A CD   2  
ATOM 2356  N NE   . ARG A 1 42  ? 2.752   15.008  5.840   1.00 0.00 ? 42  ARG A NE   2  
ATOM 2357  C CZ   . ARG A 1 42  ? 3.620   15.633  6.627   1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2358  N NH1  . ARG A 1 42  ? 3.914   16.909  6.417   1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2359  N NH2  . ARG A 1 42  ? 4.197   14.981  7.629   1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2360  H H    . ARG A 1 42  ? -0.101  12.745  2.787   1.00 0.00 ? 42  ARG A H    2  
ATOM 2361  H HA   . ARG A 1 42  ? -0.628  14.940  1.023   1.00 0.00 ? 42  ARG A HA   2  
ATOM 2362  H HB2  . ARG A 1 42  ? 0.734   16.248  2.596   1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2363  H HB3  . ARG A 1 42  ? -0.481  15.290  3.431   1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2364  H HG2  . ARG A 1 42  ? 1.094   13.808  4.286   1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2365  H HG3  . ARG A 1 42  ? 2.315   14.278  3.102   1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2366  H HD2  . ARG A 1 42  ? 2.777   16.284  4.198   1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2367  H HD3  . ARG A 1 42  ? 1.259   16.250  5.095   1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2368  H HE   . ARG A 1 42  ? 2.550   14.066  6.013   1.00 0.00 ? 42  ARG A HE   2  
ATOM 2369  H HH11 . ARG A 1 42  ? 3.480   17.402  5.663   1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2370  H HH12 . ARG A 1 42  ? 4.567   17.377  7.012   1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2371  H HH21 . ARG A 1 42  ? 3.978   14.019  7.791   1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2372  H HH22 . ARG A 1 42  ? 4.850   15.452  8.221   1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2373  N N    . CYS A 1 43  ? 1.441   15.288  -0.317  1.00 0.00 ? 43  CYS A N    2  
ATOM 2374  C CA   . CYS A 1 43  ? 2.582   15.370  -1.223  1.00 0.00 ? 43  CYS A CA   2  
ATOM 2375  C C    . CYS A 1 43  ? 2.592   16.702  -1.965  1.00 0.00 ? 43  CYS A C    2  
ATOM 2376  O O    . CYS A 1 43  ? 1.638   17.041  -2.665  1.00 0.00 ? 43  CYS A O    2  
ATOM 2377  C CB   . CYS A 1 43  ? 2.549   14.215  -2.224  1.00 0.00 ? 43  CYS A CB   2  
ATOM 2378  S SG   . CYS A 1 43  ? 1.078   14.191  -3.276  1.00 0.00 ? 43  CYS A SG   2  
ATOM 2379  H H    . CYS A 1 43  ? 0.668   15.872  -0.469  1.00 0.00 ? 43  CYS A H    2  
ATOM 2380  H HA   . CYS A 1 43  ? 3.480   15.296  -0.629  1.00 0.00 ? 43  CYS A HA   2  
ATOM 2381  H HB2  . CYS A 1 43  ? 3.412   14.283  -2.869  1.00 0.00 ? 43  CYS A HB2  2  
ATOM 2382  H HB3  . CYS A 1 43  ? 2.584   13.280  -1.684  1.00 0.00 ? 43  CYS A HB3  2  
ATOM 2383  H HG   . CYS A 1 43  ? 0.500   13.007  -3.143  1.00 0.00 ? 43  CYS A HG   2  
ATOM 2384  N N    . GLU A 1 44  ? 3.677   17.454  -1.805  1.00 0.00 ? 44  GLU A N    2  
ATOM 2385  C CA   . GLU A 1 44  ? 3.809   18.751  -2.459  1.00 0.00 ? 44  GLU A CA   2  
ATOM 2386  C C    . GLU A 1 44  ? 3.733   18.606  -3.976  1.00 0.00 ? 44  GLU A C    2  
ATOM 2387  O O    . GLU A 1 44  ? 3.354   19.541  -4.682  1.00 0.00 ? 44  GLU A O    2  
ATOM 2388  C CB   . GLU A 1 44  ? 5.131   19.413  -2.065  1.00 0.00 ? 44  GLU A CB   2  
ATOM 2389  C CG   . GLU A 1 44  ? 5.142   20.919  -2.269  1.00 0.00 ? 44  GLU A CG   2  
ATOM 2390  C CD   . GLU A 1 44  ? 4.282   21.651  -1.258  1.00 0.00 ? 44  GLU A CD   2  
ATOM 2391  O OE1  . GLU A 1 44  ? 3.043   21.516  -1.326  1.00 0.00 ? 44  GLU A OE1  2  
ATOM 2392  O OE2  . GLU A 1 44  ? 4.848   22.359  -0.399  1.00 0.00 ? 44  GLU A OE2  2  
ATOM 2393  H H    . GLU A 1 44  ? 4.404   17.130  -1.235  1.00 0.00 ? 44  GLU A H    2  
ATOM 2394  H HA   . GLU A 1 44  ? 2.992   19.375  -2.128  1.00 0.00 ? 44  GLU A HA   2  
ATOM 2395  H HB2  . GLU A 1 44  ? 5.325   19.210  -1.022  1.00 0.00 ? 44  GLU A HB2  2  
ATOM 2396  H HB3  . GLU A 1 44  ? 5.925   18.985  -2.659  1.00 0.00 ? 44  GLU A HB3  2  
ATOM 2397  H HG2  . GLU A 1 44  ? 6.158   21.274  -2.179  1.00 0.00 ? 44  GLU A HG2  2  
ATOM 2398  H HG3  . GLU A 1 44  ? 4.773   21.138  -3.260  1.00 0.00 ? 44  GLU A HG3  2  
ATOM 2399  N N    . ARG A 1 45  ? 4.095   17.427  -4.471  1.00 0.00 ? 45  ARG A N    2  
ATOM 2400  C CA   . ARG A 1 45  ? 4.070   17.159  -5.904  1.00 0.00 ? 45  ARG A CA   2  
ATOM 2401  C C    . ARG A 1 45  ? 2.922   16.219  -6.261  1.00 0.00 ? 45  ARG A C    2  
ATOM 2402  O O    . ARG A 1 45  ? 2.468   15.416  -5.445  1.00 0.00 ? 45  ARG A O    2  
ATOM 2403  C CB   . ARG A 1 45  ? 5.400   16.552  -6.354  1.00 0.00 ? 45  ARG A CB   2  
ATOM 2404  C CG   . ARG A 1 45  ? 6.601   17.439  -6.072  1.00 0.00 ? 45  ARG A CG   2  
ATOM 2405  C CD   . ARG A 1 45  ? 6.644   18.634  -7.012  1.00 0.00 ? 45  ARG A CD   2  
ATOM 2406  N NE   . ARG A 1 45  ? 7.572   19.662  -6.548  1.00 0.00 ? 45  ARG A NE   2  
ATOM 2407  C CZ   . ARG A 1 45  ? 7.491   20.939  -6.904  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2408  N NH1  . ARG A 1 45  ? 6.530   21.343  -7.723  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2409  N NH2  . ARG A 1 45  ? 8.373   21.816  -6.440  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2410  H H    . ARG A 1 45  ? 4.388   16.720  -3.858  1.00 0.00 ? 45  ARG A H    2  
ATOM 2411  H HA   . ARG A 1 45  ? 3.922   18.099  -6.415  1.00 0.00 ? 45  ARG A HA   2  
ATOM 2412  H HB2  . ARG A 1 45  ? 5.546   15.613  -5.841  1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2413  H HB3  . ARG A 1 45  ? 5.356   16.369  -7.418  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2414  H HG2  . ARG A 1 45  ? 6.541   17.797  -5.055  1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2415  H HG3  . ARG A 1 45  ? 7.503   16.859  -6.200  1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2416  H HD2  . ARG A 1 45  ? 6.955   18.296  -7.989  1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2417  H HD3  . ARG A 1 45  ? 5.653   19.059  -7.077  1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2418  H HE   . ARG A 1 45  ? 8.290   19.385  -5.942  1.00 0.00 ? 45  ARG A HE   2  
ATOM 2419  H HH11 . ARG A 1 45  ? 5.864   20.686  -8.074  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2420  H HH12 . ARG A 1 45  ? 6.471   22.306  -7.989  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2421  H HH21 . ARG A 1 45  ? 9.099   21.515  -5.822  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2422  H HH22 . ARG A 1 45  ? 8.312   22.776  -6.708  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2423  N N    . PRO A 1 46  ? 2.440   16.320  -7.508  1.00 0.00 ? 46  PRO A N    2  
ATOM 2424  C CA   . PRO A 1 46  ? 1.340   15.487  -8.002  1.00 0.00 ? 46  PRO A CA   2  
ATOM 2425  C C    . PRO A 1 46  ? 1.749   14.028  -8.174  1.00 0.00 ? 46  PRO A C    2  
ATOM 2426  O O    . PRO A 1 46  ? 2.749   13.726  -8.826  1.00 0.00 ? 46  PRO A O    2  
ATOM 2427  C CB   . PRO A 1 46  ? 1.003   16.111  -9.359  1.00 0.00 ? 46  PRO A CB   2  
ATOM 2428  C CG   . PRO A 1 46  ? 2.263   16.777  -9.792  1.00 0.00 ? 46  PRO A CG   2  
ATOM 2429  C CD   . PRO A 1 46  ? 2.933   17.255  -8.534  1.00 0.00 ? 46  PRO A CD   2  
ATOM 2430  H HA   . PRO A 1 46  ? 0.477   15.544  -7.354  1.00 0.00 ? 46  PRO A HA   2  
ATOM 2431  H HB2  . PRO A 1 46  ? 0.707   15.335  -10.051 1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2432  H HB3  . PRO A 1 46  ? 0.200   16.823  -9.242  1.00 0.00 ? 46  PRO A HB3  2  
ATOM 2433  H HG2  . PRO A 1 46  ? 2.894   16.070  -10.307 1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2434  H HG3  . PRO A 1 46  ? 2.033   17.614  -10.435 1.00 0.00 ? 46  PRO A HG3  2  
ATOM 2435  H HD2  . PRO A 1 46  ? 4.006   17.192  -8.630  1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2436  H HD3  . PRO A 1 46  ? 2.632   18.268  -8.307  1.00 0.00 ? 46  PRO A HD3  2  
ATOM 2437  N N    . LEU A 1 47  ? 0.970   13.127  -7.585  1.00 0.00 ? 47  LEU A N    2  
ATOM 2438  C CA   . LEU A 1 47  ? 1.252   11.698  -7.674  1.00 0.00 ? 47  LEU A CA   2  
ATOM 2439  C C    . LEU A 1 47  ? 0.981   11.176  -9.081  1.00 0.00 ? 47  LEU A C    2  
ATOM 2440  O O    . LEU A 1 47  ? 0.136   11.709  -9.799  1.00 0.00 ? 47  LEU A O    2  
ATOM 2441  C CB   . LEU A 1 47  ? 0.404   10.928  -6.660  1.00 0.00 ? 47  LEU A CB   2  
ATOM 2442  C CG   . LEU A 1 47  ? 0.474   11.420  -5.214  1.00 0.00 ? 47  LEU A CG   2  
ATOM 2443  C CD1  . LEU A 1 47  ? -0.735  10.939  -4.427  1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2444  C CD2  . LEU A 1 47  ? 1.763   10.954  -4.554  1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2445  H H    . LEU A 1 47  ? 0.187   13.428  -7.079  1.00 0.00 ? 47  LEU A H    2  
ATOM 2446  H HA   . LEU A 1 47  ? 2.296   11.551  -7.443  1.00 0.00 ? 47  LEU A HA   2  
ATOM 2447  H HB2  . LEU A 1 47  ? -0.625  10.984  -6.979  1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2448  H HB3  . LEU A 1 47  ? 0.727   9.897   -6.675  1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2449  H HG   . LEU A 1 47  ? 0.466   12.502  -5.208  1.00 0.00 ? 47  LEU A HG   2  
ATOM 2450  H HD11 . LEU A 1 47  ? -1.617  11.460  -4.768  1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2451  H HD12 . LEU A 1 47  ? -0.583  11.137  -3.376  1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2452  H HD13 . LEU A 1 47  ? -0.863  9.877   -4.578  1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2453  H HD21 . LEU A 1 47  ? 1.531   10.458  -3.623  1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2454  H HD22 . LEU A 1 47  ? 2.396   11.807  -4.359  1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2455  H HD23 . LEU A 1 47  ? 2.276   10.267  -5.211  1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2456  N N    . GLN A 1 48  ? 1.704   10.130  -9.468  1.00 0.00 ? 48  GLN A N    2  
ATOM 2457  C CA   . GLN A 1 48  ? 1.541   9.535   -10.789 1.00 0.00 ? 48  GLN A CA   2  
ATOM 2458  C C    . GLN A 1 48  ? 0.792   8.209   -10.700 1.00 0.00 ? 48  GLN A C    2  
ATOM 2459  O O    . GLN A 1 48  ? 0.247   7.725   -11.691 1.00 0.00 ? 48  GLN A O    2  
ATOM 2460  C CB   . GLN A 1 48  ? 2.905   9.321   -11.447 1.00 0.00 ? 48  GLN A CB   2  
ATOM 2461  C CG   . GLN A 1 48  ? 3.524   10.597  -11.993 1.00 0.00 ? 48  GLN A CG   2  
ATOM 2462  C CD   . GLN A 1 48  ? 4.936   10.389  -12.503 1.00 0.00 ? 48  GLN A CD   2  
ATOM 2463  O OE1  . GLN A 1 48  ? 5.342   9.264   -12.800 1.00 0.00 ? 48  GLN A OE1  2  
ATOM 2464  N NE2  . GLN A 1 48  ? 5.694   11.474  -12.609 1.00 0.00 ? 48  GLN A NE2  2  
ATOM 2465  H H    . GLN A 1 48  ? 2.363   9.749   -8.850  1.00 0.00 ? 48  GLN A H    2  
ATOM 2466  H HA   . GLN A 1 48  ? 0.964   10.220  -11.391 1.00 0.00 ? 48  GLN A HA   2  
ATOM 2467  H HB2  . GLN A 1 48  ? 3.581   8.901   -10.718 1.00 0.00 ? 48  GLN A HB2  2  
ATOM 2468  H HB3  . GLN A 1 48  ? 2.791   8.623   -12.264 1.00 0.00 ? 48  GLN A HB3  2  
ATOM 2469  H HG2  . GLN A 1 48  ? 2.913   10.959  -12.807 1.00 0.00 ? 48  GLN A HG2  2  
ATOM 2470  H HG3  . GLN A 1 48  ? 3.546   11.336  -11.206 1.00 0.00 ? 48  GLN A HG3  2  
ATOM 2471  H HE21 . GLN A 1 48  ? 5.304   12.337  -12.354 1.00 0.00 ? 48  GLN A HE21 2  
ATOM 2472  H HE22 . GLN A 1 48  ? 6.611   11.368  -12.935 1.00 0.00 ? 48  GLN A HE22 2  
ATOM 2473  N N    . GLY A 1 49  ? 0.769   7.627   -9.505  1.00 0.00 ? 49  GLY A N    2  
ATOM 2474  C CA   . GLY A 1 49  ? 0.084   6.362   -9.309  1.00 0.00 ? 49  GLY A CA   2  
ATOM 2475  C C    . GLY A 1 49  ? 0.220   5.843   -7.891  1.00 0.00 ? 49  GLY A C    2  
ATOM 2476  O O    . GLY A 1 49  ? 0.303   6.623   -6.943  1.00 0.00 ? 49  GLY A O    2  
ATOM 2477  H H    . GLY A 1 49  ? 1.220   8.059   -8.750  1.00 0.00 ? 49  GLY A H    2  
ATOM 2478  H HA2  . GLY A 1 49  ? -0.963  6.493   -9.535  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 2479  H HA3  . GLY A 1 49  ? 0.500   5.632   -9.988  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 2480  N N    . TYR A 1 50  ? 0.240   4.523   -7.746  1.00 0.00 ? 50  TYR A N    2  
ATOM 2481  C CA   . TYR A 1 50  ? 0.361   3.900   -6.433  1.00 0.00 ? 50  TYR A CA   2  
ATOM 2482  C C    . TYR A 1 50  ? 0.985   2.513   -6.544  1.00 0.00 ? 50  TYR A C    2  
ATOM 2483  O O    . TYR A 1 50  ? 1.165   1.986   -7.642  1.00 0.00 ? 50  TYR A O    2  
ATOM 2484  C CB   . TYR A 1 50  ? -1.010  3.803   -5.762  1.00 0.00 ? 50  TYR A CB   2  
ATOM 2485  C CG   . TYR A 1 50  ? -1.538  5.132   -5.270  1.00 0.00 ? 50  TYR A CG   2  
ATOM 2486  C CD1  . TYR A 1 50  ? -0.911  5.809   -4.231  1.00 0.00 ? 50  TYR A CD1  2  
ATOM 2487  C CD2  . TYR A 1 50  ? -2.665  5.709   -5.842  1.00 0.00 ? 50  TYR A CD2  2  
ATOM 2488  C CE1  . TYR A 1 50  ? -1.391  7.022   -3.777  1.00 0.00 ? 50  TYR A CE1  2  
ATOM 2489  C CE2  . TYR A 1 50  ? -3.151  6.922   -5.396  1.00 0.00 ? 50  TYR A CE2  2  
ATOM 2490  C CZ   . TYR A 1 50  ? -2.511  7.575   -4.363  1.00 0.00 ? 50  TYR A CZ   2  
ATOM 2491  O OH   . TYR A 1 50  ? -2.992  8.784   -3.914  1.00 0.00 ? 50  TYR A OH   2  
ATOM 2492  H H    . TYR A 1 50  ? 0.169   3.953   -8.540  1.00 0.00 ? 50  TYR A H    2  
ATOM 2493  H HA   . TYR A 1 50  ? 1.004   4.524   -5.829  1.00 0.00 ? 50  TYR A HA   2  
ATOM 2494  H HB2  . TYR A 1 50  ? -1.721  3.406   -6.469  1.00 0.00 ? 50  TYR A HB2  2  
ATOM 2495  H HB3  . TYR A 1 50  ? -0.942  3.138   -4.914  1.00 0.00 ? 50  TYR A HB3  2  
ATOM 2496  H HD1  . TYR A 1 50  ? -0.034  5.373   -3.774  1.00 0.00 ? 50  TYR A HD1  2  
ATOM 2497  H HD2  . TYR A 1 50  ? -3.164  5.195   -6.651  1.00 0.00 ? 50  TYR A HD2  2  
ATOM 2498  H HE1  . TYR A 1 50  ? -0.890  7.534   -2.969  1.00 0.00 ? 50  TYR A HE1  2  
ATOM 2499  H HE2  . TYR A 1 50  ? -4.028  7.355   -5.854  1.00 0.00 ? 50  TYR A HE2  2  
ATOM 2500  H HH   . TYR A 1 50  ? -2.818  9.461   -4.572  1.00 0.00 ? 50  TYR A HH   2  
ATOM 2501  N N    . SER A 1 51  ? 1.313   1.925   -5.398  1.00 0.00 ? 51  SER A N    2  
ATOM 2502  C CA   . SER A 1 51  ? 1.920   0.599   -5.364  1.00 0.00 ? 51  SER A CA   2  
ATOM 2503  C C    . SER A 1 51  ? 1.413   -0.200  -4.167  1.00 0.00 ? 51  SER A C    2  
ATOM 2504  O O    . SER A 1 51  ? 1.417   0.285   -3.036  1.00 0.00 ? 51  SER A O    2  
ATOM 2505  C CB   . SER A 1 51  ? 3.444   0.714   -5.307  1.00 0.00 ? 51  SER A CB   2  
ATOM 2506  O OG   . SER A 1 51  ? 4.053   -0.565  -5.307  1.00 0.00 ? 51  SER A OG   2  
ATOM 2507  H H    . SER A 1 51  ? 1.145   2.396   -4.554  1.00 0.00 ? 51  SER A H    2  
ATOM 2508  H HA   . SER A 1 51  ? 1.640   0.084   -6.271  1.00 0.00 ? 51  SER A HA   2  
ATOM 2509  H HB2  . SER A 1 51  ? 3.794   1.266   -6.167  1.00 0.00 ? 51  SER A HB2  2  
ATOM 2510  H HB3  . SER A 1 51  ? 3.729   1.236   -4.405  1.00 0.00 ? 51  SER A HB3  2  
ATOM 2511  H HG   . SER A 1 51  ? 3.518   -1.174  -4.792  1.00 0.00 ? 51  SER A HG   2  
ATOM 2512  N N    . VAL A 1 52  ? 0.978   -1.429  -4.426  1.00 0.00 ? 52  VAL A N    2  
ATOM 2513  C CA   . VAL A 1 52  ? 0.469   -2.297  -3.371  1.00 0.00 ? 52  VAL A CA   2  
ATOM 2514  C C    . VAL A 1 52  ? 1.220   -3.624  -3.341  1.00 0.00 ? 52  VAL A C    2  
ATOM 2515  O O    . VAL A 1 52  ? 0.958   -4.514  -4.149  1.00 0.00 ? 52  VAL A O    2  
ATOM 2516  C CB   . VAL A 1 52  ? -1.035  -2.575  -3.550  1.00 0.00 ? 52  VAL A CB   2  
ATOM 2517  C CG1  . VAL A 1 52  ? -1.572  -3.383  -2.378  1.00 0.00 ? 52  VAL A CG1  2  
ATOM 2518  C CG2  . VAL A 1 52  ? -1.803  -1.271  -3.706  1.00 0.00 ? 52  VAL A CG2  2  
ATOM 2519  H H    . VAL A 1 52  ? 1.000   -1.760  -5.348  1.00 0.00 ? 52  VAL A H    2  
ATOM 2520  H HA   . VAL A 1 52  ? 0.610   -1.793  -2.426  1.00 0.00 ? 52  VAL A HA   2  
ATOM 2521  H HB   . VAL A 1 52  ? -1.169  -3.157  -4.450  1.00 0.00 ? 52  VAL A HB   2  
ATOM 2522  H HG11 . VAL A 1 52  ? -2.113  -4.241  -2.751  1.00 0.00 ? 52  VAL A HG11 2  
ATOM 2523  H HG12 . VAL A 1 52  ? -0.749  -3.715  -1.762  1.00 0.00 ? 52  VAL A HG12 2  
ATOM 2524  H HG13 . VAL A 1 52  ? -2.237  -2.767  -1.791  1.00 0.00 ? 52  VAL A HG13 2  
ATOM 2525  H HG21 . VAL A 1 52  ? -2.737  -1.336  -3.167  1.00 0.00 ? 52  VAL A HG21 2  
ATOM 2526  H HG22 . VAL A 1 52  ? -1.214  -0.458  -3.309  1.00 0.00 ? 52  VAL A HG22 2  
ATOM 2527  H HG23 . VAL A 1 52  ? -2.003  -1.094  -4.752  1.00 0.00 ? 52  VAL A HG23 2  
ATOM 2528  N N    . GLU A 1 53  ? 2.154   -3.748  -2.404  1.00 0.00 ? 53  GLU A N    2  
ATOM 2529  C CA   . GLU A 1 53  ? 2.943   -4.966  -2.269  1.00 0.00 ? 53  GLU A CA   2  
ATOM 2530  C C    . GLU A 1 53  ? 2.374   -5.866  -1.176  1.00 0.00 ? 53  GLU A C    2  
ATOM 2531  O O    . GLU A 1 53  ? 2.044   -5.401  -0.084  1.00 0.00 ? 53  GLU A O    2  
ATOM 2532  C CB   . GLU A 1 53  ? 4.401   -4.624  -1.955  1.00 0.00 ? 53  GLU A CB   2  
ATOM 2533  C CG   . GLU A 1 53  ? 5.243   -4.355  -3.191  1.00 0.00 ? 53  GLU A CG   2  
ATOM 2534  C CD   . GLU A 1 53  ? 6.450   -3.485  -2.897  1.00 0.00 ? 53  GLU A CD   2  
ATOM 2535  O OE1  . GLU A 1 53  ? 6.377   -2.671  -1.953  1.00 0.00 ? 53  GLU A OE1  2  
ATOM 2536  O OE2  . GLU A 1 53  ? 7.466   -3.618  -3.610  1.00 0.00 ? 53  GLU A OE2  2  
ATOM 2537  H H    . GLU A 1 53  ? 2.317   -3.002  -1.789  1.00 0.00 ? 53  GLU A H    2  
ATOM 2538  H HA   . GLU A 1 53  ? 2.902   -5.494  -3.210  1.00 0.00 ? 53  GLU A HA   2  
ATOM 2539  H HB2  . GLU A 1 53  ? 4.425   -3.744  -1.329  1.00 0.00 ? 53  GLU A HB2  2  
ATOM 2540  H HB3  . GLU A 1 53  ? 4.844   -5.449  -1.416  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 2541  H HG2  . GLU A 1 53  ? 5.587   -5.298  -3.589  1.00 0.00 ? 53  GLU A HG2  2  
ATOM 2542  H HG3  . GLU A 1 53  ? 4.630   -3.857  -3.927  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 2543  N N    . TYR A 1 54  ? 2.261   -7.154  -1.478  1.00 0.00 ? 54  TYR A N    2  
ATOM 2544  C CA   . TYR A 1 54  ? 1.728   -8.119  -0.523  1.00 0.00 ? 54  TYR A CA   2  
ATOM 2545  C C    . TYR A 1 54  ? 2.518   -9.424  -0.569  1.00 0.00 ? 54  TYR A C    2  
ATOM 2546  O O    . TYR A 1 54  ? 2.940   -9.868  -1.636  1.00 0.00 ? 54  TYR A O    2  
ATOM 2547  C CB   . TYR A 1 54  ? 0.251   -8.393  -0.812  1.00 0.00 ? 54  TYR A CB   2  
ATOM 2548  C CG   . TYR A 1 54  ? 0.025   -9.290  -2.009  1.00 0.00 ? 54  TYR A CG   2  
ATOM 2549  C CD1  . TYR A 1 54  ? 0.296   -10.651 -1.942  1.00 0.00 ? 54  TYR A CD1  2  
ATOM 2550  C CD2  . TYR A 1 54  ? -0.458  -8.776  -3.205  1.00 0.00 ? 54  TYR A CD2  2  
ATOM 2551  C CE1  . TYR A 1 54  ? 0.092   -11.474 -3.032  1.00 0.00 ? 54  TYR A CE1  2  
ATOM 2552  C CE2  . TYR A 1 54  ? -0.667  -9.592  -4.301  1.00 0.00 ? 54  TYR A CE2  2  
ATOM 2553  C CZ   . TYR A 1 54  ? -0.390  -10.940 -4.209  1.00 0.00 ? 54  TYR A CZ   2  
ATOM 2554  O OH   . TYR A 1 54  ? -0.596  -11.756 -5.298  1.00 0.00 ? 54  TYR A OH   2  
ATOM 2555  H H    . TYR A 1 54  ? 2.540   -7.464  -2.364  1.00 0.00 ? 54  TYR A H    2  
ATOM 2556  H HA   . TYR A 1 54  ? 1.818   -7.692  0.465   1.00 0.00 ? 54  TYR A HA   2  
ATOM 2557  H HB2  . TYR A 1 54  ? -0.195  -8.869  0.047   1.00 0.00 ? 54  TYR A HB2  2  
ATOM 2558  H HB3  . TYR A 1 54  ? -0.251  -7.456  -1.000  1.00 0.00 ? 54  TYR A HB3  2  
ATOM 2559  H HD1  . TYR A 1 54  ? 0.674   -11.067 -1.019  1.00 0.00 ? 54  TYR A HD1  2  
ATOM 2560  H HD2  . TYR A 1 54  ? -0.673  -7.719  -3.274  1.00 0.00 ? 54  TYR A HD2  2  
ATOM 2561  H HE1  . TYR A 1 54  ? 0.308   -12.530 -2.962  1.00 0.00 ? 54  TYR A HE1  2  
ATOM 2562  H HE2  . TYR A 1 54  ? -1.044  -9.173  -5.222  1.00 0.00 ? 54  TYR A HE2  2  
ATOM 2563  H HH   . TYR A 1 54  ? -1.271  -11.372 -5.862  1.00 0.00 ? 54  TYR A HH   2  
ATOM 2564  N N    . GLN A 1 55  ? 2.712   -10.032 0.597   1.00 0.00 ? 55  GLN A N    2  
ATOM 2565  C CA   . GLN A 1 55  ? 3.450   -11.285 0.691   1.00 0.00 ? 55  GLN A CA   2  
ATOM 2566  C C    . GLN A 1 55  ? 3.214   -11.957 2.040   1.00 0.00 ? 55  GLN A C    2  
ATOM 2567  O O    . GLN A 1 55  ? 2.864   -11.298 3.020   1.00 0.00 ? 55  GLN A O    2  
ATOM 2568  C CB   . GLN A 1 55  ? 4.946   -11.037 0.486   1.00 0.00 ? 55  GLN A CB   2  
ATOM 2569  C CG   . GLN A 1 55  ? 5.695   -10.736 1.774   1.00 0.00 ? 55  GLN A CG   2  
ATOM 2570  C CD   . GLN A 1 55  ? 7.168   -10.462 1.542   1.00 0.00 ? 55  GLN A CD   2  
ATOM 2571  O OE1  . GLN A 1 55  ? 7.726   -9.508  2.084   1.00 0.00 ? 55  GLN A OE1  2  
ATOM 2572  N NE2  . GLN A 1 55  ? 7.806   -11.300 0.733   1.00 0.00 ? 55  GLN A NE2  2  
ATOM 2573  H H    . GLN A 1 55  ? 2.350   -9.628  1.413   1.00 0.00 ? 55  GLN A H    2  
ATOM 2574  H HA   . GLN A 1 55  ? 3.093   -11.939 -0.090  1.00 0.00 ? 55  GLN A HA   2  
ATOM 2575  H HB2  . GLN A 1 55  ? 5.385   -11.914 0.035   1.00 0.00 ? 55  GLN A HB2  2  
ATOM 2576  H HB3  . GLN A 1 55  ? 5.071   -10.198 -0.182  1.00 0.00 ? 55  GLN A HB3  2  
ATOM 2577  H HG2  . GLN A 1 55  ? 5.252   -9.868  2.238   1.00 0.00 ? 55  GLN A HG2  2  
ATOM 2578  H HG3  . GLN A 1 55  ? 5.601   -11.585 2.436   1.00 0.00 ? 55  GLN A HG3  2  
ATOM 2579  H HE21 . GLN A 1 55  ? 7.296   -12.038 0.336   1.00 0.00 ? 55  GLN A HE21 2  
ATOM 2580  H HE22 . GLN A 1 55  ? 8.758   -11.146 0.565   1.00 0.00 ? 55  GLN A HE22 2  
ATOM 2581  N N    . LEU A 1 56  ? 3.408   -13.270 2.083   1.00 0.00 ? 56  LEU A N    2  
ATOM 2582  C CA   . LEU A 1 56  ? 3.216   -14.032 3.312   1.00 0.00 ? 56  LEU A CA   2  
ATOM 2583  C C    . LEU A 1 56  ? 3.921   -13.358 4.486   1.00 0.00 ? 56  LEU A C    2  
ATOM 2584  O O    . LEU A 1 56  ? 5.139   -13.180 4.472   1.00 0.00 ? 56  LEU A O    2  
ATOM 2585  C CB   . LEU A 1 56  ? 3.739   -15.458 3.139   1.00 0.00 ? 56  LEU A CB   2  
ATOM 2586  C CG   . LEU A 1 56  ? 2.837   -16.414 2.358   1.00 0.00 ? 56  LEU A CG   2  
ATOM 2587  C CD1  . LEU A 1 56  ? 3.600   -17.671 1.968   1.00 0.00 ? 56  LEU A CD1  2  
ATOM 2588  C CD2  . LEU A 1 56  ? 1.603   -16.769 3.174   1.00 0.00 ? 56  LEU A CD2  2  
ATOM 2589  H H    . LEU A 1 56  ? 3.686   -13.740 1.270   1.00 0.00 ? 56  LEU A H    2  
ATOM 2590  H HA   . LEU A 1 56  ? 2.156   -14.068 3.517   1.00 0.00 ? 56  LEU A HA   2  
ATOM 2591  H HB2  . LEU A 1 56  ? 4.686   -15.403 2.624   1.00 0.00 ? 56  LEU A HB2  2  
ATOM 2592  H HB3  . LEU A 1 56  ? 3.892   -15.876 4.124   1.00 0.00 ? 56  LEU A HB3  2  
ATOM 2593  H HG   . LEU A 1 56  ? 2.510   -15.928 1.449   1.00 0.00 ? 56  LEU A HG   2  
ATOM 2594  H HD11 . LEU A 1 56  ? 2.913   -18.400 1.567   1.00 0.00 ? 56  LEU A HD11 2  
ATOM 2595  H HD12 . LEU A 1 56  ? 4.090   -18.079 2.840   1.00 0.00 ? 56  LEU A HD12 2  
ATOM 2596  H HD13 . LEU A 1 56  ? 4.341   -17.425 1.222   1.00 0.00 ? 56  LEU A HD13 2  
ATOM 2597  H HD21 . LEU A 1 56  ? 1.856   -17.531 3.896   1.00 0.00 ? 56  LEU A HD21 2  
ATOM 2598  H HD22 . LEU A 1 56  ? 0.831   -17.139 2.516   1.00 0.00 ? 56  LEU A HD22 2  
ATOM 2599  H HD23 . LEU A 1 56  ? 1.246   -15.889 3.688   1.00 0.00 ? 56  LEU A HD23 2  
ATOM 2600  N N    . LEU A 1 57  ? 3.147   -12.988 5.500   1.00 0.00 ? 57  LEU A N    2  
ATOM 2601  C CA   . LEU A 1 57  ? 3.697   -12.336 6.684   1.00 0.00 ? 57  LEU A CA   2  
ATOM 2602  C C    . LEU A 1 57  ? 5.019   -12.978 7.094   1.00 0.00 ? 57  LEU A C    2  
ATOM 2603  O O    . LEU A 1 57  ? 5.968   -12.286 7.461   1.00 0.00 ? 57  LEU A O    2  
ATOM 2604  C CB   . LEU A 1 57  ? 2.700   -12.411 7.841   1.00 0.00 ? 57  LEU A CB   2  
ATOM 2605  C CG   . LEU A 1 57  ? 2.857   -11.351 8.932   1.00 0.00 ? 57  LEU A CG   2  
ATOM 2606  C CD1  . LEU A 1 57  ? 2.720   -9.955  8.345   1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2607  C CD2  . LEU A 1 57  ? 1.836   -11.569 10.039  1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2608  H H    . LEU A 1 57  ? 2.183   -13.156 5.453   1.00 0.00 ? 57  LEU A H    2  
ATOM 2609  H HA   . LEU A 1 57  ? 3.875   -11.300 6.438   1.00 0.00 ? 57  LEU A HA   2  
ATOM 2610  H HB2  . LEU A 1 57  ? 1.707   -12.315 7.429   1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2611  H HB3  . LEU A 1 57  ? 2.804   -13.382 8.304   1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2612  H HG   . LEU A 1 57  ? 3.845   -11.434 9.366   1.00 0.00 ? 57  LEU A HG   2  
ATOM 2613  H HD11 . LEU A 1 57  ? 3.700   -9.529  8.196   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2614  H HD12 . LEU A 1 57  ? 2.156   -9.333  9.024   1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2615  H HD13 . LEU A 1 57  ? 2.204   -10.013 7.397   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2616  H HD21 . LEU A 1 57  ? 1.555   -12.611 10.070  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2617  H HD22 . LEU A 1 57  ? 0.961   -10.966 9.845   1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2618  H HD23 . LEU A 1 57  ? 2.267   -11.283 10.988  1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2619  N N    . ASN A 1 58  ? 5.073   -14.304 7.027   1.00 0.00 ? 58  ASN A N    2  
ATOM 2620  C CA   . ASN A 1 58  ? 6.279   -15.039 7.390   1.00 0.00 ? 58  ASN A CA   2  
ATOM 2621  C C    . ASN A 1 58  ? 7.397   -14.780 6.384   1.00 0.00 ? 58  ASN A C    2  
ATOM 2622  O O    . ASN A 1 58  ? 8.510   -14.412 6.759   1.00 0.00 ? 58  ASN A O    2  
ATOM 2623  C CB   . ASN A 1 58  ? 5.984   -16.538 7.466   1.00 0.00 ? 58  ASN A CB   2  
ATOM 2624  C CG   . ASN A 1 58  ? 4.756   -16.844 8.301   1.00 0.00 ? 58  ASN A CG   2  
ATOM 2625  O OD1  . ASN A 1 58  ? 4.520   -16.214 9.332   1.00 0.00 ? 58  ASN A OD1  2  
ATOM 2626  N ND2  . ASN A 1 58  ? 3.966   -17.816 7.859   1.00 0.00 ? 58  ASN A ND2  2  
ATOM 2627  H H    . ASN A 1 58  ? 4.283   -14.800 6.726   1.00 0.00 ? 58  ASN A H    2  
ATOM 2628  H HA   . ASN A 1 58  ? 6.597   -14.694 8.362   1.00 0.00 ? 58  ASN A HA   2  
ATOM 2629  H HB2  . ASN A 1 58  ? 5.820   -16.918 6.468   1.00 0.00 ? 58  ASN A HB2  2  
ATOM 2630  H HB3  . ASN A 1 58  ? 6.830   -17.044 7.905   1.00 0.00 ? 58  ASN A HB3  2  
ATOM 2631  H HD21 . ASN A 1 58  ? 4.216   -18.274 7.029   1.00 0.00 ? 58  ASN A HD21 2  
ATOM 2632  H HD22 . ASN A 1 58  ? 3.165   -18.033 8.379   1.00 0.00 ? 58  ASN A HD22 2  
ATOM 2633  N N    . GLY A 1 59  ? 7.092   -14.975 5.105   1.00 0.00 ? 59  GLY A N    2  
ATOM 2634  C CA   . GLY A 1 59  ? 8.081   -14.757 4.065   1.00 0.00 ? 59  GLY A CA   2  
ATOM 2635  C C    . GLY A 1 59  ? 8.006   -15.799 2.967   1.00 0.00 ? 59  GLY A C    2  
ATOM 2636  O O    . GLY A 1 59  ? 8.513   -16.910 3.119   1.00 0.00 ? 59  GLY A O    2  
ATOM 2637  H H    . GLY A 1 59  ? 6.188   -15.269 4.865   1.00 0.00 ? 59  GLY A H    2  
ATOM 2638  H HA2  . GLY A 1 59  ? 7.923   -13.781 3.632   1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2639  H HA3  . GLY A 1 59  ? 9.065   -14.789 4.508   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2640  N N    . GLY A 1 60  ? 7.370   -15.441 1.855   1.00 0.00 ? 60  GLY A N    2  
ATOM 2641  C CA   . GLY A 1 60  ? 7.241   -16.365 0.744   1.00 0.00 ? 60  GLY A CA   2  
ATOM 2642  C C    . GLY A 1 60  ? 7.350   -15.673 -0.601  1.00 0.00 ? 60  GLY A C    2  
ATOM 2643  O O    . GLY A 1 60  ? 8.434   -15.250 -1.002  1.00 0.00 ? 60  GLY A O    2  
ATOM 2644  H H    . GLY A 1 60  ? 6.986   -14.541 1.789   1.00 0.00 ? 60  GLY A H    2  
ATOM 2645  H HA2  . GLY A 1 60  ? 8.018   -17.111 0.818   1.00 0.00 ? 60  GLY A HA2  2  
ATOM 2646  H HA3  . GLY A 1 60  ? 6.279   -16.853 0.807   1.00 0.00 ? 60  GLY A HA3  2  
ATOM 2647  N N    . GLU A 1 61  ? 6.225   -15.560 -1.300  1.00 0.00 ? 61  GLU A N    2  
ATOM 2648  C CA   . GLU A 1 61  ? 6.201   -14.918 -2.608  1.00 0.00 ? 61  GLU A CA   2  
ATOM 2649  C C    . GLU A 1 61  ? 5.685   -13.485 -2.502  1.00 0.00 ? 61  GLU A C    2  
ATOM 2650  O O    . GLU A 1 61  ? 4.589   -13.244 -1.995  1.00 0.00 ? 61  GLU A O    2  
ATOM 2651  C CB   . GLU A 1 61  ? 5.325   -15.715 -3.577  1.00 0.00 ? 61  GLU A CB   2  
ATOM 2652  C CG   . GLU A 1 61  ? 5.648   -15.461 -5.040  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2653  C CD   . GLU A 1 61  ? 5.002   -16.475 -5.964  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2654  O OE1  . GLU A 1 61  ? 3.787   -16.724 -5.816  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2655  O OE2  . GLU A 1 61  ? 5.711   -17.019 -6.836  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2656  H H    . GLU A 1 61  ? 5.392   -15.918 -0.927  1.00 0.00 ? 61  GLU A H    2  
ATOM 2657  H HA   . GLU A 1 61  ? 7.212   -14.896 -2.986  1.00 0.00 ? 61  GLU A HA   2  
ATOM 2658  H HB2  . GLU A 1 61  ? 5.456   -16.769 -3.378  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2659  H HB3  . GLU A 1 61  ? 4.291   -15.452 -3.408  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2660  H HG2  . GLU A 1 61  ? 5.295   -14.477 -5.307  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2661  H HG3  . GLU A 1 61  ? 6.719   -15.507 -5.172  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2662  N N    . LEU A 1 62  ? 6.484   -12.538 -2.982  1.00 0.00 ? 62  LEU A N    2  
ATOM 2663  C CA   . LEU A 1 62  ? 6.110   -11.129 -2.941  1.00 0.00 ? 62  LEU A CA   2  
ATOM 2664  C C    . LEU A 1 62  ? 5.543   -10.676 -4.283  1.00 0.00 ? 62  LEU A C    2  
ATOM 2665  O O    . LEU A 1 62  ? 6.148   -10.901 -5.332  1.00 0.00 ? 62  LEU A O    2  
ATOM 2666  C CB   . LEU A 1 62  ? 7.321   -10.271 -2.571  1.00 0.00 ? 62  LEU A CB   2  
ATOM 2667  C CG   . LEU A 1 62  ? 7.111   -8.757  -2.620  1.00 0.00 ? 62  LEU A CG   2  
ATOM 2668  C CD1  . LEU A 1 62  ? 6.946   -8.288  -4.058  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 2669  C CD2  . LEU A 1 62  ? 5.903   -8.358  -1.785  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 2670  H H    . LEU A 1 62  ? 7.345   -12.792 -3.374  1.00 0.00 ? 62  LEU A H    2  
ATOM 2671  H HA   . LEU A 1 62  ? 5.350   -11.010 -2.184  1.00 0.00 ? 62  LEU A HA   2  
ATOM 2672  H HB2  . LEU A 1 62  ? 7.615   -10.530 -1.566  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 2673  H HB3  . LEU A 1 62  ? 8.121   -10.517 -3.254  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 2674  H HG   . LEU A 1 62  ? 7.981   -8.265  -2.208  1.00 0.00 ? 62  LEU A HG   2  
ATOM 2675  H HD11 . LEU A 1 62  ? 7.228   -9.083  -4.731  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 2676  H HD12 . LEU A 1 62  ? 7.576   -7.428  -4.230  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 2677  H HD13 . LEU A 1 62  ? 5.914   -8.018  -4.231  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 2678  H HD21 . LEU A 1 62  ? 6.097   -8.577  -0.745  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 2679  H HD22 . LEU A 1 62  ? 5.038   -8.914  -2.115  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 2680  H HD23 . LEU A 1 62  ? 5.717   -7.300  -1.903  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 2681  N N    . HIS A 1 63  ? 4.379   -10.036 -4.242  1.00 0.00 ? 63  HIS A N    2  
ATOM 2682  C CA   . HIS A 1 63  ? 3.731   -9.549  -5.455  1.00 0.00 ? 63  HIS A CA   2  
ATOM 2683  C C    . HIS A 1 63  ? 3.555   -8.034  -5.405  1.00 0.00 ? 63  HIS A C    2  
ATOM 2684  O O    . HIS A 1 63  ? 2.909   -7.504  -4.501  1.00 0.00 ? 63  HIS A O    2  
ATOM 2685  C CB   . HIS A 1 63  ? 2.373   -10.226 -5.640  1.00 0.00 ? 63  HIS A CB   2  
ATOM 2686  C CG   . HIS A 1 63  ? 2.466   -11.707 -5.847  1.00 0.00 ? 63  HIS A CG   2  
ATOM 2687  N ND1  . HIS A 1 63  ? 2.100   -12.327 -7.023  1.00 0.00 ? 63  HIS A ND1  2  
ATOM 2688  C CD2  . HIS A 1 63  ? 2.888   -12.691 -5.019  1.00 0.00 ? 63  HIS A CD2  2  
ATOM 2689  C CE1  . HIS A 1 63  ? 2.291   -13.629 -6.909  1.00 0.00 ? 63  HIS A CE1  2  
ATOM 2690  N NE2  . HIS A 1 63  ? 2.769   -13.876 -5.703  1.00 0.00 ? 63  HIS A NE2  2  
ATOM 2691  H H    . HIS A 1 63  ? 3.946   -9.887  -3.376  1.00 0.00 ? 63  HIS A H    2  
ATOM 2692  H HA   . HIS A 1 63  ? 4.365   -9.798  -6.292  1.00 0.00 ? 63  HIS A HA   2  
ATOM 2693  H HB2  . HIS A 1 63  ? 1.768   -10.052 -4.763  1.00 0.00 ? 63  HIS A HB2  2  
ATOM 2694  H HB3  . HIS A 1 63  ? 1.880   -9.800  -6.502  1.00 0.00 ? 63  HIS A HB3  2  
ATOM 2695  H HD2  . HIS A 1 63  ? 3.250   -12.569 -4.008  1.00 0.00 ? 63  HIS A HD2  2  
ATOM 2696  H HE1  . HIS A 1 63  ? 2.091   -14.366 -7.672  1.00 0.00 ? 63  HIS A HE1  2  
ATOM 2697  H HE2  . HIS A 1 63  ? 2.919   -14.769 -5.328  1.00 0.00 ? 63  HIS A HE2  2  
ATOM 2698  N N    . ARG A 1 64  ? 4.133   -7.344  -6.383  1.00 0.00 ? 64  ARG A N    2  
ATOM 2699  C CA   . ARG A 1 64  ? 4.042   -5.890  -6.449  1.00 0.00 ? 64  ARG A CA   2  
ATOM 2700  C C    . ARG A 1 64  ? 2.978   -5.458  -7.455  1.00 0.00 ? 64  ARG A C    2  
ATOM 2701  O O    . ARG A 1 64  ? 3.053   -5.795  -8.637  1.00 0.00 ? 64  ARG A O    2  
ATOM 2702  C CB   . ARG A 1 64  ? 5.395   -5.289  -6.833  1.00 0.00 ? 64  ARG A CB   2  
ATOM 2703  C CG   . ARG A 1 64  ? 5.412   -3.770  -6.823  1.00 0.00 ? 64  ARG A CG   2  
ATOM 2704  C CD   . ARG A 1 64  ? 6.720   -3.223  -7.374  1.00 0.00 ? 64  ARG A CD   2  
ATOM 2705  N NE   . ARG A 1 64  ? 6.833   -3.424  -8.816  1.00 0.00 ? 64  ARG A NE   2  
ATOM 2706  C CZ   . ARG A 1 64  ? 7.742   -2.821  -9.573  1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2707  N NH1  . ARG A 1 64  ? 8.614   -1.983  -9.027  1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2708  N NH2  . ARG A 1 64  ? 7.782   -3.055  -10.878 1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2709  H H    . ARG A 1 64  ? 4.635   -7.823  -7.075  1.00 0.00 ? 64  ARG A H    2  
ATOM 2710  H HA   . ARG A 1 64  ? 3.762   -5.530  -5.471  1.00 0.00 ? 64  ARG A HA   2  
ATOM 2711  H HB2  . ARG A 1 64  ? 6.142   -5.640  -6.136  1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2712  H HB3  . ARG A 1 64  ? 5.655   -5.624  -7.826  1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2713  H HG2  . ARG A 1 64  ? 4.598   -3.406  -7.432  1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2714  H HG3  . ARG A 1 64  ? 5.286   -3.424  -5.808  1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2715  H HD2  . ARG A 1 64  ? 6.770   -2.166  -7.162  1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2716  H HD3  . ARG A 1 64  ? 7.539   -3.727  -6.884  1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2717  H HE   . ARG A 1 64  ? 6.199   -4.039  -9.240  1.00 0.00 ? 64  ARG A HE   2  
ATOM 2718  H HH11 . ARG A 1 64  ? 8.587   -1.806  -8.044  1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2719  H HH12 . ARG A 1 64  ? 9.298   -1.531  -9.599  1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2720  H HH21 . ARG A 1 64  ? 7.127   -3.686  -11.293 1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2721  H HH22 . ARG A 1 64  ? 8.467   -2.600  -11.447 1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2722  N N    . LEU A 1 65  ? 1.989   -4.711  -6.977  1.00 0.00 ? 65  LEU A N    2  
ATOM 2723  C CA   . LEU A 1 65  ? 0.909   -4.233  -7.833  1.00 0.00 ? 65  LEU A CA   2  
ATOM 2724  C C    . LEU A 1 65  ? 1.026   -2.731  -8.070  1.00 0.00 ? 65  LEU A C    2  
ATOM 2725  O O    . LEU A 1 65  ? 0.995   -1.940  -7.128  1.00 0.00 ? 65  LEU A O    2  
ATOM 2726  C CB   . LEU A 1 65  ? -0.448  -4.558  -7.206  1.00 0.00 ? 65  LEU A CB   2  
ATOM 2727  C CG   . LEU A 1 65  ? -0.672  -6.018  -6.809  1.00 0.00 ? 65  LEU A CG   2  
ATOM 2728  C CD1  . LEU A 1 65  ? -1.882  -6.143  -5.897  1.00 0.00 ? 65  LEU A CD1  2  
ATOM 2729  C CD2  . LEU A 1 65  ? -0.842  -6.887  -8.047  1.00 0.00 ? 65  LEU A CD2  2  
ATOM 2730  H H    . LEU A 1 65  ? 1.983   -4.475  -6.026  1.00 0.00 ? 65  LEU A H    2  
ATOM 2731  H HA   . LEU A 1 65  ? 0.989   -4.742  -8.782  1.00 0.00 ? 65  LEU A HA   2  
ATOM 2732  H HB2  . LEU A 1 65  ? -0.555  -3.954  -6.318  1.00 0.00 ? 65  LEU A HB2  2  
ATOM 2733  H HB3  . LEU A 1 65  ? -1.214  -4.287  -7.919  1.00 0.00 ? 65  LEU A HB3  2  
ATOM 2734  H HG   . LEU A 1 65  ? 0.193   -6.373  -6.266  1.00 0.00 ? 65  LEU A HG   2  
ATOM 2735  H HD11 . LEU A 1 65  ? -1.879  -7.115  -5.427  1.00 0.00 ? 65  LEU A HD11 2  
ATOM 2736  H HD12 . LEU A 1 65  ? -2.784  -6.026  -6.478  1.00 0.00 ? 65  LEU A HD12 2  
ATOM 2737  H HD13 . LEU A 1 65  ? -1.841  -5.376  -5.138  1.00 0.00 ? 65  LEU A HD13 2  
ATOM 2738  H HD21 . LEU A 1 65  ? 0.010   -7.544  -8.145  1.00 0.00 ? 65  LEU A HD21 2  
ATOM 2739  H HD22 . LEU A 1 65  ? -0.914  -6.257  -8.921  1.00 0.00 ? 65  LEU A HD22 2  
ATOM 2740  H HD23 . LEU A 1 65  ? -1.743  -7.476  -7.952  1.00 0.00 ? 65  LEU A HD23 2  
ATOM 2741  N N    . ASN A 1 66  ? 1.158   -2.345  -9.335  1.00 0.00 ? 66  ASN A N    2  
ATOM 2742  C CA   . ASN A 1 66  ? 1.278   -0.936  -9.695  1.00 0.00 ? 66  ASN A CA   2  
ATOM 2743  C C    . ASN A 1 66  ? -0.070  -0.369  -10.129 1.00 0.00 ? 66  ASN A C    2  
ATOM 2744  O O    . ASN A 1 66  ? -0.892  -1.074  -10.716 1.00 0.00 ? 66  ASN A O    2  
ATOM 2745  C CB   . ASN A 1 66  ? 2.303   -0.761  -10.818 1.00 0.00 ? 66  ASN A CB   2  
ATOM 2746  C CG   . ASN A 1 66  ? 3.705   -1.142  -10.385 1.00 0.00 ? 66  ASN A CG   2  
ATOM 2747  O OD1  . ASN A 1 66  ? 4.312   -0.473  -9.548  1.00 0.00 ? 66  ASN A OD1  2  
ATOM 2748  N ND2  . ASN A 1 66  ? 4.228   -2.222  -10.955 1.00 0.00 ? 66  ASN A ND2  2  
ATOM 2749  H H    . ASN A 1 66  ? 1.176   -3.022  -10.042 1.00 0.00 ? 66  ASN A H    2  
ATOM 2750  H HA   . ASN A 1 66  ? 1.618   -0.399  -8.823  1.00 0.00 ? 66  ASN A HA   2  
ATOM 2751  H HB2  . ASN A 1 66  ? 2.023   -1.387  -11.653 1.00 0.00 ? 66  ASN A HB2  2  
ATOM 2752  H HB3  . ASN A 1 66  ? 2.310   0.271   -11.133 1.00 0.00 ? 66  ASN A HB3  2  
ATOM 2753  H HD21 . ASN A 1 66  ? 3.687   -2.705  -11.614 1.00 0.00 ? 66  ASN A HD21 2  
ATOM 2754  H HD22 . ASN A 1 66  ? 5.133   -2.491  -10.693 1.00 0.00 ? 66  ASN A HD22 2  
ATOM 2755  N N    . ILE A 1 67  ? -0.290  0.908   -9.837  1.00 0.00 ? 67  ILE A N    2  
ATOM 2756  C CA   . ILE A 1 67  ? -1.537  1.570   -10.198 1.00 0.00 ? 67  ILE A CA   2  
ATOM 2757  C C    . ILE A 1 67  ? -1.302  2.650   -11.249 1.00 0.00 ? 67  ILE A C    2  
ATOM 2758  O O    . ILE A 1 67  ? -0.707  3.693   -10.980 1.00 0.00 ? 67  ILE A O    2  
ATOM 2759  C CB   . ILE A 1 67  ? -2.215  2.204   -8.969  1.00 0.00 ? 67  ILE A CB   2  
ATOM 2760  C CG1  . ILE A 1 67  ? -2.076  1.287   -7.753  1.00 0.00 ? 67  ILE A CG1  2  
ATOM 2761  C CG2  . ILE A 1 67  ? -3.681  2.488   -9.260  1.00 0.00 ? 67  ILE A CG2  2  
ATOM 2762  C CD1  . ILE A 1 67  ? -2.573  -0.121  -7.997  1.00 0.00 ? 67  ILE A CD1  2  
ATOM 2763  H H    . ILE A 1 67  ? 0.403   1.418   -9.368  1.00 0.00 ? 67  ILE A H    2  
ATOM 2764  H HA   . ILE A 1 67  ? -2.204  0.824   -10.607 1.00 0.00 ? 67  ILE A HA   2  
ATOM 2765  H HB   . ILE A 1 67  ? -1.726  3.143   -8.761  1.00 0.00 ? 67  ILE A HB   2  
ATOM 2766  H HG12 . ILE A 1 67  ? -1.036  1.227   -7.472  1.00 0.00 ? 67  ILE A HG12 2  
ATOM 2767  H HG13 . ILE A 1 67  ? -2.642  1.702   -6.931  1.00 0.00 ? 67  ILE A HG13 2  
ATOM 2768  H HG21 . ILE A 1 67  ? -4.289  1.692   -8.857  1.00 0.00 ? 67  ILE A HG21 2  
ATOM 2769  H HG22 . ILE A 1 67  ? -3.964  3.423   -8.800  1.00 0.00 ? 67  ILE A HG22 2  
ATOM 2770  H HG23 . ILE A 1 67  ? -3.831  2.552   -10.327 1.00 0.00 ? 67  ILE A HG23 2  
ATOM 2771  H HD11 . ILE A 1 67  ? -2.475  -0.700  -7.090  1.00 0.00 ? 67  ILE A HD11 2  
ATOM 2772  H HD12 . ILE A 1 67  ? -3.611  -0.090  -8.293  1.00 0.00 ? 67  ILE A HD12 2  
ATOM 2773  H HD13 . ILE A 1 67  ? -1.987  -0.579  -8.780  1.00 0.00 ? 67  ILE A HD13 2  
ATOM 2774  N N    . PRO A 1 68  ? -1.782  2.396   -12.475 1.00 0.00 ? 68  PRO A N    2  
ATOM 2775  C CA   . PRO A 1 68  ? -1.639  3.336   -13.591 1.00 0.00 ? 68  PRO A CA   2  
ATOM 2776  C C    . PRO A 1 68  ? -2.492  4.587   -13.410 1.00 0.00 ? 68  PRO A C    2  
ATOM 2777  O O    . PRO A 1 68  ? -2.542  5.448   -14.286 1.00 0.00 ? 68  PRO A O    2  
ATOM 2778  C CB   . PRO A 1 68  ? -2.123  2.529   -14.799 1.00 0.00 ? 68  PRO A CB   2  
ATOM 2779  C CG   . PRO A 1 68  ? -3.047  1.510   -14.227 1.00 0.00 ? 68  PRO A CG   2  
ATOM 2780  C CD   . PRO A 1 68  ? -2.502  1.173   -12.867 1.00 0.00 ? 68  PRO A CD   2  
ATOM 2781  H HA   . PRO A 1 68  ? -0.608  3.623   -13.738 1.00 0.00 ? 68  PRO A HA   2  
ATOM 2782  H HB2  . PRO A 1 68  ? -2.634  3.184   -15.491 1.00 0.00 ? 68  PRO A HB2  2  
ATOM 2783  H HB3  . PRO A 1 68  ? -1.280  2.066   -15.289 1.00 0.00 ? 68  PRO A HB3  2  
ATOM 2784  H HG2  . PRO A 1 68  ? -4.041  1.923   -14.142 1.00 0.00 ? 68  PRO A HG2  2  
ATOM 2785  H HG3  . PRO A 1 68  ? -3.057  0.631   -14.855 1.00 0.00 ? 68  PRO A HG3  2  
ATOM 2786  H HD2  . PRO A 1 68  ? -3.308  0.963   -12.179 1.00 0.00 ? 68  PRO A HD2  2  
ATOM 2787  H HD3  . PRO A 1 68  ? -1.827  0.332   -12.929 1.00 0.00 ? 68  PRO A HD3  2  
ATOM 2788  N N    . ASN A 1 69  ? -3.161  4.680   -12.265 1.00 0.00 ? 69  ASN A N    2  
ATOM 2789  C CA   . ASN A 1 69  ? -4.013  5.826   -11.969 1.00 0.00 ? 69  ASN A CA   2  
ATOM 2790  C C    . ASN A 1 69  ? -3.748  6.351   -10.561 1.00 0.00 ? 69  ASN A C    2  
ATOM 2791  O O    . ASN A 1 69  ? -3.955  5.658   -9.564  1.00 0.00 ? 69  ASN A O    2  
ATOM 2792  C CB   . ASN A 1 69  ? -5.487  5.443   -12.113 1.00 0.00 ? 69  ASN A CB   2  
ATOM 2793  C CG   . ASN A 1 69  ? -6.400  6.654   -12.124 1.00 0.00 ? 69  ASN A CG   2  
ATOM 2794  O OD1  . ASN A 1 69  ? -6.057  7.699   -12.676 1.00 0.00 ? 69  ASN A OD1  2  
ATOM 2795  N ND2  . ASN A 1 69  ? -7.570  6.518   -11.510 1.00 0.00 ? 69  ASN A ND2  2  
ATOM 2796  H H    . ASN A 1 69  ? -3.081  3.960   -11.604 1.00 0.00 ? 69  ASN A H    2  
ATOM 2797  H HA   . ASN A 1 69  ? -3.780  6.604   -12.680 1.00 0.00 ? 69  ASN A HA   2  
ATOM 2798  H HB2  . ASN A 1 69  ? -5.624  4.906   -13.040 1.00 0.00 ? 69  ASN A HB2  2  
ATOM 2799  H HB3  . ASN A 1 69  ? -5.771  4.808   -11.288 1.00 0.00 ? 69  ASN A HB3  2  
ATOM 2800  H HD21 . ASN A 1 69  ? -7.776  5.656   -11.091 1.00 0.00 ? 69  ASN A HD21 2  
ATOM 2801  H HD22 . ASN A 1 69  ? -8.180  7.285   -11.502 1.00 0.00 ? 69  ASN A HD22 2  
ATOM 2802  N N    . PRO A 1 70  ? -3.279  7.604   -10.475 1.00 0.00 ? 70  PRO A N    2  
ATOM 2803  C CA   . PRO A 1 70  ? -2.977  8.251   -9.195  1.00 0.00 ? 70  PRO A CA   2  
ATOM 2804  C C    . PRO A 1 70  ? -4.235  8.562   -8.391  1.00 0.00 ? 70  PRO A C    2  
ATOM 2805  O O    . PRO A 1 70  ? -4.158  9.055   -7.266  1.00 0.00 ? 70  PRO A O    2  
ATOM 2806  C CB   . PRO A 1 70  ? -2.273  9.546   -9.608  1.00 0.00 ? 70  PRO A CB   2  
ATOM 2807  C CG   . PRO A 1 70  ? -2.776  9.828   -10.981 1.00 0.00 ? 70  PRO A CG   2  
ATOM 2808  C CD   . PRO A 1 70  ? -3.009  8.488   -11.622 1.00 0.00 ? 70  PRO A CD   2  
ATOM 2809  H HA   . PRO A 1 70  ? -2.307  7.651   -8.596  1.00 0.00 ? 70  PRO A HA   2  
ATOM 2810  H HB2  . PRO A 1 70  ? -2.535  10.337  -8.920  1.00 0.00 ? 70  PRO A HB2  2  
ATOM 2811  H HB3  . PRO A 1 70  ? -1.204  9.396   -9.603  1.00 0.00 ? 70  PRO A HB3  2  
ATOM 2812  H HG2  . PRO A 1 70  ? -3.701  10.383  -10.927 1.00 0.00 ? 70  PRO A HG2  2  
ATOM 2813  H HG3  . PRO A 1 70  ? -2.035  10.385  -11.536 1.00 0.00 ? 70  PRO A HG3  2  
ATOM 2814  H HD2  . PRO A 1 70  ? -3.859  8.529   -12.286 1.00 0.00 ? 70  PRO A HD2  2  
ATOM 2815  H HD3  . PRO A 1 70  ? -2.126  8.167   -12.155 1.00 0.00 ? 70  PRO A HD3  2  
ATOM 2816  N N    . ALA A 1 71  ? -5.392  8.270   -8.975  1.00 0.00 ? 71  ALA A N    2  
ATOM 2817  C CA   . ALA A 1 71  ? -6.666  8.516   -8.312  1.00 0.00 ? 71  ALA A CA   2  
ATOM 2818  C C    . ALA A 1 71  ? -7.230  7.232   -7.713  1.00 0.00 ? 71  ALA A C    2  
ATOM 2819  O O    . ALA A 1 71  ? -8.038  7.273   -6.785  1.00 0.00 ? 71  ALA A O    2  
ATOM 2820  C CB   . ALA A 1 71  ? -7.661  9.126   -9.289  1.00 0.00 ? 71  ALA A CB   2  
ATOM 2821  H H    . ALA A 1 71  ? -5.388  7.878   -9.874  1.00 0.00 ? 71  ALA A H    2  
ATOM 2822  H HA   . ALA A 1 71  ? -6.497  9.229   -7.517  1.00 0.00 ? 71  ALA A HA   2  
ATOM 2823  H HB1  . ALA A 1 71  ? -7.295  9.003   -10.298 1.00 0.00 ? 71  ALA A HB1  2  
ATOM 2824  H HB2  . ALA A 1 71  ? -8.614  8.629   -9.188  1.00 0.00 ? 71  ALA A HB2  2  
ATOM 2825  H HB3  . ALA A 1 71  ? -7.778  10.178  -9.074  1.00 0.00 ? 71  ALA A HB3  2  
ATOM 2826  N N    . GLN A 1 72  ? -6.800  6.095   -8.249  1.00 0.00 ? 72  GLN A N    2  
ATOM 2827  C CA   . GLN A 1 72  ? -7.264  4.800   -7.767  1.00 0.00 ? 72  GLN A CA   2  
ATOM 2828  C C    . GLN A 1 72  ? -6.543  4.407   -6.482  1.00 0.00 ? 72  GLN A C    2  
ATOM 2829  O O    . GLN A 1 72  ? -5.415  3.915   -6.515  1.00 0.00 ? 72  GLN A O    2  
ATOM 2830  C CB   . GLN A 1 72  ? -7.048  3.727   -8.836  1.00 0.00 ? 72  GLN A CB   2  
ATOM 2831  C CG   . GLN A 1 72  ? -7.320  2.314   -8.343  1.00 0.00 ? 72  GLN A CG   2  
ATOM 2832  C CD   . GLN A 1 72  ? -6.741  1.255   -9.261  1.00 0.00 ? 72  GLN A CD   2  
ATOM 2833  O OE1  . GLN A 1 72  ? -6.673  1.440   -10.476 1.00 0.00 ? 72  GLN A OE1  2  
ATOM 2834  N NE2  . GLN A 1 72  ? -6.321  0.136   -8.682  1.00 0.00 ? 72  GLN A NE2  2  
ATOM 2835  H H    . GLN A 1 72  ? -6.156  6.128   -8.987  1.00 0.00 ? 72  GLN A H    2  
ATOM 2836  H HA   . GLN A 1 72  ? -8.321  4.882   -7.562  1.00 0.00 ? 72  GLN A HA   2  
ATOM 2837  H HB2  . GLN A 1 72  ? -7.704  3.928   -9.669  1.00 0.00 ? 72  GLN A HB2  2  
ATOM 2838  H HB3  . GLN A 1 72  ? -6.023  3.775   -9.175  1.00 0.00 ? 72  GLN A HB3  2  
ATOM 2839  H HG2  . GLN A 1 72  ? -6.881  2.198   -7.363  1.00 0.00 ? 72  GLN A HG2  2  
ATOM 2840  H HG3  . GLN A 1 72  ? -8.388  2.170   -8.278  1.00 0.00 ? 72  GLN A HG3  2  
ATOM 2841  H HE21 . GLN A 1 72  ? -6.408  0.058   -7.709  1.00 0.00 ? 72  GLN A HE21 2  
ATOM 2842  H HE22 . GLN A 1 72  ? -5.944  -0.566  -9.251  1.00 0.00 ? 72  GLN A HE22 2  
ATOM 2843  N N    . THR A 1 73  ? -7.202  4.628   -5.348  1.00 0.00 ? 73  THR A N    2  
ATOM 2844  C CA   . THR A 1 73  ? -6.624  4.299   -4.052  1.00 0.00 ? 73  THR A CA   2  
ATOM 2845  C C    . THR A 1 73  ? -7.194  2.992   -3.511  1.00 0.00 ? 73  THR A C    2  
ATOM 2846  O O    . THR A 1 73  ? -7.295  2.802   -2.300  1.00 0.00 ? 73  THR A O    2  
ATOM 2847  C CB   . THR A 1 73  ? -6.875  5.419   -3.024  1.00 0.00 ? 73  THR A CB   2  
ATOM 2848  O OG1  . THR A 1 73  ? -8.280  5.557   -2.784  1.00 0.00 ? 73  THR A OG1  2  
ATOM 2849  C CG2  . THR A 1 73  ? -6.307  6.741   -3.516  1.00 0.00 ? 73  THR A CG2  2  
ATOM 2850  H H    . THR A 1 73  ? -8.099  5.022   -5.387  1.00 0.00 ? 73  THR A H    2  
ATOM 2851  H HA   . THR A 1 73  ? -5.557  4.189   -4.180  1.00 0.00 ? 73  THR A HA   2  
ATOM 2852  H HB   . THR A 1 73  ? -6.383  5.154   -2.099  1.00 0.00 ? 73  THR A HB   2  
ATOM 2853  H HG1  . THR A 1 73  ? -8.768  5.233   -3.544  1.00 0.00 ? 73  THR A HG1  2  
ATOM 2854  H HG21 . THR A 1 73  ? -5.318  6.882   -3.106  1.00 0.00 ? 73  THR A HG21 2  
ATOM 2855  H HG22 . THR A 1 73  ? -6.947  7.550   -3.195  1.00 0.00 ? 73  THR A HG22 2  
ATOM 2856  H HG23 . THR A 1 73  ? -6.252  6.731   -4.594  1.00 0.00 ? 73  THR A HG23 2  
ATOM 2857  N N    . SER A 1 74  ? -7.563  2.093   -4.418  1.00 0.00 ? 74  SER A N    2  
ATOM 2858  C CA   . SER A 1 74  ? -8.125  0.804   -4.032  1.00 0.00 ? 74  SER A CA   2  
ATOM 2859  C C    . SER A 1 74  ? -7.855  -0.249  -5.102  1.00 0.00 ? 74  SER A C    2  
ATOM 2860  O O    . SER A 1 74  ? -8.230  -0.082  -6.263  1.00 0.00 ? 74  SER A O    2  
ATOM 2861  C CB   . SER A 1 74  ? -9.631  0.932   -3.795  1.00 0.00 ? 74  SER A CB   2  
ATOM 2862  O OG   . SER A 1 74  ? -10.269 1.562   -4.892  1.00 0.00 ? 74  SER A OG   2  
ATOM 2863  H H    . SER A 1 74  ? -7.457  2.303   -5.370  1.00 0.00 ? 74  SER A H    2  
ATOM 2864  H HA   . SER A 1 74  ? -7.649  0.497   -3.113  1.00 0.00 ? 74  SER A HA   2  
ATOM 2865  H HB2  . SER A 1 74  ? -10.057 -0.051  -3.662  1.00 0.00 ? 74  SER A HB2  2  
ATOM 2866  H HB3  . SER A 1 74  ? -9.804  1.522   -2.906  1.00 0.00 ? 74  SER A HB3  2  
ATOM 2867  H HG   . SER A 1 74  ? -11.113 1.136   -5.059  1.00 0.00 ? 74  SER A HG   2  
ATOM 2868  N N    . VAL A 1 75  ? -7.201  -1.335  -4.703  1.00 0.00 ? 75  VAL A N    2  
ATOM 2869  C CA   . VAL A 1 75  ? -6.881  -2.417  -5.626  1.00 0.00 ? 75  VAL A CA   2  
ATOM 2870  C C    . VAL A 1 75  ? -7.343  -3.762  -5.077  1.00 0.00 ? 75  VAL A C    2  
ATOM 2871  O O    . VAL A 1 75  ? -7.268  -4.014  -3.874  1.00 0.00 ? 75  VAL A O    2  
ATOM 2872  C CB   . VAL A 1 75  ? -5.368  -2.483  -5.910  1.00 0.00 ? 75  VAL A CB   2  
ATOM 2873  C CG1  . VAL A 1 75  ? -4.606  -2.882  -4.655  1.00 0.00 ? 75  VAL A CG1  2  
ATOM 2874  C CG2  . VAL A 1 75  ? -5.082  -3.451  -7.048  1.00 0.00 ? 75  VAL A CG2  2  
ATOM 2875  H H    . VAL A 1 75  ? -6.928  -1.411  -3.765  1.00 0.00 ? 75  VAL A H    2  
ATOM 2876  H HA   . VAL A 1 75  ? -7.393  -2.224  -6.557  1.00 0.00 ? 75  VAL A HA   2  
ATOM 2877  H HB   . VAL A 1 75  ? -5.035  -1.500  -6.209  1.00 0.00 ? 75  VAL A HB   2  
ATOM 2878  H HG11 . VAL A 1 75  ? -5.043  -3.778  -4.239  1.00 0.00 ? 75  VAL A HG11 2  
ATOM 2879  H HG12 . VAL A 1 75  ? -3.572  -3.068  -4.906  1.00 0.00 ? 75  VAL A HG12 2  
ATOM 2880  H HG13 . VAL A 1 75  ? -4.664  -2.084  -3.930  1.00 0.00 ? 75  VAL A HG13 2  
ATOM 2881  H HG21 . VAL A 1 75  ? -4.327  -3.032  -7.696  1.00 0.00 ? 75  VAL A HG21 2  
ATOM 2882  H HG22 . VAL A 1 75  ? -4.730  -4.388  -6.643  1.00 0.00 ? 75  VAL A HG22 2  
ATOM 2883  H HG23 . VAL A 1 75  ? -5.987  -3.621  -7.613  1.00 0.00 ? 75  VAL A HG23 2  
ATOM 2884  N N    . VAL A 1 76  ? -7.821  -4.626  -5.968  1.00 0.00 ? 76  VAL A N    2  
ATOM 2885  C CA   . VAL A 1 76  ? -8.295  -5.947  -5.574  1.00 0.00 ? 76  VAL A CA   2  
ATOM 2886  C C    . VAL A 1 76  ? -7.195  -6.992  -5.724  1.00 0.00 ? 76  VAL A C    2  
ATOM 2887  O O    . VAL A 1 76  ? -6.632  -7.166  -6.805  1.00 0.00 ? 76  VAL A O    2  
ATOM 2888  C CB   . VAL A 1 76  ? -9.515  -6.378  -6.408  1.00 0.00 ? 76  VAL A CB   2  
ATOM 2889  C CG1  . VAL A 1 76  ? -9.813  -7.855  -6.196  1.00 0.00 ? 76  VAL A CG1  2  
ATOM 2890  C CG2  . VAL A 1 76  ? -10.726 -5.526  -6.060  1.00 0.00 ? 76  VAL A CG2  2  
ATOM 2891  H H    . VAL A 1 76  ? -7.856  -4.368  -6.912  1.00 0.00 ? 76  VAL A H    2  
ATOM 2892  H HA   . VAL A 1 76  ? -8.593  -5.899  -4.536  1.00 0.00 ? 76  VAL A HA   2  
ATOM 2893  H HB   . VAL A 1 76  ? -9.283  -6.227  -7.452  1.00 0.00 ? 76  VAL A HB   2  
ATOM 2894  H HG11 . VAL A 1 76  ? -10.098 -8.019  -5.167  1.00 0.00 ? 76  VAL A HG11 2  
ATOM 2895  H HG12 . VAL A 1 76  ? -10.620 -8.157  -6.847  1.00 0.00 ? 76  VAL A HG12 2  
ATOM 2896  H HG13 . VAL A 1 76  ? -8.931  -8.436  -6.422  1.00 0.00 ? 76  VAL A HG13 2  
ATOM 2897  H HG21 . VAL A 1 76  ? -10.526 -4.966  -5.159  1.00 0.00 ? 76  VAL A HG21 2  
ATOM 2898  H HG22 . VAL A 1 76  ? -10.930 -4.843  -6.871  1.00 0.00 ? 76  VAL A HG22 2  
ATOM 2899  H HG23 . VAL A 1 76  ? -11.584 -6.165  -5.903  1.00 0.00 ? 76  VAL A HG23 2  
ATOM 2900  N N    . VAL A 1 77  ? -6.894  -7.688  -4.632  1.00 0.00 ? 77  VAL A N    2  
ATOM 2901  C CA   . VAL A 1 77  ? -5.862  -8.718  -4.642  1.00 0.00 ? 77  VAL A CA   2  
ATOM 2902  C C    . VAL A 1 77  ? -6.478  -10.113 -4.623  1.00 0.00 ? 77  VAL A C    2  
ATOM 2903  O O    . VAL A 1 77  ? -7.196  -10.471 -3.691  1.00 0.00 ? 77  VAL A O    2  
ATOM 2904  C CB   . VAL A 1 77  ? -4.911  -8.572  -3.440  1.00 0.00 ? 77  VAL A CB   2  
ATOM 2905  C CG1  . VAL A 1 77  ? -3.868  -9.679  -3.446  1.00 0.00 ? 77  VAL A CG1  2  
ATOM 2906  C CG2  . VAL A 1 77  ? -4.248  -7.203  -3.449  1.00 0.00 ? 77  VAL A CG2  2  
ATOM 2907  H H    . VAL A 1 77  ? -7.377  -7.504  -3.800  1.00 0.00 ? 77  VAL A H    2  
ATOM 2908  H HA   . VAL A 1 77  ? -5.284  -8.603  -5.548  1.00 0.00 ? 77  VAL A HA   2  
ATOM 2909  H HB   . VAL A 1 77  ? -5.492  -8.661  -2.534  1.00 0.00 ? 77  VAL A HB   2  
ATOM 2910  H HG11 . VAL A 1 77  ? -3.641  -9.966  -2.430  1.00 0.00 ? 77  VAL A HG11 2  
ATOM 2911  H HG12 . VAL A 1 77  ? -4.251  -10.533 -3.986  1.00 0.00 ? 77  VAL A HG12 2  
ATOM 2912  H HG13 . VAL A 1 77  ? -2.968  -9.323  -3.927  1.00 0.00 ? 77  VAL A HG13 2  
ATOM 2913  H HG21 . VAL A 1 77  ? -4.448  -6.712  -4.389  1.00 0.00 ? 77  VAL A HG21 2  
ATOM 2914  H HG22 . VAL A 1 77  ? -4.642  -6.608  -2.639  1.00 0.00 ? 77  VAL A HG22 2  
ATOM 2915  H HG23 . VAL A 1 77  ? -3.181  -7.319  -3.323  1.00 0.00 ? 77  VAL A HG23 2  
ATOM 2916  N N    . GLU A 1 78  ? -6.190  -10.895 -5.659  1.00 0.00 ? 78  GLU A N    2  
ATOM 2917  C CA   . GLU A 1 78  ? -6.717  -12.251 -5.760  1.00 0.00 ? 78  GLU A CA   2  
ATOM 2918  C C    . GLU A 1 78  ? -5.586  -13.264 -5.912  1.00 0.00 ? 78  GLU A C    2  
ATOM 2919  O O    . GLU A 1 78  ? -4.408  -12.908 -5.863  1.00 0.00 ? 78  GLU A O    2  
ATOM 2920  C CB   . GLU A 1 78  ? -7.677  -12.362 -6.946  1.00 0.00 ? 78  GLU A CB   2  
ATOM 2921  C CG   . GLU A 1 78  ? -8.833  -11.376 -6.888  1.00 0.00 ? 78  GLU A CG   2  
ATOM 2922  C CD   . GLU A 1 78  ? -9.922  -11.694 -7.893  1.00 0.00 ? 78  GLU A CD   2  
ATOM 2923  O OE1  . GLU A 1 78  ? -10.656 -12.682 -7.679  1.00 0.00 ? 78  GLU A OE1  2  
ATOM 2924  O OE2  . GLU A 1 78  ? -10.041 -10.957 -8.894  1.00 0.00 ? 78  GLU A OE2  2  
ATOM 2925  H H    . GLU A 1 78  ? -5.612  -10.552 -6.371  1.00 0.00 ? 78  GLU A H    2  
ATOM 2926  H HA   . GLU A 1 78  ? -7.257  -12.466 -4.851  1.00 0.00 ? 78  GLU A HA   2  
ATOM 2927  H HB2  . GLU A 1 78  ? -7.126  -12.186 -7.858  1.00 0.00 ? 78  GLU A HB2  2  
ATOM 2928  H HB3  . GLU A 1 78  ? -8.086  -13.361 -6.971  1.00 0.00 ? 78  GLU A HB3  2  
ATOM 2929  H HG2  . GLU A 1 78  ? -9.260  -11.401 -5.897  1.00 0.00 ? 78  GLU A HG2  2  
ATOM 2930  H HG3  . GLU A 1 78  ? -8.454  -10.385 -7.091  1.00 0.00 ? 78  GLU A HG3  2  
ATOM 2931  N N    . ASP A 1 79  ? -5.952  -14.528 -6.096  1.00 0.00 ? 79  ASP A N    2  
ATOM 2932  C CA   . ASP A 1 79  ? -4.969  -15.593 -6.255  1.00 0.00 ? 79  ASP A CA   2  
ATOM 2933  C C    . ASP A 1 79  ? -4.115  -15.737 -4.999  1.00 0.00 ? 79  ASP A C    2  
ATOM 2934  O O    . ASP A 1 79  ? -2.890  -15.836 -5.077  1.00 0.00 ? 79  ASP A O    2  
ATOM 2935  C CB   . ASP A 1 79  ? -4.076  -15.315 -7.465  1.00 0.00 ? 79  ASP A CB   2  
ATOM 2936  C CG   . ASP A 1 79  ? -4.875  -15.062 -8.729  1.00 0.00 ? 79  ASP A CG   2  
ATOM 2937  O OD1  . ASP A 1 79  ? -5.394  -16.039 -9.308  1.00 0.00 ? 79  ASP A OD1  2  
ATOM 2938  O OD2  . ASP A 1 79  ? -4.981  -13.888 -9.137  1.00 0.00 ? 79  ASP A OD2  2  
ATOM 2939  H H    . ASP A 1 79  ? -6.906  -14.749 -6.126  1.00 0.00 ? 79  ASP A H    2  
ATOM 2940  H HA   . ASP A 1 79  ? -5.504  -16.516 -6.419  1.00 0.00 ? 79  ASP A HA   2  
ATOM 2941  H HB2  . ASP A 1 79  ? -3.469  -14.444 -7.265  1.00 0.00 ? 79  ASP A HB2  2  
ATOM 2942  H HB3  . ASP A 1 79  ? -3.432  -16.166 -7.632  1.00 0.00 ? 79  ASP A HB3  2  
ATOM 2943  N N    . LEU A 1 80  ? -4.769  -15.746 -3.843  1.00 0.00 ? 80  LEU A N    2  
ATOM 2944  C CA   . LEU A 1 80  ? -4.070  -15.876 -2.569  1.00 0.00 ? 80  LEU A CA   2  
ATOM 2945  C C    . LEU A 1 80  ? -4.284  -17.263 -1.970  1.00 0.00 ? 80  LEU A C    2  
ATOM 2946  O O    . LEU A 1 80  ? -4.964  -18.106 -2.556  1.00 0.00 ? 80  LEU A O    2  
ATOM 2947  C CB   . LEU A 1 80  ? -4.551  -14.805 -1.589  1.00 0.00 ? 80  LEU A CB   2  
ATOM 2948  C CG   . LEU A 1 80  ? -4.519  -13.364 -2.101  1.00 0.00 ? 80  LEU A CG   2  
ATOM 2949  C CD1  . LEU A 1 80  ? -5.617  -12.541 -1.446  1.00 0.00 ? 80  LEU A CD1  2  
ATOM 2950  C CD2  . LEU A 1 80  ? -3.156  -12.737 -1.846  1.00 0.00 ? 80  LEU A CD2  2  
ATOM 2951  H H    . LEU A 1 80  ? -5.745  -15.663 -3.845  1.00 0.00 ? 80  LEU A H    2  
ATOM 2952  H HA   . LEU A 1 80  ? -3.015  -15.736 -2.755  1.00 0.00 ? 80  LEU A HA   2  
ATOM 2953  H HB2  . LEU A 1 80  ? -5.569  -15.037 -1.319  1.00 0.00 ? 80  LEU A HB2  2  
ATOM 2954  H HB3  . LEU A 1 80  ? -3.925  -14.858 -0.709  1.00 0.00 ? 80  LEU A HB3  2  
ATOM 2955  H HG   . LEU A 1 80  ? -4.694  -13.364 -3.168  1.00 0.00 ? 80  LEU A HG   2  
ATOM 2956  H HD11 . LEU A 1 80  ? -5.452  -11.494 -1.650  1.00 0.00 ? 80  LEU A HD11 2  
ATOM 2957  H HD12 . LEU A 1 80  ? -5.604  -12.707 -0.379  1.00 0.00 ? 80  LEU A HD12 2  
ATOM 2958  H HD13 . LEU A 1 80  ? -6.576  -12.839 -1.844  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 2959  H HD21 . LEU A 1 80  ? -3.166  -12.230 -0.893  1.00 0.00 ? 80  LEU A HD21 2  
ATOM 2960  H HD22 . LEU A 1 80  ? -2.934  -12.028 -2.629  1.00 0.00 ? 80  LEU A HD22 2  
ATOM 2961  H HD23 . LEU A 1 80  ? -2.401  -13.510 -1.836  1.00 0.00 ? 80  LEU A HD23 2  
ATOM 2962  N N    . LEU A 1 81  ? -3.701  -17.491 -0.799  1.00 0.00 ? 81  LEU A N    2  
ATOM 2963  C CA   . LEU A 1 81  ? -3.829  -18.775 -0.118  1.00 0.00 ? 81  LEU A CA   2  
ATOM 2964  C C    . LEU A 1 81  ? -4.753  -18.660 1.091   1.00 0.00 ? 81  LEU A C    2  
ATOM 2965  O O    . LEU A 1 81  ? -4.718  -17.684 1.840   1.00 0.00 ? 81  LEU A O    2  
ATOM 2966  C CB   . LEU A 1 81  ? -2.455  -19.281 0.323   1.00 0.00 ? 81  LEU A CB   2  
ATOM 2967  C CG   . LEU A 1 81  ? -1.535  -19.782 -0.792  1.00 0.00 ? 81  LEU A CG   2  
ATOM 2968  C CD1  . LEU A 1 81  ? -0.096  -19.852 -0.305  1.00 0.00 ? 81  LEU A CD1  2  
ATOM 2969  C CD2  . LEU A 1 81  ? -1.997  -21.143 -1.293  1.00 0.00 ? 81  LEU A CD2  2  
ATOM 2970  H H    . LEU A 1 81  ? -3.172  -16.781 -0.381  1.00 0.00 ? 81  LEU A H    2  
ATOM 2971  H HA   . LEU A 1 81  ? -4.256  -19.479 -0.816  1.00 0.00 ? 81  LEU A HA   2  
ATOM 2972  H HB2  . LEU A 1 81  ? -1.951  -18.471 0.828   1.00 0.00 ? 81  LEU A HB2  2  
ATOM 2973  H HB3  . LEU A 1 81  ? -2.609  -20.095 1.017   1.00 0.00 ? 81  LEU A HB3  2  
ATOM 2974  H HG   . LEU A 1 81  ? -1.573  -19.089 -1.620  1.00 0.00 ? 81  LEU A HG   2  
ATOM 2975  H HD11 . LEU A 1 81  ? -0.084  -19.945 0.770   1.00 0.00 ? 81  LEU A HD11 2  
ATOM 2976  H HD12 . LEU A 1 81  ? 0.426   -18.952 -0.595  1.00 0.00 ? 81  LEU A HD12 2  
ATOM 2977  H HD13 . LEU A 1 81  ? 0.392   -20.708 -0.747  1.00 0.00 ? 81  LEU A HD13 2  
ATOM 2978  H HD21 . LEU A 1 81  ? -1.179  -21.845 -1.235  1.00 0.00 ? 81  LEU A HD21 2  
ATOM 2979  H HD22 . LEU A 1 81  ? -2.325  -21.055 -2.318  1.00 0.00 ? 81  LEU A HD22 2  
ATOM 2980  H HD23 . LEU A 1 81  ? -2.817  -21.492 -0.682  1.00 0.00 ? 81  LEU A HD23 2  
ATOM 2981  N N    . PRO A 1 82  ? -5.599  -19.683 1.289   1.00 0.00 ? 82  PRO A N    2  
ATOM 2982  C CA   . PRO A 1 82  ? -6.546  -19.721 2.407   1.00 0.00 ? 82  PRO A CA   2  
ATOM 2983  C C    . PRO A 1 82  ? -5.849  -19.910 3.750   1.00 0.00 ? 82  PRO A C    2  
ATOM 2984  O O    . PRO A 1 82  ? -4.880  -20.660 3.857   1.00 0.00 ? 82  PRO A O    2  
ATOM 2985  C CB   . PRO A 1 82  ? -7.424  -20.933 2.086   1.00 0.00 ? 82  PRO A CB   2  
ATOM 2986  C CG   . PRO A 1 82  ? -6.569  -21.806 1.235   1.00 0.00 ? 82  PRO A CG   2  
ATOM 2987  C CD   . PRO A 1 82  ? -5.695  -20.879 0.436   1.00 0.00 ? 82  PRO A CD   2  
ATOM 2988  H HA   . PRO A 1 82  ? -7.156  -18.831 2.441   1.00 0.00 ? 82  PRO A HA   2  
ATOM 2989  H HB2  . PRO A 1 82  ? -7.708  -21.429 3.004   1.00 0.00 ? 82  PRO A HB2  2  
ATOM 2990  H HB3  . PRO A 1 82  ? -8.309  -20.610 1.556   1.00 0.00 ? 82  PRO A HB3  2  
ATOM 2991  H HG2  . PRO A 1 82  ? -5.964  -22.447 1.858   1.00 0.00 ? 82  PRO A HG2  2  
ATOM 2992  H HG3  . PRO A 1 82  ? -7.188  -22.397 0.577   1.00 0.00 ? 82  PRO A HG3  2  
ATOM 2993  H HD2  . PRO A 1 82  ? -4.722  -21.320 0.278   1.00 0.00 ? 82  PRO A HD2  2  
ATOM 2994  H HD3  . PRO A 1 82  ? -6.162  -20.642 -0.509  1.00 0.00 ? 82  PRO A HD3  2  
ATOM 2995  N N    . ASN A 1 83  ? -6.350  -19.224 4.773   1.00 0.00 ? 83  ASN A N    2  
ATOM 2996  C CA   . ASN A 1 83  ? -5.775  -19.316 6.110   1.00 0.00 ? 83  ASN A CA   2  
ATOM 2997  C C    . ASN A 1 83  ? -4.288  -18.977 6.087   1.00 0.00 ? 83  ASN A C    2  
ATOM 2998  O O    . ASN A 1 83  ? -3.455  -19.754 6.555   1.00 0.00 ? 83  ASN A O    2  
ATOM 2999  C CB   . ASN A 1 83  ? -5.980  -20.721 6.680   1.00 0.00 ? 83  ASN A CB   2  
ATOM 3000  C CG   . ASN A 1 83  ? -7.439  -21.022 6.966   1.00 0.00 ? 83  ASN A CG   2  
ATOM 3001  O OD1  . ASN A 1 83  ? -7.788  -21.484 8.052   1.00 0.00 ? 83  ASN A OD1  2  
ATOM 3002  N ND2  . ASN A 1 83  ? -8.299  -20.760 5.988   1.00 0.00 ? 83  ASN A ND2  2  
ATOM 3003  H H    . ASN A 1 83  ? -7.124  -18.642 4.625   1.00 0.00 ? 83  ASN A H    2  
ATOM 3004  H HA   . ASN A 1 83  ? -6.285  -18.604 6.740   1.00 0.00 ? 83  ASN A HA   2  
ATOM 3005  H HB2  . ASN A 1 83  ? -5.615  -21.448 5.969   1.00 0.00 ? 83  ASN A HB2  2  
ATOM 3006  H HB3  . ASN A 1 83  ? -5.425  -20.814 7.601   1.00 0.00 ? 83  ASN A HB3  2  
ATOM 3007  H HD21 . ASN A 1 83  ? -7.949  -20.393 5.149   1.00 0.00 ? 83  ASN A HD21 2  
ATOM 3008  H HD22 . ASN A 1 83  ? -9.248  -20.944 6.146   1.00 0.00 ? 83  ASN A HD22 2  
ATOM 3009  N N    . HIS A 1 84  ? -3.961  -17.810 5.540   1.00 0.00 ? 84  HIS A N    2  
ATOM 3010  C CA   . HIS A 1 84  ? -2.574  -17.367 5.457   1.00 0.00 ? 84  HIS A CA   2  
ATOM 3011  C C    . HIS A 1 84  ? -2.479  -15.850 5.595   1.00 0.00 ? 84  HIS A C    2  
ATOM 3012  O O    . HIS A 1 84  ? -3.285  -15.114 5.028   1.00 0.00 ? 84  HIS A O    2  
ATOM 3013  C CB   . HIS A 1 84  ? -1.953  -17.809 4.132   1.00 0.00 ? 84  HIS A CB   2  
ATOM 3014  C CG   . HIS A 1 84  ? -1.545  -19.250 4.113   1.00 0.00 ? 84  HIS A CG   2  
ATOM 3015  N ND1  . HIS A 1 84  ? -2.441  -20.288 4.264   1.00 0.00 ? 84  HIS A ND1  2  
ATOM 3016  C CD2  . HIS A 1 84  ? -0.330  -19.825 3.957   1.00 0.00 ? 84  HIS A CD2  2  
ATOM 3017  C CE1  . HIS A 1 84  ? -1.794  -21.438 4.204   1.00 0.00 ? 84  HIS A CE1  2  
ATOM 3018  N NE2  . HIS A 1 84  ? -0.511  -21.185 4.018   1.00 0.00 ? 84  HIS A NE2  2  
ATOM 3019  H H    . HIS A 1 84  ? -4.669  -17.234 5.184   1.00 0.00 ? 84  HIS A H    2  
ATOM 3020  H HA   . HIS A 1 84  ? -2.030  -17.824 6.269   1.00 0.00 ? 84  HIS A HA   2  
ATOM 3021  H HB2  . HIS A 1 84  ? -2.669  -17.657 3.338   1.00 0.00 ? 84  HIS A HB2  2  
ATOM 3022  H HB3  . HIS A 1 84  ? -1.074  -17.212 3.936   1.00 0.00 ? 84  HIS A HB3  2  
ATOM 3023  H HD2  . HIS A 1 84  ? 0.610   -19.310 3.812   1.00 0.00 ? 84  HIS A HD2  2  
ATOM 3024  H HE1  . HIS A 1 84  ? -2.237  -22.418 4.292   1.00 0.00 ? 84  HIS A HE1  2  
ATOM 3025  H HE2  . HIS A 1 84  ? 0.203   -21.855 4.023   1.00 0.00 ? 84  HIS A HE2  2  
ATOM 3026  N N    . SER A 1 85  ? -1.489  -15.391 6.354   1.00 0.00 ? 85  SER A N    2  
ATOM 3027  C CA   . SER A 1 85  ? -1.292  -13.962 6.571   1.00 0.00 ? 85  SER A CA   2  
ATOM 3028  C C    . SER A 1 85  ? -0.501  -13.343 5.423   1.00 0.00 ? 85  SER A C    2  
ATOM 3029  O O    . SER A 1 85  ? 0.396   -13.972 4.861   1.00 0.00 ? 85  SER A O    2  
ATOM 3030  C CB   . SER A 1 85  ? -0.564  -13.722 7.895   1.00 0.00 ? 85  SER A CB   2  
ATOM 3031  O OG   . SER A 1 85  ? -1.434  -13.915 8.998   1.00 0.00 ? 85  SER A OG   2  
ATOM 3032  H H    . SER A 1 85  ? -0.879  -16.028 6.781   1.00 0.00 ? 85  SER A H    2  
ATOM 3033  H HA   . SER A 1 85  ? -2.265  -13.496 6.615   1.00 0.00 ? 85  SER A HA   2  
ATOM 3034  H HB2  . SER A 1 85  ? 0.262   -14.411 7.979   1.00 0.00 ? 85  SER A HB2  2  
ATOM 3035  H HB3  . SER A 1 85  ? -0.192  -12.708 7.919   1.00 0.00 ? 85  SER A HB3  2  
ATOM 3036  H HG   . SER A 1 85  ? -1.114  -13.411 9.750   1.00 0.00 ? 85  SER A HG   2  
ATOM 3037  N N    . TYR A 1 86  ? -0.840  -12.105 5.080   1.00 0.00 ? 86  TYR A N    2  
ATOM 3038  C CA   . TYR A 1 86  ? -0.165  -11.400 3.997   1.00 0.00 ? 86  TYR A CA   2  
ATOM 3039  C C    . TYR A 1 86  ? 0.050   -9.932  4.354   1.00 0.00 ? 86  TYR A C    2  
ATOM 3040  O O    . TYR A 1 86  ? -0.907  -9.175  4.518   1.00 0.00 ? 86  TYR A O    2  
ATOM 3041  C CB   . TYR A 1 86  ? -0.976  -11.509 2.705   1.00 0.00 ? 86  TYR A CB   2  
ATOM 3042  C CG   . TYR A 1 86  ? -0.874  -12.862 2.039   1.00 0.00 ? 86  TYR A CG   2  
ATOM 3043  C CD1  . TYR A 1 86  ? 0.251   -13.213 1.301   1.00 0.00 ? 86  TYR A CD1  2  
ATOM 3044  C CD2  . TYR A 1 86  ? -1.901  -13.791 2.148   1.00 0.00 ? 86  TYR A CD2  2  
ATOM 3045  C CE1  . TYR A 1 86  ? 0.348   -14.448 0.690   1.00 0.00 ? 86  TYR A CE1  2  
ATOM 3046  C CE2  . TYR A 1 86  ? -1.812  -15.030 1.541   1.00 0.00 ? 86  TYR A CE2  2  
ATOM 3047  C CZ   . TYR A 1 86  ? -0.686  -15.353 0.813   1.00 0.00 ? 86  TYR A CZ   2  
ATOM 3048  O OH   . TYR A 1 86  ? -0.593  -16.585 0.207   1.00 0.00 ? 86  TYR A OH   2  
ATOM 3049  H H    . TYR A 1 86  ? -1.563  -11.655 5.565   1.00 0.00 ? 86  TYR A H    2  
ATOM 3050  H HA   . TYR A 1 86  ? 0.798   -11.866 3.847   1.00 0.00 ? 86  TYR A HA   2  
ATOM 3051  H HB2  . TYR A 1 86  ? -2.016  -11.326 2.924   1.00 0.00 ? 86  TYR A HB2  2  
ATOM 3052  H HB3  . TYR A 1 86  ? -0.624  -10.766 2.004   1.00 0.00 ? 86  TYR A HB3  2  
ATOM 3053  H HD1  . TYR A 1 86  ? 1.059   -12.502 1.207   1.00 0.00 ? 86  TYR A HD1  2  
ATOM 3054  H HD2  . TYR A 1 86  ? -2.782  -13.535 2.718   1.00 0.00 ? 86  TYR A HD2  2  
ATOM 3055  H HE1  . TYR A 1 86  ? 1.229   -14.702 0.121   1.00 0.00 ? 86  TYR A HE1  2  
ATOM 3056  H HE2  . TYR A 1 86  ? -2.621  -15.738 1.637   1.00 0.00 ? 86  TYR A HE2  2  
ATOM 3057  H HH   . TYR A 1 86  ? 0.053   -17.122 0.673   1.00 0.00 ? 86  TYR A HH   2  
ATOM 3058  N N    . VAL A 1 87  ? 1.313   -9.537  4.471   1.00 0.00 ? 87  VAL A N    2  
ATOM 3059  C CA   . VAL A 1 87  ? 1.656   -8.160  4.806   1.00 0.00 ? 87  VAL A CA   2  
ATOM 3060  C C    . VAL A 1 87  ? 1.436   -7.233  3.615   1.00 0.00 ? 87  VAL A C    2  
ATOM 3061  O O    . VAL A 1 87  ? 2.210   -7.240  2.658   1.00 0.00 ? 87  VAL A O    2  
ATOM 3062  C CB   . VAL A 1 87  ? 3.120   -8.042  5.270   1.00 0.00 ? 87  VAL A CB   2  
ATOM 3063  C CG1  . VAL A 1 87  ? 4.067   -8.490  4.167   1.00 0.00 ? 87  VAL A CG1  2  
ATOM 3064  C CG2  . VAL A 1 87  ? 3.429   -6.617  5.703   1.00 0.00 ? 87  VAL A CG2  2  
ATOM 3065  H H    . VAL A 1 87  ? 2.033   -10.187 4.328   1.00 0.00 ? 87  VAL A H    2  
ATOM 3066  H HA   . VAL A 1 87  ? 1.017   -7.845  5.618   1.00 0.00 ? 87  VAL A HA   2  
ATOM 3067  H HB   . VAL A 1 87  ? 3.260   -8.693  6.121   1.00 0.00 ? 87  VAL A HB   2  
ATOM 3068  H HG11 . VAL A 1 87  ? 4.950   -8.931  4.608   1.00 0.00 ? 87  VAL A HG11 2  
ATOM 3069  H HG12 . VAL A 1 87  ? 3.573   -9.220  3.542   1.00 0.00 ? 87  VAL A HG12 2  
ATOM 3070  H HG13 . VAL A 1 87  ? 4.352   -7.637  3.569   1.00 0.00 ? 87  VAL A HG13 2  
ATOM 3071  H HG21 . VAL A 1 87  ? 2.523   -6.140  6.046   1.00 0.00 ? 87  VAL A HG21 2  
ATOM 3072  H HG22 . VAL A 1 87  ? 4.153   -6.634  6.503   1.00 0.00 ? 87  VAL A HG22 2  
ATOM 3073  H HG23 . VAL A 1 87  ? 3.831   -6.065  4.865   1.00 0.00 ? 87  VAL A HG23 2  
ATOM 3074  N N    . PHE A 1 88  ? 0.374   -6.437  3.681   1.00 0.00 ? 88  PHE A N    2  
ATOM 3075  C CA   . PHE A 1 88  ? 0.051   -5.504  2.608   1.00 0.00 ? 88  PHE A CA   2  
ATOM 3076  C C    . PHE A 1 88  ? 0.699   -4.145  2.855   1.00 0.00 ? 88  PHE A C    2  
ATOM 3077  O O    . PHE A 1 88  ? 0.234   -3.365  3.687   1.00 0.00 ? 88  PHE A O    2  
ATOM 3078  C CB   . PHE A 1 88  ? -1.465  -5.343  2.483   1.00 0.00 ? 88  PHE A CB   2  
ATOM 3079  C CG   . PHE A 1 88  ? -2.131  -6.481  1.764   1.00 0.00 ? 88  PHE A CG   2  
ATOM 3080  C CD1  . PHE A 1 88  ? -2.524  -7.618  2.452   1.00 0.00 ? 88  PHE A CD1  2  
ATOM 3081  C CD2  . PHE A 1 88  ? -2.366  -6.414  0.400   1.00 0.00 ? 88  PHE A CD2  2  
ATOM 3082  C CE1  . PHE A 1 88  ? -3.136  -8.667  1.792   1.00 0.00 ? 88  PHE A CE1  2  
ATOM 3083  C CE2  . PHE A 1 88  ? -2.978  -7.460  -0.265  1.00 0.00 ? 88  PHE A CE2  2  
ATOM 3084  C CZ   . PHE A 1 88  ? -3.365  -8.587  0.433   1.00 0.00 ? 88  PHE A CZ   2  
ATOM 3085  H H    . PHE A 1 88  ? -0.206  -6.477  4.470   1.00 0.00 ? 88  PHE A H    2  
ATOM 3086  H HA   . PHE A 1 88  ? 0.439   -5.912  1.687   1.00 0.00 ? 88  PHE A HA   2  
ATOM 3087  H HB2  . PHE A 1 88  ? -1.896  -5.278  3.470   1.00 0.00 ? 88  PHE A HB2  2  
ATOM 3088  H HB3  . PHE A 1 88  ? -1.680  -4.435  1.940   1.00 0.00 ? 88  PHE A HB3  2  
ATOM 3089  H HD1  . PHE A 1 88  ? -2.347  -7.682  3.515   1.00 0.00 ? 88  PHE A HD1  2  
ATOM 3090  H HD2  . PHE A 1 88  ? -2.064  -5.532  -0.147  1.00 0.00 ? 88  PHE A HD2  2  
ATOM 3091  H HE1  . PHE A 1 88  ? -3.437  -9.547  2.340   1.00 0.00 ? 88  PHE A HE1  2  
ATOM 3092  H HE2  . PHE A 1 88  ? -3.155  -7.394  -1.328  1.00 0.00 ? 88  PHE A HE2  2  
ATOM 3093  H HZ   . PHE A 1 88  ? -3.842  -9.406  -0.085  1.00 0.00 ? 88  PHE A HZ   2  
ATOM 3094  N N    . ARG A 1 89  ? 1.776   -3.868  2.127   1.00 0.00 ? 89  ARG A N    2  
ATOM 3095  C CA   . ARG A 1 89  ? 2.489   -2.604  2.267   1.00 0.00 ? 89  ARG A CA   2  
ATOM 3096  C C    . ARG A 1 89  ? 2.146   -1.656  1.122   1.00 0.00 ? 89  ARG A C    2  
ATOM 3097  O O    . ARG A 1 89  ? 2.635   -1.814  0.004   1.00 0.00 ? 89  ARG A O    2  
ATOM 3098  C CB   . ARG A 1 89  ? 3.999   -2.848  2.307   1.00 0.00 ? 89  ARG A CB   2  
ATOM 3099  C CG   . ARG A 1 89  ? 4.442   -3.736  3.458   1.00 0.00 ? 89  ARG A CG   2  
ATOM 3100  C CD   . ARG A 1 89  ? 5.926   -3.574  3.747   1.00 0.00 ? 89  ARG A CD   2  
ATOM 3101  N NE   . ARG A 1 89  ? 6.502   -4.776  4.345   1.00 0.00 ? 89  ARG A NE   2  
ATOM 3102  C CZ   . ARG A 1 89  ? 6.551   -5.952  3.728   1.00 0.00 ? 89  ARG A CZ   2  
ATOM 3103  N NH1  . ARG A 1 89  ? 6.061   -6.083  2.503   1.00 0.00 ? 89  ARG A NH1  2  
ATOM 3104  N NH2  . ARG A 1 89  ? 7.091   -7.000  4.338   1.00 0.00 ? 89  ARG A NH2  2  
ATOM 3105  H H    . ARG A 1 89  ? 2.098   -4.529  1.480   1.00 0.00 ? 89  ARG A H    2  
ATOM 3106  H HA   . ARG A 1 89  ? 2.182   -2.152  3.198   1.00 0.00 ? 89  ARG A HA   2  
ATOM 3107  H HB2  . ARG A 1 89  ? 4.300   -3.318  1.383   1.00 0.00 ? 89  ARG A HB2  2  
ATOM 3108  H HB3  . ARG A 1 89  ? 4.502   -1.898  2.400   1.00 0.00 ? 89  ARG A HB3  2  
ATOM 3109  H HG2  . ARG A 1 89  ? 3.883   -3.469  4.343   1.00 0.00 ? 89  ARG A HG2  2  
ATOM 3110  H HG3  . ARG A 1 89  ? 4.244   -4.767  3.203   1.00 0.00 ? 89  ARG A HG3  2  
ATOM 3111  H HD2  . ARG A 1 89  ? 6.439   -3.364  2.821   1.00 0.00 ? 89  ARG A HD2  2  
ATOM 3112  H HD3  . ARG A 1 89  ? 6.058   -2.746  4.428   1.00 0.00 ? 89  ARG A HD3  2  
ATOM 3113  H HE   . ARG A 1 89  ? 6.870   -4.702  5.249   1.00 0.00 ? 89  ARG A HE   2  
ATOM 3114  H HH11 . ARG A 1 89  ? 5.655   -5.295  2.041   1.00 0.00 ? 89  ARG A HH11 2  
ATOM 3115  H HH12 . ARG A 1 89  ? 6.100   -6.969  2.041   1.00 0.00 ? 89  ARG A HH12 2  
ATOM 3116  H HH21 . ARG A 1 89  ? 7.461   -6.905  5.261   1.00 0.00 ? 89  ARG A HH21 2  
ATOM 3117  H HH22 . ARG A 1 89  ? 7.127   -7.884  3.873   1.00 0.00 ? 89  ARG A HH22 2  
ATOM 3118  N N    . VAL A 1 90  ? 1.302   -0.670  1.410   1.00 0.00 ? 90  VAL A N    2  
ATOM 3119  C CA   . VAL A 1 90  ? 0.894   0.305   0.405   1.00 0.00 ? 90  VAL A CA   2  
ATOM 3120  C C    . VAL A 1 90  ? 1.809   1.524   0.419   1.00 0.00 ? 90  VAL A C    2  
ATOM 3121  O O    . VAL A 1 90  ? 2.511   1.776   1.399   1.00 0.00 ? 90  VAL A O    2  
ATOM 3122  C CB   . VAL A 1 90  ? -0.559  0.764   0.627   1.00 0.00 ? 90  VAL A CB   2  
ATOM 3123  C CG1  . VAL A 1 90  ? -0.919  1.881   -0.342  1.00 0.00 ? 90  VAL A CG1  2  
ATOM 3124  C CG2  . VAL A 1 90  ? -1.516  -0.409  0.481   1.00 0.00 ? 90  VAL A CG2  2  
ATOM 3125  H H    . VAL A 1 90  ? 0.946   -0.596  2.320   1.00 0.00 ? 90  VAL A H    2  
ATOM 3126  H HA   . VAL A 1 90  ? 0.956   -0.169  -0.564  1.00 0.00 ? 90  VAL A HA   2  
ATOM 3127  H HB   . VAL A 1 90  ? -0.644  1.149   1.632   1.00 0.00 ? 90  VAL A HB   2  
ATOM 3128  H HG11 . VAL A 1 90  ? -0.629  1.596   -1.342  1.00 0.00 ? 90  VAL A HG11 2  
ATOM 3129  H HG12 . VAL A 1 90  ? -1.985  2.055   -0.310  1.00 0.00 ? 90  VAL A HG12 2  
ATOM 3130  H HG13 . VAL A 1 90  ? -0.398  2.784   -0.060  1.00 0.00 ? 90  VAL A HG13 2  
ATOM 3131  H HG21 . VAL A 1 90  ? -2.297  -0.331  1.222   1.00 0.00 ? 90  VAL A HG21 2  
ATOM 3132  H HG22 . VAL A 1 90  ? -1.954  -0.395  -0.506  1.00 0.00 ? 90  VAL A HG22 2  
ATOM 3133  H HG23 . VAL A 1 90  ? -0.977  -1.334  0.623   1.00 0.00 ? 90  VAL A HG23 2  
ATOM 3134  N N    . ARG A 1 91  ? 1.796   2.279   -0.675  1.00 0.00 ? 91  ARG A N    2  
ATOM 3135  C CA   . ARG A 1 91  ? 2.626   3.473   -0.789  1.00 0.00 ? 91  ARG A CA   2  
ATOM 3136  C C    . ARG A 1 91  ? 2.267   4.265   -2.043  1.00 0.00 ? 91  ARG A C    2  
ATOM 3137  O O    . ARG A 1 91  ? 1.529   3.786   -2.903  1.00 0.00 ? 91  ARG A O    2  
ATOM 3138  C CB   . ARG A 1 91  ? 4.107   3.089   -0.821  1.00 0.00 ? 91  ARG A CB   2  
ATOM 3139  C CG   . ARG A 1 91  ? 4.456   2.098   -1.919  1.00 0.00 ? 91  ARG A CG   2  
ATOM 3140  C CD   . ARG A 1 91  ? 5.961   1.940   -2.069  1.00 0.00 ? 91  ARG A CD   2  
ATOM 3141  N NE   . ARG A 1 91  ? 6.308   0.943   -3.078  1.00 0.00 ? 91  ARG A NE   2  
ATOM 3142  C CZ   . ARG A 1 91  ? 7.490   0.339   -3.137  1.00 0.00 ? 91  ARG A CZ   2  
ATOM 3143  N NH1  . ARG A 1 91  ? 8.431   0.628   -2.250  1.00 0.00 ? 91  ARG A NH1  2  
ATOM 3144  N NH2  . ARG A 1 91  ? 7.731   -0.558  -4.085  1.00 0.00 ? 91  ARG A NH2  2  
ATOM 3145  H H    . ARG A 1 91  ? 1.216   2.027   -1.423  1.00 0.00 ? 91  ARG A H    2  
ATOM 3146  H HA   . ARG A 1 91  ? 2.441   4.089   0.077   1.00 0.00 ? 91  ARG A HA   2  
ATOM 3147  H HB2  . ARG A 1 91  ? 4.694   3.983   -0.974  1.00 0.00 ? 91  ARG A HB2  2  
ATOM 3148  H HB3  . ARG A 1 91  ? 4.373   2.651   0.128   1.00 0.00 ? 91  ARG A HB3  2  
ATOM 3149  H HG2  . ARG A 1 91  ? 4.027   1.137   -1.673  1.00 0.00 ? 91  ARG A HG2  2  
ATOM 3150  H HG3  . ARG A 1 91  ? 4.044   2.449   -2.853  1.00 0.00 ? 91  ARG A HG3  2  
ATOM 3151  H HD2  . ARG A 1 91  ? 6.382   2.892   -2.357  1.00 0.00 ? 91  ARG A HD2  2  
ATOM 3152  H HD3  . ARG A 1 91  ? 6.374   1.637   -1.119  1.00 0.00 ? 91  ARG A HD3  2  
ATOM 3153  H HE   . ARG A 1 91  ? 5.627   0.715   -3.744  1.00 0.00 ? 91  ARG A HE   2  
ATOM 3154  H HH11 . ARG A 1 91  ? 8.252   1.302   -1.533  1.00 0.00 ? 91  ARG A HH11 2  
ATOM 3155  H HH12 . ARG A 1 91  ? 9.319   0.170   -2.295  1.00 0.00 ? 91  ARG A HH12 2  
ATOM 3156  H HH21 . ARG A 1 91  ? 7.023   -0.778  -4.756  1.00 0.00 ? 91  ARG A HH21 2  
ATOM 3157  H HH22 . ARG A 1 91  ? 8.620   -1.012  -4.129  1.00 0.00 ? 91  ARG A HH22 2  
ATOM 3158  N N    . ALA A 1 92  ? 2.795   5.481   -2.139  1.00 0.00 ? 92  ALA A N    2  
ATOM 3159  C CA   . ALA A 1 92  ? 2.532   6.340   -3.287  1.00 0.00 ? 92  ALA A CA   2  
ATOM 3160  C C    . ALA A 1 92  ? 3.833   6.829   -3.916  1.00 0.00 ? 92  ALA A C    2  
ATOM 3161  O O    . ALA A 1 92  ? 4.889   6.791   -3.286  1.00 0.00 ? 92  ALA A O    2  
ATOM 3162  C CB   . ALA A 1 92  ? 1.666   7.521   -2.875  1.00 0.00 ? 92  ALA A CB   2  
ATOM 3163  H H    . ALA A 1 92  ? 3.376   5.808   -1.420  1.00 0.00 ? 92  ALA A H    2  
ATOM 3164  H HA   . ALA A 1 92  ? 1.986   5.762   -4.018  1.00 0.00 ? 92  ALA A HA   2  
ATOM 3165  H HB1  . ALA A 1 92  ? 2.297   8.367   -2.646  1.00 0.00 ? 92  ALA A HB1  2  
ATOM 3166  H HB2  . ALA A 1 92  ? 1.000   7.778   -3.686  1.00 0.00 ? 92  ALA A HB2  2  
ATOM 3167  H HB3  . ALA A 1 92  ? 1.087   7.256   -2.003  1.00 0.00 ? 92  ALA A HB3  2  
ATOM 3168  N N    . GLN A 1 93  ? 3.747   7.287   -5.161  1.00 0.00 ? 93  GLN A N    2  
ATOM 3169  C CA   . GLN A 1 93  ? 4.918   7.782   -5.874  1.00 0.00 ? 93  GLN A CA   2  
ATOM 3170  C C    . GLN A 1 93  ? 4.676   9.190   -6.407  1.00 0.00 ? 93  GLN A C    2  
ATOM 3171  O O    . GLN A 1 93  ? 3.575   9.517   -6.849  1.00 0.00 ? 93  GLN A O    2  
ATOM 3172  C CB   . GLN A 1 93  ? 5.274   6.842   -7.027  1.00 0.00 ? 93  GLN A CB   2  
ATOM 3173  C CG   . GLN A 1 93  ? 6.469   7.306   -7.844  1.00 0.00 ? 93  GLN A CG   2  
ATOM 3174  C CD   . GLN A 1 93  ? 7.156   6.167   -8.572  1.00 0.00 ? 93  GLN A CD   2  
ATOM 3175  O OE1  . GLN A 1 93  ? 8.382   6.054   -8.555  1.00 0.00 ? 93  GLN A OE1  2  
ATOM 3176  N NE2  . GLN A 1 93  ? 6.367   5.316   -9.218  1.00 0.00 ? 93  GLN A NE2  2  
ATOM 3177  H H    . GLN A 1 93  ? 2.876   7.291   -5.609  1.00 0.00 ? 93  GLN A H    2  
ATOM 3178  H HA   . GLN A 1 93  ? 5.743   7.810   -5.178  1.00 0.00 ? 93  GLN A HA   2  
ATOM 3179  H HB2  . GLN A 1 93  ? 5.497   5.865   -6.625  1.00 0.00 ? 93  GLN A HB2  2  
ATOM 3180  H HB3  . GLN A 1 93  ? 4.422   6.763   -7.688  1.00 0.00 ? 93  GLN A HB3  2  
ATOM 3181  H HG2  . GLN A 1 93  ? 6.131   8.027   -8.574  1.00 0.00 ? 93  GLN A HG2  2  
ATOM 3182  H HG3  . GLN A 1 93  ? 7.182   7.773   -7.181  1.00 0.00 ? 93  GLN A HG3  2  
ATOM 3183  H HE21 . GLN A 1 93  ? 5.399   5.469   -9.189  1.00 0.00 ? 93  GLN A HE21 2  
ATOM 3184  H HE22 . GLN A 1 93  ? 6.785   4.571   -9.697  1.00 0.00 ? 93  GLN A HE22 2  
ATOM 3185  N N    . SER A 1 94  ? 5.713   10.021  -6.361  1.00 0.00 ? 94  SER A N    2  
ATOM 3186  C CA   . SER A 1 94  ? 5.612   11.396  -6.835  1.00 0.00 ? 94  SER A CA   2  
ATOM 3187  C C    . SER A 1 94  ? 6.861   11.796  -7.614  1.00 0.00 ? 94  SER A C    2  
ATOM 3188  O O    . SER A 1 94  ? 7.802   11.012  -7.741  1.00 0.00 ? 94  SER A O    2  
ATOM 3189  C CB   . SER A 1 94  ? 5.404   12.350  -5.657  1.00 0.00 ? 94  SER A CB   2  
ATOM 3190  O OG   . SER A 1 94  ? 6.621   12.583  -4.969  1.00 0.00 ? 94  SER A OG   2  
ATOM 3191  H H    . SER A 1 94  ? 6.565   9.702   -5.997  1.00 0.00 ? 94  SER A H    2  
ATOM 3192  H HA   . SER A 1 94  ? 4.757   11.458  -7.492  1.00 0.00 ? 94  SER A HA   2  
ATOM 3193  H HB2  . SER A 1 94  ? 5.025   13.292  -6.022  1.00 0.00 ? 94  SER A HB2  2  
ATOM 3194  H HB3  . SER A 1 94  ? 4.693   11.918  -4.968  1.00 0.00 ? 94  SER A HB3  2  
ATOM 3195  H HG   . SER A 1 94  ? 7.100   11.756  -4.875  1.00 0.00 ? 94  SER A HG   2  
ATOM 3196  N N    . GLN A 1 95  ? 6.862   13.020  -8.132  1.00 0.00 ? 95  GLN A N    2  
ATOM 3197  C CA   . GLN A 1 95  ? 7.995   13.523  -8.899  1.00 0.00 ? 95  GLN A CA   2  
ATOM 3198  C C    . GLN A 1 95  ? 9.315   13.113  -8.253  1.00 0.00 ? 95  GLN A C    2  
ATOM 3199  O O    . GLN A 1 95  ? 10.253  12.710  -8.941  1.00 0.00 ? 95  GLN A O    2  
ATOM 3200  C CB   . GLN A 1 95  ? 7.923   15.047  -9.014  1.00 0.00 ? 95  GLN A CB   2  
ATOM 3201  C CG   . GLN A 1 95  ? 9.065   15.651  -9.816  1.00 0.00 ? 95  GLN A CG   2  
ATOM 3202  C CD   . GLN A 1 95  ? 8.925   17.150  -9.991  1.00 0.00 ? 95  GLN A CD   2  
ATOM 3203  O OE1  . GLN A 1 95  ? 9.268   17.926  -9.099  1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3204  N NE2  . GLN A 1 95  ? 8.419   17.567  -11.146 1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3205  H H    . GLN A 1 95  ? 6.083   13.597  -7.995  1.00 0.00 ? 95  GLN A H    2  
ATOM 3206  H HA   . GLN A 1 95  ? 7.943   13.094  -9.887  1.00 0.00 ? 95  GLN A HA   2  
ATOM 3207  H HB2  . GLN A 1 95  ? 6.993   15.316  -9.493  1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3208  H HB3  . GLN A 1 95  ? 7.944   15.473  -8.022  1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3209  H HG2  . GLN A 1 95  ? 9.994   15.450  -9.303  1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3210  H HG3  . GLN A 1 95  ? 9.086   15.189  -10.791 1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3211  H HE21 . GLN A 1 95  ? 8.166   16.891  -11.811 1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3212  H HE22 . GLN A 1 95  ? 8.317   18.530  -11.286 1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3213  N N    . GLU A 1 96  ? 9.379   13.219  -6.930  1.00 0.00 ? 96  GLU A N    2  
ATOM 3214  C CA   . GLU A 1 96  ? 10.585  12.859  -6.193  1.00 0.00 ? 96  GLU A CA   2  
ATOM 3215  C C    . GLU A 1 96  ? 10.815  11.351  -6.229  1.00 0.00 ? 96  GLU A C    2  
ATOM 3216  O O    . GLU A 1 96  ? 11.858  10.882  -6.683  1.00 0.00 ? 96  GLU A O    2  
ATOM 3217  C CB   . GLU A 1 96  ? 10.485  13.336  -4.743  1.00 0.00 ? 96  GLU A CB   2  
ATOM 3218  C CG   . GLU A 1 96  ? 10.963  14.764  -4.538  1.00 0.00 ? 96  GLU A CG   2  
ATOM 3219  C CD   . GLU A 1 96  ? 12.455  14.848  -4.279  1.00 0.00 ? 96  GLU A CD   2  
ATOM 3220  O OE1  . GLU A 1 96  ? 13.192  13.968  -4.771  1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3221  O OE2  . GLU A 1 96  ? 12.885  15.792  -3.584  1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3222  H H    . GLU A 1 96  ? 8.598   13.547  -6.438  1.00 0.00 ? 96  GLU A H    2  
ATOM 3223  H HA   . GLU A 1 96  ? 11.422  13.350  -6.667  1.00 0.00 ? 96  GLU A HA   2  
ATOM 3224  H HB2  . GLU A 1 96  ? 9.454   13.275  -4.426  1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3225  H HB3  . GLU A 1 96  ? 11.082  12.686  -4.121  1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3226  H HG2  . GLU A 1 96  ? 10.735  15.338  -5.423  1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3227  H HG3  . GLU A 1 96  ? 10.442  15.187  -3.692  1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3228  N N    . GLY A 1 97  ? 9.833   10.597  -5.746  1.00 0.00 ? 97  GLY A N    2  
ATOM 3229  C CA   . GLY A 1 97  ? 9.947   9.150   -5.731  1.00 0.00 ? 97  GLY A CA   2  
ATOM 3230  C C    . GLY A 1 97  ? 8.989   8.503   -4.750  1.00 0.00 ? 97  GLY A C    2  
ATOM 3231  O O    . GLY A 1 97  ? 8.014   9.122   -4.324  1.00 0.00 ? 97  GLY A O    2  
ATOM 3232  H H    . GLY A 1 97  ? 9.024   11.026  -5.397  1.00 0.00 ? 97  GLY A H    2  
ATOM 3233  H HA2  . GLY A 1 97  ? 9.741   8.773   -6.721  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3234  H HA3  . GLY A 1 97  ? 10.957  8.883   -5.458  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3235  N N    . TRP A 1 98  ? 9.266   7.254   -4.392  1.00 0.00 ? 98  TRP A N    2  
ATOM 3236  C CA   . TRP A 1 98  ? 8.420   6.522   -3.456  1.00 0.00 ? 98  TRP A CA   2  
ATOM 3237  C C    . TRP A 1 98  ? 8.750   6.898   -2.016  1.00 0.00 ? 98  TRP A C    2  
ATOM 3238  O O    . TRP A 1 98  ? 9.865   6.675   -1.546  1.00 0.00 ? 98  TRP A O    2  
ATOM 3239  C CB   . TRP A 1 98  ? 8.589   5.015   -3.655  1.00 0.00 ? 98  TRP A CB   2  
ATOM 3240  C CG   . TRP A 1 98  ? 8.154   4.542   -5.009  1.00 0.00 ? 98  TRP A CG   2  
ATOM 3241  C CD1  . TRP A 1 98  ? 8.952   4.321   -6.095  1.00 0.00 ? 98  TRP A CD1  2  
ATOM 3242  C CD2  . TRP A 1 98  ? 6.818   4.235   -5.421  1.00 0.00 ? 98  TRP A CD2  2  
ATOM 3243  N NE1  . TRP A 1 98  ? 8.192   3.895   -7.158  1.00 0.00 ? 98  TRP A NE1  2  
ATOM 3244  C CE2  . TRP A 1 98  ? 6.880   3.832   -6.770  1.00 0.00 ? 98  TRP A CE2  2  
ATOM 3245  C CE3  . TRP A 1 98  ? 5.576   4.258   -4.782  1.00 0.00 ? 98  TRP A CE3  2  
ATOM 3246  C CZ2  . TRP A 1 98  ? 5.747   3.458   -7.487  1.00 0.00 ? 98  TRP A CZ2  2  
ATOM 3247  C CZ3  . TRP A 1 98  ? 4.452   3.887   -5.496  1.00 0.00 ? 98  TRP A CZ3  2  
ATOM 3248  C CH2  . TRP A 1 98  ? 4.544   3.491   -6.837  1.00 0.00 ? 98  TRP A CH2  2  
ATOM 3249  H H    . TRP A 1 98  ? 10.058  6.814   -4.765  1.00 0.00 ? 98  TRP A H    2  
ATOM 3250  H HA   . TRP A 1 98  ? 7.394   6.790   -3.659  1.00 0.00 ? 98  TRP A HA   2  
ATOM 3251  H HB2  . TRP A 1 98  ? 9.630   4.756   -3.530  1.00 0.00 ? 98  TRP A HB2  2  
ATOM 3252  H HB3  . TRP A 1 98  ? 8.001   4.494   -2.914  1.00 0.00 ? 98  TRP A HB3  2  
ATOM 3253  H HD1  . TRP A 1 98  ? 10.022  4.467   -6.104  1.00 0.00 ? 98  TRP A HD1  2  
ATOM 3254  H HE1  . TRP A 1 98  ? 8.535   3.670   -8.048  1.00 0.00 ? 98  TRP A HE1  2  
ATOM 3255  H HE3  . TRP A 1 98  ? 5.485   4.560   -3.749  1.00 0.00 ? 98  TRP A HE3  2  
ATOM 3256  H HZ2  . TRP A 1 98  ? 5.801   3.150   -8.521  1.00 0.00 ? 98  TRP A HZ2  2  
ATOM 3257  H HZ3  . TRP A 1 98  ? 3.483   3.899   -5.018  1.00 0.00 ? 98  TRP A HZ3  2  
ATOM 3258  H HH2  . TRP A 1 98  ? 3.640   3.209   -7.355  1.00 0.00 ? 98  TRP A HH2  2  
ATOM 3259  N N    . GLY A 1 99  ? 7.772   7.468   -1.318  1.00 0.00 ? 99  GLY A N    2  
ATOM 3260  C CA   . GLY A 1 99  ? 7.980   7.865   0.062   1.00 0.00 ? 99  GLY A CA   2  
ATOM 3261  C C    . GLY A 1 99  ? 7.933   6.688   1.017   1.00 0.00 ? 99  GLY A C    2  
ATOM 3262  O O    . GLY A 1 99  ? 8.693   5.731   0.871   1.00 0.00 ? 99  GLY A O    2  
ATOM 3263  H H    . GLY A 1 99  ? 6.903   7.621   -1.744  1.00 0.00 ? 99  GLY A H    2  
ATOM 3264  H HA2  . GLY A 1 99  ? 8.943   8.345   0.147   1.00 0.00 ? 99  GLY A HA2  2  
ATOM 3265  H HA3  . GLY A 1 99  ? 7.212   8.571   0.342   1.00 0.00 ? 99  GLY A HA3  2  
ATOM 3266  N N    . ARG A 1 100 ? 7.039   6.760   1.998   1.00 0.00 ? 100 ARG A N    2  
ATOM 3267  C CA   . ARG A 1 100 ? 6.898   5.693   2.982   1.00 0.00 ? 100 ARG A CA   2  
ATOM 3268  C C    . ARG A 1 100 ? 5.728   4.780   2.630   1.00 0.00 ? 100 ARG A C    2  
ATOM 3269  O O    . ARG A 1 100 ? 4.995   5.035   1.675   1.00 0.00 ? 100 ARG A O    2  
ATOM 3270  C CB   . ARG A 1 100 ? 6.696   6.283   4.379   1.00 0.00 ? 100 ARG A CB   2  
ATOM 3271  C CG   . ARG A 1 100 ? 7.993   6.674   5.069   1.00 0.00 ? 100 ARG A CG   2  
ATOM 3272  C CD   . ARG A 1 100 ? 7.774   7.795   6.073   1.00 0.00 ? 100 ARG A CD   2  
ATOM 3273  N NE   . ARG A 1 100 ? 9.033   8.389   6.513   1.00 0.00 ? 100 ARG A NE   2  
ATOM 3274  C CZ   . ARG A 1 100 ? 9.158   9.109   7.623   1.00 0.00 ? 100 ARG A CZ   2  
ATOM 3275  N NH1  . ARG A 1 100 ? 8.106   9.322   8.400   1.00 0.00 ? 100 ARG A NH1  2  
ATOM 3276  N NH2  . ARG A 1 100 ? 10.338  9.617   7.956   1.00 0.00 ? 100 ARG A NH2  2  
ATOM 3277  H H    . ARG A 1 100 ? 6.461   7.549   2.062   1.00 0.00 ? 100 ARG A H    2  
ATOM 3278  H HA   . ARG A 1 100 ? 7.808   5.112   2.975   1.00 0.00 ? 100 ARG A HA   2  
ATOM 3279  H HB2  . ARG A 1 100 ? 6.077   7.165   4.299   1.00 0.00 ? 100 ARG A HB2  2  
ATOM 3280  H HB3  . ARG A 1 100 ? 6.191   5.554   4.995   1.00 0.00 ? 100 ARG A HB3  2  
ATOM 3281  H HG2  . ARG A 1 100 ? 8.387   5.813   5.588   1.00 0.00 ? 100 ARG A HG2  2  
ATOM 3282  H HG3  . ARG A 1 100 ? 8.701   7.003   4.323   1.00 0.00 ? 100 ARG A HG3  2  
ATOM 3283  H HD2  . ARG A 1 100 ? 7.168   8.560   5.612   1.00 0.00 ? 100 ARG A HD2  2  
ATOM 3284  H HD3  . ARG A 1 100 ? 7.256   7.394   6.932   1.00 0.00 ? 100 ARG A HD3  2  
ATOM 3285  H HE   . ARG A 1 100 ? 9.824   8.244   5.953   1.00 0.00 ? 100 ARG A HE   2  
ATOM 3286  H HH11 . ARG A 1 100 ? 7.216   8.940   8.152   1.00 0.00 ? 100 ARG A HH11 2  
ATOM 3287  H HH12 . ARG A 1 100 ? 8.203   9.863   9.236   1.00 0.00 ? 100 ARG A HH12 2  
ATOM 3288  H HH21 . ARG A 1 100 ? 11.133  9.458   7.372   1.00 0.00 ? 100 ARG A HH21 2  
ATOM 3289  H HH22 . ARG A 1 100 ? 10.431  10.158  8.791   1.00 0.00 ? 100 ARG A HH22 2  
ATOM 3290  N N    . GLU A 1 101 ? 5.559   3.715   3.408   1.00 0.00 ? 101 GLU A N    2  
ATOM 3291  C CA   . GLU A 1 101 ? 4.479   2.764   3.177   1.00 0.00 ? 101 GLU A CA   2  
ATOM 3292  C C    . GLU A 1 101 ? 3.764   2.424   4.482   1.00 0.00 ? 101 GLU A C    2  
ATOM 3293  O O    . GLU A 1 101 ? 4.237   2.762   5.567   1.00 0.00 ? 101 GLU A O    2  
ATOM 3294  C CB   . GLU A 1 101 ? 5.024   1.487   2.534   1.00 0.00 ? 101 GLU A CB   2  
ATOM 3295  C CG   . GLU A 1 101 ? 6.129   0.824   3.338   1.00 0.00 ? 101 GLU A CG   2  
ATOM 3296  C CD   . GLU A 1 101 ? 5.763   0.647   4.798   1.00 0.00 ? 101 GLU A CD   2  
ATOM 3297  O OE1  . GLU A 1 101 ? 4.691   0.070   5.076   1.00 0.00 ? 101 GLU A OE1  2  
ATOM 3298  O OE2  . GLU A 1 101 ? 6.549   1.085   5.664   1.00 0.00 ? 101 GLU A OE2  2  
ATOM 3299  H H    . GLU A 1 101 ? 6.176   3.566   4.155   1.00 0.00 ? 101 GLU A H    2  
ATOM 3300  H HA   . GLU A 1 101 ? 3.772   3.222   2.502   1.00 0.00 ? 101 GLU A HA   2  
ATOM 3301  H HB2  . GLU A 1 101 ? 4.214   0.780   2.423   1.00 0.00 ? 101 GLU A HB2  2  
ATOM 3302  H HB3  . GLU A 1 101 ? 5.414   1.729   1.556   1.00 0.00 ? 101 GLU A HB3  2  
ATOM 3303  H HG2  . GLU A 1 101 ? 6.333   -0.148  2.913   1.00 0.00 ? 101 GLU A HG2  2  
ATOM 3304  H HG3  . GLU A 1 101 ? 7.018   1.435   3.276   1.00 0.00 ? 101 GLU A HG3  2  
ATOM 3305  N N    . ARG A 1 102 ? 2.622   1.755   4.367   1.00 0.00 ? 102 ARG A N    2  
ATOM 3306  C CA   . ARG A 1 102 ? 1.841   1.371   5.536   1.00 0.00 ? 102 ARG A CA   2  
ATOM 3307  C C    . ARG A 1 102 ? 1.672   -0.144  5.604   1.00 0.00 ? 102 ARG A C    2  
ATOM 3308  O O    . ARG A 1 102 ? 1.209   -0.769  4.650   1.00 0.00 ? 102 ARG A O    2  
ATOM 3309  C CB   . ARG A 1 102 ? 0.469   2.047   5.504   1.00 0.00 ? 102 ARG A CB   2  
ATOM 3310  C CG   . ARG A 1 102 ? -0.504  1.499   6.535   1.00 0.00 ? 102 ARG A CG   2  
ATOM 3311  C CD   . ARG A 1 102 ? -0.220  2.058   7.921   1.00 0.00 ? 102 ARG A CD   2  
ATOM 3312  N NE   . ARG A 1 102 ? -0.603  1.124   8.976   1.00 0.00 ? 102 ARG A NE   2  
ATOM 3313  C CZ   . ARG A 1 102 ? -0.894  1.497   10.217  1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3314  N NH1  . ARG A 1 102 ? -0.846  2.778   10.557  1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3315  N NH2  . ARG A 1 102 ? -1.233  0.588   11.122  1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3316  H H    . ARG A 1 102 ? 2.296   1.514   3.474   1.00 0.00 ? 102 ARG A H    2  
ATOM 3317  H HA   . ARG A 1 102 ? 2.374   1.701   6.415   1.00 0.00 ? 102 ARG A HA   2  
ATOM 3318  H HB2  . ARG A 1 102 ? 0.596   3.103   5.687   1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3319  H HB3  . ARG A 1 102 ? 0.036   1.909   4.524   1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3320  H HG2  . ARG A 1 102 ? -1.509  1.772   6.249   1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3321  H HG3  . ARG A 1 102 ? -0.416  0.424   6.564   1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3322  H HD2  . ARG A 1 102 ? 0.837   2.264   8.001   1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3323  H HD3  . ARG A 1 102 ? -0.776  2.975   8.045   1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3324  H HE   . ARG A 1 102 ? -0.644  0.172   8.747   1.00 0.00 ? 102 ARG A HE   2  
ATOM 3325  H HH11 . ARG A 1 102 ? -0.591  3.465   9.877   1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3326  H HH12 . ARG A 1 102 ? -1.067  3.056   11.492  1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3327  H HH21 . ARG A 1 102 ? -1.270  -0.379  10.870  1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3328  H HH22 . ARG A 1 102 ? -1.452  0.869   12.056  1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3329  N N    . GLU A 1 103 ? 2.051   -0.727  6.737   1.00 0.00 ? 103 GLU A N    2  
ATOM 3330  C CA   . GLU A 1 103 ? 1.942   -2.169  6.927   1.00 0.00 ? 103 GLU A CA   2  
ATOM 3331  C C    . GLU A 1 103 ? 0.517   -2.562  7.307   1.00 0.00 ? 103 GLU A C    2  
ATOM 3332  O O    . GLU A 1 103 ? -0.129  -1.893  8.113   1.00 0.00 ? 103 GLU A O    2  
ATOM 3333  C CB   . GLU A 1 103 ? 2.918   -2.638  8.009   1.00 0.00 ? 103 GLU A CB   2  
ATOM 3334  C CG   . GLU A 1 103 ? 3.366   -4.080  7.840   1.00 0.00 ? 103 GLU A CG   2  
ATOM 3335  C CD   . GLU A 1 103 ? 4.036   -4.632  9.083   1.00 0.00 ? 103 GLU A CD   2  
ATOM 3336  O OE1  . GLU A 1 103 ? 4.731   -3.860  9.776   1.00 0.00 ? 103 GLU A OE1  2  
ATOM 3337  O OE2  . GLU A 1 103 ? 3.863   -5.837  9.364   1.00 0.00 ? 103 GLU A OE2  2  
ATOM 3338  H H    . GLU A 1 103 ? 2.412   -0.175  7.461   1.00 0.00 ? 103 GLU A H    2  
ATOM 3339  H HA   . GLU A 1 103 ? 2.198   -2.647  5.993   1.00 0.00 ? 103 GLU A HA   2  
ATOM 3340  H HB2  . GLU A 1 103 ? 3.792   -2.005  7.987   1.00 0.00 ? 103 GLU A HB2  2  
ATOM 3341  H HB3  . GLU A 1 103 ? 2.440   -2.542  8.972   1.00 0.00 ? 103 GLU A HB3  2  
ATOM 3342  H HG2  . GLU A 1 103 ? 2.503   -4.688  7.614   1.00 0.00 ? 103 GLU A HG2  2  
ATOM 3343  H HG3  . GLU A 1 103 ? 4.066   -4.132  7.019   1.00 0.00 ? 103 GLU A HG3  2  
ATOM 3344  N N    . GLY A 1 104 ? 0.033   -3.652  6.719   1.00 0.00 ? 104 GLY A N    2  
ATOM 3345  C CA   . GLY A 1 104 ? -1.311  -4.115  7.007   1.00 0.00 ? 104 GLY A CA   2  
ATOM 3346  C C    . GLY A 1 104 ? -1.503  -5.582  6.677   1.00 0.00 ? 104 GLY A C    2  
ATOM 3347  O O    . GLY A 1 104 ? -1.909  -5.928  5.567   1.00 0.00 ? 104 GLY A O    2  
ATOM 3348  H H    . GLY A 1 104 ? 0.594   -4.145  6.084   1.00 0.00 ? 104 GLY A H    2  
ATOM 3349  H HA2  . GLY A 1 104 ? -1.516  -3.963  8.056   1.00 0.00 ? 104 GLY A HA2  2  
ATOM 3350  H HA3  . GLY A 1 104 ? -2.012  -3.533  6.426   1.00 0.00 ? 104 GLY A HA3  2  
ATOM 3351  N N    . VAL A 1 105 ? -1.207  -6.448  7.641   1.00 0.00 ? 105 VAL A N    2  
ATOM 3352  C CA   . VAL A 1 105 ? -1.348  -7.886  7.447   1.00 0.00 ? 105 VAL A CA   2  
ATOM 3353  C C    . VAL A 1 105 ? -2.795  -8.327  7.636   1.00 0.00 ? 105 VAL A C    2  
ATOM 3354  O O    . VAL A 1 105 ? -3.476  -7.877  8.559   1.00 0.00 ? 105 VAL A O    2  
ATOM 3355  C CB   . VAL A 1 105 ? -0.451  -8.674  8.420   1.00 0.00 ? 105 VAL A CB   2  
ATOM 3356  C CG1  . VAL A 1 105 ? -0.774  -8.307  9.860   1.00 0.00 ? 105 VAL A CG1  2  
ATOM 3357  C CG2  . VAL A 1 105 ? -0.608  -10.170 8.194   1.00 0.00 ? 105 VAL A CG2  2  
ATOM 3358  H H    . VAL A 1 105 ? -0.888  -6.111  8.504   1.00 0.00 ? 105 VAL A H    2  
ATOM 3359  H HA   . VAL A 1 105 ? -1.040  -8.118  6.438   1.00 0.00 ? 105 VAL A HA   2  
ATOM 3360  H HB   . VAL A 1 105 ? 0.577   -8.408  8.225   1.00 0.00 ? 105 VAL A HB   2  
ATOM 3361  H HG11 . VAL A 1 105 ? -0.651  -7.242  9.996   1.00 0.00 ? 105 VAL A HG11 2  
ATOM 3362  H HG12 . VAL A 1 105 ? -1.794  -8.585  10.083  1.00 0.00 ? 105 VAL A HG12 2  
ATOM 3363  H HG13 . VAL A 1 105 ? -0.104  -8.833  10.524  1.00 0.00 ? 105 VAL A HG13 2  
ATOM 3364  H HG21 . VAL A 1 105 ? 0.332   -10.585 7.861   1.00 0.00 ? 105 VAL A HG21 2  
ATOM 3365  H HG22 . VAL A 1 105 ? -0.903  -10.644 9.119   1.00 0.00 ? 105 VAL A HG22 2  
ATOM 3366  H HG23 . VAL A 1 105 ? -1.365  -10.345 7.443   1.00 0.00 ? 105 VAL A HG23 2  
ATOM 3367  N N    . ILE A 1 106 ? -3.259  -9.209  6.758   1.00 0.00 ? 106 ILE A N    2  
ATOM 3368  C CA   . ILE A 1 106 ? -4.625  -9.712  6.829   1.00 0.00 ? 106 ILE A CA   2  
ATOM 3369  C C    . ILE A 1 106 ? -4.645  -11.228 6.991   1.00 0.00 ? 106 ILE A C    2  
ATOM 3370  O O    . ILE A 1 106 ? -3.792  -11.933 6.452   1.00 0.00 ? 106 ILE A O    2  
ATOM 3371  C CB   . ILE A 1 106 ? -5.433  -9.330  5.574   1.00 0.00 ? 106 ILE A CB   2  
ATOM 3372  C CG1  . ILE A 1 106 ? -6.891  -9.768  5.727   1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3373  C CG2  . ILE A 1 106 ? -4.812  -9.957  4.335   1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3374  C CD1  . ILE A 1 106 ? -7.722  -8.819  6.561   1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3375  H H    . ILE A 1 106 ? -2.669  -9.529  6.045   1.00 0.00 ? 106 ILE A H    2  
ATOM 3376  H HA   . ILE A 1 106 ? -5.101  -9.262  7.689   1.00 0.00 ? 106 ILE A HA   2  
ATOM 3377  H HB   . ILE A 1 106 ? -5.396  -8.257  5.463   1.00 0.00 ? 106 ILE A HB   2  
ATOM 3378  H HG12 . ILE A 1 106 ? -7.344  -9.834  4.750   1.00 0.00 ? 106 ILE A HG12 2  
ATOM 3379  H HG13 . ILE A 1 106 ? -6.919  -10.739 6.199   1.00 0.00 ? 106 ILE A HG13 2  
ATOM 3380  H HG21 . ILE A 1 106 ? -5.132  -10.985 4.253   1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3381  H HG22 . ILE A 1 106 ? -5.130  -9.412  3.459   1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3382  H HG23 . ILE A 1 106 ? -3.736  -9.920  4.412   1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3383  H HD11 . ILE A 1 106 ? -7.549  -9.016  7.610   1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3384  H HD12 . ILE A 1 106 ? -7.442  -7.801  6.336   1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3385  H HD13 . ILE A 1 106 ? -8.768  -8.964  6.337   1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3386  N N    . THR A 1 107 ? -5.627  -11.725 7.737   1.00 0.00 ? 107 THR A N    2  
ATOM 3387  C CA   . THR A 1 107 ? -5.759  -13.158 7.970   1.00 0.00 ? 107 THR A CA   2  
ATOM 3388  C C    . THR A 1 107 ? -6.984  -13.720 7.257   1.00 0.00 ? 107 THR A C    2  
ATOM 3389  O O    . THR A 1 107 ? -8.120  -13.410 7.617   1.00 0.00 ? 107 THR A O    2  
ATOM 3390  C CB   . THR A 1 107 ? -5.865  -13.475 9.474   1.00 0.00 ? 107 THR A CB   2  
ATOM 3391  O OG1  . THR A 1 107 ? -4.613  -13.213 10.118  1.00 0.00 ? 107 THR A OG1  2  
ATOM 3392  C CG2  . THR A 1 107 ? -6.260  -14.927 9.694   1.00 0.00 ? 107 THR A CG2  2  
ATOM 3393  H H    . THR A 1 107 ? -6.277  -11.112 8.141   1.00 0.00 ? 107 THR A H    2  
ATOM 3394  H HA   . THR A 1 107 ? -4.875  -13.642 7.582   1.00 0.00 ? 107 THR A HA   2  
ATOM 3395  H HB   . THR A 1 107 ? -6.624  -12.841 9.908   1.00 0.00 ? 107 THR A HB   2  
ATOM 3396  H HG1  . THR A 1 107 ? -4.381  -12.288 10.002  1.00 0.00 ? 107 THR A HG1  2  
ATOM 3397  H HG21 . THR A 1 107 ? -5.840  -15.277 10.625  1.00 0.00 ? 107 THR A HG21 2  
ATOM 3398  H HG22 . THR A 1 107 ? -5.883  -15.530 8.881   1.00 0.00 ? 107 THR A HG22 2  
ATOM 3399  H HG23 . THR A 1 107 ? -7.336  -15.006 9.732   1.00 0.00 ? 107 THR A HG23 2  
ATOM 3400  N N    . ILE A 1 108 ? -6.745  -14.547 6.245   1.00 0.00 ? 108 ILE A N    2  
ATOM 3401  C CA   . ILE A 1 108 ? -7.830  -15.153 5.483   1.00 0.00 ? 108 ILE A CA   2  
ATOM 3402  C C    . ILE A 1 108 ? -8.679  -16.063 6.364   1.00 0.00 ? 108 ILE A C    2  
ATOM 3403  O O    . ILE A 1 108 ? -8.211  -17.097 6.838   1.00 0.00 ? 108 ILE A O    2  
ATOM 3404  C CB   . ILE A 1 108 ? -7.293  -15.968 4.291   1.00 0.00 ? 108 ILE A CB   2  
ATOM 3405  C CG1  . ILE A 1 108 ? -6.448  -15.078 3.376   1.00 0.00 ? 108 ILE A CG1  2  
ATOM 3406  C CG2  . ILE A 1 108 ? -8.443  -16.593 3.516   1.00 0.00 ? 108 ILE A CG2  2  
ATOM 3407  C CD1  . ILE A 1 108 ? -7.252  -14.025 2.647   1.00 0.00 ? 108 ILE A CD1  2  
ATOM 3408  H H    . ILE A 1 108 ? -5.818  -14.755 6.006   1.00 0.00 ? 108 ILE A H    2  
ATOM 3409  H HA   . ILE A 1 108 ? -8.452  -14.358 5.099   1.00 0.00 ? 108 ILE A HA   2  
ATOM 3410  H HB   . ILE A 1 108 ? -6.676  -16.765 4.677   1.00 0.00 ? 108 ILE A HB   2  
ATOM 3411  H HG12 . ILE A 1 108 ? -5.700  -14.574 3.966   1.00 0.00 ? 108 ILE A HG12 2  
ATOM 3412  H HG13 . ILE A 1 108 ? -5.961  -15.696 2.636   1.00 0.00 ? 108 ILE A HG13 2  
ATOM 3413  H HG21 . ILE A 1 108 ? -9.379  -16.187 3.871   1.00 0.00 ? 108 ILE A HG21 2  
ATOM 3414  H HG22 . ILE A 1 108 ? -8.332  -16.371 2.465   1.00 0.00 ? 108 ILE A HG22 2  
ATOM 3415  H HG23 . ILE A 1 108 ? -8.437  -17.663 3.661   1.00 0.00 ? 108 ILE A HG23 2  
ATOM 3416  H HD11 . ILE A 1 108 ? -8.277  -14.355 2.554   1.00 0.00 ? 108 ILE A HD11 2  
ATOM 3417  H HD12 . ILE A 1 108 ? -7.223  -13.100 3.204   1.00 0.00 ? 108 ILE A HD12 2  
ATOM 3418  H HD13 . ILE A 1 108 ? -6.834  -13.868 1.665   1.00 0.00 ? 108 ILE A HD13 2  
ATOM 3419  N N    . GLU A 1 109 ? -9.931  -15.669 6.577   1.00 0.00 ? 109 GLU A N    2  
ATOM 3420  C CA   . GLU A 1 109 ? -10.846 -16.450 7.401   1.00 0.00 ? 109 GLU A CA   2  
ATOM 3421  C C    . GLU A 1 109 ? -12.047 -16.921 6.585   1.00 0.00 ? 109 GLU A C    2  
ATOM 3422  O O    . GLU A 1 109 ? -12.868 -16.115 6.148   1.00 0.00 ? 109 GLU A O    2  
ATOM 3423  C CB   . GLU A 1 109 ? -11.322 -15.624 8.598   1.00 0.00 ? 109 GLU A CB   2  
ATOM 3424  C CG   . GLU A 1 109 ? -10.240 -15.375 9.634   1.00 0.00 ? 109 GLU A CG   2  
ATOM 3425  C CD   . GLU A 1 109 ? -10.803 -14.931 10.971  1.00 0.00 ? 109 GLU A CD   2  
ATOM 3426  O OE1  . GLU A 1 109 ? -11.251 -15.803 11.745  1.00 0.00 ? 109 GLU A OE1  2  
ATOM 3427  O OE2  . GLU A 1 109 ? -10.794 -13.713 11.243  1.00 0.00 ? 109 GLU A OE2  2  
ATOM 3428  H H    . GLU A 1 109 ? -10.246 -14.834 6.172   1.00 0.00 ? 109 GLU A H    2  
ATOM 3429  H HA   . GLU A 1 109 ? -10.311 -17.315 7.763   1.00 0.00 ? 109 GLU A HA   2  
ATOM 3430  H HB2  . GLU A 1 109 ? -11.678 -14.668 8.242   1.00 0.00 ? 109 GLU A HB2  2  
ATOM 3431  H HB3  . GLU A 1 109 ? -12.138 -16.145 9.078   1.00 0.00 ? 109 GLU A HB3  2  
ATOM 3432  H HG2  . GLU A 1 109 ? -9.683  -16.288 9.781   1.00 0.00 ? 109 GLU A HG2  2  
ATOM 3433  H HG3  . GLU A 1 109 ? -9.577  -14.605 9.267   1.00 0.00 ? 109 GLU A HG3  2  
ATOM 3434  N N    . SER A 1 110 ? -12.140 -18.231 6.382   1.00 0.00 ? 110 SER A N    2  
ATOM 3435  C CA   . SER A 1 110 ? -13.236 -18.810 5.614   1.00 0.00 ? 110 SER A CA   2  
ATOM 3436  C C    . SER A 1 110 ? -14.038 -19.790 6.465   1.00 0.00 ? 110 SER A C    2  
ATOM 3437  O O    . SER A 1 110 ? -14.409 -20.869 6.004   1.00 0.00 ? 110 SER A O    2  
ATOM 3438  C CB   . SER A 1 110 ? -12.698 -19.519 4.370   1.00 0.00 ? 110 SER A CB   2  
ATOM 3439  O OG   . SER A 1 110 ? -13.754 -19.943 3.527   1.00 0.00 ? 110 SER A OG   2  
ATOM 3440  H H    . SER A 1 110 ? -11.453 -18.822 6.756   1.00 0.00 ? 110 SER A H    2  
ATOM 3441  H HA   . SER A 1 110 ? -13.886 -18.004 5.306   1.00 0.00 ? 110 SER A HA   2  
ATOM 3442  H HB2  . SER A 1 110 ? -12.064 -18.841 3.819   1.00 0.00 ? 110 SER A HB2  2  
ATOM 3443  H HB3  . SER A 1 110 ? -12.124 -20.383 4.672   1.00 0.00 ? 110 SER A HB3  2  
ATOM 3444  H HG   . SER A 1 110 ? -13.392 -20.390 2.759   1.00 0.00 ? 110 SER A HG   2  
ATOM 3445  N N    . GLN A 1 111 ? -14.300 -19.406 7.710   1.00 0.00 ? 111 GLN A N    2  
ATOM 3446  C CA   . GLN A 1 111 ? -15.056 -20.251 8.627   1.00 0.00 ? 111 GLN A CA   2  
ATOM 3447  C C    . GLN A 1 111 ? -16.537 -20.260 8.262   1.00 0.00 ? 111 GLN A C    2  
ATOM 3448  O O    . GLN A 1 111 ? -17.252 -19.288 8.505   1.00 0.00 ? 111 GLN A O    2  
ATOM 3449  C CB   . GLN A 1 111 ? -14.876 -19.767 10.067  1.00 0.00 ? 111 GLN A CB   2  
ATOM 3450  C CG   . GLN A 1 111 ? -15.579 -20.639 11.094  1.00 0.00 ? 111 GLN A CG   2  
ATOM 3451  C CD   . GLN A 1 111 ? -14.748 -21.837 11.509  1.00 0.00 ? 111 GLN A CD   2  
ATOM 3452  O OE1  . GLN A 1 111 ? -13.555 -21.913 11.211  1.00 0.00 ? 111 GLN A OE1  2  
ATOM 3453  N NE2  . GLN A 1 111 ? -15.374 -22.782 12.201  1.00 0.00 ? 111 GLN A NE2  2  
ATOM 3454  H H    . GLN A 1 111 ? -13.977 -18.534 8.020   1.00 0.00 ? 111 GLN A H    2  
ATOM 3455  H HA   . GLN A 1 111 ? -14.672 -21.256 8.544   1.00 0.00 ? 111 GLN A HA   2  
ATOM 3456  H HB2  . GLN A 1 111 ? -13.822 -19.751 10.300  1.00 0.00 ? 111 GLN A HB2  2  
ATOM 3457  H HB3  . GLN A 1 111 ? -15.269 -18.764 10.149  1.00 0.00 ? 111 GLN A HB3  2  
ATOM 3458  H HG2  . GLN A 1 111 ? -15.786 -20.044 11.971  1.00 0.00 ? 111 GLN A HG2  2  
ATOM 3459  H HG3  . GLN A 1 111 ? -16.508 -20.992 10.672  1.00 0.00 ? 111 GLN A HG3  2  
ATOM 3460  H HE21 . GLN A 1 111 ? -16.325 -22.654 12.401  1.00 0.00 ? 111 GLN A HE21 2  
ATOM 3461  H HE22 . GLN A 1 111 ? -14.861 -23.567 12.481  1.00 0.00 ? 111 GLN A HE22 2  
ATOM 3462  N N    . VAL A 1 112 ? -16.991 -21.364 7.678   1.00 0.00 ? 112 VAL A N    2  
ATOM 3463  C CA   . VAL A 1 112 ? -18.387 -21.500 7.281   1.00 0.00 ? 112 VAL A CA   2  
ATOM 3464  C C    . VAL A 1 112 ? -19.193 -22.235 8.347   1.00 0.00 ? 112 VAL A C    2  
ATOM 3465  O O    . VAL A 1 112 ? -18.841 -23.342 8.752   1.00 0.00 ? 112 VAL A O    2  
ATOM 3466  C CB   . VAL A 1 112 ? -18.519 -22.253 5.944   1.00 0.00 ? 112 VAL A CB   2  
ATOM 3467  C CG1  . VAL A 1 112 ? -17.776 -21.515 4.840   1.00 0.00 ? 112 VAL A CG1  2  
ATOM 3468  C CG2  . VAL A 1 112 ? -18.006 -23.678 6.082   1.00 0.00 ? 112 VAL A CG2  2  
ATOM 3469  H H    . VAL A 1 112 ? -16.372 -22.105 7.511   1.00 0.00 ? 112 VAL A H    2  
ATOM 3470  H HA   . VAL A 1 112 ? -18.796 -20.508 7.154   1.00 0.00 ? 112 VAL A HA   2  
ATOM 3471  H HB   . VAL A 1 112 ? -19.565 -22.293 5.678   1.00 0.00 ? 112 VAL A HB   2  
ATOM 3472  H HG11 . VAL A 1 112 ? -16.993 -20.912 5.275   1.00 0.00 ? 112 VAL A HG11 2  
ATOM 3473  H HG12 . VAL A 1 112 ? -17.344 -22.231 4.156   1.00 0.00 ? 112 VAL A HG12 2  
ATOM 3474  H HG13 . VAL A 1 112 ? -18.466 -20.878 4.306   1.00 0.00 ? 112 VAL A HG13 2  
ATOM 3475  H HG21 . VAL A 1 112 ? -17.813 -24.089 5.102   1.00 0.00 ? 112 VAL A HG21 2  
ATOM 3476  H HG22 . VAL A 1 112 ? -17.094 -23.677 6.659   1.00 0.00 ? 112 VAL A HG22 2  
ATOM 3477  H HG23 . VAL A 1 112 ? -18.749 -24.281 6.584   1.00 0.00 ? 112 VAL A HG23 2  
ATOM 3478  N N    . SER A 1 113 ? -20.276 -21.610 8.797   1.00 0.00 ? 113 SER A N    2  
ATOM 3479  C CA   . SER A 1 113 ? -21.131 -22.203 9.818   1.00 0.00 ? 113 SER A CA   2  
ATOM 3480  C C    . SER A 1 113 ? -22.598 -21.878 9.554   1.00 0.00 ? 113 SER A C    2  
ATOM 3481  O O    . SER A 1 113 ? -23.015 -20.723 9.633   1.00 0.00 ? 113 SER A O    2  
ATOM 3482  C CB   . SER A 1 113 ? -20.728 -21.700 11.206  1.00 0.00 ? 113 SER A CB   2  
ATOM 3483  O OG   . SER A 1 113 ? -21.103 -20.345 11.386  1.00 0.00 ? 113 SER A OG   2  
ATOM 3484  H H    . SER A 1 113 ? -20.504 -20.728 8.434   1.00 0.00 ? 113 SER A H    2  
ATOM 3485  H HA   . SER A 1 113 ? -20.999 -23.274 9.781   1.00 0.00 ? 113 SER A HA   2  
ATOM 3486  H HB2  . SER A 1 113 ? -21.216 -22.299 11.959  1.00 0.00 ? 113 SER A HB2  2  
ATOM 3487  H HB3  . SER A 1 113 ? -19.656 -21.782 11.318  1.00 0.00 ? 113 SER A HB3  2  
ATOM 3488  H HG   . SER A 1 113 ? -20.550 -19.947 12.062  1.00 0.00 ? 113 SER A HG   2  
ATOM 3489  N N    . GLY A 1 114 ? -23.378 -22.908 9.239   1.00 0.00 ? 114 GLY A N    2  
ATOM 3490  C CA   . GLY A 1 114 ? -24.790 -22.714 8.968   1.00 0.00 ? 114 GLY A CA   2  
ATOM 3491  C C    . GLY A 1 114 ? -25.099 -22.700 7.484   1.00 0.00 ? 114 GLY A C    2  
ATOM 3492  O O    . GLY A 1 114 ? -24.222 -22.481 6.647   1.00 0.00 ? 114 GLY A O    2  
ATOM 3493  H H    . GLY A 1 114 ? -22.992 -23.808 9.191   1.00 0.00 ? 114 GLY A H    2  
ATOM 3494  H HA2  . GLY A 1 114 ? -25.349 -23.511 9.434   1.00 0.00 ? 114 GLY A HA2  2  
ATOM 3495  H HA3  . GLY A 1 114 ? -25.101 -21.772 9.396   1.00 0.00 ? 114 GLY A HA3  2  
ATOM 3496  N N    . PRO A 1 115 ? -26.373 -22.941 7.138   1.00 0.00 ? 115 PRO A N    2  
ATOM 3497  C CA   . PRO A 1 115 ? -26.824 -22.962 5.743   1.00 0.00 ? 115 PRO A CA   2  
ATOM 3498  C C    . PRO A 1 115 ? -26.810 -21.576 5.108   1.00 0.00 ? 115 PRO A C    2  
ATOM 3499  O O    . PRO A 1 115 ? -27.204 -21.408 3.954   1.00 0.00 ? 115 PRO A O    2  
ATOM 3500  C CB   . PRO A 1 115 ? -28.257 -23.491 5.842   1.00 0.00 ? 115 PRO A CB   2  
ATOM 3501  C CG   . PRO A 1 115 ? -28.699 -23.132 7.218   1.00 0.00 ? 115 PRO A CG   2  
ATOM 3502  C CD   . PRO A 1 115 ? -27.470 -23.210 8.082   1.00 0.00 ? 115 PRO A CD   2  
ATOM 3503  H HA   . PRO A 1 115 ? -26.229 -23.637 5.144   1.00 0.00 ? 115 PRO A HA   2  
ATOM 3504  H HB2  . PRO A 1 115 ? -28.871 -23.015 5.091   1.00 0.00 ? 115 PRO A HB2  2  
ATOM 3505  H HB3  . PRO A 1 115 ? -28.260 -24.561 5.693   1.00 0.00 ? 115 PRO A HB3  2  
ATOM 3506  H HG2  . PRO A 1 115 ? -29.100 -22.130 7.226   1.00 0.00 ? 115 PRO A HG2  2  
ATOM 3507  H HG3  . PRO A 1 115 ? -29.442 -23.837 7.561   1.00 0.00 ? 115 PRO A HG3  2  
ATOM 3508  H HD2  . PRO A 1 115 ? -27.505 -22.458 8.857   1.00 0.00 ? 115 PRO A HD2  2  
ATOM 3509  H HD3  . PRO A 1 115 ? -27.374 -24.195 8.513   1.00 0.00 ? 115 PRO A HD3  2  
ATOM 3510  N N    . SER A 1 116 ? -26.355 -20.586 5.869   1.00 0.00 ? 116 SER A N    2  
ATOM 3511  C CA   . SER A 1 116 ? -26.293 -19.213 5.381   1.00 0.00 ? 116 SER A CA   2  
ATOM 3512  C C    . SER A 1 116 ? -25.964 -19.180 3.892   1.00 0.00 ? 116 SER A C    2  
ATOM 3513  O O    . SER A 1 116 ? -25.048 -19.861 3.432   1.00 0.00 ? 116 SER A O    2  
ATOM 3514  C CB   . SER A 1 116 ? -25.246 -18.418 6.164   1.00 0.00 ? 116 SER A CB   2  
ATOM 3515  O OG   . SER A 1 116 ? -25.328 -17.035 5.865   1.00 0.00 ? 116 SER A OG   2  
ATOM 3516  H H    . SER A 1 116 ? -26.055 -20.784 6.781   1.00 0.00 ? 116 SER A H    2  
ATOM 3517  H HA   . SER A 1 116 ? -27.263 -18.763 5.534   1.00 0.00 ? 116 SER A HA   2  
ATOM 3518  H HB2  . SER A 1 116 ? -25.411 -18.555 7.222   1.00 0.00 ? 116 SER A HB2  2  
ATOM 3519  H HB3  . SER A 1 116 ? -24.260 -18.773 5.904   1.00 0.00 ? 116 SER A HB3  2  
ATOM 3520  H HG   . SER A 1 116 ? -25.294 -16.528 6.679   1.00 0.00 ? 116 SER A HG   2  
ATOM 3521  N N    . SER A 1 117 ? -26.720 -18.383 3.143   1.00 0.00 ? 117 SER A N    2  
ATOM 3522  C CA   . SER A 1 117 ? -26.512 -18.263 1.705   1.00 0.00 ? 117 SER A CA   2  
ATOM 3523  C C    . SER A 1 117 ? -25.024 -18.244 1.370   1.00 0.00 ? 117 SER A C    2  
ATOM 3524  O O    . SER A 1 117 ? -24.228 -17.613 2.064   1.00 0.00 ? 117 SER A O    2  
ATOM 3525  C CB   . SER A 1 117 ? -27.182 -16.993 1.176   1.00 0.00 ? 117 SER A CB   2  
ATOM 3526  O OG   . SER A 1 117 ? -26.364 -15.857 1.394   1.00 0.00 ? 117 SER A OG   2  
ATOM 3527  H H    . SER A 1 117 ? -27.435 -17.865 3.568   1.00 0.00 ? 117 SER A H    2  
ATOM 3528  H HA   . SER A 1 117 ? -26.965 -19.122 1.232   1.00 0.00 ? 117 SER A HA   2  
ATOM 3529  H HB2  . SER A 1 117 ? -27.358 -17.097 0.116   1.00 0.00 ? 117 SER A HB2  2  
ATOM 3530  H HB3  . SER A 1 117 ? -28.124 -16.848 1.685   1.00 0.00 ? 117 SER A HB3  2  
ATOM 3531  H HG   . SER A 1 117 ? -25.689 -15.812 0.712   1.00 0.00 ? 117 SER A HG   2  
ATOM 3532  N N    . GLY A 1 118 ? -24.655 -18.942 0.300   1.00 0.00 ? 118 GLY A N    2  
ATOM 3533  C CA   . GLY A 1 118 ? -23.263 -18.993 -0.109  1.00 0.00 ? 118 GLY A CA   2  
ATOM 3534  C C    . GLY A 1 118 ? -22.915 -17.913 -1.114  1.00 0.00 ? 118 GLY A C    2  
ATOM 3535  O O    . GLY A 1 118 ? -22.665 -16.767 -0.743  1.00 0.00 ? 118 GLY A O    2  
ATOM 3536  H H    . GLY A 1 118 ? -25.333 -19.426 -0.216  1.00 0.00 ? 118 GLY A H    2  
ATOM 3537  H HA2  . GLY A 1 118 ? -22.639 -18.873 0.763   1.00 0.00 ? 118 GLY A HA2  2  
ATOM 3538  H HA3  . GLY A 1 118 ? -23.065 -19.958 -0.552  1.00 0.00 ? 118 GLY A HA3  2  
ATOM 3539  N N    . GLY A 1 1   ? 23.883  7.138   -14.267 1.00 0.00 ? 1   GLY A N    3  
ATOM 3540  C CA   . GLY A 1 1   ? 24.242  7.838   -15.487 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3541  C C    . GLY A 1 1   ? 25.634  8.434   -15.425 1.00 0.00 ? 1   GLY A C    3  
ATOM 3542  O O    . GLY A 1 1   ? 26.451  8.036   -14.595 1.00 0.00 ? 1   GLY A O    3  
ATOM 3543  H H1   . GLY A 1 1   ? 22.939  7.028   -14.027 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3544  H HA2  . GLY A 1 1   ? 24.194  7.145   -16.314 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3545  H HA3  . GLY A 1 1   ? 23.530  8.633   -15.654 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3546  N N    . SER A 1 2   ? 25.907  9.389   -16.308 1.00 0.00 ? 2   SER A N    3  
ATOM 3547  C CA   . SER A 1 2   ? 27.212  10.037  -16.354 1.00 0.00 ? 2   SER A CA   3  
ATOM 3548  C C    . SER A 1 2   ? 27.089  11.529  -16.059 1.00 0.00 ? 2   SER A C    3  
ATOM 3549  O O    . SER A 1 2   ? 27.721  12.045  -15.137 1.00 0.00 ? 2   SER A O    3  
ATOM 3550  C CB   . SER A 1 2   ? 27.860  9.829   -17.724 1.00 0.00 ? 2   SER A CB   3  
ATOM 3551  O OG   . SER A 1 2   ? 29.074  10.552  -17.830 1.00 0.00 ? 2   SER A OG   3  
ATOM 3552  H H    . SER A 1 2   ? 25.214  9.663   -16.944 1.00 0.00 ? 2   SER A H    3  
ATOM 3553  H HA   . SER A 1 2   ? 27.835  9.583   -15.598 1.00 0.00 ? 2   SER A HA   3  
ATOM 3554  H HB2  . SER A 1 2   ? 28.067  8.779   -17.866 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3555  H HB3  . SER A 1 2   ? 27.184  10.170  -18.495 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3556  H HG   . SER A 1 2   ? 29.495  10.599  -16.968 1.00 0.00 ? 2   SER A HG   3  
ATOM 3557  N N    . SER A 1 3   ? 26.271  12.217  -16.849 1.00 0.00 ? 3   SER A N    3  
ATOM 3558  C CA   . SER A 1 3   ? 26.067  13.650  -16.676 1.00 0.00 ? 3   SER A CA   3  
ATOM 3559  C C    . SER A 1 3   ? 26.106  14.030  -15.199 1.00 0.00 ? 3   SER A C    3  
ATOM 3560  O O    . SER A 1 3   ? 25.269  13.593  -14.411 1.00 0.00 ? 3   SER A O    3  
ATOM 3561  C CB   . SER A 1 3   ? 24.730  14.074  -17.288 1.00 0.00 ? 3   SER A CB   3  
ATOM 3562  O OG   . SER A 1 3   ? 24.562  15.480  -17.222 1.00 0.00 ? 3   SER A OG   3  
ATOM 3563  H H    . SER A 1 3   ? 25.795  11.749  -17.567 1.00 0.00 ? 3   SER A H    3  
ATOM 3564  H HA   . SER A 1 3   ? 26.867  14.163  -17.189 1.00 0.00 ? 3   SER A HA   3  
ATOM 3565  H HB2  . SER A 1 3   ? 24.697  13.768  -18.322 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3566  H HB3  . SER A 1 3   ? 23.924  13.601  -16.746 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3567  H HG   . SER A 1 3   ? 23.637  15.685  -17.068 1.00 0.00 ? 3   SER A HG   3  
ATOM 3568  N N    . GLY A 1 4   ? 27.087  14.849  -14.831 1.00 0.00 ? 4   GLY A N    3  
ATOM 3569  C CA   . GLY A 1 4   ? 27.219  15.274  -13.449 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3570  C C    . GLY A 1 4   ? 28.269  16.353  -13.273 1.00 0.00 ? 4   GLY A C    3  
ATOM 3571  O O    . GLY A 1 4   ? 29.450  16.129  -13.540 1.00 0.00 ? 4   GLY A O    3  
ATOM 3572  H H    . GLY A 1 4   ? 27.727  15.166  -15.502 1.00 0.00 ? 4   GLY A H    3  
ATOM 3573  H HA2  . GLY A 1 4   ? 26.267  15.654  -13.109 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3574  H HA3  . GLY A 1 4   ? 27.492  14.421  -12.846 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3575  N N    . SER A 1 5   ? 27.840  17.528  -12.824 1.00 0.00 ? 5   SER A N    3  
ATOM 3576  C CA   . SER A 1 5   ? 28.751  18.647  -12.618 1.00 0.00 ? 5   SER A CA   3  
ATOM 3577  C C    . SER A 1 5   ? 29.651  18.399  -11.411 1.00 0.00 ? 5   SER A C    3  
ATOM 3578  O O    . SER A 1 5   ? 29.429  17.468  -10.637 1.00 0.00 ? 5   SER A O    3  
ATOM 3579  C CB   . SER A 1 5   ? 27.963  19.944  -12.422 1.00 0.00 ? 5   SER A CB   3  
ATOM 3580  O OG   . SER A 1 5   ? 27.502  20.452  -13.662 1.00 0.00 ? 5   SER A OG   3  
ATOM 3581  H H    . SER A 1 5   ? 26.886  17.645  -12.629 1.00 0.00 ? 5   SER A H    3  
ATOM 3582  H HA   . SER A 1 5   ? 29.367  18.740  -13.499 1.00 0.00 ? 5   SER A HA   3  
ATOM 3583  H HB2  . SER A 1 5   ? 27.112  19.754  -11.786 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3584  H HB3  . SER A 1 5   ? 28.601  20.683  -11.959 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3585  H HG   . SER A 1 5   ? 26.549  20.350  -13.716 1.00 0.00 ? 5   SER A HG   3  
ATOM 3586  N N    . SER A 1 6   ? 30.670  19.240  -11.258 1.00 0.00 ? 6   SER A N    3  
ATOM 3587  C CA   . SER A 1 6   ? 31.607  19.111  -10.149 1.00 0.00 ? 6   SER A CA   3  
ATOM 3588  C C    . SER A 1 6   ? 31.828  17.644  -9.792  1.00 0.00 ? 6   SER A C    3  
ATOM 3589  O O    . SER A 1 6   ? 31.837  17.273  -8.619  1.00 0.00 ? 6   SER A O    3  
ATOM 3590  C CB   . SER A 1 6   ? 31.092  19.873  -8.926  1.00 0.00 ? 6   SER A CB   3  
ATOM 3591  O OG   . SER A 1 6   ? 29.888  19.304  -8.442  1.00 0.00 ? 6   SER A OG   3  
ATOM 3592  H H    . SER A 1 6   ? 30.795  19.962  -11.909 1.00 0.00 ? 6   SER A H    3  
ATOM 3593  H HA   . SER A 1 6   ? 32.549  19.539  -10.459 1.00 0.00 ? 6   SER A HA   3  
ATOM 3594  H HB2  . SER A 1 6   ? 31.834  19.836  -8.144  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3595  H HB3  . SER A 1 6   ? 30.906  20.902  -9.199  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3596  H HG   . SER A 1 6   ? 29.222  19.326  -9.133  1.00 0.00 ? 6   SER A HG   3  
ATOM 3597  N N    . GLY A 1 7   ? 32.006  16.813  -10.814 1.00 0.00 ? 7   GLY A N    3  
ATOM 3598  C CA   . GLY A 1 7   ? 32.224  15.396  -10.589 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3599  C C    . GLY A 1 7   ? 30.932  14.643  -10.341 1.00 0.00 ? 7   GLY A C    3  
ATOM 3600  O O    . GLY A 1 7   ? 30.087  14.536  -11.230 1.00 0.00 ? 7   GLY A O    3  
ATOM 3601  H H    . GLY A 1 7   ? 31.989  17.165  -11.729 1.00 0.00 ? 7   GLY A H    3  
ATOM 3602  H HA2  . GLY A 1 7   ? 32.713  14.976  -11.455 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3603  H HA3  . GLY A 1 7   ? 32.868  15.274  -9.730  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3604  N N    . SER A 1 8   ? 30.778  14.117  -9.130  1.00 0.00 ? 8   SER A N    3  
ATOM 3605  C CA   . SER A 1 8   ? 29.582  13.364  -8.770  1.00 0.00 ? 8   SER A CA   3  
ATOM 3606  C C    . SER A 1 8   ? 28.627  14.224  -7.949  1.00 0.00 ? 8   SER A C    3  
ATOM 3607  O O    . SER A 1 8   ? 28.934  15.369  -7.614  1.00 0.00 ? 8   SER A O    3  
ATOM 3608  C CB   . SER A 1 8   ? 29.962  12.109  -7.982  1.00 0.00 ? 8   SER A CB   3  
ATOM 3609  O OG   . SER A 1 8   ? 30.792  11.256  -8.751  1.00 0.00 ? 8   SER A OG   3  
ATOM 3610  H H    . SER A 1 8   ? 31.488  14.236  -8.464  1.00 0.00 ? 8   SER A H    3  
ATOM 3611  H HA   . SER A 1 8   ? 29.088  13.070  -9.684  1.00 0.00 ? 8   SER A HA   3  
ATOM 3612  H HB2  . SER A 1 8   ? 30.492  12.395  -7.087  1.00 0.00 ? 8   SER A HB2  3  
ATOM 3613  H HB3  . SER A 1 8   ? 29.064  11.571  -7.713  1.00 0.00 ? 8   SER A HB3  3  
ATOM 3614  H HG   . SER A 1 8   ? 31.711  11.506  -8.627  1.00 0.00 ? 8   SER A HG   3  
ATOM 3615  N N    . HIS A 1 9   ? 27.465  13.664  -7.626  1.00 0.00 ? 9   HIS A N    3  
ATOM 3616  C CA   . HIS A 1 9   ? 26.463  14.378  -6.843  1.00 0.00 ? 9   HIS A CA   3  
ATOM 3617  C C    . HIS A 1 9   ? 25.637  13.409  -6.003  1.00 0.00 ? 9   HIS A C    3  
ATOM 3618  O O    . HIS A 1 9   ? 25.022  12.483  -6.532  1.00 0.00 ? 9   HIS A O    3  
ATOM 3619  C CB   . HIS A 1 9   ? 25.545  15.184  -7.763  1.00 0.00 ? 9   HIS A CB   3  
ATOM 3620  C CG   . HIS A 1 9   ? 26.059  16.556  -8.070  1.00 0.00 ? 9   HIS A CG   3  
ATOM 3621  N ND1  . HIS A 1 9   ? 26.630  16.893  -9.280  1.00 0.00 ? 9   HIS A ND1  3  
ATOM 3622  C CD2  . HIS A 1 9   ? 26.084  17.681  -7.318  1.00 0.00 ? 9   HIS A CD2  3  
ATOM 3623  C CE1  . HIS A 1 9   ? 26.985  18.165  -9.257  1.00 0.00 ? 9   HIS A CE1  3  
ATOM 3624  N NE2  . HIS A 1 9   ? 26.665  18.667  -8.077  1.00 0.00 ? 9   HIS A NE2  3  
ATOM 3625  H H    . HIS A 1 9   ? 27.277  12.749  -7.922  1.00 0.00 ? 9   HIS A H    3  
ATOM 3626  H HA   . HIS A 1 9   ? 26.980  15.057  -6.182  1.00 0.00 ? 9   HIS A HA   3  
ATOM 3627  H HB2  . HIS A 1 9   ? 25.431  14.656  -8.699  1.00 0.00 ? 9   HIS A HB2  3  
ATOM 3628  H HB3  . HIS A 1 9   ? 24.577  15.288  -7.294  1.00 0.00 ? 9   HIS A HB3  3  
ATOM 3629  H HD2  . HIS A 1 9   ? 25.716  17.785  -6.306  1.00 0.00 ? 9   HIS A HD2  3  
ATOM 3630  H HE1  . HIS A 1 9   ? 27.457  18.705  -10.064 1.00 0.00 ? 9   HIS A HE1  3  
ATOM 3631  H HE2  . HIS A 1 9   ? 26.896  19.566  -7.765  1.00 0.00 ? 9   HIS A HE2  3  
ATOM 3632  N N    . ASP A 1 10  ? 25.629  13.628  -4.693  1.00 0.00 ? 10  ASP A N    3  
ATOM 3633  C CA   . ASP A 1 10  ? 24.879  12.773  -3.779  1.00 0.00 ? 10  ASP A CA   3  
ATOM 3634  C C    . ASP A 1 10  ? 23.553  12.347  -4.400  1.00 0.00 ? 10  ASP A C    3  
ATOM 3635  O O    . ASP A 1 10  ? 23.156  11.185  -4.305  1.00 0.00 ? 10  ASP A O    3  
ATOM 3636  C CB   . ASP A 1 10  ? 24.628  13.501  -2.458  1.00 0.00 ? 10  ASP A CB   3  
ATOM 3637  C CG   . ASP A 1 10  ? 25.830  14.302  -2.000  1.00 0.00 ? 10  ASP A CG   3  
ATOM 3638  O OD1  . ASP A 1 10  ? 26.893  13.693  -1.760  1.00 0.00 ? 10  ASP A OD1  3  
ATOM 3639  O OD2  . ASP A 1 10  ? 25.708  15.540  -1.881  1.00 0.00 ? 10  ASP A OD2  3  
ATOM 3640  H H    . ASP A 1 10  ? 26.140  14.383  -4.331  1.00 0.00 ? 10  ASP A H    3  
ATOM 3641  H HA   . ASP A 1 10  ? 25.472  11.892  -3.587  1.00 0.00 ? 10  ASP A HA   3  
ATOM 3642  H HB2  . ASP A 1 10  ? 23.793  14.176  -2.579  1.00 0.00 ? 10  ASP A HB2  3  
ATOM 3643  H HB3  . ASP A 1 10  ? 24.390  12.774  -1.694  1.00 0.00 ? 10  ASP A HB3  3  
ATOM 3644  N N    . SER A 1 11  ? 22.870  13.295  -5.035  1.00 0.00 ? 11  SER A N    3  
ATOM 3645  C CA   . SER A 1 11  ? 21.585  13.019  -5.667  1.00 0.00 ? 11  SER A CA   3  
ATOM 3646  C C    . SER A 1 11  ? 20.642  12.316  -4.695  1.00 0.00 ? 11  SER A C    3  
ATOM 3647  O O    . SER A 1 11  ? 19.928  11.385  -5.070  1.00 0.00 ? 11  SER A O    3  
ATOM 3648  C CB   . SER A 1 11  ? 21.782  12.158  -6.916  1.00 0.00 ? 11  SER A CB   3  
ATOM 3649  O OG   . SER A 1 11  ? 22.017  12.964  -8.058  1.00 0.00 ? 11  SER A OG   3  
ATOM 3650  H H    . SER A 1 11  ? 23.239  14.202  -5.076  1.00 0.00 ? 11  SER A H    3  
ATOM 3651  H HA   . SER A 1 11  ? 21.148  13.963  -5.956  1.00 0.00 ? 11  SER A HA   3  
ATOM 3652  H HB2  . SER A 1 11  ? 22.630  11.505  -6.771  1.00 0.00 ? 11  SER A HB2  3  
ATOM 3653  H HB3  . SER A 1 11  ? 20.895  11.565  -7.085  1.00 0.00 ? 11  SER A HB3  3  
ATOM 3654  H HG   . SER A 1 11  ? 22.268  12.405  -8.798  1.00 0.00 ? 11  SER A HG   3  
ATOM 3655  N N    . ARG A 1 12  ? 20.645  12.769  -3.446  1.00 0.00 ? 12  ARG A N    3  
ATOM 3656  C CA   . ARG A 1 12  ? 19.791  12.183  -2.419  1.00 0.00 ? 12  ARG A CA   3  
ATOM 3657  C C    . ARG A 1 12  ? 19.042  13.269  -1.651  1.00 0.00 ? 12  ARG A C    3  
ATOM 3658  O O    . ARG A 1 12  ? 19.460  13.678  -0.567  1.00 0.00 ? 12  ARG A O    3  
ATOM 3659  C CB   . ARG A 1 12  ? 20.624  11.341  -1.451  1.00 0.00 ? 12  ARG A CB   3  
ATOM 3660  C CG   . ARG A 1 12  ? 19.827  10.795  -0.278  1.00 0.00 ? 12  ARG A CG   3  
ATOM 3661  C CD   . ARG A 1 12  ? 19.174  9.465   -0.619  1.00 0.00 ? 12  ARG A CD   3  
ATOM 3662  N NE   . ARG A 1 12  ? 17.886  9.643   -1.285  1.00 0.00 ? 12  ARG A NE   3  
ATOM 3663  C CZ   . ARG A 1 12  ? 17.012  8.660   -1.469  1.00 0.00 ? 12  ARG A CZ   3  
ATOM 3664  N NH1  . ARG A 1 12  ? 17.285  7.436   -1.039  1.00 0.00 ? 12  ARG A NH1  3  
ATOM 3665  N NH2  . ARG A 1 12  ? 15.861  8.901   -2.085  1.00 0.00 ? 12  ARG A NH2  3  
ATOM 3666  H H    . ARG A 1 12  ? 21.236  13.513  -3.208  1.00 0.00 ? 12  ARG A H    3  
ATOM 3667  H HA   . ARG A 1 12  ? 19.071  11.545  -2.910  1.00 0.00 ? 12  ARG A HA   3  
ATOM 3668  H HB2  . ARG A 1 12  ? 21.046  10.506  -1.991  1.00 0.00 ? 12  ARG A HB2  3  
ATOM 3669  H HB3  . ARG A 1 12  ? 21.425  11.951  -1.062  1.00 0.00 ? 12  ARG A HB3  3  
ATOM 3670  H HG2  . ARG A 1 12  ? 20.492  10.652  0.561   1.00 0.00 ? 12  ARG A HG2  3  
ATOM 3671  H HG3  . ARG A 1 12  ? 19.059  11.507  -0.014  1.00 0.00 ? 12  ARG A HG3  3  
ATOM 3672  H HD2  . ARG A 1 12  ? 19.832  8.913   -1.272  1.00 0.00 ? 12  ARG A HD2  3  
ATOM 3673  H HD3  . ARG A 1 12  ? 19.022  8.909   0.294   1.00 0.00 ? 12  ARG A HD3  3  
ATOM 3674  H HE   . ARG A 1 12  ? 17.664  10.540  -1.611  1.00 0.00 ? 12  ARG A HE   3  
ATOM 3675  H HH11 . ARG A 1 12  ? 18.151  7.253   -0.574  1.00 0.00 ? 12  ARG A HH11 3  
ATOM 3676  H HH12 . ARG A 1 12  ? 16.625  6.698   -1.178  1.00 0.00 ? 12  ARG A HH12 3  
ATOM 3677  H HH21 . ARG A 1 12  ? 15.652  9.822   -2.411  1.00 0.00 ? 12  ARG A HH21 3  
ATOM 3678  H HH22 . ARG A 1 12  ? 15.204  8.160   -2.223  1.00 0.00 ? 12  ARG A HH22 3  
ATOM 3679  N N    . LEU A 1 13  ? 17.934  13.731  -2.220  1.00 0.00 ? 13  LEU A N    3  
ATOM 3680  C CA   . LEU A 1 13  ? 17.127  14.770  -1.589  1.00 0.00 ? 13  LEU A CA   3  
ATOM 3681  C C    . LEU A 1 13  ? 15.640  14.527  -1.832  1.00 0.00 ? 13  LEU A C    3  
ATOM 3682  O O    . LEU A 1 13  ? 15.155  14.649  -2.957  1.00 0.00 ? 13  LEU A O    3  
ATOM 3683  C CB   . LEU A 1 13  ? 17.524  16.147  -2.124  1.00 0.00 ? 13  LEU A CB   3  
ATOM 3684  C CG   . LEU A 1 13  ? 19.005  16.509  -2.011  1.00 0.00 ? 13  LEU A CG   3  
ATOM 3685  C CD1  . LEU A 1 13  ? 19.356  17.628  -2.979  1.00 0.00 ? 13  LEU A CD1  3  
ATOM 3686  C CD2  . LEU A 1 13  ? 19.350  16.907  -0.584  1.00 0.00 ? 13  LEU A CD2  3  
ATOM 3687  H H    . LEU A 1 13  ? 17.651  13.366  -3.084  1.00 0.00 ? 13  LEU A H    3  
ATOM 3688  H HA   . LEU A 1 13  ? 17.316  14.737  -0.527  1.00 0.00 ? 13  LEU A HA   3  
ATOM 3689  H HB2  . LEU A 1 13  ? 17.252  16.187  -3.167  1.00 0.00 ? 13  LEU A HB2  3  
ATOM 3690  H HB3  . LEU A 1 13  ? 16.958  16.888  -1.577  1.00 0.00 ? 13  LEU A HB3  3  
ATOM 3691  H HG   . LEU A 1 13  ? 19.601  15.645  -2.271  1.00 0.00 ? 13  LEU A HG   3  
ATOM 3692  H HD11 . LEU A 1 13  ? 18.504  17.842  -3.606  1.00 0.00 ? 13  LEU A HD11 3  
ATOM 3693  H HD12 . LEU A 1 13  ? 20.189  17.324  -3.594  1.00 0.00 ? 13  LEU A HD12 3  
ATOM 3694  H HD13 . LEU A 1 13  ? 19.625  18.514  -2.422  1.00 0.00 ? 13  LEU A HD13 3  
ATOM 3695  H HD21 . LEU A 1 13  ? 20.282  17.453  -0.577  1.00 0.00 ? 13  LEU A HD21 3  
ATOM 3696  H HD22 . LEU A 1 13  ? 19.447  16.020  0.024   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 3697  H HD23 . LEU A 1 13  ? 18.563  17.532  -0.185  1.00 0.00 ? 13  LEU A HD23 3  
ATOM 3698  N N    . THR A 1 14  ? 14.921  14.183  -0.768  1.00 0.00 ? 14  THR A N    3  
ATOM 3699  C CA   . THR A 1 14  ? 13.490  13.924  -0.865  1.00 0.00 ? 14  THR A CA   3  
ATOM 3700  C C    . THR A 1 14  ? 12.688  14.975  -0.106  1.00 0.00 ? 14  THR A C    3  
ATOM 3701  O O    . THR A 1 14  ? 12.703  15.012  1.124   1.00 0.00 ? 14  THR A O    3  
ATOM 3702  C CB   . THR A 1 14  ? 13.133  12.529  -0.319  1.00 0.00 ? 14  THR A CB   3  
ATOM 3703  O OG1  . THR A 1 14  ? 13.552  12.416  1.046   1.00 0.00 ? 14  THR A OG1  3  
ATOM 3704  C CG2  . THR A 1 14  ? 13.792  11.438  -1.149  1.00 0.00 ? 14  THR A CG2  3  
ATOM 3705  H H    . THR A 1 14  ? 15.364  14.102  0.102   1.00 0.00 ? 14  THR A H    3  
ATOM 3706  H HA   . THR A 1 14  ? 13.214  13.960  -1.909  1.00 0.00 ? 14  THR A HA   3  
ATOM 3707  H HB   . THR A 1 14  ? 12.061  12.402  -0.370  1.00 0.00 ? 14  THR A HB   3  
ATOM 3708  H HG1  . THR A 1 14  ? 13.573  11.489  1.298   1.00 0.00 ? 14  THR A HG1  3  
ATOM 3709  H HG21 . THR A 1 14  ? 14.626  11.855  -1.693  1.00 0.00 ? 14  THR A HG21 3  
ATOM 3710  H HG22 . THR A 1 14  ? 13.074  11.032  -1.846  1.00 0.00 ? 14  THR A HG22 3  
ATOM 3711  H HG23 . THR A 1 14  ? 14.144  10.653  -0.497  1.00 0.00 ? 14  THR A HG23 3  
ATOM 3712  N N    . ALA A 1 15  ? 11.988  15.828  -0.846  1.00 0.00 ? 15  ALA A N    3  
ATOM 3713  C CA   . ALA A 1 15  ? 11.177  16.878  -0.242  1.00 0.00 ? 15  ALA A CA   3  
ATOM 3714  C C    . ALA A 1 15  ? 9.737   16.816  -0.740  1.00 0.00 ? 15  ALA A C    3  
ATOM 3715  O O    . ALA A 1 15  ? 8.795   17.003  0.029   1.00 0.00 ? 15  ALA A O    3  
ATOM 3716  C CB   . ALA A 1 15  ? 11.780  18.244  -0.533  1.00 0.00 ? 15  ALA A CB   3  
ATOM 3717  H H    . ALA A 1 15  ? 12.015  15.748  -1.822  1.00 0.00 ? 15  ALA A H    3  
ATOM 3718  H HA   . ALA A 1 15  ? 11.184  16.730  0.829   1.00 0.00 ? 15  ALA A HA   3  
ATOM 3719  H HB1  . ALA A 1 15  ? 12.552  18.144  -1.282  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 3720  H HB2  . ALA A 1 15  ? 11.009  18.907  -0.897  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 3721  H HB3  . ALA A 1 15  ? 12.207  18.650  0.372   1.00 0.00 ? 15  ALA A HB3  3  
ATOM 3722  N N    . GLY A 1 16  ? 9.574   16.552  -2.033  1.00 0.00 ? 16  GLY A N    3  
ATOM 3723  C CA   . GLY A 1 16  ? 8.246   16.471  -2.612  1.00 0.00 ? 16  GLY A CA   3  
ATOM 3724  C C    . GLY A 1 16  ? 7.737   15.046  -2.697  1.00 0.00 ? 16  GLY A C    3  
ATOM 3725  O O    . GLY A 1 16  ? 6.990   14.699  -3.613  1.00 0.00 ? 16  GLY A O    3  
ATOM 3726  H H    . GLY A 1 16  ? 10.362  16.411  -2.598  1.00 0.00 ? 16  GLY A H    3  
ATOM 3727  H HA2  . GLY A 1 16  ? 7.565   17.049  -2.005  1.00 0.00 ? 16  GLY A HA2  3  
ATOM 3728  H HA3  . GLY A 1 16  ? 8.273   16.891  -3.606  1.00 0.00 ? 16  GLY A HA3  3  
ATOM 3729  N N    . VAL A 1 17  ? 8.142   14.215  -1.742  1.00 0.00 ? 17  VAL A N    3  
ATOM 3730  C CA   . VAL A 1 17  ? 7.723   12.819  -1.713  1.00 0.00 ? 17  VAL A CA   3  
ATOM 3731  C C    . VAL A 1 17  ? 6.490   12.634  -0.836  1.00 0.00 ? 17  VAL A C    3  
ATOM 3732  O O    . VAL A 1 17  ? 6.281   13.349  0.144   1.00 0.00 ? 17  VAL A O    3  
ATOM 3733  C CB   . VAL A 1 17  ? 8.850   11.905  -1.196  1.00 0.00 ? 17  VAL A CB   3  
ATOM 3734  C CG1  . VAL A 1 17  ? 9.966   11.799  -2.224  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3735  C CG2  . VAL A 1 17  ? 9.385   12.419  0.132   1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3736  H H    . VAL A 1 17  ? 8.737   14.550  -1.039  1.00 0.00 ? 17  VAL A H    3  
ATOM 3737  H HA   . VAL A 1 17  ? 7.482   12.522  -2.723  1.00 0.00 ? 17  VAL A HA   3  
ATOM 3738  H HB   . VAL A 1 17  ? 8.441   10.918  -1.037  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3739  H HG11 . VAL A 1 17  ? 10.124  12.763  -2.684  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3740  H HG12 . VAL A 1 17  ? 10.874  11.477  -1.737  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3741  H HG13 . VAL A 1 17  ? 9.689   11.081  -2.982  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3742  H HG21 . VAL A 1 17  ? 9.749   11.589  0.719   1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3743  H HG22 . VAL A 1 17  ? 10.191  13.114  -0.050  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3744  H HG23 . VAL A 1 17  ? 8.593   12.920  0.670   1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3745  N N    . PRO A 1 18  ? 5.651   11.650  -1.194  1.00 0.00 ? 18  PRO A N    3  
ATOM 3746  C CA   . PRO A 1 18  ? 4.424   11.346  -0.452  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3747  C C    . PRO A 1 18  ? 4.710   10.737  0.916   1.00 0.00 ? 18  PRO A C    3  
ATOM 3748  O O    . PRO A 1 18  ? 5.493   9.794   1.035   1.00 0.00 ? 18  PRO A O    3  
ATOM 3749  C CB   . PRO A 1 18  ? 3.709   10.333  -1.350  1.00 0.00 ? 18  PRO A CB   3  
ATOM 3750  C CG   . PRO A 1 18  ? 4.797   9.693   -2.141  1.00 0.00 ? 18  PRO A CG   3  
ATOM 3751  C CD   . PRO A 1 18  ? 5.837   10.758  -2.351  1.00 0.00 ? 18  PRO A CD   3  
ATOM 3752  H HA   . PRO A 1 18  ? 3.806   12.223  -0.333  1.00 0.00 ? 18  PRO A HA   3  
ATOM 3753  H HB2  . PRO A 1 18  ? 3.187   9.611   -0.737  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3754  H HB3  . PRO A 1 18  ? 3.006   10.846  -1.989  1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3755  H HG2  . PRO A 1 18  ? 5.214   8.865   -1.589  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3756  H HG3  . PRO A 1 18  ? 4.409   9.355   -3.091  1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3757  H HD2  . PRO A 1 18  ? 6.826   10.325  -2.350  1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3758  H HD3  . PRO A 1 18  ? 5.656   11.285  -3.277  1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3759  N N    . ASP A 1 19  ? 4.071   11.281  1.946   1.00 0.00 ? 19  ASP A N    3  
ATOM 3760  C CA   . ASP A 1 19  ? 4.256   10.790  3.306   1.00 0.00 ? 19  ASP A CA   3  
ATOM 3761  C C    . ASP A 1 19  ? 3.605   9.422   3.483   1.00 0.00 ? 19  ASP A C    3  
ATOM 3762  O O    . ASP A 1 19  ? 2.890   8.943   2.602   1.00 0.00 ? 19  ASP A O    3  
ATOM 3763  C CB   . ASP A 1 19  ? 3.670   11.781  4.313   1.00 0.00 ? 19  ASP A CB   3  
ATOM 3764  C CG   . ASP A 1 19  ? 4.359   11.712  5.662   1.00 0.00 ? 19  ASP A CG   3  
ATOM 3765  O OD1  . ASP A 1 19  ? 5.588   11.493  5.689   1.00 0.00 ? 19  ASP A OD1  3  
ATOM 3766  O OD2  . ASP A 1 19  ? 3.669   11.879  6.689   1.00 0.00 ? 19  ASP A OD2  3  
ATOM 3767  H H    . ASP A 1 19  ? 3.460   12.031  1.787   1.00 0.00 ? 19  ASP A H    3  
ATOM 3768  H HA   . ASP A 1 19  ? 5.316   10.696  3.484   1.00 0.00 ? 19  ASP A HA   3  
ATOM 3769  H HB2  . ASP A 1 19  ? 3.777   12.784  3.926   1.00 0.00 ? 19  ASP A HB2  3  
ATOM 3770  H HB3  . ASP A 1 19  ? 2.621   11.564  4.453   1.00 0.00 ? 19  ASP A HB3  3  
ATOM 3771  N N    . THR A 1 20  ? 3.858   8.795   4.628   1.00 0.00 ? 20  THR A N    3  
ATOM 3772  C CA   . THR A 1 20  ? 3.299   7.481   4.920   1.00 0.00 ? 20  THR A CA   3  
ATOM 3773  C C    . THR A 1 20  ? 1.780   7.491   4.801   1.00 0.00 ? 20  THR A C    3  
ATOM 3774  O O    . THR A 1 20  ? 1.094   8.338   5.373   1.00 0.00 ? 20  THR A O    3  
ATOM 3775  C CB   . THR A 1 20  ? 3.689   7.005   6.332   1.00 0.00 ? 20  THR A CB   3  
ATOM 3776  O OG1  . THR A 1 20  ? 4.971   7.534   6.690   1.00 0.00 ? 20  THR A OG1  3  
ATOM 3777  C CG2  . THR A 1 20  ? 3.725   5.486   6.401   1.00 0.00 ? 20  THR A CG2  3  
ATOM 3778  H H    . THR A 1 20  ? 4.435   9.228   5.291   1.00 0.00 ? 20  THR A H    3  
ATOM 3779  H HA   . THR A 1 20  ? 3.702   6.780   4.202   1.00 0.00 ? 20  THR A HA   3  
ATOM 3780  H HB   . THR A 1 20  ? 2.951   7.366   7.033   1.00 0.00 ? 20  THR A HB   3  
ATOM 3781  H HG1  . THR A 1 20  ? 5.482   7.702   5.895   1.00 0.00 ? 20  THR A HG1  3  
ATOM 3782  H HG21 . THR A 1 20  ? 3.815   5.175   7.430   1.00 0.00 ? 20  THR A HG21 3  
ATOM 3783  H HG22 . THR A 1 20  ? 4.572   5.120   5.839   1.00 0.00 ? 20  THR A HG22 3  
ATOM 3784  H HG23 . THR A 1 20  ? 2.814   5.085   5.981   1.00 0.00 ? 20  THR A HG23 3  
ATOM 3785  N N    . PRO A 1 21  ? 1.238   6.527   4.041   1.00 0.00 ? 21  PRO A N    3  
ATOM 3786  C CA   . PRO A 1 21  ? -0.207  6.403   3.831   1.00 0.00 ? 21  PRO A CA   3  
ATOM 3787  C C    . PRO A 1 21  ? -0.940  5.957   5.092   1.00 0.00 ? 21  PRO A C    3  
ATOM 3788  O O    . PRO A 1 21  ? -0.353  5.336   5.978   1.00 0.00 ? 21  PRO A O    3  
ATOM 3789  C CB   . PRO A 1 21  ? -0.317  5.333   2.742   1.00 0.00 ? 21  PRO A CB   3  
ATOM 3790  C CG   . PRO A 1 21  ? 0.928   4.526   2.878   1.00 0.00 ? 21  PRO A CG   3  
ATOM 3791  C CD   . PRO A 1 21  ? 1.995   5.484   3.330   1.00 0.00 ? 21  PRO A CD   3  
ATOM 3792  H HA   . PRO A 1 21  ? -0.637  7.328   3.474   1.00 0.00 ? 21  PRO A HA   3  
ATOM 3793  H HB2  . PRO A 1 21  ? -1.199  4.732   2.912   1.00 0.00 ? 21  PRO A HB2  3  
ATOM 3794  H HB3  . PRO A 1 21  ? -0.377  5.805   1.773   1.00 0.00 ? 21  PRO A HB3  3  
ATOM 3795  H HG2  . PRO A 1 21  ? 0.784   3.750   3.614   1.00 0.00 ? 21  PRO A HG2  3  
ATOM 3796  H HG3  . PRO A 1 21  ? 1.192   4.095   1.923   1.00 0.00 ? 21  PRO A HG3  3  
ATOM 3797  H HD2  . PRO A 1 21  ? 2.689   4.990   3.994   1.00 0.00 ? 21  PRO A HD2  3  
ATOM 3798  H HD3  . PRO A 1 21  ? 2.515   5.898   2.479   1.00 0.00 ? 21  PRO A HD3  3  
ATOM 3799  N N    . THR A 1 22  ? -2.228  6.278   5.166   1.00 0.00 ? 22  THR A N    3  
ATOM 3800  C CA   . THR A 1 22  ? -3.042  5.911   6.319   1.00 0.00 ? 22  THR A CA   3  
ATOM 3801  C C    . THR A 1 22  ? -3.371  4.422   6.308   1.00 0.00 ? 22  THR A C    3  
ATOM 3802  O O    . THR A 1 22  ? -3.024  3.707   5.368   1.00 0.00 ? 22  THR A O    3  
ATOM 3803  C CB   . THR A 1 22  ? -4.355  6.715   6.358   1.00 0.00 ? 22  THR A CB   3  
ATOM 3804  O OG1  . THR A 1 22  ? -4.151  8.014   5.793   1.00 0.00 ? 22  THR A OG1  3  
ATOM 3805  C CG2  . THR A 1 22  ? -4.863  6.851   7.786   1.00 0.00 ? 22  THR A CG2  3  
ATOM 3806  H H    . THR A 1 22  ? -2.640  6.773   4.428   1.00 0.00 ? 22  THR A H    3  
ATOM 3807  H HA   . THR A 1 22  ? -2.477  6.139   7.211   1.00 0.00 ? 22  THR A HA   3  
ATOM 3808  H HB   . THR A 1 22  ? -5.099  6.190   5.776   1.00 0.00 ? 22  THR A HB   3  
ATOM 3809  H HG1  . THR A 1 22  ? -3.549  8.515   6.349   1.00 0.00 ? 22  THR A HG1  3  
ATOM 3810  H HG21 . THR A 1 22  ? -5.021  7.895   8.013   1.00 0.00 ? 22  THR A HG21 3  
ATOM 3811  H HG22 . THR A 1 22  ? -4.134  6.441   8.468   1.00 0.00 ? 22  THR A HG22 3  
ATOM 3812  H HG23 . THR A 1 22  ? -5.795  6.315   7.889   1.00 0.00 ? 22  THR A HG23 3  
ATOM 3813  N N    . ARG A 1 23  ? -4.042  3.962   7.359   1.00 0.00 ? 23  ARG A N    3  
ATOM 3814  C CA   . ARG A 1 23  ? -4.417  2.558   7.470   1.00 0.00 ? 23  ARG A CA   3  
ATOM 3815  C C    . ARG A 1 23  ? -5.100  2.074   6.194   1.00 0.00 ? 23  ARG A C    3  
ATOM 3816  O O    . ARG A 1 23  ? -5.679  2.866   5.449   1.00 0.00 ? 23  ARG A O    3  
ATOM 3817  C CB   . ARG A 1 23  ? -5.345  2.349   8.668   1.00 0.00 ? 23  ARG A CB   3  
ATOM 3818  C CG   . ARG A 1 23  ? -4.762  2.840   9.983   1.00 0.00 ? 23  ARG A CG   3  
ATOM 3819  C CD   . ARG A 1 23  ? -5.484  2.231   11.175  1.00 0.00 ? 23  ARG A CD   3  
ATOM 3820  N NE   . ARG A 1 23  ? -4.976  2.745   12.444  1.00 0.00 ? 23  ARG A NE   3  
ATOM 3821  C CZ   . ARG A 1 23  ? -3.867  2.301   13.025  1.00 0.00 ? 23  ARG A CZ   3  
ATOM 3822  N NH1  . ARG A 1 23  ? -3.153  1.341   12.453  1.00 0.00 ? 23  ARG A NH1  3  
ATOM 3823  N NH2  . ARG A 1 23  ? -3.468  2.819   14.180  1.00 0.00 ? 23  ARG A NH2  3  
ATOM 3824  H H    . ARG A 1 23  ? -4.290  4.581   8.076   1.00 0.00 ? 23  ARG A H    3  
ATOM 3825  H HA   . ARG A 1 23  ? -3.515  1.984   7.621   1.00 0.00 ? 23  ARG A HA   3  
ATOM 3826  H HB2  . ARG A 1 23  ? -6.270  2.879   8.489   1.00 0.00 ? 23  ARG A HB2  3  
ATOM 3827  H HB3  . ARG A 1 23  ? -5.557  1.295   8.765   1.00 0.00 ? 23  ARG A HB3  3  
ATOM 3828  H HG2  . ARG A 1 23  ? -3.719  2.565   10.029  1.00 0.00 ? 23  ARG A HG2  3  
ATOM 3829  H HG3  . ARG A 1 23  ? -4.855  3.915   10.027  1.00 0.00 ? 23  ARG A HG3  3  
ATOM 3830  H HD2  . ARG A 1 23  ? -6.536  2.463   11.099  1.00 0.00 ? 23  ARG A HD2  3  
ATOM 3831  H HD3  . ARG A 1 23  ? -5.349  1.160   11.150  1.00 0.00 ? 23  ARG A HD3  3  
ATOM 3832  H HE   . ARG A 1 23  ? -5.487  3.455   12.883  1.00 0.00 ? 23  ARG A HE   3  
ATOM 3833  H HH11 . ARG A 1 23  ? -3.450  0.949   11.583  1.00 0.00 ? 23  ARG A HH11 3  
ATOM 3834  H HH12 . ARG A 1 23  ? -2.318  1.010   12.892  1.00 0.00 ? 23  ARG A HH12 3  
ATOM 3835  H HH21 . ARG A 1 23  ? -4.003  3.544   14.613  1.00 0.00 ? 23  ARG A HH21 3  
ATOM 3836  H HH22 . ARG A 1 23  ? -2.634  2.485   14.616  1.00 0.00 ? 23  ARG A HH22 3  
ATOM 3837  N N    . LEU A 1 24  ? -5.028  0.771   5.947   1.00 0.00 ? 24  LEU A N    3  
ATOM 3838  C CA   . LEU A 1 24  ? -5.639  0.182   4.761   1.00 0.00 ? 24  LEU A CA   3  
ATOM 3839  C C    . LEU A 1 24  ? -6.972  -0.474  5.104   1.00 0.00 ? 24  LEU A C    3  
ATOM 3840  O O    . LEU A 1 24  ? -7.224  -0.830  6.255   1.00 0.00 ? 24  LEU A O    3  
ATOM 3841  C CB   . LEU A 1 24  ? -4.696  -0.849  4.136   1.00 0.00 ? 24  LEU A CB   3  
ATOM 3842  C CG   . LEU A 1 24  ? -3.201  -0.594  4.329   1.00 0.00 ? 24  LEU A CG   3  
ATOM 3843  C CD1  . LEU A 1 24  ? -2.390  -1.791  3.857   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 3844  C CD2  . LEU A 1 24  ? -2.774  0.666   3.590   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 3845  H H    . LEU A 1 24  ? -4.553  0.191   6.578   1.00 0.00 ? 24  LEU A H    3  
ATOM 3846  H HA   . LEU A 1 24  ? -5.814  0.975   4.050   1.00 0.00 ? 24  LEU A HA   3  
ATOM 3847  H HB2  . LEU A 1 24  ? -4.926  -1.811  4.568   1.00 0.00 ? 24  LEU A HB2  3  
ATOM 3848  H HB3  . LEU A 1 24  ? -4.894  -0.875  3.074   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 3849  H HG   . LEU A 1 24  ? -2.999  -0.450  5.382   1.00 0.00 ? 24  LEU A HG   3  
ATOM 3850  H HD11 . LEU A 1 24  ? -1.996  -1.593  2.872   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 3851  H HD12 . LEU A 1 24  ? -3.025  -2.664  3.823   1.00 0.00 ? 24  LEU A HD12 3  
ATOM 3852  H HD13 . LEU A 1 24  ? -1.575  -1.967  4.544   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 3853  H HD21 . LEU A 1 24  ? -3.639  1.288   3.411   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 3854  H HD22 . LEU A 1 24  ? -2.324  0.394   2.647   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 3855  H HD23 . LEU A 1 24  ? -2.057  1.209   4.188   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 3856  N N    . VAL A 1 25  ? -7.824  -0.634  4.096   1.00 0.00 ? 25  VAL A N    3  
ATOM 3857  C CA   . VAL A 1 25  ? -9.131  -1.251  4.289   1.00 0.00 ? 25  VAL A CA   3  
ATOM 3858  C C    . VAL A 1 25  ? -9.273  -2.513  3.446   1.00 0.00 ? 25  VAL A C    3  
ATOM 3859  O O    . VAL A 1 25  ? -9.249  -2.457  2.216   1.00 0.00 ? 25  VAL A O    3  
ATOM 3860  C CB   . VAL A 1 25  ? -10.269 -0.277  3.933   1.00 0.00 ? 25  VAL A CB   3  
ATOM 3861  C CG1  . VAL A 1 25  ? -11.590 -1.021  3.807   1.00 0.00 ? 25  VAL A CG1  3  
ATOM 3862  C CG2  . VAL A 1 25  ? -10.369 0.830   4.972   1.00 0.00 ? 25  VAL A CG2  3  
ATOM 3863  H H    . VAL A 1 25  ? -7.567  -0.331  3.200   1.00 0.00 ? 25  VAL A H    3  
ATOM 3864  H HA   . VAL A 1 25  ? -9.224  -1.514  5.333   1.00 0.00 ? 25  VAL A HA   3  
ATOM 3865  H HB   . VAL A 1 25  ? -10.044 0.175   2.978   1.00 0.00 ? 25  VAL A HB   3  
ATOM 3866  H HG11 . VAL A 1 25  ? -12.394 -0.310  3.692   1.00 0.00 ? 25  VAL A HG11 3  
ATOM 3867  H HG12 . VAL A 1 25  ? -11.556 -1.671  2.944   1.00 0.00 ? 25  VAL A HG12 3  
ATOM 3868  H HG13 . VAL A 1 25  ? -11.756 -1.612  4.696   1.00 0.00 ? 25  VAL A HG13 3  
ATOM 3869  H HG21 . VAL A 1 25  ? -11.336 0.789   5.449   1.00 0.00 ? 25  VAL A HG21 3  
ATOM 3870  H HG22 . VAL A 1 25  ? -9.595  0.697   5.713   1.00 0.00 ? 25  VAL A HG22 3  
ATOM 3871  H HG23 . VAL A 1 25  ? -10.245 1.789   4.490   1.00 0.00 ? 25  VAL A HG23 3  
ATOM 3872  N N    . PHE A 1 26  ? -9.423  -3.651  4.115   1.00 0.00 ? 26  PHE A N    3  
ATOM 3873  C CA   . PHE A 1 26  ? -9.569  -4.929  3.427   1.00 0.00 ? 26  PHE A CA   3  
ATOM 3874  C C    . PHE A 1 26  ? -11.029 -5.373  3.411   1.00 0.00 ? 26  PHE A C    3  
ATOM 3875  O O    . PHE A 1 26  ? -11.727 -5.287  4.421   1.00 0.00 ? 26  PHE A O    3  
ATOM 3876  C CB   . PHE A 1 26  ? -8.707  -5.997  4.102   1.00 0.00 ? 26  PHE A CB   3  
ATOM 3877  C CG   . PHE A 1 26  ? -7.282  -5.572  4.313   1.00 0.00 ? 26  PHE A CG   3  
ATOM 3878  C CD1  . PHE A 1 26  ? -6.935  -4.776  5.394   1.00 0.00 ? 26  PHE A CD1  3  
ATOM 3879  C CD2  . PHE A 1 26  ? -6.289  -5.967  3.431   1.00 0.00 ? 26  PHE A CD2  3  
ATOM 3880  C CE1  . PHE A 1 26  ? -5.625  -4.383  5.591   1.00 0.00 ? 26  PHE A CE1  3  
ATOM 3881  C CE2  . PHE A 1 26  ? -4.977  -5.577  3.623   1.00 0.00 ? 26  PHE A CE2  3  
ATOM 3882  C CZ   . PHE A 1 26  ? -4.645  -4.783  4.704   1.00 0.00 ? 26  PHE A CZ   3  
ATOM 3883  H H    . PHE A 1 26  ? -9.435  -3.631  5.095   1.00 0.00 ? 26  PHE A H    3  
ATOM 3884  H HA   . PHE A 1 26  ? -9.234  -4.797  2.410   1.00 0.00 ? 26  PHE A HA   3  
ATOM 3885  H HB2  . PHE A 1 26  ? -9.128  -6.233  5.068   1.00 0.00 ? 26  PHE A HB2  3  
ATOM 3886  H HB3  . PHE A 1 26  ? -8.702  -6.885  3.489   1.00 0.00 ? 26  PHE A HB3  3  
ATOM 3887  H HD1  . PHE A 1 26  ? -7.702  -4.462  6.088   1.00 0.00 ? 26  PHE A HD1  3  
ATOM 3888  H HD2  . PHE A 1 26  ? -6.547  -6.586  2.585   1.00 0.00 ? 26  PHE A HD2  3  
ATOM 3889  H HE1  . PHE A 1 26  ? -5.369  -3.763  6.437   1.00 0.00 ? 26  PHE A HE1  3  
ATOM 3890  H HE2  . PHE A 1 26  ? -4.213  -5.891  2.928   1.00 0.00 ? 26  PHE A HE2  3  
ATOM 3891  H HZ   . PHE A 1 26  ? -3.620  -4.478  4.857   1.00 0.00 ? 26  PHE A HZ   3  
ATOM 3892  N N    . SER A 1 27  ? -11.483 -5.849  2.256   1.00 0.00 ? 27  SER A N    3  
ATOM 3893  C CA   . SER A 1 27  ? -12.861 -6.303  2.105   1.00 0.00 ? 27  SER A CA   3  
ATOM 3894  C C    . SER A 1 27  ? -12.942 -7.825  2.182   1.00 0.00 ? 27  SER A C    3  
ATOM 3895  O O    . SER A 1 27  ? -13.872 -8.378  2.768   1.00 0.00 ? 27  SER A O    3  
ATOM 3896  C CB   . SER A 1 27  ? -13.438 -5.817  0.774   1.00 0.00 ? 27  SER A CB   3  
ATOM 3897  O OG   . SER A 1 27  ? -14.840 -6.018  0.722   1.00 0.00 ? 27  SER A OG   3  
ATOM 3898  H H    . SER A 1 27  ? -10.878 -5.892  1.486   1.00 0.00 ? 27  SER A H    3  
ATOM 3899  H HA   . SER A 1 27  ? -13.439 -5.882  2.914   1.00 0.00 ? 27  SER A HA   3  
ATOM 3900  H HB2  . SER A 1 27  ? -13.234 -4.763  0.660   1.00 0.00 ? 27  SER A HB2  3  
ATOM 3901  H HB3  . SER A 1 27  ? -12.977 -6.363  -0.036  1.00 0.00 ? 27  SER A HB3  3  
ATOM 3902  H HG   . SER A 1 27  ? -15.146 -5.906  -0.181  1.00 0.00 ? 27  SER A HG   3  
ATOM 3903  N N    . ALA A 1 28  ? -11.962 -8.494  1.584   1.00 0.00 ? 28  ALA A N    3  
ATOM 3904  C CA   . ALA A 1 28  ? -11.921 -9.951  1.586   1.00 0.00 ? 28  ALA A CA   3  
ATOM 3905  C C    . ALA A 1 28  ? -13.121 -10.535 0.848   1.00 0.00 ? 28  ALA A C    3  
ATOM 3906  O O    . ALA A 1 28  ? -13.836 -11.386 1.380   1.00 0.00 ? 28  ALA A O    3  
ATOM 3907  C CB   . ALA A 1 28  ? -11.870 -10.476 3.013   1.00 0.00 ? 28  ALA A CB   3  
ATOM 3908  H H    . ALA A 1 28  ? -11.249 -7.996  1.133   1.00 0.00 ? 28  ALA A H    3  
ATOM 3909  H HA   . ALA A 1 28  ? -11.016 -10.260 1.082   1.00 0.00 ? 28  ALA A HA   3  
ATOM 3910  H HB1  . ALA A 1 28  ? -12.051 -11.541 3.012   1.00 0.00 ? 28  ALA A HB1  3  
ATOM 3911  H HB2  . ALA A 1 28  ? -10.895 -10.277 3.435   1.00 0.00 ? 28  ALA A HB2  3  
ATOM 3912  H HB3  . ALA A 1 28  ? -12.626 -9.983  3.605   1.00 0.00 ? 28  ALA A HB3  3  
ATOM 3913  N N    . LEU A 1 29  ? -13.337 -10.074 -0.379  1.00 0.00 ? 29  LEU A N    3  
ATOM 3914  C CA   . LEU A 1 29  ? -14.452 -10.550 -1.190  1.00 0.00 ? 29  LEU A CA   3  
ATOM 3915  C C    . LEU A 1 29  ? -14.634 -12.057 -1.035  1.00 0.00 ? 29  LEU A C    3  
ATOM 3916  O O    . LEU A 1 29  ? -15.726 -12.585 -1.238  1.00 0.00 ? 29  LEU A O    3  
ATOM 3917  C CB   . LEU A 1 29  ? -14.223 -10.202 -2.662  1.00 0.00 ? 29  LEU A CB   3  
ATOM 3918  C CG   . LEU A 1 29  ? -14.101 -8.713  -2.988  1.00 0.00 ? 29  LEU A CG   3  
ATOM 3919  C CD1  . LEU A 1 29  ? -14.910 -7.883  -2.004  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 3920  C CD2  . LEU A 1 29  ? -12.641 -8.282  -2.977  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 3921  H H    . LEU A 1 29  ? -12.734 -9.396  -0.748  1.00 0.00 ? 29  LEU A H    3  
ATOM 3922  H HA   . LEU A 1 29  ? -15.347 -10.054 -0.846  1.00 0.00 ? 29  LEU A HA   3  
ATOM 3923  H HB2  . LEU A 1 29  ? -13.311 -10.685 -2.978  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 3924  H HB3  . LEU A 1 29  ? -15.053 -10.599 -3.228  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 3925  H HG   . LEU A 1 29  ? -14.496 -8.534  -3.978  1.00 0.00 ? 29  LEU A HG   3  
ATOM 3926  H HD11 . LEU A 1 29  ? -14.564 -8.077  -0.999  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 3927  H HD12 . LEU A 1 29  ? -15.954 -8.147  -2.083  1.00 0.00 ? 29  LEU A HD12 3  
ATOM 3928  H HD13 . LEU A 1 29  ? -14.786 -6.834  -2.231  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 3929  H HD21 . LEU A 1 29  ? -12.530 -7.402  -2.362  1.00 0.00 ? 29  LEU A HD21 3  
ATOM 3930  H HD22 . LEU A 1 29  ? -12.325 -8.060  -3.986  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 3931  H HD23 . LEU A 1 29  ? -12.033 -9.081  -2.578  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 3932  N N    . GLY A 1 30  ? -13.555 -12.743 -0.670  1.00 0.00 ? 30  GLY A N    3  
ATOM 3933  C CA   . GLY A 1 30  ? -13.617 -14.182 -0.491  1.00 0.00 ? 30  GLY A CA   3  
ATOM 3934  C C    . GLY A 1 30  ? -12.340 -14.749 0.096   1.00 0.00 ? 30  GLY A C    3  
ATOM 3935  O O    . GLY A 1 30  ? -11.471 -14.017 0.570   1.00 0.00 ? 30  GLY A O    3  
ATOM 3936  H H    . GLY A 1 30  ? -12.710 -12.269 -0.522  1.00 0.00 ? 30  GLY A H    3  
ATOM 3937  H HA2  . GLY A 1 30  ? -14.440 -14.417 0.167   1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3938  H HA3  . GLY A 1 30  ? -13.794 -14.645 -1.451  1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3939  N N    . PRO A 1 31  ? -12.214 -16.084 0.072   1.00 0.00 ? 31  PRO A N    3  
ATOM 3940  C CA   . PRO A 1 31  ? -11.038 -16.779 0.603   1.00 0.00 ? 31  PRO A CA   3  
ATOM 3941  C C    . PRO A 1 31  ? -9.794  -16.548 -0.248  1.00 0.00 ? 31  PRO A C    3  
ATOM 3942  O O    . PRO A 1 31  ? -8.669  -16.597 0.250   1.00 0.00 ? 31  PRO A O    3  
ATOM 3943  C CB   . PRO A 1 31  ? -11.447 -18.253 0.563   1.00 0.00 ? 31  PRO A CB   3  
ATOM 3944  C CG   . PRO A 1 31  ? -12.476 -18.331 -0.512  1.00 0.00 ? 31  PRO A CG   3  
ATOM 3945  C CD   . PRO A 1 31  ? -13.211 -17.019 -0.478  1.00 0.00 ? 31  PRO A CD   3  
ATOM 3946  H HA   . PRO A 1 31  ? -10.833 -16.488 1.624   1.00 0.00 ? 31  PRO A HA   3  
ATOM 3947  H HB2  . PRO A 1 31  ? -10.585 -18.862 0.331   1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3948  H HB3  . PRO A 1 31  ? -11.854 -18.544 1.520   1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3949  H HG2  . PRO A 1 31  ? -11.997 -18.468 -1.469  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3950  H HG3  . PRO A 1 31  ? -13.156 -19.145 -0.311  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3951  H HD2  . PRO A 1 31  ? -13.506 -16.726 -1.474  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3952  H HD3  . PRO A 1 31  ? -14.073 -17.086 0.169   1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3953  N N    . THR A 1 32  ? -10.003 -16.295 -1.537  1.00 0.00 ? 32  THR A N    3  
ATOM 3954  C CA   . THR A 1 32  ? -8.899  -16.057 -2.458  1.00 0.00 ? 32  THR A CA   3  
ATOM 3955  C C    . THR A 1 32  ? -9.016  -14.685 -3.113  1.00 0.00 ? 32  THR A C    3  
ATOM 3956  O O    . THR A 1 32  ? -8.413  -14.432 -4.156  1.00 0.00 ? 32  THR A O    3  
ATOM 3957  C CB   . THR A 1 32  ? -8.842  -17.135 -3.556  1.00 0.00 ? 32  THR A CB   3  
ATOM 3958  O OG1  . THR A 1 32  ? -10.143 -17.326 -4.123  1.00 0.00 ? 32  THR A OG1  3  
ATOM 3959  C CG2  . THR A 1 32  ? -8.329  -18.452 -2.995  1.00 0.00 ? 32  THR A CG2  3  
ATOM 3960  H H    . THR A 1 32  ? -10.923 -16.268 -1.874  1.00 0.00 ? 32  THR A H    3  
ATOM 3961  H HA   . THR A 1 32  ? -7.979  -16.098 -1.893  1.00 0.00 ? 32  THR A HA   3  
ATOM 3962  H HB   . THR A 1 32  ? -8.165  -16.802 -4.331  1.00 0.00 ? 32  THR A HB   3  
ATOM 3963  H HG1  . THR A 1 32  ? -10.063 -17.455 -5.072  1.00 0.00 ? 32  THR A HG1  3  
ATOM 3964  H HG21 . THR A 1 32  ? -8.436  -18.452 -1.921  1.00 0.00 ? 32  THR A HG21 3  
ATOM 3965  H HG22 . THR A 1 32  ? -7.287  -18.572 -3.253  1.00 0.00 ? 32  THR A HG22 3  
ATOM 3966  H HG23 . THR A 1 32  ? -8.900  -19.268 -3.414  1.00 0.00 ? 32  THR A HG23 3  
ATOM 3967  N N    . SER A 1 33  ? -9.794  -13.803 -2.494  1.00 0.00 ? 33  SER A N    3  
ATOM 3968  C CA   . SER A 1 33  ? -9.992  -12.457 -3.020  1.00 0.00 ? 33  SER A CA   3  
ATOM 3969  C C    . SER A 1 33  ? -9.960  -11.425 -1.896  1.00 0.00 ? 33  SER A C    3  
ATOM 3970  O O    . SER A 1 33  ? -10.358 -11.709 -0.766  1.00 0.00 ? 33  SER A O    3  
ATOM 3971  C CB   . SER A 1 33  ? -11.322 -12.370 -3.770  1.00 0.00 ? 33  SER A CB   3  
ATOM 3972  O OG   . SER A 1 33  ? -12.331 -13.113 -3.107  1.00 0.00 ? 33  SER A OG   3  
ATOM 3973  H H    . SER A 1 33  ? -10.248 -14.065 -1.666  1.00 0.00 ? 33  SER A H    3  
ATOM 3974  H HA   . SER A 1 33  ? -9.186  -12.248 -3.708  1.00 0.00 ? 33  SER A HA   3  
ATOM 3975  H HB2  . SER A 1 33  ? -11.632 -11.338 -3.830  1.00 0.00 ? 33  SER A HB2  3  
ATOM 3976  H HB3  . SER A 1 33  ? -11.197 -12.767 -4.767  1.00 0.00 ? 33  SER A HB3  3  
ATOM 3977  H HG   . SER A 1 33  ? -12.728 -12.571 -2.421  1.00 0.00 ? 33  SER A HG   3  
ATOM 3978  N N    . LEU A 1 34  ? -9.484  -10.227 -2.216  1.00 0.00 ? 34  LEU A N    3  
ATOM 3979  C CA   . LEU A 1 34  ? -9.399  -9.151  -1.235  1.00 0.00 ? 34  LEU A CA   3  
ATOM 3980  C C    . LEU A 1 34  ? -9.411  -7.788  -1.919  1.00 0.00 ? 34  LEU A C    3  
ATOM 3981  O O    . LEU A 1 34  ? -9.218  -7.689  -3.131  1.00 0.00 ? 34  LEU A O    3  
ATOM 3982  C CB   . LEU A 1 34  ? -8.131  -9.301  -0.392  1.00 0.00 ? 34  LEU A CB   3  
ATOM 3983  C CG   . LEU A 1 34  ? -8.276  -10.102 0.902   1.00 0.00 ? 34  LEU A CG   3  
ATOM 3984  C CD1  . LEU A 1 34  ? -6.980  -10.826 1.230   1.00 0.00 ? 34  LEU A CD1  3  
ATOM 3985  C CD2  . LEU A 1 34  ? -8.685  -9.191  2.050   1.00 0.00 ? 34  LEU A CD2  3  
ATOM 3986  H H    . LEU A 1 34  ? -9.182  -10.061 -3.133  1.00 0.00 ? 34  LEU A H    3  
ATOM 3987  H HA   . LEU A 1 34  ? -10.262 -9.223  -0.589  1.00 0.00 ? 34  LEU A HA   3  
ATOM 3988  H HB2  . LEU A 1 34  ? -7.386  -9.789  -1.001  1.00 0.00 ? 34  LEU A HB2  3  
ATOM 3989  H HB3  . LEU A 1 34  ? -7.789  -8.309  -0.132  1.00 0.00 ? 34  LEU A HB3  3  
ATOM 3990  H HG   . LEU A 1 34  ? -9.050  -10.846 0.773   1.00 0.00 ? 34  LEU A HG   3  
ATOM 3991  H HD11 . LEU A 1 34  ? -6.813  -11.610 0.507   1.00 0.00 ? 34  LEU A HD11 3  
ATOM 3992  H HD12 . LEU A 1 34  ? -7.047  -11.255 2.218   1.00 0.00 ? 34  LEU A HD12 3  
ATOM 3993  H HD13 . LEU A 1 34  ? -6.158  -10.125 1.197   1.00 0.00 ? 34  LEU A HD13 3  
ATOM 3994  H HD21 . LEU A 1 34  ? -8.200  -8.232  1.940   1.00 0.00 ? 34  LEU A HD21 3  
ATOM 3995  H HD22 . LEU A 1 34  ? -8.389  -9.638  2.987   1.00 0.00 ? 34  LEU A HD22 3  
ATOM 3996  H HD23 . LEU A 1 34  ? -9.757  -9.056  2.038   1.00 0.00 ? 34  LEU A HD23 3  
ATOM 3997  N N    . ARG A 1 35  ? -9.635  -6.739  -1.134  1.00 0.00 ? 35  ARG A N    3  
ATOM 3998  C CA   . ARG A 1 35  ? -9.670  -5.382  -1.665  1.00 0.00 ? 35  ARG A CA   3  
ATOM 3999  C C    . ARG A 1 35  ? -9.030  -4.399  -0.688  1.00 0.00 ? 35  ARG A C    3  
ATOM 4000  O O    . ARG A 1 35  ? -9.622  -4.049  0.334   1.00 0.00 ? 35  ARG A O    3  
ATOM 4001  C CB   . ARG A 1 35  ? -11.113 -4.962  -1.955  1.00 0.00 ? 35  ARG A CB   3  
ATOM 4002  C CG   . ARG A 1 35  ? -11.232 -3.577  -2.569  1.00 0.00 ? 35  ARG A CG   3  
ATOM 4003  C CD   . ARG A 1 35  ? -12.658 -3.054  -2.492  1.00 0.00 ? 35  ARG A CD   3  
ATOM 4004  N NE   . ARG A 1 35  ? -12.795 -1.743  -3.120  1.00 0.00 ? 35  ARG A NE   3  
ATOM 4005  C CZ   . ARG A 1 35  ? -13.787 -0.900  -2.854  1.00 0.00 ? 35  ARG A CZ   3  
ATOM 4006  N NH1  . ARG A 1 35  ? -14.723 -1.230  -1.975  1.00 0.00 ? 35  ARG A NH1  3  
ATOM 4007  N NH2  . ARG A 1 35  ? -13.843 0.276   -3.466  1.00 0.00 ? 35  ARG A NH2  3  
ATOM 4008  H H    . ARG A 1 35  ? -9.781  -6.882  -0.176  1.00 0.00 ? 35  ARG A H    3  
ATOM 4009  H HA   . ARG A 1 35  ? -9.109  -5.371  -2.587  1.00 0.00 ? 35  ARG A HA   3  
ATOM 4010  H HB2  . ARG A 1 35  ? -11.552 -5.673  -2.639  1.00 0.00 ? 35  ARG A HB2  3  
ATOM 4011  H HB3  . ARG A 1 35  ? -11.670 -4.971  -1.031  1.00 0.00 ? 35  ARG A HB3  3  
ATOM 4012  H HG2  . ARG A 1 35  ? -10.583 -2.899  -2.035  1.00 0.00 ? 35  ARG A HG2  3  
ATOM 4013  H HG3  . ARG A 1 35  ? -10.930 -3.625  -3.605  1.00 0.00 ? 35  ARG A HG3  3  
ATOM 4014  H HD2  . ARG A 1 35  ? -13.311 -3.753  -2.994  1.00 0.00 ? 35  ARG A HD2  3  
ATOM 4015  H HD3  . ARG A 1 35  ? -12.943 -2.978  -1.454  1.00 0.00 ? 35  ARG A HD3  3  
ATOM 4016  H HE   . ARG A 1 35  ? -12.113 -1.478  -3.772  1.00 0.00 ? 35  ARG A HE   3  
ATOM 4017  H HH11 . ARG A 1 35  ? -14.683 -2.115  -1.512  1.00 0.00 ? 35  ARG A HH11 3  
ATOM 4018  H HH12 . ARG A 1 35  ? -15.468 -0.594  -1.775  1.00 0.00 ? 35  ARG A HH12 3  
ATOM 4019  H HH21 . ARG A 1 35  ? -13.138 0.528   -4.128  1.00 0.00 ? 35  ARG A HH21 3  
ATOM 4020  H HH22 . ARG A 1 35  ? -14.589 0.909   -3.265  1.00 0.00 ? 35  ARG A HH22 3  
ATOM 4021  N N    . VAL A 1 36  ? -7.818  -3.959  -1.008  1.00 0.00 ? 36  VAL A N    3  
ATOM 4022  C CA   . VAL A 1 36  ? -7.098  -3.017  -0.160  1.00 0.00 ? 36  VAL A CA   3  
ATOM 4023  C C    . VAL A 1 36  ? -7.355  -1.579  -0.594  1.00 0.00 ? 36  VAL A C    3  
ATOM 4024  O O    . VAL A 1 36  ? -7.234  -1.244  -1.773  1.00 0.00 ? 36  VAL A O    3  
ATOM 4025  C CB   . VAL A 1 36  ? -5.581  -3.286  -0.184  1.00 0.00 ? 36  VAL A CB   3  
ATOM 4026  C CG1  . VAL A 1 36  ? -4.816  -2.076  0.331   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4027  C CG2  . VAL A 1 36  ? -5.247  -4.526  0.631   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4028  H H    . VAL A 1 36  ? -7.398  -4.274  -1.836  1.00 0.00 ? 36  VAL A H    3  
ATOM 4029  H HA   . VAL A 1 36  ? -7.448  -3.145  0.854   1.00 0.00 ? 36  VAL A HA   3  
ATOM 4030  H HB   . VAL A 1 36  ? -5.284  -3.463  -1.208  1.00 0.00 ? 36  VAL A HB   3  
ATOM 4031  H HG11 . VAL A 1 36  ? -5.109  -1.873  1.350   1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4032  H HG12 . VAL A 1 36  ? -3.756  -2.278  0.293   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4033  H HG13 . VAL A 1 36  ? -5.042  -1.219  -0.285  1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4034  H HG21 . VAL A 1 36  ? -5.352  -4.304  1.683   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4035  H HG22 . VAL A 1 36  ? -5.921  -5.325  0.362   1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4036  H HG23 . VAL A 1 36  ? -4.230  -4.828  0.427   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4037  N N    . SER A 1 37  ? -7.710  -0.731  0.366   1.00 0.00 ? 37  SER A N    3  
ATOM 4038  C CA   . SER A 1 37  ? -7.988  0.672   0.083   1.00 0.00 ? 37  SER A CA   3  
ATOM 4039  C C    . SER A 1 37  ? -7.268  1.580   1.076   1.00 0.00 ? 37  SER A C    3  
ATOM 4040  O O    . SER A 1 37  ? -7.384  1.406   2.289   1.00 0.00 ? 37  SER A O    3  
ATOM 4041  C CB   . SER A 1 37  ? -9.494  0.936   0.132   1.00 0.00 ? 37  SER A CB   3  
ATOM 4042  O OG   . SER A 1 37  ? -9.766  2.325   0.199   1.00 0.00 ? 37  SER A OG   3  
ATOM 4043  H H    . SER A 1 37  ? -7.789  -1.058  1.287   1.00 0.00 ? 37  SER A H    3  
ATOM 4044  H HA   . SER A 1 37  ? -7.625  0.888   -0.912  1.00 0.00 ? 37  SER A HA   3  
ATOM 4045  H HB2  . SER A 1 37  ? -9.956  0.533   -0.756  1.00 0.00 ? 37  SER A HB2  3  
ATOM 4046  H HB3  . SER A 1 37  ? -9.912  0.457   1.005   1.00 0.00 ? 37  SER A HB3  3  
ATOM 4047  H HG   . SER A 1 37  ? -10.469 2.544   -0.417  1.00 0.00 ? 37  SER A HG   3  
ATOM 4048  N N    . TRP A 1 38  ? -6.525  2.548   0.552   1.00 0.00 ? 38  TRP A N    3  
ATOM 4049  C CA   . TRP A 1 38  ? -5.786  3.484   1.392   1.00 0.00 ? 38  TRP A CA   3  
ATOM 4050  C C    . TRP A 1 38  ? -6.275  4.912   1.176   1.00 0.00 ? 38  TRP A C    3  
ATOM 4051  O O    . TRP A 1 38  ? -7.232  5.144   0.439   1.00 0.00 ? 38  TRP A O    3  
ATOM 4052  C CB   . TRP A 1 38  ? -4.288  3.394   1.095   1.00 0.00 ? 38  TRP A CB   3  
ATOM 4053  C CG   . TRP A 1 38  ? -3.962  3.532   -0.362  1.00 0.00 ? 38  TRP A CG   3  
ATOM 4054  C CD1  . TRP A 1 38  ? -3.426  4.625   -0.981  1.00 0.00 ? 38  TRP A CD1  3  
ATOM 4055  C CD2  . TRP A 1 38  ? -4.154  2.545   -1.380  1.00 0.00 ? 38  TRP A CD2  3  
ATOM 4056  N NE1  . TRP A 1 38  ? -3.272  4.376   -2.324  1.00 0.00 ? 38  TRP A NE1  3  
ATOM 4057  C CE2  . TRP A 1 38  ? -3.710  3.106   -2.594  1.00 0.00 ? 38  TRP A CE2  3  
ATOM 4058  C CE3  . TRP A 1 38  ? -4.654  1.240   -1.385  1.00 0.00 ? 38  TRP A CE3  3  
ATOM 4059  C CZ2  . TRP A 1 38  ? -3.755  2.407   -3.797  1.00 0.00 ? 38  TRP A CZ2  3  
ATOM 4060  C CZ3  . TRP A 1 38  ? -4.698  0.548   -2.581  1.00 0.00 ? 38  TRP A CZ3  3  
ATOM 4061  C CH2  . TRP A 1 38  ? -4.250  1.132   -3.773  1.00 0.00 ? 38  TRP A CH2  3  
ATOM 4062  H H    . TRP A 1 38  ? -6.472  2.636   -0.423  1.00 0.00 ? 38  TRP A H    3  
ATOM 4063  H HA   . TRP A 1 38  ? -5.956  3.209   2.422   1.00 0.00 ? 38  TRP A HA   3  
ATOM 4064  H HB2  . TRP A 1 38  ? -3.774  4.180   1.627   1.00 0.00 ? 38  TRP A HB2  3  
ATOM 4065  H HB3  . TRP A 1 38  ? -3.919  2.436   1.430   1.00 0.00 ? 38  TRP A HB3  3  
ATOM 4066  H HD1  . TRP A 1 38  ? -3.167  5.543   -0.477  1.00 0.00 ? 38  TRP A HD1  3  
ATOM 4067  H HE1  . TRP A 1 38  ? -2.906  5.005   -2.981  1.00 0.00 ? 38  TRP A HE1  3  
ATOM 4068  H HE3  . TRP A 1 38  ? -5.004  0.773   -0.477  1.00 0.00 ? 38  TRP A HE3  3  
ATOM 4069  H HZ2  . TRP A 1 38  ? -3.413  2.844   -4.724  1.00 0.00 ? 38  TRP A HZ2  3  
ATOM 4070  H HZ3  . TRP A 1 38  ? -5.082  -0.461  -2.604  1.00 0.00 ? 38  TRP A HZ3  3  
ATOM 4071  H HH2  . TRP A 1 38  ? -4.303  0.555   -4.683  1.00 0.00 ? 38  TRP A HH2  3  
ATOM 4072  N N    . GLN A 1 39  ? -5.612  5.864   1.824   1.00 0.00 ? 39  GLN A N    3  
ATOM 4073  C CA   . GLN A 1 39  ? -5.981  7.269   1.703   1.00 0.00 ? 39  GLN A CA   3  
ATOM 4074  C C    . GLN A 1 39  ? -4.850  8.077   1.075   1.00 0.00 ? 39  GLN A C    3  
ATOM 4075  O O    . GLN A 1 39  ? -3.694  7.964   1.482   1.00 0.00 ? 39  GLN A O    3  
ATOM 4076  C CB   . GLN A 1 39  ? -6.334  7.846   3.075   1.00 0.00 ? 39  GLN A CB   3  
ATOM 4077  C CG   . GLN A 1 39  ? -6.680  9.326   3.042   1.00 0.00 ? 39  GLN A CG   3  
ATOM 4078  C CD   . GLN A 1 39  ? -7.977  9.606   2.309   1.00 0.00 ? 39  GLN A CD   3  
ATOM 4079  O OE1  . GLN A 1 39  ? -7.983  9.830   1.098   1.00 0.00 ? 39  GLN A OE1  3  
ATOM 4080  N NE2  . GLN A 1 39  ? -9.085  9.595   3.041   1.00 0.00 ? 39  GLN A NE2  3  
ATOM 4081  H H    . GLN A 1 39  ? -4.857  5.616   2.398   1.00 0.00 ? 39  GLN A H    3  
ATOM 4082  H HA   . GLN A 1 39  ? -6.848  7.330   1.063   1.00 0.00 ? 39  GLN A HA   3  
ATOM 4083  H HB2  . GLN A 1 39  ? -7.183  7.309   3.470   1.00 0.00 ? 39  GLN A HB2  3  
ATOM 4084  H HB3  . GLN A 1 39  ? -5.492  7.710   3.737   1.00 0.00 ? 39  GLN A HB3  3  
ATOM 4085  H HG2  . GLN A 1 39  ? -6.774  9.683   4.057   1.00 0.00 ? 39  GLN A HG2  3  
ATOM 4086  H HG3  . GLN A 1 39  ? -5.881  9.858   2.547   1.00 0.00 ? 39  GLN A HG3  3  
ATOM 4087  H HE21 . GLN A 1 39  ? -9.003  9.410   4.001   1.00 0.00 ? 39  GLN A HE21 3  
ATOM 4088  H HE22 . GLN A 1 39  ? -9.937  9.774   2.593   1.00 0.00 ? 39  GLN A HE22 3  
ATOM 4089  N N    . GLU A 1 40  ? -5.191  8.891   0.081   1.00 0.00 ? 40  GLU A N    3  
ATOM 4090  C CA   . GLU A 1 40  ? -4.203  9.716   -0.604  1.00 0.00 ? 40  GLU A CA   3  
ATOM 4091  C C    . GLU A 1 40  ? -3.385  10.527  0.397   1.00 0.00 ? 40  GLU A C    3  
ATOM 4092  O O    . GLU A 1 40  ? -3.866  11.489  0.996   1.00 0.00 ? 40  GLU A O    3  
ATOM 4093  C CB   . GLU A 1 40  ? -4.890  10.655  -1.597  1.00 0.00 ? 40  GLU A CB   3  
ATOM 4094  C CG   . GLU A 1 40  ? -3.921  11.493  -2.414  1.00 0.00 ? 40  GLU A CG   3  
ATOM 4095  C CD   . GLU A 1 40  ? -4.595  12.669  -3.094  1.00 0.00 ? 40  GLU A CD   3  
ATOM 4096  O OE1  . GLU A 1 40  ? -5.126  12.485  -4.209  1.00 0.00 ? 40  GLU A OE1  3  
ATOM 4097  O OE2  . GLU A 1 40  ? -4.591  13.773  -2.510  1.00 0.00 ? 40  GLU A OE2  3  
ATOM 4098  H H    . GLU A 1 40  ? -6.129  8.937   -0.199  1.00 0.00 ? 40  GLU A H    3  
ATOM 4099  H HA   . GLU A 1 40  ? -3.539  9.059   -1.144  1.00 0.00 ? 40  GLU A HA   3  
ATOM 4100  H HB2  . GLU A 1 40  ? -5.486  10.065  -2.278  1.00 0.00 ? 40  GLU A HB2  3  
ATOM 4101  H HB3  . GLU A 1 40  ? -5.540  11.324  -1.052  1.00 0.00 ? 40  GLU A HB3  3  
ATOM 4102  H HG2  . GLU A 1 40  ? -3.150  11.870  -1.758  1.00 0.00 ? 40  GLU A HG2  3  
ATOM 4103  H HG3  . GLU A 1 40  ? -3.472  10.866  -3.171  1.00 0.00 ? 40  GLU A HG3  3  
ATOM 4104  N N    . PRO A 1 41  ? -2.117  10.131  0.583   1.00 0.00 ? 41  PRO A N    3  
ATOM 4105  C CA   . PRO A 1 41  ? -1.204  10.807  1.510   1.00 0.00 ? 41  PRO A CA   3  
ATOM 4106  C C    . PRO A 1 41  ? -0.802  12.193  1.019   1.00 0.00 ? 41  PRO A C    3  
ATOM 4107  O O    . PRO A 1 41  ? -0.979  12.523  -0.154  1.00 0.00 ? 41  PRO A O    3  
ATOM 4108  C CB   . PRO A 1 41  ? 0.013   9.879   1.548   1.00 0.00 ? 41  PRO A CB   3  
ATOM 4109  C CG   . PRO A 1 41  ? -0.022  9.154   0.247   1.00 0.00 ? 41  PRO A CG   3  
ATOM 4110  C CD   . PRO A 1 41  ? -1.477  8.993   -0.098  1.00 0.00 ? 41  PRO A CD   3  
ATOM 4111  H HA   . PRO A 1 41  ? -1.630  10.885  2.499   1.00 0.00 ? 41  PRO A HA   3  
ATOM 4112  H HB2  . PRO A 1 41  ? 0.914   10.468  1.649   1.00 0.00 ? 41  PRO A HB2  3  
ATOM 4113  H HB3  . PRO A 1 41  ? -0.074  9.199   2.382   1.00 0.00 ? 41  PRO A HB3  3  
ATOM 4114  H HG2  . PRO A 1 41  ? 0.481   9.735   -0.511  1.00 0.00 ? 41  PRO A HG2  3  
ATOM 4115  H HG3  . PRO A 1 41  ? 0.447   8.187   0.354   1.00 0.00 ? 41  PRO A HG3  3  
ATOM 4116  H HD2  . PRO A 1 41  ? -1.620  9.052   -1.167  1.00 0.00 ? 41  PRO A HD2  3  
ATOM 4117  H HD3  . PRO A 1 41  ? -1.853  8.055   0.283   1.00 0.00 ? 41  PRO A HD3  3  
ATOM 4118  N N    . ARG A 1 42  ? -0.260  13.002  1.924   1.00 0.00 ? 42  ARG A N    3  
ATOM 4119  C CA   . ARG A 1 42  ? 0.167   14.353  1.583   1.00 0.00 ? 42  ARG A CA   3  
ATOM 4120  C C    . ARG A 1 42  ? 1.352   14.323  0.622   1.00 0.00 ? 42  ARG A C    3  
ATOM 4121  O O    . ARG A 1 42  ? 2.170   13.403  0.658   1.00 0.00 ? 42  ARG A O    3  
ATOM 4122  C CB   . ARG A 1 42  ? 0.543   15.127  2.849   1.00 0.00 ? 42  ARG A CB   3  
ATOM 4123  C CG   . ARG A 1 42  ? 1.843   14.662  3.483   1.00 0.00 ? 42  ARG A CG   3  
ATOM 4124  C CD   . ARG A 1 42  ? 2.549   15.800  4.205   1.00 0.00 ? 42  ARG A CD   3  
ATOM 4125  N NE   . ARG A 1 42  ? 3.869   15.406  4.689   1.00 0.00 ? 42  ARG A NE   3  
ATOM 4126  C CZ   . ARG A 1 42  ? 4.836   16.271  4.971   1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4127  N NH1  . ARG A 1 42  ? 4.632   17.572  4.820   1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4128  N NH2  . ARG A 1 42  ? 6.012   15.835  5.407   1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4129  H H    . ARG A 1 42  ? -0.145  12.682  2.844   1.00 0.00 ? 42  ARG A H    3  
ATOM 4130  H HA   . ARG A 1 42  ? -0.661  14.851  1.100   1.00 0.00 ? 42  ARG A HA   3  
ATOM 4131  H HB2  . ARG A 1 42  ? 0.643   16.173  2.601   1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4132  H HB3  . ARG A 1 42  ? -0.248  15.011  3.574   1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4133  H HG2  . ARG A 1 42  ? 1.627   13.879  4.194   1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4134  H HG3  . ARG A 1 42  ? 2.493   14.280  2.710   1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4135  H HD2  . ARG A 1 42  ? 2.659   16.629  3.522   1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4136  H HD3  . ARG A 1 42  ? 1.943   16.104  5.046   1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4137  H HE   . ARG A 1 42  ? 4.042   14.449  4.808   1.00 0.00 ? 42  ARG A HE   3  
ATOM 4138  H HH11 . ARG A 1 42  ? 3.747   17.903  4.492   1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4139  H HH12 . ARG A 1 42  ? 5.361   18.222  5.034   1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4140  H HH21 . ARG A 1 42  ? 6.169   14.855  5.523   1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4141  H HH22 . ARG A 1 42  ? 6.739   16.487  5.619   1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4142  N N    . CYS A 1 43  ? 1.436   15.334  -0.236  1.00 0.00 ? 43  CYS A N    3  
ATOM 4143  C CA   . CYS A 1 43  ? 2.520   15.423  -1.208  1.00 0.00 ? 43  CYS A CA   3  
ATOM 4144  C C    . CYS A 1 43  ? 2.486   16.761  -1.939  1.00 0.00 ? 43  CYS A C    3  
ATOM 4145  O O    . CYS A 1 43  ? 1.544   17.053  -2.674  1.00 0.00 ? 43  CYS A O    3  
ATOM 4146  C CB   . CYS A 1 43  ? 2.425   14.275  -2.215  1.00 0.00 ? 43  CYS A CB   3  
ATOM 4147  S SG   . CYS A 1 43  ? 0.907   14.278  -3.196  1.00 0.00 ? 43  CYS A SG   3  
ATOM 4148  H H    . CYS A 1 43  ? 0.754   16.037  -0.216  1.00 0.00 ? 43  CYS A H    3  
ATOM 4149  H HA   . CYS A 1 43  ? 3.453   15.343  -0.671  1.00 0.00 ? 43  CYS A HA   3  
ATOM 4150  H HB2  . CYS A 1 43  ? 3.258   14.338  -2.899  1.00 0.00 ? 43  CYS A HB2  3  
ATOM 4151  H HB3  . CYS A 1 43  ? 2.474   13.336  -1.684  1.00 0.00 ? 43  CYS A HB3  3  
ATOM 4152  H HG   . CYS A 1 43  ? -0.004  14.979  -2.538  1.00 0.00 ? 43  CYS A HG   3  
ATOM 4153  N N    . GLU A 1 44  ? 3.521   17.570  -1.731  1.00 0.00 ? 44  GLU A N    3  
ATOM 4154  C CA   . GLU A 1 44  ? 3.607   18.878  -2.368  1.00 0.00 ? 44  GLU A CA   3  
ATOM 4155  C C    . GLU A 1 44  ? 3.476   18.754  -3.884  1.00 0.00 ? 44  GLU A C    3  
ATOM 4156  O O    . GLU A 1 44  ? 3.062   19.696  -4.560  1.00 0.00 ? 44  GLU A O    3  
ATOM 4157  C CB   . GLU A 1 44  ? 4.932   19.556  -2.014  1.00 0.00 ? 44  GLU A CB   3  
ATOM 4158  C CG   . GLU A 1 44  ? 4.892   21.070  -2.136  1.00 0.00 ? 44  GLU A CG   3  
ATOM 4159  C CD   . GLU A 1 44  ? 6.251   21.709  -1.920  1.00 0.00 ? 44  GLU A CD   3  
ATOM 4160  O OE1  . GLU A 1 44  ? 7.128   21.549  -2.794  1.00 0.00 ? 44  GLU A OE1  3  
ATOM 4161  O OE2  . GLU A 1 44  ? 6.436   22.369  -0.876  1.00 0.00 ? 44  GLU A OE2  3  
ATOM 4162  H H    . GLU A 1 44  ? 4.242   17.280  -1.134  1.00 0.00 ? 44  GLU A H    3  
ATOM 4163  H HA   . GLU A 1 44  ? 2.793   19.482  -1.997  1.00 0.00 ? 44  GLU A HA   3  
ATOM 4164  H HB2  . GLU A 1 44  ? 5.191   19.304  -0.996  1.00 0.00 ? 44  GLU A HB2  3  
ATOM 4165  H HB3  . GLU A 1 44  ? 5.701   19.183  -2.674  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 4166  H HG2  . GLU A 1 44  ? 4.543   21.330  -3.124  1.00 0.00 ? 44  GLU A HG2  3  
ATOM 4167  H HG3  . GLU A 1 44  ? 4.206   21.461  -1.399  1.00 0.00 ? 44  GLU A HG3  3  
ATOM 4168  N N    . ARG A 1 45  ? 3.832   17.587  -4.409  1.00 0.00 ? 45  ARG A N    3  
ATOM 4169  C CA   . ARG A 1 45  ? 3.756   17.340  -5.844  1.00 0.00 ? 45  ARG A CA   3  
ATOM 4170  C C    . ARG A 1 45  ? 2.671   16.315  -6.163  1.00 0.00 ? 45  ARG A C    3  
ATOM 4171  O O    . ARG A 1 45  ? 2.293   15.494  -5.326  1.00 0.00 ? 45  ARG A O    3  
ATOM 4172  C CB   . ARG A 1 45  ? 5.106   16.850  -6.371  1.00 0.00 ? 45  ARG A CB   3  
ATOM 4173  C CG   . ARG A 1 45  ? 6.169   17.935  -6.422  1.00 0.00 ? 45  ARG A CG   3  
ATOM 4174  C CD   . ARG A 1 45  ? 5.868   18.959  -7.505  1.00 0.00 ? 45  ARG A CD   3  
ATOM 4175  N NE   . ARG A 1 45  ? 6.502   18.616  -8.775  1.00 0.00 ? 45  ARG A NE   3  
ATOM 4176  C CZ   . ARG A 1 45  ? 6.788   19.506  -9.718  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 4177  N NH1  . ARG A 1 45  ? 6.498   20.787  -9.535  1.00 0.00 ? 45  ARG A NH1  3  
ATOM 4178  N NH2  . ARG A 1 45  ? 7.365   19.116  -10.848 1.00 0.00 ? 45  ARG A NH2  3  
ATOM 4179  H H    . ARG A 1 45  ? 4.154   16.874  -3.818  1.00 0.00 ? 45  ARG A H    3  
ATOM 4180  H HA   . ARG A 1 45  ? 3.507   18.272  -6.328  1.00 0.00 ? 45  ARG A HA   3  
ATOM 4181  H HB2  . ARG A 1 45  ? 5.463   16.057  -5.730  1.00 0.00 ? 45  ARG A HB2  3  
ATOM 4182  H HB3  . ARG A 1 45  ? 4.970   16.462  -7.369  1.00 0.00 ? 45  ARG A HB3  3  
ATOM 4183  H HG2  . ARG A 1 45  ? 6.205   18.437  -5.467  1.00 0.00 ? 45  ARG A HG2  3  
ATOM 4184  H HG3  . ARG A 1 45  ? 7.126   17.478  -6.627  1.00 0.00 ? 45  ARG A HG3  3  
ATOM 4185  H HD2  . ARG A 1 45  ? 4.799   19.008  -7.649  1.00 0.00 ? 45  ARG A HD2  3  
ATOM 4186  H HD3  . ARG A 1 45  ? 6.232   19.923  -7.181  1.00 0.00 ? 45  ARG A HD3  3  
ATOM 4187  H HE   . ARG A 1 45  ? 6.725   17.675  -8.931  1.00 0.00 ? 45  ARG A HE   3  
ATOM 4188  H HH11 . ARG A 1 45  ? 6.064   21.084  -8.685  1.00 0.00 ? 45  ARG A HH11 3  
ATOM 4189  H HH12 . ARG A 1 45  ? 6.715   21.456  -10.246 1.00 0.00 ? 45  ARG A HH12 3  
ATOM 4190  H HH21 . ARG A 1 45  ? 7.586   18.152  -10.989 1.00 0.00 ? 45  ARG A HH21 3  
ATOM 4191  H HH22 . ARG A 1 45  ? 7.580   19.787  -11.557 1.00 0.00 ? 45  ARG A HH22 3  
ATOM 4192  N N    . PRO A 1 46  ? 2.158   16.362  -7.401  1.00 0.00 ? 46  PRO A N    3  
ATOM 4193  C CA   . PRO A 1 46  ? 1.110   15.444  -7.859  1.00 0.00 ? 46  PRO A CA   3  
ATOM 4194  C C    . PRO A 1 46  ? 1.619   14.016  -8.018  1.00 0.00 ? 46  PRO A C    3  
ATOM 4195  O O    . PRO A 1 46  ? 2.664   13.782  -8.626  1.00 0.00 ? 46  PRO A O    3  
ATOM 4196  C CB   . PRO A 1 46  ? 0.702   16.021  -9.217  1.00 0.00 ? 46  PRO A CB   3  
ATOM 4197  C CG   . PRO A 1 46  ? 1.902   16.768  -9.687  1.00 0.00 ? 46  PRO A CG   3  
ATOM 4198  C CD   . PRO A 1 46  ? 2.562   17.313  -8.450  1.00 0.00 ? 46  PRO A CD   3  
ATOM 4199  H HA   . PRO A 1 46  ? 0.259   15.450  -7.193  1.00 0.00 ? 46  PRO A HA   3  
ATOM 4200  H HB2  . PRO A 1 46  ? 0.448   15.216  -9.891  1.00 0.00 ? 46  PRO A HB2  3  
ATOM 4201  H HB3  . PRO A 1 46  ? -0.147  16.676  -9.093  1.00 0.00 ? 46  PRO A HB3  3  
ATOM 4202  H HG2  . PRO A 1 46  ? 2.572   16.099  -10.205 1.00 0.00 ? 46  PRO A HG2  3  
ATOM 4203  H HG3  . PRO A 1 46  ? 1.600   17.576  -10.336 1.00 0.00 ? 46  PRO A HG3  3  
ATOM 4204  H HD2  . PRO A 1 46  ? 3.635   17.324  -8.568  1.00 0.00 ? 46  PRO A HD2  3  
ATOM 4205  H HD3  . PRO A 1 46  ? 2.194   18.305  -8.232  1.00 0.00 ? 46  PRO A HD3  3  
ATOM 4206  N N    . LEU A 1 47  ? 0.874   13.063  -7.468  1.00 0.00 ? 47  LEU A N    3  
ATOM 4207  C CA   . LEU A 1 47  ? 1.250   11.656  -7.550  1.00 0.00 ? 47  LEU A CA   3  
ATOM 4208  C C    . LEU A 1 47  ? 0.983   11.101  -8.945  1.00 0.00 ? 47  LEU A C    3  
ATOM 4209  O O    . LEU A 1 47  ? 0.086   11.567  -9.647  1.00 0.00 ? 47  LEU A O    3  
ATOM 4210  C CB   . LEU A 1 47  ? 0.480   10.841  -6.509  1.00 0.00 ? 47  LEU A CB   3  
ATOM 4211  C CG   . LEU A 1 47  ? 0.513   11.378  -5.078  1.00 0.00 ? 47  LEU A CG   3  
ATOM 4212  C CD1  . LEU A 1 47  ? -0.699  10.893  -4.298  1.00 0.00 ? 47  LEU A CD1  3  
ATOM 4213  C CD2  . LEU A 1 47  ? 1.800   10.961  -4.381  1.00 0.00 ? 47  LEU A CD2  3  
ATOM 4214  H H    . LEU A 1 47  ? 0.052   13.310  -6.996  1.00 0.00 ? 47  LEU A H    3  
ATOM 4215  H HA   . LEU A 1 47  ? 2.307   11.583  -7.342  1.00 0.00 ? 47  LEU A HA   3  
ATOM 4216  H HB2  . LEU A 1 47  ? -0.552  10.796  -6.821  1.00 0.00 ? 47  LEU A HB2  3  
ATOM 4217  H HB3  . LEU A 1 47  ? 0.895   9.843   -6.498  1.00 0.00 ? 47  LEU A HB3  3  
ATOM 4218  H HG   . LEU A 1 47  ? 0.481   12.459  -5.105  1.00 0.00 ? 47  LEU A HG   3  
ATOM 4219  H HD11 . LEU A 1 47  ? -1.503  11.607  -4.401  1.00 0.00 ? 47  LEU A HD11 3  
ATOM 4220  H HD12 . LEU A 1 47  ? -0.439  10.792  -3.254  1.00 0.00 ? 47  LEU A HD12 3  
ATOM 4221  H HD13 . LEU A 1 47  ? -1.016  9.935   -4.684  1.00 0.00 ? 47  LEU A HD13 3  
ATOM 4222  H HD21 . LEU A 1 47  ? 1.561   10.422  -3.476  1.00 0.00 ? 47  LEU A HD21 3  
ATOM 4223  H HD22 . LEU A 1 47  ? 2.377   11.840  -4.135  1.00 0.00 ? 47  LEU A HD22 3  
ATOM 4224  H HD23 . LEU A 1 47  ? 2.375   10.325  -5.038  1.00 0.00 ? 47  LEU A HD23 3  
ATOM 4225  N N    . GLN A 1 48  ? 1.767   10.102  -9.339  1.00 0.00 ? 48  GLN A N    3  
ATOM 4226  C CA   . GLN A 1 48  ? 1.614   9.483   -10.651 1.00 0.00 ? 48  GLN A CA   3  
ATOM 4227  C C    . GLN A 1 48  ? 0.805   8.194   -10.553 1.00 0.00 ? 48  GLN A C    3  
ATOM 4228  O O    . GLN A 1 48  ? 0.205   7.750   -11.531 1.00 0.00 ? 48  GLN A O    3  
ATOM 4229  C CB   . GLN A 1 48  ? 2.984   9.194   -11.265 1.00 0.00 ? 48  GLN A CB   3  
ATOM 4230  C CG   . GLN A 1 48  ? 3.800   10.445  -11.548 1.00 0.00 ? 48  GLN A CG   3  
ATOM 4231  C CD   . GLN A 1 48  ? 5.261   10.141  -11.817 1.00 0.00 ? 48  GLN A CD   3  
ATOM 4232  O OE1  . GLN A 1 48  ? 5.616   9.021   -12.185 1.00 0.00 ? 48  GLN A OE1  3  
ATOM 4233  N NE2  . GLN A 1 48  ? 6.117   11.140  -11.636 1.00 0.00 ? 48  GLN A NE2  3  
ATOM 4234  H H    . GLN A 1 48  ? 2.464   9.775   -8.735  1.00 0.00 ? 48  GLN A H    3  
ATOM 4235  H HA   . GLN A 1 48  ? 1.084   10.178  -11.285 1.00 0.00 ? 48  GLN A HA   3  
ATOM 4236  H HB2  . GLN A 1 48  ? 3.546   8.570   -10.585 1.00 0.00 ? 48  GLN A HB2  3  
ATOM 4237  H HB3  . GLN A 1 48  ? 2.844   8.664   -12.195 1.00 0.00 ? 48  GLN A HB3  3  
ATOM 4238  H HG2  . GLN A 1 48  ? 3.387   10.941  -12.413 1.00 0.00 ? 48  GLN A HG2  3  
ATOM 4239  H HG3  . GLN A 1 48  ? 3.736   11.102  -10.693 1.00 0.00 ? 48  GLN A HG3  3  
ATOM 4240  H HE21 . GLN A 1 48  ? 5.762   12.005  -11.341 1.00 0.00 ? 48  GLN A HE21 3  
ATOM 4241  H HE22 . GLN A 1 48  ? 7.067   10.971  -11.802 1.00 0.00 ? 48  GLN A HE22 3  
ATOM 4242  N N    . GLY A 1 49  ? 0.794   7.596   -9.365  1.00 0.00 ? 49  GLY A N    3  
ATOM 4243  C CA   . GLY A 1 49  ? 0.057   6.363   -9.161  1.00 0.00 ? 49  GLY A CA   3  
ATOM 4244  C C    . GLY A 1 49  ? 0.184   5.838   -7.745  1.00 0.00 ? 49  GLY A C    3  
ATOM 4245  O O    . GLY A 1 49  ? 0.184   6.612   -6.787  1.00 0.00 ? 49  GLY A O    3  
ATOM 4246  H H    . GLY A 1 49  ? 1.291   7.996   -8.621  1.00 0.00 ? 49  GLY A H    3  
ATOM 4247  H HA2  . GLY A 1 49  ? -0.987  6.541   -9.376  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 4248  H HA3  . GLY A 1 49  ? 0.432   5.616   -9.845  1.00 0.00 ? 49  GLY A HA3  3  
ATOM 4249  N N    . TYR A 1 50  ? 0.290   4.521   -7.611  1.00 0.00 ? 50  TYR A N    3  
ATOM 4250  C CA   . TYR A 1 50  ? 0.415   3.893   -6.301  1.00 0.00 ? 50  TYR A CA   3  
ATOM 4251  C C    . TYR A 1 50  ? 1.041   2.507   -6.418  1.00 0.00 ? 50  TYR A C    3  
ATOM 4252  O O    . TYR A 1 50  ? 1.207   1.980   -7.518  1.00 0.00 ? 50  TYR A O    3  
ATOM 4253  C CB   . TYR A 1 50  ? -0.956  3.791   -5.630  1.00 0.00 ? 50  TYR A CB   3  
ATOM 4254  C CG   . TYR A 1 50  ? -1.412  5.080   -4.985  1.00 0.00 ? 50  TYR A CG   3  
ATOM 4255  C CD1  . TYR A 1 50  ? -0.790  5.566   -3.841  1.00 0.00 ? 50  TYR A CD1  3  
ATOM 4256  C CD2  . TYR A 1 50  ? -2.466  5.812   -5.518  1.00 0.00 ? 50  TYR A CD2  3  
ATOM 4257  C CE1  . TYR A 1 50  ? -1.204  6.743   -3.248  1.00 0.00 ? 50  TYR A CE1  3  
ATOM 4258  C CE2  . TYR A 1 50  ? -2.885  6.991   -4.933  1.00 0.00 ? 50  TYR A CE2  3  
ATOM 4259  C CZ   . TYR A 1 50  ? -2.252  7.452   -3.798  1.00 0.00 ? 50  TYR A CZ   3  
ATOM 4260  O OH   . TYR A 1 50  ? -2.667  8.625   -3.211  1.00 0.00 ? 50  TYR A OH   3  
ATOM 4261  H H    . TYR A 1 50  ? 0.284   3.957   -8.412  1.00 0.00 ? 50  TYR A H    3  
ATOM 4262  H HA   . TYR A 1 50  ? 1.056   4.516   -5.695  1.00 0.00 ? 50  TYR A HA   3  
ATOM 4263  H HB2  . TYR A 1 50  ? -1.691  3.512   -6.368  1.00 0.00 ? 50  TYR A HB2  3  
ATOM 4264  H HB3  . TYR A 1 50  ? -0.917  3.031   -4.862  1.00 0.00 ? 50  TYR A HB3  3  
ATOM 4265  H HD1  . TYR A 1 50  ? 0.030   5.008   -3.413  1.00 0.00 ? 50  TYR A HD1  3  
ATOM 4266  H HD2  . TYR A 1 50  ? -2.961  5.448   -6.407  1.00 0.00 ? 50  TYR A HD2  3  
ATOM 4267  H HE1  . TYR A 1 50  ? -0.708  7.105   -2.360  1.00 0.00 ? 50  TYR A HE1  3  
ATOM 4268  H HE2  . TYR A 1 50  ? -3.706  7.546   -5.363  1.00 0.00 ? 50  TYR A HE2  3  
ATOM 4269  H HH   . TYR A 1 50  ? -3.615  8.724   -3.330  1.00 0.00 ? 50  TYR A HH   3  
ATOM 4270  N N    . SER A 1 51  ? 1.387   1.923   -5.276  1.00 0.00 ? 51  SER A N    3  
ATOM 4271  C CA   . SER A 1 51  ? 1.998   0.599   -5.248  1.00 0.00 ? 51  SER A CA   3  
ATOM 4272  C C    . SER A 1 51  ? 1.461   -0.223  -4.080  1.00 0.00 ? 51  SER A C    3  
ATOM 4273  O O    . SER A 1 51  ? 1.313   0.282   -2.967  1.00 0.00 ? 51  SER A O    3  
ATOM 4274  C CB   . SER A 1 51  ? 3.519   0.719   -5.146  1.00 0.00 ? 51  SER A CB   3  
ATOM 4275  O OG   . SER A 1 51  ? 4.122   -0.555  -4.994  1.00 0.00 ? 51  SER A OG   3  
ATOM 4276  H H    . SER A 1 51  ? 1.229   2.395   -4.431  1.00 0.00 ? 51  SER A H    3  
ATOM 4277  H HA   . SER A 1 51  ? 1.746   0.098   -6.171  1.00 0.00 ? 51  SER A HA   3  
ATOM 4278  H HB2  . SER A 1 51  ? 3.903   1.180   -6.044  1.00 0.00 ? 51  SER A HB2  3  
ATOM 4279  H HB3  . SER A 1 51  ? 3.773   1.329   -4.291  1.00 0.00 ? 51  SER A HB3  3  
ATOM 4280  H HG   . SER A 1 51  ? 3.561   -1.224  -5.392  1.00 0.00 ? 51  SER A HG   3  
ATOM 4281  N N    . VAL A 1 52  ? 1.171   -1.493  -4.343  1.00 0.00 ? 52  VAL A N    3  
ATOM 4282  C CA   . VAL A 1 52  ? 0.652   -2.387  -3.314  1.00 0.00 ? 52  VAL A CA   3  
ATOM 4283  C C    . VAL A 1 52  ? 1.424   -3.702  -3.288  1.00 0.00 ? 52  VAL A C    3  
ATOM 4284  O O    . VAL A 1 52  ? 1.140   -4.615  -4.062  1.00 0.00 ? 52  VAL A O    3  
ATOM 4285  C CB   . VAL A 1 52  ? -0.842  -2.687  -3.533  1.00 0.00 ? 52  VAL A CB   3  
ATOM 4286  C CG1  . VAL A 1 52  ? -1.400  -3.499  -2.375  1.00 0.00 ? 52  VAL A CG1  3  
ATOM 4287  C CG2  . VAL A 1 52  ? -1.624  -1.394  -3.713  1.00 0.00 ? 52  VAL A CG2  3  
ATOM 4288  H H    . VAL A 1 52  ? 1.311   -1.838  -5.249  1.00 0.00 ? 52  VAL A H    3  
ATOM 4289  H HA   . VAL A 1 52  ? 0.763   -1.896  -2.358  1.00 0.00 ? 52  VAL A HA   3  
ATOM 4290  H HB   . VAL A 1 52  ? -0.943  -3.272  -4.436  1.00 0.00 ? 52  VAL A HB   3  
ATOM 4291  H HG11 . VAL A 1 52  ? -0.584  -3.916  -1.803  1.00 0.00 ? 52  VAL A HG11 3  
ATOM 4292  H HG12 . VAL A 1 52  ? -1.996  -2.860  -1.740  1.00 0.00 ? 52  VAL A HG12 3  
ATOM 4293  H HG13 . VAL A 1 52  ? -2.015  -4.300  -2.759  1.00 0.00 ? 52  VAL A HG13 3  
ATOM 4294  H HG21 . VAL A 1 52  ? -1.213  -0.837  -4.542  1.00 0.00 ? 52  VAL A HG21 3  
ATOM 4295  H HG22 . VAL A 1 52  ? -2.660  -1.625  -3.912  1.00 0.00 ? 52  VAL A HG22 3  
ATOM 4296  H HG23 . VAL A 1 52  ? -1.553  -0.802  -2.812  1.00 0.00 ? 52  VAL A HG23 3  
ATOM 4297  N N    . GLU A 1 53  ? 2.402   -3.790  -2.392  1.00 0.00 ? 53  GLU A N    3  
ATOM 4298  C CA   . GLU A 1 53  ? 3.215   -4.993  -2.265  1.00 0.00 ? 53  GLU A CA   3  
ATOM 4299  C C    . GLU A 1 53  ? 2.661   -5.913  -1.181  1.00 0.00 ? 53  GLU A C    3  
ATOM 4300  O O    . GLU A 1 53  ? 2.378   -5.476  -0.066  1.00 0.00 ? 53  GLU A O    3  
ATOM 4301  C CB   . GLU A 1 53  ? 4.665   -4.624  -1.944  1.00 0.00 ? 53  GLU A CB   3  
ATOM 4302  C CG   . GLU A 1 53  ? 5.528   -4.418  -3.177  1.00 0.00 ? 53  GLU A CG   3  
ATOM 4303  C CD   . GLU A 1 53  ? 6.665   -3.444  -2.937  1.00 0.00 ? 53  GLU A CD   3  
ATOM 4304  O OE1  . GLU A 1 53  ? 6.448   -2.444  -2.221  1.00 0.00 ? 53  GLU A OE1  3  
ATOM 4305  O OE2  . GLU A 1 53  ? 7.772   -3.680  -3.466  1.00 0.00 ? 53  GLU A OE2  3  
ATOM 4306  H H    . GLU A 1 53  ? 2.581   -3.027  -1.802  1.00 0.00 ? 53  GLU A H    3  
ATOM 4307  H HA   . GLU A 1 53  ? 3.187   -5.513  -3.211  1.00 0.00 ? 53  GLU A HA   3  
ATOM 4308  H HB2  . GLU A 1 53  ? 4.673   -3.711  -1.367  1.00 0.00 ? 53  GLU A HB2  3  
ATOM 4309  H HB3  . GLU A 1 53  ? 5.102   -5.416  -1.353  1.00 0.00 ? 53  GLU A HB3  3  
ATOM 4310  H HG2  . GLU A 1 53  ? 5.946   -5.369  -3.472  1.00 0.00 ? 53  GLU A HG2  3  
ATOM 4311  H HG3  . GLU A 1 53  ? 4.909   -4.036  -3.975  1.00 0.00 ? 53  GLU A HG3  3  
ATOM 4312  N N    . TYR A 1 54  ? 2.508   -7.189  -1.518  1.00 0.00 ? 54  TYR A N    3  
ATOM 4313  C CA   . TYR A 1 54  ? 1.985   -8.171  -0.575  1.00 0.00 ? 54  TYR A CA   3  
ATOM 4314  C C    . TYR A 1 54  ? 2.786   -9.468  -0.639  1.00 0.00 ? 54  TYR A C    3  
ATOM 4315  O O    . TYR A 1 54  ? 3.248   -9.872  -1.705  1.00 0.00 ? 54  TYR A O    3  
ATOM 4316  C CB   . TYR A 1 54  ? 0.511   -8.454  -0.867  1.00 0.00 ? 54  TYR A CB   3  
ATOM 4317  C CG   . TYR A 1 54  ? 0.290   -9.315  -2.090  1.00 0.00 ? 54  TYR A CG   3  
ATOM 4318  C CD1  . TYR A 1 54  ? 0.441   -10.695 -2.028  1.00 0.00 ? 54  TYR A CD1  3  
ATOM 4319  C CD2  . TYR A 1 54  ? -0.068  -8.750  -3.307  1.00 0.00 ? 54  TYR A CD2  3  
ATOM 4320  C CE1  . TYR A 1 54  ? 0.241   -11.487 -3.142  1.00 0.00 ? 54  TYR A CE1  3  
ATOM 4321  C CE2  . TYR A 1 54  ? -0.271  -9.533  -4.427  1.00 0.00 ? 54  TYR A CE2  3  
ATOM 4322  C CZ   . TYR A 1 54  ? -0.115  -10.901 -4.339  1.00 0.00 ? 54  TYR A CZ   3  
ATOM 4323  O OH   . TYR A 1 54  ? -0.315  -11.685 -5.453  1.00 0.00 ? 54  TYR A OH   3  
ATOM 4324  H H    . TYR A 1 54  ? 2.752   -7.478  -2.422  1.00 0.00 ? 54  TYR A H    3  
ATOM 4325  H HA   . TYR A 1 54  ? 2.072   -7.756  0.418   1.00 0.00 ? 54  TYR A HA   3  
ATOM 4326  H HB2  . TYR A 1 54  ? 0.074   -8.962  -0.021  1.00 0.00 ? 54  TYR A HB2  3  
ATOM 4327  H HB3  . TYR A 1 54  ? -0.005  -7.517  -1.024  1.00 0.00 ? 54  TYR A HB3  3  
ATOM 4328  H HD1  . TYR A 1 54  ? 0.720   -11.151 -1.089  1.00 0.00 ? 54  TYR A HD1  3  
ATOM 4329  H HD2  . TYR A 1 54  ? -0.189  -7.678  -3.372  1.00 0.00 ? 54  TYR A HD2  3  
ATOM 4330  H HE1  . TYR A 1 54  ? 0.363   -12.558 -3.075  1.00 0.00 ? 54  TYR A HE1  3  
ATOM 4331  H HE2  . TYR A 1 54  ? -0.549  -9.075  -5.364  1.00 0.00 ? 54  TYR A HE2  3  
ATOM 4332  H HH   . TYR A 1 54  ? -0.835  -12.456 -5.212  1.00 0.00 ? 54  TYR A HH   3  
ATOM 4333  N N    . GLN A 1 55  ? 2.944   -10.115 0.511   1.00 0.00 ? 55  GLN A N    3  
ATOM 4334  C CA   . GLN A 1 55  ? 3.689   -11.366 0.587   1.00 0.00 ? 55  GLN A CA   3  
ATOM 4335  C C    . GLN A 1 55  ? 3.395   -12.096 1.893   1.00 0.00 ? 55  GLN A C    3  
ATOM 4336  O O    . GLN A 1 55  ? 3.074   -11.473 2.907   1.00 0.00 ? 55  GLN A O    3  
ATOM 4337  C CB   . GLN A 1 55  ? 5.190   -11.099 0.465   1.00 0.00 ? 55  GLN A CB   3  
ATOM 4338  C CG   . GLN A 1 55  ? 5.861   -10.779 1.790   1.00 0.00 ? 55  GLN A CG   3  
ATOM 4339  C CD   . GLN A 1 55  ? 7.293   -10.312 1.622   1.00 0.00 ? 55  GLN A CD   3  
ATOM 4340  O OE1  . GLN A 1 55  ? 7.681   -9.263  2.137   1.00 0.00 ? 55  GLN A OE1  3  
ATOM 4341  N NE2  . GLN A 1 55  ? 8.089   -11.090 0.897   1.00 0.00 ? 55  GLN A NE2  3  
ATOM 4342  H H    . GLN A 1 55  ? 2.551   -9.742  1.327   1.00 0.00 ? 55  GLN A H    3  
ATOM 4343  H HA   . GLN A 1 55  ? 3.375   -11.989 -0.237  1.00 0.00 ? 55  GLN A HA   3  
ATOM 4344  H HB2  . GLN A 1 55  ? 5.666   -11.973 0.046   1.00 0.00 ? 55  GLN A HB2  3  
ATOM 4345  H HB3  . GLN A 1 55  ? 5.341   -10.263 -0.202  1.00 0.00 ? 55  GLN A HB3  3  
ATOM 4346  H HG2  . GLN A 1 55  ? 5.300   -10.000 2.284   1.00 0.00 ? 55  GLN A HG2  3  
ATOM 4347  H HG3  . GLN A 1 55  ? 5.857   -11.668 2.404   1.00 0.00 ? 55  GLN A HG3  3  
ATOM 4348  H HE21 . GLN A 1 55  ? 7.711   -11.911 0.516   1.00 0.00 ? 55  GLN A HE21 3  
ATOM 4349  H HE22 . GLN A 1 55  ? 9.019   -10.812 0.771   1.00 0.00 ? 55  GLN A HE22 3  
ATOM 4350  N N    . LEU A 1 56  ? 3.506   -13.420 1.864   1.00 0.00 ? 56  LEU A N    3  
ATOM 4351  C CA   . LEU A 1 56  ? 3.252   -14.235 3.046   1.00 0.00 ? 56  LEU A CA   3  
ATOM 4352  C C    . LEU A 1 56  ? 3.929   -13.638 4.276   1.00 0.00 ? 56  LEU A C    3  
ATOM 4353  O O    . LEU A 1 56  ? 5.152   -13.499 4.318   1.00 0.00 ? 56  LEU A O    3  
ATOM 4354  C CB   . LEU A 1 56  ? 3.749   -15.664 2.820   1.00 0.00 ? 56  LEU A CB   3  
ATOM 4355  C CG   . LEU A 1 56  ? 2.829   -16.574 2.006   1.00 0.00 ? 56  LEU A CG   3  
ATOM 4356  C CD1  . LEU A 1 56  ? 3.567   -17.833 1.576   1.00 0.00 ? 56  LEU A CD1  3  
ATOM 4357  C CD2  . LEU A 1 56  ? 1.585   -16.930 2.807   1.00 0.00 ? 56  LEU A CD2  3  
ATOM 4358  H H    . LEU A 1 56  ? 3.765   -13.859 1.028   1.00 0.00 ? 56  LEU A H    3  
ATOM 4359  H HA   . LEU A 1 56  ? 2.186   -14.256 3.212   1.00 0.00 ? 56  LEU A HA   3  
ATOM 4360  H HB2  . LEU A 1 56  ? 4.697   -15.608 2.307   1.00 0.00 ? 56  LEU A HB2  3  
ATOM 4361  H HB3  . LEU A 1 56  ? 3.894   -16.121 3.789   1.00 0.00 ? 56  LEU A HB3  3  
ATOM 4362  H HG   . LEU A 1 56  ? 2.515   -16.051 1.113   1.00 0.00 ? 56  LEU A HG   3  
ATOM 4363  H HD11 . LEU A 1 56  ? 2.851   -18.598 1.315   1.00 0.00 ? 56  LEU A HD11 3  
ATOM 4364  H HD12 . LEU A 1 56  ? 4.187   -18.182 2.389   1.00 0.00 ? 56  LEU A HD12 3  
ATOM 4365  H HD13 . LEU A 1 56  ? 4.187   -17.612 0.720   1.00 0.00 ? 56  LEU A HD13 3  
ATOM 4366  H HD21 . LEU A 1 56  ? 1.238   -16.057 3.339   1.00 0.00 ? 56  LEU A HD21 3  
ATOM 4367  H HD22 . LEU A 1 56  ? 1.824   -17.712 3.513   1.00 0.00 ? 56  LEU A HD22 3  
ATOM 4368  H HD23 . LEU A 1 56  ? 0.811   -17.275 2.136   1.00 0.00 ? 56  LEU A HD23 3  
ATOM 4369  N N    . LEU A 1 57  ? 3.127   -13.288 5.275   1.00 0.00 ? 57  LEU A N    3  
ATOM 4370  C CA   . LEU A 1 57  ? 3.648   -12.708 6.508   1.00 0.00 ? 57  LEU A CA   3  
ATOM 4371  C C    . LEU A 1 57  ? 4.940   -13.398 6.931   1.00 0.00 ? 57  LEU A C    3  
ATOM 4372  O O    . LEU A 1 57  ? 5.990   -12.764 7.032   1.00 0.00 ? 57  LEU A O    3  
ATOM 4373  C CB   . LEU A 1 57  ? 2.609   -12.817 7.625   1.00 0.00 ? 57  LEU A CB   3  
ATOM 4374  C CG   . LEU A 1 57  ? 2.855   -11.946 8.857   1.00 0.00 ? 57  LEU A CG   3  
ATOM 4375  C CD1  . LEU A 1 57  ? 2.446   -10.507 8.584   1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4376  C CD2  . LEU A 1 57  ? 2.102   -12.497 10.059  1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4377  H H    . LEU A 1 57  ? 2.161   -13.423 5.183   1.00 0.00 ? 57  LEU A H    3  
ATOM 4378  H HA   . LEU A 1 57  ? 3.855   -11.665 6.320   1.00 0.00 ? 57  LEU A HA   3  
ATOM 4379  H HB2  . LEU A 1 57  ? 1.650   -12.542 7.213   1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4380  H HB3  . LEU A 1 57  ? 2.578   -13.848 7.948   1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4381  H HG   . LEU A 1 57  ? 3.911   -11.953 9.091   1.00 0.00 ? 57  LEU A HG   3  
ATOM 4382  H HD11 . LEU A 1 57  ? 1.466   -10.491 8.131   1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4383  H HD12 . LEU A 1 57  ? 3.160   -10.050 7.915   1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4384  H HD13 . LEU A 1 57  ? 2.422   -9.957  9.514   1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4385  H HD21 . LEU A 1 57  ? 1.839   -11.687 10.722  1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4386  H HD22 . LEU A 1 57  ? 2.729   -13.203 10.584  1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4387  H HD23 . LEU A 1 57  ? 1.203   -12.995 9.723   1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4388  N N    . ASN A 1 58  ? 4.857   -14.702 7.174   1.00 0.00 ? 58  ASN A N    3  
ATOM 4389  C CA   . ASN A 1 58  ? 6.020   -15.479 7.585   1.00 0.00 ? 58  ASN A CA   3  
ATOM 4390  C C    . ASN A 1 58  ? 7.184   -15.266 6.622   1.00 0.00 ? 58  ASN A C    3  
ATOM 4391  O O    . ASN A 1 58  ? 8.320   -15.051 7.042   1.00 0.00 ? 58  ASN A O    3  
ATOM 4392  C CB   . ASN A 1 58  ? 5.667   -16.966 7.655   1.00 0.00 ? 58  ASN A CB   3  
ATOM 4393  C CG   . ASN A 1 58  ? 5.001   -17.463 6.386   1.00 0.00 ? 58  ASN A CG   3  
ATOM 4394  O OD1  . ASN A 1 58  ? 3.785   -17.358 6.228   1.00 0.00 ? 58  ASN A OD1  3  
ATOM 4395  N ND2  . ASN A 1 58  ? 5.798   -18.008 5.474   1.00 0.00 ? 58  ASN A ND2  3  
ATOM 4396  H H    . ASN A 1 58  ? 3.992   -15.152 7.076   1.00 0.00 ? 58  ASN A H    3  
ATOM 4397  H HA   . ASN A 1 58  ? 6.315   -15.142 8.567   1.00 0.00 ? 58  ASN A HA   3  
ATOM 4398  H HB2  . ASN A 1 58  ? 6.571   -17.538 7.811   1.00 0.00 ? 58  ASN A HB2  3  
ATOM 4399  H HB3  . ASN A 1 58  ? 4.994   -17.132 8.482   1.00 0.00 ? 58  ASN A HB3  3  
ATOM 4400  H HD21 . ASN A 1 58  ? 6.758   -18.058 5.668   1.00 0.00 ? 58  ASN A HD21 3  
ATOM 4401  H HD22 . ASN A 1 58  ? 5.394   -18.337 4.644   1.00 0.00 ? 58  ASN A HD22 3  
ATOM 4402  N N    . GLY A 1 59  ? 6.892   -15.327 5.326   1.00 0.00 ? 59  GLY A N    3  
ATOM 4403  C CA   . GLY A 1 59  ? 7.923   -15.138 4.323   1.00 0.00 ? 59  GLY A CA   3  
ATOM 4404  C C    . GLY A 1 59  ? 7.760   -16.072 3.140   1.00 0.00 ? 59  GLY A C    3  
ATOM 4405  O O    . GLY A 1 59  ? 7.899   -17.287 3.276   1.00 0.00 ? 59  GLY A O    3  
ATOM 4406  H H    . GLY A 1 59  ? 5.968   -15.501 5.049   1.00 0.00 ? 59  GLY A H    3  
ATOM 4407  H HA2  . GLY A 1 59  ? 7.886   -14.118 3.971   1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4408  H HA3  . GLY A 1 59  ? 8.887   -15.316 4.777   1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4409  N N    . GLY A 1 60  ? 7.463   -15.503 1.976   1.00 0.00 ? 60  GLY A N    3  
ATOM 4410  C CA   . GLY A 1 60  ? 7.283   -16.308 0.782   1.00 0.00 ? 60  GLY A CA   3  
ATOM 4411  C C    . GLY A 1 60  ? 7.536   -15.523 -0.490  1.00 0.00 ? 60  GLY A C    3  
ATOM 4412  O O    . GLY A 1 60  ? 8.607   -14.942 -0.665  1.00 0.00 ? 60  GLY A O    3  
ATOM 4413  H H    . GLY A 1 60  ? 7.364   -14.529 1.927   1.00 0.00 ? 60  GLY A H    3  
ATOM 4414  H HA2  . GLY A 1 60  ? 7.966   -17.144 0.818   1.00 0.00 ? 60  GLY A HA2  3  
ATOM 4415  H HA3  . GLY A 1 60  ? 6.271   -16.684 0.763   1.00 0.00 ? 60  GLY A HA3  3  
ATOM 4416  N N    . GLU A 1 61  ? 6.549   -15.507 -1.381  1.00 0.00 ? 61  GLU A N    3  
ATOM 4417  C CA   . GLU A 1 61  ? 6.672   -14.790 -2.644  1.00 0.00 ? 61  GLU A CA   3  
ATOM 4418  C C    . GLU A 1 61  ? 6.104   -13.379 -2.526  1.00 0.00 ? 61  GLU A C    3  
ATOM 4419  O O    . GLU A 1 61  ? 4.988   -13.185 -2.041  1.00 0.00 ? 61  GLU A O    3  
ATOM 4420  C CB   . GLU A 1 61  ? 5.953   -15.550 -3.760  1.00 0.00 ? 61  GLU A CB   3  
ATOM 4421  C CG   . GLU A 1 61  ? 6.336   -15.088 -5.156  1.00 0.00 ? 61  GLU A CG   3  
ATOM 4422  C CD   . GLU A 1 61  ? 6.054   -16.136 -6.215  1.00 0.00 ? 61  GLU A CD   3  
ATOM 4423  O OE1  . GLU A 1 61  ? 6.071   -17.339 -5.878  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4424  O OE2  . GLU A 1 61  ? 5.817   -15.755 -7.380  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4425  H H    . GLU A 1 61  ? 5.719   -15.990 -1.184  1.00 0.00 ? 61  GLU A H    3  
ATOM 4426  H HA   . GLU A 1 61  ? 7.722   -14.722 -2.886  1.00 0.00 ? 61  GLU A HA   3  
ATOM 4427  H HB2  . GLU A 1 61  ? 6.188   -16.601 -3.673  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4428  H HB3  . GLU A 1 61  ? 4.888   -15.418 -3.640  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4429  H HG2  . GLU A 1 61  ? 5.773   -14.198 -5.394  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4430  H HG3  . GLU A 1 61  ? 7.391   -14.859 -5.169  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4431  N N    . LEU A 1 62  ? 6.878   -12.396 -2.972  1.00 0.00 ? 62  LEU A N    3  
ATOM 4432  C CA   . LEU A 1 62  ? 6.453   -11.002 -2.917  1.00 0.00 ? 62  LEU A CA   3  
ATOM 4433  C C    . LEU A 1 62  ? 5.879   -10.554 -4.257  1.00 0.00 ? 62  LEU A C    3  
ATOM 4434  O O    . LEU A 1 62  ? 6.490   -10.758 -5.306  1.00 0.00 ? 62  LEU A O    3  
ATOM 4435  C CB   . LEU A 1 62  ? 7.629   -10.104 -2.527  1.00 0.00 ? 62  LEU A CB   3  
ATOM 4436  C CG   . LEU A 1 62  ? 7.352   -8.601  -2.520  1.00 0.00 ? 62  LEU A CG   3  
ATOM 4437  C CD1  . LEU A 1 62  ? 7.129   -8.092  -3.936  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 4438  C CD2  . LEU A 1 62  ? 6.151   -8.284  -1.642  1.00 0.00 ? 62  LEU A CD2  3  
ATOM 4439  H H    . LEU A 1 62  ? 7.756   -12.612 -3.348  1.00 0.00 ? 62  LEU A H    3  
ATOM 4440  H HA   . LEU A 1 62  ? 5.683   -10.920 -2.164  1.00 0.00 ? 62  LEU A HA   3  
ATOM 4441  H HB2  . LEU A 1 62  ? 7.946   -10.387 -1.535  1.00 0.00 ? 62  LEU A HB2  3  
ATOM 4442  H HB3  . LEU A 1 62  ? 8.432   -10.291 -3.227  1.00 0.00 ? 62  LEU A HB3  3  
ATOM 4443  H HG   . LEU A 1 62  ? 8.211   -8.085  -2.113  1.00 0.00 ? 62  LEU A HG   3  
ATOM 4444  H HD11 . LEU A 1 62  ? 6.070   -7.984  -4.117  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 4445  H HD12 . LEU A 1 62  ? 7.544   -8.797  -4.641  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 4446  H HD13 . LEU A 1 62  ? 7.615   -7.135  -4.055  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 4447  H HD21 . LEU A 1 62  ? 5.319   -8.910  -1.930  1.00 0.00 ? 62  LEU A HD21 3  
ATOM 4448  H HD22 . LEU A 1 62  ? 5.879   -7.245  -1.765  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 4449  H HD23 . LEU A 1 62  ? 6.402   -8.470  -0.608  1.00 0.00 ? 62  LEU A HD23 3  
ATOM 4450  N N    . HIS A 1 63  ? 4.701   -9.940  -4.215  1.00 0.00 ? 63  HIS A N    3  
ATOM 4451  C CA   . HIS A 1 63  ? 4.045   -9.460  -5.426  1.00 0.00 ? 63  HIS A CA   3  
ATOM 4452  C C    . HIS A 1 63  ? 3.819   -7.952  -5.361  1.00 0.00 ? 63  HIS A C    3  
ATOM 4453  O O    . HIS A 1 63  ? 3.120   -7.457  -4.476  1.00 0.00 ? 63  HIS A O    3  
ATOM 4454  C CB   . HIS A 1 63  ? 2.710   -10.178 -5.628  1.00 0.00 ? 63  HIS A CB   3  
ATOM 4455  C CG   . HIS A 1 63  ? 2.845   -11.664 -5.764  1.00 0.00 ? 63  HIS A CG   3  
ATOM 4456  N ND1  . HIS A 1 63  ? 3.189   -12.284 -6.947  1.00 0.00 ? 63  HIS A ND1  3  
ATOM 4457  C CD2  . HIS A 1 63  ? 2.681   -12.654 -4.856  1.00 0.00 ? 63  HIS A CD2  3  
ATOM 4458  C CE1  . HIS A 1 63  ? 3.230   -13.591 -6.761  1.00 0.00 ? 63  HIS A CE1  3  
ATOM 4459  N NE2  . HIS A 1 63  ? 2.926   -13.842 -5.500  1.00 0.00 ? 63  HIS A NE2  3  
ATOM 4460  H H    . HIS A 1 63  ? 4.262   -9.806  -3.349  1.00 0.00 ? 63  HIS A H    3  
ATOM 4461  H HA   . HIS A 1 63  ? 4.692   -9.678  -6.262  1.00 0.00 ? 63  HIS A HA   3  
ATOM 4462  H HB2  . HIS A 1 63  ? 2.070   -9.980  -4.781  1.00 0.00 ? 63  HIS A HB2  3  
ATOM 4463  H HB3  . HIS A 1 63  ? 2.239   -9.804  -6.525  1.00 0.00 ? 63  HIS A HB3  3  
ATOM 4464  H HD2  . HIS A 1 63  ? 2.408   -12.534 -3.817  1.00 0.00 ? 63  HIS A HD2  3  
ATOM 4465  H HE1  . HIS A 1 63  ? 3.471   -14.329 -7.511  1.00 0.00 ? 63  HIS A HE1  3  
ATOM 4466  H HE2  . HIS A 1 63  ? 2.799   -14.735 -5.118  1.00 0.00 ? 63  HIS A HE2  3  
ATOM 4467  N N    . ARG A 1 64  ? 4.415   -7.228  -6.302  1.00 0.00 ? 64  ARG A N    3  
ATOM 4468  C CA   . ARG A 1 64  ? 4.281   -5.777  -6.350  1.00 0.00 ? 64  ARG A CA   3  
ATOM 4469  C C    . ARG A 1 64  ? 3.215   -5.363  -7.360  1.00 0.00 ? 64  ARG A C    3  
ATOM 4470  O O    . ARG A 1 64  ? 3.304   -5.693  -8.543  1.00 0.00 ? 64  ARG A O    3  
ATOM 4471  C CB   . ARG A 1 64  ? 5.620   -5.131  -6.711  1.00 0.00 ? 64  ARG A CB   3  
ATOM 4472  C CG   . ARG A 1 64  ? 5.582   -3.612  -6.713  1.00 0.00 ? 64  ARG A CG   3  
ATOM 4473  C CD   . ARG A 1 64  ? 6.784   -3.025  -7.436  1.00 0.00 ? 64  ARG A CD   3  
ATOM 4474  N NE   . ARG A 1 64  ? 6.673   -3.165  -8.886  1.00 0.00 ? 64  ARG A NE   3  
ATOM 4475  C CZ   . ARG A 1 64  ? 7.575   -2.696  -9.741  1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4476  N NH1  . ARG A 1 64  ? 8.649   -2.061  -9.294  1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4477  N NH2  . ARG A 1 64  ? 7.403   -2.863  -11.046 1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4478  H H    . ARG A 1 64  ? 4.960   -7.680  -6.980  1.00 0.00 ? 64  ARG A H    3  
ATOM 4479  H HA   . ARG A 1 64  ? 3.981   -5.439  -5.369  1.00 0.00 ? 64  ARG A HA   3  
ATOM 4480  H HB2  . ARG A 1 64  ? 6.365   -5.450  -5.997  1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4481  H HB3  . ARG A 1 64  ? 5.912   -5.463  -7.696  1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4482  H HG2  . ARG A 1 64  ? 4.682   -3.284  -7.211  1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4483  H HG3  . ARG A 1 64  ? 5.580   -3.260  -5.692  1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4484  H HD2  . ARG A 1 64  ? 6.860   -1.977  -7.191  1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4485  H HD3  . ARG A 1 64  ? 7.674   -3.538  -7.102  1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4486  H HE   . ARG A 1 64  ? 5.887   -3.632  -9.238  1.00 0.00 ? 64  ARG A HE   3  
ATOM 4487  H HH11 . ARG A 1 64  ? 8.782   -1.934  -8.311  1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4488  H HH12 . ARG A 1 64  ? 9.328   -1.709  -9.940  1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4489  H HH21 . ARG A 1 64  ? 6.595   -3.342  -11.387 1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4490  H HH22 . ARG A 1 64  ? 8.082   -2.509  -11.689 1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4491  N N    . LEU A 1 65  ? 2.208   -4.638  -6.886  1.00 0.00 ? 65  LEU A N    3  
ATOM 4492  C CA   . LEU A 1 65  ? 1.123   -4.179  -7.747  1.00 0.00 ? 65  LEU A CA   3  
ATOM 4493  C C    . LEU A 1 65  ? 1.219   -2.676  -7.988  1.00 0.00 ? 65  LEU A C    3  
ATOM 4494  O O    . LEU A 1 65  ? 1.186   -1.883  -7.048  1.00 0.00 ? 65  LEU A O    3  
ATOM 4495  C CB   . LEU A 1 65  ? -0.230  -4.521  -7.122  1.00 0.00 ? 65  LEU A CB   3  
ATOM 4496  C CG   . LEU A 1 65  ? -0.444  -5.988  -6.745  1.00 0.00 ? 65  LEU A CG   3  
ATOM 4497  C CD1  . LEU A 1 65  ? -1.653  -6.134  -5.835  1.00 0.00 ? 65  LEU A CD1  3  
ATOM 4498  C CD2  . LEU A 1 65  ? -0.608  -6.841  -7.994  1.00 0.00 ? 65  LEU A CD2  3  
ATOM 4499  H H    . LEU A 1 65  ? 2.191   -4.406  -5.934  1.00 0.00 ? 65  LEU A H    3  
ATOM 4500  H HA   . LEU A 1 65  ? 1.213   -4.690  -8.694  1.00 0.00 ? 65  LEU A HA   3  
ATOM 4501  H HB2  . LEU A 1 65  ? -0.340  -3.930  -6.226  1.00 0.00 ? 65  LEU A HB2  3  
ATOM 4502  H HB3  . LEU A 1 65  ? -0.999  -4.245  -7.830  1.00 0.00 ? 65  LEU A HB3  3  
ATOM 4503  H HG   . LEU A 1 65  ? 0.423   -6.345  -6.207  1.00 0.00 ? 65  LEU A HG   3  
ATOM 4504  H HD11 . LEU A 1 65  ? -1.354  -5.973  -4.810  1.00 0.00 ? 65  LEU A HD11 3  
ATOM 4505  H HD12 . LEU A 1 65  ? -2.064  -7.128  -5.938  1.00 0.00 ? 65  LEU A HD12 3  
ATOM 4506  H HD13 . LEU A 1 65  ? -2.402  -5.405  -6.111  1.00 0.00 ? 65  LEU A HD13 3  
ATOM 4507  H HD21 . LEU A 1 65  ? 0.347   -7.261  -8.271  1.00 0.00 ? 65  LEU A HD21 3  
ATOM 4508  H HD22 . LEU A 1 65  ? -0.980  -6.228  -8.802  1.00 0.00 ? 65  LEU A HD22 3  
ATOM 4509  H HD23 . LEU A 1 65  ? -1.310  -7.639  -7.796  1.00 0.00 ? 65  LEU A HD23 3  
ATOM 4510  N N    . ASN A 1 66  ? 1.336   -2.291  -9.255  1.00 0.00 ? 66  ASN A N    3  
ATOM 4511  C CA   . ASN A 1 66  ? 1.435   -0.883  -9.620  1.00 0.00 ? 66  ASN A CA   3  
ATOM 4512  C C    . ASN A 1 66  ? 0.071   -0.328  -10.020 1.00 0.00 ? 66  ASN A C    3  
ATOM 4513  O O    . ASN A 1 66  ? -0.748  -1.032  -10.610 1.00 0.00 ? 66  ASN A O    3  
ATOM 4514  C CB   . ASN A 1 66  ? 2.429   -0.701  -10.769 1.00 0.00 ? 66  ASN A CB   3  
ATOM 4515  C CG   . ASN A 1 66  ? 3.868   -0.867  -10.320 1.00 0.00 ? 66  ASN A CG   3  
ATOM 4516  O OD1  . ASN A 1 66  ? 4.406   -1.975  -10.319 1.00 0.00 ? 66  ASN A OD1  3  
ATOM 4517  N ND2  . ASN A 1 66  ? 4.499   0.236   -9.936  1.00 0.00 ? 66  ASN A ND2  3  
ATOM 4518  H H    . ASN A 1 66  ? 1.357   -2.971  -9.961  1.00 0.00 ? 66  ASN A H    3  
ATOM 4519  H HA   . ASN A 1 66  ? 1.793   -0.341  -8.758  1.00 0.00 ? 66  ASN A HA   3  
ATOM 4520  H HB2  . ASN A 1 66  ? 2.224   -1.436  -11.534 1.00 0.00 ? 66  ASN A HB2  3  
ATOM 4521  H HB3  . ASN A 1 66  ? 2.312   0.288   -11.185 1.00 0.00 ? 66  ASN A HB3  3  
ATOM 4522  H HD21 . ASN A 1 66  ? 4.008   1.084   -9.963  1.00 0.00 ? 66  ASN A HD21 3  
ATOM 4523  H HD22 . ASN A 1 66  ? 5.430   0.158   -9.642  1.00 0.00 ? 66  ASN A HD22 3  
ATOM 4524  N N    . ILE A 1 67  ? -0.164  0.939   -9.695  1.00 0.00 ? 67  ILE A N    3  
ATOM 4525  C CA   . ILE A 1 67  ? -1.427  1.589   -10.022 1.00 0.00 ? 67  ILE A CA   3  
ATOM 4526  C C    . ILE A 1 67  ? -1.222  2.713   -11.032 1.00 0.00 ? 67  ILE A C    3  
ATOM 4527  O O    . ILE A 1 67  ? -0.659  3.764   -10.723 1.00 0.00 ? 67  ILE A O    3  
ATOM 4528  C CB   . ILE A 1 67  ? -2.107  2.162   -8.764  1.00 0.00 ? 67  ILE A CB   3  
ATOM 4529  C CG1  . ILE A 1 67  ? -2.012  1.165   -7.607  1.00 0.00 ? 67  ILE A CG1  3  
ATOM 4530  C CG2  . ILE A 1 67  ? -3.560  2.505   -9.057  1.00 0.00 ? 67  ILE A CG2  3  
ATOM 4531  C CD1  . ILE A 1 67  ? -2.861  -0.071  -7.804  1.00 0.00 ? 67  ILE A CD1  3  
ATOM 4532  H H    . ILE A 1 67  ? 0.529   1.449   -9.225  1.00 0.00 ? 67  ILE A H    3  
ATOM 4533  H HA   . ILE A 1 67  ? -2.082  0.846   -10.454 1.00 0.00 ? 67  ILE A HA   3  
ATOM 4534  H HB   . ILE A 1 67  ? -1.596  3.072   -8.489  1.00 0.00 ? 67  ILE A HB   3  
ATOM 4535  H HG12 . ILE A 1 67  ? -0.987  0.848   -7.496  1.00 0.00 ? 67  ILE A HG12 3  
ATOM 4536  H HG13 . ILE A 1 67  ? -2.336  1.649   -6.697  1.00 0.00 ? 67  ILE A HG13 3  
ATOM 4537  H HG21 . ILE A 1 67  ? -3.824  3.419   -8.546  1.00 0.00 ? 67  ILE A HG21 3  
ATOM 4538  H HG22 . ILE A 1 67  ? -3.690  2.638   -10.121 1.00 0.00 ? 67  ILE A HG22 3  
ATOM 4539  H HG23 . ILE A 1 67  ? -4.196  1.703   -8.714  1.00 0.00 ? 67  ILE A HG23 3  
ATOM 4540  H HD11 . ILE A 1 67  ? -3.265  -0.074  -8.807  1.00 0.00 ? 67  ILE A HD11 3  
ATOM 4541  H HD12 . ILE A 1 67  ? -2.253  -0.953  -7.660  1.00 0.00 ? 67  ILE A HD12 3  
ATOM 4542  H HD13 . ILE A 1 67  ? -3.671  -0.070  -7.090  1.00 0.00 ? 67  ILE A HD13 3  
ATOM 4543  N N    . PRO A 1 68  ? -1.689  2.489   -12.269 1.00 0.00 ? 68  PRO A N    3  
ATOM 4544  C CA   . PRO A 1 68  ? -1.571  3.473   -13.349 1.00 0.00 ? 68  PRO A CA   3  
ATOM 4545  C C    . PRO A 1 68  ? -2.463  4.689   -13.126 1.00 0.00 ? 68  PRO A C    3  
ATOM 4546  O O    . PRO A 1 68  ? -2.524  5.587   -13.965 1.00 0.00 ? 68  PRO A O    3  
ATOM 4547  C CB   . PRO A 1 68  ? -2.026  2.696   -14.587 1.00 0.00 ? 68  PRO A CB   3  
ATOM 4548  C CG   . PRO A 1 68  ? -2.921  1.629   -14.057 1.00 0.00 ? 68  PRO A CG   3  
ATOM 4549  C CD   . PRO A 1 68  ? -2.370  1.260   -12.708 1.00 0.00 ? 68  PRO A CD   3  
ATOM 4550  H HA   . PRO A 1 68  ? -0.549  3.796   -13.481 1.00 0.00 ? 68  PRO A HA   3  
ATOM 4551  H HB2  . PRO A 1 68  ? -2.555  3.359   -15.257 1.00 0.00 ? 68  PRO A HB2  3  
ATOM 4552  H HB3  . PRO A 1 68  ? -1.168  2.277   -15.090 1.00 0.00 ? 68  PRO A HB3  3  
ATOM 4553  H HG2  . PRO A 1 68  ? -3.927  2.008   -13.961 1.00 0.00 ? 68  PRO A HG2  3  
ATOM 4554  H HG3  . PRO A 1 68  ? -2.902  0.774   -14.716 1.00 0.00 ? 68  PRO A HG3  3  
ATOM 4555  H HD2  . PRO A 1 68  ? -3.171  1.000   -12.031 1.00 0.00 ? 68  PRO A HD2  3  
ATOM 4556  H HD3  . PRO A 1 68  ? -1.669  0.443   -12.797 1.00 0.00 ? 68  PRO A HD3  3  
ATOM 4557  N N    . ASN A 1 69  ? -3.152  4.712   -11.990 1.00 0.00 ? 69  ASN A N    3  
ATOM 4558  C CA   . ASN A 1 69  ? -4.040  5.819   -11.657 1.00 0.00 ? 69  ASN A CA   3  
ATOM 4559  C C    . ASN A 1 69  ? -3.770  6.328   -10.244 1.00 0.00 ? 69  ASN A C    3  
ATOM 4560  O O    . ASN A 1 69  ? -4.024  5.644   -9.252  1.00 0.00 ? 69  ASN A O    3  
ATOM 4561  C CB   . ASN A 1 69  ? -5.502  5.384   -11.784 1.00 0.00 ? 69  ASN A CB   3  
ATOM 4562  C CG   . ASN A 1 69  ? -6.459  6.560   -11.770 1.00 0.00 ? 69  ASN A CG   3  
ATOM 4563  O OD1  . ASN A 1 69  ? -6.163  7.621   -12.318 1.00 0.00 ? 69  ASN A OD1  3  
ATOM 4564  N ND2  . ASN A 1 69  ? -7.614  6.375   -11.140 1.00 0.00 ? 69  ASN A ND2  3  
ATOM 4565  H H    . ASN A 1 69  ? -3.061  3.966   -11.360 1.00 0.00 ? 69  ASN A H    3  
ATOM 4566  H HA   . ASN A 1 69  ? -3.850  6.619   -12.357 1.00 0.00 ? 69  ASN A HA   3  
ATOM 4567  H HB2  . ASN A 1 69  ? -5.632  4.849   -12.714 1.00 0.00 ? 69  ASN A HB2  3  
ATOM 4568  H HB3  . ASN A 1 69  ? -5.749  4.731   -10.960 1.00 0.00 ? 69  ASN A HB3  3  
ATOM 4569  H HD21 . ASN A 1 69  ? -7.781  5.502   -10.726 1.00 0.00 ? 69  ASN A HD21 3  
ATOM 4570  H HD22 . ASN A 1 69  ? -8.251  7.118   -11.116 1.00 0.00 ? 69  ASN A HD22 3  
ATOM 4571  N N    . PRO A 1 70  ? -3.243  7.557   -10.148 1.00 0.00 ? 70  PRO A N    3  
ATOM 4572  C CA   . PRO A 1 70  ? -2.928  8.186   -8.862  1.00 0.00 ? 70  PRO A CA   3  
ATOM 4573  C C    . PRO A 1 70  ? -4.181  8.555   -8.075  1.00 0.00 ? 70  PRO A C    3  
ATOM 4574  O O    . PRO A 1 70  ? -4.097  9.030   -6.943  1.00 0.00 ? 70  PRO A O    3  
ATOM 4575  C CB   . PRO A 1 70  ? -2.157  9.446   -9.262  1.00 0.00 ? 70  PRO A CB   3  
ATOM 4576  C CG   . PRO A 1 70  ? -2.627  9.756   -10.641 1.00 0.00 ? 70  PRO A CG   3  
ATOM 4577  C CD   . PRO A 1 70  ? -2.915  8.429   -11.289 1.00 0.00 ? 70  PRO A CD   3  
ATOM 4578  H HA   . PRO A 1 70  ? -2.297  7.553   -8.255  1.00 0.00 ? 70  PRO A HA   3  
ATOM 4579  H HB2  . PRO A 1 70  ? -2.391  10.247  -8.575  1.00 0.00 ? 70  PRO A HB2  3  
ATOM 4580  H HB3  . PRO A 1 70  ? -1.097  9.245   -9.242  1.00 0.00 ? 70  PRO A HB3  3  
ATOM 4581  H HG2  . PRO A 1 70  ? -3.525  10.354  -10.598 1.00 0.00 ? 70  PRO A HG2  3  
ATOM 4582  H HG3  . PRO A 1 70  ? -1.853  10.277  -11.184 1.00 0.00 ? 70  PRO A HG3  3  
ATOM 4583  H HD2  . PRO A 1 70  ? -3.753  8.513   -11.964 1.00 0.00 ? 70  PRO A HD2  3  
ATOM 4584  H HD3  . PRO A 1 70  ? -2.041  8.067   -11.811 1.00 0.00 ? 70  PRO A HD3  3  
ATOM 4585  N N    . ALA A 1 71  ? -5.342  8.333   -8.682  1.00 0.00 ? 71  ALA A N    3  
ATOM 4586  C CA   . ALA A 1 71  ? -6.613  8.640   -8.036  1.00 0.00 ? 71  ALA A CA   3  
ATOM 4587  C C    . ALA A 1 71  ? -7.229  7.391   -7.415  1.00 0.00 ? 71  ALA A C    3  
ATOM 4588  O O    . ALA A 1 71  ? -8.005  7.479   -6.464  1.00 0.00 ? 71  ALA A O    3  
ATOM 4589  C CB   . ALA A 1 71  ? -7.575  9.265   -9.035  1.00 0.00 ? 71  ALA A CB   3  
ATOM 4590  H H    . ALA A 1 71  ? -5.345  7.952   -9.584  1.00 0.00 ? 71  ALA A H    3  
ATOM 4591  H HA   . ALA A 1 71  ? -6.424  9.362   -7.255  1.00 0.00 ? 71  ALA A HA   3  
ATOM 4592  H HB1  . ALA A 1 71  ? -8.061  10.116  -8.583  1.00 0.00 ? 71  ALA A HB1  3  
ATOM 4593  H HB2  . ALA A 1 71  ? -7.026  9.586   -9.909  1.00 0.00 ? 71  ALA A HB2  3  
ATOM 4594  H HB3  . ALA A 1 71  ? -8.318  8.536   -9.324  1.00 0.00 ? 71  ALA A HB3  3  
ATOM 4595  N N    . GLN A 1 72  ? -6.879  6.230   -7.961  1.00 0.00 ? 72  GLN A N    3  
ATOM 4596  C CA   . GLN A 1 72  ? -7.400  4.964   -7.460  1.00 0.00 ? 72  GLN A CA   3  
ATOM 4597  C C    . GLN A 1 72  ? -6.706  4.564   -6.162  1.00 0.00 ? 72  GLN A C    3  
ATOM 4598  O O    . GLN A 1 72  ? -5.603  4.017   -6.178  1.00 0.00 ? 72  GLN A O    3  
ATOM 4599  C CB   . GLN A 1 72  ? -7.221  3.864   -8.508  1.00 0.00 ? 72  GLN A CB   3  
ATOM 4600  C CG   . GLN A 1 72  ? -7.462  2.464   -7.968  1.00 0.00 ? 72  GLN A CG   3  
ATOM 4601  C CD   . GLN A 1 72  ? -7.052  1.382   -8.948  1.00 0.00 ? 72  GLN A CD   3  
ATOM 4602  O OE1  . GLN A 1 72  ? -7.150  1.559   -10.162 1.00 0.00 ? 72  GLN A OE1  3  
ATOM 4603  N NE2  . GLN A 1 72  ? -6.588  0.253   -8.424  1.00 0.00 ? 72  GLN A NE2  3  
ATOM 4604  H H    . GLN A 1 72  ? -6.257  6.226   -8.717  1.00 0.00 ? 72  GLN A H    3  
ATOM 4605  H HA   . GLN A 1 72  ? -8.454  5.093   -7.265  1.00 0.00 ? 72  GLN A HA   3  
ATOM 4606  H HB2  . GLN A 1 72  ? -7.913  4.039   -9.318  1.00 0.00 ? 72  GLN A HB2  3  
ATOM 4607  H HB3  . GLN A 1 72  ? -6.212  3.910   -8.891  1.00 0.00 ? 72  GLN A HB3  3  
ATOM 4608  H HG2  . GLN A 1 72  ? -6.893  2.339   -7.059  1.00 0.00 ? 72  GLN A HG2  3  
ATOM 4609  H HG3  . GLN A 1 72  ? -8.514  2.353   -7.751  1.00 0.00 ? 72  GLN A HG3  3  
ATOM 4610  H HE21 . GLN A 1 72  ? -6.539  0.183   -7.447  1.00 0.00 ? 72  GLN A HE21 3  
ATOM 4611  H HE22 . GLN A 1 72  ? -6.317  -0.463  -9.033  1.00 0.00 ? 72  GLN A HE22 3  
ATOM 4612  N N    . THR A 1 73  ? -7.359  4.842   -5.038  1.00 0.00 ? 73  THR A N    3  
ATOM 4613  C CA   . THR A 1 73  ? -6.804  4.513   -3.731  1.00 0.00 ? 73  THR A CA   3  
ATOM 4614  C C    . THR A 1 73  ? -7.342  3.180   -3.225  1.00 0.00 ? 73  THR A C    3  
ATOM 4615  O O    . THR A 1 73  ? -7.534  2.993   -2.023  1.00 0.00 ? 73  THR A O    3  
ATOM 4616  C CB   . THR A 1 73  ? -7.120  5.608   -2.695  1.00 0.00 ? 73  THR A CB   3  
ATOM 4617  O OG1  . THR A 1 73  ? -8.533  5.681   -2.475  1.00 0.00 ? 73  THR A OG1  3  
ATOM 4618  C CG2  . THR A 1 73  ? -6.603  6.960   -3.162  1.00 0.00 ? 73  THR A CG2  3  
ATOM 4619  H H    . THR A 1 73  ? -8.234  5.279   -5.090  1.00 0.00 ? 73  THR A H    3  
ATOM 4620  H HA   . THR A 1 73  ? -5.731  4.442   -3.833  1.00 0.00 ? 73  THR A HA   3  
ATOM 4621  H HB   . THR A 1 73  ? -6.631  5.354   -1.765  1.00 0.00 ? 73  THR A HB   3  
ATOM 4622  H HG1  . THR A 1 73  ? -8.848  4.839   -2.137  1.00 0.00 ? 73  THR A HG1  3  
ATOM 4623  H HG21 . THR A 1 73  ? -6.360  6.909   -4.212  1.00 0.00 ? 73  THR A HG21 3  
ATOM 4624  H HG22 . THR A 1 73  ? -5.719  7.222   -2.600  1.00 0.00 ? 73  THR A HG22 3  
ATOM 4625  H HG23 . THR A 1 73  ? -7.365  7.710   -3.005  1.00 0.00 ? 73  THR A HG23 3  
ATOM 4626  N N    . SER A 1 74  ? -7.583  2.255   -4.148  1.00 0.00 ? 74  SER A N    3  
ATOM 4627  C CA   . SER A 1 74  ? -8.103  0.939   -3.795  1.00 0.00 ? 74  SER A CA   3  
ATOM 4628  C C    . SER A 1 74  ? -7.845  -0.065  -4.915  1.00 0.00 ? 74  SER A C    3  
ATOM 4629  O O    . SER A 1 74  ? -8.058  0.230   -6.091  1.00 0.00 ? 74  SER A O    3  
ATOM 4630  C CB   . SER A 1 74  ? -9.602  1.021   -3.504  1.00 0.00 ? 74  SER A CB   3  
ATOM 4631  O OG   . SER A 1 74  ? -10.288 1.696   -4.544  1.00 0.00 ? 74  SER A OG   3  
ATOM 4632  H H    . SER A 1 74  ? -7.410  2.464   -5.090  1.00 0.00 ? 74  SER A H    3  
ATOM 4633  H HA   . SER A 1 74  ? -7.589  0.608   -2.905  1.00 0.00 ? 74  SER A HA   3  
ATOM 4634  H HB2  . SER A 1 74  ? -10.004 0.023   -3.413  1.00 0.00 ? 74  SER A HB2  3  
ATOM 4635  H HB3  . SER A 1 74  ? -9.758  1.557   -2.579  1.00 0.00 ? 74  SER A HB3  3  
ATOM 4636  H HG   . SER A 1 74  ? -9.679  2.277   -5.005  1.00 0.00 ? 74  SER A HG   3  
ATOM 4637  N N    . VAL A 1 75  ? -7.384  -1.254  -4.540  1.00 0.00 ? 75  VAL A N    3  
ATOM 4638  C CA   . VAL A 1 75  ? -7.097  -2.304  -5.511  1.00 0.00 ? 75  VAL A CA   3  
ATOM 4639  C C    . VAL A 1 75  ? -7.544  -3.667  -4.994  1.00 0.00 ? 75  VAL A C    3  
ATOM 4640  O O    . VAL A 1 75  ? -7.451  -3.951  -3.800  1.00 0.00 ? 75  VAL A O    3  
ATOM 4641  C CB   . VAL A 1 75  ? -5.596  -2.362  -5.848  1.00 0.00 ? 75  VAL A CB   3  
ATOM 4642  C CG1  . VAL A 1 75  ? -4.794  -2.820  -4.639  1.00 0.00 ? 75  VAL A CG1  3  
ATOM 4643  C CG2  . VAL A 1 75  ? -5.352  -3.277  -7.038  1.00 0.00 ? 75  VAL A CG2  3  
ATOM 4644  H H    . VAL A 1 75  ? -7.234  -1.430  -3.588  1.00 0.00 ? 75  VAL A H    3  
ATOM 4645  H HA   . VAL A 1 75  ? -7.640  -2.078  -6.417  1.00 0.00 ? 75  VAL A HA   3  
ATOM 4646  H HB   . VAL A 1 75  ? -5.268  -1.367  -6.112  1.00 0.00 ? 75  VAL A HB   3  
ATOM 4647  H HG11 . VAL A 1 75  ? -4.836  -2.062  -3.871  1.00 0.00 ? 75  VAL A HG11 3  
ATOM 4648  H HG12 . VAL A 1 75  ? -5.210  -3.742  -4.260  1.00 0.00 ? 75  VAL A HG12 3  
ATOM 4649  H HG13 . VAL A 1 75  ? -3.766  -2.981  -4.929  1.00 0.00 ? 75  VAL A HG13 3  
ATOM 4650  H HG21 . VAL A 1 75  ? -6.299  -3.584  -7.456  1.00 0.00 ? 75  VAL A HG21 3  
ATOM 4651  H HG22 . VAL A 1 75  ? -4.782  -2.748  -7.787  1.00 0.00 ? 75  VAL A HG22 3  
ATOM 4652  H HG23 . VAL A 1 75  ? -4.801  -4.149  -6.716  1.00 0.00 ? 75  VAL A HG23 3  
ATOM 4653  N N    . VAL A 1 76  ? -8.029  -4.508  -5.902  1.00 0.00 ? 76  VAL A N    3  
ATOM 4654  C CA   . VAL A 1 76  ? -8.489  -5.843  -5.539  1.00 0.00 ? 76  VAL A CA   3  
ATOM 4655  C C    . VAL A 1 76  ? -7.370  -6.869  -5.686  1.00 0.00 ? 76  VAL A C    3  
ATOM 4656  O O    . VAL A 1 76  ? -6.804  -7.035  -6.766  1.00 0.00 ? 76  VAL A O    3  
ATOM 4657  C CB   . VAL A 1 76  ? -9.686  -6.279  -6.404  1.00 0.00 ? 76  VAL A CB   3  
ATOM 4658  C CG1  . VAL A 1 76  ? -10.024 -7.740  -6.152  1.00 0.00 ? 76  VAL A CG1  3  
ATOM 4659  C CG2  . VAL A 1 76  ? -10.891 -5.390  -6.132  1.00 0.00 ? 76  VAL A CG2  3  
ATOM 4660  H H    . VAL A 1 76  ? -8.078  -4.224  -6.839  1.00 0.00 ? 76  VAL A H    3  
ATOM 4661  H HA   . VAL A 1 76  ? -8.807  -5.817  -4.507  1.00 0.00 ? 76  VAL A HA   3  
ATOM 4662  H HB   . VAL A 1 76  ? -9.412  -6.170  -7.444  1.00 0.00 ? 76  VAL A HB   3  
ATOM 4663  H HG11 . VAL A 1 76  ? -9.403  -8.120  -5.354  1.00 0.00 ? 76  VAL A HG11 3  
ATOM 4664  H HG12 . VAL A 1 76  ? -11.064 -7.827  -5.873  1.00 0.00 ? 76  VAL A HG12 3  
ATOM 4665  H HG13 . VAL A 1 76  ? -9.843  -8.311  -7.051  1.00 0.00 ? 76  VAL A HG13 3  
ATOM 4666  H HG21 . VAL A 1 76  ? -11.770 -5.826  -6.583  1.00 0.00 ? 76  VAL A HG21 3  
ATOM 4667  H HG22 . VAL A 1 76  ? -11.038 -5.301  -5.066  1.00 0.00 ? 76  VAL A HG22 3  
ATOM 4668  H HG23 . VAL A 1 76  ? -10.719 -4.410  -6.555  1.00 0.00 ? 76  VAL A HG23 3  
ATOM 4669  N N    . VAL A 1 77  ? -7.056  -7.555  -4.592  1.00 0.00 ? 77  VAL A N    3  
ATOM 4670  C CA   . VAL A 1 77  ? -6.006  -8.566  -4.598  1.00 0.00 ? 77  VAL A CA   3  
ATOM 4671  C C    . VAL A 1 77  ? -6.596  -9.972  -4.588  1.00 0.00 ? 77  VAL A C    3  
ATOM 4672  O O    . VAL A 1 77  ? -7.284  -10.359 -3.644  1.00 0.00 ? 77  VAL A O    3  
ATOM 4673  C CB   . VAL A 1 77  ? -5.066  -8.407  -3.389  1.00 0.00 ? 77  VAL A CB   3  
ATOM 4674  C CG1  . VAL A 1 77  ? -3.970  -9.461  -3.421  1.00 0.00 ? 77  VAL A CG1  3  
ATOM 4675  C CG2  . VAL A 1 77  ? -4.470  -7.008  -3.358  1.00 0.00 ? 77  VAL A CG2  3  
ATOM 4676  H H    . VAL A 1 77  ? -7.544  -7.377  -3.760  1.00 0.00 ? 77  VAL A H    3  
ATOM 4677  H HA   . VAL A 1 77  ? -5.424  -8.437  -5.499  1.00 0.00 ? 77  VAL A HA   3  
ATOM 4678  H HB   . VAL A 1 77  ? -5.645  -8.548  -2.488  1.00 0.00 ? 77  VAL A HB   3  
ATOM 4679  H HG11 . VAL A 1 77  ? -4.219  -10.216 -4.153  1.00 0.00 ? 77  VAL A HG11 3  
ATOM 4680  H HG12 . VAL A 1 77  ? -3.031  -8.997  -3.686  1.00 0.00 ? 77  VAL A HG12 3  
ATOM 4681  H HG13 . VAL A 1 77  ? -3.883  -9.920  -2.447  1.00 0.00 ? 77  VAL A HG13 3  
ATOM 4682  H HG21 . VAL A 1 77  ? -4.772  -6.468  -4.244  1.00 0.00 ? 77  VAL A HG21 3  
ATOM 4683  H HG22 . VAL A 1 77  ? -4.822  -6.486  -2.481  1.00 0.00 ? 77  VAL A HG22 3  
ATOM 4684  H HG23 . VAL A 1 77  ? -3.392  -7.075  -3.328  1.00 0.00 ? 77  VAL A HG23 3  
ATOM 4685  N N    . GLU A 1 78  ? -6.323  -10.731 -5.644  1.00 0.00 ? 78  GLU A N    3  
ATOM 4686  C CA   . GLU A 1 78  ? -6.827  -12.094 -5.756  1.00 0.00 ? 78  GLU A CA   3  
ATOM 4687  C C    . GLU A 1 78  ? -5.682  -13.085 -5.939  1.00 0.00 ? 78  GLU A C    3  
ATOM 4688  O O    . GLU A 1 78  ? -4.510  -12.713 -5.881  1.00 0.00 ? 78  GLU A O    3  
ATOM 4689  C CB   . GLU A 1 78  ? -7.805  -12.205 -6.928  1.00 0.00 ? 78  GLU A CB   3  
ATOM 4690  C CG   . GLU A 1 78  ? -9.065  -11.375 -6.751  1.00 0.00 ? 78  GLU A CG   3  
ATOM 4691  C CD   . GLU A 1 78  ? -10.147 -11.736 -7.750  1.00 0.00 ? 78  GLU A CD   3  
ATOM 4692  O OE1  . GLU A 1 78  ? -10.597 -12.901 -7.741  1.00 0.00 ? 78  GLU A OE1  3  
ATOM 4693  O OE2  . GLU A 1 78  ? -10.543 -10.854 -8.541  1.00 0.00 ? 78  GLU A OE2  3  
ATOM 4694  H H    . GLU A 1 78  ? -5.769  -10.365 -6.365  1.00 0.00 ? 78  GLU A H    3  
ATOM 4695  H HA   . GLU A 1 78  ? -7.349  -12.330 -4.841  1.00 0.00 ? 78  GLU A HA   3  
ATOM 4696  H HB2  . GLU A 1 78  ? -7.306  -11.879 -7.829  1.00 0.00 ? 78  GLU A HB2  3  
ATOM 4697  H HB3  . GLU A 1 78  ? -8.094  -13.240 -7.042  1.00 0.00 ? 78  GLU A HB3  3  
ATOM 4698  H HG2  . GLU A 1 78  ? -9.449  -11.534 -5.754  1.00 0.00 ? 78  GLU A HG2  3  
ATOM 4699  H HG3  . GLU A 1 78  ? -8.813  -10.332 -6.876  1.00 0.00 ? 78  GLU A HG3  3  
ATOM 4700  N N    . ASP A 1 79  ? -6.030  -14.348 -6.159  1.00 0.00 ? 79  ASP A N    3  
ATOM 4701  C CA   . ASP A 1 79  ? -5.032  -15.394 -6.351  1.00 0.00 ? 79  ASP A CA   3  
ATOM 4702  C C    . ASP A 1 79  ? -4.160  -15.548 -5.109  1.00 0.00 ? 79  ASP A C    3  
ATOM 4703  O O    . ASP A 1 79  ? -2.934  -15.624 -5.203  1.00 0.00 ? 79  ASP A O    3  
ATOM 4704  C CB   . ASP A 1 79  ? -4.158  -15.078 -7.567  1.00 0.00 ? 79  ASP A CB   3  
ATOM 4705  C CG   . ASP A 1 79  ? -4.845  -15.413 -8.876  1.00 0.00 ? 79  ASP A CG   3  
ATOM 4706  O OD1  . ASP A 1 79  ? -6.011  -15.006 -9.055  1.00 0.00 ? 79  ASP A OD1  3  
ATOM 4707  O OD2  . ASP A 1 79  ? -4.216  -16.083 -9.722  1.00 0.00 ? 79  ASP A OD2  3  
ATOM 4708  H H    . ASP A 1 79  ? -6.981  -14.583 -6.195  1.00 0.00 ? 79  ASP A H    3  
ATOM 4709  H HA   . ASP A 1 79  ? -5.554  -16.322 -6.527  1.00 0.00 ? 79  ASP A HA   3  
ATOM 4710  H HB2  . ASP A 1 79  ? -3.920  -14.024 -7.566  1.00 0.00 ? 79  ASP A HB2  3  
ATOM 4711  H HB3  . ASP A 1 79  ? -3.244  -15.650 -7.503  1.00 0.00 ? 79  ASP A HB3  3  
ATOM 4712  N N    . LEU A 1 80  ? -4.800  -15.592 -3.946  1.00 0.00 ? 80  LEU A N    3  
ATOM 4713  C CA   . LEU A 1 80  ? -4.083  -15.736 -2.683  1.00 0.00 ? 80  LEU A CA   3  
ATOM 4714  C C    . LEU A 1 80  ? -4.269  -17.137 -2.108  1.00 0.00 ? 80  LEU A C    3  
ATOM 4715  O O    . LEU A 1 80  ? -4.996  -17.958 -2.668  1.00 0.00 ? 80  LEU A O    3  
ATOM 4716  C CB   . LEU A 1 80  ? -4.567  -14.691 -1.677  1.00 0.00 ? 80  LEU A CB   3  
ATOM 4717  C CG   . LEU A 1 80  ? -4.473  -13.232 -2.127  1.00 0.00 ? 80  LEU A CG   3  
ATOM 4718  C CD1  . LEU A 1 80  ? -5.516  -12.386 -1.414  1.00 0.00 ? 80  LEU A CD1  3  
ATOM 4719  C CD2  . LEU A 1 80  ? -3.076  -12.685 -1.875  1.00 0.00 ? 80  LEU A CD2  3  
ATOM 4720  H H    . LEU A 1 80  ? -5.777  -15.527 -3.934  1.00 0.00 ? 80  LEU A H    3  
ATOM 4721  H HA   . LEU A 1 80  ? -3.033  -15.577 -2.879  1.00 0.00 ? 80  LEU A HA   3  
ATOM 4722  H HB2  . LEU A 1 80  ? -5.601  -14.902 -1.453  1.00 0.00 ? 80  LEU A HB2  3  
ATOM 4723  H HB3  . LEU A 1 80  ? -3.976  -14.799 -0.779  1.00 0.00 ? 80  LEU A HB3  3  
ATOM 4724  H HG   . LEU A 1 80  ? -4.668  -13.177 -3.189  1.00 0.00 ? 80  LEU A HG   3  
ATOM 4725  H HD11 . LEU A 1 80  ? -5.731  -11.507 -2.004  1.00 0.00 ? 80  LEU A HD11 3  
ATOM 4726  H HD12 . LEU A 1 80  ? -5.138  -12.088 -0.448  1.00 0.00 ? 80  LEU A HD12 3  
ATOM 4727  H HD13 . LEU A 1 80  ? -6.420  -12.963 -1.285  1.00 0.00 ? 80  LEU A HD13 3  
ATOM 4728  H HD21 . LEU A 1 80  ? -3.058  -12.167 -0.928  1.00 0.00 ? 80  LEU A HD21 3  
ATOM 4729  H HD22 . LEU A 1 80  ? -2.810  -11.999 -2.666  1.00 0.00 ? 80  LEU A HD22 3  
ATOM 4730  H HD23 . LEU A 1 80  ? -2.368  -13.501 -1.853  1.00 0.00 ? 80  LEU A HD23 3  
ATOM 4731  N N    . LEU A 1 81  ? -3.609  -17.402 -0.986  1.00 0.00 ? 81  LEU A N    3  
ATOM 4732  C CA   . LEU A 1 81  ? -3.704  -18.703 -0.332  1.00 0.00 ? 81  LEU A CA   3  
ATOM 4733  C C    . LEU A 1 81  ? -4.634  -18.639 0.875   1.00 0.00 ? 81  LEU A C    3  
ATOM 4734  O O    . LEU A 1 81  ? -4.631  -17.677 1.643   1.00 0.00 ? 81  LEU A O    3  
ATOM 4735  C CB   . LEU A 1 81  ? -2.317  -19.178 0.103   1.00 0.00 ? 81  LEU A CB   3  
ATOM 4736  C CG   . LEU A 1 81  ? -1.469  -19.852 -0.976  1.00 0.00 ? 81  LEU A CG   3  
ATOM 4737  C CD1  . LEU A 1 81  ? -0.033  -20.015 -0.502  1.00 0.00 ? 81  LEU A CD1  3  
ATOM 4738  C CD2  . LEU A 1 81  ? -2.063  -21.200 -1.357  1.00 0.00 ? 81  LEU A CD2  3  
ATOM 4739  H H    . LEU A 1 81  ? -3.046  -16.707 -0.586  1.00 0.00 ? 81  LEU A H    3  
ATOM 4740  H HA   . LEU A 1 81  ? -4.108  -19.404 -1.047  1.00 0.00 ? 81  LEU A HA   3  
ATOM 4741  H HB2  . LEU A 1 81  ? -1.771  -18.320 0.464   1.00 0.00 ? 81  LEU A HB2  3  
ATOM 4742  H HB3  . LEU A 1 81  ? -2.448  -19.885 0.911   1.00 0.00 ? 81  LEU A HB3  3  
ATOM 4743  H HG   . LEU A 1 81  ? -1.459  -19.228 -1.859  1.00 0.00 ? 81  LEU A HG   3  
ATOM 4744  H HD11 . LEU A 1 81  ? 0.005   -20.750 0.287   1.00 0.00 ? 81  LEU A HD11 3  
ATOM 4745  H HD12 . LEU A 1 81  ? 0.334   -19.069 -0.132  1.00 0.00 ? 81  LEU A HD12 3  
ATOM 4746  H HD13 . LEU A 1 81  ? 0.584   -20.340 -1.328  1.00 0.00 ? 81  LEU A HD13 3  
ATOM 4747  H HD21 . LEU A 1 81  ? -1.938  -21.893 -0.538  1.00 0.00 ? 81  LEU A HD21 3  
ATOM 4748  H HD22 . LEU A 1 81  ? -1.558  -21.581 -2.232  1.00 0.00 ? 81  LEU A HD22 3  
ATOM 4749  H HD23 . LEU A 1 81  ? -3.115  -21.082 -1.572  1.00 0.00 ? 81  LEU A HD23 3  
ATOM 4750  N N    . PRO A 1 82  ? -5.450  -19.690 1.050   1.00 0.00 ? 82  PRO A N    3  
ATOM 4751  C CA   . PRO A 1 82  ? -6.399  -19.779 2.163   1.00 0.00 ? 82  PRO A CA   3  
ATOM 4752  C C    . PRO A 1 82  ? -5.701  -19.973 3.505   1.00 0.00 ? 82  PRO A C    3  
ATOM 4753  O O    . PRO A 1 82  ? -4.655  -20.615 3.585   1.00 0.00 ? 82  PRO A O    3  
ATOM 4754  C CB   . PRO A 1 82  ? -7.240  -21.010 1.815   1.00 0.00 ? 82  PRO A CB   3  
ATOM 4755  C CG   . PRO A 1 82  ? -6.355  -21.841 0.951   1.00 0.00 ? 82  PRO A CG   3  
ATOM 4756  C CD   . PRO A 1 82  ? -5.507  -20.872 0.174   1.00 0.00 ? 82  PRO A CD   3  
ATOM 4757  H HA   . PRO A 1 82  ? -7.035  -18.908 2.212   1.00 0.00 ? 82  PRO A HA   3  
ATOM 4758  H HB2  . PRO A 1 82  ? -7.511  -21.532 2.722   1.00 0.00 ? 82  PRO A HB2  3  
ATOM 4759  H HB3  . PRO A 1 82  ? -8.131  -20.704 1.289   1.00 0.00 ? 82  PRO A HB3  3  
ATOM 4760  H HG2  . PRO A 1 82  ? -5.734  -22.475 1.564   1.00 0.00 ? 82  PRO A HG2  3  
ATOM 4761  H HG3  . PRO A 1 82  ? -6.955  -22.437 0.279   1.00 0.00 ? 82  PRO A HG3  3  
ATOM 4762  H HD2  . PRO A 1 82  ? -4.521  -21.280 0.011   1.00 0.00 ? 82  PRO A HD2  3  
ATOM 4763  H HD3  . PRO A 1 82  ? -5.978  -20.630 -0.768  1.00 0.00 ? 82  PRO A HD3  3  
ATOM 4764  N N    . ASN A 1 83  ? -6.288  -19.413 4.558   1.00 0.00 ? 83  ASN A N    3  
ATOM 4765  C CA   . ASN A 1 83  ? -5.722  -19.525 5.898   1.00 0.00 ? 83  ASN A CA   3  
ATOM 4766  C C    . ASN A 1 83  ? -4.236  -19.178 5.891   1.00 0.00 ? 83  ASN A C    3  
ATOM 4767  O O    . ASN A 1 83  ? -3.415  -19.907 6.447   1.00 0.00 ? 83  ASN A O    3  
ATOM 4768  C CB   . ASN A 1 83  ? -5.924  -20.940 6.443   1.00 0.00 ? 83  ASN A CB   3  
ATOM 4769  C CG   . ASN A 1 83  ? -7.370  -21.217 6.809   1.00 0.00 ? 83  ASN A CG   3  
ATOM 4770  O OD1  . ASN A 1 83  ? -7.665  -21.682 7.910   1.00 0.00 ? 83  ASN A OD1  3  
ATOM 4771  N ND2  . ASN A 1 83  ? -8.279  -20.933 5.883   1.00 0.00 ? 83  ASN A ND2  3  
ATOM 4772  H H    . ASN A 1 83  ? -7.121  -18.913 4.432   1.00 0.00 ? 83  ASN A H    3  
ATOM 4773  H HA   . ASN A 1 83  ? -6.240  -18.825 6.536   1.00 0.00 ? 83  ASN A HA   3  
ATOM 4774  H HB2  . ASN A 1 83  ? -5.619  -21.655 5.693   1.00 0.00 ? 83  ASN A HB2  3  
ATOM 4775  H HB3  . ASN A 1 83  ? -5.317  -21.069 7.326   1.00 0.00 ? 83  ASN A HB3  3  
ATOM 4776  H HD21 . ASN A 1 83  ? -7.971  -20.566 5.029   1.00 0.00 ? 83  ASN A HD21 3  
ATOM 4777  H HD22 . ASN A 1 83  ? -9.221  -21.102 6.094   1.00 0.00 ? 83  ASN A HD22 3  
ATOM 4778  N N    . HIS A 1 84  ? -3.898  -18.059 5.258   1.00 0.00 ? 84  HIS A N    3  
ATOM 4779  C CA   . HIS A 1 84  ? -2.511  -17.614 5.180   1.00 0.00 ? 84  HIS A CA   3  
ATOM 4780  C C    . HIS A 1 84  ? -2.416  -16.100 5.347   1.00 0.00 ? 84  HIS A C    3  
ATOM 4781  O O    . HIS A 1 84  ? -3.083  -15.345 4.640   1.00 0.00 ? 84  HIS A O    3  
ATOM 4782  C CB   . HIS A 1 84  ? -1.894  -18.031 3.845   1.00 0.00 ? 84  HIS A CB   3  
ATOM 4783  C CG   . HIS A 1 84  ? -1.347  -19.426 3.848   1.00 0.00 ? 84  HIS A CG   3  
ATOM 4784  N ND1  . HIS A 1 84  ? -2.130  -20.542 3.641   1.00 0.00 ? 84  HIS A ND1  3  
ATOM 4785  C CD2  . HIS A 1 84  ? -0.086  -19.881 4.033   1.00 0.00 ? 84  HIS A CD2  3  
ATOM 4786  C CE1  . HIS A 1 84  ? -1.374  -21.624 3.700   1.00 0.00 ? 84  HIS A CE1  3  
ATOM 4787  N NE2  . HIS A 1 84  ? -0.130  -21.250 3.937   1.00 0.00 ? 84  HIS A NE2  3  
ATOM 4788  H H    . HIS A 1 84  ? -4.598  -17.520 4.834   1.00 0.00 ? 84  HIS A H    3  
ATOM 4789  H HA   . HIS A 1 84  ? -1.966  -18.087 5.983   1.00 0.00 ? 84  HIS A HA   3  
ATOM 4790  H HB2  . HIS A 1 84  ? -2.648  -17.973 3.074   1.00 0.00 ? 84  HIS A HB2  3  
ATOM 4791  H HB3  . HIS A 1 84  ? -1.085  -17.357 3.603   1.00 0.00 ? 84  HIS A HB3  3  
ATOM 4792  H HD2  . HIS A 1 84  ? 0.793   -19.280 4.222   1.00 0.00 ? 84  HIS A HD2  3  
ATOM 4793  H HE1  . HIS A 1 84  ? -1.715  -22.641 3.576   1.00 0.00 ? 84  HIS A HE1  3  
ATOM 4794  H HE2  . HIS A 1 84  ? 0.618   -21.859 4.112   1.00 0.00 ? 84  HIS A HE2  3  
ATOM 4795  N N    . SER A 1 85  ? -1.583  -15.664 6.286   1.00 0.00 ? 85  SER A N    3  
ATOM 4796  C CA   . SER A 1 85  ? -1.404  -14.241 6.549   1.00 0.00 ? 85  SER A CA   3  
ATOM 4797  C C    . SER A 1 85  ? -0.601  -13.580 5.434   1.00 0.00 ? 85  SER A C    3  
ATOM 4798  O O    . SER A 1 85  ? 0.288   -14.196 4.844   1.00 0.00 ? 85  SER A O    3  
ATOM 4799  C CB   . SER A 1 85  ? -0.702  -14.033 7.892   1.00 0.00 ? 85  SER A CB   3  
ATOM 4800  O OG   . SER A 1 85  ? 0.226   -15.074 8.149   1.00 0.00 ? 85  SER A OG   3  
ATOM 4801  H H    . SER A 1 85  ? -1.079  -16.316 6.817   1.00 0.00 ? 85  SER A H    3  
ATOM 4802  H HA   . SER A 1 85  ? -2.383  -13.786 6.590   1.00 0.00 ? 85  SER A HA   3  
ATOM 4803  H HB2  . SER A 1 85  ? -0.173  -13.092 7.877   1.00 0.00 ? 85  SER A HB2  3  
ATOM 4804  H HB3  . SER A 1 85  ? -1.438  -14.020 8.682   1.00 0.00 ? 85  SER A HB3  3  
ATOM 4805  H HG   . SER A 1 85  ? 0.876   -15.105 7.444   1.00 0.00 ? 85  SER A HG   3  
ATOM 4806  N N    . TYR A 1 86  ? -0.919  -12.322 5.150   1.00 0.00 ? 86  TYR A N    3  
ATOM 4807  C CA   . TYR A 1 86  ? -0.229  -11.576 4.104   1.00 0.00 ? 86  TYR A CA   3  
ATOM 4808  C C    . TYR A 1 86  ? -0.007  -10.126 4.524   1.00 0.00 ? 86  TYR A C    3  
ATOM 4809  O O    . TYR A 1 86  ? -0.952  -9.416  4.868   1.00 0.00 ? 86  TYR A O    3  
ATOM 4810  C CB   . TYR A 1 86  ? -1.030  -11.624 2.801   1.00 0.00 ? 86  TYR A CB   3  
ATOM 4811  C CG   . TYR A 1 86  ? -0.792  -12.878 1.991   1.00 0.00 ? 86  TYR A CG   3  
ATOM 4812  C CD1  . TYR A 1 86  ? 0.305   -12.986 1.146   1.00 0.00 ? 86  TYR A CD1  3  
ATOM 4813  C CD2  . TYR A 1 86  ? -1.666  -13.956 2.071   1.00 0.00 ? 86  TYR A CD2  3  
ATOM 4814  C CE1  . TYR A 1 86  ? 0.526   -14.130 0.403   1.00 0.00 ? 86  TYR A CE1  3  
ATOM 4815  C CE2  . TYR A 1 86  ? -1.453  -15.105 1.332   1.00 0.00 ? 86  TYR A CE2  3  
ATOM 4816  C CZ   . TYR A 1 86  ? -0.356  -15.186 0.500   1.00 0.00 ? 86  TYR A CZ   3  
ATOM 4817  O OH   . TYR A 1 86  ? -0.139  -16.328 -0.237  1.00 0.00 ? 86  TYR A OH   3  
ATOM 4818  H H    . TYR A 1 86  ? -1.636  -11.884 5.655   1.00 0.00 ? 86  TYR A H    3  
ATOM 4819  H HA   . TYR A 1 86  ? 0.731   -12.043 3.942   1.00 0.00 ? 86  TYR A HA   3  
ATOM 4820  H HB2  . TYR A 1 86  ? -2.083  -11.574 3.032   1.00 0.00 ? 86  TYR A HB2  3  
ATOM 4821  H HB3  . TYR A 1 86  ? -0.759  -10.777 2.189   1.00 0.00 ? 86  TYR A HB3  3  
ATOM 4822  H HD1  . TYR A 1 86  ? 0.994   -12.157 1.073   1.00 0.00 ? 86  TYR A HD1  3  
ATOM 4823  H HD2  . TYR A 1 86  ? -2.524  -13.889 2.724   1.00 0.00 ? 86  TYR A HD2  3  
ATOM 4824  H HE1  . TYR A 1 86  ? 1.385   -14.194 -0.248  1.00 0.00 ? 86  TYR A HE1  3  
ATOM 4825  H HE2  . TYR A 1 86  ? -2.143  -15.932 1.408   1.00 0.00 ? 86  TYR A HE2  3  
ATOM 4826  H HH   . TYR A 1 86  ? -0.070  -17.082 0.353   1.00 0.00 ? 86  TYR A HH   3  
ATOM 4827  N N    . VAL A 1 87  ? 1.249   -9.694  4.493   1.00 0.00 ? 87  VAL A N    3  
ATOM 4828  C CA   . VAL A 1 87  ? 1.597   -8.328  4.868   1.00 0.00 ? 87  VAL A CA   3  
ATOM 4829  C C    . VAL A 1 87  ? 1.470   -7.382  3.680   1.00 0.00 ? 87  VAL A C    3  
ATOM 4830  O O    . VAL A 1 87  ? 2.316   -7.373  2.786   1.00 0.00 ? 87  VAL A O    3  
ATOM 4831  C CB   . VAL A 1 87  ? 3.031   -8.247  5.423   1.00 0.00 ? 87  VAL A CB   3  
ATOM 4832  C CG1  . VAL A 1 87  ? 4.025   -8.815  4.421   1.00 0.00 ? 87  VAL A CG1  3  
ATOM 4833  C CG2  . VAL A 1 87  ? 3.383   -6.811  5.781   1.00 0.00 ? 87  VAL A CG2  3  
ATOM 4834  H H    . VAL A 1 87  ? 1.959   -10.307 4.209   1.00 0.00 ? 87  VAL A H    3  
ATOM 4835  H HA   . VAL A 1 87  ? 0.915   -8.011  5.644   1.00 0.00 ? 87  VAL A HA   3  
ATOM 4836  H HB   . VAL A 1 87  ? 3.082   -8.843  6.323   1.00 0.00 ? 87  VAL A HB   3  
ATOM 4837  H HG11 . VAL A 1 87  ? 3.490   -9.228  3.579   1.00 0.00 ? 87  VAL A HG11 3  
ATOM 4838  H HG12 . VAL A 1 87  ? 4.682   -8.028  4.081   1.00 0.00 ? 87  VAL A HG12 3  
ATOM 4839  H HG13 . VAL A 1 87  ? 4.608   -9.592  4.893   1.00 0.00 ? 87  VAL A HG13 3  
ATOM 4840  H HG21 . VAL A 1 87  ? 2.680   -6.140  5.311   1.00 0.00 ? 87  VAL A HG21 3  
ATOM 4841  H HG22 . VAL A 1 87  ? 3.339   -6.687  6.853   1.00 0.00 ? 87  VAL A HG22 3  
ATOM 4842  H HG23 . VAL A 1 87  ? 4.382   -6.587  5.434   1.00 0.00 ? 87  VAL A HG23 3  
ATOM 4843  N N    . PHE A 1 88  ? 0.406   -6.586  3.676   1.00 0.00 ? 88  PHE A N    3  
ATOM 4844  C CA   . PHE A 1 88  ? 0.166   -5.635  2.597   1.00 0.00 ? 88  PHE A CA   3  
ATOM 4845  C C    . PHE A 1 88  ? 0.783   -4.277  2.921   1.00 0.00 ? 88  PHE A C    3  
ATOM 4846  O O    . PHE A 1 88  ? 0.403   -3.627  3.895   1.00 0.00 ? 88  PHE A O    3  
ATOM 4847  C CB   . PHE A 1 88  ? -1.336  -5.479  2.350   1.00 0.00 ? 88  PHE A CB   3  
ATOM 4848  C CG   . PHE A 1 88  ? -1.950  -6.647  1.634   1.00 0.00 ? 88  PHE A CG   3  
ATOM 4849  C CD1  . PHE A 1 88  ? -2.272  -7.807  2.321   1.00 0.00 ? 88  PHE A CD1  3  
ATOM 4850  C CD2  . PHE A 1 88  ? -2.206  -6.587  0.273   1.00 0.00 ? 88  PHE A CD2  3  
ATOM 4851  C CE1  . PHE A 1 88  ? -2.836  -8.884  1.664   1.00 0.00 ? 88  PHE A CE1  3  
ATOM 4852  C CE2  . PHE A 1 88  ? -2.771  -7.660  -0.389  1.00 0.00 ? 88  PHE A CE2  3  
ATOM 4853  C CZ   . PHE A 1 88  ? -3.087  -8.810  0.308   1.00 0.00 ? 88  PHE A CZ   3  
ATOM 4854  H H    . PHE A 1 88  ? -0.234  -6.639  4.417   1.00 0.00 ? 88  PHE A H    3  
ATOM 4855  H HA   . PHE A 1 88  ? 0.631   -6.024  1.704   1.00 0.00 ? 88  PHE A HA   3  
ATOM 4856  H HB2  . PHE A 1 88  ? -1.840  -5.369  3.298   1.00 0.00 ? 88  PHE A HB2  3  
ATOM 4857  H HB3  . PHE A 1 88  ? -1.505  -4.595  1.753   1.00 0.00 ? 88  PHE A HB3  3  
ATOM 4858  H HD1  . PHE A 1 88  ? -2.077  -7.865  3.382   1.00 0.00 ? 88  PHE A HD1  3  
ATOM 4859  H HD2  . PHE A 1 88  ? -1.959  -5.687  -0.273  1.00 0.00 ? 88  PHE A HD2  3  
ATOM 4860  H HE1  . PHE A 1 88  ? -3.083  -9.781  2.211   1.00 0.00 ? 88  PHE A HE1  3  
ATOM 4861  H HE2  . PHE A 1 88  ? -2.965  -7.599  -1.449  1.00 0.00 ? 88  PHE A HE2  3  
ATOM 4862  H HZ   . PHE A 1 88  ? -3.528  -9.650  -0.207  1.00 0.00 ? 88  PHE A HZ   3  
ATOM 4863  N N    . ARG A 1 89  ? 1.738   -3.856  2.098   1.00 0.00 ? 89  ARG A N    3  
ATOM 4864  C CA   . ARG A 1 89  ? 2.410   -2.578  2.297   1.00 0.00 ? 89  ARG A CA   3  
ATOM 4865  C C    . ARG A 1 89  ? 2.107   -1.620  1.148   1.00 0.00 ? 89  ARG A C    3  
ATOM 4866  O O    . ARG A 1 89  ? 2.710   -1.706  0.079   1.00 0.00 ? 89  ARG A O    3  
ATOM 4867  C CB   . ARG A 1 89  ? 3.920   -2.784  2.418   1.00 0.00 ? 89  ARG A CB   3  
ATOM 4868  C CG   . ARG A 1 89  ? 4.338   -3.482  3.703   1.00 0.00 ? 89  ARG A CG   3  
ATOM 4869  C CD   . ARG A 1 89  ? 5.825   -3.310  3.971   1.00 0.00 ? 89  ARG A CD   3  
ATOM 4870  N NE   . ARG A 1 89  ? 6.359   -4.386  4.802   1.00 0.00 ? 89  ARG A NE   3  
ATOM 4871  C CZ   . ARG A 1 89  ? 7.649   -4.700  4.859   1.00 0.00 ? 89  ARG A CZ   3  
ATOM 4872  N NH1  . ARG A 1 89  ? 8.532   -4.023  4.138   1.00 0.00 ? 89  ARG A NH1  3  
ATOM 4873  N NH2  . ARG A 1 89  ? 8.057   -5.692  5.640   1.00 0.00 ? 89  ARG A NH2  3  
ATOM 4874  H H    . ARG A 1 89  ? 1.997   -4.419  1.338   1.00 0.00 ? 89  ARG A H    3  
ATOM 4875  H HA   . ARG A 1 89  ? 2.039   -2.148  3.216   1.00 0.00 ? 89  ARG A HA   3  
ATOM 4876  H HB2  . ARG A 1 89  ? 4.259   -3.381  1.584   1.00 0.00 ? 89  ARG A HB2  3  
ATOM 4877  H HB3  . ARG A 1 89  ? 4.407   -1.822  2.382   1.00 0.00 ? 89  ARG A HB3  3  
ATOM 4878  H HG2  . ARG A 1 89  ? 3.784   -3.059  4.528   1.00 0.00 ? 89  ARG A HG2  3  
ATOM 4879  H HG3  . ARG A 1 89  ? 4.115   -4.535  3.618   1.00 0.00 ? 89  ARG A HG3  3  
ATOM 4880  H HD2  . ARG A 1 89  ? 6.350   -3.304  3.027   1.00 0.00 ? 89  ARG A HD2  3  
ATOM 4881  H HD3  . ARG A 1 89  ? 5.980   -2.368  4.475   1.00 0.00 ? 89  ARG A HD3  3  
ATOM 4882  H HE   . ARG A 1 89  ? 5.724   -4.899  5.344   1.00 0.00 ? 89  ARG A HE   3  
ATOM 4883  H HH11 . ARG A 1 89  ? 8.226   -3.274  3.550   1.00 0.00 ? 89  ARG A HH11 3  
ATOM 4884  H HH12 . ARG A 1 89  ? 9.502   -4.260  4.184   1.00 0.00 ? 89  ARG A HH12 3  
ATOM 4885  H HH21 . ARG A 1 89  ? 7.395   -6.204  6.185   1.00 0.00 ? 89  ARG A HH21 3  
ATOM 4886  H HH22 . ARG A 1 89  ? 9.028   -5.927  5.682   1.00 0.00 ? 89  ARG A HH22 3  
ATOM 4887  N N    . VAL A 1 90  ? 1.169   -0.706  1.378   1.00 0.00 ? 90  VAL A N    3  
ATOM 4888  C CA   . VAL A 1 90  ? 0.786   0.268   0.363   1.00 0.00 ? 90  VAL A CA   3  
ATOM 4889  C C    . VAL A 1 90  ? 1.742   1.456   0.354   1.00 0.00 ? 90  VAL A C    3  
ATOM 4890  O O    . VAL A 1 90  ? 2.051   2.025   1.401   1.00 0.00 ? 90  VAL A O    3  
ATOM 4891  C CB   . VAL A 1 90  ? -0.649  0.780   0.589   1.00 0.00 ? 90  VAL A CB   3  
ATOM 4892  C CG1  . VAL A 1 90  ? -0.922  2.002   -0.275  1.00 0.00 ? 90  VAL A CG1  3  
ATOM 4893  C CG2  . VAL A 1 90  ? -1.658  -0.322  0.303   1.00 0.00 ? 90  VAL A CG2  3  
ATOM 4894  H H    . VAL A 1 90  ? 0.723   -0.687  2.250   1.00 0.00 ? 90  VAL A H    3  
ATOM 4895  H HA   . VAL A 1 90  ? 0.824   -0.220  -0.600  1.00 0.00 ? 90  VAL A HA   3  
ATOM 4896  H HB   . VAL A 1 90  ? -0.747  1.069   1.625   1.00 0.00 ? 90  VAL A HB   3  
ATOM 4897  H HG11 . VAL A 1 90  ? -1.987  2.105   -0.424  1.00 0.00 ? 90  VAL A HG11 3  
ATOM 4898  H HG12 . VAL A 1 90  ? -0.539  2.884   0.217   1.00 0.00 ? 90  VAL A HG12 3  
ATOM 4899  H HG13 . VAL A 1 90  ? -0.435  1.883   -1.231  1.00 0.00 ? 90  VAL A HG13 3  
ATOM 4900  H HG21 . VAL A 1 90  ? -1.551  -0.653  -0.719  1.00 0.00 ? 90  VAL A HG21 3  
ATOM 4901  H HG22 . VAL A 1 90  ? -1.483  -1.152  0.971   1.00 0.00 ? 90  VAL A HG22 3  
ATOM 4902  H HG23 . VAL A 1 90  ? -2.659  0.057   0.455   1.00 0.00 ? 90  VAL A HG23 3  
ATOM 4903  N N    . ARG A 1 91  ? 2.207   1.825   -0.835  1.00 0.00 ? 91  ARG A N    3  
ATOM 4904  C CA   . ARG A 1 91  ? 3.129   2.945   -0.981  1.00 0.00 ? 91  ARG A CA   3  
ATOM 4905  C C    . ARG A 1 91  ? 2.688   3.868   -2.114  1.00 0.00 ? 91  ARG A C    3  
ATOM 4906  O O    . ARG A 1 91  ? 1.928   3.466   -2.994  1.00 0.00 ? 91  ARG A O    3  
ATOM 4907  C CB   . ARG A 1 91  ? 4.547   2.435   -1.247  1.00 0.00 ? 91  ARG A CB   3  
ATOM 4908  C CG   . ARG A 1 91  ? 5.584   3.542   -1.341  1.00 0.00 ? 91  ARG A CG   3  
ATOM 4909  C CD   . ARG A 1 91  ? 6.962   2.987   -1.670  1.00 0.00 ? 91  ARG A CD   3  
ATOM 4910  N NE   . ARG A 1 91  ? 8.030   3.804   -1.101  1.00 0.00 ? 91  ARG A NE   3  
ATOM 4911  C CZ   . ARG A 1 91  ? 9.276   3.372   -0.935  1.00 0.00 ? 91  ARG A CZ   3  
ATOM 4912  N NH1  . ARG A 1 91  ? 9.607   2.140   -1.294  1.00 0.00 ? 91  ARG A NH1  3  
ATOM 4913  N NH2  . ARG A 1 91  ? 10.193  4.175   -0.411  1.00 0.00 ? 91  ARG A NH2  3  
ATOM 4914  H H    . ARG A 1 91  ? 1.924   1.331   -1.634  1.00 0.00 ? 91  ARG A H    3  
ATOM 4915  H HA   . ARG A 1 91  ? 3.124   3.502   -0.056  1.00 0.00 ? 91  ARG A HA   3  
ATOM 4916  H HB2  . ARG A 1 91  ? 4.834   1.770   -0.445  1.00 0.00 ? 91  ARG A HB2  3  
ATOM 4917  H HB3  . ARG A 1 91  ? 4.551   1.887   -2.177  1.00 0.00 ? 91  ARG A HB3  3  
ATOM 4918  H HG2  . ARG A 1 91  ? 5.291   4.232   -2.118  1.00 0.00 ? 91  ARG A HG2  3  
ATOM 4919  H HG3  . ARG A 1 91  ? 5.631   4.060   -0.395  1.00 0.00 ? 91  ARG A HG3  3  
ATOM 4920  H HD2  . ARG A 1 91  ? 7.036   1.986   -1.273  1.00 0.00 ? 91  ARG A HD2  3  
ATOM 4921  H HD3  . ARG A 1 91  ? 7.076   2.958   -2.743  1.00 0.00 ? 91  ARG A HD3  3  
ATOM 4922  H HE   . ARG A 1 91  ? 7.807   4.718   -0.829  1.00 0.00 ? 91  ARG A HE   3  
ATOM 4923  H HH11 . ARG A 1 91  ? 8.919   1.533   -1.691  1.00 0.00 ? 91  ARG A HH11 3  
ATOM 4924  H HH12 . ARG A 1 91  ? 10.546  1.818   -1.169  1.00 0.00 ? 91  ARG A HH12 3  
ATOM 4925  H HH21 . ARG A 1 91  ? 9.947   5.105   -0.139  1.00 0.00 ? 91  ARG A HH21 3  
ATOM 4926  H HH22 . ARG A 1 91  ? 11.130  3.850   -0.286  1.00 0.00 ? 91  ARG A HH22 3  
ATOM 4927  N N    . ALA A 1 92  ? 3.171   5.106   -2.083  1.00 0.00 ? 92  ALA A N    3  
ATOM 4928  C CA   . ALA A 1 92  ? 2.828   6.085   -3.107  1.00 0.00 ? 92  ALA A CA   3  
ATOM 4929  C C    . ALA A 1 92  ? 4.066   6.525   -3.881  1.00 0.00 ? 92  ALA A C    3  
ATOM 4930  O O    . ALA A 1 92  ? 5.193   6.343   -3.422  1.00 0.00 ? 92  ALA A O    3  
ATOM 4931  C CB   . ALA A 1 92  ? 2.141   7.287   -2.478  1.00 0.00 ? 92  ALA A CB   3  
ATOM 4932  H H    . ALA A 1 92  ? 3.773   5.366   -1.355  1.00 0.00 ? 92  ALA A H    3  
ATOM 4933  H HA   . ALA A 1 92  ? 2.134   5.621   -3.793  1.00 0.00 ? 92  ALA A HA   3  
ATOM 4934  H HB1  . ALA A 1 92  ? 2.749   8.167   -2.625  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 4935  H HB2  . ALA A 1 92  ? 1.177   7.434   -2.944  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 4936  H HB3  . ALA A 1 92  ? 2.007   7.113   -1.421  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 4937  N N    . GLN A 1 93  ? 3.848   7.105   -5.057  1.00 0.00 ? 93  GLN A N    3  
ATOM 4938  C CA   . GLN A 1 93  ? 4.947   7.570   -5.895  1.00 0.00 ? 93  GLN A CA   3  
ATOM 4939  C C    . GLN A 1 93  ? 4.644   8.947   -6.475  1.00 0.00 ? 93  GLN A C    3  
ATOM 4940  O O    . GLN A 1 93  ? 3.585   9.164   -7.065  1.00 0.00 ? 93  GLN A O    3  
ATOM 4941  C CB   . GLN A 1 93  ? 5.211   6.574   -7.025  1.00 0.00 ? 93  GLN A CB   3  
ATOM 4942  C CG   . GLN A 1 93  ? 6.253   7.051   -8.025  1.00 0.00 ? 93  GLN A CG   3  
ATOM 4943  C CD   . GLN A 1 93  ? 6.088   6.411   -9.389  1.00 0.00 ? 93  GLN A CD   3  
ATOM 4944  O OE1  . GLN A 1 93  ? 5.306   6.880   -10.217 1.00 0.00 ? 93  GLN A OE1  3  
ATOM 4945  N NE2  . GLN A 1 93  ? 6.825   5.333   -9.631  1.00 0.00 ? 93  GLN A NE2  3  
ATOM 4946  H H    . GLN A 1 93  ? 2.927   7.222   -5.369  1.00 0.00 ? 93  GLN A H    3  
ATOM 4947  H HA   . GLN A 1 93  ? 5.828   7.640   -5.276  1.00 0.00 ? 93  GLN A HA   3  
ATOM 4948  H HB2  . GLN A 1 93  ? 5.554   5.644   -6.597  1.00 0.00 ? 93  GLN A HB2  3  
ATOM 4949  H HB3  . GLN A 1 93  ? 4.288   6.398   -7.557  1.00 0.00 ? 93  GLN A HB3  3  
ATOM 4950  H HG2  . GLN A 1 93  ? 6.165   8.121   -8.134  1.00 0.00 ? 93  GLN A HG2  3  
ATOM 4951  H HG3  . GLN A 1 93  ? 7.234   6.808   -7.646  1.00 0.00 ? 93  GLN A HG3  3  
ATOM 4952  H HE21 . GLN A 1 93  ? 7.425   5.015   -8.924  1.00 0.00 ? 93  GLN A HE21 3  
ATOM 4953  H HE22 . GLN A 1 93  ? 6.738   4.899   -10.504 1.00 0.00 ? 93  GLN A HE22 3  
ATOM 4954  N N    . SER A 1 94  ? 5.579   9.875   -6.304  1.00 0.00 ? 94  SER A N    3  
ATOM 4955  C CA   . SER A 1 94  ? 5.411   11.234  -6.807  1.00 0.00 ? 94  SER A CA   3  
ATOM 4956  C C    . SER A 1 94  ? 6.591   11.638  -7.685  1.00 0.00 ? 94  SER A C    3  
ATOM 4957  O O    . SER A 1 94  ? 7.618   10.962  -7.711  1.00 0.00 ? 94  SER A O    3  
ATOM 4958  C CB   . SER A 1 94  ? 5.264   12.217  -5.644  1.00 0.00 ? 94  SER A CB   3  
ATOM 4959  O OG   . SER A 1 94  ? 6.510   12.442  -5.007  1.00 0.00 ? 94  SER A OG   3  
ATOM 4960  H H    . SER A 1 94  ? 6.402   9.642   -5.824  1.00 0.00 ? 94  SER A H    3  
ATOM 4961  H HA   . SER A 1 94  ? 4.510   11.257  -7.402  1.00 0.00 ? 94  SER A HA   3  
ATOM 4962  H HB2  . SER A 1 94  ? 4.889   13.158  -6.016  1.00 0.00 ? 94  SER A HB2  3  
ATOM 4963  H HB3  . SER A 1 94  ? 4.571   11.813  -4.920  1.00 0.00 ? 94  SER A HB3  3  
ATOM 4964  H HG   . SER A 1 94  ? 6.934   11.599  -4.825  1.00 0.00 ? 94  SER A HG   3  
ATOM 4965  N N    . GLN A 1 95  ? 6.435   12.747  -8.401  1.00 0.00 ? 95  GLN A N    3  
ATOM 4966  C CA   . GLN A 1 95  ? 7.487   13.242  -9.281  1.00 0.00 ? 95  GLN A CA   3  
ATOM 4967  C C    . GLN A 1 95  ? 8.863   13.025  -8.659  1.00 0.00 ? 95  GLN A C    3  
ATOM 4968  O O    . GLN A 1 95  ? 9.800   12.605  -9.337  1.00 0.00 ? 95  GLN A O    3  
ATOM 4969  C CB   . GLN A 1 95  ? 7.277   14.728  -9.576  1.00 0.00 ? 95  GLN A CB   3  
ATOM 4970  C CG   . GLN A 1 95  ? 8.165   15.259  -10.689 1.00 0.00 ? 95  GLN A CG   3  
ATOM 4971  C CD   . GLN A 1 95  ? 8.042   14.455  -11.968 1.00 0.00 ? 95  GLN A CD   3  
ATOM 4972  O OE1  . GLN A 1 95  ? 9.035   13.961  -12.504 1.00 0.00 ? 95  GLN A OE1  3  
ATOM 4973  N NE2  . GLN A 1 95  ? 6.818   14.317  -12.466 1.00 0.00 ? 95  GLN A NE2  3  
ATOM 4974  H H    . GLN A 1 95  ? 5.593   13.243  -8.337  1.00 0.00 ? 95  GLN A H    3  
ATOM 4975  H HA   . GLN A 1 95  ? 7.432   12.689  -10.206 1.00 0.00 ? 95  GLN A HA   3  
ATOM 4976  H HB2  . GLN A 1 95  ? 6.247   14.884  -9.861  1.00 0.00 ? 95  GLN A HB2  3  
ATOM 4977  H HB3  . GLN A 1 95  ? 7.483   15.294  -8.680  1.00 0.00 ? 95  GLN A HB3  3  
ATOM 4978  H HG2  . GLN A 1 95  ? 7.888   16.282  -10.898 1.00 0.00 ? 95  GLN A HG2  3  
ATOM 4979  H HG3  . GLN A 1 95  ? 9.193   15.226  -10.358 1.00 0.00 ? 95  GLN A HG3  3  
ATOM 4980  H HE21 . GLN A 1 95  ? 6.074   14.739  -11.986 1.00 0.00 ? 95  GLN A HE21 3  
ATOM 4981  H HE22 . GLN A 1 95  ? 6.709   13.803  -13.292 1.00 0.00 ? 95  GLN A HE22 3  
ATOM 4982  N N    . GLU A 1 96  ? 8.976   13.314  -7.367  1.00 0.00 ? 96  GLU A N    3  
ATOM 4983  C CA   . GLU A 1 96  ? 10.238  13.151  -6.656  1.00 0.00 ? 96  GLU A CA   3  
ATOM 4984  C C    . GLU A 1 96  ? 10.657  11.684  -6.620  1.00 0.00 ? 96  GLU A C    3  
ATOM 4985  O O    . GLU A 1 96  ? 11.701  11.313  -7.154  1.00 0.00 ? 96  GLU A O    3  
ATOM 4986  C CB   . GLU A 1 96  ? 10.120  13.694  -5.230  1.00 0.00 ? 96  GLU A CB   3  
ATOM 4987  C CG   . GLU A 1 96  ? 10.327  15.196  -5.131  1.00 0.00 ? 96  GLU A CG   3  
ATOM 4988  C CD   . GLU A 1 96  ? 11.793  15.583  -5.123  1.00 0.00 ? 96  GLU A CD   3  
ATOM 4989  O OE1  . GLU A 1 96  ? 12.488  15.256  -4.139  1.00 0.00 ? 96  GLU A OE1  3  
ATOM 4990  O OE2  . GLU A 1 96  ? 12.245  16.214  -6.101  1.00 0.00 ? 96  GLU A OE2  3  
ATOM 4991  H H    . GLU A 1 96  ? 8.192   13.646  -6.881  1.00 0.00 ? 96  GLU A H    3  
ATOM 4992  H HA   . GLU A 1 96  ? 10.992  13.716  -7.184  1.00 0.00 ? 96  GLU A HA   3  
ATOM 4993  H HB2  . GLU A 1 96  ? 9.136   13.461  -4.849  1.00 0.00 ? 96  GLU A HB2  3  
ATOM 4994  H HB3  . GLU A 1 96  ? 10.859  13.208  -4.611  1.00 0.00 ? 96  GLU A HB3  3  
ATOM 4995  H HG2  . GLU A 1 96  ? 9.850   15.669  -5.977  1.00 0.00 ? 96  GLU A HG2  3  
ATOM 4996  H HG3  . GLU A 1 96  ? 9.871   15.550  -4.218  1.00 0.00 ? 96  GLU A HG3  3  
ATOM 4997  N N    . GLY A 1 97  ? 9.834   10.855  -5.986  1.00 0.00 ? 97  GLY A N    3  
ATOM 4998  C CA   . GLY A 1 97  ? 10.136  9.439   -5.891  1.00 0.00 ? 97  GLY A CA   3  
ATOM 4999  C C    . GLY A 1 97  ? 9.195   8.707   -4.954  1.00 0.00 ? 97  GLY A C    3  
ATOM 5000  O O    . GLY A 1 97  ? 8.208   9.275   -4.487  1.00 0.00 ? 97  GLY A O    3  
ATOM 5001  H H    . GLY A 1 97  ? 9.015   11.208  -5.578  1.00 0.00 ? 97  GLY A H    3  
ATOM 5002  H HA2  . GLY A 1 97  ? 10.061  8.999   -6.874  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 5003  H HA3  . GLY A 1 97  ? 11.147  9.321   -5.531  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 5004  N N    . TRP A 1 98  ? 9.501   7.444   -4.679  1.00 0.00 ? 98  TRP A N    3  
ATOM 5005  C CA   . TRP A 1 98  ? 8.674   6.633   -3.793  1.00 0.00 ? 98  TRP A CA   3  
ATOM 5006  C C    . TRP A 1 98  ? 8.820   7.088   -2.345  1.00 0.00 ? 98  TRP A C    3  
ATOM 5007  O O    . TRP A 1 98  ? 9.913   7.057   -1.782  1.00 0.00 ? 98  TRP A O    3  
ATOM 5008  C CB   . TRP A 1 98  ? 9.053   5.156   -3.917  1.00 0.00 ? 98  TRP A CB   3  
ATOM 5009  C CG   . TRP A 1 98  ? 8.675   4.555   -5.237  1.00 0.00 ? 98  TRP A CG   3  
ATOM 5010  C CD1  . TRP A 1 98  ? 9.496   4.348   -6.308  1.00 0.00 ? 98  TRP A CD1  3  
ATOM 5011  C CD2  . TRP A 1 98  ? 7.380   4.086   -5.625  1.00 0.00 ? 98  TRP A CD2  3  
ATOM 5012  N NE1  . TRP A 1 98  ? 8.789   3.778   -7.339  1.00 0.00 ? 98  TRP A NE1  3  
ATOM 5013  C CE2  . TRP A 1 98  ? 7.489   3.606   -6.945  1.00 0.00 ? 98  TRP A CE2  3  
ATOM 5014  C CE3  . TRP A 1 98  ? 6.139   4.022   -4.986  1.00 0.00 ? 98  TRP A CE3  3  
ATOM 5015  C CZ2  . TRP A 1 98  ? 6.403   3.072   -7.635  1.00 0.00 ? 98  TRP A CZ2  3  
ATOM 5016  C CZ3  . TRP A 1 98  ? 5.062   3.492   -5.672  1.00 0.00 ? 98  TRP A CZ3  3  
ATOM 5017  C CH2  . TRP A 1 98  ? 5.200   3.022   -6.985  1.00 0.00 ? 98  TRP A CH2  3  
ATOM 5018  H H    . TRP A 1 98  ? 10.301  7.047   -5.083  1.00 0.00 ? 98  TRP A H    3  
ATOM 5019  H HA   . TRP A 1 98  ? 7.645   6.758   -4.095  1.00 0.00 ? 98  TRP A HA   3  
ATOM 5020  H HB2  . TRP A 1 98  ? 10.121  5.054   -3.798  1.00 0.00 ? 98  TRP A HB2  3  
ATOM 5021  H HB3  . TRP A 1 98  ? 8.553   4.597   -3.140  1.00 0.00 ? 98  TRP A HB3  3  
ATOM 5022  H HD1  . TRP A 1 98  ? 10.545  4.602   -6.329  1.00 0.00 ? 98  TRP A HD1  3  
ATOM 5023  H HE1  . TRP A 1 98  ? 9.157   3.532   -8.214  1.00 0.00 ? 98  TRP A HE1  3  
ATOM 5024  H HE3  . TRP A 1 98  ? 6.013   4.379   -3.974  1.00 0.00 ? 98  TRP A HE3  3  
ATOM 5025  H HZ2  . TRP A 1 98  ? 6.494   2.705   -8.647  1.00 0.00 ? 98  TRP A HZ2  3  
ATOM 5026  H HZ3  . TRP A 1 98  ? 4.095   3.435   -5.194  1.00 0.00 ? 98  TRP A HZ3  3  
ATOM 5027  H HH2  . TRP A 1 98  ? 4.333   2.616   -7.482  1.00 0.00 ? 98  TRP A HH2  3  
ATOM 5028  N N    . GLY A 1 99  ? 7.710   7.510   -1.747  1.00 0.00 ? 99  GLY A N    3  
ATOM 5029  C CA   . GLY A 1 99  ? 7.737   7.966   -0.369  1.00 0.00 ? 99  GLY A CA   3  
ATOM 5030  C C    . GLY A 1 99  ? 7.701   6.819   0.621   1.00 0.00 ? 99  GLY A C    3  
ATOM 5031  O O    . GLY A 1 99  ? 8.411   5.826   0.457   1.00 0.00 ? 99  GLY A O    3  
ATOM 5032  H H    . GLY A 1 99  ? 6.866   7.513   -2.245  1.00 0.00 ? 99  GLY A H    3  
ATOM 5033  H HA2  . GLY A 1 99  ? 8.638   8.539   -0.209  1.00 0.00 ? 99  GLY A HA2  3  
ATOM 5034  H HA3  . GLY A 1 99  ? 6.881   8.602   -0.196  1.00 0.00 ? 99  GLY A HA3  3  
ATOM 5035  N N    . ARG A 1 100 ? 6.874   6.955   1.653   1.00 0.00 ? 100 ARG A N    3  
ATOM 5036  C CA   . ARG A 1 100 ? 6.752   5.923   2.675   1.00 0.00 ? 100 ARG A CA   3  
ATOM 5037  C C    . ARG A 1 100 ? 5.582   4.991   2.369   1.00 0.00 ? 100 ARG A C    3  
ATOM 5038  O O    . ARG A 1 100 ? 4.846   5.200   1.406   1.00 0.00 ? 100 ARG A O    3  
ATOM 5039  C CB   . ARG A 1 100 ? 6.564   6.560   4.053   1.00 0.00 ? 100 ARG A CB   3  
ATOM 5040  C CG   . ARG A 1 100 ? 7.869   6.951   4.727   1.00 0.00 ? 100 ARG A CG   3  
ATOM 5041  C CD   . ARG A 1 100 ? 8.456   5.792   5.518   1.00 0.00 ? 100 ARG A CD   3  
ATOM 5042  N NE   . ARG A 1 100 ? 7.983   5.778   6.900   1.00 0.00 ? 100 ARG A NE   3  
ATOM 5043  C CZ   . ARG A 1 100 ? 8.497   6.537   7.861   1.00 0.00 ? 100 ARG A CZ   3  
ATOM 5044  N NH1  . ARG A 1 100 ? 9.496   7.367   7.591   1.00 0.00 ? 100 ARG A NH1  3  
ATOM 5045  N NH2  . ARG A 1 100 ? 8.013   6.468   9.094   1.00 0.00 ? 100 ARG A NH2  3  
ATOM 5046  H H    . ARG A 1 100 ? 6.334   7.769   1.728   1.00 0.00 ? 100 ARG A H    3  
ATOM 5047  H HA   . ARG A 1 100 ? 7.665   5.347   2.676   1.00 0.00 ? 100 ARG A HA   3  
ATOM 5048  H HB2  . ARG A 1 100 ? 5.959   7.449   3.946   1.00 0.00 ? 100 ARG A HB2  3  
ATOM 5049  H HB3  . ARG A 1 100 ? 6.049   5.859   4.693   1.00 0.00 ? 100 ARG A HB3  3  
ATOM 5050  H HG2  . ARG A 1 100 ? 8.578   7.251   3.970   1.00 0.00 ? 100 ARG A HG2  3  
ATOM 5051  H HG3  . ARG A 1 100 ? 7.684   7.777   5.397   1.00 0.00 ? 100 ARG A HG3  3  
ATOM 5052  H HD2  . ARG A 1 100 ? 8.171   4.867   5.041   1.00 0.00 ? 100 ARG A HD2  3  
ATOM 5053  H HD3  . ARG A 1 100 ? 9.532   5.882   5.516   1.00 0.00 ? 100 ARG A HD3  3  
ATOM 5054  H HE   . ARG A 1 100 ? 7.245   5.172   7.121   1.00 0.00 ? 100 ARG A HE   3  
ATOM 5055  H HH11 . ARG A 1 100 ? 9.862   7.422   6.663   1.00 0.00 ? 100 ARG A HH11 3  
ATOM 5056  H HH12 . ARG A 1 100 ? 9.881   7.938   8.317   1.00 0.00 ? 100 ARG A HH12 3  
ATOM 5057  H HH21 . ARG A 1 100 ? 7.260   5.844   9.300   1.00 0.00 ? 100 ARG A HH21 3  
ATOM 5058  H HH22 . ARG A 1 100 ? 8.401   7.039   9.816   1.00 0.00 ? 100 ARG A HH22 3  
ATOM 5059  N N    . GLU A 1 101 ? 5.419   3.963   3.197   1.00 0.00 ? 101 GLU A N    3  
ATOM 5060  C CA   . GLU A 1 101 ? 4.340   3.000   3.013   1.00 0.00 ? 101 GLU A CA   3  
ATOM 5061  C C    . GLU A 1 101 ? 3.733   2.601   4.355   1.00 0.00 ? 101 GLU A C    3  
ATOM 5062  O O    . GLU A 1 101 ? 4.349   2.783   5.406   1.00 0.00 ? 101 GLU A O    3  
ATOM 5063  C CB   . GLU A 1 101 ? 4.855   1.757   2.284   1.00 0.00 ? 101 GLU A CB   3  
ATOM 5064  C CG   . GLU A 1 101 ? 5.719   0.856   3.152   1.00 0.00 ? 101 GLU A CG   3  
ATOM 5065  C CD   . GLU A 1 101 ? 4.931   0.182   4.258   1.00 0.00 ? 101 GLU A CD   3  
ATOM 5066  O OE1  . GLU A 1 101 ? 3.828   -0.330  3.974   1.00 0.00 ? 101 GLU A OE1  3  
ATOM 5067  O OE2  . GLU A 1 101 ? 5.418   0.167   5.408   1.00 0.00 ? 101 GLU A OE2  3  
ATOM 5068  H H    . GLU A 1 101 ? 6.039   3.850   3.947   1.00 0.00 ? 101 GLU A H    3  
ATOM 5069  H HA   . GLU A 1 101 ? 3.577   3.468   2.411   1.00 0.00 ? 101 GLU A HA   3  
ATOM 5070  H HB2  . GLU A 1 101 ? 4.010   1.183   1.935   1.00 0.00 ? 101 GLU A HB2  3  
ATOM 5071  H HB3  . GLU A 1 101 ? 5.442   2.071   1.433   1.00 0.00 ? 101 GLU A HB3  3  
ATOM 5072  H HG2  . GLU A 1 101 ? 6.160   0.093   2.529   1.00 0.00 ? 101 GLU A HG2  3  
ATOM 5073  H HG3  . GLU A 1 101 ? 6.502   1.452   3.599   1.00 0.00 ? 101 GLU A HG3  3  
ATOM 5074  N N    . ARG A 1 102 ? 2.522   2.057   4.311   1.00 0.00 ? 102 ARG A N    3  
ATOM 5075  C CA   . ARG A 1 102 ? 1.830   1.634   5.523   1.00 0.00 ? 102 ARG A CA   3  
ATOM 5076  C C    . ARG A 1 102 ? 1.666   0.117   5.554   1.00 0.00 ? 102 ARG A C    3  
ATOM 5077  O O    . ARG A 1 102 ? 1.404   -0.509  4.528   1.00 0.00 ? 102 ARG A O    3  
ATOM 5078  C CB   . ARG A 1 102 ? 0.459   2.307   5.615   1.00 0.00 ? 102 ARG A CB   3  
ATOM 5079  C CG   . ARG A 1 102 ? -0.359  1.862   6.816   1.00 0.00 ? 102 ARG A CG   3  
ATOM 5080  C CD   . ARG A 1 102 ? -0.100  2.746   8.025   1.00 0.00 ? 102 ARG A CD   3  
ATOM 5081  N NE   . ARG A 1 102 ? 1.158   2.412   8.688   1.00 0.00 ? 102 ARG A NE   3  
ATOM 5082  C CZ   . ARG A 1 102 ? 1.706   3.156   9.642   1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5083  N NH1  . ARG A 1 102 ? 1.110   4.270   10.043  1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5084  N NH2  . ARG A 1 102 ? 2.853   2.786   10.197  1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5085  H H    . ARG A 1 102 ? 2.082   1.938   3.444   1.00 0.00 ? 102 ARG A H    3  
ATOM 5086  H HA   . ARG A 1 102 ? 2.427   1.937   6.370   1.00 0.00 ? 102 ARG A HA   3  
ATOM 5087  H HB2  . ARG A 1 102 ? 0.599   3.376   5.679   1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5088  H HB3  . ARG A 1 102 ? -0.101  2.079   4.720   1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5089  H HG2  . ARG A 1 102 ? -1.408  1.914   6.564   1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5090  H HG3  . ARG A 1 102 ? -0.096  0.844   7.061   1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5091  H HD2  . ARG A 1 102 ? -0.062  3.775   7.701   1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5092  H HD3  . ARG A 1 102 ? -0.911  2.620   8.727   1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5093  H HE   . ARG A 1 102 ? 1.615   1.593   8.407   1.00 0.00 ? 102 ARG A HE   3  
ATOM 5094  H HH11 . ARG A 1 102 ? 0.245   4.551   9.627   1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5095  H HH12 . ARG A 1 102 ? 1.524   4.828   10.763  1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5096  H HH21 . ARG A 1 102 ? 3.305   1.946   9.898   1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5097  H HH22 . ARG A 1 102 ? 3.265   3.346   10.915  1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5098  N N    . GLU A 1 103 ? 1.824   -0.466  6.739   1.00 0.00 ? 103 GLU A N    3  
ATOM 5099  C CA   . GLU A 1 103 ? 1.696   -1.909  6.902   1.00 0.00 ? 103 GLU A CA   3  
ATOM 5100  C C    . GLU A 1 103 ? 0.242   -2.301  7.154   1.00 0.00 ? 103 GLU A C    3  
ATOM 5101  O O    . GLU A 1 103 ? -0.481  -1.614  7.874   1.00 0.00 ? 103 GLU A O    3  
ATOM 5102  C CB   . GLU A 1 103 ? 2.574   -2.394  8.058   1.00 0.00 ? 103 GLU A CB   3  
ATOM 5103  C CG   . GLU A 1 103 ? 2.906   -3.875  7.990   1.00 0.00 ? 103 GLU A CG   3  
ATOM 5104  C CD   . GLU A 1 103 ? 3.160   -4.479  9.357   1.00 0.00 ? 103 GLU A CD   3  
ATOM 5105  O OE1  . GLU A 1 103 ? 2.341   -4.244  10.270  1.00 0.00 ? 103 GLU A OE1  3  
ATOM 5106  O OE2  . GLU A 1 103 ? 4.177   -5.187  9.514   1.00 0.00 ? 103 GLU A OE2  3  
ATOM 5107  H H    . GLU A 1 103 ? 2.033   0.087   7.520   1.00 0.00 ? 103 GLU A H    3  
ATOM 5108  H HA   . GLU A 1 103 ? 2.029   -2.377  5.988   1.00 0.00 ? 103 GLU A HA   3  
ATOM 5109  H HB2  . GLU A 1 103 ? 3.499   -1.837  8.049   1.00 0.00 ? 103 GLU A HB2  3  
ATOM 5110  H HB3  . GLU A 1 103 ? 2.059   -2.205  8.988   1.00 0.00 ? 103 GLU A HB3  3  
ATOM 5111  H HG2  . GLU A 1 103 ? 2.079   -4.396  7.531   1.00 0.00 ? 103 GLU A HG2  3  
ATOM 5112  H HG3  . GLU A 1 103 ? 3.791   -4.005  7.385   1.00 0.00 ? 103 GLU A HG3  3  
ATOM 5113  N N    . GLY A 1 104 ? -0.178  -3.410  6.555   1.00 0.00 ? 104 GLY A N    3  
ATOM 5114  C CA   . GLY A 1 104 ? -1.542  -3.874  6.725   1.00 0.00 ? 104 GLY A CA   3  
ATOM 5115  C C    . GLY A 1 104 ? -1.676  -5.371  6.523   1.00 0.00 ? 104 GLY A C    3  
ATOM 5116  O O    . GLY A 1 104 ? -2.006  -5.829  5.429   1.00 0.00 ? 104 GLY A O    3  
ATOM 5117  H H    . GLY A 1 104 ? 0.443   -3.918  5.992   1.00 0.00 ? 104 GLY A H    3  
ATOM 5118  H HA2  . GLY A 1 104 ? -1.874  -3.626  7.722   1.00 0.00 ? 104 GLY A HA2  3  
ATOM 5119  H HA3  . GLY A 1 104 ? -2.175  -3.368  6.010   1.00 0.00 ? 104 GLY A HA3  3  
ATOM 5120  N N    . VAL A 1 105 ? -1.416  -6.135  7.579   1.00 0.00 ? 105 VAL A N    3  
ATOM 5121  C CA   . VAL A 1 105 ? -1.508  -7.588  7.512   1.00 0.00 ? 105 VAL A CA   3  
ATOM 5122  C C    . VAL A 1 105 ? -2.962  -8.047  7.493   1.00 0.00 ? 105 VAL A C    3  
ATOM 5123  O O    . VAL A 1 105 ? -3.845  -7.365  8.015   1.00 0.00 ? 105 VAL A O    3  
ATOM 5124  C CB   . VAL A 1 105 ? -0.788  -8.252  8.701   1.00 0.00 ? 105 VAL A CB   3  
ATOM 5125  C CG1  . VAL A 1 105 ? -0.981  -9.760  8.668   1.00 0.00 ? 105 VAL A CG1  3  
ATOM 5126  C CG2  . VAL A 1 105 ? 0.691   -7.894  8.694   1.00 0.00 ? 105 VAL A CG2  3  
ATOM 5127  H H    . VAL A 1 105 ? -1.158  -5.711  8.424   1.00 0.00 ? 105 VAL A H    3  
ATOM 5128  H HA   . VAL A 1 105 ? -1.027  -7.912  6.600   1.00 0.00 ? 105 VAL A HA   3  
ATOM 5129  H HB   . VAL A 1 105 ? -1.223  -7.875  9.615   1.00 0.00 ? 105 VAL A HB   3  
ATOM 5130  H HG11 . VAL A 1 105 ? -0.579  -10.154 7.746   1.00 0.00 ? 105 VAL A HG11 3  
ATOM 5131  H HG12 . VAL A 1 105 ? -0.466  -10.207 9.506   1.00 0.00 ? 105 VAL A HG12 3  
ATOM 5132  H HG13 . VAL A 1 105 ? -2.034  -9.989  8.728   1.00 0.00 ? 105 VAL A HG13 3  
ATOM 5133  H HG21 . VAL A 1 105 ? 1.135   -8.216  7.764   1.00 0.00 ? 105 VAL A HG21 3  
ATOM 5134  H HG22 . VAL A 1 105 ? 0.802   -6.825  8.796   1.00 0.00 ? 105 VAL A HG22 3  
ATOM 5135  H HG23 . VAL A 1 105 ? 1.185   -8.388  9.518   1.00 0.00 ? 105 VAL A HG23 3  
ATOM 5136  N N    . ILE A 1 106 ? -3.204  -9.205  6.890   1.00 0.00 ? 106 ILE A N    3  
ATOM 5137  C CA   . ILE A 1 106 ? -4.551  -9.756  6.804   1.00 0.00 ? 106 ILE A CA   3  
ATOM 5138  C C    . ILE A 1 106 ? -4.538  -11.270 6.980   1.00 0.00 ? 106 ILE A C    3  
ATOM 5139  O O    . ILE A 1 106 ? -3.583  -11.944 6.591   1.00 0.00 ? 106 ILE A O    3  
ATOM 5140  C CB   . ILE A 1 106 ? -5.215  -9.412  5.458   1.00 0.00 ? 106 ILE A CB   3  
ATOM 5141  C CG1  . ILE A 1 106 ? -6.690  -9.820  5.473   1.00 0.00 ? 106 ILE A CG1  3  
ATOM 5142  C CG2  . ILE A 1 106 ? -4.482  -10.097 4.315   1.00 0.00 ? 106 ILE A CG2  3  
ATOM 5143  C CD1  . ILE A 1 106 ? -7.568  -8.885  6.275   1.00 0.00 ? 106 ILE A CD1  3  
ATOM 5144  H H    . ILE A 1 106 ? -2.458  -9.702  6.493   1.00 0.00 ? 106 ILE A H    3  
ATOM 5145  H HA   . ILE A 1 106 ? -5.140  -9.317  7.597   1.00 0.00 ? 106 ILE A HA   3  
ATOM 5146  H HB   . ILE A 1 106 ? -5.146  -8.345  5.310   1.00 0.00 ? 106 ILE A HB   3  
ATOM 5147  H HG12 . ILE A 1 106 ? -7.062  -9.838  4.461   1.00 0.00 ? 106 ILE A HG12 3  
ATOM 5148  H HG13 . ILE A 1 106 ? -6.777  -10.808 5.902   1.00 0.00 ? 106 ILE A HG13 3  
ATOM 5149  H HG21 . ILE A 1 106 ? -3.416  -10.030 4.479   1.00 0.00 ? 106 ILE A HG21 3  
ATOM 5150  H HG22 . ILE A 1 106 ? -4.773  -11.136 4.273   1.00 0.00 ? 106 ILE A HG22 3  
ATOM 5151  H HG23 . ILE A 1 106 ? -4.734  -9.614  3.383   1.00 0.00 ? 106 ILE A HG23 3  
ATOM 5152  H HD11 . ILE A 1 106 ? -6.982  -8.039  6.609   1.00 0.00 ? 106 ILE A HD11 3  
ATOM 5153  H HD12 . ILE A 1 106 ? -8.381  -8.535  5.657   1.00 0.00 ? 106 ILE A HD12 3  
ATOM 5154  H HD13 . ILE A 1 106 ? -7.964  -9.408  7.132   1.00 0.00 ? 106 ILE A HD13 3  
ATOM 5155  N N    . THR A 1 107 ? -5.606  -11.802 7.567   1.00 0.00 ? 107 THR A N    3  
ATOM 5156  C CA   . THR A 1 107 ? -5.719  -13.237 7.793   1.00 0.00 ? 107 THR A CA   3  
ATOM 5157  C C    . THR A 1 107 ? -6.929  -13.815 7.069   1.00 0.00 ? 107 THR A C    3  
ATOM 5158  O O    . THR A 1 107 ? -8.072  -13.527 7.425   1.00 0.00 ? 107 THR A O    3  
ATOM 5159  C CB   . THR A 1 107 ? -5.830  -13.562 9.295   1.00 0.00 ? 107 THR A CB   3  
ATOM 5160  O OG1  . THR A 1 107 ? -4.650  -13.126 9.979   1.00 0.00 ? 107 THR A OG1  3  
ATOM 5161  C CG2  . THR A 1 107 ? -6.027  -15.054 9.513   1.00 0.00 ? 107 THR A CG2  3  
ATOM 5162  H H    . THR A 1 107 ? -6.334  -11.213 7.855   1.00 0.00 ? 107 THR A H    3  
ATOM 5163  H HA   . THR A 1 107 ? -4.824  -13.707 7.410   1.00 0.00 ? 107 THR A HA   3  
ATOM 5164  H HB   . THR A 1 107 ? -6.685  -13.038 9.699   1.00 0.00 ? 107 THR A HB   3  
ATOM 5165  H HG1  . THR A 1 107 ? -4.072  -12.670 9.362   1.00 0.00 ? 107 THR A HG1  3  
ATOM 5166  H HG21 . THR A 1 107 ? -5.769  -15.587 8.610   1.00 0.00 ? 107 THR A HG21 3  
ATOM 5167  H HG22 . THR A 1 107 ? -7.060  -15.249 9.762   1.00 0.00 ? 107 THR A HG22 3  
ATOM 5168  H HG23 . THR A 1 107 ? -5.393  -15.387 10.321  1.00 0.00 ? 107 THR A HG23 3  
ATOM 5169  N N    . ILE A 1 108 ? -6.671  -14.631 6.053   1.00 0.00 ? 108 ILE A N    3  
ATOM 5170  C CA   . ILE A 1 108 ? -7.740  -15.250 5.280   1.00 0.00 ? 108 ILE A CA   3  
ATOM 5171  C C    . ILE A 1 108 ? -8.597  -16.158 6.156   1.00 0.00 ? 108 ILE A C    3  
ATOM 5172  O O    . ILE A 1 108 ? -8.141  -17.206 6.611   1.00 0.00 ? 108 ILE A O    3  
ATOM 5173  C CB   . ILE A 1 108 ? -7.182  -16.070 4.102   1.00 0.00 ? 108 ILE A CB   3  
ATOM 5174  C CG1  . ILE A 1 108 ? -6.269  -15.201 3.235   1.00 0.00 ? 108 ILE A CG1  3  
ATOM 5175  C CG2  . ILE A 1 108 ? -8.319  -16.647 3.272   1.00 0.00 ? 108 ILE A CG2  3  
ATOM 5176  C CD1  . ILE A 1 108 ? -7.010  -14.136 2.456   1.00 0.00 ? 108 ILE A CD1  3  
ATOM 5177  H H    . ILE A 1 108 ? -5.739  -14.821 5.818   1.00 0.00 ? 108 ILE A H    3  
ATOM 5178  H HA   . ILE A 1 108 ? -8.362  -14.462 4.881   1.00 0.00 ? 108 ILE A HA   3  
ATOM 5179  H HB   . ILE A 1 108 ? -6.609  -16.892 4.504   1.00 0.00 ? 108 ILE A HB   3  
ATOM 5180  H HG12 . ILE A 1 108 ? -5.547  -14.707 3.865   1.00 0.00 ? 108 ILE A HG12 3  
ATOM 5181  H HG13 . ILE A 1 108 ? -5.752  -15.831 2.526   1.00 0.00 ? 108 ILE A HG13 3  
ATOM 5182  H HG21 . ILE A 1 108 ? -8.727  -17.512 3.773   1.00 0.00 ? 108 ILE A HG21 3  
ATOM 5183  H HG22 . ILE A 1 108 ? -9.092  -15.902 3.154   1.00 0.00 ? 108 ILE A HG22 3  
ATOM 5184  H HG23 . ILE A 1 108 ? -7.946  -16.936 2.301   1.00 0.00 ? 108 ILE A HG23 3  
ATOM 5185  H HD11 . ILE A 1 108 ? -6.317  -13.364 2.153   1.00 0.00 ? 108 ILE A HD11 3  
ATOM 5186  H HD12 . ILE A 1 108 ? -7.460  -14.578 1.579   1.00 0.00 ? 108 ILE A HD12 3  
ATOM 5187  H HD13 . ILE A 1 108 ? -7.780  -13.705 3.078   1.00 0.00 ? 108 ILE A HD13 3  
ATOM 5188  N N    . GLU A 1 109 ? -9.840  -15.748 6.387   1.00 0.00 ? 109 GLU A N    3  
ATOM 5189  C CA   . GLU A 1 109 ? -10.761 -16.526 7.208   1.00 0.00 ? 109 GLU A CA   3  
ATOM 5190  C C    . GLU A 1 109 ? -11.977 -16.962 6.396   1.00 0.00 ? 109 GLU A C    3  
ATOM 5191  O O    . GLU A 1 109 ? -12.798 -16.137 5.996   1.00 0.00 ? 109 GLU A O    3  
ATOM 5192  C CB   . GLU A 1 109 ? -11.210 -15.710 8.422   1.00 0.00 ? 109 GLU A CB   3  
ATOM 5193  C CG   . GLU A 1 109 ? -10.243 -15.779 9.592   1.00 0.00 ? 109 GLU A CG   3  
ATOM 5194  C CD   . GLU A 1 109 ? -10.661 -14.889 10.747  1.00 0.00 ? 109 GLU A CD   3  
ATOM 5195  O OE1  . GLU A 1 109 ? -10.309 -13.690 10.727  1.00 0.00 ? 109 GLU A OE1  3  
ATOM 5196  O OE2  . GLU A 1 109 ? -11.337 -15.389 11.669  1.00 0.00 ? 109 GLU A OE2  3  
ATOM 5197  H H    . GLU A 1 109 ? -10.145 -14.903 5.996   1.00 0.00 ? 109 GLU A H    3  
ATOM 5198  H HA   . GLU A 1 109 ? -10.237 -17.405 7.550   1.00 0.00 ? 109 GLU A HA   3  
ATOM 5199  H HB2  . GLU A 1 109 ? -11.314 -14.676 8.128   1.00 0.00 ? 109 GLU A HB2  3  
ATOM 5200  H HB3  . GLU A 1 109 ? -12.169 -16.079 8.753   1.00 0.00 ? 109 GLU A HB3  3  
ATOM 5201  H HG2  . GLU A 1 109 ? -10.196 -16.799 9.944   1.00 0.00 ? 109 GLU A HG2  3  
ATOM 5202  H HG3  . GLU A 1 109 ? -9.265  -15.470 9.254   1.00 0.00 ? 109 GLU A HG3  3  
ATOM 5203  N N    . SER A 1 110 ? -12.085 -18.265 6.157   1.00 0.00 ? 110 SER A N    3  
ATOM 5204  C CA   . SER A 1 110 ? -13.198 -18.812 5.390   1.00 0.00 ? 110 SER A CA   3  
ATOM 5205  C C    . SER A 1 110 ? -14.206 -19.497 6.308   1.00 0.00 ? 110 SER A C    3  
ATOM 5206  O O    . SER A 1 110 ? -15.404 -19.226 6.243   1.00 0.00 ? 110 SER A O    3  
ATOM 5207  C CB   . SER A 1 110 ? -12.686 -19.805 4.345   1.00 0.00 ? 110 SER A CB   3  
ATOM 5208  O OG   . SER A 1 110 ? -13.580 -19.900 3.250   1.00 0.00 ? 110 SER A OG   3  
ATOM 5209  H H    . SER A 1 110 ? -11.398 -18.873 6.503   1.00 0.00 ? 110 SER A H    3  
ATOM 5210  H HA   . SER A 1 110 ? -13.688 -17.992 4.886   1.00 0.00 ? 110 SER A HA   3  
ATOM 5211  H HB2  . SER A 1 110 ? -11.724 -19.477 3.981   1.00 0.00 ? 110 SER A HB2  3  
ATOM 5212  H HB3  . SER A 1 110 ? -12.585 -20.781 4.798   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5213  H HG   . SER A 1 110 ? -14.246 -20.565 3.437   1.00 0.00 ? 110 SER A HG   3  
ATOM 5214  N N    . GLN A 1 111 ? -13.709 -20.387 7.162   1.00 0.00 ? 111 GLN A N    3  
ATOM 5215  C CA   . GLN A 1 111 ? -14.566 -21.112 8.093   1.00 0.00 ? 111 GLN A CA   3  
ATOM 5216  C C    . GLN A 1 111 ? -15.032 -20.203 9.225   1.00 0.00 ? 111 GLN A C    3  
ATOM 5217  O O    . GLN A 1 111 ? -14.267 -19.884 10.135  1.00 0.00 ? 111 GLN A O    3  
ATOM 5218  C CB   . GLN A 1 111 ? -13.824 -22.321 8.666   1.00 0.00 ? 111 GLN A CB   3  
ATOM 5219  C CG   . GLN A 1 111 ? -14.579 -23.025 9.782   1.00 0.00 ? 111 GLN A CG   3  
ATOM 5220  C CD   . GLN A 1 111 ? -14.115 -24.453 9.989   1.00 0.00 ? 111 GLN A CD   3  
ATOM 5221  O OE1  . GLN A 1 111 ? -14.254 -25.298 9.104   1.00 0.00 ? 111 GLN A OE1  3  
ATOM 5222  N NE2  . GLN A 1 111 ? -13.560 -24.732 11.163  1.00 0.00 ? 111 GLN A NE2  3  
ATOM 5223  H H    . GLN A 1 111 ? -12.745 -20.560 7.165   1.00 0.00 ? 111 GLN A H    3  
ATOM 5224  H HA   . GLN A 1 111 ? -15.430 -21.458 7.547   1.00 0.00 ? 111 GLN A HA   3  
ATOM 5225  H HB2  . GLN A 1 111 ? -13.651 -23.032 7.873   1.00 0.00 ? 111 GLN A HB2  3  
ATOM 5226  H HB3  . GLN A 1 111 ? -12.872 -21.991 9.057   1.00 0.00 ? 111 GLN A HB3  3  
ATOM 5227  H HG2  . GLN A 1 111 ? -14.430 -22.478 10.701  1.00 0.00 ? 111 GLN A HG2  3  
ATOM 5228  H HG3  . GLN A 1 111 ? -15.630 -23.035 9.537   1.00 0.00 ? 111 GLN A HG3  3  
ATOM 5229  H HE21 . GLN A 1 111 ? -13.484 -24.009 11.821  1.00 0.00 ? 111 GLN A HE21 3  
ATOM 5230  H HE22 . GLN A 1 111 ? -13.253 -25.647 11.324  1.00 0.00 ? 111 GLN A HE22 3  
ATOM 5231  N N    . VAL A 1 112 ? -16.293 -19.787 9.162   1.00 0.00 ? 112 VAL A N    3  
ATOM 5232  C CA   . VAL A 1 112 ? -16.862 -18.915 10.182  1.00 0.00 ? 112 VAL A CA   3  
ATOM 5233  C C    . VAL A 1 112 ? -18.196 -19.455 10.687  1.00 0.00 ? 112 VAL A C    3  
ATOM 5234  O O    . VAL A 1 112 ? -19.211 -19.375 9.996   1.00 0.00 ? 112 VAL A O    3  
ATOM 5235  C CB   . VAL A 1 112 ? -17.070 -17.486 9.646   1.00 0.00 ? 112 VAL A CB   3  
ATOM 5236  C CG1  . VAL A 1 112 ? -17.706 -16.603 10.710  1.00 0.00 ? 112 VAL A CG1  3  
ATOM 5237  C CG2  . VAL A 1 112 ? -15.750 -16.897 9.173   1.00 0.00 ? 112 VAL A CG2  3  
ATOM 5238  H H    . VAL A 1 112 ? -16.855 -20.075 8.412   1.00 0.00 ? 112 VAL A H    3  
ATOM 5239  H HA   . VAL A 1 112 ? -16.167 -18.869 11.008  1.00 0.00 ? 112 VAL A HA   3  
ATOM 5240  H HB   . VAL A 1 112 ? -17.742 -17.534 8.802   1.00 0.00 ? 112 VAL A HB   3  
ATOM 5241  H HG11 . VAL A 1 112 ? -18.120 -17.224 11.491  1.00 0.00 ? 112 VAL A HG11 3  
ATOM 5242  H HG12 . VAL A 1 112 ? -16.957 -15.948 11.129  1.00 0.00 ? 112 VAL A HG12 3  
ATOM 5243  H HG13 . VAL A 1 112 ? -18.493 -16.013 10.264  1.00 0.00 ? 112 VAL A HG13 3  
ATOM 5244  H HG21 . VAL A 1 112 ? -15.031 -16.932 9.977   1.00 0.00 ? 112 VAL A HG21 3  
ATOM 5245  H HG22 . VAL A 1 112 ? -15.382 -17.470 8.335   1.00 0.00 ? 112 VAL A HG22 3  
ATOM 5246  H HG23 . VAL A 1 112 ? -15.901 -15.871 8.869   1.00 0.00 ? 112 VAL A HG23 3  
ATOM 5247  N N    . SER A 1 113 ? -18.185 -20.007 11.896  1.00 0.00 ? 113 SER A N    3  
ATOM 5248  C CA   . SER A 1 113 ? -19.393 -20.564 12.493  1.00 0.00 ? 113 SER A CA   3  
ATOM 5249  C C    . SER A 1 113 ? -20.086 -19.534 13.379  1.00 0.00 ? 113 SER A C    3  
ATOM 5250  O O    . SER A 1 113 ? -19.491 -19.002 14.314  1.00 0.00 ? 113 SER A O    3  
ATOM 5251  C CB   . SER A 1 113 ? -19.054 -21.812 13.311  1.00 0.00 ? 113 SER A CB   3  
ATOM 5252  O OG   . SER A 1 113 ? -20.192 -22.292 14.005  1.00 0.00 ? 113 SER A OG   3  
ATOM 5253  H H    . SER A 1 113 ? -17.343 -20.041 12.398  1.00 0.00 ? 113 SER A H    3  
ATOM 5254  H HA   . SER A 1 113 ? -20.061 -20.841 11.691  1.00 0.00 ? 113 SER A HA   3  
ATOM 5255  H HB2  . SER A 1 113 ? -18.697 -22.587 12.650  1.00 0.00 ? 113 SER A HB2  3  
ATOM 5256  H HB3  . SER A 1 113 ? -18.284 -21.569 14.030  1.00 0.00 ? 113 SER A HB3  3  
ATOM 5257  H HG   . SER A 1 113 ? -20.288 -23.234 13.850  1.00 0.00 ? 113 SER A HG   3  
ATOM 5258  N N    . GLY A 1 114 ? -21.351 -19.258 13.076  1.00 0.00 ? 114 GLY A N    3  
ATOM 5259  C CA   . GLY A 1 114 ? -22.107 -18.293 13.853  1.00 0.00 ? 114 GLY A CA   3  
ATOM 5260  C C    . GLY A 1 114 ? -21.293 -17.060 14.195  1.00 0.00 ? 114 GLY A C    3  
ATOM 5261  O O    . GLY A 1 114 ? -20.248 -16.796 13.601  1.00 0.00 ? 114 GLY A O    3  
ATOM 5262  H H    . GLY A 1 114 ? -21.775 -19.714 12.319  1.00 0.00 ? 114 GLY A H    3  
ATOM 5263  H HA2  . GLY A 1 114 ? -22.976 -17.993 13.288  1.00 0.00 ? 114 GLY A HA2  3  
ATOM 5264  H HA3  . GLY A 1 114 ? -22.431 -18.761 14.771  1.00 0.00 ? 114 GLY A HA3  3  
ATOM 5265  N N    . PRO A 1 115 ? -21.777 -16.280 15.173  1.00 0.00 ? 115 PRO A N    3  
ATOM 5266  C CA   . PRO A 1 115 ? -21.104 -15.054 15.614  1.00 0.00 ? 115 PRO A CA   3  
ATOM 5267  C C    . PRO A 1 115 ? -19.802 -15.342 16.354  1.00 0.00 ? 115 PRO A C    3  
ATOM 5268  O O    . PRO A 1 115 ? -18.988 -14.444 16.570  1.00 0.00 ? 115 PRO A O    3  
ATOM 5269  C CB   . PRO A 1 115 ? -22.123 -14.409 16.556  1.00 0.00 ? 115 PRO A CB   3  
ATOM 5270  C CG   . PRO A 1 115 ? -22.950 -15.544 17.054  1.00 0.00 ? 115 PRO A CG   3  
ATOM 5271  C CD   . PRO A 1 115 ? -23.018 -16.534 15.924  1.00 0.00 ? 115 PRO A CD   3  
ATOM 5272  H HA   . PRO A 1 115 ? -20.906 -14.390 14.785  1.00 0.00 ? 115 PRO A HA   3  
ATOM 5273  H HB2  . PRO A 1 115 ? -21.605 -13.912 17.364  1.00 0.00 ? 115 PRO A HB2  3  
ATOM 5274  H HB3  . PRO A 1 115 ? -22.721 -13.694 16.011  1.00 0.00 ? 115 PRO A HB3  3  
ATOM 5275  H HG2  . PRO A 1 115 ? -22.480 -15.991 17.916  1.00 0.00 ? 115 PRO A HG2  3  
ATOM 5276  H HG3  . PRO A 1 115 ? -23.941 -15.193 17.304  1.00 0.00 ? 115 PRO A HG3  3  
ATOM 5277  H HD2  . PRO A 1 115 ? -23.037 -17.543 16.307  1.00 0.00 ? 115 PRO A HD2  3  
ATOM 5278  H HD3  . PRO A 1 115 ? -23.885 -16.345 15.308  1.00 0.00 ? 115 PRO A HD3  3  
ATOM 5279  N N    . SER A 1 116 ? -19.611 -16.600 16.738  1.00 0.00 ? 116 SER A N    3  
ATOM 5280  C CA   . SER A 1 116 ? -18.409 -17.005 17.457  1.00 0.00 ? 116 SER A CA   3  
ATOM 5281  C C    . SER A 1 116 ? -17.166 -16.799 16.597  1.00 0.00 ? 116 SER A C    3  
ATOM 5282  O O    . SER A 1 116 ? -16.906 -17.566 15.669  1.00 0.00 ? 116 SER A O    3  
ATOM 5283  C CB   . SER A 1 116 ? -18.512 -18.472 17.881  1.00 0.00 ? 116 SER A CB   3  
ATOM 5284  O OG   . SER A 1 116 ? -19.208 -18.600 19.109  1.00 0.00 ? 116 SER A OG   3  
ATOM 5285  H H    . SER A 1 116 ? -20.297 -17.271 16.536  1.00 0.00 ? 116 SER A H    3  
ATOM 5286  H HA   . SER A 1 116 ? -18.327 -16.389 18.340  1.00 0.00 ? 116 SER A HA   3  
ATOM 5287  H HB2  . SER A 1 116 ? -19.042 -19.027 17.121  1.00 0.00 ? 116 SER A HB2  3  
ATOM 5288  H HB3  . SER A 1 116 ? -17.519 -18.880 17.999  1.00 0.00 ? 116 SER A HB3  3  
ATOM 5289  H HG   . SER A 1 116 ? -19.846 -19.314 19.042  1.00 0.00 ? 116 SER A HG   3  
ATOM 5290  N N    . SER A 1 117 ? -16.402 -15.759 16.911  1.00 0.00 ? 117 SER A N    3  
ATOM 5291  C CA   . SER A 1 117 ? -15.188 -15.448 16.165  1.00 0.00 ? 117 SER A CA   3  
ATOM 5292  C C    . SER A 1 117 ? -14.192 -16.602 16.244  1.00 0.00 ? 117 SER A C    3  
ATOM 5293  O O    . SER A 1 117 ? -14.262 -17.437 17.144  1.00 0.00 ? 117 SER A O    3  
ATOM 5294  C CB   . SER A 1 117 ? -14.546 -14.168 16.704  1.00 0.00 ? 117 SER A CB   3  
ATOM 5295  O OG   . SER A 1 117 ? -13.617 -13.634 15.777  1.00 0.00 ? 117 SER A OG   3  
ATOM 5296  H H    . SER A 1 117 ? -16.662 -15.184 17.662  1.00 0.00 ? 117 SER A H    3  
ATOM 5297  H HA   . SER A 1 117 ? -15.463 -15.295 15.133  1.00 0.00 ? 117 SER A HA   3  
ATOM 5298  H HB2  . SER A 1 117 ? -15.315 -13.433 16.889  1.00 0.00 ? 117 SER A HB2  3  
ATOM 5299  H HB3  . SER A 1 117 ? -14.030 -14.389 17.627  1.00 0.00 ? 117 SER A HB3  3  
ATOM 5300  H HG   . SER A 1 117 ? -14.086 -13.133 15.106  1.00 0.00 ? 117 SER A HG   3  
ATOM 5301  N N    . GLY A 1 118 ? -13.264 -16.640 15.292  1.00 0.00 ? 118 GLY A N    3  
ATOM 5302  C CA   . GLY A 1 118 ? -12.267 -17.694 15.270  1.00 0.00 ? 118 GLY A CA   3  
ATOM 5303  C C    . GLY A 1 118 ? -11.554 -17.845 16.599  1.00 0.00 ? 118 GLY A C    3  
ATOM 5304  O O    . GLY A 1 118 ? -10.970 -16.889 17.110  1.00 0.00 ? 118 GLY A O    3  
ATOM 5305  H H    . GLY A 1 118 ? -13.257 -15.946 14.599  1.00 0.00 ? 118 GLY A H    3  
ATOM 5306  H HA2  . GLY A 1 118 ? -12.751 -18.627 15.025  1.00 0.00 ? 118 GLY A HA2  3  
ATOM 5307  H HA3  . GLY A 1 118 ? -11.537 -17.467 14.507  1.00 0.00 ? 118 GLY A HA3  3  
ATOM 5308  N N    . GLY A 1 1   ? 9.930   -10.698 9.642   1.00 0.00 ? 1   GLY A N    4  
ATOM 5309  C CA   . GLY A 1 1   ? 9.806   -9.787  8.519   1.00 0.00 ? 1   GLY A CA   4  
ATOM 5310  C C    . GLY A 1 1   ? 11.076  -9.709  7.694   1.00 0.00 ? 1   GLY A C    4  
ATOM 5311  O O    . GLY A 1 1   ? 12.146  -9.398  8.216   1.00 0.00 ? 1   GLY A O    4  
ATOM 5312  H H1   . GLY A 1 1   ? 10.462  -10.441 10.423  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5313  H HA2  . GLY A 1 1   ? 8.998   -10.120 7.886   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5314  H HA3  . GLY A 1 1   ? 9.574   -8.801  8.894   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5315  N N    . SER A 1 2   ? 10.957  -9.994  6.401   1.00 0.00 ? 2   SER A N    4  
ATOM 5316  C CA   . SER A 1 2   ? 12.105  -9.960  5.502   1.00 0.00 ? 2   SER A CA   4  
ATOM 5317  C C    . SER A 1 2   ? 12.599  -8.530  5.306   1.00 0.00 ? 2   SER A C    4  
ATOM 5318  O O    . SER A 1 2   ? 11.923  -7.707  4.688   1.00 0.00 ? 2   SER A O    4  
ATOM 5319  C CB   . SER A 1 2   ? 11.740  -10.576 4.150   1.00 0.00 ? 2   SER A CB   4  
ATOM 5320  O OG   . SER A 1 2   ? 12.901  -10.944 3.427   1.00 0.00 ? 2   SER A OG   4  
ATOM 5321  H H    . SER A 1 2   ? 10.077  -10.235 6.043   1.00 0.00 ? 2   SER A H    4  
ATOM 5322  H HA   . SER A 1 2   ? 12.895  -10.543 5.952   1.00 0.00 ? 2   SER A HA   4  
ATOM 5323  H HB2  . SER A 1 2   ? 11.136  -11.456 4.310   1.00 0.00 ? 2   SER A HB2  4  
ATOM 5324  H HB3  . SER A 1 2   ? 11.181  -9.856  3.569   1.00 0.00 ? 2   SER A HB3  4  
ATOM 5325  H HG   . SER A 1 2   ? 13.654  -10.446 3.754   1.00 0.00 ? 2   SER A HG   4  
ATOM 5326  N N    . SER A 1 3   ? 13.784  -8.242  5.836   1.00 0.00 ? 3   SER A N    4  
ATOM 5327  C CA   . SER A 1 3   ? 14.368  -6.911  5.723   1.00 0.00 ? 3   SER A CA   4  
ATOM 5328  C C    . SER A 1 3   ? 15.419  -6.871  4.618   1.00 0.00 ? 3   SER A C    4  
ATOM 5329  O O    . SER A 1 3   ? 15.918  -7.908  4.182   1.00 0.00 ? 3   SER A O    4  
ATOM 5330  C CB   . SER A 1 3   ? 14.995  -6.492  7.054   1.00 0.00 ? 3   SER A CB   4  
ATOM 5331  O OG   . SER A 1 3   ? 16.203  -7.194  7.292   1.00 0.00 ? 3   SER A OG   4  
ATOM 5332  H H    . SER A 1 3   ? 14.275  -8.941  6.317   1.00 0.00 ? 3   SER A H    4  
ATOM 5333  H HA   . SER A 1 3   ? 13.575  -6.221  5.475   1.00 0.00 ? 3   SER A HA   4  
ATOM 5334  H HB2  . SER A 1 3   ? 15.207  -5.433  7.032   1.00 0.00 ? 3   SER A HB2  4  
ATOM 5335  H HB3  . SER A 1 3   ? 14.305  -6.704  7.857   1.00 0.00 ? 3   SER A HB3  4  
ATOM 5336  H HG   . SER A 1 3   ? 16.060  -8.133  7.156   1.00 0.00 ? 3   SER A HG   4  
ATOM 5337  N N    . GLY A 1 4   ? 15.751  -5.664  4.168   1.00 0.00 ? 4   GLY A N    4  
ATOM 5338  C CA   . GLY A 1 4   ? 16.740  -5.510  3.118   1.00 0.00 ? 4   GLY A CA   4  
ATOM 5339  C C    . GLY A 1 4   ? 18.106  -5.136  3.658   1.00 0.00 ? 4   GLY A C    4  
ATOM 5340  O O    . GLY A 1 4   ? 18.216  -4.336  4.587   1.00 0.00 ? 4   GLY A O    4  
ATOM 5341  H H    . GLY A 1 4   ? 15.320  -4.872  4.553   1.00 0.00 ? 4   GLY A H    4  
ATOM 5342  H HA2  . GLY A 1 4   ? 16.821  -6.440  2.575   1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5343  H HA3  . GLY A 1 4   ? 16.410  -4.737  2.439   1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5344  N N    . SER A 1 5   ? 19.150  -5.717  3.076   1.00 0.00 ? 5   SER A N    4  
ATOM 5345  C CA   . SER A 1 5   ? 20.516  -5.445  3.508   1.00 0.00 ? 5   SER A CA   4  
ATOM 5346  C C    . SER A 1 5   ? 21.214  -4.497  2.538   1.00 0.00 ? 5   SER A C    4  
ATOM 5347  O O    . SER A 1 5   ? 21.839  -4.930  1.570   1.00 0.00 ? 5   SER A O    4  
ATOM 5348  C CB   . SER A 1 5   ? 21.307  -6.749  3.622   1.00 0.00 ? 5   SER A CB   4  
ATOM 5349  O OG   . SER A 1 5   ? 22.386  -6.614  4.530   1.00 0.00 ? 5   SER A OG   4  
ATOM 5350  H H    . SER A 1 5   ? 18.998  -6.347  2.340   1.00 0.00 ? 5   SER A H    4  
ATOM 5351  H HA   . SER A 1 5   ? 20.469  -4.977  4.480   1.00 0.00 ? 5   SER A HA   4  
ATOM 5352  H HB2  . SER A 1 5   ? 20.654  -7.534  3.972   1.00 0.00 ? 5   SER A HB2  4  
ATOM 5353  H HB3  . SER A 1 5   ? 21.700  -7.015  2.651   1.00 0.00 ? 5   SER A HB3  4  
ATOM 5354  H HG   . SER A 1 5   ? 22.119  -6.057  5.265   1.00 0.00 ? 5   SER A HG   4  
ATOM 5355  N N    . SER A 1 6   ? 21.102  -3.199  2.805   1.00 0.00 ? 6   SER A N    4  
ATOM 5356  C CA   . SER A 1 6   ? 21.718  -2.188  1.955   1.00 0.00 ? 6   SER A CA   4  
ATOM 5357  C C    . SER A 1 6   ? 22.563  -1.223  2.782   1.00 0.00 ? 6   SER A C    4  
ATOM 5358  O O    . SER A 1 6   ? 22.544  -1.262  4.012   1.00 0.00 ? 6   SER A O    4  
ATOM 5359  C CB   . SER A 1 6   ? 20.645  -1.414  1.187   1.00 0.00 ? 6   SER A CB   4  
ATOM 5360  O OG   . SER A 1 6   ? 19.839  -0.650  2.067   1.00 0.00 ? 6   SER A OG   4  
ATOM 5361  H H    . SER A 1 6   ? 20.590  -2.916  3.592   1.00 0.00 ? 6   SER A H    4  
ATOM 5362  H HA   . SER A 1 6   ? 22.360  -2.694  1.249   1.00 0.00 ? 6   SER A HA   4  
ATOM 5363  H HB2  . SER A 1 6   ? 21.120  -0.747  0.483   1.00 0.00 ? 6   SER A HB2  4  
ATOM 5364  H HB3  . SER A 1 6   ? 20.015  -2.111  0.653   1.00 0.00 ? 6   SER A HB3  4  
ATOM 5365  H HG   . SER A 1 6   ? 18.926  -0.940  1.998   1.00 0.00 ? 6   SER A HG   4  
ATOM 5366  N N    . GLY A 1 7   ? 23.303  -0.357  2.097   1.00 0.00 ? 7   GLY A N    4  
ATOM 5367  C CA   . GLY A 1 7   ? 24.145  0.605   2.784   1.00 0.00 ? 7   GLY A CA   4  
ATOM 5368  C C    . GLY A 1 7   ? 23.348  1.548   3.663   1.00 0.00 ? 7   GLY A C    4  
ATOM 5369  O O    . GLY A 1 7   ? 22.118  1.506   3.676   1.00 0.00 ? 7   GLY A O    4  
ATOM 5370  H H    . GLY A 1 7   ? 23.278  -0.372  1.117   1.00 0.00 ? 7   GLY A H    4  
ATOM 5371  H HA2  . GLY A 1 7   ? 24.856  0.073   3.397   1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5372  H HA3  . GLY A 1 7   ? 24.682  1.186   2.048   1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5373  N N    . SER A 1 8   ? 24.050  2.400   4.403   1.00 0.00 ? 8   SER A N    4  
ATOM 5374  C CA   . SER A 1 8   ? 23.400  3.354   5.295   1.00 0.00 ? 8   SER A CA   4  
ATOM 5375  C C    . SER A 1 8   ? 23.694  4.788   4.863   1.00 0.00 ? 8   SER A C    4  
ATOM 5376  O O    . SER A 1 8   ? 24.833  5.134   4.551   1.00 0.00 ? 8   SER A O    4  
ATOM 5377  C CB   . SER A 1 8   ? 23.867  3.137   6.736   1.00 0.00 ? 8   SER A CB   4  
ATOM 5378  O OG   . SER A 1 8   ? 23.015  3.801   7.653   1.00 0.00 ? 8   SER A OG   4  
ATOM 5379  H H    . SER A 1 8   ? 25.029  2.385   4.350   1.00 0.00 ? 8   SER A H    4  
ATOM 5380  H HA   . SER A 1 8   ? 22.335  3.185   5.241   1.00 0.00 ? 8   SER A HA   4  
ATOM 5381  H HB2  . SER A 1 8   ? 23.863  2.081   6.958   1.00 0.00 ? 8   SER A HB2  4  
ATOM 5382  H HB3  . SER A 1 8   ? 24.870  3.525   6.848   1.00 0.00 ? 8   SER A HB3  4  
ATOM 5383  H HG   . SER A 1 8   ? 22.135  3.873   7.278   1.00 0.00 ? 8   SER A HG   4  
ATOM 5384  N N    . HIS A 1 9   ? 22.656  5.619   4.849   1.00 0.00 ? 9   HIS A N    4  
ATOM 5385  C CA   . HIS A 1 9   ? 22.801  7.016   4.456   1.00 0.00 ? 9   HIS A CA   4  
ATOM 5386  C C    . HIS A 1 9   ? 21.557  7.817   4.827   1.00 0.00 ? 9   HIS A C    4  
ATOM 5387  O O    . HIS A 1 9   ? 20.496  7.248   5.088   1.00 0.00 ? 9   HIS A O    4  
ATOM 5388  C CB   . HIS A 1 9   ? 23.060  7.121   2.953   1.00 0.00 ? 9   HIS A CB   4  
ATOM 5389  C CG   . HIS A 1 9   ? 21.920  6.631   2.113   1.00 0.00 ? 9   HIS A CG   4  
ATOM 5390  N ND1  . HIS A 1 9   ? 21.532  5.309   2.069   1.00 0.00 ? 9   HIS A ND1  4  
ATOM 5391  C CD2  . HIS A 1 9   ? 21.082  7.296   1.284   1.00 0.00 ? 9   HIS A CD2  4  
ATOM 5392  C CE1  . HIS A 1 9   ? 20.506  5.181   1.247   1.00 0.00 ? 9   HIS A CE1  4  
ATOM 5393  N NE2  . HIS A 1 9   ? 20.213  6.372   0.758   1.00 0.00 ? 9   HIS A NE2  4  
ATOM 5394  H H    . HIS A 1 9   ? 21.773  5.284   5.108   1.00 0.00 ? 9   HIS A H    4  
ATOM 5395  H HA   . HIS A 1 9   ? 23.648  7.423   4.988   1.00 0.00 ? 9   HIS A HA   4  
ATOM 5396  H HB2  . HIS A 1 9   ? 23.240  8.155   2.697   1.00 0.00 ? 9   HIS A HB2  4  
ATOM 5397  H HB3  . HIS A 1 9   ? 23.933  6.536   2.703   1.00 0.00 ? 9   HIS A HB3  4  
ATOM 5398  H HD2  . HIS A 1 9   ? 21.095  8.356   1.074   1.00 0.00 ? 9   HIS A HD2  4  
ATOM 5399  H HE1  . HIS A 1 9   ? 19.993  4.260   1.015   1.00 0.00 ? 9   HIS A HE1  4  
ATOM 5400  H HE2  . HIS A 1 9   ? 19.549  6.548   0.059   1.00 0.00 ? 9   HIS A HE2  4  
ATOM 5401  N N    . ASP A 1 10  ? 21.694  9.138   4.851   1.00 0.00 ? 10  ASP A N    4  
ATOM 5402  C CA   . ASP A 1 10  ? 20.581  10.016  5.190   1.00 0.00 ? 10  ASP A CA   4  
ATOM 5403  C C    . ASP A 1 10  ? 19.294  9.547   4.518   1.00 0.00 ? 10  ASP A C    4  
ATOM 5404  O O    . ASP A 1 10  ? 19.312  9.080   3.379   1.00 0.00 ? 10  ASP A O    4  
ATOM 5405  C CB   . ASP A 1 10  ? 20.893  11.455  4.774   1.00 0.00 ? 10  ASP A CB   4  
ATOM 5406  C CG   . ASP A 1 10  ? 22.216  11.944  5.330   1.00 0.00 ? 10  ASP A CG   4  
ATOM 5407  O OD1  . ASP A 1 10  ? 23.256  11.713  4.678   1.00 0.00 ? 10  ASP A OD1  4  
ATOM 5408  O OD2  . ASP A 1 10  ? 22.211  12.559  6.417   1.00 0.00 ? 10  ASP A OD2  4  
ATOM 5409  H H    . ASP A 1 10  ? 22.565  9.531   4.634   1.00 0.00 ? 10  ASP A H    4  
ATOM 5410  H HA   . ASP A 1 10  ? 20.446  9.983   6.260   1.00 0.00 ? 10  ASP A HA   4  
ATOM 5411  H HB2  . ASP A 1 10  ? 20.936  11.509  3.695   1.00 0.00 ? 10  ASP A HB2  4  
ATOM 5412  H HB3  . ASP A 1 10  ? 20.109  12.105  5.133   1.00 0.00 ? 10  ASP A HB3  4  
ATOM 5413  N N    . SER A 1 11  ? 18.180  9.675   5.231   1.00 0.00 ? 11  SER A N    4  
ATOM 5414  C CA   . SER A 1 11  ? 16.884  9.260   4.705   1.00 0.00 ? 11  SER A CA   4  
ATOM 5415  C C    . SER A 1 11  ? 16.064  10.468  4.265   1.00 0.00 ? 11  SER A C    4  
ATOM 5416  O O    . SER A 1 11  ? 15.453  10.462  3.196   1.00 0.00 ? 11  SER A O    4  
ATOM 5417  C CB   . SER A 1 11  ? 16.114  8.463   5.760   1.00 0.00 ? 11  SER A CB   4  
ATOM 5418  O OG   . SER A 1 11  ? 14.963  7.855   5.200   1.00 0.00 ? 11  SER A OG   4  
ATOM 5419  H H    . SER A 1 11  ? 18.231  10.055  6.133   1.00 0.00 ? 11  SER A H    4  
ATOM 5420  H HA   . SER A 1 11  ? 17.062  8.628   3.848   1.00 0.00 ? 11  SER A HA   4  
ATOM 5421  H HB2  . SER A 1 11  ? 16.753  7.692   6.163   1.00 0.00 ? 11  SER A HB2  4  
ATOM 5422  H HB3  . SER A 1 11  ? 15.806  9.127   6.555   1.00 0.00 ? 11  SER A HB3  4  
ATOM 5423  H HG   . SER A 1 11  ? 14.695  8.339   4.416   1.00 0.00 ? 11  SER A HG   4  
ATOM 5424  N N    . ARG A 1 12  ? 16.055  11.505  5.097   1.00 0.00 ? 12  ARG A N    4  
ATOM 5425  C CA   . ARG A 1 12  ? 15.309  12.720  4.795   1.00 0.00 ? 12  ARG A CA   4  
ATOM 5426  C C    . ARG A 1 12  ? 16.040  13.561  3.752   1.00 0.00 ? 12  ARG A C    4  
ATOM 5427  O O    . ARG A 1 12  ? 16.707  14.542  4.085   1.00 0.00 ? 12  ARG A O    4  
ATOM 5428  C CB   . ARG A 1 12  ? 15.095  13.542  6.068   1.00 0.00 ? 12  ARG A CB   4  
ATOM 5429  C CG   . ARG A 1 12  ? 14.202  14.755  5.867   1.00 0.00 ? 12  ARG A CG   4  
ATOM 5430  C CD   . ARG A 1 12  ? 12.731  14.370  5.865   1.00 0.00 ? 12  ARG A CD   4  
ATOM 5431  N NE   . ARG A 1 12  ? 12.324  13.756  7.126   1.00 0.00 ? 12  ARG A NE   4  
ATOM 5432  C CZ   . ARG A 1 12  ? 11.058  13.639  7.512   1.00 0.00 ? 12  ARG A CZ   4  
ATOM 5433  N NH1  . ARG A 1 12  ? 10.081  14.092  6.738   1.00 0.00 ? 12  ARG A NH1  4  
ATOM 5434  N NH2  . ARG A 1 12  ? 10.768  13.068  8.674   1.00 0.00 ? 12  ARG A NH2  4  
ATOM 5435  H H    . ARG A 1 12  ? 16.562  11.450  5.934   1.00 0.00 ? 12  ARG A H    4  
ATOM 5436  H HA   . ARG A 1 12  ? 14.348  12.430  4.398   1.00 0.00 ? 12  ARG A HA   4  
ATOM 5437  H HB2  . ARG A 1 12  ? 14.642  12.910  6.818   1.00 0.00 ? 12  ARG A HB2  4  
ATOM 5438  H HB3  . ARG A 1 12  ? 16.053  13.883  6.428   1.00 0.00 ? 12  ARG A HB3  4  
ATOM 5439  H HG2  . ARG A 1 12  ? 14.377  15.457  6.669   1.00 0.00 ? 12  ARG A HG2  4  
ATOM 5440  H HG3  . ARG A 1 12  ? 14.445  15.216  4.922   1.00 0.00 ? 12  ARG A HG3  4  
ATOM 5441  H HD2  . ARG A 1 12  ? 12.140  15.258  5.701   1.00 0.00 ? 12  ARG A HD2  4  
ATOM 5442  H HD3  . ARG A 1 12  ? 12.557  13.669  5.062   1.00 0.00 ? 12  ARG A HD3  4  
ATOM 5443  H HE   . ARG A 1 12  ? 13.030  13.415  7.713   1.00 0.00 ? 12  ARG A HE   4  
ATOM 5444  H HH11 . ARG A 1 12  ? 10.297  14.521  5.862   1.00 0.00 ? 12  ARG A HH11 4  
ATOM 5445  H HH12 . ARG A 1 12  ? 9.129   14.001  7.031   1.00 0.00 ? 12  ARG A HH12 4  
ATOM 5446  H HH21 . ARG A 1 12  ? 11.501  12.726  9.260   1.00 0.00 ? 12  ARG A HH21 4  
ATOM 5447  H HH22 . ARG A 1 12  ? 9.815   12.981  8.964   1.00 0.00 ? 12  ARG A HH22 4  
ATOM 5448  N N    . LEU A 1 13  ? 15.909  13.172  2.489   1.00 0.00 ? 13  LEU A N    4  
ATOM 5449  C CA   . LEU A 1 13  ? 16.556  13.889  1.396   1.00 0.00 ? 13  LEU A CA   4  
ATOM 5450  C C    . LEU A 1 13  ? 15.584  14.118  0.243   1.00 0.00 ? 13  LEU A C    4  
ATOM 5451  O O    . LEU A 1 13  ? 15.972  14.098  -0.925  1.00 0.00 ? 13  LEU A O    4  
ATOM 5452  C CB   . LEU A 1 13  ? 17.777  13.111  0.902   1.00 0.00 ? 13  LEU A CB   4  
ATOM 5453  C CG   . LEU A 1 13  ? 18.844  12.799  1.951   1.00 0.00 ? 13  LEU A CG   4  
ATOM 5454  C CD1  . LEU A 1 13  ? 19.902  11.869  1.376   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 5455  C CD2  . LEU A 1 13  ? 19.481  14.083  2.463   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 5456  H H    . LEU A 1 13  ? 15.365  12.383  2.285   1.00 0.00 ? 13  LEU A H    4  
ATOM 5457  H HA   . LEU A 1 13  ? 16.880  14.847  1.774   1.00 0.00 ? 13  LEU A HA   4  
ATOM 5458  H HB2  . LEU A 1 13  ? 17.429  12.173  0.495   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 5459  H HB3  . LEU A 1 13  ? 18.242  13.690  0.117   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 5460  H HG   . LEU A 1 13  ? 18.380  12.297  2.789   1.00 0.00 ? 13  LEU A HG   4  
ATOM 5461  H HD11 . LEU A 1 13  ? 19.674  10.851  1.651   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 5462  H HD12 . LEU A 1 13  ? 20.871  12.140  1.770   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 5463  H HD13 . LEU A 1 13  ? 19.914  11.959  0.300   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 5464  H HD21 . LEU A 1 13  ? 19.678  14.743  1.631   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 5465  H HD22 . LEU A 1 13  ? 20.408  13.849  2.965   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 5466  H HD23 . LEU A 1 13  ? 18.808  14.567  3.156   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 5467  N N    . THR A 1 14  ? 14.317  14.338  0.580   1.00 0.00 ? 14  THR A N    4  
ATOM 5468  C CA   . THR A 1 14  ? 13.288  14.572  -0.426  1.00 0.00 ? 14  THR A CA   4  
ATOM 5469  C C    . THR A 1 14  ? 12.249  15.569  0.072   1.00 0.00 ? 14  THR A C    4  
ATOM 5470  O O    . THR A 1 14  ? 11.478  15.273  0.984   1.00 0.00 ? 14  THR A O    4  
ATOM 5471  C CB   . THR A 1 14  ? 12.579  13.262  -0.820  1.00 0.00 ? 14  THR A CB   4  
ATOM 5472  O OG1  . THR A 1 14  ? 12.361  12.455  0.342   1.00 0.00 ? 14  THR A OG1  4  
ATOM 5473  C CG2  . THR A 1 14  ? 13.403  12.486  -1.836  1.00 0.00 ? 14  THR A CG2  4  
ATOM 5474  H H    . THR A 1 14  ? 14.069  14.341  1.528   1.00 0.00 ? 14  THR A H    4  
ATOM 5475  H HA   . THR A 1 14  ? 13.768  14.976  -1.306  1.00 0.00 ? 14  THR A HA   4  
ATOM 5476  H HB   . THR A 1 14  ? 11.625  13.507  -1.264  1.00 0.00 ? 14  THR A HB   4  
ATOM 5477  H HG1  . THR A 1 14  ? 12.580  12.960  1.129   1.00 0.00 ? 14  THR A HG1  4  
ATOM 5478  H HG21 . THR A 1 14  ? 14.182  11.940  -1.326  1.00 0.00 ? 14  THR A HG21 4  
ATOM 5479  H HG22 . THR A 1 14  ? 13.847  13.173  -2.541  1.00 0.00 ? 14  THR A HG22 4  
ATOM 5480  H HG23 . THR A 1 14  ? 12.764  11.793  -2.363  1.00 0.00 ? 14  THR A HG23 4  
ATOM 5481  N N    . ALA A 1 15  ? 12.233  16.752  -0.534  1.00 0.00 ? 15  ALA A N    4  
ATOM 5482  C CA   . ALA A 1 15  ? 11.286  17.793  -0.153  1.00 0.00 ? 15  ALA A CA   4  
ATOM 5483  C C    . ALA A 1 15  ? 10.098  17.831  -1.109  1.00 0.00 ? 15  ALA A C    4  
ATOM 5484  O O    . ALA A 1 15  ? 10.081  18.608  -2.062  1.00 0.00 ? 15  ALA A O    4  
ATOM 5485  C CB   . ALA A 1 15  ? 11.977  19.147  -0.113  1.00 0.00 ? 15  ALA A CB   4  
ATOM 5486  H H    . ALA A 1 15  ? 12.873  16.929  -1.254  1.00 0.00 ? 15  ALA A H    4  
ATOM 5487  H HA   . ALA A 1 15  ? 10.927  17.570  0.842   1.00 0.00 ? 15  ALA A HA   4  
ATOM 5488  H HB1  . ALA A 1 15  ? 11.264  19.922  -0.349  1.00 0.00 ? 15  ALA A HB1  4  
ATOM 5489  H HB2  . ALA A 1 15  ? 12.379  19.317  0.875   1.00 0.00 ? 15  ALA A HB2  4  
ATOM 5490  H HB3  . ALA A 1 15  ? 12.779  19.163  -0.836  1.00 0.00 ? 15  ALA A HB3  4  
ATOM 5491  N N    . GLY A 1 16  ? 9.106   16.985  -0.847  1.00 0.00 ? 16  GLY A N    4  
ATOM 5492  C CA   . GLY A 1 16  ? 7.929   16.938  -1.694  1.00 0.00 ? 16  GLY A CA   4  
ATOM 5493  C C    . GLY A 1 16  ? 7.457   15.520  -1.952  1.00 0.00 ? 16  GLY A C    4  
ATOM 5494  O O    . GLY A 1 16  ? 6.907   15.225  -3.013  1.00 0.00 ? 16  GLY A O    4  
ATOM 5495  H H    . GLY A 1 16  ? 9.175   16.388  -0.072  1.00 0.00 ? 16  GLY A H    4  
ATOM 5496  H HA2  . GLY A 1 16  ? 7.133   17.489  -1.216  1.00 0.00 ? 16  GLY A HA2  4  
ATOM 5497  H HA3  . GLY A 1 16  ? 8.161   17.405  -2.639  1.00 0.00 ? 16  GLY A HA3  4  
ATOM 5498  N N    . VAL A 1 17  ? 7.674   14.640  -0.981  1.00 0.00 ? 17  VAL A N    4  
ATOM 5499  C CA   . VAL A 1 17  ? 7.268   13.245  -1.108  1.00 0.00 ? 17  VAL A CA   4  
ATOM 5500  C C    . VAL A 1 17  ? 5.998   12.968  -0.312  1.00 0.00 ? 17  VAL A C    4  
ATOM 5501  O O    . VAL A 1 17  ? 5.706   13.625  0.687   1.00 0.00 ? 17  VAL A O    4  
ATOM 5502  C CB   . VAL A 1 17  ? 8.379   12.291  -0.631  1.00 0.00 ? 17  VAL A CB   4  
ATOM 5503  C CG1  . VAL A 1 17  ? 9.521   12.257  -1.635  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5504  C CG2  . VAL A 1 17  ? 8.879   12.702  0.745   1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5505  H H    . VAL A 1 17  ? 8.117   14.935  -0.158  1.00 0.00 ? 17  VAL A H    4  
ATOM 5506  H HA   . VAL A 1 17  ? 7.076   13.047  -2.153  1.00 0.00 ? 17  VAL A HA   4  
ATOM 5507  H HB   . VAL A 1 17  ? 7.964   11.296  -0.558  1.00 0.00 ? 17  VAL A HB   4  
ATOM 5508  H HG11 . VAL A 1 17  ? 10.407  11.865  -1.158  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5509  H HG12 . VAL A 1 17  ? 9.250   11.626  -2.468  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5510  H HG13 . VAL A 1 17  ? 9.718   13.258  -1.989  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5511  H HG21 . VAL A 1 17  ? 8.985   11.826  1.367   1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5512  H HG22 . VAL A 1 17  ? 9.835   13.194  0.648   1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5513  H HG23 . VAL A 1 17  ? 8.170   13.381  1.198   1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5514  N N    . PRO A 1 18  ? 5.223   11.969  -0.762  1.00 0.00 ? 18  PRO A N    4  
ATOM 5515  C CA   . PRO A 1 18  ? 3.972   11.581  -0.105  1.00 0.00 ? 18  PRO A CA   4  
ATOM 5516  C C    . PRO A 1 18  ? 4.209   10.918  1.248   1.00 0.00 ? 18  PRO A C    4  
ATOM 5517  O O    . PRO A 1 18  ? 4.735   9.807   1.322   1.00 0.00 ? 18  PRO A O    4  
ATOM 5518  C CB   . PRO A 1 18  ? 3.350   10.584  -1.087  1.00 0.00 ? 18  PRO A CB   4  
ATOM 5519  C CG   . PRO A 1 18  ? 4.506   10.028  -1.845  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5520  C CD   . PRO A 1 18  ? 5.510   11.143  -1.947  1.00 0.00 ? 18  PRO A CD   4  
ATOM 5521  H HA   . PRO A 1 18  ? 3.310   12.425  0.020   1.00 0.00 ? 18  PRO A HA   4  
ATOM 5522  H HB2  . PRO A 1 18  ? 2.828   9.813   -0.539  1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5523  H HB3  . PRO A 1 18  ? 2.662   11.099  -1.740  1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5524  H HG2  . PRO A 1 18  ? 4.928   9.191   -1.309  1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5525  H HG3  . PRO A 1 18  ? 4.186   9.721   -2.829  1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5526  H HD2  . PRO A 1 18  ? 6.515   10.750  -1.909  1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5527  H HD3  . PRO A 1 18  ? 5.357   11.707  -2.855  1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5528  N N    . ASP A 1 19  ? 3.816   11.605  2.314   1.00 0.00 ? 19  ASP A N    4  
ATOM 5529  C CA   . ASP A 1 19  ? 3.985   11.082  3.665   1.00 0.00 ? 19  ASP A CA   4  
ATOM 5530  C C    . ASP A 1 19  ? 3.305   9.724   3.811   1.00 0.00 ? 19  ASP A C    4  
ATOM 5531  O O    . ASP A 1 19  ? 2.383   9.396   3.064   1.00 0.00 ? 19  ASP A O    4  
ATOM 5532  C CB   . ASP A 1 19  ? 3.415   12.064  4.690   1.00 0.00 ? 19  ASP A CB   4  
ATOM 5533  C CG   . ASP A 1 19  ? 4.140   11.999  6.020   1.00 0.00 ? 19  ASP A CG   4  
ATOM 5534  O OD1  . ASP A 1 19  ? 5.310   12.432  6.080   1.00 0.00 ? 19  ASP A OD1  4  
ATOM 5535  O OD2  . ASP A 1 19  ? 3.537   11.516  7.001   1.00 0.00 ? 19  ASP A OD2  4  
ATOM 5536  H H    . ASP A 1 19  ? 3.403   12.486  2.191   1.00 0.00 ? 19  ASP A H    4  
ATOM 5537  H HA   . ASP A 1 19  ? 5.042   10.962  3.845   1.00 0.00 ? 19  ASP A HA   4  
ATOM 5538  H HB2  . ASP A 1 19  ? 3.501   13.069  4.303   1.00 0.00 ? 19  ASP A HB2  4  
ATOM 5539  H HB3  . ASP A 1 19  ? 2.372   11.836  4.857   1.00 0.00 ? 19  ASP A HB3  4  
ATOM 5540  N N    . THR A 1 20  ? 3.767   8.938   4.778   1.00 0.00 ? 20  THR A N    4  
ATOM 5541  C CA   . THR A 1 20  ? 3.206   7.615   5.020   1.00 0.00 ? 20  THR A CA   4  
ATOM 5542  C C    . THR A 1 20  ? 1.694   7.614   4.822   1.00 0.00 ? 20  THR A C    4  
ATOM 5543  O O    . THR A 1 20  ? 0.967   8.412   5.413   1.00 0.00 ? 20  THR A O    4  
ATOM 5544  C CB   . THR A 1 20  ? 3.526   7.120   6.443   1.00 0.00 ? 20  THR A CB   4  
ATOM 5545  O OG1  . THR A 1 20  ? 4.862   7.492   6.802   1.00 0.00 ? 20  THR A OG1  4  
ATOM 5546  C CG2  . THR A 1 20  ? 3.372   5.610   6.539   1.00 0.00 ? 20  THR A CG2  4  
ATOM 5547  H H    . THR A 1 20  ? 4.504   9.256   5.340   1.00 0.00 ? 20  THR A H    4  
ATOM 5548  H HA   . THR A 1 20  ? 3.652   6.929   4.314   1.00 0.00 ? 20  THR A HA   4  
ATOM 5549  H HB   . THR A 1 20  ? 2.835   7.583   7.133   1.00 0.00 ? 20  THR A HB   4  
ATOM 5550  H HG1  . THR A 1 20  ? 4.838   8.079   7.562   1.00 0.00 ? 20  THR A HG1  4  
ATOM 5551  H HG21 . THR A 1 20  ? 3.560   5.293   7.554   1.00 0.00 ? 20  THR A HG21 4  
ATOM 5552  H HG22 . THR A 1 20  ? 4.080   5.133   5.877   1.00 0.00 ? 20  THR A HG22 4  
ATOM 5553  H HG23 . THR A 1 20  ? 2.368   5.332   6.255   1.00 0.00 ? 20  THR A HG23 4  
ATOM 5554  N N    . PRO A 1 21  ? 1.208   6.697   3.973   1.00 0.00 ? 21  PRO A N    4  
ATOM 5555  C CA   . PRO A 1 21  ? -0.222  6.570   3.679   1.00 0.00 ? 21  PRO A CA   4  
ATOM 5556  C C    . PRO A 1 21  ? -1.012  6.030   4.866   1.00 0.00 ? 21  PRO A C    4  
ATOM 5557  O O    . PRO A 1 21  ? -0.591  5.079   5.525   1.00 0.00 ? 21  PRO A O    4  
ATOM 5558  C CB   . PRO A 1 21  ? -0.258  5.574   2.516   1.00 0.00 ? 21  PRO A CB   4  
ATOM 5559  C CG   . PRO A 1 21  ? 0.991   4.775   2.663   1.00 0.00 ? 21  PRO A CG   4  
ATOM 5560  C CD   . PRO A 1 21  ? 2.018   5.714   3.234   1.00 0.00 ? 21  PRO A CD   4  
ATOM 5561  H HA   . PRO A 1 21  ? -0.647  7.511   3.362   1.00 0.00 ? 21  PRO A HA   4  
ATOM 5562  H HB2  . PRO A 1 21  ? -1.138  4.952   2.599   1.00 0.00 ? 21  PRO A HB2  4  
ATOM 5563  H HB3  . PRO A 1 21  ? -0.276  6.110   1.579   1.00 0.00 ? 21  PRO A HB3  4  
ATOM 5564  H HG2  . PRO A 1 21  ? 0.821   3.950   3.337   1.00 0.00 ? 21  PRO A HG2  4  
ATOM 5565  H HG3  . PRO A 1 21  ? 1.310   4.414   1.696   1.00 0.00 ? 21  PRO A HG3  4  
ATOM 5566  H HD2  . PRO A 1 21  ? 2.684   5.184   3.899   1.00 0.00 ? 21  PRO A HD2  4  
ATOM 5567  H HD3  . PRO A 1 21  ? 2.574   6.191   2.441   1.00 0.00 ? 21  PRO A HD3  4  
ATOM 5568  N N    . THR A 1 22  ? -2.161  6.644   5.135   1.00 0.00 ? 22  THR A N    4  
ATOM 5569  C CA   . THR A 1 22  ? -3.009  6.226   6.244   1.00 0.00 ? 22  THR A CA   4  
ATOM 5570  C C    . THR A 1 22  ? -3.226  4.717   6.232   1.00 0.00 ? 22  THR A C    4  
ATOM 5571  O O    . THR A 1 22  ? -2.758  4.021   5.331   1.00 0.00 ? 22  THR A O    4  
ATOM 5572  C CB   . THR A 1 22  ? -4.378  6.930   6.200   1.00 0.00 ? 22  THR A CB   4  
ATOM 5573  O OG1  . THR A 1 22  ? -4.246  8.222   5.597   1.00 0.00 ? 22  THR A OG1  4  
ATOM 5574  C CG2  . THR A 1 22  ? -4.958  7.075   7.599   1.00 0.00 ? 22  THR A CG2  4  
ATOM 5575  H H    . THR A 1 22  ? -2.442  7.396   4.573   1.00 0.00 ? 22  THR A H    4  
ATOM 5576  H HA   . THR A 1 22  ? -2.515  6.502   7.164   1.00 0.00 ? 22  THR A HA   4  
ATOM 5577  H HB   . THR A 1 22  ? -5.055  6.332   5.606   1.00 0.00 ? 22  THR A HB   4  
ATOM 5578  H HG1  . THR A 1 22  ? -4.219  8.128   4.641   1.00 0.00 ? 22  THR A HG1  4  
ATOM 5579  H HG21 . THR A 1 22  ? -4.164  6.998   8.326   1.00 0.00 ? 22  THR A HG21 4  
ATOM 5580  H HG22 . THR A 1 22  ? -5.682  6.293   7.772   1.00 0.00 ? 22  THR A HG22 4  
ATOM 5581  H HG23 . THR A 1 22  ? -5.438  8.038   7.691   1.00 0.00 ? 22  THR A HG23 4  
ATOM 5582  N N    . ARG A 1 23  ? -3.939  4.218   7.237   1.00 0.00 ? 23  ARG A N    4  
ATOM 5583  C CA   . ARG A 1 23  ? -4.217  2.791   7.341   1.00 0.00 ? 23  ARG A CA   4  
ATOM 5584  C C    . ARG A 1 23  ? -4.895  2.275   6.075   1.00 0.00 ? 23  ARG A C    4  
ATOM 5585  O O    . ARG A 1 23  ? -5.434  3.052   5.286   1.00 0.00 ? 23  ARG A O    4  
ATOM 5586  C CB   . ARG A 1 23  ? -5.102  2.510   8.557   1.00 0.00 ? 23  ARG A CB   4  
ATOM 5587  C CG   . ARG A 1 23  ? -6.491  3.117   8.453   1.00 0.00 ? 23  ARG A CG   4  
ATOM 5588  C CD   . ARG A 1 23  ? -7.282  2.923   9.737   1.00 0.00 ? 23  ARG A CD   4  
ATOM 5589  N NE   . ARG A 1 23  ? -7.019  3.982   10.707  1.00 0.00 ? 23  ARG A NE   4  
ATOM 5590  C CZ   . ARG A 1 23  ? -7.856  4.306   11.686  1.00 0.00 ? 23  ARG A CZ   4  
ATOM 5591  N NH1  . ARG A 1 23  ? -9.003  3.655   11.825  1.00 0.00 ? 23  ARG A NH1  4  
ATOM 5592  N NH2  . ARG A 1 23  ? -7.547  5.282   12.530  1.00 0.00 ? 23  ARG A NH2  4  
ATOM 5593  H H    . ARG A 1 23  ? -4.285  4.824   7.925   1.00 0.00 ? 23  ARG A H    4  
ATOM 5594  H HA   . ARG A 1 23  ? -3.275  2.278   7.466   1.00 0.00 ? 23  ARG A HA   4  
ATOM 5595  H HB2  . ARG A 1 23  ? -5.207  1.441   8.672   1.00 0.00 ? 23  ARG A HB2  4  
ATOM 5596  H HB3  . ARG A 1 23  ? -4.622  2.913   9.437   1.00 0.00 ? 23  ARG A HB3  4  
ATOM 5597  H HG2  . ARG A 1 23  ? -6.398  4.175   8.257   1.00 0.00 ? 23  ARG A HG2  4  
ATOM 5598  H HG3  . ARG A 1 23  ? -7.020  2.643   7.639   1.00 0.00 ? 23  ARG A HG3  4  
ATOM 5599  H HD2  . ARG A 1 23  ? -8.335  2.919   9.499   1.00 0.00 ? 23  ARG A HD2  4  
ATOM 5600  H HD3  . ARG A 1 23  ? -7.008  1.973   10.172  1.00 0.00 ? 23  ARG A HD3  4  
ATOM 5601  H HE   . ARG A 1 23  ? -6.178  4.476   10.623  1.00 0.00 ? 23  ARG A HE   4  
ATOM 5602  H HH11 . ARG A 1 23  ? -9.239  2.918   11.191  1.00 0.00 ? 23  ARG A HH11 4  
ATOM 5603  H HH12 . ARG A 1 23  ? -9.631  3.900   12.564  1.00 0.00 ? 23  ARG A HH12 4  
ATOM 5604  H HH21 . ARG A 1 23  ? -6.683  5.775   12.429  1.00 0.00 ? 23  ARG A HH21 4  
ATOM 5605  H HH22 . ARG A 1 23  ? -8.177  5.525   13.266  1.00 0.00 ? 23  ARG A HH22 4  
ATOM 5606  N N    . LEU A 1 24  ? -4.864  0.960   5.888   1.00 0.00 ? 24  LEU A N    4  
ATOM 5607  C CA   . LEU A 1 24  ? -5.475  0.340   4.717   1.00 0.00 ? 24  LEU A CA   4  
ATOM 5608  C C    . LEU A 1 24  ? -6.827  -0.271  5.069   1.00 0.00 ? 24  LEU A C    4  
ATOM 5609  O O    . LEU A 1 24  ? -7.163  -0.429  6.243   1.00 0.00 ? 24  LEU A O    4  
ATOM 5610  C CB   . LEU A 1 24  ? -4.550  -0.736  4.145   1.00 0.00 ? 24  LEU A CB   4  
ATOM 5611  C CG   . LEU A 1 24  ? -3.051  -0.510  4.347   1.00 0.00 ? 24  LEU A CG   4  
ATOM 5612  C CD1  . LEU A 1 24  ? -2.254  -1.671  3.774   1.00 0.00 ? 24  LEU A CD1  4  
ATOM 5613  C CD2  . LEU A 1 24  ? -2.619  0.802   3.710   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 5614  H H    . LEU A 1 24  ? -4.419  0.393   6.551   1.00 0.00 ? 24  LEU A H    4  
ATOM 5615  H HA   . LEU A 1 24  ? -5.623  1.109   3.974   1.00 0.00 ? 24  LEU A HA   4  
ATOM 5616  H HB2  . LEU A 1 24  ? -4.808  -1.675  4.609   1.00 0.00 ? 24  LEU A HB2  4  
ATOM 5617  H HB3  . LEU A 1 24  ? -4.736  -0.799  3.082   1.00 0.00 ? 24  LEU A HB3  4  
ATOM 5618  H HG   . LEU A 1 24  ? -2.842  -0.453  5.407   1.00 0.00 ? 24  LEU A HG   4  
ATOM 5619  H HD11 . LEU A 1 24  ? -2.523  -2.581  4.289   1.00 0.00 ? 24  LEU A HD11 4  
ATOM 5620  H HD12 . LEU A 1 24  ? -1.199  -1.482  3.904   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 5621  H HD13 . LEU A 1 24  ? -2.474  -1.774  2.722   1.00 0.00 ? 24  LEU A HD13 4  
ATOM 5622  H HD21 . LEU A 1 24  ? -3.451  1.233   3.173   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 5623  H HD22 . LEU A 1 24  ? -1.805  0.618   3.024   1.00 0.00 ? 24  LEU A HD22 4  
ATOM 5624  H HD23 . LEU A 1 24  ? -2.293  1.487   4.480   1.00 0.00 ? 24  LEU A HD23 4  
ATOM 5625  N N    . VAL A 1 25  ? -7.600  -0.615  4.043   1.00 0.00 ? 25  VAL A N    4  
ATOM 5626  C CA   . VAL A 1 25  ? -8.915  -1.212  4.244   1.00 0.00 ? 25  VAL A CA   4  
ATOM 5627  C C    . VAL A 1 25  ? -9.081  -2.472  3.401   1.00 0.00 ? 25  VAL A C    4  
ATOM 5628  O O    . VAL A 1 25  ? -9.026  -2.422  2.172   1.00 0.00 ? 25  VAL A O    4  
ATOM 5629  C CB   . VAL A 1 25  ? -10.041 -0.221  3.892   1.00 0.00 ? 25  VAL A CB   4  
ATOM 5630  C CG1  . VAL A 1 25  ? -11.347 -0.961  3.648   1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5631  C CG2  . VAL A 1 25  ? -10.203 0.814   4.995   1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5632  H H    . VAL A 1 25  ? -7.277  -0.465  3.130   1.00 0.00 ? 25  VAL A H    4  
ATOM 5633  H HA   . VAL A 1 25  ? -9.008  -1.474  5.288   1.00 0.00 ? 25  VAL A HA   4  
ATOM 5634  H HB   . VAL A 1 25  ? -9.769  0.293   2.982   1.00 0.00 ? 25  VAL A HB   4  
ATOM 5635  H HG11 . VAL A 1 25  ? -12.155 -0.433  4.132   1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5636  H HG12 . VAL A 1 25  ? -11.537 -1.017  2.586   1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5637  H HG13 . VAL A 1 25  ? -11.276 -1.960  4.054   1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5638  H HG21 . VAL A 1 25  ? -9.264  1.322   5.153   1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5639  H HG22 . VAL A 1 25  ? -10.957 1.531   4.707   1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5640  H HG23 . VAL A 1 25  ? -10.504 0.322   5.909   1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5641  N N    . PHE A 1 26  ? -9.284  -3.602  4.071   1.00 0.00 ? 26  PHE A N    4  
ATOM 5642  C CA   . PHE A 1 26  ? -9.458  -4.876  3.384   1.00 0.00 ? 26  PHE A CA   4  
ATOM 5643  C C    . PHE A 1 26  ? -10.934 -5.256  3.306   1.00 0.00 ? 26  PHE A C    4  
ATOM 5644  O O    . PHE A 1 26  ? -11.667 -5.148  4.289   1.00 0.00 ? 26  PHE A O    4  
ATOM 5645  C CB   . PHE A 1 26  ? -8.674  -5.977  4.102   1.00 0.00 ? 26  PHE A CB   4  
ATOM 5646  C CG   . PHE A 1 26  ? -7.234  -5.626  4.347   1.00 0.00 ? 26  PHE A CG   4  
ATOM 5647  C CD1  . PHE A 1 26  ? -6.857  -4.958  5.501   1.00 0.00 ? 26  PHE A CD1  4  
ATOM 5648  C CD2  . PHE A 1 26  ? -6.258  -5.963  3.423   1.00 0.00 ? 26  PHE A CD2  4  
ATOM 5649  C CE1  . PHE A 1 26  ? -5.533  -4.633  5.729   1.00 0.00 ? 26  PHE A CE1  4  
ATOM 5650  C CE2  . PHE A 1 26  ? -4.933  -5.641  3.646   1.00 0.00 ? 26  PHE A CE2  4  
ATOM 5651  C CZ   . PHE A 1 26  ? -4.570  -4.975  4.800   1.00 0.00 ? 26  PHE A CZ   4  
ATOM 5652  H H    . PHE A 1 26  ? -9.318  -3.578  5.050   1.00 0.00 ? 26  PHE A H    4  
ATOM 5653  H HA   . PHE A 1 26  ? -9.073  -4.767  2.382   1.00 0.00 ? 26  PHE A HA   4  
ATOM 5654  H HB2  . PHE A 1 26  ? -9.135  -6.172  5.059   1.00 0.00 ? 26  PHE A HB2  4  
ATOM 5655  H HB3  . PHE A 1 26  ? -8.701  -6.876  3.504   1.00 0.00 ? 26  PHE A HB3  4  
ATOM 5656  H HD1  . PHE A 1 26  ? -7.611  -4.690  6.228   1.00 0.00 ? 26  PHE A HD1  4  
ATOM 5657  H HD2  . PHE A 1 26  ? -6.541  -6.483  2.519   1.00 0.00 ? 26  PHE A HD2  4  
ATOM 5658  H HE1  . PHE A 1 26  ? -5.253  -4.112  6.633   1.00 0.00 ? 26  PHE A HE1  4  
ATOM 5659  H HE2  . PHE A 1 26  ? -4.182  -5.909  2.918   1.00 0.00 ? 26  PHE A HE2  4  
ATOM 5660  H HZ   . PHE A 1 26  ? -3.535  -4.723  4.978   1.00 0.00 ? 26  PHE A HZ   4  
ATOM 5661  N N    . SER A 1 27  ? -11.363 -5.700  2.129   1.00 0.00 ? 27  SER A N    4  
ATOM 5662  C CA   . SER A 1 27  ? -12.752 -6.092  1.920   1.00 0.00 ? 27  SER A CA   4  
ATOM 5663  C C    . SER A 1 27  ? -12.913 -7.605  2.031   1.00 0.00 ? 27  SER A C    4  
ATOM 5664  O O    . SER A 1 27  ? -13.889 -8.096  2.596   1.00 0.00 ? 27  SER A O    4  
ATOM 5665  C CB   . SER A 1 27  ? -13.237 -5.615  0.550   1.00 0.00 ? 27  SER A CB   4  
ATOM 5666  O OG   . SER A 1 27  ? -14.647 -5.719  0.443   1.00 0.00 ? 27  SER A OG   4  
ATOM 5667  H H    . SER A 1 27  ? -10.730 -5.764  1.383   1.00 0.00 ? 27  SER A H    4  
ATOM 5668  H HA   . SER A 1 27  ? -13.348 -5.621  2.687   1.00 0.00 ? 27  SER A HA   4  
ATOM 5669  H HB2  . SER A 1 27  ? -12.953 -4.584  0.408   1.00 0.00 ? 27  SER A HB2  4  
ATOM 5670  H HB3  . SER A 1 27  ? -12.784 -6.222  -0.221  1.00 0.00 ? 27  SER A HB3  4  
ATOM 5671  H HG   . SER A 1 27  ? -14.891 -6.639  0.320   1.00 0.00 ? 27  SER A HG   4  
ATOM 5672  N N    . ALA A 1 28  ? -11.946 -8.338  1.488   1.00 0.00 ? 28  ALA A N    4  
ATOM 5673  C CA   . ALA A 1 28  ? -11.978 -9.794  1.527   1.00 0.00 ? 28  ALA A CA   4  
ATOM 5674  C C    . ALA A 1 28  ? -13.180 -10.338 0.762   1.00 0.00 ? 28  ALA A C    4  
ATOM 5675  O O    . ALA A 1 28  ? -13.982 -11.099 1.305   1.00 0.00 ? 28  ALA A O    4  
ATOM 5676  C CB   . ALA A 1 28  ? -12.002 -10.283 2.968   1.00 0.00 ? 28  ALA A CB   4  
ATOM 5677  H H    . ALA A 1 28  ? -11.193 -7.888  1.052   1.00 0.00 ? 28  ALA A H    4  
ATOM 5678  H HA   . ALA A 1 28  ? -11.073 -10.161 1.064   1.00 0.00 ? 28  ALA A HA   4  
ATOM 5679  H HB1  . ALA A 1 28  ? -12.288 -11.324 2.990   1.00 0.00 ? 28  ALA A HB1  4  
ATOM 5680  H HB2  . ALA A 1 28  ? -11.019 -10.170 3.402   1.00 0.00 ? 28  ALA A HB2  4  
ATOM 5681  H HB3  . ALA A 1 28  ? -12.715 -9.701  3.533   1.00 0.00 ? 28  ALA A HB3  4  
ATOM 5682  N N    . LEU A 1 29  ? -13.299 -9.942  -0.501  1.00 0.00 ? 29  LEU A N    4  
ATOM 5683  C CA   . LEU A 1 29  ? -14.405 -10.390 -1.341  1.00 0.00 ? 29  LEU A CA   4  
ATOM 5684  C C    . LEU A 1 29  ? -14.635 -11.889 -1.185  1.00 0.00 ? 29  LEU A C    4  
ATOM 5685  O O    . LEU A 1 29  ? -15.752 -12.377 -1.353  1.00 0.00 ? 29  LEU A O    4  
ATOM 5686  C CB   . LEU A 1 29  ? -14.124 -10.056 -2.807  1.00 0.00 ? 29  LEU A CB   4  
ATOM 5687  C CG   . LEU A 1 29  ? -13.948 -8.573  -3.136  1.00 0.00 ? 29  LEU A CG   4  
ATOM 5688  C CD1  . LEU A 1 29  ? -14.770 -7.714  -2.186  1.00 0.00 ? 29  LEU A CD1  4  
ATOM 5689  C CD2  . LEU A 1 29  ? -12.479 -8.183  -3.074  1.00 0.00 ? 29  LEU A CD2  4  
ATOM 5690  H H    . LEU A 1 29  ? -12.629 -9.336  -0.877  1.00 0.00 ? 29  LEU A H    4  
ATOM 5691  H HA   . LEU A 1 29  ? -15.294 -9.866  -1.025  1.00 0.00 ? 29  LEU A HA   4  
ATOM 5692  H HB2  . LEU A 1 29  ? -13.219 -10.567 -3.095  1.00 0.00 ? 29  LEU A HB2  4  
ATOM 5693  H HB3  . LEU A 1 29  ? -14.950 -10.430 -3.395  1.00 0.00 ? 29  LEU A HB3  4  
ATOM 5694  H HG   . LEU A 1 29  ? -14.302 -8.389  -4.141  1.00 0.00 ? 29  LEU A HG   4  
ATOM 5695  H HD11 . LEU A 1 29  ? -15.817 -7.951  -2.302  1.00 0.00 ? 29  LEU A HD11 4  
ATOM 5696  H HD12 . LEU A 1 29  ? -14.609 -6.671  -2.413  1.00 0.00 ? 29  LEU A HD12 4  
ATOM 5697  H HD13 . LEU A 1 29  ? -14.466 -7.912  -1.169  1.00 0.00 ? 29  LEU A HD13 4  
ATOM 5698  H HD21 . LEU A 1 29  ? -12.107 -8.018  -4.074  1.00 0.00 ? 29  LEU A HD21 4  
ATOM 5699  H HD22 . LEU A 1 29  ? -11.916 -8.977  -2.606  1.00 0.00 ? 29  LEU A HD22 4  
ATOM 5700  H HD23 . LEU A 1 29  ? -12.371 -7.277  -2.495  1.00 0.00 ? 29  LEU A HD23 4  
ATOM 5701  N N    . GLY A 1 30  ? -13.570 -12.616 -0.859  1.00 0.00 ? 30  GLY A N    4  
ATOM 5702  C CA   . GLY A 1 30  ? -13.678 -14.053 -0.683  1.00 0.00 ? 30  GLY A CA   4  
ATOM 5703  C C    . GLY A 1 30  ? -12.451 -14.650 -0.024  1.00 0.00 ? 30  GLY A C    4  
ATOM 5704  O O    . GLY A 1 30  ? -11.598 -13.939 0.509   1.00 0.00 ? 30  GLY A O    4  
ATOM 5705  H H    . GLY A 1 30  ? -12.705 -12.173 -0.738  1.00 0.00 ? 30  GLY A H    4  
ATOM 5706  H HA2  . GLY A 1 30  ? -14.542 -14.266 -0.072  1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5707  H HA3  . GLY A 1 30  ? -13.813 -14.513 -1.651  1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5708  N N    . PRO A 1 31  ? -12.350 -15.987 -0.053  1.00 0.00 ? 31  PRO A N    4  
ATOM 5709  C CA   . PRO A 1 31  ? -11.223 -16.709 0.543   1.00 0.00 ? 31  PRO A CA   4  
ATOM 5710  C C    . PRO A 1 31  ? -9.925  -16.497 -0.230  1.00 0.00 ? 31  PRO A C    4  
ATOM 5711  O O    . PRO A 1 31  ? -8.834  -16.560 0.338   1.00 0.00 ? 31  PRO A O    4  
ATOM 5712  C CB   . PRO A 1 31  ? -11.658 -18.175 0.464   1.00 0.00 ? 31  PRO A CB   4  
ATOM 5713  C CG   . PRO A 1 31  ? -12.621 -18.223 -0.672  1.00 0.00 ? 31  PRO A CG   4  
ATOM 5714  C CD   . PRO A 1 31  ? -13.330 -16.897 -0.671  1.00 0.00 ? 31  PRO A CD   4  
ATOM 5715  H HA   . PRO A 1 31  ? -11.075 -16.431 1.576   1.00 0.00 ? 31  PRO A HA   4  
ATOM 5716  H HB2  . PRO A 1 31  ? -10.796 -18.800 0.279   1.00 0.00 ? 31  PRO A HB2  4  
ATOM 5717  H HB3  . PRO A 1 31  ? -12.128 -18.465 1.391   1.00 0.00 ? 31  PRO A HB3  4  
ATOM 5718  H HG2  . PRO A 1 31  ? -12.087 -18.362 -1.600  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 5719  H HG3  . PRO A 1 31  ? -13.327 -19.026 -0.520  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 5720  H HD2  . PRO A 1 31  ? -13.558 -16.590 -1.681  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 5721  H HD3  . PRO A 1 31  ? -14.231 -16.952 -0.078  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 5722  N N    . THR A 1 32  ? -10.050 -16.244 -1.529  1.00 0.00 ? 32  THR A N    4  
ATOM 5723  C CA   . THR A 1 32  ? -8.887  -16.023 -2.380  1.00 0.00 ? 32  THR A CA   4  
ATOM 5724  C C    . THR A 1 32  ? -8.957  -14.663 -3.065  1.00 0.00 ? 32  THR A C    4  
ATOM 5725  O O    . THR A 1 32  ? -8.310  -14.438 -4.087  1.00 0.00 ? 32  THR A O    4  
ATOM 5726  C CB   . THR A 1 32  ? -8.759  -17.120 -3.453  1.00 0.00 ? 32  THR A CB   4  
ATOM 5727  O OG1  . THR A 1 32  ? -9.994  -17.253 -4.167  1.00 0.00 ? 32  THR A OG1  4  
ATOM 5728  C CG2  . THR A 1 32  ? -8.386  -18.453 -2.823  1.00 0.00 ? 32  THR A CG2  4  
ATOM 5729  H H    . THR A 1 32  ? -10.946 -16.207 -1.924  1.00 0.00 ? 32  THR A H    4  
ATOM 5730  H HA   . THR A 1 32  ? -8.006  -16.056 -1.755  1.00 0.00 ? 32  THR A HA   4  
ATOM 5731  H HB   . THR A 1 32  ? -7.981  -16.836 -4.146  1.00 0.00 ? 32  THR A HB   4  
ATOM 5732  H HG1  . THR A 1 32  ? -9.818  -17.574 -5.054  1.00 0.00 ? 32  THR A HG1  4  
ATOM 5733  H HG21 . THR A 1 32  ? -8.353  -18.347 -1.749  1.00 0.00 ? 32  THR A HG21 4  
ATOM 5734  H HG22 . THR A 1 32  ? -7.416  -18.763 -3.183  1.00 0.00 ? 32  THR A HG22 4  
ATOM 5735  H HG23 . THR A 1 32  ? -9.122  -19.197 -3.089  1.00 0.00 ? 32  THR A HG23 4  
ATOM 5736  N N    . SER A 1 33  ? -9.748  -13.759 -2.495  1.00 0.00 ? 33  SER A N    4  
ATOM 5737  C CA   . SER A 1 33  ? -9.905  -12.421 -3.053  1.00 0.00 ? 33  SER A CA   4  
ATOM 5738  C C    . SER A 1 33  ? -9.892  -11.367 -1.950  1.00 0.00 ? 33  SER A C    4  
ATOM 5739  O O    . SER A 1 33  ? -10.352 -11.614 -0.834  1.00 0.00 ? 33  SER A O    4  
ATOM 5740  C CB   . SER A 1 33  ? -11.209 -12.328 -3.848  1.00 0.00 ? 33  SER A CB   4  
ATOM 5741  O OG   . SER A 1 33  ? -12.223 -13.125 -3.261  1.00 0.00 ? 33  SER A OG   4  
ATOM 5742  H H    . SER A 1 33  ? -10.239 -13.999 -1.681  1.00 0.00 ? 33  SER A H    4  
ATOM 5743  H HA   . SER A 1 33  ? -9.074  -12.240 -3.718  1.00 0.00 ? 33  SER A HA   4  
ATOM 5744  H HB2  . SER A 1 33  ? -11.542 -11.301 -3.870  1.00 0.00 ? 33  SER A HB2  4  
ATOM 5745  H HB3  . SER A 1 33  ? -11.037 -12.671 -4.858  1.00 0.00 ? 33  SER A HB3  4  
ATOM 5746  H HG   . SER A 1 33  ? -12.729 -12.594 -2.642  1.00 0.00 ? 33  SER A HG   4  
ATOM 5747  N N    . LEU A 1 34  ? -9.363  -10.192 -2.270  1.00 0.00 ? 34  LEU A N    4  
ATOM 5748  C CA   . LEU A 1 34  ? -9.289  -9.098  -1.307  1.00 0.00 ? 34  LEU A CA   4  
ATOM 5749  C C    . LEU A 1 34  ? -9.272  -7.748  -2.017  1.00 0.00 ? 34  LEU A C    4  
ATOM 5750  O O    . LEU A 1 34  ? -9.054  -7.674  -3.226  1.00 0.00 ? 34  LEU A O    4  
ATOM 5751  C CB   . LEU A 1 34  ? -8.042  -9.245  -0.434  1.00 0.00 ? 34  LEU A CB   4  
ATOM 5752  C CG   . LEU A 1 34  ? -8.220  -10.033 0.864   1.00 0.00 ? 34  LEU A CG   4  
ATOM 5753  C CD1  . LEU A 1 34  ? -6.931  -10.749 1.235   1.00 0.00 ? 34  LEU A CD1  4  
ATOM 5754  C CD2  . LEU A 1 34  ? -8.663  -9.111  1.991   1.00 0.00 ? 34  LEU A CD2  4  
ATOM 5755  H H    . LEU A 1 34  ? -9.013  -10.055 -3.175  1.00 0.00 ? 34  LEU A H    4  
ATOM 5756  H HA   . LEU A 1 34  ? -10.167 -9.150  -0.680  1.00 0.00 ? 34  LEU A HA   4  
ATOM 5757  H HB2  . LEU A 1 34  ? -7.284  -9.741  -1.020  1.00 0.00 ? 34  LEU A HB2  4  
ATOM 5758  H HB3  . LEU A 1 34  ? -7.702  -8.252  -0.175  1.00 0.00 ? 34  LEU A HB3  4  
ATOM 5759  H HG   . LEU A 1 34  ? -8.988  -10.781 0.721   1.00 0.00 ? 34  LEU A HG   4  
ATOM 5760  H HD11 . LEU A 1 34  ? -6.772  -11.576 0.559   1.00 0.00 ? 34  LEU A HD11 4  
ATOM 5761  H HD12 . LEU A 1 34  ? -7.004  -11.120 2.247   1.00 0.00 ? 34  LEU A HD12 4  
ATOM 5762  H HD13 . LEU A 1 34  ? -6.103  -10.060 1.163   1.00 0.00 ? 34  LEU A HD13 4  
ATOM 5763  H HD21 . LEU A 1 34  ? -9.715  -9.260  2.186   1.00 0.00 ? 34  LEU A HD21 4  
ATOM 5764  H HD22 . LEU A 1 34  ? -8.492  -8.084  1.704   1.00 0.00 ? 34  LEU A HD22 4  
ATOM 5765  H HD23 . LEU A 1 34  ? -8.096  -9.334  2.883   1.00 0.00 ? 34  LEU A HD23 4  
ATOM 5766  N N    . ARG A 1 35  ? -9.500  -6.682  -1.256  1.00 0.00 ? 35  ARG A N    4  
ATOM 5767  C CA   . ARG A 1 35  ? -9.509  -5.335  -1.812  1.00 0.00 ? 35  ARG A CA   4  
ATOM 5768  C C    . ARG A 1 35  ? -8.926  -4.333  -0.820  1.00 0.00 ? 35  ARG A C    4  
ATOM 5769  O O    . ARG A 1 35  ? -9.555  -4.001  0.185   1.00 0.00 ? 35  ARG A O    4  
ATOM 5770  C CB   . ARG A 1 35  ? -10.934 -4.925  -2.189  1.00 0.00 ? 35  ARG A CB   4  
ATOM 5771  C CG   . ARG A 1 35  ? -11.029 -3.533  -2.791  1.00 0.00 ? 35  ARG A CG   4  
ATOM 5772  C CD   . ARG A 1 35  ? -12.428 -2.955  -2.642  1.00 0.00 ? 35  ARG A CD   4  
ATOM 5773  N NE   . ARG A 1 35  ? -12.550 -1.647  -3.279  1.00 0.00 ? 35  ARG A NE   4  
ATOM 5774  C CZ   . ARG A 1 35  ? -12.815 -1.479  -4.570  1.00 0.00 ? 35  ARG A CZ   4  
ATOM 5775  N NH1  . ARG A 1 35  ? -12.984 -2.533  -5.357  1.00 0.00 ? 35  ARG A NH1  4  
ATOM 5776  N NH2  . ARG A 1 35  ? -12.911 -0.256  -5.075  1.00 0.00 ? 35  ARG A NH2  4  
ATOM 5777  H H    . ARG A 1 35  ? -9.667  -6.806  -0.298  1.00 0.00 ? 35  ARG A H    4  
ATOM 5778  H HA   . ARG A 1 35  ? -8.898  -5.339  -2.702  1.00 0.00 ? 35  ARG A HA   4  
ATOM 5779  H HB2  . ARG A 1 35  ? -11.321 -5.631  -2.909  1.00 0.00 ? 35  ARG A HB2  4  
ATOM 5780  H HB3  . ARG A 1 35  ? -11.550 -4.953  -1.302  1.00 0.00 ? 35  ARG A HB3  4  
ATOM 5781  H HG2  . ARG A 1 35  ? -10.328 -2.884  -2.286  1.00 0.00 ? 35  ARG A HG2  4  
ATOM 5782  H HG3  . ARG A 1 35  ? -10.780 -3.587  -3.840  1.00 0.00 ? 35  ARG A HG3  4  
ATOM 5783  H HD2  . ARG A 1 35  ? -13.133 -3.634  -3.098  1.00 0.00 ? 35  ARG A HD2  4  
ATOM 5784  H HD3  . ARG A 1 35  ? -12.652 -2.857  -1.590  1.00 0.00 ? 35  ARG A HD3  4  
ATOM 5785  H HE   . ARG A 1 35  ? -12.429 -0.855  -2.715  1.00 0.00 ? 35  ARG A HE   4  
ATOM 5786  H HH11 . ARG A 1 35  ? -12.913 -3.455  -4.978  1.00 0.00 ? 35  ARG A HH11 4  
ATOM 5787  H HH12 . ARG A 1 35  ? -13.184 -2.404  -6.329  1.00 0.00 ? 35  ARG A HH12 4  
ATOM 5788  H HH21 . ARG A 1 35  ? -12.784 0.540   -4.485  1.00 0.00 ? 35  ARG A HH21 4  
ATOM 5789  H HH22 . ARG A 1 35  ? -13.110 -0.131  -6.047  1.00 0.00 ? 35  ARG A HH22 4  
ATOM 5790  N N    . VAL A 1 36  ? -7.720  -3.855  -1.108  1.00 0.00 ? 36  VAL A N    4  
ATOM 5791  C CA   . VAL A 1 36  ? -7.052  -2.892  -0.242  1.00 0.00 ? 36  VAL A CA   4  
ATOM 5792  C C    . VAL A 1 36  ? -7.288  -1.464  -0.723  1.00 0.00 ? 36  VAL A C    4  
ATOM 5793  O O    . VAL A 1 36  ? -7.126  -1.162  -1.905  1.00 0.00 ? 36  VAL A O    4  
ATOM 5794  C CB   . VAL A 1 36  ? -5.536  -3.155  -0.174  1.00 0.00 ? 36  VAL A CB   4  
ATOM 5795  C CG1  . VAL A 1 36  ? -4.804  -1.930  0.355   1.00 0.00 ? 36  VAL A CG1  4  
ATOM 5796  C CG2  . VAL A 1 36  ? -5.245  -4.373  0.689   1.00 0.00 ? 36  VAL A CG2  4  
ATOM 5797  H H    . VAL A 1 36  ? -7.269  -4.158  -1.924  1.00 0.00 ? 36  VAL A H    4  
ATOM 5798  H HA   . VAL A 1 36  ? -7.460  -2.998  0.753   1.00 0.00 ? 36  VAL A HA   4  
ATOM 5799  H HB   . VAL A 1 36  ? -5.180  -3.355  -1.174  1.00 0.00 ? 36  VAL A HB   4  
ATOM 5800  H HG11 . VAL A 1 36  ? -3.744  -2.134  0.395   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 5801  H HG12 . VAL A 1 36  ? -4.987  -1.091  -0.300  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 5802  H HG13 . VAL A 1 36  ? -5.163  -1.698  1.347   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 5803  H HG21 . VAL A 1 36  ? -6.175  -4.839  0.980   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 5804  H HG22 . VAL A 1 36  ? -4.649  -5.077  0.128   1.00 0.00 ? 36  VAL A HG22 4  
ATOM 5805  H HG23 . VAL A 1 36  ? -4.704  -4.068  1.574   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 5806  N N    . SER A 1 37  ? -7.671  -0.590  0.202   1.00 0.00 ? 37  SER A N    4  
ATOM 5807  C CA   . SER A 1 37  ? -7.933  0.806   -0.129  1.00 0.00 ? 37  SER A CA   4  
ATOM 5808  C C    . SER A 1 37  ? -7.264  1.737   0.879   1.00 0.00 ? 37  SER A C    4  
ATOM 5809  O O    . SER A 1 37  ? -7.480  1.621   2.085   1.00 0.00 ? 37  SER A O    4  
ATOM 5810  C CB   . SER A 1 37  ? -9.439  1.070   -0.163  1.00 0.00 ? 37  SER A CB   4  
ATOM 5811  O OG   . SER A 1 37  ? -9.910  1.502   1.102   1.00 0.00 ? 37  SER A OG   4  
ATOM 5812  H H    . SER A 1 37  ? -7.783  -0.892  1.128   1.00 0.00 ? 37  SER A H    4  
ATOM 5813  H HA   . SER A 1 37  ? -7.520  0.998   -1.108  1.00 0.00 ? 37  SER A HA   4  
ATOM 5814  H HB2  . SER A 1 37  ? -9.651  1.837   -0.892  1.00 0.00 ? 37  SER A HB2  4  
ATOM 5815  H HB3  . SER A 1 37  ? -9.955  0.161   -0.435  1.00 0.00 ? 37  SER A HB3  4  
ATOM 5816  H HG   . SER A 1 37  ? -10.840 1.732   1.037   1.00 0.00 ? 37  SER A HG   4  
ATOM 5817  N N    . TRP A 1 38  ? -6.454  2.660   0.374   1.00 0.00 ? 38  TRP A N    4  
ATOM 5818  C CA   . TRP A 1 38  ? -5.753  3.611   1.229   1.00 0.00 ? 38  TRP A CA   4  
ATOM 5819  C C    . TRP A 1 38  ? -6.309  5.019   1.046   1.00 0.00 ? 38  TRP A C    4  
ATOM 5820  O O    . TRP A 1 38  ? -7.290  5.220   0.331   1.00 0.00 ? 38  TRP A O    4  
ATOM 5821  C CB   . TRP A 1 38  ? -4.255  3.598   0.921   1.00 0.00 ? 38  TRP A CB   4  
ATOM 5822  C CG   . TRP A 1 38  ? -3.947  3.732   -0.539  1.00 0.00 ? 38  TRP A CG   4  
ATOM 5823  C CD1  . TRP A 1 38  ? -3.555  4.866   -1.193  1.00 0.00 ? 38  TRP A CD1  4  
ATOM 5824  C CD2  . TRP A 1 38  ? -4.007  2.698   -1.527  1.00 0.00 ? 38  TRP A CD2  4  
ATOM 5825  N NE1  . TRP A 1 38  ? -3.368  4.598   -2.528  1.00 0.00 ? 38  TRP A NE1  4  
ATOM 5826  C CE2  . TRP A 1 38  ? -3.638  3.275   -2.758  1.00 0.00 ? 38  TRP A CE2  4  
ATOM 5827  C CE3  . TRP A 1 38  ? -4.334  1.340   -1.491  1.00 0.00 ? 38  TRP A CE3  4  
ATOM 5828  C CZ2  . TRP A 1 38  ? -3.590  2.540   -3.939  1.00 0.00 ? 38  TRP A CZ2  4  
ATOM 5829  C CZ3  . TRP A 1 38  ? -4.286  0.612   -2.665  1.00 0.00 ? 38  TRP A CZ3  4  
ATOM 5830  C CH2  . TRP A 1 38  ? -3.916  1.212   -3.875  1.00 0.00 ? 38  TRP A CH2  4  
ATOM 5831  H H    . TRP A 1 38  ? -6.323  2.702   -0.597  1.00 0.00 ? 38  TRP A H    4  
ATOM 5832  H HA   . TRP A 1 38  ? -5.904  3.308   2.254   1.00 0.00 ? 38  TRP A HA   4  
ATOM 5833  H HB2  . TRP A 1 38  ? -3.780  4.417   1.439   1.00 0.00 ? 38  TRP A HB2  4  
ATOM 5834  H HB3  . TRP A 1 38  ? -3.833  2.665   1.267   1.00 0.00 ? 38  TRP A HB3  4  
ATOM 5835  H HD1  . TRP A 1 38  ? -3.418  5.825   -0.718  1.00 0.00 ? 38  TRP A HD1  4  
ATOM 5836  H HE1  . TRP A 1 38  ? -3.086  5.249   -3.204  1.00 0.00 ? 38  TRP A HE1  4  
ATOM 5837  H HE3  . TRP A 1 38  ? -4.623  0.859   -0.568  1.00 0.00 ? 38  TRP A HE3  4  
ATOM 5838  H HZ2  . TRP A 1 38  ? -3.305  2.988   -4.880  1.00 0.00 ? 38  TRP A HZ2  4  
ATOM 5839  H HZ3  . TRP A 1 38  ? -4.537  -0.439  -2.656  1.00 0.00 ? 38  TRP A HZ3  4  
ATOM 5840  H HH2  . TRP A 1 38  ? -3.892  0.605   -4.767  1.00 0.00 ? 38  TRP A HH2  4  
ATOM 5841  N N    . GLN A 1 39  ? -5.676  5.990   1.696   1.00 0.00 ? 39  GLN A N    4  
ATOM 5842  C CA   . GLN A 1 39  ? -6.109  7.379   1.604   1.00 0.00 ? 39  GLN A CA   4  
ATOM 5843  C C    . GLN A 1 39  ? -4.996  8.261   1.047   1.00 0.00 ? 39  GLN A C    4  
ATOM 5844  O O    . GLN A 1 39  ? -3.887  8.285   1.578   1.00 0.00 ? 39  GLN A O    4  
ATOM 5845  C CB   . GLN A 1 39  ? -6.542  7.893   2.979   1.00 0.00 ? 39  GLN A CB   4  
ATOM 5846  C CG   . GLN A 1 39  ? -8.019  7.681   3.270   1.00 0.00 ? 39  GLN A CG   4  
ATOM 5847  C CD   . GLN A 1 39  ? -8.316  7.603   4.754   1.00 0.00 ? 39  GLN A CD   4  
ATOM 5848  O OE1  . GLN A 1 39  ? -8.417  8.625   5.433   1.00 0.00 ? 39  GLN A OE1  4  
ATOM 5849  N NE2  . GLN A 1 39  ? -8.458  6.386   5.266   1.00 0.00 ? 39  GLN A NE2  4  
ATOM 5850  H H    . GLN A 1 39  ? -4.900  5.767   2.251   1.00 0.00 ? 39  GLN A H    4  
ATOM 5851  H HA   . GLN A 1 39  ? -6.953  7.419   0.933   1.00 0.00 ? 39  GLN A HA   4  
ATOM 5852  H HB2  . GLN A 1 39  ? -5.970  7.380   3.738   1.00 0.00 ? 39  GLN A HB2  4  
ATOM 5853  H HB3  . GLN A 1 39  ? -6.334  8.951   3.037   1.00 0.00 ? 39  GLN A HB3  4  
ATOM 5854  H HG2  . GLN A 1 39  ? -8.577  8.505   2.850   1.00 0.00 ? 39  GLN A HG2  4  
ATOM 5855  H HG3  . GLN A 1 39  ? -8.335  6.759   2.804   1.00 0.00 ? 39  GLN A HG3  4  
ATOM 5856  H HE21 . GLN A 1 39  ? -8.363  5.617   4.665   1.00 0.00 ? 39  GLN A HE21 4  
ATOM 5857  H HE22 . GLN A 1 39  ? -8.650  6.306   6.223   1.00 0.00 ? 39  GLN A HE22 4  
ATOM 5858  N N    . GLU A 1 40  ? -5.302  8.983   -0.027  1.00 0.00 ? 40  GLU A N    4  
ATOM 5859  C CA   . GLU A 1 40  ? -4.326  9.864   -0.657  1.00 0.00 ? 40  GLU A CA   4  
ATOM 5860  C C    . GLU A 1 40  ? -3.609  10.716  0.387   1.00 0.00 ? 40  GLU A C    4  
ATOM 5861  O O    . GLU A 1 40  ? -4.172  11.653  0.954   1.00 0.00 ? 40  GLU A O    4  
ATOM 5862  C CB   . GLU A 1 40  ? -5.010  10.767  -1.685  1.00 0.00 ? 40  GLU A CB   4  
ATOM 5863  C CG   . GLU A 1 40  ? -4.038  11.526  -2.572  1.00 0.00 ? 40  GLU A CG   4  
ATOM 5864  C CD   . GLU A 1 40  ? -4.602  12.846  -3.062  1.00 0.00 ? 40  GLU A CD   4  
ATOM 5865  O OE1  . GLU A 1 40  ? -5.454  13.425  -2.355  1.00 0.00 ? 40  GLU A OE1  4  
ATOM 5866  O OE2  . GLU A 1 40  ? -4.193  13.299  -4.151  1.00 0.00 ? 40  GLU A OE2  4  
ATOM 5867  H H    . GLU A 1 40  ? -6.204  8.920   -0.405  1.00 0.00 ? 40  GLU A H    4  
ATOM 5868  H HA   . GLU A 1 40  ? -3.598  9.247   -1.161  1.00 0.00 ? 40  GLU A HA   4  
ATOM 5869  H HB2  . GLU A 1 40  ? -5.642  10.160  -2.316  1.00 0.00 ? 40  GLU A HB2  4  
ATOM 5870  H HB3  . GLU A 1 40  ? -5.624  11.486  -1.163  1.00 0.00 ? 40  GLU A HB3  4  
ATOM 5871  H HG2  . GLU A 1 40  ? -3.137  11.725  -2.010  1.00 0.00 ? 40  GLU A HG2  4  
ATOM 5872  H HG3  . GLU A 1 40  ? -3.798  10.914  -3.429  1.00 0.00 ? 40  GLU A HG3  4  
ATOM 5873  N N    . PRO A 1 41  ? -2.336  10.384  0.648   1.00 0.00 ? 41  PRO A N    4  
ATOM 5874  C CA   . PRO A 1 41  ? -1.514  11.105  1.625   1.00 0.00 ? 41  PRO A CA   4  
ATOM 5875  C C    . PRO A 1 41  ? -1.154  12.510  1.154   1.00 0.00 ? 41  PRO A C    4  
ATOM 5876  O O    . PRO A 1 41  ? -1.463  12.896  0.026   1.00 0.00 ? 41  PRO A O    4  
ATOM 5877  C CB   . PRO A 1 41  ? -0.257  10.240  1.738   1.00 0.00 ? 41  PRO A CB   4  
ATOM 5878  C CG   . PRO A 1 41  ? -0.179  9.513   0.439   1.00 0.00 ? 41  PRO A CG   4  
ATOM 5879  C CD   . PRO A 1 41  ? -1.601  9.279   0.010   1.00 0.00 ? 41  PRO A CD   4  
ATOM 5880  H HA   . PRO A 1 41  ? -2.001  11.163  2.587   1.00 0.00 ? 41  PRO A HA   4  
ATOM 5881  H HB2  . PRO A 1 41  ? 0.606   10.873  1.889   1.00 0.00 ? 41  PRO A HB2  4  
ATOM 5882  H HB3  . PRO A 1 41  ? -0.359  9.557   2.567   1.00 0.00 ? 41  PRO A HB3  4  
ATOM 5883  H HG2  . PRO A 1 41  ? 0.338   10.118  -0.290  1.00 0.00 ? 41  PRO A HG2  4  
ATOM 5884  H HG3  . PRO A 1 41  ? 0.331   8.571   0.577   1.00 0.00 ? 41  PRO A HG3  4  
ATOM 5885  H HD2  . PRO A 1 41  ? -1.684  9.331   -1.065  1.00 0.00 ? 41  PRO A HD2  4  
ATOM 5886  H HD3  . PRO A 1 41  ? -1.952  8.324   0.372   1.00 0.00 ? 41  PRO A HD3  4  
ATOM 5887  N N    . ARG A 1 42  ? -0.499  13.271  2.024   1.00 0.00 ? 42  ARG A N    4  
ATOM 5888  C CA   . ARG A 1 42  ? -0.097  14.634  1.697   1.00 0.00 ? 42  ARG A CA   4  
ATOM 5889  C C    . ARG A 1 42  ? 1.158   14.637  0.829   1.00 0.00 ? 42  ARG A C    4  
ATOM 5890  O O    . ARG A 1 42  ? 2.121   13.923  1.110   1.00 0.00 ? 42  ARG A O    4  
ATOM 5891  C CB   . ARG A 1 42  ? 0.153   15.436  2.976   1.00 0.00 ? 42  ARG A CB   4  
ATOM 5892  C CG   . ARG A 1 42  ? 1.470   15.102  3.657   1.00 0.00 ? 42  ARG A CG   4  
ATOM 5893  C CD   . ARG A 1 42  ? 1.726   16.010  4.849   1.00 0.00 ? 42  ARG A CD   4  
ATOM 5894  N NE   . ARG A 1 42  ? 2.360   17.266  4.455   1.00 0.00 ? 42  ARG A NE   4  
ATOM 5895  C CZ   . ARG A 1 42  ? 3.664   17.395  4.240   1.00 0.00 ? 42  ARG A CZ   4  
ATOM 5896  N NH1  . ARG A 1 42  ? 4.469   16.351  4.380   1.00 0.00 ? 42  ARG A NH1  4  
ATOM 5897  N NH2  . ARG A 1 42  ? 4.165   18.571  3.883   1.00 0.00 ? 42  ARG A NH2  4  
ATOM 5898  H H    . ARG A 1 42  ? -0.281  12.908  2.908   1.00 0.00 ? 42  ARG A H    4  
ATOM 5899  H HA   . ARG A 1 42  ? -0.903  15.094  1.146   1.00 0.00 ? 42  ARG A HA   4  
ATOM 5900  H HB2  . ARG A 1 42  ? 0.155   16.488  2.732   1.00 0.00 ? 42  ARG A HB2  4  
ATOM 5901  H HB3  . ARG A 1 42  ? -0.648  15.238  3.672   1.00 0.00 ? 42  ARG A HB3  4  
ATOM 5902  H HG2  . ARG A 1 42  ? 1.439   14.078  3.998   1.00 0.00 ? 42  ARG A HG2  4  
ATOM 5903  H HG3  . ARG A 1 42  ? 2.273   15.222  2.944   1.00 0.00 ? 42  ARG A HG3  4  
ATOM 5904  H HD2  . ARG A 1 42  ? 0.784   16.229  5.328   1.00 0.00 ? 42  ARG A HD2  4  
ATOM 5905  H HD3  . ARG A 1 42  ? 2.372   15.495  5.544   1.00 0.00 ? 42  ARG A HD3  4  
ATOM 5906  H HE   . ARG A 1 42  ? 1.783   18.050  4.345   1.00 0.00 ? 42  ARG A HE   4  
ATOM 5907  H HH11 . ARG A 1 42  ? 4.094   15.464  4.647   1.00 0.00 ? 42  ARG A HH11 4  
ATOM 5908  H HH12 . ARG A 1 42  ? 5.451   16.451  4.216   1.00 0.00 ? 42  ARG A HH12 4  
ATOM 5909  H HH21 . ARG A 1 42  ? 3.562   19.360  3.776   1.00 0.00 ? 42  ARG A HH21 4  
ATOM 5910  H HH22 . ARG A 1 42  ? 5.147   18.667  3.722   1.00 0.00 ? 42  ARG A HH22 4  
ATOM 5911  N N    . CYS A 1 43  ? 1.139   15.445  -0.226  1.00 0.00 ? 43  CYS A N    4  
ATOM 5912  C CA   . CYS A 1 43  ? 2.275   15.540  -1.136  1.00 0.00 ? 43  CYS A CA   4  
ATOM 5913  C C    . CYS A 1 43  ? 2.222   16.837  -1.937  1.00 0.00 ? 43  CYS A C    4  
ATOM 5914  O O    . CYS A 1 43  ? 1.333   17.029  -2.766  1.00 0.00 ? 43  CYS A O    4  
ATOM 5915  C CB   . CYS A 1 43  ? 2.297   14.341  -2.085  1.00 0.00 ? 43  CYS A CB   4  
ATOM 5916  S SG   . CYS A 1 43  ? 0.772   14.119  -3.030  1.00 0.00 ? 43  CYS A SG   4  
ATOM 5917  H H    . CYS A 1 43  ? 0.343   15.990  -0.397  1.00 0.00 ? 43  CYS A H    4  
ATOM 5918  H HA   . CYS A 1 43  ? 3.176   15.535  -0.542  1.00 0.00 ? 43  CYS A HA   4  
ATOM 5919  H HB2  . CYS A 1 43  ? 3.105   14.464  -2.791  1.00 0.00 ? 43  CYS A HB2  4  
ATOM 5920  H HB3  . CYS A 1 43  ? 2.464   13.441  -1.511  1.00 0.00 ? 43  CYS A HB3  4  
ATOM 5921  H HG   . CYS A 1 43  ? -0.103  13.496  -2.254  1.00 0.00 ? 43  CYS A HG   4  
ATOM 5922  N N    . GLU A 1 44  ? 3.179   17.723  -1.682  1.00 0.00 ? 44  GLU A N    4  
ATOM 5923  C CA   . GLU A 1 44  ? 3.239   19.003  -2.379  1.00 0.00 ? 44  GLU A CA   4  
ATOM 5924  C C    . GLU A 1 44  ? 3.210   18.801  -3.891  1.00 0.00 ? 44  GLU A C    4  
ATOM 5925  O O    . GLU A 1 44  ? 2.821   19.698  -4.640  1.00 0.00 ? 44  GLU A O    4  
ATOM 5926  C CB   . GLU A 1 44  ? 4.503   19.767  -1.980  1.00 0.00 ? 44  GLU A CB   4  
ATOM 5927  C CG   . GLU A 1 44  ? 4.486   20.265  -0.544  1.00 0.00 ? 44  GLU A CG   4  
ATOM 5928  C CD   . GLU A 1 44  ? 5.876   20.542  -0.006  1.00 0.00 ? 44  GLU A CD   4  
ATOM 5929  O OE1  . GLU A 1 44  ? 6.563   21.423  -0.563  1.00 0.00 ? 44  GLU A OE1  4  
ATOM 5930  O OE2  . GLU A 1 44  ? 6.276   19.878  0.973   1.00 0.00 ? 44  GLU A OE2  4  
ATOM 5931  H H    . GLU A 1 44  ? 3.860   17.512  -1.010  1.00 0.00 ? 44  GLU A H    4  
ATOM 5932  H HA   . GLU A 1 44  ? 2.374   19.580  -2.088  1.00 0.00 ? 44  GLU A HA   4  
ATOM 5933  H HB2  . GLU A 1 44  ? 5.357   19.118  -2.104  1.00 0.00 ? 44  GLU A HB2  4  
ATOM 5934  H HB3  . GLU A 1 44  ? 4.614   20.621  -2.632  1.00 0.00 ? 44  GLU A HB3  4  
ATOM 5935  H HG2  . GLU A 1 44  ? 3.910   21.177  -0.499  1.00 0.00 ? 44  GLU A HG2  4  
ATOM 5936  H HG3  . GLU A 1 44  ? 4.018   19.515  0.077   1.00 0.00 ? 44  GLU A HG3  4  
ATOM 5937  N N    . ARG A 1 45  ? 3.625   17.618  -4.333  1.00 0.00 ? 45  ARG A N    4  
ATOM 5938  C CA   . ARG A 1 45  ? 3.648   17.299  -5.755  1.00 0.00 ? 45  ARG A CA   4  
ATOM 5939  C C    . ARG A 1 45  ? 2.579   16.265  -6.097  1.00 0.00 ? 45  ARG A C    4  
ATOM 5940  O O    . ARG A 1 45  ? 2.182   15.448  -5.267  1.00 0.00 ? 45  ARG A O    4  
ATOM 5941  C CB   . ARG A 1 45  ? 5.027   16.775  -6.159  1.00 0.00 ? 45  ARG A CB   4  
ATOM 5942  C CG   . ARG A 1 45  ? 6.170   17.688  -5.746  1.00 0.00 ? 45  ARG A CG   4  
ATOM 5943  C CD   . ARG A 1 45  ? 6.261   18.909  -6.647  1.00 0.00 ? 45  ARG A CD   4  
ATOM 5944  N NE   . ARG A 1 45  ? 7.562   19.566  -6.550  1.00 0.00 ? 45  ARG A NE   4  
ATOM 5945  C CZ   . ARG A 1 45  ? 7.932   20.582  -7.322  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 5946  N NH1  . ARG A 1 45  ? 7.103   21.055  -8.243  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 5947  N NH2  . ARG A 1 45  ? 9.132   21.127  -7.173  1.00 0.00 ? 45  ARG A NH2  4  
ATOM 5948  H H    . ARG A 1 45  ? 3.923   16.944  -3.686  1.00 0.00 ? 45  ARG A H    4  
ATOM 5949  H HA   . ARG A 1 45  ? 3.443   18.206  -6.302  1.00 0.00 ? 45  ARG A HA   4  
ATOM 5950  H HB2  . ARG A 1 45  ? 5.182   15.810  -5.699  1.00 0.00 ? 45  ARG A HB2  4  
ATOM 5951  H HB3  . ARG A 1 45  ? 5.055   16.661  -7.232  1.00 0.00 ? 45  ARG A HB3  4  
ATOM 5952  H HG2  . ARG A 1 45  ? 6.008   18.015  -4.730  1.00 0.00 ? 45  ARG A HG2  4  
ATOM 5953  H HG3  . ARG A 1 45  ? 7.097   17.137  -5.806  1.00 0.00 ? 45  ARG A HG3  4  
ATOM 5954  H HD2  . ARG A 1 45  ? 6.101   18.599  -7.669  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 5955  H HD3  . ARG A 1 45  ? 5.491   19.610  -6.359  1.00 0.00 ? 45  ARG A HD3  4  
ATOM 5956  H HE   . ARG A 1 45  ? 8.189   19.233  -5.876  1.00 0.00 ? 45  ARG A HE   4  
ATOM 5957  H HH11 . ARG A 1 45  ? 6.198   20.647  -8.357  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 5958  H HH12 . ARG A 1 45  ? 7.384   21.821  -8.822  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 5959  H HH21 . ARG A 1 45  ? 9.759   20.773  -6.480  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 5960  H HH22 . ARG A 1 45  ? 9.410   21.891  -7.755  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 5961  N N    . PRO A 1 46  ? 2.101   16.300  -7.350  1.00 0.00 ? 46  PRO A N    4  
ATOM 5962  C CA   . PRO A 1 46  ? 1.072   15.374  -7.832  1.00 0.00 ? 46  PRO A CA   4  
ATOM 5963  C C    . PRO A 1 46  ? 1.594   13.947  -7.966  1.00 0.00 ? 46  PRO A C    4  
ATOM 5964  O O    . PRO A 1 46  ? 2.696   13.723  -8.470  1.00 0.00 ? 46  PRO A O    4  
ATOM 5965  C CB   . PRO A 1 46  ? 0.700   15.939  -9.205  1.00 0.00 ? 46  PRO A CB   4  
ATOM 5966  C CG   . PRO A 1 46  ? 1.909   16.691  -9.645  1.00 0.00 ? 46  PRO A CG   4  
ATOM 5967  C CD   . PRO A 1 46  ? 2.529   17.247  -8.394  1.00 0.00 ? 46  PRO A CD   4  
ATOM 5968  H HA   . PRO A 1 46  ? 0.203   15.379  -7.191  1.00 0.00 ? 46  PRO A HA   4  
ATOM 5969  H HB2  . PRO A 1 46  ? 0.470   15.127  -9.881  1.00 0.00 ? 46  PRO A HB2  4  
ATOM 5970  H HB3  . PRO A 1 46  ? -0.156  16.590  -9.110  1.00 0.00 ? 46  PRO A HB3  4  
ATOM 5971  H HG2  . PRO A 1 46  ? 2.597   16.022  -10.139 1.00 0.00 ? 46  PRO A HG2  4  
ATOM 5972  H HG3  . PRO A 1 46  ? 1.620   17.492  -10.309 1.00 0.00 ? 46  PRO A HG3  4  
ATOM 5973  H HD2  . PRO A 1 46  ? 3.605   17.264  -8.481  1.00 0.00 ? 46  PRO A HD2  4  
ATOM 5974  H HD3  . PRO A 1 46  ? 2.150   18.238  -8.193  1.00 0.00 ? 46  PRO A HD3  4  
ATOM 5975  N N    . LEU A 1 47  ? 0.797   12.986  -7.514  1.00 0.00 ? 47  LEU A N    4  
ATOM 5976  C CA   . LEU A 1 47  ? 1.178   11.579  -7.585  1.00 0.00 ? 47  LEU A CA   4  
ATOM 5977  C C    . LEU A 1 47  ? 0.917   11.014  -8.977  1.00 0.00 ? 47  LEU A C    4  
ATOM 5978  O O    . LEU A 1 47  ? 0.009   11.460  -9.678  1.00 0.00 ? 47  LEU A O    4  
ATOM 5979  C CB   . LEU A 1 47  ? 0.409   10.769  -6.540  1.00 0.00 ? 47  LEU A CB   4  
ATOM 5980  C CG   . LEU A 1 47  ? 0.374   11.355  -5.128  1.00 0.00 ? 47  LEU A CG   4  
ATOM 5981  C CD1  . LEU A 1 47  ? -0.858  10.872  -4.380  1.00 0.00 ? 47  LEU A CD1  4  
ATOM 5982  C CD2  . LEU A 1 47  ? 1.640   10.990  -4.367  1.00 0.00 ? 47  LEU A CD2  4  
ATOM 5983  H H    . LEU A 1 47  ? -0.069  13.226  -7.124  1.00 0.00 ? 47  LEU A H    4  
ATOM 5984  H HA   . LEU A 1 47  ? 2.235   11.512  -7.375  1.00 0.00 ? 47  LEU A HA   4  
ATOM 5985  H HB2  . LEU A 1 47  ? -0.610  10.671  -6.882  1.00 0.00 ? 47  LEU A HB2  4  
ATOM 5986  H HB3  . LEU A 1 47  ? 0.864   9.790   -6.482  1.00 0.00 ? 47  LEU A HB3  4  
ATOM 5987  H HG   . LEU A 1 47  ? 0.322   12.434  -5.194  1.00 0.00 ? 47  LEU A HG   4  
ATOM 5988  H HD11 . LEU A 1 47  ? -1.144  9.898   -4.747  1.00 0.00 ? 47  LEU A HD11 4  
ATOM 5989  H HD12 . LEU A 1 47  ? -1.670  11.568  -4.536  1.00 0.00 ? 47  LEU A HD12 4  
ATOM 5990  H HD13 . LEU A 1 47  ? -0.636  10.809  -3.325  1.00 0.00 ? 47  LEU A HD13 4  
ATOM 5991  H HD21 . LEU A 1 47  ? 2.265   10.364  -4.987  1.00 0.00 ? 47  LEU A HD21 4  
ATOM 5992  H HD22 . LEU A 1 47  ? 1.376   10.456  -3.466  1.00 0.00 ? 47  LEU A HD22 4  
ATOM 5993  H HD23 . LEU A 1 47  ? 2.177   11.890  -4.108  1.00 0.00 ? 47  LEU A HD23 4  
ATOM 5994  N N    . GLN A 1 48  ? 1.717   10.028  -9.370  1.00 0.00 ? 48  GLN A N    4  
ATOM 5995  C CA   . GLN A 1 48  ? 1.570   9.400   -10.678 1.00 0.00 ? 48  GLN A CA   4  
ATOM 5996  C C    . GLN A 1 48  ? 0.848   8.062   -10.561 1.00 0.00 ? 48  GLN A C    4  
ATOM 5997  O O    . GLN A 1 48  ? 0.272   7.570   -11.531 1.00 0.00 ? 48  GLN A O    4  
ATOM 5998  C CB   . GLN A 1 48  ? 2.941   9.199   -11.326 1.00 0.00 ? 48  GLN A CB   4  
ATOM 5999  C CG   . GLN A 1 48  ? 3.709   10.493  -11.540 1.00 0.00 ? 48  GLN A CG   4  
ATOM 6000  C CD   . GLN A 1 48  ? 4.905   10.318  -12.455 1.00 0.00 ? 48  GLN A CD   4  
ATOM 6001  O OE1  . GLN A 1 48  ? 4.786   9.779   -13.555 1.00 0.00 ? 48  GLN A OE1  4  
ATOM 6002  N NE2  . GLN A 1 48  ? 6.068   10.775  -12.003 1.00 0.00 ? 48  GLN A NE2  4  
ATOM 6003  H H    . GLN A 1 48  ? 2.422   9.716   -8.766  1.00 0.00 ? 48  GLN A H    4  
ATOM 6004  H HA   . GLN A 1 48  ? 0.982   10.060  -11.297 1.00 0.00 ? 48  GLN A HA   4  
ATOM 6005  H HB2  . GLN A 1 48  ? 3.534   8.553   -10.696 1.00 0.00 ? 48  GLN A HB2  4  
ATOM 6006  H HB3  . GLN A 1 48  ? 2.805   8.724   -12.287 1.00 0.00 ? 48  GLN A HB3  4  
ATOM 6007  H HG2  . GLN A 1 48  ? 3.045   11.223  -11.978 1.00 0.00 ? 48  GLN A HG2  4  
ATOM 6008  H HG3  . GLN A 1 48  ? 4.056   10.853  -10.582 1.00 0.00 ? 48  GLN A HG3  4  
ATOM 6009  H HE21 . GLN A 1 48  ? 6.088   11.192  -11.116 1.00 0.00 ? 48  GLN A HE21 4  
ATOM 6010  H HE22 . GLN A 1 48  ? 6.857   10.674  -12.573 1.00 0.00 ? 48  GLN A HE22 4  
ATOM 6011  N N    . GLY A 1 49  ? 0.884   7.477   -9.368  1.00 0.00 ? 49  GLY A N    4  
ATOM 6012  C CA   . GLY A 1 49  ? 0.230   6.201   -9.147  1.00 0.00 ? 49  GLY A CA   4  
ATOM 6013  C C    . GLY A 1 49  ? 0.453   5.669   -7.745  1.00 0.00 ? 49  GLY A C    4  
ATOM 6014  O O    . GLY A 1 49  ? 0.703   6.437   -6.815  1.00 0.00 ? 49  GLY A O    4  
ATOM 6015  H H    . GLY A 1 49  ? 1.359   7.916   -8.631  1.00 0.00 ? 49  GLY A H    4  
ATOM 6016  H HA2  . GLY A 1 49  ? -0.831  6.319   -9.312  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 6017  H HA3  . GLY A 1 49  ? 0.616   5.484   -9.857  1.00 0.00 ? 49  GLY A HA3  4  
ATOM 6018  N N    . TYR A 1 50  ? 0.362   4.353   -7.592  1.00 0.00 ? 50  TYR A N    4  
ATOM 6019  C CA   . TYR A 1 50  ? 0.551   3.720   -6.292  1.00 0.00 ? 50  TYR A CA   4  
ATOM 6020  C C    . TYR A 1 50  ? 1.098   2.304   -6.450  1.00 0.00 ? 50  TYR A C    4  
ATOM 6021  O O    . TYR A 1 50  ? 1.126   1.757   -7.552  1.00 0.00 ? 50  TYR A O    4  
ATOM 6022  C CB   . TYR A 1 50  ? -0.769  3.686   -5.520  1.00 0.00 ? 50  TYR A CB   4  
ATOM 6023  C CG   . TYR A 1 50  ? -1.138  5.011   -4.894  1.00 0.00 ? 50  TYR A CG   4  
ATOM 6024  C CD1  . TYR A 1 50  ? -1.775  5.999   -5.634  1.00 0.00 ? 50  TYR A CD1  4  
ATOM 6025  C CD2  . TYR A 1 50  ? -0.851  5.275   -3.560  1.00 0.00 ? 50  TYR A CD2  4  
ATOM 6026  C CE1  . TYR A 1 50  ? -2.114  7.211   -5.066  1.00 0.00 ? 50  TYR A CE1  4  
ATOM 6027  C CE2  . TYR A 1 50  ? -1.188  6.484   -2.983  1.00 0.00 ? 50  TYR A CE2  4  
ATOM 6028  C CZ   . TYR A 1 50  ? -1.818  7.449   -3.740  1.00 0.00 ? 50  TYR A CZ   4  
ATOM 6029  O OH   . TYR A 1 50  ? -2.155  8.655   -3.169  1.00 0.00 ? 50  TYR A OH   4  
ATOM 6030  H H    . TYR A 1 50  ? 0.160   3.793   -8.371  1.00 0.00 ? 50  TYR A H    4  
ATOM 6031  H HA   . TYR A 1 50  ? 1.266   4.310   -5.737  1.00 0.00 ? 50  TYR A HA   4  
ATOM 6032  H HB2  . TYR A 1 50  ? -1.564  3.405   -6.193  1.00 0.00 ? 50  TYR A HB2  4  
ATOM 6033  H HB3  . TYR A 1 50  ? -0.697  2.953   -4.730  1.00 0.00 ? 50  TYR A HB3  4  
ATOM 6034  H HD1  . TYR A 1 50  ? -2.006  5.809   -6.673  1.00 0.00 ? 50  TYR A HD1  4  
ATOM 6035  H HD2  . TYR A 1 50  ? -0.357  4.517   -2.969  1.00 0.00 ? 50  TYR A HD2  4  
ATOM 6036  H HE1  . TYR A 1 50  ? -2.608  7.967   -5.658  1.00 0.00 ? 50  TYR A HE1  4  
ATOM 6037  H HE2  . TYR A 1 50  ? -0.956  6.671   -1.944  1.00 0.00 ? 50  TYR A HE2  4  
ATOM 6038  H HH   . TYR A 1 50  ? -3.104  8.785   -3.233  1.00 0.00 ? 50  TYR A HH   4  
ATOM 6039  N N    . SER A 1 51  ? 1.531   1.717   -5.339  1.00 0.00 ? 51  SER A N    4  
ATOM 6040  C CA   . SER A 1 51  ? 2.080   0.366   -5.353  1.00 0.00 ? 51  SER A CA   4  
ATOM 6041  C C    . SER A 1 51  ? 1.583   -0.435  -4.154  1.00 0.00 ? 51  SER A C    4  
ATOM 6042  O O    . SER A 1 51  ? 1.700   0.002   -3.009  1.00 0.00 ? 51  SER A O    4  
ATOM 6043  C CB   . SER A 1 51  ? 3.609   0.414   -5.350  1.00 0.00 ? 51  SER A CB   4  
ATOM 6044  O OG   . SER A 1 51  ? 4.158   -0.840  -4.984  1.00 0.00 ? 51  SER A OG   4  
ATOM 6045  H H    . SER A 1 51  ? 1.483   2.205   -4.491  1.00 0.00 ? 51  SER A H    4  
ATOM 6046  H HA   . SER A 1 51  ? 1.746   -0.118  -6.258  1.00 0.00 ? 51  SER A HA   4  
ATOM 6047  H HB2  . SER A 1 51  ? 3.961   0.674   -6.337  1.00 0.00 ? 51  SER A HB2  4  
ATOM 6048  H HB3  . SER A 1 51  ? 3.942   1.160   -4.642  1.00 0.00 ? 51  SER A HB3  4  
ATOM 6049  H HG   . SER A 1 51  ? 4.584   -1.238  -5.747  1.00 0.00 ? 51  SER A HG   4  
ATOM 6050  N N    . VAL A 1 52  ? 1.026   -1.611  -4.425  1.00 0.00 ? 52  VAL A N    4  
ATOM 6051  C CA   . VAL A 1 52  ? 0.511   -2.475  -3.369  1.00 0.00 ? 52  VAL A CA   4  
ATOM 6052  C C    . VAL A 1 52  ? 1.249   -3.809  -3.342  1.00 0.00 ? 52  VAL A C    4  
ATOM 6053  O O    . VAL A 1 52  ? 0.951   -4.709  -4.126  1.00 0.00 ? 52  VAL A O    4  
ATOM 6054  C CB   . VAL A 1 52  ? -0.997  -2.738  -3.545  1.00 0.00 ? 52  VAL A CB   4  
ATOM 6055  C CG1  . VAL A 1 52  ? -1.540  -3.534  -2.369  1.00 0.00 ? 52  VAL A CG1  4  
ATOM 6056  C CG2  . VAL A 1 52  ? -1.751  -1.427  -3.707  1.00 0.00 ? 52  VAL A CG2  4  
ATOM 6057  H H    . VAL A 1 52  ? 0.960   -1.905  -5.358  1.00 0.00 ? 52  VAL A H    4  
ATOM 6058  H HA   . VAL A 1 52  ? 0.659   -1.972  -2.425  1.00 0.00 ? 52  VAL A HA   4  
ATOM 6059  H HB   . VAL A 1 52  ? -1.137  -3.323  -4.442  1.00 0.00 ? 52  VAL A HB   4  
ATOM 6060  H HG11 . VAL A 1 52  ? -0.720  -3.979  -1.825  1.00 0.00 ? 52  VAL A HG11 4  
ATOM 6061  H HG12 . VAL A 1 52  ? -2.093  -2.876  -1.713  1.00 0.00 ? 52  VAL A HG12 4  
ATOM 6062  H HG13 . VAL A 1 52  ? -2.194  -4.313  -2.733  1.00 0.00 ? 52  VAL A HG13 4  
ATOM 6063  H HG21 . VAL A 1 52  ? -1.153  -0.617  -3.317  1.00 0.00 ? 52  VAL A HG21 4  
ATOM 6064  H HG22 . VAL A 1 52  ? -1.953  -1.255  -4.753  1.00 0.00 ? 52  VAL A HG22 4  
ATOM 6065  H HG23 . VAL A 1 52  ? -2.684  -1.478  -3.164  1.00 0.00 ? 52  VAL A HG23 4  
ATOM 6066  N N    . GLU A 1 53  ? 2.212   -3.927  -2.434  1.00 0.00 ? 53  GLU A N    4  
ATOM 6067  C CA   . GLU A 1 53  ? 2.993   -5.152  -2.305  1.00 0.00 ? 53  GLU A CA   4  
ATOM 6068  C C    . GLU A 1 53  ? 2.419   -6.050  -1.212  1.00 0.00 ? 53  GLU A C    4  
ATOM 6069  O O    . GLU A 1 53  ? 2.164   -5.601  -0.095  1.00 0.00 ? 53  GLU A O    4  
ATOM 6070  C CB   . GLU A 1 53  ? 4.454   -4.821  -1.994  1.00 0.00 ? 53  GLU A CB   4  
ATOM 6071  C CG   . GLU A 1 53  ? 5.272   -4.464  -3.223  1.00 0.00 ? 53  GLU A CG   4  
ATOM 6072  C CD   . GLU A 1 53  ? 6.480   -3.609  -2.892  1.00 0.00 ? 53  GLU A CD   4  
ATOM 6073  O OE1  . GLU A 1 53  ? 6.332   -2.370  -2.837  1.00 0.00 ? 53  GLU A OE1  4  
ATOM 6074  O OE2  . GLU A 1 53  ? 7.572   -4.179  -2.688  1.00 0.00 ? 53  GLU A OE2  4  
ATOM 6075  H H    . GLU A 1 53  ? 2.402   -3.174  -1.837  1.00 0.00 ? 53  GLU A H    4  
ATOM 6076  H HA   . GLU A 1 53  ? 2.945   -5.676  -3.247  1.00 0.00 ? 53  GLU A HA   4  
ATOM 6077  H HB2  . GLU A 1 53  ? 4.484   -3.985  -1.311  1.00 0.00 ? 53  GLU A HB2  4  
ATOM 6078  H HB3  . GLU A 1 53  ? 4.911   -5.677  -1.519  1.00 0.00 ? 53  GLU A HB3  4  
ATOM 6079  H HG2  . GLU A 1 53  ? 5.613   -5.376  -3.690  1.00 0.00 ? 53  GLU A HG2  4  
ATOM 6080  H HG3  . GLU A 1 53  ? 4.643   -3.921  -3.913  1.00 0.00 ? 53  GLU A HG3  4  
ATOM 6081  N N    . TYR A 1 54  ? 2.219   -7.321  -1.544  1.00 0.00 ? 54  TYR A N    4  
ATOM 6082  C CA   . TYR A 1 54  ? 1.673   -8.282  -0.593  1.00 0.00 ? 54  TYR A CA   4  
ATOM 6083  C C    . TYR A 1 54  ? 2.441   -9.599  -0.649  1.00 0.00 ? 54  TYR A C    4  
ATOM 6084  O O    . TYR A 1 54  ? 2.818   -10.065 -1.724  1.00 0.00 ? 54  TYR A O    4  
ATOM 6085  C CB   . TYR A 1 54  ? 0.191   -8.530  -0.881  1.00 0.00 ? 54  TYR A CB   4  
ATOM 6086  C CG   . TYR A 1 54  ? -0.053  -9.381  -2.107  1.00 0.00 ? 54  TYR A CG   4  
ATOM 6087  C CD1  . TYR A 1 54  ? 0.013   -10.767 -2.038  1.00 0.00 ? 54  TYR A CD1  4  
ATOM 6088  C CD2  . TYR A 1 54  ? -0.350  -8.799  -3.333  1.00 0.00 ? 54  TYR A CD2  4  
ATOM 6089  C CE1  . TYR A 1 54  ? -0.209  -11.549 -3.156  1.00 0.00 ? 54  TYR A CE1  4  
ATOM 6090  C CE2  . TYR A 1 54  ? -0.575  -9.573  -4.455  1.00 0.00 ? 54  TYR A CE2  4  
ATOM 6091  C CZ   . TYR A 1 54  ? -0.503  -10.947 -4.361  1.00 0.00 ? 54  TYR A CZ   4  
ATOM 6092  O OH   . TYR A 1 54  ? -0.725  -11.721 -5.477  1.00 0.00 ? 54  TYR A OH   4  
ATOM 6093  H H    . TYR A 1 54  ? 2.442   -7.619  -2.450  1.00 0.00 ? 54  TYR A H    4  
ATOM 6094  H HA   . TYR A 1 54  ? 1.772   -7.862  0.397   1.00 0.00 ? 54  TYR A HA   4  
ATOM 6095  H HB2  . TYR A 1 54  ? -0.253  -9.032  -0.036  1.00 0.00 ? 54  TYR A HB2  4  
ATOM 6096  H HB3  . TYR A 1 54  ? -0.303  -7.582  -1.031  1.00 0.00 ? 54  TYR A HB3  4  
ATOM 6097  H HD1  . TYR A 1 54  ? 0.244   -11.236 -1.093  1.00 0.00 ? 54  TYR A HD1  4  
ATOM 6098  H HD2  . TYR A 1 54  ? -0.405  -7.722  -3.402  1.00 0.00 ? 54  TYR A HD2  4  
ATOM 6099  H HE1  . TYR A 1 54  ? -0.153  -12.625 -3.083  1.00 0.00 ? 54  TYR A HE1  4  
ATOM 6100  H HE2  . TYR A 1 54  ? -0.805  -9.101  -5.399  1.00 0.00 ? 54  TYR A HE2  4  
ATOM 6101  H HH   . TYR A 1 54  ? -1.665  -11.740 -5.672  1.00 0.00 ? 54  TYR A HH   4  
ATOM 6102  N N    . GLN A 1 55  ? 2.668   -10.194 0.518   1.00 0.00 ? 55  GLN A N    4  
ATOM 6103  C CA   . GLN A 1 55  ? 3.391   -11.457 0.603   1.00 0.00 ? 55  GLN A CA   4  
ATOM 6104  C C    . GLN A 1 55  ? 3.155   -12.129 1.952   1.00 0.00 ? 55  GLN A C    4  
ATOM 6105  O O    . GLN A 1 55  ? 2.887   -11.462 2.952   1.00 0.00 ? 55  GLN A O    4  
ATOM 6106  C CB   . GLN A 1 55  ? 4.888   -11.228 0.389   1.00 0.00 ? 55  GLN A CB   4  
ATOM 6107  C CG   . GLN A 1 55  ? 5.629   -10.830 1.655   1.00 0.00 ? 55  GLN A CG   4  
ATOM 6108  C CD   . GLN A 1 55  ? 7.075   -10.457 1.391   1.00 0.00 ? 55  GLN A CD   4  
ATOM 6109  O OE1  . GLN A 1 55  ? 7.513   -9.353  1.716   1.00 0.00 ? 55  GLN A OE1  4  
ATOM 6110  N NE2  . GLN A 1 55  ? 7.826   -11.379 0.800   1.00 0.00 ? 55  GLN A NE2  4  
ATOM 6111  H H    . GLN A 1 55  ? 2.342   -9.773  1.340   1.00 0.00 ? 55  GLN A H    4  
ATOM 6112  H HA   . GLN A 1 55  ? 3.020   -12.104 -0.177  1.00 0.00 ? 55  GLN A HA   4  
ATOM 6113  H HB2  . GLN A 1 55  ? 5.329   -12.138 0.010   1.00 0.00 ? 55  GLN A HB2  4  
ATOM 6114  H HB3  . GLN A 1 55  ? 5.019   -10.443 -0.341  1.00 0.00 ? 55  GLN A HB3  4  
ATOM 6115  H HG2  . GLN A 1 55  ? 5.130   -9.980  2.097   1.00 0.00 ? 55  GLN A HG2  4  
ATOM 6116  H HG3  . GLN A 1 55  ? 5.607   -11.659 2.346   1.00 0.00 ? 55  GLN A HG3  4  
ATOM 6117  H HE21 . GLN A 1 55  ? 7.409   -12.236 0.569   1.00 0.00 ? 55  GLN A HE21 4  
ATOM 6118  H HE22 . GLN A 1 55  ? 8.764   -11.165 0.617   1.00 0.00 ? 55  GLN A HE22 4  
ATOM 6119  N N    . LEU A 1 56  ? 3.256   -13.454 1.973   1.00 0.00 ? 56  LEU A N    4  
ATOM 6120  C CA   . LEU A 1 56  ? 3.053   -14.217 3.199   1.00 0.00 ? 56  LEU A CA   4  
ATOM 6121  C C    . LEU A 1 56  ? 3.676   -13.503 4.394   1.00 0.00 ? 56  LEU A C    4  
ATOM 6122  O O    . LEU A 1 56  ? 4.887   -13.282 4.437   1.00 0.00 ? 56  LEU A O    4  
ATOM 6123  C CB   . LEU A 1 56  ? 3.654   -15.617 3.057   1.00 0.00 ? 56  LEU A CB   4  
ATOM 6124  C CG   . LEU A 1 56  ? 2.811   -16.634 2.287   1.00 0.00 ? 56  LEU A CG   4  
ATOM 6125  C CD1  . LEU A 1 56  ? 3.623   -17.886 1.993   1.00 0.00 ? 56  LEU A CD1  4  
ATOM 6126  C CD2  . LEU A 1 56  ? 1.552   -16.984 3.068   1.00 0.00 ? 56  LEU A CD2  4  
ATOM 6127  H H    . LEU A 1 56  ? 3.472   -13.931 1.145   1.00 0.00 ? 56  LEU A H    4  
ATOM 6128  H HA   . LEU A 1 56  ? 1.990   -14.306 3.362   1.00 0.00 ? 56  LEU A HA   4  
ATOM 6129  H HB2  . LEU A 1 56  ? 4.601   -15.520 2.548   1.00 0.00 ? 56  LEU A HB2  4  
ATOM 6130  H HB3  . LEU A 1 56  ? 3.820   -16.008 4.051   1.00 0.00 ? 56  LEU A HB3  4  
ATOM 6131  H HG   . LEU A 1 56  ? 2.511   -16.202 1.343   1.00 0.00 ? 56  LEU A HG   4  
ATOM 6132  H HD11 . LEU A 1 56  ? 2.954   -18.702 1.761   1.00 0.00 ? 56  LEU A HD11 4  
ATOM 6133  H HD12 . LEU A 1 56  ? 4.216   -18.142 2.858   1.00 0.00 ? 56  LEU A HD12 4  
ATOM 6134  H HD13 . LEU A 1 56  ? 4.274   -17.703 1.151   1.00 0.00 ? 56  LEU A HD13 4  
ATOM 6135  H HD21 . LEU A 1 56  ? 0.877   -17.536 2.433   1.00 0.00 ? 56  LEU A HD21 4  
ATOM 6136  H HD22 . LEU A 1 56  ? 1.072   -16.075 3.401   1.00 0.00 ? 56  LEU A HD22 4  
ATOM 6137  H HD23 . LEU A 1 56  ? 1.816   -17.586 3.925   1.00 0.00 ? 56  LEU A HD23 4  
ATOM 6138  N N    . LEU A 1 57  ? 2.842   -13.147 5.365   1.00 0.00 ? 57  LEU A N    4  
ATOM 6139  C CA   . LEU A 1 57  ? 3.311   -12.460 6.563   1.00 0.00 ? 57  LEU A CA   4  
ATOM 6140  C C    . LEU A 1 57  ? 4.712   -12.925 6.944   1.00 0.00 ? 57  LEU A C    4  
ATOM 6141  O O    . LEU A 1 57  ? 5.657   -12.137 6.957   1.00 0.00 ? 57  LEU A O    4  
ATOM 6142  C CB   . LEU A 1 57  ? 2.346   -12.703 7.725   1.00 0.00 ? 57  LEU A CB   4  
ATOM 6143  C CG   . LEU A 1 57  ? 2.295   -11.612 8.795   1.00 0.00 ? 57  LEU A CG   4  
ATOM 6144  C CD1  . LEU A 1 57  ? 1.428   -12.051 9.964   1.00 0.00 ? 57  LEU A CD1  4  
ATOM 6145  C CD2  . LEU A 1 57  ? 3.698   -11.263 9.269   1.00 0.00 ? 57  LEU A CD2  4  
ATOM 6146  H H    . LEU A 1 57  ? 1.888   -13.350 5.274   1.00 0.00 ? 57  LEU A H    4  
ATOM 6147  H HA   . LEU A 1 57  ? 3.342   -11.402 6.347   1.00 0.00 ? 57  LEU A HA   4  
ATOM 6148  H HB2  . LEU A 1 57  ? 1.354   -12.810 7.314   1.00 0.00 ? 57  LEU A HB2  4  
ATOM 6149  H HB3  . LEU A 1 57  ? 2.636   -13.626 8.206   1.00 0.00 ? 57  LEU A HB3  4  
ATOM 6150  H HG   . LEU A 1 57  ? 1.854   -10.721 8.370   1.00 0.00 ? 57  LEU A HG   4  
ATOM 6151  H HD11 . LEU A 1 57  ? 1.663   -11.453 10.831  1.00 0.00 ? 57  LEU A HD11 4  
ATOM 6152  H HD12 . LEU A 1 57  ? 1.619   -13.092 10.183  1.00 0.00 ? 57  LEU A HD12 4  
ATOM 6153  H HD13 . LEU A 1 57  ? 0.386   -11.923 9.709   1.00 0.00 ? 57  LEU A HD13 4  
ATOM 6154  H HD21 . LEU A 1 57  ? 4.283   -12.167 9.357   1.00 0.00 ? 57  LEU A HD21 4  
ATOM 6155  H HD22 . LEU A 1 57  ? 3.641   -10.775 10.231  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 6156  H HD23 . LEU A 1 57  ? 4.165   -10.600 8.556   1.00 0.00 ? 57  LEU A HD23 4  
ATOM 6157  N N    . ASN A 1 58  ? 4.839   -14.212 7.253   1.00 0.00 ? 58  ASN A N    4  
ATOM 6158  C CA   . ASN A 1 58  ? 6.126   -14.783 7.633   1.00 0.00 ? 58  ASN A CA   4  
ATOM 6159  C C    . ASN A 1 58  ? 7.196   -14.452 6.597   1.00 0.00 ? 58  ASN A C    4  
ATOM 6160  O O    . ASN A 1 58  ? 8.260   -13.934 6.931   1.00 0.00 ? 58  ASN A O    4  
ATOM 6161  C CB   . ASN A 1 58  ? 6.007   -16.300 7.794   1.00 0.00 ? 58  ASN A CB   4  
ATOM 6162  C CG   . ASN A 1 58  ? 6.063   -17.028 6.464   1.00 0.00 ? 58  ASN A CG   4  
ATOM 6163  O OD1  . ASN A 1 58  ? 7.112   -17.533 6.064   1.00 0.00 ? 58  ASN A OD1  4  
ATOM 6164  N ND2  . ASN A 1 58  ? 4.931   -17.084 5.773   1.00 0.00 ? 58  ASN A ND2  4  
ATOM 6165  H H    . ASN A 1 58  ? 4.049   -14.791 7.225   1.00 0.00 ? 58  ASN A H    4  
ATOM 6166  H HA   . ASN A 1 58  ? 6.413   -14.351 8.580   1.00 0.00 ? 58  ASN A HA   4  
ATOM 6167  H HB2  . ASN A 1 58  ? 6.819   -16.656 8.411   1.00 0.00 ? 58  ASN A HB2  4  
ATOM 6168  H HB3  . ASN A 1 58  ? 5.068   -16.533 8.272   1.00 0.00 ? 58  ASN A HB3  4  
ATOM 6169  H HD21 . ASN A 1 58  ? 4.134   -16.659 6.154   1.00 0.00 ? 58  ASN A HD21 4  
ATOM 6170  H HD22 . ASN A 1 58  ? 4.938   -17.549 4.910   1.00 0.00 ? 58  ASN A HD22 4  
ATOM 6171  N N    . GLY A 1 59  ? 6.904   -14.756 5.336   1.00 0.00 ? 59  GLY A N    4  
ATOM 6172  C CA   . GLY A 1 59  ? 7.850   -14.484 4.269   1.00 0.00 ? 59  GLY A CA   4  
ATOM 6173  C C    . GLY A 1 59  ? 7.739   -15.475 3.128   1.00 0.00 ? 59  GLY A C    4  
ATOM 6174  O O    . GLY A 1 59  ? 8.233   -16.598 3.222   1.00 0.00 ? 59  GLY A O    4  
ATOM 6175  H H    . GLY A 1 59  ? 6.039   -15.168 5.128   1.00 0.00 ? 59  GLY A H    4  
ATOM 6176  H HA2  . GLY A 1 59  ? 7.669   -13.490 3.888   1.00 0.00 ? 59  GLY A HA2  4  
ATOM 6177  H HA3  . GLY A 1 59  ? 8.851   -14.527 4.672   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 6178  N N    . GLY A 1 60  ? 7.085   -15.061 2.047   1.00 0.00 ? 60  GLY A N    4  
ATOM 6179  C CA   . GLY A 1 60  ? 6.920   -15.934 0.900   1.00 0.00 ? 60  GLY A CA   4  
ATOM 6180  C C    . GLY A 1 60  ? 6.892   -15.171 -0.410  1.00 0.00 ? 60  GLY A C    4  
ATOM 6181  O O    . GLY A 1 60  ? 7.484   -14.098 -0.523  1.00 0.00 ? 60  GLY A O    4  
ATOM 6182  H H    . GLY A 1 60  ? 6.711   -14.155 2.029   1.00 0.00 ? 60  GLY A H    4  
ATOM 6183  H HA2  . GLY A 1 60  ? 7.738   -16.638 0.877   1.00 0.00 ? 60  GLY A HA2  4  
ATOM 6184  H HA3  . GLY A 1 60  ? 5.993   -16.478 1.006   1.00 0.00 ? 60  GLY A HA3  4  
ATOM 6185  N N    . GLU A 1 61  ? 6.205   -15.727 -1.403  1.00 0.00 ? 61  GLU A N    4  
ATOM 6186  C CA   . GLU A 1 61  ? 6.105   -15.092 -2.711  1.00 0.00 ? 61  GLU A CA   4  
ATOM 6187  C C    . GLU A 1 61  ? 5.599   -13.658 -2.583  1.00 0.00 ? 61  GLU A C    4  
ATOM 6188  O O    . GLU A 1 61  ? 4.525   -13.413 -2.033  1.00 0.00 ? 61  GLU A O    4  
ATOM 6189  C CB   . GLU A 1 61  ? 5.173   -15.894 -3.622  1.00 0.00 ? 61  GLU A CB   4  
ATOM 6190  C CG   . GLU A 1 61  ? 5.528   -15.794 -5.096  1.00 0.00 ? 61  GLU A CG   4  
ATOM 6191  C CD   . GLU A 1 61  ? 5.071   -17.003 -5.889  1.00 0.00 ? 61  GLU A CD   4  
ATOM 6192  O OE1  . GLU A 1 61  ? 3.862   -17.094 -6.189  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6193  O OE2  . GLU A 1 61  ? 5.923   -17.858 -6.211  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6194  H H    . GLU A 1 61  ? 5.755   -16.584 -1.251  1.00 0.00 ? 61  GLU A H    4  
ATOM 6195  H HA   . GLU A 1 61  ? 7.092   -15.075 -3.148  1.00 0.00 ? 61  GLU A HA   4  
ATOM 6196  H HB2  . GLU A 1 61  ? 5.212   -16.933 -3.332  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6197  H HB3  . GLU A 1 61  ? 4.164   -15.531 -3.492  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6198  H HG2  . GLU A 1 61  ? 5.058   -14.914 -5.508  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6199  H HG3  . GLU A 1 61  ? 6.601   -15.705 -5.190  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6200  N N    . LEU A 1 62  ? 6.381   -12.714 -3.095  1.00 0.00 ? 62  LEU A N    4  
ATOM 6201  C CA   . LEU A 1 62  ? 6.014   -11.303 -3.038  1.00 0.00 ? 62  LEU A CA   4  
ATOM 6202  C C    . LEU A 1 62  ? 5.472   -10.826 -4.382  1.00 0.00 ? 62  LEU A C    4  
ATOM 6203  O O    . LEU A 1 62  ? 6.099   -11.029 -5.423  1.00 0.00 ? 62  LEU A O    4  
ATOM 6204  C CB   . LEU A 1 62  ? 7.223   -10.457 -2.634  1.00 0.00 ? 62  LEU A CB   4  
ATOM 6205  C CG   . LEU A 1 62  ? 7.028   -8.941  -2.681  1.00 0.00 ? 62  LEU A CG   4  
ATOM 6206  C CD1  . LEU A 1 62  ? 6.922   -8.461  -4.120  1.00 0.00 ? 62  LEU A CD1  4  
ATOM 6207  C CD2  . LEU A 1 62  ? 5.792   -8.538  -1.890  1.00 0.00 ? 62  LEU A CD2  4  
ATOM 6208  H H    . LEU A 1 62  ? 7.225   -12.970 -3.521  1.00 0.00 ? 62  LEU A H    4  
ATOM 6209  H HA   . LEU A 1 62  ? 5.241   -11.191 -2.292  1.00 0.00 ? 62  LEU A HA   4  
ATOM 6210  H HB2  . LEU A 1 62  ? 7.490   -10.724 -1.623  1.00 0.00 ? 62  LEU A HB2  4  
ATOM 6211  H HB3  . LEU A 1 62  ? 8.038   -10.707 -3.298  1.00 0.00 ? 62  LEU A HB3  4  
ATOM 6212  H HG   . LEU A 1 62  ? 7.885   -8.460  -2.231  1.00 0.00 ? 62  LEU A HG   4  
ATOM 6213  H HD11 . LEU A 1 62  ? 5.896   -8.208  -4.340  1.00 0.00 ? 62  LEU A HD11 4  
ATOM 6214  H HD12 . LEU A 1 62  ? 7.250   -9.246  -4.786  1.00 0.00 ? 62  LEU A HD12 4  
ATOM 6215  H HD13 . LEU A 1 62  ? 7.546   -7.590  -4.256  1.00 0.00 ? 62  LEU A HD13 4  
ATOM 6216  H HD21 . LEU A 1 62  ? 5.949   -8.750  -0.843  1.00 0.00 ? 62  LEU A HD21 4  
ATOM 6217  H HD22 . LEU A 1 62  ? 4.939   -9.096  -2.246  1.00 0.00 ? 62  LEU A HD22 4  
ATOM 6218  H HD23 . LEU A 1 62  ? 5.610   -7.481  -2.021  1.00 0.00 ? 62  LEU A HD23 4  
ATOM 6219  N N    . HIS A 1 63  ? 4.305   -10.191 -4.352  1.00 0.00 ? 63  HIS A N    4  
ATOM 6220  C CA   . HIS A 1 63  ? 3.680   -9.682  -5.568  1.00 0.00 ? 63  HIS A CA   4  
ATOM 6221  C C    . HIS A 1 63  ? 3.502   -8.169  -5.495  1.00 0.00 ? 63  HIS A C    4  
ATOM 6222  O O    . HIS A 1 63  ? 2.838   -7.655  -4.595  1.00 0.00 ? 63  HIS A O    4  
ATOM 6223  C CB   . HIS A 1 63  ? 2.326   -10.357 -5.791  1.00 0.00 ? 63  HIS A CB   4  
ATOM 6224  C CG   . HIS A 1 63  ? 2.423   -11.835 -6.010  1.00 0.00 ? 63  HIS A CG   4  
ATOM 6225  N ND1  . HIS A 1 63  ? 1.936   -12.462 -7.138  1.00 0.00 ? 63  HIS A ND1  4  
ATOM 6226  C CD2  . HIS A 1 63  ? 2.955   -12.812 -5.239  1.00 0.00 ? 63  HIS A CD2  4  
ATOM 6227  C CE1  . HIS A 1 63  ? 2.164   -13.761 -7.050  1.00 0.00 ? 63  HIS A CE1  4  
ATOM 6228  N NE2  . HIS A 1 63  ? 2.781   -13.999 -5.907  1.00 0.00 ? 63  HIS A NE2  4  
ATOM 6229  H H    . HIS A 1 63  ? 3.854   -10.060 -3.492  1.00 0.00 ? 63  HIS A H    4  
ATOM 6230  H HA   . HIS A 1 63  ? 4.330   -9.916  -6.397  1.00 0.00 ? 63  HIS A HA   4  
ATOM 6231  H HB2  . HIS A 1 63  ? 1.702   -10.191 -4.925  1.00 0.00 ? 63  HIS A HB2  4  
ATOM 6232  H HB3  . HIS A 1 63  ? 1.853   -9.922  -6.659  1.00 0.00 ? 63  HIS A HB3  4  
ATOM 6233  H HD2  . HIS A 1 63  ? 3.429   -12.683 -4.276  1.00 0.00 ? 63  HIS A HD2  4  
ATOM 6234  H HE1  . HIS A 1 63  ? 1.892   -14.501 -7.787  1.00 0.00 ? 63  HIS A HE1  4  
ATOM 6235  H HE2  . HIS A 1 63  ? 2.990   -14.889 -5.554  1.00 0.00 ? 63  HIS A HE2  4  
ATOM 6236  N N    . ARG A 1 64  ? 4.100   -7.461  -6.448  1.00 0.00 ? 64  ARG A N    4  
ATOM 6237  C CA   . ARG A 1 64  ? 4.008   -6.007  -6.490  1.00 0.00 ? 64  ARG A CA   4  
ATOM 6238  C C    . ARG A 1 64  ? 2.937   -5.558  -7.480  1.00 0.00 ? 64  ARG A C    4  
ATOM 6239  O O    . ARG A 1 64  ? 2.987   -5.897  -8.663  1.00 0.00 ? 64  ARG A O    4  
ATOM 6240  C CB   . ARG A 1 64  ? 5.359   -5.401  -6.875  1.00 0.00 ? 64  ARG A CB   4  
ATOM 6241  C CG   . ARG A 1 64  ? 5.394   -3.884  -6.787  1.00 0.00 ? 64  ARG A CG   4  
ATOM 6242  C CD   . ARG A 1 64  ? 6.622   -3.313  -7.479  1.00 0.00 ? 64  ARG A CD   4  
ATOM 6243  N NE   . ARG A 1 64  ? 6.424   -3.177  -8.919  1.00 0.00 ? 64  ARG A NE   4  
ATOM 6244  C CZ   . ARG A 1 64  ? 7.353   -2.713  -9.748  1.00 0.00 ? 64  ARG A CZ   4  
ATOM 6245  N NH1  . ARG A 1 64  ? 8.537   -2.342  -9.280  1.00 0.00 ? 64  ARG A NH1  4  
ATOM 6246  N NH2  . ARG A 1 64  ? 7.098   -2.619  -11.046 1.00 0.00 ? 64  ARG A NH2  4  
ATOM 6247  H H    . ARG A 1 64  ? 4.615   -7.928  -7.138  1.00 0.00 ? 64  ARG A H    4  
ATOM 6248  H HA   . ARG A 1 64  ? 3.737   -5.662  -5.504  1.00 0.00 ? 64  ARG A HA   4  
ATOM 6249  H HB2  . ARG A 1 64  ? 6.119   -5.795  -6.216  1.00 0.00 ? 64  ARG A HB2  4  
ATOM 6250  H HB3  . ARG A 1 64  ? 5.591   -5.686  -7.890  1.00 0.00 ? 64  ARG A HB3  4  
ATOM 6251  H HG2  . ARG A 1 64  ? 4.509   -3.484  -7.260  1.00 0.00 ? 64  ARG A HG2  4  
ATOM 6252  H HG3  . ARG A 1 64  ? 5.410   -3.594  -5.746  1.00 0.00 ? 64  ARG A HG3  4  
ATOM 6253  H HD2  . ARG A 1 64  ? 6.834   -2.340  -7.061  1.00 0.00 ? 64  ARG A HD2  4  
ATOM 6254  H HD3  . ARG A 1 64  ? 7.458   -3.972  -7.299  1.00 0.00 ? 64  ARG A HD3  4  
ATOM 6255  H HE   . ARG A 1 64  ? 5.556   -3.445  -9.286  1.00 0.00 ? 64  ARG A HE   4  
ATOM 6256  H HH11 . ARG A 1 64  ? 8.733   -2.413  -8.302  1.00 0.00 ? 64  ARG A HH11 4  
ATOM 6257  H HH12 . ARG A 1 64  ? 9.236   -1.994  -9.906  1.00 0.00 ? 64  ARG A HH12 4  
ATOM 6258  H HH21 . ARG A 1 64  ? 6.207   -2.897  -11.402 1.00 0.00 ? 64  ARG A HH21 4  
ATOM 6259  H HH22 . ARG A 1 64  ? 7.798   -2.269  -11.669 1.00 0.00 ? 64  ARG A HH22 4  
ATOM 6260  N N    . LEU A 1 65  ? 1.968   -4.794  -6.988  1.00 0.00 ? 65  LEU A N    4  
ATOM 6261  C CA   . LEU A 1 65  ? 0.883   -4.299  -7.828  1.00 0.00 ? 65  LEU A CA   4  
ATOM 6262  C C    . LEU A 1 65  ? 1.039   -2.805  -8.094  1.00 0.00 ? 65  LEU A C    4  
ATOM 6263  O O    . LEU A 1 65  ? 1.043   -1.997  -7.166  1.00 0.00 ? 65  LEU A O    4  
ATOM 6264  C CB   . LEU A 1 65  ? -0.468  -4.572  -7.165  1.00 0.00 ? 65  LEU A CB   4  
ATOM 6265  C CG   . LEU A 1 65  ? -0.738  -6.023  -6.765  1.00 0.00 ? 65  LEU A CG   4  
ATOM 6266  C CD1  . LEU A 1 65  ? -1.923  -6.104  -5.815  1.00 0.00 ? 65  LEU A CD1  4  
ATOM 6267  C CD2  . LEU A 1 65  ? -0.983  -6.879  -8.000  1.00 0.00 ? 65  LEU A CD2  4  
ATOM 6268  H H    . LEU A 1 65  ? 1.981   -4.557  -6.037  1.00 0.00 ? 65  LEU A H    4  
ATOM 6269  H HA   . LEU A 1 65  ? 0.926   -4.826  -8.769  1.00 0.00 ? 65  LEU A HA   4  
ATOM 6270  H HB2  . LEU A 1 65  ? -0.527  -3.968  -6.273  1.00 0.00 ? 65  LEU A HB2  4  
ATOM 6271  H HB3  . LEU A 1 65  ? -1.242  -4.268  -7.855  1.00 0.00 ? 65  LEU A HB3  4  
ATOM 6272  H HG   . LEU A 1 65  ? 0.129   -6.416  -6.252  1.00 0.00 ? 65  LEU A HG   4  
ATOM 6273  H HD11 . LEU A 1 65  ? -1.968  -5.205  -5.220  1.00 0.00 ? 65  LEU A HD11 4  
ATOM 6274  H HD12 . LEU A 1 65  ? -1.806  -6.960  -5.167  1.00 0.00 ? 65  LEU A HD12 4  
ATOM 6275  H HD13 . LEU A 1 65  ? -2.835  -6.206  -6.385  1.00 0.00 ? 65  LEU A HD13 4  
ATOM 6276  H HD21 . LEU A 1 65  ? -1.298  -6.249  -8.818  1.00 0.00 ? 65  LEU A HD21 4  
ATOM 6277  H HD22 . LEU A 1 65  ? -1.753  -7.605  -7.787  1.00 0.00 ? 65  LEU A HD22 4  
ATOM 6278  H HD23 . LEU A 1 65  ? -0.070  -7.392  -8.269  1.00 0.00 ? 65  LEU A HD23 4  
ATOM 6279  N N    . ASN A 1 66  ? 1.165   -2.445  -9.367  1.00 0.00 ? 66  ASN A N    4  
ATOM 6280  C CA   . ASN A 1 66  ? 1.319   -1.048  -9.755  1.00 0.00 ? 66  ASN A CA   4  
ATOM 6281  C C    . ASN A 1 66  ? -0.025  -0.440  -10.145 1.00 0.00 ? 66  ASN A C    4  
ATOM 6282  O O    . ASN A 1 66  ? -0.868  -1.106  -10.748 1.00 0.00 ? 66  ASN A O    4  
ATOM 6283  C CB   . ASN A 1 66  ? 2.303   -0.926  -10.920 1.00 0.00 ? 66  ASN A CB   4  
ATOM 6284  C CG   . ASN A 1 66  ? 3.738   -1.164  -10.491 1.00 0.00 ? 66  ASN A CG   4  
ATOM 6285  O OD1  . ASN A 1 66  ? 4.152   -2.303  -10.274 1.00 0.00 ? 66  ASN A OD1  4  
ATOM 6286  N ND2  . ASN A 1 66  ? 4.505   -0.087  -10.368 1.00 0.00 ? 66  ASN A ND2  4  
ATOM 6287  H H    . ASN A 1 66  ? 1.154   -3.136  -10.062 1.00 0.00 ? 66  ASN A H    4  
ATOM 6288  H HA   . ASN A 1 66  ? 1.711   -0.510  -8.906  1.00 0.00 ? 66  ASN A HA   4  
ATOM 6289  H HB2  . ASN A 1 66  ? 2.048   -1.654  -11.676 1.00 0.00 ? 66  ASN A HB2  4  
ATOM 6290  H HB3  . ASN A 1 66  ? 2.232   0.065   -11.342 1.00 0.00 ? 66  ASN A HB3  4  
ATOM 6291  H HD21 . ASN A 1 66  ? 4.108   0.788   -10.558 1.00 0.00 ? 66  ASN A HD21 4  
ATOM 6292  H HD22 . ASN A 1 66  ? 5.437   -0.213  -10.093 1.00 0.00 ? 66  ASN A HD22 4  
ATOM 6293  N N    . ILE A 1 67  ? -0.218  0.828   -9.797  1.00 0.00 ? 67  ILE A N    4  
ATOM 6294  C CA   . ILE A 1 67  ? -1.459  1.525   -10.112 1.00 0.00 ? 67  ILE A CA   4  
ATOM 6295  C C    . ILE A 1 67  ? -1.221  2.638   -11.127 1.00 0.00 ? 67  ILE A C    4  
ATOM 6296  O O    . ILE A 1 67  ? -0.641  3.680   -10.820 1.00 0.00 ? 67  ILE A O    4  
ATOM 6297  C CB   . ILE A 1 67  ? -2.102  2.127   -8.849  1.00 0.00 ? 67  ILE A CB   4  
ATOM 6298  C CG1  . ILE A 1 67  ? -2.013  1.139   -7.684  1.00 0.00 ? 67  ILE A CG1  4  
ATOM 6299  C CG2  . ILE A 1 67  ? -3.551  2.505   -9.121  1.00 0.00 ? 67  ILE A CG2  4  
ATOM 6300  C CD1  . ILE A 1 67  ? -2.899  -0.076  -7.854  1.00 0.00 ? 67  ILE A CD1  4  
ATOM 6301  H H    . ILE A 1 67  ? 0.490   1.305   -9.318  1.00 0.00 ? 67  ILE A H    4  
ATOM 6302  H HA   . ILE A 1 67  ? -2.147  0.807   -10.535 1.00 0.00 ? 67  ILE A HA   4  
ATOM 6303  H HB   . ILE A 1 67  ? -1.564  3.026   -8.591  1.00 0.00 ? 67  ILE A HB   4  
ATOM 6304  H HG12 . ILE A 1 67  ? -0.995  0.796   -7.588  1.00 0.00 ? 67  ILE A HG12 4  
ATOM 6305  H HG13 . ILE A 1 67  ? -2.307  1.641   -6.773  1.00 0.00 ? 67  ILE A HG13 4  
ATOM 6306  H HG21 . ILE A 1 67  ? -4.195  1.685   -8.840  1.00 0.00 ? 67  ILE A HG21 4  
ATOM 6307  H HG22 . ILE A 1 67  ? -3.809  3.379   -8.542  1.00 0.00 ? 67  ILE A HG22 4  
ATOM 6308  H HG23 . ILE A 1 67  ? -3.676  2.718   -10.172 1.00 0.00 ? 67  ILE A HG23 4  
ATOM 6309  H HD11 . ILE A 1 67  ? -3.245  -0.128  -8.876  1.00 0.00 ? 67  ILE A HD11 4  
ATOM 6310  H HD12 . ILE A 1 67  ? -2.336  -0.967  -7.619  1.00 0.00 ? 67  ILE A HD12 4  
ATOM 6311  H HD13 . ILE A 1 67  ? -3.747  0.001   -7.190  1.00 0.00 ? 67  ILE A HD13 4  
ATOM 6312  N N    . PRO A 1 68  ? -1.681  2.415   -12.368 1.00 0.00 ? 68  PRO A N    4  
ATOM 6313  C CA   . PRO A 1 68  ? -1.532  3.388   -13.454 1.00 0.00 ? 68  PRO A CA   4  
ATOM 6314  C C    . PRO A 1 68  ? -2.402  4.624   -13.248 1.00 0.00 ? 68  PRO A C    4  
ATOM 6315  O O    . PRO A 1 68  ? -2.443  5.513   -14.097 1.00 0.00 ? 68  PRO A O    4  
ATOM 6316  C CB   . PRO A 1 68  ? -1.990  2.612   -14.691 1.00 0.00 ? 68  PRO A CB   4  
ATOM 6317  C CG   . PRO A 1 68  ? -2.911  1.567   -14.163 1.00 0.00 ? 68  PRO A CG   4  
ATOM 6318  C CD   . PRO A 1 68  ? -2.381  1.196   -12.805 1.00 0.00 ? 68  PRO A CD   4  
ATOM 6319  H HA   . PRO A 1 68  ? -0.502  3.691   -13.577 1.00 0.00 ? 68  PRO A HA   4  
ATOM 6320  H HB2  . PRO A 1 68  ? -2.499  3.281   -15.371 1.00 0.00 ? 68  PRO A HB2  4  
ATOM 6321  H HB3  . PRO A 1 68  ? -1.135  2.173   -15.182 1.00 0.00 ? 68  PRO A HB3  4  
ATOM 6322  H HG2  . PRO A 1 68  ? -3.910  1.966   -14.079 1.00 0.00 ? 68  PRO A HG2  4  
ATOM 6323  H HG3  . PRO A 1 68  ? -2.902  0.706   -14.816 1.00 0.00 ? 68  PRO A HG3  4  
ATOM 6324  H HD2  . PRO A 1 68  ? -3.194  0.957   -12.135 1.00 0.00 ? 68  PRO A HD2  4  
ATOM 6325  H HD3  . PRO A 1 68  ? -1.696  0.365   -12.881 1.00 0.00 ? 68  PRO A HD3  4  
ATOM 6326  N N    . ASN A 1 69  ? -3.094  4.672   -12.115 1.00 0.00 ? 69  ASN A N    4  
ATOM 6327  C CA   . ASN A 1 69  ? -3.964  5.799   -11.798 1.00 0.00 ? 69  ASN A CA   4  
ATOM 6328  C C    . ASN A 1 69  ? -3.704  6.306   -10.383 1.00 0.00 ? 69  ASN A C    4  
ATOM 6329  O O    . ASN A 1 69  ? -3.949  5.614   -9.394  1.00 0.00 ? 69  ASN A O    4  
ATOM 6330  C CB   . ASN A 1 69  ? -5.432  5.395   -11.945 1.00 0.00 ? 69  ASN A CB   4  
ATOM 6331  C CG   . ASN A 1 69  ? -6.343  6.590   -12.153 1.00 0.00 ? 69  ASN A CG   4  
ATOM 6332  O OD1  . ASN A 1 69  ? -5.919  7.626   -12.665 1.00 0.00 ? 69  ASN A OD1  4  
ATOM 6333  N ND2  . ASN A 1 69  ? -7.602  6.450   -11.754 1.00 0.00 ? 69  ASN A ND2  4  
ATOM 6334  H H    . ASN A 1 69  ? -3.020  3.932   -11.477 1.00 0.00 ? 69  ASN A H    4  
ATOM 6335  H HA   . ASN A 1 69  ? -3.746  6.592   -12.497 1.00 0.00 ? 69  ASN A HA   4  
ATOM 6336  H HB2  . ASN A 1 69  ? -5.534  4.737   -12.796 1.00 0.00 ? 69  ASN A HB2  4  
ATOM 6337  H HB3  . ASN A 1 69  ? -5.748  4.875   -11.053 1.00 0.00 ? 69  ASN A HB3  4  
ATOM 6338  H HD21 . ASN A 1 69  ? -7.869  5.596   -11.354 1.00 0.00 ? 69  ASN A HD21 4  
ATOM 6339  H HD22 . ASN A 1 69  ? -8.212  7.207   -11.877 1.00 0.00 ? 69  ASN A HD22 4  
ATOM 6340  N N    . PRO A 1 70  ? -3.195  7.543   -10.281 1.00 0.00 ? 70  PRO A N    4  
ATOM 6341  C CA   . PRO A 1 70  ? -2.891  8.170   -8.991  1.00 0.00 ? 70  PRO A CA   4  
ATOM 6342  C C    . PRO A 1 70  ? -4.150  8.518   -8.205  1.00 0.00 ? 70  PRO A C    4  
ATOM 6343  O O    . PRO A 1 70  ? -4.077  8.922   -7.045  1.00 0.00 ? 70  PRO A O    4  
ATOM 6344  C CB   . PRO A 1 70  ? -2.138  9.443   -9.385  1.00 0.00 ? 70  PRO A CB   4  
ATOM 6345  C CG   . PRO A 1 70  ? -2.610  9.752   -10.764 1.00 0.00 ? 70  PRO A CG   4  
ATOM 6346  C CD   . PRO A 1 70  ? -2.877  8.424   -11.417 1.00 0.00 ? 70  PRO A CD   4  
ATOM 6347  H HA   . PRO A 1 70  ? -2.252  7.544   -8.386  1.00 0.00 ? 70  PRO A HA   4  
ATOM 6348  H HB2  . PRO A 1 70  ? -2.384  10.238  -8.695  1.00 0.00 ? 70  PRO A HB2  4  
ATOM 6349  H HB3  . PRO A 1 70  ? -1.074  9.258   -9.364  1.00 0.00 ? 70  PRO A HB3  4  
ATOM 6350  H HG2  . PRO A 1 70  ? -3.516  10.337  -10.719 1.00 0.00 ? 70  PRO A HG2  4  
ATOM 6351  H HG3  . PRO A 1 70  ? -1.842  10.287  -11.303 1.00 0.00 ? 70  PRO A HG3  4  
ATOM 6352  H HD2  . PRO A 1 70  ? -3.715  8.498   -12.094 1.00 0.00 ? 70  PRO A HD2  4  
ATOM 6353  H HD3  . PRO A 1 70  ? -1.997  8.077   -11.939 1.00 0.00 ? 70  PRO A HD3  4  
ATOM 6354  N N    . ALA A 1 71  ? -5.304  8.359   -8.845  1.00 0.00 ? 71  ALA A N    4  
ATOM 6355  C CA   . ALA A 1 71  ? -6.580  8.654   -8.204  1.00 0.00 ? 71  ALA A CA   4  
ATOM 6356  C C    . ALA A 1 71  ? -7.188  7.398   -7.587  1.00 0.00 ? 71  ALA A C    4  
ATOM 6357  O O    . ALA A 1 71  ? -7.922  7.474   -6.602  1.00 0.00 ? 71  ALA A O    4  
ATOM 6358  C CB   . ALA A 1 71  ? -7.544  9.271   -9.206  1.00 0.00 ? 71  ALA A CB   4  
ATOM 6359  H H    . ALA A 1 71  ? -5.298  8.034   -9.769  1.00 0.00 ? 71  ALA A H    4  
ATOM 6360  H HA   . ALA A 1 71  ? -6.401  9.377   -7.421  1.00 0.00 ? 71  ALA A HA   4  
ATOM 6361  H HB1  . ALA A 1 71  ? -8.345  9.765   -8.677  1.00 0.00 ? 71  ALA A HB1  4  
ATOM 6362  H HB2  . ALA A 1 71  ? -7.016  9.992   -9.814  1.00 0.00 ? 71  ALA A HB2  4  
ATOM 6363  H HB3  . ALA A 1 71  ? -7.952  8.496   -9.837  1.00 0.00 ? 71  ALA A HB3  4  
ATOM 6364  N N    . GLN A 1 72  ? -6.877  6.247   -8.173  1.00 0.00 ? 72  GLN A N    4  
ATOM 6365  C CA   . GLN A 1 72  ? -7.395  4.975   -7.681  1.00 0.00 ? 72  GLN A CA   4  
ATOM 6366  C C    . GLN A 1 72  ? -6.711  4.578   -6.377  1.00 0.00 ? 72  GLN A C    4  
ATOM 6367  O O    . GLN A 1 72  ? -5.596  4.053   -6.382  1.00 0.00 ? 72  GLN A O    4  
ATOM 6368  C CB   . GLN A 1 72  ? -7.197  3.880   -8.729  1.00 0.00 ? 72  GLN A CB   4  
ATOM 6369  C CG   . GLN A 1 72  ? -7.439  2.477   -8.196  1.00 0.00 ? 72  GLN A CG   4  
ATOM 6370  C CD   . GLN A 1 72  ? -6.836  1.404   -9.082  1.00 0.00 ? 72  GLN A CD   4  
ATOM 6371  O OE1  . GLN A 1 72  ? -6.749  1.564   -10.299 1.00 0.00 ? 72  GLN A OE1  4  
ATOM 6372  N NE2  . GLN A 1 72  ? -6.416  0.301   -8.473  1.00 0.00 ? 72  GLN A NE2  4  
ATOM 6373  H H    . GLN A 1 72  ? -6.287  6.252   -8.955  1.00 0.00 ? 72  GLN A H    4  
ATOM 6374  H HA   . GLN A 1 72  ? -8.451  5.097   -7.495  1.00 0.00 ? 72  GLN A HA   4  
ATOM 6375  H HB2  . GLN A 1 72  ? -7.879  4.054   -9.548  1.00 0.00 ? 72  GLN A HB2  4  
ATOM 6376  H HB3  . GLN A 1 72  ? -6.183  3.930   -9.099  1.00 0.00 ? 72  GLN A HB3  4  
ATOM 6377  H HG2  . GLN A 1 72  ? -7.000  2.398   -7.213  1.00 0.00 ? 72  GLN A HG2  4  
ATOM 6378  H HG3  . GLN A 1 72  ? -8.504  2.311   -8.128  1.00 0.00 ? 72  GLN A HG3  4  
ATOM 6379  H HE21 . GLN A 1 72  ? -6.518  0.243   -7.500  1.00 0.00 ? 72  GLN A HE21 4  
ATOM 6380  H HE22 . GLN A 1 72  ? -6.023  -0.409  -9.021  1.00 0.00 ? 72  GLN A HE22 4  
ATOM 6381  N N    . THR A 1 73  ? -7.384  4.831   -5.259  1.00 0.00 ? 73  THR A N    4  
ATOM 6382  C CA   . THR A 1 73  ? -6.841  4.501   -3.948  1.00 0.00 ? 73  THR A CA   4  
ATOM 6383  C C    . THR A 1 73  ? -7.406  3.181   -3.435  1.00 0.00 ? 73  THR A C    4  
ATOM 6384  O O    . THR A 1 73  ? -7.643  3.019   -2.238  1.00 0.00 ? 73  THR A O    4  
ATOM 6385  C CB   . THR A 1 73  ? -7.142  5.608   -2.920  1.00 0.00 ? 73  THR A CB   4  
ATOM 6386  O OG1  . THR A 1 73  ? -8.556  5.730   -2.730  1.00 0.00 ? 73  THR A OG1  4  
ATOM 6387  C CG2  . THR A 1 73  ? -6.569  6.941   -3.379  1.00 0.00 ? 73  THR A CG2  4  
ATOM 6388  H H    . THR A 1 73  ? -8.268  5.251   -5.320  1.00 0.00 ? 73  THR A H    4  
ATOM 6389  H HA   . THR A 1 73  ? -5.769  4.409   -4.044  1.00 0.00 ? 73  THR A HA   4  
ATOM 6390  H HB   . THR A 1 73  ? -6.681  5.340   -1.980  1.00 0.00 ? 73  THR A HB   4  
ATOM 6391  H HG1  . THR A 1 73  ? -8.965  6.015   -3.551  1.00 0.00 ? 73  THR A HG1  4  
ATOM 6392  H HG21 . THR A 1 73  ? -7.364  7.668   -3.450  1.00 0.00 ? 73  THR A HG21 4  
ATOM 6393  H HG22 . THR A 1 73  ? -6.105  6.820   -4.346  1.00 0.00 ? 73  THR A HG22 4  
ATOM 6394  H HG23 . THR A 1 73  ? -5.833  7.281   -2.666  1.00 0.00 ? 73  THR A HG23 4  
ATOM 6395  N N    . SER A 1 74  ? -7.620  2.239   -4.348  1.00 0.00 ? 74  SER A N    4  
ATOM 6396  C CA   . SER A 1 74  ? -8.160  0.934   -3.988  1.00 0.00 ? 74  SER A CA   4  
ATOM 6397  C C    . SER A 1 74  ? -7.857  -0.097  -5.072  1.00 0.00 ? 74  SER A C    4  
ATOM 6398  O O    . SER A 1 74  ? -8.119  0.131   -6.253  1.00 0.00 ? 74  SER A O    4  
ATOM 6399  C CB   . SER A 1 74  ? -9.671  1.027   -3.765  1.00 0.00 ? 74  SER A CB   4  
ATOM 6400  O OG   . SER A 1 74  ? -10.309 1.667   -4.857  1.00 0.00 ? 74  SER A OG   4  
ATOM 6401  H H    . SER A 1 74  ? -7.411  2.428   -5.287  1.00 0.00 ? 74  SER A H    4  
ATOM 6402  H HA   . SER A 1 74  ? -7.688  0.621   -3.069  1.00 0.00 ? 74  SER A HA   4  
ATOM 6403  H HB2  . SER A 1 74  ? -10.078 0.034   -3.657  1.00 0.00 ? 74  SER A HB2  4  
ATOM 6404  H HB3  . SER A 1 74  ? -9.865  1.596   -2.867  1.00 0.00 ? 74  SER A HB3  4  
ATOM 6405  H HG   . SER A 1 74  ? -10.557 1.010   -5.512  1.00 0.00 ? 74  SER A HG   4  
ATOM 6406  N N    . VAL A 1 75  ? -7.304  -1.234  -4.660  1.00 0.00 ? 75  VAL A N    4  
ATOM 6407  C CA   . VAL A 1 75  ? -6.966  -2.301  -5.594  1.00 0.00 ? 75  VAL A CA   4  
ATOM 6408  C C    . VAL A 1 75  ? -7.450  -3.653  -5.081  1.00 0.00 ? 75  VAL A C    4  
ATOM 6409  O O    . VAL A 1 75  ? -7.469  -3.902  -3.876  1.00 0.00 ? 75  VAL A O    4  
ATOM 6410  C CB   . VAL A 1 75  ? -5.447  -2.371  -5.840  1.00 0.00 ? 75  VAL A CB   4  
ATOM 6411  C CG1  . VAL A 1 75  ? -4.724  -2.837  -4.586  1.00 0.00 ? 75  VAL A CG1  4  
ATOM 6412  C CG2  . VAL A 1 75  ? -5.140  -3.288  -7.015  1.00 0.00 ? 75  VAL A CG2  4  
ATOM 6413  H H    . VAL A 1 75  ? -7.120  -1.357  -3.706  1.00 0.00 ? 75  VAL A H    4  
ATOM 6414  H HA   . VAL A 1 75  ? -7.453  -2.089  -6.535  1.00 0.00 ? 75  VAL A HA   4  
ATOM 6415  H HB   . VAL A 1 75  ? -5.097  -1.379  -6.084  1.00 0.00 ? 75  VAL A HB   4  
ATOM 6416  H HG11 . VAL A 1 75  ? -4.751  -2.053  -3.843  1.00 0.00 ? 75  VAL A HG11 4  
ATOM 6417  H HG12 . VAL A 1 75  ? -5.208  -3.721  -4.198  1.00 0.00 ? 75  VAL A HG12 4  
ATOM 6418  H HG13 . VAL A 1 75  ? -3.696  -3.066  -4.828  1.00 0.00 ? 75  VAL A HG13 4  
ATOM 6419  H HG21 . VAL A 1 75  ? -4.670  -4.191  -6.654  1.00 0.00 ? 75  VAL A HG21 4  
ATOM 6420  H HG22 . VAL A 1 75  ? -6.059  -3.539  -7.524  1.00 0.00 ? 75  VAL A HG22 4  
ATOM 6421  H HG23 . VAL A 1 75  ? -4.474  -2.785  -7.701  1.00 0.00 ? 75  VAL A HG23 4  
ATOM 6422  N N    . VAL A 1 76  ? -7.840  -4.526  -6.005  1.00 0.00 ? 76  VAL A N    4  
ATOM 6423  C CA   . VAL A 1 76  ? -8.322  -5.854  -5.648  1.00 0.00 ? 76  VAL A CA   4  
ATOM 6424  C C    . VAL A 1 76  ? -7.209  -6.890  -5.756  1.00 0.00 ? 76  VAL A C    4  
ATOM 6425  O O    . VAL A 1 76  ? -6.641  -7.098  -6.828  1.00 0.00 ? 76  VAL A O    4  
ATOM 6426  C CB   . VAL A 1 76  ? -9.498  -6.284  -6.544  1.00 0.00 ? 76  VAL A CB   4  
ATOM 6427  C CG1  . VAL A 1 76  ? -9.905  -7.718  -6.240  1.00 0.00 ? 76  VAL A CG1  4  
ATOM 6428  C CG2  . VAL A 1 76  ? -10.676 -5.338  -6.368  1.00 0.00 ? 76  VAL A CG2  4  
ATOM 6429  H H    . VAL A 1 76  ? -7.801  -4.270  -6.951  1.00 0.00 ? 76  VAL A H    4  
ATOM 6430  H HA   . VAL A 1 76  ? -8.670  -5.819  -4.626  1.00 0.00 ? 76  VAL A HA   4  
ATOM 6431  H HB   . VAL A 1 76  ? -9.176  -6.236  -7.574  1.00 0.00 ? 76  VAL A HB   4  
ATOM 6432  H HG11 . VAL A 1 76  ? -10.368 -7.761  -5.265  1.00 0.00 ? 76  VAL A HG11 4  
ATOM 6433  H HG12 . VAL A 1 76  ? -10.604 -8.061  -6.989  1.00 0.00 ? 76  VAL A HG12 4  
ATOM 6434  H HG13 . VAL A 1 76  ? -9.029  -8.350  -6.250  1.00 0.00 ? 76  VAL A HG13 4  
ATOM 6435  H HG21 . VAL A 1 76  ? -10.522 -4.455  -6.969  1.00 0.00 ? 76  VAL A HG21 4  
ATOM 6436  H HG22 . VAL A 1 76  ? -11.584 -5.833  -6.680  1.00 0.00 ? 76  VAL A HG22 4  
ATOM 6437  H HG23 . VAL A 1 76  ? -10.759 -5.056  -5.328  1.00 0.00 ? 76  VAL A HG23 4  
ATOM 6438  N N    . VAL A 1 77  ? -6.902  -7.540  -4.637  1.00 0.00 ? 77  VAL A N    4  
ATOM 6439  C CA   . VAL A 1 77  ? -5.858  -8.557  -4.606  1.00 0.00 ? 77  VAL A CA   4  
ATOM 6440  C C    . VAL A 1 77  ? -6.456  -9.959  -4.590  1.00 0.00 ? 77  VAL A C    4  
ATOM 6441  O O    . VAL A 1 77  ? -7.237  -10.300 -3.702  1.00 0.00 ? 77  VAL A O    4  
ATOM 6442  C CB   . VAL A 1 77  ? -4.945  -8.386  -3.377  1.00 0.00 ? 77  VAL A CB   4  
ATOM 6443  C CG1  . VAL A 1 77  ? -3.844  -9.436  -3.380  1.00 0.00 ? 77  VAL A CG1  4  
ATOM 6444  C CG2  . VAL A 1 77  ? -4.356  -6.984  -3.343  1.00 0.00 ? 77  VAL A CG2  4  
ATOM 6445  H H    . VAL A 1 77  ? -7.391  -7.331  -3.814  1.00 0.00 ? 77  VAL A H    4  
ATOM 6446  H HA   . VAL A 1 77  ? -5.255  -8.444  -5.495  1.00 0.00 ? 77  VAL A HA   4  
ATOM 6447  H HB   . VAL A 1 77  ? -5.542  -8.525  -2.488  1.00 0.00 ? 77  VAL A HB   4  
ATOM 6448  H HG11 . VAL A 1 77  ? -3.763  -9.874  -2.396  1.00 0.00 ? 77  VAL A HG11 4  
ATOM 6449  H HG12 . VAL A 1 77  ? -4.082  -10.206 -4.100  1.00 0.00 ? 77  VAL A HG12 4  
ATOM 6450  H HG13 . VAL A 1 77  ? -2.905  -8.972  -3.645  1.00 0.00 ? 77  VAL A HG13 4  
ATOM 6451  H HG21 . VAL A 1 77  ? -4.885  -6.389  -2.614  1.00 0.00 ? 77  VAL A HG21 4  
ATOM 6452  H HG22 . VAL A 1 77  ? -3.312  -7.040  -3.073  1.00 0.00 ? 77  VAL A HG22 4  
ATOM 6453  H HG23 . VAL A 1 77  ? -4.452  -6.528  -4.318  1.00 0.00 ? 77  VAL A HG23 4  
ATOM 6454  N N    . GLU A 1 78  ? -6.084  -10.767 -5.578  1.00 0.00 ? 78  GLU A N    4  
ATOM 6455  C CA   . GLU A 1 78  ? -6.585  -12.133 -5.676  1.00 0.00 ? 78  GLU A CA   4  
ATOM 6456  C C    . GLU A 1 78  ? -5.437  -13.122 -5.857  1.00 0.00 ? 78  GLU A C    4  
ATOM 6457  O O    . GLU A 1 78  ? -4.268  -12.736 -5.872  1.00 0.00 ? 78  GLU A O    4  
ATOM 6458  C CB   . GLU A 1 78  ? -7.567  -12.256 -6.843  1.00 0.00 ? 78  GLU A CB   4  
ATOM 6459  C CG   . GLU A 1 78  ? -8.752  -11.310 -6.743  1.00 0.00 ? 78  GLU A CG   4  
ATOM 6460  C CD   . GLU A 1 78  ? -9.888  -11.697 -7.670  1.00 0.00 ? 78  GLU A CD   4  
ATOM 6461  O OE1  . GLU A 1 78  ? -10.054 -12.908 -7.931  1.00 0.00 ? 78  GLU A OE1  4  
ATOM 6462  O OE2  . GLU A 1 78  ? -10.610 -10.791 -8.136  1.00 0.00 ? 78  GLU A OE2  4  
ATOM 6463  H H    . GLU A 1 78  ? -5.458  -10.437 -6.255  1.00 0.00 ? 78  GLU A H    4  
ATOM 6464  H HA   . GLU A 1 78  ? -7.101  -12.364 -4.757  1.00 0.00 ? 78  GLU A HA   4  
ATOM 6465  H HB2  . GLU A 1 78  ? -7.043  -12.048 -7.763  1.00 0.00 ? 78  GLU A HB2  4  
ATOM 6466  H HB3  . GLU A 1 78  ? -7.944  -13.268 -6.875  1.00 0.00 ? 78  GLU A HB3  4  
ATOM 6467  H HG2  . GLU A 1 78  ? -9.119  -11.319 -5.727  1.00 0.00 ? 78  GLU A HG2  4  
ATOM 6468  H HG3  . GLU A 1 78  ? -8.423  -10.313 -6.997  1.00 0.00 ? 78  GLU A HG3  4  
ATOM 6469  N N    . ASP A 1 79  ? -5.779  -14.398 -5.994  1.00 0.00 ? 79  ASP A N    4  
ATOM 6470  C CA   . ASP A 1 79  ? -4.778  -15.443 -6.175  1.00 0.00 ? 79  ASP A CA   4  
ATOM 6471  C C    . ASP A 1 79  ? -3.947  -15.624 -4.909  1.00 0.00 ? 79  ASP A C    4  
ATOM 6472  O O    . ASP A 1 79  ? -2.734  -15.829 -4.974  1.00 0.00 ? 79  ASP A O    4  
ATOM 6473  C CB   . ASP A 1 79  ? -3.866  -15.106 -7.356  1.00 0.00 ? 79  ASP A CB   4  
ATOM 6474  C CG   . ASP A 1 79  ? -3.059  -16.302 -7.823  1.00 0.00 ? 79  ASP A CG   4  
ATOM 6475  O OD1  . ASP A 1 79  ? -1.951  -16.517 -7.288  1.00 0.00 ? 79  ASP A OD1  4  
ATOM 6476  O OD2  . ASP A 1 79  ? -3.536  -17.023 -8.724  1.00 0.00 ? 79  ASP A OD2  4  
ATOM 6477  H H    . ASP A 1 79  ? -6.728  -14.643 -5.974  1.00 0.00 ? 79  ASP A H    4  
ATOM 6478  H HA   . ASP A 1 79  ? -5.297  -16.366 -6.385  1.00 0.00 ? 79  ASP A HA   4  
ATOM 6479  H HB2  . ASP A 1 79  ? -4.470  -14.758 -8.181  1.00 0.00 ? 79  ASP A HB2  4  
ATOM 6480  H HB3  . ASP A 1 79  ? -3.181  -14.325 -7.061  1.00 0.00 ? 79  ASP A HB3  4  
ATOM 6481  N N    . LEU A 1 80  ? -4.606  -15.547 -3.758  1.00 0.00 ? 80  LEU A N    4  
ATOM 6482  C CA   . LEU A 1 80  ? -3.928  -15.701 -2.476  1.00 0.00 ? 80  LEU A CA   4  
ATOM 6483  C C    . LEU A 1 80  ? -4.170  -17.091 -1.896  1.00 0.00 ? 80  LEU A C    4  
ATOM 6484  O O    . LEU A 1 80  ? -4.951  -17.874 -2.438  1.00 0.00 ? 80  LEU A O    4  
ATOM 6485  C CB   . LEU A 1 80  ? -4.410  -14.634 -1.491  1.00 0.00 ? 80  LEU A CB   4  
ATOM 6486  C CG   . LEU A 1 80  ? -4.336  -13.187 -1.979  1.00 0.00 ? 80  LEU A CG   4  
ATOM 6487  C CD1  . LEU A 1 80  ? -5.401  -12.340 -1.300  1.00 0.00 ? 80  LEU A CD1  4  
ATOM 6488  C CD2  . LEU A 1 80  ? -2.951  -12.609 -1.728  1.00 0.00 ? 80  LEU A CD2  4  
ATOM 6489  H H    . LEU A 1 80  ? -5.572  -15.382 -3.770  1.00 0.00 ? 80  LEU A H    4  
ATOM 6490  H HA   . LEU A 1 80  ? -2.869  -15.573 -2.644  1.00 0.00 ? 80  LEU A HA   4  
ATOM 6491  H HB2  . LEU A 1 80  ? -5.439  -14.849 -1.248  1.00 0.00 ? 80  LEU A HB2  4  
ATOM 6492  H HB3  . LEU A 1 80  ? -3.806  -14.714 -0.598  1.00 0.00 ? 80  LEU A HB3  4  
ATOM 6493  H HG   . LEU A 1 80  ? -4.521  -13.164 -3.045  1.00 0.00 ? 80  LEU A HG   4  
ATOM 6494  H HD11 . LEU A 1 80  ? -5.619  -11.478 -1.912  1.00 0.00 ? 80  LEU A HD11 4  
ATOM 6495  H HD12 . LEU A 1 80  ? -5.040  -12.015 -0.335  1.00 0.00 ? 80  LEU A HD12 4  
ATOM 6496  H HD13 . LEU A 1 80  ? -6.298  -12.927 -1.170  1.00 0.00 ? 80  LEU A HD13 4  
ATOM 6497  H HD21 . LEU A 1 80  ? -2.353  -13.329 -1.190  1.00 0.00 ? 80  LEU A HD21 4  
ATOM 6498  H HD22 . LEU A 1 80  ? -3.039  -11.705 -1.144  1.00 0.00 ? 80  LEU A HD22 4  
ATOM 6499  H HD23 . LEU A 1 80  ? -2.479  -12.382 -2.673  1.00 0.00 ? 80  LEU A HD23 4  
ATOM 6500  N N    . LEU A 1 81  ? -3.496  -17.390 -0.791  1.00 0.00 ? 81  LEU A N    4  
ATOM 6501  C CA   . LEU A 1 81  ? -3.639  -18.686 -0.135  1.00 0.00 ? 81  LEU A CA   4  
ATOM 6502  C C    . LEU A 1 81  ? -4.556  -18.583 1.079   1.00 0.00 ? 81  LEU A C    4  
ATOM 6503  O O    . LEU A 1 81  ? -4.473  -17.646 1.873   1.00 0.00 ? 81  LEU A O    4  
ATOM 6504  C CB   . LEU A 1 81  ? -2.269  -19.218 0.290   1.00 0.00 ? 81  LEU A CB   4  
ATOM 6505  C CG   . LEU A 1 81  ? -1.422  -19.851 -0.815  1.00 0.00 ? 81  LEU A CG   4  
ATOM 6506  C CD1  . LEU A 1 81  ? 0.032   -19.953 -0.382  1.00 0.00 ? 81  LEU A CD1  4  
ATOM 6507  C CD2  . LEU A 1 81  ? -1.968  -21.223 -1.185  1.00 0.00 ? 81  LEU A CD2  4  
ATOM 6508  H H    . LEU A 1 81  ? -2.888  -16.725 -0.406  1.00 0.00 ? 81  LEU A H    4  
ATOM 6509  H HA   . LEU A 1 81  ? -4.077  -19.370 -0.846  1.00 0.00 ? 81  LEU A HA   4  
ATOM 6510  H HB2  . LEU A 1 81  ? -1.708  -18.394 0.704   1.00 0.00 ? 81  LEU A HB2  4  
ATOM 6511  H HB3  . LEU A 1 81  ? -2.428  -19.964 1.055   1.00 0.00 ? 81  LEU A HB3  4  
ATOM 6512  H HG   . LEU A 1 81  ? -1.465  -19.225 -1.696  1.00 0.00 ? 81  LEU A HG   4  
ATOM 6513  H HD11 . LEU A 1 81  ? 0.589   -20.509 -1.120  1.00 0.00 ? 81  LEU A HD11 4  
ATOM 6514  H HD12 . LEU A 1 81  ? 0.089   -20.460 0.570   1.00 0.00 ? 81  LEU A HD12 4  
ATOM 6515  H HD13 . LEU A 1 81  ? 0.449   -18.961 -0.286  1.00 0.00 ? 81  LEU A HD13 4  
ATOM 6516  H HD21 . LEU A 1 81  ? -3.019  -21.141 -1.418  1.00 0.00 ? 81  LEU A HD21 4  
ATOM 6517  H HD22 . LEU A 1 81  ? -1.834  -21.899 -0.354  1.00 0.00 ? 81  LEU A HD22 4  
ATOM 6518  H HD23 . LEU A 1 81  ? -1.436  -21.601 -2.046  1.00 0.00 ? 81  LEU A HD23 4  
ATOM 6519  N N    . PRO A 1 82  ? -5.452  -19.570 1.229   1.00 0.00 ? 82  PRO A N    4  
ATOM 6520  C CA   . PRO A 1 82  ? -6.401  -19.615 2.346   1.00 0.00 ? 82  PRO A CA   4  
ATOM 6521  C C    . PRO A 1 82  ? -5.715  -19.902 3.677   1.00 0.00 ? 82  PRO A C    4  
ATOM 6522  O O    . PRO A 1 82  ? -4.725  -20.630 3.732   1.00 0.00 ? 82  PRO A O    4  
ATOM 6523  C CB   . PRO A 1 82  ? -7.338  -20.765 1.968   1.00 0.00 ? 82  PRO A CB   4  
ATOM 6524  C CG   . PRO A 1 82  ? -6.527  -21.638 1.075   1.00 0.00 ? 82  PRO A CG   4  
ATOM 6525  C CD   . PRO A 1 82  ? -5.607  -20.718 0.320   1.00 0.00 ? 82  PRO A CD   4  
ATOM 6526  H HA   . PRO A 1 82  ? -6.966  -18.698 2.423   1.00 0.00 ? 82  PRO A HA   4  
ATOM 6527  H HB2  . PRO A 1 82  ? -7.647  -21.289 2.862   1.00 0.00 ? 82  PRO A HB2  4  
ATOM 6528  H HB3  . PRO A 1 82  ? -8.205  -20.374 1.456   1.00 0.00 ? 82  PRO A HB3  4  
ATOM 6529  H HG2  . PRO A 1 82  ? -5.955  -22.338 1.666   1.00 0.00 ? 82  PRO A HG2  4  
ATOM 6530  H HG3  . PRO A 1 82  ? -7.175  -22.165 0.390   1.00 0.00 ? 82  PRO A HG3  4  
ATOM 6531  H HD2  . PRO A 1 82  ? -4.657  -21.199 0.140   1.00 0.00 ? 82  PRO A HD2  4  
ATOM 6532  H HD3  . PRO A 1 82  ? -6.061  -20.413 -0.612  1.00 0.00 ? 82  PRO A HD3  4  
ATOM 6533  N N    . ASN A 1 83  ? -6.250  -19.326 4.749   1.00 0.00 ? 83  ASN A N    4  
ATOM 6534  C CA   . ASN A 1 83  ? -5.689  -19.520 6.081   1.00 0.00 ? 83  ASN A CA   4  
ATOM 6535  C C    . ASN A 1 83  ? -4.200  -19.186 6.099   1.00 0.00 ? 83  ASN A C    4  
ATOM 6536  O O    . ASN A 1 83  ? -3.389  -19.944 6.631   1.00 0.00 ? 83  ASN A O    4  
ATOM 6537  C CB   . ASN A 1 83  ? -5.904  -20.963 6.542   1.00 0.00 ? 83  ASN A CB   4  
ATOM 6538  C CG   . ASN A 1 83  ? -7.353  -21.251 6.884   1.00 0.00 ? 83  ASN A CG   4  
ATOM 6539  O OD1  . ASN A 1 83  ? -7.661  -21.739 7.972   1.00 0.00 ? 83  ASN A OD1  4  
ATOM 6540  N ND2  . ASN A 1 83  ? -8.252  -20.948 5.955   1.00 0.00 ? 83  ASN A ND2  4  
ATOM 6541  H H    . ASN A 1 83  ? -7.040  -18.756 4.642   1.00 0.00 ? 83  ASN A H    4  
ATOM 6542  H HA   . ASN A 1 83  ? -6.203  -18.855 6.758   1.00 0.00 ? 83  ASN A HA   4  
ATOM 6543  H HB2  . ASN A 1 83  ? -5.601  -21.636 5.753   1.00 0.00 ? 83  ASN A HB2  4  
ATOM 6544  H HB3  . ASN A 1 83  ? -5.302  -21.149 7.419   1.00 0.00 ? 83  ASN A HB3  4  
ATOM 6545  H HD21 . ASN A 1 83  ? -7.934  -20.562 5.112   1.00 0.00 ? 83  ASN A HD21 4  
ATOM 6546  H HD22 . ASN A 1 83  ? -9.196  -21.123 6.150   1.00 0.00 ? 83  ASN A HD22 4  
ATOM 6547  N N    . HIS A 1 84  ? -3.848  -18.046 5.513   1.00 0.00 ? 84  HIS A N    4  
ATOM 6548  C CA   . HIS A 1 84  ? -2.457  -17.610 5.462   1.00 0.00 ? 84  HIS A CA   4  
ATOM 6549  C C    . HIS A 1 84  ? -2.359  -16.092 5.579   1.00 0.00 ? 84  HIS A C    4  
ATOM 6550  O O    . HIS A 1 84  ? -3.015  -15.359 4.839   1.00 0.00 ? 84  HIS A O    4  
ATOM 6551  C CB   . HIS A 1 84  ? -1.802  -18.076 4.162   1.00 0.00 ? 84  HIS A CB   4  
ATOM 6552  C CG   . HIS A 1 84  ? -1.341  -19.500 4.200   1.00 0.00 ? 84  HIS A CG   4  
ATOM 6553  N ND1  . HIS A 1 84  ? -2.201  -20.573 4.091   1.00 0.00 ? 84  HIS A ND1  4  
ATOM 6554  C CD2  . HIS A 1 84  ? -0.101  -20.027 4.335   1.00 0.00 ? 84  HIS A CD2  4  
ATOM 6555  C CE1  . HIS A 1 84  ? -1.510  -21.697 4.160   1.00 0.00 ? 84  HIS A CE1  4  
ATOM 6556  N NE2  . HIS A 1 84  ? -0.233  -21.393 4.307   1.00 0.00 ? 84  HIS A NE2  4  
ATOM 6557  H H    . HIS A 1 84  ? -4.541  -17.485 5.106   1.00 0.00 ? 84  HIS A H    4  
ATOM 6558  H HA   . HIS A 1 84  ? -1.939  -18.057 6.296   1.00 0.00 ? 84  HIS A HA   4  
ATOM 6559  H HB2  . HIS A 1 84  ? -2.512  -17.980 3.354   1.00 0.00 ? 84  HIS A HB2  4  
ATOM 6560  H HB3  . HIS A 1 84  ? -0.943  -17.454 3.956   1.00 0.00 ? 84  HIS A HB3  4  
ATOM 6561  H HD2  . HIS A 1 84  ? 0.822   -19.474 4.446   1.00 0.00 ? 84  HIS A HD2  4  
ATOM 6562  H HE1  . HIS A 1 84  ? -1.919  -22.695 4.104   1.00 0.00 ? 84  HIS A HE1  4  
ATOM 6563  H HE2  . HIS A 1 84  ? 0.485   -22.039 4.469   1.00 0.00 ? 84  HIS A HE2  4  
ATOM 6564  N N    . SER A 1 85  ? -1.537  -15.627 6.514   1.00 0.00 ? 85  SER A N    4  
ATOM 6565  C CA   . SER A 1 85  ? -1.357  -14.196 6.732   1.00 0.00 ? 85  SER A CA   4  
ATOM 6566  C C    . SER A 1 85  ? -0.580  -13.566 5.580   1.00 0.00 ? 85  SER A C    4  
ATOM 6567  O O    . SER A 1 85  ? 0.217   -14.230 4.916   1.00 0.00 ? 85  SER A O    4  
ATOM 6568  C CB   . SER A 1 85  ? -0.625  -13.948 8.052   1.00 0.00 ? 85  SER A CB   4  
ATOM 6569  O OG   . SER A 1 85  ? -1.388  -14.411 9.153   1.00 0.00 ? 85  SER A OG   4  
ATOM 6570  H H    . SER A 1 85  ? -1.042  -16.262 7.073   1.00 0.00 ? 85  SER A H    4  
ATOM 6571  H HA   . SER A 1 85  ? -2.335  -13.743 6.781   1.00 0.00 ? 85  SER A HA   4  
ATOM 6572  H HB2  . SER A 1 85  ? 0.320   -14.468 8.040   1.00 0.00 ? 85  SER A HB2  4  
ATOM 6573  H HB3  . SER A 1 85  ? -0.452  -12.888 8.170   1.00 0.00 ? 85  SER A HB3  4  
ATOM 6574  H HG   . SER A 1 85  ? -0.840  -14.970 9.710   1.00 0.00 ? 85  SER A HG   4  
ATOM 6575  N N    . TYR A 1 86  ? -0.817  -12.280 5.349   1.00 0.00 ? 86  TYR A N    4  
ATOM 6576  C CA   . TYR A 1 86  ? -0.142  -11.558 4.277   1.00 0.00 ? 86  TYR A CA   4  
ATOM 6577  C C    . TYR A 1 86  ? 0.113   -10.107 4.673   1.00 0.00 ? 86  TYR A C    4  
ATOM 6578  O O    . TYR A 1 86  ? -0.810  -9.380  5.039   1.00 0.00 ? 86  TYR A O    4  
ATOM 6579  C CB   . TYR A 1 86  ? -0.976  -11.610 2.995   1.00 0.00 ? 86  TYR A CB   4  
ATOM 6580  C CG   . TYR A 1 86  ? -0.789  -12.883 2.202   1.00 0.00 ? 86  TYR A CG   4  
ATOM 6581  C CD1  . TYR A 1 86  ? 0.201   -12.982 1.233   1.00 0.00 ? 86  TYR A CD1  4  
ATOM 6582  C CD2  . TYR A 1 86  ? -1.603  -13.988 2.422   1.00 0.00 ? 86  TYR A CD2  4  
ATOM 6583  C CE1  . TYR A 1 86  ? 0.375   -14.144 0.505   1.00 0.00 ? 86  TYR A CE1  4  
ATOM 6584  C CE2  . TYR A 1 86  ? -1.436  -15.154 1.700   1.00 0.00 ? 86  TYR A CE2  4  
ATOM 6585  C CZ   . TYR A 1 86  ? -0.446  -15.226 0.743   1.00 0.00 ? 86  TYR A CZ   4  
ATOM 6586  O OH   . TYR A 1 86  ? -0.275  -16.385 0.021   1.00 0.00 ? 86  TYR A OH   4  
ATOM 6587  H H    . TYR A 1 86  ? -1.463  -11.804 5.912   1.00 0.00 ? 86  TYR A H    4  
ATOM 6588  H HA   . TYR A 1 86  ? 0.806   -12.043 4.097   1.00 0.00 ? 86  TYR A HA   4  
ATOM 6589  H HB2  . TYR A 1 86  ? -2.021  -11.529 3.251   1.00 0.00 ? 86  TYR A HB2  4  
ATOM 6590  H HB3  . TYR A 1 86  ? -0.701  -10.780 2.361   1.00 0.00 ? 86  TYR A HB3  4  
ATOM 6591  H HD1  . TYR A 1 86  ? 0.843   -12.132 1.050   1.00 0.00 ? 86  TYR A HD1  4  
ATOM 6592  H HD2  . TYR A 1 86  ? -2.378  -13.928 3.173   1.00 0.00 ? 86  TYR A HD2  4  
ATOM 6593  H HE1  . TYR A 1 86  ? 1.150   -14.201 -0.244  1.00 0.00 ? 86  TYR A HE1  4  
ATOM 6594  H HE2  . TYR A 1 86  ? -2.078  -16.002 1.886   1.00 0.00 ? 86  TYR A HE2  4  
ATOM 6595  H HH   . TYR A 1 86  ? 0.562   -16.791 0.259   1.00 0.00 ? 86  TYR A HH   4  
ATOM 6596  N N    . VAL A 1 87  ? 1.374   -9.693  4.595   1.00 0.00 ? 87  VAL A N    4  
ATOM 6597  C CA   . VAL A 1 87  ? 1.753   -8.328  4.943   1.00 0.00 ? 87  VAL A CA   4  
ATOM 6598  C C    . VAL A 1 87  ? 1.616   -7.397  3.744   1.00 0.00 ? 87  VAL A C    4  
ATOM 6599  O O    . VAL A 1 87  ? 2.437   -7.423  2.827   1.00 0.00 ? 87  VAL A O    4  
ATOM 6600  C CB   . VAL A 1 87  ? 3.200   -8.264  5.466   1.00 0.00 ? 87  VAL A CB   4  
ATOM 6601  C CG1  . VAL A 1 87  ? 4.166   -8.834  4.438   1.00 0.00 ? 87  VAL A CG1  4  
ATOM 6602  C CG2  . VAL A 1 87  ? 3.573   -6.834  5.825   1.00 0.00 ? 87  VAL A CG2  4  
ATOM 6603  H H    . VAL A 1 87  ? 2.066   -10.319 4.295   1.00 0.00 ? 87  VAL A H    4  
ATOM 6604  H HA   . VAL A 1 87  ? 1.093   -7.988  5.728   1.00 0.00 ? 87  VAL A HA   4  
ATOM 6605  H HB   . VAL A 1 87  ? 3.265   -8.866  6.360   1.00 0.00 ? 87  VAL A HB   4  
ATOM 6606  H HG11 . VAL A 1 87  ? 3.614   -9.396  3.699   1.00 0.00 ? 87  VAL A HG11 4  
ATOM 6607  H HG12 . VAL A 1 87  ? 4.696   -8.026  3.955   1.00 0.00 ? 87  VAL A HG12 4  
ATOM 6608  H HG13 . VAL A 1 87  ? 4.872   -9.485  4.930   1.00 0.00 ? 87  VAL A HG13 4  
ATOM 6609  H HG21 . VAL A 1 87  ? 4.027   -6.354  4.970   1.00 0.00 ? 87  VAL A HG21 4  
ATOM 6610  H HG22 . VAL A 1 87  ? 2.685   -6.292  6.113   1.00 0.00 ? 87  VAL A HG22 4  
ATOM 6611  H HG23 . VAL A 1 87  ? 4.274   -6.839  6.648   1.00 0.00 ? 87  VAL A HG23 4  
ATOM 6612  N N    . PHE A 1 88  ? 0.572   -6.574  3.757   1.00 0.00 ? 88  PHE A N    4  
ATOM 6613  C CA   . PHE A 1 88  ? 0.327   -5.634  2.670   1.00 0.00 ? 88  PHE A CA   4  
ATOM 6614  C C    . PHE A 1 88  ? 1.017   -4.300  2.938   1.00 0.00 ? 88  PHE A C    4  
ATOM 6615  O O    . PHE A 1 88  ? 0.877   -3.722  4.016   1.00 0.00 ? 88  PHE A O    4  
ATOM 6616  C CB   . PHE A 1 88  ? -1.177  -5.415  2.486   1.00 0.00 ? 88  PHE A CB   4  
ATOM 6617  C CG   . PHE A 1 88  ? -1.868  -6.555  1.795   1.00 0.00 ? 88  PHE A CG   4  
ATOM 6618  C CD1  . PHE A 1 88  ? -1.877  -7.821  2.357   1.00 0.00 ? 88  PHE A CD1  4  
ATOM 6619  C CD2  . PHE A 1 88  ? -2.511  -6.360  0.583   1.00 0.00 ? 88  PHE A CD2  4  
ATOM 6620  C CE1  . PHE A 1 88  ? -2.512  -8.871  1.723   1.00 0.00 ? 88  PHE A CE1  4  
ATOM 6621  C CE2  . PHE A 1 88  ? -3.148  -7.406  -0.056  1.00 0.00 ? 88  PHE A CE2  4  
ATOM 6622  C CZ   . PHE A 1 88  ? -3.149  -8.664  0.515   1.00 0.00 ? 88  PHE A CZ   4  
ATOM 6623  H H    . PHE A 1 88  ? -0.048  -6.601  4.516   1.00 0.00 ? 88  PHE A H    4  
ATOM 6624  H HA   . PHE A 1 88  ? 0.733   -6.060  1.766   1.00 0.00 ? 88  PHE A HA   4  
ATOM 6625  H HB2  . PHE A 1 88  ? -1.635  -5.288  3.455   1.00 0.00 ? 88  PHE A HB2  4  
ATOM 6626  H HB3  . PHE A 1 88  ? -1.334  -4.523  1.898   1.00 0.00 ? 88  PHE A HB3  4  
ATOM 6627  H HD1  . PHE A 1 88  ? -1.380  -7.985  3.302   1.00 0.00 ? 88  PHE A HD1  4  
ATOM 6628  H HD2  . PHE A 1 88  ? -2.510  -5.376  0.135   1.00 0.00 ? 88  PHE A HD2  4  
ATOM 6629  H HE1  . PHE A 1 88  ? -2.512  -9.854  2.172   1.00 0.00 ? 88  PHE A HE1  4  
ATOM 6630  H HE2  . PHE A 1 88  ? -3.645  -7.240  -1.001  1.00 0.00 ? 88  PHE A HE2  4  
ATOM 6631  H HZ   . PHE A 1 88  ? -3.646  -9.483  0.017   1.00 0.00 ? 88  PHE A HZ   4  
ATOM 6632  N N    . ARG A 1 89  ? 1.764   -3.817  1.950   1.00 0.00 ? 89  ARG A N    4  
ATOM 6633  C CA   . ARG A 1 89  ? 2.478   -2.553  2.079   1.00 0.00 ? 89  ARG A CA   4  
ATOM 6634  C C    . ARG A 1 89  ? 2.170   -1.632  0.902   1.00 0.00 ? 89  ARG A C    4  
ATOM 6635  O O    . ARG A 1 89  ? 2.626   -1.864  -0.218  1.00 0.00 ? 89  ARG A O    4  
ATOM 6636  C CB   . ARG A 1 89  ? 3.985   -2.801  2.166   1.00 0.00 ? 89  ARG A CB   4  
ATOM 6637  C CG   . ARG A 1 89  ? 4.391   -3.683  3.335   1.00 0.00 ? 89  ARG A CG   4  
ATOM 6638  C CD   . ARG A 1 89  ? 5.896   -3.659  3.555   1.00 0.00 ? 89  ARG A CD   4  
ATOM 6639  N NE   . ARG A 1 89  ? 6.363   -4.842  4.272   1.00 0.00 ? 89  ARG A NE   4  
ATOM 6640  C CZ   . ARG A 1 89  ? 6.602   -6.010  3.686   1.00 0.00 ? 89  ARG A CZ   4  
ATOM 6641  N NH1  . ARG A 1 89  ? 6.420   -6.150  2.380   1.00 0.00 ? 89  ARG A NH1  4  
ATOM 6642  N NH2  . ARG A 1 89  ? 7.026   -7.040  4.406   1.00 0.00 ? 89  ARG A NH2  4  
ATOM 6643  H H    . ARG A 1 89  ? 1.836   -4.324  1.114   1.00 0.00 ? 89  ARG A H    4  
ATOM 6644  H HA   . ARG A 1 89  ? 2.147   -2.077  2.990   1.00 0.00 ? 89  ARG A HA   4  
ATOM 6645  H HB2  . ARG A 1 89  ? 4.313   -3.277  1.253   1.00 0.00 ? 89  ARG A HB2  4  
ATOM 6646  H HB3  . ARG A 1 89  ? 4.488   -1.851  2.267   1.00 0.00 ? 89  ARG A HB3  4  
ATOM 6647  H HG2  . ARG A 1 89  ? 3.902   -3.326  4.230   1.00 0.00 ? 89  ARG A HG2  4  
ATOM 6648  H HG3  . ARG A 1 89  ? 4.081   -4.697  3.133   1.00 0.00 ? 89  ARG A HG3  4  
ATOM 6649  H HD2  . ARG A 1 89  ? 6.386   -3.615  2.594   1.00 0.00 ? 89  ARG A HD2  4  
ATOM 6650  H HD3  . ARG A 1 89  ? 6.148   -2.779  4.127   1.00 0.00 ? 89  ARG A HD3  4  
ATOM 6651  H HE   . ARG A 1 89  ? 6.504   -4.761  5.238   1.00 0.00 ? 89  ARG A HE   4  
ATOM 6652  H HH11 . ARG A 1 89  ? 6.102   -5.374  1.835   1.00 0.00 ? 89  ARG A HH11 4  
ATOM 6653  H HH12 . ARG A 1 89  ? 6.602   -7.030  1.941   1.00 0.00 ? 89  ARG A HH12 4  
ATOM 6654  H HH21 . ARG A 1 89  ? 7.165   -6.939  5.391   1.00 0.00 ? 89  ARG A HH21 4  
ATOM 6655  H HH22 . ARG A 1 89  ? 7.206   -7.919  3.964   1.00 0.00 ? 89  ARG A HH22 4  
ATOM 6656  N N    . VAL A 1 90  ? 1.392   -0.586  1.164   1.00 0.00 ? 90  VAL A N    4  
ATOM 6657  C CA   . VAL A 1 90  ? 1.023   0.370   0.127   1.00 0.00 ? 90  VAL A CA   4  
ATOM 6658  C C    . VAL A 1 90  ? 1.978   1.559   0.110   1.00 0.00 ? 90  VAL A C    4  
ATOM 6659  O O    . VAL A 1 90  ? 2.425   2.023   1.159   1.00 0.00 ? 90  VAL A O    4  
ATOM 6660  C CB   . VAL A 1 90  ? -0.415  0.885   0.324   1.00 0.00 ? 90  VAL A CB   4  
ATOM 6661  C CG1  . VAL A 1 90  ? -0.778  1.887   -0.761  1.00 0.00 ? 90  VAL A CG1  4  
ATOM 6662  C CG2  . VAL A 1 90  ? -1.398  -0.276  0.338   1.00 0.00 ? 90  VAL A CG2  4  
ATOM 6663  H H    . VAL A 1 90  ? 1.059   -0.454  2.076   1.00 0.00 ? 90  VAL A H    4  
ATOM 6664  H HA   . VAL A 1 90  ? 1.075   -0.134  -0.827  1.00 0.00 ? 90  VAL A HA   4  
ATOM 6665  H HB   . VAL A 1 90  ? -0.469  1.386   1.279   1.00 0.00 ? 90  VAL A HB   4  
ATOM 6666  H HG11 . VAL A 1 90  ? -1.774  1.680   -1.124  1.00 0.00 ? 90  VAL A HG11 4  
ATOM 6667  H HG12 . VAL A 1 90  ? -0.741  2.887   -0.355  1.00 0.00 ? 90  VAL A HG12 4  
ATOM 6668  H HG13 . VAL A 1 90  ? -0.074  1.804   -1.577  1.00 0.00 ? 90  VAL A HG13 4  
ATOM 6669  H HG21 . VAL A 1 90  ? -2.322  0.039   0.800   1.00 0.00 ? 90  VAL A HG21 4  
ATOM 6670  H HG22 . VAL A 1 90  ? -1.592  -0.595  -0.675  1.00 0.00 ? 90  VAL A HG22 4  
ATOM 6671  H HG23 . VAL A 1 90  ? -0.978  -1.098  0.900   1.00 0.00 ? 90  VAL A HG23 4  
ATOM 6672  N N    . ARG A 1 91  ? 2.287   2.046   -1.087  1.00 0.00 ? 91  ARG A N    4  
ATOM 6673  C CA   . ARG A 1 91  ? 3.190   3.181   -1.240  1.00 0.00 ? 91  ARG A CA   4  
ATOM 6674  C C    . ARG A 1 91  ? 2.628   4.192   -2.235  1.00 0.00 ? 91  ARG A C    4  
ATOM 6675  O O    . ARG A 1 91  ? 1.739   3.873   -3.024  1.00 0.00 ? 91  ARG A O    4  
ATOM 6676  C CB   . ARG A 1 91  ? 4.567   2.704   -1.704  1.00 0.00 ? 91  ARG A CB   4  
ATOM 6677  C CG   . ARG A 1 91  ? 5.065   1.471   -0.967  1.00 0.00 ? 91  ARG A CG   4  
ATOM 6678  C CD   . ARG A 1 91  ? 6.584   1.416   -0.936  1.00 0.00 ? 91  ARG A CD   4  
ATOM 6679  N NE   . ARG A 1 91  ? 7.075   0.135   -0.435  1.00 0.00 ? 91  ARG A NE   4  
ATOM 6680  C CZ   . ARG A 1 91  ? 8.312   -0.307  -0.635  1.00 0.00 ? 91  ARG A CZ   4  
ATOM 6681  N NH1  . ARG A 1 91  ? 9.178   0.425   -1.322  1.00 0.00 ? 91  ARG A NH1  4  
ATOM 6682  N NH2  . ARG A 1 91  ? 8.684   -1.484  -0.148  1.00 0.00 ? 91  ARG A NH2  4  
ATOM 6683  H H    . ARG A 1 91  ? 1.899   1.633   -1.886  1.00 0.00 ? 91  ARG A H    4  
ATOM 6684  H HA   . ARG A 1 91  ? 3.289   3.658   -0.277  1.00 0.00 ? 91  ARG A HA   4  
ATOM 6685  H HB2  . ARG A 1 91  ? 4.519   2.471   -2.758  1.00 0.00 ? 91  ARG A HB2  4  
ATOM 6686  H HB3  . ARG A 1 91  ? 5.280   3.500   -1.551  1.00 0.00 ? 91  ARG A HB3  4  
ATOM 6687  H HG2  . ARG A 1 91  ? 4.696   1.495   0.047   1.00 0.00 ? 91  ARG A HG2  4  
ATOM 6688  H HG3  . ARG A 1 91  ? 4.691   0.589   -1.467  1.00 0.00 ? 91  ARG A HG3  4  
ATOM 6689  H HD2  . ARG A 1 91  ? 6.957   1.566   -1.938  1.00 0.00 ? 91  ARG A HD2  4  
ATOM 6690  H HD3  . ARG A 1 91  ? 6.946   2.205   -0.295  1.00 0.00 ? 91  ARG A HD3  4  
ATOM 6691  H HE   . ARG A 1 91  ? 6.452   -0.422  0.075   1.00 0.00 ? 91  ARG A HE   4  
ATOM 6692  H HH11 . ARG A 1 91  ? 8.901   1.312   -1.689  1.00 0.00 ? 91  ARG A HH11 4  
ATOM 6693  H HH12 . ARG A 1 91  ? 10.109  0.091   -1.470  1.00 0.00 ? 91  ARG A HH12 4  
ATOM 6694  H HH21 . ARG A 1 91  ? 8.034   -2.038  0.371   1.00 0.00 ? 91  ARG A HH21 4  
ATOM 6695  H HH22 . ARG A 1 91  ? 9.615   -1.815  -0.299  1.00 0.00 ? 91  ARG A HH22 4  
ATOM 6696  N N    . ALA A 1 92  ? 3.153   5.412   -2.192  1.00 0.00 ? 92  ALA A N    4  
ATOM 6697  C CA   . ALA A 1 92  ? 2.706   6.469   -3.090  1.00 0.00 ? 92  ALA A CA   4  
ATOM 6698  C C    . ALA A 1 92  ? 3.885   7.111   -3.812  1.00 0.00 ? 92  ALA A C    4  
ATOM 6699  O O    . ALA A 1 92  ? 4.842   7.558   -3.181  1.00 0.00 ? 92  ALA A O    4  
ATOM 6700  C CB   . ALA A 1 92  ? 1.921   7.520   -2.318  1.00 0.00 ? 92  ALA A CB   4  
ATOM 6701  H H    . ALA A 1 92  ? 3.860   5.605   -1.541  1.00 0.00 ? 92  ALA A H    4  
ATOM 6702  H HA   . ALA A 1 92  ? 2.045   6.027   -3.822  1.00 0.00 ? 92  ALA A HA   4  
ATOM 6703  H HB1  . ALA A 1 92  ? 2.372   8.489   -2.470  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 6704  H HB2  . ALA A 1 92  ? 0.901   7.538   -2.673  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 6705  H HB3  . ALA A 1 92  ? 1.933   7.277   -1.266  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 6706  N N    . GLN A 1 93  ? 3.810   7.152   -5.139  1.00 0.00 ? 93  GLN A N    4  
ATOM 6707  C CA   . GLN A 1 93  ? 4.872   7.739   -5.946  1.00 0.00 ? 93  GLN A CA   4  
ATOM 6708  C C    . GLN A 1 93  ? 4.489   9.137   -6.418  1.00 0.00 ? 93  GLN A C    4  
ATOM 6709  O O    . GLN A 1 93  ? 3.358   9.370   -6.847  1.00 0.00 ? 93  GLN A O    4  
ATOM 6710  C CB   . GLN A 1 93  ? 5.178   6.847   -7.151  1.00 0.00 ? 93  GLN A CB   4  
ATOM 6711  C CG   . GLN A 1 93  ? 6.196   7.446   -8.108  1.00 0.00 ? 93  GLN A CG   4  
ATOM 6712  C CD   . GLN A 1 93  ? 6.113   6.845   -9.498  1.00 0.00 ? 93  GLN A CD   4  
ATOM 6713  O OE1  . GLN A 1 93  ? 5.951   7.560   -10.487 1.00 0.00 ? 93  GLN A OE1  4  
ATOM 6714  N NE2  . GLN A 1 93  ? 6.224   5.524   -9.580  1.00 0.00 ? 93  GLN A NE2  4  
ATOM 6715  H H    . GLN A 1 93  ? 3.021   6.779   -5.584  1.00 0.00 ? 93  GLN A H    4  
ATOM 6716  H HA   . GLN A 1 93  ? 5.756   7.811   -5.330  1.00 0.00 ? 93  GLN A HA   4  
ATOM 6717  H HB2  . GLN A 1 93  ? 5.562   5.902   -6.796  1.00 0.00 ? 93  GLN A HB2  4  
ATOM 6718  H HB3  . GLN A 1 93  ? 4.262   6.673   -7.696  1.00 0.00 ? 93  GLN A HB3  4  
ATOM 6719  H HG2  . GLN A 1 93  ? 6.020   8.509   -8.182  1.00 0.00 ? 93  GLN A HG2  4  
ATOM 6720  H HG3  . GLN A 1 93  ? 7.186   7.272   -7.715  1.00 0.00 ? 93  GLN A HG3  4  
ATOM 6721  H HE21 . GLN A 1 93  ? 6.350   5.018   -8.749  1.00 0.00 ? 93  GLN A HE21 4  
ATOM 6722  H HE22 . GLN A 1 93  ? 6.174   5.110   -10.465 1.00 0.00 ? 93  GLN A HE22 4  
ATOM 6723  N N    . SER A 1 94  ? 5.437   10.065  -6.336  1.00 0.00 ? 94  SER A N    4  
ATOM 6724  C CA   . SER A 1 94  ? 5.196   11.442  -6.751  1.00 0.00 ? 94  SER A CA   4  
ATOM 6725  C C    . SER A 1 94  ? 6.400   12.000  -7.505  1.00 0.00 ? 94  SER A C    4  
ATOM 6726  O O    . SER A 1 94  ? 7.468   11.390  -7.527  1.00 0.00 ? 94  SER A O    4  
ATOM 6727  C CB   . SER A 1 94  ? 4.891   12.318  -5.535  1.00 0.00 ? 94  SER A CB   4  
ATOM 6728  O OG   . SER A 1 94  ? 6.069   12.593  -4.796  1.00 0.00 ? 94  SER A OG   4  
ATOM 6729  H H    . SER A 1 94  ? 6.318   9.818   -5.986  1.00 0.00 ? 94  SER A H    4  
ATOM 6730  H HA   . SER A 1 94  ? 4.341   11.445  -7.410  1.00 0.00 ? 94  SER A HA   4  
ATOM 6731  H HB2  . SER A 1 94  ? 4.462   13.252  -5.865  1.00 0.00 ? 94  SER A HB2  4  
ATOM 6732  H HB3  . SER A 1 94  ? 4.189   11.806  -4.893  1.00 0.00 ? 94  SER A HB3  4  
ATOM 6733  H HG   . SER A 1 94  ? 6.442   13.428  -5.087  1.00 0.00 ? 94  SER A HG   4  
ATOM 6734  N N    . GLN A 1 95  ? 6.217   13.164  -8.121  1.00 0.00 ? 95  GLN A N    4  
ATOM 6735  C CA   . GLN A 1 95  ? 7.287   13.804  -8.877  1.00 0.00 ? 95  GLN A CA   4  
ATOM 6736  C C    . GLN A 1 95  ? 8.637   13.583  -8.202  1.00 0.00 ? 95  GLN A C    4  
ATOM 6737  O O    . GLN A 1 95  ? 9.643   13.346  -8.870  1.00 0.00 ? 95  GLN A O    4  
ATOM 6738  C CB   . GLN A 1 95  ? 7.014   15.302  -9.019  1.00 0.00 ? 95  GLN A CB   4  
ATOM 6739  C CG   . GLN A 1 95  ? 7.688   15.932  -10.227 1.00 0.00 ? 95  GLN A CG   4  
ATOM 6740  C CD   . GLN A 1 95  ? 6.916   17.117  -10.774 1.00 0.00 ? 95  GLN A CD   4  
ATOM 6741  O OE1  . GLN A 1 95  ? 6.119   17.734  -10.067 1.00 0.00 ? 95  GLN A OE1  4  
ATOM 6742  N NE2  . GLN A 1 95  ? 7.150   17.442  -12.041 1.00 0.00 ? 95  GLN A NE2  4  
ATOM 6743  H H    . GLN A 1 95  ? 5.342   13.601  -8.067  1.00 0.00 ? 95  GLN A H    4  
ATOM 6744  H HA   . GLN A 1 95  ? 7.312   13.358  -9.859  1.00 0.00 ? 95  GLN A HA   4  
ATOM 6745  H HB2  . GLN A 1 95  ? 5.948   15.455  -9.107  1.00 0.00 ? 95  GLN A HB2  4  
ATOM 6746  H HB3  . GLN A 1 95  ? 7.369   15.807  -8.132  1.00 0.00 ? 95  GLN A HB3  4  
ATOM 6747  H HG2  . GLN A 1 95  ? 8.674   16.267  -9.940  1.00 0.00 ? 95  GLN A HG2  4  
ATOM 6748  H HG3  . GLN A 1 95  ? 7.774   15.187  -11.004 1.00 0.00 ? 95  GLN A HG3  4  
ATOM 6749  H HE21 . GLN A 1 95  ? 7.798   16.904  -12.544 1.00 0.00 ? 95  GLN A HE21 4  
ATOM 6750  H HE22 . GLN A 1 95  ? 6.665   18.202  -12.420 1.00 0.00 ? 95  GLN A HE22 4  
ATOM 6751  N N    . GLU A 1 96  ? 8.651   13.664  -6.876  1.00 0.00 ? 96  GLU A N    4  
ATOM 6752  C CA   . GLU A 1 96  ? 9.878   13.474  -6.112  1.00 0.00 ? 96  GLU A CA   4  
ATOM 6753  C C    . GLU A 1 96  ? 10.280  12.002  -6.086  1.00 0.00 ? 96  GLU A C    4  
ATOM 6754  O O    . GLU A 1 96  ? 11.359  11.634  -6.547  1.00 0.00 ? 96  GLU A O    4  
ATOM 6755  C CB   . GLU A 1 96  ? 9.701   13.991  -4.683  1.00 0.00 ? 96  GLU A CB   4  
ATOM 6756  C CG   . GLU A 1 96  ? 9.832   15.500  -4.561  1.00 0.00 ? 96  GLU A CG   4  
ATOM 6757  C CD   . GLU A 1 96  ? 11.158  16.015  -5.086  1.00 0.00 ? 96  GLU A CD   4  
ATOM 6758  O OE1  . GLU A 1 96  ? 11.292  16.156  -6.319  1.00 0.00 ? 96  GLU A OE1  4  
ATOM 6759  O OE2  . GLU A 1 96  ? 12.061  16.276  -4.264  1.00 0.00 ? 96  GLU A OE2  4  
ATOM 6760  H H    . GLU A 1 96  ? 7.816   13.856  -6.399  1.00 0.00 ? 96  GLU A H    4  
ATOM 6761  H HA   . GLU A 1 96  ? 10.660  14.039  -6.595  1.00 0.00 ? 96  GLU A HA   4  
ATOM 6762  H HB2  . GLU A 1 96  ? 8.722   13.705  -4.328  1.00 0.00 ? 96  GLU A HB2  4  
ATOM 6763  H HB3  . GLU A 1 96  ? 10.450  13.534  -4.052  1.00 0.00 ? 96  GLU A HB3  4  
ATOM 6764  H HG2  . GLU A 1 96  ? 9.036   15.964  -5.123  1.00 0.00 ? 96  GLU A HG2  4  
ATOM 6765  H HG3  . GLU A 1 96  ? 9.743   15.773  -3.520  1.00 0.00 ? 96  GLU A HG3  4  
ATOM 6766  N N    . GLY A 1 97  ? 9.403   11.164  -5.541  1.00 0.00 ? 97  GLY A N    4  
ATOM 6767  C CA   . GLY A 1 97  ? 9.684   9.743   -5.463  1.00 0.00 ? 97  GLY A CA   4  
ATOM 6768  C C    . GLY A 1 97  ? 8.838   9.040   -4.420  1.00 0.00 ? 97  GLY A C    4  
ATOM 6769  O O    . GLY A 1 97  ? 8.021   9.670   -3.748  1.00 0.00 ? 97  GLY A O    4  
ATOM 6770  H H    . GLY A 1 97  ? 8.558   11.515  -5.188  1.00 0.00 ? 97  GLY A H    4  
ATOM 6771  H HA2  . GLY A 1 97  ? 9.493   9.296   -6.427  1.00 0.00 ? 97  GLY A HA2  4  
ATOM 6772  H HA3  . GLY A 1 97  ? 10.727  9.607   -5.215  1.00 0.00 ? 97  GLY A HA3  4  
ATOM 6773  N N    . TRP A 1 98  ? 9.031   7.733   -4.286  1.00 0.00 ? 98  TRP A N    4  
ATOM 6774  C CA   . TRP A 1 98  ? 8.277   6.944   -3.318  1.00 0.00 ? 98  TRP A CA   4  
ATOM 6775  C C    . TRP A 1 98  ? 8.597   7.381   -1.893  1.00 0.00 ? 98  TRP A C    4  
ATOM 6776  O O    . TRP A 1 98  ? 9.725   7.229   -1.425  1.00 0.00 ? 98  TRP A O    4  
ATOM 6777  C CB   . TRP A 1 98  ? 8.587   5.457   -3.491  1.00 0.00 ? 98  TRP A CB   4  
ATOM 6778  C CG   . TRP A 1 98  ? 8.148   4.908   -4.814  1.00 0.00 ? 98  TRP A CG   4  
ATOM 6779  C CD1  . TRP A 1 98  ? 8.874   4.879   -5.971  1.00 0.00 ? 98  TRP A CD1  4  
ATOM 6780  C CD2  . TRP A 1 98  ? 6.882   4.312   -5.118  1.00 0.00 ? 98  TRP A CD2  4  
ATOM 6781  N NE1  . TRP A 1 98  ? 8.135   4.300   -6.975  1.00 0.00 ? 98  TRP A NE1  4  
ATOM 6782  C CE2  . TRP A 1 98  ? 6.910   3.943   -6.477  1.00 0.00 ? 98  TRP A CE2  4  
ATOM 6783  C CE3  . TRP A 1 98  ? 5.729   4.051   -4.373  1.00 0.00 ? 98  TRP A CE3  4  
ATOM 6784  C CZ2  . TRP A 1 98  ? 5.829   3.330   -7.104  1.00 0.00 ? 98  TRP A CZ2  4  
ATOM 6785  C CZ3  . TRP A 1 98  ? 4.656   3.443   -4.997  1.00 0.00 ? 98  TRP A CZ3  4  
ATOM 6786  C CH2  . TRP A 1 98  ? 4.712   3.087   -6.351  1.00 0.00 ? 98  TRP A CH2  4  
ATOM 6787  H H    . TRP A 1 98  ? 9.697   7.288   -4.851  1.00 0.00 ? 98  TRP A H    4  
ATOM 6788  H HA   . TRP A 1 98  ? 7.226   7.108   -3.505  1.00 0.00 ? 98  TRP A HA   4  
ATOM 6789  H HB2  . TRP A 1 98  ? 9.652   5.304   -3.404  1.00 0.00 ? 98  TRP A HB2  4  
ATOM 6790  H HB3  . TRP A 1 98  ? 8.083   4.899   -2.714  1.00 0.00 ? 98  TRP A HB3  4  
ATOM 6791  H HD1  . TRP A 1 98  ? 9.878   5.260   -6.068  1.00 0.00 ? 98  TRP A HD1  4  
ATOM 6792  H HE1  . TRP A 1 98  ? 8.438   4.164   -7.898  1.00 0.00 ? 98  TRP A HE1  4  
ATOM 6793  H HE3  . TRP A 1 98  ? 5.666   4.318   -3.328  1.00 0.00 ? 98  TRP A HE3  4  
ATOM 6794  H HZ2  . TRP A 1 98  ? 5.857   3.049   -8.147  1.00 0.00 ? 98  TRP A HZ2  4  
ATOM 6795  H HZ3  . TRP A 1 98  ? 3.756   3.234   -4.437  1.00 0.00 ? 98  TRP A HZ3  4  
ATOM 6796  H HH2  . TRP A 1 98  ? 3.851   2.614   -6.797  1.00 0.00 ? 98  TRP A HH2  4  
ATOM 6797  N N    . GLY A 1 99  ? 7.597   7.925   -1.206  1.00 0.00 ? 99  GLY A N    4  
ATOM 6798  C CA   . GLY A 1 99  ? 7.793   8.375   0.159   1.00 0.00 ? 99  GLY A CA   4  
ATOM 6799  C C    . GLY A 1 99  ? 7.811   7.228   1.151   1.00 0.00 ? 99  GLY A C    4  
ATOM 6800  O O    . GLY A 1 99  ? 8.717   6.395   1.130   1.00 0.00 ? 99  GLY A O    4  
ATOM 6801  H H    . GLY A 1 99  ? 6.718   8.021   -1.631  1.00 0.00 ? 99  GLY A H    4  
ATOM 6802  H HA2  . GLY A 1 99  ? 8.731   8.905   0.221   1.00 0.00 ? 99  GLY A HA2  4  
ATOM 6803  H HA3  . GLY A 1 99  ? 6.991   9.049   0.422   1.00 0.00 ? 99  GLY A HA3  4  
ATOM 6804  N N    . ARG A 1 100 ? 6.809   7.186   2.023   1.00 0.00 ? 100 ARG A N    4  
ATOM 6805  C CA   . ARG A 1 100 ? 6.716   6.134   3.028   1.00 0.00 ? 100 ARG A CA   4  
ATOM 6806  C C    . ARG A 1 100 ? 5.608   5.145   2.679   1.00 0.00 ? 100 ARG A C    4  
ATOM 6807  O O    . ARG A 1 100 ? 4.838   5.365   1.745   1.00 0.00 ? 100 ARG A O    4  
ATOM 6808  C CB   . ARG A 1 100 ? 6.456   6.741   4.408   1.00 0.00 ? 100 ARG A CB   4  
ATOM 6809  C CG   . ARG A 1 100 ? 7.707   7.283   5.081   1.00 0.00 ? 100 ARG A CG   4  
ATOM 6810  C CD   . ARG A 1 100 ? 8.624   6.160   5.539   1.00 0.00 ? 100 ARG A CD   4  
ATOM 6811  N NE   . ARG A 1 100 ? 9.612   6.622   6.510   1.00 0.00 ? 100 ARG A NE   4  
ATOM 6812  C CZ   . ARG A 1 100 ? 10.339  5.806   7.265   1.00 0.00 ? 100 ARG A CZ   4  
ATOM 6813  N NH1  . ARG A 1 100 ? 10.189  4.492   7.161   1.00 0.00 ? 100 ARG A NH1  4  
ATOM 6814  N NH2  . ARG A 1 100 ? 11.219  6.303   8.125   1.00 0.00 ? 100 ARG A NH2  4  
ATOM 6815  H H    . ARG A 1 100 ? 6.116   7.878   1.990   1.00 0.00 ? 100 ARG A H    4  
ATOM 6816  H HA   . ARG A 1 100 ? 7.659   5.609   3.048   1.00 0.00 ? 100 ARG A HA   4  
ATOM 6817  H HB2  . ARG A 1 100 ? 5.749   7.551   4.306   1.00 0.00 ? 100 ARG A HB2  4  
ATOM 6818  H HB3  . ARG A 1 100 ? 6.030   5.982   5.047   1.00 0.00 ? 100 ARG A HB3  4  
ATOM 6819  H HG2  . ARG A 1 100 ? 8.241   7.905   4.378   1.00 0.00 ? 100 ARG A HG2  4  
ATOM 6820  H HG3  . ARG A 1 100 ? 7.416   7.872   5.938   1.00 0.00 ? 100 ARG A HG3  4  
ATOM 6821  H HD2  . ARG A 1 100 ? 8.023   5.385   5.993   1.00 0.00 ? 100 ARG A HD2  4  
ATOM 6822  H HD3  . ARG A 1 100 ? 9.138   5.759   4.679   1.00 0.00 ? 100 ARG A HD3  4  
ATOM 6823  H HE   . ARG A 1 100 ? 9.739   7.589   6.603   1.00 0.00 ? 100 ARG A HE   4  
ATOM 6824  H HH11 . ARG A 1 100 ? 9.528   4.115   6.513   1.00 0.00 ? 100 ARG A HH11 4  
ATOM 6825  H HH12 . ARG A 1 100 ? 10.738  3.880   7.730   1.00 0.00 ? 100 ARG A HH12 4  
ATOM 6826  H HH21 . ARG A 1 100 ? 11.335  7.292   8.205   1.00 0.00 ? 100 ARG A HH21 4  
ATOM 6827  H HH22 . ARG A 1 100 ? 11.765  5.687   8.692   1.00 0.00 ? 100 ARG A HH22 4  
ATOM 6828  N N    . GLU A 1 101 ? 5.535   4.054   3.436   1.00 0.00 ? 101 GLU A N    4  
ATOM 6829  C CA   . GLU A 1 101 ? 4.522   3.031   3.205   1.00 0.00 ? 101 GLU A CA   4  
ATOM 6830  C C    . GLU A 1 101 ? 3.932   2.542   4.525   1.00 0.00 ? 101 GLU A C    4  
ATOM 6831  O O    . GLU A 1 101 ? 4.566   2.641   5.575   1.00 0.00 ? 101 GLU A O    4  
ATOM 6832  C CB   . GLU A 1 101 ? 5.122   1.853   2.435   1.00 0.00 ? 101 GLU A CB   4  
ATOM 6833  C CG   . GLU A 1 101 ? 5.956   0.922   3.299   1.00 0.00 ? 101 GLU A CG   4  
ATOM 6834  C CD   . GLU A 1 101 ? 5.110   0.082   4.236   1.00 0.00 ? 101 GLU A CD   4  
ATOM 6835  O OE1  . GLU A 1 101 ? 4.007   -0.336  3.826   1.00 0.00 ? 101 GLU A OE1  4  
ATOM 6836  O OE2  . GLU A 1 101 ? 5.552   -0.157  5.379   1.00 0.00 ? 101 GLU A OE2  4  
ATOM 6837  H H    . GLU A 1 101 ? 6.177   3.935   4.167   1.00 0.00 ? 101 GLU A H    4  
ATOM 6838  H HA   . GLU A 1 101 ? 3.734   3.472   2.614   1.00 0.00 ? 101 GLU A HA   4  
ATOM 6839  H HB2  . GLU A 1 101 ? 4.320   1.280   1.994   1.00 0.00 ? 101 GLU A HB2  4  
ATOM 6840  H HB3  . GLU A 1 101 ? 5.752   2.238   1.646   1.00 0.00 ? 101 GLU A HB3  4  
ATOM 6841  H HG2  . GLU A 1 101 ? 6.517   0.261   2.656   1.00 0.00 ? 101 GLU A HG2  4  
ATOM 6842  H HG3  . GLU A 1 101 ? 6.640   1.515   3.888   1.00 0.00 ? 101 GLU A HG3  4  
ATOM 6843  N N    . ARG A 1 102 ? 2.713   2.015   4.462   1.00 0.00 ? 102 ARG A N    4  
ATOM 6844  C CA   . ARG A 1 102 ? 2.036   1.512   5.650   1.00 0.00 ? 102 ARG A CA   4  
ATOM 6845  C C    . ARG A 1 102 ? 1.874   -0.003  5.584   1.00 0.00 ? 102 ARG A C    4  
ATOM 6846  O O    . ARG A 1 102 ? 1.595   -0.561  4.523   1.00 0.00 ? 102 ARG A O    4  
ATOM 6847  C CB   . ARG A 1 102 ? 0.666   2.176   5.802   1.00 0.00 ? 102 ARG A CB   4  
ATOM 6848  C CG   . ARG A 1 102 ? -0.131  1.664   6.991   1.00 0.00 ? 102 ARG A CG   4  
ATOM 6849  C CD   . ARG A 1 102 ? 0.180   2.455   8.252   1.00 0.00 ? 102 ARG A CD   4  
ATOM 6850  N NE   . ARG A 1 102 ? 1.299   1.882   8.996   1.00 0.00 ? 102 ARG A NE   4  
ATOM 6851  C CZ   . ARG A 1 102 ? 1.504   2.090   10.292  1.00 0.00 ? 102 ARG A CZ   4  
ATOM 6852  N NH1  . ARG A 1 102 ? 0.670   2.854   10.984  1.00 0.00 ? 102 ARG A NH1  4  
ATOM 6853  N NH2  . ARG A 1 102 ? 2.545   1.533   10.898  1.00 0.00 ? 102 ARG A NH2  4  
ATOM 6854  H H    . ARG A 1 102 ? 2.258   1.964   3.595   1.00 0.00 ? 102 ARG A H    4  
ATOM 6855  H HA   . ARG A 1 102 ? 2.643   1.760   6.508   1.00 0.00 ? 102 ARG A HA   4  
ATOM 6856  H HB2  . ARG A 1 102 ? 0.806   3.241   5.922   1.00 0.00 ? 102 ARG A HB2  4  
ATOM 6857  H HB3  . ARG A 1 102 ? 0.091   1.996   4.907   1.00 0.00 ? 102 ARG A HB3  4  
ATOM 6858  H HG2  . ARG A 1 102 ? -1.185  1.756   6.773   1.00 0.00 ? 102 ARG A HG2  4  
ATOM 6859  H HG3  . ARG A 1 102 ? 0.116   0.626   7.157   1.00 0.00 ? 102 ARG A HG3  4  
ATOM 6860  H HD2  . ARG A 1 102 ? 0.428   3.469   7.974   1.00 0.00 ? 102 ARG A HD2  4  
ATOM 6861  H HD3  . ARG A 1 102 ? -0.696  2.459   8.883   1.00 0.00 ? 102 ARG A HD3  4  
ATOM 6862  H HE   . ARG A 1 102 ? 1.928   1.314   8.504   1.00 0.00 ? 102 ARG A HE   4  
ATOM 6863  H HH11 . ARG A 1 102 ? -0.116  3.274   10.530  1.00 0.00 ? 102 ARG A HH11 4  
ATOM 6864  H HH12 . ARG A 1 102 ? 0.825   3.008   11.960  1.00 0.00 ? 102 ARG A HH12 4  
ATOM 6865  H HH21 . ARG A 1 102 ? 3.175   0.957   10.379  1.00 0.00 ? 102 ARG A HH21 4  
ATOM 6866  H HH22 . ARG A 1 102 ? 2.698   1.691   11.873  1.00 0.00 ? 102 ARG A HH22 4  
ATOM 6867  N N    . GLU A 1 103 ? 2.051   -0.663  6.724   1.00 0.00 ? 103 GLU A N    4  
ATOM 6868  C CA   . GLU A 1 103 ? 1.926   -2.114  6.794   1.00 0.00 ? 103 GLU A CA   4  
ATOM 6869  C C    . GLU A 1 103 ? 0.510   -2.519  7.195   1.00 0.00 ? 103 GLU A C    4  
ATOM 6870  O O    . GLU A 1 103 ? -0.083  -1.932  8.099   1.00 0.00 ? 103 GLU A O    4  
ATOM 6871  C CB   . GLU A 1 103 ? 2.934   -2.688  7.791   1.00 0.00 ? 103 GLU A CB   4  
ATOM 6872  C CG   . GLU A 1 103 ? 3.276   -4.147  7.539   1.00 0.00 ? 103 GLU A CG   4  
ATOM 6873  C CD   . GLU A 1 103 ? 3.985   -4.792  8.715   1.00 0.00 ? 103 GLU A CD   4  
ATOM 6874  O OE1  . GLU A 1 103 ? 3.470   -4.685  9.848   1.00 0.00 ? 103 GLU A OE1  4  
ATOM 6875  O OE2  . GLU A 1 103 ? 5.053   -5.402  8.502   1.00 0.00 ? 103 GLU A OE2  4  
ATOM 6876  H H    . GLU A 1 103 ? 2.272   -0.163  7.537   1.00 0.00 ? 103 GLU A H    4  
ATOM 6877  H HA   . GLU A 1 103 ? 2.137   -2.513  5.813   1.00 0.00 ? 103 GLU A HA   4  
ATOM 6878  H HB2  . GLU A 1 103 ? 3.845   -2.111  7.736   1.00 0.00 ? 103 GLU A HB2  4  
ATOM 6879  H HB3  . GLU A 1 103 ? 2.525   -2.603  8.787   1.00 0.00 ? 103 GLU A HB3  4  
ATOM 6880  H HG2  . GLU A 1 103 ? 2.363   -4.690  7.348   1.00 0.00 ? 103 GLU A HG2  4  
ATOM 6881  H HG3  . GLU A 1 103 ? 3.919   -4.209  6.673   1.00 0.00 ? 103 GLU A HG3  4  
ATOM 6882  N N    . GLY A 1 104 ? -0.025  -3.529  6.515   1.00 0.00 ? 104 GLY A N    4  
ATOM 6883  C CA   . GLY A 1 104 ? -1.367  -3.995  6.814   1.00 0.00 ? 104 GLY A CA   4  
ATOM 6884  C C    . GLY A 1 104 ? -1.511  -5.494  6.642   1.00 0.00 ? 104 GLY A C    4  
ATOM 6885  O O    . GLY A 1 104 ? -1.832  -5.974  5.554   1.00 0.00 ? 104 GLY A O    4  
ATOM 6886  H H    . GLY A 1 104 ? 0.494   -3.960  5.805   1.00 0.00 ? 104 GLY A H    4  
ATOM 6887  H HA2  . GLY A 1 104 ? -1.608  -3.736  7.834   1.00 0.00 ? 104 GLY A HA2  4  
ATOM 6888  H HA3  . GLY A 1 104 ? -2.063  -3.500  6.153   1.00 0.00 ? 104 GLY A HA3  4  
ATOM 6889  N N    . VAL A 1 105 ? -1.272  -6.238  7.717   1.00 0.00 ? 105 VAL A N    4  
ATOM 6890  C CA   . VAL A 1 105 ? -1.376  -7.692  7.680   1.00 0.00 ? 105 VAL A CA   4  
ATOM 6891  C C    . VAL A 1 105 ? -2.834  -8.138  7.685   1.00 0.00 ? 105 VAL A C    4  
ATOM 6892  O O    . VAL A 1 105 ? -3.672  -7.548  8.368   1.00 0.00 ? 105 VAL A O    4  
ATOM 6893  C CB   . VAL A 1 105 ? -0.649  -8.337  8.875   1.00 0.00 ? 105 VAL A CB   4  
ATOM 6894  C CG1  . VAL A 1 105 ? -1.107  -7.708  10.182  1.00 0.00 ? 105 VAL A CG1  4  
ATOM 6895  C CG2  . VAL A 1 105 ? -0.879  -9.841  8.888   1.00 0.00 ? 105 VAL A CG2  4  
ATOM 6896  H H    . VAL A 1 105 ? -1.020  -5.798  8.556   1.00 0.00 ? 105 VAL A H    4  
ATOM 6897  H HA   . VAL A 1 105 ? -0.907  -8.037  6.771   1.00 0.00 ? 105 VAL A HA   4  
ATOM 6898  H HB   . VAL A 1 105 ? 0.410   -8.157  8.766   1.00 0.00 ? 105 VAL A HB   4  
ATOM 6899  H HG11 . VAL A 1 105 ? -1.295  -8.485  10.908  1.00 0.00 ? 105 VAL A HG11 4  
ATOM 6900  H HG12 . VAL A 1 105 ? -0.337  -7.046  10.552  1.00 0.00 ? 105 VAL A HG12 4  
ATOM 6901  H HG13 . VAL A 1 105 ? -2.014  -7.147  10.013  1.00 0.00 ? 105 VAL A HG13 4  
ATOM 6902  H HG21 . VAL A 1 105 ? -0.661  -10.230 9.872   1.00 0.00 ? 105 VAL A HG21 4  
ATOM 6903  H HG22 . VAL A 1 105 ? -1.908  -10.049 8.637   1.00 0.00 ? 105 VAL A HG22 4  
ATOM 6904  H HG23 . VAL A 1 105 ? -0.229  -10.311 8.164   1.00 0.00 ? 105 VAL A HG23 4  
ATOM 6905  N N    . ILE A 1 106 ? -3.129  -9.183  6.920   1.00 0.00 ? 106 ILE A N    4  
ATOM 6906  C CA   . ILE A 1 106 ? -4.486  -9.710  6.837   1.00 0.00 ? 106 ILE A CA   4  
ATOM 6907  C C    . ILE A 1 106 ? -4.500  -11.224 7.020   1.00 0.00 ? 106 ILE A C    4  
ATOM 6908  O O    . ILE A 1 106 ? -3.550  -11.914 6.650   1.00 0.00 ? 106 ILE A O    4  
ATOM 6909  C CB   . ILE A 1 106 ? -5.144  -9.361  5.489   1.00 0.00 ? 106 ILE A CB   4  
ATOM 6910  C CG1  . ILE A 1 106 ? -6.618  -9.773  5.495   1.00 0.00 ? 106 ILE A CG1  4  
ATOM 6911  C CG2  . ILE A 1 106 ? -4.404  -10.040 4.347   1.00 0.00 ? 106 ILE A CG2  4  
ATOM 6912  C CD1  . ILE A 1 106 ? -7.500  -8.849  6.306   1.00 0.00 ? 106 ILE A CD1  4  
ATOM 6913  H H    . ILE A 1 106 ? -2.418  -9.610  6.399   1.00 0.00 ? 106 ILE A H    4  
ATOM 6914  H HA   . ILE A 1 106 ? -5.068  -9.257  7.627   1.00 0.00 ? 106 ILE A HA   4  
ATOM 6915  H HB   . ILE A 1 106 ? -5.077  -8.294  5.346   1.00 0.00 ? 106 ILE A HB   4  
ATOM 6916  H HG12 . ILE A 1 106 ? -6.988  -9.778  4.482   1.00 0.00 ? 106 ILE A HG12 4  
ATOM 6917  H HG13 . ILE A 1 106 ? -6.705  -10.766 5.911   1.00 0.00 ? 106 ILE A HG13 4  
ATOM 6918  H HG21 . ILE A 1 106 ? -4.718  -9.608  3.408   1.00 0.00 ? 106 ILE A HG21 4  
ATOM 6919  H HG22 . ILE A 1 106 ? -3.341  -9.895  4.471   1.00 0.00 ? 106 ILE A HG22 4  
ATOM 6920  H HG23 . ILE A 1 106 ? -4.626  -11.096 4.350   1.00 0.00 ? 106 ILE A HG23 4  
ATOM 6921  H HD11 . ILE A 1 106 ? -8.479  -9.294  6.418   1.00 0.00 ? 106 ILE A HD11 4  
ATOM 6922  H HD12 . ILE A 1 106 ? -7.062  -8.696  7.281   1.00 0.00 ? 106 ILE A HD12 4  
ATOM 6923  H HD13 . ILE A 1 106 ? -7.592  -7.901  5.798   1.00 0.00 ? 106 ILE A HD13 4  
ATOM 6924  N N    . THR A 1 107 ? -5.585  -11.735 7.593   1.00 0.00 ? 107 THR A N    4  
ATOM 6925  C CA   . THR A 1 107 ? -5.725  -13.167 7.825   1.00 0.00 ? 107 THR A CA   4  
ATOM 6926  C C    . THR A 1 107 ? -6.967  -13.718 7.134   1.00 0.00 ? 107 THR A C    4  
ATOM 6927  O O    . THR A 1 107 ? -8.093  -13.400 7.517   1.00 0.00 ? 107 THR A O    4  
ATOM 6928  C CB   . THR A 1 107 ? -5.803  -13.487 9.330   1.00 0.00 ? 107 THR A CB   4  
ATOM 6929  O OG1  . THR A 1 107 ? -4.606  -13.056 9.986   1.00 0.00 ? 107 THR A OG1  4  
ATOM 6930  C CG2  . THR A 1 107 ? -6.002  -14.979 9.556   1.00 0.00 ? 107 THR A CG2  4  
ATOM 6931  H H    . THR A 1 107 ? -6.309  -11.133 7.866   1.00 0.00 ? 107 THR A H    4  
ATOM 6932  H HA   . THR A 1 107 ? -4.851  -13.657 7.419   1.00 0.00 ? 107 THR A HA   4  
ATOM 6933  H HB   . THR A 1 107 ? -6.646  -12.959 9.751   1.00 0.00 ? 107 THR A HB   4  
ATOM 6934  H HG1  . THR A 1 107 ? -4.749  -13.041 10.935  1.00 0.00 ? 107 THR A HG1  4  
ATOM 6935  H HG21 . THR A 1 107 ? -7.048  -15.178 9.737   1.00 0.00 ? 107 THR A HG21 4  
ATOM 6936  H HG22 . THR A 1 107 ? -5.423  -15.294 10.411  1.00 0.00 ? 107 THR A HG22 4  
ATOM 6937  H HG23 . THR A 1 107 ? -5.678  -15.522 8.681   1.00 0.00 ? 107 THR A HG23 4  
ATOM 6938  N N    . ILE A 1 108 ? -6.754  -14.545 6.116   1.00 0.00 ? 108 ILE A N    4  
ATOM 6939  C CA   . ILE A 1 108 ? -7.858  -15.141 5.374   1.00 0.00 ? 108 ILE A CA   4  
ATOM 6940  C C    . ILE A 1 108 ? -8.666  -16.086 6.255   1.00 0.00 ? 108 ILE A C    4  
ATOM 6941  O O    . ILE A 1 108 ? -8.195  -17.162 6.624   1.00 0.00 ? 108 ILE A O    4  
ATOM 6942  C CB   . ILE A 1 108 ? -7.354  -15.913 4.140   1.00 0.00 ? 108 ILE A CB   4  
ATOM 6943  C CG1  . ILE A 1 108 ? -6.558  -14.984 3.220   1.00 0.00 ? 108 ILE A CG1  4  
ATOM 6944  C CG2  . ILE A 1 108 ? -8.523  -16.535 3.390   1.00 0.00 ? 108 ILE A CG2  4  
ATOM 6945  C CD1  . ILE A 1 108 ? -7.366  -13.821 2.690   1.00 0.00 ? 108 ILE A CD1  4  
ATOM 6946  H H    . ILE A 1 108 ? -5.834  -14.760 5.859   1.00 0.00 ? 108 ILE A H    4  
ATOM 6947  H HA   . ILE A 1 108 ? -8.502  -14.342 5.035   1.00 0.00 ? 108 ILE A HA   4  
ATOM 6948  H HB   . ILE A 1 108 ? -6.710  -16.710 4.479   1.00 0.00 ? 108 ILE A HB   4  
ATOM 6949  H HG12 . ILE A 1 108 ? -5.718  -14.583 3.764   1.00 0.00 ? 108 ILE A HG12 4  
ATOM 6950  H HG13 . ILE A 1 108 ? -6.197  -15.552 2.374   1.00 0.00 ? 108 ILE A HG13 4  
ATOM 6951  H HG21 . ILE A 1 108 ? -8.934  -17.346 3.974   1.00 0.00 ? 108 ILE A HG21 4  
ATOM 6952  H HG22 . ILE A 1 108 ? -9.285  -15.787 3.229   1.00 0.00 ? 108 ILE A HG22 4  
ATOM 6953  H HG23 . ILE A 1 108 ? -8.181  -16.913 2.439   1.00 0.00 ? 108 ILE A HG23 4  
ATOM 6954  H HD11 . ILE A 1 108 ? -8.420  -14.030 2.812   1.00 0.00 ? 108 ILE A HD11 4  
ATOM 6955  H HD12 . ILE A 1 108 ? -7.112  -12.926 3.238   1.00 0.00 ? 108 ILE A HD12 4  
ATOM 6956  H HD13 . ILE A 1 108 ? -7.147  -13.677 1.643   1.00 0.00 ? 108 ILE A HD13 4  
ATOM 6957  N N    . GLU A 1 109 ? -9.887  -15.678 6.588   1.00 0.00 ? 109 GLU A N    4  
ATOM 6958  C CA   . GLU A 1 109 ? -10.762 -16.489 7.426   1.00 0.00 ? 109 GLU A CA   4  
ATOM 6959  C C    . GLU A 1 109 ? -12.010 -16.915 6.658   1.00 0.00 ? 109 GLU A C    4  
ATOM 6960  O O    . GLU A 1 109 ? -12.940 -16.129 6.480   1.00 0.00 ? 109 GLU A O    4  
ATOM 6961  C CB   . GLU A 1 109 ? -11.162 -15.715 8.683   1.00 0.00 ? 109 GLU A CB   4  
ATOM 6962  C CG   . GLU A 1 109 ? -10.061 -15.637 9.727   1.00 0.00 ? 109 GLU A CG   4  
ATOM 6963  C CD   . GLU A 1 109 ? -10.249 -14.480 10.688  1.00 0.00 ? 109 GLU A CD   4  
ATOM 6964  O OE1  . GLU A 1 109 ? -10.680 -13.398 10.236  1.00 0.00 ? 109 GLU A OE1  4  
ATOM 6965  O OE2  . GLU A 1 109 ? -9.964  -14.655 11.891  1.00 0.00 ? 109 GLU A OE2  4  
ATOM 6966  H H    . GLU A 1 109 ? -10.206 -14.810 6.263   1.00 0.00 ? 109 GLU A H    4  
ATOM 6967  H HA   . GLU A 1 109 ? -10.215 -17.373 7.718   1.00 0.00 ? 109 GLU A HA   4  
ATOM 6968  H HB2  . GLU A 1 109 ? -11.435 -14.709 8.401   1.00 0.00 ? 109 GLU A HB2  4  
ATOM 6969  H HB3  . GLU A 1 109 ? -12.019 -16.198 9.131   1.00 0.00 ? 109 GLU A HB3  4  
ATOM 6970  H HG2  . GLU A 1 109 ? -10.052 -16.557 10.293  1.00 0.00 ? 109 GLU A HG2  4  
ATOM 6971  H HG3  . GLU A 1 109 ? -9.113  -15.517 9.223   1.00 0.00 ? 109 GLU A HG3  4  
ATOM 6972  N N    . SER A 1 110 ? -12.021 -18.164 6.204   1.00 0.00 ? 110 SER A N    4  
ATOM 6973  C CA   . SER A 1 110 ? -13.152 -18.693 5.451   1.00 0.00 ? 110 SER A CA   4  
ATOM 6974  C C    . SER A 1 110 ? -14.184 -19.317 6.386   1.00 0.00 ? 110 SER A C    4  
ATOM 6975  O O    . SER A 1 110 ? -13.897 -19.585 7.553   1.00 0.00 ? 110 SER A O    4  
ATOM 6976  C CB   . SER A 1 110 ? -12.674 -19.733 4.435   1.00 0.00 ? 110 SER A CB   4  
ATOM 6977  O OG   . SER A 1 110 ? -12.221 -20.908 5.084   1.00 0.00 ? 110 SER A OG   4  
ATOM 6978  H H    . SER A 1 110 ? -11.249 -18.742 6.378   1.00 0.00 ? 110 SER A H    4  
ATOM 6979  H HA   . SER A 1 110 ? -13.613 -17.872 4.923   1.00 0.00 ? 110 SER A HA   4  
ATOM 6980  H HB2  . SER A 1 110 ? -13.490 -19.991 3.777   1.00 0.00 ? 110 SER A HB2  4  
ATOM 6981  H HB3  . SER A 1 110 ? -11.861 -19.319 3.856   1.00 0.00 ? 110 SER A HB3  4  
ATOM 6982  H HG   . SER A 1 110 ? -12.807 -21.638 4.871   1.00 0.00 ? 110 SER A HG   4  
ATOM 6983  N N    . GLN A 1 111 ? -15.385 -19.544 5.865   1.00 0.00 ? 111 GLN A N    4  
ATOM 6984  C CA   . GLN A 1 111 ? -16.460 -20.135 6.654   1.00 0.00 ? 111 GLN A CA   4  
ATOM 6985  C C    . GLN A 1 111 ? -17.300 -21.083 5.804   1.00 0.00 ? 111 GLN A C    4  
ATOM 6986  O O    . GLN A 1 111 ? -17.893 -20.677 4.804   1.00 0.00 ? 111 GLN A O    4  
ATOM 6987  C CB   . GLN A 1 111 ? -17.347 -19.040 7.247   1.00 0.00 ? 111 GLN A CB   4  
ATOM 6988  C CG   . GLN A 1 111 ? -16.832 -18.486 8.565   1.00 0.00 ? 111 GLN A CG   4  
ATOM 6989  C CD   . GLN A 1 111 ? -17.872 -17.664 9.300   1.00 0.00 ? 111 GLN A CD   4  
ATOM 6990  O OE1  . GLN A 1 111 ? -18.362 -18.062 10.357  1.00 0.00 ? 111 GLN A OE1  4  
ATOM 6991  N NE2  . GLN A 1 111 ? -18.216 -16.509 8.742   1.00 0.00 ? 111 GLN A NE2  4  
ATOM 6992  H H    . GLN A 1 111 ? -15.552 -19.309 4.929   1.00 0.00 ? 111 GLN A H    4  
ATOM 6993  H HA   . GLN A 1 111 ? -16.010 -20.697 7.458   1.00 0.00 ? 111 GLN A HA   4  
ATOM 6994  H HB2  . GLN A 1 111 ? -17.414 -18.225 6.541   1.00 0.00 ? 111 GLN A HB2  4  
ATOM 6995  H HB3  . GLN A 1 111 ? -18.335 -19.444 7.413   1.00 0.00 ? 111 GLN A HB3  4  
ATOM 6996  H HG2  . GLN A 1 111 ? -16.537 -19.312 9.197   1.00 0.00 ? 111 GLN A HG2  4  
ATOM 6997  H HG3  . GLN A 1 111 ? -15.974 -17.861 8.367   1.00 0.00 ? 111 GLN A HG3  4  
ATOM 6998  H HE21 . GLN A 1 111 ? -17.785 -16.257 7.898   1.00 0.00 ? 111 GLN A HE21 4  
ATOM 6999  H HE22 . GLN A 1 111 ? -18.886 -15.958 9.195   1.00 0.00 ? 111 GLN A HE22 4  
ATOM 7000  N N    . VAL A 1 112 ? -17.348 -22.348 6.209   1.00 0.00 ? 112 VAL A N    4  
ATOM 7001  C CA   . VAL A 1 112 ? -18.116 -23.354 5.485   1.00 0.00 ? 112 VAL A CA   4  
ATOM 7002  C C    . VAL A 1 112 ? -19.421 -23.672 6.206   1.00 0.00 ? 112 VAL A C    4  
ATOM 7003  O O    . VAL A 1 112 ? -19.463 -23.743 7.434   1.00 0.00 ? 112 VAL A O    4  
ATOM 7004  C CB   . VAL A 1 112 ? -17.311 -24.654 5.307   1.00 0.00 ? 112 VAL A CB   4  
ATOM 7005  C CG1  . VAL A 1 112 ? -16.058 -24.398 4.484   1.00 0.00 ? 112 VAL A CG1  4  
ATOM 7006  C CG2  . VAL A 1 112 ? -16.958 -25.252 6.660   1.00 0.00 ? 112 VAL A CG2  4  
ATOM 7007  H H    . VAL A 1 112 ? -16.855 -22.611 7.013   1.00 0.00 ? 112 VAL A H    4  
ATOM 7008  H HA   . VAL A 1 112 ? -18.344 -22.959 4.506   1.00 0.00 ? 112 VAL A HA   4  
ATOM 7009  H HB   . VAL A 1 112 ? -17.926 -25.364 4.773   1.00 0.00 ? 112 VAL A HB   4  
ATOM 7010  H HG11 . VAL A 1 112 ? -15.530 -25.328 4.333   1.00 0.00 ? 112 VAL A HG11 4  
ATOM 7011  H HG12 . VAL A 1 112 ? -16.333 -23.979 3.527   1.00 0.00 ? 112 VAL A HG12 4  
ATOM 7012  H HG13 . VAL A 1 112 ? -15.418 -23.704 5.010   1.00 0.00 ? 112 VAL A HG13 4  
ATOM 7013  H HG21 . VAL A 1 112 ? -17.308 -26.272 6.706   1.00 0.00 ? 112 VAL A HG21 4  
ATOM 7014  H HG22 . VAL A 1 112 ? -15.887 -25.231 6.793   1.00 0.00 ? 112 VAL A HG22 4  
ATOM 7015  H HG23 . VAL A 1 112 ? -17.429 -24.675 7.443   1.00 0.00 ? 112 VAL A HG23 4  
ATOM 7016  N N    . SER A 1 113 ? -20.486 -23.863 5.434   1.00 0.00 ? 113 SER A N    4  
ATOM 7017  C CA   . SER A 1 113 ? -21.795 -24.171 5.999   1.00 0.00 ? 113 SER A CA   4  
ATOM 7018  C C    . SER A 1 113 ? -22.279 -25.541 5.535   1.00 0.00 ? 113 SER A C    4  
ATOM 7019  O O    . SER A 1 113 ? -22.705 -25.708 4.394   1.00 0.00 ? 113 SER A O    4  
ATOM 7020  C CB   . SER A 1 113 ? -22.811 -23.098 5.602   1.00 0.00 ? 113 SER A CB   4  
ATOM 7021  O OG   . SER A 1 113 ? -24.069 -23.336 6.209   1.00 0.00 ? 113 SER A OG   4  
ATOM 7022  H H    . SER A 1 113 ? -20.390 -23.793 4.461   1.00 0.00 ? 113 SER A H    4  
ATOM 7023  H HA   . SER A 1 113 ? -21.698 -24.181 7.075   1.00 0.00 ? 113 SER A HA   4  
ATOM 7024  H HB2  . SER A 1 113 ? -22.450 -22.130 5.917   1.00 0.00 ? 113 SER A HB2  4  
ATOM 7025  H HB3  . SER A 1 113 ? -22.935 -23.104 4.529   1.00 0.00 ? 113 SER A HB3  4  
ATOM 7026  H HG   . SER A 1 113 ? -24.600 -23.893 5.636   1.00 0.00 ? 113 SER A HG   4  
ATOM 7027  N N    . GLY A 1 114 ? -22.208 -26.521 6.431   1.00 0.00 ? 114 GLY A N    4  
ATOM 7028  C CA   . GLY A 1 114 ? -22.641 -27.865 6.096   1.00 0.00 ? 114 GLY A CA   4  
ATOM 7029  C C    . GLY A 1 114 ? -23.927 -28.252 6.800   1.00 0.00 ? 114 GLY A C    4  
ATOM 7030  O O    . GLY A 1 114 ? -24.490 -27.481 7.577   1.00 0.00 ? 114 GLY A O    4  
ATOM 7031  H H    . GLY A 1 114 ? -21.859 -26.330 7.327   1.00 0.00 ? 114 GLY A H    4  
ATOM 7032  H HA2  . GLY A 1 114 ? -22.794 -27.927 5.029   1.00 0.00 ? 114 GLY A HA2  4  
ATOM 7033  H HA3  . GLY A 1 114 ? -21.866 -28.562 6.379   1.00 0.00 ? 114 GLY A HA3  4  
ATOM 7034  N N    . PRO A 1 115 ? -24.411 -29.473 6.528   1.00 0.00 ? 115 PRO A N    4  
ATOM 7035  C CA   . PRO A 1 115 ? -25.644 -29.988 7.129   1.00 0.00 ? 115 PRO A CA   4  
ATOM 7036  C C    . PRO A 1 115 ? -25.486 -30.276 8.619   1.00 0.00 ? 115 PRO A C    4  
ATOM 7037  O O    . PRO A 1 115 ? -24.835 -31.246 9.008   1.00 0.00 ? 115 PRO A O    4  
ATOM 7038  C CB   . PRO A 1 115 ? -25.900 -31.286 6.358   1.00 0.00 ? 115 PRO A CB   4  
ATOM 7039  C CG   . PRO A 1 115 ? -24.556 -31.712 5.877   1.00 0.00 ? 115 PRO A CG   4  
ATOM 7040  C CD   . PRO A 1 115 ? -23.790 -30.445 5.611   1.00 0.00 ? 115 PRO A CD   4  
ATOM 7041  H HA   . PRO A 1 115 ? -26.471 -29.310 6.981   1.00 0.00 ? 115 PRO A HA   4  
ATOM 7042  H HB2  . PRO A 1 115 ? -26.335 -32.021 7.021   1.00 0.00 ? 115 PRO A HB2  4  
ATOM 7043  H HB3  . PRO A 1 115 ? -26.571 -31.093 5.535   1.00 0.00 ? 115 PRO A HB3  4  
ATOM 7044  H HG2  . PRO A 1 115 ? -24.061 -32.296 6.638   1.00 0.00 ? 115 PRO A HG2  4  
ATOM 7045  H HG3  . PRO A 1 115 ? -24.657 -32.286 4.968   1.00 0.00 ? 115 PRO A HG3  4  
ATOM 7046  H HD2  . PRO A 1 115 ? -22.744 -30.580 5.843   1.00 0.00 ? 115 PRO A HD2  4  
ATOM 7047  H HD3  . PRO A 1 115 ? -23.914 -30.138 4.583   1.00 0.00 ? 115 PRO A HD3  4  
ATOM 7048  N N    . SER A 1 116 ? -26.086 -29.428 9.448   1.00 0.00 ? 116 SER A N    4  
ATOM 7049  C CA   . SER A 1 116 ? -26.008 -29.589 10.895  1.00 0.00 ? 116 SER A CA   4  
ATOM 7050  C C    . SER A 1 116 ? -26.968 -30.675 11.372  1.00 0.00 ? 116 SER A C    4  
ATOM 7051  O O    . SER A 1 116 ? -28.123 -30.728 10.950  1.00 0.00 ? 116 SER A O    4  
ATOM 7052  C CB   . SER A 1 116 ? -26.328 -28.267 11.595  1.00 0.00 ? 116 SER A CB   4  
ATOM 7053  O OG   . SER A 1 116 ? -25.214 -27.392 11.566  1.00 0.00 ? 116 SER A OG   4  
ATOM 7054  H H    . SER A 1 116 ? -26.590 -28.673 9.077   1.00 0.00 ? 116 SER A H    4  
ATOM 7055  H HA   . SER A 1 116 ? -24.999 -29.883 11.142  1.00 0.00 ? 116 SER A HA   4  
ATOM 7056  H HB2  . SER A 1 116 ? -27.158 -27.790 11.096  1.00 0.00 ? 116 SER A HB2  4  
ATOM 7057  H HB3  . SER A 1 116 ? -26.591 -28.462 12.624  1.00 0.00 ? 116 SER A HB3  4  
ATOM 7058  H HG   . SER A 1 116 ? -24.840 -27.379 10.682  1.00 0.00 ? 116 SER A HG   4  
ATOM 7059  N N    . SER A 1 117 ? -26.480 -31.541 12.255  1.00 0.00 ? 117 SER A N    4  
ATOM 7060  C CA   . SER A 1 117 ? -27.292 -32.629 12.787  1.00 0.00 ? 117 SER A CA   4  
ATOM 7061  C C    . SER A 1 117 ? -26.589 -33.307 13.960  1.00 0.00 ? 117 SER A C    4  
ATOM 7062  O O    . SER A 1 117 ? -25.483 -33.827 13.819  1.00 0.00 ? 117 SER A O    4  
ATOM 7063  C CB   . SER A 1 117 ? -27.588 -33.655 11.693  1.00 0.00 ? 117 SER A CB   4  
ATOM 7064  O OG   . SER A 1 117 ? -26.432 -34.409 11.373  1.00 0.00 ? 117 SER A OG   4  
ATOM 7065  H H    . SER A 1 117 ? -25.551 -31.447 12.553  1.00 0.00 ? 117 SER A H    4  
ATOM 7066  H HA   . SER A 1 117 ? -28.223 -32.208 13.136  1.00 0.00 ? 117 SER A HA   4  
ATOM 7067  H HB2  . SER A 1 117 ? -28.359 -34.330 12.034  1.00 0.00 ? 117 SER A HB2  4  
ATOM 7068  H HB3  . SER A 1 117 ? -27.927 -33.142 10.804  1.00 0.00 ? 117 SER A HB3  4  
ATOM 7069  H HG   . SER A 1 117 ? -26.638 -35.031 10.672  1.00 0.00 ? 117 SER A HG   4  
ATOM 7070  N N    . GLY A 1 118 ? -27.241 -33.298 15.118  1.00 0.00 ? 118 GLY A N    4  
ATOM 7071  C CA   . GLY A 1 118 ? -26.665 -33.915 16.299  1.00 0.00 ? 118 GLY A CA   4  
ATOM 7072  C C    . GLY A 1 118 ? -27.720 -34.399 17.274  1.00 0.00 ? 118 GLY A C    4  
ATOM 7073  O O    . GLY A 1 118 ? -28.768 -33.771 17.426  1.00 0.00 ? 118 GLY A O    4  
ATOM 7074  H H    . GLY A 1 118 ? -28.121 -32.869 15.172  1.00 0.00 ? 118 GLY A H    4  
ATOM 7075  H HA2  . GLY A 1 118 ? -26.059 -34.755 15.993  1.00 0.00 ? 118 GLY A HA2  4  
ATOM 7076  H HA3  . GLY A 1 118 ? -26.036 -33.192 16.797  1.00 0.00 ? 118 GLY A HA3  4  
ATOM 7077  N N    . GLY A 1 1   ? 9.498   4.184   14.901  1.00 0.00 ? 1   GLY A N    5  
ATOM 7078  C CA   . GLY A 1 1   ? 10.293  3.808   16.055  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7079  C C    . GLY A 1 1   ? 11.781  3.957   15.807  1.00 0.00 ? 1   GLY A C    5  
ATOM 7080  O O    . GLY A 1 1   ? 12.566  3.073   16.149  1.00 0.00 ? 1   GLY A O    5  
ATOM 7081  H H1   . GLY A 1 1   ? 8.577   3.858   14.815  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7082  H HA2  . GLY A 1 1   ? 10.014  4.433   16.890  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7083  H HA3  . GLY A 1 1   ? 10.083  2.778   16.303  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7084  N N    . SER A 1 2   ? 12.171  5.079   15.209  1.00 0.00 ? 2   SER A N    5  
ATOM 7085  C CA   . SER A 1 2   ? 13.574  5.338   14.910  1.00 0.00 ? 2   SER A CA   5  
ATOM 7086  C C    . SER A 1 2   ? 14.439  5.140   16.150  1.00 0.00 ? 2   SER A C    5  
ATOM 7087  O O    . SER A 1 2   ? 14.533  6.023   17.003  1.00 0.00 ? 2   SER A O    5  
ATOM 7088  C CB   . SER A 1 2   ? 13.749  6.761   14.374  1.00 0.00 ? 2   SER A CB   5  
ATOM 7089  O OG   . SER A 1 2   ? 13.301  6.859   13.033  1.00 0.00 ? 2   SER A OG   5  
ATOM 7090  H H    . SER A 1 2   ? 11.497  5.746   14.960  1.00 0.00 ? 2   SER A H    5  
ATOM 7091  H HA   . SER A 1 2   ? 13.887  4.636   14.151  1.00 0.00 ? 2   SER A HA   5  
ATOM 7092  H HB2  . SER A 1 2   ? 13.177  7.445   14.983  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7093  H HB3  . SER A 1 2   ? 14.794  7.031   14.414  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7094  H HG   . SER A 1 2   ? 12.651  6.175   12.861  1.00 0.00 ? 2   SER A HG   5  
ATOM 7095  N N    . SER A 1 3   ? 15.070  3.974   16.244  1.00 0.00 ? 3   SER A N    5  
ATOM 7096  C CA   . SER A 1 3   ? 15.925  3.656   17.382  1.00 0.00 ? 3   SER A CA   5  
ATOM 7097  C C    . SER A 1 3   ? 17.392  3.901   17.044  1.00 0.00 ? 3   SER A C    5  
ATOM 7098  O O    . SER A 1 3   ? 17.890  3.439   16.018  1.00 0.00 ? 3   SER A O    5  
ATOM 7099  C CB   . SER A 1 3   ? 15.724  2.200   17.808  1.00 0.00 ? 3   SER A CB   5  
ATOM 7100  O OG   . SER A 1 3   ? 15.906  1.319   16.713  1.00 0.00 ? 3   SER A OG   5  
ATOM 7101  H H    . SER A 1 3   ? 14.955  3.310   15.532  1.00 0.00 ? 3   SER A H    5  
ATOM 7102  H HA   . SER A 1 3   ? 15.643  4.303   18.199  1.00 0.00 ? 3   SER A HA   5  
ATOM 7103  H HB2  . SER A 1 3   ? 16.438  1.951   18.577  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7104  H HB3  . SER A 1 3   ? 14.722  2.076   18.192  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7105  H HG   . SER A 1 3   ? 16.681  0.774   16.866  1.00 0.00 ? 3   SER A HG   5  
ATOM 7106  N N    . GLY A 1 4   ? 18.080  4.633   17.916  1.00 0.00 ? 4   GLY A N    5  
ATOM 7107  C CA   . GLY A 1 4   ? 19.483  4.928   17.693  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7108  C C    . GLY A 1 4   ? 19.801  6.400   17.863  1.00 0.00 ? 4   GLY A C    5  
ATOM 7109  O O    . GLY A 1 4   ? 19.484  7.215   16.996  1.00 0.00 ? 4   GLY A O    5  
ATOM 7110  H H    . GLY A 1 4   ? 17.630  4.975   18.717  1.00 0.00 ? 4   GLY A H    5  
ATOM 7111  H HA2  . GLY A 1 4   ? 20.075  4.359   18.394  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7112  H HA3  . GLY A 1 4   ? 19.747  4.628   16.689  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7113  N N    . SER A 1 5   ? 20.426  6.743   18.985  1.00 0.00 ? 5   SER A N    5  
ATOM 7114  C CA   . SER A 1 5   ? 20.781  8.129   19.269  1.00 0.00 ? 5   SER A CA   5  
ATOM 7115  C C    . SER A 1 5   ? 22.256  8.383   18.972  1.00 0.00 ? 5   SER A C    5  
ATOM 7116  O O    . SER A 1 5   ? 22.955  9.031   19.751  1.00 0.00 ? 5   SER A O    5  
ATOM 7117  C CB   . SER A 1 5   ? 20.478  8.466   20.730  1.00 0.00 ? 5   SER A CB   5  
ATOM 7118  O OG   . SER A 1 5   ? 19.096  8.716   20.919  1.00 0.00 ? 5   SER A OG   5  
ATOM 7119  H H    . SER A 1 5   ? 20.652  6.048   19.638  1.00 0.00 ? 5   SER A H    5  
ATOM 7120  H HA   . SER A 1 5   ? 20.184  8.762   18.630  1.00 0.00 ? 5   SER A HA   5  
ATOM 7121  H HB2  . SER A 1 5   ? 20.770  7.637   21.356  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7122  H HB3  . SER A 1 5   ? 21.034  9.347   21.016  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7123  H HG   . SER A 1 5   ? 18.978  9.586   21.307  1.00 0.00 ? 5   SER A HG   5  
ATOM 7124  N N    . SER A 1 6   ? 22.723  7.868   17.839  1.00 0.00 ? 6   SER A N    5  
ATOM 7125  C CA   . SER A 1 6   ? 24.115  8.035   17.439  1.00 0.00 ? 6   SER A CA   5  
ATOM 7126  C C    . SER A 1 6   ? 24.225  8.261   15.934  1.00 0.00 ? 6   SER A C    5  
ATOM 7127  O O    . SER A 1 6   ? 23.654  7.515   15.140  1.00 0.00 ? 6   SER A O    5  
ATOM 7128  C CB   . SER A 1 6   ? 24.935  6.809   17.844  1.00 0.00 ? 6   SER A CB   5  
ATOM 7129  O OG   . SER A 1 6   ? 25.346  6.894   19.198  1.00 0.00 ? 6   SER A OG   5  
ATOM 7130  H H    . SER A 1 6   ? 22.116  7.361   17.259  1.00 0.00 ? 6   SER A H    5  
ATOM 7131  H HA   . SER A 1 6   ? 24.505  8.903   17.951  1.00 0.00 ? 6   SER A HA   5  
ATOM 7132  H HB2  . SER A 1 6   ? 24.335  5.920   17.718  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7133  H HB3  . SER A 1 6   ? 25.812  6.743   17.217  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7134  H HG   . SER A 1 6   ? 25.087  6.094   19.662  1.00 0.00 ? 6   SER A HG   5  
ATOM 7135  N N    . GLY A 1 7   ? 24.966  9.296   15.550  1.00 0.00 ? 7   GLY A N    5  
ATOM 7136  C CA   . GLY A 1 7   ? 25.138  9.603   14.142  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7137  C C    . GLY A 1 7   ? 24.083  10.560  13.623  1.00 0.00 ? 7   GLY A C    5  
ATOM 7138  O O    . GLY A 1 7   ? 24.407  11.607  13.065  1.00 0.00 ? 7   GLY A O    5  
ATOM 7139  H H    . GLY A 1 7   ? 25.399  9.856   16.228  1.00 0.00 ? 7   GLY A H    5  
ATOM 7140  H HA2  . GLY A 1 7   ? 26.113  10.045  13.998  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7141  H HA3  . GLY A 1 7   ? 25.084  8.684   13.576  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7142  N N    . SER A 1 8   ? 22.817  10.198  13.807  1.00 0.00 ? 8   SER A N    5  
ATOM 7143  C CA   . SER A 1 8   ? 21.711  11.030  13.349  1.00 0.00 ? 8   SER A CA   5  
ATOM 7144  C C    . SER A 1 8   ? 21.942  11.500  11.916  1.00 0.00 ? 8   SER A C    5  
ATOM 7145  O O    . SER A 1 8   ? 21.768  12.677  11.600  1.00 0.00 ? 8   SER A O    5  
ATOM 7146  C CB   . SER A 1 8   ? 21.537  12.238  14.272  1.00 0.00 ? 8   SER A CB   5  
ATOM 7147  O OG   . SER A 1 8   ? 21.026  11.846  15.534  1.00 0.00 ? 8   SER A OG   5  
ATOM 7148  H H    . SER A 1 8   ? 22.623  9.351   14.260  1.00 0.00 ? 8   SER A H    5  
ATOM 7149  H HA   . SER A 1 8   ? 20.812  10.432  13.379  1.00 0.00 ? 8   SER A HA   5  
ATOM 7150  H HB2  . SER A 1 8   ? 22.492  12.718  14.417  1.00 0.00 ? 8   SER A HB2  5  
ATOM 7151  H HB3  . SER A 1 8   ? 20.848  12.937  13.819  1.00 0.00 ? 8   SER A HB3  5  
ATOM 7152  H HG   . SER A 1 8   ? 20.507  12.562  15.906  1.00 0.00 ? 8   SER A HG   5  
ATOM 7153  N N    . HIS A 1 9   ? 22.335  10.570  11.051  1.00 0.00 ? 9   HIS A N    5  
ATOM 7154  C CA   . HIS A 1 9   ? 22.590  10.888  9.650   1.00 0.00 ? 9   HIS A CA   5  
ATOM 7155  C C    . HIS A 1 9   ? 21.535  11.848  9.110   1.00 0.00 ? 9   HIS A C    5  
ATOM 7156  O O    . HIS A 1 9   ? 20.344  11.692  9.380   1.00 0.00 ? 9   HIS A O    5  
ATOM 7157  C CB   . HIS A 1 9   ? 22.611  9.609   8.811   1.00 0.00 ? 9   HIS A CB   5  
ATOM 7158  C CG   . HIS A 1 9   ? 23.631  8.611   9.265   1.00 0.00 ? 9   HIS A CG   5  
ATOM 7159  N ND1  . HIS A 1 9   ? 23.365  7.636   10.203  1.00 0.00 ? 9   HIS A ND1  5  
ATOM 7160  C CD2  . HIS A 1 9   ? 24.924  8.440   8.903   1.00 0.00 ? 9   HIS A CD2  5  
ATOM 7161  C CE1  . HIS A 1 9   ? 24.450  6.909   10.399  1.00 0.00 ? 9   HIS A CE1  5  
ATOM 7162  N NE2  . HIS A 1 9   ? 25.411  7.376   9.622   1.00 0.00 ? 9   HIS A NE2  5  
ATOM 7163  H H    . HIS A 1 9   ? 22.457  9.649   11.362  1.00 0.00 ? 9   HIS A H    5  
ATOM 7164  H HA   . HIS A 1 9   ? 23.557  11.364  9.589   1.00 0.00 ? 9   HIS A HA   5  
ATOM 7165  H HB2  . HIS A 1 9   ? 21.640  9.138   8.862   1.00 0.00 ? 9   HIS A HB2  5  
ATOM 7166  H HB3  . HIS A 1 9   ? 22.828  9.864   7.784   1.00 0.00 ? 9   HIS A HB3  5  
ATOM 7167  H HD2  . HIS A 1 9   ? 25.473  9.031   8.183   1.00 0.00 ? 9   HIS A HD2  5  
ATOM 7168  H HE1  . HIS A 1 9   ? 24.538  6.075   11.079  1.00 0.00 ? 9   HIS A HE1  5  
ATOM 7169  H HE2  . HIS A 1 9   ? 26.342  7.074   9.634   1.00 0.00 ? 9   HIS A HE2  5  
ATOM 7170  N N    . ASP A 1 10  ? 21.980  12.841  8.348   1.00 0.00 ? 10  ASP A N    5  
ATOM 7171  C CA   . ASP A 1 10  ? 21.074  13.826  7.770   1.00 0.00 ? 10  ASP A CA   5  
ATOM 7172  C C    . ASP A 1 10  ? 19.871  13.146  7.125   1.00 0.00 ? 10  ASP A C    5  
ATOM 7173  O O    . ASP A 1 10  ? 20.012  12.401  6.155   1.00 0.00 ? 10  ASP A O    5  
ATOM 7174  C CB   . ASP A 1 10  ? 21.808  14.680  6.735   1.00 0.00 ? 10  ASP A CB   5  
ATOM 7175  C CG   . ASP A 1 10  ? 22.745  15.686  7.374   1.00 0.00 ? 10  ASP A CG   5  
ATOM 7176  O OD1  . ASP A 1 10  ? 22.291  16.808  7.680   1.00 0.00 ? 10  ASP A OD1  5  
ATOM 7177  O OD2  . ASP A 1 10  ? 23.933  15.352  7.567   1.00 0.00 ? 10  ASP A OD2  5  
ATOM 7178  H H    . ASP A 1 10  ? 22.941  12.912  8.170   1.00 0.00 ? 10  ASP A H    5  
ATOM 7179  H HA   . ASP A 1 10  ? 20.726  14.465  8.568   1.00 0.00 ? 10  ASP A HA   5  
ATOM 7180  H HB2  . ASP A 1 10  ? 22.388  14.035  6.091   1.00 0.00 ? 10  ASP A HB2  5  
ATOM 7181  H HB3  . ASP A 1 10  ? 21.083  15.217  6.141   1.00 0.00 ? 10  ASP A HB3  5  
ATOM 7182  N N    . SER A 1 11  ? 18.687  13.406  7.672   1.00 0.00 ? 11  SER A N    5  
ATOM 7183  C CA   . SER A 1 11  ? 17.459  12.814  7.153   1.00 0.00 ? 11  SER A CA   5  
ATOM 7184  C C    . SER A 1 11  ? 17.488  12.753  5.628   1.00 0.00 ? 11  SER A C    5  
ATOM 7185  O O    . SER A 1 11  ? 18.107  13.592  4.974   1.00 0.00 ? 11  SER A O    5  
ATOM 7186  C CB   . SER A 1 11  ? 16.244  13.618  7.620   1.00 0.00 ? 11  SER A CB   5  
ATOM 7187  O OG   . SER A 1 11  ? 15.962  13.369  8.986   1.00 0.00 ? 11  SER A OG   5  
ATOM 7188  H H    . SER A 1 11  ? 18.639  14.008  8.444   1.00 0.00 ? 11  SER A H    5  
ATOM 7189  H HA   . SER A 1 11  ? 17.386  11.809  7.540   1.00 0.00 ? 11  SER A HA   5  
ATOM 7190  H HB2  . SER A 1 11  ? 16.442  14.672  7.492   1.00 0.00 ? 11  SER A HB2  5  
ATOM 7191  H HB3  . SER A 1 11  ? 15.383  13.339  7.029   1.00 0.00 ? 11  SER A HB3  5  
ATOM 7192  H HG   . SER A 1 11  ? 16.290  12.500  9.227   1.00 0.00 ? 11  SER A HG   5  
ATOM 7193  N N    . ARG A 1 12  ? 16.813  11.754  5.070   1.00 0.00 ? 12  ARG A N    5  
ATOM 7194  C CA   . ARG A 1 12  ? 16.761  11.582  3.623   1.00 0.00 ? 12  ARG A CA   5  
ATOM 7195  C C    . ARG A 1 12  ? 16.692  12.932  2.917   1.00 0.00 ? 12  ARG A C    5  
ATOM 7196  O O    . ARG A 1 12  ? 16.139  13.896  3.449   1.00 0.00 ? 12  ARG A O    5  
ATOM 7197  C CB   . ARG A 1 12  ? 15.553  10.727  3.233   1.00 0.00 ? 12  ARG A CB   5  
ATOM 7198  C CG   . ARG A 1 12  ? 15.755  9.241   3.476   1.00 0.00 ? 12  ARG A CG   5  
ATOM 7199  C CD   . ARG A 1 12  ? 16.476  8.579   2.312   1.00 0.00 ? 12  ARG A CD   5  
ATOM 7200  N NE   . ARG A 1 12  ? 17.925  8.738   2.404   1.00 0.00 ? 12  ARG A NE   5  
ATOM 7201  C CZ   . ARG A 1 12  ? 18.772  8.304   1.478   1.00 0.00 ? 12  ARG A CZ   5  
ATOM 7202  N NH1  . ARG A 1 12  ? 18.318  7.688   0.396   1.00 0.00 ? 12  ARG A NH1  5  
ATOM 7203  N NH2  . ARG A 1 12  ? 20.077  8.486   1.634   1.00 0.00 ? 12  ARG A NH2  5  
ATOM 7204  H H    . ARG A 1 12  ? 16.339  11.117  5.644   1.00 0.00 ? 12  ARG A H    5  
ATOM 7205  H HA   . ARG A 1 12  ? 17.663  11.074  3.317   1.00 0.00 ? 12  ARG A HA   5  
ATOM 7206  H HB2  . ARG A 1 12  ? 14.697  11.051  3.808   1.00 0.00 ? 12  ARG A HB2  5  
ATOM 7207  H HB3  . ARG A 1 12  ? 15.348  10.874  2.183   1.00 0.00 ? 12  ARG A HB3  5  
ATOM 7208  H HG2  . ARG A 1 12  ? 16.343  9.108   4.372   1.00 0.00 ? 12  ARG A HG2  5  
ATOM 7209  H HG3  . ARG A 1 12  ? 14.790  8.772   3.604   1.00 0.00 ? 12  ARG A HG3  5  
ATOM 7210  H HD2  . ARG A 1 12  ? 16.239  7.525   2.311   1.00 0.00 ? 12  ARG A HD2  5  
ATOM 7211  H HD3  . ARG A 1 12  ? 16.132  9.026   1.392   1.00 0.00 ? 12  ARG A HD3  5  
ATOM 7212  H HE   . ARG A 1 12  ? 18.282  9.191   3.196   1.00 0.00 ? 12  ARG A HE   5  
ATOM 7213  H HH11 . ARG A 1 12  ? 17.335  7.550   0.275   1.00 0.00 ? 12  ARG A HH11 5  
ATOM 7214  H HH12 . ARG A 1 12  ? 18.958  7.363   -0.301  1.00 0.00 ? 12  ARG A HH12 5  
ATOM 7215  H HH21 . ARG A 1 12  ? 20.424  8.951   2.448   1.00 0.00 ? 12  ARG A HH21 5  
ATOM 7216  H HH22 . ARG A 1 12  ? 20.714  8.159   0.936   1.00 0.00 ? 12  ARG A HH22 5  
ATOM 7217  N N    . LEU A 1 13  ? 17.256  12.995  1.716   1.00 0.00 ? 13  LEU A N    5  
ATOM 7218  C CA   . LEU A 1 13  ? 17.259  14.228  0.936   1.00 0.00 ? 13  LEU A CA   5  
ATOM 7219  C C    . LEU A 1 13  ? 15.986  14.350  0.104   1.00 0.00 ? 13  LEU A C    5  
ATOM 7220  O O    . LEU A 1 13  ? 16.009  14.865  -1.014  1.00 0.00 ? 13  LEU A O    5  
ATOM 7221  C CB   . LEU A 1 13  ? 18.485  14.274  0.022   1.00 0.00 ? 13  LEU A CB   5  
ATOM 7222  C CG   . LEU A 1 13  ? 19.834  14.464  0.717   1.00 0.00 ? 13  LEU A CG   5  
ATOM 7223  C CD1  . LEU A 1 13  ? 20.382  13.129  1.195   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 7224  C CD2  . LEU A 1 13  ? 20.823  15.146  -0.216  1.00 0.00 ? 13  LEU A CD2  5  
ATOM 7225  H H    . LEU A 1 13  ? 17.681  12.195  1.344   1.00 0.00 ? 13  LEU A H    5  
ATOM 7226  H HA   . LEU A 1 13  ? 17.304  15.057  1.627   1.00 0.00 ? 13  LEU A HA   5  
ATOM 7227  H HB2  . LEU A 1 13  ? 18.524  13.344  -0.525  1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7228  H HB3  . LEU A 1 13  ? 18.350  15.092  -0.671  1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7229  H HG   . LEU A 1 13  ? 19.699  15.098  1.583   1.00 0.00 ? 13  LEU A HG   5  
ATOM 7230  H HD11 . LEU A 1 13  ? 19.583  12.546  1.628   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7231  H HD12 . LEU A 1 13  ? 21.147  13.299  1.938   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7232  H HD13 . LEU A 1 13  ? 20.806  12.593  0.358   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7233  H HD21 . LEU A 1 13  ? 20.332  15.957  -0.732  1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7234  H HD22 . LEU A 1 13  ? 21.189  14.430  -0.937  1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7235  H HD23 . LEU A 1 13  ? 21.653  15.533  0.358   1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7236  N N    . THR A 1 14  ? 14.876  13.874  0.659   1.00 0.00 ? 14  THR A N    5  
ATOM 7237  C CA   . THR A 1 14  ? 13.593  13.930  -0.031  1.00 0.00 ? 14  THR A CA   5  
ATOM 7238  C C    . THR A 1 14  ? 12.616  14.845  0.699   1.00 0.00 ? 14  THR A C    5  
ATOM 7239  O O    . THR A 1 14  ? 12.463  14.760  1.917   1.00 0.00 ? 14  THR A O    5  
ATOM 7240  C CB   . THR A 1 14  ? 12.965  12.529  -0.163  1.00 0.00 ? 14  THR A CB   5  
ATOM 7241  O OG1  . THR A 1 14  ? 12.630  12.018  1.131   1.00 0.00 ? 14  THR A OG1  5  
ATOM 7242  C CG2  . THR A 1 14  ? 13.919  11.572  -0.861  1.00 0.00 ? 14  THR A CG2  5  
ATOM 7243  H H    . THR A 1 14  ? 14.922  13.475  1.553   1.00 0.00 ? 14  THR A H    5  
ATOM 7244  H HA   . THR A 1 14  ? 13.764  14.320  -1.023  1.00 0.00 ? 14  THR A HA   5  
ATOM 7245  H HB   . THR A 1 14  ? 12.064  12.610  -0.754  1.00 0.00 ? 14  THR A HB   5  
ATOM 7246  H HG1  . THR A 1 14  ? 12.080  11.237  1.035   1.00 0.00 ? 14  THR A HG1  5  
ATOM 7247  H HG21 . THR A 1 14  ? 13.556  11.363  -1.855  1.00 0.00 ? 14  THR A HG21 5  
ATOM 7248  H HG22 . THR A 1 14  ? 13.980  10.652  -0.299  1.00 0.00 ? 14  THR A HG22 5  
ATOM 7249  H HG23 . THR A 1 14  ? 14.899  12.022  -0.923  1.00 0.00 ? 14  THR A HG23 5  
ATOM 7250  N N    . ALA A 1 15  ? 11.957  15.720  -0.054  1.00 0.00 ? 15  ALA A N    5  
ATOM 7251  C CA   . ALA A 1 15  ? 10.993  16.649  0.521   1.00 0.00 ? 15  ALA A CA   5  
ATOM 7252  C C    . ALA A 1 15  ? 9.648   16.557  -0.193  1.00 0.00 ? 15  ALA A C    5  
ATOM 7253  O O    . ALA A 1 15  ? 8.597   16.524  0.445   1.00 0.00 ? 15  ALA A O    5  
ATOM 7254  C CB   . ALA A 1 15  ? 11.529  18.072  0.459   1.00 0.00 ? 15  ALA A CB   5  
ATOM 7255  H H    . ALA A 1 15  ? 12.122  15.739  -1.020  1.00 0.00 ? 15  ALA A H    5  
ATOM 7256  H HA   . ALA A 1 15  ? 10.856  16.387  1.560   1.00 0.00 ? 15  ALA A HA   5  
ATOM 7257  H HB1  . ALA A 1 15  ? 12.287  18.204  1.216   1.00 0.00 ? 15  ALA A HB1  5  
ATOM 7258  H HB2  . ALA A 1 15  ? 11.958  18.251  -0.516  1.00 0.00 ? 15  ALA A HB2  5  
ATOM 7259  H HB3  . ALA A 1 15  ? 10.722  18.768  0.631   1.00 0.00 ? 15  ALA A HB3  5  
ATOM 7260  N N    . GLY A 1 16  ? 9.690   16.516  -1.521  1.00 0.00 ? 16  GLY A N    5  
ATOM 7261  C CA   . GLY A 1 16  ? 8.468   16.429  -2.299  1.00 0.00 ? 16  GLY A CA   5  
ATOM 7262  C C    . GLY A 1 16  ? 7.954   15.008  -2.414  1.00 0.00 ? 16  GLY A C    5  
ATOM 7263  O O    . GLY A 1 16  ? 7.423   14.613  -3.452  1.00 0.00 ? 16  GLY A O    5  
ATOM 7264  H H    . GLY A 1 16  ? 10.557  16.546  -1.976  1.00 0.00 ? 16  GLY A H    5  
ATOM 7265  H HA2  . GLY A 1 16  ? 7.710   17.038  -1.829  1.00 0.00 ? 16  GLY A HA2  5  
ATOM 7266  H HA3  . GLY A 1 16  ? 8.659   16.811  -3.291  1.00 0.00 ? 16  GLY A HA3  5  
ATOM 7267  N N    . VAL A 1 17  ? 8.112   14.235  -1.344  1.00 0.00 ? 17  VAL A N    5  
ATOM 7268  C CA   . VAL A 1 17  ? 7.660   12.848  -1.329  1.00 0.00 ? 17  VAL A CA   5  
ATOM 7269  C C    . VAL A 1 17  ? 6.367   12.700  -0.534  1.00 0.00 ? 17  VAL A C    5  
ATOM 7270  O O    . VAL A 1 17  ? 6.133   13.397  0.453   1.00 0.00 ? 17  VAL A O    5  
ATOM 7271  C CB   . VAL A 1 17  ? 8.729   11.916  -0.728  1.00 0.00 ? 17  VAL A CB   5  
ATOM 7272  C CG1  . VAL A 1 17  ? 9.882   11.728  -1.701  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 7273  C CG2  . VAL A 1 17  ? 9.226   12.464  0.602   1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7274  H H    . VAL A 1 17  ? 8.542   14.606  -0.546  1.00 0.00 ? 17  VAL A H    5  
ATOM 7275  H HA   . VAL A 1 17  ? 7.481   12.544  -2.350  1.00 0.00 ? 17  VAL A HA   5  
ATOM 7276  H HB   . VAL A 1 17  ? 8.277   10.952  -0.549  1.00 0.00 ? 17  VAL A HB   5  
ATOM 7277  H HG11 . VAL A 1 17  ? 10.605  11.048  -1.275  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7278  H HG12 . VAL A 1 17  ? 9.508   11.322  -2.629  1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7279  H HG13 . VAL A 1 17  ? 10.353  12.682  -1.890  1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7280  H HG21 . VAL A 1 17  ? 9.548   11.648  1.230   1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7281  H HG22 . VAL A 1 17  ? 10.055  13.133  0.426   1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7282  H HG23 . VAL A 1 17  ? 8.427   13.002  1.092   1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7283  N N    . PRO A 1 18  ? 5.506   11.771  -0.974  1.00 0.00 ? 18  PRO A N    5  
ATOM 7284  C CA   . PRO A 1 18  ? 4.222   11.508  -0.317  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7285  C C    . PRO A 1 18  ? 4.392   10.847  1.046   1.00 0.00 ? 18  PRO A C    5  
ATOM 7286  O O    . PRO A 1 18  ? 4.973   9.767   1.155   1.00 0.00 ? 18  PRO A O    5  
ATOM 7287  C CB   . PRO A 1 18  ? 3.516   10.558  -1.287  1.00 0.00 ? 18  PRO A CB   5  
ATOM 7288  C CG   . PRO A 1 18  ? 4.618   9.887   -2.031  1.00 0.00 ? 18  PRO A CG   5  
ATOM 7289  C CD   . PRO A 1 18  ? 5.720   10.903  -2.144  1.00 0.00 ? 18  PRO A CD   5  
ATOM 7290  H HA   . PRO A 1 18  ? 3.640   12.412  -0.208  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7291  H HB2  . PRO A 1 18  ? 2.923   9.846   -0.730  1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7292  H HB3  . PRO A 1 18  ? 2.879   11.123  -1.951  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7293  H HG2  . PRO A 1 18  ? 4.960   9.023   -1.480  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7294  H HG3  . PRO A 1 18  ? 4.275   9.596   -3.012  1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7295  H HD2  . PRO A 1 18  ? 6.685   10.421  -2.096  1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7296  H HD3  . PRO A 1 18  ? 5.622   11.465  -3.062  1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7297  N N    . ASP A 1 19  ? 3.883   11.502  2.084   1.00 0.00 ? 19  ASP A N    5  
ATOM 7298  C CA   . ASP A 1 19  ? 3.977   10.976  3.441   1.00 0.00 ? 19  ASP A CA   5  
ATOM 7299  C C    . ASP A 1 19  ? 3.333   9.597   3.536   1.00 0.00 ? 19  ASP A C    5  
ATOM 7300  O O    . ASP A 1 19  ? 2.671   9.143   2.602   1.00 0.00 ? 19  ASP A O    5  
ATOM 7301  C CB   . ASP A 1 19  ? 3.309   11.934  4.429   1.00 0.00 ? 19  ASP A CB   5  
ATOM 7302  C CG   . ASP A 1 19  ? 3.945   11.884  5.804   1.00 0.00 ? 19  ASP A CG   5  
ATOM 7303  O OD1  . ASP A 1 19  ? 5.171   11.659  5.883   1.00 0.00 ? 19  ASP A OD1  5  
ATOM 7304  O OD2  . ASP A 1 19  ? 3.217   12.071  6.801   1.00 0.00 ? 19  ASP A OD2  5  
ATOM 7305  H H    . ASP A 1 19  ? 3.431   12.359  1.933   1.00 0.00 ? 19  ASP A H    5  
ATOM 7306  H HA   . ASP A 1 19  ? 5.024   10.889  3.691   1.00 0.00 ? 19  ASP A HA   5  
ATOM 7307  H HB2  . ASP A 1 19  ? 3.389   12.943  4.052   1.00 0.00 ? 19  ASP A HB2  5  
ATOM 7308  H HB3  . ASP A 1 19  ? 2.265   11.671  4.524   1.00 0.00 ? 19  ASP A HB3  5  
ATOM 7309  N N    . THR A 1 20  ? 3.532   8.933   4.670   1.00 0.00 ? 20  THR A N    5  
ATOM 7310  C CA   . THR A 1 20  ? 2.973   7.604   4.886   1.00 0.00 ? 20  THR A CA   5  
ATOM 7311  C C    . THR A 1 20  ? 1.462   7.605   4.688   1.00 0.00 ? 20  THR A C    5  
ATOM 7312  O O    . THR A 1 20  ? 0.742   8.448   5.224   1.00 0.00 ? 20  THR A O    5  
ATOM 7313  C CB   . THR A 1 20  ? 3.295   7.083   6.300   1.00 0.00 ? 20  THR A CB   5  
ATOM 7314  O OG1  . THR A 1 20  ? 4.561   7.592   6.734   1.00 0.00 ? 20  THR A OG1  5  
ATOM 7315  C CG2  . THR A 1 20  ? 3.318   5.562   6.323   1.00 0.00 ? 20  THR A CG2  5  
ATOM 7316  H H    . THR A 1 20  ? 4.069   9.348   5.377   1.00 0.00 ? 20  THR A H    5  
ATOM 7317  H HA   . THR A 1 20  ? 3.421   6.933   4.167   1.00 0.00 ? 20  THR A HA   5  
ATOM 7318  H HB   . THR A 1 20  ? 2.526   7.427   6.977   1.00 0.00 ? 20  THR A HB   5  
ATOM 7319  H HG1  . THR A 1 20  ? 5.161   7.636   5.986   1.00 0.00 ? 20  THR A HG1  5  
ATOM 7320  H HG21 . THR A 1 20  ? 4.027   5.203   5.592   1.00 0.00 ? 20  THR A HG21 5  
ATOM 7321  H HG22 . THR A 1 20  ? 2.335   5.183   6.088   1.00 0.00 ? 20  THR A HG22 5  
ATOM 7322  H HG23 . THR A 1 20  ? 3.611   5.222   7.305   1.00 0.00 ? 20  THR A HG23 5  
ATOM 7323  N N    . PRO A 1 21  ? 0.967   6.637   3.902   1.00 0.00 ? 21  PRO A N    5  
ATOM 7324  C CA   . PRO A 1 21  ? -0.464  6.504   3.616   1.00 0.00 ? 21  PRO A CA   5  
ATOM 7325  C C    . PRO A 1 21  ? -1.259  6.053   4.837   1.00 0.00 ? 21  PRO A C    5  
ATOM 7326  O O    . PRO A 1 21  ? -0.780  5.256   5.644   1.00 0.00 ? 21  PRO A O    5  
ATOM 7327  C CB   . PRO A 1 21  ? -0.510  5.433   2.523   1.00 0.00 ? 21  PRO A CB   5  
ATOM 7328  C CG   . PRO A 1 21  ? 0.731   4.634   2.724   1.00 0.00 ? 21  PRO A CG   5  
ATOM 7329  C CD   . PRO A 1 21  ? 1.767   5.599   3.231   1.00 0.00 ? 21  PRO A CD   5  
ATOM 7330  H HA   . PRO A 1 21  ? -0.881  7.426   3.237   1.00 0.00 ? 21  PRO A HA   5  
ATOM 7331  H HB2  . PRO A 1 21  ? -1.396  4.827   2.647   1.00 0.00 ? 21  PRO A HB2  5  
ATOM 7332  H HB3  . PRO A 1 21  ? -0.523  5.905   1.552   1.00 0.00 ? 21  PRO A HB3  5  
ATOM 7333  H HG2  . PRO A 1 21  ? 0.554   3.857   3.451   1.00 0.00 ? 21  PRO A HG2  5  
ATOM 7334  H HG3  . PRO A 1 21  ? 1.047   4.206   1.784   1.00 0.00 ? 21  PRO A HG3  5  
ATOM 7335  H HD2  . PRO A 1 21  ? 2.428   5.109   3.931   1.00 0.00 ? 21  PRO A HD2  5  
ATOM 7336  H HD3  . PRO A 1 21  ? 2.328   6.017   2.408   1.00 0.00 ? 21  PRO A HD3  5  
ATOM 7337  N N    . THR A 1 22  ? -2.478  6.568   4.967   1.00 0.00 ? 22  THR A N    5  
ATOM 7338  C CA   . THR A 1 22  ? -3.340  6.219   6.089   1.00 0.00 ? 22  THR A CA   5  
ATOM 7339  C C    . THR A 1 22  ? -3.656  4.728   6.097   1.00 0.00 ? 22  THR A C    5  
ATOM 7340  O O    . THR A 1 22  ? -3.434  4.032   5.106   1.00 0.00 ? 22  THR A O    5  
ATOM 7341  C CB   . THR A 1 22  ? -4.660  7.012   6.052   1.00 0.00 ? 22  THR A CB   5  
ATOM 7342  O OG1  . THR A 1 22  ? -4.473  8.241   5.341   1.00 0.00 ? 22  THR A OG1  5  
ATOM 7343  C CG2  . THR A 1 22  ? -5.155  7.305   7.460   1.00 0.00 ? 22  THR A CG2  5  
ATOM 7344  H H    . THR A 1 22  ? -2.804  7.198   4.290   1.00 0.00 ? 22  THR A H    5  
ATOM 7345  H HA   . THR A 1 22  ? -2.818  6.472   7.001   1.00 0.00 ? 22  THR A HA   5  
ATOM 7346  H HB   . THR A 1 22  ? -5.404  6.419   5.540   1.00 0.00 ? 22  THR A HB   5  
ATOM 7347  H HG1  . THR A 1 22  ? -5.100  8.894   5.662   1.00 0.00 ? 22  THR A HG1  5  
ATOM 7348  H HG21 . THR A 1 22  ? -5.424  6.379   7.946   1.00 0.00 ? 22  THR A HG21 5  
ATOM 7349  H HG22 . THR A 1 22  ? -6.021  7.949   7.411   1.00 0.00 ? 22  THR A HG22 5  
ATOM 7350  H HG23 . THR A 1 22  ? -4.374  7.793   8.022   1.00 0.00 ? 22  THR A HG23 5  
ATOM 7351  N N    . ARG A 1 23  ? -4.176  4.244   7.220   1.00 0.00 ? 23  ARG A N    5  
ATOM 7352  C CA   . ARG A 1 23  ? -4.522  2.834   7.356   1.00 0.00 ? 23  ARG A CA   5  
ATOM 7353  C C    . ARG A 1 23  ? -5.182  2.311   6.083   1.00 0.00 ? 23  ARG A C    5  
ATOM 7354  O O    . ARG A 1 23  ? -5.757  3.077   5.309   1.00 0.00 ? 23  ARG A O    5  
ATOM 7355  C CB   . ARG A 1 23  ? -5.457  2.630   8.549   1.00 0.00 ? 23  ARG A CB   5  
ATOM 7356  C CG   . ARG A 1 23  ? -6.821  3.277   8.372   1.00 0.00 ? 23  ARG A CG   5  
ATOM 7357  C CD   . ARG A 1 23  ? -7.759  2.922   9.515   1.00 0.00 ? 23  ARG A CD   5  
ATOM 7358  N NE   . ARG A 1 23  ? -7.418  3.635   10.744  1.00 0.00 ? 23  ARG A NE   5  
ATOM 7359  C CZ   . ARG A 1 23  ? -8.289  3.880   11.717  1.00 0.00 ? 23  ARG A CZ   5  
ATOM 7360  N NH1  . ARG A 1 23  ? -9.545  3.471   11.605  1.00 0.00 ? 23  ARG A NH1  5  
ATOM 7361  N NH2  . ARG A 1 23  ? -7.903  4.534   12.805  1.00 0.00 ? 23  ARG A NH2  5  
ATOM 7362  H H    . ARG A 1 23  ? -4.330  4.849   7.975   1.00 0.00 ? 23  ARG A H    5  
ATOM 7363  H HA   . ARG A 1 23  ? -3.609  2.283   7.527   1.00 0.00 ? 23  ARG A HA   5  
ATOM 7364  H HB2  . ARG A 1 23  ? -5.603  1.570   8.700   1.00 0.00 ? 23  ARG A HB2  5  
ATOM 7365  H HB3  . ARG A 1 23  ? -4.995  3.050   9.429   1.00 0.00 ? 23  ARG A HB3  5  
ATOM 7366  H HG2  . ARG A 1 23  ? -6.699  4.350   8.341   1.00 0.00 ? 23  ARG A HG2  5  
ATOM 7367  H HG3  . ARG A 1 23  ? -7.254  2.935   7.443   1.00 0.00 ? 23  ARG A HG3  5  
ATOM 7368  H HD2  . ARG A 1 23  ? -8.768  3.180   9.229   1.00 0.00 ? 23  ARG A HD2  5  
ATOM 7369  H HD3  . ARG A 1 23  ? -7.697  1.860   9.697   1.00 0.00 ? 23  ARG A HD3  5  
ATOM 7370  H HE   . ARG A 1 23  ? -6.495  3.946   10.847  1.00 0.00 ? 23  ARG A HE   5  
ATOM 7371  H HH11 . ARG A 1 23  ? -9.838  2.977   10.787  1.00 0.00 ? 23  ARG A HH11 5  
ATOM 7372  H HH12 . ARG A 1 23  ? -10.198 3.656   12.340  1.00 0.00 ? 23  ARG A HH12 5  
ATOM 7373  H HH21 . ARG A 1 23  ? -6.956  4.844   12.892  1.00 0.00 ? 23  ARG A HH21 5  
ATOM 7374  H HH22 . ARG A 1 23  ? -8.558  4.718   13.536  1.00 0.00 ? 23  ARG A HH22 5  
ATOM 7375  N N    . LEU A 1 24  ? -5.094  1.002   5.872   1.00 0.00 ? 24  LEU A N    5  
ATOM 7376  C CA   . LEU A 1 24  ? -5.682  0.376   4.693   1.00 0.00 ? 24  LEU A CA   5  
ATOM 7377  C C    . LEU A 1 24  ? -7.010  -0.292  5.036   1.00 0.00 ? 24  LEU A C    5  
ATOM 7378  O O    . LEU A 1 24  ? -7.319  -0.518  6.206   1.00 0.00 ? 24  LEU A O    5  
ATOM 7379  C CB   . LEU A 1 24  ? -4.717  -0.654  4.104   1.00 0.00 ? 24  LEU A CB   5  
ATOM 7380  C CG   . LEU A 1 24  ? -3.228  -0.373  4.308   1.00 0.00 ? 24  LEU A CG   5  
ATOM 7381  C CD1  . LEU A 1 24  ? -2.387  -1.502  3.734   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 7382  C CD2  . LEU A 1 24  ? -2.844  0.956   3.673   1.00 0.00 ? 24  LEU A CD2  5  
ATOM 7383  H H    . LEU A 1 24  ? -4.623  0.443   6.524   1.00 0.00 ? 24  LEU A H    5  
ATOM 7384  H HA   . LEU A 1 24  ? -5.860  1.150   3.962   1.00 0.00 ? 24  LEU A HA   5  
ATOM 7385  H HB2  . LEU A 1 24  ? -4.937  -1.609  4.555   1.00 0.00 ? 24  LEU A HB2  5  
ATOM 7386  H HB3  . LEU A 1 24  ? -4.902  -0.709  3.041   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 7387  H HG   . LEU A 1 24  ? -3.022  -0.310  5.368   1.00 0.00 ? 24  LEU A HG   5  
ATOM 7388  H HD11 . LEU A 1 24  ? -2.078  -2.162  4.530   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 7389  H HD12 . LEU A 1 24  ? -1.515  -1.091  3.248   1.00 0.00 ? 24  LEU A HD12 5  
ATOM 7390  H HD13 . LEU A 1 24  ? -2.972  -2.056  3.014   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 7391  H HD21 . LEU A 1 24  ? -3.493  1.154   2.833   1.00 0.00 ? 24  LEU A HD21 5  
ATOM 7392  H HD22 . LEU A 1 24  ? -1.820  0.910   3.334   1.00 0.00 ? 24  LEU A HD22 5  
ATOM 7393  H HD23 . LEU A 1 24  ? -2.947  1.747   4.403   1.00 0.00 ? 24  LEU A HD23 5  
ATOM 7394  N N    . VAL A 1 25  ? -7.790  -0.607  4.008   1.00 0.00 ? 25  VAL A N    5  
ATOM 7395  C CA   . VAL A 1 25  ? -9.084  -1.253  4.200   1.00 0.00 ? 25  VAL A CA   5  
ATOM 7396  C C    . VAL A 1 25  ? -9.198  -2.517  3.355   1.00 0.00 ? 25  VAL A C    5  
ATOM 7397  O O    . VAL A 1 25  ? -9.127  -2.464  2.127   1.00 0.00 ? 25  VAL A O    5  
ATOM 7398  C CB   . VAL A 1 25  ? -10.243 -0.304  3.843   1.00 0.00 ? 25  VAL A CB   5  
ATOM 7399  C CG1  . VAL A 1 25  ? -11.537 -1.084  3.667   1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7400  C CG2  . VAL A 1 25  ? -10.399 0.770   4.910   1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7401  H H    . VAL A 1 25  ? -7.489  -0.402  3.098   1.00 0.00 ? 25  VAL A H    5  
ATOM 7402  H HA   . VAL A 1 25  ? -9.172  -1.520  5.243   1.00 0.00 ? 25  VAL A HA   5  
ATOM 7403  H HB   . VAL A 1 25  ? -10.010 0.181   2.907   1.00 0.00 ? 25  VAL A HB   5  
ATOM 7404  H HG11 . VAL A 1 25  ? -11.801 -1.559  4.600   1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7405  H HG12 . VAL A 1 25  ? -12.326 -0.409  3.369   1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7406  H HG13 . VAL A 1 25  ? -11.401 -1.838  2.906   1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7407  H HG21 . VAL A 1 25  ? -9.692  0.593   5.706   1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7408  H HG22 . VAL A 1 25  ? -10.216 1.740   4.473   1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7409  H HG23 . VAL A 1 25  ? -11.403 0.739   5.308   1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7410  N N    . PHE A 1 26  ? -9.376  -3.653  4.021   1.00 0.00 ? 26  PHE A N    5  
ATOM 7411  C CA   . PHE A 1 26  ? -9.499  -4.932  3.331   1.00 0.00 ? 26  PHE A CA   5  
ATOM 7412  C C    . PHE A 1 26  ? -10.960 -5.367  3.250   1.00 0.00 ? 26  PHE A C    5  
ATOM 7413  O O    . PHE A 1 26  ? -11.684 -5.336  4.245   1.00 0.00 ? 26  PHE A O    5  
ATOM 7414  C CB   . PHE A 1 26  ? -8.675  -6.004  4.048   1.00 0.00 ? 26  PHE A CB   5  
ATOM 7415  C CG   . PHE A 1 26  ? -7.248  -5.602  4.287   1.00 0.00 ? 26  PHE A CG   5  
ATOM 7416  C CD1  . PHE A 1 26  ? -6.902  -4.855  5.402   1.00 0.00 ? 26  PHE A CD1  5  
ATOM 7417  C CD2  . PHE A 1 26  ? -6.252  -5.971  3.397   1.00 0.00 ? 26  PHE A CD2  5  
ATOM 7418  C CE1  . PHE A 1 26  ? -5.590  -4.484  5.625   1.00 0.00 ? 26  PHE A CE1  5  
ATOM 7419  C CE2  . PHE A 1 26  ? -4.938  -5.603  3.616   1.00 0.00 ? 26  PHE A CE2  5  
ATOM 7420  C CZ   . PHE A 1 26  ? -4.606  -4.858  4.730   1.00 0.00 ? 26  PHE A CZ   5  
ATOM 7421  H H    . PHE A 1 26  ? -9.424  -3.631  5.000   1.00 0.00 ? 26  PHE A H    5  
ATOM 7422  H HA   . PHE A 1 26  ? -9.117  -4.806  2.330   1.00 0.00 ? 26  PHE A HA   5  
ATOM 7423  H HB2  . PHE A 1 26  ? -9.126  -6.213  5.007   1.00 0.00 ? 26  PHE A HB2  5  
ATOM 7424  H HB3  . PHE A 1 26  ? -8.673  -6.904  3.452   1.00 0.00 ? 26  PHE A HB3  5  
ATOM 7425  H HD1  . PHE A 1 26  ? -7.671  -4.562  6.103   1.00 0.00 ? 26  PHE A HD1  5  
ATOM 7426  H HD2  . PHE A 1 26  ? -6.510  -6.553  2.525   1.00 0.00 ? 26  PHE A HD2  5  
ATOM 7427  H HE1  . PHE A 1 26  ? -5.334  -3.901  6.498   1.00 0.00 ? 26  PHE A HE1  5  
ATOM 7428  H HE2  . PHE A 1 26  ? -4.171  -5.897  2.914   1.00 0.00 ? 26  PHE A HE2  5  
ATOM 7429  H HZ   . PHE A 1 26  ? -3.580  -4.570  4.903   1.00 0.00 ? 26  PHE A HZ   5  
ATOM 7430  N N    . SER A 1 27  ? -11.385 -5.771  2.057   1.00 0.00 ? 27  SER A N    5  
ATOM 7431  C CA   . SER A 1 27  ? -12.760 -6.208  1.844   1.00 0.00 ? 27  SER A CA   5  
ATOM 7432  C C    . SER A 1 27  ? -12.874 -7.724  1.976   1.00 0.00 ? 27  SER A C    5  
ATOM 7433  O O    . SER A 1 27  ? -13.849 -8.238  2.523   1.00 0.00 ? 27  SER A O    5  
ATOM 7434  C CB   . SER A 1 27  ? -13.249 -5.766  0.463   1.00 0.00 ? 27  SER A CB   5  
ATOM 7435  O OG   . SER A 1 27  ? -14.641 -5.989  0.321   1.00 0.00 ? 27  SER A OG   5  
ATOM 7436  H H    . SER A 1 27  ? -10.760 -5.773  1.303   1.00 0.00 ? 27  SER A H    5  
ATOM 7437  H HA   . SER A 1 27  ? -13.376 -5.745  2.600   1.00 0.00 ? 27  SER A HA   5  
ATOM 7438  H HB2  . SER A 1 27  ? -13.050 -4.714  0.333   1.00 0.00 ? 27  SER A HB2  5  
ATOM 7439  H HB3  . SER A 1 27  ? -12.727 -6.329  -0.297  1.00 0.00 ? 27  SER A HB3  5  
ATOM 7440  H HG   . SER A 1 27  ? -15.094 -5.145  0.247   1.00 0.00 ? 27  SER A HG   5  
ATOM 7441  N N    . ALA A 1 28  ? -11.871 -8.433  1.469   1.00 0.00 ? 28  ALA A N    5  
ATOM 7442  C CA   . ALA A 1 28  ? -11.857 -9.889  1.531   1.00 0.00 ? 28  ALA A CA   5  
ATOM 7443  C C    . ALA A 1 28  ? -13.045 -10.482 0.781   1.00 0.00 ? 28  ALA A C    5  
ATOM 7444  O O    . ALA A 1 28  ? -13.805 -11.280 1.331   1.00 0.00 ? 28  ALA A O    5  
ATOM 7445  C CB   . ALA A 1 28  ? -11.860 -10.356 2.980   1.00 0.00 ? 28  ALA A CB   5  
ATOM 7446  H H    . ALA A 1 28  ? -11.122 -7.966  1.045   1.00 0.00 ? 28  ALA A H    5  
ATOM 7447  H HA   . ALA A 1 28  ? -10.944 -10.234 1.069   1.00 0.00 ? 28  ALA A HA   5  
ATOM 7448  H HB1  . ALA A 1 28  ? -10.897 -10.153 3.424   1.00 0.00 ? 28  ALA A HB1  5  
ATOM 7449  H HB2  . ALA A 1 28  ? -12.628 -9.827  3.526   1.00 0.00 ? 28  ALA A HB2  5  
ATOM 7450  H HB3  . ALA A 1 28  ? -12.057 -11.417 3.015   1.00 0.00 ? 28  ALA A HB3  5  
ATOM 7451  N N    . LEU A 1 29  ? -13.200 -10.088 -0.478  1.00 0.00 ? 29  LEU A N    5  
ATOM 7452  C CA   . LEU A 1 29  ? -14.296 -10.580 -1.305  1.00 0.00 ? 29  LEU A CA   5  
ATOM 7453  C C    . LEU A 1 29  ? -14.453 -12.090 -1.158  1.00 0.00 ? 29  LEU A C    5  
ATOM 7454  O O    . LEU A 1 29  ? -15.547 -12.629 -1.320  1.00 0.00 ? 29  LEU A O    5  
ATOM 7455  C CB   . LEU A 1 29  ? -14.055 -10.221 -2.773  1.00 0.00 ? 29  LEU A CB   5  
ATOM 7456  C CG   . LEU A 1 29  ? -13.957 -8.729  -3.092  1.00 0.00 ? 29  LEU A CG   5  
ATOM 7457  C CD1  . LEU A 1 29  ? -14.801 -7.919  -2.120  1.00 0.00 ? 29  LEU A CD1  5  
ATOM 7458  C CD2  . LEU A 1 29  ? -12.506 -8.269  -3.052  1.00 0.00 ? 29  LEU A CD2  5  
ATOM 7459  H H    . LEU A 1 29  ? -12.562 -9.450  -0.862  1.00 0.00 ? 29  LEU A H    5  
ATOM 7460  H HA   . LEU A 1 29  ? -15.204 -10.101 -0.971  1.00 0.00 ? 29  LEU A HA   5  
ATOM 7461  H HB2  . LEU A 1 29  ? -13.131 -10.686 -3.079  1.00 0.00 ? 29  LEU A HB2  5  
ATOM 7462  H HB3  . LEU A 1 29  ? -14.871 -10.631 -3.351  1.00 0.00 ? 29  LEU A HB3  5  
ATOM 7463  H HG   . LEU A 1 29  ? -14.336 -8.554  -4.089  1.00 0.00 ? 29  LEU A HG   5  
ATOM 7464  H HD11 . LEU A 1 29  ? -15.835 -8.218  -2.205  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 7465  H HD12 . LEU A 1 29  ? -14.711 -6.868  -2.354  1.00 0.00 ? 29  LEU A HD12 5  
ATOM 7466  H HD13 . LEU A 1 29  ? -14.457 -8.094  -1.111  1.00 0.00 ? 29  LEU A HD13 5  
ATOM 7467  H HD21 . LEU A 1 29  ? -12.419 -7.410  -2.404  1.00 0.00 ? 29  LEU A HD21 5  
ATOM 7468  H HD22 . LEU A 1 29  ? -12.186 -8.004  -4.048  1.00 0.00 ? 29  LEU A HD22 5  
ATOM 7469  H HD23 . LEU A 1 29  ? -11.886 -9.070  -2.676  1.00 0.00 ? 29  LEU A HD23 5  
ATOM 7470  N N    . GLY A 1 30  ? -13.352 -12.767 -0.848  1.00 0.00 ? 30  GLY A N    5  
ATOM 7471  C CA   . GLY A 1 30  ? -13.390 -14.208 -0.682  1.00 0.00 ? 30  GLY A CA   5  
ATOM 7472  C C    . GLY A 1 30  ? -12.125 -14.752 -0.048  1.00 0.00 ? 30  GLY A C    5  
ATOM 7473  O O    . GLY A 1 30  ? -11.301 -14.007 0.483   1.00 0.00 ? 30  GLY A O    5  
ATOM 7474  H H    . GLY A 1 30  ? -12.507 -12.284 -0.731  1.00 0.00 ? 30  GLY A H    5  
ATOM 7475  H HA2  . GLY A 1 30  ? -14.233 -14.466 -0.058  1.00 0.00 ? 30  GLY A HA2  5  
ATOM 7476  H HA3  . GLY A 1 30  ? -13.518 -14.668 -1.651  1.00 0.00 ? 30  GLY A HA3  5  
ATOM 7477  N N    . PRO A 1 31  ? -11.959 -16.082 -0.097  1.00 0.00 ? 31  PRO A N    5  
ATOM 7478  C CA   . PRO A 1 31  ? -10.788 -16.755 0.474   1.00 0.00 ? 31  PRO A CA   5  
ATOM 7479  C C    . PRO A 1 31  ? -9.514  -16.468 -0.313  1.00 0.00 ? 31  PRO A C    5  
ATOM 7480  O O    . PRO A 1 31  ? -8.412  -16.490 0.238   1.00 0.00 ? 31  PRO A O    5  
ATOM 7481  C CB   . PRO A 1 31  ? -11.151 -18.239 0.381   1.00 0.00 ? 31  PRO A CB   5  
ATOM 7482  C CG   . PRO A 1 31  ? -12.126 -18.321 -0.743  1.00 0.00 ? 31  PRO A CG   5  
ATOM 7483  C CD   . PRO A 1 31  ? -12.900 -17.032 -0.714  1.00 0.00 ? 31  PRO A CD   5  
ATOM 7484  H HA   . PRO A 1 31  ? -10.639 -16.483 1.509   1.00 0.00 ? 31  PRO A HA   5  
ATOM 7485  H HB2  . PRO A 1 31  ? -10.261 -18.818 0.176   1.00 0.00 ? 31  PRO A HB2  5  
ATOM 7486  H HB3  . PRO A 1 31  ? -11.592 -18.565 1.311   1.00 0.00 ? 31  PRO A HB3  5  
ATOM 7487  H HG2  . PRO A 1 31  ? -11.599 -18.421 -1.680  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 7488  H HG3  . PRO A 1 31  ? -12.790 -19.159 -0.592  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 7489  H HD2  . PRO A 1 31  ? -13.157 -16.723 -1.716  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 7490  H HD3  . PRO A 1 31  ? -13.789 -17.139 -0.110  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 7491  N N    . THR A 1 32  ? -9.669  -16.198 -1.605  1.00 0.00 ? 32  THR A N    5  
ATOM 7492  C CA   . THR A 1 32  ? -8.531  -15.907 -2.468  1.00 0.00 ? 32  THR A CA   5  
ATOM 7493  C C    . THR A 1 32  ? -8.672  -14.537 -3.121  1.00 0.00 ? 32  THR A C    5  
ATOM 7494  O O    . THR A 1 32  ? -8.036  -14.254 -4.136  1.00 0.00 ? 32  THR A O    5  
ATOM 7495  C CB   . THR A 1 32  ? -8.373  -16.974 -3.568  1.00 0.00 ? 32  THR A CB   5  
ATOM 7496  O OG1  . THR A 1 32  ? -9.624  -17.179 -4.235  1.00 0.00 ? 32  THR A OG1  5  
ATOM 7497  C CG2  . THR A 1 32  ? -7.884  -18.289 -2.980  1.00 0.00 ? 32  THR A CG2  5  
ATOM 7498  H H    . THR A 1 32  ? -10.572 -16.196 -1.986  1.00 0.00 ? 32  THR A H    5  
ATOM 7499  H HA   . THR A 1 32  ? -7.640  -15.914 -1.858  1.00 0.00 ? 32  THR A HA   5  
ATOM 7500  H HB   . THR A 1 32  ? -7.645  -16.624 -4.285  1.00 0.00 ? 32  THR A HB   5  
ATOM 7501  H HG1  . THR A 1 32  ? -10.119 -16.356 -4.247  1.00 0.00 ? 32  THR A HG1  5  
ATOM 7502  H HG21 . THR A 1 32  ? -8.563  -18.611 -2.205  1.00 0.00 ? 32  THR A HG21 5  
ATOM 7503  H HG22 . THR A 1 32  ? -6.899  -18.152 -2.561  1.00 0.00 ? 32  THR A HG22 5  
ATOM 7504  H HG23 . THR A 1 32  ? -7.844  -19.038 -3.757  1.00 0.00 ? 32  THR A HG23 5  
ATOM 7505  N N    . SER A 1 33  ? -9.510  -13.689 -2.532  1.00 0.00 ? 33  SER A N    5  
ATOM 7506  C CA   . SER A 1 33  ? -9.737  -12.349 -3.059  1.00 0.00 ? 33  SER A CA   5  
ATOM 7507  C C    . SER A 1 33  ? -9.746  -11.317 -1.935  1.00 0.00 ? 33  SER A C    5  
ATOM 7508  O O    . SER A 1 33  ? -10.160 -11.609 -0.812  1.00 0.00 ? 33  SER A O    5  
ATOM 7509  C CB   . SER A 1 33  ? -11.060 -12.296 -3.826  1.00 0.00 ? 33  SER A CB   5  
ATOM 7510  O OG   . SER A 1 33  ? -12.053 -13.076 -3.182  1.00 0.00 ? 33  SER A OG   5  
ATOM 7511  H H    . SER A 1 33  ? -9.989  -13.974 -1.725  1.00 0.00 ? 33  SER A H    5  
ATOM 7512  H HA   . SER A 1 33  ? -8.929  -12.118 -3.737  1.00 0.00 ? 33  SER A HA   5  
ATOM 7513  H HB2  . SER A 1 33  ? -11.401 -11.274 -3.880  1.00 0.00 ? 33  SER A HB2  5  
ATOM 7514  H HB3  . SER A 1 33  ? -10.910 -12.679 -4.825  1.00 0.00 ? 33  SER A HB3  5  
ATOM 7515  H HG   . SER A 1 33  ? -12.907 -12.903 -3.586  1.00 0.00 ? 33  SER A HG   5  
ATOM 7516  N N    . LEU A 1 34  ? -9.286  -10.110 -2.245  1.00 0.00 ? 34  LEU A N    5  
ATOM 7517  C CA   . LEU A 1 34  ? -9.240  -9.033  -1.262  1.00 0.00 ? 34  LEU A CA   5  
ATOM 7518  C C    . LEU A 1 34  ? -9.274  -7.670  -1.946  1.00 0.00 ? 34  LEU A C    5  
ATOM 7519  O O    . LEU A 1 34  ? -9.048  -7.564  -3.151  1.00 0.00 ? 34  LEU A O    5  
ATOM 7520  C CB   . LEU A 1 34  ? -7.981  -9.155  -0.402  1.00 0.00 ? 34  LEU A CB   5  
ATOM 7521  C CG   . LEU A 1 34  ? -8.123  -9.968  0.885   1.00 0.00 ? 34  LEU A CG   5  
ATOM 7522  C CD1  . LEU A 1 34  ? -6.808  -10.646 1.236   1.00 0.00 ? 34  LEU A CD1  5  
ATOM 7523  C CD2  . LEU A 1 34  ? -8.590  -9.080  2.029   1.00 0.00 ? 34  LEU A CD2  5  
ATOM 7524  H H    . LEU A 1 34  ? -8.970  -9.938  -3.156  1.00 0.00 ? 34  LEU A H    5  
ATOM 7525  H HA   . LEU A 1 34  ? -10.110 -9.126  -0.628  1.00 0.00 ? 34  LEU A HA   5  
ATOM 7526  H HB2  . LEU A 1 34  ? -7.214  -9.618  -1.003  1.00 0.00 ? 34  LEU A HB2  5  
ATOM 7527  H HB3  . LEU A 1 34  ? -7.670  -8.156  -0.130  1.00 0.00 ? 34  LEU A HB3  5  
ATOM 7528  H HG   . LEU A 1 34  ? -8.866  -10.740 0.735   1.00 0.00 ? 34  LEU A HG   5  
ATOM 7529  H HD11 . LEU A 1 34  ? -6.052  -9.896  1.411   1.00 0.00 ? 34  LEU A HD11 5  
ATOM 7530  H HD12 . LEU A 1 34  ? -6.502  -11.282 0.419   1.00 0.00 ? 34  LEU A HD12 5  
ATOM 7531  H HD13 . LEU A 1 34  ? -6.937  -11.242 2.127   1.00 0.00 ? 34  LEU A HD13 5  
ATOM 7532  H HD21 . LEU A 1 34  ? -8.231  -8.074  1.873   1.00 0.00 ? 34  LEU A HD21 5  
ATOM 7533  H HD22 . LEU A 1 34  ? -8.200  -9.461  2.962   1.00 0.00 ? 34  LEU A HD22 5  
ATOM 7534  H HD23 . LEU A 1 34  ? -9.670  -9.077  2.065   1.00 0.00 ? 34  LEU A HD23 5  
ATOM 7535  N N    . ARG A 1 35  ? -9.555  -6.630  -1.167  1.00 0.00 ? 35  ARG A N    5  
ATOM 7536  C CA   . ARG A 1 35  ? -9.617  -5.274  -1.697  1.00 0.00 ? 35  ARG A CA   5  
ATOM 7537  C C    . ARG A 1 35  ? -8.994  -4.280  -0.721  1.00 0.00 ? 35  ARG A C    5  
ATOM 7538  O O    . ARG A 1 35  ? -9.590  -3.941  0.302   1.00 0.00 ? 35  ARG A O    5  
ATOM 7539  C CB   . ARG A 1 35  ? -11.067 -4.882  -1.985  1.00 0.00 ? 35  ARG A CB   5  
ATOM 7540  C CG   . ARG A 1 35  ? -11.208 -3.537  -2.680  1.00 0.00 ? 35  ARG A CG   5  
ATOM 7541  C CD   . ARG A 1 35  ? -12.657 -3.077  -2.716  1.00 0.00 ? 35  ARG A CD   5  
ATOM 7542  N NE   . ARG A 1 35  ? -12.810 -1.803  -3.414  1.00 0.00 ? 35  ARG A NE   5  
ATOM 7543  C CZ   . ARG A 1 35  ? -13.969 -1.360  -3.888  1.00 0.00 ? 35  ARG A CZ   5  
ATOM 7544  N NH1  . ARG A 1 35  ? -15.070 -2.083  -3.740  1.00 0.00 ? 35  ARG A NH1  5  
ATOM 7545  N NH2  . ARG A 1 35  ? -14.028 -0.190  -4.511  1.00 0.00 ? 35  ARG A NH2  5  
ATOM 7546  H H    . ARG A 1 35  ? -9.726  -6.779  -0.213  1.00 0.00 ? 35  ARG A H    5  
ATOM 7547  H HA   . ARG A 1 35  ? -9.057  -5.252  -2.620  1.00 0.00 ? 35  ARG A HA   5  
ATOM 7548  H HB2  . ARG A 1 35  ? -11.513 -5.636  -2.616  1.00 0.00 ? 35  ARG A HB2  5  
ATOM 7549  H HB3  . ARG A 1 35  ? -11.608 -4.838  -1.052  1.00 0.00 ? 35  ARG A HB3  5  
ATOM 7550  H HG2  . ARG A 1 35  ? -10.622 -2.803  -2.146  1.00 0.00 ? 35  ARG A HG2  5  
ATOM 7551  H HG3  . ARG A 1 35  ? -10.842 -3.625  -3.692  1.00 0.00 ? 35  ARG A HG3  5  
ATOM 7552  H HD2  . ARG A 1 35  ? -13.246 -3.827  -3.223  1.00 0.00 ? 35  ARG A HD2  5  
ATOM 7553  H HD3  . ARG A 1 35  ? -13.010 -2.967  -1.702  1.00 0.00 ? 35  ARG A HD3  5  
ATOM 7554  H HE   . ARG A 1 35  ? -12.009 -1.253  -3.534  1.00 0.00 ? 35  ARG A HE   5  
ATOM 7555  H HH11 . ARG A 1 35  ? -15.029 -2.965  -3.269  1.00 0.00 ? 35  ARG A HH11 5  
ATOM 7556  H HH12 . ARG A 1 35  ? -15.942 -1.747  -4.097  1.00 0.00 ? 35  ARG A HH12 5  
ATOM 7557  H HH21 . ARG A 1 35  ? -13.200 0.358   -4.624  1.00 0.00 ? 35  ARG A HH21 5  
ATOM 7558  H HH22 . ARG A 1 35  ? -14.900 0.143   -4.868  1.00 0.00 ? 35  ARG A HH22 5  
ATOM 7559  N N    . VAL A 1 36  ? -7.791  -3.816  -1.044  1.00 0.00 ? 36  VAL A N    5  
ATOM 7560  C CA   . VAL A 1 36  ? -7.087  -2.860  -0.196  1.00 0.00 ? 36  VAL A CA   5  
ATOM 7561  C C    . VAL A 1 36  ? -7.357  -1.428  -0.642  1.00 0.00 ? 36  VAL A C    5  
ATOM 7562  O O    . VAL A 1 36  ? -7.201  -1.092  -1.816  1.00 0.00 ? 36  VAL A O    5  
ATOM 7563  C CB   . VAL A 1 36  ? -5.568  -3.112  -0.208  1.00 0.00 ? 36  VAL A CB   5  
ATOM 7564  C CG1  . VAL A 1 36  ? -4.820  -1.889  0.299   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 7565  C CG2  . VAL A 1 36  ? -5.225  -4.339  0.624   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 7566  H H    . VAL A 1 36  ? -7.367  -4.123  -1.872  1.00 0.00 ? 36  VAL A H    5  
ATOM 7567  H HA   . VAL A 1 36  ? -7.444  -2.986  0.816   1.00 0.00 ? 36  VAL A HA   5  
ATOM 7568  H HB   . VAL A 1 36  ? -5.262  -3.297  -1.227  1.00 0.00 ? 36  VAL A HB   5  
ATOM 7569  H HG11 . VAL A 1 36  ? -5.019  -1.050  -0.353  1.00 0.00 ? 36  VAL A HG11 5  
ATOM 7570  H HG12 . VAL A 1 36  ? -5.149  -1.654  1.300   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 7571  H HG13 . VAL A 1 36  ? -3.759  -2.093  0.307   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 7572  H HG21 . VAL A 1 36  ? -5.337  -4.107  1.672   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 7573  H HG22 . VAL A 1 36  ? -5.890  -5.148  0.361   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 7574  H HG23 . VAL A 1 36  ? -4.204  -4.634  0.427   1.00 0.00 ? 36  VAL A HG23 5  
ATOM 7575  N N    . SER A 1 37  ? -7.764  -0.586  0.304   1.00 0.00 ? 37  SER A N    5  
ATOM 7576  C CA   . SER A 1 37  ? -8.059  0.811   0.008   1.00 0.00 ? 37  SER A CA   5  
ATOM 7577  C C    . SER A 1 37  ? -7.317  1.737   0.967   1.00 0.00 ? 37  SER A C    5  
ATOM 7578  O O    . SER A 1 37  ? -7.347  1.543   2.182   1.00 0.00 ? 37  SER A O    5  
ATOM 7579  C CB   . SER A 1 37  ? -9.565  1.066   0.097   1.00 0.00 ? 37  SER A CB   5  
ATOM 7580  O OG   . SER A 1 37  ? -9.838  2.442   0.291   1.00 0.00 ? 37  SER A OG   5  
ATOM 7581  H H    . SER A 1 37  ? -7.869  -0.914  1.221   1.00 0.00 ? 37  SER A H    5  
ATOM 7582  H HA   . SER A 1 37  ? -7.727  1.014   -0.999  1.00 0.00 ? 37  SER A HA   5  
ATOM 7583  H HB2  . SER A 1 37  ? -10.037 0.743   -0.818  1.00 0.00 ? 37  SER A HB2  5  
ATOM 7584  H HB3  . SER A 1 37  ? -9.973  0.509   0.929   1.00 0.00 ? 37  SER A HB3  5  
ATOM 7585  H HG   . SER A 1 37  ? -10.132 2.830   -0.537  1.00 0.00 ? 37  SER A HG   5  
ATOM 7586  N N    . TRP A 1 38  ? -6.653  2.744   0.411   1.00 0.00 ? 38  TRP A N    5  
ATOM 7587  C CA   . TRP A 1 38  ? -5.903  3.701   1.216   1.00 0.00 ? 38  TRP A CA   5  
ATOM 7588  C C    . TRP A 1 38  ? -6.409  5.121   0.985   1.00 0.00 ? 38  TRP A C    5  
ATOM 7589  O O    . TRP A 1 38  ? -7.372  5.333   0.249   1.00 0.00 ? 38  TRP A O    5  
ATOM 7590  C CB   . TRP A 1 38  ? -4.411  3.618   0.886   1.00 0.00 ? 38  TRP A CB   5  
ATOM 7591  C CG   . TRP A 1 38  ? -4.120  3.735   -0.580  1.00 0.00 ? 38  TRP A CG   5  
ATOM 7592  C CD1  . TRP A 1 38  ? -3.616  4.824   -1.231  1.00 0.00 ? 38  TRP A CD1  5  
ATOM 7593  C CD2  . TRP A 1 38  ? -4.317  2.725   -1.575  1.00 0.00 ? 38  TRP A CD2  5  
ATOM 7594  N NE1  . TRP A 1 38  ? -3.488  4.553   -2.572  1.00 0.00 ? 38  TRP A NE1  5  
ATOM 7595  C CE2  . TRP A 1 38  ? -3.910  3.271   -2.809  1.00 0.00 ? 38  TRP A CE2  5  
ATOM 7596  C CE3  . TRP A 1 38  ? -4.795  1.412   -1.545  1.00 0.00 ? 38  TRP A CE3  5  
ATOM 7597  C CZ2  . TRP A 1 38  ? -3.970  2.549   -3.998  1.00 0.00 ? 38  TRP A CZ2  5  
ATOM 7598  C CZ3  . TRP A 1 38  ? -4.854  0.697   -2.726  1.00 0.00 ? 38  TRP A CZ3  5  
ATOM 7599  C CH2  . TRP A 1 38  ? -4.442  1.266   -3.939  1.00 0.00 ? 38  TRP A CH2  5  
ATOM 7600  H H    . TRP A 1 38  ? -6.667  2.846   -0.564  1.00 0.00 ? 38  TRP A H    5  
ATOM 7601  H HA   . TRP A 1 38  ? -6.047  3.444   2.255   1.00 0.00 ? 38  TRP A HA   5  
ATOM 7602  H HB2  . TRP A 1 38  ? -3.892  4.417   1.393   1.00 0.00 ? 38  TRP A HB2  5  
ATOM 7603  H HB3  . TRP A 1 38  ? -4.027  2.669   1.229   1.00 0.00 ? 38  TRP A HB3  5  
ATOM 7604  H HD1  . TRP A 1 38  ? -3.362  5.756   -0.750  1.00 0.00 ? 38  TRP A HD1  5  
ATOM 7605  H HE1  . TRP A 1 38  ? -3.147  5.175   -3.248  1.00 0.00 ? 38  TRP A HE1  5  
ATOM 7606  H HE3  . TRP A 1 38  ? -5.117  0.956   -0.620  1.00 0.00 ? 38  TRP A HE3  5  
ATOM 7607  H HZ2  . TRP A 1 38  ? -3.655  2.974   -4.940  1.00 0.00 ? 38  TRP A HZ2  5  
ATOM 7608  H HZ3  . TRP A 1 38  ? -5.221  -0.318  -2.722  1.00 0.00 ? 38  TRP A HZ3  5  
ATOM 7609  H HH2  . TRP A 1 38  ? -4.505  0.671   -4.837  1.00 0.00 ? 38  TRP A HH2  5  
ATOM 7610  N N    . GLN A 1 39  ? -5.753  6.089   1.618   1.00 0.00 ? 39  GLN A N    5  
ATOM 7611  C CA   . GLN A 1 39  ? -6.139  7.488   1.481   1.00 0.00 ? 39  GLN A CA   5  
ATOM 7612  C C    . GLN A 1 39  ? -5.004  8.309   0.877   1.00 0.00 ? 39  GLN A C    5  
ATOM 7613  O O    . GLN A 1 39  ? -3.860  8.224   1.321   1.00 0.00 ? 39  GLN A O    5  
ATOM 7614  C CB   . GLN A 1 39  ? -6.534  8.066   2.841   1.00 0.00 ? 39  GLN A CB   5  
ATOM 7615  C CG   . GLN A 1 39  ? -7.382  9.323   2.745   1.00 0.00 ? 39  GLN A CG   5  
ATOM 7616  C CD   . GLN A 1 39  ? -6.557  10.565  2.469   1.00 0.00 ? 39  GLN A CD   5  
ATOM 7617  O OE1  . GLN A 1 39  ? -6.695  11.195  1.420   1.00 0.00 ? 39  GLN A OE1  5  
ATOM 7618  N NE2  . GLN A 1 39  ? -5.693  10.923  3.411   1.00 0.00 ? 39  GLN A NE2  5  
ATOM 7619  H H    . GLN A 1 39  ? -4.994  5.856   2.191   1.00 0.00 ? 39  GLN A H    5  
ATOM 7620  H HA   . GLN A 1 39  ? -6.991  7.534   0.820   1.00 0.00 ? 39  GLN A HA   5  
ATOM 7621  H HB2  . GLN A 1 39  ? -7.093  7.321   3.387   1.00 0.00 ? 39  GLN A HB2  5  
ATOM 7622  H HB3  . GLN A 1 39  ? -5.636  8.305   3.392   1.00 0.00 ? 39  GLN A HB3  5  
ATOM 7623  H HG2  . GLN A 1 39  ? -8.097  9.200   1.945   1.00 0.00 ? 39  GLN A HG2  5  
ATOM 7624  H HG3  . GLN A 1 39  ? -7.909  9.459   3.678   1.00 0.00 ? 39  GLN A HG3  5  
ATOM 7625  H HE21 . GLN A 1 39  ? -5.636  10.373  4.220   1.00 0.00 ? 39  GLN A HE21 5  
ATOM 7626  H HE22 . GLN A 1 39  ? -5.146  11.721  3.258   1.00 0.00 ? 39  GLN A HE22 5  
ATOM 7627  N N    . GLU A 1 40  ? -5.330  9.102   -0.139  1.00 0.00 ? 40  GLU A N    5  
ATOM 7628  C CA   . GLU A 1 40  ? -4.337  9.936   -0.805  1.00 0.00 ? 40  GLU A CA   5  
ATOM 7629  C C    . GLU A 1 40  ? -3.523  10.730  0.213   1.00 0.00 ? 40  GLU A C    5  
ATOM 7630  O O    . GLU A 1 40  ? -4.000  11.694  0.811   1.00 0.00 ? 40  GLU A O    5  
ATOM 7631  C CB   . GLU A 1 40  ? -5.017  10.892  -1.787  1.00 0.00 ? 40  GLU A CB   5  
ATOM 7632  C CG   . GLU A 1 40  ? -4.044  11.628  -2.693  1.00 0.00 ? 40  GLU A CG   5  
ATOM 7633  C CD   . GLU A 1 40  ? -4.577  12.971  -3.154  1.00 0.00 ? 40  GLU A CD   5  
ATOM 7634  O OE1  . GLU A 1 40  ? -5.336  13.000  -4.144  1.00 0.00 ? 40  GLU A OE1  5  
ATOM 7635  O OE2  . GLU A 1 40  ? -4.234  13.992  -2.522  1.00 0.00 ? 40  GLU A OE2  5  
ATOM 7636  H H    . GLU A 1 40  ? -6.260  9.126   -0.449  1.00 0.00 ? 40  GLU A H    5  
ATOM 7637  H HA   . GLU A 1 40  ? -3.671  9.287   -1.352  1.00 0.00 ? 40  GLU A HA   5  
ATOM 7638  H HB2  . GLU A 1 40  ? -5.698  10.328  -2.407  1.00 0.00 ? 40  GLU A HB2  5  
ATOM 7639  H HB3  . GLU A 1 40  ? -5.578  11.625  -1.226  1.00 0.00 ? 40  GLU A HB3  5  
ATOM 7640  H HG2  . GLU A 1 40  ? -3.122  11.790  -2.155  1.00 0.00 ? 40  GLU A HG2  5  
ATOM 7641  H HG3  . GLU A 1 40  ? -3.849  11.017  -3.562  1.00 0.00 ? 40  GLU A HG3  5  
ATOM 7642  N N    . PRO A 1 41  ? -2.263  10.315  0.416   1.00 0.00 ? 41  PRO A N    5  
ATOM 7643  C CA   . PRO A 1 41  ? -1.356  10.972  1.361   1.00 0.00 ? 41  PRO A CA   5  
ATOM 7644  C C    . PRO A 1 41  ? -0.927  12.356  0.886   1.00 0.00 ? 41  PRO A C    5  
ATOM 7645  O O    . PRO A 1 41  ? -1.069  12.690  -0.290  1.00 0.00 ? 41  PRO A O    5  
ATOM 7646  C CB   . PRO A 1 41  ? -0.152  10.028  1.412   1.00 0.00 ? 41  PRO A CB   5  
ATOM 7647  C CG   . PRO A 1 41  ? -0.177  9.311   0.106   1.00 0.00 ? 41  PRO A CG   5  
ATOM 7648  C CD   . PRO A 1 41  ? -1.628  9.172   -0.262  1.00 0.00 ? 41  PRO A CD   5  
ATOM 7649  H HA   . PRO A 1 41  ? -1.796  11.050  2.344   1.00 0.00 ? 41  PRO A HA   5  
ATOM 7650  H HB2  . PRO A 1 41  ? 0.755   10.603  1.530   1.00 0.00 ? 41  PRO A HB2  5  
ATOM 7651  H HB3  . PRO A 1 41  ? -0.262  9.343   2.239   1.00 0.00 ? 41  PRO A HB3  5  
ATOM 7652  H HG2  . PRO A 1 41  ? 0.346   9.890   -0.640  1.00 0.00 ? 41  PRO A HG2  5  
ATOM 7653  H HG3  . PRO A 1 41  ? 0.277   8.337   0.213   1.00 0.00 ? 41  PRO A HG3  5  
ATOM 7654  H HD2  . PRO A 1 41  ? -1.754  9.241   -1.333  1.00 0.00 ? 41  PRO A HD2  5  
ATOM 7655  H HD3  . PRO A 1 41  ? -2.024  8.237   0.107   1.00 0.00 ? 41  PRO A HD3  5  
ATOM 7656  N N    . ARG A 1 42  ? -0.402  13.157  1.808   1.00 0.00 ? 42  ARG A N    5  
ATOM 7657  C CA   . ARG A 1 42  ? 0.047   14.505  1.482   1.00 0.00 ? 42  ARG A CA   5  
ATOM 7658  C C    . ARG A 1 42  ? 1.317   14.466  0.637   1.00 0.00 ? 42  ARG A C    5  
ATOM 7659  O O    . ARG A 1 42  ? 2.225   13.677  0.900   1.00 0.00 ? 42  ARG A O    5  
ATOM 7660  C CB   . ARG A 1 42  ? 0.297   15.305  2.762   1.00 0.00 ? 42  ARG A CB   5  
ATOM 7661  C CG   . ARG A 1 42  ? 1.595   14.939  3.465   1.00 0.00 ? 42  ARG A CG   5  
ATOM 7662  C CD   . ARG A 1 42  ? 1.965   15.968  4.521   1.00 0.00 ? 42  ARG A CD   5  
ATOM 7663  N NE   . ARG A 1 42  ? 1.180   15.806  5.742   1.00 0.00 ? 42  ARG A NE   5  
ATOM 7664  C CZ   . ARG A 1 42  ? 1.087   16.738  6.685   1.00 0.00 ? 42  ARG A CZ   5  
ATOM 7665  N NH1  . ARG A 1 42  ? 1.725   17.892  6.547   1.00 0.00 ? 42  ARG A NH1  5  
ATOM 7666  N NH2  . ARG A 1 42  ? 0.353   16.516  7.768   1.00 0.00 ? 42  ARG A NH2  5  
ATOM 7667  H H    . ARG A 1 42  ? -0.315  12.833  2.729   1.00 0.00 ? 42  ARG A H    5  
ATOM 7668  H HA   . ARG A 1 42  ? -0.735  14.987  0.914   1.00 0.00 ? 42  ARG A HA   5  
ATOM 7669  H HB2  . ARG A 1 42  ? 0.331   16.356  2.516   1.00 0.00 ? 42  ARG A HB2  5  
ATOM 7670  H HB3  . ARG A 1 42  ? -0.519  15.130  3.447   1.00 0.00 ? 42  ARG A HB3  5  
ATOM 7671  H HG2  . ARG A 1 42  ? 1.476   13.977  3.941   1.00 0.00 ? 42  ARG A HG2  5  
ATOM 7672  H HG3  . ARG A 1 42  ? 2.386   14.886  2.733   1.00 0.00 ? 42  ARG A HG3  5  
ATOM 7673  H HD2  . ARG A 1 42  ? 3.012   15.858  4.761   1.00 0.00 ? 42  ARG A HD2  5  
ATOM 7674  H HD3  . ARG A 1 42  ? 1.790   16.955  4.120   1.00 0.00 ? 42  ARG A HD3  5  
ATOM 7675  H HE   . ARG A 1 42  ? 0.700   14.961  5.864   1.00 0.00 ? 42  ARG A HE   5  
ATOM 7676  H HH11 . ARG A 1 42  ? 2.278   18.062  5.731   1.00 0.00 ? 42  ARG A HH11 5  
ATOM 7677  H HH12 . ARG A 1 42  ? 1.652   18.592  7.257   1.00 0.00 ? 42  ARG A HH12 5  
ATOM 7678  H HH21 . ARG A 1 42  ? -0.130  15.648  7.875   1.00 0.00 ? 42  ARG A HH21 5  
ATOM 7679  H HH22 . ARG A 1 42  ? 0.283   17.218  8.476   1.00 0.00 ? 42  ARG A HH22 5  
ATOM 7680  N N    . CYS A 1 43  ? 1.372   15.323  -0.377  1.00 0.00 ? 43  CYS A N    5  
ATOM 7681  C CA   . CYS A 1 43  ? 2.530   15.386  -1.261  1.00 0.00 ? 43  CYS A CA   5  
ATOM 7682  C C    . CYS A 1 43  ? 2.547   16.695  -2.043  1.00 0.00 ? 43  CYS A C    5  
ATOM 7683  O O    . CYS A 1 43  ? 1.699   16.924  -2.906  1.00 0.00 ? 43  CYS A O    5  
ATOM 7684  C CB   . CYS A 1 43  ? 2.525   14.201  -2.228  1.00 0.00 ? 43  CYS A CB   5  
ATOM 7685  S SG   . CYS A 1 43  ? 1.059   14.115  -3.282  1.00 0.00 ? 43  CYS A SG   5  
ATOM 7686  H H    . CYS A 1 43  ? 0.617   15.927  -0.535  1.00 0.00 ? 43  CYS A H    5  
ATOM 7687  H HA   . CYS A 1 43  ? 3.418   15.336  -0.649  1.00 0.00 ? 43  CYS A HA   5  
ATOM 7688  H HB2  . CYS A 1 43  ? 3.389   14.268  -2.873  1.00 0.00 ? 43  CYS A HB2  5  
ATOM 7689  H HB3  . CYS A 1 43  ? 2.578   13.283  -1.661  1.00 0.00 ? 43  CYS A HB3  5  
ATOM 7690  H HG   . CYS A 1 43  ? 0.095   14.813  -2.700  1.00 0.00 ? 43  CYS A HG   5  
ATOM 7691  N N    . GLU A 1 44  ? 3.515   17.552  -1.734  1.00 0.00 ? 44  GLU A N    5  
ATOM 7692  C CA   . GLU A 1 44  ? 3.639   18.839  -2.406  1.00 0.00 ? 44  GLU A CA   5  
ATOM 7693  C C    . GLU A 1 44  ? 3.651   18.663  -3.922  1.00 0.00 ? 44  GLU A C    5  
ATOM 7694  O O    . GLU A 1 44  ? 3.277   19.569  -4.666  1.00 0.00 ? 44  GLU A O    5  
ATOM 7695  C CB   . GLU A 1 44  ? 4.914   19.555  -1.955  1.00 0.00 ? 44  GLU A CB   5  
ATOM 7696  C CG   . GLU A 1 44  ? 4.776   20.258  -0.615  1.00 0.00 ? 44  GLU A CG   5  
ATOM 7697  C CD   . GLU A 1 44  ? 3.609   21.226  -0.582  1.00 0.00 ? 44  GLU A CD   5  
ATOM 7698  O OE1  . GLU A 1 44  ? 3.810   22.409  -0.928  1.00 0.00 ? 44  GLU A OE1  5  
ATOM 7699  O OE2  . GLU A 1 44  ? 2.495   20.801  -0.211  1.00 0.00 ? 44  GLU A OE2  5  
ATOM 7700  H H    . GLU A 1 44  ? 4.161   17.312  -1.037  1.00 0.00 ? 44  GLU A H    5  
ATOM 7701  H HA   . GLU A 1 44  ? 2.785   19.440  -2.133  1.00 0.00 ? 44  GLU A HA   5  
ATOM 7702  H HB2  . GLU A 1 44  ? 5.711   18.830  -1.878  1.00 0.00 ? 44  GLU A HB2  5  
ATOM 7703  H HB3  . GLU A 1 44  ? 5.181   20.291  -2.699  1.00 0.00 ? 44  GLU A HB3  5  
ATOM 7704  H HG2  . GLU A 1 44  ? 4.629   19.515  0.153   1.00 0.00 ? 44  GLU A HG2  5  
ATOM 7705  H HG3  . GLU A 1 44  ? 5.685   20.806  -0.415  1.00 0.00 ? 44  GLU A HG3  5  
ATOM 7706  N N    . ARG A 1 45  ? 4.084   17.489  -4.372  1.00 0.00 ? 45  ARG A N    5  
ATOM 7707  C CA   . ARG A 1 45  ? 4.147   17.193  -5.798  1.00 0.00 ? 45  ARG A CA   5  
ATOM 7708  C C    . ARG A 1 45  ? 3.019   16.251  -6.208  1.00 0.00 ? 45  ARG A C    5  
ATOM 7709  O O    . ARG A 1 45  ? 2.475   15.504  -5.395  1.00 0.00 ? 45  ARG A O    5  
ATOM 7710  C CB   . ARG A 1 45  ? 5.500   16.573  -6.152  1.00 0.00 ? 45  ARG A CB   5  
ATOM 7711  C CG   . ARG A 1 45  ? 6.643   17.573  -6.169  1.00 0.00 ? 45  ARG A CG   5  
ATOM 7712  C CD   . ARG A 1 45  ? 6.292   18.807  -6.986  1.00 0.00 ? 45  ARG A CD   5  
ATOM 7713  N NE   . ARG A 1 45  ? 5.664   19.843  -6.170  1.00 0.00 ? 45  ARG A NE   5  
ATOM 7714  C CZ   . ARG A 1 45  ? 5.586   21.118  -6.534  1.00 0.00 ? 45  ARG A CZ   5  
ATOM 7715  N NH1  . ARG A 1 45  ? 6.092   21.512  -7.695  1.00 0.00 ? 45  ARG A NH1  5  
ATOM 7716  N NH2  . ARG A 1 45  ? 4.999   22.002  -5.737  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 7717  H H    . ARG A 1 45  ? 4.369   16.806  -3.729  1.00 0.00 ? 45  ARG A H    5  
ATOM 7718  H HA   . ARG A 1 45  ? 4.036   18.124  -6.335  1.00 0.00 ? 45  ARG A HA   5  
ATOM 7719  H HB2  . ARG A 1 45  ? 5.732   15.806  -5.428  1.00 0.00 ? 45  ARG A HB2  5  
ATOM 7720  H HB3  . ARG A 1 45  ? 5.430   16.122  -7.131  1.00 0.00 ? 45  ARG A HB3  5  
ATOM 7721  H HG2  . ARG A 1 45  ? 6.860   17.876  -5.155  1.00 0.00 ? 45  ARG A HG2  5  
ATOM 7722  H HG3  . ARG A 1 45  ? 7.515   17.103  -6.600  1.00 0.00 ? 45  ARG A HG3  5  
ATOM 7723  H HD2  . ARG A 1 45  ? 7.197   19.204  -7.421  1.00 0.00 ? 45  ARG A HD2  5  
ATOM 7724  H HD3  . ARG A 1 45  ? 5.611   18.519  -7.773  1.00 0.00 ? 45  ARG A HD3  5  
ATOM 7725  H HE   . ARG A 1 45  ? 5.284   19.574  -5.309  1.00 0.00 ? 45  ARG A HE   5  
ATOM 7726  H HH11 . ARG A 1 45  ? 6.534   20.848  -8.297  1.00 0.00 ? 45  ARG A HH11 5  
ATOM 7727  H HH12 . ARG A 1 45  ? 6.031   22.473  -7.967  1.00 0.00 ? 45  ARG A HH12 5  
ATOM 7728  H HH21 . ARG A 1 45  ? 4.615   21.709  -4.862  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 7729  H HH22 . ARG A 1 45  ? 4.940   22.961  -6.012  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 7730  N N    . PRO A 1 46  ? 2.659   16.286  -7.499  1.00 0.00 ? 46  PRO A N    5  
ATOM 7731  C CA   . PRO A 1 46  ? 1.593   15.441  -8.047  1.00 0.00 ? 46  PRO A CA   5  
ATOM 7732  C C    . PRO A 1 46  ? 1.987   13.969  -8.095  1.00 0.00 ? 46  PRO A C    5  
ATOM 7733  O O    . PRO A 1 46  ? 3.114   13.629  -8.458  1.00 0.00 ? 46  PRO A O    5  
ATOM 7734  C CB   . PRO A 1 46  ? 1.398   15.989  -9.463  1.00 0.00 ? 46  PRO A CB   5  
ATOM 7735  C CG   . PRO A 1 46  ? 2.706   16.610  -9.812  1.00 0.00 ? 46  PRO A CG   5  
ATOM 7736  C CD   . PRO A 1 46  ? 3.264   17.152  -8.525  1.00 0.00 ? 46  PRO A CD   5  
ATOM 7737  H HA   . PRO A 1 46  ? 0.675   15.548  -7.488  1.00 0.00 ? 46  PRO A HA   5  
ATOM 7738  H HB2  . PRO A 1 46  ? 1.153   15.178  -10.134 1.00 0.00 ? 46  PRO A HB2  5  
ATOM 7739  H HB3  . PRO A 1 46  ? 0.602   16.718  -9.464  1.00 0.00 ? 46  PRO A HB3  5  
ATOM 7740  H HG2  . PRO A 1 46  ? 3.369   15.864  -10.224 1.00 0.00 ? 46  PRO A HG2  5  
ATOM 7741  H HG3  . PRO A 1 46  ? 2.554   17.411  -10.520 1.00 0.00 ? 46  PRO A HG3  5  
ATOM 7742  H HD2  . PRO A 1 46  ? 4.341   17.067  -8.515  1.00 0.00 ? 46  PRO A HD2  5  
ATOM 7743  H HD3  . PRO A 1 46  ? 2.964   18.180  -8.386  1.00 0.00 ? 46  PRO A HD3  5  
ATOM 7744  N N    . LEU A 1 47  ? 1.053   13.099  -7.728  1.00 0.00 ? 47  LEU A N    5  
ATOM 7745  C CA   . LEU A 1 47  ? 1.303   11.661  -7.730  1.00 0.00 ? 47  LEU A CA   5  
ATOM 7746  C C    . LEU A 1 47  ? 1.089   11.073  -9.121  1.00 0.00 ? 47  LEU A C    5  
ATOM 7747  O O    . LEU A 1 47  ? 0.314   11.604  -9.916  1.00 0.00 ? 47  LEU A O    5  
ATOM 7748  C CB   . LEU A 1 47  ? 0.388   10.963  -6.722  1.00 0.00 ? 47  LEU A CB   5  
ATOM 7749  C CG   . LEU A 1 47  ? 0.427   11.506  -5.293  1.00 0.00 ? 47  LEU A CG   5  
ATOM 7750  C CD1  . LEU A 1 47  ? -0.871  11.187  -4.566  1.00 0.00 ? 47  LEU A CD1  5  
ATOM 7751  C CD2  . LEU A 1 47  ? 1.617   10.934  -4.537  1.00 0.00 ? 47  LEU A CD2  5  
ATOM 7752  H H    . LEU A 1 47  ? 0.175   13.429  -7.448  1.00 0.00 ? 47  LEU A H    5  
ATOM 7753  H HA   . LEU A 1 47  ? 2.331   11.504  -7.440  1.00 0.00 ? 47  LEU A HA   5  
ATOM 7754  H HB2  . LEU A 1 47  ? -0.626  11.049  -7.081  1.00 0.00 ? 47  LEU A HB2  5  
ATOM 7755  H HB3  . LEU A 1 47  ? 0.669   9.920   -6.689  1.00 0.00 ? 47  LEU A HB3  5  
ATOM 7756  H HG   . LEU A 1 47  ? 0.535   12.581  -5.325  1.00 0.00 ? 47  LEU A HG   5  
ATOM 7757  H HD11 . LEU A 1 47  ? -1.707  11.529  -5.156  1.00 0.00 ? 47  LEU A HD11 5  
ATOM 7758  H HD12 . LEU A 1 47  ? -0.878  11.685  -3.608  1.00 0.00 ? 47  LEU A HD12 5  
ATOM 7759  H HD13 . LEU A 1 47  ? -0.947  10.120  -4.417  1.00 0.00 ? 47  LEU A HD13 5  
ATOM 7760  H HD21 . LEU A 1 47  ? 1.766   9.904   -4.825  1.00 0.00 ? 47  LEU A HD21 5  
ATOM 7761  H HD22 . LEU A 1 47  ? 1.429   10.988  -3.475  1.00 0.00 ? 47  LEU A HD22 5  
ATOM 7762  H HD23 . LEU A 1 47  ? 2.503   11.507  -4.775  1.00 0.00 ? 47  LEU A HD23 5  
ATOM 7763  N N    . GLN A 1 48  ? 1.779   9.974   -9.406  1.00 0.00 ? 48  GLN A N    5  
ATOM 7764  C CA   . GLN A 1 48  ? 1.663   9.313   -10.700 1.00 0.00 ? 48  GLN A CA   5  
ATOM 7765  C C    . GLN A 1 48  ? 0.836   8.037   -10.588 1.00 0.00 ? 48  GLN A C    5  
ATOM 7766  O O    . GLN A 1 48  ? 0.242   7.582   -11.565 1.00 0.00 ? 48  GLN A O    5  
ATOM 7767  C CB   . GLN A 1 48  ? 3.050   8.989   -11.258 1.00 0.00 ? 48  GLN A CB   5  
ATOM 7768  C CG   . GLN A 1 48  ? 3.915   10.217  -11.490 1.00 0.00 ? 48  GLN A CG   5  
ATOM 7769  C CD   . GLN A 1 48  ? 5.206   9.893   -12.214 1.00 0.00 ? 48  GLN A CD   5  
ATOM 7770  O OE1  . GLN A 1 48  ? 5.289   8.908   -12.950 1.00 0.00 ? 48  GLN A OE1  5  
ATOM 7771  N NE2  . GLN A 1 48  ? 6.224   10.721  -12.010 1.00 0.00 ? 48  GLN A NE2  5  
ATOM 7772  H H    . GLN A 1 48  ? 2.381   9.599   -8.730  1.00 0.00 ? 48  GLN A H    5  
ATOM 7773  H HA   . GLN A 1 48  ? 1.164   9.992   -11.375 1.00 0.00 ? 48  GLN A HA   5  
ATOM 7774  H HB2  . GLN A 1 48  ? 3.562   8.341   -10.562 1.00 0.00 ? 48  GLN A HB2  5  
ATOM 7775  H HB3  . GLN A 1 48  ? 2.934   8.473   -12.200 1.00 0.00 ? 48  GLN A HB3  5  
ATOM 7776  H HG2  . GLN A 1 48  ? 3.357   10.928  -12.082 1.00 0.00 ? 48  GLN A HG2  5  
ATOM 7777  H HG3  . GLN A 1 48  ? 4.156   10.658  -10.534 1.00 0.00 ? 48  GLN A HG3  5  
ATOM 7778  H HE21 . GLN A 1 48  ? 6.086   11.484  -11.410 1.00 0.00 ? 48  GLN A HE21 5  
ATOM 7779  H HE22 . GLN A 1 48  ? 7.071   10.535  -12.465 1.00 0.00 ? 48  GLN A HE22 5  
ATOM 7780  N N    . GLY A 1 49  ? 0.801   7.464   -9.388  1.00 0.00 ? 49  GLY A N    5  
ATOM 7781  C CA   . GLY A 1 49  ? 0.044   6.245   -9.170  1.00 0.00 ? 49  GLY A CA   5  
ATOM 7782  C C    . GLY A 1 49  ? 0.174   5.728   -7.752  1.00 0.00 ? 49  GLY A C    5  
ATOM 7783  O O    . GLY A 1 49  ? 0.240   6.509   -6.802  1.00 0.00 ? 49  GLY A O    5  
ATOM 7784  H H    . GLY A 1 49  ? 1.294   7.872   -8.646  1.00 0.00 ? 49  GLY A H    5  
ATOM 7785  H HA2  . GLY A 1 49  ? -0.997  6.439   -9.378  1.00 0.00 ? 49  GLY A HA2  5  
ATOM 7786  H HA3  . GLY A 1 49  ? 0.401   5.486   -9.852  1.00 0.00 ? 49  GLY A HA3  5  
ATOM 7787  N N    . TYR A 1 50  ? 0.209   4.408   -7.606  1.00 0.00 ? 50  TYR A N    5  
ATOM 7788  C CA   . TYR A 1 50  ? 0.327   3.787   -6.292  1.00 0.00 ? 50  TYR A CA   5  
ATOM 7789  C C    . TYR A 1 50  ? 0.881   2.370   -6.407  1.00 0.00 ? 50  TYR A C    5  
ATOM 7790  O O    . TYR A 1 50  ? 0.853   1.766   -7.479  1.00 0.00 ? 50  TYR A O    5  
ATOM 7791  C CB   . TYR A 1 50  ? -1.033  3.761   -5.593  1.00 0.00 ? 50  TYR A CB   5  
ATOM 7792  C CG   . TYR A 1 50  ? -1.455  5.102   -5.037  1.00 0.00 ? 50  TYR A CG   5  
ATOM 7793  C CD1  . TYR A 1 50  ? -0.848  5.628   -3.903  1.00 0.00 ? 50  TYR A CD1  5  
ATOM 7794  C CD2  . TYR A 1 50  ? -2.460  5.843   -5.646  1.00 0.00 ? 50  TYR A CD2  5  
ATOM 7795  C CE1  . TYR A 1 50  ? -1.231  6.854   -3.392  1.00 0.00 ? 50  TYR A CE1  5  
ATOM 7796  C CE2  . TYR A 1 50  ? -2.848  7.069   -5.142  1.00 0.00 ? 50  TYR A CE2  5  
ATOM 7797  C CZ   . TYR A 1 50  ? -2.231  7.570   -4.015  1.00 0.00 ? 50  TYR A CZ   5  
ATOM 7798  O OH   . TYR A 1 50  ? -2.615  8.791   -3.510  1.00 0.00 ? 50  TYR A OH   5  
ATOM 7799  H H    . TYR A 1 50  ? 0.152   3.837   -8.400  1.00 0.00 ? 50  TYR A H    5  
ATOM 7800  H HA   . TYR A 1 50  ? 1.011   4.382   -5.704  1.00 0.00 ? 50  TYR A HA   5  
ATOM 7801  H HB2  . TYR A 1 50  ? -1.786  3.442   -6.297  1.00 0.00 ? 50  TYR A HB2  5  
ATOM 7802  H HB3  . TYR A 1 50  ? -0.995  3.059   -4.772  1.00 0.00 ? 50  TYR A HB3  5  
ATOM 7803  H HD1  . TYR A 1 50  ? -0.065  5.065   -3.418  1.00 0.00 ? 50  TYR A HD1  5  
ATOM 7804  H HD2  . TYR A 1 50  ? -2.942  5.447   -6.528  1.00 0.00 ? 50  TYR A HD2  5  
ATOM 7805  H HE1  . TYR A 1 50  ? -0.747  7.246   -2.510  1.00 0.00 ? 50  TYR A HE1  5  
ATOM 7806  H HE2  . TYR A 1 50  ? -3.632  7.631   -5.630  1.00 0.00 ? 50  TYR A HE2  5  
ATOM 7807  H HH   . TYR A 1 50  ? -3.565  8.795   -3.370  1.00 0.00 ? 50  TYR A HH   5  
ATOM 7808  N N    . SER A 1 51  ? 1.382   1.845   -5.293  1.00 0.00 ? 51  SER A N    5  
ATOM 7809  C CA   . SER A 1 51  ? 1.945   0.500   -5.267  1.00 0.00 ? 51  SER A CA   5  
ATOM 7810  C C    . SER A 1 51  ? 1.439   -0.278  -4.057  1.00 0.00 ? 51  SER A C    5  
ATOM 7811  O O    . SER A 1 51  ? 1.327   0.265   -2.958  1.00 0.00 ? 51  SER A O    5  
ATOM 7812  C CB   . SER A 1 51  ? 3.473   0.565   -5.244  1.00 0.00 ? 51  SER A CB   5  
ATOM 7813  O OG   . SER A 1 51  ? 4.030   -0.682  -4.865  1.00 0.00 ? 51  SER A OG   5  
ATOM 7814  H H    . SER A 1 51  ? 1.375   2.377   -4.469  1.00 0.00 ? 51  SER A H    5  
ATOM 7815  H HA   . SER A 1 51  ? 1.628   -0.008  -6.166  1.00 0.00 ? 51  SER A HA   5  
ATOM 7816  H HB2  . SER A 1 51  ? 3.835   0.824   -6.227  1.00 0.00 ? 51  SER A HB2  5  
ATOM 7817  H HB3  . SER A 1 51  ? 3.788   1.317   -4.535  1.00 0.00 ? 51  SER A HB3  5  
ATOM 7818  H HG   . SER A 1 51  ? 4.980   -0.663  -5.001  1.00 0.00 ? 51  SER A HG   5  
ATOM 7819  N N    . VAL A 1 52  ? 1.133   -1.554  -4.267  1.00 0.00 ? 52  VAL A N    5  
ATOM 7820  C CA   . VAL A 1 52  ? 0.640   -2.409  -3.194  1.00 0.00 ? 52  VAL A CA   5  
ATOM 7821  C C    . VAL A 1 52  ? 1.414   -3.721  -3.136  1.00 0.00 ? 52  VAL A C    5  
ATOM 7822  O O    . VAL A 1 52  ? 1.026   -4.710  -3.756  1.00 0.00 ? 52  VAL A O    5  
ATOM 7823  C CB   . VAL A 1 52  ? -0.859  -2.718  -3.367  1.00 0.00 ? 52  VAL A CB   5  
ATOM 7824  C CG1  . VAL A 1 52  ? -1.408  -3.412  -2.130  1.00 0.00 ? 52  VAL A CG1  5  
ATOM 7825  C CG2  . VAL A 1 52  ? -1.635  -1.443  -3.661  1.00 0.00 ? 52  VAL A CG2  5  
ATOM 7826  H H    . VAL A 1 52  ? 1.244   -1.930  -5.165  1.00 0.00 ? 52  VAL A H    5  
ATOM 7827  H HA   . VAL A 1 52  ? 0.772   -1.882  -2.260  1.00 0.00 ? 52  VAL A HA   5  
ATOM 7828  H HB   . VAL A 1 52  ? -0.974  -3.386  -4.208  1.00 0.00 ? 52  VAL A HB   5  
ATOM 7829  H HG11 . VAL A 1 52  ? -2.048  -2.731  -1.589  1.00 0.00 ? 52  VAL A HG11 5  
ATOM 7830  H HG12 . VAL A 1 52  ? -1.975  -4.282  -2.427  1.00 0.00 ? 52  VAL A HG12 5  
ATOM 7831  H HG13 . VAL A 1 52  ? -0.589  -3.716  -1.495  1.00 0.00 ? 52  VAL A HG13 5  
ATOM 7832  H HG21 . VAL A 1 52  ? -2.551  -1.438  -3.089  1.00 0.00 ? 52  VAL A HG21 5  
ATOM 7833  H HG22 . VAL A 1 52  ? -1.036  -0.587  -3.389  1.00 0.00 ? 52  VAL A HG22 5  
ATOM 7834  H HG23 . VAL A 1 52  ? -1.869  -1.398  -4.715  1.00 0.00 ? 52  VAL A HG23 5  
ATOM 7835  N N    . GLU A 1 53  ? 2.512   -3.721  -2.386  1.00 0.00 ? 53  GLU A N    5  
ATOM 7836  C CA   . GLU A 1 53  ? 3.342   -4.912  -2.247  1.00 0.00 ? 53  GLU A CA   5  
ATOM 7837  C C    . GLU A 1 53  ? 2.838   -5.797  -1.110  1.00 0.00 ? 53  GLU A C    5  
ATOM 7838  O O    . GLU A 1 53  ? 2.782   -5.371  0.044   1.00 0.00 ? 53  GLU A O    5  
ATOM 7839  C CB   . GLU A 1 53  ? 4.799   -4.519  -1.995  1.00 0.00 ? 53  GLU A CB   5  
ATOM 7840  C CG   . GLU A 1 53  ? 5.557   -4.149  -3.259  1.00 0.00 ? 53  GLU A CG   5  
ATOM 7841  C CD   . GLU A 1 53  ? 6.829   -3.376  -2.970  1.00 0.00 ? 53  GLU A CD   5  
ATOM 7842  O OE1  . GLU A 1 53  ? 6.826   -2.562  -2.023  1.00 0.00 ? 53  GLU A OE1  5  
ATOM 7843  O OE2  . GLU A 1 53  ? 7.827   -3.585  -3.691  1.00 0.00 ? 53  GLU A OE2  5  
ATOM 7844  H H    . GLU A 1 53  ? 2.770   -2.901  -1.916  1.00 0.00 ? 53  GLU A H    5  
ATOM 7845  H HA   . GLU A 1 53  ? 3.283   -5.466  -3.172  1.00 0.00 ? 53  GLU A HA   5  
ATOM 7846  H HB2  . GLU A 1 53  ? 4.820   -3.672  -1.325  1.00 0.00 ? 53  GLU A HB2  5  
ATOM 7847  H HB3  . GLU A 1 53  ? 5.306   -5.349  -1.526  1.00 0.00 ? 53  GLU A HB3  5  
ATOM 7848  H HG2  . GLU A 1 53  ? 5.816   -5.054  -3.786  1.00 0.00 ? 53  GLU A HG2  5  
ATOM 7849  H HG3  . GLU A 1 53  ? 4.917   -3.541  -3.882  1.00 0.00 ? 53  GLU A HG3  5  
ATOM 7850  N N    . TYR A 1 54  ? 2.471   -7.029  -1.446  1.00 0.00 ? 54  TYR A N    5  
ATOM 7851  C CA   . TYR A 1 54  ? 1.969   -7.973  -0.455  1.00 0.00 ? 54  TYR A CA   5  
ATOM 7852  C C    . TYR A 1 54  ? 2.666   -9.324  -0.588  1.00 0.00 ? 54  TYR A C    5  
ATOM 7853  O O    . TYR A 1 54  ? 2.944   -9.784  -1.695  1.00 0.00 ? 54  TYR A O    5  
ATOM 7854  C CB   . TYR A 1 54  ? 0.457   -8.149  -0.607  1.00 0.00 ? 54  TYR A CB   5  
ATOM 7855  C CG   . TYR A 1 54  ? 0.059   -8.909  -1.852  1.00 0.00 ? 54  TYR A CG   5  
ATOM 7856  C CD1  . TYR A 1 54  ? -0.056  -8.264  -3.077  1.00 0.00 ? 54  TYR A CD1  5  
ATOM 7857  C CD2  . TYR A 1 54  ? -0.202  -10.273 -1.803  1.00 0.00 ? 54  TYR A CD2  5  
ATOM 7858  C CE1  . TYR A 1 54  ? -0.421  -8.955  -4.217  1.00 0.00 ? 54  TYR A CE1  5  
ATOM 7859  C CE2  . TYR A 1 54  ? -0.566  -10.972 -2.938  1.00 0.00 ? 54  TYR A CE2  5  
ATOM 7860  C CZ   . TYR A 1 54  ? -0.675  -10.308 -4.142  1.00 0.00 ? 54  TYR A CZ   5  
ATOM 7861  O OH   . TYR A 1 54  ? -1.037  -11.000 -5.275  1.00 0.00 ? 54  TYR A OH   5  
ATOM 7862  H H    . TYR A 1 54  ? 2.539   -7.310  -2.382  1.00 0.00 ? 54  TYR A H    5  
ATOM 7863  H HA   . TYR A 1 54  ? 2.178   -7.568  0.525   1.00 0.00 ? 54  TYR A HA   5  
ATOM 7864  H HB2  . TYR A 1 54  ? 0.077   -8.688  0.246   1.00 0.00 ? 54  TYR A HB2  5  
ATOM 7865  H HB3  . TYR A 1 54  ? -0.009  -7.175  -0.649  1.00 0.00 ? 54  TYR A HB3  5  
ATOM 7866  H HD1  . TYR A 1 54  ? 0.143   -7.203  -3.132  1.00 0.00 ? 54  TYR A HD1  5  
ATOM 7867  H HD2  . TYR A 1 54  ? -0.116  -10.790 -0.858  1.00 0.00 ? 54  TYR A HD2  5  
ATOM 7868  H HE1  . TYR A 1 54  ? -0.506  -8.435  -5.160  1.00 0.00 ? 54  TYR A HE1  5  
ATOM 7869  H HE2  . TYR A 1 54  ? -0.765  -12.032 -2.879  1.00 0.00 ? 54  TYR A HE2  5  
ATOM 7870  H HH   . TYR A 1 54  ? -0.279  -11.076 -5.859  1.00 0.00 ? 54  TYR A HH   5  
ATOM 7871  N N    . GLN A 1 55  ? 2.943   -9.954  0.549   1.00 0.00 ? 55  GLN A N    5  
ATOM 7872  C CA   . GLN A 1 55  ? 3.606   -11.252 0.561   1.00 0.00 ? 55  GLN A CA   5  
ATOM 7873  C C    . GLN A 1 55  ? 3.215   -12.052 1.799   1.00 0.00 ? 55  GLN A C    5  
ATOM 7874  O O    . GLN A 1 55  ? 2.498   -11.558 2.670   1.00 0.00 ? 55  GLN A O    5  
ATOM 7875  C CB   . GLN A 1 55  ? 5.125   -11.073 0.513   1.00 0.00 ? 55  GLN A CB   5  
ATOM 7876  C CG   . GLN A 1 55  ? 5.721   -10.587 1.825   1.00 0.00 ? 55  GLN A CG   5  
ATOM 7877  C CD   . GLN A 1 55  ? 7.219   -10.369 1.739   1.00 0.00 ? 55  GLN A CD   5  
ATOM 7878  O OE1  . GLN A 1 55  ? 7.744   -9.379  2.249   1.00 0.00 ? 55  GLN A OE1  5  
ATOM 7879  N NE2  . GLN A 1 55  ? 7.916   -11.296 1.092   1.00 0.00 ? 55  GLN A NE2  5  
ATOM 7880  H H    . GLN A 1 55  ? 2.695   -9.536  1.400   1.00 0.00 ? 55  GLN A H    5  
ATOM 7881  H HA   . GLN A 1 55  ? 3.289   -11.794 -0.317  1.00 0.00 ? 55  GLN A HA   5  
ATOM 7882  H HB2  . GLN A 1 55  ? 5.579   -12.020 0.264   1.00 0.00 ? 55  GLN A HB2  5  
ATOM 7883  H HB3  . GLN A 1 55  ? 5.366   -10.353 -0.255  1.00 0.00 ? 55  GLN A HB3  5  
ATOM 7884  H HG2  . GLN A 1 55  ? 5.252   -9.653  2.095   1.00 0.00 ? 55  GLN A HG2  5  
ATOM 7885  H HG3  . GLN A 1 55  ? 5.522   -11.323 2.590   1.00 0.00 ? 55  GLN A HG3  5  
ATOM 7886  H HE21 . GLN A 1 55  ? 7.431   -12.058 0.710   1.00 0.00 ? 55  GLN A HE21 5  
ATOM 7887  H HE22 . GLN A 1 55  ? 8.886   -11.180 1.021   1.00 0.00 ? 55  GLN A HE22 5  
ATOM 7888  N N    . LEU A 1 56  ? 3.691   -13.290 1.871   1.00 0.00 ? 56  LEU A N    5  
ATOM 7889  C CA   . LEU A 1 56  ? 3.391   -14.160 3.003   1.00 0.00 ? 56  LEU A CA   5  
ATOM 7890  C C    . LEU A 1 56  ? 4.097   -13.675 4.265   1.00 0.00 ? 56  LEU A C    5  
ATOM 7891  O O    . LEU A 1 56  ? 5.326   -13.692 4.348   1.00 0.00 ? 56  LEU A O    5  
ATOM 7892  C CB   . LEU A 1 56  ? 3.810   -15.598 2.692   1.00 0.00 ? 56  LEU A CB   5  
ATOM 7893  C CG   . LEU A 1 56  ? 2.845   -16.405 1.823   1.00 0.00 ? 56  LEU A CG   5  
ATOM 7894  C CD1  . LEU A 1 56  ? 3.500   -17.695 1.354   1.00 0.00 ? 56  LEU A CD1  5  
ATOM 7895  C CD2  . LEU A 1 56  ? 1.562   -16.703 2.585   1.00 0.00 ? 56  LEU A CD2  5  
ATOM 7896  H H    . LEU A 1 56  ? 4.257   -13.629 1.147   1.00 0.00 ? 56  LEU A H    5  
ATOM 7897  H HA   . LEU A 1 56  ? 2.324   -14.133 3.169   1.00 0.00 ? 56  LEU A HA   5  
ATOM 7898  H HB2  . LEU A 1 56  ? 4.762   -15.563 2.184   1.00 0.00 ? 56  LEU A HB2  5  
ATOM 7899  H HB3  . LEU A 1 56  ? 3.925   -16.119 3.632   1.00 0.00 ? 56  LEU A HB3  5  
ATOM 7900  H HG   . LEU A 1 56  ? 2.589   -15.825 0.947   1.00 0.00 ? 56  LEU A HG   5  
ATOM 7901  H HD11 . LEU A 1 56  ? 3.037   -18.022 0.436   1.00 0.00 ? 56  LEU A HD11 5  
ATOM 7902  H HD12 . LEU A 1 56  ? 3.376   -18.457 2.110   1.00 0.00 ? 56  LEU A HD12 5  
ATOM 7903  H HD13 . LEU A 1 56  ? 4.554   -17.524 1.186   1.00 0.00 ? 56  LEU A HD13 5  
ATOM 7904  H HD21 . LEU A 1 56  ? 1.754   -17.457 3.333   1.00 0.00 ? 56  LEU A HD21 5  
ATOM 7905  H HD22 . LEU A 1 56  ? 0.810   -17.060 1.897   1.00 0.00 ? 56  LEU A HD22 5  
ATOM 7906  H HD23 . LEU A 1 56  ? 1.211   -15.800 3.064   1.00 0.00 ? 56  LEU A HD23 5  
ATOM 7907  N N    . LEU A 1 57  ? 3.312   -13.244 5.247   1.00 0.00 ? 57  LEU A N    5  
ATOM 7908  C CA   . LEU A 1 57  ? 3.862   -12.755 6.507   1.00 0.00 ? 57  LEU A CA   5  
ATOM 7909  C C    . LEU A 1 57  ? 5.046   -13.608 6.952   1.00 0.00 ? 57  LEU A C    5  
ATOM 7910  O O    . LEU A 1 57  ? 6.085   -13.085 7.352   1.00 0.00 ? 57  LEU A O    5  
ATOM 7911  C CB   . LEU A 1 57  ? 2.783   -12.756 7.591   1.00 0.00 ? 57  LEU A CB   5  
ATOM 7912  C CG   . LEU A 1 57  ? 3.016   -11.811 8.770   1.00 0.00 ? 57  LEU A CG   5  
ATOM 7913  C CD1  . LEU A 1 57  ? 2.875   -10.362 8.329   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 7914  C CD2  . LEU A 1 57  ? 2.047   -12.122 9.902   1.00 0.00 ? 57  LEU A CD2  5  
ATOM 7915  H H    . LEU A 1 57  ? 2.341   -13.254 5.122   1.00 0.00 ? 57  LEU A H    5  
ATOM 7916  H HA   . LEU A 1 57  ? 4.202   -11.743 6.349   1.00 0.00 ? 57  LEU A HA   5  
ATOM 7917  H HB2  . LEU A 1 57  ? 1.848   -12.481 7.127   1.00 0.00 ? 57  LEU A HB2  5  
ATOM 7918  H HB3  . LEU A 1 57  ? 2.707   -13.761 7.981   1.00 0.00 ? 57  LEU A HB3  5  
ATOM 7919  H HG   . LEU A 1 57  ? 4.021   -11.950 9.142   1.00 0.00 ? 57  LEU A HG   5  
ATOM 7920  H HD11 . LEU A 1 57  ? 3.800   -10.031 7.882   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 7921  H HD12 . LEU A 1 57  ? 2.648   -9.746  9.187   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 7922  H HD13 . LEU A 1 57  ? 2.076   -10.282 7.607   1.00 0.00 ? 57  LEU A HD13 5  
ATOM 7923  H HD21 . LEU A 1 57  ? 1.466   -12.996 9.648   1.00 0.00 ? 57  LEU A HD21 5  
ATOM 7924  H HD22 . LEU A 1 57  ? 1.387   -11.281 10.052  1.00 0.00 ? 57  LEU A HD22 5  
ATOM 7925  H HD23 . LEU A 1 57  ? 2.603   -12.310 10.810  1.00 0.00 ? 57  LEU A HD23 5  
ATOM 7926  N N    . ASN A 1 58  ? 4.881   -14.925 6.877   1.00 0.00 ? 58  ASN A N    5  
ATOM 7927  C CA   . ASN A 1 58  ? 5.938   -15.850 7.270   1.00 0.00 ? 58  ASN A CA   5  
ATOM 7928  C C    . ASN A 1 58  ? 7.213   -15.590 6.475   1.00 0.00 ? 58  ASN A C    5  
ATOM 7929  O O    . ASN A 1 58  ? 8.306   -15.531 7.037   1.00 0.00 ? 58  ASN A O    5  
ATOM 7930  C CB   . ASN A 1 58  ? 5.480   -17.296 7.063   1.00 0.00 ? 58  ASN A CB   5  
ATOM 7931  C CG   . ASN A 1 58  ? 4.796   -17.500 5.725   1.00 0.00 ? 58  ASN A CG   5  
ATOM 7932  O OD1  . ASN A 1 58  ? 5.421   -17.384 4.671   1.00 0.00 ? 58  ASN A OD1  5  
ATOM 7933  N ND2  . ASN A 1 58  ? 3.504   -17.805 5.763   1.00 0.00 ? 58  ASN A ND2  5  
ATOM 7934  H H    . ASN A 1 58  ? 4.030   -15.283 6.549   1.00 0.00 ? 58  ASN A H    5  
ATOM 7935  H HA   . ASN A 1 58  ? 6.142   -15.694 8.318   1.00 0.00 ? 58  ASN A HA   5  
ATOM 7936  H HB2  . ASN A 1 58  ? 6.340   -17.949 7.108   1.00 0.00 ? 58  ASN A HB2  5  
ATOM 7937  H HB3  . ASN A 1 58  ? 4.788   -17.564 7.846   1.00 0.00 ? 58  ASN A HB3  5  
ATOM 7938  H HD21 . ASN A 1 58  ? 3.071   -17.880 6.639   1.00 0.00 ? 58  ASN A HD21 5  
ATOM 7939  H HD22 . ASN A 1 58  ? 3.036   -17.943 4.913   1.00 0.00 ? 58  ASN A HD22 5  
ATOM 7940  N N    . GLY A 1 59  ? 7.065   -15.433 5.163   1.00 0.00 ? 59  GLY A N    5  
ATOM 7941  C CA   . GLY A 1 59  ? 8.213   -15.180 4.312   1.00 0.00 ? 59  GLY A CA   5  
ATOM 7942  C C    . GLY A 1 59  ? 8.178   -15.995 3.034   1.00 0.00 ? 59  GLY A C    5  
ATOM 7943  O O    . GLY A 1 59  ? 8.433   -17.199 3.050   1.00 0.00 ? 59  GLY A O    5  
ATOM 7944  H H    . GLY A 1 59  ? 6.169   -15.490 4.770   1.00 0.00 ? 59  GLY A H    5  
ATOM 7945  H HA2  . GLY A 1 59  ? 8.234   -14.131 4.057   1.00 0.00 ? 59  GLY A HA2  5  
ATOM 7946  H HA3  . GLY A 1 59  ? 9.112   -15.426 4.857   1.00 0.00 ? 59  GLY A HA3  5  
ATOM 7947  N N    . GLY A 1 60  ? 7.860   -15.338 1.923   1.00 0.00 ? 60  GLY A N    5  
ATOM 7948  C CA   . GLY A 1 60  ? 7.796   -16.026 0.646   1.00 0.00 ? 60  GLY A CA   5  
ATOM 7949  C C    . GLY A 1 60  ? 7.740   -15.067 -0.527  1.00 0.00 ? 60  GLY A C    5  
ATOM 7950  O O    . GLY A 1 60  ? 8.057   -13.886 -0.386  1.00 0.00 ? 60  GLY A O    5  
ATOM 7951  H H    . GLY A 1 60  ? 7.666   -14.378 1.970   1.00 0.00 ? 60  GLY A H    5  
ATOM 7952  H HA2  . GLY A 1 60  ? 8.669   -16.653 0.544   1.00 0.00 ? 60  GLY A HA2  5  
ATOM 7953  H HA3  . GLY A 1 60  ? 6.914   -16.648 0.630   1.00 0.00 ? 60  GLY A HA3  5  
ATOM 7954  N N    . GLU A 1 61  ? 7.338   -15.576 -1.687  1.00 0.00 ? 61  GLU A N    5  
ATOM 7955  C CA   . GLU A 1 61  ? 7.245   -14.757 -2.889  1.00 0.00 ? 61  GLU A CA   5  
ATOM 7956  C C    . GLU A 1 61  ? 6.441   -13.488 -2.621  1.00 0.00 ? 61  GLU A C    5  
ATOM 7957  O O    . GLU A 1 61  ? 5.407   -13.524 -1.952  1.00 0.00 ? 61  GLU A O    5  
ATOM 7958  C CB   . GLU A 1 61  ? 6.601   -15.552 -4.027  1.00 0.00 ? 61  GLU A CB   5  
ATOM 7959  C CG   . GLU A 1 61  ? 6.627   -14.831 -5.364  1.00 0.00 ? 61  GLU A CG   5  
ATOM 7960  C CD   . GLU A 1 61  ? 5.740   -15.492 -6.401  1.00 0.00 ? 61  GLU A CD   5  
ATOM 7961  O OE1  . GLU A 1 61  ? 6.001   -16.665 -6.743  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 7962  O OE2  . GLU A 1 61  ? 4.786   -14.838 -6.870  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 7963  H H    . GLU A 1 61  ? 7.100   -16.526 -1.735  1.00 0.00 ? 61  GLU A H    5  
ATOM 7964  H HA   . GLU A 1 61  ? 8.247   -14.478 -3.179  1.00 0.00 ? 61  GLU A HA   5  
ATOM 7965  H HB2  . GLU A 1 61  ? 7.126   -16.490 -4.136  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 7966  H HB3  . GLU A 1 61  ? 5.572   -15.753 -3.770  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 7967  H HG2  . GLU A 1 61  ? 6.289   -13.816 -5.218  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 7968  H HG3  . GLU A 1 61  ? 7.642   -14.821 -5.733  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 7969  N N    . LEU A 1 62  ? 6.922   -12.367 -3.148  1.00 0.00 ? 62  LEU A N    5  
ATOM 7970  C CA   . LEU A 1 62  ? 6.249   -11.086 -2.966  1.00 0.00 ? 62  LEU A CA   5  
ATOM 7971  C C    . LEU A 1 62  ? 5.591   -10.627 -4.264  1.00 0.00 ? 62  LEU A C    5  
ATOM 7972  O O    . LEU A 1 62  ? 6.184   -10.721 -5.340  1.00 0.00 ? 62  LEU A O    5  
ATOM 7973  C CB   . LEU A 1 62  ? 7.243   -10.029 -2.484  1.00 0.00 ? 62  LEU A CB   5  
ATOM 7974  C CG   . LEU A 1 62  ? 6.644   -8.689  -2.055  1.00 0.00 ? 62  LEU A CG   5  
ATOM 7975  C CD1  . LEU A 1 62  ? 7.574   -7.973  -1.088  1.00 0.00 ? 62  LEU A CD1  5  
ATOM 7976  C CD2  . LEU A 1 62  ? 6.361   -7.818  -3.270  1.00 0.00 ? 62  LEU A CD2  5  
ATOM 7977  H H    . LEU A 1 62  ? 7.749   -12.401 -3.671  1.00 0.00 ? 62  LEU A H    5  
ATOM 7978  H HA   . LEU A 1 62  ? 5.483   -11.217 -2.216  1.00 0.00 ? 62  LEU A HA   5  
ATOM 7979  H HB2  . LEU A 1 62  ? 7.777   -10.438 -1.640  1.00 0.00 ? 62  LEU A HB2  5  
ATOM 7980  H HB3  . LEU A 1 62  ? 7.939   -9.839  -3.289  1.00 0.00 ? 62  LEU A HB3  5  
ATOM 7981  H HG   . LEU A 1 62  ? 5.707   -8.868  -1.546  1.00 0.00 ? 62  LEU A HG   5  
ATOM 7982  H HD11 . LEU A 1 62  ? 8.542   -8.450  -1.100  1.00 0.00 ? 62  LEU A HD11 5  
ATOM 7983  H HD12 . LEU A 1 62  ? 7.161   -8.020  -0.091  1.00 0.00 ? 62  LEU A HD12 5  
ATOM 7984  H HD13 . LEU A 1 62  ? 7.677   -6.940  -1.386  1.00 0.00 ? 62  LEU A HD13 5  
ATOM 7985  H HD21 . LEU A 1 62  ? 7.273   -7.677  -3.832  1.00 0.00 ? 62  LEU A HD21 5  
ATOM 7986  H HD22 . LEU A 1 62  ? 5.987   -6.858  -2.945  1.00 0.00 ? 62  LEU A HD22 5  
ATOM 7987  H HD23 . LEU A 1 62  ? 5.623   -8.299  -3.895  1.00 0.00 ? 62  LEU A HD23 5  
ATOM 7988  N N    . HIS A 1 63  ? 4.363   -10.130 -4.156  1.00 0.00 ? 63  HIS A N    5  
ATOM 7989  C CA   . HIS A 1 63  ? 3.626   -9.654  -5.321  1.00 0.00 ? 63  HIS A CA   5  
ATOM 7990  C C    . HIS A 1 63  ? 3.518   -8.132  -5.311  1.00 0.00 ? 63  HIS A C    5  
ATOM 7991  O O    . HIS A 1 63  ? 2.945   -7.547  -4.392  1.00 0.00 ? 63  HIS A O    5  
ATOM 7992  C CB   . HIS A 1 63  ? 2.230   -10.276 -5.357  1.00 0.00 ? 63  HIS A CB   5  
ATOM 7993  C CG   . HIS A 1 63  ? 2.242   -11.773 -5.391  1.00 0.00 ? 63  HIS A CG   5  
ATOM 7994  N ND1  . HIS A 1 63  ? 1.892   -12.503 -6.507  1.00 0.00 ? 63  HIS A ND1  5  
ATOM 7995  C CD2  . HIS A 1 63  ? 2.566   -12.677 -4.437  1.00 0.00 ? 63  HIS A CD2  5  
ATOM 7996  C CE1  . HIS A 1 63  ? 1.998   -13.792 -6.238  1.00 0.00 ? 63  HIS A CE1  5  
ATOM 7997  N NE2  . HIS A 1 63  ? 2.406   -13.925 -4.989  1.00 0.00 ? 63  HIS A NE2  5  
ATOM 7998  H H    . HIS A 1 63  ? 3.944   -10.082 -3.272  1.00 0.00 ? 63  HIS A H    5  
ATOM 7999  H HA   . HIS A 1 63  ? 4.168   -9.958  -6.204  1.00 0.00 ? 63  HIS A HA   5  
ATOM 8000  H HB2  . HIS A 1 63  ? 1.684   -9.969  -4.477  1.00 0.00 ? 63  HIS A HB2  5  
ATOM 8001  H HB3  . HIS A 1 63  ? 1.710   -9.927  -6.237  1.00 0.00 ? 63  HIS A HB3  5  
ATOM 8002  H HD2  . HIS A 1 63  ? 2.889   -12.459 -3.429  1.00 0.00 ? 63  HIS A HD2  5  
ATOM 8003  H HE1  . HIS A 1 63  ? 1.789   -14.600 -6.922  1.00 0.00 ? 63  HIS A HE1  5  
ATOM 8004  H HE2  . HIS A 1 63  ? 2.484   -14.775 -4.508  1.00 0.00 ? 63  HIS A HE2  5  
ATOM 8005  N N    . ARG A 1 64  ? 4.073   -7.497  -6.338  1.00 0.00 ? 64  ARG A N    5  
ATOM 8006  C CA   . ARG A 1 64  ? 4.041   -6.044  -6.446  1.00 0.00 ? 64  ARG A CA   5  
ATOM 8007  C C    . ARG A 1 64  ? 2.937   -5.593  -7.398  1.00 0.00 ? 64  ARG A C    5  
ATOM 8008  O O    . ARG A 1 64  ? 2.912   -5.985  -8.566  1.00 0.00 ? 64  ARG A O    5  
ATOM 8009  C CB   . ARG A 1 64  ? 5.393   -5.516  -6.930  1.00 0.00 ? 64  ARG A CB   5  
ATOM 8010  C CG   . ARG A 1 64  ? 5.529   -4.006  -6.831  1.00 0.00 ? 64  ARG A CG   5  
ATOM 8011  C CD   . ARG A 1 64  ? 6.776   -3.510  -7.546  1.00 0.00 ? 64  ARG A CD   5  
ATOM 8012  N NE   . ARG A 1 64  ? 6.800   -2.055  -7.658  1.00 0.00 ? 64  ARG A NE   5  
ATOM 8013  C CZ   . ARG A 1 64  ? 7.679   -1.389  -8.400  1.00 0.00 ? 64  ARG A CZ   5  
ATOM 8014  N NH1  . ARG A 1 64  ? 8.599   -2.047  -9.093  1.00 0.00 ? 64  ARG A NH1  5  
ATOM 8015  N NH2  . ARG A 1 64  ? 7.637   -0.064  -8.452  1.00 0.00 ? 64  ARG A NH2  5  
ATOM 8016  H H    . ARG A 1 64  ? 4.516   -8.019  -7.040  1.00 0.00 ? 64  ARG A H    5  
ATOM 8017  H HA   . ARG A 1 64  ? 3.838   -5.642  -5.464  1.00 0.00 ? 64  ARG A HA   5  
ATOM 8018  H HB2  . ARG A 1 64  ? 6.175   -5.966  -6.336  1.00 0.00 ? 64  ARG A HB2  5  
ATOM 8019  H HB3  . ARG A 1 64  ? 5.528   -5.801  -7.962  1.00 0.00 ? 64  ARG A HB3  5  
ATOM 8020  H HG2  . ARG A 1 64  ? 4.662   -3.545  -7.282  1.00 0.00 ? 64  ARG A HG2  5  
ATOM 8021  H HG3  . ARG A 1 64  ? 5.586   -3.727  -5.789  1.00 0.00 ? 64  ARG A HG3  5  
ATOM 8022  H HD2  . ARG A 1 64  ? 7.645   -3.834  -6.992  1.00 0.00 ? 64  ARG A HD2  5  
ATOM 8023  H HD3  . ARG A 1 64  ? 6.801   -3.939  -8.536  1.00 0.00 ? 64  ARG A HD3  5  
ATOM 8024  H HE   . ARG A 1 64  ? 6.129   -1.549  -7.155  1.00 0.00 ? 64  ARG A HE   5  
ATOM 8025  H HH11 . ARG A 1 64  ? 8.632   -3.045  -9.057  1.00 0.00 ? 64  ARG A HH11 5  
ATOM 8026  H HH12 . ARG A 1 64  ? 9.258   -1.543  -9.652  1.00 0.00 ? 64  ARG A HH12 5  
ATOM 8027  H HH21 . ARG A 1 64  ? 6.944   0.435   -7.931  1.00 0.00 ? 64  ARG A HH21 5  
ATOM 8028  H HH22 . ARG A 1 64  ? 8.298   0.435   -9.010  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 8029  N N    . LEU A 1 65  ? 2.026   -4.770  -6.892  1.00 0.00 ? 65  LEU A N    5  
ATOM 8030  C CA   . LEU A 1 65  ? 0.918   -4.266  -7.698  1.00 0.00 ? 65  LEU A CA   5  
ATOM 8031  C C    . LEU A 1 65  ? 1.061   -2.768  -7.944  1.00 0.00 ? 65  LEU A C    5  
ATOM 8032  O O    . LEU A 1 65  ? 1.093   -1.975  -7.004  1.00 0.00 ? 65  LEU A O    5  
ATOM 8033  C CB   . LEU A 1 65  ? -0.415  -4.556  -7.005  1.00 0.00 ? 65  LEU A CB   5  
ATOM 8034  C CG   . LEU A 1 65  ? -0.653  -6.008  -6.590  1.00 0.00 ? 65  LEU A CG   5  
ATOM 8035  C CD1  . LEU A 1 65  ? -1.836  -6.104  -5.639  1.00 0.00 ? 65  LEU A CD1  5  
ATOM 8036  C CD2  . LEU A 1 65  ? -0.878  -6.883  -7.814  1.00 0.00 ? 65  LEU A CD2  5  
ATOM 8037  H H    . LEU A 1 65  ? 2.098   -4.493  -5.956  1.00 0.00 ? 65  LEU A H    5  
ATOM 8038  H HA   . LEU A 1 65  ? 0.940   -4.779  -8.648  1.00 0.00 ? 65  LEU A HA   5  
ATOM 8039  H HB2  . LEU A 1 65  ? -0.465  -3.946  -6.117  1.00 0.00 ? 65  LEU A HB2  5  
ATOM 8040  H HB3  . LEU A 1 65  ? -1.207  -4.270  -7.682  1.00 0.00 ? 65  LEU A HB3  5  
ATOM 8041  H HG   . LEU A 1 65  ? 0.221   -6.376  -6.071  1.00 0.00 ? 65  LEU A HG   5  
ATOM 8042  H HD11 . LEU A 1 65  ? -2.670  -5.552  -6.046  1.00 0.00 ? 65  LEU A HD11 5  
ATOM 8043  H HD12 . LEU A 1 65  ? -1.563  -5.688  -4.681  1.00 0.00 ? 65  LEU A HD12 5  
ATOM 8044  H HD13 . LEU A 1 65  ? -2.116  -7.140  -5.515  1.00 0.00 ? 65  LEU A HD13 5  
ATOM 8045  H HD21 . LEU A 1 65  ? -0.111  -7.641  -7.861  1.00 0.00 ? 65  LEU A HD21 5  
ATOM 8046  H HD22 . LEU A 1 65  ? -0.837  -6.273  -8.705  1.00 0.00 ? 65  LEU A HD22 5  
ATOM 8047  H HD23 . LEU A 1 65  ? -1.848  -7.355  -7.746  1.00 0.00 ? 65  LEU A HD23 5  
ATOM 8048  N N    . ASN A 1 66  ? 1.144   -2.387  -9.214  1.00 0.00 ? 66  ASN A N    5  
ATOM 8049  C CA   . ASN A 1 66  ? 1.282   -0.983  -9.584  1.00 0.00 ? 66  ASN A CA   5  
ATOM 8050  C C    . ASN A 1 66  ? -0.063  -0.397  -10.004 1.00 0.00 ? 66  ASN A C    5  
ATOM 8051  O O    . ASN A 1 66  ? -0.901  -1.091  -10.580 1.00 0.00 ? 66  ASN A O    5  
ATOM 8052  C CB   . ASN A 1 66  ? 2.295   -0.831  -10.721 1.00 0.00 ? 66  ASN A CB   5  
ATOM 8053  C CG   . ASN A 1 66  ? 3.710   -1.154  -10.282 1.00 0.00 ? 66  ASN A CG   5  
ATOM 8054  O OD1  . ASN A 1 66  ? 4.129   -2.311  -10.304 1.00 0.00 ? 66  ASN A OD1  5  
ATOM 8055  N ND2  . ASN A 1 66  ? 4.452   -0.129  -9.879  1.00 0.00 ? 66  ASN A ND2  5  
ATOM 8056  H H    . ASN A 1 66  ? 1.113   -3.066  -9.920  1.00 0.00 ? 66  ASN A H    5  
ATOM 8057  H HA   . ASN A 1 66  ? 1.641   -0.446  -8.719  1.00 0.00 ? 66  ASN A HA   5  
ATOM 8058  H HB2  . ASN A 1 66  ? 2.027   -1.500  -11.526 1.00 0.00 ? 66  ASN A HB2  5  
ATOM 8059  H HB3  . ASN A 1 66  ? 2.272   0.187   -11.081 1.00 0.00 ? 66  ASN A HB3  5  
ATOM 8060  H HD21 . ASN A 1 66  ? 4.052   0.765   -9.888  1.00 0.00 ? 66  ASN A HD21 5  
ATOM 8061  H HD22 . ASN A 1 66  ? 5.371   -0.310  -9.590  1.00 0.00 ? 66  ASN A HD22 5  
ATOM 8062  N N    . ILE A 1 67  ? -0.260  0.884   -9.713  1.00 0.00 ? 67  ILE A N    5  
ATOM 8063  C CA   . ILE A 1 67  ? -1.502  1.564   -10.061 1.00 0.00 ? 67  ILE A CA   5  
ATOM 8064  C C    . ILE A 1 67  ? -1.246  2.713   -11.030 1.00 0.00 ? 67  ILE A C    5  
ATOM 8065  O O    . ILE A 1 67  ? -0.734  3.769   -10.659 1.00 0.00 ? 67  ILE A O    5  
ATOM 8066  C CB   . ILE A 1 67  ? -2.214  2.111   -8.810  1.00 0.00 ? 67  ILE A CB   5  
ATOM 8067  C CG1  . ILE A 1 67  ? -2.138  1.096   -7.668  1.00 0.00 ? 67  ILE A CG1  5  
ATOM 8068  C CG2  . ILE A 1 67  ? -3.663  2.448   -9.131  1.00 0.00 ? 67  ILE A CG2  5  
ATOM 8069  C CD1  . ILE A 1 67  ? -3.077  -0.077  -7.839  1.00 0.00 ? 67  ILE A CD1  5  
ATOM 8070  H H    . ILE A 1 67  ? 0.446   1.384   -9.253  1.00 0.00 ? 67  ILE A H    5  
ATOM 8071  H HA   . ILE A 1 67  ? -2.153  0.845   -10.536 1.00 0.00 ? 67  ILE A HA   5  
ATOM 8072  H HB   . ILE A 1 67  ? -1.717  3.020   -8.509  1.00 0.00 ? 67  ILE A HB   5  
ATOM 8073  H HG12 . ILE A 1 67  ? -1.133  0.709   -7.605  1.00 0.00 ? 67  ILE A HG12 5  
ATOM 8074  H HG13 . ILE A 1 67  ? -2.389  1.590   -6.740  1.00 0.00 ? 67  ILE A HG13 5  
ATOM 8075  H HG21 . ILE A 1 67  ? -3.810  3.516   -9.053  1.00 0.00 ? 67  ILE A HG21 5  
ATOM 8076  H HG22 . ILE A 1 67  ? -3.893  2.127   -10.136 1.00 0.00 ? 67  ILE A HG22 5  
ATOM 8077  H HG23 . ILE A 1 67  ? -4.313  1.944   -8.433  1.00 0.00 ? 67  ILE A HG23 5  
ATOM 8078  H HD11 . ILE A 1 67  ? -3.951  0.068   -7.219  1.00 0.00 ? 67  ILE A HD11 5  
ATOM 8079  H HD12 . ILE A 1 67  ? -3.380  -0.149  -8.873  1.00 0.00 ? 67  ILE A HD12 5  
ATOM 8080  H HD13 . ILE A 1 67  ? -2.575  -0.987  -7.545  1.00 0.00 ? 67  ILE A HD13 5  
ATOM 8081  N N    . PRO A 1 68  ? -1.611  2.505   -12.304 1.00 0.00 ? 68  PRO A N    5  
ATOM 8082  C CA   . PRO A 1 68  ? -1.433  3.514   -13.353 1.00 0.00 ? 68  PRO A CA   5  
ATOM 8083  C C    . PRO A 1 68  ? -2.368  4.705   -13.176 1.00 0.00 ? 68  PRO A C    5  
ATOM 8084  O O    . PRO A 1 68  ? -2.389  5.618   -14.002 1.00 0.00 ? 68  PRO A O    5  
ATOM 8085  C CB   . PRO A 1 68  ? -1.774  2.753   -14.637 1.00 0.00 ? 68  PRO A CB   5  
ATOM 8086  C CG   . PRO A 1 68  ? -2.681  1.656   -14.199 1.00 0.00 ? 68  PRO A CG   5  
ATOM 8087  C CD   . PRO A 1 68  ? -2.227  1.271   -12.818 1.00 0.00 ? 68  PRO A CD   5  
ATOM 8088  H HA   . PRO A 1 68  ? -0.412  3.862   -13.399 1.00 0.00 ? 68  PRO A HA   5  
ATOM 8089  H HB2  . PRO A 1 68  ? -2.265  3.419   -15.333 1.00 0.00 ? 68  PRO A HB2  5  
ATOM 8090  H HB3  . PRO A 1 68  ? -0.869  2.364   -15.080 1.00 0.00 ? 68  PRO A HB3  5  
ATOM 8091  H HG2  . PRO A 1 68  ? -3.700  2.010   -14.173 1.00 0.00 ? 68  PRO A HG2  5  
ATOM 8092  H HG3  . PRO A 1 68  ? -2.591  0.815   -14.871 1.00 0.00 ? 68  PRO A HG3  5  
ATOM 8093  H HD2  . PRO A 1 68  ? -3.072  0.979   -12.211 1.00 0.00 ? 68  PRO A HD2  5  
ATOM 8094  H HD3  . PRO A 1 68  ? -1.503  0.471   -12.868 1.00 0.00 ? 68  PRO A HD3  5  
ATOM 8095  N N    . ASN A 1 69  ? -3.140  4.691   -12.094 1.00 0.00 ? 69  ASN A N    5  
ATOM 8096  C CA   . ASN A 1 69  ? -4.077  5.771   -11.810 1.00 0.00 ? 69  ASN A CA   5  
ATOM 8097  C C    . ASN A 1 69  ? -3.851  6.333   -10.409 1.00 0.00 ? 69  ASN A C    5  
ATOM 8098  O O    . ASN A 1 69  ? -4.106  5.674   -9.401  1.00 0.00 ? 69  ASN A O    5  
ATOM 8099  C CB   . ASN A 1 69  ? -5.518  5.274   -11.946 1.00 0.00 ? 69  ASN A CB   5  
ATOM 8100  C CG   . ASN A 1 69  ? -6.498  6.404   -12.195 1.00 0.00 ? 69  ASN A CG   5  
ATOM 8101  O OD1  . ASN A 1 69  ? -6.118  7.480   -12.657 1.00 0.00 ? 69  ASN A OD1  5  
ATOM 8102  N ND2  . ASN A 1 69  ? -7.768  6.163   -11.888 1.00 0.00 ? 69  ASN A ND2  5  
ATOM 8103  H H    . ASN A 1 69  ? -3.078  3.936   -11.473 1.00 0.00 ? 69  ASN A H    5  
ATOM 8104  H HA   . ASN A 1 69  ? -3.907  6.556   -12.531 1.00 0.00 ? 69  ASN A HA   5  
ATOM 8105  H HB2  . ASN A 1 69  ? -5.577  4.583   -12.774 1.00 0.00 ? 69  ASN A HB2  5  
ATOM 8106  H HB3  . ASN A 1 69  ? -5.804  4.766   -11.037 1.00 0.00 ? 69  ASN A HB3  5  
ATOM 8107  H HD21 . ASN A 1 69  ? -7.998  5.283   -11.524 1.00 0.00 ? 69  ASN A HD21 5  
ATOM 8108  H HD22 . ASN A 1 69  ? -8.423  6.876   -12.040 1.00 0.00 ? 69  ASN A HD22 5  
ATOM 8109  N N    . PRO A 1 70  ? -3.361  7.580   -10.343 1.00 0.00 ? 70  PRO A N    5  
ATOM 8110  C CA   . PRO A 1 70  ? -3.091  8.258   -9.072  1.00 0.00 ? 70  PRO A CA   5  
ATOM 8111  C C    . PRO A 1 70  ? -4.370  8.615   -8.322  1.00 0.00 ? 70  PRO A C    5  
ATOM 8112  O O    . PRO A 1 70  ? -4.323  9.148   -7.214  1.00 0.00 ? 70  PRO A O    5  
ATOM 8113  C CB   . PRO A 1 70  ? -2.349  9.527   -9.498  1.00 0.00 ? 70  PRO A CB   5  
ATOM 8114  C CG   . PRO A 1 70  ? -2.799  9.778   -10.895 1.00 0.00 ? 70  PRO A CG   5  
ATOM 8115  C CD   . PRO A 1 70  ? -3.034  8.424   -11.504 1.00 0.00 ? 70  PRO A CD   5  
ATOM 8116  H HA   . PRO A 1 70  ? -2.455  7.664   -8.432  1.00 0.00 ? 70  PRO A HA   5  
ATOM 8117  H HB2  . PRO A 1 70  ? -2.619  10.342  -8.842  1.00 0.00 ? 70  PRO A HB2  5  
ATOM 8118  H HB3  . PRO A 1 70  ? -1.283  9.358   -9.450  1.00 0.00 ? 70  PRO A HB3  5  
ATOM 8119  H HG2  . PRO A 1 70  ? -3.713  10.351  -10.889 1.00 0.00 ? 70  PRO A HG2  5  
ATOM 8120  H HG3  . PRO A 1 70  ? -2.028  10.304  -11.439 1.00 0.00 ? 70  PRO A HG3  5  
ATOM 8121  H HD2  . PRO A 1 70  ? -3.860  8.461   -12.199 1.00 0.00 ? 70  PRO A HD2  5  
ATOM 8122  H HD3  . PRO A 1 70  ? -2.140  8.071   -11.997 1.00 0.00 ? 70  PRO A HD3  5  
ATOM 8123  N N    . ALA A 1 71  ? -5.512  8.318   -8.934  1.00 0.00 ? 71  ALA A N    5  
ATOM 8124  C CA   . ALA A 1 71  ? -6.804  8.607   -8.323  1.00 0.00 ? 71  ALA A CA   5  
ATOM 8125  C C    . ALA A 1 71  ? -7.400  7.357   -7.685  1.00 0.00 ? 71  ALA A C    5  
ATOM 8126  O O    . ALA A 1 71  ? -8.188  7.446   -6.745  1.00 0.00 ? 71  ALA A O    5  
ATOM 8127  C CB   . ALA A 1 71  ? -7.760  9.181   -9.358  1.00 0.00 ? 71  ALA A CB   5  
ATOM 8128  H H    . ALA A 1 71  ? -5.485  7.894   -9.817  1.00 0.00 ? 71  ALA A H    5  
ATOM 8129  H HA   . ALA A 1 71  ? -6.651  9.352   -7.556  1.00 0.00 ? 71  ALA A HA   5  
ATOM 8130  H HB1  . ALA A 1 71  ? -8.753  9.237   -8.937  1.00 0.00 ? 71  ALA A HB1  5  
ATOM 8131  H HB2  . ALA A 1 71  ? -7.432  10.171  -9.640  1.00 0.00 ? 71  ALA A HB2  5  
ATOM 8132  H HB3  . ALA A 1 71  ? -7.773  8.544   -10.229 1.00 0.00 ? 71  ALA A HB3  5  
ATOM 8133  N N    . GLN A 1 72  ? -7.019  6.194   -8.204  1.00 0.00 ? 72  GLN A N    5  
ATOM 8134  C CA   . GLN A 1 72  ? -7.519  4.926   -7.685  1.00 0.00 ? 72  GLN A CA   5  
ATOM 8135  C C    . GLN A 1 72  ? -6.847  4.577   -6.361  1.00 0.00 ? 72  GLN A C    5  
ATOM 8136  O O    . GLN A 1 72  ? -5.716  4.090   -6.336  1.00 0.00 ? 72  GLN A O    5  
ATOM 8137  C CB   . GLN A 1 72  ? -7.283  3.807   -8.701  1.00 0.00 ? 72  GLN A CB   5  
ATOM 8138  C CG   . GLN A 1 72  ? -7.548  2.416   -8.146  1.00 0.00 ? 72  GLN A CG   5  
ATOM 8139  C CD   . GLN A 1 72  ? -6.918  1.323   -8.986  1.00 0.00 ? 72  GLN A CD   5  
ATOM 8140  O OE1  . GLN A 1 72  ? -6.851  1.426   -10.211 1.00 0.00 ? 72  GLN A OE1  5  
ATOM 8141  N NE2  . GLN A 1 72  ? -6.451  0.267   -8.330  1.00 0.00 ? 72  GLN A NE2  5  
ATOM 8142  H H    . GLN A 1 72  ? -6.389  6.188   -8.954  1.00 0.00 ? 72  GLN A H    5  
ATOM 8143  H HA   . GLN A 1 72  ? -8.580  5.031   -7.519  1.00 0.00 ? 72  GLN A HA   5  
ATOM 8144  H HB2  . GLN A 1 72  ? -7.933  3.963   -9.548  1.00 0.00 ? 72  GLN A HB2  5  
ATOM 8145  H HB3  . GLN A 1 72  ? -6.256  3.848   -9.032  1.00 0.00 ? 72  GLN A HB3  5  
ATOM 8146  H HG2  . GLN A 1 72  ? -7.144  2.358   -7.146  1.00 0.00 ? 72  GLN A HG2  5  
ATOM 8147  H HG3  . GLN A 1 72  ? -8.615  2.254   -8.112  1.00 0.00 ? 72  GLN A HG3  5  
ATOM 8148  H HE21 . GLN A 1 72  ? -6.540  0.253   -7.353  1.00 0.00 ? 72  GLN A HE21 5  
ATOM 8149  H HE22 . GLN A 1 72  ? -6.039  -0.455  -8.847  1.00 0.00 ? 72  GLN A HE22 5  
ATOM 8150  N N    . THR A 1 73  ? -7.549  4.830   -5.262  1.00 0.00 ? 73  THR A N    5  
ATOM 8151  C CA   . THR A 1 73  ? -7.021  4.545   -3.934  1.00 0.00 ? 73  THR A CA   5  
ATOM 8152  C C    . THR A 1 73  ? -7.533  3.207   -3.414  1.00 0.00 ? 73  THR A C    5  
ATOM 8153  O O    . THR A 1 73  ? -7.734  3.033   -2.212  1.00 0.00 ? 73  THR A O    5  
ATOM 8154  C CB   . THR A 1 73  ? -7.396  5.651   -2.930  1.00 0.00 ? 73  THR A CB   5  
ATOM 8155  O OG1  . THR A 1 73  ? -8.820  5.732   -2.800  1.00 0.00 ? 73  THR A OG1  5  
ATOM 8156  C CG2  . THR A 1 73  ? -6.846  6.997   -3.376  1.00 0.00 ? 73  THR A CG2  5  
ATOM 8157  H H    . THR A 1 73  ? -8.445  5.219   -5.347  1.00 0.00 ? 73  THR A H    5  
ATOM 8158  H HA   . THR A 1 73  ? -5.943  4.504   -4.006  1.00 0.00 ? 73  THR A HA   5  
ATOM 8159  H HB   . THR A 1 73  ? -6.968  5.404   -1.969  1.00 0.00 ? 73  THR A HB   5  
ATOM 8160  H HG1  . THR A 1 73  ? -9.235  5.335   -3.570  1.00 0.00 ? 73  THR A HG1  5  
ATOM 8161  H HG21 . THR A 1 73  ? -5.942  7.215   -2.828  1.00 0.00 ? 73  THR A HG21 5  
ATOM 8162  H HG22 . THR A 1 73  ? -7.578  7.767   -3.184  1.00 0.00 ? 73  THR A HG22 5  
ATOM 8163  H HG23 . THR A 1 73  ? -6.626  6.963   -4.433  1.00 0.00 ? 73  THR A HG23 5  
ATOM 8164  N N    . SER A 1 74  ? -7.742  2.263   -4.326  1.00 0.00 ? 74  SER A N    5  
ATOM 8165  C CA   . SER A 1 74  ? -8.234  0.941   -3.960  1.00 0.00 ? 74  SER A CA   5  
ATOM 8166  C C    . SER A 1 74  ? -7.879  -0.087  -5.029  1.00 0.00 ? 74  SER A C    5  
ATOM 8167  O O    . SER A 1 74  ? -8.138  0.118   -6.215  1.00 0.00 ? 74  SER A O    5  
ATOM 8168  C CB   . SER A 1 74  ? -9.750  0.976   -3.754  1.00 0.00 ? 74  SER A CB   5  
ATOM 8169  O OG   . SER A 1 74  ? -10.406 1.509   -4.891  1.00 0.00 ? 74  SER A OG   5  
ATOM 8170  H H    . SER A 1 74  ? -7.563  2.463   -5.269  1.00 0.00 ? 74  SER A H    5  
ATOM 8171  H HA   . SER A 1 74  ? -7.761  0.656   -3.032  1.00 0.00 ? 74  SER A HA   5  
ATOM 8172  H HB2  . SER A 1 74  ? -10.111 -0.026  -3.582  1.00 0.00 ? 74  SER A HB2  5  
ATOM 8173  H HB3  . SER A 1 74  ? -9.980  1.594   -2.898  1.00 0.00 ? 74  SER A HB3  5  
ATOM 8174  H HG   . SER A 1 74  ? -11.310 1.188   -4.919  1.00 0.00 ? 74  SER A HG   5  
ATOM 8175  N N    . VAL A 1 75  ? -7.283  -1.196  -4.601  1.00 0.00 ? 75  VAL A N    5  
ATOM 8176  C CA   . VAL A 1 75  ? -6.892  -2.258  -5.521  1.00 0.00 ? 75  VAL A CA   5  
ATOM 8177  C C    . VAL A 1 75  ? -7.355  -3.620  -5.016  1.00 0.00 ? 75  VAL A C    5  
ATOM 8178  O O    . VAL A 1 75  ? -7.247  -3.924  -3.828  1.00 0.00 ? 75  VAL A O    5  
ATOM 8179  C CB   . VAL A 1 75  ? -5.366  -2.290  -5.725  1.00 0.00 ? 75  VAL A CB   5  
ATOM 8180  C CG1  . VAL A 1 75  ? -4.667  -2.753  -4.455  1.00 0.00 ? 75  VAL A CG1  5  
ATOM 8181  C CG2  . VAL A 1 75  ? -5.005  -3.186  -6.900  1.00 0.00 ? 75  VAL A CG2  5  
ATOM 8182  H H    . VAL A 1 75  ? -7.103  -1.303  -3.644  1.00 0.00 ? 75  VAL A H    5  
ATOM 8183  H HA   . VAL A 1 75  ? -7.358  -2.061  -6.475  1.00 0.00 ? 75  VAL A HA   5  
ATOM 8184  H HB   . VAL A 1 75  ? -5.032  -1.287  -5.947  1.00 0.00 ? 75  VAL A HB   5  
ATOM 8185  H HG11 . VAL A 1 75  ? -5.052  -3.720  -4.166  1.00 0.00 ? 75  VAL A HG11 5  
ATOM 8186  H HG12 . VAL A 1 75  ? -3.604  -2.826  -4.635  1.00 0.00 ? 75  VAL A HG12 5  
ATOM 8187  H HG13 . VAL A 1 75  ? -4.850  -2.042  -3.664  1.00 0.00 ? 75  VAL A HG13 5  
ATOM 8188  H HG21 . VAL A 1 75  ? -4.246  -3.892  -6.595  1.00 0.00 ? 75  VAL A HG21 5  
ATOM 8189  H HG22 . VAL A 1 75  ? -5.884  -3.720  -7.228  1.00 0.00 ? 75  VAL A HG22 5  
ATOM 8190  H HG23 . VAL A 1 75  ? -4.627  -2.581  -7.712  1.00 0.00 ? 75  VAL A HG23 5  
ATOM 8191  N N    . VAL A 1 76  ? -7.872  -4.438  -5.927  1.00 0.00 ? 76  VAL A N    5  
ATOM 8192  C CA   . VAL A 1 76  ? -8.350  -5.770  -5.575  1.00 0.00 ? 76  VAL A CA   5  
ATOM 8193  C C    . VAL A 1 76  ? -7.245  -6.809  -5.726  1.00 0.00 ? 76  VAL A C    5  
ATOM 8194  O O    . VAL A 1 76  ? -6.709  -7.008  -6.816  1.00 0.00 ? 76  VAL A O    5  
ATOM 8195  C CB   . VAL A 1 76  ? -9.550  -6.184  -6.448  1.00 0.00 ? 76  VAL A CB   5  
ATOM 8196  C CG1  . VAL A 1 76  ? -9.994  -7.599  -6.109  1.00 0.00 ? 76  VAL A CG1  5  
ATOM 8197  C CG2  . VAL A 1 76  ? -10.698 -5.200  -6.275  1.00 0.00 ? 76  VAL A CG2  5  
ATOM 8198  H H    . VAL A 1 76  ? -7.932  -4.140  -6.859  1.00 0.00 ? 76  VAL A H    5  
ATOM 8199  H HA   . VAL A 1 76  ? -8.672  -5.747  -4.544  1.00 0.00 ? 76  VAL A HA   5  
ATOM 8200  H HB   . VAL A 1 76  ? -9.241  -6.165  -7.482  1.00 0.00 ? 76  VAL A HB   5  
ATOM 8201  H HG11 . VAL A 1 76  ? -10.508 -8.027  -6.957  1.00 0.00 ? 76  VAL A HG11 5  
ATOM 8202  H HG12 . VAL A 1 76  ? -9.130  -8.200  -5.869  1.00 0.00 ? 76  VAL A HG12 5  
ATOM 8203  H HG13 . VAL A 1 76  ? -10.662 -7.573  -5.260  1.00 0.00 ? 76  VAL A HG13 5  
ATOM 8204  H HG21 . VAL A 1 76  ? -11.545 -5.529  -6.858  1.00 0.00 ? 76  VAL A HG21 5  
ATOM 8205  H HG22 . VAL A 1 76  ? -10.975 -5.151  -5.233  1.00 0.00 ? 76  VAL A HG22 5  
ATOM 8206  H HG23 . VAL A 1 76  ? -10.388 -4.222  -6.612  1.00 0.00 ? 76  VAL A HG23 5  
ATOM 8207  N N    . VAL A 1 77  ? -6.907  -7.470  -4.623  1.00 0.00 ? 77  VAL A N    5  
ATOM 8208  C CA   . VAL A 1 77  ? -5.866  -8.490  -4.631  1.00 0.00 ? 77  VAL A CA   5  
ATOM 8209  C C    . VAL A 1 77  ? -6.468  -9.890  -4.684  1.00 0.00 ? 77  VAL A C    5  
ATOM 8210  O O    . VAL A 1 77  ? -7.251  -10.272 -3.815  1.00 0.00 ? 77  VAL A O    5  
ATOM 8211  C CB   . VAL A 1 77  ? -4.961  -8.379  -3.390  1.00 0.00 ? 77  VAL A CB   5  
ATOM 8212  C CG1  . VAL A 1 77  ? -3.931  -9.498  -3.378  1.00 0.00 ? 77  VAL A CG1  5  
ATOM 8213  C CG2  . VAL A 1 77  ? -4.283  -7.018  -3.345  1.00 0.00 ? 77  VAL A CG2  5  
ATOM 8214  H H    . VAL A 1 77  ? -7.370  -7.267  -3.783  1.00 0.00 ? 77  VAL A H    5  
ATOM 8215  H HA   . VAL A 1 77  ? -5.256  -8.338  -5.510  1.00 0.00 ? 77  VAL A HA   5  
ATOM 8216  H HB   . VAL A 1 77  ? -5.579  -8.480  -2.509  1.00 0.00 ? 77  VAL A HB   5  
ATOM 8217  H HG11 . VAL A 1 77  ? -3.437  -9.542  -4.338  1.00 0.00 ? 77  VAL A HG11 5  
ATOM 8218  H HG12 . VAL A 1 77  ? -3.201  -9.308  -2.604  1.00 0.00 ? 77  VAL A HG12 5  
ATOM 8219  H HG13 . VAL A 1 77  ? -4.424  -10.440 -3.185  1.00 0.00 ? 77  VAL A HG13 5  
ATOM 8220  H HG21 . VAL A 1 77  ? -3.229  -7.147  -3.150  1.00 0.00 ? 77  VAL A HG21 5  
ATOM 8221  H HG22 . VAL A 1 77  ? -4.416  -6.519  -4.293  1.00 0.00 ? 77  VAL A HG22 5  
ATOM 8222  H HG23 . VAL A 1 77  ? -4.724  -6.422  -2.559  1.00 0.00 ? 77  VAL A HG23 5  
ATOM 8223  N N    . GLU A 1 78  ? -6.097  -10.649 -5.710  1.00 0.00 ? 78  GLU A N    5  
ATOM 8224  C CA   . GLU A 1 78  ? -6.602  -12.007 -5.877  1.00 0.00 ? 78  GLU A CA   5  
ATOM 8225  C C    . GLU A 1 78  ? -5.454  -12.996 -6.060  1.00 0.00 ? 78  GLU A C    5  
ATOM 8226  O O    . GLU A 1 78  ? -4.283  -12.620 -6.006  1.00 0.00 ? 78  GLU A O    5  
ATOM 8227  C CB   . GLU A 1 78  ? -7.549  -12.080 -7.076  1.00 0.00 ? 78  GLU A CB   5  
ATOM 8228  C CG   . GLU A 1 78  ? -8.772  -11.188 -6.942  1.00 0.00 ? 78  GLU A CG   5  
ATOM 8229  C CD   . GLU A 1 78  ? -9.796  -11.434 -8.032  1.00 0.00 ? 78  GLU A CD   5  
ATOM 8230  O OE1  . GLU A 1 78  ? -9.704  -10.781 -9.092  1.00 0.00 ? 78  GLU A OE1  5  
ATOM 8231  O OE2  . GLU A 1 78  ? -10.691 -12.280 -7.824  1.00 0.00 ? 78  GLU A OE2  5  
ATOM 8232  H H    . GLU A 1 78  ? -5.470  -10.288 -6.371  1.00 0.00 ? 78  GLU A H    5  
ATOM 8233  H HA   . GLU A 1 78  ? -7.148  -12.270 -4.983  1.00 0.00 ? 78  GLU A HA   5  
ATOM 8234  H HB2  . GLU A 1 78  ? -7.009  -11.785 -7.964  1.00 0.00 ? 78  GLU A HB2  5  
ATOM 8235  H HB3  . GLU A 1 78  ? -7.885  -13.100 -7.193  1.00 0.00 ? 78  GLU A HB3  5  
ATOM 8236  H HG2  . GLU A 1 78  ? -9.235  -11.376 -5.985  1.00 0.00 ? 78  GLU A HG2  5  
ATOM 8237  H HG3  . GLU A 1 78  ? -8.456  -10.156 -6.991  1.00 0.00 ? 78  GLU A HG3  5  
ATOM 8238  N N    . ASP A 1 79  ? -5.799  -14.260 -6.276  1.00 0.00 ? 79  ASP A N    5  
ATOM 8239  C CA   . ASP A 1 79  ? -4.799  -15.303 -6.468  1.00 0.00 ? 79  ASP A CA   5  
ATOM 8240  C C    . ASP A 1 79  ? -3.939  -15.469 -5.219  1.00 0.00 ? 79  ASP A C    5  
ATOM 8241  O O    . ASP A 1 79  ? -2.711  -15.521 -5.300  1.00 0.00 ? 79  ASP A O    5  
ATOM 8242  C CB   . ASP A 1 79  ? -3.913  -14.976 -7.672  1.00 0.00 ? 79  ASP A CB   5  
ATOM 8243  C CG   . ASP A 1 79  ? -4.476  -15.520 -8.970  1.00 0.00 ? 79  ASP A CG   5  
ATOM 8244  O OD1  . ASP A 1 79  ? -5.534  -15.025 -9.411  1.00 0.00 ? 79  ASP A OD1  5  
ATOM 8245  O OD2  . ASP A 1 79  ? -3.860  -16.442 -9.544  1.00 0.00 ? 79  ASP A OD2  5  
ATOM 8246  H H    . ASP A 1 79  ? -6.750  -14.497 -6.308  1.00 0.00 ? 79  ASP A H    5  
ATOM 8247  H HA   . ASP A 1 79  ? -5.319  -16.231 -6.657  1.00 0.00 ? 79  ASP A HA   5  
ATOM 8248  H HB2  . ASP A 1 79  ? -3.823  -13.903 -7.762  1.00 0.00 ? 79  ASP A HB2  5  
ATOM 8249  H HB3  . ASP A 1 79  ? -2.934  -15.404 -7.517  1.00 0.00 ? 79  ASP A HB3  5  
ATOM 8250  N N    . LEU A 1 80  ? -4.592  -15.550 -4.065  1.00 0.00 ? 80  LEU A N    5  
ATOM 8251  C CA   . LEU A 1 80  ? -3.888  -15.708 -2.797  1.00 0.00 ? 80  LEU A CA   5  
ATOM 8252  C C    . LEU A 1 80  ? -4.082  -17.114 -2.238  1.00 0.00 ? 80  LEU A C    5  
ATOM 8253  O O    . LEU A 1 80  ? -4.732  -17.956 -2.859  1.00 0.00 ? 80  LEU A O    5  
ATOM 8254  C CB   . LEU A 1 80  ? -4.379  -14.672 -1.785  1.00 0.00 ? 80  LEU A CB   5  
ATOM 8255  C CG   . LEU A 1 80  ? -4.432  -13.225 -2.277  1.00 0.00 ? 80  LEU A CG   5  
ATOM 8256  C CD1  . LEU A 1 80  ? -5.542  -12.461 -1.571  1.00 0.00 ? 80  LEU A CD1  5  
ATOM 8257  C CD2  . LEU A 1 80  ? -3.091  -12.540 -2.064  1.00 0.00 ? 80  LEU A CD2  5  
ATOM 8258  H H    . LEU A 1 80  ? -5.570  -15.502 -4.064  1.00 0.00 ? 80  LEU A H    5  
ATOM 8259  H HA   . LEU A 1 80  ? -2.835  -15.549 -2.981  1.00 0.00 ? 80  LEU A HA   5  
ATOM 8260  H HB2  . LEU A 1 80  ? -5.375  -14.954 -1.480  1.00 0.00 ? 80  LEU A HB2  5  
ATOM 8261  H HB3  . LEU A 1 80  ? -3.719  -14.707 -0.930  1.00 0.00 ? 80  LEU A HB3  5  
ATOM 8262  H HG   . LEU A 1 80  ? -4.647  -13.220 -3.337  1.00 0.00 ? 80  LEU A HG   5  
ATOM 8263  H HD11 . LEU A 1 80  ? -6.482  -12.653 -2.066  1.00 0.00 ? 80  LEU A HD11 5  
ATOM 8264  H HD12 . LEU A 1 80  ? -5.327  -11.404 -1.603  1.00 0.00 ? 80  LEU A HD12 5  
ATOM 8265  H HD13 . LEU A 1 80  ? -5.603  -12.785 -0.542  1.00 0.00 ? 80  LEU A HD13 5  
ATOM 8266  H HD21 . LEU A 1 80  ? -2.351  -13.275 -1.786  1.00 0.00 ? 80  LEU A HD21 5  
ATOM 8267  H HD22 . LEU A 1 80  ? -3.183  -11.805 -1.278  1.00 0.00 ? 80  LEU A HD22 5  
ATOM 8268  H HD23 . LEU A 1 80  ? -2.787  -12.051 -2.979  1.00 0.00 ? 80  LEU A HD23 5  
ATOM 8269  N N    . LEU A 1 81  ? -3.517  -17.360 -1.061  1.00 0.00 ? 81  LEU A N    5  
ATOM 8270  C CA   . LEU A 1 81  ? -3.630  -18.664 -0.417  1.00 0.00 ? 81  LEU A CA   5  
ATOM 8271  C C    . LEU A 1 81  ? -4.580  -18.602 0.775   1.00 0.00 ? 81  LEU A C    5  
ATOM 8272  O O    . LEU A 1 81  ? -4.589  -17.639 1.543   1.00 0.00 ? 81  LEU A O    5  
ATOM 8273  C CB   . LEU A 1 81  ? -2.253  -19.151 0.039   1.00 0.00 ? 81  LEU A CB   5  
ATOM 8274  C CG   . LEU A 1 81  ? -1.307  -19.620 -1.067  1.00 0.00 ? 81  LEU A CG   5  
ATOM 8275  C CD1  . LEU A 1 81  ? 0.128   -19.653 -0.563  1.00 0.00 ? 81  LEU A CD1  5  
ATOM 8276  C CD2  . LEU A 1 81  ? -1.726  -20.990 -1.581  1.00 0.00 ? 81  LEU A CD2  5  
ATOM 8277  H H    . LEU A 1 81  ? -3.011  -16.650 -0.615  1.00 0.00 ? 81  LEU A H    5  
ATOM 8278  H HA   . LEU A 1 81  ? -4.026  -19.359 -1.142  1.00 0.00 ? 81  LEU A HA   5  
ATOM 8279  H HB2  . LEU A 1 81  ? -1.772  -18.339 0.563   1.00 0.00 ? 81  LEU A HB2  5  
ATOM 8280  H HB3  . LEU A 1 81  ? -2.403  -19.976 0.720   1.00 0.00 ? 81  LEU A HB3  5  
ATOM 8281  H HG   . LEU A 1 81  ? -1.354  -18.923 -1.892  1.00 0.00 ? 81  LEU A HG   5  
ATOM 8282  H HD11 . LEU A 1 81  ? 0.136   -19.523 0.508   1.00 0.00 ? 81  LEU A HD11 5  
ATOM 8283  H HD12 . LEU A 1 81  ? 0.691   -18.857 -1.028  1.00 0.00 ? 81  LEU A HD12 5  
ATOM 8284  H HD13 . LEU A 1 81  ? 0.575   -20.604 -0.815  1.00 0.00 ? 81  LEU A HD13 5  
ATOM 8285  H HD21 . LEU A 1 81  ? -2.498  -20.874 -2.326  1.00 0.00 ? 81  LEU A HD21 5  
ATOM 8286  H HD22 . LEU A 1 81  ? -2.103  -21.582 -0.760  1.00 0.00 ? 81  LEU A HD22 5  
ATOM 8287  H HD23 . LEU A 1 81  ? -0.872  -21.486 -2.020  1.00 0.00 ? 81  LEU A HD23 5  
ATOM 8288  N N    . PRO A 1 82  ? -5.397  -19.653 0.936   1.00 0.00 ? 82  PRO A N    5  
ATOM 8289  C CA   . PRO A 1 82  ? -6.365  -19.742 2.034   1.00 0.00 ? 82  PRO A CA   5  
ATOM 8290  C C    . PRO A 1 82  ? -5.689  -19.936 3.387   1.00 0.00 ? 82  PRO A C    5  
ATOM 8291  O O    . PRO A 1 82  ? -4.655  -20.595 3.486   1.00 0.00 ? 82  PRO A O    5  
ATOM 8292  C CB   . PRO A 1 82  ? -7.199  -20.973 1.672   1.00 0.00 ? 82  PRO A CB   5  
ATOM 8293  C CG   . PRO A 1 82  ? -6.301  -21.803 0.822   1.00 0.00 ? 82  PRO A CG   5  
ATOM 8294  C CD   . PRO A 1 82  ? -5.441  -20.834 0.059   1.00 0.00 ? 82  PRO A CD   5  
ATOM 8295  H HA   . PRO A 1 82  ? -7.002  -18.871 2.073   1.00 0.00 ? 82  PRO A HA   5  
ATOM 8296  H HB2  . PRO A 1 82  ? -7.485  -21.495 2.574   1.00 0.00 ? 82  PRO A HB2  5  
ATOM 8297  H HB3  . PRO A 1 82  ? -8.082  -20.667 1.131   1.00 0.00 ? 82  PRO A HB3  5  
ATOM 8298  H HG2  . PRO A 1 82  ? -5.689  -22.438 1.445   1.00 0.00 ? 82  PRO A HG2  5  
ATOM 8299  H HG3  . PRO A 1 82  ? -6.889  -22.399 0.140   1.00 0.00 ? 82  PRO A HG3  5  
ATOM 8300  H HD2  . PRO A 1 82  ? -4.452  -21.242 -0.088  1.00 0.00 ? 82  PRO A HD2  5  
ATOM 8301  H HD3  . PRO A 1 82  ? -5.896  -20.593 -0.890  1.00 0.00 ? 82  PRO A HD3  5  
ATOM 8302  N N    . ASN A 1 83  ? -6.281  -19.358 4.427   1.00 0.00 ? 83  ASN A N    5  
ATOM 8303  C CA   . ASN A 1 83  ? -5.735  -19.468 5.776   1.00 0.00 ? 83  ASN A CA   5  
ATOM 8304  C C    . ASN A 1 83  ? -4.246  -19.134 5.789   1.00 0.00 ? 83  ASN A C    5  
ATOM 8305  O O    . ASN A 1 83  ? -3.436  -19.882 6.337   1.00 0.00 ? 83  ASN A O    5  
ATOM 8306  C CB   . ASN A 1 83  ? -5.958  -20.878 6.325   1.00 0.00 ? 83  ASN A CB   5  
ATOM 8307  C CG   . ASN A 1 83  ? -7.412  -21.143 6.664   1.00 0.00 ? 83  ASN A CG   5  
ATOM 8308  O OD1  . ASN A 1 83  ? -7.726  -21.666 7.734   1.00 0.00 ? 83  ASN A OD1  5  
ATOM 8309  N ND2  . ASN A 1 83  ? -8.307  -20.783 5.752   1.00 0.00 ? 83  ASN A ND2  5  
ATOM 8310  H H    . ASN A 1 83  ? -7.103  -18.845 4.285   1.00 0.00 ? 83  ASN A H    5  
ATOM 8311  H HA   . ASN A 1 83  ? -6.256  -18.760 6.403   1.00 0.00 ? 83  ASN A HA   5  
ATOM 8312  H HB2  . ASN A 1 83  ? -5.644  -21.600 5.585   1.00 0.00 ? 83  ASN A HB2  5  
ATOM 8313  H HB3  . ASN A 1 83  ? -5.369  -21.007 7.221   1.00 0.00 ? 83  ASN A HB3  5  
ATOM 8314  H HD21 . ASN A 1 83  ? -7.984  -20.372 4.923   1.00 0.00 ? 83  ASN A HD21 5  
ATOM 8315  H HD22 . ASN A 1 83  ? -9.255  -20.942 5.946   1.00 0.00 ? 83  ASN A HD22 5  
ATOM 8316  N N    . HIS A 1 84  ? -3.893  -18.005 5.181   1.00 0.00 ? 84  HIS A N    5  
ATOM 8317  C CA   . HIS A 1 84  ? -2.502  -17.571 5.124   1.00 0.00 ? 84  HIS A CA   5  
ATOM 8318  C C    . HIS A 1 84  ? -2.393  -16.065 5.341   1.00 0.00 ? 84  HIS A C    5  
ATOM 8319  O O    . HIS A 1 84  ? -3.082  -15.283 4.687   1.00 0.00 ? 84  HIS A O    5  
ATOM 8320  C CB   . HIS A 1 84  ? -1.882  -17.950 3.779   1.00 0.00 ? 84  HIS A CB   5  
ATOM 8321  C CG   . HIS A 1 84  ? -1.276  -19.320 3.763   1.00 0.00 ? 84  HIS A CG   5  
ATOM 8322  N ND1  . HIS A 1 84  ? -2.001  -20.460 3.488   1.00 0.00 ? 84  HIS A ND1  5  
ATOM 8323  C CD2  . HIS A 1 84  ? -0.006  -19.729 3.988   1.00 0.00 ? 84  HIS A CD2  5  
ATOM 8324  C CE1  . HIS A 1 84  ? -1.203  -21.512 3.546   1.00 0.00 ? 84  HIS A CE1  5  
ATOM 8325  N NE2  . HIS A 1 84  ? 0.013   -21.095 3.848   1.00 0.00 ? 84  HIS A NE2  5  
ATOM 8326  H H    . HIS A 1 84  ? -4.584  -17.452 4.762   1.00 0.00 ? 84  HIS A H    5  
ATOM 8327  H HA   . HIS A 1 84  ? -1.964  -18.076 5.913   1.00 0.00 ? 84  HIS A HA   5  
ATOM 8328  H HB2  . HIS A 1 84  ? -2.646  -17.917 3.016   1.00 0.00 ? 84  HIS A HB2  5  
ATOM 8329  H HB3  . HIS A 1 84  ? -1.105  -17.240 3.534   1.00 0.00 ? 84  HIS A HB3  5  
ATOM 8330  H HD2  . HIS A 1 84  ? 0.837   -19.098 4.233   1.00 0.00 ? 84  HIS A HD2  5  
ATOM 8331  H HE1  . HIS A 1 84  ? -1.495  -22.537 3.377   1.00 0.00 ? 84  HIS A HE1  5  
ATOM 8332  H HE2  . HIS A 1 84  ? 0.778   -21.677 4.037   1.00 0.00 ? 84  HIS A HE2  5  
ATOM 8333  N N    . SER A 1 85  ? -1.524  -15.666 6.264   1.00 0.00 ? 85  SER A N    5  
ATOM 8334  C CA   . SER A 1 85  ? -1.328  -14.254 6.571   1.00 0.00 ? 85  SER A CA   5  
ATOM 8335  C C    . SER A 1 85  ? -0.504  -13.571 5.484   1.00 0.00 ? 85  SER A C    5  
ATOM 8336  O O    . SER A 1 85  ? 0.440   -14.152 4.948   1.00 0.00 ? 85  SER A O    5  
ATOM 8337  C CB   . SER A 1 85  ? -0.637  -14.096 7.927   1.00 0.00 ? 85  SER A CB   5  
ATOM 8338  O OG   . SER A 1 85  ? -1.349  -14.777 8.945   1.00 0.00 ? 85  SER A OG   5  
ATOM 8339  H H    . SER A 1 85  ? -1.003  -16.338 6.753   1.00 0.00 ? 85  SER A H    5  
ATOM 8340  H HA   . SER A 1 85  ? -2.301  -13.787 6.616   1.00 0.00 ? 85  SER A HA   5  
ATOM 8341  H HB2  . SER A 1 85  ? 0.361   -14.503 7.868   1.00 0.00 ? 85  SER A HB2  5  
ATOM 8342  H HB3  . SER A 1 85  ? -0.584  -13.047 8.180   1.00 0.00 ? 85  SER A HB3  5  
ATOM 8343  H HG   . SER A 1 85  ? -1.948  -14.166 9.380   1.00 0.00 ? 85  SER A HG   5  
ATOM 8344  N N    . TYR A 1 86  ? -0.869  -12.334 5.164   1.00 0.00 ? 86  TYR A N    5  
ATOM 8345  C CA   . TYR A 1 86  ? -0.165  -11.572 4.139   1.00 0.00 ? 86  TYR A CA   5  
ATOM 8346  C C    . TYR A 1 86  ? 0.029   -10.123 4.576   1.00 0.00 ? 86  TYR A C    5  
ATOM 8347  O O    . TYR A 1 86  ? -0.932  -9.427  4.905   1.00 0.00 ? 86  TYR A O    5  
ATOM 8348  C CB   . TYR A 1 86  ? -0.937  -11.619 2.819   1.00 0.00 ? 86  TYR A CB   5  
ATOM 8349  C CG   . TYR A 1 86  ? -0.703  -12.886 2.027   1.00 0.00 ? 86  TYR A CG   5  
ATOM 8350  C CD1  . TYR A 1 86  ? 0.352   -12.982 1.129   1.00 0.00 ? 86  TYR A CD1  5  
ATOM 8351  C CD2  . TYR A 1 86  ? -1.538  -13.986 2.177   1.00 0.00 ? 86  TYR A CD2  5  
ATOM 8352  C CE1  . TYR A 1 86  ? 0.569   -14.137 0.402   1.00 0.00 ? 86  TYR A CE1  5  
ATOM 8353  C CE2  . TYR A 1 86  ? -1.328  -15.146 1.456   1.00 0.00 ? 86  TYR A CE2  5  
ATOM 8354  C CZ   . TYR A 1 86  ? -0.274  -15.216 0.569   1.00 0.00 ? 86  TYR A CZ   5  
ATOM 8355  O OH   . TYR A 1 86  ? -0.061  -16.369 -0.152  1.00 0.00 ? 86  TYR A OH   5  
ATOM 8356  H H    . TYR A 1 86  ? -1.629  -11.925 5.626   1.00 0.00 ? 86  TYR A H    5  
ATOM 8357  H HA   . TYR A 1 86  ? 0.804   -12.025 3.995   1.00 0.00 ? 86  TYR A HA   5  
ATOM 8358  H HB2  . TYR A 1 86  ? -1.994  -11.548 3.025   1.00 0.00 ? 86  TYR A HB2  5  
ATOM 8359  H HB3  . TYR A 1 86  ? -0.637  -10.783 2.205   1.00 0.00 ? 86  TYR A HB3  5  
ATOM 8360  H HD1  . TYR A 1 86  ? 1.011   -12.135 1.001   1.00 0.00 ? 86  TYR A HD1  5  
ATOM 8361  H HD2  . TYR A 1 86  ? -2.363  -13.928 2.872   1.00 0.00 ? 86  TYR A HD2  5  
ATOM 8362  H HE1  . TYR A 1 86  ? 1.395   -14.192 -0.292  1.00 0.00 ? 86  TYR A HE1  5  
ATOM 8363  H HE2  . TYR A 1 86  ? -1.988  -15.991 1.586   1.00 0.00 ? 86  TYR A HE2  5  
ATOM 8364  H HH   . TYR A 1 86  ? -0.769  -16.482 -0.790  1.00 0.00 ? 86  TYR A HH   5  
ATOM 8365  N N    . VAL A 1 87  ? 1.280   -9.674  4.575   1.00 0.00 ? 87  VAL A N    5  
ATOM 8366  C CA   . VAL A 1 87  ? 1.603   -8.308  4.969   1.00 0.00 ? 87  VAL A CA   5  
ATOM 8367  C C    . VAL A 1 87  ? 1.515   -7.358  3.779   1.00 0.00 ? 87  VAL A C    5  
ATOM 8368  O O    . VAL A 1 87  ? 2.397   -7.338  2.921   1.00 0.00 ? 87  VAL A O    5  
ATOM 8369  C CB   . VAL A 1 87  ? 3.013   -8.218  5.580   1.00 0.00 ? 87  VAL A CB   5  
ATOM 8370  C CG1  . VAL A 1 87  ? 4.053   -8.748  4.604   1.00 0.00 ? 87  VAL A CG1  5  
ATOM 8371  C CG2  . VAL A 1 87  ? 3.329   -6.786  5.983   1.00 0.00 ? 87  VAL A CG2  5  
ATOM 8372  H H    . VAL A 1 87  ? 2.003   -10.276 4.302   1.00 0.00 ? 87  VAL A H    5  
ATOM 8373  H HA   . VAL A 1 87  ? 0.888   -7.999  5.718   1.00 0.00 ? 87  VAL A HA   5  
ATOM 8374  H HB   . VAL A 1 87  ? 3.039   -8.833  6.468   1.00 0.00 ? 87  VAL A HB   5  
ATOM 8375  H HG11 . VAL A 1 87  ? 4.673   -7.932  4.262   1.00 0.00 ? 87  VAL A HG11 5  
ATOM 8376  H HG12 . VAL A 1 87  ? 4.667   -9.486  5.098   1.00 0.00 ? 87  VAL A HG12 5  
ATOM 8377  H HG13 . VAL A 1 87  ? 3.556   -9.200  3.759   1.00 0.00 ? 87  VAL A HG13 5  
ATOM 8378  H HG21 . VAL A 1 87  ? 3.269   -6.692  7.057   1.00 0.00 ? 87  VAL A HG21 5  
ATOM 8379  H HG22 . VAL A 1 87  ? 4.325   -6.531  5.653   1.00 0.00 ? 87  VAL A HG22 5  
ATOM 8380  H HG23 . VAL A 1 87  ? 2.616   -6.116  5.523   1.00 0.00 ? 87  VAL A HG23 5  
ATOM 8381  N N    . PHE A 1 88  ? 0.445   -6.571  3.736   1.00 0.00 ? 88  PHE A N    5  
ATOM 8382  C CA   . PHE A 1 88  ? 0.241   -5.618  2.651   1.00 0.00 ? 88  PHE A CA   5  
ATOM 8383  C C    . PHE A 1 88  ? 0.899   -4.279  2.972   1.00 0.00 ? 88  PHE A C    5  
ATOM 8384  O O    . PHE A 1 88  ? 0.625   -3.674  4.009   1.00 0.00 ? 88  PHE A O    5  
ATOM 8385  C CB   . PHE A 1 88  ? -1.255  -5.416  2.396   1.00 0.00 ? 88  PHE A CB   5  
ATOM 8386  C CG   . PHE A 1 88  ? -1.915  -6.594  1.738   1.00 0.00 ? 88  PHE A CG   5  
ATOM 8387  C CD1  . PHE A 1 88  ? -2.039  -7.799  2.410   1.00 0.00 ? 88  PHE A CD1  5  
ATOM 8388  C CD2  . PHE A 1 88  ? -2.412  -6.495  0.449   1.00 0.00 ? 88  PHE A CD2  5  
ATOM 8389  C CE1  . PHE A 1 88  ? -2.646  -8.885  1.807   1.00 0.00 ? 88  PHE A CE1  5  
ATOM 8390  C CE2  . PHE A 1 88  ? -3.020  -7.578  -0.159  1.00 0.00 ? 88  PHE A CE2  5  
ATOM 8391  C CZ   . PHE A 1 88  ? -3.138  -8.773  0.521   1.00 0.00 ? 88  PHE A CZ   5  
ATOM 8392  H H    . PHE A 1 88  ? -0.224  -6.633  4.450   1.00 0.00 ? 88  PHE A H    5  
ATOM 8393  H HA   . PHE A 1 88  ? 0.697   -6.026  1.762   1.00 0.00 ? 88  PHE A HA   5  
ATOM 8394  H HB2  . PHE A 1 88  ? -1.753  -5.240  3.337   1.00 0.00 ? 88  PHE A HB2  5  
ATOM 8395  H HB3  . PHE A 1 88  ? -1.390  -4.557  1.755   1.00 0.00 ? 88  PHE A HB3  5  
ATOM 8396  H HD1  . PHE A 1 88  ? -1.656  -7.887  3.416   1.00 0.00 ? 88  PHE A HD1  5  
ATOM 8397  H HD2  . PHE A 1 88  ? -2.320  -5.560  -0.085  1.00 0.00 ? 88  PHE A HD2  5  
ATOM 8398  H HE1  . PHE A 1 88  ? -2.737  -9.818  2.341   1.00 0.00 ? 88  PHE A HE1  5  
ATOM 8399  H HE2  . PHE A 1 88  ? -3.404  -7.487  -1.165  1.00 0.00 ? 88  PHE A HE2  5  
ATOM 8400  H HZ   . PHE A 1 88  ? -3.612  -9.620  0.048   1.00 0.00 ? 88  PHE A HZ   5  
ATOM 8401  N N    . ARG A 1 89  ? 1.767   -3.824  2.076   1.00 0.00 ? 89  ARG A N    5  
ATOM 8402  C CA   . ARG A 1 89  ? 2.466   -2.558  2.264   1.00 0.00 ? 89  ARG A CA   5  
ATOM 8403  C C    . ARG A 1 89  ? 2.187   -1.605  1.105   1.00 0.00 ? 89  ARG A C    5  
ATOM 8404  O O    . ARG A 1 89  ? 2.855   -1.654  0.072   1.00 0.00 ? 89  ARG A O    5  
ATOM 8405  C CB   . ARG A 1 89  ? 3.972   -2.796  2.390   1.00 0.00 ? 89  ARG A CB   5  
ATOM 8406  C CG   . ARG A 1 89  ? 4.356   -3.639  3.595   1.00 0.00 ? 89  ARG A CG   5  
ATOM 8407  C CD   . ARG A 1 89  ? 5.740   -3.275  4.112   1.00 0.00 ? 89  ARG A CD   5  
ATOM 8408  N NE   . ARG A 1 89  ? 6.301   -4.323  4.959   1.00 0.00 ? 89  ARG A NE   5  
ATOM 8409  C CZ   . ARG A 1 89  ? 6.805   -5.458  4.488   1.00 0.00 ? 89  ARG A CZ   5  
ATOM 8410  N NH1  . ARG A 1 89  ? 6.819   -5.689  3.182   1.00 0.00 ? 89  ARG A NH1  5  
ATOM 8411  N NH2  . ARG A 1 89  ? 7.298   -6.364  5.322   1.00 0.00 ? 89  ARG A NH2  5  
ATOM 8412  H H    . ARG A 1 89  ? 1.943   -4.351  1.269   1.00 0.00 ? 89  ARG A H    5  
ATOM 8413  H HA   . ARG A 1 89  ? 2.104   -2.111  3.177   1.00 0.00 ? 89  ARG A HA   5  
ATOM 8414  H HB2  . ARG A 1 89  ? 4.321   -3.300  1.501   1.00 0.00 ? 89  ARG A HB2  5  
ATOM 8415  H HB3  . ARG A 1 89  ? 4.470   -1.842  2.472   1.00 0.00 ? 89  ARG A HB3  5  
ATOM 8416  H HG2  . ARG A 1 89  ? 3.636   -3.474  4.383   1.00 0.00 ? 89  ARG A HG2  5  
ATOM 8417  H HG3  . ARG A 1 89  ? 4.350   -4.681  3.311   1.00 0.00 ? 89  ARG A HG3  5  
ATOM 8418  H HD2  . ARG A 1 89  ? 6.395   -3.118  3.267   1.00 0.00 ? 89  ARG A HD2  5  
ATOM 8419  H HD3  . ARG A 1 89  ? 5.666   -2.362  4.684   1.00 0.00 ? 89  ARG A HD3  5  
ATOM 8420  H HE   . ARG A 1 89  ? 6.302   -4.172  5.927   1.00 0.00 ? 89  ARG A HE   5  
ATOM 8421  H HH11 . ARG A 1 89  ? 6.449   -5.008  2.551   1.00 0.00 ? 89  ARG A HH11 5  
ATOM 8422  H HH12 . ARG A 1 89  ? 7.200   -6.544  2.830   1.00 0.00 ? 89  ARG A HH12 5  
ATOM 8423  H HH21 . ARG A 1 89  ? 7.290   -6.193  6.307   1.00 0.00 ? 89  ARG A HH21 5  
ATOM 8424  H HH22 . ARG A 1 89  ? 7.677   -7.217  4.967   1.00 0.00 ? 89  ARG A HH22 5  
ATOM 8425  N N    . VAL A 1 90  ? 1.194   -0.739  1.284   1.00 0.00 ? 90  VAL A N    5  
ATOM 8426  C CA   . VAL A 1 90  ? 0.827   0.226   0.255   1.00 0.00 ? 90  VAL A CA   5  
ATOM 8427  C C    . VAL A 1 90  ? 1.696   1.475   0.336   1.00 0.00 ? 90  VAL A C    5  
ATOM 8428  O O    . VAL A 1 90  ? 2.246   1.794   1.391   1.00 0.00 ? 90  VAL A O    5  
ATOM 8429  C CB   . VAL A 1 90  ? -0.653  0.635   0.373   1.00 0.00 ? 90  VAL A CB   5  
ATOM 8430  C CG1  . VAL A 1 90  ? -0.979  1.749   -0.610  1.00 0.00 ? 90  VAL A CG1  5  
ATOM 8431  C CG2  . VAL A 1 90  ? -1.558  -0.567  0.148   1.00 0.00 ? 90  VAL A CG2  5  
ATOM 8432  H H    . VAL A 1 90  ? 0.699   -0.748  2.130   1.00 0.00 ? 90  VAL A H    5  
ATOM 8433  H HA   . VAL A 1 90  ? 0.973   -0.241  -0.708  1.00 0.00 ? 90  VAL A HA   5  
ATOM 8434  H HB   . VAL A 1 90  ? -0.825  1.007   1.373   1.00 0.00 ? 90  VAL A HB   5  
ATOM 8435  H HG11 . VAL A 1 90  ? -2.050  1.821   -0.731  1.00 0.00 ? 90  VAL A HG11 5  
ATOM 8436  H HG12 . VAL A 1 90  ? -0.595  2.686   -0.234  1.00 0.00 ? 90  VAL A HG12 5  
ATOM 8437  H HG13 . VAL A 1 90  ? -0.525  1.531   -1.565  1.00 0.00 ? 90  VAL A HG13 5  
ATOM 8438  H HG21 . VAL A 1 90  ? -1.268  -1.071  -0.761  1.00 0.00 ? 90  VAL A HG21 5  
ATOM 8439  H HG22 . VAL A 1 90  ? -1.467  -1.246  0.983   1.00 0.00 ? 90  VAL A HG22 5  
ATOM 8440  H HG23 . VAL A 1 90  ? -2.583  -0.236  0.065   1.00 0.00 ? 90  VAL A HG23 5  
ATOM 8441  N N    . ARG A 1 91  ? 1.817   2.180   -0.784  1.00 0.00 ? 91  ARG A N    5  
ATOM 8442  C CA   . ARG A 1 91  ? 2.621   3.394   -0.840  1.00 0.00 ? 91  ARG A CA   5  
ATOM 8443  C C    . ARG A 1 91  ? 2.278   4.217   -2.079  1.00 0.00 ? 91  ARG A C    5  
ATOM 8444  O O    . ARG A 1 91  ? 1.660   3.715   -3.018  1.00 0.00 ? 91  ARG A O    5  
ATOM 8445  C CB   . ARG A 1 91  ? 4.110   3.046   -0.843  1.00 0.00 ? 91  ARG A CB   5  
ATOM 8446  C CG   . ARG A 1 91  ? 4.508   2.080   -1.946  1.00 0.00 ? 91  ARG A CG   5  
ATOM 8447  C CD   . ARG A 1 91  ? 6.017   2.039   -2.134  1.00 0.00 ? 91  ARG A CD   5  
ATOM 8448  N NE   . ARG A 1 91  ? 6.407   1.176   -3.246  1.00 0.00 ? 91  ARG A NE   5  
ATOM 8449  C CZ   . ARG A 1 91  ? 7.661   0.812   -3.489  1.00 0.00 ? 91  ARG A CZ   5  
ATOM 8450  N NH1  . ARG A 1 91  ? 8.641   1.233   -2.702  1.00 0.00 ? 91  ARG A NH1  5  
ATOM 8451  N NH2  . ARG A 1 91  ? 7.936   0.025   -4.521  1.00 0.00 ? 91  ARG A NH2  5  
ATOM 8452  H H    . ARG A 1 91  ? 1.355   1.875   -1.593  1.00 0.00 ? 91  ARG A H    5  
ATOM 8453  H HA   . ARG A 1 91  ? 2.399   3.980   0.039   1.00 0.00 ? 91  ARG A HA   5  
ATOM 8454  H HB2  . ARG A 1 91  ? 4.681   3.955   -0.968  1.00 0.00 ? 91  ARG A HB2  5  
ATOM 8455  H HB3  . ARG A 1 91  ? 4.364   2.599   0.107   1.00 0.00 ? 91  ARG A HB3  5  
ATOM 8456  H HG2  . ARG A 1 91  ? 4.162   1.090   -1.687  1.00 0.00 ? 91  ARG A HG2  5  
ATOM 8457  H HG3  . ARG A 1 91  ? 4.047   2.394   -2.871  1.00 0.00 ? 91  ARG A HG3  5  
ATOM 8458  H HD2  . ARG A 1 91  ? 6.369   3.041   -2.327  1.00 0.00 ? 91  ARG A HD2  5  
ATOM 8459  H HD3  . ARG A 1 91  ? 6.469   1.667   -1.226  1.00 0.00 ? 91  ARG A HD3  5  
ATOM 8460  H HE   . ARG A 1 91  ? 5.698   0.854   -3.840  1.00 0.00 ? 91  ARG A HE   5  
ATOM 8461  H HH11 . ARG A 1 91  ? 8.436   1.826   -1.923  1.00 0.00 ? 91  ARG A HH11 5  
ATOM 8462  H HH12 . ARG A 1 91  ? 9.585   0.957   -2.887  1.00 0.00 ? 91  ARG A HH12 5  
ATOM 8463  H HH21 . ARG A 1 91  ? 7.200   -0.294  -5.117  1.00 0.00 ? 91  ARG A HH21 5  
ATOM 8464  H HH22 . ARG A 1 91  ? 8.880   -0.248  -4.704  1.00 0.00 ? 91  ARG A HH22 5  
ATOM 8465  N N    . ALA A 1 92  ? 2.683   5.483   -2.073  1.00 0.00 ? 92  ALA A N    5  
ATOM 8466  C CA   . ALA A 1 92  ? 2.420   6.374   -3.197  1.00 0.00 ? 92  ALA A CA   5  
ATOM 8467  C C    . ALA A 1 92  ? 3.716   6.785   -3.886  1.00 0.00 ? 92  ALA A C    5  
ATOM 8468  O O    . ALA A 1 92  ? 4.790   6.733   -3.289  1.00 0.00 ? 92  ALA A O    5  
ATOM 8469  C CB   . ALA A 1 92  ? 1.657   7.603   -2.727  1.00 0.00 ? 92  ALA A CB   5  
ATOM 8470  H H    . ALA A 1 92  ? 3.171   5.825   -1.296  1.00 0.00 ? 92  ALA A H    5  
ATOM 8471  H HA   . ALA A 1 92  ? 1.799   5.844   -3.905  1.00 0.00 ? 92  ALA A HA   5  
ATOM 8472  H HB1  . ALA A 1 92  ? 1.154   7.382   -1.798  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 8473  H HB2  . ALA A 1 92  ? 2.348   8.420   -2.577  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 8474  H HB3  . ALA A 1 92  ? 0.928   7.881   -3.474  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 8475  N N    . GLN A 1 93  ? 3.607   7.191   -5.147  1.00 0.00 ? 93  GLN A N    5  
ATOM 8476  C CA   . GLN A 1 93  ? 4.772   7.609   -5.918  1.00 0.00 ? 93  GLN A CA   5  
ATOM 8477  C C    . GLN A 1 93  ? 4.571   9.007   -6.493  1.00 0.00 ? 93  GLN A C    5  
ATOM 8478  O O    . GLN A 1 93  ? 3.553   9.289   -7.125  1.00 0.00 ? 93  GLN A O    5  
ATOM 8479  C CB   . GLN A 1 93  ? 5.046   6.615   -7.047  1.00 0.00 ? 93  GLN A CB   5  
ATOM 8480  C CG   . GLN A 1 93  ? 6.128   7.073   -8.012  1.00 0.00 ? 93  GLN A CG   5  
ATOM 8481  C CD   . GLN A 1 93  ? 5.932   6.524   -9.412  1.00 0.00 ? 93  GLN A CD   5  
ATOM 8482  O OE1  . GLN A 1 93  ? 5.544   7.249   -10.328 1.00 0.00 ? 93  GLN A OE1  5  
ATOM 8483  N NE2  . GLN A 1 93  ? 6.202   5.235   -9.584  1.00 0.00 ? 93  GLN A NE2  5  
ATOM 8484  H H    . GLN A 1 93  ? 2.723   7.210   -5.569  1.00 0.00 ? 93  GLN A H    5  
ATOM 8485  H HA   . GLN A 1 93  ? 5.621   7.627   -5.252  1.00 0.00 ? 93  GLN A HA   5  
ATOM 8486  H HB2  . GLN A 1 93  ? 5.354   5.674   -6.616  1.00 0.00 ? 93  GLN A HB2  5  
ATOM 8487  H HB3  . GLN A 1 93  ? 4.135   6.464   -7.607  1.00 0.00 ? 93  GLN A HB3  5  
ATOM 8488  H HG2  . GLN A 1 93  ? 6.115   8.152   -8.062  1.00 0.00 ? 93  GLN A HG2  5  
ATOM 8489  H HG3  . GLN A 1 93  ? 7.087   6.743   -7.642  1.00 0.00 ? 93  GLN A HG3  5  
ATOM 8490  H HE21 . GLN A 1 93  ? 6.506   4.718   -8.809  1.00 0.00 ? 93  GLN A HE21 5  
ATOM 8491  H HE22 . GLN A 1 93  ? 6.083   4.853   -10.478 1.00 0.00 ? 93  GLN A HE22 5  
ATOM 8492  N N    . SER A 1 94  ? 5.548   9.880   -6.270  1.00 0.00 ? 94  SER A N    5  
ATOM 8493  C CA   . SER A 1 94  ? 5.476   11.251  -6.762  1.00 0.00 ? 94  SER A CA   5  
ATOM 8494  C C    . SER A 1 94  ? 6.737   11.615  -7.541  1.00 0.00 ? 94  SER A C    5  
ATOM 8495  O O    . SER A 1 94  ? 7.689   10.837  -7.598  1.00 0.00 ? 94  SER A O    5  
ATOM 8496  C CB   . SER A 1 94  ? 5.283   12.224  -5.598  1.00 0.00 ? 94  SER A CB   5  
ATOM 8497  O OG   . SER A 1 94  ? 6.503   12.452  -4.916  1.00 0.00 ? 94  SER A OG   5  
ATOM 8498  H H    . SER A 1 94  ? 6.335   9.596   -5.759  1.00 0.00 ? 94  SER A H    5  
ATOM 8499  H HA   . SER A 1 94  ? 4.626   11.321  -7.424  1.00 0.00 ? 94  SER A HA   5  
ATOM 8500  H HB2  . SER A 1 94  ? 4.915   13.166  -5.977  1.00 0.00 ? 94  SER A HB2  5  
ATOM 8501  H HB3  . SER A 1 94  ? 4.566   11.811  -4.903  1.00 0.00 ? 94  SER A HB3  5  
ATOM 8502  H HG   . SER A 1 94  ? 6.754   13.374  -5.007  1.00 0.00 ? 94  SER A HG   5  
ATOM 8503  N N    . GLN A 1 95  ? 6.734   12.803  -8.137  1.00 0.00 ? 95  GLN A N    5  
ATOM 8504  C CA   . GLN A 1 95  ? 7.877   13.270  -8.912  1.00 0.00 ? 95  GLN A CA   5  
ATOM 8505  C C    . GLN A 1 95  ? 9.188   12.888  -8.234  1.00 0.00 ? 95  GLN A C    5  
ATOM 8506  O O    . GLN A 1 95  ? 10.125  12.429  -8.887  1.00 0.00 ? 95  GLN A O    5  
ATOM 8507  C CB   . GLN A 1 95  ? 7.808   14.787  -9.098  1.00 0.00 ? 95  GLN A CB   5  
ATOM 8508  C CG   . GLN A 1 95  ? 9.037   15.374  -9.774  1.00 0.00 ? 95  GLN A CG   5  
ATOM 8509  C CD   . GLN A 1 95  ? 8.724   16.628  -10.567 1.00 0.00 ? 95  GLN A CD   5  
ATOM 8510  O OE1  . GLN A 1 95  ? 8.469   17.689  -9.996  1.00 0.00 ? 95  GLN A OE1  5  
ATOM 8511  N NE2  . GLN A 1 95  ? 8.741   16.512  -11.890 1.00 0.00 ? 95  GLN A NE2  5  
ATOM 8512  H H    . GLN A 1 95  ? 5.945   13.377  -8.054  1.00 0.00 ? 95  GLN A H    5  
ATOM 8513  H HA   . GLN A 1 95  ? 7.836   12.796  -9.881  1.00 0.00 ? 95  GLN A HA   5  
ATOM 8514  H HB2  . GLN A 1 95  ? 6.944   15.026  -9.699  1.00 0.00 ? 95  GLN A HB2  5  
ATOM 8515  H HB3  . GLN A 1 95  ? 7.702   15.252  -8.128  1.00 0.00 ? 95  GLN A HB3  5  
ATOM 8516  H HG2  . GLN A 1 95  ? 9.767   15.618  -9.017  1.00 0.00 ? 95  GLN A HG2  5  
ATOM 8517  H HG3  . GLN A 1 95  ? 9.449   14.635  -10.445 1.00 0.00 ? 95  GLN A HG3  5  
ATOM 8518  H HE21 . GLN A 1 95  ? 8.951   15.635  -12.274 1.00 0.00 ? 95  GLN A HE21 5  
ATOM 8519  H HE22 . GLN A 1 95  ? 8.542   17.307  -12.426 1.00 0.00 ? 95  GLN A HE22 5  
ATOM 8520  N N    . GLU A 1 96  ? 9.247   13.080  -6.920  1.00 0.00 ? 96  GLU A N    5  
ATOM 8521  C CA   . GLU A 1 96  ? 10.445  12.756  -6.154  1.00 0.00 ? 96  GLU A CA   5  
ATOM 8522  C C    . GLU A 1 96  ? 10.721  11.256  -6.184  1.00 0.00 ? 96  GLU A C    5  
ATOM 8523  O O    . GLU A 1 96  ? 11.778  10.817  -6.635  1.00 0.00 ? 96  GLU A O    5  
ATOM 8524  C CB   . GLU A 1 96  ? 10.295  13.229  -4.707  1.00 0.00 ? 96  GLU A CB   5  
ATOM 8525  C CG   . GLU A 1 96  ? 10.745  14.664  -4.486  1.00 0.00 ? 96  GLU A CG   5  
ATOM 8526  C CD   . GLU A 1 96  ? 12.237  14.845  -4.687  1.00 0.00 ? 96  GLU A CD   5  
ATOM 8527  O OE1  . GLU A 1 96  ? 12.671  14.930  -5.856  1.00 0.00 ? 96  GLU A OE1  5  
ATOM 8528  O OE2  . GLU A 1 96  ? 12.970  14.902  -3.678  1.00 0.00 ? 96  GLU A OE2  5  
ATOM 8529  H H    . GLU A 1 96  ? 8.467   13.449  -6.455  1.00 0.00 ? 96  GLU A H    5  
ATOM 8530  H HA   . GLU A 1 96  ? 11.278  13.272  -6.607  1.00 0.00 ? 96  GLU A HA   5  
ATOM 8531  H HB2  . GLU A 1 96  ? 9.257   13.151  -4.420  1.00 0.00 ? 96  GLU A HB2  5  
ATOM 8532  H HB3  . GLU A 1 96  ? 10.884  12.587  -4.069  1.00 0.00 ? 96  GLU A HB3  5  
ATOM 8533  H HG2  . GLU A 1 96  ? 10.223  15.303  -5.182  1.00 0.00 ? 96  GLU A HG2  5  
ATOM 8534  H HG3  . GLU A 1 96  ? 10.495  14.954  -3.476  1.00 0.00 ? 96  GLU A HG3  5  
ATOM 8535  N N    . GLY A 1 97  ? 9.761   10.473  -5.700  1.00 0.00 ? 97  GLY A N    5  
ATOM 8536  C CA   . GLY A 1 97  ? 9.919   9.031   -5.679  1.00 0.00 ? 97  GLY A CA   5  
ATOM 8537  C C    . GLY A 1 97  ? 8.983   8.359   -4.694  1.00 0.00 ? 97  GLY A C    5  
ATOM 8538  O O    . GLY A 1 97  ? 8.075   8.994   -4.159  1.00 0.00 ? 97  GLY A O    5  
ATOM 8539  H H    . GLY A 1 97  ? 8.939   10.879  -5.353  1.00 0.00 ? 97  GLY A H    5  
ATOM 8540  H HA2  . GLY A 1 97  ? 9.722   8.644   -6.668  1.00 0.00 ? 97  GLY A HA2  5  
ATOM 8541  H HA3  . GLY A 1 97  ? 10.938  8.796   -5.408  1.00 0.00 ? 97  GLY A HA3  5  
ATOM 8542  N N    . TRP A 1 98  ? 9.204   7.072   -4.455  1.00 0.00 ? 98  TRP A N    5  
ATOM 8543  C CA   . TRP A 1 98  ? 8.372   6.313   -3.529  1.00 0.00 ? 98  TRP A CA   5  
ATOM 8544  C C    . TRP A 1 98  ? 8.683   6.688   -2.084  1.00 0.00 ? 98  TRP A C    5  
ATOM 8545  O O    . TRP A 1 98  ? 9.760   6.384   -1.573  1.00 0.00 ? 98  TRP A O    5  
ATOM 8546  C CB   . TRP A 1 98  ? 8.581   4.812   -3.735  1.00 0.00 ? 98  TRP A CB   5  
ATOM 8547  C CG   . TRP A 1 98  ? 8.054   4.314   -5.047  1.00 0.00 ? 98  TRP A CG   5  
ATOM 8548  C CD1  . TRP A 1 98  ? 8.787   3.986   -6.153  1.00 0.00 ? 98  TRP A CD1  5  
ATOM 8549  C CD2  . TRP A 1 98  ? 6.683   4.089   -5.391  1.00 0.00 ? 98  TRP A CD2  5  
ATOM 8550  N NE1  . TRP A 1 98  ? 7.953   3.571   -7.163  1.00 0.00 ? 98  TRP A NE1  5  
ATOM 8551  C CE2  . TRP A 1 98  ? 6.657   3.624   -6.721  1.00 0.00 ? 98  TRP A CE2  5  
ATOM 8552  C CE3  . TRP A 1 98  ? 5.474   4.233   -4.705  1.00 0.00 ? 98  TRP A CE3  5  
ATOM 8553  C CZ2  . TRP A 1 98  ? 5.470   3.305   -7.374  1.00 0.00 ? 98  TRP A CZ2  5  
ATOM 8554  C CZ3  . TRP A 1 98  ? 4.297   3.916   -5.355  1.00 0.00 ? 98  TRP A CZ3  5  
ATOM 8555  C CH2  . TRP A 1 98  ? 4.302   3.456   -6.679  1.00 0.00 ? 98  TRP A CH2  5  
ATOM 8556  H H    . TRP A 1 98  ? 9.944   6.620   -4.913  1.00 0.00 ? 98  TRP A H    5  
ATOM 8557  H HA   . TRP A 1 98  ? 7.340   6.555   -3.737  1.00 0.00 ? 98  TRP A HA   5  
ATOM 8558  H HB2  . TRP A 1 98  ? 9.637   4.593   -3.695  1.00 0.00 ? 98  TRP A HB2  5  
ATOM 8559  H HB3  . TRP A 1 98  ? 8.075   4.274   -2.947  1.00 0.00 ? 98  TRP A HB3  5  
ATOM 8560  H HD1  . TRP A 1 98  ? 9.862   4.050   -6.210  1.00 0.00 ? 98  TRP A HD1  5  
ATOM 8561  H HE1  . TRP A 1 98  ? 8.240   3.282   -8.055  1.00 0.00 ? 98  TRP A HE1  5  
ATOM 8562  H HE3  . TRP A 1 98  ? 5.450   4.587   -3.684  1.00 0.00 ? 98  TRP A HE3  5  
ATOM 8563  H HZ2  . TRP A 1 98  ? 5.457   2.948   -8.394  1.00 0.00 ? 98  TRP A HZ2  5  
ATOM 8564  H HZ3  . TRP A 1 98  ? 3.353   4.022   -4.841  1.00 0.00 ? 98  TRP A HZ3  5  
ATOM 8565  H HH2  . TRP A 1 98  ? 3.358   3.220   -7.147  1.00 0.00 ? 98  TRP A HH2  5  
ATOM 8566  N N    . GLY A 1 99  ? 7.734   7.350   -1.431  1.00 0.00 ? 99  GLY A N    5  
ATOM 8567  C CA   . GLY A 1 99  ? 7.927   7.756   -0.051  1.00 0.00 ? 99  GLY A CA   5  
ATOM 8568  C C    . GLY A 1 99  ? 7.820   6.593   0.916   1.00 0.00 ? 99  GLY A C    5  
ATOM 8569  O O    . GLY A 1 99  ? 8.483   5.570   0.742   1.00 0.00 ? 99  GLY A O    5  
ATOM 8570  H H    . GLY A 1 99  ? 6.895   7.565   -1.890  1.00 0.00 ? 99  GLY A H    5  
ATOM 8571  H HA2  . GLY A 1 99  ? 8.905   8.203   0.047   1.00 0.00 ? 99  GLY A HA2  5  
ATOM 8572  H HA3  . GLY A 1 99  ? 7.179   8.491   0.205   1.00 0.00 ? 99  GLY A HA3  5  
ATOM 8573  N N    . ARG A 1 100 ? 6.985   6.750   1.938   1.00 0.00 ? 100 ARG A N    5  
ATOM 8574  C CA   . ARG A 1 100 ? 6.796   5.706   2.937   1.00 0.00 ? 100 ARG A CA   5  
ATOM 8575  C C    . ARG A 1 100 ? 5.695   4.739   2.512   1.00 0.00 ? 100 ARG A C    5  
ATOM 8576  O O    . ARG A 1 100 ? 5.025   4.953   1.502   1.00 0.00 ? 100 ARG A O    5  
ATOM 8577  C CB   . ARG A 1 100 ? 6.451   6.324   4.293   1.00 0.00 ? 100 ARG A CB   5  
ATOM 8578  C CG   . ARG A 1 100 ? 7.644   6.945   5.000   1.00 0.00 ? 100 ARG A CG   5  
ATOM 8579  C CD   . ARG A 1 100 ? 8.641   5.887   5.447   1.00 0.00 ? 100 ARG A CD   5  
ATOM 8580  N NE   . ARG A 1 100 ? 9.616   5.578   4.404   1.00 0.00 ? 100 ARG A NE   5  
ATOM 8581  C CZ   . ARG A 1 100 ? 10.702  6.308   4.174   1.00 0.00 ? 100 ARG A CZ   5  
ATOM 8582  N NH1  . ARG A 1 100 ? 10.950  7.383   4.910   1.00 0.00 ? 100 ARG A NH1  5  
ATOM 8583  N NH2  . ARG A 1 100 ? 11.542  5.964   3.207   1.00 0.00 ? 100 ARG A NH2  5  
ATOM 8584  H H    . ARG A 1 100 ? 6.485   7.589   2.022   1.00 0.00 ? 100 ARG A H    5  
ATOM 8585  H HA   . ARG A 1 100 ? 7.723   5.159   3.026   1.00 0.00 ? 100 ARG A HA   5  
ATOM 8586  H HB2  . ARG A 1 100 ? 5.707   7.094   4.146   1.00 0.00 ? 100 ARG A HB2  5  
ATOM 8587  H HB3  . ARG A 1 100 ? 6.042   5.556   4.931   1.00 0.00 ? 100 ARG A HB3  5  
ATOM 8588  H HG2  . ARG A 1 100 ? 8.139   7.626   4.323   1.00 0.00 ? 100 ARG A HG2  5  
ATOM 8589  H HG3  . ARG A 1 100 ? 7.295   7.487   5.867   1.00 0.00 ? 100 ARG A HG3  5  
ATOM 8590  H HD2  . ARG A 1 100 ? 9.163   6.249   6.319   1.00 0.00 ? 100 ARG A HD2  5  
ATOM 8591  H HD3  . ARG A 1 100 ? 8.100   4.987   5.699   1.00 0.00 ? 100 ARG A HD3  5  
ATOM 8592  H HE   . ARG A 1 100 ? 9.452   4.789   3.848   1.00 0.00 ? 100 ARG A HE   5  
ATOM 8593  H HH11 . ARG A 1 100 ? 10.319  7.645   5.640   1.00 0.00 ? 100 ARG A HH11 5  
ATOM 8594  H HH12 . ARG A 1 100 ? 11.769  7.930   4.736   1.00 0.00 ? 100 ARG A HH12 5  
ATOM 8595  H HH21 . ARG A 1 100 ? 11.358  5.154   2.651   1.00 0.00 ? 100 ARG A HH21 5  
ATOM 8596  H HH22 . ARG A 1 100 ? 12.359  6.513   3.035   1.00 0.00 ? 100 ARG A HH22 5  
ATOM 8597  N N    . GLU A 1 101 ? 5.514   3.676   3.289   1.00 0.00 ? 101 GLU A N    5  
ATOM 8598  C CA   . GLU A 1 101 ? 4.495   2.677   2.992   1.00 0.00 ? 101 GLU A CA   5  
ATOM 8599  C C    . GLU A 1 101 ? 3.860   2.148   4.275   1.00 0.00 ? 101 GLU A C    5  
ATOM 8600  O O    . GLU A 1 101 ? 4.558   1.713   5.191   1.00 0.00 ? 101 GLU A O    5  
ATOM 8601  C CB   . GLU A 1 101 ? 5.101   1.519   2.195   1.00 0.00 ? 101 GLU A CB   5  
ATOM 8602  C CG   . GLU A 1 101 ? 5.948   0.579   3.036   1.00 0.00 ? 101 GLU A CG   5  
ATOM 8603  C CD   . GLU A 1 101 ? 6.931   1.317   3.924   1.00 0.00 ? 101 GLU A CD   5  
ATOM 8604  O OE1  . GLU A 1 101 ? 7.747   2.094   3.387   1.00 0.00 ? 101 GLU A OE1  5  
ATOM 8605  O OE2  . GLU A 1 101 ? 6.885   1.116   5.156   1.00 0.00 ? 101 GLU A OE2  5  
ATOM 8606  H H    . GLU A 1 101 ? 6.080   3.561   4.081   1.00 0.00 ? 101 GLU A H    5  
ATOM 8607  H HA   . GLU A 1 101 ? 3.730   3.151   2.395   1.00 0.00 ? 101 GLU A HA   5  
ATOM 8608  H HB2  . GLU A 1 101 ? 4.301   0.948   1.748   1.00 0.00 ? 101 GLU A HB2  5  
ATOM 8609  H HB3  . GLU A 1 101 ? 5.723   1.925   1.411   1.00 0.00 ? 101 GLU A HB3  5  
ATOM 8610  H HG2  . GLU A 1 101 ? 5.295   -0.011  3.661   1.00 0.00 ? 101 GLU A HG2  5  
ATOM 8611  H HG3  . GLU A 1 101 ? 6.501   -0.074  2.377   1.00 0.00 ? 101 GLU A HG3  5  
ATOM 8612  N N    . ARG A 1 102 ? 2.533   2.189   4.332   1.00 0.00 ? 102 ARG A N    5  
ATOM 8613  C CA   . ARG A 1 102 ? 1.804   1.716   5.502   1.00 0.00 ? 102 ARG A CA   5  
ATOM 8614  C C    . ARG A 1 102 ? 1.709   0.193   5.505   1.00 0.00 ? 102 ARG A C    5  
ATOM 8615  O O    . ARG A 1 102 ? 1.526   -0.429  4.459   1.00 0.00 ? 102 ARG A O    5  
ATOM 8616  C CB   . ARG A 1 102 ? 0.401   2.325   5.536   1.00 0.00 ? 102 ARG A CB   5  
ATOM 8617  C CG   . ARG A 1 102 ? -0.450  1.830   6.694   1.00 0.00 ? 102 ARG A CG   5  
ATOM 8618  C CD   . ARG A 1 102 ? -0.302  2.723   7.916   1.00 0.00 ? 102 ARG A CD   5  
ATOM 8619  N NE   . ARG A 1 102 ? -0.567  2.000   9.157   1.00 0.00 ? 102 ARG A NE   5  
ATOM 8620  C CZ   . ARG A 1 102 ? 0.355   1.303   9.813   1.00 0.00 ? 102 ARG A CZ   5  
ATOM 8621  N NH1  . ARG A 1 102 ? 1.595   1.236   9.348   1.00 0.00 ? 102 ARG A NH1  5  
ATOM 8622  N NH2  . ARG A 1 102 ? 0.037   0.673   10.936  1.00 0.00 ? 102 ARG A NH2  5  
ATOM 8623  H H    . ARG A 1 102 ? 2.032   2.546   3.569   1.00 0.00 ? 102 ARG A H    5  
ATOM 8624  H HA   . ARG A 1 102 ? 2.345   2.033   6.381   1.00 0.00 ? 102 ARG A HA   5  
ATOM 8625  H HB2  . ARG A 1 102 ? 0.489   3.398   5.616   1.00 0.00 ? 102 ARG A HB2  5  
ATOM 8626  H HB3  . ARG A 1 102 ? -0.106  2.081   4.615   1.00 0.00 ? 102 ARG A HB3  5  
ATOM 8627  H HG2  . ARG A 1 102 ? -1.487  1.824   6.390   1.00 0.00 ? 102 ARG A HG2  5  
ATOM 8628  H HG3  . ARG A 1 102 ? -0.143  0.827   6.951   1.00 0.00 ? 102 ARG A HG3  5  
ATOM 8629  H HD2  . ARG A 1 102 ? 0.706   3.108   7.943   1.00 0.00 ? 102 ARG A HD2  5  
ATOM 8630  H HD3  . ARG A 1 102 ? -0.998  3.543   7.832   1.00 0.00 ? 102 ARG A HD3  5  
ATOM 8631  H HE   . ARG A 1 102 ? -1.477  2.036   9.518   1.00 0.00 ? 102 ARG A HE   5  
ATOM 8632  H HH11 . ARG A 1 102 ? 1.837   1.711   8.503   1.00 0.00 ? 102 ARG A HH11 5  
ATOM 8633  H HH12 . ARG A 1 102 ? 2.287   0.712   9.845   1.00 0.00 ? 102 ARG A HH12 5  
ATOM 8634  H HH21 . ARG A 1 102 ? -0.897  0.721   11.289  1.00 0.00 ? 102 ARG A HH21 5  
ATOM 8635  H HH22 . ARG A 1 102 ? 0.731   0.149   11.429  1.00 0.00 ? 102 ARG A HH22 5  
ATOM 8636  N N    . GLU A 1 103 ? 1.836   -0.401  6.688   1.00 0.00 ? 103 GLU A N    5  
ATOM 8637  C CA   . GLU A 1 103 ? 1.765   -1.851  6.825   1.00 0.00 ? 103 GLU A CA   5  
ATOM 8638  C C    . GLU A 1 103 ? 0.351   -2.295  7.187   1.00 0.00 ? 103 GLU A C    5  
ATOM 8639  O O    . GLU A 1 103 ? -0.302  -1.693  8.038   1.00 0.00 ? 103 GLU A O    5  
ATOM 8640  C CB   . GLU A 1 103 ? 2.752   -2.332  7.892   1.00 0.00 ? 103 GLU A CB   5  
ATOM 8641  C CG   . GLU A 1 103 ? 3.258   -3.746  7.658   1.00 0.00 ? 103 GLU A CG   5  
ATOM 8642  C CD   . GLU A 1 103 ? 3.860   -4.363  8.905   1.00 0.00 ? 103 GLU A CD   5  
ATOM 8643  O OE1  . GLU A 1 103 ? 3.108   -4.998  9.674   1.00 0.00 ? 103 GLU A OE1  5  
ATOM 8644  O OE2  . GLU A 1 103 ? 5.082   -4.212  9.112   1.00 0.00 ? 103 GLU A OE2  5  
ATOM 8645  H H    . GLU A 1 103 ? 1.980   0.149   7.486   1.00 0.00 ? 103 GLU A H    5  
ATOM 8646  H HA   . GLU A 1 103 ? 2.035   -2.287  5.876   1.00 0.00 ? 103 GLU A HA   5  
ATOM 8647  H HB2  . GLU A 1 103 ? 3.601   -1.665  7.907   1.00 0.00 ? 103 GLU A HB2  5  
ATOM 8648  H HB3  . GLU A 1 103 ? 2.264   -2.302  8.855   1.00 0.00 ? 103 GLU A HB3  5  
ATOM 8649  H HG2  . GLU A 1 103 ? 2.433   -4.361  7.333   1.00 0.00 ? 103 GLU A HG2  5  
ATOM 8650  H HG3  . GLU A 1 103 ? 4.013   -3.721  6.886   1.00 0.00 ? 103 GLU A HG3  5  
ATOM 8651  N N    . GLY A 1 104 ? -0.116  -3.354  6.533   1.00 0.00 ? 104 GLY A N    5  
ATOM 8652  C CA   . GLY A 1 104 ? -1.449  -3.862  6.799   1.00 0.00 ? 104 GLY A CA   5  
ATOM 8653  C C    . GLY A 1 104 ? -1.557  -5.356  6.569   1.00 0.00 ? 104 GLY A C    5  
ATOM 8654  O O    . GLY A 1 104 ? -1.853  -5.802  5.460   1.00 0.00 ? 104 GLY A O    5  
ATOM 8655  H H    . GLY A 1 104 ? 0.450   -3.795  5.865   1.00 0.00 ? 104 GLY A H    5  
ATOM 8656  H HA2  . GLY A 1 104 ? -1.707  -3.646  7.825   1.00 0.00 ? 104 GLY A HA2  5  
ATOM 8657  H HA3  . GLY A 1 104 ? -2.150  -3.358  6.148   1.00 0.00 ? 104 GLY A HA3  5  
ATOM 8658  N N    . VAL A 1 105 ? -1.316  -6.134  7.620   1.00 0.00 ? 105 VAL A N    5  
ATOM 8659  C CA   . VAL A 1 105 ? -1.387  -7.587  7.528   1.00 0.00 ? 105 VAL A CA   5  
ATOM 8660  C C    . VAL A 1 105 ? -2.832  -8.070  7.574   1.00 0.00 ? 105 VAL A C    5  
ATOM 8661  O O    . VAL A 1 105 ? -3.673  -7.483  8.256   1.00 0.00 ? 105 VAL A O    5  
ATOM 8662  C CB   . VAL A 1 105 ? -0.596  -8.261  8.665   1.00 0.00 ? 105 VAL A CB   5  
ATOM 8663  C CG1  . VAL A 1 105 ? -0.548  -9.768  8.463   1.00 0.00 ? 105 VAL A CG1  5  
ATOM 8664  C CG2  . VAL A 1 105 ? 0.808   -7.682  8.751   1.00 0.00 ? 105 VAL A CG2  5  
ATOM 8665  H H    . VAL A 1 105 ? -1.085  -5.720  8.478   1.00 0.00 ? 105 VAL A H    5  
ATOM 8666  H HA   . VAL A 1 105 ? -0.948  -7.884  6.587   1.00 0.00 ? 105 VAL A HA   5  
ATOM 8667  H HB   . VAL A 1 105 ? -1.103  -8.060  9.597   1.00 0.00 ? 105 VAL A HB   5  
ATOM 8668  H HG11 . VAL A 1 105 ? -0.168  -10.239 9.357   1.00 0.00 ? 105 VAL A HG11 5  
ATOM 8669  H HG12 . VAL A 1 105 ? -1.543  -10.135 8.256   1.00 0.00 ? 105 VAL A HG12 5  
ATOM 8670  H HG13 . VAL A 1 105 ? 0.101   -9.999  7.631   1.00 0.00 ? 105 VAL A HG13 5  
ATOM 8671  H HG21 . VAL A 1 105 ? 1.158   -7.735  9.772   1.00 0.00 ? 105 VAL A HG21 5  
ATOM 8672  H HG22 . VAL A 1 105 ? 1.470   -8.248  8.114   1.00 0.00 ? 105 VAL A HG22 5  
ATOM 8673  H HG23 . VAL A 1 105 ? 0.794   -6.651  8.429   1.00 0.00 ? 105 VAL A HG23 5  
ATOM 8674  N N    . ILE A 1 106 ? -3.114  -9.145  6.845   1.00 0.00 ? 106 ILE A N    5  
ATOM 8675  C CA   . ILE A 1 106 ? -4.458  -9.708  6.804   1.00 0.00 ? 106 ILE A CA   5  
ATOM 8676  C C    . ILE A 1 106 ? -4.420  -11.228 6.919   1.00 0.00 ? 106 ILE A C    5  
ATOM 8677  O O    . ILE A 1 106 ? -3.476  -11.874 6.463   1.00 0.00 ? 106 ILE A O    5  
ATOM 8678  C CB   . ILE A 1 106 ? -5.191  -9.321  5.506   1.00 0.00 ? 106 ILE A CB   5  
ATOM 8679  C CG1  . ILE A 1 106 ? -6.664  -9.730  5.585   1.00 0.00 ? 106 ILE A CG1  5  
ATOM 8680  C CG2  . ILE A 1 106 ? -4.520  -9.969  4.305   1.00 0.00 ? 106 ILE A CG2  5  
ATOM 8681  C CD1  . ILE A 1 106 ? -7.498  -8.818  6.457   1.00 0.00 ? 106 ILE A CD1  5  
ATOM 8682  H H    . ILE A 1 106 ? -2.402  -9.569  6.323   1.00 0.00 ? 106 ILE A H    5  
ATOM 8683  H HA   . ILE A 1 106 ? -5.013  -9.308  7.640   1.00 0.00 ? 106 ILE A HA   5  
ATOM 8684  H HB   . ILE A 1 106 ? -5.129  -8.250  5.389   1.00 0.00 ? 106 ILE A HB   5  
ATOM 8685  H HG12 . ILE A 1 106 ? -7.088  -9.719  4.594   1.00 0.00 ? 106 ILE A HG12 5  
ATOM 8686  H HG13 . ILE A 1 106 ? -6.730  -10.730 5.990   1.00 0.00 ? 106 ILE A HG13 5  
ATOM 8687  H HG21 . ILE A 1 106 ? -3.457  -10.041 4.482   1.00 0.00 ? 106 ILE A HG21 5  
ATOM 8688  H HG22 . ILE A 1 106 ? -4.927  -10.958 4.155   1.00 0.00 ? 106 ILE A HG22 5  
ATOM 8689  H HG23 . ILE A 1 106 ? -4.698  -9.369  3.425   1.00 0.00 ? 106 ILE A HG23 5  
ATOM 8690  H HD11 . ILE A 1 106 ? -8.201  -8.275  5.841   1.00 0.00 ? 106 ILE A HD11 5  
ATOM 8691  H HD12 . ILE A 1 106 ? -8.039  -9.408  7.182   1.00 0.00 ? 106 ILE A HD12 5  
ATOM 8692  H HD13 . ILE A 1 106 ? -6.854  -8.119  6.968   1.00 0.00 ? 106 ILE A HD13 5  
ATOM 8693  N N    . THR A 1 107 ? -5.455  -11.796 7.531   1.00 0.00 ? 107 THR A N    5  
ATOM 8694  C CA   . THR A 1 107 ? -5.542  -13.240 7.706   1.00 0.00 ? 107 THR A CA   5  
ATOM 8695  C C    . THR A 1 107 ? -6.790  -13.801 7.036   1.00 0.00 ? 107 THR A C    5  
ATOM 8696  O O    . THR A 1 107 ? -7.909  -13.571 7.495   1.00 0.00 ? 107 THR A O    5  
ATOM 8697  C CB   . THR A 1 107 ? -5.556  -13.626 9.197   1.00 0.00 ? 107 THR A CB   5  
ATOM 8698  O OG1  . THR A 1 107 ? -4.317  -13.253 9.811   1.00 0.00 ? 107 THR A OG1  5  
ATOM 8699  C CG2  . THR A 1 107 ? -5.782  -15.120 9.367   1.00 0.00 ? 107 THR A CG2  5  
ATOM 8700  H H    . THR A 1 107 ? -6.177  -11.228 7.873   1.00 0.00 ? 107 THR A H    5  
ATOM 8701  H HA   . THR A 1 107 ? -4.669  -13.684 7.249   1.00 0.00 ? 107 THR A HA   5  
ATOM 8702  H HB   . THR A 1 107 ? -6.363  -13.097 9.682   1.00 0.00 ? 107 THR A HB   5  
ATOM 8703  H HG1  . THR A 1 107 ? -4.492  -12.690 10.570  1.00 0.00 ? 107 THR A HG1  5  
ATOM 8704  H HG21 . THR A 1 107 ? -5.743  -15.602 8.402   1.00 0.00 ? 107 THR A HG21 5  
ATOM 8705  H HG22 . THR A 1 107 ? -6.751  -15.289 9.814   1.00 0.00 ? 107 THR A HG22 5  
ATOM 8706  H HG23 . THR A 1 107 ? -5.014  -15.530 10.006  1.00 0.00 ? 107 THR A HG23 5  
ATOM 8707  N N    . ILE A 1 108 ? -6.592  -14.539 5.949   1.00 0.00 ? 108 ILE A N    5  
ATOM 8708  C CA   . ILE A 1 108 ? -7.703  -15.135 5.217   1.00 0.00 ? 108 ILE A CA   5  
ATOM 8709  C C    . ILE A 1 108 ? -8.506  -16.077 6.108   1.00 0.00 ? 108 ILE A C    5  
ATOM 8710  O O    . ILE A 1 108 ? -7.991  -17.092 6.577   1.00 0.00 ? 108 ILE A O    5  
ATOM 8711  C CB   . ILE A 1 108 ? -7.212  -15.910 3.980   1.00 0.00 ? 108 ILE A CB   5  
ATOM 8712  C CG1  . ILE A 1 108 ? -6.277  -15.035 3.141   1.00 0.00 ? 108 ILE A CG1  5  
ATOM 8713  C CG2  . ILE A 1 108 ? -8.394  -16.382 3.147   1.00 0.00 ? 108 ILE A CG2  5  
ATOM 8714  C CD1  . ILE A 1 108 ? -6.945  -13.797 2.587   1.00 0.00 ? 108 ILE A CD1  5  
ATOM 8715  H H    . ILE A 1 108 ? -5.677  -14.687 5.632   1.00 0.00 ? 108 ILE A H    5  
ATOM 8716  H HA   . ILE A 1 108 ? -8.349  -14.335 4.883   1.00 0.00 ? 108 ILE A HA   5  
ATOM 8717  H HB   . ILE A 1 108 ? -6.671  -16.780 4.319   1.00 0.00 ? 108 ILE A HB   5  
ATOM 8718  H HG12 . ILE A 1 108 ? -5.447  -14.718 3.752   1.00 0.00 ? 108 ILE A HG12 5  
ATOM 8719  H HG13 . ILE A 1 108 ? -5.906  -15.615 2.308   1.00 0.00 ? 108 ILE A HG13 5  
ATOM 8720  H HG21 . ILE A 1 108 ? -8.211  -17.388 2.800   1.00 0.00 ? 108 ILE A HG21 5  
ATOM 8721  H HG22 . ILE A 1 108 ? -9.289  -16.367 3.751   1.00 0.00 ? 108 ILE A HG22 5  
ATOM 8722  H HG23 . ILE A 1 108 ? -8.521  -15.727 2.298   1.00 0.00 ? 108 ILE A HG23 5  
ATOM 8723  H HD11 . ILE A 1 108 ? -7.563  -14.068 1.743   1.00 0.00 ? 108 ILE A HD11 5  
ATOM 8724  H HD12 . ILE A 1 108 ? -7.560  -13.345 3.351   1.00 0.00 ? 108 ILE A HD12 5  
ATOM 8725  H HD13 . ILE A 1 108 ? -6.191  -13.093 2.268   1.00 0.00 ? 108 ILE A HD13 5  
ATOM 8726  N N    . GLU A 1 109 ? -9.770  -15.735 6.335   1.00 0.00 ? 109 GLU A N    5  
ATOM 8727  C CA   . GLU A 1 109 ? -10.644 -16.551 7.168   1.00 0.00 ? 109 GLU A CA   5  
ATOM 8728  C C    . GLU A 1 109 ? -11.910 -16.942 6.411   1.00 0.00 ? 109 GLU A C    5  
ATOM 8729  O O    . GLU A 1 109 ? -12.834 -16.141 6.269   1.00 0.00 ? 109 GLU A O    5  
ATOM 8730  C CB   . GLU A 1 109 ? -11.015 -15.799 8.448   1.00 0.00 ? 109 GLU A CB   5  
ATOM 8731  C CG   . GLU A 1 109 ? -9.949  -15.875 9.529   1.00 0.00 ? 109 GLU A CG   5  
ATOM 8732  C CD   . GLU A 1 109 ? -10.355 -15.155 10.800  1.00 0.00 ? 109 GLU A CD   5  
ATOM 8733  O OE1  . GLU A 1 109 ? -10.991 -15.791 11.666  1.00 0.00 ? 109 GLU A OE1  5  
ATOM 8734  O OE2  . GLU A 1 109 ? -10.037 -13.954 10.928  1.00 0.00 ? 109 GLU A OE2  5  
ATOM 8735  H H    . GLU A 1 109 ? -10.123 -14.914 5.933   1.00 0.00 ? 109 GLU A H    5  
ATOM 8736  H HA   . GLU A 1 109 ? -10.106 -17.449 7.433   1.00 0.00 ? 109 GLU A HA   5  
ATOM 8737  H HB2  . GLU A 1 109 ? -11.179 -14.759 8.205   1.00 0.00 ? 109 GLU A HB2  5  
ATOM 8738  H HB3  . GLU A 1 109 ? -11.929 -16.215 8.844   1.00 0.00 ? 109 GLU A HB3  5  
ATOM 8739  H HG2  . GLU A 1 109 ? -9.767  -16.913 9.765   1.00 0.00 ? 109 GLU A HG2  5  
ATOM 8740  H HG3  . GLU A 1 109 ? -9.041  -15.428 9.153   1.00 0.00 ? 109 GLU A HG3  5  
ATOM 8741  N N    . SER A 1 110 ? -11.944 -18.179 5.925   1.00 0.00 ? 110 SER A N    5  
ATOM 8742  C CA   . SER A 1 110 ? -13.093 -18.675 5.178   1.00 0.00 ? 110 SER A CA   5  
ATOM 8743  C C    . SER A 1 110 ? -14.086 -19.369 6.105   1.00 0.00 ? 110 SER A C    5  
ATOM 8744  O O    . SER A 1 110 ? -13.742 -20.332 6.790   1.00 0.00 ? 110 SER A O    5  
ATOM 8745  C CB   . SER A 1 110 ? -12.638 -19.644 4.084   1.00 0.00 ? 110 SER A CB   5  
ATOM 8746  O OG   . SER A 1 110 ? -13.744 -20.311 3.500   1.00 0.00 ? 110 SER A OG   5  
ATOM 8747  H H    . SER A 1 110 ? -11.176 -18.771 6.071   1.00 0.00 ? 110 SER A H    5  
ATOM 8748  H HA   . SER A 1 110 ? -13.580 -17.829 4.717   1.00 0.00 ? 110 SER A HA   5  
ATOM 8749  H HB2  . SER A 1 110 ? -12.117 -19.095 3.315   1.00 0.00 ? 110 SER A HB2  5  
ATOM 8750  H HB3  . SER A 1 110 ? -11.974 -20.380 4.513   1.00 0.00 ? 110 SER A HB3  5  
ATOM 8751  H HG   . SER A 1 110 ? -14.532 -19.771 3.600   1.00 0.00 ? 110 SER A HG   5  
ATOM 8752  N N    . GLN A 1 111 ? -15.318 -18.871 6.121   1.00 0.00 ? 111 GLN A N    5  
ATOM 8753  C CA   . GLN A 1 111 ? -16.361 -19.442 6.965   1.00 0.00 ? 111 GLN A CA   5  
ATOM 8754  C C    . GLN A 1 111 ? -17.516 -19.970 6.121   1.00 0.00 ? 111 GLN A C    5  
ATOM 8755  O O    . GLN A 1 111 ? -18.684 -19.811 6.478   1.00 0.00 ? 111 GLN A O    5  
ATOM 8756  C CB   . GLN A 1 111 ? -16.875 -18.396 7.956   1.00 0.00 ? 111 GLN A CB   5  
ATOM 8757  C CG   . GLN A 1 111 ? -15.774 -17.743 8.777   1.00 0.00 ? 111 GLN A CG   5  
ATOM 8758  C CD   . GLN A 1 111 ? -16.249 -17.308 10.149  1.00 0.00 ? 111 GLN A CD   5  
ATOM 8759  O OE1  . GLN A 1 111 ? -16.677 -18.130 10.960  1.00 0.00 ? 111 GLN A OE1  5  
ATOM 8760  N NE2  . GLN A 1 111 ? -16.176 -16.009 10.417  1.00 0.00 ? 111 GLN A NE2  5  
ATOM 8761  H H    . GLN A 1 111 ? -15.531 -18.103 5.553   1.00 0.00 ? 111 GLN A H    5  
ATOM 8762  H HA   . GLN A 1 111 ? -15.929 -20.264 7.516   1.00 0.00 ? 111 GLN A HA   5  
ATOM 8763  H HB2  . GLN A 1 111 ? -17.393 -17.623 7.408   1.00 0.00 ? 111 GLN A HB2  5  
ATOM 8764  H HB3  . GLN A 1 111 ? -17.567 -18.870 8.636   1.00 0.00 ? 111 GLN A HB3  5  
ATOM 8765  H HG2  . GLN A 1 111 ? -14.967 -18.450 8.900   1.00 0.00 ? 111 GLN A HG2  5  
ATOM 8766  H HG3  . GLN A 1 111 ? -15.413 -16.875 8.244   1.00 0.00 ? 111 GLN A HG3  5  
ATOM 8767  H HE21 . GLN A 1 111 ? -15.825 -15.413 9.722   1.00 0.00 ? 111 GLN A HE21 5  
ATOM 8768  H HE22 . GLN A 1 111 ? -16.477 -15.700 11.296  1.00 0.00 ? 111 GLN A HE22 5  
ATOM 8769  N N    . VAL A 1 112 ? -17.183 -20.600 4.999   1.00 0.00 ? 112 VAL A N    5  
ATOM 8770  C CA   . VAL A 1 112 ? -18.193 -21.152 4.103   1.00 0.00 ? 112 VAL A CA   5  
ATOM 8771  C C    . VAL A 1 112 ? -18.173 -22.676 4.127   1.00 0.00 ? 112 VAL A C    5  
ATOM 8772  O O    . VAL A 1 112 ? -19.220 -23.322 4.096   1.00 0.00 ? 112 VAL A O    5  
ATOM 8773  C CB   . VAL A 1 112 ? -17.984 -20.669 2.656   1.00 0.00 ? 112 VAL A CB   5  
ATOM 8774  C CG1  . VAL A 1 112 ? -18.094 -19.154 2.578   1.00 0.00 ? 112 VAL A CG1  5  
ATOM 8775  C CG2  . VAL A 1 112 ? -16.640 -21.142 2.125   1.00 0.00 ? 112 VAL A CG2  5  
ATOM 8776  H H    . VAL A 1 112 ? -16.236 -20.695 4.768   1.00 0.00 ? 112 VAL A H    5  
ATOM 8777  H HA   . VAL A 1 112 ? -19.161 -20.809 4.439   1.00 0.00 ? 112 VAL A HA   5  
ATOM 8778  H HB   . VAL A 1 112 ? -18.762 -21.096 2.040   1.00 0.00 ? 112 VAL A HB   5  
ATOM 8779  H HG11 . VAL A 1 112 ? -18.877 -18.885 1.884   1.00 0.00 ? 112 VAL A HG11 5  
ATOM 8780  H HG12 . VAL A 1 112 ? -18.326 -18.758 3.556   1.00 0.00 ? 112 VAL A HG12 5  
ATOM 8781  H HG13 . VAL A 1 112 ? -17.156 -18.742 2.236   1.00 0.00 ? 112 VAL A HG13 5  
ATOM 8782  H HG21 . VAL A 1 112 ? -15.898 -21.068 2.906   1.00 0.00 ? 112 VAL A HG21 5  
ATOM 8783  H HG22 . VAL A 1 112 ? -16.722 -22.169 1.802   1.00 0.00 ? 112 VAL A HG22 5  
ATOM 8784  H HG23 . VAL A 1 112 ? -16.345 -20.525 1.289   1.00 0.00 ? 112 VAL A HG23 5  
ATOM 8785  N N    . SER A 1 113 ? -16.973 -23.246 4.182   1.00 0.00 ? 113 SER A N    5  
ATOM 8786  C CA   . SER A 1 113 ? -16.816 -24.696 4.206   1.00 0.00 ? 113 SER A CA   5  
ATOM 8787  C C    . SER A 1 113 ? -16.698 -25.206 5.639   1.00 0.00 ? 113 SER A C    5  
ATOM 8788  O O    . SER A 1 113 ? -15.876 -26.071 5.936   1.00 0.00 ? 113 SER A O    5  
ATOM 8789  C CB   . SER A 1 113 ? -15.581 -25.109 3.402   1.00 0.00 ? 113 SER A CB   5  
ATOM 8790  O OG   . SER A 1 113 ? -15.414 -26.516 3.412   1.00 0.00 ? 113 SER A OG   5  
ATOM 8791  H H    . SER A 1 113 ? -16.175 -22.678 4.204   1.00 0.00 ? 113 SER A H    5  
ATOM 8792  H HA   . SER A 1 113 ? -17.693 -25.132 3.751   1.00 0.00 ? 113 SER A HA   5  
ATOM 8793  H HB2  . SER A 1 113 ? -15.692 -24.779 2.381   1.00 0.00 ? 113 SER A HB2  5  
ATOM 8794  H HB3  . SER A 1 113 ? -14.703 -24.651 3.835   1.00 0.00 ? 113 SER A HB3  5  
ATOM 8795  H HG   . SER A 1 113 ? -14.829 -26.774 2.695   1.00 0.00 ? 113 SER A HG   5  
ATOM 8796  N N    . GLY A 1 114 ? -17.528 -24.661 6.524   1.00 0.00 ? 114 GLY A N    5  
ATOM 8797  C CA   . GLY A 1 114 ? -17.501 -25.073 7.915   1.00 0.00 ? 114 GLY A CA   5  
ATOM 8798  C C    . GLY A 1 114 ? -18.726 -24.611 8.680   1.00 0.00 ? 114 GLY A C    5  
ATOM 8799  O O    . GLY A 1 114 ? -19.189 -23.480 8.528   1.00 0.00 ? 114 GLY A O    5  
ATOM 8800  H H    . GLY A 1 114 ? -18.162 -23.975 6.230   1.00 0.00 ? 114 GLY A H    5  
ATOM 8801  H HA2  . GLY A 1 114 ? -17.447 -26.150 7.960   1.00 0.00 ? 114 GLY A HA2  5  
ATOM 8802  H HA3  . GLY A 1 114 ? -16.621 -24.658 8.385   1.00 0.00 ? 114 GLY A HA3  5  
ATOM 8803  N N    . PRO A 1 115 ? -19.273 -25.500 9.522   1.00 0.00 ? 115 PRO A N    5  
ATOM 8804  C CA   . PRO A 1 115 ? -20.460 -25.200 10.329  1.00 0.00 ? 115 PRO A CA   5  
ATOM 8805  C C    . PRO A 1 115 ? -20.171 -24.186 11.430  1.00 0.00 ? 115 PRO A C    5  
ATOM 8806  O O    . PRO A 1 115 ? -19.837 -24.556 12.556  1.00 0.00 ? 115 PRO A O    5  
ATOM 8807  C CB   . PRO A 1 115 ? -20.830 -26.556 10.934  1.00 0.00 ? 115 PRO A CB   5  
ATOM 8808  C CG   . PRO A 1 115 ? -19.552 -27.322 10.956  1.00 0.00 ? 115 PRO A CG   5  
ATOM 8809  C CD   . PRO A 1 115 ? -18.775 -26.866 9.753   1.00 0.00 ? 115 PRO A CD   5  
ATOM 8810  H HA   . PRO A 1 115 ? -21.275 -24.842 9.717   1.00 0.00 ? 115 PRO A HA   5  
ATOM 8811  H HB2  . PRO A 1 115 ? -21.224 -26.413 11.930  1.00 0.00 ? 115 PRO A HB2  5  
ATOM 8812  H HB3  . PRO A 1 115 ? -21.569 -27.041 10.314  1.00 0.00 ? 115 PRO A HB3  5  
ATOM 8813  H HG2  . PRO A 1 115 ? -19.007 -27.100 11.861  1.00 0.00 ? 115 PRO A HG2  5  
ATOM 8814  H HG3  . PRO A 1 115 ? -19.758 -28.380 10.890  1.00 0.00 ? 115 PRO A HG3  5  
ATOM 8815  H HD2  . PRO A 1 115 ? -17.716 -26.859 9.967   1.00 0.00 ? 115 PRO A HD2  5  
ATOM 8816  H HD3  . PRO A 1 115 ? -18.985 -27.501 8.905   1.00 0.00 ? 115 PRO A HD3  5  
ATOM 8817  N N    . SER A 1 116 ? -20.303 -22.905 11.099  1.00 0.00 ? 116 SER A N    5  
ATOM 8818  C CA   . SER A 1 116 ? -20.052 -21.838 12.061  1.00 0.00 ? 116 SER A CA   5  
ATOM 8819  C C    . SER A 1 116 ? -21.360 -21.189 12.505  1.00 0.00 ? 116 SER A C    5  
ATOM 8820  O O    . SER A 1 116 ? -22.319 -21.111 11.737  1.00 0.00 ? 116 SER A O    5  
ATOM 8821  C CB   . SER A 1 116 ? -19.127 -20.782 11.453  1.00 0.00 ? 116 SER A CB   5  
ATOM 8822  O OG   . SER A 1 116 ? -19.830 -19.946 10.551  1.00 0.00 ? 116 SER A OG   5  
ATOM 8823  H H    . SER A 1 116 ? -20.572 -22.673 10.186  1.00 0.00 ? 116 SER A H    5  
ATOM 8824  H HA   . SER A 1 116 ? -19.570 -22.274 12.922  1.00 0.00 ? 116 SER A HA   5  
ATOM 8825  H HB2  . SER A 1 116 ? -18.713 -20.173 12.242  1.00 0.00 ? 116 SER A HB2  5  
ATOM 8826  H HB3  . SER A 1 116 ? -18.326 -21.274 10.920  1.00 0.00 ? 116 SER A HB3  5  
ATOM 8827  H HG   . SER A 1 116 ? -19.214 -19.345 10.124  1.00 0.00 ? 116 SER A HG   5  
ATOM 8828  N N    . SER A 1 117 ? -21.389 -20.724 13.750  1.00 0.00 ? 117 SER A N    5  
ATOM 8829  C CA   . SER A 1 117 ? -22.580 -20.085 14.299  1.00 0.00 ? 117 SER A CA   5  
ATOM 8830  C C    . SER A 1 117 ? -22.593 -18.594 13.978  1.00 0.00 ? 117 SER A C    5  
ATOM 8831  O O    . SER A 1 117 ? -21.600 -18.040 13.507  1.00 0.00 ? 117 SER A O    5  
ATOM 8832  C CB   . SER A 1 117 ? -22.643 -20.293 15.813  1.00 0.00 ? 117 SER A CB   5  
ATOM 8833  O OG   . SER A 1 117 ? -21.776 -19.397 16.488  1.00 0.00 ? 117 SER A OG   5  
ATOM 8834  H H    . SER A 1 117 ? -20.592 -20.816 14.313  1.00 0.00 ? 117 SER A H    5  
ATOM 8835  H HA   . SER A 1 117 ? -23.443 -20.547 13.844  1.00 0.00 ? 117 SER A HA   5  
ATOM 8836  H HB2  . SER A 1 117 ? -23.653 -20.124 16.155  1.00 0.00 ? 117 SER A HB2  5  
ATOM 8837  H HB3  . SER A 1 117 ? -22.348 -21.306 16.048  1.00 0.00 ? 117 SER A HB3  5  
ATOM 8838  H HG   . SER A 1 117 ? -21.911 -19.474 17.435  1.00 0.00 ? 117 SER A HG   5  
ATOM 8839  N N    . GLY A 1 118 ? -23.727 -17.949 14.236  1.00 0.00 ? 118 GLY A N    5  
ATOM 8840  C CA   . GLY A 1 118 ? -23.849 -16.528 13.968  1.00 0.00 ? 118 GLY A CA   5  
ATOM 8841  C C    . GLY A 1 118 ? -22.874 -15.699 14.779  1.00 0.00 ? 118 GLY A C    5  
ATOM 8842  O O    . GLY A 1 118 ? -21.728 -15.504 14.373  1.00 0.00 ? 118 GLY A O    5  
ATOM 8843  H H    . GLY A 1 118 ? -24.486 -18.443 14.611  1.00 0.00 ? 118 GLY A H    5  
ATOM 8844  H HA2  . GLY A 1 118 ? -23.668 -16.354 12.918  1.00 0.00 ? 118 GLY A HA2  5  
ATOM 8845  H HA3  . GLY A 1 118 ? -24.855 -16.214 14.207  1.00 0.00 ? 118 GLY A HA3  5  
ATOM 8846  N N    . GLY A 1 1   ? 36.183  5.209   -5.073  1.00 0.00 ? 1   GLY A N    6  
ATOM 8847  C CA   . GLY A 1 1   ? 35.063  6.040   -4.671  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8848  C C    . GLY A 1 1   ? 35.125  7.428   -5.278  1.00 0.00 ? 1   GLY A C    6  
ATOM 8849  O O    . GLY A 1 1   ? 34.627  7.653   -6.381  1.00 0.00 ? 1   GLY A O    6  
ATOM 8850  H H1   . GLY A 1 1   ? 37.060  5.616   -5.236  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8851  H HA2  . GLY A 1 1   ? 34.146  5.563   -4.981  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8852  H HA3  . GLY A 1 1   ? 35.065  6.130   -3.595  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8853  N N    . SER A 1 2   ? 35.736  8.361   -4.555  1.00 0.00 ? 2   SER A N    6  
ATOM 8854  C CA   . SER A 1 2   ? 35.855  9.736   -5.027  1.00 0.00 ? 2   SER A CA   6  
ATOM 8855  C C    . SER A 1 2   ? 37.019  10.446  -4.341  1.00 0.00 ? 2   SER A C    6  
ATOM 8856  O O    . SER A 1 2   ? 37.256  10.262  -3.147  1.00 0.00 ? 2   SER A O    6  
ATOM 8857  C CB   . SER A 1 2   ? 34.555  10.500  -4.771  1.00 0.00 ? 2   SER A CB   6  
ATOM 8858  O OG   . SER A 1 2   ? 33.528  10.068  -5.647  1.00 0.00 ? 2   SER A OG   6  
ATOM 8859  H H    . SER A 1 2   ? 36.112  8.120   -3.683  1.00 0.00 ? 2   SER A H    6  
ATOM 8860  H HA   . SER A 1 2   ? 36.043  9.707   -6.090  1.00 0.00 ? 2   SER A HA   6  
ATOM 8861  H HB2  . SER A 1 2   ? 34.237  10.334  -3.753  1.00 0.00 ? 2   SER A HB2  6  
ATOM 8862  H HB3  . SER A 1 2   ? 34.724  11.556  -4.927  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8863  H HG   . SER A 1 2   ? 33.623  10.510  -6.494  1.00 0.00 ? 2   SER A HG   6  
ATOM 8864  N N    . SER A 1 3   ? 37.742  11.258  -5.106  1.00 0.00 ? 3   SER A N    6  
ATOM 8865  C CA   . SER A 1 3   ? 38.884  11.993  -4.575  1.00 0.00 ? 3   SER A CA   6  
ATOM 8866  C C    . SER A 1 3   ? 38.440  12.989  -3.508  1.00 0.00 ? 3   SER A C    6  
ATOM 8867  O O    . SER A 1 3   ? 37.470  13.724  -3.694  1.00 0.00 ? 3   SER A O    6  
ATOM 8868  C CB   . SER A 1 3   ? 39.614  12.726  -5.701  1.00 0.00 ? 3   SER A CB   6  
ATOM 8869  O OG   . SER A 1 3   ? 40.609  13.593  -5.185  1.00 0.00 ? 3   SER A OG   6  
ATOM 8870  H H    . SER A 1 3   ? 37.503  11.362  -6.051  1.00 0.00 ? 3   SER A H    6  
ATOM 8871  H HA   . SER A 1 3   ? 39.558  11.279  -4.125  1.00 0.00 ? 3   SER A HA   6  
ATOM 8872  H HB2  . SER A 1 3   ? 40.085  12.004  -6.351  1.00 0.00 ? 3   SER A HB2  6  
ATOM 8873  H HB3  . SER A 1 3   ? 38.903  13.310  -6.267  1.00 0.00 ? 3   SER A HB3  6  
ATOM 8874  H HG   . SER A 1 3   ? 40.594  14.422  -5.668  1.00 0.00 ? 3   SER A HG   6  
ATOM 8875  N N    . GLY A 1 4   ? 39.158  13.008  -2.389  1.00 0.00 ? 4   GLY A N    6  
ATOM 8876  C CA   . GLY A 1 4   ? 38.823  13.918  -1.309  1.00 0.00 ? 4   GLY A CA   6  
ATOM 8877  C C    . GLY A 1 4   ? 37.991  13.254  -0.229  1.00 0.00 ? 4   GLY A C    6  
ATOM 8878  O O    . GLY A 1 4   ? 37.135  12.419  -0.521  1.00 0.00 ? 4   GLY A O    6  
ATOM 8879  H H    . GLY A 1 4   ? 39.920  12.400  -2.296  1.00 0.00 ? 4   GLY A H    6  
ATOM 8880  H HA2  . GLY A 1 4   ? 39.737  14.288  -0.868  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8881  H HA3  . GLY A 1 4   ? 38.267  14.751  -1.714  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8882  N N    . SER A 1 5   ? 38.244  13.625  1.022   1.00 0.00 ? 5   SER A N    6  
ATOM 8883  C CA   . SER A 1 5   ? 37.516  13.056  2.150   1.00 0.00 ? 5   SER A CA   6  
ATOM 8884  C C    . SER A 1 5   ? 36.009  13.145  1.925   1.00 0.00 ? 5   SER A C    6  
ATOM 8885  O O    . SER A 1 5   ? 35.512  14.122  1.365   1.00 0.00 ? 5   SER A O    6  
ATOM 8886  C CB   . SER A 1 5   ? 37.893  13.778  3.445   1.00 0.00 ? 5   SER A CB   6  
ATOM 8887  O OG   . SER A 1 5   ? 37.277  13.169  4.566   1.00 0.00 ? 5   SER A OG   6  
ATOM 8888  H H    . SER A 1 5   ? 38.939  14.295  1.191   1.00 0.00 ? 5   SER A H    6  
ATOM 8889  H HA   . SER A 1 5   ? 37.794  12.016  2.233   1.00 0.00 ? 5   SER A HA   6  
ATOM 8890  H HB2  . SER A 1 5   ? 38.964  13.742  3.575   1.00 0.00 ? 5   SER A HB2  6  
ATOM 8891  H HB3  . SER A 1 5   ? 37.572  14.807  3.386   1.00 0.00 ? 5   SER A HB3  6  
ATOM 8892  H HG   . SER A 1 5   ? 37.888  13.168  5.307   1.00 0.00 ? 5   SER A HG   6  
ATOM 8893  N N    . SER A 1 6   ? 35.289  12.119  2.366   1.00 0.00 ? 6   SER A N    6  
ATOM 8894  C CA   . SER A 1 6   ? 33.840  12.079  2.210   1.00 0.00 ? 6   SER A CA   6  
ATOM 8895  C C    . SER A 1 6   ? 33.169  11.599  3.494   1.00 0.00 ? 6   SER A C    6  
ATOM 8896  O O    . SER A 1 6   ? 33.491  10.532  4.015   1.00 0.00 ? 6   SER A O    6  
ATOM 8897  C CB   . SER A 1 6   ? 33.456  11.162  1.047   1.00 0.00 ? 6   SER A CB   6  
ATOM 8898  O OG   . SER A 1 6   ? 33.711  9.804   1.363   1.00 0.00 ? 6   SER A OG   6  
ATOM 8899  H H    . SER A 1 6   ? 35.744  11.370  2.805   1.00 0.00 ? 6   SER A H    6  
ATOM 8900  H HA   . SER A 1 6   ? 33.502  13.081  1.994   1.00 0.00 ? 6   SER A HA   6  
ATOM 8901  H HB2  . SER A 1 6   ? 32.405  11.278  0.833   1.00 0.00 ? 6   SER A HB2  6  
ATOM 8902  H HB3  . SER A 1 6   ? 34.034  11.431  0.175   1.00 0.00 ? 6   SER A HB3  6  
ATOM 8903  H HG   . SER A 1 6   ? 34.498  9.509   0.897   1.00 0.00 ? 6   SER A HG   6  
ATOM 8904  N N    . GLY A 1 7   ? 32.232  12.397  3.998   1.00 0.00 ? 7   GLY A N    6  
ATOM 8905  C CA   . GLY A 1 7   ? 31.529  12.038  5.216   1.00 0.00 ? 7   GLY A CA   6  
ATOM 8906  C C    . GLY A 1 7   ? 30.027  12.193  5.086   1.00 0.00 ? 7   GLY A C    6  
ATOM 8907  O O    . GLY A 1 7   ? 29.407  11.588  4.211   1.00 0.00 ? 7   GLY A O    6  
ATOM 8908  H H    . GLY A 1 7   ? 32.017  13.236  3.539   1.00 0.00 ? 7   GLY A H    6  
ATOM 8909  H HA2  . GLY A 1 7   ? 31.755  11.011  5.460   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8910  H HA3  . GLY A 1 7   ? 31.877  12.672  6.018   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8911  N N    . SER A 1 8   ? 29.439  13.005  5.959   1.00 0.00 ? 8   SER A N    6  
ATOM 8912  C CA   . SER A 1 8   ? 27.999  13.233  5.941   1.00 0.00 ? 8   SER A CA   6  
ATOM 8913  C C    . SER A 1 8   ? 27.659  14.497  5.157   1.00 0.00 ? 8   SER A C    6  
ATOM 8914  O O    . SER A 1 8   ? 27.607  15.593  5.715   1.00 0.00 ? 8   SER A O    6  
ATOM 8915  C CB   . SER A 1 8   ? 27.462  13.345  7.369   1.00 0.00 ? 8   SER A CB   6  
ATOM 8916  O OG   . SER A 1 8   ? 26.045  13.347  7.382   1.00 0.00 ? 8   SER A OG   6  
ATOM 8917  H H    . SER A 1 8   ? 29.988  13.459  6.633   1.00 0.00 ? 8   SER A H    6  
ATOM 8918  H HA   . SER A 1 8   ? 27.536  12.387  5.456   1.00 0.00 ? 8   SER A HA   6  
ATOM 8919  H HB2  . SER A 1 8   ? 27.814  12.507  7.950   1.00 0.00 ? 8   SER A HB2  6  
ATOM 8920  H HB3  . SER A 1 8   ? 27.815  14.265  7.812   1.00 0.00 ? 8   SER A HB3  6  
ATOM 8921  H HG   . SER A 1 8   ? 25.725  14.252  7.391   1.00 0.00 ? 8   SER A HG   6  
ATOM 8922  N N    . HIS A 1 9   ? 27.428  14.335  3.858   1.00 0.00 ? 9   HIS A N    6  
ATOM 8923  C CA   . HIS A 1 9   ? 27.092  15.462  2.995   1.00 0.00 ? 9   HIS A CA   6  
ATOM 8924  C C    . HIS A 1 9   ? 25.697  15.295  2.401   1.00 0.00 ? 9   HIS A C    6  
ATOM 8925  O O    . HIS A 1 9   ? 25.539  14.757  1.305   1.00 0.00 ? 9   HIS A O    6  
ATOM 8926  C CB   . HIS A 1 9   ? 28.123  15.599  1.874   1.00 0.00 ? 9   HIS A CB   6  
ATOM 8927  C CG   . HIS A 1 9   ? 28.075  16.922  1.173   1.00 0.00 ? 9   HIS A CG   6  
ATOM 8928  N ND1  . HIS A 1 9   ? 28.912  17.971  1.488   1.00 0.00 ? 9   HIS A ND1  6  
ATOM 8929  C CD2  . HIS A 1 9   ? 27.283  17.362  0.168   1.00 0.00 ? 9   HIS A CD2  6  
ATOM 8930  C CE1  . HIS A 1 9   ? 28.637  19.001  0.707   1.00 0.00 ? 9   HIS A CE1  6  
ATOM 8931  N NE2  . HIS A 1 9   ? 27.652  18.657  -0.104  1.00 0.00 ? 9   HIS A NE2  6  
ATOM 8932  H H    . HIS A 1 9   ? 27.485  13.437  3.470   1.00 0.00 ? 9   HIS A H    6  
ATOM 8933  H HA   . HIS A 1 9   ? 27.108  16.358  3.598   1.00 0.00 ? 9   HIS A HA   6  
ATOM 8934  H HB2  . HIS A 1 9   ? 29.114  15.480  2.289   1.00 0.00 ? 9   HIS A HB2  6  
ATOM 8935  H HB3  . HIS A 1 9   ? 27.951  14.826  1.139   1.00 0.00 ? 9   HIS A HB3  6  
ATOM 8936  H HD2  . HIS A 1 9   ? 26.505  16.800  -0.330  1.00 0.00 ? 9   HIS A HD2  6  
ATOM 8937  H HE1  . HIS A 1 9   ? 29.132  19.960  0.727   1.00 0.00 ? 9   HIS A HE1  6  
ATOM 8938  H HE2  . HIS A 1 9   ? 27.197  19.261  -0.726  1.00 0.00 ? 9   HIS A HE2  6  
ATOM 8939  N N    . ASP A 1 10  ? 24.689  15.758  3.132   1.00 0.00 ? 10  ASP A N    6  
ATOM 8940  C CA   . ASP A 1 10  ? 23.307  15.659  2.677   1.00 0.00 ? 10  ASP A CA   6  
ATOM 8941  C C    . ASP A 1 10  ? 22.784  17.021  2.229   1.00 0.00 ? 10  ASP A C    6  
ATOM 8942  O O    . ASP A 1 10  ? 22.522  17.898  3.052   1.00 0.00 ? 10  ASP A O    6  
ATOM 8943  C CB   . ASP A 1 10  ? 22.420  15.100  3.791   1.00 0.00 ? 10  ASP A CB   6  
ATOM 8944  C CG   . ASP A 1 10  ? 22.811  15.621  5.159   1.00 0.00 ? 10  ASP A CG   6  
ATOM 8945  O OD1  . ASP A 1 10  ? 23.754  15.064  5.759   1.00 0.00 ? 10  ASP A OD1  6  
ATOM 8946  O OD2  . ASP A 1 10  ? 22.173  16.586  5.632   1.00 0.00 ? 10  ASP A OD2  6  
ATOM 8947  H H    . ASP A 1 10  ? 24.879  16.176  3.998   1.00 0.00 ? 10  ASP A H    6  
ATOM 8948  H HA   . ASP A 1 10  ? 23.282  14.983  1.836   1.00 0.00 ? 10  ASP A HA   6  
ATOM 8949  H HB2  . ASP A 1 10  ? 21.394  15.379  3.600   1.00 0.00 ? 10  ASP A HB2  6  
ATOM 8950  H HB3  . ASP A 1 10  ? 22.500  14.023  3.799   1.00 0.00 ? 10  ASP A HB3  6  
ATOM 8951  N N    . SER A 1 11  ? 22.635  17.190  0.919   1.00 0.00 ? 11  SER A N    6  
ATOM 8952  C CA   . SER A 1 11  ? 22.149  18.446  0.361   1.00 0.00 ? 11  SER A CA   6  
ATOM 8953  C C    . SER A 1 11  ? 20.833  18.237  -0.382  1.00 0.00 ? 11  SER A C    6  
ATOM 8954  O O    . SER A 1 11  ? 19.916  19.053  -0.285  1.00 0.00 ? 11  SER A O    6  
ATOM 8955  C CB   . SER A 1 11  ? 23.191  19.046  -0.584  1.00 0.00 ? 11  SER A CB   6  
ATOM 8956  O OG   . SER A 1 11  ? 23.040  20.452  -0.684  1.00 0.00 ? 11  SER A OG   6  
ATOM 8957  H H    . SER A 1 11  ? 22.861  16.453  0.314   1.00 0.00 ? 11  SER A H    6  
ATOM 8958  H HA   . SER A 1 11  ? 21.982  19.130  1.180   1.00 0.00 ? 11  SER A HA   6  
ATOM 8959  H HB2  . SER A 1 11  ? 24.180  18.829  -0.211  1.00 0.00 ? 11  SER A HB2  6  
ATOM 8960  H HB3  . SER A 1 11  ? 23.074  18.613  -1.567  1.00 0.00 ? 11  SER A HB3  6  
ATOM 8961  H HG   . SER A 1 11  ? 23.905  20.865  -0.730  1.00 0.00 ? 11  SER A HG   6  
ATOM 8962  N N    . ARG A 1 12  ? 20.747  17.137  -1.123  1.00 0.00 ? 12  ARG A N    6  
ATOM 8963  C CA   . ARG A 1 12  ? 19.545  16.820  -1.884  1.00 0.00 ? 12  ARG A CA   6  
ATOM 8964  C C    . ARG A 1 12  ? 18.573  15.995  -1.045  1.00 0.00 ? 12  ARG A C    6  
ATOM 8965  O O    . ARG A 1 12  ? 18.456  14.782  -1.225  1.00 0.00 ? 12  ARG A O    6  
ATOM 8966  C CB   . ARG A 1 12  ? 19.909  16.058  -3.159  1.00 0.00 ? 12  ARG A CB   6  
ATOM 8967  C CG   . ARG A 1 12  ? 18.945  16.299  -4.309  1.00 0.00 ? 12  ARG A CG   6  
ATOM 8968  C CD   . ARG A 1 12  ? 17.671  15.485  -4.149  1.00 0.00 ? 12  ARG A CD   6  
ATOM 8969  N NE   . ARG A 1 12  ? 17.826  14.121  -4.649  1.00 0.00 ? 12  ARG A NE   6  
ATOM 8970  C CZ   . ARG A 1 12  ? 16.816  13.272  -4.794  1.00 0.00 ? 12  ARG A CZ   6  
ATOM 8971  N NH1  . ARG A 1 12  ? 15.582  13.644  -4.480  1.00 0.00 ? 12  ARG A NH1  6  
ATOM 8972  N NH2  . ARG A 1 12  ? 17.037  12.047  -5.256  1.00 0.00 ? 12  ARG A NH2  6  
ATOM 8973  H H    . ARG A 1 12  ? 21.512  16.524  -1.160  1.00 0.00 ? 12  ARG A H    6  
ATOM 8974  H HA   . ARG A 1 12  ? 19.068  17.750  -2.154  1.00 0.00 ? 12  ARG A HA   6  
ATOM 8975  H HB2  . ARG A 1 12  ? 20.896  16.360  -3.477  1.00 0.00 ? 12  ARG A HB2  6  
ATOM 8976  H HB3  . ARG A 1 12  ? 19.918  15.000  -2.942  1.00 0.00 ? 12  ARG A HB3  6  
ATOM 8977  H HG2  . ARG A 1 12  ? 18.687  17.348  -4.336  1.00 0.00 ? 12  ARG A HG2  6  
ATOM 8978  H HG3  . ARG A 1 12  ? 19.426  16.021  -5.235  1.00 0.00 ? 12  ARG A HG3  6  
ATOM 8979  H HD2  . ARG A 1 12  ? 17.413  15.446  -3.101  1.00 0.00 ? 12  ARG A HD2  6  
ATOM 8980  H HD3  . ARG A 1 12  ? 16.877  15.971  -4.697  1.00 0.00 ? 12  ARG A HD3  6  
ATOM 8981  H HE   . ARG A 1 12  ? 18.729  13.826  -4.887  1.00 0.00 ? 12  ARG A HE   6  
ATOM 8982  H HH11 . ARG A 1 12  ? 15.412  14.566  -4.133  1.00 0.00 ? 12  ARG A HH11 6  
ATOM 8983  H HH12 . ARG A 1 12  ? 14.823  13.002  -4.591  1.00 0.00 ? 12  ARG A HH12 6  
ATOM 8984  H HH21 . ARG A 1 12  ? 17.966  11.764  -5.494  1.00 0.00 ? 12  ARG A HH21 6  
ATOM 8985  H HH22 . ARG A 1 12  ? 16.276  11.409  -5.364  1.00 0.00 ? 12  ARG A HH22 6  
ATOM 8986  N N    . LEU A 1 13  ? 17.878  16.660  -0.129  1.00 0.00 ? 13  LEU A N    6  
ATOM 8987  C CA   . LEU A 1 13  ? 16.916  15.989  0.738   1.00 0.00 ? 13  LEU A CA   6  
ATOM 8988  C C    . LEU A 1 13  ? 15.521  16.007  0.121   1.00 0.00 ? 13  LEU A C    6  
ATOM 8989  O O    . LEU A 1 13  ? 14.944  17.071  -0.106  1.00 0.00 ? 13  LEU A O    6  
ATOM 8990  C CB   . LEU A 1 13  ? 16.886  16.657  2.114   1.00 0.00 ? 13  LEU A CB   6  
ATOM 8991  C CG   . LEU A 1 13  ? 18.197  16.634  2.900   1.00 0.00 ? 13  LEU A CG   6  
ATOM 8992  C CD1  . LEU A 1 13  ? 19.182  17.641  2.327   1.00 0.00 ? 13  LEU A CD1  6  
ATOM 8993  C CD2  . LEU A 1 13  ? 17.941  16.915  4.373   1.00 0.00 ? 13  LEU A CD2  6  
ATOM 8994  H H    . LEU A 1 13  ? 18.014  17.625  -0.033  1.00 0.00 ? 13  LEU A H    6  
ATOM 8995  H HA   . LEU A 1 13  ? 17.233  14.963  0.852   1.00 0.00 ? 13  LEU A HA   6  
ATOM 8996  H HB2  . LEU A 1 13  ? 16.604  17.689  1.973   1.00 0.00 ? 13  LEU A HB2  6  
ATOM 8997  H HB3  . LEU A 1 13  ? 16.134  16.157  2.707   1.00 0.00 ? 13  LEU A HB3  6  
ATOM 8998  H HG   . LEU A 1 13  ? 18.641  15.651  2.819   1.00 0.00 ? 13  LEU A HG   6  
ATOM 8999  H HD11 . LEU A 1 13  ? 19.453  17.348  1.324   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 9000  H HD12 . LEU A 1 13  ? 20.067  17.671  2.945   1.00 0.00 ? 13  LEU A HD12 6  
ATOM 9001  H HD13 . LEU A 1 13  ? 18.725  18.619  2.306   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 9002  H HD21 . LEU A 1 13  ? 16.983  16.505  4.657   1.00 0.00 ? 13  LEU A HD21 6  
ATOM 9003  H HD22 . LEU A 1 13  ? 17.939  17.982  4.540   1.00 0.00 ? 13  LEU A HD22 6  
ATOM 9004  H HD23 . LEU A 1 13  ? 18.719  16.459  4.968   1.00 0.00 ? 13  LEU A HD23 6  
ATOM 9005  N N    . THR A 1 14  ? 14.983  14.821  -0.147  1.00 0.00 ? 14  THR A N    6  
ATOM 9006  C CA   . THR A 1 14  ? 13.656  14.700  -0.736  1.00 0.00 ? 14  THR A CA   6  
ATOM 9007  C C    . THR A 1 14  ? 12.621  15.471  0.075   1.00 0.00 ? 14  THR A C    6  
ATOM 9008  O O    . THR A 1 14  ? 12.480  15.260  1.279   1.00 0.00 ? 14  THR A O    6  
ATOM 9009  C CB   . THR A 1 14  ? 13.218  13.227  -0.837  1.00 0.00 ? 14  THR A CB   6  
ATOM 9010  O OG1  . THR A 1 14  ? 13.217  12.626  0.463   1.00 0.00 ? 14  THR A OG1  6  
ATOM 9011  C CG2  . THR A 1 14  ? 14.144  12.449  -1.760  1.00 0.00 ? 14  THR A CG2  6  
ATOM 9012  H H    . THR A 1 14  ? 15.492  14.009  0.057   1.00 0.00 ? 14  THR A H    6  
ATOM 9013  H HA   . THR A 1 14  ? 13.695  15.111  -1.735  1.00 0.00 ? 14  THR A HA   6  
ATOM 9014  H HB   . THR A 1 14  ? 12.217  13.191  -1.242  1.00 0.00 ? 14  THR A HB   6  
ATOM 9015  H HG1  . THR A 1 14  ? 12.413  12.870  0.928   1.00 0.00 ? 14  THR A HG1  6  
ATOM 9016  H HG21 . THR A 1 14  ? 13.751  11.454  -1.908  1.00 0.00 ? 14  THR A HG21 6  
ATOM 9017  H HG22 . THR A 1 14  ? 15.126  12.386  -1.316  1.00 0.00 ? 14  THR A HG22 6  
ATOM 9018  H HG23 . THR A 1 14  ? 14.211  12.955  -2.712  1.00 0.00 ? 14  THR A HG23 6  
ATOM 9019  N N    . ALA A 1 15  ? 11.899  16.366  -0.592  1.00 0.00 ? 15  ALA A N    6  
ATOM 9020  C CA   . ALA A 1 15  ? 10.875  17.167  0.068   1.00 0.00 ? 15  ALA A CA   6  
ATOM 9021  C C    . ALA A 1 15  ? 9.524   17.005  -0.620  1.00 0.00 ? 15  ALA A C    6  
ATOM 9022  O O    . ALA A 1 15  ? 8.478   17.062  0.024   1.00 0.00 ? 15  ALA A O    6  
ATOM 9023  C CB   . ALA A 1 15  ? 11.285  18.632  0.091   1.00 0.00 ? 15  ALA A CB   6  
ATOM 9024  H H    . ALA A 1 15  ? 12.058  16.489  -1.551  1.00 0.00 ? 15  ALA A H    6  
ATOM 9025  H HA   . ALA A 1 15  ? 10.791  16.825  1.089   1.00 0.00 ? 15  ALA A HA   6  
ATOM 9026  H HB1  . ALA A 1 15  ? 12.173  18.766  -0.508  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 9027  H HB2  . ALA A 1 15  ? 10.484  19.235  -0.310  1.00 0.00 ? 15  ALA A HB2  6  
ATOM 9028  H HB3  . ALA A 1 15  ? 11.488  18.932  1.109   1.00 0.00 ? 15  ALA A HB3  6  
ATOM 9029  N N    . GLY A 1 16  ? 9.554   16.803  -1.934  1.00 0.00 ? 16  GLY A N    6  
ATOM 9030  C CA   . GLY A 1 16  ? 8.325   16.637  -2.687  1.00 0.00 ? 16  GLY A CA   6  
ATOM 9031  C C    . GLY A 1 16  ? 7.889   15.188  -2.773  1.00 0.00 ? 16  GLY A C    6  
ATOM 9032  O O    . GLY A 1 16  ? 7.361   14.750  -3.796  1.00 0.00 ? 16  GLY A O    6  
ATOM 9033  H H    . GLY A 1 16  ? 10.418  16.767  -2.396  1.00 0.00 ? 16  GLY A H    6  
ATOM 9034  H HA2  . GLY A 1 16  ? 7.543   17.210  -2.211  1.00 0.00 ? 16  GLY A HA2  6  
ATOM 9035  H HA3  . GLY A 1 16  ? 8.476   17.015  -3.688  1.00 0.00 ? 16  GLY A HA3  6  
ATOM 9036  N N    . VAL A 1 17  ? 8.110   14.440  -1.696  1.00 0.00 ? 17  VAL A N    6  
ATOM 9037  C CA   . VAL A 1 17  ? 7.737   13.031  -1.654  1.00 0.00 ? 17  VAL A CA   6  
ATOM 9038  C C    . VAL A 1 17  ? 6.429   12.832  -0.897  1.00 0.00 ? 17  VAL A C    6  
ATOM 9039  O O    . VAL A 1 17  ? 6.126   13.538  0.065   1.00 0.00 ? 17  VAL A O    6  
ATOM 9040  C CB   . VAL A 1 17  ? 8.836   12.179  -0.992  1.00 0.00 ? 17  VAL A CB   6  
ATOM 9041  C CG1  . VAL A 1 17  ? 10.039  12.049  -1.913  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 9042  C CG2  . VAL A 1 17  ? 9.241   12.779  0.347   1.00 0.00 ? 17  VAL A CG2  6  
ATOM 9043  H H    . VAL A 1 17  ? 8.534   14.846  -0.912  1.00 0.00 ? 17  VAL A H    6  
ATOM 9044  H HA   . VAL A 1 17  ? 7.609   12.689  -2.671  1.00 0.00 ? 17  VAL A HA   6  
ATOM 9045  H HB   . VAL A 1 17  ? 8.438   11.191  -0.814  1.00 0.00 ? 17  VAL A HB   6  
ATOM 9046  H HG11 . VAL A 1 17  ? 10.403  13.033  -2.170  1.00 0.00 ? 17  VAL A HG11 6  
ATOM 9047  H HG12 . VAL A 1 17  ? 10.819  11.495  -1.411  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 9048  H HG13 . VAL A 1 17  ? 9.749   11.527  -2.813  1.00 0.00 ? 17  VAL A HG13 6  
ATOM 9049  H HG21 . VAL A 1 17  ? 8.622   13.638  0.558   1.00 0.00 ? 17  VAL A HG21 6  
ATOM 9050  H HG22 . VAL A 1 17  ? 9.111   12.041  1.125   1.00 0.00 ? 17  VAL A HG22 6  
ATOM 9051  H HG23 . VAL A 1 17  ? 10.277  13.083  0.307   1.00 0.00 ? 17  VAL A HG23 6  
ATOM 9052  N N    . PRO A 1 18  ? 5.633   11.847  -1.340  1.00 0.00 ? 18  PRO A N    6  
ATOM 9053  C CA   . PRO A 1 18  ? 4.344   11.531  -0.717  1.00 0.00 ? 18  PRO A CA   6  
ATOM 9054  C C    . PRO A 1 18  ? 4.505   10.911  0.667   1.00 0.00 ? 18  PRO A C    6  
ATOM 9055  O O    . PRO A 1 18  ? 5.044   9.813   0.807   1.00 0.00 ? 18  PRO A O    6  
ATOM 9056  C CB   . PRO A 1 18  ? 3.721   10.522  -1.685  1.00 0.00 ? 18  PRO A CB   6  
ATOM 9057  C CG   . PRO A 1 18  ? 4.882   9.894   -2.377  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9058  C CD   . PRO A 1 18  ? 5.931   10.966  -2.482  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9059  H HA   . PRO A 1 18  ? 3.712   12.404  -0.649  1.00 0.00 ? 18  PRO A HA   6  
ATOM 9060  H HB2  . PRO A 1 18  ? 3.149   9.792   -1.130  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9061  H HB3  . PRO A 1 18  ? 3.077   11.037  -2.383  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9062  H HG2  . PRO A 1 18  ? 5.251   9.063   -1.795  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9063  H HG3  . PRO A 1 18  ? 4.586   9.563   -3.362  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9064  H HD2  . PRO A 1 18  ? 6.918   10.538  -2.391  1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9065  H HD3  . PRO A 1 18  ? 5.833   11.500  -3.415  1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9066  N N    . ASP A 1 19  ? 4.035   11.622  1.686   1.00 0.00 ? 19  ASP A N    6  
ATOM 9067  C CA   . ASP A 1 19  ? 4.125   11.141  3.060   1.00 0.00 ? 19  ASP A CA   6  
ATOM 9068  C C    . ASP A 1 19  ? 3.570   9.725   3.177   1.00 0.00 ? 19  ASP A C    6  
ATOM 9069  O O    . ASP A 1 19  ? 3.051   9.167   2.210   1.00 0.00 ? 19  ASP A O    6  
ATOM 9070  C CB   . ASP A 1 19  ? 3.369   12.079  4.002   1.00 0.00 ? 19  ASP A CB   6  
ATOM 9071  C CG   . ASP A 1 19  ? 3.939   12.070  5.407   1.00 0.00 ? 19  ASP A CG   6  
ATOM 9072  O OD1  . ASP A 1 19  ? 5.142   12.368  5.562   1.00 0.00 ? 19  ASP A OD1  6  
ATOM 9073  O OD2  . ASP A 1 19  ? 3.181   11.767  6.352   1.00 0.00 ? 19  ASP A OD2  6  
ATOM 9074  H H    . ASP A 1 19  ? 3.616   12.491  1.510   1.00 0.00 ? 19  ASP A H    6  
ATOM 9075  H HA   . ASP A 1 19  ? 5.168   11.129  3.339   1.00 0.00 ? 19  ASP A HA   6  
ATOM 9076  H HB2  . ASP A 1 19  ? 3.425   13.087  3.617   1.00 0.00 ? 19  ASP A HB2  6  
ATOM 9077  H HB3  . ASP A 1 19  ? 2.335   11.773  4.050   1.00 0.00 ? 19  ASP A HB3  6  
ATOM 9078  N N    . THR A 1 20  ? 3.682   9.147   4.369   1.00 0.00 ? 20  THR A N    6  
ATOM 9079  C CA   . THR A 1 20  ? 3.193   7.796   4.613   1.00 0.00 ? 20  THR A CA   6  
ATOM 9080  C C    . THR A 1 20  ? 1.676   7.729   4.483   1.00 0.00 ? 20  THR A C    6  
ATOM 9081  O O    . THR A 1 20  ? 0.943   8.540   5.050   1.00 0.00 ? 20  THR A O    6  
ATOM 9082  C CB   . THR A 1 20  ? 3.600   7.296   6.012   1.00 0.00 ? 20  THR A CB   6  
ATOM 9083  O OG1  . THR A 1 20  ? 5.003   7.498   6.216   1.00 0.00 ? 20  THR A OG1  6  
ATOM 9084  C CG2  . THR A 1 20  ? 3.266   5.821   6.178   1.00 0.00 ? 20  THR A CG2  6  
ATOM 9085  H H    . THR A 1 20  ? 4.105   9.643   5.101   1.00 0.00 ? 20  THR A H    6  
ATOM 9086  H HA   . THR A 1 20  ? 3.638   7.143   3.877   1.00 0.00 ? 20  THR A HA   6  
ATOM 9087  H HB   . THR A 1 20  ? 3.052   7.860   6.753   1.00 0.00 ? 20  THR A HB   6  
ATOM 9088  H HG1  . THR A 1 20  ? 5.274   8.314   5.789   1.00 0.00 ? 20  THR A HG1  6  
ATOM 9089  H HG21 . THR A 1 20  ? 3.398   5.536   7.211   1.00 0.00 ? 20  THR A HG21 6  
ATOM 9090  H HG22 . THR A 1 20  ? 3.921   5.231   5.555   1.00 0.00 ? 20  THR A HG22 6  
ATOM 9091  H HG23 . THR A 1 20  ? 2.240   5.650   5.886   1.00 0.00 ? 20  THR A HG23 6  
ATOM 9092  N N    . PRO A 1 21  ? 1.190   6.738   3.720   1.00 0.00 ? 21  PRO A N    6  
ATOM 9093  C CA   . PRO A 1 21  ? -0.245  6.541   3.499   1.00 0.00 ? 21  PRO A CA   6  
ATOM 9094  C C    . PRO A 1 21  ? -0.964  6.058   4.754   1.00 0.00 ? 21  PRO A C    6  
ATOM 9095  O O    . PRO A 1 21  ? -0.387  5.349   5.580   1.00 0.00 ? 21  PRO A O    6  
ATOM 9096  C CB   . PRO A 1 21  ? -0.292  5.466   2.410   1.00 0.00 ? 21  PRO A CB   6  
ATOM 9097  C CG   . PRO A 1 21  ? 0.992   4.724   2.555   1.00 0.00 ? 21  PRO A CG   6  
ATOM 9098  C CD   . PRO A 1 21  ? 2.005   5.735   3.015   1.00 0.00 ? 21  PRO A CD   6  
ATOM 9099  H HA   . PRO A 1 21  ? -0.719  7.442   3.138   1.00 0.00 ? 21  PRO A HA   6  
ATOM 9100  H HB2  . PRO A 1 21  ? -1.143  4.820   2.574   1.00 0.00 ? 21  PRO A HB2  6  
ATOM 9101  H HB3  . PRO A 1 21  ? -0.369  5.934   1.440   1.00 0.00 ? 21  PRO A HB3  6  
ATOM 9102  H HG2  . PRO A 1 21  ? 0.882   3.941   3.291   1.00 0.00 ? 21  PRO A HG2  6  
ATOM 9103  H HG3  . PRO A 1 21  ? 1.284   4.307   1.603   1.00 0.00 ? 21  PRO A HG3  6  
ATOM 9104  H HD2  . PRO A 1 21  ? 2.718   5.277   3.685   1.00 0.00 ? 21  PRO A HD2  6  
ATOM 9105  H HD3  . PRO A 1 21  ? 2.510   6.176   2.168   1.00 0.00 ? 21  PRO A HD3  6  
ATOM 9106  N N    . THR A 1 22  ? -2.228  6.445   4.893   1.00 0.00 ? 22  THR A N    6  
ATOM 9107  C CA   . THR A 1 22  ? -3.026  6.053   6.048   1.00 0.00 ? 22  THR A CA   6  
ATOM 9108  C C    . THR A 1 22  ? -3.314  4.556   6.034   1.00 0.00 ? 22  THR A C    6  
ATOM 9109  O O    . THR A 1 22  ? -2.999  3.863   5.067   1.00 0.00 ? 22  THR A O    6  
ATOM 9110  C CB   . THR A 1 22  ? -4.360  6.820   6.096   1.00 0.00 ? 22  THR A CB   6  
ATOM 9111  O OG1  . THR A 1 22  ? -4.179  8.150   5.595   1.00 0.00 ? 22  THR A OG1  6  
ATOM 9112  C CG2  . THR A 1 22  ? -4.901  6.878   7.517   1.00 0.00 ? 22  THR A CG2  6  
ATOM 9113  H H    . THR A 1 22  ? -2.632  7.010   4.201   1.00 0.00 ? 22  THR A H    6  
ATOM 9114  H HA   . THR A 1 22  ? -2.464  6.294   6.939   1.00 0.00 ? 22  THR A HA   6  
ATOM 9115  H HB   . THR A 1 22  ? -5.078  6.304   5.474   1.00 0.00 ? 22  THR A HB   6  
ATOM 9116  H HG1  . THR A 1 22  ? -4.110  8.124   4.638   1.00 0.00 ? 22  THR A HG1  6  
ATOM 9117  H HG21 . THR A 1 22  ? -4.080  6.826   8.216   1.00 0.00 ? 22  THR A HG21 6  
ATOM 9118  H HG22 . THR A 1 22  ? -5.567  6.044   7.683   1.00 0.00 ? 22  THR A HG22 6  
ATOM 9119  H HG23 . THR A 1 22  ? -5.438  7.803   7.661   1.00 0.00 ? 22  THR A HG23 6  
ATOM 9120  N N    . ARG A 1 23  ? -3.914  4.064   7.113   1.00 0.00 ? 23  ARG A N    6  
ATOM 9121  C CA   . ARG A 1 23  ? -4.244  2.648   7.224   1.00 0.00 ? 23  ARG A CA   6  
ATOM 9122  C C    . ARG A 1 23  ? -4.899  2.140   5.943   1.00 0.00 ? 23  ARG A C    6  
ATOM 9123  O O    . ARG A 1 23  ? -5.221  2.920   5.046   1.00 0.00 ? 23  ARG A O    6  
ATOM 9124  C CB   . ARG A 1 23  ? -5.175  2.412   8.415   1.00 0.00 ? 23  ARG A CB   6  
ATOM 9125  C CG   . ARG A 1 23  ? -4.617  2.918   9.735   1.00 0.00 ? 23  ARG A CG   6  
ATOM 9126  C CD   . ARG A 1 23  ? -5.526  2.556   10.899  1.00 0.00 ? 23  ARG A CD   6  
ATOM 9127  N NE   . ARG A 1 23  ? -6.892  3.030   10.694  1.00 0.00 ? 23  ARG A NE   6  
ATOM 9128  C CZ   . ARG A 1 23  ? -7.782  3.153   11.673  1.00 0.00 ? 23  ARG A CZ   6  
ATOM 9129  N NH1  . ARG A 1 23  ? -7.450  2.840   12.918  1.00 0.00 ? 23  ARG A NH1  6  
ATOM 9130  N NH2  . ARG A 1 23  ? -9.006  3.592   11.408  1.00 0.00 ? 23  ARG A NH2  6  
ATOM 9131  H H    . ARG A 1 23  ? -4.140  4.667   7.852   1.00 0.00 ? 23  ARG A H    6  
ATOM 9132  H HA   . ARG A 1 23  ? -3.325  2.105   7.385   1.00 0.00 ? 23  ARG A HA   6  
ATOM 9133  H HB2  . ARG A 1 23  ? -6.113  2.915   8.229   1.00 0.00 ? 23  ARG A HB2  6  
ATOM 9134  H HB3  . ARG A 1 23  ? -5.358  1.352   8.508   1.00 0.00 ? 23  ARG A HB3  6  
ATOM 9135  H HG2  . ARG A 1 23  ? -3.647  2.474   9.899   1.00 0.00 ? 23  ARG A HG2  6  
ATOM 9136  H HG3  . ARG A 1 23  ? -4.520  3.992   9.685   1.00 0.00 ? 23  ARG A HG3  6  
ATOM 9137  H HD2  . ARG A 1 23  ? -5.541  1.482   11.007  1.00 0.00 ? 23  ARG A HD2  6  
ATOM 9138  H HD3  . ARG A 1 23  ? -5.131  3.003   11.799  1.00 0.00 ? 23  ARG A HD3  6  
ATOM 9139  H HE   . ARG A 1 23  ? -7.159  3.268   9.782   1.00 0.00 ? 23  ARG A HE   6  
ATOM 9140  H HH11 . ARG A 1 23  ? -6.528  2.510   13.121  1.00 0.00 ? 23  ARG A HH11 6  
ATOM 9141  H HH12 . ARG A 1 23  ? -8.121  2.935   13.654  1.00 0.00 ? 23  ARG A HH12 6  
ATOM 9142  H HH21 . ARG A 1 23  ? -9.259  3.829   10.471  1.00 0.00 ? 23  ARG A HH21 6  
ATOM 9143  H HH22 . ARG A 1 23  ? -9.674  3.684   12.145  1.00 0.00 ? 23  ARG A HH22 6  
ATOM 9144  N N    . LEU A 1 24  ? -5.093  0.828   5.865   1.00 0.00 ? 24  LEU A N    6  
ATOM 9145  C CA   . LEU A 1 24  ? -5.709  0.215   4.693   1.00 0.00 ? 24  LEU A CA   6  
ATOM 9146  C C    . LEU A 1 24  ? -7.036  -0.444  5.058   1.00 0.00 ? 24  LEU A C    6  
ATOM 9147  O O    . LEU A 1 24  ? -7.294  -0.741  6.224   1.00 0.00 ? 24  LEU A O    6  
ATOM 9148  C CB   . LEU A 1 24  ? -4.765  -0.820  4.079   1.00 0.00 ? 24  LEU A CB   6  
ATOM 9149  C CG   . LEU A 1 24  ? -3.270  -0.561  4.268   1.00 0.00 ? 24  LEU A CG   6  
ATOM 9150  C CD1  . LEU A 1 24  ? -2.452  -1.691  3.663   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 9151  C CD2  . LEU A 1 24  ? -2.878  0.774   3.650   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 9152  H H    . LEU A 1 24  ? -4.816  0.258   6.611   1.00 0.00 ? 24  LEU A H    6  
ATOM 9153  H HA   . LEU A 1 24  ? -5.895  0.995   3.970   1.00 0.00 ? 24  LEU A HA   6  
ATOM 9154  H HB2  . LEU A 1 24  ? -4.993  -1.778  4.520   1.00 0.00 ? 24  LEU A HB2  6  
ATOM 9155  H HB3  . LEU A 1 24  ? -4.964  -0.858  3.017   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 9156  H HG   . LEU A 1 24  ? -3.050  -0.518  5.325   1.00 0.00 ? 24  LEU A HG   6  
ATOM 9157  H HD11 . LEU A 1 24  ? -1.401  -1.498  3.819   1.00 0.00 ? 24  LEU A HD11 6  
ATOM 9158  H HD12 . LEU A 1 24  ? -2.653  -1.755  2.604   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 9159  H HD13 . LEU A 1 24  ? -2.721  -2.623  4.138   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 9160  H HD21 . LEU A 1 24  ? -2.715  1.499   4.433   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 9161  H HD22 . LEU A 1 24  ? -3.671  1.116   3.001   1.00 0.00 ? 24  LEU A HD22 6  
ATOM 9162  H HD23 . LEU A 1 24  ? -1.971  0.652   3.076   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 9163  N N    . VAL A 1 25  ? -7.874  -0.671  4.052   1.00 0.00 ? 25  VAL A N    6  
ATOM 9164  C CA   . VAL A 1 25  ? -9.173  -1.298  4.265   1.00 0.00 ? 25  VAL A CA   6  
ATOM 9165  C C    . VAL A 1 25  ? -9.329  -2.547  3.405   1.00 0.00 ? 25  VAL A C    6  
ATOM 9166  O O    . VAL A 1 25  ? -9.412  -2.463  2.180   1.00 0.00 ? 25  VAL A O    6  
ATOM 9167  C CB   . VAL A 1 25  ? -10.325 -0.324  3.951   1.00 0.00 ? 25  VAL A CB   6  
ATOM 9168  C CG1  . VAL A 1 25  ? -11.646 -1.072  3.859   1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9169  C CG2  . VAL A 1 25  ? -10.395 0.774   5.001   1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9170  H H    . VAL A 1 25  ? -7.612  -0.412  3.144   1.00 0.00 ? 25  VAL A H    6  
ATOM 9171  H HA   . VAL A 1 25  ? -9.241  -1.578  5.306   1.00 0.00 ? 25  VAL A HA   6  
ATOM 9172  H HB   . VAL A 1 25  ? -10.129 0.135   2.993   1.00 0.00 ? 25  VAL A HB   6  
ATOM 9173  H HG11 . VAL A 1 25  ? -11.561 -1.866  3.132   1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9174  H HG12 . VAL A 1 25  ? -11.891 -1.490  4.824   1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9175  H HG13 . VAL A 1 25  ? -12.425 -0.389  3.555   1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9176  H HG21 . VAL A 1 25  ? -9.641  0.601   5.755   1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9177  H HG22 . VAL A 1 25  ? -10.224 1.731   4.532   1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9178  H HG23 . VAL A 1 25  ? -11.372 0.769   5.463   1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9179  N N    . PHE A 1 26  ? -9.369  -3.705  4.055   1.00 0.00 ? 26  PHE A N    6  
ATOM 9180  C CA   . PHE A 1 26  ? -9.515  -4.973  3.350   1.00 0.00 ? 26  PHE A CA   6  
ATOM 9181  C C    . PHE A 1 26  ? -10.979 -5.398  3.291   1.00 0.00 ? 26  PHE A C    6  
ATOM 9182  O O    . PHE A 1 26  ? -11.712 -5.276  4.273   1.00 0.00 ? 26  PHE A O    6  
ATOM 9183  C CB   . PHE A 1 26  ? -8.684  -6.060  4.035   1.00 0.00 ? 26  PHE A CB   6  
ATOM 9184  C CG   . PHE A 1 26  ? -7.266  -5.648  4.308   1.00 0.00 ? 26  PHE A CG   6  
ATOM 9185  C CD1  . PHE A 1 26  ? -6.945  -4.942  5.456   1.00 0.00 ? 26  PHE A CD1  6  
ATOM 9186  C CD2  . PHE A 1 26  ? -6.254  -5.967  3.417   1.00 0.00 ? 26  PHE A CD2  6  
ATOM 9187  C CE1  . PHE A 1 26  ? -5.640  -4.561  5.711   1.00 0.00 ? 26  PHE A CE1  6  
ATOM 9188  C CE2  . PHE A 1 26  ? -4.948  -5.589  3.666   1.00 0.00 ? 26  PHE A CE2  6  
ATOM 9189  C CZ   . PHE A 1 26  ? -4.641  -4.885  4.814   1.00 0.00 ? 26  PHE A CZ   6  
ATOM 9190  H H    . PHE A 1 26  ? -9.298  -3.707  5.033   1.00 0.00 ? 26  PHE A H    6  
ATOM 9191  H HA   . PHE A 1 26  ? -9.152  -4.835  2.343   1.00 0.00 ? 26  PHE A HA   6  
ATOM 9192  H HB2  . PHE A 1 26  ? -9.143  -6.313  4.979   1.00 0.00 ? 26  PHE A HB2  6  
ATOM 9193  H HB3  . PHE A 1 26  ? -8.661  -6.936  3.404   1.00 0.00 ? 26  PHE A HB3  6  
ATOM 9194  H HD1  . PHE A 1 26  ? -7.726  -4.688  6.158   1.00 0.00 ? 26  PHE A HD1  6  
ATOM 9195  H HD2  . PHE A 1 26  ? -6.493  -6.517  2.518   1.00 0.00 ? 26  PHE A HD2  6  
ATOM 9196  H HE1  . PHE A 1 26  ? -5.404  -4.011  6.609   1.00 0.00 ? 26  PHE A HE1  6  
ATOM 9197  H HE2  . PHE A 1 26  ? -4.169  -5.843  2.963   1.00 0.00 ? 26  PHE A HE2  6  
ATOM 9198  H HZ   . PHE A 1 26  ? -3.622  -4.589  5.011   1.00 0.00 ? 26  PHE A HZ   6  
ATOM 9199  N N    . SER A 1 27  ? -11.399 -5.896  2.133   1.00 0.00 ? 27  SER A N    6  
ATOM 9200  C CA   . SER A 1 27  ? -12.776 -6.335  1.943   1.00 0.00 ? 27  SER A CA   6  
ATOM 9201  C C    . SER A 1 27  ? -12.895 -7.846  2.122   1.00 0.00 ? 27  SER A C    6  
ATOM 9202  O O    . SER A 1 27  ? -13.848 -8.338  2.724   1.00 0.00 ? 27  SER A O    6  
ATOM 9203  C CB   . SER A 1 27  ? -13.275 -5.933  0.554   1.00 0.00 ? 27  SER A CB   6  
ATOM 9204  O OG   . SER A 1 27  ? -14.676 -6.118  0.442   1.00 0.00 ? 27  SER A OG   6  
ATOM 9205  H H    . SER A 1 27  ? -10.767 -5.968  1.387   1.00 0.00 ? 27  SER A H    6  
ATOM 9206  H HA   . SER A 1 27  ? -13.385 -5.847  2.690   1.00 0.00 ? 27  SER A HA   6  
ATOM 9207  H HB2  . SER A 1 27  ? -13.046 -4.893  0.378   1.00 0.00 ? 27  SER A HB2  6  
ATOM 9208  H HB3  . SER A 1 27  ? -12.783 -6.541  -0.192  1.00 0.00 ? 27  SER A HB3  6  
ATOM 9209  H HG   . SER A 1 27  ? -15.118 -5.269  0.515   1.00 0.00 ? 27  SER A HG   6  
ATOM 9210  N N    . ALA A 1 28  ? -11.918 -8.576  1.593   1.00 0.00 ? 28  ALA A N    6  
ATOM 9211  C CA   . ALA A 1 28  ? -11.911 -10.030 1.695   1.00 0.00 ? 28  ALA A CA   6  
ATOM 9212  C C    . ALA A 1 28  ? -13.117 -10.636 0.985   1.00 0.00 ? 28  ALA A C    6  
ATOM 9213  O O    . ALA A 1 28  ? -13.856 -11.432 1.565   1.00 0.00 ? 28  ALA A O    6  
ATOM 9214  C CB   . ALA A 1 28  ? -11.886 -10.457 3.155   1.00 0.00 ? 28  ALA A CB   6  
ATOM 9215  H H    . ALA A 1 28  ? -11.185 -8.126  1.124   1.00 0.00 ? 28  ALA A H    6  
ATOM 9216  H HA   . ALA A 1 28  ? -11.009 -10.393 1.224   1.00 0.00 ? 28  ALA A HA   6  
ATOM 9217  H HB1  . ALA A 1 28  ? -12.128 -11.506 3.227   1.00 0.00 ? 28  ALA A HB1  6  
ATOM 9218  H HB2  . ALA A 1 28  ? -10.901 -10.285 3.562   1.00 0.00 ? 28  ALA A HB2  6  
ATOM 9219  H HB3  . ALA A 1 28  ? -12.611 -9.881  3.710   1.00 0.00 ? 28  ALA A HB3  6  
ATOM 9220  N N    . LEU A 1 29  ? -13.310 -10.254 -0.273  1.00 0.00 ? 29  LEU A N    6  
ATOM 9221  C CA   . LEU A 1 29  ? -14.428 -10.760 -1.063  1.00 0.00 ? 29  LEU A CA   6  
ATOM 9222  C C    . LEU A 1 29  ? -14.576 -12.269 -0.892  1.00 0.00 ? 29  LEU A C    6  
ATOM 9223  O O    . LEU A 1 29  ? -15.673 -12.813 -1.015  1.00 0.00 ? 29  LEU A O    6  
ATOM 9224  C CB   . LEU A 1 29  ? -14.229 -10.420 -2.541  1.00 0.00 ? 29  LEU A CB   6  
ATOM 9225  C CG   . LEU A 1 29  ? -14.108 -8.933  -2.876  1.00 0.00 ? 29  LEU A CG   6  
ATOM 9226  C CD1  . LEU A 1 29  ? -14.900 -8.095  -1.884  1.00 0.00 ? 29  LEU A CD1  6  
ATOM 9227  C CD2  . LEU A 1 29  ? -12.648 -8.506  -2.891  1.00 0.00 ? 29  LEU A CD2  6  
ATOM 9228  H H    . LEU A 1 29  ? -12.688 -9.618  -0.681  1.00 0.00 ? 29  LEU A H    6  
ATOM 9229  H HA   . LEU A 1 29  ? -15.328 -10.280 -0.709  1.00 0.00 ? 29  LEU A HA   6  
ATOM 9230  H HB2  . LEU A 1 29  ? -13.326 -10.908 -2.874  1.00 0.00 ? 29  LEU A HB2  6  
ATOM 9231  H HB3  . LEU A 1 29  ? -15.073 -10.816 -3.087  1.00 0.00 ? 29  LEU A HB3  6  
ATOM 9232  H HG   . LEU A 1 29  ? -14.519 -8.758  -3.862  1.00 0.00 ? 29  LEU A HG   6  
ATOM 9233  H HD11 . LEU A 1 29  ? -15.956 -8.269  -2.028  1.00 0.00 ? 29  LEU A HD11 6  
ATOM 9234  H HD12 . LEU A 1 29  ? -14.682 -7.049  -2.041  1.00 0.00 ? 29  LEU A HD12 6  
ATOM 9235  H HD13 . LEU A 1 29  ? -14.623 -8.373  -0.877  1.00 0.00 ? 29  LEU A HD13 6  
ATOM 9236  H HD21 . LEU A 1 29  ? -12.538 -7.580  -2.346  1.00 0.00 ? 29  LEU A HD21 6  
ATOM 9237  H HD22 . LEU A 1 29  ? -12.325 -8.364  -3.912  1.00 0.00 ? 29  LEU A HD22 6  
ATOM 9238  H HD23 . LEU A 1 29  ? -12.044 -9.272  -2.426  1.00 0.00 ? 29  LEU A HD23 6  
ATOM 9239  N N    . GLY A 1 30  ? -13.464 -12.939 -0.606  1.00 0.00 ? 30  GLY A N    6  
ATOM 9240  C CA   . GLY A 1 30  ? -13.493 -14.378 -0.421  1.00 0.00 ? 30  GLY A CA   6  
ATOM 9241  C C    . GLY A 1 30  ? -12.199 -14.914 0.159   1.00 0.00 ? 30  GLY A C    6  
ATOM 9242  O O    . GLY A 1 30  ? -11.342 -14.160 0.622   1.00 0.00 ? 30  GLY A O    6  
ATOM 9243  H H    . GLY A 1 30  ? -12.618 -12.453 -0.520  1.00 0.00 ? 30  GLY A H    6  
ATOM 9244  H HA2  . GLY A 1 30  ? -14.305 -14.629 0.245   1.00 0.00 ? 30  GLY A HA2  6  
ATOM 9245  H HA3  . GLY A 1 30  ? -13.667 -14.849 -1.378  1.00 0.00 ? 30  GLY A HA3  6  
ATOM 9246  N N    . PRO A 1 31  ? -12.045 -16.246 0.141   1.00 0.00 ? 31  PRO A N    6  
ATOM 9247  C CA   . PRO A 1 31  ? -10.849 -16.912 0.667   1.00 0.00 ? 31  PRO A CA   6  
ATOM 9248  C C    . PRO A 1 31  ? -9.618  -16.659 -0.196  1.00 0.00 ? 31  PRO A C    6  
ATOM 9249  O O    . PRO A 1 31  ? -8.488  -16.672 0.295   1.00 0.00 ? 31  PRO A O    6  
ATOM 9250  C CB   . PRO A 1 31  ? -11.227 -18.395 0.638   1.00 0.00 ? 31  PRO A CB   6  
ATOM 9251  C CG   . PRO A 1 31  ? -12.263 -18.501 -0.427  1.00 0.00 ? 31  PRO A CG   6  
ATOM 9252  C CD   . PRO A 1 31  ? -13.025 -17.205 -0.395  1.00 0.00 ? 31  PRO A CD   6  
ATOM 9253  H HA   . PRO A 1 31  ? -10.642 -16.611 1.684   1.00 0.00 ? 31  PRO A HA   6  
ATOM 9254  H HB2  . PRO A 1 31  ? -10.354 -18.987 0.402   1.00 0.00 ? 31  PRO A HB2  6  
ATOM 9255  H HB3  . PRO A 1 31  ? -11.619 -18.689 1.600   1.00 0.00 ? 31  PRO A HB3  6  
ATOM 9256  H HG2  . PRO A 1 31  ? -11.789 -18.633 -1.388  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 9257  H HG3  . PRO A 1 31  ? -12.923 -19.329 -0.216  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 9258  H HD2  . PRO A 1 31  ? -13.335 -16.925 -1.391  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 9259  H HD3  . PRO A 1 31  ? -13.881 -17.287 0.259   1.00 0.00 ? 31  PRO A HD3  6  
ATOM 9260  N N    . THR A 1 32  ? -9.842  -16.428 -1.486  1.00 0.00 ? 32  THR A N    6  
ATOM 9261  C CA   . THR A 1 32  ? -8.751  -16.172 -2.418  1.00 0.00 ? 32  THR A CA   6  
ATOM 9262  C C    . THR A 1 32  ? -8.900  -14.806 -3.078  1.00 0.00 ? 32  THR A C    6  
ATOM 9263  O O    . THR A 1 32  ? -8.294  -14.539 -4.115  1.00 0.00 ? 32  THR A O    6  
ATOM 9264  C CB   . THR A 1 32  ? -8.682  -17.254 -3.512  1.00 0.00 ? 32  THR A CB   6  
ATOM 9265  O OG1  . THR A 1 32  ? -9.968  -17.417 -4.121  1.00 0.00 ? 32  THR A OG1  6  
ATOM 9266  C CG2  . THR A 1 32  ? -8.218  -18.582 -2.933  1.00 0.00 ? 32  THR A CG2  6  
ATOM 9267  H H    . THR A 1 32  ? -10.764 -16.430 -1.817  1.00 0.00 ? 32  THR A H    6  
ATOM 9268  H HA   . THR A 1 32  ? -7.825  -16.194 -1.861  1.00 0.00 ? 32  THR A HA   6  
ATOM 9269  H HB   . THR A 1 32  ? -7.973  -16.939 -4.265  1.00 0.00 ? 32  THR A HB   6  
ATOM 9270  H HG1  . THR A 1 32  ? -10.460 -18.097 -3.654  1.00 0.00 ? 32  THR A HG1  6  
ATOM 9271  H HG21 . THR A 1 32  ? -8.421  -19.373 -3.639  1.00 0.00 ? 32  THR A HG21 6  
ATOM 9272  H HG22 . THR A 1 32  ? -8.748  -18.778 -2.012  1.00 0.00 ? 32  THR A HG22 6  
ATOM 9273  H HG23 . THR A 1 32  ? -7.157  -18.537 -2.736  1.00 0.00 ? 32  THR A HG23 6  
ATOM 9274  N N    . SER A 1 33  ? -9.709  -13.945 -2.469  1.00 0.00 ? 33  SER A N    6  
ATOM 9275  C CA   . SER A 1 33  ? -9.940  -12.607 -3.000  1.00 0.00 ? 33  SER A CA   6  
ATOM 9276  C C    . SER A 1 33  ? -9.916  -11.568 -1.884  1.00 0.00 ? 33  SER A C    6  
ATOM 9277  O O    . SER A 1 33  ? -10.322 -11.843 -0.754  1.00 0.00 ? 33  SER A O    6  
ATOM 9278  C CB   . SER A 1 33  ? -11.281 -12.551 -3.735  1.00 0.00 ? 33  SER A CB   6  
ATOM 9279  O OG   . SER A 1 33  ? -12.241 -13.384 -3.109  1.00 0.00 ? 33  SER A OG   6  
ATOM 9280  H H    . SER A 1 33  ? -10.164 -14.218 -1.645  1.00 0.00 ? 33  SER A H    6  
ATOM 9281  H HA   . SER A 1 33  ? -9.147  -12.386 -3.699  1.00 0.00 ? 33  SER A HA   6  
ATOM 9282  H HB2  . SER A 1 33  ? -11.647 -11.536 -3.734  1.00 0.00 ? 33  SER A HB2  6  
ATOM 9283  H HB3  . SER A 1 33  ? -11.144 -12.883 -4.754  1.00 0.00 ? 33  SER A HB3  6  
ATOM 9284  H HG   . SER A 1 33  ? -12.894 -12.840 -2.662  1.00 0.00 ? 33  SER A HG   6  
ATOM 9285  N N    . LEU A 1 34  ? -9.436  -10.372 -2.208  1.00 0.00 ? 34  LEU A N    6  
ATOM 9286  C CA   . LEU A 1 34  ? -9.358  -9.290  -1.233  1.00 0.00 ? 34  LEU A CA   6  
ATOM 9287  C C    . LEU A 1 34  ? -9.385  -7.931  -1.925  1.00 0.00 ? 34  LEU A C    6  
ATOM 9288  O O    . LEU A 1 34  ? -9.191  -7.836  -3.137  1.00 0.00 ? 34  LEU A O    6  
ATOM 9289  C CB   . LEU A 1 34  ? -8.084  -9.422  -0.395  1.00 0.00 ? 34  LEU A CB   6  
ATOM 9290  C CG   . LEU A 1 34  ? -8.213  -10.228 0.898   1.00 0.00 ? 34  LEU A CG   6  
ATOM 9291  C CD1  . LEU A 1 34  ? -6.900  -10.922 1.227   1.00 0.00 ? 34  LEU A CD1  6  
ATOM 9292  C CD2  . LEU A 1 34  ? -8.645  -9.329  2.046   1.00 0.00 ? 34  LEU A CD2  6  
ATOM 9293  H H    . LEU A 1 34  ? -9.127  -10.212 -3.123  1.00 0.00 ? 34  LEU A H    6  
ATOM 9294  H HA   . LEU A 1 34  ? -10.216 -9.367  -0.583  1.00 0.00 ? 34  LEU A HA   6  
ATOM 9295  H HB2  . LEU A 1 34  ? -7.334  -9.897  -1.008  1.00 0.00 ? 34  LEU A HB2  6  
ATOM 9296  H HB3  . LEU A 1 34  ? -7.756  -8.426  -0.134  1.00 0.00 ? 34  LEU A HB3  6  
ATOM 9297  H HG   . LEU A 1 34  ? -8.968  -10.991 0.766   1.00 0.00 ? 34  LEU A HG   6  
ATOM 9298  H HD11 . LEU A 1 34  ? -6.355  -11.112 0.315   1.00 0.00 ? 34  LEU A HD11 6  
ATOM 9299  H HD12 . LEU A 1 34  ? -7.102  -11.857 1.727   1.00 0.00 ? 34  LEU A HD12 6  
ATOM 9300  H HD13 . LEU A 1 34  ? -6.310  -10.288 1.873   1.00 0.00 ? 34  LEU A HD13 6  
ATOM 9301  H HD21 . LEU A 1 34  ? -8.472  -9.835  2.985   1.00 0.00 ? 34  LEU A HD21 6  
ATOM 9302  H HD22 . LEU A 1 34  ? -9.697  -9.101  1.948   1.00 0.00 ? 34  LEU A HD22 6  
ATOM 9303  H HD23 . LEU A 1 34  ? -8.075  -8.412  2.020   1.00 0.00 ? 34  LEU A HD23 6  
ATOM 9304  N N    . ARG A 1 35  ? -9.626  -6.881  -1.146  1.00 0.00 ? 35  ARG A N    6  
ATOM 9305  C CA   . ARG A 1 35  ? -9.678  -5.527  -1.684  1.00 0.00 ? 35  ARG A CA   6  
ATOM 9306  C C    . ARG A 1 35  ? -9.073  -4.528  -0.702  1.00 0.00 ? 35  ARG A C    6  
ATOM 9307  O O    . ARG A 1 35  ? -9.687  -4.184  0.308   1.00 0.00 ? 35  ARG A O    6  
ATOM 9308  C CB   . ARG A 1 35  ? -11.123 -5.136  -2.000  1.00 0.00 ? 35  ARG A CB   6  
ATOM 9309  C CG   . ARG A 1 35  ? -11.255 -3.768  -2.649  1.00 0.00 ? 35  ARG A CG   6  
ATOM 9310  C CD   . ARG A 1 35  ? -12.709 -3.330  -2.733  1.00 0.00 ? 35  ARG A CD   6  
ATOM 9311  N NE   . ARG A 1 35  ? -12.872 -2.123  -3.539  1.00 0.00 ? 35  ARG A NE   6  
ATOM 9312  C CZ   . ARG A 1 35  ? -12.642 -0.897  -3.082  1.00 0.00 ? 35  ARG A CZ   6  
ATOM 9313  N NH1  . ARG A 1 35  ? -12.242 -0.717  -1.831  1.00 0.00 ? 35  ARG A NH1  6  
ATOM 9314  N NH2  . ARG A 1 35  ? -12.812 0.152   -3.877  1.00 0.00 ? 35  ARG A NH2  6  
ATOM 9315  H H    . ARG A 1 35  ? -9.773  -7.020  -0.187  1.00 0.00 ? 35  ARG A H    6  
ATOM 9316  H HA   . ARG A 1 35  ? -9.102  -5.510  -2.597  1.00 0.00 ? 35  ARG A HA   6  
ATOM 9317  H HB2  . ARG A 1 35  ? -11.544 -5.870  -2.671  1.00 0.00 ? 35  ARG A HB2  6  
ATOM 9318  H HB3  . ARG A 1 35  ? -11.691 -5.131  -1.082  1.00 0.00 ? 35  ARG A HB3  6  
ATOM 9319  H HG2  . ARG A 1 35  ? -10.707 -3.046  -2.062  1.00 0.00 ? 35  ARG A HG2  6  
ATOM 9320  H HG3  . ARG A 1 35  ? -10.843 -3.811  -3.646  1.00 0.00 ? 35  ARG A HG3  6  
ATOM 9321  H HD2  . ARG A 1 35  ? -13.287 -4.127  -3.177  1.00 0.00 ? 35  ARG A HD2  6  
ATOM 9322  H HD3  . ARG A 1 35  ? -13.071 -3.136  -1.735  1.00 0.00 ? 35  ARG A HD3  6  
ATOM 9323  H HE   . ARG A 1 35  ? -13.166 -2.233  -4.467  1.00 0.00 ? 35  ARG A HE   6  
ATOM 9324  H HH11 . ARG A 1 35  ? -12.112 -1.506  -1.230  1.00 0.00 ? 35  ARG A HH11 6  
ATOM 9325  H HH12 . ARG A 1 35  ? -12.069 0.207   -1.489  1.00 0.00 ? 35  ARG A HH12 6  
ATOM 9326  H HH21 . ARG A 1 35  ? -13.113 0.020   -4.821  1.00 0.00 ? 35  ARG A HH21 6  
ATOM 9327  H HH22 . ARG A 1 35  ? -12.640 1.074   -3.531  1.00 0.00 ? 35  ARG A HH22 6  
ATOM 9328  N N    . VAL A 1 36  ? -7.863  -4.066  -1.005  1.00 0.00 ? 36  VAL A N    6  
ATOM 9329  C CA   . VAL A 1 36  ? -7.175  -3.107  -0.150  1.00 0.00 ? 36  VAL A CA   6  
ATOM 9330  C C    . VAL A 1 36  ? -7.469  -1.675  -0.582  1.00 0.00 ? 36  VAL A C    6  
ATOM 9331  O O    . VAL A 1 36  ? -7.430  -1.354  -1.770  1.00 0.00 ? 36  VAL A O    6  
ATOM 9332  C CB   . VAL A 1 36  ? -5.652  -3.333  -0.165  1.00 0.00 ? 36  VAL A CB   6  
ATOM 9333  C CG1  . VAL A 1 36  ? -4.928  -2.136  0.431   1.00 0.00 ? 36  VAL A CG1  6  
ATOM 9334  C CG2  . VAL A 1 36  ? -5.295  -4.609  0.583   1.00 0.00 ? 36  VAL A CG2  6  
ATOM 9335  H H    . VAL A 1 36  ? -7.424  -4.378  -1.824  1.00 0.00 ? 36  VAL A H    6  
ATOM 9336  H HA   . VAL A 1 36  ? -7.529  -3.247  0.862   1.00 0.00 ? 36  VAL A HA   6  
ATOM 9337  H HB   . VAL A 1 36  ? -5.335  -3.443  -1.192  1.00 0.00 ? 36  VAL A HB   6  
ATOM 9338  H HG11 . VAL A 1 36  ? -5.093  -2.111  1.498   1.00 0.00 ? 36  VAL A HG11 6  
ATOM 9339  H HG12 . VAL A 1 36  ? -3.869  -2.218  0.231   1.00 0.00 ? 36  VAL A HG12 6  
ATOM 9340  H HG13 . VAL A 1 36  ? -5.309  -1.228  -0.013  1.00 0.00 ? 36  VAL A HG13 6  
ATOM 9341  H HG21 . VAL A 1 36  ? -4.363  -5.001  0.205   1.00 0.00 ? 36  VAL A HG21 6  
ATOM 9342  H HG22 . VAL A 1 36  ? -5.194  -4.391  1.636   1.00 0.00 ? 36  VAL A HG22 6  
ATOM 9343  H HG23 . VAL A 1 36  ? -6.078  -5.341  0.441   1.00 0.00 ? 36  VAL A HG23 6  
ATOM 9344  N N    . SER A 1 37  ? -7.764  -0.818  0.390   1.00 0.00 ? 37  SER A N    6  
ATOM 9345  C CA   . SER A 1 37  ? -8.069  0.581   0.109   1.00 0.00 ? 37  SER A CA   6  
ATOM 9346  C C    . SER A 1 37  ? -7.342  1.501   1.085   1.00 0.00 ? 37  SER A C    6  
ATOM 9347  O O    . SER A 1 37  ? -7.443  1.339   2.301   1.00 0.00 ? 37  SER A O    6  
ATOM 9348  C CB   . SER A 1 37  ? -9.577  0.822   0.190   1.00 0.00 ? 37  SER A CB   6  
ATOM 9349  O OG   . SER A 1 37  ? -9.862  2.187   0.443   1.00 0.00 ? 37  SER A OG   6  
ATOM 9350  H H    . SER A 1 37  ? -7.780  -1.134  1.317   1.00 0.00 ? 37  SER A H    6  
ATOM 9351  H HA   . SER A 1 37  ? -7.731  0.799   -0.893  1.00 0.00 ? 37  SER A HA   6  
ATOM 9352  H HB2  . SER A 1 37  ? -10.036 0.538   -0.745  1.00 0.00 ? 37  SER A HB2  6  
ATOM 9353  H HB3  . SER A 1 37  ? -9.992  0.226   0.990   1.00 0.00 ? 37  SER A HB3  6  
ATOM 9354  H HG   . SER A 1 37  ? -10.809 2.334   0.380   1.00 0.00 ? 37  SER A HG   6  
ATOM 9355  N N    . TRP A 1 38  ? -6.609  2.467   0.542   1.00 0.00 ? 38  TRP A N    6  
ATOM 9356  C CA   . TRP A 1 38  ? -5.864  3.414   1.364   1.00 0.00 ? 38  TRP A CA   6  
ATOM 9357  C C    . TRP A 1 38  ? -6.333  4.842   1.109   1.00 0.00 ? 38  TRP A C    6  
ATOM 9358  O O    . TRP A 1 38  ? -7.279  5.068   0.355   1.00 0.00 ? 38  TRP A O    6  
ATOM 9359  C CB   . TRP A 1 38  ? -4.366  3.297   1.082   1.00 0.00 ? 38  TRP A CB   6  
ATOM 9360  C CG   . TRP A 1 38  ? -4.019  3.469   -0.366  1.00 0.00 ? 38  TRP A CG   6  
ATOM 9361  C CD1  . TRP A 1 38  ? -3.567  4.606   -0.972  1.00 0.00 ? 38  TRP A CD1  6  
ATOM 9362  C CD2  . TRP A 1 38  ? -4.097  2.471   -1.390  1.00 0.00 ? 38  TRP A CD2  6  
ATOM 9363  N NE1  . TRP A 1 38  ? -3.361  4.376   -2.310  1.00 0.00 ? 38  TRP A NE1  6  
ATOM 9364  C CE2  . TRP A 1 38  ? -3.678  3.074   -2.592  1.00 0.00 ? 38  TRP A CE2  6  
ATOM 9365  C CE3  . TRP A 1 38  ? -4.480  1.127   -1.408  1.00 0.00 ? 38  TRP A CE3  6  
ATOM 9366  C CZ2  . TRP A 1 38  ? -3.631  2.378   -3.797  1.00 0.00 ? 38  TRP A CZ2  6  
ATOM 9367  C CZ3  . TRP A 1 38  ? -4.433  0.437   -2.605  1.00 0.00 ? 38  TRP A CZ3  6  
ATOM 9368  C CH2  . TRP A 1 38  ? -4.011  1.063   -3.786  1.00 0.00 ? 38  TRP A CH2  6  
ATOM 9369  H H    . TRP A 1 38  ? -6.568  2.545   -0.434  1.00 0.00 ? 38  TRP A H    6  
ATOM 9370  H HA   . TRP A 1 38  ? -6.046  3.168   2.400   1.00 0.00 ? 38  TRP A HA   6  
ATOM 9371  H HB2  . TRP A 1 38  ? -3.840  4.055   1.642   1.00 0.00 ? 38  TRP A HB2  6  
ATOM 9372  H HB3  . TRP A 1 38  ? -4.023  2.321   1.394   1.00 0.00 ? 38  TRP A HB3  6  
ATOM 9373  H HD1  . TRP A 1 38  ? -3.404  5.543   -0.461  1.00 0.00 ? 38  TRP A HD1  6  
ATOM 9374  H HE1  . TRP A 1 38  ? -3.037  5.038   -2.958  1.00 0.00 ? 38  TRP A HE1  6  
ATOM 9375  H HE3  . TRP A 1 38  ? -4.808  0.627   -0.509  1.00 0.00 ? 38  TRP A HE3  6  
ATOM 9376  H HZ2  . TRP A 1 38  ? -3.308  2.845   -4.715  1.00 0.00 ? 38  TRP A HZ2  6  
ATOM 9377  H HZ3  . TRP A 1 38  ? -4.726  -0.602  -2.639  1.00 0.00 ? 38  TRP A HZ3  6  
ATOM 9378  H HH2  . TRP A 1 38  ? -3.991  0.486   -4.697  1.00 0.00 ? 38  TRP A HH2  6  
ATOM 9379  N N    . GLN A 1 39  ? -5.664  5.802   1.741   1.00 0.00 ? 39  GLN A N    6  
ATOM 9380  C CA   . GLN A 1 39  ? -6.014  7.208   1.581   1.00 0.00 ? 39  GLN A CA   6  
ATOM 9381  C C    . GLN A 1 39  ? -4.901  7.968   0.866   1.00 0.00 ? 39  GLN A C    6  
ATOM 9382  O O    . GLN A 1 39  ? -3.792  7.459   0.709   1.00 0.00 ? 39  GLN A O    6  
ATOM 9383  C CB   . GLN A 1 39  ? -6.289  7.845   2.944   1.00 0.00 ? 39  GLN A CB   6  
ATOM 9384  C CG   . GLN A 1 39  ? -7.745  7.761   3.373   1.00 0.00 ? 39  GLN A CG   6  
ATOM 9385  C CD   . GLN A 1 39  ? -8.094  6.422   3.991   1.00 0.00 ? 39  GLN A CD   6  
ATOM 9386  O OE1  . GLN A 1 39  ? -8.158  6.287   5.213   1.00 0.00 ? 39  GLN A OE1  6  
ATOM 9387  N NE2  . GLN A 1 39  ? -8.323  5.422   3.148   1.00 0.00 ? 39  GLN A NE2  6  
ATOM 9388  H H    . GLN A 1 39  ? -4.920  5.558   2.328   1.00 0.00 ? 39  GLN A H    6  
ATOM 9389  H HA   . GLN A 1 39  ? -6.911  7.260   0.982   1.00 0.00 ? 39  GLN A HA   6  
ATOM 9390  H HB2  . GLN A 1 39  ? -5.687  7.347   3.689   1.00 0.00 ? 39  GLN A HB2  6  
ATOM 9391  H HB3  . GLN A 1 39  ? -6.008  8.888   2.904   1.00 0.00 ? 39  GLN A HB3  6  
ATOM 9392  H HG2  . GLN A 1 39  ? -7.939  8.536   4.099   1.00 0.00 ? 39  GLN A HG2  6  
ATOM 9393  H HG3  . GLN A 1 39  ? -8.371  7.916   2.506   1.00 0.00 ? 39  GLN A HG3  6  
ATOM 9394  H HE21 . GLN A 1 39  ? -8.253  5.602   2.186   1.00 0.00 ? 39  GLN A HE21 6  
ATOM 9395  H HE22 . GLN A 1 39  ? -8.550  4.545   3.520   1.00 0.00 ? 39  GLN A HE22 6  
ATOM 9396  N N    . GLU A 1 40  ? -5.207  9.187   0.434   1.00 0.00 ? 40  GLU A N    6  
ATOM 9397  C CA   . GLU A 1 40  ? -4.232  10.016  -0.265  1.00 0.00 ? 40  GLU A CA   6  
ATOM 9398  C C    . GLU A 1 40  ? -3.415  10.845  0.722   1.00 0.00 ? 40  GLU A C    6  
ATOM 9399  O O    . GLU A 1 40  ? -3.908  11.792  1.334   1.00 0.00 ? 40  GLU A O    6  
ATOM 9400  C CB   . GLU A 1 40  ? -4.936  10.939  -1.263  1.00 0.00 ? 40  GLU A CB   6  
ATOM 9401  C CG   . GLU A 1 40  ? -3.981  11.681  -2.183  1.00 0.00 ? 40  GLU A CG   6  
ATOM 9402  C CD   . GLU A 1 40  ? -3.514  12.999  -1.597  1.00 0.00 ? 40  GLU A CD   6  
ATOM 9403  O OE1  . GLU A 1 40  ? -4.290  13.623  -0.844  1.00 0.00 ? 40  GLU A OE1  6  
ATOM 9404  O OE2  . GLU A 1 40  ? -2.371  13.407  -1.893  1.00 0.00 ? 40  GLU A OE2  6  
ATOM 9405  H H    . GLU A 1 40  ? -6.109  9.538   0.589   1.00 0.00 ? 40  GLU A H    6  
ATOM 9406  H HA   . GLU A 1 40  ? -3.565  9.360   -0.804  1.00 0.00 ? 40  GLU A HA   6  
ATOM 9407  H HB2  . GLU A 1 40  ? -5.604  10.348  -1.871  1.00 0.00 ? 40  GLU A HB2  6  
ATOM 9408  H HB3  . GLU A 1 40  ? -5.513  11.668  -0.714  1.00 0.00 ? 40  GLU A HB3  6  
ATOM 9409  H HG2  . GLU A 1 40  ? -3.118  11.059  -2.363  1.00 0.00 ? 40  GLU A HG2  6  
ATOM 9410  H HG3  . GLU A 1 40  ? -4.484  11.877  -3.119  1.00 0.00 ? 40  GLU A HG3  6  
ATOM 9411  N N    . PRO A 1 41  ? -2.134  10.480  0.881   1.00 0.00 ? 41  PRO A N    6  
ATOM 9412  C CA   . PRO A 1 41  ? -1.220  11.176  1.792   1.00 0.00 ? 41  PRO A CA   6  
ATOM 9413  C C    . PRO A 1 41  ? -0.863  12.574  1.299   1.00 0.00 ? 41  PRO A C    6  
ATOM 9414  O O    . PRO A 1 41  ? -1.220  12.960  0.185   1.00 0.00 ? 41  PRO A O    6  
ATOM 9415  C CB   . PRO A 1 41  ? 0.021   10.280  1.803   1.00 0.00 ? 41  PRO A CB   6  
ATOM 9416  C CG   . PRO A 1 41  ? -0.022  9.558   0.500   1.00 0.00 ? 41  PRO A CG   6  
ATOM 9417  C CD   . PRO A 1 41  ? -1.478  9.361   0.183   1.00 0.00 ? 41  PRO A CD   6  
ATOM 9418  H HA   . PRO A 1 41  ? -1.628  11.241  2.790   1.00 0.00 ? 41  PRO A HA   6  
ATOM 9419  H HB2  . PRO A 1 41  ? 0.909   10.891  1.888   1.00 0.00 ? 41  PRO A HB2  6  
ATOM 9420  H HB3  . PRO A 1 41  ? -0.033  9.595   2.635   1.00 0.00 ? 41  PRO A HB3  6  
ATOM 9421  H HG2  . PRO A 1 41  ? 0.451   10.154  -0.265  1.00 0.00 ? 41  PRO A HG2  6  
ATOM 9422  H HG3  . PRO A 1 41  ? 0.474   8.603   0.594   1.00 0.00 ? 41  PRO A HG3  6  
ATOM 9423  H HD2  . PRO A 1 41  ? -1.644  9.421   -0.882  1.00 0.00 ? 41  PRO A HD2  6  
ATOM 9424  H HD3  . PRO A 1 41  ? -1.823  8.413   0.569   1.00 0.00 ? 41  PRO A HD3  6  
ATOM 9425  N N    . ARG A 1 42  ? -0.157  13.329  2.134   1.00 0.00 ? 42  ARG A N    6  
ATOM 9426  C CA   . ARG A 1 42  ? 0.247   14.685  1.783   1.00 0.00 ? 42  ARG A CA   6  
ATOM 9427  C C    . ARG A 1 42  ? 1.418   14.667  0.805   1.00 0.00 ? 42  ARG A C    6  
ATOM 9428  O O    . ARG A 1 42  ? 2.429   14.005  1.044   1.00 0.00 ? 42  ARG A O    6  
ATOM 9429  C CB   . ARG A 1 42  ? 0.630   15.468  3.040   1.00 0.00 ? 42  ARG A CB   6  
ATOM 9430  C CG   . ARG A 1 42  ? 1.834   14.896  3.770   1.00 0.00 ? 42  ARG A CG   6  
ATOM 9431  C CD   . ARG A 1 42  ? 2.198   15.733  4.986   1.00 0.00 ? 42  ARG A CD   6  
ATOM 9432  N NE   . ARG A 1 42  ? 3.543   15.438  5.472   1.00 0.00 ? 42  ARG A NE   6  
ATOM 9433  C CZ   . ARG A 1 42  ? 4.264   16.284  6.199   1.00 0.00 ? 42  ARG A CZ   6  
ATOM 9434  N NH1  . ARG A 1 42  ? 3.771   17.471  6.525   1.00 0.00 ? 42  ARG A NH1  6  
ATOM 9435  N NH2  . ARG A 1 42  ? 5.481   15.943  6.604   1.00 0.00 ? 42  ARG A NH2  6  
ATOM 9436  H H    . ARG A 1 42  ? 0.097   12.966  3.008   1.00 0.00 ? 42  ARG A H    6  
ATOM 9437  H HA   . ARG A 1 42  ? -0.594  15.170  1.310   1.00 0.00 ? 42  ARG A HA   6  
ATOM 9438  H HB2  . ARG A 1 42  ? 0.857   16.487  2.761   1.00 0.00 ? 42  ARG A HB2  6  
ATOM 9439  H HB3  . ARG A 1 42  ? -0.209  15.468  3.719   1.00 0.00 ? 42  ARG A HB3  6  
ATOM 9440  H HG2  . ARG A 1 42  ? 1.603   13.892  4.094   1.00 0.00 ? 42  ARG A HG2  6  
ATOM 9441  H HG3  . ARG A 1 42  ? 2.676   14.873  3.094   1.00 0.00 ? 42  ARG A HG3  6  
ATOM 9442  H HD2  . ARG A 1 42  ? 2.144   16.777  4.717   1.00 0.00 ? 42  ARG A HD2  6  
ATOM 9443  H HD3  . ARG A 1 42  ? 1.488   15.527  5.774   1.00 0.00 ? 42  ARG A HD3  6  
ATOM 9444  H HE   . ARG A 1 42  ? 3.927   14.566  5.243   1.00 0.00 ? 42  ARG A HE   6  
ATOM 9445  H HH11 . ARG A 1 42  ? 2.854   17.730  6.222   1.00 0.00 ? 42  ARG A HH11 6  
ATOM 9446  H HH12 . ARG A 1 42  ? 4.315   18.105  7.074   1.00 0.00 ? 42  ARG A HH12 6  
ATOM 9447  H HH21 . ARG A 1 42  ? 5.856   15.049  6.361   1.00 0.00 ? 42  ARG A HH21 6  
ATOM 9448  H HH22 . ARG A 1 42  ? 6.023   16.580  7.151   1.00 0.00 ? 42  ARG A HH22 6  
ATOM 9449  N N    . CYS A 1 43  ? 1.274   15.397  -0.295  1.00 0.00 ? 43  CYS A N    6  
ATOM 9450  C CA   . CYS A 1 43  ? 2.320   15.464  -1.310  1.00 0.00 ? 43  CYS A CA   6  
ATOM 9451  C C    . CYS A 1 43  ? 2.315   16.821  -2.007  1.00 0.00 ? 43  CYS A C    6  
ATOM 9452  O O    . CYS A 1 43  ? 1.351   17.179  -2.683  1.00 0.00 ? 43  CYS A O    6  
ATOM 9453  C CB   . CYS A 1 43  ? 2.133   14.348  -2.339  1.00 0.00 ? 43  CYS A CB   6  
ATOM 9454  S SG   . CYS A 1 43  ? 1.363   12.853  -1.675  1.00 0.00 ? 43  CYS A SG   6  
ATOM 9455  H H    . CYS A 1 43  ? 0.446   15.903  -0.429  1.00 0.00 ? 43  CYS A H    6  
ATOM 9456  H HA   . CYS A 1 43  ? 3.270   15.331  -0.816  1.00 0.00 ? 43  CYS A HA   6  
ATOM 9457  H HB2  . CYS A 1 43  ? 1.507   14.710  -3.142  1.00 0.00 ? 43  CYS A HB2  6  
ATOM 9458  H HB3  . CYS A 1 43  ? 3.097   14.073  -2.740  1.00 0.00 ? 43  CYS A HB3  6  
ATOM 9459  H HG   . CYS A 1 43  ? 0.181   13.187  -1.181  1.00 0.00 ? 43  CYS A HG   6  
ATOM 9460  N N    . GLU A 1 44  ? 3.398   17.572  -1.836  1.00 0.00 ? 44  GLU A N    6  
ATOM 9461  C CA   . GLU A 1 44  ? 3.517   18.891  -2.447  1.00 0.00 ? 44  GLU A CA   6  
ATOM 9462  C C    . GLU A 1 44  ? 3.388   18.801  -3.965  1.00 0.00 ? 44  GLU A C    6  
ATOM 9463  O O    . GLU A 1 44  ? 3.026   19.774  -4.627  1.00 0.00 ? 44  GLU A O    6  
ATOM 9464  C CB   . GLU A 1 44  ? 4.855   19.532  -2.075  1.00 0.00 ? 44  GLU A CB   6  
ATOM 9465  C CG   . GLU A 1 44  ? 4.887   21.037  -2.276  1.00 0.00 ? 44  GLU A CG   6  
ATOM 9466  C CD   . GLU A 1 44  ? 6.273   21.553  -2.611  1.00 0.00 ? 44  GLU A CD   6  
ATOM 9467  O OE1  . GLU A 1 44  ? 6.713   21.368  -3.765  1.00 0.00 ? 44  GLU A OE1  6  
ATOM 9468  O OE2  . GLU A 1 44  ? 6.918   22.142  -1.718  1.00 0.00 ? 44  GLU A OE2  6  
ATOM 9469  H H    . GLU A 1 44  ? 4.135   17.232  -1.286  1.00 0.00 ? 44  GLU A H    6  
ATOM 9470  H HA   . GLU A 1 44  ? 2.716   19.506  -2.066  1.00 0.00 ? 44  GLU A HA   6  
ATOM 9471  H HB2  . GLU A 1 44  ? 5.064   19.323  -1.036  1.00 0.00 ? 44  GLU A HB2  6  
ATOM 9472  H HB3  . GLU A 1 44  ? 5.632   19.092  -2.683  1.00 0.00 ? 44  GLU A HB3  6  
ATOM 9473  H HG2  . GLU A 1 44  ? 4.219   21.293  -3.085  1.00 0.00 ? 44  GLU A HG2  6  
ATOM 9474  H HG3  . GLU A 1 44  ? 4.550   21.516  -1.368  1.00 0.00 ? 44  GLU A HG3  6  
ATOM 9475  N N    . ARG A 1 45  ? 3.689   17.627  -4.510  1.00 0.00 ? 45  ARG A N    6  
ATOM 9476  C CA   . ARG A 1 45  ? 3.609   17.409  -5.949  1.00 0.00 ? 45  ARG A CA   6  
ATOM 9477  C C    . ARG A 1 45  ? 2.519   16.397  -6.287  1.00 0.00 ? 45  ARG A C    6  
ATOM 9478  O O    . ARG A 1 45  ? 2.129   15.569  -5.462  1.00 0.00 ? 45  ARG A O    6  
ATOM 9479  C CB   . ARG A 1 45  ? 4.956   16.923  -6.489  1.00 0.00 ? 45  ARG A CB   6  
ATOM 9480  C CG   . ARG A 1 45  ? 6.012   18.014  -6.562  1.00 0.00 ? 45  ARG A CG   6  
ATOM 9481  C CD   . ARG A 1 45  ? 5.690   19.028  -7.648  1.00 0.00 ? 45  ARG A CD   6  
ATOM 9482  N NE   . ARG A 1 45  ? 6.816   19.921  -7.914  1.00 0.00 ? 45  ARG A NE   6  
ATOM 9483  C CZ   . ARG A 1 45  ? 6.909   20.682  -8.998  1.00 0.00 ? 45  ARG A CZ   6  
ATOM 9484  N NH1  . ARG A 1 45  ? 5.950   20.660  -9.913  1.00 0.00 ? 45  ARG A NH1  6  
ATOM 9485  N NH2  . ARG A 1 45  ? 7.965   21.468  -9.169  1.00 0.00 ? 45  ARG A NH2  6  
ATOM 9486  H H    . ARG A 1 45  ? 3.972   16.889  -3.930  1.00 0.00 ? 45  ARG A H    6  
ATOM 9487  H HA   . ARG A 1 45  ? 3.365   18.353  -6.414  1.00 0.00 ? 45  ARG A HA   6  
ATOM 9488  H HB2  . ARG A 1 45  ? 5.326   16.138  -5.846  1.00 0.00 ? 45  ARG A HB2  6  
ATOM 9489  H HB3  . ARG A 1 45  ? 4.810   16.526  -7.482  1.00 0.00 ? 45  ARG A HB3  6  
ATOM 9490  H HG2  . ARG A 1 45  ? 6.057   18.523  -5.611  1.00 0.00 ? 45  ARG A HG2  6  
ATOM 9491  H HG3  . ARG A 1 45  ? 6.969   17.561  -6.776  1.00 0.00 ? 45  ARG A HG3  6  
ATOM 9492  H HD2  . ARG A 1 45  ? 5.442   18.499  -8.555  1.00 0.00 ? 45  ARG A HD2  6  
ATOM 9493  H HD3  . ARG A 1 45  ? 4.843   19.617  -7.331  1.00 0.00 ? 45  ARG A HD3  6  
ATOM 9494  H HE   . ARG A 1 45  ? 7.536   19.953  -7.251  1.00 0.00 ? 45  ARG A HE   6  
ATOM 9495  H HH11 . ARG A 1 45  ? 5.153   20.069  -9.786  1.00 0.00 ? 45  ARG A HH11 6  
ATOM 9496  H HH12 . ARG A 1 45  ? 6.022   21.235  -10.728 1.00 0.00 ? 45  ARG A HH12 6  
ATOM 9497  H HH21 . ARG A 1 45  ? 8.690   21.488  -8.482  1.00 0.00 ? 45  ARG A HH21 6  
ATOM 9498  H HH22 . ARG A 1 45  ? 8.034   22.040  -9.986  1.00 0.00 ? 45  ARG A HH22 6  
ATOM 9499  N N    . PRO A 1 46  ? 2.013   16.463  -7.527  1.00 0.00 ? 46  PRO A N    6  
ATOM 9500  C CA   . PRO A 1 46  ? 0.960   15.560  -8.002  1.00 0.00 ? 46  PRO A CA   6  
ATOM 9501  C C    . PRO A 1 46  ? 1.459   14.130  -8.176  1.00 0.00 ? 46  PRO A C    6  
ATOM 9502  O O    . PRO A 1 46  ? 2.433   13.883  -8.889  1.00 0.00 ? 46  PRO A O    6  
ATOM 9503  C CB   . PRO A 1 46  ? 0.564   16.157  -9.355  1.00 0.00 ? 46  PRO A CB   6  
ATOM 9504  C CG   . PRO A 1 46  ? 1.773   16.900  -9.809  1.00 0.00 ? 46  PRO A CG   6  
ATOM 9505  C CD   . PRO A 1 46  ? 2.429   17.424  -8.562  1.00 0.00 ? 46  PRO A CD   6  
ATOM 9506  H HA   . PRO A 1 46  ? 0.106   15.564  -7.341  1.00 0.00 ? 46  PRO A HA   6  
ATOM 9507  H HB2  . PRO A 1 46  ? 0.308   15.362  -10.041 1.00 0.00 ? 46  PRO A HB2  6  
ATOM 9508  H HB3  . PRO A 1 46  ? -0.281  16.817  -9.228  1.00 0.00 ? 46  PRO A HB3  6  
ATOM 9509  H HG2  . PRO A 1 46  ? 2.440   16.232  -10.332 1.00 0.00 ? 46  PRO A HG2  6  
ATOM 9510  H HG3  . PRO A 1 46  ? 1.480   17.719  -10.450 1.00 0.00 ? 46  PRO A HG3  6  
ATOM 9511  H HD2  . PRO A 1 46  ? 3.504   17.429  -8.674  1.00 0.00 ? 46  PRO A HD2  6  
ATOM 9512  H HD3  . PRO A 1 46  ? 2.068   18.416  -8.333  1.00 0.00 ? 46  PRO A HD3  6  
ATOM 9513  N N    . LEU A 1 47  ? 0.786   13.190  -7.521  1.00 0.00 ? 47  LEU A N    6  
ATOM 9514  C CA   . LEU A 1 47  ? 1.160   11.782  -7.605  1.00 0.00 ? 47  LEU A CA   6  
ATOM 9515  C C    . LEU A 1 47  ? 0.942   11.243  -9.014  1.00 0.00 ? 47  LEU A C    6  
ATOM 9516  O O    . LEU A 1 47  ? 0.128   11.771  -9.772  1.00 0.00 ? 47  LEU A O    6  
ATOM 9517  C CB   . LEU A 1 47  ? 0.352   10.959  -6.600  1.00 0.00 ? 47  LEU A CB   6  
ATOM 9518  C CG   . LEU A 1 47  ? 0.278   11.518  -5.179  1.00 0.00 ? 47  LEU A CG   6  
ATOM 9519  C CD1  . LEU A 1 47  ? -1.011  11.081  -4.500  1.00 0.00 ? 47  LEU A CD1  6  
ATOM 9520  C CD2  . LEU A 1 47  ? 1.487   11.075  -4.368  1.00 0.00 ? 47  LEU A CD2  6  
ATOM 9521  H H    . LEU A 1 47  ? 0.019   13.447  -6.969  1.00 0.00 ? 47  LEU A H    6  
ATOM 9522  H HA   . LEU A 1 47  ? 2.209   11.704  -7.360  1.00 0.00 ? 47  LEU A HA   6  
ATOM 9523  H HB2  . LEU A 1 47  ? -0.656  10.877  -6.976  1.00 0.00 ? 47  LEU A HB2  6  
ATOM 9524  H HB3  . LEU A 1 47  ? 0.796   9.975   -6.548  1.00 0.00 ? 47  LEU A HB3  6  
ATOM 9525  H HG   . LEU A 1 47  ? 0.282   12.598  -5.223  1.00 0.00 ? 47  LEU A HG   6  
ATOM 9526  H HD11 . LEU A 1 47  ? -1.360  10.162  -4.947  1.00 0.00 ? 47  LEU A HD11 6  
ATOM 9527  H HD12 . LEU A 1 47  ? -1.760  11.849  -4.623  1.00 0.00 ? 47  LEU A HD12 6  
ATOM 9528  H HD13 . LEU A 1 47  ? -0.827  10.923  -3.447  1.00 0.00 ? 47  LEU A HD13 6  
ATOM 9529  H HD21 . LEU A 1 47  ? 1.163   10.734  -3.396  1.00 0.00 ? 47  LEU A HD21 6  
ATOM 9530  H HD22 . LEU A 1 47  ? 2.166   11.906  -4.251  1.00 0.00 ? 47  LEU A HD22 6  
ATOM 9531  H HD23 . LEU A 1 47  ? 1.990   10.269  -4.883  1.00 0.00 ? 47  LEU A HD23 6  
ATOM 9532  N N    . GLN A 1 48  ? 1.673   10.187  -9.359  1.00 0.00 ? 48  GLN A N    6  
ATOM 9533  C CA   . GLN A 1 48  ? 1.558   9.576   -10.677 1.00 0.00 ? 48  GLN A CA   6  
ATOM 9534  C C    . GLN A 1 48  ? 0.847   8.229   -10.593 1.00 0.00 ? 48  GLN A C    6  
ATOM 9535  O O    . GLN A 1 48  ? 0.309   7.737   -11.583 1.00 0.00 ? 48  GLN A O    6  
ATOM 9536  C CB   . GLN A 1 48  ? 2.942   9.397   -11.303 1.00 0.00 ? 48  GLN A CB   6  
ATOM 9537  C CG   . GLN A 1 48  ? 3.599   10.705  -11.711 1.00 0.00 ? 48  GLN A CG   6  
ATOM 9538  C CD   . GLN A 1 48  ? 5.112   10.616  -11.737 1.00 0.00 ? 48  GLN A CD   6  
ATOM 9539  O OE1  . GLN A 1 48  ? 5.698   9.660   -11.227 1.00 0.00 ? 48  GLN A OE1  6  
ATOM 9540  N NE2  . GLN A 1 48  ? 5.755   11.613  -12.334 1.00 0.00 ? 48  GLN A NE2  6  
ATOM 9541  H H    . GLN A 1 48  ? 2.305   9.812   -8.711  1.00 0.00 ? 48  GLN A H    6  
ATOM 9542  H HA   . GLN A 1 48  ? 0.975   10.238  -11.300 1.00 0.00 ? 48  GLN A HA   6  
ATOM 9543  H HB2  . GLN A 1 48  ? 3.585   8.903   -10.589 1.00 0.00 ? 48  GLN A HB2  6  
ATOM 9544  H HB3  . GLN A 1 48  ? 2.849   8.776   -12.181 1.00 0.00 ? 48  GLN A HB3  6  
ATOM 9545  H HG2  . GLN A 1 48  ? 3.253   10.974  -12.698 1.00 0.00 ? 48  GLN A HG2  6  
ATOM 9546  H HG3  . GLN A 1 48  ? 3.310   11.473  -11.008 1.00 0.00 ? 48  GLN A HG3  6  
ATOM 9547  H HE21 . GLN A 1 48  ? 5.222   12.342  -12.717 1.00 0.00 ? 48  GLN A HE21 6  
ATOM 9548  H HE22 . GLN A 1 48  ? 6.733   11.581  -12.364 1.00 0.00 ? 48  GLN A HE22 6  
ATOM 9549  N N    . GLY A 1 49  ? 0.849   7.638   -9.402  1.00 0.00 ? 49  GLY A N    6  
ATOM 9550  C CA   . GLY A 1 49  ? 0.202   6.354   -9.210  1.00 0.00 ? 49  GLY A CA   6  
ATOM 9551  C C    . GLY A 1 49  ? 0.316   5.854   -7.783  1.00 0.00 ? 49  GLY A C    6  
ATOM 9552  O O    . GLY A 1 49  ? 0.313   6.645   -6.839  1.00 0.00 ? 49  GLY A O    6  
ATOM 9553  H H    . GLY A 1 49  ? 1.294   8.078   -8.647  1.00 0.00 ? 49  GLY A H    6  
ATOM 9554  H HA2  . GLY A 1 49  ? -0.843  6.447   -9.465  1.00 0.00 ? 49  GLY A HA2  6  
ATOM 9555  H HA3  . GLY A 1 49  ? 0.660   5.631   -9.869  1.00 0.00 ? 49  GLY A HA3  6  
ATOM 9556  N N    . TYR A 1 50  ? 0.414   4.539   -7.624  1.00 0.00 ? 50  TYR A N    6  
ATOM 9557  C CA   . TYR A 1 50  ? 0.525   3.935   -6.302  1.00 0.00 ? 50  TYR A CA   6  
ATOM 9558  C C    . TYR A 1 50  ? 1.179   2.559   -6.385  1.00 0.00 ? 50  TYR A C    6  
ATOM 9559  O O    . TYR A 1 50  ? 1.281   1.971   -7.461  1.00 0.00 ? 50  TYR A O    6  
ATOM 9560  C CB   . TYR A 1 50  ? -0.856  3.817   -5.655  1.00 0.00 ? 50  TYR A CB   6  
ATOM 9561  C CG   . TYR A 1 50  ? -1.281  5.058   -4.903  1.00 0.00 ? 50  TYR A CG   6  
ATOM 9562  C CD1  . TYR A 1 50  ? -0.870  5.274   -3.593  1.00 0.00 ? 50  TYR A CD1  6  
ATOM 9563  C CD2  . TYR A 1 50  ? -2.092  6.014   -5.501  1.00 0.00 ? 50  TYR A CD2  6  
ATOM 9564  C CE1  . TYR A 1 50  ? -1.256  6.407   -2.901  1.00 0.00 ? 50  TYR A CE1  6  
ATOM 9565  C CE2  . TYR A 1 50  ? -2.481  7.150   -4.818  1.00 0.00 ? 50  TYR A CE2  6  
ATOM 9566  C CZ   . TYR A 1 50  ? -2.061  7.341   -3.518  1.00 0.00 ? 50  TYR A CZ   6  
ATOM 9567  O OH   . TYR A 1 50  ? -2.448  8.471   -2.834  1.00 0.00 ? 50  TYR A OH   6  
ATOM 9568  H H    . TYR A 1 50  ? 0.410   3.960   -8.415  1.00 0.00 ? 50  TYR A H    6  
ATOM 9569  H HA   . TYR A 1 50  ? 1.142   4.579   -5.694  1.00 0.00 ? 50  TYR A HA   6  
ATOM 9570  H HB2  . TYR A 1 50  ? -1.591  3.628   -6.422  1.00 0.00 ? 50  TYR A HB2  6  
ATOM 9571  H HB3  . TYR A 1 50  ? -0.850  2.992   -4.958  1.00 0.00 ? 50  TYR A HB3  6  
ATOM 9572  H HD1  . TYR A 1 50  ? -0.240  4.540   -3.112  1.00 0.00 ? 50  TYR A HD1  6  
ATOM 9573  H HD2  . TYR A 1 50  ? -2.420  5.861   -6.519  1.00 0.00 ? 50  TYR A HD2  6  
ATOM 9574  H HE1  . TYR A 1 50  ? -0.927  6.557   -1.884  1.00 0.00 ? 50  TYR A HE1  6  
ATOM 9575  H HE2  . TYR A 1 50  ? -3.112  7.882   -5.301  1.00 0.00 ? 50  TYR A HE2  6  
ATOM 9576  H HH   . TYR A 1 50  ? -3.011  9.008   -3.396  1.00 0.00 ? 50  TYR A HH   6  
ATOM 9577  N N    . SER A 1 51  ? 1.621   2.052   -5.238  1.00 0.00 ? 51  SER A N    6  
ATOM 9578  C CA   . SER A 1 51  ? 2.269   0.746   -5.180  1.00 0.00 ? 51  SER A CA   6  
ATOM 9579  C C    . SER A 1 51  ? 1.705   -0.089  -4.034  1.00 0.00 ? 51  SER A C    6  
ATOM 9580  O O    . SER A 1 51  ? 1.623   0.373   -2.896  1.00 0.00 ? 51  SER A O    6  
ATOM 9581  C CB   . SER A 1 51  ? 3.780   0.911   -5.011  1.00 0.00 ? 51  SER A CB   6  
ATOM 9582  O OG   . SER A 1 51  ? 4.117   1.164   -3.658  1.00 0.00 ? 51  SER A OG   6  
ATOM 9583  H H    . SER A 1 51  ? 1.511   2.569   -4.413  1.00 0.00 ? 51  SER A H    6  
ATOM 9584  H HA   . SER A 1 51  ? 2.072   0.237   -6.111  1.00 0.00 ? 51  SER A HA   6  
ATOM 9585  H HB2  . SER A 1 51  ? 4.276   0.007   -5.329  1.00 0.00 ? 51  SER A HB2  6  
ATOM 9586  H HB3  . SER A 1 51  ? 4.119   1.740   -5.615  1.00 0.00 ? 51  SER A HB3  6  
ATOM 9587  H HG   . SER A 1 51  ? 4.506   0.376   -3.271  1.00 0.00 ? 51  SER A HG   6  
ATOM 9588  N N    . VAL A 1 52  ? 1.318   -1.322  -4.343  1.00 0.00 ? 52  VAL A N    6  
ATOM 9589  C CA   . VAL A 1 52  ? 0.763   -2.223  -3.341  1.00 0.00 ? 52  VAL A CA   6  
ATOM 9590  C C    . VAL A 1 52  ? 1.458   -3.580  -3.377  1.00 0.00 ? 52  VAL A C    6  
ATOM 9591  O O    . VAL A 1 52  ? 1.095   -4.453  -4.164  1.00 0.00 ? 52  VAL A O    6  
ATOM 9592  C CB   . VAL A 1 52  ? -0.750  -2.428  -3.546  1.00 0.00 ? 52  VAL A CB   6  
ATOM 9593  C CG1  . VAL A 1 52  ? -1.314  -3.349  -2.475  1.00 0.00 ? 52  VAL A CG1  6  
ATOM 9594  C CG2  . VAL A 1 52  ? -1.473  -1.090  -3.545  1.00 0.00 ? 52  VAL A CG2  6  
ATOM 9595  H H    . VAL A 1 52  ? 1.408   -1.633  -5.268  1.00 0.00 ? 52  VAL A H    6  
ATOM 9596  H HA   . VAL A 1 52  ? 0.916   -1.777  -2.369  1.00 0.00 ? 52  VAL A HA   6  
ATOM 9597  H HB   . VAL A 1 52  ? -0.902  -2.895  -4.508  1.00 0.00 ? 52  VAL A HB   6  
ATOM 9598  H HG11 . VAL A 1 52  ? -1.876  -4.143  -2.944  1.00 0.00 ? 52  VAL A HG11 6  
ATOM 9599  H HG12 . VAL A 1 52  ? -0.504  -3.771  -1.899  1.00 0.00 ? 52  VAL A HG12 6  
ATOM 9600  H HG13 . VAL A 1 52  ? -1.965  -2.786  -1.823  1.00 0.00 ? 52  VAL A HG13 6  
ATOM 9601  H HG21 . VAL A 1 52  ? -2.346  -1.152  -2.912  1.00 0.00 ? 52  VAL A HG21 6  
ATOM 9602  H HG22 . VAL A 1 52  ? -0.810  -0.323  -3.172  1.00 0.00 ? 52  VAL A HG22 6  
ATOM 9603  H HG23 . VAL A 1 52  ? -1.777  -0.843  -4.553  1.00 0.00 ? 52  VAL A HG23 6  
ATOM 9604  N N    . GLU A 1 53  ? 2.458   -3.749  -2.518  1.00 0.00 ? 53  GLU A N    6  
ATOM 9605  C CA   . GLU A 1 53  ? 3.204   -5.000  -2.452  1.00 0.00 ? 53  GLU A CA   6  
ATOM 9606  C C    . GLU A 1 53  ? 2.742   -5.847  -1.270  1.00 0.00 ? 53  GLU A C    6  
ATOM 9607  O O    . GLU A 1 53  ? 2.618   -5.353  -0.149  1.00 0.00 ? 53  GLU A O    6  
ATOM 9608  C CB   . GLU A 1 53  ? 4.704   -4.720  -2.338  1.00 0.00 ? 53  GLU A CB   6  
ATOM 9609  C CG   . GLU A 1 53  ? 5.410   -4.630  -3.680  1.00 0.00 ? 53  GLU A CG   6  
ATOM 9610  C CD   . GLU A 1 53  ? 6.853   -4.183  -3.551  1.00 0.00 ? 53  GLU A CD   6  
ATOM 9611  O OE1  . GLU A 1 53  ? 7.447   -4.394  -2.473  1.00 0.00 ? 53  GLU A OE1  6  
ATOM 9612  O OE2  . GLU A 1 53  ? 7.389   -3.621  -4.530  1.00 0.00 ? 53  GLU A OE2  6  
ATOM 9613  H H    . GLU A 1 53  ? 2.701   -3.015  -1.915  1.00 0.00 ? 53  GLU A H    6  
ATOM 9614  H HA   . GLU A 1 53  ? 3.018   -5.546  -3.365  1.00 0.00 ? 53  GLU A HA   6  
ATOM 9615  H HB2  . GLU A 1 53  ? 4.845   -3.784  -1.817  1.00 0.00 ? 53  GLU A HB2  6  
ATOM 9616  H HB3  . GLU A 1 53  ? 5.163   -5.513  -1.766  1.00 0.00 ? 53  GLU A HB3  6  
ATOM 9617  H HG2  . GLU A 1 53  ? 5.392   -5.603  -4.148  1.00 0.00 ? 53  GLU A HG2  6  
ATOM 9618  H HG3  . GLU A 1 53  ? 4.884   -3.923  -4.303  1.00 0.00 ? 53  GLU A HG3  6  
ATOM 9619  N N    . TYR A 1 54  ? 2.489   -7.125  -1.529  1.00 0.00 ? 54  TYR A N    6  
ATOM 9620  C CA   . TYR A 1 54  ? 2.038   -8.041  -0.488  1.00 0.00 ? 54  TYR A CA   6  
ATOM 9621  C C    . TYR A 1 54  ? 2.767   -9.378  -0.585  1.00 0.00 ? 54  TYR A C    6  
ATOM 9622  O O    . TYR A 1 54  ? 3.160   -9.804  -1.671  1.00 0.00 ? 54  TYR A O    6  
ATOM 9623  C CB   . TYR A 1 54  ? 0.529   -8.262  -0.592  1.00 0.00 ? 54  TYR A CB   6  
ATOM 9624  C CG   . TYR A 1 54  ? 0.123   -9.134  -1.759  1.00 0.00 ? 54  TYR A CG   6  
ATOM 9625  C CD1  . TYR A 1 54  ? 0.202   -10.519 -1.677  1.00 0.00 ? 54  TYR A CD1  6  
ATOM 9626  C CD2  . TYR A 1 54  ? -0.337  -8.573  -2.944  1.00 0.00 ? 54  TYR A CD2  6  
ATOM 9627  C CE1  . TYR A 1 54  ? -0.167  -11.319 -2.741  1.00 0.00 ? 54  TYR A CE1  6  
ATOM 9628  C CE2  . TYR A 1 54  ? -0.709  -9.366  -4.012  1.00 0.00 ? 54  TYR A CE2  6  
ATOM 9629  C CZ   . TYR A 1 54  ? -0.622  -10.738 -3.906  1.00 0.00 ? 54  TYR A CZ   6  
ATOM 9630  O OH   . TYR A 1 54  ? -0.990  -11.532 -4.968  1.00 0.00 ? 54  TYR A OH   6  
ATOM 9631  H H    . TYR A 1 54  ? 2.607   -7.461  -2.442  1.00 0.00 ? 54  TYR A H    6  
ATOM 9632  H HA   . TYR A 1 54  ? 2.261   -7.592  0.469   1.00 0.00 ? 54  TYR A HA   6  
ATOM 9633  H HB2  . TYR A 1 54  ? 0.177   -8.735  0.312   1.00 0.00 ? 54  TYR A HB2  6  
ATOM 9634  H HB3  . TYR A 1 54  ? 0.039   -7.306  -0.706  1.00 0.00 ? 54  TYR A HB3  6  
ATOM 9635  H HD1  . TYR A 1 54  ? 0.559   -10.971 -0.763  1.00 0.00 ? 54  TYR A HD1  6  
ATOM 9636  H HD2  . TYR A 1 54  ? -0.404  -7.497  -3.024  1.00 0.00 ? 54  TYR A HD2  6  
ATOM 9637  H HE1  . TYR A 1 54  ? -0.099  -12.394 -2.658  1.00 0.00 ? 54  TYR A HE1  6  
ATOM 9638  H HE2  . TYR A 1 54  ? -1.065  -8.911  -4.925  1.00 0.00 ? 54  TYR A HE2  6  
ATOM 9639  H HH   . TYR A 1 54  ? -1.542  -11.025 -5.569  1.00 0.00 ? 54  TYR A HH   6  
ATOM 9640  N N    . GLN A 1 55  ? 2.942   -10.034 0.557   1.00 0.00 ? 55  GLN A N    6  
ATOM 9641  C CA   . GLN A 1 55  ? 3.623   -11.323 0.601   1.00 0.00 ? 55  GLN A CA   6  
ATOM 9642  C C    . GLN A 1 55  ? 3.324   -12.052 1.907   1.00 0.00 ? 55  GLN A C    6  
ATOM 9643  O O    . GLN A 1 55  ? 3.084   -11.425 2.940   1.00 0.00 ? 55  GLN A O    6  
ATOM 9644  C CB   . GLN A 1 55  ? 5.132   -11.131 0.444   1.00 0.00 ? 55  GLN A CB   6  
ATOM 9645  C CG   . GLN A 1 55  ? 5.834   -10.746 1.736   1.00 0.00 ? 55  GLN A CG   6  
ATOM 9646  C CD   . GLN A 1 55  ? 7.248   -10.247 1.507   1.00 0.00 ? 55  GLN A CD   6  
ATOM 9647  O OE1  . GLN A 1 55  ? 7.637   -9.194  2.012   1.00 0.00 ? 55  GLN A OE1  6  
ATOM 9648  N NE2  . GLN A 1 55  ? 8.025   -11.003 0.740   1.00 0.00 ? 55  GLN A NE2  6  
ATOM 9649  H H    . GLN A 1 55  ? 2.606   -9.642  1.390   1.00 0.00 ? 55  GLN A H    6  
ATOM 9650  H HA   . GLN A 1 55  ? 3.258   -11.919 -0.221  1.00 0.00 ? 55  GLN A HA   6  
ATOM 9651  H HB2  . GLN A 1 55  ? 5.565   -12.053 0.086   1.00 0.00 ? 55  GLN A HB2  6  
ATOM 9652  H HB3  . GLN A 1 55  ? 5.311   -10.353 -0.283  1.00 0.00 ? 55  GLN A HB3  6  
ATOM 9653  H HG2  . GLN A 1 55  ? 5.268   -9.963  2.220   1.00 0.00 ? 55  GLN A HG2  6  
ATOM 9654  H HG3  . GLN A 1 55  ? 5.874   -11.611 2.381   1.00 0.00 ? 55  GLN A HG3  6  
ATOM 9655  H HE21 . GLN A 1 55  ? 7.647   -11.829 0.370   1.00 0.00 ? 55  GLN A HE21 6  
ATOM 9656  H HE22 . GLN A 1 55  ? 8.942   -10.705 0.574   1.00 0.00 ? 55  GLN A HE22 6  
ATOM 9657  N N    . LEU A 1 56  ? 3.339   -13.379 1.854   1.00 0.00 ? 56  LEU A N    6  
ATOM 9658  C CA   . LEU A 1 56  ? 3.070   -14.195 3.033   1.00 0.00 ? 56  LEU A CA   6  
ATOM 9659  C C    . LEU A 1 56  ? 3.657   -13.553 4.286   1.00 0.00 ? 56  LEU A C    6  
ATOM 9660  O O    . LEU A 1 56  ? 4.871   -13.370 4.392   1.00 0.00 ? 56  LEU A O    6  
ATOM 9661  C CB   . LEU A 1 56  ? 3.646   -15.600 2.848   1.00 0.00 ? 56  LEU A CB   6  
ATOM 9662  C CG   . LEU A 1 56  ? 2.739   -16.610 2.146   1.00 0.00 ? 56  LEU A CG   6  
ATOM 9663  C CD1  . LEU A 1 56  ? 3.515   -17.870 1.793   1.00 0.00 ? 56  LEU A CD1  6  
ATOM 9664  C CD2  . LEU A 1 56  ? 1.539   -16.948 3.019   1.00 0.00 ? 56  LEU A CD2  6  
ATOM 9665  H H    . LEU A 1 56  ? 3.537   -13.822 1.003   1.00 0.00 ? 56  LEU A H    6  
ATOM 9666  H HA   . LEU A 1 56  ? 1.998   -14.266 3.149   1.00 0.00 ? 56  LEU A HA   6  
ATOM 9667  H HB2  . LEU A 1 56  ? 4.553   -15.512 2.270   1.00 0.00 ? 56  LEU A HB2  6  
ATOM 9668  H HB3  . LEU A 1 56  ? 3.882   -15.991 3.828   1.00 0.00 ? 56  LEU A HB3  6  
ATOM 9669  H HG   . LEU A 1 56  ? 2.372   -16.176 1.226   1.00 0.00 ? 56  LEU A HG   6  
ATOM 9670  H HD11 . LEU A 1 56  ? 4.074   -17.705 0.884   1.00 0.00 ? 56  LEU A HD11 6  
ATOM 9671  H HD12 . LEU A 1 56  ? 2.826   -18.688 1.648   1.00 0.00 ? 56  LEU A HD12 6  
ATOM 9672  H HD13 . LEU A 1 56  ? 4.195   -18.110 2.597   1.00 0.00 ? 56  LEU A HD13 6  
ATOM 9673  H HD21 . LEU A 1 56  ? 1.859   -17.560 3.849   1.00 0.00 ? 56  LEU A HD21 6  
ATOM 9674  H HD22 . LEU A 1 56  ? 0.809   -17.488 2.434   1.00 0.00 ? 56  LEU A HD22 6  
ATOM 9675  H HD23 . LEU A 1 56  ? 1.098   -16.036 3.393   1.00 0.00 ? 56  LEU A HD23 6  
ATOM 9676  N N    . LEU A 1 57  ? 2.789   -13.214 5.233   1.00 0.00 ? 57  LEU A N    6  
ATOM 9677  C CA   . LEU A 1 57  ? 3.222   -12.594 6.481   1.00 0.00 ? 57  LEU A CA   6  
ATOM 9678  C C    . LEU A 1 57  ? 4.583   -13.131 6.912   1.00 0.00 ? 57  LEU A C    6  
ATOM 9679  O O    . LEU A 1 57  ? 5.547   -12.377 7.040   1.00 0.00 ? 57  LEU A O    6  
ATOM 9680  C CB   . LEU A 1 57  ? 2.190   -12.844 7.582   1.00 0.00 ? 57  LEU A CB   6  
ATOM 9681  C CG   . LEU A 1 57  ? 2.135   -11.801 8.699   1.00 0.00 ? 57  LEU A CG   6  
ATOM 9682  C CD1  . LEU A 1 57  ? 1.219   -12.267 9.820   1.00 0.00 ? 57  LEU A CD1  6  
ATOM 9683  C CD2  . LEU A 1 57  ? 3.531   -11.516 9.232   1.00 0.00 ? 57  LEU A CD2  6  
ATOM 9684  H H    . LEU A 1 57  ? 1.835   -13.385 5.091   1.00 0.00 ? 57  LEU A H    6  
ATOM 9685  H HA   . LEU A 1 57  ? 3.305   -11.531 6.311   1.00 0.00 ? 57  LEU A HA   6  
ATOM 9686  H HB2  . LEU A 1 57  ? 1.216   -12.884 7.119   1.00 0.00 ? 57  LEU A HB2  6  
ATOM 9687  H HB3  . LEU A 1 57  ? 2.413   -13.801 8.032   1.00 0.00 ? 57  LEU A HB3  6  
ATOM 9688  H HG   . LEU A 1 57  ? 1.733   -10.879 8.302   1.00 0.00 ? 57  LEU A HG   6  
ATOM 9689  H HD11 . LEU A 1 57  ? 1.154   -13.344 9.806   1.00 0.00 ? 57  LEU A HD11 6  
ATOM 9690  H HD12 . LEU A 1 57  ? 0.235   -11.845 9.679   1.00 0.00 ? 57  LEU A HD12 6  
ATOM 9691  H HD13 . LEU A 1 57  ? 1.617   -11.941 10.769  1.00 0.00 ? 57  LEU A HD13 6  
ATOM 9692  H HD21 . LEU A 1 57  ? 3.457   -11.002 10.179  1.00 0.00 ? 57  LEU A HD21 6  
ATOM 9693  H HD22 . LEU A 1 57  ? 4.066   -10.897 8.527   1.00 0.00 ? 57  LEU A HD22 6  
ATOM 9694  H HD23 . LEU A 1 57  ? 4.061   -12.448 9.368   1.00 0.00 ? 57  LEU A HD23 6  
ATOM 9695  N N    . ASN A 1 58  ? 4.654   -14.440 7.134   1.00 0.00 ? 58  ASN A N    6  
ATOM 9696  C CA   . ASN A 1 58  ? 5.897   -15.079 7.549   1.00 0.00 ? 58  ASN A CA   6  
ATOM 9697  C C    . ASN A 1 58  ? 6.973   -14.924 6.478   1.00 0.00 ? 58  ASN A C    6  
ATOM 9698  O O    . ASN A 1 58  ? 8.118   -14.588 6.778   1.00 0.00 ? 58  ASN A O    6  
ATOM 9699  C CB   . ASN A 1 58  ? 5.661   -16.562 7.840   1.00 0.00 ? 58  ASN A CB   6  
ATOM 9700  C CG   . ASN A 1 58  ? 5.440   -17.371 6.576   1.00 0.00 ? 58  ASN A CG   6  
ATOM 9701  O OD1  . ASN A 1 58  ? 6.392   -17.738 5.886   1.00 0.00 ? 58  ASN A OD1  6  
ATOM 9702  N ND2  . ASN A 1 58  ? 4.180   -17.651 6.266   1.00 0.00 ? 58  ASN A ND2  6  
ATOM 9703  H H    . ASN A 1 58  ? 3.851   -14.989 7.015   1.00 0.00 ? 58  ASN A H    6  
ATOM 9704  H HA   . ASN A 1 58  ? 6.233   -14.593 8.453   1.00 0.00 ? 58  ASN A HA   6  
ATOM 9705  H HB2  . ASN A 1 58  ? 6.522   -16.963 8.355   1.00 0.00 ? 58  ASN A HB2  6  
ATOM 9706  H HB3  . ASN A 1 58  ? 4.790   -16.666 8.468   1.00 0.00 ? 58  ASN A HB3  6  
ATOM 9707  H HD21 . ASN A 1 58  ? 3.473   -17.326 6.861   1.00 0.00 ? 58  ASN A HD21 6  
ATOM 9708  H HD22 . ASN A 1 58  ? 4.009   -18.173 5.454   1.00 0.00 ? 58  ASN A HD22 6  
ATOM 9709  N N    . GLY A 1 59  ? 6.595   -15.170 5.227   1.00 0.00 ? 59  GLY A N    6  
ATOM 9710  C CA   . GLY A 1 59  ? 7.538   -15.052 4.131   1.00 0.00 ? 59  GLY A CA   6  
ATOM 9711  C C    . GLY A 1 59  ? 7.292   -16.078 3.042   1.00 0.00 ? 59  GLY A C    6  
ATOM 9712  O O    . GLY A 1 59  ? 7.036   -17.247 3.327   1.00 0.00 ? 59  GLY A O    6  
ATOM 9713  H H    . GLY A 1 59  ? 5.668   -15.434 5.048   1.00 0.00 ? 59  GLY A H    6  
ATOM 9714  H HA2  . GLY A 1 59  ? 7.456   -14.063 3.705   1.00 0.00 ? 59  GLY A HA2  6  
ATOM 9715  H HA3  . GLY A 1 59  ? 8.538   -15.186 4.516   1.00 0.00 ? 59  GLY A HA3  6  
ATOM 9716  N N    . GLY A 1 60  ? 7.368   -15.639 1.789   1.00 0.00 ? 60  GLY A N    6  
ATOM 9717  C CA   . GLY A 1 60  ? 7.147   -16.539 0.673   1.00 0.00 ? 60  GLY A CA   6  
ATOM 9718  C C    . GLY A 1 60  ? 7.270   -15.842 -0.668  1.00 0.00 ? 60  GLY A C    6  
ATOM 9719  O O    . GLY A 1 60  ? 8.367   -15.468 -1.081  1.00 0.00 ? 60  GLY A O    6  
ATOM 9720  H H    . GLY A 1 60  ? 7.576   -14.695 1.622   1.00 0.00 ? 60  GLY A H    6  
ATOM 9721  H HA2  . GLY A 1 60  ? 7.873   -17.338 0.720   1.00 0.00 ? 60  GLY A HA2  6  
ATOM 9722  H HA3  . GLY A 1 60  ? 6.157   -16.961 0.756   1.00 0.00 ? 60  GLY A HA3  6  
ATOM 9723  N N    . GLU A 1 61  ? 6.142   -15.668 -1.348  1.00 0.00 ? 61  GLU A N    6  
ATOM 9724  C CA   . GLU A 1 61  ? 6.129   -15.013 -2.651  1.00 0.00 ? 61  GLU A CA   6  
ATOM 9725  C C    . GLU A 1 61  ? 5.651   -13.569 -2.530  1.00 0.00 ? 61  GLU A C    6  
ATOM 9726  O O    . GLU A 1 61  ? 4.599   -13.298 -1.948  1.00 0.00 ? 61  GLU A O    6  
ATOM 9727  C CB   . GLU A 1 61  ? 5.230   -15.780 -3.623  1.00 0.00 ? 61  GLU A CB   6  
ATOM 9728  C CG   . GLU A 1 61  ? 5.615   -15.596 -5.082  1.00 0.00 ? 61  GLU A CG   6  
ATOM 9729  C CD   . GLU A 1 61  ? 5.118   -16.725 -5.963  1.00 0.00 ? 61  GLU A CD   6  
ATOM 9730  O OE1  . GLU A 1 61  ? 4.065   -17.312 -5.639  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 9731  O OE2  . GLU A 1 61  ? 5.783   -17.021 -6.978  1.00 0.00 ? 61  GLU A OE2  6  
ATOM 9732  H H    . GLU A 1 61  ? 5.298   -15.988 -0.966  1.00 0.00 ? 61  GLU A H    6  
ATOM 9733  H HA   . GLU A 1 61  ? 7.139   -15.014 -3.032  1.00 0.00 ? 61  GLU A HA   6  
ATOM 9734  H HB2  . GLU A 1 61  ? 5.282   -16.833 -3.389  1.00 0.00 ? 61  GLU A HB2  6  
ATOM 9735  H HB3  . GLU A 1 61  ? 4.213   -15.442 -3.496  1.00 0.00 ? 61  GLU A HB3  6  
ATOM 9736  H HG2  . GLU A 1 61  ? 5.191   -14.669 -5.438  1.00 0.00 ? 61  GLU A HG2  6  
ATOM 9737  H HG3  . GLU A 1 61  ? 6.691   -15.549 -5.154  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 9738  N N    . LEU A 1 62  ? 6.430   -12.646 -3.082  1.00 0.00 ? 62  LEU A N    6  
ATOM 9739  C CA   . LEU A 1 62  ? 6.087   -11.229 -3.036  1.00 0.00 ? 62  LEU A CA   6  
ATOM 9740  C C    . LEU A 1 62  ? 5.479   -10.772 -4.358  1.00 0.00 ? 62  LEU A C    6  
ATOM 9741  O O    . LEU A 1 62  ? 6.056   -10.984 -5.425  1.00 0.00 ? 62  LEU A O    6  
ATOM 9742  C CB   . LEU A 1 62  ? 7.329   -10.394 -2.718  1.00 0.00 ? 62  LEU A CB   6  
ATOM 9743  C CG   . LEU A 1 62  ? 7.157   -8.877  -2.801  1.00 0.00 ? 62  LEU A CG   6  
ATOM 9744  C CD1  . LEU A 1 62  ? 7.025   -8.433  -4.249  1.00 0.00 ? 62  LEU A CD1  6  
ATOM 9745  C CD2  . LEU A 1 62  ? 5.946   -8.432  -1.992  1.00 0.00 ? 62  LEU A CD2  6  
ATOM 9746  H H    . LEU A 1 62  ? 7.255   -12.923 -3.531  1.00 0.00 ? 62  LEU A H    6  
ATOM 9747  H HA   . LEU A 1 62  ? 5.359   -11.089 -2.251  1.00 0.00 ? 62  LEU A HA   6  
ATOM 9748  H HB2  . LEU A 1 62  ? 7.642   -10.636 -1.714  1.00 0.00 ? 62  LEU A HB2  6  
ATOM 9749  H HB3  . LEU A 1 62  ? 8.105   -10.678 -3.414  1.00 0.00 ? 62  LEU A HB3  6  
ATOM 9750  H HG   . LEU A 1 62  ? 8.032   -8.398  -2.384  1.00 0.00 ? 62  LEU A HG   6  
ATOM 9751  H HD11 . LEU A 1 62  ? 7.374   -9.220  -4.900  1.00 0.00 ? 62  LEU A HD11 6  
ATOM 9752  H HD12 . LEU A 1 62  ? 7.617   -7.544  -4.409  1.00 0.00 ? 62  LEU A HD12 6  
ATOM 9753  H HD13 . LEU A 1 62  ? 5.989   -8.218  -4.467  1.00 0.00 ? 62  LEU A HD13 6  
ATOM 9754  H HD21 . LEU A 1 62  ? 5.071   -8.964  -2.333  1.00 0.00 ? 62  LEU A HD21 6  
ATOM 9755  H HD22 . LEU A 1 62  ? 5.797   -7.371  -2.123  1.00 0.00 ? 62  LEU A HD22 6  
ATOM 9756  H HD23 . LEU A 1 62  ? 6.114   -8.645  -0.946  1.00 0.00 ? 62  LEU A HD23 6  
ATOM 9757  N N    . HIS A 1 63  ? 4.311   -10.143 -4.280  1.00 0.00 ? 63  HIS A N    6  
ATOM 9758  C CA   . HIS A 1 63  ? 3.625   -9.653  -5.471  1.00 0.00 ? 63  HIS A CA   6  
ATOM 9759  C C    . HIS A 1 63  ? 3.553   -8.129  -5.469  1.00 0.00 ? 63  HIS A C    6  
ATOM 9760  O O    . HIS A 1 63  ? 2.962   -7.528  -4.572  1.00 0.00 ? 63  HIS A O    6  
ATOM 9761  C CB   . HIS A 1 63  ? 2.217   -10.242 -5.553  1.00 0.00 ? 63  HIS A CB   6  
ATOM 9762  C CG   . HIS A 1 63  ? 2.198   -11.732 -5.705  1.00 0.00 ? 63  HIS A CG   6  
ATOM 9763  N ND1  . HIS A 1 63  ? 1.686   -12.369 -6.816  1.00 0.00 ? 63  HIS A ND1  6  
ATOM 9764  C CD2  . HIS A 1 63  ? 2.634   -12.712 -4.880  1.00 0.00 ? 63  HIS A CD2  6  
ATOM 9765  C CE1  . HIS A 1 63  ? 1.807   -13.676 -6.666  1.00 0.00 ? 63  HIS A CE1  6  
ATOM 9766  N NE2  . HIS A 1 63  ? 2.379   -13.911 -5.500  1.00 0.00 ? 63  HIS A NE2  6  
ATOM 9767  H H    . HIS A 1 63  ? 3.901   -10.004 -3.402  1.00 0.00 ? 63  HIS A H    6  
ATOM 9768  H HA   . HIS A 1 63  ? 4.190   -9.973  -6.334  1.00 0.00 ? 63  HIS A HA   6  
ATOM 9769  H HB2  . HIS A 1 63  ? 1.678   -9.995  -4.650  1.00 0.00 ? 63  HIS A HB2  6  
ATOM 9770  H HB3  . HIS A 1 63  ? 1.703   -9.815  -6.402  1.00 0.00 ? 63  HIS A HB3  6  
ATOM 9771  H HD2  . HIS A 1 63  ? 3.097   -12.577 -3.912  1.00 0.00 ? 63  HIS A HD2  6  
ATOM 9772  H HE1  . HIS A 1 63  ? 1.491   -14.425 -7.377  1.00 0.00 ? 63  HIS A HE1  6  
ATOM 9773  H HE2  . HIS A 1 63  ? 2.508   -14.797 -5.103  1.00 0.00 ? 63  HIS A HE2  6  
ATOM 9774  N N    . ARG A 1 64  ? 4.158   -7.512  -6.478  1.00 0.00 ? 64  ARG A N    6  
ATOM 9775  C CA   . ARG A 1 64  ? 4.164   -6.058  -6.591  1.00 0.00 ? 64  ARG A CA   6  
ATOM 9776  C C    . ARG A 1 64  ? 3.051   -5.580  -7.520  1.00 0.00 ? 64  ARG A C    6  
ATOM 9777  O O    . ARG A 1 64  ? 3.003   -5.955  -8.692  1.00 0.00 ? 64  ARG A O    6  
ATOM 9778  C CB   . ARG A 1 64  ? 5.519   -5.571  -7.107  1.00 0.00 ? 64  ARG A CB   6  
ATOM 9779  C CG   . ARG A 1 64  ? 5.643   -4.057  -7.156  1.00 0.00 ? 64  ARG A CG   6  
ATOM 9780  C CD   . ARG A 1 64  ? 6.796   -3.621  -8.046  1.00 0.00 ? 64  ARG A CD   6  
ATOM 9781  N NE   . ARG A 1 64  ? 6.726   -2.200  -8.377  1.00 0.00 ? 64  ARG A NE   6  
ATOM 9782  C CZ   . ARG A 1 64  ? 7.081   -1.232  -7.539  1.00 0.00 ? 64  ARG A CZ   6  
ATOM 9783  N NH1  . ARG A 1 64  ? 7.529   -1.531  -6.327  1.00 0.00 ? 64  ARG A NH1  6  
ATOM 9784  N NH2  . ARG A 1 64  ? 6.989   0.038   -7.912  1.00 0.00 ? 64  ARG A NH2  6  
ATOM 9785  H H    . ARG A 1 64  ? 4.612   -8.046  -7.163  1.00 0.00 ? 64  ARG A H    6  
ATOM 9786  H HA   . ARG A 1 64  ? 3.995   -5.648  -5.606  1.00 0.00 ? 64  ARG A HA   6  
ATOM 9787  H HB2  . ARG A 1 64  ? 6.296   -5.953  -6.462  1.00 0.00 ? 64  ARG A HB2  6  
ATOM 9788  H HB3  . ARG A 1 64  ? 5.669   -5.955  -8.105  1.00 0.00 ? 64  ARG A HB3  6  
ATOM 9789  H HG2  . ARG A 1 64  ? 4.725   -3.642  -7.547  1.00 0.00 ? 64  ARG A HG2  6  
ATOM 9790  H HG3  . ARG A 1 64  ? 5.811   -3.686  -6.156  1.00 0.00 ? 64  ARG A HG3  6  
ATOM 9791  H HD2  . ARG A 1 64  ? 7.725   -3.815  -7.530  1.00 0.00 ? 64  ARG A HD2  6  
ATOM 9792  H HD3  . ARG A 1 64  ? 6.765   -4.196  -8.960  1.00 0.00 ? 64  ARG A HD3  6  
ATOM 9793  H HE   . ARG A 1 64  ? 6.398   -1.957  -9.267  1.00 0.00 ? 64  ARG A HE   6  
ATOM 9794  H HH11 . ARG A 1 64  ? 7.601   -2.487  -6.043  1.00 0.00 ? 64  ARG A HH11 6  
ATOM 9795  H HH12 . ARG A 1 64  ? 7.797   -0.801  -5.699  1.00 0.00 ? 64  ARG A HH12 6  
ATOM 9796  H HH21 . ARG A 1 64  ? 6.652   0.267   -8.825  1.00 0.00 ? 64  ARG A HH21 6  
ATOM 9797  H HH22 . ARG A 1 64  ? 7.256   0.765   -7.281  1.00 0.00 ? 64  ARG A HH22 6  
ATOM 9798  N N    . LEU A 1 65  ? 2.159   -4.752  -6.988  1.00 0.00 ? 65  LEU A N    6  
ATOM 9799  C CA   . LEU A 1 65  ? 1.046   -4.223  -7.769  1.00 0.00 ? 65  LEU A CA   6  
ATOM 9800  C C    . LEU A 1 65  ? 1.230   -2.734  -8.040  1.00 0.00 ? 65  LEU A C    6  
ATOM 9801  O O    . LEU A 1 65  ? 1.349   -1.934  -7.112  1.00 0.00 ? 65  LEU A O    6  
ATOM 9802  C CB   . LEU A 1 65  ? -0.276  -4.460  -7.036  1.00 0.00 ? 65  LEU A CB   6  
ATOM 9803  C CG   . LEU A 1 65  ? -0.569  -5.906  -6.632  1.00 0.00 ? 65  LEU A CG   6  
ATOM 9804  C CD1  . LEU A 1 65  ? -1.745  -5.963  -5.670  1.00 0.00 ? 65  LEU A CD1  6  
ATOM 9805  C CD2  . LEU A 1 65  ? -0.843  -6.758  -7.863  1.00 0.00 ? 65  LEU A CD2  6  
ATOM 9806  H H    . LEU A 1 65  ? 2.249   -4.490  -6.049  1.00 0.00 ? 65  LEU A H    6  
ATOM 9807  H HA   . LEU A 1 65  ? 1.024   -4.748  -8.712  1.00 0.00 ? 65  LEU A HA   6  
ATOM 9808  H HB2  . LEU A 1 65  ? -0.267  -3.862  -6.138  1.00 0.00 ? 65  LEU A HB2  6  
ATOM 9809  H HB3  . LEU A 1 65  ? -1.075  -4.127  -7.682  1.00 0.00 ? 65  LEU A HB3  6  
ATOM 9810  H HG   . LEU A 1 65  ? 0.295   -6.314  -6.127  1.00 0.00 ? 65  LEU A HG   6  
ATOM 9811  H HD11 . LEU A 1 65  ? -1.380  -6.085  -4.661  1.00 0.00 ? 65  LEU A HD11 6  
ATOM 9812  H HD12 . LEU A 1 65  ? -2.380  -6.798  -5.926  1.00 0.00 ? 65  LEU A HD12 6  
ATOM 9813  H HD13 . LEU A 1 65  ? -2.312  -5.046  -5.739  1.00 0.00 ? 65  LEU A HD13 6  
ATOM 9814  H HD21 . LEU A 1 65  ? -1.462  -6.205  -8.553  1.00 0.00 ? 65  LEU A HD21 6  
ATOM 9815  H HD22 . LEU A 1 65  ? -1.352  -7.663  -7.567  1.00 0.00 ? 65  LEU A HD22 6  
ATOM 9816  H HD23 . LEU A 1 65  ? 0.093   -7.011  -8.340  1.00 0.00 ? 65  LEU A HD23 6  
ATOM 9817  N N    . ASN A 1 66  ? 1.251   -2.367  -9.317  1.00 0.00 ? 66  ASN A N    6  
ATOM 9818  C CA   . ASN A 1 66  ? 1.418   -0.973  -9.710  1.00 0.00 ? 66  ASN A CA   6  
ATOM 9819  C C    . ASN A 1 66  ? 0.075   -0.342  -10.063 1.00 0.00 ? 66  ASN A C    6  
ATOM 9820  O O    . ASN A 1 66  ? -0.792  -0.991  -10.649 1.00 0.00 ? 66  ASN A O    6  
ATOM 9821  C CB   . ASN A 1 66  ? 2.372   -0.869  -10.902 1.00 0.00 ? 66  ASN A CB   6  
ATOM 9822  C CG   . ASN A 1 66  ? 3.818   -1.098  -10.507 1.00 0.00 ? 66  ASN A CG   6  
ATOM 9823  O OD1  . ASN A 1 66  ? 4.205   -0.864  -9.362  1.00 0.00 ? 66  ASN A OD1  6  
ATOM 9824  N ND2  . ASN A 1 66  ? 4.625   -1.559  -11.456 1.00 0.00 ? 66  ASN A ND2  6  
ATOM 9825  H H    . ASN A 1 66  ? 1.151   -3.051  -10.012 1.00 0.00 ? 66  ASN A H    6  
ATOM 9826  H HA   . ASN A 1 66  ? 1.844   -0.442  -8.872  1.00 0.00 ? 66  ASN A HA   6  
ATOM 9827  H HB2  . ASN A 1 66  ? 2.099   -1.609  -11.640 1.00 0.00 ? 66  ASN A HB2  6  
ATOM 9828  H HB3  . ASN A 1 66  ? 2.289   0.115   -11.338 1.00 0.00 ? 66  ASN A HB3  6  
ATOM 9829  H HD21 . ASN A 1 66  ? 4.247   -1.723  -12.345 1.00 0.00 ? 66  ASN A HD21 6  
ATOM 9830  H HD22 . ASN A 1 66  ? 5.565   -1.717  -11.228 1.00 0.00 ? 66  ASN A HD22 6  
ATOM 9831  N N    . ILE A 1 67  ? -0.089  0.927   -9.703  1.00 0.00 ? 67  ILE A N    6  
ATOM 9832  C CA   . ILE A 1 67  ? -1.326  1.646   -9.983  1.00 0.00 ? 67  ILE A CA   6  
ATOM 9833  C C    . ILE A 1 67  ? -1.091  2.776   -10.979 1.00 0.00 ? 67  ILE A C    6  
ATOM 9834  O O    . ILE A 1 67  ? -0.554  3.832   -10.643 1.00 0.00 ? 67  ILE A O    6  
ATOM 9835  C CB   . ILE A 1 67  ? -1.941  2.229   -8.697  1.00 0.00 ? 67  ILE A CB   6  
ATOM 9836  C CG1  . ILE A 1 67  ? -1.840  1.219   -7.553  1.00 0.00 ? 67  ILE A CG1  6  
ATOM 9837  C CG2  . ILE A 1 67  ? -3.391  2.624   -8.936  1.00 0.00 ? 67  ILE A CG2  6  
ATOM 9838  C CD1  . ILE A 1 67  ? -2.740  0.016   -7.728  1.00 0.00 ? 67  ILE A CD1  6  
ATOM 9839  H H    . ILE A 1 67  ? 0.639   1.390   -9.239  1.00 0.00 ? 67  ILE A H    6  
ATOM 9840  H HA   . ILE A 1 67  ? -2.029  0.945   -10.409 1.00 0.00 ? 67  ILE A HA   6  
ATOM 9841  H HB   . ILE A 1 67  ? -1.390  3.119   -8.433  1.00 0.00 ? 67  ILE A HB   6  
ATOM 9842  H HG12 . ILE A 1 67  ? -0.823  0.864   -7.483  1.00 0.00 ? 67  ILE A HG12 6  
ATOM 9843  H HG13 . ILE A 1 67  ? -2.111  1.706   -6.628  1.00 0.00 ? 67  ILE A HG13 6  
ATOM 9844  H HG21 . ILE A 1 67  ? -3.646  3.459   -8.301  1.00 0.00 ? 67  ILE A HG21 6  
ATOM 9845  H HG22 . ILE A 1 67  ? -3.521  2.906   -9.970  1.00 0.00 ? 67  ILE A HG22 6  
ATOM 9846  H HG23 . ILE A 1 67  ? -4.034  1.788   -8.707  1.00 0.00 ? 67  ILE A HG23 6  
ATOM 9847  H HD11 . ILE A 1 67  ? -2.341  -0.817  -7.165  1.00 0.00 ? 67  ILE A HD11 6  
ATOM 9848  H HD12 . ILE A 1 67  ? -3.730  0.251   -7.367  1.00 0.00 ? 67  ILE A HD12 6  
ATOM 9849  H HD13 . ILE A 1 67  ? -2.789  -0.249  -8.773  1.00 0.00 ? 67  ILE A HD13 6  
ATOM 9850  N N    . PRO A 1 68  ? -1.502  2.552   -12.236 1.00 0.00 ? 68  PRO A N    6  
ATOM 9851  C CA   . PRO A 1 68  ? -1.349  3.541   -13.307 1.00 0.00 ? 68  PRO A CA   6  
ATOM 9852  C C    . PRO A 1 68  ? -2.264  4.747   -13.118 1.00 0.00 ? 68  PRO A C    6  
ATOM 9853  O O    . PRO A 1 68  ? -2.302  5.646   -13.956 1.00 0.00 ? 68  PRO A O    6  
ATOM 9854  C CB   . PRO A 1 68  ? -1.742  2.764   -14.566 1.00 0.00 ? 68  PRO A CB   6  
ATOM 9855  C CG   . PRO A 1 68  ? -2.646  1.685   -14.079 1.00 0.00 ? 68  PRO A CG   6  
ATOM 9856  C CD   . PRO A 1 68  ? -2.149  1.317   -12.708 1.00 0.00 ? 68  PRO A CD   6  
ATOM 9857  H HA   . PRO A 1 68  ? -0.327  3.877   -13.394 1.00 0.00 ? 68  PRO A HA   6  
ATOM 9858  H HB2  . PRO A 1 68  ? -2.250  3.424   -15.256 1.00 0.00 ? 68  PRO A HB2  6  
ATOM 9859  H HB3  . PRO A 1 68  ? -0.858  2.357   -15.033 1.00 0.00 ? 68  PRO A HB3  6  
ATOM 9860  H HG2  . PRO A 1 68  ? -3.660  2.052   -14.024 1.00 0.00 ? 68  PRO A HG2  6  
ATOM 9861  H HG3  . PRO A 1 68  ? -2.589  0.833   -14.739 1.00 0.00 ? 68  PRO A HG3  6  
ATOM 9862  H HD2  . PRO A 1 68  ? -2.976  1.045   -12.068 1.00 0.00 ? 68  PRO A HD2  6  
ATOM 9863  H HD3  . PRO A 1 68  ? -1.436  0.508   -12.770 1.00 0.00 ? 68  PRO A HD3  6  
ATOM 9864  N N    . ASN A 1 69  ? -2.999  4.758   -12.011 1.00 0.00 ? 69  ASN A N    6  
ATOM 9865  C CA   . ASN A 1 69  ? -3.914  5.854   -11.712 1.00 0.00 ? 69  ASN A CA   6  
ATOM 9866  C C    . ASN A 1 69  ? -3.748  6.324   -10.270 1.00 0.00 ? 69  ASN A C    6  
ATOM 9867  O O    . ASN A 1 69  ? -3.987  5.581   -9.317  1.00 0.00 ? 69  ASN A O    6  
ATOM 9868  C CB   . ASN A 1 69  ? -5.361  5.418   -11.954 1.00 0.00 ? 69  ASN A CB   6  
ATOM 9869  C CG   . ASN A 1 69  ? -6.322  6.591   -11.972 1.00 0.00 ? 69  ASN A CG   6  
ATOM 9870  O OD1  . ASN A 1 69  ? -6.011  7.654   -12.509 1.00 0.00 ? 69  ASN A OD1  6  
ATOM 9871  N ND2  . ASN A 1 69  ? -7.497  6.402   -11.384 1.00 0.00 ? 69  ASN A ND2  6  
ATOM 9872  H H    . ASN A 1 69  ? -2.925  4.012   -11.380 1.00 0.00 ? 69  ASN A H    6  
ATOM 9873  H HA   . ASN A 1 69  ? -3.678  6.672   -12.375 1.00 0.00 ? 69  ASN A HA   6  
ATOM 9874  H HB2  . ASN A 1 69  ? -5.423  4.912   -12.907 1.00 0.00 ? 69  ASN A HB2  6  
ATOM 9875  H HB3  . ASN A 1 69  ? -5.663  4.740   -11.170 1.00 0.00 ? 69  ASN A HB3  6  
ATOM 9876  H HD21 . ASN A 1 69  ? -7.676  5.528   -10.976 1.00 0.00 ? 69  ASN A HD21 6  
ATOM 9877  H HD22 . ASN A 1 69  ? -8.138  7.143   -11.381 1.00 0.00 ? 69  ASN A HD22 6  
ATOM 9878  N N    . PRO A 1 70  ? -3.328  7.587   -10.104 1.00 0.00 ? 70  PRO A N    6  
ATOM 9879  C CA   . PRO A 1 70  ? -3.121  8.185   -8.782  1.00 0.00 ? 70  PRO A CA   6  
ATOM 9880  C C    . PRO A 1 70  ? -4.433  8.419   -8.040  1.00 0.00 ? 70  PRO A C    6  
ATOM 9881  O O    . PRO A 1 70  ? -4.437  8.711   -6.844  1.00 0.00 ? 70  PRO A O    6  
ATOM 9882  C CB   . PRO A 1 70  ? -2.440  9.519   -9.098  1.00 0.00 ? 70  PRO A CB   6  
ATOM 9883  C CG   . PRO A 1 70  ? -2.875  9.846   -10.485 1.00 0.00 ? 70  PRO A CG   6  
ATOM 9884  C CD   . PRO A 1 70  ? -3.024  8.528   -11.194 1.00 0.00 ? 70  PRO A CD   6  
ATOM 9885  H HA   . PRO A 1 70  ? -2.467  7.580   -8.171  1.00 0.00 ? 70  PRO A HA   6  
ATOM 9886  H HB2  . PRO A 1 70  ? -2.768  10.269  -8.393  1.00 0.00 ? 70  PRO A HB2  6  
ATOM 9887  H HB3  . PRO A 1 70  ? -1.369  9.403   -9.037  1.00 0.00 ? 70  PRO A HB3  6  
ATOM 9888  H HG2  . PRO A 1 70  ? -3.820  10.368  -10.460 1.00 0.00 ? 70  PRO A HG2  6  
ATOM 9889  H HG3  . PRO A 1 70  ? -2.124  10.450  -10.972 1.00 0.00 ? 70  PRO A HG3  6  
ATOM 9890  H HD2  . PRO A 1 70  ? -3.837  8.572   -11.904 1.00 0.00 ? 70  PRO A HD2  6  
ATOM 9891  H HD3  . PRO A 1 70  ? -2.102  8.260   -11.689 1.00 0.00 ? 70  PRO A HD3  6  
ATOM 9892  N N    . ALA A 1 71  ? -5.544  8.289   -8.757  1.00 0.00 ? 71  ALA A N    6  
ATOM 9893  C CA   . ALA A 1 71  ? -6.862  8.484   -8.165  1.00 0.00 ? 71  ALA A CA   6  
ATOM 9894  C C    . ALA A 1 71  ? -7.364  7.203   -7.507  1.00 0.00 ? 71  ALA A C    6  
ATOM 9895  O O    . ALA A 1 71  ? -8.074  7.248   -6.503  1.00 0.00 ? 71  ALA A O    6  
ATOM 9896  C CB   . ALA A 1 71  ? -7.849  8.959   -9.221  1.00 0.00 ? 71  ALA A CB   6  
ATOM 9897  H H    . ALA A 1 71  ? -5.476  8.055   -9.706  1.00 0.00 ? 71  ALA A H    6  
ATOM 9898  H HA   . ALA A 1 71  ? -6.779  9.255   -7.412  1.00 0.00 ? 71  ALA A HA   6  
ATOM 9899  H HB1  . ALA A 1 71  ? -8.397  8.113   -9.608  1.00 0.00 ? 71  ALA A HB1  6  
ATOM 9900  H HB2  . ALA A 1 71  ? -8.539  9.662   -8.777  1.00 0.00 ? 71  ALA A HB2  6  
ATOM 9901  H HB3  . ALA A 1 71  ? -7.313  9.440   -10.025 1.00 0.00 ? 71  ALA A HB3  6  
ATOM 9902  N N    . GLN A 1 72  ? -6.990  6.064   -8.080  1.00 0.00 ? 72  GLN A N    6  
ATOM 9903  C CA   . GLN A 1 72  ? -7.404  4.770   -7.549  1.00 0.00 ? 72  GLN A CA   6  
ATOM 9904  C C    . GLN A 1 72  ? -6.688  4.467   -6.237  1.00 0.00 ? 72  GLN A C    6  
ATOM 9905  O O    . GLN A 1 72  ? -5.537  4.029   -6.231  1.00 0.00 ? 72  GLN A O    6  
ATOM 9906  C CB   . GLN A 1 72  ? -7.122  3.663   -8.566  1.00 0.00 ? 72  GLN A CB   6  
ATOM 9907  C CG   . GLN A 1 72  ? -7.236  2.262   -7.987  1.00 0.00 ? 72  GLN A CG   6  
ATOM 9908  C CD   . GLN A 1 72  ? -6.751  1.193   -8.947  1.00 0.00 ? 72  GLN A CD   6  
ATOM 9909  O OE1  . GLN A 1 72  ? -6.828  1.355   -10.165 1.00 0.00 ? 72  GLN A OE1  6  
ATOM 9910  N NE2  . GLN A 1 72  ? -6.248  0.092   -8.401  1.00 0.00 ? 72  GLN A NE2  6  
ATOM 9911  H H    . GLN A 1 72  ? -6.423  6.093   -8.878  1.00 0.00 ? 72  GLN A H    6  
ATOM 9912  H HA   . GLN A 1 72  ? -8.467  4.814   -7.363  1.00 0.00 ? 72  GLN A HA   6  
ATOM 9913  H HB2  . GLN A 1 72  ? -7.824  3.752   -9.381  1.00 0.00 ? 72  GLN A HB2  6  
ATOM 9914  H HB3  . GLN A 1 72  ? -6.120  3.790   -8.949  1.00 0.00 ? 72  GLN A HB3  6  
ATOM 9915  H HG2  . GLN A 1 72  ? -6.645  2.209   -7.085  1.00 0.00 ? 72  GLN A HG2  6  
ATOM 9916  H HG3  . GLN A 1 72  ? -8.272  2.069   -7.749  1.00 0.00 ? 72  GLN A HG3  6  
ATOM 9917  H HE21 . GLN A 1 72  ? -6.220  0.032   -7.423  1.00 0.00 ? 72  GLN A HE21 6  
ATOM 9918  H HE22 . GLN A 1 72  ? -5.928  -0.615  -8.998  1.00 0.00 ? 72  GLN A HE22 6  
ATOM 9919  N N    . THR A 1 73  ? -7.377  4.701   -5.124  1.00 0.00 ? 73  THR A N    6  
ATOM 9920  C CA   . THR A 1 73  ? -6.807  4.454   -3.806  1.00 0.00 ? 73  THR A CA   6  
ATOM 9921  C C    . THR A 1 73  ? -7.253  3.103   -3.258  1.00 0.00 ? 73  THR A C    6  
ATOM 9922  O O    . THR A 1 73  ? -7.390  2.928   -2.048  1.00 0.00 ? 73  THR A O    6  
ATOM 9923  C CB   . THR A 1 73  ? -7.205  5.557   -2.806  1.00 0.00 ? 73  THR A CB   6  
ATOM 9924  O OG1  . THR A 1 73  ? -8.629  5.594   -2.659  1.00 0.00 ? 73  THR A OG1  6  
ATOM 9925  C CG2  . THR A 1 73  ? -6.702  6.915   -3.271  1.00 0.00 ? 73  THR A CG2  6  
ATOM 9926  H H    . THR A 1 73  ? -8.290  5.050   -5.193  1.00 0.00 ? 73  THR A H    6  
ATOM 9927  H HA   . THR A 1 73  ? -5.731  4.456   -3.902  1.00 0.00 ? 73  THR A HA   6  
ATOM 9928  H HB   . THR A 1 73  ? -6.757  5.332   -1.849  1.00 0.00 ? 73  THR A HB   6  
ATOM 9929  H HG1  . THR A 1 73  ? -8.997  4.738   -2.890  1.00 0.00 ? 73  THR A HG1  6  
ATOM 9930  H HG21 . THR A 1 73  ? -7.365  7.687   -2.908  1.00 0.00 ? 73  THR A HG21 6  
ATOM 9931  H HG22 . THR A 1 73  ? -6.678  6.941   -4.350  1.00 0.00 ? 73  THR A HG22 6  
ATOM 9932  H HG23 . THR A 1 73  ? -5.708  7.083   -2.884  1.00 0.00 ? 73  THR A HG23 6  
ATOM 9933  N N    . SER A 1 74  ? -7.476  2.150   -4.157  1.00 0.00 ? 74  SER A N    6  
ATOM 9934  C CA   . SER A 1 74  ? -7.909  0.815   -3.764  1.00 0.00 ? 74  SER A CA   6  
ATOM 9935  C C    . SER A 1 74  ? -7.684  -0.185  -4.895  1.00 0.00 ? 74  SER A C    6  
ATOM 9936  O O    . SER A 1 74  ? -7.892  0.129   -6.067  1.00 0.00 ? 74  SER A O    6  
ATOM 9937  C CB   . SER A 1 74  ? -9.387  0.830   -3.369  1.00 0.00 ? 74  SER A CB   6  
ATOM 9938  O OG   . SER A 1 74  ? -9.689  1.960   -2.568  1.00 0.00 ? 74  SER A OG   6  
ATOM 9939  H H    . SER A 1 74  ? -7.349  2.351   -5.108  1.00 0.00 ? 74  SER A H    6  
ATOM 9940  H HA   . SER A 1 74  ? -7.321  0.513   -2.910  1.00 0.00 ? 74  SER A HA   6  
ATOM 9941  H HB2  . SER A 1 74  ? -9.995  0.864   -4.261  1.00 0.00 ? 74  SER A HB2  6  
ATOM 9942  H HB3  . SER A 1 74  ? -9.617  -0.065  -2.810  1.00 0.00 ? 74  SER A HB3  6  
ATOM 9943  H HG   . SER A 1 74  ? -9.690  2.749   -3.114  1.00 0.00 ? 74  SER A HG   6  
ATOM 9944  N N    . VAL A 1 75  ? -7.257  -1.391  -4.534  1.00 0.00 ? 75  VAL A N    6  
ATOM 9945  C CA   . VAL A 1 75  ? -7.003  -2.437  -5.517  1.00 0.00 ? 75  VAL A CA   6  
ATOM 9946  C C    . VAL A 1 75  ? -7.498  -3.791  -5.018  1.00 0.00 ? 75  VAL A C    6  
ATOM 9947  O O    . VAL A 1 75  ? -7.466  -4.072  -3.820  1.00 0.00 ? 75  VAL A O    6  
ATOM 9948  C CB   . VAL A 1 75  ? -5.504  -2.543  -5.851  1.00 0.00 ? 75  VAL A CB   6  
ATOM 9949  C CG1  . VAL A 1 75  ? -4.702  -2.889  -4.606  1.00 0.00 ? 75  VAL A CG1  6  
ATOM 9950  C CG2  . VAL A 1 75  ? -5.273  -3.572  -6.947  1.00 0.00 ? 75  VAL A CG2  6  
ATOM 9951  H H    . VAL A 1 75  ? -7.109  -1.581  -3.584  1.00 0.00 ? 75  VAL A H    6  
ATOM 9952  H HA   . VAL A 1 75  ? -7.535  -2.182  -6.422  1.00 0.00 ? 75  VAL A HA   6  
ATOM 9953  H HB   . VAL A 1 75  ? -5.168  -1.582  -6.213  1.00 0.00 ? 75  VAL A HB   6  
ATOM 9954  H HG11 . VAL A 1 75  ? -4.377  -1.979  -4.122  1.00 0.00 ? 75  VAL A HG11 6  
ATOM 9955  H HG12 . VAL A 1 75  ? -5.319  -3.459  -3.927  1.00 0.00 ? 75  VAL A HG12 6  
ATOM 9956  H HG13 . VAL A 1 75  ? -3.838  -3.475  -4.885  1.00 0.00 ? 75  VAL A HG13 6  
ATOM 9957  H HG21 . VAL A 1 75  ? -5.798  -3.270  -7.841  1.00 0.00 ? 75  VAL A HG21 6  
ATOM 9958  H HG22 . VAL A 1 75  ? -4.216  -3.644  -7.156  1.00 0.00 ? 75  VAL A HG22 6  
ATOM 9959  H HG23 . VAL A 1 75  ? -5.642  -4.534  -6.621  1.00 0.00 ? 75  VAL A HG23 6  
ATOM 9960  N N    . VAL A 1 76  ? -7.954  -4.627  -5.945  1.00 0.00 ? 76  VAL A N    6  
ATOM 9961  C CA   . VAL A 1 76  ? -8.454  -5.952  -5.600  1.00 0.00 ? 76  VAL A CA   6  
ATOM 9962  C C    . VAL A 1 76  ? -7.361  -7.006  -5.742  1.00 0.00 ? 76  VAL A C    6  
ATOM 9963  O O    . VAL A 1 76  ? -6.812  -7.204  -6.826  1.00 0.00 ? 76  VAL A O    6  
ATOM 9964  C CB   . VAL A 1 76  ? -9.651  -6.348  -6.484  1.00 0.00 ? 76  VAL A CB   6  
ATOM 9965  C CG1  . VAL A 1 76  ? -10.091 -7.772  -6.182  1.00 0.00 ? 76  VAL A CG1  6  
ATOM 9966  C CG2  . VAL A 1 76  ? -10.803 -5.373  -6.288  1.00 0.00 ? 76  VAL A CG2  6  
ATOM 9967  H H    . VAL A 1 76  ? -7.953  -4.345  -6.884  1.00 0.00 ? 76  VAL A H    6  
ATOM 9968  H HA   . VAL A 1 76  ? -8.785  -5.927  -4.572  1.00 0.00 ? 76  VAL A HA   6  
ATOM 9969  H HB   . VAL A 1 76  ? -9.341  -6.302  -7.518  1.00 0.00 ? 76  VAL A HB   6  
ATOM 9970  H HG11 . VAL A 1 76  ? -9.220  -8.405  -6.087  1.00 0.00 ? 76  VAL A HG11 6  
ATOM 9971  H HG12 . VAL A 1 76  ? -10.651 -7.788  -5.259  1.00 0.00 ? 76  VAL A HG12 6  
ATOM 9972  H HG13 . VAL A 1 76  ? -10.712 -8.136  -6.988  1.00 0.00 ? 76  VAL A HG13 6  
ATOM 9973  H HG21 . VAL A 1 76  ? -10.903 -4.753  -7.166  1.00 0.00 ? 76  VAL A HG21 6  
ATOM 9974  H HG22 . VAL A 1 76  ? -11.717 -5.925  -6.130  1.00 0.00 ? 76  VAL A HG22 6  
ATOM 9975  H HG23 . VAL A 1 76  ? -10.605 -4.750  -5.428  1.00 0.00 ? 76  VAL A HG23 6  
ATOM 9976  N N    . VAL A 1 77  ? -7.050  -7.680  -4.640  1.00 0.00 ? 77  VAL A N    6  
ATOM 9977  C CA   . VAL A 1 77  ? -6.024  -8.716  -4.641  1.00 0.00 ? 77  VAL A CA   6  
ATOM 9978  C C    . VAL A 1 77  ? -6.647  -10.107 -4.641  1.00 0.00 ? 77  VAL A C    6  
ATOM 9979  O O    . VAL A 1 77  ? -7.478  -10.425 -3.792  1.00 0.00 ? 77  VAL A O    6  
ATOM 9980  C CB   . VAL A 1 77  ? -5.091  -8.583  -3.423  1.00 0.00 ? 77  VAL A CB   6  
ATOM 9981  C CG1  . VAL A 1 77  ? -4.072  -9.713  -3.405  1.00 0.00 ? 77  VAL A CG1  6  
ATOM 9982  C CG2  . VAL A 1 77  ? -4.398  -7.229  -3.428  1.00 0.00 ? 77  VAL A CG2  6  
ATOM 9983  H H    . VAL A 1 77  ? -7.523  -7.477  -3.806  1.00 0.00 ? 77  VAL A H    6  
ATOM 9984  H HA   . VAL A 1 77  ? -5.431  -8.597  -5.537  1.00 0.00 ? 77  VAL A HA   6  
ATOM 9985  H HB   . VAL A 1 77  ? -5.690  -8.654  -2.527  1.00 0.00 ? 77  VAL A HB   6  
ATOM 9986  H HG11 . VAL A 1 77  ? -4.564  -10.636 -3.138  1.00 0.00 ? 77  VAL A HG11 6  
ATOM 9987  H HG12 . VAL A 1 77  ? -3.625  -9.810  -4.383  1.00 0.00 ? 77  VAL A HG12 6  
ATOM 9988  H HG13 . VAL A 1 77  ? -3.304  -9.493  -2.678  1.00 0.00 ? 77  VAL A HG13 6  
ATOM 9989  H HG21 . VAL A 1 77  ? -4.505  -6.773  -4.401  1.00 0.00 ? 77  VAL A HG21 6  
ATOM 9990  H HG22 . VAL A 1 77  ? -4.846  -6.593  -2.680  1.00 0.00 ? 77  VAL A HG22 6  
ATOM 9991  H HG23 . VAL A 1 77  ? -3.348  -7.360  -3.207  1.00 0.00 ? 77  VAL A HG23 6  
ATOM 9992  N N    . GLU A 1 78  ? -6.238  -10.933 -5.600  1.00 0.00 ? 78  GLU A N    6  
ATOM 9993  C CA   . GLU A 1 78  ? -6.757  -12.291 -5.710  1.00 0.00 ? 78  GLU A CA   6  
ATOM 9994  C C    . GLU A 1 78  ? -5.620  -13.297 -5.869  1.00 0.00 ? 78  GLU A C    6  
ATOM 9995  O O    . GLU A 1 78  ? -4.445  -12.934 -5.820  1.00 0.00 ? 78  GLU A O    6  
ATOM 9996  C CB   . GLU A 1 78  ? -7.717  -12.399 -6.896  1.00 0.00 ? 78  GLU A CB   6  
ATOM 9997  C CG   . GLU A 1 78  ? -8.952  -11.524 -6.762  1.00 0.00 ? 78  GLU A CG   6  
ATOM 9998  C CD   . GLU A 1 78  ? -10.035 -11.885 -7.759  1.00 0.00 ? 78  GLU A CD   6  
ATOM 9999  O OE1  . GLU A 1 78  ? -9.886  -11.539 -8.950  1.00 0.00 ? 78  GLU A OE1  6  
ATOM 10000 O OE2  . GLU A 1 78  ? -11.033 -12.515 -7.349  1.00 0.00 ? 78  GLU A OE2  6  
ATOM 10001 H H    . GLU A 1 78  ? -5.572  -10.621 -6.248  1.00 0.00 ? 78  GLU A H    6  
ATOM 10002 H HA   . GLU A 1 78  ? -7.296  -12.515 -4.802  1.00 0.00 ? 78  GLU A HA   6  
ATOM 10003 H HB2  . GLU A 1 78  ? -7.193  -12.111 -7.796  1.00 0.00 ? 78  GLU A HB2  6  
ATOM 10004 H HB3  . GLU A 1 78  ? -8.039  -13.426 -6.991  1.00 0.00 ? 78  GLU A HB3  6  
ATOM 10005 H HG2  . GLU A 1 78  ? -9.351  -11.637 -5.765  1.00 0.00 ? 78  GLU A HG2  6  
ATOM 10006 H HG3  . GLU A 1 78  ? -8.667  -10.494 -6.919  1.00 0.00 ? 78  GLU A HG3  6  
ATOM 10007 N N    . ASP A 1 79  ? -5.980  -14.562 -6.058  1.00 0.00 ? 79  ASP A N    6  
ATOM 10008 C CA   . ASP A 1 79  ? -4.991  -15.621 -6.224  1.00 0.00 ? 79  ASP A CA   6  
ATOM 10009 C C    . ASP A 1 79  ? -4.131  -15.762 -4.972  1.00 0.00 ? 79  ASP A C    6  
ATOM 10010 O O    . ASP A 1 79  ? -2.902  -15.784 -5.050  1.00 0.00 ? 79  ASP A O    6  
ATOM 10011 C CB   . ASP A 1 79  ? -4.105  -15.335 -7.437  1.00 0.00 ? 79  ASP A CB   6  
ATOM 10012 C CG   . ASP A 1 79  ? -4.708  -15.852 -8.729  1.00 0.00 ? 79  ASP A CG   6  
ATOM 10013 O OD1  . ASP A 1 79  ? -5.950  -15.826 -8.855  1.00 0.00 ? 79  ASP A OD1  6  
ATOM 10014 O OD2  . ASP A 1 79  ? -3.937  -16.282 -9.613  1.00 0.00 ? 79  ASP A OD2  6  
ATOM 10015 H H    . ASP A 1 79  ? -6.933  -14.788 -6.087  1.00 0.00 ? 79  ASP A H    6  
ATOM 10016 H HA   . ASP A 1 79  ? -5.522  -16.547 -6.387  1.00 0.00 ? 79  ASP A HA   6  
ATOM 10017 H HB2  . ASP A 1 79  ? -3.965  -14.267 -7.529  1.00 0.00 ? 79  ASP A HB2  6  
ATOM 10018 H HB3  . ASP A 1 79  ? -3.145  -15.808 -7.293  1.00 0.00 ? 79  ASP A HB3  6  
ATOM 10019 N N    . LEU A 1 80  ? -4.784  -15.857 -3.819  1.00 0.00 ? 80  LEU A N    6  
ATOM 10020 C CA   . LEU A 1 80  ? -4.079  -15.995 -2.550  1.00 0.00 ? 80  LEU A CA   6  
ATOM 10021 C C    . LEU A 1 80  ? -4.283  -17.388 -1.962  1.00 0.00 ? 80  LEU A C    6  
ATOM 10022 O O    . LEU A 1 80  ? -4.983  -18.220 -2.540  1.00 0.00 ? 80  LEU A O    6  
ATOM 10023 C CB   . LEU A 1 80  ? -4.561  -14.935 -1.558  1.00 0.00 ? 80  LEU A CB   6  
ATOM 10024 C CG   . LEU A 1 80  ? -4.433  -13.481 -2.014  1.00 0.00 ? 80  LEU A CG   6  
ATOM 10025 C CD1  . LEU A 1 80  ? -5.520  -12.625 -1.383  1.00 0.00 ? 80  LEU A CD1  6  
ATOM 10026 C CD2  . LEU A 1 80  ? -3.055  -12.934 -1.671  1.00 0.00 ? 80  LEU A CD2  6  
ATOM 10027 H H    . LEU A 1 80  ? -5.763  -15.833 -3.821  1.00 0.00 ? 80  LEU A H    6  
ATOM 10028 H HA   . LEU A 1 80  ? -3.026  -15.848 -2.738  1.00 0.00 ? 80  LEU A HA   6  
ATOM 10029 H HB2  . LEU A 1 80  ? -5.603  -15.125 -1.351  1.00 0.00 ? 80  LEU A HB2  6  
ATOM 10030 H HB3  . LEU A 1 80  ? -3.988  -15.049 -0.648  1.00 0.00 ? 80  LEU A HB3  6  
ATOM 10031 H HG   . LEU A 1 80  ? -4.554  -13.435 -3.088  1.00 0.00 ? 80  LEU A HG   6  
ATOM 10032 H HD11 . LEU A 1 80  ? -5.196  -11.596 -1.352  1.00 0.00 ? 80  LEU A HD11 6  
ATOM 10033 H HD12 . LEU A 1 80  ? -5.714  -12.972 -0.379  1.00 0.00 ? 80  LEU A HD12 6  
ATOM 10034 H HD13 . LEU A 1 80  ? -6.424  -12.702 -1.970  1.00 0.00 ? 80  LEU A HD13 6  
ATOM 10035 H HD21 . LEU A 1 80  ? -2.299  -13.535 -2.153  1.00 0.00 ? 80  LEU A HD21 6  
ATOM 10036 H HD22 . LEU A 1 80  ? -2.912  -12.965 -0.600  1.00 0.00 ? 80  LEU A HD22 6  
ATOM 10037 H HD23 . LEU A 1 80  ? -2.977  -11.912 -2.014  1.00 0.00 ? 80  LEU A HD23 6  
ATOM 10038 N N    . LEU A 1 81  ? -3.670  -17.633 -0.810  1.00 0.00 ? 81  LEU A N    6  
ATOM 10039 C CA   . LEU A 1 81  ? -3.787  -18.925 -0.141  1.00 0.00 ? 81  LEU A CA   6  
ATOM 10040 C C    . LEU A 1 81  ? -4.692  -18.826 1.082   1.00 0.00 ? 81  LEU A C    6  
ATOM 10041 O O    . LEU A 1 81  ? -4.643  -17.860 1.844   1.00 0.00 ? 81  LEU A O    6  
ATOM 10042 C CB   . LEU A 1 81  ? -2.405  -19.434 0.272   1.00 0.00 ? 81  LEU A CB   6  
ATOM 10043 C CG   . LEU A 1 81  ? -1.560  -20.060 -0.838  1.00 0.00 ? 81  LEU A CG   6  
ATOM 10044 C CD1  . LEU A 1 81  ? -0.109  -20.182 -0.400  1.00 0.00 ? 81  LEU A CD1  6  
ATOM 10045 C CD2  . LEU A 1 81  ? -2.117  -21.420 -1.230  1.00 0.00 ? 81  LEU A CD2  6  
ATOM 10046 H H    . LEU A 1 81  ? -3.127  -16.931 -0.397  1.00 0.00 ? 81  LEU A H    6  
ATOM 10047 H HA   . LEU A 1 81  ? -4.223  -19.622 -0.841  1.00 0.00 ? 81  LEU A HA   6  
ATOM 10048 H HB2  . LEU A 1 81  ? -1.853  -18.599 0.677   1.00 0.00 ? 81  LEU A HB2  6  
ATOM 10049 H HB3  . LEU A 1 81  ? -2.544  -20.179 1.043   1.00 0.00 ? 81  LEU A HB3  6  
ATOM 10050 H HG   . LEU A 1 81  ? -1.592  -19.420 -1.710  1.00 0.00 ? 81  LEU A HG   6  
ATOM 10051 H HD11 . LEU A 1 81  ? 0.473   -19.395 -0.856  1.00 0.00 ? 81  LEU A HD11 6  
ATOM 10052 H HD12 . LEU A 1 81  ? 0.280   -21.142 -0.707  1.00 0.00 ? 81  LEU A HD12 6  
ATOM 10053 H HD13 . LEU A 1 81  ? -0.049  -20.098 0.675   1.00 0.00 ? 81  LEU A HD13 6  
ATOM 10054 H HD21 . LEU A 1 81  ? -1.898  -22.136 -0.452  1.00 0.00 ? 81  LEU A HD21 6  
ATOM 10055 H HD22 . LEU A 1 81  ? -1.662  -21.742 -2.155  1.00 0.00 ? 81  LEU A HD22 6  
ATOM 10056 H HD23 . LEU A 1 81  ? -3.187  -21.346 -1.362  1.00 0.00 ? 81  LEU A HD23 6  
ATOM 10057 N N    . PRO A 1 82  ? -5.536  -19.849 1.278   1.00 0.00 ? 82  PRO A N    6  
ATOM 10058 C CA   . PRO A 1 82  ? -6.467  -19.902 2.410   1.00 0.00 ? 82  PRO A CA   6  
ATOM 10059 C C    . PRO A 1 82  ? -5.751  -20.110 3.740   1.00 0.00 ? 82  PRO A C    6  
ATOM 10060 O O    . PRO A 1 82  ? -4.711  -20.765 3.800   1.00 0.00 ? 82  PRO A O    6  
ATOM 10061 C CB   . PRO A 1 82  ? -7.353  -21.107 2.085   1.00 0.00 ? 82  PRO A CB   6  
ATOM 10062 C CG   . PRO A 1 82  ? -6.512  -21.970 1.210   1.00 0.00 ? 82  PRO A CG   6  
ATOM 10063 C CD   . PRO A 1 82  ? -5.648  -21.034 0.411   1.00 0.00 ? 82  PRO A CD   6  
ATOM 10064 H HA   . PRO A 1 82  ? -7.075  -19.010 2.466   1.00 0.00 ? 82  PRO A HA   6  
ATOM 10065 H HB2  . PRO A 1 82  ? -7.623  -21.615 3.000   1.00 0.00 ? 82  PRO A HB2  6  
ATOM 10066 H HB3  . PRO A 1 82  ? -8.244  -20.776 1.574   1.00 0.00 ? 82  PRO A HB3  6  
ATOM 10067 H HG2  . PRO A 1 82  ? -5.899  -22.621 1.815   1.00 0.00 ? 82  PRO A HG2  6  
ATOM 10068 H HG3  . PRO A 1 82  ? -7.142  -22.551 0.552   1.00 0.00 ? 82  PRO A HG3  6  
ATOM 10069 H HD2  . PRO A 1 82  ? -4.678  -21.474 0.232   1.00 0.00 ? 82  PRO A HD2  6  
ATOM 10070 H HD3  . PRO A 1 82  ? -6.128  -20.782 -0.524  1.00 0.00 ? 82  PRO A HD3  6  
ATOM 10071 N N    . ASN A 1 83  ? -6.315  -19.549 4.805   1.00 0.00 ? 83  ASN A N    6  
ATOM 10072 C CA   . ASN A 1 83  ? -5.729  -19.674 6.135   1.00 0.00 ? 83  ASN A CA   6  
ATOM 10073 C C    . ASN A 1 83  ? -4.250  -19.300 6.115   1.00 0.00 ? 83  ASN A C    6  
ATOM 10074 O O    . ASN A 1 83  ? -3.407  -20.032 6.634   1.00 0.00 ? 83  ASN A O    6  
ATOM 10075 C CB   . ASN A 1 83  ? -5.899  -21.102 6.657   1.00 0.00 ? 83  ASN A CB   6  
ATOM 10076 C CG   . ASN A 1 83  ? -7.349  -21.448 6.934   1.00 0.00 ? 83  ASN A CG   6  
ATOM 10077 O OD1  . ASN A 1 83  ? -7.693  -21.905 8.024   1.00 0.00 ? 83  ASN A OD1  6  
ATOM 10078 N ND2  . ASN A 1 83  ? -8.208  -21.231 5.945   1.00 0.00 ? 83  ASN A ND2  6  
ATOM 10079 H H    . ASN A 1 83  ? -7.144  -19.039 4.694   1.00 0.00 ? 83  ASN A H    6  
ATOM 10080 H HA   . ASN A 1 83  ? -6.251  -18.995 6.792   1.00 0.00 ? 83  ASN A HA   6  
ATOM 10081 H HB2  . ASN A 1 83  ? -5.517  -21.796 5.922   1.00 0.00 ? 83  ASN A HB2  6  
ATOM 10082 H HB3  . ASN A 1 83  ? -5.340  -21.213 7.574   1.00 0.00 ? 83  ASN A HB3  6  
ATOM 10083 H HD21 . ASN A 1 83  ? -7.863  -20.864 5.104   1.00 0.00 ? 83  ASN A HD21 6  
ATOM 10084 H HD22 . ASN A 1 83  ? -9.152  -21.445 6.097   1.00 0.00 ? 83  ASN A HD22 6  
ATOM 10085 N N    . HIS A 1 84  ? -3.942  -18.156 5.513   1.00 0.00 ? 84  HIS A N    6  
ATOM 10086 C CA   . HIS A 1 84  ? -2.565  -17.683 5.427   1.00 0.00 ? 84  HIS A CA   6  
ATOM 10087 C C    . HIS A 1 84  ? -2.502  -16.165 5.566   1.00 0.00 ? 84  HIS A C    6  
ATOM 10088 O O    . HIS A 1 84  ? -3.176  -15.437 4.838   1.00 0.00 ? 84  HIS A O    6  
ATOM 10089 C CB   . HIS A 1 84  ? -1.939  -18.112 4.100   1.00 0.00 ? 84  HIS A CB   6  
ATOM 10090 C CG   . HIS A 1 84  ? -1.418  -19.516 4.109   1.00 0.00 ? 84  HIS A CG   6  
ATOM 10091 N ND1  . HIS A 1 84  ? -2.217  -20.617 3.884   1.00 0.00 ? 84  HIS A ND1  6  
ATOM 10092 C CD2  . HIS A 1 84  ? -0.169  -19.996 4.317   1.00 0.00 ? 84  HIS A CD2  6  
ATOM 10093 C CE1  . HIS A 1 84  ? -1.483  -21.713 3.955   1.00 0.00 ? 84  HIS A CE1  6  
ATOM 10094 N NE2  . HIS A 1 84  ? -0.236  -21.364 4.216   1.00 0.00 ? 84  HIS A NE2  6  
ATOM 10095 H H    . HIS A 1 84  ? -4.659  -17.616 5.118   1.00 0.00 ? 84  HIS A H    6  
ATOM 10096 H HA   . HIS A 1 84  ? -2.010  -18.130 6.238   1.00 0.00 ? 84  HIS A HA   6  
ATOM 10097 H HB2  . HIS A 1 84  ? -2.681  -18.040 3.319   1.00 0.00 ? 84  HIS A HB2  6  
ATOM 10098 H HB3  . HIS A 1 84  ? -1.115  -17.453 3.868   1.00 0.00 ? 84  HIS A HB3  6  
ATOM 10099 H HD2  . HIS A 1 84  ? 0.717   -19.412 4.524   1.00 0.00 ? 84  HIS A HD2  6  
ATOM 10100 H HE1  . HIS A 1 84  ? -1.840  -22.724 3.822   1.00 0.00 ? 84  HIS A HE1  6  
ATOM 10101 H HE2  . HIS A 1 84  ? 0.497   -21.986 4.405   1.00 0.00 ? 84  HIS A HE2  6  
ATOM 10102 N N    . SER A 1 85  ? -1.687  -15.695 6.505   1.00 0.00 ? 85  SER A N    6  
ATOM 10103 C CA   . SER A 1 85  ? -1.539  -14.264 6.743   1.00 0.00 ? 85  SER A CA   6  
ATOM 10104 C C    . SER A 1 85  ? -0.726  -13.610 5.630   1.00 0.00 ? 85  SER A C    6  
ATOM 10105 O O    . SER A 1 85  ? 0.157   -14.235 5.042   1.00 0.00 ? 85  SER A O    6  
ATOM 10106 C CB   . SER A 1 85  ? -0.867  -14.017 8.094   1.00 0.00 ? 85  SER A CB   6  
ATOM 10107 O OG   . SER A 1 85  ? -1.659  -14.516 9.157   1.00 0.00 ? 85  SER A OG   6  
ATOM 10108 H H    . SER A 1 85  ? -1.176  -16.327 7.053   1.00 0.00 ? 85  SER A H    6  
ATOM 10109 H HA   . SER A 1 85  ? -2.526  -13.827 6.756   1.00 0.00 ? 85  SER A HA   6  
ATOM 10110 H HB2  . SER A 1 85  ? 0.092   -14.513 8.112   1.00 0.00 ? 85  SER A HB2  6  
ATOM 10111 H HB3  . SER A 1 85  ? -0.726  -12.955 8.234   1.00 0.00 ? 85  SER A HB3  6  
ATOM 10112 H HG   . SER A 1 85  ? -1.575  -15.471 9.199   1.00 0.00 ? 85  SER A HG   6  
ATOM 10113 N N    . TYR A 1 86  ? -1.031  -12.349 5.346   1.00 0.00 ? 86  TYR A N    6  
ATOM 10114 C CA   . TYR A 1 86  ? -0.331  -11.610 4.302   1.00 0.00 ? 86  TYR A CA   6  
ATOM 10115 C C    . TYR A 1 86  ? -0.073  -10.169 4.735   1.00 0.00 ? 86  TYR A C    6  
ATOM 10116 O O    . TYR A 1 86  ? -0.978  -9.476  5.199   1.00 0.00 ? 86  TYR A O    6  
ATOM 10117 C CB   . TYR A 1 86  ? -1.141  -11.627 3.005   1.00 0.00 ? 86  TYR A CB   6  
ATOM 10118 C CG   . TYR A 1 86  ? -0.957  -12.889 2.192   1.00 0.00 ? 86  TYR A CG   6  
ATOM 10119 C CD1  . TYR A 1 86  ? 0.108   -13.020 1.309   1.00 0.00 ? 86  TYR A CD1  6  
ATOM 10120 C CD2  . TYR A 1 86  ? -1.846  -13.949 2.309   1.00 0.00 ? 86  TYR A CD2  6  
ATOM 10121 C CE1  . TYR A 1 86  ? 0.280   -14.171 0.565   1.00 0.00 ? 86  TYR A CE1  6  
ATOM 10122 C CE2  . TYR A 1 86  ? -1.681  -15.105 1.569   1.00 0.00 ? 86  TYR A CE2  6  
ATOM 10123 C CZ   . TYR A 1 86  ? -0.617  -15.210 0.698   1.00 0.00 ? 86  TYR A CZ   6  
ATOM 10124 O OH   . TYR A 1 86  ? -0.449  -16.359 -0.041  1.00 0.00 ? 86  TYR A OH   6  
ATOM 10125 H H    . TYR A 1 86  ? -1.745  -11.905 5.849   1.00 0.00 ? 86  TYR A H    6  
ATOM 10126 H HA   . TYR A 1 86  ? 0.617   -12.097 4.129   1.00 0.00 ? 86  TYR A HA   6  
ATOM 10127 H HB2  . TYR A 1 86  ? -2.190  -11.537 3.242   1.00 0.00 ? 86  TYR A HB2  6  
ATOM 10128 H HB3  . TYR A 1 86  ? -0.843  -10.790 2.391   1.00 0.00 ? 86  TYR A HB3  6  
ATOM 10129 H HD1  . TYR A 1 86  ? 0.809   -12.204 1.207   1.00 0.00 ? 86  TYR A HD1  6  
ATOM 10130 H HD2  . TYR A 1 86  ? -2.679  -13.864 2.992   1.00 0.00 ? 86  TYR A HD2  6  
ATOM 10131 H HE1  . TYR A 1 86  ? 1.113   -14.254 -0.117  1.00 0.00 ? 86  TYR A HE1  6  
ATOM 10132 H HE2  . TYR A 1 86  ? -2.384  -15.919 1.673   1.00 0.00 ? 86  TYR A HE2  6  
ATOM 10133 H HH   . TYR A 1 86  ? 0.200   -16.922 0.387   1.00 0.00 ? 86  TYR A HH   6  
ATOM 10134 N N    . VAL A 1 87  ? 1.170   -9.725  4.578   1.00 0.00 ? 87  VAL A N    6  
ATOM 10135 C CA   . VAL A 1 87  ? 1.549   -8.367  4.949   1.00 0.00 ? 87  VAL A CA   6  
ATOM 10136 C C    . VAL A 1 87  ? 1.437   -7.420  3.760   1.00 0.00 ? 87  VAL A C    6  
ATOM 10137 O O    . VAL A 1 87  ? 2.298   -7.407  2.880   1.00 0.00 ? 87  VAL A O    6  
ATOM 10138 C CB   . VAL A 1 87  ? 2.987   -8.317  5.498   1.00 0.00 ? 87  VAL A CB   6  
ATOM 10139 C CG1  . VAL A 1 87  ? 3.924   -9.132  4.620   1.00 0.00 ? 87  VAL A CG1  6  
ATOM 10140 C CG2  . VAL A 1 87  ? 3.465   -6.877  5.608   1.00 0.00 ? 87  VAL A CG2  6  
ATOM 10141 H H    . VAL A 1 87  ? 1.848   -10.325 4.202   1.00 0.00 ? 87  VAL A H    6  
ATOM 10142 H HA   . VAL A 1 87  ? 0.878   -8.034  5.727   1.00 0.00 ? 87  VAL A HA   6  
ATOM 10143 H HB   . VAL A 1 87  ? 2.989   -8.750  6.487   1.00 0.00 ? 87  VAL A HB   6  
ATOM 10144 H HG11 . VAL A 1 87  ? 3.674   -10.180 4.703   1.00 0.00 ? 87  VAL A HG11 6  
ATOM 10145 H HG12 . VAL A 1 87  ? 3.819   -8.817  3.592   1.00 0.00 ? 87  VAL A HG12 6  
ATOM 10146 H HG13 . VAL A 1 87  ? 4.943   -8.980  4.942   1.00 0.00 ? 87  VAL A HG13 6  
ATOM 10147 H HG21 . VAL A 1 87  ? 2.656   -6.208  5.355   1.00 0.00 ? 87  VAL A HG21 6  
ATOM 10148 H HG22 . VAL A 1 87  ? 3.792   -6.682  6.618   1.00 0.00 ? 87  VAL A HG22 6  
ATOM 10149 H HG23 . VAL A 1 87  ? 4.289   -6.717  4.926   1.00 0.00 ? 87  VAL A HG23 6  
ATOM 10150 N N    . PHE A 1 88  ? 0.371   -6.628  3.740   1.00 0.00 ? 88  PHE A N    6  
ATOM 10151 C CA   . PHE A 1 88  ? 0.145   -5.677  2.658   1.00 0.00 ? 88  PHE A CA   6  
ATOM 10152 C C    . PHE A 1 88  ? 0.859   -4.357  2.936   1.00 0.00 ? 88  PHE A C    6  
ATOM 10153 O O    . PHE A 1 88  ? 0.669   -3.746  3.987   1.00 0.00 ? 88  PHE A O    6  
ATOM 10154 C CB   . PHE A 1 88  ? -1.353  -5.430  2.471   1.00 0.00 ? 88  PHE A CB   6  
ATOM 10155 C CG   . PHE A 1 88  ? -2.062  -6.549  1.763   1.00 0.00 ? 88  PHE A CG   6  
ATOM 10156 C CD1  . PHE A 1 88  ? -2.296  -7.754  2.405   1.00 0.00 ? 88  PHE A CD1  6  
ATOM 10157 C CD2  . PHE A 1 88  ? -2.493  -6.395  0.455   1.00 0.00 ? 88  PHE A CD2  6  
ATOM 10158 C CE1  . PHE A 1 88  ? -2.947  -8.785  1.755   1.00 0.00 ? 88  PHE A CE1  6  
ATOM 10159 C CE2  . PHE A 1 88  ? -3.145  -7.423  -0.200  1.00 0.00 ? 88  PHE A CE2  6  
ATOM 10160 C CZ   . PHE A 1 88  ? -3.373  -8.619  0.451   1.00 0.00 ? 88  PHE A CZ   6  
ATOM 10161 H H    . PHE A 1 88  ? -0.281  -6.684  4.470   1.00 0.00 ? 88  PHE A H    6  
ATOM 10162 H HA   . PHE A 1 88  ? 0.546   -6.105  1.752   1.00 0.00 ? 88  PHE A HA   6  
ATOM 10163 H HB2  . PHE A 1 88  ? -1.814  -5.307  3.440   1.00 0.00 ? 88  PHE A HB2  6  
ATOM 10164 H HB3  . PHE A 1 88  ? -1.493  -4.528  1.894   1.00 0.00 ? 88  PHE A HB3  6  
ATOM 10165 H HD1  . PHE A 1 88  ? -1.965  -7.885  3.424   1.00 0.00 ? 88  PHE A HD1  6  
ATOM 10166 H HD2  . PHE A 1 88  ? -2.315  -5.459  -0.055  1.00 0.00 ? 88  PHE A HD2  6  
ATOM 10167 H HE1  . PHE A 1 88  ? -3.125  -9.720  2.266   1.00 0.00 ? 88  PHE A HE1  6  
ATOM 10168 H HE2  . PHE A 1 88  ? -3.477  -7.290  -1.219  1.00 0.00 ? 88  PHE A HE2  6  
ATOM 10169 H HZ   . PHE A 1 88  ? -3.882  -9.424  -0.059  1.00 0.00 ? 88  PHE A HZ   6  
ATOM 10170 N N    . ARG A 1 89  ? 1.682   -3.924  1.986   1.00 0.00 ? 89  ARG A N    6  
ATOM 10171 C CA   . ARG A 1 89  ? 2.426   -2.679  2.128   1.00 0.00 ? 89  ARG A CA   6  
ATOM 10172 C C    . ARG A 1 89  ? 2.084   -1.709  1.001   1.00 0.00 ? 89  ARG A C    6  
ATOM 10173 O O    . ARG A 1 89  ? 2.609   -1.819  -0.107  1.00 0.00 ? 89  ARG A O    6  
ATOM 10174 C CB   . ARG A 1 89  ? 3.930   -2.957  2.138   1.00 0.00 ? 89  ARG A CB   6  
ATOM 10175 C CG   . ARG A 1 89  ? 4.380   -3.834  3.295   1.00 0.00 ? 89  ARG A CG   6  
ATOM 10176 C CD   . ARG A 1 89  ? 5.896   -3.883  3.400   1.00 0.00 ? 89  ARG A CD   6  
ATOM 10177 N NE   . ARG A 1 89  ? 6.351   -4.984  4.244   1.00 0.00 ? 89  ARG A NE   6  
ATOM 10178 C CZ   . ARG A 1 89  ? 7.571   -5.506  4.177   1.00 0.00 ? 89  ARG A CZ   6  
ATOM 10179 N NH1  . ARG A 1 89  ? 8.453   -5.028  3.311   1.00 0.00 ? 89  ARG A NH1  6  
ATOM 10180 N NH2  . ARG A 1 89  ? 7.910   -6.507  4.979   1.00 0.00 ? 89  ARG A NH2  6  
ATOM 10181 H H    . ARG A 1 89  ? 1.792   -4.456  1.170   1.00 0.00 ? 89  ARG A H    6  
ATOM 10182 H HA   . ARG A 1 89  ? 2.145   -2.231  3.070   1.00 0.00 ? 89  ARG A HA   6  
ATOM 10183 H HB2  . ARG A 1 89  ? 4.199   -3.450  1.216   1.00 0.00 ? 89  ARG A HB2  6  
ATOM 10184 H HB3  . ARG A 1 89  ? 4.457   -2.017  2.202   1.00 0.00 ? 89  ARG A HB3  6  
ATOM 10185 H HG2  . ARG A 1 89  ? 3.979   -3.435  4.215   1.00 0.00 ? 89  ARG A HG2  6  
ATOM 10186 H HG3  . ARG A 1 89  ? 4.006   -4.835  3.141   1.00 0.00 ? 89  ARG A HG3  6  
ATOM 10187 H HD2  . ARG A 1 89  ? 6.309   -4.006  2.410   1.00 0.00 ? 89  ARG A HD2  6  
ATOM 10188 H HD3  . ARG A 1 89  ? 6.244   -2.951  3.821   1.00 0.00 ? 89  ARG A HD3  6  
ATOM 10189 H HE   . ARG A 1 89  ? 5.715   -5.352  4.892   1.00 0.00 ? 89  ARG A HE   6  
ATOM 10190 H HH11 . ARG A 1 89  ? 8.201   -4.273  2.706   1.00 0.00 ? 89  ARG A HH11 6  
ATOM 10191 H HH12 . ARG A 1 89  ? 9.371   -5.422  3.263   1.00 0.00 ? 89  ARG A HH12 6  
ATOM 10192 H HH21 . ARG A 1 89  ? 7.248   -6.870  5.634   1.00 0.00 ? 89  ARG A HH21 6  
ATOM 10193 H HH22 . ARG A 1 89  ? 8.828   -6.899  4.928   1.00 0.00 ? 89  ARG A HH22 6  
ATOM 10194 N N    . VAL A 1 90  ? 1.200   -0.760  1.291   1.00 0.00 ? 90  VAL A N    6  
ATOM 10195 C CA   . VAL A 1 90  ? 0.788   0.230   0.302   1.00 0.00 ? 90  VAL A CA   6  
ATOM 10196 C C    . VAL A 1 90  ? 1.664   1.475   0.374   1.00 0.00 ? 90  VAL A C    6  
ATOM 10197 O O    . VAL A 1 90  ? 2.045   1.917   1.458   1.00 0.00 ? 90  VAL A O    6  
ATOM 10198 C CB   . VAL A 1 90  ? -0.684  0.638   0.497   1.00 0.00 ? 90  VAL A CB   6  
ATOM 10199 C CG1  . VAL A 1 90  ? -1.062  1.750   -0.470  1.00 0.00 ? 90  VAL A CG1  6  
ATOM 10200 C CG2  . VAL A 1 90  ? -1.598  -0.565  0.323   1.00 0.00 ? 90  VAL A CG2  6  
ATOM 10201 H H    . VAL A 1 90  ? 0.816   -0.724  2.192   1.00 0.00 ? 90  VAL A H    6  
ATOM 10202 H HA   . VAL A 1 90  ? 0.890   -0.215  -0.677  1.00 0.00 ? 90  VAL A HA   6  
ATOM 10203 H HB   . VAL A 1 90  ? -0.803  1.011   1.504   1.00 0.00 ? 90  VAL A HB   6  
ATOM 10204 H HG11 . VAL A 1 90  ? -0.294  2.509   -0.464  1.00 0.00 ? 90  VAL A HG11 6  
ATOM 10205 H HG12 . VAL A 1 90  ? -1.160  1.343   -1.466  1.00 0.00 ? 90  VAL A HG12 6  
ATOM 10206 H HG13 . VAL A 1 90  ? -2.001  2.187   -0.166  1.00 0.00 ? 90  VAL A HG13 6  
ATOM 10207 H HG21 . VAL A 1 90  ? -1.286  -1.355  0.990   1.00 0.00 ? 90  VAL A HG21 6  
ATOM 10208 H HG22 . VAL A 1 90  ? -2.614  -0.280  0.551   1.00 0.00 ? 90  VAL A HG22 6  
ATOM 10209 H HG23 . VAL A 1 90  ? -1.543  -0.915  -0.698  1.00 0.00 ? 90  VAL A HG23 6  
ATOM 10210 N N    . ARG A 1 91  ? 1.978   2.039   -0.788  1.00 0.00 ? 91  ARG A N    6  
ATOM 10211 C CA   . ARG A 1 91  ? 2.810   3.234   -0.857  1.00 0.00 ? 91  ARG A CA   6  
ATOM 10212 C C    . ARG A 1 91  ? 2.427   4.093   -2.059  1.00 0.00 ? 91  ARG A C    6  
ATOM 10213 O O    . ARG A 1 91  ? 1.756   3.628   -2.979  1.00 0.00 ? 91  ARG A O    6  
ATOM 10214 C CB   . ARG A 1 91  ? 4.288   2.849   -0.943  1.00 0.00 ? 91  ARG A CB   6  
ATOM 10215 C CG   . ARG A 1 91  ? 5.184   3.975   -1.432  1.00 0.00 ? 91  ARG A CG   6  
ATOM 10216 C CD   . ARG A 1 91  ? 6.618   3.505   -1.619  1.00 0.00 ? 91  ARG A CD   6  
ATOM 10217 N NE   . ARG A 1 91  ? 6.750   2.583   -2.744  1.00 0.00 ? 91  ARG A NE   6  
ATOM 10218 C CZ   . ARG A 1 91  ? 7.765   1.738   -2.887  1.00 0.00 ? 91  ARG A CZ   6  
ATOM 10219 N NH1  . ARG A 1 91  ? 8.731   1.698   -1.980  1.00 0.00 ? 91  ARG A NH1  6  
ATOM 10220 N NH2  . ARG A 1 91  ? 7.814   0.930   -3.938  1.00 0.00 ? 91  ARG A NH2  6  
ATOM 10221 H H    . ARG A 1 91  ? 1.644   1.640   -1.619  1.00 0.00 ? 91  ARG A H    6  
ATOM 10222 H HA   . ARG A 1 91  ? 2.647   3.804   0.045   1.00 0.00 ? 91  ARG A HA   6  
ATOM 10223 H HB2  . ARG A 1 91  ? 4.627   2.549   0.038   1.00 0.00 ? 91  ARG A HB2  6  
ATOM 10224 H HB3  . ARG A 1 91  ? 4.392   2.015   -1.620  1.00 0.00 ? 91  ARG A HB3  6  
ATOM 10225 H HG2  . ARG A 1 91  ? 4.809   4.335   -2.379  1.00 0.00 ? 91  ARG A HG2  6  
ATOM 10226 H HG3  . ARG A 1 91  ? 5.168   4.776   -0.708  1.00 0.00 ? 91  ARG A HG3  6  
ATOM 10227 H HD2  . ARG A 1 91  ? 7.245   4.366   -1.796  1.00 0.00 ? 91  ARG A HD2  6  
ATOM 10228 H HD3  . ARG A 1 91  ? 6.939   3.006   -0.717  1.00 0.00 ? 91  ARG A HD3  6  
ATOM 10229 H HE   . ARG A 1 91  ? 6.047   2.596   -3.426  1.00 0.00 ? 91  ARG A HE   6  
ATOM 10230 H HH11 . ARG A 1 91  ? 8.696   2.305   -1.186  1.00 0.00 ? 91  ARG A HH11 6  
ATOM 10231 H HH12 . ARG A 1 91  ? 9.494   1.060   -2.089  1.00 0.00 ? 91  ARG A HH12 6  
ATOM 10232 H HH21 . ARG A 1 91  ? 7.088   0.958   -4.624  1.00 0.00 ? 91  ARG A HH21 6  
ATOM 10233 H HH22 . ARG A 1 91  ? 8.579   0.295   -4.045  1.00 0.00 ? 91  ARG A HH22 6  
ATOM 10234 N N    . ALA A 1 92  ? 2.859   5.350   -2.042  1.00 0.00 ? 92  ALA A N    6  
ATOM 10235 C CA   . ALA A 1 92  ? 2.563   6.274   -3.130  1.00 0.00 ? 92  ALA A CA   6  
ATOM 10236 C C    . ALA A 1 92  ? 3.843   6.753   -3.807  1.00 0.00 ? 92  ALA A C    6  
ATOM 10237 O O    . ALA A 1 92  ? 4.941   6.559   -3.286  1.00 0.00 ? 92  ALA A O    6  
ATOM 10238 C CB   . ALA A 1 92  ? 1.763   7.460   -2.612  1.00 0.00 ? 92  ALA A CB   6  
ATOM 10239 H H    . ALA A 1 92  ? 3.390   5.663   -1.280  1.00 0.00 ? 92  ALA A H    6  
ATOM 10240 H HA   . ALA A 1 92  ? 1.957   5.752   -3.856  1.00 0.00 ? 92  ALA A HA   6  
ATOM 10241 H HB1  . ALA A 1 92  ? 0.858   7.564   -3.191  1.00 0.00 ? 92  ALA A HB1  6  
ATOM 10242 H HB2  . ALA A 1 92  ? 1.510   7.297   -1.574  1.00 0.00 ? 92  ALA A HB2  6  
ATOM 10243 H HB3  . ALA A 1 92  ? 2.353   8.360   -2.702  1.00 0.00 ? 92  ALA A HB3  6  
ATOM 10244 N N    . GLN A 1 93  ? 3.693   7.377   -4.971  1.00 0.00 ? 93  GLN A N    6  
ATOM 10245 C CA   . GLN A 1 93  ? 4.838   7.881   -5.719  1.00 0.00 ? 93  GLN A CA   6  
ATOM 10246 C C    . GLN A 1 93  ? 4.545   9.262   -6.298  1.00 0.00 ? 93  GLN A C    6  
ATOM 10247 O O    . GLN A 1 93  ? 3.420   9.548   -6.706  1.00 0.00 ? 93  GLN A O    6  
ATOM 10248 C CB   . GLN A 1 93  ? 5.206   6.912   -6.844  1.00 0.00 ? 93  GLN A CB   6  
ATOM 10249 C CG   . GLN A 1 93  ? 6.229   7.471   -7.819  1.00 0.00 ? 93  GLN A CG   6  
ATOM 10250 C CD   . GLN A 1 93  ? 6.187   6.781   -9.169  1.00 0.00 ? 93  GLN A CD   6  
ATOM 10251 O OE1  . GLN A 1 93  ? 5.377   7.125   -10.030 1.00 0.00 ? 93  GLN A OE1  6  
ATOM 10252 N NE2  . GLN A 1 93  ? 7.063   5.802   -9.360  1.00 0.00 ? 93  GLN A NE2  6  
ATOM 10253 H H    . GLN A 1 93  ? 2.792   7.501   -5.334  1.00 0.00 ? 93  GLN A H    6  
ATOM 10254 H HA   . GLN A 1 93  ? 5.671   7.960   -5.038  1.00 0.00 ? 93  GLN A HA   6  
ATOM 10255 H HB2  . GLN A 1 93  ? 5.611   6.011   -6.408  1.00 0.00 ? 93  GLN A HB2  6  
ATOM 10256 H HB3  . GLN A 1 93  ? 4.312   6.664   -7.397  1.00 0.00 ? 93  GLN A HB3  6  
ATOM 10257 H HG2  . GLN A 1 93  ? 6.031   8.523   -7.965  1.00 0.00 ? 93  GLN A HG2  6  
ATOM 10258 H HG3  . GLN A 1 93  ? 7.215   7.347   -7.397  1.00 0.00 ? 93  GLN A HG3  6  
ATOM 10259 H HE21 . GLN A 1 93  ? 7.678   5.581   -8.628  1.00 0.00 ? 93  GLN A HE21 6  
ATOM 10260 H HE22 . GLN A 1 93  ? 7.058   5.338   -10.222 1.00 0.00 ? 93  GLN A HE22 6  
ATOM 10261 N N    . SER A 1 94  ? 5.565   10.114  -6.329  1.00 0.00 ? 94  SER A N    6  
ATOM 10262 C CA   . SER A 1 94  ? 5.416   11.466  -6.854  1.00 0.00 ? 94  SER A CA   6  
ATOM 10263 C C    . SER A 1 94  ? 6.576   11.821  -7.779  1.00 0.00 ? 94  SER A C    6  
ATOM 10264 O O    . SER A 1 94  ? 7.469   11.007  -8.011  1.00 0.00 ? 94  SER A O    6  
ATOM 10265 C CB   . SER A 1 94  ? 5.336   12.475  -5.706  1.00 0.00 ? 94  SER A CB   6  
ATOM 10266 O OG   . SER A 1 94  ? 6.615   12.707  -5.142  1.00 0.00 ? 94  SER A OG   6  
ATOM 10267 H H    . SER A 1 94  ? 6.438   9.826   -5.988  1.00 0.00 ? 94  SER A H    6  
ATOM 10268 H HA   . SER A 1 94  ? 4.496   11.503  -7.418  1.00 0.00 ? 94  SER A HA   6  
ATOM 10269 H HB2  . SER A 1 94  ? 4.946   13.410  -6.079  1.00 0.00 ? 94  SER A HB2  6  
ATOM 10270 H HB3  . SER A 1 94  ? 4.681   12.091  -4.938  1.00 0.00 ? 94  SER A HB3  6  
ATOM 10271 H HG   . SER A 1 94  ? 7.176   11.942  -5.293  1.00 0.00 ? 94  SER A HG   6  
ATOM 10272 N N    . GLN A 1 95  ? 6.554   13.042  -8.304  1.00 0.00 ? 95  GLN A N    6  
ATOM 10273 C CA   . GLN A 1 95  ? 7.603   13.505  -9.204  1.00 0.00 ? 95  GLN A CA   6  
ATOM 10274 C C    . GLN A 1 95  ? 8.982   13.272  -8.598  1.00 0.00 ? 95  GLN A C    6  
ATOM 10275 O O    . GLN A 1 95  ? 9.909   12.846  -9.286  1.00 0.00 ? 95  GLN A O    6  
ATOM 10276 C CB   . GLN A 1 95  ? 7.415   14.990  -9.519  1.00 0.00 ? 95  GLN A CB   6  
ATOM 10277 C CG   . GLN A 1 95  ? 8.351   15.506  -10.600 1.00 0.00 ? 95  GLN A CG   6  
ATOM 10278 C CD   . GLN A 1 95  ? 8.055   14.910  -11.962 1.00 0.00 ? 95  GLN A CD   6  
ATOM 10279 O OE1  . GLN A 1 95  ? 8.809   14.077  -12.465 1.00 0.00 ? 95  GLN A OE1  6  
ATOM 10280 N NE2  . GLN A 1 95  ? 6.952   15.335  -12.567 1.00 0.00 ? 95  GLN A NE2  6  
ATOM 10281 H H    . GLN A 1 95  ? 5.815   13.645  -8.081  1.00 0.00 ? 95  GLN A H    6  
ATOM 10282 H HA   . GLN A 1 95  ? 7.526   12.940  -10.121 1.00 0.00 ? 95  GLN A HA   6  
ATOM 10283 H HB2  . GLN A 1 95  ? 6.399   15.151  -9.846  1.00 0.00 ? 95  GLN A HB2  6  
ATOM 10284 H HB3  . GLN A 1 95  ? 7.590   15.561  -8.619  1.00 0.00 ? 95  GLN A HB3  6  
ATOM 10285 H HG2  . GLN A 1 95  ? 8.250   16.579  -10.664 1.00 0.00 ? 95  GLN A HG2  6  
ATOM 10286 H HG3  . GLN A 1 95  ? 9.366   15.257  -10.327 1.00 0.00 ? 95  GLN A HG3  6  
ATOM 10287 H HE21 . GLN A 1 95  ? 6.399   16.001  -12.106 1.00 0.00 ? 95  GLN A HE21 6  
ATOM 10288 H HE22 . GLN A 1 95  ? 6.736   14.967  -13.448 1.00 0.00 ? 95  GLN A HE22 6  
ATOM 10289 N N    . GLU A 1 96  ? 9.111   13.555  -7.305  1.00 0.00 ? 96  GLU A N    6  
ATOM 10290 C CA   . GLU A 1 96  ? 10.379  13.376  -6.607  1.00 0.00 ? 96  GLU A CA   6  
ATOM 10291 C C    . GLU A 1 96  ? 10.786  11.906  -6.585  1.00 0.00 ? 96  GLU A C    6  
ATOM 10292 O O    . GLU A 1 96  ? 11.766  11.513  -7.216  1.00 0.00 ? 96  GLU A O    6  
ATOM 10293 C CB   . GLU A 1 96  ? 10.278  13.910  -5.177  1.00 0.00 ? 96  GLU A CB   6  
ATOM 10294 C CG   . GLU A 1 96  ? 10.611  15.388  -5.054  1.00 0.00 ? 96  GLU A CG   6  
ATOM 10295 C CD   . GLU A 1 96  ? 12.102  15.644  -4.952  1.00 0.00 ? 96  GLU A CD   6  
ATOM 10296 O OE1  . GLU A 1 96  ? 12.654  15.506  -3.841  1.00 0.00 ? 96  GLU A OE1  6  
ATOM 10297 O OE2  . GLU A 1 96  ? 12.717  15.983  -5.986  1.00 0.00 ? 96  GLU A OE2  6  
ATOM 10298 H H    . GLU A 1 96  ? 8.335   13.891  -6.810  1.00 0.00 ? 96  GLU A H    6  
ATOM 10299 H HA   . GLU A 1 96  ? 11.132  13.938  -7.139  1.00 0.00 ? 96  GLU A HA   6  
ATOM 10300 H HB2  . GLU A 1 96  ? 9.271   13.758  -4.818  1.00 0.00 ? 96  GLU A HB2  6  
ATOM 10301 H HB3  . GLU A 1 96  ? 10.962  13.356  -4.550  1.00 0.00 ? 96  GLU A HB3  6  
ATOM 10302 H HG2  . GLU A 1 96  ? 10.231  15.903  -5.924  1.00 0.00 ? 96  GLU A HG2  6  
ATOM 10303 H HG3  . GLU A 1 96  ? 10.132  15.779  -4.168  1.00 0.00 ? 96  GLU A HG3  6  
ATOM 10304 N N    . GLY A 1 97  ? 10.025  11.098  -5.853  1.00 0.00 ? 97  GLY A N    6  
ATOM 10305 C CA   . GLY A 1 97  ? 10.322  9.680   -5.762  1.00 0.00 ? 97  GLY A CA   6  
ATOM 10306 C C    . GLY A 1 97  ? 9.398   8.955   -4.803  1.00 0.00 ? 97  GLY A C    6  
ATOM 10307 O O    . GLY A 1 97  ? 8.449   9.541   -4.283  1.00 0.00 ? 97  GLY A O    6  
ATOM 10308 H H    . GLY A 1 97  ? 9.255   11.467  -5.372  1.00 0.00 ? 97  GLY A H    6  
ATOM 10309 H HA2  . GLY A 1 97  ? 10.225  9.239   -6.742  1.00 0.00 ? 97  GLY A HA2  6  
ATOM 10310 H HA3  . GLY A 1 97  ? 11.340  9.559   -5.422  1.00 0.00 ? 97  GLY A HA3  6  
ATOM 10311 N N    . TRP A 1 98  ? 9.675   7.677   -4.571  1.00 0.00 ? 98  TRP A N    6  
ATOM 10312 C CA   . TRP A 1 98  ? 8.859   6.870   -3.670  1.00 0.00 ? 98  TRP A CA   6  
ATOM 10313 C C    . TRP A 1 98  ? 9.086   7.279   -2.219  1.00 0.00 ? 98  TRP A C    6  
ATOM 10314 O O    . TRP A 1 98  ? 10.210  7.241   -1.722  1.00 0.00 ? 98  TRP A O    6  
ATOM 10315 C CB   . TRP A 1 98  ? 9.179   5.386   -3.851  1.00 0.00 ? 98  TRP A CB   6  
ATOM 10316 C CG   . TRP A 1 98  ? 8.733   4.839   -5.173  1.00 0.00 ? 98  TRP A CG   6  
ATOM 10317 C CD1  . TRP A 1 98  ? 9.505   4.643   -6.283  1.00 0.00 ? 98  TRP A CD1  6  
ATOM 10318 C CD2  . TRP A 1 98  ? 7.409   4.419   -5.524  1.00 0.00 ? 98  TRP A CD2  6  
ATOM 10319 N NE1  . TRP A 1 98  ? 8.741   4.127   -7.302  1.00 0.00 ? 98  TRP A NE1  6  
ATOM 10320 C CE2  . TRP A 1 98  ? 7.453   3.979   -6.861  1.00 0.00 ? 98  TRP A CE2  6  
ATOM 10321 C CE3  . TRP A 1 98  ? 6.193   4.369   -4.838  1.00 0.00 ? 98  TRP A CE3  6  
ATOM 10322 C CZ2  . TRP A 1 98  ? 6.326   3.499   -7.524  1.00 0.00 ? 98  TRP A CZ2  6  
ATOM 10323 C CZ3  . TRP A 1 98  ? 5.076   3.892   -5.496  1.00 0.00 ? 98  TRP A CZ3  6  
ATOM 10324 C CH2  . TRP A 1 98  ? 5.148   3.462   -6.828  1.00 0.00 ? 98  TRP A CH2  6  
ATOM 10325 H H    . TRP A 1 98  ? 10.445  7.266   -5.016  1.00 0.00 ? 98  TRP A H    6  
ATOM 10326 H HA   . TRP A 1 98  ? 7.823   7.039   -3.922  1.00 0.00 ? 98  TRP A HA   6  
ATOM 10327 H HB2  . TRP A 1 98  ? 10.247  5.242   -3.775  1.00 0.00 ? 98  TRP A HB2  6  
ATOM 10328 H HB3  . TRP A 1 98  ? 8.687   4.821   -3.073  1.00 0.00 ? 98  TRP A HB3  6  
ATOM 10329 H HD1  . TRP A 1 98  ? 10.559  4.868   -6.337  1.00 0.00 ? 98  TRP A HD1  6  
ATOM 10330 H HE1  . TRP A 1 98  ? 9.068   3.900   -8.198  1.00 0.00 ? 98  TRP A HE1  6  
ATOM 10331 H HE3  . TRP A 1 98  ? 6.117   4.697   -3.811  1.00 0.00 ? 98  TRP A HE3  6  
ATOM 10332 H HZ2  . TRP A 1 98  ? 6.366   3.163   -8.549  1.00 0.00 ? 98  TRP A HZ2  6  
ATOM 10333 H HZ3  . TRP A 1 98  ? 4.127   3.847   -4.982  1.00 0.00 ? 98  TRP A HZ3  6  
ATOM 10334 H HH2  . TRP A 1 98  ? 4.250   3.097   -7.302  1.00 0.00 ? 98  TRP A HH2  6  
ATOM 10335 N N    . GLY A 1 99  ? 8.009   7.669   -1.543  1.00 0.00 ? 99  GLY A N    6  
ATOM 10336 C CA   . GLY A 1 99  ? 8.113   8.078   -0.155  1.00 0.00 ? 99  GLY A CA   6  
ATOM 10337 C C    . GLY A 1 99  ? 7.986   6.912   0.805   1.00 0.00 ? 99  GLY A C    6  
ATOM 10338 O O    . GLY A 1 99  ? 8.572   5.852   0.585   1.00 0.00 ? 99  GLY A O    6  
ATOM 10339 H H    . GLY A 1 99  ? 7.137   7.679   -1.991  1.00 0.00 ? 99  GLY A H    6  
ATOM 10340 H HA2  . GLY A 1 99  ? 9.069   8.555   -0.002  1.00 0.00 ? 99  GLY A HA2  6  
ATOM 10341 H HA3  . GLY A 1 99  ? 7.329   8.791   0.058   1.00 0.00 ? 99  GLY A HA3  6  
ATOM 10342 N N    . ARG A 1 100 ? 7.219   7.107   1.873   1.00 0.00 ? 100 ARG A N    6  
ATOM 10343 C CA   . ARG A 1 100 ? 7.020   6.063   2.871   1.00 0.00 ? 100 ARG A CA   6  
ATOM 10344 C C    . ARG A 1 100 ? 5.871   5.142   2.472   1.00 0.00 ? 100 ARG A C    6  
ATOM 10345 O O    . ARG A 1 100 ? 5.222   5.351   1.448   1.00 0.00 ? 100 ARG A O    6  
ATOM 10346 C CB   . ARG A 1 100 ? 6.738   6.684   4.240   1.00 0.00 ? 100 ARG A CB   6  
ATOM 10347 C CG   . ARG A 1 100 ? 7.972   7.267   4.910   1.00 0.00 ? 100 ARG A CG   6  
ATOM 10348 C CD   . ARG A 1 100 ? 8.680   6.232   5.770   1.00 0.00 ? 100 ARG A CD   6  
ATOM 10349 N NE   . ARG A 1 100 ? 9.438   6.848   6.856   1.00 0.00 ? 100 ARG A NE   6  
ATOM 10350 C CZ   . ARG A 1 100 ? 9.754   6.218   7.982   1.00 0.00 ? 100 ARG A CZ   6  
ATOM 10351 N NH1  . ARG A 1 100 ? 9.380   4.960   8.168   1.00 0.00 ? 100 ARG A NH1  6  
ATOM 10352 N NH2  . ARG A 1 100 ? 10.446  6.846   8.923   1.00 0.00 ? 100 ARG A NH2  6  
ATOM 10353 H H    . ARG A 1 100 ? 6.778   7.973   1.993   1.00 0.00 ? 100 ARG A H    6  
ATOM 10354 H HA   . ARG A 1 100 ? 7.928   5.482   2.929   1.00 0.00 ? 100 ARG A HA   6  
ATOM 10355 H HB2  . ARG A 1 100 ? 6.013   7.476   4.121   1.00 0.00 ? 100 ARG A HB2  6  
ATOM 10356 H HB3  . ARG A 1 100 ? 6.328   5.925   4.889   1.00 0.00 ? 100 ARG A HB3  6  
ATOM 10357 H HG2  . ARG A 1 100 ? 8.654   7.613   4.148   1.00 0.00 ? 100 ARG A HG2  6  
ATOM 10358 H HG3  . ARG A 1 100 ? 7.673   8.097   5.533   1.00 0.00 ? 100 ARG A HG3  6  
ATOM 10359 H HD2  . ARG A 1 100 ? 7.941   5.567   6.192   1.00 0.00 ? 100 ARG A HD2  6  
ATOM 10360 H HD3  . ARG A 1 100 ? 9.357   5.668   5.146   1.00 0.00 ? 100 ARG A HD3  6  
ATOM 10361 H HE   . ARG A 1 100 ? 9.724   7.778   6.739   1.00 0.00 ? 100 ARG A HE   6  
ATOM 10362 H HH11 . ARG A 1 100 ? 8.859   4.483   7.460   1.00 0.00 ? 100 ARG A HH11 6  
ATOM 10363 H HH12 . ARG A 1 100 ? 9.620   4.487   9.016   1.00 0.00 ? 100 ARG A HH12 6  
ATOM 10364 H HH21 . ARG A 1 100 ? 10.730  7.795   8.786   1.00 0.00 ? 100 ARG A HH21 6  
ATOM 10365 H HH22 . ARG A 1 100 ? 10.683  6.371   9.770   1.00 0.00 ? 100 ARG A HH22 6  
ATOM 10366 N N    . GLU A 1 101 ? 5.627   4.121   3.289   1.00 0.00 ? 101 GLU A N    6  
ATOM 10367 C CA   . GLU A 1 101 ? 4.557   3.168   3.020   1.00 0.00 ? 101 GLU A CA   6  
ATOM 10368 C C    . GLU A 1 101 ? 3.876   2.733   4.315   1.00 0.00 ? 101 GLU A C    6  
ATOM 10369 O O    . GLU A 1 101 ? 4.401   2.952   5.407   1.00 0.00 ? 101 GLU A O    6  
ATOM 10370 C CB   . GLU A 1 101 ? 5.107   1.944   2.285   1.00 0.00 ? 101 GLU A CB   6  
ATOM 10371 C CG   . GLU A 1 101 ? 5.737   0.913   3.206   1.00 0.00 ? 101 GLU A CG   6  
ATOM 10372 C CD   . GLU A 1 101 ? 4.713   0.189   4.058   1.00 0.00 ? 101 GLU A CD   6  
ATOM 10373 O OE1  . GLU A 1 101 ? 3.755   -0.373  3.487   1.00 0.00 ? 101 GLU A OE1  6  
ATOM 10374 O OE2  . GLU A 1 101 ? 4.870   0.184   5.297   1.00 0.00 ? 101 GLU A OE2  6  
ATOM 10375 H H    . GLU A 1 101 ? 6.179   4.007   4.090   1.00 0.00 ? 101 GLU A H    6  
ATOM 10376 H HA   . GLU A 1 101 ? 3.828   3.656   2.390   1.00 0.00 ? 101 GLU A HA   6  
ATOM 10377 H HB2  . GLU A 1 101 ? 4.301   1.470   1.745   1.00 0.00 ? 101 GLU A HB2  6  
ATOM 10378 H HB3  . GLU A 1 101 ? 5.857   2.270   1.579   1.00 0.00 ? 101 GLU A HB3  6  
ATOM 10379 H HG2  . GLU A 1 101 ? 6.262   0.185   2.606   1.00 0.00 ? 101 GLU A HG2  6  
ATOM 10380 H HG3  . GLU A 1 101 ? 6.438   1.412   3.858   1.00 0.00 ? 101 GLU A HG3  6  
ATOM 10381 N N    . ARG A 1 102 ? 2.706   2.118   4.184   1.00 0.00 ? 102 ARG A N    6  
ATOM 10382 C CA   . ARG A 1 102 ? 1.952   1.655   5.343   1.00 0.00 ? 102 ARG A CA   6  
ATOM 10383 C C    . ARG A 1 102 ? 1.759   0.142   5.296   1.00 0.00 ? 102 ARG A C    6  
ATOM 10384 O O    . ARG A 1 102 ? 1.471   -0.424  4.241   1.00 0.00 ? 102 ARG A O    6  
ATOM 10385 C CB   . ARG A 1 102 ? 0.592   2.352   5.405   1.00 0.00 ? 102 ARG A CB   6  
ATOM 10386 C CG   . ARG A 1 102 ? -0.325  1.801   6.484   1.00 0.00 ? 102 ARG A CG   6  
ATOM 10387 C CD   . ARG A 1 102 ? -0.118  2.516   7.810   1.00 0.00 ? 102 ARG A CD   6  
ATOM 10388 N NE   . ARG A 1 102 ? 1.105   2.084   8.480   1.00 0.00 ? 102 ARG A NE   6  
ATOM 10389 C CZ   . ARG A 1 102 ? 1.347   2.285   9.771   1.00 0.00 ? 102 ARG A CZ   6  
ATOM 10390 N NH1  . ARG A 1 102 ? 0.453   2.908   10.527  1.00 0.00 ? 102 ARG A NH1  6  
ATOM 10391 N NH2  . ARG A 1 102 ? 2.484   1.863   10.308  1.00 0.00 ? 102 ARG A NH2  6  
ATOM 10392 H H    . ARG A 1 102 ? 2.340   1.973   3.286   1.00 0.00 ? 102 ARG A H    6  
ATOM 10393 H HA   . ARG A 1 102 ? 2.517   1.906   6.228   1.00 0.00 ? 102 ARG A HA   6  
ATOM 10394 H HB2  . ARG A 1 102 ? 0.748   3.403   5.599   1.00 0.00 ? 102 ARG A HB2  6  
ATOM 10395 H HB3  . ARG A 1 102 ? 0.099   2.239   4.452   1.00 0.00 ? 102 ARG A HB3  6  
ATOM 10396 H HG2  . ARG A 1 102 ? -1.351  1.933   6.173   1.00 0.00 ? 102 ARG A HG2  6  
ATOM 10397 H HG3  . ARG A 1 102 ? -0.119  0.749   6.616   1.00 0.00 ? 102 ARG A HG3  6  
ATOM 10398 H HD2  . ARG A 1 102 ? -0.060  3.579   7.626   1.00 0.00 ? 102 ARG A HD2  6  
ATOM 10399 H HD3  . ARG A 1 102 ? -0.962  2.308   8.452   1.00 0.00 ? 102 ARG A HD3  6  
ATOM 10400 H HE   . ARG A 1 102 ? 1.779   1.622   7.940   1.00 0.00 ? 102 ARG A HE   6  
ATOM 10401 H HH11 . ARG A 1 102 ? -0.405  3.227   10.125  1.00 0.00 ? 102 ARG A HH11 6  
ATOM 10402 H HH12 . ARG A 1 102 ? 0.637   3.058   11.498  1.00 0.00 ? 102 ARG A HH12 6  
ATOM 10403 H HH21 . ARG A 1 102 ? 3.160   1.392   9.741   1.00 0.00 ? 102 ARG A HH21 6  
ATOM 10404 H HH22 . ARG A 1 102 ? 2.665   2.015   11.279  1.00 0.00 ? 102 ARG A HH22 6  
ATOM 10405 N N    . GLU A 1 103 ? 1.919   -0.506  6.445   1.00 0.00 ? 103 GLU A N    6  
ATOM 10406 C CA   . GLU A 1 103 ? 1.763   -1.953  6.534   1.00 0.00 ? 103 GLU A CA   6  
ATOM 10407 C C    . GLU A 1 103 ? 0.334   -2.324  6.920   1.00 0.00 ? 103 GLU A C    6  
ATOM 10408 O O    . GLU A 1 103 ? -0.345  -1.576  7.623   1.00 0.00 ? 103 GLU A O    6  
ATOM 10409 C CB   . GLU A 1 103 ? 2.745   -2.533  7.554   1.00 0.00 ? 103 GLU A CB   6  
ATOM 10410 C CG   . GLU A 1 103 ? 3.032   -4.011  7.350   1.00 0.00 ? 103 GLU A CG   6  
ATOM 10411 C CD   . GLU A 1 103 ? 3.777   -4.627  8.518   1.00 0.00 ? 103 GLU A CD   6  
ATOM 10412 O OE1  . GLU A 1 103 ? 3.147   -4.846  9.574   1.00 0.00 ? 103 GLU A OE1  6  
ATOM 10413 O OE2  . GLU A 1 103 ? 4.990   -4.889  8.377   1.00 0.00 ? 103 GLU A OE2  6  
ATOM 10414 H H    . GLU A 1 103 ? 2.148   0.001   7.252   1.00 0.00 ? 103 GLU A H    6  
ATOM 10415 H HA   . GLU A 1 103 ? 1.979   -2.370  5.562   1.00 0.00 ? 103 GLU A HA   6  
ATOM 10416 H HB2  . GLU A 1 103 ? 3.678   -1.993  7.485   1.00 0.00 ? 103 GLU A HB2  6  
ATOM 10417 H HB3  . GLU A 1 103 ? 2.336   -2.401  8.544   1.00 0.00 ? 103 GLU A HB3  6  
ATOM 10418 H HG2  . GLU A 1 103 ? 2.096   -4.533  7.225   1.00 0.00 ? 103 GLU A HG2  6  
ATOM 10419 H HG3  . GLU A 1 103 ? 3.630   -4.129  6.458   1.00 0.00 ? 103 GLU A HG3  6  
ATOM 10420 N N    . GLY A 1 104 ? -0.117  -3.485  6.455   1.00 0.00 ? 104 GLY A N    6  
ATOM 10421 C CA   . GLY A 1 104 ? -1.462  -3.935  6.761   1.00 0.00 ? 104 GLY A CA   6  
ATOM 10422 C C    . GLY A 1 104 ? -1.618  -5.436  6.621   1.00 0.00 ? 104 GLY A C    6  
ATOM 10423 O O    . GLY A 1 104 ? -1.983  -5.933  5.556   1.00 0.00 ? 104 GLY A O    6  
ATOM 10424 H H    . GLY A 1 104 ? 0.469   -4.041  5.899   1.00 0.00 ? 104 GLY A H    6  
ATOM 10425 H HA2  . GLY A 1 104 ? -1.703  -3.651  7.775   1.00 0.00 ? 104 GLY A HA2  6  
ATOM 10426 H HA3  . GLY A 1 104 ? -2.154  -3.449  6.088   1.00 0.00 ? 104 GLY A HA3  6  
ATOM 10427 N N    . VAL A 1 105 ? -1.338  -6.161  7.700   1.00 0.00 ? 105 VAL A N    6  
ATOM 10428 C CA   . VAL A 1 105 ? -1.447  -7.615  7.693   1.00 0.00 ? 105 VAL A CA   6  
ATOM 10429 C C    . VAL A 1 105 ? -2.907  -8.056  7.666   1.00 0.00 ? 105 VAL A C    6  
ATOM 10430 O O    . VAL A 1 105 ? -3.773  -7.405  8.251   1.00 0.00 ? 105 VAL A O    6  
ATOM 10431 C CB   . VAL A 1 105 ? -0.758  -8.236  8.922   1.00 0.00 ? 105 VAL A CB   6  
ATOM 10432 C CG1  . VAL A 1 105 ? -1.240  -7.566  10.200  1.00 0.00 ? 105 VAL A CG1  6  
ATOM 10433 C CG2  . VAL A 1 105 ? -1.005  -9.736  8.970   1.00 0.00 ? 105 VAL A CG2  6  
ATOM 10434 H H    . VAL A 1 105 ? -1.051  -5.708  8.519   1.00 0.00 ? 105 VAL A H    6  
ATOM 10435 H HA   . VAL A 1 105 ? -0.954  -7.983  6.805   1.00 0.00 ? 105 VAL A HA   6  
ATOM 10436 H HB   . VAL A 1 105 ? 0.306   -8.071  8.834   1.00 0.00 ? 105 VAL A HB   6  
ATOM 10437 H HG11 . VAL A 1 105 ? -0.388  -7.276  10.797  1.00 0.00 ? 105 VAL A HG11 6  
ATOM 10438 H HG12 . VAL A 1 105 ? -1.822  -6.691  9.951   1.00 0.00 ? 105 VAL A HG12 6  
ATOM 10439 H HG13 . VAL A 1 105 ? -1.852  -8.258  10.760  1.00 0.00 ? 105 VAL A HG13 6  
ATOM 10440 H HG21 . VAL A 1 105 ? -0.411  -10.224 8.212   1.00 0.00 ? 105 VAL A HG21 6  
ATOM 10441 H HG22 . VAL A 1 105 ? -0.730  -10.115 9.943   1.00 0.00 ? 105 VAL A HG22 6  
ATOM 10442 H HG23 . VAL A 1 105 ? -2.052  -9.935  8.791   1.00 0.00 ? 105 VAL A HG23 6  
ATOM 10443 N N    . ILE A 1 106 ? -3.171  -9.165  6.983   1.00 0.00 ? 106 ILE A N    6  
ATOM 10444 C CA   . ILE A 1 106 ? -4.526  -9.694  6.882   1.00 0.00 ? 106 ILE A CA   6  
ATOM 10445 C C    . ILE A 1 106 ? -4.536  -11.212 7.026   1.00 0.00 ? 106 ILE A C    6  
ATOM 10446 O O    . ILE A 1 106 ? -3.571  -11.888 6.665   1.00 0.00 ? 106 ILE A O    6  
ATOM 10447 C CB   . ILE A 1 106 ? -5.180  -9.313  5.540   1.00 0.00 ? 106 ILE A CB   6  
ATOM 10448 C CG1  . ILE A 1 106 ? -6.648  -9.741  5.524   1.00 0.00 ? 106 ILE A CG1  6  
ATOM 10449 C CG2  . ILE A 1 106 ? -4.424  -9.948  4.383   1.00 0.00 ? 106 ILE A CG2  6  
ATOM 10450 C CD1  . ILE A 1 106 ? -7.528  -8.917  6.438   1.00 0.00 ? 106 ILE A CD1  6  
ATOM 10451 H H    . ILE A 1 106 ? -2.438  -9.639  6.539   1.00 0.00 ? 106 ILE A H    6  
ATOM 10452 H HA   . ILE A 1 106 ? -5.112  -9.263  7.681   1.00 0.00 ? 106 ILE A HA   6  
ATOM 10453 H HB   . ILE A 1 106 ? -5.123  -8.241  5.430   1.00 0.00 ? 106 ILE A HB   6  
ATOM 10454 H HG12 . ILE A 1 106 ? -7.033  -9.647  4.521   1.00 0.00 ? 106 ILE A HG12 6  
ATOM 10455 H HG13 . ILE A 1 106 ? -6.718  -10.773 5.837   1.00 0.00 ? 106 ILE A HG13 6  
ATOM 10456 H HG21 . ILE A 1 106 ? -4.709  -9.467  3.459   1.00 0.00 ? 106 ILE A HG21 6  
ATOM 10457 H HG22 . ILE A 1 106 ? -3.362  -9.828  4.538   1.00 0.00 ? 106 ILE A HG22 6  
ATOM 10458 H HG23 . ILE A 1 106 ? -4.664  -11.000 4.331   1.00 0.00 ? 106 ILE A HG23 6  
ATOM 10459 H HD11 . ILE A 1 106 ? -8.223  -8.341  5.845   1.00 0.00 ? 106 ILE A HD11 6  
ATOM 10460 H HD12 . ILE A 1 106 ? -8.077  -9.573  7.097   1.00 0.00 ? 106 ILE A HD12 6  
ATOM 10461 H HD13 . ILE A 1 106 ? -6.915  -8.249  7.023   1.00 0.00 ? 106 ILE A HD13 6  
ATOM 10462 N N    . THR A 1 107 ? -5.633  -11.744 7.555   1.00 0.00 ? 107 THR A N    6  
ATOM 10463 C CA   . THR A 1 107 ? -5.770  -13.182 7.747   1.00 0.00 ? 107 THR A CA   6  
ATOM 10464 C C    . THR A 1 107 ? -7.010  -13.716 7.038   1.00 0.00 ? 107 THR A C    6  
ATOM 10465 O O    . THR A 1 107 ? -8.115  -13.210 7.237   1.00 0.00 ? 107 THR A O    6  
ATOM 10466 C CB   . THR A 1 107 ? -5.850  -13.544 9.242   1.00 0.00 ? 107 THR A CB   6  
ATOM 10467 O OG1  . THR A 1 107 ? -4.640  -13.162 9.904   1.00 0.00 ? 107 THR A OG1  6  
ATOM 10468 C CG2  . THR A 1 107 ? -6.086  -15.036 9.425   1.00 0.00 ? 107 THR A CG2  6  
ATOM 10469 H H    . THR A 1 107 ? -6.368  -11.153 7.823   1.00 0.00 ? 107 THR A H    6  
ATOM 10470 H HA   . THR A 1 107 ? -4.895  -13.659 7.329   1.00 0.00 ? 107 THR A HA   6  
ATOM 10471 H HB   . THR A 1 107 ? -6.678  -13.008 9.682   1.00 0.00 ? 107 THR A HB   6  
ATOM 10472 H HG1  . THR A 1 107 ? -3.917  -13.154 9.272   1.00 0.00 ? 107 THR A HG1  6  
ATOM 10473 H HG21 . THR A 1 107 ? -6.163  -15.261 10.478  1.00 0.00 ? 107 THR A HG21 6  
ATOM 10474 H HG22 . THR A 1 107 ? -5.259  -15.586 8.999   1.00 0.00 ? 107 THR A HG22 6  
ATOM 10475 H HG23 . THR A 1 107 ? -7.001  -15.320 8.928   1.00 0.00 ? 107 THR A HG23 6  
ATOM 10476 N N    . ILE A 1 108 ? -6.819  -14.740 6.213   1.00 0.00 ? 108 ILE A N    6  
ATOM 10477 C CA   . ILE A 1 108 ? -7.924  -15.342 5.477   1.00 0.00 ? 108 ILE A CA   6  
ATOM 10478 C C    . ILE A 1 108 ? -8.706  -16.312 6.357   1.00 0.00 ? 108 ILE A C    6  
ATOM 10479 O O    . ILE A 1 108 ? -8.266  -17.435 6.602   1.00 0.00 ? 108 ILE A O    6  
ATOM 10480 C CB   . ILE A 1 108 ? -7.425  -16.089 4.226   1.00 0.00 ? 108 ILE A CB   6  
ATOM 10481 C CG1  . ILE A 1 108 ? -6.578  -15.160 3.355   1.00 0.00 ? 108 ILE A CG1  6  
ATOM 10482 C CG2  . ILE A 1 108 ? -8.602  -16.640 3.434   1.00 0.00 ? 108 ILE A CG2  6  
ATOM 10483 C CD1  . ILE A 1 108 ? -7.359  -14.010 2.760   1.00 0.00 ? 108 ILE A CD1  6  
ATOM 10484 H H    . ILE A 1 108 ? -5.915  -15.099 6.097   1.00 0.00 ? 108 ILE A H    6  
ATOM 10485 H HA   . ILE A 1 108 ? -8.584  -14.549 5.159   1.00 0.00 ? 108 ILE A HA   6  
ATOM 10486 H HB   . ILE A 1 108 ? -6.819  -16.921 4.549   1.00 0.00 ? 108 ILE A HB   6  
ATOM 10487 H HG12 . ILE A 1 108 ? -5.781  -14.745 3.951   1.00 0.00 ? 108 ILE A HG12 6  
ATOM 10488 H HG13 . ILE A 1 108 ? -6.153  -15.730 2.541   1.00 0.00 ? 108 ILE A HG13 6  
ATOM 10489 H HG21 . ILE A 1 108 ? -8.603  -16.207 2.444   1.00 0.00 ? 108 ILE A HG21 6  
ATOM 10490 H HG22 . ILE A 1 108 ? -8.512  -17.713 3.357   1.00 0.00 ? 108 ILE A HG22 6  
ATOM 10491 H HG23 . ILE A 1 108 ? -9.523  -16.390 3.937   1.00 0.00 ? 108 ILE A HG23 6  
ATOM 10492 H HD11 . ILE A 1 108 ? -7.133  -13.103 3.302   1.00 0.00 ? 108 ILE A HD11 6  
ATOM 10493 H HD12 . ILE A 1 108 ? -7.085  -13.886 1.723   1.00 0.00 ? 108 ILE A HD12 6  
ATOM 10494 H HD13 . ILE A 1 108 ? -8.416  -14.217 2.831   1.00 0.00 ? 108 ILE A HD13 6  
ATOM 10495 N N    . GLU A 1 109 ? -9.869  -15.871 6.826   1.00 0.00 ? 109 GLU A N    6  
ATOM 10496 C CA   . GLU A 1 109 ? -10.713 -16.701 7.677   1.00 0.00 ? 109 GLU A CA   6  
ATOM 10497 C C    . GLU A 1 109 ? -11.965 -17.151 6.929   1.00 0.00 ? 109 GLU A C    6  
ATOM 10498 O O    . GLU A 1 109 ? -12.918 -16.387 6.778   1.00 0.00 ? 109 GLU A O    6  
ATOM 10499 C CB   . GLU A 1 109 ? -11.108 -15.937 8.942   1.00 0.00 ? 109 GLU A CB   6  
ATOM 10500 C CG   . GLU A 1 109 ? -10.010 -15.887 9.991   1.00 0.00 ? 109 GLU A CG   6  
ATOM 10501 C CD   . GLU A 1 109 ? -10.413 -15.097 11.221  1.00 0.00 ? 109 GLU A CD   6  
ATOM 10502 O OE1  . GLU A 1 109 ? -10.604 -13.869 11.100  1.00 0.00 ? 109 GLU A OE1  6  
ATOM 10503 O OE2  . GLU A 1 109 ? -10.537 -15.706 12.304  1.00 0.00 ? 109 GLU A OE2  6  
ATOM 10504 H H    . GLU A 1 109 ? -10.166 -14.966 6.595   1.00 0.00 ? 109 GLU A H    6  
ATOM 10505 H HA   . GLU A 1 109 ? -10.143 -17.574 7.958   1.00 0.00 ? 109 GLU A HA   6  
ATOM 10506 H HB2  . GLU A 1 109 ? -11.365 -14.924 8.671   1.00 0.00 ? 109 GLU A HB2  6  
ATOM 10507 H HB3  . GLU A 1 109 ? -11.973 -16.413 9.380   1.00 0.00 ? 109 GLU A HB3  6  
ATOM 10508 H HG2  . GLU A 1 109 ? -9.771  -16.896 10.293  1.00 0.00 ? 109 GLU A HG2  6  
ATOM 10509 H HG3  . GLU A 1 109 ? -9.135  -15.427 9.556   1.00 0.00 ? 109 GLU A HG3  6  
ATOM 10510 N N    . SER A 1 110 ? -11.954 -18.396 6.464   1.00 0.00 ? 110 SER A N    6  
ATOM 10511 C CA   . SER A 1 110 ? -13.086 -18.947 5.728   1.00 0.00 ? 110 SER A CA   6  
ATOM 10512 C C    . SER A 1 110 ? -14.092 -19.588 6.679   1.00 0.00 ? 110 SER A C    6  
ATOM 10513 O O    . SER A 1 110 ? -13.714 -20.234 7.656   1.00 0.00 ? 110 SER A O    6  
ATOM 10514 C CB   . SER A 1 110 ? -12.603 -19.979 4.707   1.00 0.00 ? 110 SER A CB   6  
ATOM 10515 O OG   . SER A 1 110 ? -12.322 -21.220 5.330   1.00 0.00 ? 110 SER A OG   6  
ATOM 10516 H H    . SER A 1 110 ? -11.164 -18.956 6.617   1.00 0.00 ? 110 SER A H    6  
ATOM 10517 H HA   . SER A 1 110 ? -13.568 -18.135 5.206   1.00 0.00 ? 110 SER A HA   6  
ATOM 10518 H HB2  . SER A 1 110 ? -13.370 -20.130 3.962   1.00 0.00 ? 110 SER A HB2  6  
ATOM 10519 H HB3  . SER A 1 110 ? -11.704 -19.617 4.230   1.00 0.00 ? 110 SER A HB3  6  
ATOM 10520 H HG   . SER A 1 110 ? -12.313 -21.916 4.669   1.00 0.00 ? 110 SER A HG   6  
ATOM 10521 N N    . GLN A 1 111 ? -15.375 -19.403 6.385   1.00 0.00 ? 111 GLN A N    6  
ATOM 10522 C CA   . GLN A 1 111 ? -16.436 -19.962 7.215   1.00 0.00 ? 111 GLN A CA   6  
ATOM 10523 C C    . GLN A 1 111 ? -17.692 -20.221 6.389   1.00 0.00 ? 111 GLN A C    6  
ATOM 10524 O O    . GLN A 1 111 ? -18.194 -19.328 5.706   1.00 0.00 ? 111 GLN A O    6  
ATOM 10525 C CB   . GLN A 1 111 ? -16.759 -19.016 8.373   1.00 0.00 ? 111 GLN A CB   6  
ATOM 10526 C CG   . GLN A 1 111 ? -17.863 -19.526 9.285   1.00 0.00 ? 111 GLN A CG   6  
ATOM 10527 C CD   . GLN A 1 111 ? -18.191 -18.557 10.403  1.00 0.00 ? 111 GLN A CD   6  
ATOM 10528 O OE1  . GLN A 1 111 ? -19.230 -17.897 10.384  1.00 0.00 ? 111 GLN A OE1  6  
ATOM 10529 N NE2  . GLN A 1 111 ? -17.303 -18.464 11.387  1.00 0.00 ? 111 GLN A NE2  6  
ATOM 10530 H H    . GLN A 1 111 ? -15.613 -18.878 5.594   1.00 0.00 ? 111 GLN A H    6  
ATOM 10531 H HA   . GLN A 1 111 ? -16.084 -20.900 7.615   1.00 0.00 ? 111 GLN A HA   6  
ATOM 10532 H HB2  . GLN A 1 111 ? -15.868 -18.875 8.966   1.00 0.00 ? 111 GLN A HB2  6  
ATOM 10533 H HB3  . GLN A 1 111 ? -17.068 -18.063 7.969   1.00 0.00 ? 111 GLN A HB3  6  
ATOM 10534 H HG2  . GLN A 1 111 ? -18.754 -19.687 8.696   1.00 0.00 ? 111 GLN A HG2  6  
ATOM 10535 H HG3  . GLN A 1 111 ? -17.547 -20.463 9.721   1.00 0.00 ? 111 GLN A HG3  6  
ATOM 10536 H HE21 . GLN A 1 111 ? -16.496 -19.020 11.335  1.00 0.00 ? 111 GLN A HE21 6  
ATOM 10537 H HE22 . GLN A 1 111 ? -17.489 -17.845 12.122  1.00 0.00 ? 111 GLN A HE22 6  
ATOM 10538 N N    . VAL A 1 112 ? -18.196 -21.450 6.457   1.00 0.00 ? 112 VAL A N    6  
ATOM 10539 C CA   . VAL A 1 112 ? -19.394 -21.827 5.717   1.00 0.00 ? 112 VAL A CA   6  
ATOM 10540 C C    . VAL A 1 112 ? -20.513 -22.251 6.661   1.00 0.00 ? 112 VAL A C    6  
ATOM 10541 O O    . VAL A 1 112 ? -21.662 -21.841 6.502   1.00 0.00 ? 112 VAL A O    6  
ATOM 10542 C CB   . VAL A 1 112 ? -19.106 -22.974 4.731   1.00 0.00 ? 112 VAL A CB   6  
ATOM 10543 C CG1  . VAL A 1 112 ? -20.376 -23.381 4.000   1.00 0.00 ? 112 VAL A CG1  6  
ATOM 10544 C CG2  . VAL A 1 112 ? -18.020 -22.570 3.745   1.00 0.00 ? 112 VAL A CG2  6  
ATOM 10545 H H    . VAL A 1 112 ? -17.751 -22.118 7.019   1.00 0.00 ? 112 VAL A H    6  
ATOM 10546 H HA   . VAL A 1 112 ? -19.721 -20.967 5.150   1.00 0.00 ? 112 VAL A HA   6  
ATOM 10547 H HB   . VAL A 1 112 ? -18.753 -23.826 5.294   1.00 0.00 ? 112 VAL A HB   6  
ATOM 10548 H HG11 . VAL A 1 112 ? -20.884 -24.152 4.562   1.00 0.00 ? 112 VAL A HG11 6  
ATOM 10549 H HG12 . VAL A 1 112 ? -21.024 -22.523 3.897   1.00 0.00 ? 112 VAL A HG12 6  
ATOM 10550 H HG13 . VAL A 1 112 ? -20.122 -23.760 3.020   1.00 0.00 ? 112 VAL A HG13 6  
ATOM 10551 H HG21 . VAL A 1 112 ? -18.465 -22.038 2.917   1.00 0.00 ? 112 VAL A HG21 6  
ATOM 10552 H HG22 . VAL A 1 112 ? -17.305 -21.931 4.241   1.00 0.00 ? 112 VAL A HG22 6  
ATOM 10553 H HG23 . VAL A 1 112 ? -17.520 -23.454 3.377   1.00 0.00 ? 112 VAL A HG23 6  
ATOM 10554 N N    . SER A 1 113 ? -20.168 -23.075 7.646   1.00 0.00 ? 113 SER A N    6  
ATOM 10555 C CA   . SER A 1 113 ? -21.144 -23.558 8.615   1.00 0.00 ? 113 SER A CA   6  
ATOM 10556 C C    . SER A 1 113 ? -20.497 -23.765 9.981   1.00 0.00 ? 113 SER A C    6  
ATOM 10557 O O    . SER A 1 113 ? -19.428 -24.366 10.089  1.00 0.00 ? 113 SER A O    6  
ATOM 10558 C CB   . SER A 1 113 ? -21.770 -24.868 8.131   1.00 0.00 ? 113 SER A CB   6  
ATOM 10559 O OG   . SER A 1 113 ? -22.890 -24.621 7.299   1.00 0.00 ? 113 SER A OG   6  
ATOM 10560 H H    . SER A 1 113 ? -19.235 -23.367 7.720   1.00 0.00 ? 113 SER A H    6  
ATOM 10561 H HA   . SER A 1 113 ? -21.918 -22.811 8.706   1.00 0.00 ? 113 SER A HA   6  
ATOM 10562 H HB2  . SER A 1 113 ? -21.037 -25.428 7.570   1.00 0.00 ? 113 SER A HB2  6  
ATOM 10563 H HB3  . SER A 1 113 ? -22.091 -25.447 8.984   1.00 0.00 ? 113 SER A HB3  6  
ATOM 10564 H HG   . SER A 1 113 ? -22.629 -24.699 6.379   1.00 0.00 ? 113 SER A HG   6  
ATOM 10565 N N    . GLY A 1 114 ? -21.153 -23.263 11.022  1.00 0.00 ? 114 GLY A N    6  
ATOM 10566 C CA   . GLY A 1 114 ? -20.627 -23.402 12.368  1.00 0.00 ? 114 GLY A CA   6  
ATOM 10567 C C    . GLY A 1 114 ? -21.573 -22.857 13.419  1.00 0.00 ? 114 GLY A C    6  
ATOM 10568 O O    . GLY A 1 114 ? -22.323 -21.910 13.179  1.00 0.00 ? 114 GLY A O    6  
ATOM 10569 H H    . GLY A 1 114 ? -22.001 -22.794 10.876  1.00 0.00 ? 114 GLY A H    6  
ATOM 10570 H HA2  . GLY A 1 114 ? -20.449 -24.449 12.567  1.00 0.00 ? 114 GLY A HA2  6  
ATOM 10571 H HA3  . GLY A 1 114 ? -19.690 -22.869 12.433  1.00 0.00 ? 114 GLY A HA3  6  
ATOM 10572 N N    . PRO A 1 115 ? -21.547 -23.462 14.616  1.00 0.00 ? 115 PRO A N    6  
ATOM 10573 C CA   . PRO A 1 115 ? -22.404 -23.049 15.731  1.00 0.00 ? 115 PRO A CA   6  
ATOM 10574 C C    . PRO A 1 115 ? -22.001 -21.692 16.299  1.00 0.00 ? 115 PRO A C    6  
ATOM 10575 O O    . PRO A 1 115 ? -20.837 -21.300 16.229  1.00 0.00 ? 115 PRO A O    6  
ATOM 10576 C CB   . PRO A 1 115 ? -22.187 -24.150 16.772  1.00 0.00 ? 115 PRO A CB   6  
ATOM 10577 C CG   . PRO A 1 115 ? -20.838 -24.703 16.464  1.00 0.00 ? 115 PRO A CG   6  
ATOM 10578 C CD   . PRO A 1 115 ? -20.679 -24.597 14.972  1.00 0.00 ? 115 PRO A CD   6  
ATOM 10579 H HA   . PRO A 1 115 ? -23.445 -23.023 15.444  1.00 0.00 ? 115 PRO A HA   6  
ATOM 10580 H HB2  . PRO A 1 115 ? -22.222 -23.723 17.764  1.00 0.00 ? 115 PRO A HB2  6  
ATOM 10581 H HB3  . PRO A 1 115 ? -22.954 -24.903 16.670  1.00 0.00 ? 115 PRO A HB3  6  
ATOM 10582 H HG2  . PRO A 1 115 ? -20.080 -24.121 16.964  1.00 0.00 ? 115 PRO A HG2  6  
ATOM 10583 H HG3  . PRO A 1 115 ? -20.786 -25.736 16.773  1.00 0.00 ? 115 PRO A HG3  6  
ATOM 10584 H HD2  . PRO A 1 115 ? -19.650 -24.390 14.717  1.00 0.00 ? 115 PRO A HD2  6  
ATOM 10585 H HD3  . PRO A 1 115 ? -21.014 -25.504 14.491  1.00 0.00 ? 115 PRO A HD3  6  
ATOM 10586 N N    . SER A 1 116 ? -22.972 -20.980 16.863  1.00 0.00 ? 116 SER A N    6  
ATOM 10587 C CA   . SER A 1 116 ? -22.719 -19.665 17.441  1.00 0.00 ? 116 SER A CA   6  
ATOM 10588 C C    . SER A 1 116 ? -23.745 -19.340 18.521  1.00 0.00 ? 116 SER A C    6  
ATOM 10589 O O    . SER A 1 116 ? -24.935 -19.196 18.239  1.00 0.00 ? 116 SER A O    6  
ATOM 10590 C CB   . SER A 1 116 ? -22.750 -18.592 16.351  1.00 0.00 ? 116 SER A CB   6  
ATOM 10591 O OG   . SER A 1 116 ? -22.482 -17.309 16.891  1.00 0.00 ? 116 SER A OG   6  
ATOM 10592 H H    . SER A 1 116 ? -23.880 -21.347 16.889  1.00 0.00 ? 116 SER A H    6  
ATOM 10593 H HA   . SER A 1 116 ? -21.736 -19.683 17.888  1.00 0.00 ? 116 SER A HA   6  
ATOM 10594 H HB2  . SER A 1 116 ? -22.004 -18.818 15.605  1.00 0.00 ? 116 SER A HB2  6  
ATOM 10595 H HB3  . SER A 1 116 ? -23.728 -18.579 15.891  1.00 0.00 ? 116 SER A HB3  6  
ATOM 10596 H HG   . SER A 1 116 ? -23.100 -16.672 16.525  1.00 0.00 ? 116 SER A HG   6  
ATOM 10597 N N    . SER A 1 117 ? -23.276 -19.226 19.760  1.00 0.00 ? 117 SER A N    6  
ATOM 10598 C CA   . SER A 1 117 ? -24.153 -18.921 20.884  1.00 0.00 ? 117 SER A CA   6  
ATOM 10599 C C    . SER A 1 117 ? -24.652 -17.482 20.810  1.00 0.00 ? 117 SER A C    6  
ATOM 10600 O O    . SER A 1 117 ? -23.968 -16.602 20.288  1.00 0.00 ? 117 SER A O    6  
ATOM 10601 C CB   . SER A 1 117 ? -23.418 -19.150 22.207  1.00 0.00 ? 117 SER A CB   6  
ATOM 10602 O OG   . SER A 1 117 ? -24.158 -18.629 23.298  1.00 0.00 ? 117 SER A OG   6  
ATOM 10603 H H    . SER A 1 117 ? -22.317 -19.352 19.920  1.00 0.00 ? 117 SER A H    6  
ATOM 10604 H HA   . SER A 1 117 ? -25.001 -19.587 20.833  1.00 0.00 ? 117 SER A HA   6  
ATOM 10605 H HB2  . SER A 1 117 ? -23.276 -20.210 22.358  1.00 0.00 ? 117 SER A HB2  6  
ATOM 10606 H HB3  . SER A 1 117 ? -22.457 -18.659 22.172  1.00 0.00 ? 117 SER A HB3  6  
ATOM 10607 H HG   . SER A 1 117 ? -24.984 -19.111 23.384  1.00 0.00 ? 117 SER A HG   6  
ATOM 10608 N N    . GLY A 1 118 ? -25.851 -17.249 21.336  1.00 0.00 ? 118 GLY A N    6  
ATOM 10609 C CA   . GLY A 1 118 ? -26.423 -15.916 21.319  1.00 0.00 ? 118 GLY A CA   6  
ATOM 10610 C C    . GLY A 1 118 ? -26.431 -15.271 22.691  1.00 0.00 ? 118 GLY A C    6  
ATOM 10611 O O    . GLY A 1 118 ? -26.637 -14.064 22.815  1.00 0.00 ? 118 GLY A O    6  
ATOM 10612 H H    . GLY A 1 118 ? -26.351 -17.990 21.739  1.00 0.00 ? 118 GLY A H    6  
ATOM 10613 H HA2  . GLY A 1 118 ? -25.848 -15.298 20.645  1.00 0.00 ? 118 GLY A HA2  6  
ATOM 10614 H HA3  . GLY A 1 118 ? -27.439 -15.977 20.957  1.00 0.00 ? 118 GLY A HA3  6  
ATOM 10615 N N    . GLY A 1 1   ? 35.240  1.616   22.874  1.00 0.00 ? 1   GLY A N    7  
ATOM 10616 C CA   . GLY A 1 1   ? 34.424  2.576   23.595  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10617 C C    . GLY A 1 1   ? 33.382  3.232   22.710  1.00 0.00 ? 1   GLY A C    7  
ATOM 10618 O O    . GLY A 1 1   ? 32.260  2.740   22.591  1.00 0.00 ? 1   GLY A O    7  
ATOM 10619 H H1   . GLY A 1 1   ? 35.251  1.624   21.894  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10620 H HA2  . GLY A 1 1   ? 33.924  2.069   24.407  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10621 H HA3  . GLY A 1 1   ? 35.066  3.342   24.003  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10622 N N    . SER A 1 2   ? 33.753  4.346   22.088  1.00 0.00 ? 2   SER A N    7  
ATOM 10623 C CA   . SER A 1 2   ? 32.841  5.074   21.214  1.00 0.00 ? 2   SER A CA   7  
ATOM 10624 C C    . SER A 1 2   ? 32.725  4.387   19.857  1.00 0.00 ? 2   SER A C    7  
ATOM 10625 O O    . SER A 1 2   ? 33.669  4.385   19.067  1.00 0.00 ? 2   SER A O    7  
ATOM 10626 C CB   . SER A 1 2   ? 33.319  6.516   21.029  1.00 0.00 ? 2   SER A CB   7  
ATOM 10627 O OG   . SER A 1 2   ? 33.067  7.289   22.189  1.00 0.00 ? 2   SER A OG   7  
ATOM 10628 H H    . SER A 1 2   ? 34.662  4.689   22.223  1.00 0.00 ? 2   SER A H    7  
ATOM 10629 H HA   . SER A 1 2   ? 31.869  5.084   21.684  1.00 0.00 ? 2   SER A HA   7  
ATOM 10630 H HB2  . SER A 1 2   ? 34.380  6.518   20.834  1.00 0.00 ? 2   SER A HB2  7  
ATOM 10631 H HB3  . SER A 1 2   ? 32.798  6.960   20.194  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10632 H HG   . SER A 1 2   ? 33.309  6.786   22.969  1.00 0.00 ? 2   SER A HG   7  
ATOM 10633 N N    . SER A 1 3   ? 31.560  3.804   19.594  1.00 0.00 ? 3   SER A N    7  
ATOM 10634 C CA   . SER A 1 3   ? 31.320  3.109   18.334  1.00 0.00 ? 3   SER A CA   7  
ATOM 10635 C C    . SER A 1 3   ? 31.295  4.092   17.168  1.00 0.00 ? 3   SER A C    7  
ATOM 10636 O O    . SER A 1 3   ? 31.886  3.842   16.118  1.00 0.00 ? 3   SER A O    7  
ATOM 10637 C CB   . SER A 1 3   ? 29.999  2.339   18.396  1.00 0.00 ? 3   SER A CB   7  
ATOM 10638 O OG   . SER A 1 3   ? 29.934  1.356   17.377  1.00 0.00 ? 3   SER A OG   7  
ATOM 10639 H H    . SER A 1 3   ? 30.845  3.839   20.264  1.00 0.00 ? 3   SER A H    7  
ATOM 10640 H HA   . SER A 1 3   ? 32.128  2.409   18.183  1.00 0.00 ? 3   SER A HA   7  
ATOM 10641 H HB2  . SER A 1 3   ? 29.913  1.853   19.355  1.00 0.00 ? 3   SER A HB2  7  
ATOM 10642 H HB3  . SER A 1 3   ? 29.177  3.029   18.266  1.00 0.00 ? 3   SER A HB3  7  
ATOM 10643 H HG   . SER A 1 3   ? 29.544  0.553   17.732  1.00 0.00 ? 3   SER A HG   7  
ATOM 10644 N N    . GLY A 1 4   ? 30.605  5.212   17.361  1.00 0.00 ? 4   GLY A N    7  
ATOM 10645 C CA   . GLY A 1 4   ? 30.515  6.217   16.317  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10646 C C    . GLY A 1 4   ? 29.217  6.998   16.375  1.00 0.00 ? 4   GLY A C    7  
ATOM 10647 O O    . GLY A 1 4   ? 28.436  6.849   17.315  1.00 0.00 ? 4   GLY A O    7  
ATOM 10648 H H    . GLY A 1 4   ? 30.154  5.358   18.218  1.00 0.00 ? 4   GLY A H    7  
ATOM 10649 H HA2  . GLY A 1 4   ? 31.341  6.904   16.421  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10650 H HA3  . GLY A 1 4   ? 30.585  5.728   15.356  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10651 N N    . SER A 1 5   ? 28.987  7.835   15.369  1.00 0.00 ? 5   SER A N    7  
ATOM 10652 C CA   . SER A 1 5   ? 27.777  8.647   15.311  1.00 0.00 ? 5   SER A CA   7  
ATOM 10653 C C    . SER A 1 5   ? 27.146  8.586   13.924  1.00 0.00 ? 5   SER A C    7  
ATOM 10654 O O    . SER A 1 5   ? 27.816  8.273   12.939  1.00 0.00 ? 5   SER A O    7  
ATOM 10655 C CB   . SER A 1 5   ? 28.094  10.099  15.676  1.00 0.00 ? 5   SER A CB   7  
ATOM 10656 O OG   . SER A 1 5   ? 29.057  10.648  14.793  1.00 0.00 ? 5   SER A OG   7  
ATOM 10657 H H    . SER A 1 5   ? 29.648  7.910   14.648  1.00 0.00 ? 5   SER A H    7  
ATOM 10658 H HA   . SER A 1 5   ? 27.076  8.249   16.030  1.00 0.00 ? 5   SER A HA   7  
ATOM 10659 H HB2  . SER A 1 5   ? 27.191  10.688  15.617  1.00 0.00 ? 5   SER A HB2  7  
ATOM 10660 H HB3  . SER A 1 5   ? 28.483  10.137  16.683  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10661 H HG   . SER A 1 5   ? 28.812  10.447  13.887  1.00 0.00 ? 5   SER A HG   7  
ATOM 10662 N N    . SER A 1 6   ? 25.854  8.886   13.854  1.00 0.00 ? 6   SER A N    7  
ATOM 10663 C CA   . SER A 1 6   ? 25.130  8.862   12.588  1.00 0.00 ? 6   SER A CA   7  
ATOM 10664 C C    . SER A 1 6   ? 24.313  10.137  12.405  1.00 0.00 ? 6   SER A C    7  
ATOM 10665 O O    . SER A 1 6   ? 23.216  10.268  12.946  1.00 0.00 ? 6   SER A O    7  
ATOM 10666 C CB   . SER A 1 6   ? 24.211  7.640   12.525  1.00 0.00 ? 6   SER A CB   7  
ATOM 10667 O OG   . SER A 1 6   ? 24.955  6.453   12.314  1.00 0.00 ? 6   SER A OG   7  
ATOM 10668 H H    . SER A 1 6   ? 25.374  9.128   14.674  1.00 0.00 ? 6   SER A H    7  
ATOM 10669 H HA   . SER A 1 6   ? 25.857  8.797   11.792  1.00 0.00 ? 6   SER A HA   7  
ATOM 10670 H HB2  . SER A 1 6   ? 23.670  7.552   13.455  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10671 H HB3  . SER A 1 6   ? 23.511  7.762   11.711  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10672 H HG   . SER A 1 6   ? 25.167  6.053   13.161  1.00 0.00 ? 6   SER A HG   7  
ATOM 10673 N N    . GLY A 1 7   ? 24.857  11.076  11.636  1.00 0.00 ? 7   GLY A N    7  
ATOM 10674 C CA   . GLY A 1 7   ? 24.166  12.329  11.395  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10675 C C    . GLY A 1 7   ? 24.816  13.147  10.297  1.00 0.00 ? 7   GLY A C    7  
ATOM 10676 O O    . GLY A 1 7   ? 25.172  14.307  10.505  1.00 0.00 ? 7   GLY A O    7  
ATOM 10677 H H    . GLY A 1 7   ? 25.734  10.917  11.230  1.00 0.00 ? 7   GLY A H    7  
ATOM 10678 H HA2  . GLY A 1 7   ? 23.145  12.116  11.115  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10679 H HA3  . GLY A 1 7   ? 24.165  12.908  12.306  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10680 N N    . SER A 1 8   ? 24.973  12.542  9.124   1.00 0.00 ? 8   SER A N    7  
ATOM 10681 C CA   . SER A 1 8   ? 25.590  13.220  7.990   1.00 0.00 ? 8   SER A CA   7  
ATOM 10682 C C    . SER A 1 8   ? 24.928  14.572  7.740   1.00 0.00 ? 8   SER A C    7  
ATOM 10683 O O    . SER A 1 8   ? 23.748  14.763  8.035   1.00 0.00 ? 8   SER A O    7  
ATOM 10684 C CB   . SER A 1 8   ? 25.493  12.352  6.734   1.00 0.00 ? 8   SER A CB   7  
ATOM 10685 O OG   . SER A 1 8   ? 26.119  11.096  6.933   1.00 0.00 ? 8   SER A OG   7  
ATOM 10686 H H    . SER A 1 8   ? 24.669  11.616  9.019   1.00 0.00 ? 8   SER A H    7  
ATOM 10687 H HA   . SER A 1 8   ? 26.631  13.381  8.227   1.00 0.00 ? 8   SER A HA   7  
ATOM 10688 H HB2  . SER A 1 8   ? 24.454  12.188  6.492   1.00 0.00 ? 8   SER A HB2  7  
ATOM 10689 H HB3  . SER A 1 8   ? 25.979  12.857  5.912   1.00 0.00 ? 8   SER A HB3  7  
ATOM 10690 H HG   . SER A 1 8   ? 26.089  10.868  7.865   1.00 0.00 ? 8   SER A HG   7  
ATOM 10691 N N    . HIS A 1 9   ? 25.697  15.508  7.193   1.00 0.00 ? 9   HIS A N    7  
ATOM 10692 C CA   . HIS A 1 9   ? 25.186  16.843  6.902   1.00 0.00 ? 9   HIS A CA   7  
ATOM 10693 C C    . HIS A 1 9   ? 24.462  16.867  5.559   1.00 0.00 ? 9   HIS A C    7  
ATOM 10694 O O    . HIS A 1 9   ? 24.698  17.747  4.731   1.00 0.00 ? 9   HIS A O    7  
ATOM 10695 C CB   . HIS A 1 9   ? 26.328  17.860  6.896   1.00 0.00 ? 9   HIS A CB   7  
ATOM 10696 C CG   . HIS A 1 9   ? 25.864  19.283  6.929   1.00 0.00 ? 9   HIS A CG   7  
ATOM 10697 N ND1  . HIS A 1 9   ? 25.700  20.047  5.793   1.00 0.00 ? 9   HIS A ND1  7  
ATOM 10698 C CD2  . HIS A 1 9   ? 25.526  20.080  7.969   1.00 0.00 ? 9   HIS A CD2  7  
ATOM 10699 C CE1  . HIS A 1 9   ? 25.283  21.254  6.134   1.00 0.00 ? 9   HIS A CE1  7  
ATOM 10700 N NE2  . HIS A 1 9   ? 25.169  21.300  7.449   1.00 0.00 ? 9   HIS A NE2  7  
ATOM 10701 H H    . HIS A 1 9   ? 26.629  15.296  6.980   1.00 0.00 ? 9   HIS A H    7  
ATOM 10702 H HA   . HIS A 1 9   ? 24.485  17.107  7.679   1.00 0.00 ? 9   HIS A HA   7  
ATOM 10703 H HB2  . HIS A 1 9   ? 26.952  17.695  7.763   1.00 0.00 ? 9   HIS A HB2  7  
ATOM 10704 H HB3  . HIS A 1 9   ? 26.919  17.723  6.002   1.00 0.00 ? 9   HIS A HB3  7  
ATOM 10705 H HD2  . HIS A 1 9   ? 25.535  19.809  9.016   1.00 0.00 ? 9   HIS A HD2  7  
ATOM 10706 H HE1  . HIS A 1 9   ? 25.071  22.065  5.453   1.00 0.00 ? 9   HIS A HE1  7  
ATOM 10707 H HE2  . HIS A 1 9   ? 24.960  22.103  7.969   1.00 0.00 ? 9   HIS A HE2  7  
ATOM 10708 N N    . ASP A 1 10  ? 23.581  15.895  5.350   1.00 0.00 ? 10  ASP A N    7  
ATOM 10709 C CA   . ASP A 1 10  ? 22.822  15.804  4.108   1.00 0.00 ? 10  ASP A CA   7  
ATOM 10710 C C    . ASP A 1 10  ? 21.876  16.992  3.962   1.00 0.00 ? 10  ASP A C    7  
ATOM 10711 O O    . ASP A 1 10  ? 21.189  17.372  4.910   1.00 0.00 ? 10  ASP A O    7  
ATOM 10712 C CB   . ASP A 1 10  ? 22.030  14.496  4.064   1.00 0.00 ? 10  ASP A CB   7  
ATOM 10713 C CG   . ASP A 1 10  ? 22.910  13.296  3.776   1.00 0.00 ? 10  ASP A CG   7  
ATOM 10714 O OD1  . ASP A 1 10  ? 24.031  13.237  4.323   1.00 0.00 ? 10  ASP A OD1  7  
ATOM 10715 O OD2  . ASP A 1 10  ? 22.476  12.415  3.005   1.00 0.00 ? 10  ASP A OD2  7  
ATOM 10716 H H    . ASP A 1 10  ? 23.437  15.222  6.049   1.00 0.00 ? 10  ASP A H    7  
ATOM 10717 H HA   . ASP A 1 10  ? 23.525  15.816  3.289   1.00 0.00 ? 10  ASP A HA   7  
ATOM 10718 H HB2  . ASP A 1 10  ? 21.546  14.344  5.018   1.00 0.00 ? 10  ASP A HB2  7  
ATOM 10719 H HB3  . ASP A 1 10  ? 21.279  14.564  3.291   1.00 0.00 ? 10  ASP A HB3  7  
ATOM 10720 N N    . SER A 1 11  ? 21.847  17.574  2.767   1.00 0.00 ? 11  SER A N    7  
ATOM 10721 C CA   . SER A 1 11  ? 20.989  18.722  2.498   1.00 0.00 ? 11  SER A CA   7  
ATOM 10722 C C    . SER A 1 11  ? 20.019  18.420  1.359   1.00 0.00 ? 11  SER A C    7  
ATOM 10723 O O    . SER A 1 11  ? 18.824  18.697  1.458   1.00 0.00 ? 11  SER A O    7  
ATOM 10724 C CB   . SER A 1 11  ? 21.836  19.948  2.149   1.00 0.00 ? 11  SER A CB   7  
ATOM 10725 O OG   . SER A 1 11  ? 22.565  19.741  0.952   1.00 0.00 ? 11  SER A OG   7  
ATOM 10726 H H    . SER A 1 11  ? 22.418  17.225  2.051   1.00 0.00 ? 11  SER A H    7  
ATOM 10727 H HA   . SER A 1 11  ? 20.422  18.930  3.393   1.00 0.00 ? 11  SER A HA   7  
ATOM 10728 H HB2  . SER A 1 11  ? 21.190  20.803  2.020   1.00 0.00 ? 11  SER A HB2  7  
ATOM 10729 H HB3  . SER A 1 11  ? 22.532  20.141  2.952   1.00 0.00 ? 11  SER A HB3  7  
ATOM 10730 H HG   . SER A 1 11  ? 21.955  19.678  0.213   1.00 0.00 ? 11  SER A HG   7  
ATOM 10731 N N    . ARG A 1 12  ? 20.543  17.850  0.279   1.00 0.00 ? 12  ARG A N    7  
ATOM 10732 C CA   . ARG A 1 12  ? 19.725  17.510  -0.879  1.00 0.00 ? 12  ARG A CA   7  
ATOM 10733 C C    . ARG A 1 12  ? 19.135  16.110  -0.736  1.00 0.00 ? 12  ARG A C    7  
ATOM 10734 O O    . ARG A 1 12  ? 19.705  15.133  -1.223  1.00 0.00 ? 12  ARG A O    7  
ATOM 10735 C CB   . ARG A 1 12  ? 20.556  17.597  -2.160  1.00 0.00 ? 12  ARG A CB   7  
ATOM 10736 C CG   . ARG A 1 12  ? 20.687  19.010  -2.706  1.00 0.00 ? 12  ARG A CG   7  
ATOM 10737 C CD   . ARG A 1 12  ? 20.989  19.005  -4.197  1.00 0.00 ? 12  ARG A CD   7  
ATOM 10738 N NE   . ARG A 1 12  ? 22.309  18.450  -4.486  1.00 0.00 ? 12  ARG A NE   7  
ATOM 10739 C CZ   . ARG A 1 12  ? 23.431  19.159  -4.437  1.00 0.00 ? 12  ARG A CZ   7  
ATOM 10740 N NH1  . ARG A 1 12  ? 23.394  20.444  -4.110  1.00 0.00 ? 12  ARG A NH1  7  
ATOM 10741 N NH2  . ARG A 1 12  ? 24.594  18.584  -4.714  1.00 0.00 ? 12  ARG A NH2  7  
ATOM 10742 H H    . ARG A 1 12  ? 21.503  17.653  0.261   1.00 0.00 ? 12  ARG A H    7  
ATOM 10743 H HA   . ARG A 1 12  ? 18.917  18.224  -0.935  1.00 0.00 ? 12  ARG A HA   7  
ATOM 10744 H HB2  . ARG A 1 12  ? 21.548  17.220  -1.959  1.00 0.00 ? 12  ARG A HB2  7  
ATOM 10745 H HB3  . ARG A 1 12  ? 20.093  16.984  -2.917  1.00 0.00 ? 12  ARG A HB3  7  
ATOM 10746 H HG2  . ARG A 1 12  ? 19.760  19.538  -2.540  1.00 0.00 ? 12  ARG A HG2  7  
ATOM 10747 H HG3  . ARG A 1 12  ? 21.489  19.513  -2.187  1.00 0.00 ? 12  ARG A HG3  7  
ATOM 10748 H HD2  . ARG A 1 12  ? 20.241  18.411  -4.700  1.00 0.00 ? 12  ARG A HD2  7  
ATOM 10749 H HD3  . ARG A 1 12  ? 20.947  20.020  -4.562  1.00 0.00 ? 12  ARG A HD3  7  
ATOM 10750 H HE   . ARG A 1 12  ? 22.359  17.503  -4.730  1.00 0.00 ? 12  ARG A HE   7  
ATOM 10751 H HH11 . ARG A 1 12  ? 22.519  20.880  -3.899  1.00 0.00 ? 12  ARG A HH11 7  
ATOM 10752 H HH12 . ARG A 1 12  ? 24.240  20.975  -4.072  1.00 0.00 ? 12  ARG A HH12 7  
ATOM 10753 H HH21 . ARG A 1 12  ? 24.626  17.615  -4.960  1.00 0.00 ? 12  ARG A HH21 7  
ATOM 10754 H HH22 . ARG A 1 12  ? 25.438  19.118  -4.676  1.00 0.00 ? 12  ARG A HH22 7  
ATOM 10755 N N    . LEU A 1 13  ? 17.992  16.021  -0.066  1.00 0.00 ? 13  LEU A N    7  
ATOM 10756 C CA   . LEU A 1 13  ? 17.325  14.740  0.141   1.00 0.00 ? 13  LEU A CA   7  
ATOM 10757 C C    . LEU A 1 13  ? 15.874  14.801  -0.325  1.00 0.00 ? 13  LEU A C    7  
ATOM 10758 O O    . LEU A 1 13  ? 15.352  15.874  -0.631  1.00 0.00 ? 13  LEU A O    7  
ATOM 10759 C CB   . LEU A 1 13  ? 17.382  14.346  1.618   1.00 0.00 ? 13  LEU A CB   7  
ATOM 10760 C CG   . LEU A 1 13  ? 18.777  14.281  2.242   1.00 0.00 ? 13  LEU A CG   7  
ATOM 10761 C CD1  . LEU A 1 13  ? 18.681  14.220  3.758   1.00 0.00 ? 13  LEU A CD1  7  
ATOM 10762 C CD2  . LEU A 1 13  ? 19.545  13.082  1.706   1.00 0.00 ? 13  LEU A CD2  7  
ATOM 10763 H H    . LEU A 1 13  ? 17.586  16.835  0.299   1.00 0.00 ? 13  LEU A H    7  
ATOM 10764 H HA   . LEU A 1 13  ? 17.847  13.997  -0.442  1.00 0.00 ? 13  LEU A HA   7  
ATOM 10765 H HB2  . LEU A 1 13  ? 16.804  15.068  2.175   1.00 0.00 ? 13  LEU A HB2  7  
ATOM 10766 H HB3  . LEU A 1 13  ? 16.928  13.370  1.717   1.00 0.00 ? 13  LEU A HB3  7  
ATOM 10767 H HG   . LEU A 1 13  ? 19.324  15.175  1.978   1.00 0.00 ? 13  LEU A HG   7  
ATOM 10768 H HD11 . LEU A 1 13  ? 19.412  13.523  4.138   1.00 0.00 ? 13  LEU A HD11 7  
ATOM 10769 H HD12 . LEU A 1 13  ? 17.691  13.896  4.044   1.00 0.00 ? 13  LEU A HD12 7  
ATOM 10770 H HD13 . LEU A 1 13  ? 18.870  15.201  4.170   1.00 0.00 ? 13  LEU A HD13 7  
ATOM 10771 H HD21 . LEU A 1 13  ? 18.848  12.322  1.385   1.00 0.00 ? 13  LEU A HD21 7  
ATOM 10772 H HD22 . LEU A 1 13  ? 20.179  12.684  2.485   1.00 0.00 ? 13  LEU A HD22 7  
ATOM 10773 H HD23 . LEU A 1 13  ? 20.154  13.390  0.868   1.00 0.00 ? 13  LEU A HD23 7  
ATOM 10774 N N    . THR A 1 14  ? 15.224  13.642  -0.374  1.00 0.00 ? 14  THR A N    7  
ATOM 10775 C CA   . THR A 1 14  ? 13.833  13.563  -0.801  1.00 0.00 ? 14  THR A CA   7  
ATOM 10776 C C    . THR A 1 14  ? 12.975  14.592  -0.074  1.00 0.00 ? 14  THR A C    7  
ATOM 10777 O O    . THR A 1 14  ? 12.902  14.596  1.154   1.00 0.00 ? 14  THR A O    7  
ATOM 10778 C CB   . THR A 1 14  ? 13.249  12.159  -0.556  1.00 0.00 ? 14  THR A CB   7  
ATOM 10779 O OG1  . THR A 1 14  ? 13.396  11.801  0.823   1.00 0.00 ? 14  THR A OG1  7  
ATOM 10780 C CG2  . THR A 1 14  ? 13.942  11.124  -1.430  1.00 0.00 ? 14  THR A CG2  7  
ATOM 10781 H H    . THR A 1 14  ? 15.694  12.821  -0.118  1.00 0.00 ? 14  THR A H    7  
ATOM 10782 H HA   . THR A 1 14  ? 13.798  13.764  -1.862  1.00 0.00 ? 14  THR A HA   7  
ATOM 10783 H HB   . THR A 1 14  ? 12.198  12.174  -0.806  1.00 0.00 ? 14  THR A HB   7  
ATOM 10784 H HG1  . THR A 1 14  ? 12.554  11.906  1.272   1.00 0.00 ? 14  THR A HG1  7  
ATOM 10785 H HG21 . THR A 1 14  ? 13.672  10.133  -1.097  1.00 0.00 ? 14  THR A HG21 7  
ATOM 10786 H HG22 . THR A 1 14  ? 15.012  11.249  -1.356  1.00 0.00 ? 14  THR A HG22 7  
ATOM 10787 H HG23 . THR A 1 14  ? 13.634  11.256  -2.456  1.00 0.00 ? 14  THR A HG23 7  
ATOM 10788 N N    . ALA A 1 15  ? 12.327  15.462  -0.840  1.00 0.00 ? 15  ALA A N    7  
ATOM 10789 C CA   . ALA A 1 15  ? 11.471  16.495  -0.268  1.00 0.00 ? 15  ALA A CA   7  
ATOM 10790 C C    . ALA A 1 15  ? 10.067  16.434  -0.860  1.00 0.00 ? 15  ALA A C    7  
ATOM 10791 O O    . ALA A 1 15  ? 9.077   16.394  -0.131  1.00 0.00 ? 15  ALA A O    7  
ATOM 10792 C CB   . ALA A 1 15  ? 12.082  17.870  -0.493  1.00 0.00 ? 15  ALA A CB   7  
ATOM 10793 H H    . ALA A 1 15  ? 12.425  15.408  -1.814  1.00 0.00 ? 15  ALA A H    7  
ATOM 10794 H HA   . ALA A 1 15  ? 11.410  16.325  0.797   1.00 0.00 ? 15  ALA A HA   7  
ATOM 10795 H HB1  . ALA A 1 15  ? 11.409  18.628  -0.120  1.00 0.00 ? 15  ALA A HB1  7  
ATOM 10796 H HB2  . ALA A 1 15  ? 13.024  17.935  0.032   1.00 0.00 ? 15  ALA A HB2  7  
ATOM 10797 H HB3  . ALA A 1 15  ? 12.247  18.023  -1.549  1.00 0.00 ? 15  ALA A HB3  7  
ATOM 10798 N N    . GLY A 1 16  ? 9.989   16.428  -2.187  1.00 0.00 ? 16  GLY A N    7  
ATOM 10799 C CA   . GLY A 1 16  ? 8.701   16.373  -2.854  1.00 0.00 ? 16  GLY A CA   7  
ATOM 10800 C C    . GLY A 1 16  ? 8.146   14.964  -2.929  1.00 0.00 ? 16  GLY A C    7  
ATOM 10801 O O    . GLY A 1 16  ? 7.560   14.573  -3.938  1.00 0.00 ? 16  GLY A O    7  
ATOM 10802 H H    . GLY A 1 16  ? 10.812  16.461  -2.718  1.00 0.00 ? 16  GLY A H    7  
ATOM 10803 H HA2  . GLY A 1 16  ? 8.002   16.996  -2.316  1.00 0.00 ? 16  GLY A HA2  7  
ATOM 10804 H HA3  . GLY A 1 16  ? 8.811   16.758  -3.858  1.00 0.00 ? 16  GLY A HA3  7  
ATOM 10805 N N    . VAL A 1 17  ? 8.333   14.199  -1.858  1.00 0.00 ? 17  VAL A N    7  
ATOM 10806 C CA   . VAL A 1 17  ? 7.847   12.825  -1.806  1.00 0.00 ? 17  VAL A CA   7  
ATOM 10807 C C    . VAL A 1 17  ? 6.591   12.718  -0.949  1.00 0.00 ? 17  VAL A C    7  
ATOM 10808 O O    . VAL A 1 17  ? 6.368   13.506  -0.030  1.00 0.00 ? 17  VAL A O    7  
ATOM 10809 C CB   . VAL A 1 17  ? 8.920   11.872  -1.247  1.00 0.00 ? 17  VAL A CB   7  
ATOM 10810 C CG1  . VAL A 1 17  ? 10.011  11.631  -2.279  1.00 0.00 ? 17  VAL A CG1  7  
ATOM 10811 C CG2  . VAL A 1 17  ? 9.507   12.428  0.041   1.00 0.00 ? 17  VAL A CG2  7  
ATOM 10812 H H    . VAL A 1 17  ? 8.808   14.568  -1.084  1.00 0.00 ? 17  VAL A H    7  
ATOM 10813 H HA   . VAL A 1 17  ? 7.611   12.516  -2.814  1.00 0.00 ? 17  VAL A HA   7  
ATOM 10814 H HB   . VAL A 1 17  ? 8.450   10.925  -1.025  1.00 0.00 ? 17  VAL A HB   7  
ATOM 10815 H HG11 . VAL A 1 17  ? 9.599   11.092  -3.120  1.00 0.00 ? 17  VAL A HG11 7  
ATOM 10816 H HG12 . VAL A 1 17  ? 10.405  12.579  -2.615  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 10817 H HG13 . VAL A 1 17  ? 10.805  11.049  -1.834  1.00 0.00 ? 17  VAL A HG13 7  
ATOM 10818 H HG21 . VAL A 1 17  ? 10.248  11.742  0.425   1.00 0.00 ? 17  VAL A HG21 7  
ATOM 10819 H HG22 . VAL A 1 17  ? 9.968   13.383  -0.157  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 10820 H HG23 . VAL A 1 17  ? 8.720   12.553  0.771   1.00 0.00 ? 17  VAL A HG23 7  
ATOM 10821 N N    . PRO A 1 18  ? 5.750   11.719  -1.255  1.00 0.00 ? 18  PRO A N    7  
ATOM 10822 C CA   . PRO A 1 18  ? 4.501   11.484  -0.524  1.00 0.00 ? 18  PRO A CA   7  
ATOM 10823 C C    . PRO A 1 18  ? 4.746   10.975  0.892   1.00 0.00 ? 18  PRO A C    7  
ATOM 10824 O O    . PRO A 1 18  ? 5.609   10.126  1.117   1.00 0.00 ? 18  PRO A O    7  
ATOM 10825 C CB   . PRO A 1 18  ? 3.795   10.415  -1.362  1.00 0.00 ? 18  PRO A CB   7  
ATOM 10826 C CG   . PRO A 1 18  ? 4.894   9.707   -2.076  1.00 0.00 ? 18  PRO A CG   7  
ATOM 10827 C CD   . PRO A 1 18  ? 5.953   10.742  -2.338  1.00 0.00 ? 18  PRO A CD   7  
ATOM 10828 H HA   . PRO A 1 18  ? 3.891   12.374  -0.485  1.00 0.00 ? 18  PRO A HA   7  
ATOM 10829 H HB2  . PRO A 1 18  ? 3.250   9.746   -0.711  1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10830 H HB3  . PRO A 1 18  ? 3.114   10.887  -2.054  1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10831 H HG2  . PRO A 1 18  ? 5.288   8.918   -1.454  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10832 H HG3  . PRO A 1 18  ? 4.526   9.304   -3.008  1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10833 H HD2  . PRO A 1 18  ? 6.936   10.300  -2.279  1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10834 H HD3  . PRO A 1 18  ? 5.800   11.201  -3.304  1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10835 N N    . ASP A 1 19  ? 3.982   11.499  1.844   1.00 0.00 ? 19  ASP A N    7  
ATOM 10836 C CA   . ASP A 1 19  ? 4.115   11.096  3.240   1.00 0.00 ? 19  ASP A CA   7  
ATOM 10837 C C    . ASP A 1 19  ? 3.484   9.727   3.472   1.00 0.00 ? 19  ASP A C    7  
ATOM 10838 O O    . ASP A 1 19  ? 2.628   9.286   2.705   1.00 0.00 ? 19  ASP A O    7  
ATOM 10839 C CB   . ASP A 1 19  ? 3.465   12.134  4.156   1.00 0.00 ? 19  ASP A CB   7  
ATOM 10840 C CG   . ASP A 1 19  ? 4.134   12.206  5.515   1.00 0.00 ? 19  ASP A CG   7  
ATOM 10841 O OD1  . ASP A 1 19  ? 5.349   12.488  5.564   1.00 0.00 ? 19  ASP A OD1  7  
ATOM 10842 O OD2  . ASP A 1 19  ? 3.441   11.981  6.530   1.00 0.00 ? 19  ASP A OD2  7  
ATOM 10843 H H    . ASP A 1 19  ? 3.311   12.172  1.603   1.00 0.00 ? 19  ASP A H    7  
ATOM 10844 H HA   . ASP A 1 19  ? 5.168   11.037  3.469   1.00 0.00 ? 19  ASP A HA   7  
ATOM 10845 H HB2  . ASP A 1 19  ? 3.530   13.107  3.692   1.00 0.00 ? 19  ASP A HB2  7  
ATOM 10846 H HB3  . ASP A 1 19  ? 2.425   11.876  4.300   1.00 0.00 ? 19  ASP A HB3  7  
ATOM 10847 N N    . THR A 1 20  ? 3.914   9.056   4.537   1.00 0.00 ? 20  THR A N    7  
ATOM 10848 C CA   . THR A 1 20  ? 3.393   7.736   4.870   1.00 0.00 ? 20  THR A CA   7  
ATOM 10849 C C    . THR A 1 20  ? 1.873   7.704   4.771   1.00 0.00 ? 20  THR A C    7  
ATOM 10850 O O    . THR A 1 20  ? 1.171   8.532   5.352   1.00 0.00 ? 20  THR A O    7  
ATOM 10851 C CB   . THR A 1 20  ? 3.814   7.308   6.289   1.00 0.00 ? 20  THR A CB   7  
ATOM 10852 O OG1  . THR A 1 20  ? 5.112   7.831   6.594   1.00 0.00 ? 20  THR A OG1  7  
ATOM 10853 C CG2  . THR A 1 20  ? 3.830   5.792   6.414   1.00 0.00 ? 20  THR A CG2  7  
ATOM 10854 H H    . THR A 1 20  ? 4.598   9.460   5.111   1.00 0.00 ? 20  THR A H    7  
ATOM 10855 H HA   . THR A 1 20  ? 3.805   7.028   4.166   1.00 0.00 ? 20  THR A HA   7  
ATOM 10856 H HB   . THR A 1 20  ? 3.099   7.705   6.995   1.00 0.00 ? 20  THR A HB   7  
ATOM 10857 H HG1  . THR A 1 20  ? 5.594   7.986   5.778   1.00 0.00 ? 20  THR A HG1  7  
ATOM 10858 H HG21 . THR A 1 20  ? 4.417   5.371   5.611   1.00 0.00 ? 20  THR A HG21 7  
ATOM 10859 H HG22 . THR A 1 20  ? 2.820   5.415   6.356   1.00 0.00 ? 20  THR A HG22 7  
ATOM 10860 H HG23 . THR A 1 20  ? 4.265   5.514   7.362   1.00 0.00 ? 20  THR A HG23 7  
ATOM 10861 N N    . PRO A 1 21  ? 1.348   6.725   4.020   1.00 0.00 ? 21  PRO A N    7  
ATOM 10862 C CA   . PRO A 1 21  ? -0.096  6.560   3.829   1.00 0.00 ? 21  PRO A CA   7  
ATOM 10863 C C    . PRO A 1 21  ? -0.799  6.095   5.099   1.00 0.00 ? 21  PRO A C    7  
ATOM 10864 O O    . PRO A 1 21  ? -0.190  5.466   5.965   1.00 0.00 ? 21  PRO A O    7  
ATOM 10865 C CB   . PRO A 1 21  ? -0.190  5.487   2.742   1.00 0.00 ? 21  PRO A CB   7  
ATOM 10866 C CG   . PRO A 1 21  ? 1.079   4.715   2.861   1.00 0.00 ? 21  PRO A CG   7  
ATOM 10867 C CD   . PRO A 1 21  ? 2.125   5.702   3.299   1.00 0.00 ? 21  PRO A CD   7  
ATOM 10868 H HA   . PRO A 1 21  ? -0.556  7.472   3.477   1.00 0.00 ? 21  PRO A HA   7  
ATOM 10869 H HB2  . PRO A 1 21  ? -1.053  4.861   2.924   1.00 0.00 ? 21  PRO A HB2  7  
ATOM 10870 H HB3  . PRO A 1 21  ? -0.277  5.956   1.773   1.00 0.00 ? 21  PRO A HB3  7  
ATOM 10871 H HG2  . PRO A 1 21  ? 0.966   3.935   3.599   1.00 0.00 ? 21  PRO A HG2  7  
ATOM 10872 H HG3  . PRO A 1 21  ? 1.341   4.291   1.903   1.00 0.00 ? 21  PRO A HG3  7  
ATOM 10873 H HD2  . PRO A 1 21  ? 2.840   5.228   3.954   1.00 0.00 ? 21  PRO A HD2  7  
ATOM 10874 H HD3  . PRO A 1 21  ? 2.622   6.130   2.440   1.00 0.00 ? 21  PRO A HD3  7  
ATOM 10875 N N    . THR A 1 22  ? -2.087  6.408   5.205   1.00 0.00 ? 22  THR A N    7  
ATOM 10876 C CA   . THR A 1 22  ? -2.874  6.023   6.370   1.00 0.00 ? 22  THR A CA   7  
ATOM 10877 C C    . THR A 1 22  ? -3.201  4.534   6.345   1.00 0.00 ? 22  THR A C    7  
ATOM 10878 O O    . THR A 1 22  ? -2.779  3.812   5.442   1.00 0.00 ? 22  THR A O    7  
ATOM 10879 C CB   . THR A 1 22  ? -4.187  6.824   6.452   1.00 0.00 ? 22  THR A CB   7  
ATOM 10880 O OG1  . THR A 1 22  ? -4.025  8.096   5.813   1.00 0.00 ? 22  THR A OG1  7  
ATOM 10881 C CG2  . THR A 1 22  ? -4.607  7.028   7.900   1.00 0.00 ? 22  THR A CG2  7  
ATOM 10882 H H    . THR A 1 22  ? -2.517  6.910   4.482   1.00 0.00 ? 22  THR A H    7  
ATOM 10883 H HA   . THR A 1 22  ? -2.289  6.238   7.253   1.00 0.00 ? 22  THR A HA   7  
ATOM 10884 H HB   . THR A 1 22  ? -4.961  6.270   5.942   1.00 0.00 ? 22  THR A HB   7  
ATOM 10885 H HG1  . THR A 1 22  ? -3.151  8.442   6.007   1.00 0.00 ? 22  THR A HG1  7  
ATOM 10886 H HG21 . THR A 1 22  ? -5.607  6.648   8.041   1.00 0.00 ? 22  THR A HG21 7  
ATOM 10887 H HG22 . THR A 1 22  ? -4.587  8.082   8.135   1.00 0.00 ? 22  THR A HG22 7  
ATOM 10888 H HG23 . THR A 1 22  ? -3.925  6.501   8.550   1.00 0.00 ? 22  THR A HG23 7  
ATOM 10889 N N    . ARG A 1 23  ? -3.956  4.082   7.341   1.00 0.00 ? 23  ARG A N    7  
ATOM 10890 C CA   . ARG A 1 23  ? -4.339  2.678   7.433   1.00 0.00 ? 23  ARG A CA   7  
ATOM 10891 C C    . ARG A 1 23  ? -5.021  2.216   6.148   1.00 0.00 ? 23  ARG A C    7  
ATOM 10892 O O    . ARG A 1 23  ? -5.571  3.024   5.398   1.00 0.00 ? 23  ARG A O    7  
ATOM 10893 C CB   . ARG A 1 23  ? -5.273  2.459   8.625   1.00 0.00 ? 23  ARG A CB   7  
ATOM 10894 C CG   . ARG A 1 23  ? -6.647  3.082   8.445   1.00 0.00 ? 23  ARG A CG   7  
ATOM 10895 C CD   . ARG A 1 23  ? -7.634  2.091   7.848   1.00 0.00 ? 23  ARG A CD   7  
ATOM 10896 N NE   . ARG A 1 23  ? -9.011  2.392   8.231   1.00 0.00 ? 23  ARG A NE   7  
ATOM 10897 C CZ   . ARG A 1 23  ? -9.977  1.481   8.276   1.00 0.00 ? 23  ARG A CZ   7  
ATOM 10898 N NH1  . ARG A 1 23  ? -9.717  0.219   7.965   1.00 0.00 ? 23  ARG A NH1  7  
ATOM 10899 N NH2  . ARG A 1 23  ? -11.205 1.833   8.634   1.00 0.00 ? 23  ARG A NH2  7  
ATOM 10900 H H    . ARG A 1 23  ? -4.262  4.707   8.031   1.00 0.00 ? 23  ARG A H    7  
ATOM 10901 H HA   . ARG A 1 23  ? -3.441  2.098   7.578   1.00 0.00 ? 23  ARG A HA   7  
ATOM 10902 H HB2  . ARG A 1 23  ? -5.400  1.398   8.777   1.00 0.00 ? 23  ARG A HB2  7  
ATOM 10903 H HB3  . ARG A 1 23  ? -4.819  2.889   9.505   1.00 0.00 ? 23  ARG A HB3  7  
ATOM 10904 H HG2  . ARG A 1 23  ? -7.015  3.404   9.408   1.00 0.00 ? 23  ARG A HG2  7  
ATOM 10905 H HG3  . ARG A 1 23  ? -6.562  3.934   7.786   1.00 0.00 ? 23  ARG A HG3  7  
ATOM 10906 H HD2  . ARG A 1 23  ? -7.554  2.128   6.772   1.00 0.00 ? 23  ARG A HD2  7  
ATOM 10907 H HD3  . ARG A 1 23  ? -7.382  1.100   8.194   1.00 0.00 ? 23  ARG A HD3  7  
ATOM 10908 H HE   . ARG A 1 23  ? -9.225  3.319   8.465   1.00 0.00 ? 23  ARG A HE   7  
ATOM 10909 H HH11 . ARG A 1 23  ? -8.792  -0.049  7.696   1.00 0.00 ? 23  ARG A HH11 7  
ATOM 10910 H HH12 . ARG A 1 23  ? -10.446 -0.465  8.001   1.00 0.00 ? 23  ARG A HH12 7  
ATOM 10911 H HH21 . ARG A 1 23  ? -11.405 2.783   8.870   1.00 0.00 ? 23  ARG A HH21 7  
ATOM 10912 H HH22 . ARG A 1 23  ? -11.931 1.147   8.668   1.00 0.00 ? 23  ARG A HH22 7  
ATOM 10913 N N    . LEU A 1 24  ? -4.980  0.912   5.899   1.00 0.00 ? 24  LEU A N    7  
ATOM 10914 C CA   . LEU A 1 24  ? -5.593  0.341   4.705   1.00 0.00 ? 24  LEU A CA   7  
ATOM 10915 C C    . LEU A 1 24  ? -6.942  -0.291  5.034   1.00 0.00 ? 24  LEU A C    7  
ATOM 10916 O O    . LEU A 1 24  ? -7.289  -0.467  6.202   1.00 0.00 ? 24  LEU A O    7  
ATOM 10917 C CB   . LEU A 1 24  ? -4.666  -0.704  4.081   1.00 0.00 ? 24  LEU A CB   7  
ATOM 10918 C CG   . LEU A 1 24  ? -3.168  -0.480  4.288   1.00 0.00 ? 24  LEU A CG   7  
ATOM 10919 C CD1  . LEU A 1 24  ? -2.374  -1.670  3.771   1.00 0.00 ? 24  LEU A CD1  7  
ATOM 10920 C CD2  . LEU A 1 24  ? -2.720  0.801   3.599   1.00 0.00 ? 24  LEU A CD2  7  
ATOM 10921 H H    . LEU A 1 24  ? -4.528  0.318   6.533   1.00 0.00 ? 24  LEU A H    7  
ATOM 10922 H HA   . LEU A 1 24  ? -5.748  1.142   3.997   1.00 0.00 ? 24  LEU A HA   7  
ATOM 10923 H HB2  . LEU A 1 24  ? -4.918  -1.664  4.505   1.00 0.00 ? 24  LEU A HB2  7  
ATOM 10924 H HB3  . LEU A 1 24  ? -4.856  -0.720  3.017   1.00 0.00 ? 24  LEU A HB3  7  
ATOM 10925 H HG   . LEU A 1 24  ? -2.967  -0.380  5.346   1.00 0.00 ? 24  LEU A HG   7  
ATOM 10926 H HD11 . LEU A 1 24  ? -2.272  -1.596  2.699   1.00 0.00 ? 24  LEU A HD11 7  
ATOM 10927 H HD12 . LEU A 1 24  ? -2.892  -2.584  4.021   1.00 0.00 ? 24  LEU A HD12 7  
ATOM 10928 H HD13 . LEU A 1 24  ? -1.395  -1.675  4.227   1.00 0.00 ? 24  LEU A HD13 7  
ATOM 10929 H HD21 . LEU A 1 24  ? -3.011  1.652   4.198   1.00 0.00 ? 24  LEU A HD21 7  
ATOM 10930 H HD22 . LEU A 1 24  ? -3.186  0.869   2.627   1.00 0.00 ? 24  LEU A HD22 7  
ATOM 10931 H HD23 . LEU A 1 24  ? -1.646  0.791   3.484   1.00 0.00 ? 24  LEU A HD23 7  
ATOM 10932 N N    . VAL A 1 25  ? -7.699  -0.632  3.996   1.00 0.00 ? 25  VAL A N    7  
ATOM 10933 C CA   . VAL A 1 25  ? -9.008  -1.248  4.174   1.00 0.00 ? 25  VAL A CA   7  
ATOM 10934 C C    . VAL A 1 25  ? -9.132  -2.525  3.351   1.00 0.00 ? 25  VAL A C    7  
ATOM 10935 O O    . VAL A 1 25  ? -9.059  -2.495  2.123   1.00 0.00 ? 25  VAL A O    7  
ATOM 10936 C CB   . VAL A 1 25  ? -10.141 -0.283  3.777   1.00 0.00 ? 25  VAL A CB   7  
ATOM 10937 C CG1  . VAL A 1 25  ? -11.472 -1.017  3.718   1.00 0.00 ? 25  VAL A CG1  7  
ATOM 10938 C CG2  . VAL A 1 25  ? -10.210 0.886   4.747   1.00 0.00 ? 25  VAL A CG2  7  
ATOM 10939 H H    . VAL A 1 25  ? -7.368  -0.467  3.088   1.00 0.00 ? 25  VAL A H    7  
ATOM 10940 H HA   . VAL A 1 25  ? -9.123  -1.493  5.220   1.00 0.00 ? 25  VAL A HA   7  
ATOM 10941 H HB   . VAL A 1 25  ? -9.927  0.106   2.792   1.00 0.00 ? 25  VAL A HB   7  
ATOM 10942 H HG11 . VAL A 1 25  ? -11.426 -1.787  2.962   1.00 0.00 ? 25  VAL A HG11 7  
ATOM 10943 H HG12 . VAL A 1 25  ? -11.678 -1.466  4.679   1.00 0.00 ? 25  VAL A HG12 7  
ATOM 10944 H HG13 . VAL A 1 25  ? -12.258 -0.318  3.471   1.00 0.00 ? 25  VAL A HG13 7  
ATOM 10945 H HG21 . VAL A 1 25  ? -11.081 1.485   4.529   1.00 0.00 ? 25  VAL A HG21 7  
ATOM 10946 H HG22 . VAL A 1 25  ? -10.273 0.511   5.758   1.00 0.00 ? 25  VAL A HG22 7  
ATOM 10947 H HG23 . VAL A 1 25  ? -9.321  1.493   4.644   1.00 0.00 ? 25  VAL A HG23 7  
ATOM 10948 N N    . PHE A 1 26  ? -9.319  -3.648  4.037   1.00 0.00 ? 26  PHE A N    7  
ATOM 10949 C CA   . PHE A 1 26  ? -9.452  -4.938  3.369   1.00 0.00 ? 26  PHE A CA   7  
ATOM 10950 C C    . PHE A 1 26  ? -10.911 -5.386  3.336   1.00 0.00 ? 26  PHE A C    7  
ATOM 10951 O O    . PHE A 1 26  ? -11.621 -5.296  4.337   1.00 0.00 ? 26  PHE A O    7  
ATOM 10952 C CB   . PHE A 1 26  ? -8.599  -5.993  4.077   1.00 0.00 ? 26  PHE A CB   7  
ATOM 10953 C CG   . PHE A 1 26  ? -7.191  -5.545  4.344   1.00 0.00 ? 26  PHE A CG   7  
ATOM 10954 C CD1  . PHE A 1 26  ? -6.889  -4.802  5.474   1.00 0.00 ? 26  PHE A CD1  7  
ATOM 10955 C CD2  . PHE A 1 26  ? -6.169  -5.866  3.465   1.00 0.00 ? 26  PHE A CD2  7  
ATOM 10956 C CE1  . PHE A 1 26  ? -5.594  -4.388  5.723   1.00 0.00 ? 26  PHE A CE1  7  
ATOM 10957 C CE2  . PHE A 1 26  ? -4.872  -5.455  3.709   1.00 0.00 ? 26  PHE A CE2  7  
ATOM 10958 C CZ   . PHE A 1 26  ? -4.584  -4.714  4.839   1.00 0.00 ? 26  PHE A CZ   7  
ATOM 10959 H H    . PHE A 1 26  ? -9.368  -3.609  5.015   1.00 0.00 ? 26  PHE A H    7  
ATOM 10960 H HA   . PHE A 1 26  ? -9.100  -4.824  2.356   1.00 0.00 ? 26  PHE A HA   7  
ATOM 10961 H HB2  . PHE A 1 26  ? -9.055  -6.237  5.025   1.00 0.00 ? 26  PHE A HB2  7  
ATOM 10962 H HB3  . PHE A 1 26  ? -8.556  -6.881  3.464   1.00 0.00 ? 26  PHE A HB3  7  
ATOM 10963 H HD1  . PHE A 1 26  ? -7.679  -4.545  6.167   1.00 0.00 ? 26  PHE A HD1  7  
ATOM 10964 H HD2  . PHE A 1 26  ? -6.393  -6.444  2.581   1.00 0.00 ? 26  PHE A HD2  7  
ATOM 10965 H HE1  . PHE A 1 26  ? -5.373  -3.809  6.608   1.00 0.00 ? 26  PHE A HE1  7  
ATOM 10966 H HE2  . PHE A 1 26  ? -4.085  -5.711  3.016   1.00 0.00 ? 26  PHE A HE2  7  
ATOM 10967 H HZ   . PHE A 1 26  ? -3.572  -4.392  5.032   1.00 0.00 ? 26  PHE A HZ   7  
ATOM 10968 N N    . SER A 1 27  ? -11.350 -5.867  2.178   1.00 0.00 ? 27  SER A N    7  
ATOM 10969 C CA   . SER A 1 27  ? -12.724 -6.324  2.012   1.00 0.00 ? 27  SER A CA   7  
ATOM 10970 C C    . SER A 1 27  ? -12.804 -7.846  2.089   1.00 0.00 ? 27  SER A C    7  
ATOM 10971 O O    . SER A 1 27  ? -13.770 -8.402  2.609   1.00 0.00 ? 27  SER A O    7  
ATOM 10972 C CB   . SER A 1 27  ? -13.287 -5.840  0.674   1.00 0.00 ? 27  SER A CB   7  
ATOM 10973 O OG   . SER A 1 27  ? -14.691 -6.024  0.615   1.00 0.00 ? 27  SER A OG   7  
ATOM 10974 H H    . SER A 1 27  ? -10.735 -5.913  1.416   1.00 0.00 ? 27  SER A H    7  
ATOM 10975 H HA   . SER A 1 27  ? -13.313 -5.904  2.813   1.00 0.00 ? 27  SER A HA   7  
ATOM 10976 H HB2  . SER A 1 27  ? -13.069 -4.790  0.553   1.00 0.00 ? 27  SER A HB2  7  
ATOM 10977 H HB3  . SER A 1 27  ? -12.829 -6.398  -0.130  1.00 0.00 ? 27  SER A HB3  7  
ATOM 10978 H HG   . SER A 1 27  ? -15.006 -5.804  -0.265  1.00 0.00 ? 27  SER A HG   7  
ATOM 10979 N N    . ALA A 1 28  ? -11.779 -8.512  1.567   1.00 0.00 ? 28  ALA A N    7  
ATOM 10980 C CA   . ALA A 1 28  ? -11.731 -9.969  1.578   1.00 0.00 ? 28  ALA A CA   7  
ATOM 10981 C C    . ALA A 1 28  ? -12.910 -10.563 0.815   1.00 0.00 ? 28  ALA A C    7  
ATOM 10982 O O    . ALA A 1 28  ? -13.634 -11.414 1.335   1.00 0.00 ? 28  ALA A O    7  
ATOM 10983 C CB   . ALA A 1 28  ? -11.711 -10.486 3.009   1.00 0.00 ? 28  ALA A CB   7  
ATOM 10984 H H    . ALA A 1 28  ? -11.038 -8.013  1.166   1.00 0.00 ? 28  ALA A H    7  
ATOM 10985 H HA   . ALA A 1 28  ? -10.813 -10.276 1.097   1.00 0.00 ? 28  ALA A HA   7  
ATOM 10986 H HB1  . ALA A 1 28  ? -12.460 -9.969  3.588   1.00 0.00 ? 28  ALA A HB1  7  
ATOM 10987 H HB2  . ALA A 1 28  ? -11.921 -11.546 3.011   1.00 0.00 ? 28  ALA A HB2  7  
ATOM 10988 H HB3  . ALA A 1 28  ? -10.737 -10.311 3.440   1.00 0.00 ? 28  ALA A HB3  7  
ATOM 10989 N N    . LEU A 1 29  ? -13.099 -10.110 -0.419  1.00 0.00 ? 29  LEU A N    7  
ATOM 10990 C CA   . LEU A 1 29  ? -14.192 -10.597 -1.254  1.00 0.00 ? 29  LEU A CA   7  
ATOM 10991 C C    . LEU A 1 29  ? -14.377 -12.102 -1.086  1.00 0.00 ? 29  LEU A C    7  
ATOM 10992 O O    . LEU A 1 29  ? -15.483 -12.621 -1.226  1.00 0.00 ? 29  LEU A O    7  
ATOM 10993 C CB   . LEU A 1 29  ? -13.926 -10.265 -2.723  1.00 0.00 ? 29  LEU A CB   7  
ATOM 10994 C CG   . LEU A 1 29  ? -13.767 -8.781  -3.057  1.00 0.00 ? 29  LEU A CG   7  
ATOM 10995 C CD1  . LEU A 1 29  ? -14.609 -7.930  -2.120  1.00 0.00 ? 29  LEU A CD1  7  
ATOM 10996 C CD2  . LEU A 1 29  ? -12.303 -8.371  -2.982  1.00 0.00 ? 29  LEU A CD2  7  
ATOM 10997 H H    . LEU A 1 29  ? -12.490 -9.433  -0.779  1.00 0.00 ? 29  LEU A H    7  
ATOM 10998 H HA   . LEU A 1 29  ? -15.097 -10.098 -0.939  1.00 0.00 ? 29  LEU A HA   7  
ATOM 10999 H HB2  . LEU A 1 29  ? -13.017 -10.768 -3.016  1.00 0.00 ? 29  LEU A HB2  7  
ATOM 11000 H HB3  . LEU A 1 29  ? -14.752 -10.649 -3.303  1.00 0.00 ? 29  LEU A HB3  7  
ATOM 11001 H HG   . LEU A 1 29  ? -14.113 -8.607  -4.067  1.00 0.00 ? 29  LEU A HG   7  
ATOM 11002 H HD11 . LEU A 1 29  ? -15.647 -8.212  -2.213  1.00 0.00 ? 29  LEU A HD11 7  
ATOM 11003 H HD12 . LEU A 1 29  ? -14.495 -6.888  -2.380  1.00 0.00 ? 29  LEU A HD12 7  
ATOM 11004 H HD13 . LEU A 1 29  ? -14.283 -8.084  -1.102  1.00 0.00 ? 29  LEU A HD13 7  
ATOM 11005 H HD21 . LEU A 1 29  ? -12.213 -7.462  -2.406  1.00 0.00 ? 29  LEU A HD21 7  
ATOM 11006 H HD22 . LEU A 1 29  ? -11.926 -8.204  -3.980  1.00 0.00 ? 29  LEU A HD22 7  
ATOM 11007 H HD23 . LEU A 1 29  ? -11.733 -9.157  -2.509  1.00 0.00 ? 29  LEU A HD23 7  
ATOM 11008 N N    . GLY A 1 30  ? -13.284 -12.797 -0.785  1.00 0.00 ? 30  GLY A N    7  
ATOM 11009 C CA   . GLY A 1 30  ? -13.347 -14.235 -0.601  1.00 0.00 ? 30  GLY A CA   7  
ATOM 11010 C C    . GLY A 1 30  ? -12.080 -14.798 0.011   1.00 0.00 ? 30  GLY A C    7  
ATOM 11011 O O    . GLY A 1 30  ? -11.231 -14.064 0.517   1.00 0.00 ? 30  GLY A O    7  
ATOM 11012 H H    . GLY A 1 30  ? -12.428 -12.330 -0.686  1.00 0.00 ? 30  GLY A H    7  
ATOM 11013 H HA2  . GLY A 1 30  ? -14.181 -14.469 0.045   1.00 0.00 ? 30  GLY A HA2  7  
ATOM 11014 H HA3  . GLY A 1 30  ? -13.507 -14.703 -1.562  1.00 0.00 ? 30  GLY A HA3  7  
ATOM 11015 N N    . PRO A 1 31  ? -11.940 -16.131 -0.029  1.00 0.00 ? 31  PRO A N    7  
ATOM 11016 C CA   . PRO A 1 31  ? -10.770 -16.821 0.523   1.00 0.00 ? 31  PRO A CA   7  
ATOM 11017 C C    . PRO A 1 31  ? -9.508  -16.566 -0.294  1.00 0.00 ? 31  PRO A C    7  
ATOM 11018 O O    . PRO A 1 31  ? -8.395  -16.618 0.231   1.00 0.00 ? 31  PRO A O    7  
ATOM 11019 C CB   . PRO A 1 31  ? -11.164 -18.299 0.452   1.00 0.00 ? 31  PRO A CB   7  
ATOM 11020 C CG   . PRO A 1 31  ? -12.164 -18.372 -0.650  1.00 0.00 ? 31  PRO A CG   7  
ATOM 11021 C CD   . PRO A 1 31  ? -12.913 -17.068 -0.616  1.00 0.00 ? 31  PRO A CD   7  
ATOM 11022 H HA   . PRO A 1 31  ? -10.594 -16.543 1.552   1.00 0.00 ? 31  PRO A HA   7  
ATOM 11023 H HB2  . PRO A 1 31  ? -10.290 -18.896 0.233   1.00 0.00 ? 31  PRO A HB2  7  
ATOM 11024 H HB3  . PRO A 1 31  ? -11.591 -18.607 1.394   1.00 0.00 ? 31  PRO A HB3  7  
ATOM 11025 H HG2  . PRO A 1 31  ? -11.660 -18.490 -1.597  1.00 0.00 ? 31  PRO A HG2  7  
ATOM 11026 H HG3  . PRO A 1 31  ? -12.841 -19.196 -0.477  1.00 0.00 ? 31  PRO A HG3  7  
ATOM 11027 H HD2  . PRO A 1 31  ? -13.186 -16.764 -1.616  1.00 0.00 ? 31  PRO A HD2  7  
ATOM 11028 H HD3  . PRO A 1 31  ? -13.790 -17.152 0.008   1.00 0.00 ? 31  PRO A HD3  7  
ATOM 11029 N N    . THR A 1 32  ? -9.688  -16.290 -1.582  1.00 0.00 ? 32  THR A N    7  
ATOM 11030 C CA   . THR A 1 32  ? -8.563  -16.027 -2.471  1.00 0.00 ? 32  THR A CA   7  
ATOM 11031 C C    . THR A 1 32  ? -8.689  -14.656 -3.126  1.00 0.00 ? 32  THR A C    7  
ATOM 11032 O O    . THR A 1 32  ? -8.075  -14.394 -4.160  1.00 0.00 ? 32  THR A O    7  
ATOM 11033 C CB   . THR A 1 32  ? -8.454  -17.101 -3.571  1.00 0.00 ? 32  THR A CB   7  
ATOM 11034 O OG1  . THR A 1 32  ? -9.729  -17.295 -4.193  1.00 0.00 ? 32  THR A OG1  7  
ATOM 11035 C CG2  . THR A 1 32  ? -7.960  -18.418 -2.994  1.00 0.00 ? 32  THR A CG2  7  
ATOM 11036 H H    . THR A 1 32  ? -10.599 -16.263 -1.941  1.00 0.00 ? 32  THR A H    7  
ATOM 11037 H HA   . THR A 1 32  ? -7.659  -16.053 -1.882  1.00 0.00 ? 32  THR A HA   7  
ATOM 11038 H HB   . THR A 1 32  ? -7.747  -16.762 -4.314  1.00 0.00 ? 32  THR A HB   7  
ATOM 11039 H HG1  . THR A 1 32  ? -9.613  -17.772 -5.019  1.00 0.00 ? 32  THR A HG1  7  
ATOM 11040 H HG21 . THR A 1 32  ? -8.241  -18.483 -1.953  1.00 0.00 ? 32  THR A HG21 7  
ATOM 11041 H HG22 . THR A 1 32  ? -6.884  -18.468 -3.079  1.00 0.00 ? 32  THR A HG22 7  
ATOM 11042 H HG23 . THR A 1 32  ? -8.403  -19.239 -3.538  1.00 0.00 ? 32  THR A HG23 7  
ATOM 11043 N N    . SER A 1 33  ? -9.487  -13.786 -2.517  1.00 0.00 ? 33  SER A N    7  
ATOM 11044 C CA   . SER A 1 33  ? -9.695  -12.441 -3.043  1.00 0.00 ? 33  SER A CA   7  
ATOM 11045 C C    . SER A 1 33  ? -9.680  -11.410 -1.919  1.00 0.00 ? 33  SER A C    7  
ATOM 11046 O O    . SER A 1 33  ? -10.059 -11.705 -0.784  1.00 0.00 ? 33  SER A O    7  
ATOM 11047 C CB   . SER A 1 33  ? -11.022 -12.367 -3.801  1.00 0.00 ? 33  SER A CB   7  
ATOM 11048 O OG   . SER A 1 33  ? -12.042 -13.072 -3.114  1.00 0.00 ? 33  SER A OG   7  
ATOM 11049 H H    . SER A 1 33  ? -9.949  -14.055 -1.695  1.00 0.00 ? 33  SER A H    7  
ATOM 11050 H HA   . SER A 1 33  ? -8.887  -12.224 -3.726  1.00 0.00 ? 33  SER A HA   7  
ATOM 11051 H HB2  . SER A 1 33  ? -11.319 -11.335 -3.901  1.00 0.00 ? 33  SER A HB2  7  
ATOM 11052 H HB3  . SER A 1 33  ? -10.897 -12.803 -4.782  1.00 0.00 ? 33  SER A HB3  7  
ATOM 11053 H HG   . SER A 1 33  ? -11.660 -13.542 -2.369  1.00 0.00 ? 33  SER A HG   7  
ATOM 11054 N N    . LEU A 1 34  ? -9.240  -10.199 -2.242  1.00 0.00 ? 34  LEU A N    7  
ATOM 11055 C CA   . LEU A 1 34  ? -9.176  -9.121  -1.261  1.00 0.00 ? 34  LEU A CA   7  
ATOM 11056 C C    . LEU A 1 34  ? -9.225  -7.759  -1.944  1.00 0.00 ? 34  LEU A C    7  
ATOM 11057 O O    . LEU A 1 34  ? -9.083  -7.659  -3.163  1.00 0.00 ? 34  LEU A O    7  
ATOM 11058 C CB   . LEU A 1 34  ? -7.898  -9.240  -0.427  1.00 0.00 ? 34  LEU A CB   7  
ATOM 11059 C CG   . LEU A 1 34  ? -8.013  -10.050 0.865   1.00 0.00 ? 34  LEU A CG   7  
ATOM 11060 C CD1  . LEU A 1 34  ? -6.692  -10.730 1.188   1.00 0.00 ? 34  LEU A CD1  7  
ATOM 11061 C CD2  . LEU A 1 34  ? -8.450  -9.156  2.017   1.00 0.00 ? 34  LEU A CD2  7  
ATOM 11062 H H    . LEU A 1 34  ? -8.952  -10.024 -3.162  1.00 0.00 ? 34  LEU A H    7  
ATOM 11063 H HA   . LEU A 1 34  ? -10.031 -9.215  -0.609  1.00 0.00 ? 34  LEU A HA   7  
ATOM 11064 H HB2  . LEU A 1 34  ? -7.144  -9.706  -1.043  1.00 0.00 ? 34  LEU A HB2  7  
ATOM 11065 H HB3  . LEU A 1 34  ? -7.581  -8.241  -0.166  1.00 0.00 ? 34  LEU A HB3  7  
ATOM 11066 H HG   . LEU A 1 34  ? -8.761  -10.820 0.735   1.00 0.00 ? 34  LEU A HG   7  
ATOM 11067 H HD11 . LEU A 1 34  ? -6.882  -11.720 1.573   1.00 0.00 ? 34  LEU A HD11 7  
ATOM 11068 H HD12 . LEU A 1 34  ? -6.160  -10.151 1.929   1.00 0.00 ? 34  LEU A HD12 7  
ATOM 11069 H HD13 . LEU A 1 34  ? -6.095  -10.800 0.290   1.00 0.00 ? 34  LEU A HD13 7  
ATOM 11070 H HD21 . LEU A 1 34  ? -9.495  -9.329  2.230   1.00 0.00 ? 34  LEU A HD21 7  
ATOM 11071 H HD22 . LEU A 1 34  ? -8.305  -8.121  1.744   1.00 0.00 ? 34  LEU A HD22 7  
ATOM 11072 H HD23 . LEU A 1 34  ? -7.861  -9.384  2.893   1.00 0.00 ? 34  LEU A HD23 7  
ATOM 11073 N N    . ARG A 1 35  ? -9.426  -6.711  -1.150  1.00 0.00 ? 35  ARG A N    7  
ATOM 11074 C CA   . ARG A 1 35  ? -9.493  -5.354  -1.679  1.00 0.00 ? 35  ARG A CA   7  
ATOM 11075 C C    . ARG A 1 35  ? -8.863  -4.361  -0.707  1.00 0.00 ? 35  ARG A C    7  
ATOM 11076 O O    . ARG A 1 35  ? -9.452  -4.023  0.320   1.00 0.00 ? 35  ARG A O    7  
ATOM 11077 C CB   . ARG A 1 35  ? -10.946 -4.963  -1.955  1.00 0.00 ? 35  ARG A CB   7  
ATOM 11078 C CG   . ARG A 1 35  ? -11.100 -3.571  -2.545  1.00 0.00 ? 35  ARG A CG   7  
ATOM 11079 C CD   . ARG A 1 35  ? -12.560 -3.150  -2.606  1.00 0.00 ? 35  ARG A CD   7  
ATOM 11080 N NE   . ARG A 1 35  ? -12.732 -1.863  -3.275  1.00 0.00 ? 35  ARG A NE   7  
ATOM 11081 C CZ   . ARG A 1 35  ? -12.611 -0.693  -2.658  1.00 0.00 ? 35  ARG A CZ   7  
ATOM 11082 N NH1  . ARG A 1 35  ? -12.318 -0.648  -1.366  1.00 0.00 ? 35  ARG A NH1  7  
ATOM 11083 N NH2  . ARG A 1 35  ? -12.781 0.436   -3.335  1.00 0.00 ? 35  ARG A NH2  7  
ATOM 11084 H H    . ARG A 1 35  ? -9.532  -6.855  -0.187  1.00 0.00 ? 35  ARG A H    7  
ATOM 11085 H HA   . ARG A 1 35  ? -8.941  -5.332  -2.606  1.00 0.00 ? 35  ARG A HA   7  
ATOM 11086 H HB2  . ARG A 1 35  ? -11.372 -5.673  -2.648  1.00 0.00 ? 35  ARG A HB2  7  
ATOM 11087 H HB3  . ARG A 1 35  ? -11.498 -5.001  -1.028  1.00 0.00 ? 35  ARG A HB3  7  
ATOM 11088 H HG2  . ARG A 1 35  ? -10.560 -2.867  -1.930  1.00 0.00 ? 35  ARG A HG2  7  
ATOM 11089 H HG3  . ARG A 1 35  ? -10.691 -3.567  -3.545  1.00 0.00 ? 35  ARG A HG3  7  
ATOM 11090 H HD2  . ARG A 1 35  ? -13.115 -3.902  -3.147  1.00 0.00 ? 35  ARG A HD2  7  
ATOM 11091 H HD3  . ARG A 1 35  ? -12.941 -3.076  -1.599  1.00 0.00 ? 35  ARG A HD3  7  
ATOM 11092 H HE   . ARG A 1 35  ? -12.948 -1.873  -4.230  1.00 0.00 ? 35  ARG A HE   7  
ATOM 11093 H HH11 . ARG A 1 35  ? -12.188 -1.497  -0.854  1.00 0.00 ? 35  ARG A HH11 7  
ATOM 11094 H HH12 . ARG A 1 35  ? -12.227 0.235   -0.904  1.00 0.00 ? 35  ARG A HH12 7  
ATOM 11095 H HH21 . ARG A 1 35  ? -13.001 0.406   -4.309  1.00 0.00 ? 35  ARG A HH21 7  
ATOM 11096 H HH22 . ARG A 1 35  ? -12.690 1.316   -2.870  1.00 0.00 ? 35  ARG A HH22 7  
ATOM 11097 N N    . VAL A 1 36  ? -7.663  -3.896  -1.039  1.00 0.00 ? 36  VAL A N    7  
ATOM 11098 C CA   . VAL A 1 36  ? -6.953  -2.941  -0.196  1.00 0.00 ? 36  VAL A CA   7  
ATOM 11099 C C    . VAL A 1 36  ? -7.205  -1.509  -0.656  1.00 0.00 ? 36  VAL A C    7  
ATOM 11100 O O    . VAL A 1 36  ? -7.048  -1.188  -1.834  1.00 0.00 ? 36  VAL A O    7  
ATOM 11101 C CB   . VAL A 1 36  ? -5.437  -3.209  -0.198  1.00 0.00 ? 36  VAL A CB   7  
ATOM 11102 C CG1  . VAL A 1 36  ? -4.680  -2.002  0.335   1.00 0.00 ? 36  VAL A CG1  7  
ATOM 11103 C CG2  . VAL A 1 36  ? -5.115  -4.453  0.618   1.00 0.00 ? 36  VAL A CG2  7  
ATOM 11104 H H    . VAL A 1 36  ? -7.245  -4.202  -1.870  1.00 0.00 ? 36  VAL A H    7  
ATOM 11105 H HA   . VAL A 1 36  ? -7.317  -3.053  0.815   1.00 0.00 ? 36  VAL A HA   7  
ATOM 11106 H HB   . VAL A 1 36  ? -5.123  -3.382  -1.217  1.00 0.00 ? 36  VAL A HB   7  
ATOM 11107 H HG11 . VAL A 1 36  ? -4.949  -1.836  1.368   1.00 0.00 ? 36  VAL A HG11 7  
ATOM 11108 H HG12 . VAL A 1 36  ? -3.617  -2.183  0.264   1.00 0.00 ? 36  VAL A HG12 7  
ATOM 11109 H HG13 . VAL A 1 36  ? -4.937  -1.130  -0.248  1.00 0.00 ? 36  VAL A HG13 7  
ATOM 11110 H HG21 . VAL A 1 36  ? -4.091  -4.745  0.441   1.00 0.00 ? 36  VAL A HG21 7  
ATOM 11111 H HG22 . VAL A 1 36  ? -5.254  -4.240  1.667   1.00 0.00 ? 36  VAL A HG22 7  
ATOM 11112 H HG23 . VAL A 1 36  ? -5.775  -5.257  0.324   1.00 0.00 ? 36  VAL A HG23 7  
ATOM 11113 N N    . SER A 1 37  ? -7.597  -0.652  0.282   1.00 0.00 ? 37  SER A N    7  
ATOM 11114 C CA   . SER A 1 37  ? -7.874  0.745   -0.027  1.00 0.00 ? 37  SER A CA   7  
ATOM 11115 C C    . SER A 1 37  ? -7.181  1.670   0.969   1.00 0.00 ? 37  SER A C    7  
ATOM 11116 O O    . SER A 1 37  ? -7.276  1.477   2.181   1.00 0.00 ? 37  SER A O    7  
ATOM 11117 C CB   . SER A 1 37  ? -9.382  1.003   -0.016  1.00 0.00 ? 37  SER A CB   7  
ATOM 11118 O OG   . SER A 1 37  ? -9.662  2.385   0.124   1.00 0.00 ? 37  SER A OG   7  
ATOM 11119 H H    . SER A 1 37  ? -7.705  -0.969  1.203   1.00 0.00 ? 37  SER A H    7  
ATOM 11120 H HA   . SER A 1 37  ? -7.490  0.949   -1.016  1.00 0.00 ? 37  SER A HA   7  
ATOM 11121 H HB2  . SER A 1 37  ? -9.812  0.653   -0.942  1.00 0.00 ? 37  SER A HB2  7  
ATOM 11122 H HB3  . SER A 1 37  ? -9.829  0.471   0.812   1.00 0.00 ? 37  SER A HB3  7  
ATOM 11123 H HG   . SER A 1 37  ? -10.459 2.602   -0.367  1.00 0.00 ? 37  SER A HG   7  
ATOM 11124 N N    . TRP A 1 38  ? -6.484  2.674   0.449   1.00 0.00 ? 38  TRP A N    7  
ATOM 11125 C CA   . TRP A 1 38  ? -5.775  3.629   1.292   1.00 0.00 ? 38  TRP A CA   7  
ATOM 11126 C C    . TRP A 1 38  ? -6.314  5.040   1.088   1.00 0.00 ? 38  TRP A C    7  
ATOM 11127 O O    . TRP A 1 38  ? -7.284  5.244   0.359   1.00 0.00 ? 38  TRP A O    7  
ATOM 11128 C CB   . TRP A 1 38  ? -4.276  3.594   0.988   1.00 0.00 ? 38  TRP A CB   7  
ATOM 11129 C CG   . TRP A 1 38  ? -3.964  3.696   -0.474  1.00 0.00 ? 38  TRP A CG   7  
ATOM 11130 C CD1  . TRP A 1 38  ? -3.444  4.777   -1.128  1.00 0.00 ? 38  TRP A CD1  7  
ATOM 11131 C CD2  . TRP A 1 38  ? -4.153  2.679   -1.464  1.00 0.00 ? 38  TRP A CD2  7  
ATOM 11132 N NE1  . TRP A 1 38  ? -3.299  4.493   -2.465  1.00 0.00 ? 38  TRP A NE1  7  
ATOM 11133 C CE2  . TRP A 1 38  ? -3.726  3.212   -2.696  1.00 0.00 ? 38  TRP A CE2  7  
ATOM 11134 C CE3  . TRP A 1 38  ? -4.640  1.370   -1.430  1.00 0.00 ? 38  TRP A CE3  7  
ATOM 11135 C CZ2  . TRP A 1 38  ? -3.774  2.481   -3.880  1.00 0.00 ? 38  TRP A CZ2  7  
ATOM 11136 C CZ3  . TRP A 1 38  ? -4.686  0.645   -2.606  1.00 0.00 ? 38  TRP A CZ3  7  
ATOM 11137 C CH2  . TRP A 1 38  ? -4.255  1.201   -3.817  1.00 0.00 ? 38  TRP A CH2  7  
ATOM 11138 H H    . TRP A 1 38  ? -6.446  2.775   -0.526  1.00 0.00 ? 38  TRP A H    7  
ATOM 11139 H HA   . TRP A 1 38  ? -5.931  3.341   2.321   1.00 0.00 ? 38  TRP A HA   7  
ATOM 11140 H HB2  . TRP A 1 38  ? -3.794  4.419   1.490   1.00 0.00 ? 38  TRP A HB2  7  
ATOM 11141 H HB3  . TRP A 1 38  ? -3.864  2.664   1.353   1.00 0.00 ? 38  TRP A HB3  7  
ATOM 11142 H HD1  . TRP A 1 38  ? -3.191  5.712   -0.651  1.00 0.00 ? 38  TRP A HD1  7  
ATOM 11143 H HE1  . TRP A 1 38  ? -2.946  5.108   -3.141  1.00 0.00 ? 38  TRP A HE1  7  
ATOM 11144 H HE3  . TRP A 1 38  ? -4.977  0.923   -0.506  1.00 0.00 ? 38  TRP A HE3  7  
ATOM 11145 H HZ2  . TRP A 1 38  ? -3.444  2.895   -4.822  1.00 0.00 ? 38  TRP A HZ2  7  
ATOM 11146 H HZ3  . TRP A 1 38  ? -5.060  -0.368  -2.598  1.00 0.00 ? 38  TRP A HZ3  7  
ATOM 11147 H HH2  . TRP A 1 38  ? -4.309  0.599   -4.711  1.00 0.00 ? 38  TRP A HH2  7  
ATOM 11148 N N    . GLN A 1 39  ? -5.679  6.011   1.737   1.00 0.00 ? 39  GLN A N    7  
ATOM 11149 C CA   . GLN A 1 39  ? -6.097  7.404   1.626   1.00 0.00 ? 39  GLN A CA   7  
ATOM 11150 C C    . GLN A 1 39  ? -4.993  8.256   1.008   1.00 0.00 ? 39  GLN A C    7  
ATOM 11151 O O    . GLN A 1 39  ? -3.860  8.262   1.487   1.00 0.00 ? 39  GLN A O    7  
ATOM 11152 C CB   . GLN A 1 39  ? -6.474  7.956   3.002   1.00 0.00 ? 39  GLN A CB   7  
ATOM 11153 C CG   . GLN A 1 39  ? -7.199  9.291   2.943   1.00 0.00 ? 39  GLN A CG   7  
ATOM 11154 C CD   . GLN A 1 39  ? -8.665  9.144   2.586   1.00 0.00 ? 39  GLN A CD   7  
ATOM 11155 O OE1  . GLN A 1 39  ? -9.015  8.463   1.622   1.00 0.00 ? 39  GLN A OE1  7  
ATOM 11156 N NE2  . GLN A 1 39  ? -9.531  9.785   3.362   1.00 0.00 ? 39  GLN A NE2  7  
ATOM 11157 H H    . GLN A 1 39  ? -4.912  5.786   2.303   1.00 0.00 ? 39  GLN A H    7  
ATOM 11158 H HA   . GLN A 1 39  ? -6.964  7.439   0.984   1.00 0.00 ? 39  GLN A HA   7  
ATOM 11159 H HB2  . GLN A 1 39  ? -7.116  7.244   3.499   1.00 0.00 ? 39  GLN A HB2  7  
ATOM 11160 H HB3  . GLN A 1 39  ? -5.574  8.085   3.584   1.00 0.00 ? 39  GLN A HB3  7  
ATOM 11161 H HG2  . GLN A 1 39  ? -7.126  9.768   3.909   1.00 0.00 ? 39  GLN A HG2  7  
ATOM 11162 H HG3  . GLN A 1 39  ? -6.722  9.913   2.200   1.00 0.00 ? 39  GLN A HG3  7  
ATOM 11163 H HE21 . GLN A 1 39  ? -9.179  10.311  4.111   1.00 0.00 ? 39  GLN A HE21 7  
ATOM 11164 H HE22 . GLN A 1 39  ? -10.484 9.709   3.153   1.00 0.00 ? 39  GLN A HE22 7  
ATOM 11165 N N    . GLU A 1 40  ? -5.333  8.974   -0.058  1.00 0.00 ? 40  GLU A N    7  
ATOM 11166 C CA   . GLU A 1 40  ? -4.370  9.829   -0.742  1.00 0.00 ? 40  GLU A CA   7  
ATOM 11167 C C    . GLU A 1 40  ? -3.585  10.673  0.259   1.00 0.00 ? 40  GLU A C    7  
ATOM 11168 O O    . GLU A 1 40  ? -4.090  11.647  0.817   1.00 0.00 ? 40  GLU A O    7  
ATOM 11169 C CB   . GLU A 1 40  ? -5.083  10.738  -1.744  1.00 0.00 ? 40  GLU A CB   7  
ATOM 11170 C CG   . GLU A 1 40  ? -4.145  11.665  -2.499  1.00 0.00 ? 40  GLU A CG   7  
ATOM 11171 C CD   . GLU A 1 40  ? -4.842  12.911  -3.010  1.00 0.00 ? 40  GLU A CD   7  
ATOM 11172 O OE1  . GLU A 1 40  ? -4.890  13.912  -2.264  1.00 0.00 ? 40  GLU A OE1  7  
ATOM 11173 O OE2  . GLU A 1 40  ? -5.340  12.886  -4.155  1.00 0.00 ? 40  GLU A OE2  7  
ATOM 11174 H H    . GLU A 1 40  ? -6.253  8.927   -0.393  1.00 0.00 ? 40  GLU A H    7  
ATOM 11175 H HA   . GLU A 1 40  ? -3.681  9.191   -1.275  1.00 0.00 ? 40  GLU A HA   7  
ATOM 11176 H HB2  . GLU A 1 40  ? -5.604  10.123  -2.463  1.00 0.00 ? 40  GLU A HB2  7  
ATOM 11177 H HB3  . GLU A 1 40  ? -5.803  11.344  -1.214  1.00 0.00 ? 40  GLU A HB3  7  
ATOM 11178 H HG2  . GLU A 1 40  ? -3.346  11.965  -1.837  1.00 0.00 ? 40  GLU A HG2  7  
ATOM 11179 H HG3  . GLU A 1 40  ? -3.731  11.130  -3.342  1.00 0.00 ? 40  GLU A HG3  7  
ATOM 11180 N N    . PRO A 1 41  ? -2.321  10.290  0.492   1.00 0.00 ? 41  PRO A N    7  
ATOM 11181 C CA   . PRO A 1 41  ? -1.440  10.997  1.426   1.00 0.00 ? 41  PRO A CA   7  
ATOM 11182 C C    . PRO A 1 41  ? -1.032  12.373  0.909   1.00 0.00 ? 41  PRO A C    7  
ATOM 11183 O O    . PRO A 1 41  ? -1.287  12.713  -0.246  1.00 0.00 ? 41  PRO A O    7  
ATOM 11184 C CB   . PRO A 1 41  ? -0.219  10.079  1.525   1.00 0.00 ? 41  PRO A CB   7  
ATOM 11185 C CG   . PRO A 1 41  ? -0.212  9.318   0.245   1.00 0.00 ? 41  PRO A CG   7  
ATOM 11186 C CD   . PRO A 1 41  ? -1.655  9.138   -0.138  1.00 0.00 ? 41  PRO A CD   7  
ATOM 11187 H HA   . PRO A 1 41  ? -1.895  11.101  2.400   1.00 0.00 ? 41  PRO A HA   7  
ATOM 11188 H HB2  . PRO A 1 41  ? 0.676   10.677  1.636   1.00 0.00 ? 41  PRO A HB2  7  
ATOM 11189 H HB3  . PRO A 1 41  ? -0.326  9.422   2.374   1.00 0.00 ? 41  PRO A HB3  7  
ATOM 11190 H HG2  . PRO A 1 41  ? 0.310   9.881   -0.514  1.00 0.00 ? 41  PRO A HG2  7  
ATOM 11191 H HG3  . PRO A 1 41  ? 0.259   8.358   0.391   1.00 0.00 ? 41  PRO A HG3  7  
ATOM 11192 H HD2  . PRO A 1 41  ? -1.767  9.167   -1.211  1.00 0.00 ? 41  PRO A HD2  7  
ATOM 11193 H HD3  . PRO A 1 41  ? -2.037  8.209   0.258   1.00 0.00 ? 41  PRO A HD3  7  
ATOM 11194 N N    . ARG A 1 42  ? -0.396  13.159  1.772   1.00 0.00 ? 42  ARG A N    7  
ATOM 11195 C CA   . ARG A 1 42  ? 0.046   14.498  1.402   1.00 0.00 ? 42  ARG A CA   7  
ATOM 11196 C C    . ARG A 1 42  ? 1.346   14.440  0.604   1.00 0.00 ? 42  ARG A C    7  
ATOM 11197 O O    . ARG A 1 42  ? 2.163   13.538  0.794   1.00 0.00 ? 42  ARG A O    7  
ATOM 11198 C CB   . ARG A 1 42  ? 0.242   15.358  2.652   1.00 0.00 ? 42  ARG A CB   7  
ATOM 11199 C CG   . ARG A 1 42  ? 1.472   14.984  3.462   1.00 0.00 ? 42  ARG A CG   7  
ATOM 11200 C CD   . ARG A 1 42  ? 1.658   15.911  4.653   1.00 0.00 ? 42  ARG A CD   7  
ATOM 11201 N NE   . ARG A 1 42  ? 2.776   15.499  5.498   1.00 0.00 ? 42  ARG A NE   7  
ATOM 11202 C CZ   . ARG A 1 42  ? 4.050   15.689  5.176   1.00 0.00 ? 42  ARG A CZ   7  
ATOM 11203 N NH1  . ARG A 1 42  ? 4.367   16.282  4.033   1.00 0.00 ? 42  ARG A NH1  7  
ATOM 11204 N NH2  . ARG A 1 42  ? 5.011   15.286  5.998   1.00 0.00 ? 42  ARG A NH2  7  
ATOM 11205 H H    . ARG A 1 42  ? -0.222  12.832  2.679   1.00 0.00 ? 42  ARG A H    7  
ATOM 11206 H HA   . ARG A 1 42  ? -0.721  14.943  0.786   1.00 0.00 ? 42  ARG A HA   7  
ATOM 11207 H HB2  . ARG A 1 42  ? 0.335   16.391  2.353   1.00 0.00 ? 42  ARG A HB2  7  
ATOM 11208 H HB3  . ARG A 1 42  ? -0.626  15.251  3.286   1.00 0.00 ? 42  ARG A HB3  7  
ATOM 11209 H HG2  . ARG A 1 42  ? 1.361   13.972  3.822   1.00 0.00 ? 42  ARG A HG2  7  
ATOM 11210 H HG3  . ARG A 1 42  ? 2.343   15.048  2.827   1.00 0.00 ? 42  ARG A HG3  7  
ATOM 11211 H HD2  . ARG A 1 42  ? 1.845   16.910  4.288   1.00 0.00 ? 42  ARG A HD2  7  
ATOM 11212 H HD3  . ARG A 1 42  ? 0.753   15.906  5.240   1.00 0.00 ? 42  ARG A HD3  7  
ATOM 11213 H HE   . ARG A 1 42  ? 2.564   15.060  6.347   1.00 0.00 ? 42  ARG A HE   7  
ATOM 11214 H HH11 . ARG A 1 42  ? 3.645   16.587  3.412   1.00 0.00 ? 42  ARG A HH11 7  
ATOM 11215 H HH12 . ARG A 1 42  ? 5.328   16.424  3.793   1.00 0.00 ? 42  ARG A HH12 7  
ATOM 11216 H HH21 . ARG A 1 42  ? 4.775   14.839  6.860   1.00 0.00 ? 42  ARG A HH21 7  
ATOM 11217 H HH22 . ARG A 1 42  ? 5.969   15.429  5.754   1.00 0.00 ? 42  ARG A HH22 7  
ATOM 11218 N N    . CYS A 1 43  ? 1.529   15.406  -0.289  1.00 0.00 ? 43  CYS A N    7  
ATOM 11219 C CA   . CYS A 1 43  ? 2.728   15.464  -1.118  1.00 0.00 ? 43  CYS A CA   7  
ATOM 11220 C C    . CYS A 1 43  ? 2.778   16.766  -1.911  1.00 0.00 ? 43  CYS A C    7  
ATOM 11221 O O    . CYS A 1 43  ? 1.887   17.050  -2.711  1.00 0.00 ? 43  CYS A O    7  
ATOM 11222 C CB   . CYS A 1 43  ? 2.773   14.270  -2.071  1.00 0.00 ? 43  CYS A CB   7  
ATOM 11223 S SG   . CYS A 1 43  ? 4.436   13.838  -2.636  1.00 0.00 ? 43  CYS A SG   7  
ATOM 11224 H H    . CYS A 1 43  ? 0.842   16.097  -0.395  1.00 0.00 ? 43  CYS A H    7  
ATOM 11225 H HA   . CYS A 1 43  ? 3.585   15.424  -0.462  1.00 0.00 ? 43  CYS A HA   7  
ATOM 11226 H HB2  . CYS A 1 43  ? 2.362   13.404  -1.572  1.00 0.00 ? 43  CYS A HB2  7  
ATOM 11227 H HB3  . CYS A 1 43  ? 2.176   14.491  -2.943  1.00 0.00 ? 43  CYS A HB3  7  
ATOM 11228 H HG   . CYS A 1 43  ? 4.391   12.614  -3.139  1.00 0.00 ? 43  CYS A HG   7  
ATOM 11229 N N    . GLU A 1 44  ? 3.825   17.553  -1.683  1.00 0.00 ? 44  GLU A N    7  
ATOM 11230 C CA   . GLU A 1 44  ? 3.989   18.825  -2.375  1.00 0.00 ? 44  GLU A CA   7  
ATOM 11231 C C    . GLU A 1 44  ? 3.694   18.676  -3.865  1.00 0.00 ? 44  GLU A C    7  
ATOM 11232 O O    . GLU A 1 44  ? 3.144   19.581  -4.493  1.00 0.00 ? 44  GLU A O    7  
ATOM 11233 C CB   . GLU A 1 44  ? 5.409   19.361  -2.176  1.00 0.00 ? 44  GLU A CB   7  
ATOM 11234 C CG   . GLU A 1 44  ? 5.612   20.066  -0.846  1.00 0.00 ? 44  GLU A CG   7  
ATOM 11235 C CD   . GLU A 1 44  ? 6.782   21.030  -0.870  1.00 0.00 ? 44  GLU A CD   7  
ATOM 11236 O OE1  . GLU A 1 44  ? 7.935   20.561  -0.979  1.00 0.00 ? 44  GLU A OE1  7  
ATOM 11237 O OE2  . GLU A 1 44  ? 6.546   22.253  -0.780  1.00 0.00 ? 44  GLU A OE2  7  
ATOM 11238 H H    . GLU A 1 44  ? 4.503   17.271  -1.033  1.00 0.00 ? 44  GLU A H    7  
ATOM 11239 H HA   . GLU A 1 44  ? 3.287   19.527  -1.950  1.00 0.00 ? 44  GLU A HA   7  
ATOM 11240 H HB2  . GLU A 1 44  ? 6.103   18.535  -2.233  1.00 0.00 ? 44  GLU A HB2  7  
ATOM 11241 H HB3  . GLU A 1 44  ? 5.630   20.061  -2.968  1.00 0.00 ? 44  GLU A HB3  7  
ATOM 11242 H HG2  . GLU A 1 44  ? 4.716   20.618  -0.605  1.00 0.00 ? 44  GLU A HG2  7  
ATOM 11243 H HG3  . GLU A 1 44  ? 5.792   19.323  -0.083  1.00 0.00 ? 44  GLU A HG3  7  
ATOM 11244 N N    . ARG A 1 45  ? 4.065   17.529  -4.424  1.00 0.00 ? 45  ARG A N    7  
ATOM 11245 C CA   . ARG A 1 45  ? 3.842   17.261  -5.839  1.00 0.00 ? 45  ARG A CA   7  
ATOM 11246 C C    . ARG A 1 45  ? 2.695   16.273  -6.032  1.00 0.00 ? 45  ARG A C    7  
ATOM 11247 O O    . ARG A 1 45  ? 2.403   15.447  -5.167  1.00 0.00 ? 45  ARG A O    7  
ATOM 11248 C CB   . ARG A 1 45  ? 5.116   16.711  -6.483  1.00 0.00 ? 45  ARG A CB   7  
ATOM 11249 C CG   . ARG A 1 45  ? 6.314   17.638  -6.352  1.00 0.00 ? 45  ARG A CG   7  
ATOM 11250 C CD   . ARG A 1 45  ? 6.014   19.018  -6.915  1.00 0.00 ? 45  ARG A CD   7  
ATOM 11251 N NE   . ARG A 1 45  ? 7.161   19.915  -6.805  1.00 0.00 ? 45  ARG A NE   7  
ATOM 11252 C CZ   . ARG A 1 45  ? 8.196   19.890  -7.638  1.00 0.00 ? 45  ARG A CZ   7  
ATOM 11253 N NH1  . ARG A 1 45  ? 8.227   19.018  -8.636  1.00 0.00 ? 45  ARG A NH1  7  
ATOM 11254 N NH2  . ARG A 1 45  ? 9.203   20.738  -7.473  1.00 0.00 ? 45  ARG A NH2  7  
ATOM 11255 H H    . ARG A 1 45  ? 4.499   16.846  -3.871  1.00 0.00 ? 45  ARG A H    7  
ATOM 11256 H HA   . ARG A 1 45  ? 3.582   18.194  -6.317  1.00 0.00 ? 45  ARG A HA   7  
ATOM 11257 H HB2  . ARG A 1 45  ? 5.365   15.770  -6.015  1.00 0.00 ? 45  ARG A HB2  7  
ATOM 11258 H HB3  . ARG A 1 45  ? 4.931   16.544  -7.533  1.00 0.00 ? 45  ARG A HB3  7  
ATOM 11259 H HG2  . ARG A 1 45  ? 6.569   17.735  -5.307  1.00 0.00 ? 45  ARG A HG2  7  
ATOM 11260 H HG3  . ARG A 1 45  ? 7.147   17.212  -6.890  1.00 0.00 ? 45  ARG A HG3  7  
ATOM 11261 H HD2  . ARG A 1 45  ? 5.747   18.917  -7.956  1.00 0.00 ? 45  ARG A HD2  7  
ATOM 11262 H HD3  . ARG A 1 45  ? 5.184   19.442  -6.370  1.00 0.00 ? 45  ARG A HD3  7  
ATOM 11263 H HE   . ARG A 1 45  ? 7.159   20.567  -6.074  1.00 0.00 ? 45  ARG A HE   7  
ATOM 11264 H HH11 . ARG A 1 45  ? 7.469   18.378  -8.764  1.00 0.00 ? 45  ARG A HH11 7  
ATOM 11265 H HH12 . ARG A 1 45  ? 9.007   19.002  -9.263  1.00 0.00 ? 45  ARG A HH12 7  
ATOM 11266 H HH21 . ARG A 1 45  ? 9.183   21.397  -6.721  1.00 0.00 ? 45  ARG A HH21 7  
ATOM 11267 H HH22 . ARG A 1 45  ? 9.981   20.719  -8.100  1.00 0.00 ? 45  ARG A HH22 7  
ATOM 11268 N N    . PRO A 1 46  ? 2.028   16.360  -7.192  1.00 0.00 ? 46  PRO A N    7  
ATOM 11269 C CA   . PRO A 1 46  ? 0.902   15.481  -7.526  1.00 0.00 ? 46  PRO A CA   7  
ATOM 11270 C C    . PRO A 1 46  ? 1.343   14.043  -7.774  1.00 0.00 ? 46  PRO A C    7  
ATOM 11271 O O    . PRO A 1 46  ? 2.203   13.782  -8.616  1.00 0.00 ? 46  PRO A O    7  
ATOM 11272 C CB   . PRO A 1 46  ? 0.341   16.097  -8.810  1.00 0.00 ? 46  PRO A CB   7  
ATOM 11273 C CG   . PRO A 1 46  ? 1.492   16.820  -9.419  1.00 0.00 ? 46  PRO A CG   7  
ATOM 11274 C CD   . PRO A 1 46  ? 2.321   17.321  -8.269  1.00 0.00 ? 46  PRO A CD   7  
ATOM 11275 H HA   . PRO A 1 46  ? 0.145   15.497  -6.756  1.00 0.00 ? 46  PRO A HA   7  
ATOM 11276 H HB2  . PRO A 1 46  ? -0.023  15.313  -9.459  1.00 0.00 ? 46  PRO A HB2  7  
ATOM 11277 H HB3  . PRO A 1 46  ? -0.466  16.773  -8.566  1.00 0.00 ? 46  PRO A HB3  7  
ATOM 11278 H HG2  . PRO A 1 46  ? 2.069   16.143  -10.030 1.00 0.00 ? 46  PRO A HG2  7  
ATOM 11279 H HG3  . PRO A 1 46  ? 1.133   17.650  -10.010 1.00 0.00 ? 46  PRO A HG3  7  
ATOM 11280 H HD2  . PRO A 1 46  ? 3.370   17.305  -8.525  1.00 0.00 ? 46  PRO A HD2  7  
ATOM 11281 H HD3  . PRO A 1 46  ? 2.015   18.318  -7.988  1.00 0.00 ? 46  PRO A HD3  7  
ATOM 11282 N N    . LEU A 1 47  ? 0.749   13.112  -7.035  1.00 0.00 ? 47  LEU A N    7  
ATOM 11283 C CA   . LEU A 1 47  ? 1.081   11.698  -7.175  1.00 0.00 ? 47  LEU A CA   7  
ATOM 11284 C C    . LEU A 1 47  ? 0.864   11.228  -8.610  1.00 0.00 ? 47  LEU A C    7  
ATOM 11285 O O    . LEU A 1 47  ? -0.014  11.728  -9.311  1.00 0.00 ? 47  LEU A O    7  
ATOM 11286 C CB   . LEU A 1 47  ? 0.233   10.858  -6.218  1.00 0.00 ? 47  LEU A CB   7  
ATOM 11287 C CG   . LEU A 1 47  ? 0.244   11.295  -4.753  1.00 0.00 ? 47  LEU A CG   7  
ATOM 11288 C CD1  . LEU A 1 47  ? -0.975  10.750  -4.024  1.00 0.00 ? 47  LEU A CD1  7  
ATOM 11289 C CD2  . LEU A 1 47  ? 1.525   10.837  -4.070  1.00 0.00 ? 47  LEU A CD2  7  
ATOM 11290 H H    . LEU A 1 47  ? 0.072   13.380  -6.381  1.00 0.00 ? 47  LEU A H    7  
ATOM 11291 H HA   . LEU A 1 47  ? 2.123   11.575  -6.922  1.00 0.00 ? 47  LEU A HA   7  
ATOM 11292 H HB2  . LEU A 1 47  ? -0.788  10.891  -6.565  1.00 0.00 ? 47  LEU A HB2  7  
ATOM 11293 H HB3  . LEU A 1 47  ? 0.594   9.840   -6.264  1.00 0.00 ? 47  LEU A HB3  7  
ATOM 11294 H HG   . LEU A 1 47  ? 0.206   12.374  -4.705  1.00 0.00 ? 47  LEU A HG   7  
ATOM 11295 H HD11 . LEU A 1 47  ? -0.730  10.587  -2.986  1.00 0.00 ? 47  LEU A HD11 7  
ATOM 11296 H HD12 . LEU A 1 47  ? -1.276  9.816   -4.475  1.00 0.00 ? 47  LEU A HD12 7  
ATOM 11297 H HD13 . LEU A 1 47  ? -1.785  11.461  -4.097  1.00 0.00 ? 47  LEU A HD13 7  
ATOM 11298 H HD21 . LEU A 1 47  ? 2.058   10.160  -4.721  1.00 0.00 ? 47  LEU A HD21 7  
ATOM 11299 H HD22 . LEU A 1 47  ? 1.279   10.331  -3.147  1.00 0.00 ? 47  LEU A HD22 7  
ATOM 11300 H HD23 . LEU A 1 47  ? 2.145   11.696  -3.855  1.00 0.00 ? 47  LEU A HD23 7  
ATOM 11301 N N    . GLN A 1 48  ? 1.670   10.261  -9.039  1.00 0.00 ? 48  GLN A N    7  
ATOM 11302 C CA   . GLN A 1 48  ? 1.566   9.723   -10.389 1.00 0.00 ? 48  GLN A CA   7  
ATOM 11303 C C    . GLN A 1 48  ? 0.859   8.371   -10.383 1.00 0.00 ? 48  GLN A C    7  
ATOM 11304 O O    . GLN A 1 48  ? 0.295   7.950   -11.392 1.00 0.00 ? 48  GLN A O    7  
ATOM 11305 C CB   . GLN A 1 48  ? 2.955   9.582   -11.014 1.00 0.00 ? 48  GLN A CB   7  
ATOM 11306 C CG   . GLN A 1 48  ? 3.761   10.871  -11.001 1.00 0.00 ? 48  GLN A CG   7  
ATOM 11307 C CD   . GLN A 1 48  ? 3.557   11.700  -12.254 1.00 0.00 ? 48  GLN A CD   7  
ATOM 11308 O OE1  . GLN A 1 48  ? 2.484   12.264  -12.472 1.00 0.00 ? 48  GLN A OE1  7  
ATOM 11309 N NE2  . GLN A 1 48  ? 4.589   11.779  -13.086 1.00 0.00 ? 48  GLN A NE2  7  
ATOM 11310 H H    . GLN A 1 48  ? 2.351   9.903   -8.433  1.00 0.00 ? 48  GLN A H    7  
ATOM 11311 H HA   . GLN A 1 48  ? 0.984   10.416  -10.978 1.00 0.00 ? 48  GLN A HA   7  
ATOM 11312 H HB2  . GLN A 1 48  ? 3.507   8.832   -10.470 1.00 0.00 ? 48  GLN A HB2  7  
ATOM 11313 H HB3  . GLN A 1 48  ? 2.844   9.263   -12.040 1.00 0.00 ? 48  GLN A HB3  7  
ATOM 11314 H HG2  . GLN A 1 48  ? 3.461   11.460  -10.147 1.00 0.00 ? 48  GLN A HG2  7  
ATOM 11315 H HG3  . GLN A 1 48  ? 4.809   10.624  -10.917 1.00 0.00 ? 48  GLN A HG3  7  
ATOM 11316 H HE21 . GLN A 1 48  ? 5.412   11.302  -12.848 1.00 0.00 ? 48  GLN A HE21 7  
ATOM 11317 H HE22 . GLN A 1 48  ? 4.485   12.307  -13.904 1.00 0.00 ? 48  GLN A HE22 7  
ATOM 11318 N N    . GLY A 1 49  ? 0.894   7.695   -9.239  1.00 0.00 ? 49  GLY A N    7  
ATOM 11319 C CA   . GLY A 1 49  ? 0.254   6.398   -9.123  1.00 0.00 ? 49  GLY A CA   7  
ATOM 11320 C C    . GLY A 1 49  ? 0.318   5.844   -7.714  1.00 0.00 ? 49  GLY A C    7  
ATOM 11321 O O    . GLY A 1 49  ? 0.353   6.600   -6.742  1.00 0.00 ? 49  GLY A O    7  
ATOM 11322 H H    . GLY A 1 49  ? 1.359   8.081   -8.466  1.00 0.00 ? 49  GLY A H    7  
ATOM 11323 H HA2  . GLY A 1 49  ? -0.781  6.493   -9.415  1.00 0.00 ? 49  GLY A HA2  7  
ATOM 11324 H HA3  . GLY A 1 49  ? 0.745   5.707   -9.792  1.00 0.00 ? 49  GLY A HA3  7  
ATOM 11325 N N    . TYR A 1 50  ? 0.333   4.520   -7.601  1.00 0.00 ? 50  TYR A N    7  
ATOM 11326 C CA   . TYR A 1 50  ? 0.389   3.865   -6.299  1.00 0.00 ? 50  TYR A CA   7  
ATOM 11327 C C    . TYR A 1 50  ? 1.014   2.478   -6.414  1.00 0.00 ? 50  TYR A C    7  
ATOM 11328 O O    . TYR A 1 50  ? 1.192   1.954   -7.514  1.00 0.00 ? 50  TYR A O    7  
ATOM 11329 C CB   . TYR A 1 50  ? -1.014  3.756   -5.699  1.00 0.00 ? 50  TYR A CB   7  
ATOM 11330 C CG   . TYR A 1 50  ? -1.496  5.033   -5.050  1.00 0.00 ? 50  TYR A CG   7  
ATOM 11331 C CD1  . TYR A 1 50  ? -0.838  5.567   -3.949  1.00 0.00 ? 50  TYR A CD1  7  
ATOM 11332 C CD2  . TYR A 1 50  ? -2.610  5.706   -5.537  1.00 0.00 ? 50  TYR A CD2  7  
ATOM 11333 C CE1  . TYR A 1 50  ? -1.276  6.734   -3.352  1.00 0.00 ? 50  TYR A CE1  7  
ATOM 11334 C CE2  . TYR A 1 50  ? -3.053  6.874   -4.948  1.00 0.00 ? 50  TYR A CE2  7  
ATOM 11335 C CZ   . TYR A 1 50  ? -2.383  7.384   -3.856  1.00 0.00 ? 50  TYR A CZ   7  
ATOM 11336 O OH   . TYR A 1 50  ? -2.822  8.546   -3.265  1.00 0.00 ? 50  TYR A OH   7  
ATOM 11337 H H    . TYR A 1 50  ? 0.303   3.971   -8.411  1.00 0.00 ? 50  TYR A H    7  
ATOM 11338 H HA   . TYR A 1 50  ? 1.002   4.471   -5.649  1.00 0.00 ? 50  TYR A HA   7  
ATOM 11339 H HB2  . TYR A 1 50  ? -1.713  3.496   -6.479  1.00 0.00 ? 50  TYR A HB2  7  
ATOM 11340 H HB3  . TYR A 1 50  ? -1.017  2.980   -4.947  1.00 0.00 ? 50  TYR A HB3  7  
ATOM 11341 H HD1  . TYR A 1 50  ? 0.029   5.056   -3.556  1.00 0.00 ? 50  TYR A HD1  7  
ATOM 11342 H HD2  . TYR A 1 50  ? -3.133  5.304   -6.393  1.00 0.00 ? 50  TYR A HD2  7  
ATOM 11343 H HE1  . TYR A 1 50  ? -0.751  7.134   -2.496  1.00 0.00 ? 50  TYR A HE1  7  
ATOM 11344 H HE2  . TYR A 1 50  ? -3.920  7.383   -5.342  1.00 0.00 ? 50  TYR A HE2  7  
ATOM 11345 H HH   . TYR A 1 50  ? -3.782  8.553   -3.247  1.00 0.00 ? 50  TYR A HH   7  
ATOM 11346 N N    . SER A 1 51  ? 1.346   1.889   -5.270  1.00 0.00 ? 51  SER A N    7  
ATOM 11347 C CA   . SER A 1 51  ? 1.955   0.564   -5.240  1.00 0.00 ? 51  SER A CA   7  
ATOM 11348 C C    . SER A 1 51  ? 1.404   -0.261  -4.081  1.00 0.00 ? 51  SER A C    7  
ATOM 11349 O O    . SER A 1 51  ? 1.314   0.218   -2.950  1.00 0.00 ? 51  SER A O    7  
ATOM 11350 C CB   . SER A 1 51  ? 3.475   0.681   -5.121  1.00 0.00 ? 51  SER A CB   7  
ATOM 11351 O OG   . SER A 1 51  ? 4.065   -0.580  -4.858  1.00 0.00 ? 51  SER A OG   7  
ATOM 11352 H H    . SER A 1 51  ? 1.179   2.358   -4.425  1.00 0.00 ? 51  SER A H    7  
ATOM 11353 H HA   . SER A 1 51  ? 1.712   0.067   -6.168  1.00 0.00 ? 51  SER A HA   7  
ATOM 11354 H HB2  . SER A 1 51  ? 3.878   1.067   -6.045  1.00 0.00 ? 51  SER A HB2  7  
ATOM 11355 H HB3  . SER A 1 51  ? 3.719   1.355   -4.313  1.00 0.00 ? 51  SER A HB3  7  
ATOM 11356 H HG   . SER A 1 51  ? 4.937   -0.615  -5.257  1.00 0.00 ? 51  SER A HG   7  
ATOM 11357 N N    . VAL A 1 52  ? 1.037   -1.505  -4.370  1.00 0.00 ? 52  VAL A N    7  
ATOM 11358 C CA   . VAL A 1 52  ? 0.496   -2.399  -3.353  1.00 0.00 ? 52  VAL A CA   7  
ATOM 11359 C C    . VAL A 1 52  ? 1.257   -3.720  -3.321  1.00 0.00 ? 52  VAL A C    7  
ATOM 11360 O O    . VAL A 1 52  ? 0.978   -4.626  -4.105  1.00 0.00 ? 52  VAL A O    7  
ATOM 11361 C CB   . VAL A 1 52  ? -0.998  -2.685  -3.594  1.00 0.00 ? 52  VAL A CB   7  
ATOM 11362 C CG1  . VAL A 1 52  ? -1.566  -3.537  -2.470  1.00 0.00 ? 52  VAL A CG1  7  
ATOM 11363 C CG2  . VAL A 1 52  ? -1.773  -1.383  -3.732  1.00 0.00 ? 52  VAL A CG2  7  
ATOM 11364 H H    . VAL A 1 52  ? 1.133   -1.830  -5.290  1.00 0.00 ? 52  VAL A H    7  
ATOM 11365 H HA   . VAL A 1 52  ? 0.598   -1.913  -2.393  1.00 0.00 ? 52  VAL A HA   7  
ATOM 11366 H HB   . VAL A 1 52  ? -1.093  -3.236  -4.518  1.00 0.00 ? 52  VAL A HB   7  
ATOM 11367 H HG11 . VAL A 1 52  ? -2.207  -4.301  -2.886  1.00 0.00 ? 52  VAL A HG11 7  
ATOM 11368 H HG12 . VAL A 1 52  ? -0.758  -4.002  -1.925  1.00 0.00 ? 52  VAL A HG12 7  
ATOM 11369 H HG13 . VAL A 1 52  ? -2.140  -2.913  -1.800  1.00 0.00 ? 52  VAL A HG13 7  
ATOM 11370 H HG21 . VAL A 1 52  ? -1.224  -0.584  -3.257  1.00 0.00 ? 52  VAL A HG21 7  
ATOM 11371 H HG22 . VAL A 1 52  ? -1.909  -1.156  -4.779  1.00 0.00 ? 52  VAL A HG22 7  
ATOM 11372 H HG23 . VAL A 1 52  ? -2.739  -1.487  -3.259  1.00 0.00 ? 52  VAL A HG23 7  
ATOM 11373 N N    . GLU A 1 53  ? 2.219   -3.821  -2.410  1.00 0.00 ? 53  GLU A N    7  
ATOM 11374 C CA   . GLU A 1 53  ? 3.020   -5.032  -2.277  1.00 0.00 ? 53  GLU A CA   7  
ATOM 11375 C C    . GLU A 1 53  ? 2.486   -5.917  -1.154  1.00 0.00 ? 53  GLU A C    7  
ATOM 11376 O O    . GLU A 1 53  ? 2.196   -5.439  -0.057  1.00 0.00 ? 53  GLU A O    7  
ATOM 11377 C CB   . GLU A 1 53  ? 4.484   -4.675  -2.008  1.00 0.00 ? 53  GLU A CB   7  
ATOM 11378 C CG   . GLU A 1 53  ? 5.284   -4.397  -3.269  1.00 0.00 ? 53  GLU A CG   7  
ATOM 11379 C CD   . GLU A 1 53  ? 6.408   -3.406  -3.040  1.00 0.00 ? 53  GLU A CD   7  
ATOM 11380 O OE1  . GLU A 1 53  ? 6.110   -2.222  -2.773  1.00 0.00 ? 53  GLU A OE1  7  
ATOM 11381 O OE2  . GLU A 1 53  ? 7.585   -3.812  -3.128  1.00 0.00 ? 53  GLU A OE2  7  
ATOM 11382 H H    . GLU A 1 53  ? 2.394   -3.064  -1.813  1.00 0.00 ? 53  GLU A H    7  
ATOM 11383 H HA   . GLU A 1 53  ? 2.957   -5.575  -3.207  1.00 0.00 ? 53  GLU A HA   7  
ATOM 11384 H HB2  . GLU A 1 53  ? 4.518   -3.795  -1.383  1.00 0.00 ? 53  GLU A HB2  7  
ATOM 11385 H HB3  . GLU A 1 53  ? 4.951   -5.496  -1.484  1.00 0.00 ? 53  GLU A HB3  7  
ATOM 11386 H HG2  . GLU A 1 53  ? 5.709   -5.324  -3.623  1.00 0.00 ? 53  GLU A HG2  7  
ATOM 11387 H HG3  . GLU A 1 53  ? 4.619   -3.998  -4.021  1.00 0.00 ? 53  GLU A HG3  7  
ATOM 11388 N N    . TYR A 1 54  ? 2.360   -7.209  -1.436  1.00 0.00 ? 54  TYR A N    7  
ATOM 11389 C CA   . TYR A 1 54  ? 1.858   -8.161  -0.452  1.00 0.00 ? 54  TYR A CA   7  
ATOM 11390 C C    . TYR A 1 54  ? 2.642   -9.468  -0.511  1.00 0.00 ? 54  TYR A C    7  
ATOM 11391 O O    . TYR A 1 54  ? 3.024   -9.927  -1.587  1.00 0.00 ? 54  TYR A O    7  
ATOM 11392 C CB   . TYR A 1 54  ? 0.372   -8.433  -0.687  1.00 0.00 ? 54  TYR A CB   7  
ATOM 11393 C CG   . TYR A 1 54  ? 0.100   -9.320  -1.881  1.00 0.00 ? 54  TYR A CG   7  
ATOM 11394 C CD1  . TYR A 1 54  ? 0.277   -10.696 -1.803  1.00 0.00 ? 54  TYR A CD1  7  
ATOM 11395 C CD2  . TYR A 1 54  ? -0.333  -8.782  -3.086  1.00 0.00 ? 54  TYR A CD2  7  
ATOM 11396 C CE1  . TYR A 1 54  ? 0.030   -11.510 -2.892  1.00 0.00 ? 54  TYR A CE1  7  
ATOM 11397 C CE2  . TYR A 1 54  ? -0.583  -9.589  -4.179  1.00 0.00 ? 54  TYR A CE2  7  
ATOM 11398 C CZ   . TYR A 1 54  ? -0.400  -10.952 -4.077  1.00 0.00 ? 54  TYR A CZ   7  
ATOM 11399 O OH   . TYR A 1 54  ? -0.647  -11.759 -5.164  1.00 0.00 ? 54  TYR A OH   7  
ATOM 11400 H H    . TYR A 1 54  ? 2.608   -7.530  -2.328  1.00 0.00 ? 54  TYR A H    7  
ATOM 11401 H HA   . TYR A 1 54  ? 1.984   -7.722  0.527   1.00 0.00 ? 54  TYR A HA   7  
ATOM 11402 H HB2  . TYR A 1 54  ? -0.041  -8.917  0.185   1.00 0.00 ? 54  TYR A HB2  7  
ATOM 11403 H HB3  . TYR A 1 54  ? -0.138  -7.495  -0.847  1.00 0.00 ? 54  TYR A HB3  7  
ATOM 11404 H HD1  . TYR A 1 54  ? 0.614   -11.130 -0.873  1.00 0.00 ? 54  TYR A HD1  7  
ATOM 11405 H HD2  . TYR A 1 54  ? -0.475  -7.714  -3.163  1.00 0.00 ? 54  TYR A HD2  7  
ATOM 11406 H HE1  . TYR A 1 54  ? 0.173   -12.578 -2.812  1.00 0.00 ? 54  TYR A HE1  7  
ATOM 11407 H HE2  . TYR A 1 54  ? -0.920  -9.152  -5.108  1.00 0.00 ? 54  TYR A HE2  7  
ATOM 11408 H HH   . TYR A 1 54  ? -1.578  -11.996 -5.182  1.00 0.00 ? 54  TYR A HH   7  
ATOM 11409 N N    . GLN A 1 55  ? 2.877   -10.062 0.655   1.00 0.00 ? 55  GLN A N    7  
ATOM 11410 C CA   . GLN A 1 55  ? 3.615   -11.317 0.737   1.00 0.00 ? 55  GLN A CA   7  
ATOM 11411 C C    . GLN A 1 55  ? 3.264   -12.072 2.015   1.00 0.00 ? 55  GLN A C    7  
ATOM 11412 O O    . GLN A 1 55  ? 2.826   -11.477 3.000   1.00 0.00 ? 55  GLN A O    7  
ATOM 11413 C CB   . GLN A 1 55  ? 5.120   -11.052 0.684   1.00 0.00 ? 55  GLN A CB   7  
ATOM 11414 C CG   . GLN A 1 55  ? 5.707   -10.606 2.014   1.00 0.00 ? 55  GLN A CG   7  
ATOM 11415 C CD   . GLN A 1 55  ? 7.107   -10.043 1.874   1.00 0.00 ? 55  GLN A CD   7  
ATOM 11416 O OE1  . GLN A 1 55  ? 7.382   -8.919  2.294   1.00 0.00 ? 55  GLN A OE1  7  
ATOM 11417 N NE2  . GLN A 1 55  ? 8.003   -10.824 1.282   1.00 0.00 ? 55  GLN A NE2  7  
ATOM 11418 H H    . GLN A 1 55  ? 2.546   -9.647  1.478   1.00 0.00 ? 55  GLN A H    7  
ATOM 11419 H HA   . GLN A 1 55  ? 3.335   -11.923 -0.112  1.00 0.00 ? 55  GLN A HA   7  
ATOM 11420 H HB2  . GLN A 1 55  ? 5.623   -11.958 0.379   1.00 0.00 ? 55  GLN A HB2  7  
ATOM 11421 H HB3  . GLN A 1 55  ? 5.312   -10.280 -0.046  1.00 0.00 ? 55  GLN A HB3  7  
ATOM 11422 H HG2  . GLN A 1 55  ? 5.070   -9.843  2.435   1.00 0.00 ? 55  GLN A HG2  7  
ATOM 11423 H HG3  . GLN A 1 55  ? 5.740   -11.455 2.681   1.00 0.00 ? 55  GLN A HG3  7  
ATOM 11424 H HE21 . GLN A 1 55  ? 7.713   -11.708 0.971   1.00 0.00 ? 55  GLN A HE21 7  
ATOM 11425 H HE22 . GLN A 1 55  ? 8.916   -10.486 1.178   1.00 0.00 ? 55  GLN A HE22 7  
ATOM 11426 N N    . LEU A 1 56  ? 3.459   -13.386 1.992   1.00 0.00 ? 56  LEU A N    7  
ATOM 11427 C CA   . LEU A 1 56  ? 3.163   -14.224 3.150   1.00 0.00 ? 56  LEU A CA   7  
ATOM 11428 C C    . LEU A 1 56  ? 3.705   -13.596 4.429   1.00 0.00 ? 56  LEU A C    7  
ATOM 11429 O O    . LEU A 1 56  ? 4.914   -13.416 4.581   1.00 0.00 ? 56  LEU A O    7  
ATOM 11430 C CB   . LEU A 1 56  ? 3.760   -15.619 2.960   1.00 0.00 ? 56  LEU A CB   7  
ATOM 11431 C CG   . LEU A 1 56  ? 2.901   -16.616 2.181   1.00 0.00 ? 56  LEU A CG   7  
ATOM 11432 C CD1  . LEU A 1 56  ? 3.708   -17.858 1.834   1.00 0.00 ? 56  LEU A CD1  7  
ATOM 11433 C CD2  . LEU A 1 56  ? 1.661   -16.989 2.979   1.00 0.00 ? 56  LEU A CD2  7  
ATOM 11434 H H    . LEU A 1 56  ? 3.810   -13.804 1.179   1.00 0.00 ? 56  LEU A H    7  
ATOM 11435 H HA   . LEU A 1 56  ? 2.089   -14.308 3.231   1.00 0.00 ? 56  LEU A HA   7  
ATOM 11436 H HB2  . LEU A 1 56  ? 4.697   -15.510 2.436   1.00 0.00 ? 56  LEU A HB2  7  
ATOM 11437 H HB3  . LEU A 1 56  ? 3.944   -16.035 3.940   1.00 0.00 ? 56  LEU A HB3  7  
ATOM 11438 H HG   . LEU A 1 56  ? 2.580   -16.159 1.255   1.00 0.00 ? 56  LEU A HG   7  
ATOM 11439 H HD11 . LEU A 1 56  ? 4.389   -17.632 1.028   1.00 0.00 ? 56  LEU A HD11 7  
ATOM 11440 H HD12 . LEU A 1 56  ? 3.038   -18.648 1.529   1.00 0.00 ? 56  LEU A HD12 7  
ATOM 11441 H HD13 . LEU A 1 56  ? 4.268   -18.177 2.701   1.00 0.00 ? 56  LEU A HD13 7  
ATOM 11442 H HD21 . LEU A 1 56  ? 0.872   -17.283 2.302   1.00 0.00 ? 56  LEU A HD21 7  
ATOM 11443 H HD22 . LEU A 1 56  ? 1.338   -16.138 3.561   1.00 0.00 ? 56  LEU A HD22 7  
ATOM 11444 H HD23 . LEU A 1 56  ? 1.892   -17.811 3.642   1.00 0.00 ? 56  LEU A HD23 7  
ATOM 11445 N N    . LEU A 1 57  ? 2.804   -13.266 5.348   1.00 0.00 ? 57  LEU A N    7  
ATOM 11446 C CA   . LEU A 1 57  ? 3.192   -12.660 6.617   1.00 0.00 ? 57  LEU A CA   7  
ATOM 11447 C C    . LEU A 1 57  ? 4.509   -13.243 7.119   1.00 0.00 ? 57  LEU A C    7  
ATOM 11448 O O    . LEU A 1 57  ? 5.484   -12.519 7.318   1.00 0.00 ? 57  LEU A O    7  
ATOM 11449 C CB   . LEU A 1 57  ? 2.096   -12.872 7.663   1.00 0.00 ? 57  LEU A CB   7  
ATOM 11450 C CG   . LEU A 1 57  ? 1.999   -11.810 8.758   1.00 0.00 ? 57  LEU A CG   7  
ATOM 11451 C CD1  . LEU A 1 57  ? 0.951   -12.201 9.789   1.00 0.00 ? 57  LEU A CD1  7  
ATOM 11452 C CD2  . LEU A 1 57  ? 3.352   -11.604 9.423   1.00 0.00 ? 57  LEU A CD2  7  
ATOM 11453 H H    . LEU A 1 57  ? 1.856   -13.433 5.170   1.00 0.00 ? 57  LEU A H    7  
ATOM 11454 H HA   . LEU A 1 57  ? 3.321   -11.600 6.453   1.00 0.00 ? 57  LEU A HA   7  
ATOM 11455 H HB2  . LEU A 1 57  ? 1.149   -12.903 7.147   1.00 0.00 ? 57  LEU A HB2  7  
ATOM 11456 H HB3  . LEU A 1 57  ? 2.275   -13.826 8.139   1.00 0.00 ? 57  LEU A HB3  7  
ATOM 11457 H HG   . LEU A 1 57  ? 1.696   -10.871 8.315   1.00 0.00 ? 57  LEU A HG   7  
ATOM 11458 H HD11 . LEU A 1 57  ? 1.134   -11.668 10.709  1.00 0.00 ? 57  LEU A HD11 7  
ATOM 11459 H HD12 . LEU A 1 57  ? 1.005   -13.264 9.972   1.00 0.00 ? 57  LEU A HD12 7  
ATOM 11460 H HD13 . LEU A 1 57  ? -0.032  -11.951 9.416   1.00 0.00 ? 57  LEU A HD13 7  
ATOM 11461 H HD21 . LEU A 1 57  ? 3.965   -12.479 9.270   1.00 0.00 ? 57  LEU A HD21 7  
ATOM 11462 H HD22 . LEU A 1 57  ? 3.212   -11.443 10.482  1.00 0.00 ? 57  LEU A HD22 7  
ATOM 11463 H HD23 . LEU A 1 57  ? 3.838   -10.742 8.989   1.00 0.00 ? 57  LEU A HD23 7  
ATOM 11464 N N    . ASN A 1 58  ? 4.531   -14.557 7.319   1.00 0.00 ? 58  ASN A N    7  
ATOM 11465 C CA   . ASN A 1 58  ? 5.729   -15.238 7.796   1.00 0.00 ? 58  ASN A CA   7  
ATOM 11466 C C    . ASN A 1 58  ? 6.861   -15.124 6.778   1.00 0.00 ? 58  ASN A C    7  
ATOM 11467 O O    . ASN A 1 58  ? 7.999   -14.817 7.131   1.00 0.00 ? 58  ASN A O    7  
ATOM 11468 C CB   . ASN A 1 58  ? 5.427   -16.711 8.076   1.00 0.00 ? 58  ASN A CB   7  
ATOM 11469 C CG   . ASN A 1 58  ? 4.448   -17.300 7.078   1.00 0.00 ? 58  ASN A CG   7  
ATOM 11470 O OD1  . ASN A 1 58  ? 4.386   -16.871 5.926   1.00 0.00 ? 58  ASN A OD1  7  
ATOM 11471 N ND2  . ASN A 1 58  ? 3.679   -18.289 7.518   1.00 0.00 ? 58  ASN A ND2  7  
ATOM 11472 H H    . ASN A 1 58  ? 3.722   -15.081 7.142   1.00 0.00 ? 58  ASN A H    7  
ATOM 11473 H HA   . ASN A 1 58  ? 6.038   -14.761 8.714   1.00 0.00 ? 58  ASN A HA   7  
ATOM 11474 H HB2  . ASN A 1 58  ? 6.346   -17.277 8.027   1.00 0.00 ? 58  ASN A HB2  7  
ATOM 11475 H HB3  . ASN A 1 58  ? 5.004   -16.804 9.065   1.00 0.00 ? 58  ASN A HB3  7  
ATOM 11476 H HD21 . ASN A 1 58  ? 3.784   -18.579 8.448   1.00 0.00 ? 58  ASN A HD21 7  
ATOM 11477 H HD22 . ASN A 1 58  ? 3.038   -18.689 6.893   1.00 0.00 ? 58  ASN A HD22 7  
ATOM 11478 N N    . GLY A 1 59  ? 6.539   -15.374 5.513   1.00 0.00 ? 59  GLY A N    7  
ATOM 11479 C CA   . GLY A 1 59  ? 7.538   -15.294 4.463   1.00 0.00 ? 59  GLY A CA   7  
ATOM 11480 C C    . GLY A 1 59  ? 7.196   -16.165 3.270   1.00 0.00 ? 59  GLY A C    7  
ATOM 11481 O O    . GLY A 1 59  ? 6.597   -17.228 3.420   1.00 0.00 ? 59  GLY A O    7  
ATOM 11482 H H    . GLY A 1 59  ? 5.615   -15.615 5.290   1.00 0.00 ? 59  GLY A H    7  
ATOM 11483 H HA2  . GLY A 1 59  ? 7.620   -14.269 4.136   1.00 0.00 ? 59  GLY A HA2  7  
ATOM 11484 H HA3  . GLY A 1 59  ? 8.490   -15.611 4.864   1.00 0.00 ? 59  GLY A HA3  7  
ATOM 11485 N N    . GLY A 1 60  ? 7.577   -15.711 2.080   1.00 0.00 ? 60  GLY A N    7  
ATOM 11486 C CA   . GLY A 1 60  ? 7.297   -16.467 0.873   1.00 0.00 ? 60  GLY A CA   7  
ATOM 11487 C C    . GLY A 1 60  ? 7.511   -15.650 -0.386  1.00 0.00 ? 60  GLY A C    7  
ATOM 11488 O O    . GLY A 1 60  ? 8.598   -15.118 -0.611  1.00 0.00 ? 60  GLY A O    7  
ATOM 11489 H H    . GLY A 1 60  ? 8.053   -14.855 2.021   1.00 0.00 ? 60  GLY A H    7  
ATOM 11490 H HA2  . GLY A 1 60  ? 7.945   -17.330 0.844   1.00 0.00 ? 60  GLY A HA2  7  
ATOM 11491 H HA3  . GLY A 1 60  ? 6.271   -16.800 0.901   1.00 0.00 ? 60  GLY A HA3  7  
ATOM 11492 N N    . GLU A 1 61  ? 6.472   -15.550 -1.209  1.00 0.00 ? 61  GLU A N    7  
ATOM 11493 C CA   . GLU A 1 61  ? 6.553   -14.794 -2.453  1.00 0.00 ? 61  GLU A CA   7  
ATOM 11494 C C    . GLU A 1 61  ? 6.063   -13.363 -2.252  1.00 0.00 ? 61  GLU A C    7  
ATOM 11495 O O    . GLU A 1 61  ? 5.179   -13.106 -1.434  1.00 0.00 ? 61  GLU A O    7  
ATOM 11496 C CB   . GLU A 1 61  ? 5.729   -15.478 -3.546  1.00 0.00 ? 61  GLU A CB   7  
ATOM 11497 C CG   . GLU A 1 61  ? 6.092   -15.029 -4.952  1.00 0.00 ? 61  GLU A CG   7  
ATOM 11498 C CD   . GLU A 1 61  ? 7.168   -15.893 -5.580  1.00 0.00 ? 61  GLU A CD   7  
ATOM 11499 O OE1  . GLU A 1 61  ? 6.838   -16.998 -6.059  1.00 0.00 ? 61  GLU A OE1  7  
ATOM 11500 O OE2  . GLU A 1 61  ? 8.341   -15.463 -5.594  1.00 0.00 ? 61  GLU A OE2  7  
ATOM 11501 H H    . GLU A 1 61  ? 5.632   -15.996 -0.974  1.00 0.00 ? 61  GLU A H    7  
ATOM 11502 H HA   . GLU A 1 61  ? 7.588   -14.768 -2.758  1.00 0.00 ? 61  GLU A HA   7  
ATOM 11503 H HB2  . GLU A 1 61  ? 5.882   -16.545 -3.480  1.00 0.00 ? 61  GLU A HB2  7  
ATOM 11504 H HB3  . GLU A 1 61  ? 4.684   -15.262 -3.380  1.00 0.00 ? 61  GLU A HB3  7  
ATOM 11505 H HG2  . GLU A 1 61  ? 5.208   -15.076 -5.570  1.00 0.00 ? 61  GLU A HG2  7  
ATOM 11506 H HG3  . GLU A 1 61  ? 6.447   -14.010 -4.910  1.00 0.00 ? 61  GLU A HG3  7  
ATOM 11507 N N    . LEU A 1 62  ? 6.644   -12.434 -3.004  1.00 0.00 ? 62  LEU A N    7  
ATOM 11508 C CA   . LEU A 1 62  ? 6.268   -11.028 -2.910  1.00 0.00 ? 62  LEU A CA   7  
ATOM 11509 C C    . LEU A 1 62  ? 5.663   -10.537 -4.222  1.00 0.00 ? 62  LEU A C    7  
ATOM 11510 O O    . LEU A 1 62  ? 6.328   -10.527 -5.258  1.00 0.00 ? 62  LEU A O    7  
ATOM 11511 C CB   . LEU A 1 62  ? 7.486   -10.177 -2.546  1.00 0.00 ? 62  LEU A CB   7  
ATOM 11512 C CG   . LEU A 1 62  ? 7.293   -8.662  -2.620  1.00 0.00 ? 62  LEU A CG   7  
ATOM 11513 C CD1  . LEU A 1 62  ? 7.403   -8.179  -4.057  1.00 0.00 ? 62  LEU A CD1  7  
ATOM 11514 C CD2  . LEU A 1 62  ? 5.949   -8.266  -2.024  1.00 0.00 ? 62  LEU A CD2  7  
ATOM 11515 H H    . LEU A 1 62  ? 7.341   -12.700 -3.639  1.00 0.00 ? 62  LEU A H    7  
ATOM 11516 H HA   . LEU A 1 62  ? 5.527   -10.935 -2.129  1.00 0.00 ? 62  LEU A HA   7  
ATOM 11517 H HB2  . LEU A 1 62  ? 7.772   -10.425 -1.536  1.00 0.00 ? 62  LEU A HB2  7  
ATOM 11518 H HB3  . LEU A 1 62  ? 8.287   -10.443 -3.221  1.00 0.00 ? 62  LEU A HB3  7  
ATOM 11519 H HG   . LEU A 1 62  ? 8.070   -8.178  -2.045  1.00 0.00 ? 62  LEU A HG   7  
ATOM 11520 H HD11 . LEU A 1 62  ? 7.894   -7.218  -4.077  1.00 0.00 ? 62  LEU A HD11 7  
ATOM 11521 H HD12 . LEU A 1 62  ? 6.415   -8.088  -4.483  1.00 0.00 ? 62  LEU A HD12 7  
ATOM 11522 H HD13 . LEU A 1 62  ? 7.979   -8.889  -4.632  1.00 0.00 ? 62  LEU A HD13 7  
ATOM 11523 H HD21 . LEU A 1 62  ? 5.885   -8.629  -1.009  1.00 0.00 ? 62  LEU A HD21 7  
ATOM 11524 H HD22 . LEU A 1 62  ? 5.154   -8.700  -2.612  1.00 0.00 ? 62  LEU A HD22 7  
ATOM 11525 H HD23 . LEU A 1 62  ? 5.856   -7.190  -2.030  1.00 0.00 ? 62  LEU A HD23 7  
ATOM 11526 N N    . HIS A 1 63  ? 4.400   -10.127 -4.168  1.00 0.00 ? 63  HIS A N    7  
ATOM 11527 C CA   . HIS A 1 63  ? 3.707   -9.631  -5.352  1.00 0.00 ? 63  HIS A CA   7  
ATOM 11528 C C    . HIS A 1 63  ? 3.624   -8.108  -5.335  1.00 0.00 ? 63  HIS A C    7  
ATOM 11529 O O    . HIS A 1 63  ? 3.033   -7.519  -4.429  1.00 0.00 ? 63  HIS A O    7  
ATOM 11530 C CB   . HIS A 1 63  ? 2.302   -10.229 -5.434  1.00 0.00 ? 63  HIS A CB   7  
ATOM 11531 C CG   . HIS A 1 63  ? 2.293   -11.718 -5.597  1.00 0.00 ? 63  HIS A CG   7  
ATOM 11532 N ND1  . HIS A 1 63  ? 2.228   -12.340 -6.826  1.00 0.00 ? 63  HIS A ND1  7  
ATOM 11533 C CD2  . HIS A 1 63  ? 2.344   -12.709 -4.677  1.00 0.00 ? 63  HIS A CD2  7  
ATOM 11534 C CE1  . HIS A 1 63  ? 2.237   -13.650 -6.655  1.00 0.00 ? 63  HIS A CE1  7  
ATOM 11535 N NE2  . HIS A 1 63  ? 2.307   -13.900 -5.360  1.00 0.00 ? 63  HIS A NE2  7  
ATOM 11536 H H    . HIS A 1 63  ? 3.923   -10.159 -3.313  1.00 0.00 ? 63  HIS A H    7  
ATOM 11537 H HA   . HIS A 1 63  ? 4.270   -9.938  -6.220  1.00 0.00 ? 63  HIS A HA   7  
ATOM 11538 H HB2  . HIS A 1 63  ? 1.763   -9.992  -4.528  1.00 0.00 ? 63  HIS A HB2  7  
ATOM 11539 H HB3  . HIS A 1 63  ? 1.783   -9.799  -6.279  1.00 0.00 ? 63  HIS A HB3  7  
ATOM 11540 H HD2  . HIS A 1 63  ? 2.401   -12.587 -3.604  1.00 0.00 ? 63  HIS A HD2  7  
ATOM 11541 H HE1  . HIS A 1 63  ? 2.195   -14.391 -7.439  1.00 0.00 ? 63  HIS A HE1  7  
ATOM 11542 H HE2  . HIS A 1 63  ? 2.243   -14.789 -4.953  1.00 0.00 ? 63  HIS A HE2  7  
ATOM 11543 N N    . ARG A 1 64  ? 4.220   -7.476  -6.341  1.00 0.00 ? 64  ARG A N    7  
ATOM 11544 C CA   . ARG A 1 64  ? 4.215   -6.021  -6.440  1.00 0.00 ? 64  ARG A CA   7  
ATOM 11545 C C    . ARG A 1 64  ? 3.148   -5.547  -7.422  1.00 0.00 ? 64  ARG A C    7  
ATOM 11546 O O    . ARG A 1 64  ? 3.174   -5.901  -8.602  1.00 0.00 ? 64  ARG A O    7  
ATOM 11547 C CB   . ARG A 1 64  ? 5.590   -5.514  -6.879  1.00 0.00 ? 64  ARG A CB   7  
ATOM 11548 C CG   . ARG A 1 64  ? 5.708   -3.999  -6.880  1.00 0.00 ? 64  ARG A CG   7  
ATOM 11549 C CD   . ARG A 1 64  ? 7.108   -3.550  -7.268  1.00 0.00 ? 64  ARG A CD   7  
ATOM 11550 N NE   . ARG A 1 64  ? 7.410   -3.844  -8.666  1.00 0.00 ? 64  ARG A NE   7  
ATOM 11551 C CZ   . ARG A 1 64  ? 8.636   -3.816  -9.175  1.00 0.00 ? 64  ARG A CZ   7  
ATOM 11552 N NH1  . ARG A 1 64  ? 9.671   -3.509  -8.404  1.00 0.00 ? 64  ARG A NH1  7  
ATOM 11553 N NH2  . ARG A 1 64  ? 8.831   -4.097  -10.458 1.00 0.00 ? 64  ARG A NH2  7  
ATOM 11554 H H    . ARG A 1 64  ? 4.675   -8.000  -7.033  1.00 0.00 ? 64  ARG A H    7  
ATOM 11555 H HA   . ARG A 1 64  ? 3.990   -5.623  -5.462  1.00 0.00 ? 64  ARG A HA   7  
ATOM 11556 H HB2  . ARG A 1 64  ? 6.338   -5.911  -6.208  1.00 0.00 ? 64  ARG A HB2  7  
ATOM 11557 H HB3  . ARG A 1 64  ? 5.789   -5.870  -7.878  1.00 0.00 ? 64  ARG A HB3  7  
ATOM 11558 H HG2  . ARG A 1 64  ? 5.002   -3.593  -7.590  1.00 0.00 ? 64  ARG A HG2  7  
ATOM 11559 H HG3  . ARG A 1 64  ? 5.481   -3.629  -5.892  1.00 0.00 ? 64  ARG A HG3  7  
ATOM 11560 H HD2  . ARG A