data_2YUY
# 
_entry.id   2YUY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2YUY         pdb_00002yuy 10.2210/pdb2yuy/pdb 
RCSB  RCSB027166   ?            ?                   
WWPDB D_1000027166 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002201396.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2YUY 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-06 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Niraula, T.N.'                                          1 
'Yoneyama, M.'                                           2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of PDZ domain of Rho GTPase Activating Protein 21' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Niraula, T.N.' 1 ? 
primary 'Yoneyama, M.'  2 ? 
primary 'Koshiba, S.'   3 ? 
primary 'Inoue, M.'     4 ? 
primary 'Kigawa, T.'    5 ? 
primary 'Yokoyama, S.'  6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Rho GTPase activating protein 21' 
_entity.formula_weight             13501.110 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGGPKTVTLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLC
TGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGGPKTVTLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLC
TGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002201396.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLY n 
1 9   PRO n 
1 10  LYS n 
1 11  THR n 
1 12  VAL n 
1 13  THR n 
1 14  LEU n 
1 15  LYS n 
1 16  ARG n 
1 17  THR n 
1 18  SER n 
1 19  GLN n 
1 20  GLY n 
1 21  PHE n 
1 22  GLY n 
1 23  PHE n 
1 24  THR n 
1 25  LEU n 
1 26  ARG n 
1 27  HIS n 
1 28  PHE n 
1 29  ILE n 
1 30  VAL n 
1 31  TYR n 
1 32  PRO n 
1 33  PRO n 
1 34  GLU n 
1 35  SER n 
1 36  ALA n 
1 37  ILE n 
1 38  GLN n 
1 39  PHE n 
1 40  SER n 
1 41  TYR n 
1 42  LYS n 
1 43  ASP n 
1 44  GLU n 
1 45  GLU n 
1 46  ASN n 
1 47  GLY n 
1 48  ASN n 
1 49  ARG n 
1 50  GLY n 
1 51  GLY n 
1 52  LYS n 
1 53  GLN n 
1 54  ARG n 
1 55  ASN n 
1 56  ARG n 
1 57  LEU n 
1 58  GLU n 
1 59  PRO n 
1 60  MET n 
1 61  ASP n 
1 62  THR n 
1 63  ILE n 
1 64  PHE n 
1 65  VAL n 
1 66  LYS n 
1 67  GLN n 
1 68  VAL n 
1 69  LYS n 
1 70  GLU n 
1 71  GLY n 
1 72  GLY n 
1 73  PRO n 
1 74  ALA n 
1 75  PHE n 
1 76  GLU n 
1 77  ALA n 
1 78  GLY n 
1 79  LEU n 
1 80  CYS n 
1 81  THR n 
1 82  GLY n 
1 83  ASP n 
1 84  ARG n 
1 85  ILE n 
1 86  ILE n 
1 87  LYS n 
1 88  VAL n 
1 89  ASN n 
1 90  GLY n 
1 91  GLU n 
1 92  SER n 
1 93  VAL n 
1 94  ILE n 
1 95  GLY n 
1 96  LYS n 
1 97  THR n 
1 98  TYR n 
1 99  SER n 
1 100 GLN n 
1 101 VAL n 
1 102 ILE n 
1 103 ALA n 
1 104 LEU n 
1 105 ILE n 
1 106 GLN n 
1 107 ASN n 
1 108 SER n 
1 109 ASP n 
1 110 THR n 
1 111 THR n 
1 112 LEU n 
1 113 GLU n 
1 114 LEU n 
1 115 SER n 
1 116 VAL n 
1 117 MET n 
1 118 PRO n 
1 119 LYS n 
1 120 ASP n 
1 121 SER n 
1 122 GLY n 
1 123 PRO n 
1 124 SER n 
1 125 SER n 
1 126 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ARHGAP21 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P051017-09 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5T5U3_HUMAN 
_struct_ref.pdbx_db_accession          Q5T5U3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GPKTVTLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIK
VNGESVIGKTYSQVIALIQNSDTTLELSVMPKD
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2YUY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 120 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5T5U3 
_struct_ref_seq.db_align_beg                  46 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  158 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YUY GLY A 1   ? UNP Q5T5U3 ? ? 'expression tag' 1   1  
1 2YUY SER A 2   ? UNP Q5T5U3 ? ? 'expression tag' 2   2  
1 2YUY SER A 3   ? UNP Q5T5U3 ? ? 'expression tag' 3   3  
1 2YUY GLY A 4   ? UNP Q5T5U3 ? ? 'expression tag' 4   4  
1 2YUY SER A 5   ? UNP Q5T5U3 ? ? 'expression tag' 5   5  
1 2YUY SER A 6   ? UNP Q5T5U3 ? ? 'expression tag' 6   6  
1 2YUY GLY A 7   ? UNP Q5T5U3 ? ? 'expression tag' 7   7  
1 2YUY SER A 121 ? UNP Q5T5U3 ? ? 'expression tag' 121 8  
1 2YUY GLY A 122 ? UNP Q5T5U3 ? ? 'expression tag' 122 9  
1 2YUY PRO A 123 ? UNP Q5T5U3 ? ? 'expression tag' 123 10 
1 2YUY SER A 124 ? UNP Q5T5U3 ? ? 'expression tag' 124 11 
1 2YUY SER A 125 ? UNP Q5T5U3 ? ? 'expression tag' 125 12 
1 2YUY GLY A 126 ? UNP Q5T5U3 ? ? 'expression tag' 126 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.22mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2YUY 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.entry_id                                      2YUY 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2YUY 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR 2.6      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9820   'Kobayashi, N.' 4 
'structure solution' CYANA   1.0.8    'Guntert, P.'   5 
refinement           CYANA   1.0.8    'Guntert, P.'   6 
# 
_exptl.method            'SOLUTION NMR' 
_exptl.entry_id          2YUY 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2YUY 
_struct.title                     'Solution Structure of PDZ domain of Rho GTPase Activating Protein 21' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YUY 
_struct_keywords.text            
;PDZ domain, Rho GTPase activating protein 21, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 72 ? GLY A 78  ? GLY A 72 GLY A 78  1 ? 7  
HELX_P HELX_P2 2 THR A 97 ? ASN A 107 ? THR A 97 ASN A 107 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 12  ? LYS A 15  ? VAL A 12  LYS A 15  
A 2 THR A 111 ? SER A 115 ? THR A 111 SER A 115 
A 3 LYS A 87  ? VAL A 88  ? LYS A 87  VAL A 88  
A 4 GLU A 91  ? SER A 92  ? GLU A 91  SER A 92  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 14  ? N LEU A 14  O LEU A 112 ? O LEU A 112 
A 2 3 O SER A 115 ? O SER A 115 N LYS A 87  ? N LYS A 87  
A 3 4 N VAL A 88  ? N VAL A 88  O GLU A 91  ? O GLU A 91  
# 
_atom_sites.entry_id                    2YUY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -7.284  -29.230 15.667  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -8.117  -28.103 15.284  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -7.278  -26.993 14.648  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -6.408  -27.263 13.822  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -6.474  -28.994 16.204  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -8.882  -28.434 14.582  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -8.636  -27.714 16.161  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -7.570  -25.767 15.057  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -6.854  -24.615 14.536  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -7.041  -24.522 13.021  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -7.411  -25.502 12.377  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -5.365  -24.688 14.884  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -5.151  -24.841 16.285  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -8.281  -25.555 15.727  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -7.299  -23.751 15.030  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB3  . SER A 1 2   ? -4.866  -23.784 14.536  1.00 0.00 ? 2   SER A HB3  1  
ATOM 17    H HG   . SER A 1 2   ? -4.329  -25.386 16.447  1.00 0.00 ? 2   SER A HG   1  
ATOM 18    N N    . SER A 1 3   ? -6.776  -23.335 12.495  1.00 0.00 ? 3   SER A N    1  
ATOM 19    C CA   . SER A 1 3   ? -6.912  -23.103 11.068  1.00 0.00 ? 3   SER A CA   1  
ATOM 20    C C    . SER A 1 3   ? -6.430  -21.692 10.719  1.00 0.00 ? 3   SER A C    1  
ATOM 21    O O    . SER A 1 3   ? -6.386  -20.816 11.583  1.00 0.00 ? 3   SER A O    1  
ATOM 22    C CB   . SER A 1 3   ? -8.358  -23.296 10.611  1.00 0.00 ? 3   SER A CB   1  
ATOM 23    O OG   . SER A 1 3   ? -9.233  -22.327 11.183  1.00 0.00 ? 3   SER A OG   1  
ATOM 24    H H    . SER A 1 3   ? -6.475  -22.543 13.026  1.00 0.00 ? 3   SER A H    1  
ATOM 25    H HA   . SER A 1 3   ? -6.277  -23.850 10.592  1.00 0.00 ? 3   SER A HA   1  
ATOM 26    H HB3  . SER A 1 3   ? -8.695  -24.295 10.889  1.00 0.00 ? 3   SER A HB3  1  
ATOM 27    H HG   . SER A 1 3   ? -10.114 -22.746 11.398  1.00 0.00 ? 3   SER A HG   1  
ATOM 28    N N    . GLY A 1 4   ? -6.081  -21.515 9.453   1.00 0.00 ? 4   GLY A N    1  
ATOM 29    C CA   . GLY A 1 4   ? -5.605  -20.226 8.981   1.00 0.00 ? 4   GLY A CA   1  
ATOM 30    C C    . GLY A 1 4   ? -6.773  -19.333 8.557   1.00 0.00 ? 4   GLY A C    1  
ATOM 31    O O    . GLY A 1 4   ? -6.747  -18.744 7.476   1.00 0.00 ? 4   GLY A O    1  
ATOM 32    H H    . GLY A 1 4   ? -6.121  -22.232 8.757   1.00 0.00 ? 4   GLY A H    1  
ATOM 33    H HA2  . GLY A 1 4   ? -5.034  -19.734 9.768   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 34    H HA3  . GLY A 1 4   ? -4.929  -20.370 8.139   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 35    N N    . SER A 1 5   ? -7.768  -19.259 9.429   1.00 0.00 ? 5   SER A N    1  
ATOM 36    C CA   . SER A 1 5   ? -8.942  -18.446 9.158   1.00 0.00 ? 5   SER A CA   1  
ATOM 37    C C    . SER A 1 5   ? -9.717  -19.026 7.972   1.00 0.00 ? 5   SER A C    1  
ATOM 38    O O    . SER A 1 5   ? -9.264  -18.948 6.832   1.00 0.00 ? 5   SER A O    1  
ATOM 39    C CB   . SER A 1 5   ? -8.554  -16.993 8.878   1.00 0.00 ? 5   SER A CB   1  
ATOM 40    O OG   . SER A 1 5   ? -8.999  -16.115 9.908   1.00 0.00 ? 5   SER A OG   1  
ATOM 41    H H    . SER A 1 5   ? -7.780  -19.740 10.305  1.00 0.00 ? 5   SER A H    1  
ATOM 42    H HA   . SER A 1 5   ? -9.541  -18.494 10.066  1.00 0.00 ? 5   SER A HA   1  
ATOM 43    H HB3  . SER A 1 5   ? -8.982  -16.680 7.926   1.00 0.00 ? 5   SER A HB3  1  
ATOM 44    H HG   . SER A 1 5   ? -9.945  -16.325 10.152  1.00 0.00 ? 5   SER A HG   1  
ATOM 45    N N    . SER A 1 6   ? -10.872 -19.597 8.284   1.00 0.00 ? 6   SER A N    1  
ATOM 46    C CA   . SER A 1 6   ? -11.714 -20.190 7.259   1.00 0.00 ? 6   SER A CA   1  
ATOM 47    C C    . SER A 1 6   ? -12.859 -19.237 6.907   1.00 0.00 ? 6   SER A C    1  
ATOM 48    O O    . SER A 1 6   ? -13.971 -19.387 7.412   1.00 0.00 ? 6   SER A O    1  
ATOM 49    C CB   . SER A 1 6   ? -12.267 -21.541 7.715   1.00 0.00 ? 6   SER A CB   1  
ATOM 50    O OG   . SER A 1 6   ? -11.896 -22.595 6.830   1.00 0.00 ? 6   SER A OG   1  
ATOM 51    H H    . SER A 1 6   ? -11.232 -19.656 9.214   1.00 0.00 ? 6   SER A H    1  
ATOM 52    H HA   . SER A 1 6   ? -11.060 -20.336 6.398   1.00 0.00 ? 6   SER A HA   1  
ATOM 53    H HB3  . SER A 1 6   ? -13.354 -21.485 7.777   1.00 0.00 ? 6   SER A HB3  1  
ATOM 54    H HG   . SER A 1 6   ? -11.446 -23.328 7.340   1.00 0.00 ? 6   SER A HG   1  
ATOM 55    N N    . GLY A 1 7   ? -12.548 -18.281 6.045   1.00 0.00 ? 7   GLY A N    1  
ATOM 56    C CA   . GLY A 1 7   ? -13.538 -17.306 5.620   1.00 0.00 ? 7   GLY A CA   1  
ATOM 57    C C    . GLY A 1 7   ? -13.526 -16.079 6.534   1.00 0.00 ? 7   GLY A C    1  
ATOM 58    O O    . GLY A 1 7   ? -13.481 -16.211 7.756   1.00 0.00 ? 7   GLY A O    1  
ATOM 59    H H    . GLY A 1 7   ? -11.642 -18.167 5.638   1.00 0.00 ? 7   GLY A H    1  
ATOM 60    H HA2  . GLY A 1 7   ? -13.336 -17.001 4.593   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 61    H HA3  . GLY A 1 7   ? -14.528 -17.761 5.629   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 62    N N    . GLY A 1 8   ? -13.566 -14.914 5.906   1.00 0.00 ? 8   GLY A N    1  
ATOM 63    C CA   . GLY A 1 8   ? -13.560 -13.664 6.648   1.00 0.00 ? 8   GLY A CA   1  
ATOM 64    C C    . GLY A 1 8   ? -12.313 -12.840 6.324   1.00 0.00 ? 8   GLY A C    1  
ATOM 65    O O    . GLY A 1 8   ? -11.298 -13.386 5.897   1.00 0.00 ? 8   GLY A O    1  
ATOM 66    H H    . GLY A 1 8   ? -13.602 -14.814 4.913   1.00 0.00 ? 8   GLY A H    1  
ATOM 67    H HA2  . GLY A 1 8   ? -14.454 -13.088 6.406   1.00 0.00 ? 8   GLY A HA2  1  
ATOM 68    H HA3  . GLY A 1 8   ? -13.596 -13.871 7.719   1.00 0.00 ? 8   GLY A HA3  1  
ATOM 69    N N    . PRO A 1 9   ? -12.432 -11.503 6.547   1.00 0.00 ? 9   PRO A N    1  
ATOM 70    C CA   . PRO A 1 9   ? -11.327 -10.599 6.283   1.00 0.00 ? 9   PRO A CA   1  
ATOM 71    C C    . PRO A 1 9   ? -10.252 -10.717 7.365   1.00 0.00 ? 9   PRO A C    1  
ATOM 72    O O    . PRO A 1 9   ? -10.568 -10.851 8.545   1.00 0.00 ? 9   PRO A O    1  
ATOM 73    C CB   . PRO A 1 9   ? -11.956 -9.216  6.218   1.00 0.00 ? 9   PRO A CB   1  
ATOM 74    C CG   . PRO A 1 9   ? -13.307 -9.340  6.905   1.00 0.00 ? 9   PRO A CG   1  
ATOM 75    C CD   . PRO A 1 9   ? -13.620 -10.821 7.051   1.00 0.00 ? 9   PRO A CD   1  
ATOM 76    H HA   . PRO A 1 9   ? -10.877 -10.841 5.422   1.00 0.00 ? 9   PRO A HA   1  
ATOM 77    H HB3  . PRO A 1 9   ? -12.073 -8.888  5.185   1.00 0.00 ? 9   PRO A HB3  1  
ATOM 78    H HG3  . PRO A 1 9   ? -14.080 -8.842  6.321   1.00 0.00 ? 9   PRO A HG3  1  
ATOM 79    H HD3  . PRO A 1 9   ? -14.507 -11.095 6.482   1.00 0.00 ? 9   PRO A HD3  1  
ATOM 80    N N    . LYS A 1 10  ? -9.004  -10.659 6.923   1.00 0.00 ? 10  LYS A N    1  
ATOM 81    C CA   . LYS A 1 10  ? -7.881  -10.758 7.840   1.00 0.00 ? 10  LYS A CA   1  
ATOM 82    C C    . LYS A 1 10  ? -7.528  -9.364  8.358   1.00 0.00 ? 10  LYS A C    1  
ATOM 83    O O    . LYS A 1 10  ? -7.622  -8.381  7.624   1.00 0.00 ? 10  LYS A O    1  
ATOM 84    C CB   . LYS A 1 10  ? -6.708  -11.482 7.174   1.00 0.00 ? 10  LYS A CB   1  
ATOM 85    C CG   . LYS A 1 10  ? -5.408  -11.241 7.942   1.00 0.00 ? 10  LYS A CG   1  
ATOM 86    C CD   . LYS A 1 10  ? -5.369  -12.069 9.228   1.00 0.00 ? 10  LYS A CD   1  
ATOM 87    C CE   . LYS A 1 10  ? -3.981  -12.672 9.450   1.00 0.00 ? 10  LYS A CE   1  
ATOM 88    N NZ   . LYS A 1 10  ? -4.036  -13.738 10.475  1.00 0.00 ? 10  LYS A NZ   1  
ATOM 89    H H    . LYS A 1 10  ? -8.756  -10.548 5.961   1.00 0.00 ? 10  LYS A H    1  
ATOM 90    H HA   . LYS A 1 10  ? -8.200  -11.371 8.683   1.00 0.00 ? 10  LYS A HA   1  
ATOM 91    H HB3  . LYS A 1 10  ? -6.598  -11.134 6.147   1.00 0.00 ? 10  LYS A HB3  1  
ATOM 92    H HG3  . LYS A 1 10  ? -5.315  -10.182 8.185   1.00 0.00 ? 10  LYS A HG3  1  
ATOM 93    H HD3  . LYS A 1 10  ? -6.111  -12.867 9.174   1.00 0.00 ? 10  LYS A HD3  1  
ATOM 94    H HE3  . LYS A 1 10  ? -3.285  -11.893 9.764   1.00 0.00 ? 10  LYS A HE3  1  
ATOM 95    H HZ1  . LYS A 1 10  ? -4.059  -13.324 11.386  1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 96    H HZ2  . LYS A 1 10  ? -4.859  -14.290 10.340  1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 97    H HZ3  . LYS A 1 10  ? -3.227  -14.321 10.394  1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 98    N N    . THR A 1 11  ? -7.128  -9.320  9.621   1.00 0.00 ? 11  THR A N    1  
ATOM 99    C CA   . THR A 1 11  ? -6.761  -8.061  10.246  1.00 0.00 ? 11  THR A CA   1  
ATOM 100   C C    . THR A 1 11  ? -5.442  -8.210  11.009  1.00 0.00 ? 11  THR A C    1  
ATOM 101   O O    . THR A 1 11  ? -5.218  -9.218  11.678  1.00 0.00 ? 11  THR A O    1  
ATOM 102   C CB   . THR A 1 11  ? -7.927  -7.613  11.130  1.00 0.00 ? 11  THR A CB   1  
ATOM 103   O OG1  . THR A 1 11  ? -9.033  -7.542  10.236  1.00 0.00 ? 11  THR A OG1  1  
ATOM 104   C CG2  . THR A 1 11  ? -7.760  -6.180  11.636  1.00 0.00 ? 11  THR A CG2  1  
ATOM 105   H H    . THR A 1 11  ? -7.054  -10.124 10.212  1.00 0.00 ? 11  THR A H    1  
ATOM 106   H HA   . THR A 1 11  ? -6.595  -7.323  9.463   1.00 0.00 ? 11  THR A HA   1  
ATOM 107   H HB   . THR A 1 11  ? -8.072  -8.304  11.962  1.00 0.00 ? 11  THR A HB   1  
ATOM 108   H HG1  . THR A 1 11  ? -9.875  -7.369  10.746  1.00 0.00 ? 11  THR A HG1  1  
ATOM 109   H HG21 . THR A 1 11  ? -8.743  -5.744  11.822  1.00 0.00 ? 11  THR A HG21 1  
ATOM 110   H HG22 . THR A 1 11  ? -7.184  -6.184  12.562  1.00 0.00 ? 11  THR A HG22 1  
ATOM 111   H HG23 . THR A 1 11  ? -7.239  -5.587  10.885  1.00 0.00 ? 11  THR A HG23 1  
ATOM 112   N N    . VAL A 1 12  ? -4.604  -7.191  10.883  1.00 0.00 ? 12  VAL A N    1  
ATOM 113   C CA   . VAL A 1 12  ? -3.314  -7.196  11.552  1.00 0.00 ? 12  VAL A CA   1  
ATOM 114   C C    . VAL A 1 12  ? -3.040  -5.807  12.133  1.00 0.00 ? 12  VAL A C    1  
ATOM 115   O O    . VAL A 1 12  ? -3.162  -4.802  11.430  1.00 0.00 ? 12  VAL A O    1  
ATOM 116   C CB   . VAL A 1 12  ? -2.225  -7.667  10.586  1.00 0.00 ? 12  VAL A CB   1  
ATOM 117   C CG1  . VAL A 1 12  ? -2.051  -9.184  10.653  1.00 0.00 ? 12  VAL A CG1  1  
ATOM 118   C CG2  . VAL A 1 12  ? -2.527  -7.212  9.157   1.00 0.00 ? 12  VAL A CG2  1  
ATOM 119   H H    . VAL A 1 12  ? -4.795  -6.375  10.338  1.00 0.00 ? 12  VAL A H    1  
ATOM 120   H HA   . VAL A 1 12  ? -3.371  -7.913  12.371  1.00 0.00 ? 12  VAL A HA   1  
ATOM 121   H HB   . VAL A 1 12  ? -1.286  -7.207  10.892  1.00 0.00 ? 12  VAL A HB   1  
ATOM 122   H HG11 . VAL A 1 12  ? -2.045  -9.503  11.695  1.00 0.00 ? 12  VAL A HG11 1  
ATOM 123   H HG12 . VAL A 1 12  ? -2.877  -9.669  10.131  1.00 0.00 ? 12  VAL A HG12 1  
ATOM 124   H HG13 . VAL A 1 12  ? -1.110  -9.464  10.181  1.00 0.00 ? 12  VAL A HG13 1  
ATOM 125   H HG21 . VAL A 1 12  ? -2.969  -8.037  8.598   1.00 0.00 ? 12  VAL A HG21 1  
ATOM 126   H HG22 . VAL A 1 12  ? -3.226  -6.374  9.181   1.00 0.00 ? 12  VAL A HG22 1  
ATOM 127   H HG23 . VAL A 1 12  ? -1.602  -6.899  8.672   1.00 0.00 ? 12  VAL A HG23 1  
ATOM 128   N N    . THR A 1 13  ? -2.675  -5.793  13.405  1.00 0.00 ? 13  THR A N    1  
ATOM 129   C CA   . THR A 1 13  ? -2.383  -4.544  14.086  1.00 0.00 ? 13  THR A CA   1  
ATOM 130   C C    . THR A 1 13  ? -0.871  -4.354  14.227  1.00 0.00 ? 13  THR A C    1  
ATOM 131   O O    . THR A 1 13  ? -0.143  -5.312  14.478  1.00 0.00 ? 13  THR A O    1  
ATOM 132   C CB   . THR A 1 13  ? -3.122  -4.552  15.427  1.00 0.00 ? 13  THR A CB   1  
ATOM 133   O OG1  . THR A 1 13  ? -4.466  -4.872  15.080  1.00 0.00 ? 13  THR A OG1  1  
ATOM 134   C CG2  . THR A 1 13  ? -3.219  -3.158  16.050  1.00 0.00 ? 13  THR A CG2  1  
ATOM 135   H H    . THR A 1 13  ? -2.579  -6.614  13.968  1.00 0.00 ? 13  THR A H    1  
ATOM 136   H HA   . THR A 1 13  ? -2.753  -3.722  13.473  1.00 0.00 ? 13  THR A HA   1  
ATOM 137   H HB   . THR A 1 13  ? -2.663  -5.256  16.119  1.00 0.00 ? 13  THR A HB   1  
ATOM 138   H HG1  . THR A 1 13  ? -4.499  -5.758  14.618  1.00 0.00 ? 13  THR A HG1  1  
ATOM 139   H HG21 . THR A 1 13  ? -2.219  -2.783  16.262  1.00 0.00 ? 13  THR A HG21 1  
ATOM 140   H HG22 . THR A 1 13  ? -3.719  -2.482  15.354  1.00 0.00 ? 13  THR A HG22 1  
ATOM 141   H HG23 . THR A 1 13  ? -3.791  -3.213  16.976  1.00 0.00 ? 13  THR A HG23 1  
ATOM 142   N N    . LEU A 1 14  ? -0.445  -3.110  14.061  1.00 0.00 ? 14  LEU A N    1  
ATOM 143   C CA   . LEU A 1 14  ? 0.967   -2.783  14.165  1.00 0.00 ? 14  LEU A CA   1  
ATOM 144   C C    . LEU A 1 14  ? 1.139   -1.580  15.096  1.00 0.00 ? 14  LEU A C    1  
ATOM 145   O O    . LEU A 1 14  ? 0.254   -0.731  15.187  1.00 0.00 ? 14  LEU A O    1  
ATOM 146   C CB   . LEU A 1 14  ? 1.574   -2.578  12.777  1.00 0.00 ? 14  LEU A CB   1  
ATOM 147   C CG   . LEU A 1 14  ? 1.499   -3.776  11.828  1.00 0.00 ? 14  LEU A CG   1  
ATOM 148   C CD1  . LEU A 1 14  ? 0.140   -3.838  11.129  1.00 0.00 ? 14  LEU A CD1  1  
ATOM 149   C CD2  . LEU A 1 14  ? 2.658   -3.758  10.829  1.00 0.00 ? 14  LEU A CD2  1  
ATOM 150   H H    . LEU A 1 14  ? -1.045  -2.337  13.856  1.00 0.00 ? 14  LEU A H    1  
ATOM 151   H HA   . LEU A 1 14  ? 1.468   -3.641  14.612  1.00 0.00 ? 14  LEU A HA   1  
ATOM 152   H HB3  . LEU A 1 14  ? 2.621   -2.301  12.897  1.00 0.00 ? 14  LEU A HB3  1  
ATOM 153   H HG   . LEU A 1 14  ? 1.599   -4.686  12.419  1.00 0.00 ? 14  LEU A HG   1  
ATOM 154   H HD11 . LEU A 1 14  ? 0.165   -4.604  10.354  1.00 0.00 ? 14  LEU A HD11 1  
ATOM 155   H HD12 . LEU A 1 14  ? -0.633  -4.082  11.858  1.00 0.00 ? 14  LEU A HD12 1  
ATOM 156   H HD13 . LEU A 1 14  ? -0.080  -2.871  10.676  1.00 0.00 ? 14  LEU A HD13 1  
ATOM 157   H HD21 . LEU A 1 14  ? 2.687   -2.793  10.324  1.00 0.00 ? 14  LEU A HD21 1  
ATOM 158   H HD22 . LEU A 1 14  ? 3.597   -3.920  11.359  1.00 0.00 ? 14  LEU A HD22 1  
ATOM 159   H HD23 . LEU A 1 14  ? 2.515   -4.550  10.093  1.00 0.00 ? 14  LEU A HD23 1  
ATOM 160   N N    . LYS A 1 15  ? 2.284   -1.547  15.762  1.00 0.00 ? 15  LYS A N    1  
ATOM 161   C CA   . LYS A 1 15  ? 2.583   -0.462  16.681  1.00 0.00 ? 15  LYS A CA   1  
ATOM 162   C C    . LYS A 1 15  ? 3.698   0.404   16.095  1.00 0.00 ? 15  LYS A C    1  
ATOM 163   O O    . LYS A 1 15  ? 4.708   -0.113  15.621  1.00 0.00 ? 15  LYS A O    1  
ATOM 164   C CB   . LYS A 1 15  ? 2.900   -1.012  18.074  1.00 0.00 ? 15  LYS A CB   1  
ATOM 165   C CG   . LYS A 1 15  ? 1.772   -1.918  18.575  1.00 0.00 ? 15  LYS A CG   1  
ATOM 166   C CD   . LYS A 1 15  ? 1.273   -1.464  19.948  1.00 0.00 ? 15  LYS A CD   1  
ATOM 167   C CE   . LYS A 1 15  ? 0.576   -2.609  20.685  1.00 0.00 ? 15  LYS A CE   1  
ATOM 168   N NZ   . LYS A 1 15  ? 0.866   -2.545  22.134  1.00 0.00 ? 15  LYS A NZ   1  
ATOM 169   H H    . LYS A 1 15  ? 2.998   -2.242  15.681  1.00 0.00 ? 15  LYS A H    1  
ATOM 170   H HA   . LYS A 1 15  ? 1.684   0.146   16.772  1.00 0.00 ? 15  LYS A HA   1  
ATOM 171   H HB3  . LYS A 1 15  ? 3.044   -0.187  18.770  1.00 0.00 ? 15  LYS A HB3  1  
ATOM 172   H HG3  . LYS A 1 15  ? 2.127   -2.947  18.636  1.00 0.00 ? 15  LYS A HG3  1  
ATOM 173   H HD3  . LYS A 1 15  ? 0.582   -0.629  19.829  1.00 0.00 ? 15  LYS A HD3  1  
ATOM 174   H HE3  . LYS A 1 15  ? 0.910   -3.566  20.282  1.00 0.00 ? 15  LYS A HE3  1  
ATOM 175   H HZ1  . LYS A 1 15  ? 0.773   -1.601  22.452  1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 176   H HZ2  . LYS A 1 15  ? 0.221   -3.127  22.629  1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 177   H HZ3  . LYS A 1 15  ? 1.798   -2.862  22.301  1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 178   N N    . ARG A 1 16  ? 3.479   1.711   16.146  1.00 0.00 ? 16  ARG A N    1  
ATOM 179   C CA   . ARG A 1 16  ? 4.453   2.654   15.626  1.00 0.00 ? 16  ARG A CA   1  
ATOM 180   C C    . ARG A 1 16  ? 5.816   2.426   16.282  1.00 0.00 ? 16  ARG A C    1  
ATOM 181   O O    . ARG A 1 16  ? 5.982   2.663   17.477  1.00 0.00 ? 16  ARG A O    1  
ATOM 182   C CB   . ARG A 1 16  ? 4.010   4.097   15.875  1.00 0.00 ? 16  ARG A CB   1  
ATOM 183   C CG   . ARG A 1 16  ? 4.966   5.087   15.205  1.00 0.00 ? 16  ARG A CG   1  
ATOM 184   C CD   . ARG A 1 16  ? 4.198   6.091   14.342  1.00 0.00 ? 16  ARG A CD   1  
ATOM 185   N NE   . ARG A 1 16  ? 5.028   7.292   14.103  1.00 0.00 ? 16  ARG A NE   1  
ATOM 186   C CZ   . ARG A 1 16  ? 4.546   8.466   13.672  1.00 0.00 ? 16  ARG A CZ   1  
ATOM 187   N NH1  . ARG A 1 16  ? 3.234   8.602   13.427  1.00 0.00 ? 16  ARG A NH1  1  
ATOM 188   N NH2  . ARG A 1 16  ? 5.373   9.503   13.483  1.00 0.00 ? 16  ARG A NH2  1  
ATOM 189   H H    . ARG A 1 16  ? 2.655   2.124   16.534  1.00 0.00 ? 16  ARG A H    1  
ATOM 190   H HA   . ARG A 1 16  ? 4.494   2.451   14.555  1.00 0.00 ? 16  ARG A HA   1  
ATOM 191   H HB3  . ARG A 1 16  ? 3.973   4.290   16.947  1.00 0.00 ? 16  ARG A HB3  1  
ATOM 192   H HG3  . ARG A 1 16  ? 5.683   4.547   14.590  1.00 0.00 ? 16  ARG A HG3  1  
ATOM 193   H HD3  . ARG A 1 16  ? 3.268   6.373   14.838  1.00 0.00 ? 16  ARG A HD3  1  
ATOM 194   H HE   . ARG A 1 16  ? 6.011   7.226   14.277  1.00 0.00 ? 16  ARG A HE   1  
ATOM 195   H HH11 . ARG A 1 16  ? 2.617   7.828   13.567  1.00 0.00 ? 16  ARG A HH11 1  
ATOM 196   H HH12 . ARG A 1 16  ? 2.875   9.476   13.104  1.00 0.00 ? 16  ARG A HH12 1  
ATOM 197   H HH21 . ARG A 1 16  ? 6.352   9.400   13.665  1.00 0.00 ? 16  ARG A HH21 1  
ATOM 198   H HH22 . ARG A 1 16  ? 5.013   10.377  13.160  1.00 0.00 ? 16  ARG A HH22 1  
ATOM 199   N N    . THR A 1 17  ? 6.759   1.968   15.470  1.00 0.00 ? 17  THR A N    1  
ATOM 200   C CA   . THR A 1 17  ? 8.102   1.706   15.956  1.00 0.00 ? 17  THR A CA   1  
ATOM 201   C C    . THR A 1 17  ? 9.141   2.187   14.942  1.00 0.00 ? 17  THR A C    1  
ATOM 202   O O    . THR A 1 17  ? 9.162   1.727   13.802  1.00 0.00 ? 17  THR A O    1  
ATOM 203   C CB   . THR A 1 17  ? 8.208   0.212   16.271  1.00 0.00 ? 17  THR A CB   1  
ATOM 204   O OG1  . THR A 1 17  ? 9.338   0.118   17.134  1.00 0.00 ? 17  THR A OG1  1  
ATOM 205   C CG2  . THR A 1 17  ? 8.603   -0.617  15.047  1.00 0.00 ? 17  THR A CG2  1  
ATOM 206   H H    . THR A 1 17  ? 6.616   1.778   14.499  1.00 0.00 ? 17  THR A H    1  
ATOM 207   H HA   . THR A 1 17  ? 8.257   2.281   16.869  1.00 0.00 ? 17  THR A HA   1  
ATOM 208   H HB   . THR A 1 17  ? 7.282   -0.159  16.711  1.00 0.00 ? 17  THR A HB   1  
ATOM 209   H HG1  . THR A 1 17  ? 10.107  0.627   16.748  1.00 0.00 ? 17  THR A HG1  1  
ATOM 210   H HG21 . THR A 1 17  ? 9.629   -0.382  14.765  1.00 0.00 ? 17  THR A HG21 1  
ATOM 211   H HG22 . THR A 1 17  ? 8.527   -1.678  15.287  1.00 0.00 ? 17  THR A HG22 1  
ATOM 212   H HG23 . THR A 1 17  ? 7.935   -0.383  14.219  1.00 0.00 ? 17  THR A HG23 1  
ATOM 213   N N    . SER A 1 18  ? 9.978   3.111   15.394  1.00 0.00 ? 18  SER A N    1  
ATOM 214   C CA   . SER A 1 18  ? 11.017  3.661   14.539  1.00 0.00 ? 18  SER A CA   1  
ATOM 215   C C    . SER A 1 18  ? 10.417  4.099   13.201  1.00 0.00 ? 18  SER A C    1  
ATOM 216   O O    . SER A 1 18  ? 10.933  3.747   12.142  1.00 0.00 ? 18  SER A O    1  
ATOM 217   C CB   . SER A 1 18  ? 12.137  2.644   14.310  1.00 0.00 ? 18  SER A CB   1  
ATOM 218   O OG   . SER A 1 18  ? 12.517  1.988   15.518  1.00 0.00 ? 18  SER A OG   1  
ATOM 219   H H    . SER A 1 18  ? 9.955   3.480   16.322  1.00 0.00 ? 18  SER A H    1  
ATOM 220   H HA   . SER A 1 18  ? 11.411  4.520   15.081  1.00 0.00 ? 18  SER A HA   1  
ATOM 221   H HB3  . SER A 1 18  ? 13.004  3.149   13.885  1.00 0.00 ? 18  SER A HB3  1  
ATOM 222   H HG   . SER A 1 18  ? 11.959  1.168   15.651  1.00 0.00 ? 18  SER A HG   1  
ATOM 223   N N    . GLN A 1 19  ? 9.336   4.859   13.295  1.00 0.00 ? 19  GLN A N    1  
ATOM 224   C CA   . GLN A 1 19  ? 8.660   5.348   12.104  1.00 0.00 ? 19  GLN A CA   1  
ATOM 225   C C    . GLN A 1 19  ? 8.030   4.185   11.336  1.00 0.00 ? 19  GLN A C    1  
ATOM 226   O O    . GLN A 1 19  ? 6.808   4.043   11.309  1.00 0.00 ? 19  GLN A O    1  
ATOM 227   C CB   . GLN A 1 19  ? 9.622   6.136   11.214  1.00 0.00 ? 19  GLN A CB   1  
ATOM 228   C CG   . GLN A 1 19  ? 10.175  7.358   11.950  1.00 0.00 ? 19  GLN A CG   1  
ATOM 229   C CD   . GLN A 1 19  ? 11.700  7.418   11.843  1.00 0.00 ? 19  GLN A CD   1  
ATOM 230   O OE1  . GLN A 1 19  ? 12.408  6.479   12.165  1.00 0.00 ? 19  GLN A OE1  1  
ATOM 231   N NE2  . GLN A 1 19  ? 12.164  8.574   11.375  1.00 0.00 ? 19  GLN A NE2  1  
ATOM 232   H H    . GLN A 1 19  ? 8.923   5.140   14.160  1.00 0.00 ? 19  GLN A H    1  
ATOM 233   H HA   . GLN A 1 19  ? 7.881   6.016   12.469  1.00 0.00 ? 19  GLN A HA   1  
ATOM 234   H HB3  . GLN A 1 19  ? 9.104   6.457   10.309  1.00 0.00 ? 19  GLN A HB3  1  
ATOM 235   H HG3  . GLN A 1 19  ? 9.882   7.319   12.999  1.00 0.00 ? 19  GLN A HG3  1  
ATOM 236   H HE21 . GLN A 1 19  ? 11.528  9.306   11.130  1.00 0.00 ? 19  GLN A HE21 1  
ATOM 237   H HE22 . GLN A 1 19  ? 13.149  8.710   11.269  1.00 0.00 ? 19  GLN A HE22 1  
ATOM 238   N N    . GLY A 1 20  ? 8.891   3.381   10.730  1.00 0.00 ? 20  GLY A N    1  
ATOM 239   C CA   . GLY A 1 20  ? 8.434   2.235   9.964   1.00 0.00 ? 20  GLY A CA   1  
ATOM 240   C C    . GLY A 1 20  ? 7.640   1.267   10.844  1.00 0.00 ? 20  GLY A C    1  
ATOM 241   O O    . GLY A 1 20  ? 7.538   1.465   12.054  1.00 0.00 ? 20  GLY A O    1  
ATOM 242   H H    . GLY A 1 20  ? 9.883   3.503   10.757  1.00 0.00 ? 20  GLY A H    1  
ATOM 243   H HA2  . GLY A 1 20  ? 7.812   2.572   9.135   1.00 0.00 ? 20  GLY A HA2  1  
ATOM 244   H HA3  . GLY A 1 20  ? 9.290   1.718   9.529   1.00 0.00 ? 20  GLY A HA3  1  
ATOM 245   N N    . PHE A 1 21  ? 7.098   0.243   10.201  1.00 0.00 ? 21  PHE A N    1  
ATOM 246   C CA   . PHE A 1 21  ? 6.317   -0.756  10.912  1.00 0.00 ? 21  PHE A CA   1  
ATOM 247   C C    . PHE A 1 21  ? 6.780   -2.170  10.553  1.00 0.00 ? 21  PHE A C    1  
ATOM 248   O O    . PHE A 1 21  ? 5.962   -3.079  10.421  1.00 0.00 ? 21  PHE A O    1  
ATOM 249   C CB   . PHE A 1 21  ? 4.861   -0.581  10.472  1.00 0.00 ? 21  PHE A CB   1  
ATOM 250   C CG   . PHE A 1 21  ? 4.193   0.679   11.023  1.00 0.00 ? 21  PHE A CG   1  
ATOM 251   C CD1  . PHE A 1 21  ? 4.550   1.902   10.545  1.00 0.00 ? 21  PHE A CD1  1  
ATOM 252   C CD2  . PHE A 1 21  ? 3.241   0.577   11.988  1.00 0.00 ? 21  PHE A CD2  1  
ATOM 253   C CE1  . PHE A 1 21  ? 3.929   3.073   11.057  1.00 0.00 ? 21  PHE A CE1  1  
ATOM 254   C CE2  . PHE A 1 21  ? 2.619   1.747   12.500  1.00 0.00 ? 21  PHE A CE2  1  
ATOM 255   C CZ   . PHE A 1 21  ? 2.977   2.970   12.023  1.00 0.00 ? 21  PHE A CZ   1  
ATOM 256   H H    . PHE A 1 21  ? 7.186   0.090   9.218   1.00 0.00 ? 21  PHE A H    1  
ATOM 257   H HA   . PHE A 1 21  ? 6.467   -0.586  11.978  1.00 0.00 ? 21  PHE A HA   1  
ATOM 258   H HB3  . PHE A 1 21  ? 4.290   -1.453  10.790  1.00 0.00 ? 21  PHE A HB3  1  
ATOM 259   H HD1  . PHE A 1 21  ? 5.313   1.983   9.771   1.00 0.00 ? 21  PHE A HD1  1  
ATOM 260   H HD2  . PHE A 1 21  ? 2.954   -0.403  12.370  1.00 0.00 ? 21  PHE A HD2  1  
ATOM 261   H HE1  . PHE A 1 21  ? 4.215   4.053   10.676  1.00 0.00 ? 21  PHE A HE1  1  
ATOM 262   H HE2  . PHE A 1 21  ? 1.856   1.666   13.274  1.00 0.00 ? 21  PHE A HE2  1  
ATOM 263   H HZ   . PHE A 1 21  ? 2.500   3.869   12.414  1.00 0.00 ? 21  PHE A HZ   1  
ATOM 264   N N    . GLY A 1 22  ? 8.089   -2.310  10.408  1.00 0.00 ? 22  GLY A N    1  
ATOM 265   C CA   . GLY A 1 22  ? 8.670   -3.598  10.068  1.00 0.00 ? 22  GLY A CA   1  
ATOM 266   C C    . GLY A 1 22  ? 8.565   -3.867  8.565   1.00 0.00 ? 22  GLY A C    1  
ATOM 267   O O    . GLY A 1 22  ? 9.551   -3.750  7.839   1.00 0.00 ? 22  GLY A O    1  
ATOM 268   H H    . GLY A 1 22  ? 8.747   -1.564  10.517  1.00 0.00 ? 22  GLY A H    1  
ATOM 269   H HA2  . GLY A 1 22  ? 9.716   -3.621  10.372  1.00 0.00 ? 22  GLY A HA2  1  
ATOM 270   H HA3  . GLY A 1 22  ? 8.160   -4.388  10.619  1.00 0.00 ? 22  GLY A HA3  1  
ATOM 271   N N    . PHE A 1 23  ? 7.360   -4.222  8.143   1.00 0.00 ? 23  PHE A N    1  
ATOM 272   C CA   . PHE A 1 23  ? 7.114   -4.508  6.740   1.00 0.00 ? 23  PHE A CA   1  
ATOM 273   C C    . PHE A 1 23  ? 7.265   -3.248  5.887   1.00 0.00 ? 23  PHE A C    1  
ATOM 274   O O    . PHE A 1 23  ? 7.586   -2.179  6.405   1.00 0.00 ? 23  PHE A O    1  
ATOM 275   C CB   . PHE A 1 23  ? 5.672   -5.011  6.633   1.00 0.00 ? 23  PHE A CB   1  
ATOM 276   C CG   . PHE A 1 23  ? 4.633   -3.897  6.490   1.00 0.00 ? 23  PHE A CG   1  
ATOM 277   C CD1  . PHE A 1 23  ? 4.397   -3.051  7.528   1.00 0.00 ? 23  PHE A CD1  1  
ATOM 278   C CD2  . PHE A 1 23  ? 3.946   -3.754  5.325   1.00 0.00 ? 23  PHE A CD2  1  
ATOM 279   C CE1  . PHE A 1 23  ? 3.432   -2.017  7.395   1.00 0.00 ? 23  PHE A CE1  1  
ATOM 280   C CE2  . PHE A 1 23  ? 2.982   -2.719  5.192   1.00 0.00 ? 23  PHE A CE2  1  
ATOM 281   C CZ   . PHE A 1 23  ? 2.746   -1.872  6.230   1.00 0.00 ? 23  PHE A CZ   1  
ATOM 282   H H    . PHE A 1 23  ? 6.563   -4.314  8.740   1.00 0.00 ? 23  PHE A H    1  
ATOM 283   H HA   . PHE A 1 23  ? 7.850   -5.249  6.425   1.00 0.00 ? 23  PHE A HA   1  
ATOM 284   H HB3  . PHE A 1 23  ? 5.436   -5.602  7.518   1.00 0.00 ? 23  PHE A HB3  1  
ATOM 285   H HD1  . PHE A 1 23  ? 4.948   -3.166  8.461   1.00 0.00 ? 23  PHE A HD1  1  
ATOM 286   H HD2  . PHE A 1 23  ? 4.136   -4.432  4.493   1.00 0.00 ? 23  PHE A HD2  1  
ATOM 287   H HE1  . PHE A 1 23  ? 3.243   -1.338  8.227   1.00 0.00 ? 23  PHE A HE1  1  
ATOM 288   H HE2  . PHE A 1 23  ? 2.432   -2.604  4.258   1.00 0.00 ? 23  PHE A HE2  1  
ATOM 289   H HZ   . PHE A 1 23  ? 2.006   -1.078  6.127   1.00 0.00 ? 23  PHE A HZ   1  
ATOM 290   N N    . THR A 1 24  ? 7.029   -3.413  4.594   1.00 0.00 ? 24  THR A N    1  
ATOM 291   C CA   . THR A 1 24  ? 7.136   -2.302  3.665   1.00 0.00 ? 24  THR A CA   1  
ATOM 292   C C    . THR A 1 24  ? 6.316   -2.580  2.403   1.00 0.00 ? 24  THR A C    1  
ATOM 293   O O    . THR A 1 24  ? 5.918   -3.719  2.156   1.00 0.00 ? 24  THR A O    1  
ATOM 294   C CB   . THR A 1 24  ? 8.620   -2.061  3.384   1.00 0.00 ? 24  THR A CB   1  
ATOM 295   O OG1  . THR A 1 24  ? 8.623   -1.058  2.370   1.00 0.00 ? 24  THR A OG1  1  
ATOM 296   C CG2  . THR A 1 24  ? 9.293   -3.264  2.722   1.00 0.00 ? 24  THR A CG2  1  
ATOM 297   H H    . THR A 1 24  ? 6.768   -4.286  4.180   1.00 0.00 ? 24  THR A H    1  
ATOM 298   H HA   . THR A 1 24  ? 6.706   -1.417  4.136   1.00 0.00 ? 24  THR A HA   1  
ATOM 299   H HB   . THR A 1 24  ? 9.146   -1.773  4.295   1.00 0.00 ? 24  THR A HB   1  
ATOM 300   H HG1  . THR A 1 24  ? 9.257   -0.325  2.617   1.00 0.00 ? 24  THR A HG1  1  
ATOM 301   H HG21 . THR A 1 24  ? 9.964   -3.744  3.435   1.00 0.00 ? 24  THR A HG21 1  
ATOM 302   H HG22 . THR A 1 24  ? 8.532   -3.978  2.403   1.00 0.00 ? 24  THR A HG22 1  
ATOM 303   H HG23 . THR A 1 24  ? 9.863   -2.930  1.855   1.00 0.00 ? 24  THR A HG23 1  
ATOM 304   N N    . LEU A 1 25  ? 6.089   -1.523  1.638   1.00 0.00 ? 25  LEU A N    1  
ATOM 305   C CA   . LEU A 1 25  ? 5.324   -1.639  0.408   1.00 0.00 ? 25  LEU A CA   1  
ATOM 306   C C    . LEU A 1 25  ? 6.265   -1.493  -0.789  1.00 0.00 ? 25  LEU A C    1  
ATOM 307   O O    . LEU A 1 25  ? 7.471   -1.315  -0.617  1.00 0.00 ? 25  LEU A O    1  
ATOM 308   C CB   . LEU A 1 25  ? 4.163   -0.643  0.403   1.00 0.00 ? 25  LEU A CB   1  
ATOM 309   C CG   . LEU A 1 25  ? 3.083   -0.866  1.463   1.00 0.00 ? 25  LEU A CG   1  
ATOM 310   C CD1  . LEU A 1 25  ? 2.895   -2.357  1.749   1.00 0.00 ? 25  LEU A CD1  1  
ATOM 311   C CD2  . LEU A 1 25  ? 3.388   -0.072  2.734   1.00 0.00 ? 25  LEU A CD2  1  
ATOM 312   H H    . LEU A 1 25  ? 6.415   -0.602  1.847   1.00 0.00 ? 25  LEU A H    1  
ATOM 313   H HA   . LEU A 1 25  ? 4.891   -2.639  0.386   1.00 0.00 ? 25  LEU A HA   1  
ATOM 314   H HB3  . LEU A 1 25  ? 3.692   -0.671  -0.581  1.00 0.00 ? 25  LEU A HB3  1  
ATOM 315   H HG   . LEU A 1 25  ? 2.137   -0.492  1.069   1.00 0.00 ? 25  LEU A HG   1  
ATOM 316   H HD11 . LEU A 1 25  ? 2.917   -2.912  0.811   1.00 0.00 ? 25  LEU A HD11 1  
ATOM 317   H HD12 . LEU A 1 25  ? 3.698   -2.706  2.397   1.00 0.00 ? 25  LEU A HD12 1  
ATOM 318   H HD13 . LEU A 1 25  ? 1.935   -2.515  2.240   1.00 0.00 ? 25  LEU A HD13 1  
ATOM 319   H HD21 . LEU A 1 25  ? 2.701   0.769   2.812   1.00 0.00 ? 25  LEU A HD21 1  
ATOM 320   H HD22 . LEU A 1 25  ? 3.272   -0.720  3.603   1.00 0.00 ? 25  LEU A HD22 1  
ATOM 321   H HD23 . LEU A 1 25  ? 4.413   0.299   2.692   1.00 0.00 ? 25  LEU A HD23 1  
ATOM 322   N N    . ARG A 1 26  ? 5.681   -1.576  -1.975  1.00 0.00 ? 26  ARG A N    1  
ATOM 323   C CA   . ARG A 1 26  ? 6.453   -1.455  -3.199  1.00 0.00 ? 26  ARG A CA   1  
ATOM 324   C C    . ARG A 1 26  ? 6.096   -0.156  -3.926  1.00 0.00 ? 26  ARG A C    1  
ATOM 325   O O    . ARG A 1 26  ? 4.920   0.171   -4.078  1.00 0.00 ? 26  ARG A O    1  
ATOM 326   C CB   . ARG A 1 26  ? 6.196   -2.640  -4.131  1.00 0.00 ? 26  ARG A CB   1  
ATOM 327   C CG   . ARG A 1 26  ? 7.376   -3.614  -4.119  1.00 0.00 ? 26  ARG A CG   1  
ATOM 328   C CD   . ARG A 1 26  ? 8.142   -3.566  -5.442  1.00 0.00 ? 26  ARG A CD   1  
ATOM 329   N NE   . ARG A 1 26  ? 7.594   -4.573  -6.380  1.00 0.00 ? 26  ARG A NE   1  
ATOM 330   C CZ   . ARG A 1 26  ? 7.750   -5.895  -6.237  1.00 0.00 ? 26  ARG A CZ   1  
ATOM 331   N NH1  . ARG A 1 26  ? 8.437   -6.381  -5.194  1.00 0.00 ? 26  ARG A NH1  1  
ATOM 332   N NH2  . ARG A 1 26  ? 7.219   -6.734  -7.138  1.00 0.00 ? 26  ARG A NH2  1  
ATOM 333   H H    . ARG A 1 26  ? 4.700   -1.721  -2.106  1.00 0.00 ? 26  ARG A H    1  
ATOM 334   H HA   . ARG A 1 26  ? 7.494   -1.449  -2.875  1.00 0.00 ? 26  ARG A HA   1  
ATOM 335   H HB3  . ARG A 1 26  ? 6.029   -2.280  -5.147  1.00 0.00 ? 26  ARG A HB3  1  
ATOM 336   H HG3  . ARG A 1 26  ? 7.014   -4.627  -3.940  1.00 0.00 ? 26  ARG A HG3  1  
ATOM 337   H HD3  . ARG A 1 26  ? 9.200   -3.759  -5.267  1.00 0.00 ? 26  ARG A HD3  1  
ATOM 338   H HE   . ARG A 1 26  ? 7.076   -4.243  -7.170  1.00 0.00 ? 26  ARG A HE   1  
ATOM 339   H HH11 . ARG A 1 26  ? 8.832   -5.756  -4.522  1.00 0.00 ? 26  ARG A HH11 1  
ATOM 340   H HH12 . ARG A 1 26  ? 8.552   -7.368  -5.087  1.00 0.00 ? 26  ARG A HH12 1  
ATOM 341   H HH21 . ARG A 1 26  ? 6.706   -6.371  -7.916  1.00 0.00 ? 26  ARG A HH21 1  
ATOM 342   H HH22 . ARG A 1 26  ? 7.334   -7.721  -7.032  1.00 0.00 ? 26  ARG A HH22 1  
ATOM 343   N N    . HIS A 1 27  ? 7.133   0.546   -4.358  1.00 0.00 ? 27  HIS A N    1  
ATOM 344   C CA   . HIS A 1 27  ? 6.942   1.802   -5.065  1.00 0.00 ? 27  HIS A CA   1  
ATOM 345   C C    . HIS A 1 27  ? 5.746   1.682   -6.012  1.00 0.00 ? 27  HIS A C    1  
ATOM 346   O O    . HIS A 1 27  ? 5.550   0.644   -6.641  1.00 0.00 ? 27  HIS A O    1  
ATOM 347   C CB   . HIS A 1 27  ? 8.227   2.221   -5.783  1.00 0.00 ? 27  HIS A CB   1  
ATOM 348   C CG   . HIS A 1 27  ? 9.100   3.158   -4.985  1.00 0.00 ? 27  HIS A CG   1  
ATOM 349   N ND1  . HIS A 1 27  ? 10.483  3.103   -5.013  1.00 0.00 ? 27  HIS A ND1  1  
ATOM 350   C CD2  . HIS A 1 27  ? 8.772   4.177   -4.138  1.00 0.00 ? 27  HIS A CD2  1  
ATOM 351   C CE1  . HIS A 1 27  ? 10.955  4.048   -4.213  1.00 0.00 ? 27  HIS A CE1  1  
ATOM 352   N NE2  . HIS A 1 27  ? 9.893   4.713   -3.672  1.00 0.00 ? 27  HIS A NE2  1  
ATOM 353   H H    . HIS A 1 27  ? 8.086   0.273   -4.231  1.00 0.00 ? 27  HIS A H    1  
ATOM 354   H HA   . HIS A 1 27  ? 6.724   2.557   -4.311  1.00 0.00 ? 27  HIS A HA   1  
ATOM 355   H HB3  . HIS A 1 27  ? 7.964   2.698   -6.727  1.00 0.00 ? 27  HIS A HB3  1  
ATOM 356   H HD1  . HIS A 1 27  ? 11.031  2.458   -5.545  1.00 0.00 ? 27  HIS A HD1  1  
ATOM 357   H HD2  . HIS A 1 27  ? 7.761   4.496   -3.887  1.00 0.00 ? 27  HIS A HD2  1  
ATOM 358   H HE1  . HIS A 1 27  ? 12.007  4.258   -4.023  1.00 0.00 ? 27  HIS A HE1  1  
ATOM 359   N N    . PHE A 1 28  ? 4.978   2.759   -6.082  1.00 0.00 ? 28  PHE A N    1  
ATOM 360   C CA   . PHE A 1 28  ? 3.807   2.788   -6.940  1.00 0.00 ? 28  PHE A CA   1  
ATOM 361   C C    . PHE A 1 28  ? 4.205   2.710   -8.414  1.00 0.00 ? 28  PHE A C    1  
ATOM 362   O O    . PHE A 1 28  ? 5.149   3.374   -8.844  1.00 0.00 ? 28  PHE A O    1  
ATOM 363   C CB   . PHE A 1 28  ? 3.098   4.120   -6.686  1.00 0.00 ? 28  PHE A CB   1  
ATOM 364   C CG   . PHE A 1 28  ? 4.019   5.339   -6.763  1.00 0.00 ? 28  PHE A CG   1  
ATOM 365   C CD1  . PHE A 1 28  ? 4.272   5.927   -7.963  1.00 0.00 ? 28  PHE A CD1  1  
ATOM 366   C CD2  . PHE A 1 28  ? 4.583   5.836   -5.630  1.00 0.00 ? 28  PHE A CD2  1  
ATOM 367   C CE1  . PHE A 1 28  ? 5.126   7.057   -8.034  1.00 0.00 ? 28  PHE A CE1  1  
ATOM 368   C CE2  . PHE A 1 28  ? 5.438   6.968   -5.700  1.00 0.00 ? 28  PHE A CE2  1  
ATOM 369   C CZ   . PHE A 1 28  ? 5.691   7.555   -6.901  1.00 0.00 ? 28  PHE A CZ   1  
ATOM 370   H H    . PHE A 1 28  ? 5.145   3.600   -5.566  1.00 0.00 ? 28  PHE A H    1  
ATOM 371   H HA   . PHE A 1 28  ? 3.197   1.922   -6.684  1.00 0.00 ? 28  PHE A HA   1  
ATOM 372   H HB3  . PHE A 1 28  ? 2.633   4.089   -5.700  1.00 0.00 ? 28  PHE A HB3  1  
ATOM 373   H HD1  . PHE A 1 28  ? 3.819   5.527   -8.870  1.00 0.00 ? 28  PHE A HD1  1  
ATOM 374   H HD2  . PHE A 1 28  ? 4.381   5.366   -4.667  1.00 0.00 ? 28  PHE A HD2  1  
ATOM 375   H HE1  . PHE A 1 28  ? 5.329   7.527   -8.996  1.00 0.00 ? 28  PHE A HE1  1  
ATOM 376   H HE2  . PHE A 1 28  ? 5.891   7.366   -4.793  1.00 0.00 ? 28  PHE A HE2  1  
ATOM 377   H HZ   . PHE A 1 28  ? 6.347   8.424   -6.956  1.00 0.00 ? 28  PHE A HZ   1  
ATOM 378   N N    . ILE A 1 29  ? 3.468   1.892   -9.153  1.00 0.00 ? 29  ILE A N    1  
ATOM 379   C CA   . ILE A 1 29  ? 3.732   1.718   -10.570 1.00 0.00 ? 29  ILE A CA   1  
ATOM 380   C C    . ILE A 1 29  ? 3.789   3.090   -11.247 1.00 0.00 ? 29  ILE A C    1  
ATOM 381   O O    . ILE A 1 29  ? 2.753   3.670   -11.567 1.00 0.00 ? 29  ILE A O    1  
ATOM 382   C CB   . ILE A 1 29  ? 2.709   0.767   -11.194 1.00 0.00 ? 29  ILE A CB   1  
ATOM 383   C CG1  . ILE A 1 29  ? 2.802   -0.625  -10.568 1.00 0.00 ? 29  ILE A CG1  1  
ATOM 384   C CG2  . ILE A 1 29  ? 2.859   0.722   -12.715 1.00 0.00 ? 29  ILE A CG2  1  
ATOM 385   C CD1  . ILE A 1 29  ? 1.504   -1.407  -10.775 1.00 0.00 ? 29  ILE A CD1  1  
ATOM 386   H H    . ILE A 1 29  ? 2.701   1.355   -8.797  1.00 0.00 ? 29  ILE A H    1  
ATOM 387   H HA   . ILE A 1 29  ? 4.710   1.246   -10.665 1.00 0.00 ? 29  ILE A HA   1  
ATOM 388   H HB   . ILE A 1 29  ? 1.711   1.151   -10.980 1.00 0.00 ? 29  ILE A HB   1  
ATOM 389   H HG13 . ILE A 1 29  ? 3.010   -0.535  -9.502  1.00 0.00 ? 29  ILE A HG13 1  
ATOM 390   H HG21 . ILE A 1 29  ? 3.892   0.488   -12.973 1.00 0.00 ? 29  ILE A HG21 1  
ATOM 391   H HG22 . ILE A 1 29  ? 2.200   -0.044  -13.124 1.00 0.00 ? 29  ILE A HG22 1  
ATOM 392   H HG23 . ILE A 1 29  ? 2.592   1.693   -13.136 1.00 0.00 ? 29  ILE A HG23 1  
ATOM 393   H HD11 . ILE A 1 29  ? 1.178   -1.828  -9.824  1.00 0.00 ? 29  ILE A HD11 1  
ATOM 394   H HD12 . ILE A 1 29  ? 0.734   -0.739  -11.159 1.00 0.00 ? 29  ILE A HD12 1  
ATOM 395   H HD13 . ILE A 1 29  ? 1.675   -2.213  -11.489 1.00 0.00 ? 29  ILE A HD13 1  
ATOM 396   N N    . VAL A 1 30  ? 5.009   3.570   -11.441 1.00 0.00 ? 30  VAL A N    1  
ATOM 397   C CA   . VAL A 1 30  ? 5.213   4.862   -12.073 1.00 0.00 ? 30  VAL A CA   1  
ATOM 398   C C    . VAL A 1 30  ? 4.215   5.027   -13.221 1.00 0.00 ? 30  VAL A C    1  
ATOM 399   O O    . VAL A 1 30  ? 3.845   4.052   -13.873 1.00 0.00 ? 30  VAL A O    1  
ATOM 400   C CB   . VAL A 1 30  ? 6.668   5.000   -12.522 1.00 0.00 ? 30  VAL A CB   1  
ATOM 401   C CG1  . VAL A 1 30  ? 6.942   6.400   -13.075 1.00 0.00 ? 30  VAL A CG1  1  
ATOM 402   C CG2  . VAL A 1 30  ? 7.629   4.665   -11.379 1.00 0.00 ? 30  VAL A CG2  1  
ATOM 403   H H    . VAL A 1 30  ? 5.846   3.090   -11.178 1.00 0.00 ? 30  VAL A H    1  
ATOM 404   H HA   . VAL A 1 30  ? 5.017   5.628   -11.323 1.00 0.00 ? 30  VAL A HA   1  
ATOM 405   H HB   . VAL A 1 30  ? 6.842   4.283   -13.326 1.00 0.00 ? 30  VAL A HB   1  
ATOM 406   H HG11 . VAL A 1 30  ? 5.997   6.920   -13.229 1.00 0.00 ? 30  VAL A HG11 1  
ATOM 407   H HG12 . VAL A 1 30  ? 7.551   6.959   -12.365 1.00 0.00 ? 30  VAL A HG12 1  
ATOM 408   H HG13 . VAL A 1 30  ? 7.471   6.319   -14.024 1.00 0.00 ? 30  VAL A HG13 1  
ATOM 409   H HG21 . VAL A 1 30  ? 7.806   3.589   -11.357 1.00 0.00 ? 30  VAL A HG21 1  
ATOM 410   H HG22 . VAL A 1 30  ? 8.575   5.185   -11.534 1.00 0.00 ? 30  VAL A HG22 1  
ATOM 411   H HG23 . VAL A 1 30  ? 7.192   4.981   -10.433 1.00 0.00 ? 30  VAL A HG23 1  
ATOM 412   N N    . TYR A 1 31  ? 3.809   6.270   -13.434 1.00 0.00 ? 31  TYR A N    1  
ATOM 413   C CA   . TYR A 1 31  ? 2.861   6.576   -14.493 1.00 0.00 ? 31  TYR A CA   1  
ATOM 414   C C    . TYR A 1 31  ? 3.349   7.749   -15.345 1.00 0.00 ? 31  TYR A C    1  
ATOM 415   O O    . TYR A 1 31  ? 2.700   8.793   -15.400 1.00 0.00 ? 31  TYR A O    1  
ATOM 416   C CB   . TYR A 1 31  ? 1.561   6.976   -13.792 1.00 0.00 ? 31  TYR A CB   1  
ATOM 417   C CG   . TYR A 1 31  ? 1.305   6.228   -12.482 1.00 0.00 ? 31  TYR A CG   1  
ATOM 418   C CD1  . TYR A 1 31  ? 1.815   6.718   -11.297 1.00 0.00 ? 31  TYR A CD1  1  
ATOM 419   C CD2  . TYR A 1 31  ? 0.564   5.064   -12.485 1.00 0.00 ? 31  TYR A CD2  1  
ATOM 420   C CE1  . TYR A 1 31  ? 1.574   6.015   -10.064 1.00 0.00 ? 31  TYR A CE1  1  
ATOM 421   C CE2  . TYR A 1 31  ? 0.323   4.362   -11.252 1.00 0.00 ? 31  TYR A CE2  1  
ATOM 422   C CZ   . TYR A 1 31  ? 0.840   4.870   -10.102 1.00 0.00 ? 31  TYR A CZ   1  
ATOM 423   O OH   . TYR A 1 31  ? 0.612   4.206   -8.937  1.00 0.00 ? 31  TYR A OH   1  
ATOM 424   H H    . TYR A 1 31  ? 4.114   7.058   -12.901 1.00 0.00 ? 31  TYR A H    1  
ATOM 425   H HA   . TYR A 1 31  ? 2.765   5.693   -15.124 1.00 0.00 ? 31  TYR A HA   1  
ATOM 426   H HB3  . TYR A 1 31  ? 0.725   6.799   -14.469 1.00 0.00 ? 31  TYR A HB3  1  
ATOM 427   H HD1  . TYR A 1 31  ? 2.400   7.637   -11.293 1.00 0.00 ? 31  TYR A HD1  1  
ATOM 428   H HD2  . TYR A 1 31  ? 0.161   4.676   -13.422 1.00 0.00 ? 31  TYR A HD2  1  
ATOM 429   H HE1  . TYR A 1 31  ? 1.971   6.391   -9.120  1.00 0.00 ? 31  TYR A HE1  1  
ATOM 430   H HE2  . TYR A 1 31  ? -0.261  3.439   -11.241 1.00 0.00 ? 31  TYR A HE2  1  
ATOM 431   H HH   . TYR A 1 31  ? 0.790   3.230   -9.060  1.00 0.00 ? 31  TYR A HH   1  
ATOM 432   N N    . PRO A 1 32  ? 4.520   7.533   -16.003 1.00 0.00 ? 32  PRO A N    1  
ATOM 433   C CA   . PRO A 1 32  ? 5.102   8.561   -16.849 1.00 0.00 ? 32  PRO A CA   1  
ATOM 434   C C    . PRO A 1 32  ? 4.341   8.680   -18.171 1.00 0.00 ? 32  PRO A C    1  
ATOM 435   O O    . PRO A 1 32  ? 3.723   7.719   -18.623 1.00 0.00 ? 32  PRO A O    1  
ATOM 436   C CB   . PRO A 1 32  ? 6.552   8.142   -17.034 1.00 0.00 ? 32  PRO A CB   1  
ATOM 437   C CG   . PRO A 1 32  ? 6.608   6.665   -16.677 1.00 0.00 ? 32  PRO A CG   1  
ATOM 438   C CD   . PRO A 1 32  ? 5.316   6.310   -15.960 1.00 0.00 ? 32  PRO A CD   1  
ATOM 439   H HA   . PRO A 1 32  ? 5.029   9.456   -16.408 1.00 0.00 ? 32  PRO A HA   1  
ATOM 440   H HB3  . PRO A 1 32  ? 7.212   8.724   -16.394 1.00 0.00 ? 32  PRO A HB3  1  
ATOM 441   H HG3  . PRO A 1 32  ? 7.468   6.460   -16.038 1.00 0.00 ? 32  PRO A HG3  1  
ATOM 442   H HD3  . PRO A 1 32  ? 5.505   5.997   -14.934 1.00 0.00 ? 32  PRO A HD3  1  
ATOM 443   N N    . PRO A 1 33  ? 4.411   9.902   -18.765 1.00 0.00 ? 33  PRO A N    1  
ATOM 444   C CA   . PRO A 1 33  ? 3.736   10.161  -20.025 1.00 0.00 ? 33  PRO A CA   1  
ATOM 445   C C    . PRO A 1 33  ? 4.482   9.510   -21.192 1.00 0.00 ? 33  PRO A C    1  
ATOM 446   O O    . PRO A 1 33  ? 5.712   9.511   -21.224 1.00 0.00 ? 33  PRO A O    1  
ATOM 447   C CB   . PRO A 1 33  ? 3.669   11.675  -20.133 1.00 0.00 ? 33  PRO A CB   1  
ATOM 448   C CG   . PRO A 1 33  ? 4.714   12.208  -19.165 1.00 0.00 ? 33  PRO A CG   1  
ATOM 449   C CD   . PRO A 1 33  ? 5.133   11.064  -18.257 1.00 0.00 ? 33  PRO A CD   1  
ATOM 450   H HA   . PRO A 1 33  ? 2.825   9.748   -20.022 1.00 0.00 ? 33  PRO A HA   1  
ATOM 451   H HB3  . PRO A 1 33  ? 2.675   12.041  -19.875 1.00 0.00 ? 33  PRO A HB3  1  
ATOM 452   H HG3  . PRO A 1 33  ? 4.306   13.032  -18.580 1.00 0.00 ? 33  PRO A HG3  1  
ATOM 453   H HD3  . PRO A 1 33  ? 4.872   11.269  -17.218 1.00 0.00 ? 33  PRO A HD3  1  
ATOM 454   N N    . GLU A 1 34  ? 3.709   8.970   -22.121 1.00 0.00 ? 34  GLU A N    1  
ATOM 455   C CA   . GLU A 1 34  ? 4.283   8.318   -23.287 1.00 0.00 ? 34  GLU A CA   1  
ATOM 456   C C    . GLU A 1 34  ? 5.229   9.272   -24.017 1.00 0.00 ? 34  GLU A C    1  
ATOM 457   O O    . GLU A 1 34  ? 6.430   9.020   -24.099 1.00 0.00 ? 34  GLU A O    1  
ATOM 458   C CB   . GLU A 1 34  ? 3.186   7.809   -24.224 1.00 0.00 ? 34  GLU A CB   1  
ATOM 459   C CG   . GLU A 1 34  ? 3.535   6.424   -24.775 1.00 0.00 ? 34  GLU A CG   1  
ATOM 460   C CD   . GLU A 1 34  ? 4.689   6.508   -25.776 1.00 0.00 ? 34  GLU A CD   1  
ATOM 461   O OE1  . GLU A 1 34  ? 4.458   7.085   -26.862 1.00 0.00 ? 34  GLU A OE1  1  
ATOM 462   O OE2  . GLU A 1 34  ? 5.775   5.993   -25.435 1.00 0.00 ? 34  GLU A OE2  1  
ATOM 463   H H    . GLU A 1 34  ? 2.710   8.973   -22.089 1.00 0.00 ? 34  GLU A H    1  
ATOM 464   H HA   . GLU A 1 34  ? 4.841   7.468   -22.896 1.00 0.00 ? 34  GLU A HA   1  
ATOM 465   H HB3  . GLU A 1 34  ? 3.053   8.509   -25.049 1.00 0.00 ? 34  GLU A HB3  1  
ATOM 466   H HG3  . GLU A 1 34  ? 2.660   5.990   -25.257 1.00 0.00 ? 34  GLU A HG3  1  
ATOM 467   N N    . SER A 1 35  ? 4.652   10.350  -24.529 1.00 0.00 ? 35  SER A N    1  
ATOM 468   C CA   . SER A 1 35  ? 5.429   11.344  -25.250 1.00 0.00 ? 35  SER A CA   1  
ATOM 469   C C    . SER A 1 35  ? 5.244   12.720  -24.608 1.00 0.00 ? 35  SER A C    1  
ATOM 470   O O    . SER A 1 35  ? 4.122   13.217  -24.509 1.00 0.00 ? 35  SER A O    1  
ATOM 471   C CB   . SER A 1 35  ? 5.032   11.389  -26.726 1.00 0.00 ? 35  SER A CB   1  
ATOM 472   O OG   . SER A 1 35  ? 5.957   12.144  -27.505 1.00 0.00 ? 35  SER A OG   1  
ATOM 473   H H    . SER A 1 35  ? 3.675   10.548  -24.458 1.00 0.00 ? 35  SER A H    1  
ATOM 474   H HA   . SER A 1 35  ? 6.466   11.018  -25.163 1.00 0.00 ? 35  SER A HA   1  
ATOM 475   H HB3  . SER A 1 35  ? 4.037   11.825  -26.822 1.00 0.00 ? 35  SER A HB3  1  
ATOM 476   H HG   . SER A 1 35  ? 5.899   13.111  -27.262 1.00 0.00 ? 35  SER A HG   1  
ATOM 477   N N    . ALA A 1 36  ? 6.360   13.298  -24.187 1.00 0.00 ? 36  ALA A N    1  
ATOM 478   C CA   . ALA A 1 36  ? 6.334   14.607  -23.558 1.00 0.00 ? 36  ALA A CA   1  
ATOM 479   C C    . ALA A 1 36  ? 7.766   15.048  -23.250 1.00 0.00 ? 36  ALA A C    1  
ATOM 480   O O    . ALA A 1 36  ? 8.527   15.376  -24.159 1.00 0.00 ? 36  ALA A O    1  
ATOM 481   C CB   . ALA A 1 36  ? 5.459   14.553  -22.304 1.00 0.00 ? 36  ALA A CB   1  
ATOM 482   H H    . ALA A 1 36  ? 7.267   12.886  -24.272 1.00 0.00 ? 36  ALA A H    1  
ATOM 483   H HA   . ALA A 1 36  ? 5.891   15.307  -24.265 1.00 0.00 ? 36  ALA A HA   1  
ATOM 484   H HB1  . ALA A 1 36  ? 4.410   14.489  -22.595 1.00 0.00 ? 36  ALA A HB1  1  
ATOM 485   H HB2  . ALA A 1 36  ? 5.726   13.677  -21.711 1.00 0.00 ? 36  ALA A HB2  1  
ATOM 486   H HB3  . ALA A 1 36  ? 5.616   15.454  -21.711 1.00 0.00 ? 36  ALA A HB3  1  
ATOM 487   N N    . ILE A 1 37  ? 8.091   15.043  -21.966 1.00 0.00 ? 37  ILE A N    1  
ATOM 488   C CA   . ILE A 1 37  ? 9.418   15.440  -21.528 1.00 0.00 ? 37  ILE A CA   1  
ATOM 489   C C    . ILE A 1 37  ? 9.688   16.880  -21.970 1.00 0.00 ? 37  ILE A C    1  
ATOM 490   O O    . ILE A 1 37  ? 10.353  17.108  -22.978 1.00 0.00 ? 37  ILE A O    1  
ATOM 491   C CB   . ILE A 1 37  ? 10.465  14.439  -22.019 1.00 0.00 ? 37  ILE A CB   1  
ATOM 492   C CG1  . ILE A 1 37  ? 10.125  13.019  -21.560 1.00 0.00 ? 37  ILE A CG1  1  
ATOM 493   C CG2  . ILE A 1 37  ? 11.871  14.860  -21.587 1.00 0.00 ? 37  ILE A CG2  1  
ATOM 494   C CD1  . ILE A 1 37  ? 10.473  11.995  -22.643 1.00 0.00 ? 37  ILE A CD1  1  
ATOM 495   H H    . ILE A 1 37  ? 7.465   14.776  -21.232 1.00 0.00 ? 37  ILE A H    1  
ATOM 496   H HA   . ILE A 1 37  ? 9.426   15.405  -20.438 1.00 0.00 ? 37  ILE A HA   1  
ATOM 497   H HB   . ILE A 1 37  ? 10.452  14.437  -23.109 1.00 0.00 ? 37  ILE A HB   1  
ATOM 498   H HG13 . ILE A 1 37  ? 9.064   12.955  -21.321 1.00 0.00 ? 37  ILE A HG13 1  
ATOM 499   H HG21 . ILE A 1 37  ? 11.802  15.553  -20.749 1.00 0.00 ? 37  ILE A HG21 1  
ATOM 500   H HG22 . ILE A 1 37  ? 12.437  13.978  -21.282 1.00 0.00 ? 37  ILE A HG22 1  
ATOM 501   H HG23 . ILE A 1 37  ? 12.378  15.347  -22.420 1.00 0.00 ? 37  ILE A HG23 1  
ATOM 502   H HD11 . ILE A 1 37  ? 10.905  12.507  -23.502 1.00 0.00 ? 37  ILE A HD11 1  
ATOM 503   H HD12 . ILE A 1 37  ? 11.190  11.277  -22.247 1.00 0.00 ? 37  ILE A HD12 1  
ATOM 504   H HD13 . ILE A 1 37  ? 9.567   11.471  -22.951 1.00 0.00 ? 37  ILE A HD13 1  
ATOM 505   N N    . GLN A 1 38  ? 9.157   17.813  -21.193 1.00 0.00 ? 38  GLN A N    1  
ATOM 506   C CA   . GLN A 1 38  ? 9.332   19.223  -21.492 1.00 0.00 ? 38  GLN A CA   1  
ATOM 507   C C    . GLN A 1 38  ? 8.925   20.075  -20.288 1.00 0.00 ? 38  GLN A C    1  
ATOM 508   O O    . GLN A 1 38  ? 8.305   21.126  -20.448 1.00 0.00 ? 38  GLN A O    1  
ATOM 509   C CB   . GLN A 1 38  ? 8.540   19.622  -22.739 1.00 0.00 ? 38  GLN A CB   1  
ATOM 510   C CG   . GLN A 1 38  ? 7.036   19.591  -22.468 1.00 0.00 ? 38  GLN A CG   1  
ATOM 511   C CD   . GLN A 1 38  ? 6.414   18.285  -22.963 1.00 0.00 ? 38  GLN A CD   1  
ATOM 512   O OE1  . GLN A 1 38  ? 5.731   17.579  -22.240 1.00 0.00 ? 38  GLN A OE1  1  
ATOM 513   N NE2  . GLN A 1 38  ? 6.690   18.003  -24.233 1.00 0.00 ? 38  GLN A NE2  1  
ATOM 514   H H    . GLN A 1 38  ? 8.616   17.617  -20.374 1.00 0.00 ? 38  GLN A H    1  
ATOM 515   H HA   . GLN A 1 38  ? 10.397  19.348  -21.690 1.00 0.00 ? 38  GLN A HA   1  
ATOM 516   H HB3  . GLN A 1 38  ? 8.779   18.943  -23.558 1.00 0.00 ? 38  GLN A HB3  1  
ATOM 517   H HG3  . GLN A 1 38  ? 6.556   20.437  -22.960 1.00 0.00 ? 38  GLN A HG3  1  
ATOM 518   H HE21 . GLN A 1 38  ? 7.259   18.625  -24.772 1.00 0.00 ? 38  GLN A HE21 1  
ATOM 519   H HE22 . GLN A 1 38  ? 6.329   17.169  -24.650 1.00 0.00 ? 38  GLN A HE22 1  
ATOM 520   N N    . PHE A 1 39  ? 9.288   19.591  -19.110 1.00 0.00 ? 39  PHE A N    1  
ATOM 521   C CA   . PHE A 1 39  ? 8.967   20.295  -17.880 1.00 0.00 ? 39  PHE A CA   1  
ATOM 522   C C    . PHE A 1 39  ? 10.089  20.140  -16.852 1.00 0.00 ? 39  PHE A C    1  
ATOM 523   O O    . PHE A 1 39  ? 10.188  19.111  -16.185 1.00 0.00 ? 39  PHE A O    1  
ATOM 524   C CB   . PHE A 1 39  ? 7.690   19.662  -17.323 1.00 0.00 ? 39  PHE A CB   1  
ATOM 525   C CG   . PHE A 1 39  ? 6.808   20.634  -16.534 1.00 0.00 ? 39  PHE A CG   1  
ATOM 526   C CD1  . PHE A 1 39  ? 6.102   21.594  -17.187 1.00 0.00 ? 39  PHE A CD1  1  
ATOM 527   C CD2  . PHE A 1 39  ? 6.731   20.534  -15.180 1.00 0.00 ? 39  PHE A CD2  1  
ATOM 528   C CE1  . PHE A 1 39  ? 5.284   22.495  -16.456 1.00 0.00 ? 39  PHE A CE1  1  
ATOM 529   C CE2  . PHE A 1 39  ? 5.913   21.436  -14.448 1.00 0.00 ? 39  PHE A CE2  1  
ATOM 530   C CZ   . PHE A 1 39  ? 5.207   22.397  -15.101 1.00 0.00 ? 39  PHE A CZ   1  
ATOM 531   H H    . PHE A 1 39  ? 9.790   18.735  -18.989 1.00 0.00 ? 39  PHE A H    1  
ATOM 532   H HA   . PHE A 1 39  ? 8.850   21.349  -18.132 1.00 0.00 ? 39  PHE A HA   1  
ATOM 533   H HB3  . PHE A 1 39  ? 7.962   18.828  -16.675 1.00 0.00 ? 39  PHE A HB3  1  
ATOM 534   H HD1  . PHE A 1 39  ? 6.164   21.673  -18.273 1.00 0.00 ? 39  PHE A HD1  1  
ATOM 535   H HD2  . PHE A 1 39  ? 7.298   19.765  -14.657 1.00 0.00 ? 39  PHE A HD2  1  
ATOM 536   H HE1  . PHE A 1 39  ? 4.717   23.264  -16.979 1.00 0.00 ? 39  PHE A HE1  1  
ATOM 537   H HE2  . PHE A 1 39  ? 5.851   21.357  -13.363 1.00 0.00 ? 39  PHE A HE2  1  
ATOM 538   H HZ   . PHE A 1 39  ? 4.579   23.088  -14.540 1.00 0.00 ? 39  PHE A HZ   1  
ATOM 539   N N    . SER A 1 40  ? 10.907  21.178  -16.754 1.00 0.00 ? 40  SER A N    1  
ATOM 540   C CA   . SER A 1 40  ? 12.019  21.170  -15.820 1.00 0.00 ? 40  SER A CA   1  
ATOM 541   C C    . SER A 1 40  ? 12.925  19.969  -16.094 1.00 0.00 ? 40  SER A C    1  
ATOM 542   O O    . SER A 1 40  ? 12.674  19.195  -17.015 1.00 0.00 ? 40  SER A O    1  
ATOM 543   C CB   . SER A 1 40  ? 11.520  21.139  -14.373 1.00 0.00 ? 40  SER A CB   1  
ATOM 544   O OG   . SER A 1 40  ? 11.147  22.435  -13.909 1.00 0.00 ? 40  SER A OG   1  
ATOM 545   H H    . SER A 1 40  ? 10.820  22.011  -17.300 1.00 0.00 ? 40  SER A H    1  
ATOM 546   H HA   . SER A 1 40  ? 12.553  22.103  -15.999 1.00 0.00 ? 40  SER A HA   1  
ATOM 547   H HB3  . SER A 1 40  ? 12.302  20.735  -13.729 1.00 0.00 ? 40  SER A HB3  1  
ATOM 548   H HG   . SER A 1 40  ? 10.814  22.379  -12.968 1.00 0.00 ? 40  SER A HG   1  
ATOM 549   N N    . TYR A 1 41  ? 13.961  19.851  -15.275 1.00 0.00 ? 41  TYR A N    1  
ATOM 550   C CA   . TYR A 1 41  ? 14.906  18.757  -15.418 1.00 0.00 ? 41  TYR A CA   1  
ATOM 551   C C    . TYR A 1 41  ? 14.985  17.928  -14.134 1.00 0.00 ? 41  TYR A C    1  
ATOM 552   O O    . TYR A 1 41  ? 15.049  16.700  -14.187 1.00 0.00 ? 41  TYR A O    1  
ATOM 553   C CB   . TYR A 1 41  ? 16.268  19.408  -15.675 1.00 0.00 ? 41  TYR A CB   1  
ATOM 554   C CG   . TYR A 1 41  ? 16.425  20.791  -15.042 1.00 0.00 ? 41  TYR A CG   1  
ATOM 555   C CD1  . TYR A 1 41  ? 15.699  21.859  -15.528 1.00 0.00 ? 41  TYR A CD1  1  
ATOM 556   C CD2  . TYR A 1 41  ? 17.294  20.971  -13.984 1.00 0.00 ? 41  TYR A CD2  1  
ATOM 557   C CE1  . TYR A 1 41  ? 15.848  23.162  -14.932 1.00 0.00 ? 41  TYR A CE1  1  
ATOM 558   C CE2  . TYR A 1 41  ? 17.443  22.274  -13.389 1.00 0.00 ? 41  TYR A CE2  1  
ATOM 559   C CZ   . TYR A 1 41  ? 16.711  23.304  -13.893 1.00 0.00 ? 41  TYR A CZ   1  
ATOM 560   O OH   . TYR A 1 41  ? 16.853  24.536  -13.330 1.00 0.00 ? 41  TYR A OH   1  
ATOM 561   H H    . TYR A 1 41  ? 14.157  20.485  -14.528 1.00 0.00 ? 41  TYR A H    1  
ATOM 562   H HA   . TYR A 1 41  ? 14.564  18.120  -16.232 1.00 0.00 ? 41  TYR A HA   1  
ATOM 563   H HB3  . TYR A 1 41  ? 16.422  19.490  -16.750 1.00 0.00 ? 41  TYR A HB3  1  
ATOM 564   H HD1  . TYR A 1 41  ? 15.013  21.717  -16.364 1.00 0.00 ? 41  TYR A HD1  1  
ATOM 565   H HD2  . TYR A 1 41  ? 17.867  20.127  -13.600 1.00 0.00 ? 41  TYR A HD2  1  
ATOM 566   H HE1  . TYR A 1 41  ? 15.281  24.014  -15.307 1.00 0.00 ? 41  TYR A HE1  1  
ATOM 567   H HE2  . TYR A 1 41  ? 18.125  22.431  -12.553 1.00 0.00 ? 41  TYR A HE2  1  
ATOM 568   H HH   . TYR A 1 41  ? 17.616  24.532  -12.685 1.00 0.00 ? 41  TYR A HH   1  
ATOM 569   N N    . LYS A 1 42  ? 14.975  18.633  -13.012 1.00 0.00 ? 42  LYS A N    1  
ATOM 570   C CA   . LYS A 1 42  ? 15.044  17.977  -11.717 1.00 0.00 ? 42  LYS A CA   1  
ATOM 571   C C    . LYS A 1 42  ? 14.167  18.736  -10.719 1.00 0.00 ? 42  LYS A C    1  
ATOM 572   O O    . LYS A 1 42  ? 14.647  19.626  -10.018 1.00 0.00 ? 42  LYS A O    1  
ATOM 573   C CB   . LYS A 1 42  ? 16.499  17.827  -11.268 1.00 0.00 ? 42  LYS A CB   1  
ATOM 574   C CG   . LYS A 1 42  ? 17.080  16.489  -11.727 1.00 0.00 ? 42  LYS A CG   1  
ATOM 575   C CD   . LYS A 1 42  ? 16.769  15.382  -10.717 1.00 0.00 ? 42  LYS A CD   1  
ATOM 576   C CE   . LYS A 1 42  ? 16.199  14.146  -11.416 1.00 0.00 ? 42  LYS A CE   1  
ATOM 577   N NZ   . LYS A 1 42  ? 17.200  13.057  -11.443 1.00 0.00 ? 42  LYS A NZ   1  
ATOM 578   H H    . LYS A 1 42  ? 14.922  19.629  -12.978 1.00 0.00 ? 42  LYS A H    1  
ATOM 579   H HA   . LYS A 1 42  ? 14.639  16.972  -11.838 1.00 0.00 ? 42  LYS A HA   1  
ATOM 580   H HB3  . LYS A 1 42  ? 16.558  17.902  -10.182 1.00 0.00 ? 42  LYS A HB3  1  
ATOM 581   H HG3  . LYS A 1 42  ? 18.159  16.580  -11.852 1.00 0.00 ? 42  LYS A HG3  1  
ATOM 582   H HD3  . LYS A 1 42  ? 16.055  15.748  -9.978  1.00 0.00 ? 42  LYS A HD3  1  
ATOM 583   H HE3  . LYS A 1 42  ? 15.902  14.400  -12.433 1.00 0.00 ? 42  LYS A HE3  1  
ATOM 584   H HZ1  . LYS A 1 42  ? 17.372  12.785  -12.389 1.00 0.00 ? 42  LYS A HZ1  1  
ATOM 585   H HZ2  . LYS A 1 42  ? 18.053  13.377  -11.029 1.00 0.00 ? 42  LYS A HZ2  1  
ATOM 586   H HZ3  . LYS A 1 42  ? 16.854  12.273  -10.928 1.00 0.00 ? 42  LYS A HZ3  1  
ATOM 587   N N    . ASP A 1 43  ? 12.899  18.357  -10.686 1.00 0.00 ? 43  ASP A N    1  
ATOM 588   C CA   . ASP A 1 43  ? 11.950  18.991  -9.785  1.00 0.00 ? 43  ASP A CA   1  
ATOM 589   C C    . ASP A 1 43  ? 10.621  18.234  -9.835  1.00 0.00 ? 43  ASP A C    1  
ATOM 590   O O    . ASP A 1 43  ? 10.365  17.485  -10.775 1.00 0.00 ? 43  ASP A O    1  
ATOM 591   C CB   . ASP A 1 43  ? 11.685  20.441  -10.197 1.00 0.00 ? 43  ASP A CB   1  
ATOM 592   C CG   . ASP A 1 43  ? 11.842  21.470  -9.077  1.00 0.00 ? 43  ASP A CG   1  
ATOM 593   O OD1  . ASP A 1 43  ? 12.795  21.309  -8.287  1.00 0.00 ? 43  ASP A OD1  1  
ATOM 594   O OD2  . ASP A 1 43  ? 11.004  22.397  -9.037  1.00 0.00 ? 43  ASP A OD2  1  
ATOM 595   H H    . ASP A 1 43  ? 12.517  17.632  -11.259 1.00 0.00 ? 43  ASP A H    1  
ATOM 596   H HA   . ASP A 1 43  ? 12.419  18.950  -8.802  1.00 0.00 ? 43  ASP A HA   1  
ATOM 597   H HB3  . ASP A 1 43  ? 10.672  20.509  -10.595 1.00 0.00 ? 43  ASP A HB3  1  
ATOM 598   N N    . GLU A 1 44  ? 9.813   18.457  -8.810  1.00 0.00 ? 44  GLU A N    1  
ATOM 599   C CA   . GLU A 1 44  ? 8.516   17.805  -8.724  1.00 0.00 ? 44  GLU A CA   1  
ATOM 600   C C    . GLU A 1 44  ? 7.725   18.025  -10.015 1.00 0.00 ? 44  GLU A C    1  
ATOM 601   O O    . GLU A 1 44  ? 8.151   18.782  -10.886 1.00 0.00 ? 44  GLU A O    1  
ATOM 602   C CB   . GLU A 1 44  ? 7.732   18.302  -7.508  1.00 0.00 ? 44  GLU A CB   1  
ATOM 603   C CG   . GLU A 1 44  ? 8.179   17.579  -6.235  1.00 0.00 ? 44  GLU A CG   1  
ATOM 604   C CD   . GLU A 1 44  ? 8.848   18.549  -5.259  1.00 0.00 ? 44  GLU A CD   1  
ATOM 605   O OE1  . GLU A 1 44  ? 9.654   19.374  -5.743  1.00 0.00 ? 44  GLU A OE1  1  
ATOM 606   O OE2  . GLU A 1 44  ? 8.537   18.446  -4.052  1.00 0.00 ? 44  GLU A OE2  1  
ATOM 607   H H    . GLU A 1 44  ? 10.030  19.068  -8.049  1.00 0.00 ? 44  GLU A H    1  
ATOM 608   H HA   . GLU A 1 44  ? 8.734   16.744  -8.601  1.00 0.00 ? 44  GLU A HA   1  
ATOM 609   H HB3  . GLU A 1 44  ? 6.667   18.139  -7.668  1.00 0.00 ? 44  GLU A HB3  1  
ATOM 610   H HG3  . GLU A 1 44  ? 8.874   16.779  -6.492  1.00 0.00 ? 44  GLU A HG3  1  
ATOM 611   N N    . GLU A 1 45  ? 6.588   17.352  -10.095 1.00 0.00 ? 45  GLU A N    1  
ATOM 612   C CA   . GLU A 1 45  ? 5.733   17.464  -11.266 1.00 0.00 ? 45  GLU A CA   1  
ATOM 613   C C    . GLU A 1 45  ? 4.261   17.446  -10.851 1.00 0.00 ? 45  GLU A C    1  
ATOM 614   O O    . GLU A 1 45  ? 3.866   16.667  -9.984  1.00 0.00 ? 45  GLU A O    1  
ATOM 615   C CB   . GLU A 1 45  ? 6.034   16.354  -12.273 1.00 0.00 ? 45  GLU A CB   1  
ATOM 616   C CG   . GLU A 1 45  ? 5.653   14.984  -11.710 1.00 0.00 ? 45  GLU A CG   1  
ATOM 617   C CD   . GLU A 1 45  ? 5.961   13.872  -12.714 1.00 0.00 ? 45  GLU A CD   1  
ATOM 618   O OE1  . GLU A 1 45  ? 5.236   13.809  -13.730 1.00 0.00 ? 45  GLU A OE1  1  
ATOM 619   O OE2  . GLU A 1 45  ? 6.914   13.110  -12.443 1.00 0.00 ? 45  GLU A OE2  1  
ATOM 620   H H    . GLU A 1 45  ? 6.248   16.738  -9.382  1.00 0.00 ? 45  GLU A H    1  
ATOM 621   H HA   . GLU A 1 45  ? 5.979   18.428  -11.713 1.00 0.00 ? 45  GLU A HA   1  
ATOM 622   H HB3  . GLU A 1 45  ? 7.092   16.365  -12.527 1.00 0.00 ? 45  GLU A HB3  1  
ATOM 623   H HG3  . GLU A 1 45  ? 4.590   14.971  -11.462 1.00 0.00 ? 45  GLU A HG3  1  
ATOM 624   N N    . ASN A 1 46  ? 3.487   18.312  -11.488 1.00 0.00 ? 46  ASN A N    1  
ATOM 625   C CA   . ASN A 1 46  ? 2.067   18.404  -11.197 1.00 0.00 ? 46  ASN A CA   1  
ATOM 626   C C    . ASN A 1 46  ? 1.430   17.021  -11.344 1.00 0.00 ? 46  ASN A C    1  
ATOM 627   O O    . ASN A 1 46  ? 1.722   16.298  -12.294 1.00 0.00 ? 46  ASN A O    1  
ATOM 628   C CB   . ASN A 1 46  ? 1.366   19.354  -12.169 1.00 0.00 ? 46  ASN A CB   1  
ATOM 629   C CG   . ASN A 1 46  ? 1.016   20.679  -11.487 1.00 0.00 ? 46  ASN A CG   1  
ATOM 630   O OD1  . ASN A 1 46  ? 1.874   21.488  -11.171 1.00 0.00 ? 46  ASN A OD1  1  
ATOM 631   N ND2  . ASN A 1 46  ? -0.285  20.854  -11.279 1.00 0.00 ? 46  ASN A ND2  1  
ATOM 632   H H    . ASN A 1 46  ? 3.817   18.942  -12.193 1.00 0.00 ? 46  ASN A H    1  
ATOM 633   H HA   . ASN A 1 46  ? 2.008   18.784  -10.176 1.00 0.00 ? 46  ASN A HA   1  
ATOM 634   H HB3  . ASN A 1 46  ? 0.457   18.887  -12.548 1.00 0.00 ? 46  ASN A HB3  1  
ATOM 635   H HD21 . ASN A 1 46  ? -0.935  20.151  -11.563 1.00 0.00 ? 46  ASN A HD21 1  
ATOM 636   H HD22 . ASN A 1 46  ? -0.612  21.691  -10.838 1.00 0.00 ? 46  ASN A HD22 1  
ATOM 637   N N    . GLY A 1 47  ? 0.571   16.697  -10.389 1.00 0.00 ? 47  GLY A N    1  
ATOM 638   C CA   . GLY A 1 47  ? -0.111  15.414  -10.401 1.00 0.00 ? 47  GLY A CA   1  
ATOM 639   C C    . GLY A 1 47  ? -1.630  15.597  -10.371 1.00 0.00 ? 47  GLY A C    1  
ATOM 640   O O    . GLY A 1 47  ? -2.317  15.283  -11.342 1.00 0.00 ? 47  GLY A O    1  
ATOM 641   H H    . GLY A 1 47  ? 0.338   17.291  -9.620  1.00 0.00 ? 47  GLY A H    1  
ATOM 642   H HA2  . GLY A 1 47  ? 0.172   14.855  -11.293 1.00 0.00 ? 47  GLY A HA2  1  
ATOM 643   H HA3  . GLY A 1 47  ? 0.203   14.823  -9.541  1.00 0.00 ? 47  GLY A HA3  1  
ATOM 644   N N    . ASN A 1 48  ? -2.110  16.109  -9.246  1.00 0.00 ? 48  ASN A N    1  
ATOM 645   C CA   . ASN A 1 48  ? -3.533  16.340  -9.077  1.00 0.00 ? 48  ASN A CA   1  
ATOM 646   C C    . ASN A 1 48  ? -4.028  17.279  -10.178 1.00 0.00 ? 48  ASN A C    1  
ATOM 647   O O    . ASN A 1 48  ? -3.243  18.023  -10.764 1.00 0.00 ? 48  ASN A O    1  
ATOM 648   C CB   . ASN A 1 48  ? -3.829  16.997  -7.727  1.00 0.00 ? 48  ASN A CB   1  
ATOM 649   C CG   . ASN A 1 48  ? -4.400  15.981  -6.736  1.00 0.00 ? 48  ASN A CG   1  
ATOM 650   O OD1  . ASN A 1 48  ? -5.299  15.215  -7.041  1.00 0.00 ? 48  ASN A OD1  1  
ATOM 651   N ND2  . ASN A 1 48  ? -3.830  16.017  -5.536  1.00 0.00 ? 48  ASN A ND2  1  
ATOM 652   H H    . ASN A 1 48  ? -1.544  16.363  -8.461  1.00 0.00 ? 48  ASN A H    1  
ATOM 653   H HA   . ASN A 1 48  ? -3.993  15.352  -9.135  1.00 0.00 ? 48  ASN A HA   1  
ATOM 654   H HB3  . ASN A 1 48  ? -4.536  17.815  -7.863  1.00 0.00 ? 48  ASN A HB3  1  
ATOM 655   H HD21 . ASN A 1 48  ? -3.096  16.669  -5.349  1.00 0.00 ? 48  ASN A HD21 1  
ATOM 656   H HD22 . ASN A 1 48  ? -4.135  15.390  -4.818  1.00 0.00 ? 48  ASN A HD22 1  
ATOM 657   N N    . ARG A 1 49  ? -5.328  17.217  -10.427 1.00 0.00 ? 49  ARG A N    1  
ATOM 658   C CA   . ARG A 1 49  ? -5.937  18.054  -11.447 1.00 0.00 ? 49  ARG A CA   1  
ATOM 659   C C    . ARG A 1 49  ? -5.315  17.759  -12.814 1.00 0.00 ? 49  ARG A C    1  
ATOM 660   O O    . ARG A 1 49  ? -4.259  17.135  -12.898 1.00 0.00 ? 49  ARG A O    1  
ATOM 661   C CB   . ARG A 1 49  ? -5.757  19.538  -11.121 1.00 0.00 ? 49  ARG A CB   1  
ATOM 662   C CG   . ARG A 1 49  ? -7.097  20.188  -10.772 1.00 0.00 ? 49  ARG A CG   1  
ATOM 663   C CD   . ARG A 1 49  ? -7.083  21.683  -11.100 1.00 0.00 ? 49  ARG A CD   1  
ATOM 664   N NE   . ARG A 1 49  ? -8.344  22.064  -11.776 1.00 0.00 ? 49  ARG A NE   1  
ATOM 665   C CZ   . ARG A 1 49  ? -8.639  21.755  -13.047 1.00 0.00 ? 49  ARG A CZ   1  
ATOM 666   N NH1  . ARG A 1 49  ? -7.766  21.058  -13.786 1.00 0.00 ? 49  ARG A NH1  1  
ATOM 667   N NH2  . ARG A 1 49  ? -9.807  22.142  -13.575 1.00 0.00 ? 49  ARG A NH2  1  
ATOM 668   H H    . ARG A 1 49  ? -5.960  16.609  -9.945  1.00 0.00 ? 49  ARG A H    1  
ATOM 669   H HA   . ARG A 1 49  ? -6.993  17.789  -11.431 1.00 0.00 ? 49  ARG A HA   1  
ATOM 670   H HB3  . ARG A 1 49  ? -5.312  20.049  -11.973 1.00 0.00 ? 49  ARG A HB3  1  
ATOM 671   H HG3  . ARG A 1 49  ? -7.309  20.047  -9.712  1.00 0.00 ? 49  ARG A HG3  1  
ATOM 672   H HD3  . ARG A 1 49  ? -6.233  21.915  -11.741 1.00 0.00 ? 49  ARG A HD3  1  
ATOM 673   H HE   . ARG A 1 49  ? -9.018  22.585  -11.251 1.00 0.00 ? 49  ARG A HE   1  
ATOM 674   H HH11 . ARG A 1 49  ? -6.894  20.769  -13.391 1.00 0.00 ? 49  ARG A HH11 1  
ATOM 675   H HH12 . ARG A 1 49  ? -7.986  20.829  -14.734 1.00 0.00 ? 49  ARG A HH12 1  
ATOM 676   H HH21 . ARG A 1 49  ? -10.459 22.663  -13.024 1.00 0.00 ? 49  ARG A HH21 1  
ATOM 677   H HH22 . ARG A 1 49  ? -10.028 21.912  -14.524 1.00 0.00 ? 49  ARG A HH22 1  
ATOM 678   N N    . GLY A 1 50  ? -5.997  18.224  -13.850 1.00 0.00 ? 50  GLY A N    1  
ATOM 679   C CA   . GLY A 1 50  ? -5.525  18.020  -15.210 1.00 0.00 ? 50  GLY A CA   1  
ATOM 680   C C    . GLY A 1 50  ? -6.633  18.307  -16.224 1.00 0.00 ? 50  GLY A C    1  
ATOM 681   O O    . GLY A 1 50  ? -6.661  19.376  -16.833 1.00 0.00 ? 50  GLY A O    1  
ATOM 682   H H    . GLY A 1 50  ? -6.855  18.732  -13.773 1.00 0.00 ? 50  GLY A H    1  
ATOM 683   H HA2  . GLY A 1 50  ? -4.671  18.669  -15.404 1.00 0.00 ? 50  GLY A HA2  1  
ATOM 684   H HA3  . GLY A 1 50  ? -5.178  16.993  -15.327 1.00 0.00 ? 50  GLY A HA3  1  
ATOM 685   N N    . GLY A 1 51  ? -7.522  17.336  -16.375 1.00 0.00 ? 51  GLY A N    1  
ATOM 686   C CA   . GLY A 1 51  ? -8.630  17.473  -17.304 1.00 0.00 ? 51  GLY A CA   1  
ATOM 687   C C    . GLY A 1 51  ? -9.483  16.202  -17.330 1.00 0.00 ? 51  GLY A C    1  
ATOM 688   O O    . GLY A 1 51  ? -9.013  15.144  -17.747 1.00 0.00 ? 51  GLY A O    1  
ATOM 689   H H    . GLY A 1 51  ? -7.493  16.471  -15.875 1.00 0.00 ? 51  GLY A H    1  
ATOM 690   H HA2  . GLY A 1 51  ? -9.247  18.323  -17.018 1.00 0.00 ? 51  GLY A HA2  1  
ATOM 691   H HA3  . GLY A 1 51  ? -8.246  17.678  -18.304 1.00 0.00 ? 51  GLY A HA3  1  
ATOM 692   N N    . LYS A 1 52  ? -10.720 16.350  -16.880 1.00 0.00 ? 52  LYS A N    1  
ATOM 693   C CA   . LYS A 1 52  ? -11.643 15.228  -16.848 1.00 0.00 ? 52  LYS A CA   1  
ATOM 694   C C    . LYS A 1 52  ? -12.251 15.032  -18.237 1.00 0.00 ? 52  LYS A C    1  
ATOM 695   O O    . LYS A 1 52  ? -13.455 15.202  -18.421 1.00 0.00 ? 52  LYS A O    1  
ATOM 696   C CB   . LYS A 1 52  ? -12.683 15.422  -15.742 1.00 0.00 ? 52  LYS A CB   1  
ATOM 697   C CG   . LYS A 1 52  ? -13.607 16.601  -16.061 1.00 0.00 ? 52  LYS A CG   1  
ATOM 698   C CD   . LYS A 1 52  ? -13.719 17.547  -14.864 1.00 0.00 ? 52  LYS A CD   1  
ATOM 699   C CE   . LYS A 1 52  ? -14.839 18.568  -15.077 1.00 0.00 ? 52  LYS A CE   1  
ATOM 700   N NZ   . LYS A 1 52  ? -14.724 19.674  -14.100 1.00 0.00 ? 52  LYS A NZ   1  
ATOM 701   H H    . LYS A 1 52  ? -11.094 17.215  -16.543 1.00 0.00 ? 52  LYS A H    1  
ATOM 702   H HA   . LYS A 1 52  ? -11.066 14.337  -16.594 1.00 0.00 ? 52  LYS A HA   1  
ATOM 703   H HB3  . LYS A 1 52  ? -12.181 15.596  -14.791 1.00 0.00 ? 52  LYS A HB3  1  
ATOM 704   H HG3  . LYS A 1 52  ? -14.596 16.230  -16.329 1.00 0.00 ? 52  LYS A HG3  1  
ATOM 705   H HD3  . LYS A 1 52  ? -12.772 18.066  -14.716 1.00 0.00 ? 52  LYS A HD3  1  
ATOM 706   H HE3  . LYS A 1 52  ? -15.809 18.081  -14.971 1.00 0.00 ? 52  LYS A HE3  1  
ATOM 707   H HZ1  . LYS A 1 52  ? -14.663 20.545  -14.587 1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 708   H HZ2  . LYS A 1 52  ? -15.530 19.681  -13.507 1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 709   H HZ3  . LYS A 1 52  ? -13.903 19.544  -13.545 1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 710   N N    . GLN A 1 53  ? -11.391 14.676  -19.181 1.00 0.00 ? 53  GLN A N    1  
ATOM 711   C CA   . GLN A 1 53  ? -11.829 14.456  -20.548 1.00 0.00 ? 53  GLN A CA   1  
ATOM 712   C C    . GLN A 1 53  ? -11.438 13.050  -21.010 1.00 0.00 ? 53  GLN A C    1  
ATOM 713   O O    . GLN A 1 53  ? -12.300 12.248  -21.365 1.00 0.00 ? 53  GLN A O    1  
ATOM 714   C CB   . GLN A 1 53  ? -11.255 15.519  -21.486 1.00 0.00 ? 53  GLN A CB   1  
ATOM 715   C CG   . GLN A 1 53  ? -12.360 16.161  -22.328 1.00 0.00 ? 53  GLN A CG   1  
ATOM 716   C CD   . GLN A 1 53  ? -11.985 17.589  -22.727 1.00 0.00 ? 53  GLN A CD   1  
ATOM 717   O OE1  . GLN A 1 53  ? -11.490 18.374  -21.936 1.00 0.00 ? 53  GLN A OE1  1  
ATOM 718   N NE2  . GLN A 1 53  ? -12.249 17.883  -23.998 1.00 0.00 ? 53  GLN A NE2  1  
ATOM 719   H H    . GLN A 1 53  ? -10.413 14.540  -19.022 1.00 0.00 ? 53  GLN A H    1  
ATOM 720   H HA   . GLN A 1 53  ? -12.914 14.549  -20.523 1.00 0.00 ? 53  GLN A HA   1  
ATOM 721   H HB3  . GLN A 1 53  ? -10.510 15.070  -22.140 1.00 0.00 ? 53  GLN A HB3  1  
ATOM 722   H HG3  . GLN A 1 53  ? -13.293 16.171  -21.765 1.00 0.00 ? 53  GLN A HG3  1  
ATOM 723   H HE21 . GLN A 1 53  ? -12.655 17.192  -24.596 1.00 0.00 ? 53  GLN A HE21 1  
ATOM 724   H HE22 . GLN A 1 53  ? -12.038 18.793  -24.355 1.00 0.00 ? 53  GLN A HE22 1  
ATOM 725   N N    . ARG A 1 54  ? -10.138 12.796  -20.991 1.00 0.00 ? 54  ARG A N    1  
ATOM 726   C CA   . ARG A 1 54  ? -9.622  11.501  -21.403 1.00 0.00 ? 54  ARG A CA   1  
ATOM 727   C C    . ARG A 1 54  ? -9.262  10.658  -20.177 1.00 0.00 ? 54  ARG A C    1  
ATOM 728   O O    . ARG A 1 54  ? -9.835  9.591   -19.963 1.00 0.00 ? 54  ARG A O    1  
ATOM 729   C CB   . ARG A 1 54  ? -8.384  11.658  -22.289 1.00 0.00 ? 54  ARG A CB   1  
ATOM 730   C CG   . ARG A 1 54  ? -8.244  10.474  -23.248 1.00 0.00 ? 54  ARG A CG   1  
ATOM 731   C CD   . ARG A 1 54  ? -8.006  10.953  -24.680 1.00 0.00 ? 54  ARG A CD   1  
ATOM 732   N NE   . ARG A 1 54  ? -6.579  10.801  -25.036 1.00 0.00 ? 54  ARG A NE   1  
ATOM 733   C CZ   . ARG A 1 54  ? -5.995  11.409  -26.078 1.00 0.00 ? 54  ARG A CZ   1  
ATOM 734   N NH1  . ARG A 1 54  ? -6.713  12.213  -26.873 1.00 0.00 ? 54  ARG A NH1  1  
ATOM 735   N NH2  . ARG A 1 54  ? -4.692  11.212  -26.324 1.00 0.00 ? 54  ARG A NH2  1  
ATOM 736   H H    . ARG A 1 54  ? -9.443  13.454  -20.700 1.00 0.00 ? 54  ARG A H    1  
ATOM 737   H HA   . ARG A 1 54  ? -10.435 11.044  -21.968 1.00 0.00 ? 54  ARG A HA   1  
ATOM 738   H HB3  . ARG A 1 54  ? -7.494  11.733  -21.665 1.00 0.00 ? 54  ARG A HB3  1  
ATOM 739   H HG3  . ARG A 1 54  ? -9.144  9.861   -23.209 1.00 0.00 ? 54  ARG A HG3  1  
ATOM 740   H HD3  . ARG A 1 54  ? -8.304  11.998  -24.777 1.00 0.00 ? 54  ARG A HD3  1  
ATOM 741   H HE   . ARG A 1 54  ? -6.013  10.207  -24.462 1.00 0.00 ? 54  ARG A HE   1  
ATOM 742   H HH11 . ARG A 1 54  ? -7.684  12.361  -26.689 1.00 0.00 ? 54  ARG A HH11 1  
ATOM 743   H HH12 . ARG A 1 54  ? -6.275  12.666  -27.650 1.00 0.00 ? 54  ARG A HH12 1  
ATOM 744   H HH21 . ARG A 1 54  ? -4.156  10.610  -25.731 1.00 0.00 ? 54  ARG A HH21 1  
ATOM 745   H HH22 . ARG A 1 54  ? -4.256  11.665  -27.103 1.00 0.00 ? 54  ARG A HH22 1  
ATOM 746   N N    . ASN A 1 55  ? -8.314  11.169  -19.407 1.00 0.00 ? 55  ASN A N    1  
ATOM 747   C CA   . ASN A 1 55  ? -7.870  10.478  -18.209 1.00 0.00 ? 55  ASN A CA   1  
ATOM 748   C C    . ASN A 1 55  ? -7.122  9.203   -18.608 1.00 0.00 ? 55  ASN A C    1  
ATOM 749   O O    . ASN A 1 55  ? -7.720  8.269   -19.141 1.00 0.00 ? 55  ASN A O    1  
ATOM 750   C CB   . ASN A 1 55  ? -9.059  10.072  -17.333 1.00 0.00 ? 55  ASN A CB   1  
ATOM 751   C CG   . ASN A 1 55  ? -8.667  10.049  -15.855 1.00 0.00 ? 55  ASN A CG   1  
ATOM 752   O OD1  . ASN A 1 55  ? -7.778  10.757  -15.409 1.00 0.00 ? 55  ASN A OD1  1  
ATOM 753   N ND2  . ASN A 1 55  ? -9.377  9.197   -15.121 1.00 0.00 ? 55  ASN A ND2  1  
ATOM 754   H H    . ASN A 1 55  ? -7.852  12.038  -19.588 1.00 0.00 ? 55  ASN A H    1  
ATOM 755   H HA   . ASN A 1 55  ? -7.230  11.190  -17.687 1.00 0.00 ? 55  ASN A HA   1  
ATOM 756   H HB3  . ASN A 1 55  ? -9.417  9.089   -17.634 1.00 0.00 ? 55  ASN A HB3  1  
ATOM 757   H HD21 . ASN A 1 55  ? -10.094 8.645   -15.549 1.00 0.00 ? 55  ASN A HD21 1  
ATOM 758   H HD22 . ASN A 1 55  ? -9.196  9.109   -14.142 1.00 0.00 ? 55  ASN A HD22 1  
ATOM 759   N N    . ARG A 1 56  ? -5.825  9.207   -18.336 1.00 0.00 ? 56  ARG A N    1  
ATOM 760   C CA   . ARG A 1 56  ? -4.990  8.062   -18.661 1.00 0.00 ? 56  ARG A CA   1  
ATOM 761   C C    . ARG A 1 56  ? -5.439  6.835   -17.868 1.00 0.00 ? 56  ARG A C    1  
ATOM 762   O O    . ARG A 1 56  ? -5.856  6.955   -16.716 1.00 0.00 ? 56  ARG A O    1  
ATOM 763   C CB   . ARG A 1 56  ? -3.519  8.350   -18.353 1.00 0.00 ? 56  ARG A CB   1  
ATOM 764   C CG   . ARG A 1 56  ? -2.642  8.100   -19.581 1.00 0.00 ? 56  ARG A CG   1  
ATOM 765   C CD   . ARG A 1 56  ? -2.903  6.711   -20.167 1.00 0.00 ? 56  ARG A CD   1  
ATOM 766   N NE   . ARG A 1 56  ? -1.819  6.346   -21.105 1.00 0.00 ? 56  ARG A NE   1  
ATOM 767   C CZ   . ARG A 1 56  ? -1.875  5.305   -21.948 1.00 0.00 ? 56  ARG A CZ   1  
ATOM 768   N NH1  . ARG A 1 56  ? -2.961  4.522   -21.976 1.00 0.00 ? 56  ARG A NH1  1  
ATOM 769   N NH2  . ARG A 1 56  ? -0.842  5.048   -22.765 1.00 0.00 ? 56  ARG A NH2  1  
ATOM 770   H H    . ARG A 1 56  ? -5.347  9.971   -17.904 1.00 0.00 ? 56  ARG A H    1  
ATOM 771   H HA   . ARG A 1 56  ? -5.129  7.911   -19.732 1.00 0.00 ? 56  ARG A HA   1  
ATOM 772   H HB3  . ARG A 1 56  ? -3.187  7.719   -17.529 1.00 0.00 ? 56  ARG A HB3  1  
ATOM 773   H HG3  . ARG A 1 56  ? -1.591  8.191   -19.307 1.00 0.00 ? 56  ARG A HG3  1  
ATOM 774   H HD3  . ARG A 1 56  ? -3.862  6.699   -20.685 1.00 0.00 ? 56  ARG A HD3  1  
ATOM 775   H HE   . ARG A 1 56  ? -0.993  6.910   -21.111 1.00 0.00 ? 56  ARG A HE   1  
ATOM 776   H HH11 . ARG A 1 56  ? -3.730  4.713   -21.367 1.00 0.00 ? 56  ARG A HH11 1  
ATOM 777   H HH12 . ARG A 1 56  ? -3.002  3.745   -22.606 1.00 0.00 ? 56  ARG A HH12 1  
ATOM 778   H HH21 . ARG A 1 56  ? -0.032  5.634   -22.744 1.00 0.00 ? 56  ARG A HH21 1  
ATOM 779   H HH22 . ARG A 1 56  ? -0.884  4.272   -23.395 1.00 0.00 ? 56  ARG A HH22 1  
ATOM 780   N N    . LEU A 1 57  ? -5.340  5.682   -18.514 1.00 0.00 ? 57  LEU A N    1  
ATOM 781   C CA   . LEU A 1 57  ? -5.730  4.434   -17.883 1.00 0.00 ? 57  LEU A CA   1  
ATOM 782   C C    . LEU A 1 57  ? -4.604  3.957   -16.964 1.00 0.00 ? 57  LEU A C    1  
ATOM 783   O O    . LEU A 1 57  ? -3.782  3.133   -17.362 1.00 0.00 ? 57  LEU A O    1  
ATOM 784   C CB   . LEU A 1 57  ? -6.141  3.406   -18.938 1.00 0.00 ? 57  LEU A CB   1  
ATOM 785   C CG   . LEU A 1 57  ? -7.639  3.315   -19.240 1.00 0.00 ? 57  LEU A CG   1  
ATOM 786   C CD1  . LEU A 1 57  ? -8.398  2.694   -18.065 1.00 0.00 ? 57  LEU A CD1  1  
ATOM 787   C CD2  . LEU A 1 57  ? -8.203  4.682   -19.630 1.00 0.00 ? 57  LEU A CD2  1  
ATOM 788   H H    . LEU A 1 57  ? -4.999  5.595   -19.450 1.00 0.00 ? 57  LEU A H    1  
ATOM 789   H HA   . LEU A 1 57  ? -6.610  4.638   -17.273 1.00 0.00 ? 57  LEU A HA   1  
ATOM 790   H HB3  . LEU A 1 57  ? -5.795  2.424   -18.615 1.00 0.00 ? 57  LEU A HB3  1  
ATOM 791   H HG   . LEU A 1 57  ? -7.774  2.654   -20.096 1.00 0.00 ? 57  LEU A HG   1  
ATOM 792   H HD11 . LEU A 1 57  ? -9.433  2.515   -18.356 1.00 0.00 ? 57  LEU A HD11 1  
ATOM 793   H HD12 . LEU A 1 57  ? -7.929  1.752   -17.788 1.00 0.00 ? 57  LEU A HD12 1  
ATOM 794   H HD13 . LEU A 1 57  ? -8.372  3.378   -17.216 1.00 0.00 ? 57  LEU A HD13 1  
ATOM 795   H HD21 . LEU A 1 57  ? -7.678  5.463   -19.079 1.00 0.00 ? 57  LEU A HD21 1  
ATOM 796   H HD22 . LEU A 1 57  ? -8.067  4.839   -20.701 1.00 0.00 ? 57  LEU A HD22 1  
ATOM 797   H HD23 . LEU A 1 57  ? -9.265  4.719   -19.390 1.00 0.00 ? 57  LEU A HD23 1  
ATOM 798   N N    . GLU A 1 58  ? -4.602  4.495   -15.754 1.00 0.00 ? 58  GLU A N    1  
ATOM 799   C CA   . GLU A 1 58  ? -3.589  4.135   -14.776 1.00 0.00 ? 58  GLU A CA   1  
ATOM 800   C C    . GLU A 1 58  ? -3.816  2.705   -14.279 1.00 0.00 ? 58  GLU A C    1  
ATOM 801   O O    . GLU A 1 58  ? -4.929  2.186   -14.358 1.00 0.00 ? 58  GLU A O    1  
ATOM 802   C CB   . GLU A 1 58  ? -3.576  5.125   -13.610 1.00 0.00 ? 58  GLU A CB   1  
ATOM 803   C CG   . GLU A 1 58  ? -3.488  6.566   -14.116 1.00 0.00 ? 58  GLU A CG   1  
ATOM 804   C CD   . GLU A 1 58  ? -3.590  7.561   -12.958 1.00 0.00 ? 58  GLU A CD   1  
ATOM 805   O OE1  . GLU A 1 58  ? -4.568  7.439   -12.189 1.00 0.00 ? 58  GLU A OE1  1  
ATOM 806   O OE2  . GLU A 1 58  ? -2.686  8.420   -12.867 1.00 0.00 ? 58  GLU A OE2  1  
ATOM 807   H H    . GLU A 1 58  ? -5.275  5.165   -15.438 1.00 0.00 ? 58  GLU A H    1  
ATOM 808   H HA   . GLU A 1 58  ? -2.639  4.195   -15.307 1.00 0.00 ? 58  GLU A HA   1  
ATOM 809   H HB3  . GLU A 1 58  ? -2.729  4.913   -12.957 1.00 0.00 ? 58  GLU A HB3  1  
ATOM 810   H HG3  . GLU A 1 58  ? -4.288  6.754   -14.831 1.00 0.00 ? 58  GLU A HG3  1  
ATOM 811   N N    . PRO A 1 59  ? -2.716  2.094   -13.764 1.00 0.00 ? 59  PRO A N    1  
ATOM 812   C CA   . PRO A 1 59  ? -2.786  0.736   -13.254 1.00 0.00 ? 59  PRO A CA   1  
ATOM 813   C C    . PRO A 1 59  ? -3.486  0.695   -11.896 1.00 0.00 ? 59  PRO A C    1  
ATOM 814   O O    . PRO A 1 59  ? -4.686  0.433   -11.819 1.00 0.00 ? 59  PRO A O    1  
ATOM 815   C CB   . PRO A 1 59  ? -1.341  0.266   -13.192 1.00 0.00 ? 59  PRO A CB   1  
ATOM 816   C CG   . PRO A 1 59  ? -0.490  1.525   -13.226 1.00 0.00 ? 59  PRO A CG   1  
ATOM 817   C CD   . PRO A 1 59  ? -1.383  2.679   -13.654 1.00 0.00 ? 59  PRO A CD   1  
ATOM 818   H HA   . PRO A 1 59  ? -3.335  0.164   -13.863 1.00 0.00 ? 59  PRO A HA   1  
ATOM 819   H HB3  . PRO A 1 59  ? -1.105  -0.387  -14.034 1.00 0.00 ? 59  PRO A HB3  1  
ATOM 820   H HG3  . PRO A 1 59  ? 0.341   1.407   -13.921 1.00 0.00 ? 59  PRO A HG3  1  
ATOM 821   H HD3  . PRO A 1 59  ? -1.056  3.100   -14.604 1.00 0.00 ? 59  PRO A HD3  1  
ATOM 822   N N    . MET A 1 60  ? -2.707  0.957   -10.856 1.00 0.00 ? 60  MET A N    1  
ATOM 823   C CA   . MET A 1 60  ? -3.239  0.952   -9.504  1.00 0.00 ? 60  MET A CA   1  
ATOM 824   C C    . MET A 1 60  ? -4.133  -0.267  -9.268  1.00 0.00 ? 60  MET A C    1  
ATOM 825   O O    . MET A 1 60  ? -5.358  -0.150  -9.257  1.00 0.00 ? 60  MET A O    1  
ATOM 826   C CB   . MET A 1 60  ? -4.046  2.231   -9.268  1.00 0.00 ? 60  MET A CB   1  
ATOM 827   C CG   . MET A 1 60  ? -3.132  3.456   -9.215  1.00 0.00 ? 60  MET A CG   1  
ATOM 828   S SD   . MET A 1 60  ? -4.065  4.932   -9.584  1.00 0.00 ? 60  MET A SD   1  
ATOM 829   C CE   . MET A 1 60  ? -2.920  6.174   -9.008  1.00 0.00 ? 60  MET A CE   1  
ATOM 830   H H    . MET A 1 60  ? -1.733  1.168   -10.927 1.00 0.00 ? 60  MET A H    1  
ATOM 831   H HA   . MET A 1 60  ? -2.370  0.907   -8.847  1.00 0.00 ? 60  MET A HA   1  
ATOM 832   H HB3  . MET A 1 60  ? -4.603  2.148   -8.335  1.00 0.00 ? 60  MET A HB3  1  
ATOM 833   H HG3  . MET A 1 60  ? -2.317  3.343   -9.932  1.00 0.00 ? 60  MET A HG3  1  
ATOM 834   H HE1  . MET A 1 60  ? -3.111  6.384   -7.956  1.00 0.00 ? 60  MET A HE1  1  
ATOM 835   H HE2  . MET A 1 60  ? -1.899  5.812   -9.127  1.00 0.00 ? 60  MET A HE2  1  
ATOM 836   H HE3  . MET A 1 60  ? -3.051  7.087   -9.590  1.00 0.00 ? 60  MET A HE3  1  
ATOM 837   N N    . ASP A 1 61  ? -3.486  -1.408  -9.088  1.00 0.00 ? 61  ASP A N    1  
ATOM 838   C CA   . ASP A 1 61  ? -4.207  -2.649  -8.854  1.00 0.00 ? 61  ASP A CA   1  
ATOM 839   C C    . ASP A 1 61  ? -4.319  -2.893  -7.348  1.00 0.00 ? 61  ASP A C    1  
ATOM 840   O O    . ASP A 1 61  ? -5.416  -2.881  -6.793  1.00 0.00 ? 61  ASP A O    1  
ATOM 841   C CB   . ASP A 1 61  ? -3.470  -3.838  -9.473  1.00 0.00 ? 61  ASP A CB   1  
ATOM 842   C CG   . ASP A 1 61  ? -4.371  -4.980  -9.948  1.00 0.00 ? 61  ASP A CG   1  
ATOM 843   O OD1  . ASP A 1 61  ? -5.495  -4.667  -10.394 1.00 0.00 ? 61  ASP A OD1  1  
ATOM 844   O OD2  . ASP A 1 61  ? -3.915  -6.139  -9.852  1.00 0.00 ? 61  ASP A OD2  1  
ATOM 845   H H    . ASP A 1 61  ? -2.489  -1.495  -9.099  1.00 0.00 ? 61  ASP A H    1  
ATOM 846   H HA   . ASP A 1 61  ? -5.179  -2.508  -9.326  1.00 0.00 ? 61  ASP A HA   1  
ATOM 847   H HB3  . ASP A 1 61  ? -2.766  -4.232  -8.738  1.00 0.00 ? 61  ASP A HB3  1  
ATOM 848   N N    . THR A 1 62  ? -3.167  -3.106  -6.728  1.00 0.00 ? 62  THR A N    1  
ATOM 849   C CA   . THR A 1 62  ? -3.122  -3.352  -5.297  1.00 0.00 ? 62  THR A CA   1  
ATOM 850   C C    . THR A 1 62  ? -1.812  -2.827  -4.707  1.00 0.00 ? 62  THR A C    1  
ATOM 851   O O    . THR A 1 62  ? -0.916  -2.417  -5.443  1.00 0.00 ? 62  THR A O    1  
ATOM 852   C CB   . THR A 1 62  ? -3.335  -4.850  -5.068  1.00 0.00 ? 62  THR A CB   1  
ATOM 853   O OG1  . THR A 1 62  ? -4.607  -5.113  -5.655  1.00 0.00 ? 62  THR A OG1  1  
ATOM 854   C CG2  . THR A 1 62  ? -3.528  -5.194  -3.589  1.00 0.00 ? 62  THR A CG2  1  
ATOM 855   H H    . THR A 1 62  ? -2.278  -3.113  -7.186  1.00 0.00 ? 62  THR A H    1  
ATOM 856   H HA   . THR A 1 62  ? -3.931  -2.793  -4.826  1.00 0.00 ? 62  THR A HA   1  
ATOM 857   H HB   . THR A 1 62  ? -2.519  -5.429  -5.499  1.00 0.00 ? 62  THR A HB   1  
ATOM 858   H HG1  . THR A 1 62  ? -5.322  -4.628  -5.152  1.00 0.00 ? 62  THR A HG1  1  
ATOM 859   H HG21 . THR A 1 62  ? -4.083  -4.393  -3.099  1.00 0.00 ? 62  THR A HG21 1  
ATOM 860   H HG22 . THR A 1 62  ? -4.086  -6.127  -3.503  1.00 0.00 ? 62  THR A HG22 1  
ATOM 861   H HG23 . THR A 1 62  ? -2.555  -5.308  -3.112  1.00 0.00 ? 62  THR A HG23 1  
ATOM 862   N N    . ILE A 1 63  ? -1.742  -2.859  -3.384  1.00 0.00 ? 63  ILE A N    1  
ATOM 863   C CA   . ILE A 1 63  ? -0.556  -2.391  -2.686  1.00 0.00 ? 63  ILE A CA   1  
ATOM 864   C C    . ILE A 1 63  ? 0.489   -3.509  -2.658  1.00 0.00 ? 63  ILE A C    1  
ATOM 865   O O    . ILE A 1 63  ? 1.618   -3.321  -3.107  1.00 0.00 ? 63  ILE A O    1  
ATOM 866   C CB   . ILE A 1 63  ? -0.923  -1.859  -1.300  1.00 0.00 ? 63  ILE A CB   1  
ATOM 867   C CG1  . ILE A 1 63  ? -1.422  -0.414  -1.382  1.00 0.00 ? 63  ILE A CG1  1  
ATOM 868   C CG2  . ILE A 1 63  ? 0.247   -2.007  -0.326  1.00 0.00 ? 63  ILE A CG2  1  
ATOM 869   C CD1  . ILE A 1 63  ? -2.877  -0.310  -0.920  1.00 0.00 ? 63  ILE A CD1  1  
ATOM 870   H H    . ILE A 1 63  ? -2.474  -3.194  -2.792  1.00 0.00 ? 63  ILE A H    1  
ATOM 871   H HA   . ILE A 1 63  ? -0.150  -1.555  -3.255  1.00 0.00 ? 63  ILE A HA   1  
ATOM 872   H HB   . ILE A 1 63  ? -1.744  -2.461  -0.909  1.00 0.00 ? 63  ILE A HB   1  
ATOM 873   H HG13 . ILE A 1 63  ? -1.336  -0.054  -2.406  1.00 0.00 ? 63  ILE A HG13 1  
ATOM 874   H HG21 . ILE A 1 63  ? 1.186   -1.870  -0.864  1.00 0.00 ? 63  ILE A HG21 1  
ATOM 875   H HG22 . ILE A 1 63  ? 0.165   -1.255  0.459   1.00 0.00 ? 63  ILE A HG22 1  
ATOM 876   H HG23 . ILE A 1 63  ? 0.225   -3.002  0.118   1.00 0.00 ? 63  ILE A HG23 1  
ATOM 877   H HD11 . ILE A 1 63  ? -2.926  -0.455  0.159   1.00 0.00 ? 63  ILE A HD11 1  
ATOM 878   H HD12 . ILE A 1 63  ? -3.268  0.676   -1.171  1.00 0.00 ? 63  ILE A HD12 1  
ATOM 879   H HD13 . ILE A 1 63  ? -3.473  -1.074  -1.417  1.00 0.00 ? 63  ILE A HD13 1  
ATOM 880   N N    . PHE A 1 64  ? 0.073   -4.650  -2.126  1.00 0.00 ? 64  PHE A N    1  
ATOM 881   C CA   . PHE A 1 64  ? 0.958   -5.798  -2.033  1.00 0.00 ? 64  PHE A CA   1  
ATOM 882   C C    . PHE A 1 64  ? 2.179   -5.482  -1.167  1.00 0.00 ? 64  PHE A C    1  
ATOM 883   O O    . PHE A 1 64  ? 2.795   -4.428  -1.317  1.00 0.00 ? 64  PHE A O    1  
ATOM 884   C CB   . PHE A 1 64  ? 1.426   -6.118  -3.455  1.00 0.00 ? 64  PHE A CB   1  
ATOM 885   C CG   . PHE A 1 64  ? 0.825   -7.400  -4.034  1.00 0.00 ? 64  PHE A CG   1  
ATOM 886   C CD1  . PHE A 1 64  ? -0.393  -7.369  -4.638  1.00 0.00 ? 64  PHE A CD1  1  
ATOM 887   C CD2  . PHE A 1 64  ? 1.509   -8.572  -3.945  1.00 0.00 ? 64  PHE A CD2  1  
ATOM 888   C CE1  . PHE A 1 64  ? -0.951  -8.559  -5.177  1.00 0.00 ? 64  PHE A CE1  1  
ATOM 889   C CE2  . PHE A 1 64  ? 0.952   -9.763  -4.483  1.00 0.00 ? 64  PHE A CE2  1  
ATOM 890   C CZ   . PHE A 1 64  ? -0.266  -9.730  -5.087  1.00 0.00 ? 64  PHE A CZ   1  
ATOM 891   H H    . PHE A 1 64  ? -0.847  -4.796  -1.764  1.00 0.00 ? 64  PHE A H    1  
ATOM 892   H HA   . PHE A 1 64  ? 0.389   -6.609  -1.577  1.00 0.00 ? 64  PHE A HA   1  
ATOM 893   H HB3  . PHE A 1 64  ? 2.512   -6.205  -3.458  1.00 0.00 ? 64  PHE A HB3  1  
ATOM 894   H HD1  . PHE A 1 64  ? -0.942  -6.429  -4.711  1.00 0.00 ? 64  PHE A HD1  1  
ATOM 895   H HD2  . PHE A 1 64  ? 2.486   -8.599  -3.461  1.00 0.00 ? 64  PHE A HD2  1  
ATOM 896   H HE1  . PHE A 1 64  ? -1.927  -8.533  -5.660  1.00 0.00 ? 64  PHE A HE1  1  
ATOM 897   H HE2  . PHE A 1 64  ? 1.500   -10.702 -4.411  1.00 0.00 ? 64  PHE A HE2  1  
ATOM 898   H HZ   . PHE A 1 64  ? -0.694  -10.644 -5.499  1.00 0.00 ? 64  PHE A HZ   1  
ATOM 899   N N    . VAL A 1 65  ? 2.490   -6.414  -0.278  1.00 0.00 ? 65  VAL A N    1  
ATOM 900   C CA   . VAL A 1 65  ? 3.625   -6.248  0.614   1.00 0.00 ? 65  VAL A CA   1  
ATOM 901   C C    . VAL A 1 65  ? 4.910   -6.621  -0.129  1.00 0.00 ? 65  VAL A C    1  
ATOM 902   O O    . VAL A 1 65  ? 4.861   -7.277  -1.169  1.00 0.00 ? 65  VAL A O    1  
ATOM 903   C CB   . VAL A 1 65  ? 3.413   -7.066  1.889   1.00 0.00 ? 65  VAL A CB   1  
ATOM 904   C CG1  . VAL A 1 65  ? 4.712   -7.183  2.687   1.00 0.00 ? 65  VAL A CG1  1  
ATOM 905   C CG2  . VAL A 1 65  ? 2.297   -6.464  2.745   1.00 0.00 ? 65  VAL A CG2  1  
ATOM 906   H H    . VAL A 1 65  ? 1.982   -7.268  -0.162  1.00 0.00 ? 65  VAL A H    1  
ATOM 907   H HA   . VAL A 1 65  ? 3.674   -5.195  0.891   1.00 0.00 ? 65  VAL A HA   1  
ATOM 908   H HB   . VAL A 1 65  ? 3.108   -8.069  1.597   1.00 0.00 ? 65  VAL A HB   1  
ATOM 909   H HG11 . VAL A 1 65  ? 4.524   -7.733  3.609   1.00 0.00 ? 65  VAL A HG11 1  
ATOM 910   H HG12 . VAL A 1 65  ? 5.458   -7.713  2.093   1.00 0.00 ? 65  VAL A HG12 1  
ATOM 911   H HG13 . VAL A 1 65  ? 5.083   -6.186  2.928   1.00 0.00 ? 65  VAL A HG13 1  
ATOM 912   H HG21 . VAL A 1 65  ? 1.461   -7.163  2.796   1.00 0.00 ? 65  VAL A HG21 1  
ATOM 913   H HG22 . VAL A 1 65  ? 2.672   -6.273  3.750   1.00 0.00 ? 65  VAL A HG22 1  
ATOM 914   H HG23 . VAL A 1 65  ? 1.961   -5.528  2.300   1.00 0.00 ? 65  VAL A HG23 1  
ATOM 915   N N    . LYS A 1 66  ? 6.028   -6.189  0.433   1.00 0.00 ? 66  LYS A N    1  
ATOM 916   C CA   . LYS A 1 66  ? 7.323   -6.471  -0.163  1.00 0.00 ? 66  LYS A CA   1  
ATOM 917   C C    . LYS A 1 66  ? 8.108   -7.412  0.754   1.00 0.00 ? 66  LYS A C    1  
ATOM 918   O O    . LYS A 1 66  ? 8.438   -8.531  0.364   1.00 0.00 ? 66  LYS A O    1  
ATOM 919   C CB   . LYS A 1 66  ? 8.061   -5.169  -0.481  1.00 0.00 ? 66  LYS A CB   1  
ATOM 920   C CG   . LYS A 1 66  ? 9.416   -5.450  -1.135  1.00 0.00 ? 66  LYS A CG   1  
ATOM 921   C CD   . LYS A 1 66  ? 10.522  -4.622  -0.480  1.00 0.00 ? 66  LYS A CD   1  
ATOM 922   C CE   . LYS A 1 66  ? 11.897  -5.243  -0.739  1.00 0.00 ? 66  LYS A CE   1  
ATOM 923   N NZ   . LYS A 1 66  ? 12.564  -4.569  -1.875  1.00 0.00 ? 66  LYS A NZ   1  
ATOM 924   H H    . LYS A 1 66  ? 6.059   -5.656  1.280   1.00 0.00 ? 66  LYS A H    1  
ATOM 925   H HA   . LYS A 1 66  ? 7.144   -6.980  -1.108  1.00 0.00 ? 66  LYS A HA   1  
ATOM 926   H HB3  . LYS A 1 66  ? 8.207   -4.594  0.434   1.00 0.00 ? 66  LYS A HB3  1  
ATOM 927   H HG3  . LYS A 1 66  ? 9.364   -5.220  -2.198  1.00 0.00 ? 66  LYS A HG3  1  
ATOM 928   H HD3  . LYS A 1 66  ? 10.347  -4.555  0.593   1.00 0.00 ? 66  LYS A HD3  1  
ATOM 929   H HE3  . LYS A 1 66  ? 11.789  -6.305  -0.951  1.00 0.00 ? 66  LYS A HE3  1  
ATOM 930   H HZ1  . LYS A 1 66  ? 13.448  -5.003  -2.048  1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 931   H HZ2  . LYS A 1 66  ? 11.991  -4.645  -2.692  1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 932   H HZ3  . LYS A 1 66  ? 12.705  -3.603  -1.655  1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 933   N N    . GLN A 1 67  ? 8.383   -6.924  1.956   1.00 0.00 ? 67  GLN A N    1  
ATOM 934   C CA   . GLN A 1 67  ? 9.123   -7.707  2.930   1.00 0.00 ? 67  GLN A CA   1  
ATOM 935   C C    . GLN A 1 67  ? 8.554   -7.483  4.332   1.00 0.00 ? 67  GLN A C    1  
ATOM 936   O O    . GLN A 1 67  ? 7.717   -6.605  4.534   1.00 0.00 ? 67  GLN A O    1  
ATOM 937   C CB   . GLN A 1 67  ? 10.616  -7.373  2.884   1.00 0.00 ? 67  GLN A CB   1  
ATOM 938   C CG   . GLN A 1 67  ? 11.348  -8.280  1.892   1.00 0.00 ? 67  GLN A CG   1  
ATOM 939   C CD   . GLN A 1 67  ? 12.651  -8.812  2.496   1.00 0.00 ? 67  GLN A CD   1  
ATOM 940   O OE1  . GLN A 1 67  ? 12.678  -9.811  3.196   1.00 0.00 ? 67  GLN A OE1  1  
ATOM 941   N NE2  . GLN A 1 67  ? 13.724  -8.089  2.189   1.00 0.00 ? 67  GLN A NE2  1  
ATOM 942   H H    . GLN A 1 67  ? 8.110   -6.013  2.264   1.00 0.00 ? 67  GLN A H    1  
ATOM 943   H HA   . GLN A 1 67  ? 8.979   -8.747  2.635   1.00 0.00 ? 67  GLN A HA   1  
ATOM 944   H HB3  . GLN A 1 67  ? 11.048  -7.489  3.877   1.00 0.00 ? 67  GLN A HB3  1  
ATOM 945   H HG3  . GLN A 1 67  ? 11.567  -7.727  0.980   1.00 0.00 ? 67  GLN A HG3  1  
ATOM 946   H HE21 . GLN A 1 67  ? 13.632  -7.278  1.610   1.00 0.00 ? 67  GLN A HE21 1  
ATOM 947   H HE22 . GLN A 1 67  ? 14.623  -8.355  2.536   1.00 0.00 ? 67  GLN A HE22 1  
ATOM 948   N N    . VAL A 1 68  ? 9.032   -8.292  5.267   1.00 0.00 ? 68  VAL A N    1  
ATOM 949   C CA   . VAL A 1 68  ? 8.581   -8.193  6.645   1.00 0.00 ? 68  VAL A CA   1  
ATOM 950   C C    . VAL A 1 68  ? 9.787   -8.302  7.580   1.00 0.00 ? 68  VAL A C    1  
ATOM 951   O O    . VAL A 1 68  ? 10.404  -9.362  7.682   1.00 0.00 ? 68  VAL A O    1  
ATOM 952   C CB   . VAL A 1 68  ? 7.511   -9.250  6.923   1.00 0.00 ? 68  VAL A CB   1  
ATOM 953   C CG1  . VAL A 1 68  ? 7.237   -9.371  8.423   1.00 0.00 ? 68  VAL A CG1  1  
ATOM 954   C CG2  . VAL A 1 68  ? 6.224   -8.944  6.154   1.00 0.00 ? 68  VAL A CG2  1  
ATOM 955   H H    . VAL A 1 68  ? 9.713   -9.004  5.095   1.00 0.00 ? 68  VAL A H    1  
ATOM 956   H HA   . VAL A 1 68  ? 8.126   -7.210  6.772   1.00 0.00 ? 68  VAL A HA   1  
ATOM 957   H HB   . VAL A 1 68  ? 7.890   -10.211 6.574   1.00 0.00 ? 68  VAL A HB   1  
ATOM 958   H HG11 . VAL A 1 68  ? 7.832   -8.633  8.962   1.00 0.00 ? 68  VAL A HG11 1  
ATOM 959   H HG12 . VAL A 1 68  ? 6.179   -9.197  8.615   1.00 0.00 ? 68  VAL A HG12 1  
ATOM 960   H HG13 . VAL A 1 68  ? 7.507   -10.372 8.762   1.00 0.00 ? 68  VAL A HG13 1  
ATOM 961   H HG21 . VAL A 1 68  ? 5.363   -9.161  6.786   1.00 0.00 ? 68  VAL A HG21 1  
ATOM 962   H HG22 . VAL A 1 68  ? 6.212   -7.891  5.872   1.00 0.00 ? 68  VAL A HG22 1  
ATOM 963   H HG23 . VAL A 1 68  ? 6.182   -9.561  5.256   1.00 0.00 ? 68  VAL A HG23 1  
ATOM 964   N N    . LYS A 1 69  ? 10.087  -7.193  8.240   1.00 0.00 ? 69  LYS A N    1  
ATOM 965   C CA   . LYS A 1 69  ? 11.208  -7.152  9.163   1.00 0.00 ? 69  LYS A CA   1  
ATOM 966   C C    . LYS A 1 69  ? 11.182  -8.400  10.047  1.00 0.00 ? 69  LYS A C    1  
ATOM 967   O O    . LYS A 1 69  ? 10.150  -9.058  10.167  1.00 0.00 ? 69  LYS A O    1  
ATOM 968   C CB   . LYS A 1 69  ? 11.205  -5.840  9.951   1.00 0.00 ? 69  LYS A CB   1  
ATOM 969   C CG   . LYS A 1 69  ? 12.632  -5.386  10.267  1.00 0.00 ? 69  LYS A CG   1  
ATOM 970   C CD   . LYS A 1 69  ? 12.659  -3.918  10.693  1.00 0.00 ? 69  LYS A CD   1  
ATOM 971   C CE   . LYS A 1 69  ? 14.095  -3.416  10.843  1.00 0.00 ? 69  LYS A CE   1  
ATOM 972   N NZ   . LYS A 1 69  ? 14.661  -3.058  9.523   1.00 0.00 ? 69  LYS A NZ   1  
ATOM 973   H H    . LYS A 1 69  ? 9.580   -6.336  8.152   1.00 0.00 ? 69  LYS A H    1  
ATOM 974   H HA   . LYS A 1 69  ? 12.122  -7.168  8.569   1.00 0.00 ? 69  LYS A HA   1  
ATOM 975   H HB3  . LYS A 1 69  ? 10.647  -5.969  10.878  1.00 0.00 ? 69  LYS A HB3  1  
ATOM 976   H HG3  . LYS A 1 69  ? 13.264  -5.526  9.390   1.00 0.00 ? 69  LYS A HG3  1  
ATOM 977   H HD3  . LYS A 1 69  ? 12.127  -3.799  11.638  1.00 0.00 ? 69  LYS A HD3  1  
ATOM 978   H HE3  . LYS A 1 69  ? 14.709  -4.186  11.312  1.00 0.00 ? 69  LYS A HE3  1  
ATOM 979   H HZ1  . LYS A 1 69  ? 14.731  -3.879  8.957   1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 980   H HZ2  . LYS A 1 69  ? 14.062  -2.394  9.073   1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 981   H HZ3  . LYS A 1 69  ? 15.569  -2.658  9.647   1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 982   N N    . GLU A 1 70  ? 12.330  -8.686  10.644  1.00 0.00 ? 70  GLU A N    1  
ATOM 983   C CA   . GLU A 1 70  ? 12.450  -9.845  11.514  1.00 0.00 ? 70  GLU A CA   1  
ATOM 984   C C    . GLU A 1 70  ? 12.553  -9.403  12.974  1.00 0.00 ? 70  GLU A C    1  
ATOM 985   O O    . GLU A 1 70  ? 13.648  -9.163  13.481  1.00 0.00 ? 70  GLU A O    1  
ATOM 986   C CB   . GLU A 1 70  ? 13.652  -10.705 11.117  1.00 0.00 ? 70  GLU A CB   1  
ATOM 987   C CG   . GLU A 1 70  ? 13.281  -12.189 11.096  1.00 0.00 ? 70  GLU A CG   1  
ATOM 988   C CD   . GLU A 1 70  ? 14.421  -13.048 11.646  1.00 0.00 ? 70  GLU A CD   1  
ATOM 989   O OE1  . GLU A 1 70  ? 15.559  -12.853 11.167  1.00 0.00 ? 70  GLU A OE1  1  
ATOM 990   O OE2  . GLU A 1 70  ? 14.129  -13.879 12.533  1.00 0.00 ? 70  GLU A OE2  1  
ATOM 991   H H    . GLU A 1 70  ? 13.165  -8.147  10.541  1.00 0.00 ? 70  GLU A H    1  
ATOM 992   H HA   . GLU A 1 70  ? 11.535  -10.417 11.363  1.00 0.00 ? 70  GLU A HA   1  
ATOM 993   H HB3  . GLU A 1 70  ? 14.469  -10.541 11.819  1.00 0.00 ? 70  GLU A HB3  1  
ATOM 994   H HG3  . GLU A 1 70  ? 13.049  -12.495 10.075  1.00 0.00 ? 70  GLU A HG3  1  
ATOM 995   N N    . GLY A 1 71  ? 11.395  -9.308  13.613  1.00 0.00 ? 71  GLY A N    1  
ATOM 996   C CA   . GLY A 1 71  ? 11.339  -8.899  15.006  1.00 0.00 ? 71  GLY A CA   1  
ATOM 997   C C    . GLY A 1 71  ? 10.685  -7.523  15.148  1.00 0.00 ? 71  GLY A C    1  
ATOM 998   O O    . GLY A 1 71  ? 10.990  -6.781  16.080  1.00 0.00 ? 71  GLY A O    1  
ATOM 999   H H    . GLY A 1 71  ? 10.508  -9.505  13.194  1.00 0.00 ? 71  GLY A H    1  
ATOM 1000  H HA2  . GLY A 1 71  ? 10.777  -9.633  15.582  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1001  H HA3  . GLY A 1 71  ? 12.347  -8.871  15.421  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1002  N N    . GLY A 1 72  ? 9.801   -7.223  14.209  1.00 0.00 ? 72  GLY A N    1  
ATOM 1003  C CA   . GLY A 1 72  ? 9.102   -5.950  14.217  1.00 0.00 ? 72  GLY A CA   1  
ATOM 1004  C C    . GLY A 1 72  ? 7.625   -6.137  14.569  1.00 0.00 ? 72  GLY A C    1  
ATOM 1005  O O    . GLY A 1 72  ? 7.241   -7.166  15.125  1.00 0.00 ? 72  GLY A O    1  
ATOM 1006  H H    . GLY A 1 72  ? 9.560   -7.834  13.453  1.00 0.00 ? 72  GLY A H    1  
ATOM 1007  H HA2  . GLY A 1 72  ? 9.569   -5.279  14.938  1.00 0.00 ? 72  GLY A HA2  1  
ATOM 1008  H HA3  . GLY A 1 72  ? 9.189   -5.477  13.238  1.00 0.00 ? 72  GLY A HA3  1  
ATOM 1009  N N    . PRO A 1 73  ? 6.815   -5.101  14.223  1.00 0.00 ? 73  PRO A N    1  
ATOM 1010  C CA   . PRO A 1 73  ? 5.388   -5.142  14.497  1.00 0.00 ? 73  PRO A CA   1  
ATOM 1011  C C    . PRO A 1 73  ? 4.670   -6.074  13.521  1.00 0.00 ? 73  PRO A C    1  
ATOM 1012  O O    . PRO A 1 73  ? 4.091   -7.080  13.929  1.00 0.00 ? 73  PRO A O    1  
ATOM 1013  C CB   . PRO A 1 73  ? 4.927   -3.697  14.388  1.00 0.00 ? 73  PRO A CB   1  
ATOM 1014  C CG   . PRO A 1 73  ? 6.009   -2.971  13.607  1.00 0.00 ? 73  PRO A CG   1  
ATOM 1015  C CD   . PRO A 1 73  ? 7.235   -3.867  13.565  1.00 0.00 ? 73  PRO A CD   1  
ATOM 1016  H HA   . PRO A 1 73  ? 5.221   -5.518  15.408  1.00 0.00 ? 73  PRO A HA   1  
ATOM 1017  H HB3  . PRO A 1 73  ? 4.795   -3.255  15.376  1.00 0.00 ? 73  PRO A HB3  1  
ATOM 1018  H HG3  . PRO A 1 73  ? 6.248   -2.018  14.081  1.00 0.00 ? 73  PRO A HG3  1  
ATOM 1019  H HD3  . PRO A 1 73  ? 8.078   -3.409  14.081  1.00 0.00 ? 73  PRO A HD3  1  
ATOM 1020  N N    . ALA A 1 74  ? 4.730   -5.707  12.249  1.00 0.00 ? 74  ALA A N    1  
ATOM 1021  C CA   . ALA A 1 74  ? 4.092   -6.499  11.211  1.00 0.00 ? 74  ALA A CA   1  
ATOM 1022  C C    . ALA A 1 74  ? 4.410   -7.978  11.436  1.00 0.00 ? 74  ALA A C    1  
ATOM 1023  O O    . ALA A 1 74  ? 3.505   -8.809  11.502  1.00 0.00 ? 74  ALA A O    1  
ATOM 1024  C CB   . ALA A 1 74  ? 4.550   -6.006  9.838   1.00 0.00 ? 74  ALA A CB   1  
ATOM 1025  H H    . ALA A 1 74  ? 5.202   -4.887  11.925  1.00 0.00 ? 74  ALA A H    1  
ATOM 1026  H HA   . ALA A 1 74  ? 3.015   -6.351  11.296  1.00 0.00 ? 74  ALA A HA   1  
ATOM 1027  H HB1  . ALA A 1 74  ? 3.742   -6.136  9.116   1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1028  H HB2  . ALA A 1 74  ? 4.813   -4.950  9.901   1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1029  H HB3  . ALA A 1 74  ? 5.419   -6.578  9.517   1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1030  N N    . PHE A 1 75  ? 5.699   -8.263  11.544  1.00 0.00 ? 75  PHE A N    1  
ATOM 1031  C CA   . PHE A 1 75  ? 6.150   -9.628  11.760  1.00 0.00 ? 75  PHE A CA   1  
ATOM 1032  C C    . PHE A 1 75  ? 5.298   -10.324 12.825  1.00 0.00 ? 75  PHE A C    1  
ATOM 1033  O O    . PHE A 1 75  ? 4.893   -11.472 12.648  1.00 0.00 ? 75  PHE A O    1  
ATOM 1034  C CB   . PHE A 1 75  ? 7.596   -9.551  12.251  1.00 0.00 ? 75  PHE A CB   1  
ATOM 1035  C CG   . PHE A 1 75  ? 8.062   -10.792 13.012  1.00 0.00 ? 75  PHE A CG   1  
ATOM 1036  C CD1  . PHE A 1 75  ? 8.155   -11.989 12.370  1.00 0.00 ? 75  PHE A CD1  1  
ATOM 1037  C CD2  . PHE A 1 75  ? 8.386   -10.700 14.331  1.00 0.00 ? 75  PHE A CD2  1  
ATOM 1038  C CE1  . PHE A 1 75  ? 8.588   -13.142 13.077  1.00 0.00 ? 75  PHE A CE1  1  
ATOM 1039  C CE2  . PHE A 1 75  ? 8.819   -11.854 15.037  1.00 0.00 ? 75  PHE A CE2  1  
ATOM 1040  C CZ   . PHE A 1 75  ? 8.911   -13.049 14.395  1.00 0.00 ? 75  PHE A CZ   1  
ATOM 1041  H H    . PHE A 1 75  ? 6.429   -7.581  11.490  1.00 0.00 ? 75  PHE A H    1  
ATOM 1042  H HA   . PHE A 1 75  ? 6.045   -10.155 10.812  1.00 0.00 ? 75  PHE A HA   1  
ATOM 1043  H HB3  . PHE A 1 75  ? 7.703   -8.680  12.897  1.00 0.00 ? 75  PHE A HB3  1  
ATOM 1044  H HD1  . PHE A 1 75  ? 7.896   -12.061 11.314  1.00 0.00 ? 75  PHE A HD1  1  
ATOM 1045  H HD2  . PHE A 1 75  ? 8.312   -9.743  14.844  1.00 0.00 ? 75  PHE A HD2  1  
ATOM 1046  H HE1  . PHE A 1 75  ? 8.661   -14.100 12.563  1.00 0.00 ? 75  PHE A HE1  1  
ATOM 1047  H HE2  . PHE A 1 75  ? 9.078   -11.781 16.092  1.00 0.00 ? 75  PHE A HE2  1  
ATOM 1048  H HZ   . PHE A 1 75  ? 9.243   -13.936 14.937  1.00 0.00 ? 75  PHE A HZ   1  
ATOM 1049  N N    . GLU A 1 76  ? 5.054   -9.600  13.907  1.00 0.00 ? 76  GLU A N    1  
ATOM 1050  C CA   . GLU A 1 76  ? 4.260   -10.133 15.000  1.00 0.00 ? 76  GLU A CA   1  
ATOM 1051  C C    . GLU A 1 76  ? 2.788   -10.227 14.591  1.00 0.00 ? 76  GLU A C    1  
ATOM 1052  O O    . GLU A 1 76  ? 2.177   -11.291 14.696  1.00 0.00 ? 76  GLU A O    1  
ATOM 1053  C CB   . GLU A 1 76  ? 4.424   -9.285  16.264  1.00 0.00 ? 76  GLU A CB   1  
ATOM 1054  C CG   . GLU A 1 76  ? 5.897   -9.163  16.655  1.00 0.00 ? 76  GLU A CG   1  
ATOM 1055  C CD   . GLU A 1 76  ? 6.195   -9.966  17.922  1.00 0.00 ? 76  GLU A CD   1  
ATOM 1056  O OE1  . GLU A 1 76  ? 6.496   -11.170 17.775  1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1057  O OE2  . GLU A 1 76  ? 6.116   -9.357  19.011  1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1058  H H    . GLU A 1 76  ? 5.387   -8.668  14.043  1.00 0.00 ? 76  GLU A H    1  
ATOM 1059  H HA   . GLU A 1 76  ? 4.656   -11.132 15.187  1.00 0.00 ? 76  GLU A HA   1  
ATOM 1060  H HB3  . GLU A 1 76  ? 3.862   -9.732  17.082  1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1061  H HG3  . GLU A 1 76  ? 6.150   -8.115  16.816  1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1062  N N    . ALA A 1 77  ? 2.261   -9.102  14.133  1.00 0.00 ? 77  ALA A N    1  
ATOM 1063  C CA   . ALA A 1 77  ? 0.873   -9.043  13.706  1.00 0.00 ? 77  ALA A CA   1  
ATOM 1064  C C    . ALA A 1 77  ? 0.520   -10.329 12.955  1.00 0.00 ? 77  ALA A C    1  
ATOM 1065  O O    . ALA A 1 77  ? -0.624  -10.777 12.986  1.00 0.00 ? 77  ALA A O    1  
ATOM 1066  C CB   . ALA A 1 77  ? 0.652   -7.792  12.855  1.00 0.00 ? 77  ALA A CB   1  
ATOM 1067  H H    . ALA A 1 77  ? 2.764   -8.241  14.050  1.00 0.00 ? 77  ALA A H    1  
ATOM 1068  H HA   . ALA A 1 77  ? 0.254   -8.975  14.601  1.00 0.00 ? 77  ALA A HA   1  
ATOM 1069  H HB1  . ALA A 1 77  ? 1.041   -6.920  13.382  1.00 0.00 ? 77  ALA A HB1  1  
ATOM 1070  H HB2  . ALA A 1 77  ? 1.172   -7.903  11.903  1.00 0.00 ? 77  ALA A HB2  1  
ATOM 1071  H HB3  . ALA A 1 77  ? -0.414  -7.660  12.674  1.00 0.00 ? 77  ALA A HB3  1  
ATOM 1072  N N    . GLY A 1 78  ? 1.528   -10.889 12.298  1.00 0.00 ? 78  GLY A N    1  
ATOM 1073  C CA   . GLY A 1 78  ? 1.339   -12.113 11.541  1.00 0.00 ? 78  GLY A CA   1  
ATOM 1074  C C    . GLY A 1 78  ? 1.422   -11.846 10.037  1.00 0.00 ? 78  GLY A C    1  
ATOM 1075  O O    . GLY A 1 78  ? 0.964   -12.658 9.233   1.00 0.00 ? 78  GLY A O    1  
ATOM 1076  H H    . GLY A 1 78  ? 2.456   -10.519 12.278  1.00 0.00 ? 78  GLY A H    1  
ATOM 1077  H HA2  . GLY A 1 78  ? 2.097   -12.843 11.827  1.00 0.00 ? 78  GLY A HA2  1  
ATOM 1078  H HA3  . GLY A 1 78  ? 0.369   -12.549 11.783  1.00 0.00 ? 78  GLY A HA3  1  
ATOM 1079  N N    . LEU A 1 79  ? 2.008   -10.707 9.703   1.00 0.00 ? 79  LEU A N    1  
ATOM 1080  C CA   . LEU A 1 79  ? 2.156   -10.323 8.309   1.00 0.00 ? 79  LEU A CA   1  
ATOM 1081  C C    . LEU A 1 79  ? 3.206   -11.217 7.646   1.00 0.00 ? 79  LEU A C    1  
ATOM 1082  O O    . LEU A 1 79  ? 3.825   -12.050 8.308   1.00 0.00 ? 79  LEU A O    1  
ATOM 1083  C CB   . LEU A 1 79  ? 2.462   -8.828  8.195   1.00 0.00 ? 79  LEU A CB   1  
ATOM 1084  C CG   . LEU A 1 79  ? 1.717   -8.072  7.093   1.00 0.00 ? 79  LEU A CG   1  
ATOM 1085  C CD1  . LEU A 1 79  ? 0.257   -7.833  7.484   1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1086  C CD2  . LEU A 1 79  ? 2.436   -6.769  6.738   1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1087  H H    . LEU A 1 79  ? 2.377   -10.052 10.363  1.00 0.00 ? 79  LEU A H    1  
ATOM 1088  H HA   . LEU A 1 79  ? 1.198   -10.494 7.819   1.00 0.00 ? 79  LEU A HA   1  
ATOM 1089  H HB3  . LEU A 1 79  ? 3.533   -8.709  8.029   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1090  H HG   . LEU A 1 79  ? 1.713   -8.692  6.197   1.00 0.00 ? 79  LEU A HG   1  
ATOM 1091  H HD11 . LEU A 1 79  ? 0.122   -8.058  8.543   1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1092  H HD12 . LEU A 1 79  ? -0.002  -6.791  7.300   1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1093  H HD13 . LEU A 1 79  ? -0.389  -8.478  6.891   1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1094  H HD21 . LEU A 1 79  ? 2.097   -6.422  5.762   1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1095  H HD22 . LEU A 1 79  ? 2.212   -6.013  7.491   1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1096  H HD23 . LEU A 1 79  ? 3.511   -6.944  6.709   1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1097  N N    . CYS A 1 80  ? 3.374   -11.016 6.348   1.00 0.00 ? 80  CYS A N    1  
ATOM 1098  C CA   . CYS A 1 80  ? 4.337   -11.795 5.588   1.00 0.00 ? 80  CYS A CA   1  
ATOM 1099  C C    . CYS A 1 80  ? 4.566   -11.100 4.245   1.00 0.00 ? 80  CYS A C    1  
ATOM 1100  O O    . CYS A 1 80  ? 4.214   -9.932  4.078   1.00 0.00 ? 80  CYS A O    1  
ATOM 1101  C CB   . CYS A 1 80  ? 3.880   -13.244 5.411   1.00 0.00 ? 80  CYS A CB   1  
ATOM 1102  S SG   . CYS A 1 80  ? 5.149   -14.387 6.071   1.00 0.00 ? 80  CYS A SG   1  
ATOM 1103  H H    . CYS A 1 80  ? 2.866   -10.338 5.817   1.00 0.00 ? 80  CYS A H    1  
ATOM 1104  H HA   . CYS A 1 80  ? 5.257   -11.814 6.176   1.00 0.00 ? 80  CYS A HA   1  
ATOM 1105  H HB3  . CYS A 1 80  ? 3.705   -13.452 4.356   1.00 0.00 ? 80  CYS A HB3  1  
ATOM 1106  H HG   . CYS A 1 80  ? 6.069   -14.118 5.150   1.00 0.00 ? 80  CYS A HG   1  
ATOM 1107  N N    . THR A 1 81  ? 5.153   -11.846 3.320   1.00 0.00 ? 81  THR A N    1  
ATOM 1108  C CA   . THR A 1 81  ? 5.431   -11.315 1.997   1.00 0.00 ? 81  THR A CA   1  
ATOM 1109  C C    . THR A 1 81  ? 4.414   -11.846 0.985   1.00 0.00 ? 81  THR A C    1  
ATOM 1110  O O    . THR A 1 81  ? 4.135   -13.043 0.949   1.00 0.00 ? 81  THR A O    1  
ATOM 1111  C CB   . THR A 1 81  ? 6.879   -11.664 1.643   1.00 0.00 ? 81  THR A CB   1  
ATOM 1112  O OG1  . THR A 1 81  ? 6.941   -13.080 1.790   1.00 0.00 ? 81  THR A OG1  1  
ATOM 1113  C CG2  . THR A 1 81  ? 7.877   -11.137 2.677   1.00 0.00 ? 81  THR A CG2  1  
ATOM 1114  H H    . THR A 1 81  ? 5.435   -12.794 3.464   1.00 0.00 ? 81  THR A H    1  
ATOM 1115  H HA   . THR A 1 81  ? 5.315   -10.232 2.030   1.00 0.00 ? 81  THR A HA   1  
ATOM 1116  H HB   . THR A 1 81  ? 7.131   -11.310 0.644   1.00 0.00 ? 81  THR A HB   1  
ATOM 1117  H HG1  . THR A 1 81  ? 6.809   -13.521 0.903   1.00 0.00 ? 81  THR A HG1  1  
ATOM 1118  H HG21 . THR A 1 81  ? 8.722   -10.678 2.165   1.00 0.00 ? 81  THR A HG21 1  
ATOM 1119  H HG22 . THR A 1 81  ? 7.388   -10.395 3.309   1.00 0.00 ? 81  THR A HG22 1  
ATOM 1120  H HG23 . THR A 1 81  ? 8.230   -11.965 3.294   1.00 0.00 ? 81  THR A HG23 1  
ATOM 1121  N N    . GLY A 1 82  ? 3.889   -10.929 0.185   1.00 0.00 ? 82  GLY A N    1  
ATOM 1122  C CA   . GLY A 1 82  ? 2.908   -11.289 -0.824  1.00 0.00 ? 82  GLY A CA   1  
ATOM 1123  C C    . GLY A 1 82  ? 1.501   -10.871 -0.395  1.00 0.00 ? 82  GLY A C    1  
ATOM 1124  O O    . GLY A 1 82  ? 0.622   -10.683 -1.236  1.00 0.00 ? 82  GLY A O    1  
ATOM 1125  H H    . GLY A 1 82  ? 4.122   -9.957  0.221   1.00 0.00 ? 82  GLY A H    1  
ATOM 1126  H HA2  . GLY A 1 82  ? 3.162   -10.810 -1.770  1.00 0.00 ? 82  GLY A HA2  1  
ATOM 1127  H HA3  . GLY A 1 82  ? 2.936   -12.365 -0.996  1.00 0.00 ? 82  GLY A HA3  1  
ATOM 1128  N N    . ASP A 1 83  ? 1.329   -10.737 0.911   1.00 0.00 ? 83  ASP A N    1  
ATOM 1129  C CA   . ASP A 1 83  ? 0.044   -10.343 1.461   1.00 0.00 ? 83  ASP A CA   1  
ATOM 1130  C C    . ASP A 1 83  ? -0.381  -9.007  0.851   1.00 0.00 ? 83  ASP A C    1  
ATOM 1131  O O    . ASP A 1 83  ? 0.376   -8.037  0.886   1.00 0.00 ? 83  ASP A O    1  
ATOM 1132  C CB   . ASP A 1 83  ? 0.124   -10.167 2.979   1.00 0.00 ? 83  ASP A CB   1  
ATOM 1133  C CG   . ASP A 1 83  ? 0.355   -11.458 3.768   1.00 0.00 ? 83  ASP A CG   1  
ATOM 1134  O OD1  . ASP A 1 83  ? 0.174   -12.536 3.161   1.00 0.00 ? 83  ASP A OD1  1  
ATOM 1135  O OD2  . ASP A 1 83  ? 0.704   -11.338 4.963   1.00 0.00 ? 83  ASP A OD2  1  
ATOM 1136  H H    . ASP A 1 83  ? 2.048   -10.891 1.588   1.00 0.00 ? 83  ASP A H    1  
ATOM 1137  H HA   . ASP A 1 83  ? -0.639  -11.154 1.202   1.00 0.00 ? 83  ASP A HA   1  
ATOM 1138  H HB3  . ASP A 1 83  ? -0.801  -9.707  3.325   1.00 0.00 ? 83  ASP A HB3  1  
ATOM 1139  N N    . ARG A 1 84  ? -1.588  -8.996  0.308   1.00 0.00 ? 84  ARG A N    1  
ATOM 1140  C CA   . ARG A 1 84  ? -2.122  -7.794  -0.309  1.00 0.00 ? 84  ARG A CA   1  
ATOM 1141  C C    . ARG A 1 84  ? -2.953  -7.002  0.703   1.00 0.00 ? 84  ARG A C    1  
ATOM 1142  O O    . ARG A 1 84  ? -3.661  -7.586  1.522   1.00 0.00 ? 84  ARG A O    1  
ATOM 1143  C CB   . ARG A 1 84  ? -2.993  -8.134  -1.519  1.00 0.00 ? 84  ARG A CB   1  
ATOM 1144  C CG   . ARG A 1 84  ? -2.348  -9.230  -2.368  1.00 0.00 ? 84  ARG A CG   1  
ATOM 1145  C CD   . ARG A 1 84  ? -3.344  -9.798  -3.382  1.00 0.00 ? 84  ARG A CD   1  
ATOM 1146  N NE   . ARG A 1 84  ? -3.138  -11.256 -3.533  1.00 0.00 ? 84  ARG A NE   1  
ATOM 1147  C CZ   . ARG A 1 84  ? -4.067  -12.101 -4.000  1.00 0.00 ? 84  ARG A CZ   1  
ATOM 1148  N NH1  . ARG A 1 84  ? -5.270  -11.638 -4.366  1.00 0.00 ? 84  ARG A NH1  1  
ATOM 1149  N NH2  . ARG A 1 84  ? -3.792  -13.408 -4.103  1.00 0.00 ? 84  ARG A NH2  1  
ATOM 1150  H H    . ARG A 1 84  ? -2.198  -9.789  0.283   1.00 0.00 ? 84  ARG A H    1  
ATOM 1151  H HA   . ARG A 1 84  ? -1.244  -7.227  -0.622  1.00 0.00 ? 84  ARG A HA   1  
ATOM 1152  H HB3  . ARG A 1 84  ? -3.145  -7.242  -2.126  1.00 0.00 ? 84  ARG A HB3  1  
ATOM 1153  H HG3  . ARG A 1 84  ? -1.986  -10.031 -1.722  1.00 0.00 ? 84  ARG A HG3  1  
ATOM 1154  H HD3  . ARG A 1 84  ? -3.217  -9.302  -4.344  1.00 0.00 ? 84  ARG A HD3  1  
ATOM 1155  H HE   . ARG A 1 84  ? -2.251  -11.634 -3.268  1.00 0.00 ? 84  ARG A HE   1  
ATOM 1156  H HH11 . ARG A 1 84  ? -5.476  -10.663 -4.290  1.00 0.00 ? 84  ARG A HH11 1  
ATOM 1157  H HH12 . ARG A 1 84  ? -5.964  -12.269 -4.715  1.00 0.00 ? 84  ARG A HH12 1  
ATOM 1158  H HH21 . ARG A 1 84  ? -2.895  -13.753 -3.830  1.00 0.00 ? 84  ARG A HH21 1  
ATOM 1159  H HH22 . ARG A 1 84  ? -4.485  -14.038 -4.453  1.00 0.00 ? 84  ARG A HH22 1  
ATOM 1160  N N    . ILE A 1 85  ? -2.840  -5.685  0.614   1.00 0.00 ? 85  ILE A N    1  
ATOM 1161  C CA   . ILE A 1 85  ? -3.572  -4.808  1.511   1.00 0.00 ? 85  ILE A CA   1  
ATOM 1162  C C    . ILE A 1 85  ? -4.985  -4.593  0.965   1.00 0.00 ? 85  ILE A C    1  
ATOM 1163  O O    . ILE A 1 85  ? -5.163  -4.338  -0.225  1.00 0.00 ? 85  ILE A O    1  
ATOM 1164  C CB   . ILE A 1 85  ? -2.797  -3.509  1.742   1.00 0.00 ? 85  ILE A CB   1  
ATOM 1165  C CG1  . ILE A 1 85  ? -1.321  -3.794  2.029   1.00 0.00 ? 85  ILE A CG1  1  
ATOM 1166  C CG2  . ILE A 1 85  ? -3.446  -2.672  2.846   1.00 0.00 ? 85  ILE A CG2  1  
ATOM 1167  C CD1  . ILE A 1 85  ? -1.167  -4.674  3.272   1.00 0.00 ? 85  ILE A CD1  1  
ATOM 1168  H H    . ILE A 1 85  ? -2.261  -5.218  -0.056  1.00 0.00 ? 85  ILE A H    1  
ATOM 1169  H HA   . ILE A 1 85  ? -3.647  -5.314  2.475   1.00 0.00 ? 85  ILE A HA   1  
ATOM 1170  H HB   . ILE A 1 85  ? -2.838  -2.919  0.825   1.00 0.00 ? 85  ILE A HB   1  
ATOM 1171  H HG13 . ILE A 1 85  ? -0.789  -2.855  2.174   1.00 0.00 ? 85  ILE A HG13 1  
ATOM 1172  H HG21 . ILE A 1 85  ? -3.050  -1.657  2.814   1.00 0.00 ? 85  ILE A HG21 1  
ATOM 1173  H HG22 . ILE A 1 85  ? -4.526  -2.645  2.696   1.00 0.00 ? 85  ILE A HG22 1  
ATOM 1174  H HG23 . ILE A 1 85  ? -3.225  -3.118  3.816   1.00 0.00 ? 85  ILE A HG23 1  
ATOM 1175  H HD11 . ILE A 1 85  ? -0.112  -4.910  3.419   1.00 0.00 ? 85  ILE A HD11 1  
ATOM 1176  H HD12 . ILE A 1 85  ? -1.546  -4.142  4.144   1.00 0.00 ? 85  ILE A HD12 1  
ATOM 1177  H HD13 . ILE A 1 85  ? -1.729  -5.597  3.135   1.00 0.00 ? 85  ILE A HD13 1  
ATOM 1178  N N    . ILE A 1 86  ? -5.954  -4.703  1.863   1.00 0.00 ? 86  ILE A N    1  
ATOM 1179  C CA   . ILE A 1 86  ? -7.347  -4.523  1.486   1.00 0.00 ? 86  ILE A CA   1  
ATOM 1180  C C    . ILE A 1 86  ? -7.934  -3.349  2.271   1.00 0.00 ? 86  ILE A C    1  
ATOM 1181  O O    . ILE A 1 86  ? -8.708  -2.560  1.729   1.00 0.00 ? 86  ILE A O    1  
ATOM 1182  C CB   . ILE A 1 86  ? -8.122  -5.830  1.661   1.00 0.00 ? 86  ILE A CB   1  
ATOM 1183  C CG1  . ILE A 1 86  ? -8.221  -6.215  3.139   1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1184  C CG2  . ILE A 1 86  ? -7.507  -6.949  0.819   1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1185  C CD1  . ILE A 1 86  ? -9.030  -7.502  3.318   1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1186  H H    . ILE A 1 86  ? -5.801  -4.909  2.829   1.00 0.00 ? 86  ILE A H    1  
ATOM 1187  H HA   . ILE A 1 86  ? -7.370  -4.275  0.425   1.00 0.00 ? 86  ILE A HA   1  
ATOM 1188  H HB   . ILE A 1 86  ? -9.138  -5.675  1.300   1.00 0.00 ? 86  ILE A HB   1  
ATOM 1189  H HG13 . ILE A 1 86  ? -8.691  -5.407  3.698   1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1190  H HG21 . ILE A 1 86  ? -8.281  -7.406  0.201   1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1191  H HG22 . ILE A 1 86  ? -6.728  -6.535  0.179   1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1192  H HG23 . ILE A 1 86  ? -7.075  -7.704  1.475   1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1193  H HD11 . ILE A 1 86  ? -8.380  -8.364  3.157   1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1194  H HD12 . ILE A 1 86  ? -9.437  -7.537  4.328   1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1195  H HD13 . ILE A 1 86  ? -9.845  -7.522  2.595   1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1196  N N    . LYS A 1 87  ? -7.548  -3.272  3.537   1.00 0.00 ? 87  LYS A N    1  
ATOM 1197  C CA   . LYS A 1 87  ? -8.028  -2.207  4.402   1.00 0.00 ? 87  LYS A CA   1  
ATOM 1198  C C    . LYS A 1 87  ? -6.853  -1.634  5.197   1.00 0.00 ? 87  LYS A C    1  
ATOM 1199  O O    . LYS A 1 87  ? -5.812  -2.276  5.322   1.00 0.00 ? 87  LYS A O    1  
ATOM 1200  C CB   . LYS A 1 87  ? -9.178  -2.706  5.277   1.00 0.00 ? 87  LYS A CB   1  
ATOM 1201  C CG   . LYS A 1 87  ? -10.379 -3.117  4.421   1.00 0.00 ? 87  LYS A CG   1  
ATOM 1202  C CD   . LYS A 1 87  ? -10.870 -4.516  4.804   1.00 0.00 ? 87  LYS A CD   1  
ATOM 1203  C CE   . LYS A 1 87  ? -11.488 -5.229  3.599   1.00 0.00 ? 87  LYS A CE   1  
ATOM 1204  N NZ   . LYS A 1 87  ? -12.402 -6.304  4.045   1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1205  H H    . LYS A 1 87  ? -6.919  -3.917  3.970   1.00 0.00 ? 87  LYS A H    1  
ATOM 1206  H HA   . LYS A 1 87  ? -8.427  -1.420  3.761   1.00 0.00 ? 87  LYS A HA   1  
ATOM 1207  H HB3  . LYS A 1 87  ? -9.476  -1.922  5.973   1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1208  H HG3  . LYS A 1 87  ? -10.102 -3.102  3.368   1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1209  H HD3  . LYS A 1 87  ? -11.607 -4.441  5.603   1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1210  H HE3  . LYS A 1 87  ? -10.699 -5.649  2.975   1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1211  H HZ1  . LYS A 1 87  ? -12.076 -6.679  4.914   1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1212  H HZ2  . LYS A 1 87  ? -13.320 -5.930  4.168   1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1213  H HZ3  . LYS A 1 87  ? -12.425 -7.028  3.357   1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1214  N N    . VAL A 1 88  ? -7.061  -0.433  5.717   1.00 0.00 ? 88  VAL A N    1  
ATOM 1215  C CA   . VAL A 1 88  ? -6.033  0.233   6.498   1.00 0.00 ? 88  VAL A CA   1  
ATOM 1216  C C    . VAL A 1 88  ? -6.695  1.152   7.527   1.00 0.00 ? 88  VAL A C    1  
ATOM 1217  O O    . VAL A 1 88  ? -7.515  1.998   7.171   1.00 0.00 ? 88  VAL A O    1  
ATOM 1218  C CB   . VAL A 1 88  ? -5.068  0.973   5.569   1.00 0.00 ? 88  VAL A CB   1  
ATOM 1219  C CG1  . VAL A 1 88  ? -4.096  1.843   6.368   1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1220  C CG2  . VAL A 1 88  ? -4.313  -0.008  4.670   1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1221  H H    . VAL A 1 88  ? -7.912  0.083   5.611   1.00 0.00 ? 88  VAL A H    1  
ATOM 1222  H HA   . VAL A 1 88  ? -5.470  -0.537  7.025   1.00 0.00 ? 88  VAL A HA   1  
ATOM 1223  H HB   . VAL A 1 88  ? -5.656  1.630   4.928   1.00 0.00 ? 88  VAL A HB   1  
ATOM 1224  H HG11 . VAL A 1 88  ? -3.580  2.525   5.693   1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1225  H HG12 . VAL A 1 88  ? -4.649  2.416   7.113   1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1226  H HG13 . VAL A 1 88  ? -3.367  1.206   6.869   1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1227  H HG21 . VAL A 1 88  ? -3.832  -0.769  5.284   1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1228  H HG22 . VAL A 1 88  ? -5.012  -0.484  3.983   1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1229  H HG23 . VAL A 1 88  ? -3.555  0.531   4.100   1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1230  N N    . ASN A 1 89  ? -6.314  0.956   8.780   1.00 0.00 ? 89  ASN A N    1  
ATOM 1231  C CA   . ASN A 1 89  ? -6.859  1.756   9.862   1.00 0.00 ? 89  ASN A CA   1  
ATOM 1232  C C    . ASN A 1 89  ? -8.387  1.767   9.762   1.00 0.00 ? 89  ASN A C    1  
ATOM 1233  O O    . ASN A 1 89  ? -9.000  2.830   9.683   1.00 0.00 ? 89  ASN A O    1  
ATOM 1234  C CB   . ASN A 1 89  ? -6.371  3.205   9.777   1.00 0.00 ? 89  ASN A CB   1  
ATOM 1235  C CG   . ASN A 1 89  ? -4.941  3.331   10.307  1.00 0.00 ? 89  ASN A CG   1  
ATOM 1236  O OD1  . ASN A 1 89  ? -4.437  2.480   11.021  1.00 0.00 ? 89  ASN A OD1  1  
ATOM 1237  N ND2  . ASN A 1 89  ? -4.317  4.439   9.917   1.00 0.00 ? 89  ASN A ND2  1  
ATOM 1238  H H    . ASN A 1 89  ? -5.646  0.267   9.059   1.00 0.00 ? 89  ASN A H    1  
ATOM 1239  H HA   . ASN A 1 89  ? -6.504  1.282   10.776  1.00 0.00 ? 89  ASN A HA   1  
ATOM 1240  H HB3  . ASN A 1 89  ? -7.034  3.850   10.354  1.00 0.00 ? 89  ASN A HB3  1  
ATOM 1241  H HD21 . ASN A 1 89  ? -4.788  5.098   9.329   1.00 0.00 ? 89  ASN A HD21 1  
ATOM 1242  H HD22 . ASN A 1 89  ? -3.377  4.614   10.210  1.00 0.00 ? 89  ASN A HD22 1  
ATOM 1243  N N    . GLY A 1 90  ? -8.955  0.570   9.773   1.00 0.00 ? 90  GLY A N    1  
ATOM 1244  C CA   . GLY A 1 90  ? -10.400 0.428   9.684   1.00 0.00 ? 90  GLY A CA   1  
ATOM 1245  C C    . GLY A 1 90  ? -10.982 1.381   8.639   1.00 0.00 ? 90  GLY A C    1  
ATOM 1246  O O    . GLY A 1 90  ? -12.141 1.780   8.735   1.00 0.00 ? 90  GLY A O    1  
ATOM 1247  H H    . GLY A 1 90  ? -8.449  -0.289  9.838   1.00 0.00 ? 90  GLY A H    1  
ATOM 1248  H HA2  . GLY A 1 90  ? -10.652 -0.600  9.425   1.00 0.00 ? 90  GLY A HA2  1  
ATOM 1249  H HA3  . GLY A 1 90  ? -10.848 0.632   10.657  1.00 0.00 ? 90  GLY A HA3  1  
ATOM 1250  N N    . GLU A 1 91  ? -10.150 1.719   7.664   1.00 0.00 ? 91  GLU A N    1  
ATOM 1251  C CA   . GLU A 1 91  ? -10.568 2.618   6.602   1.00 0.00 ? 91  GLU A CA   1  
ATOM 1252  C C    . GLU A 1 91  ? -10.639 1.869   5.269   1.00 0.00 ? 91  GLU A C    1  
ATOM 1253  O O    . GLU A 1 91  ? -9.708  1.151   4.907   1.00 0.00 ? 91  GLU A O    1  
ATOM 1254  C CB   . GLU A 1 91  ? -9.631  3.823   6.503   1.00 0.00 ? 91  GLU A CB   1  
ATOM 1255  C CG   . GLU A 1 91  ? -10.401 5.133   6.681   1.00 0.00 ? 91  GLU A CG   1  
ATOM 1256  C CD   . GLU A 1 91  ? -11.665 5.147   5.818   1.00 0.00 ? 91  GLU A CD   1  
ATOM 1257  O OE1  . GLU A 1 91  ? -11.517 5.375   4.598   1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1258  O OE2  . GLU A 1 91  ? -12.749 4.928   6.398   1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1259  H H    . GLU A 1 91  ? -9.208  1.391   7.594   1.00 0.00 ? 91  GLU A H    1  
ATOM 1260  H HA   . GLU A 1 91  ? -11.562 2.961   6.887   1.00 0.00 ? 91  GLU A HA   1  
ATOM 1261  H HB3  . GLU A 1 91  ? -9.128  3.820   5.535   1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1262  H HG3  . GLU A 1 91  ? -9.762  5.975   6.410   1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1263  N N    . SER A 1 92  ? -11.752 2.061   4.579   1.00 0.00 ? 92  SER A N    1  
ATOM 1264  C CA   . SER A 1 92  ? -11.957 1.411   3.294   1.00 0.00 ? 92  SER A CA   1  
ATOM 1265  C C    . SER A 1 92  ? -11.055 2.048   2.237   1.00 0.00 ? 92  SER A C    1  
ATOM 1266  O O    . SER A 1 92  ? -11.293 3.177   1.812   1.00 0.00 ? 92  SER A O    1  
ATOM 1267  C CB   . SER A 1 92  ? -13.423 1.495   2.863   1.00 0.00 ? 92  SER A CB   1  
ATOM 1268  O OG   . SER A 1 92  ? -14.184 2.345   3.717   1.00 0.00 ? 92  SER A OG   1  
ATOM 1269  H H    . SER A 1 92  ? -12.505 2.644   4.882   1.00 0.00 ? 92  SER A H    1  
ATOM 1270  H HA   . SER A 1 92  ? -11.684 0.368   3.452   1.00 0.00 ? 92  SER A HA   1  
ATOM 1271  H HB3  . SER A 1 92  ? -13.859 0.495   2.865   1.00 0.00 ? 92  SER A HB3  1  
ATOM 1272  H HG   . SER A 1 92  ? -15.117 2.433   3.369   1.00 0.00 ? 92  SER A HG   1  
ATOM 1273  N N    . VAL A 1 93  ? -10.038 1.296   1.840   1.00 0.00 ? 93  VAL A N    1  
ATOM 1274  C CA   . VAL A 1 93  ? -9.099  1.774   0.839   1.00 0.00 ? 93  VAL A CA   1  
ATOM 1275  C C    . VAL A 1 93  ? -9.295  0.982   -0.455  1.00 0.00 ? 93  VAL A C    1  
ATOM 1276  O O    . VAL A 1 93  ? -8.326  0.527   -1.061  1.00 0.00 ? 93  VAL A O    1  
ATOM 1277  C CB   . VAL A 1 93  ? -7.672  1.690   1.381   1.00 0.00 ? 93  VAL A CB   1  
ATOM 1278  C CG1  . VAL A 1 93  ? -7.501  2.577   2.616   1.00 0.00 ? 93  VAL A CG1  1  
ATOM 1279  C CG2  . VAL A 1 93  ? -7.284  0.244   1.688   1.00 0.00 ? 93  VAL A CG2  1  
ATOM 1280  H H    . VAL A 1 93  ? -9.853  0.379   2.191   1.00 0.00 ? 93  VAL A H    1  
ATOM 1281  H HA   . VAL A 1 93  ? -9.328  2.821   0.648   1.00 0.00 ? 93  VAL A HA   1  
ATOM 1282  H HB   . VAL A 1 93  ? -6.998  2.061   0.608   1.00 0.00 ? 93  VAL A HB   1  
ATOM 1283  H HG11 . VAL A 1 93  ? -6.942  2.035   3.379   1.00 0.00 ? 93  VAL A HG11 1  
ATOM 1284  H HG12 . VAL A 1 93  ? -6.958  3.482   2.342   1.00 0.00 ? 93  VAL A HG12 1  
ATOM 1285  H HG13 . VAL A 1 93  ? -8.481  2.846   3.008   1.00 0.00 ? 93  VAL A HG13 1  
ATOM 1286  H HG21 . VAL A 1 93  ? -7.069  0.141   2.751   1.00 0.00 ? 93  VAL A HG21 1  
ATOM 1287  H HG22 . VAL A 1 93  ? -8.107  -0.419  1.418   1.00 0.00 ? 93  VAL A HG22 1  
ATOM 1288  H HG23 . VAL A 1 93  ? -6.397  -0.027  1.111   1.00 0.00 ? 93  VAL A HG23 1  
ATOM 1289  N N    . ILE A 1 94  ? -10.554 0.841   -0.841  1.00 0.00 ? 94  ILE A N    1  
ATOM 1290  C CA   . ILE A 1 94  ? -10.889 0.112   -2.052  1.00 0.00 ? 94  ILE A CA   1  
ATOM 1291  C C    . ILE A 1 94  ? -10.610 0.998   -3.269  1.00 0.00 ? 94  ILE A C    1  
ATOM 1292  O O    . ILE A 1 94  ? -9.867  0.607   -4.168  1.00 0.00 ? 94  ILE A O    1  
ATOM 1293  C CB   . ILE A 1 94  ? -12.327 -0.406  -1.986  1.00 0.00 ? 94  ILE A CB   1  
ATOM 1294  C CG1  . ILE A 1 94  ? -12.488 -1.437  -0.868  1.00 0.00 ? 94  ILE A CG1  1  
ATOM 1295  C CG2  . ILE A 1 94  ? -12.774 -0.956  -3.342  1.00 0.00 ? 94  ILE A CG2  1  
ATOM 1296  C CD1  . ILE A 1 94  ? -11.724 -2.723  -1.193  1.00 0.00 ? 94  ILE A CD1  1  
ATOM 1297  H H    . ILE A 1 94  ? -11.337 1.213   -0.343  1.00 0.00 ? 94  ILE A H    1  
ATOM 1298  H HA   . ILE A 1 94  ? -10.235 -0.758  -2.102  1.00 0.00 ? 94  ILE A HA   1  
ATOM 1299  H HB   . ILE A 1 94  ? -12.982 0.433   -1.748  1.00 0.00 ? 94  ILE A HB   1  
ATOM 1300  H HG13 . ILE A 1 94  ? -13.543 -1.664  -0.725  1.00 0.00 ? 94  ILE A HG13 1  
ATOM 1301  H HG21 . ILE A 1 94  ? -13.512 -0.286  -3.781  1.00 0.00 ? 94  ILE A HG21 1  
ATOM 1302  H HG22 . ILE A 1 94  ? -11.913 -1.034  -4.005  1.00 0.00 ? 94  ILE A HG22 1  
ATOM 1303  H HG23 . ILE A 1 94  ? -13.217 -1.945  -3.205  1.00 0.00 ? 94  ILE A HG23 1  
ATOM 1304  H HD11 . ILE A 1 94  ? -12.424 -3.554  -1.257  1.00 0.00 ? 94  ILE A HD11 1  
ATOM 1305  H HD12 . ILE A 1 94  ? -11.207 -2.606  -2.145  1.00 0.00 ? 94  ILE A HD12 1  
ATOM 1306  H HD13 . ILE A 1 94  ? -10.996 -2.922  -0.406  1.00 0.00 ? 94  ILE A HD13 1  
ATOM 1307  N N    . GLY A 1 95  ? -11.221 2.173   -3.257  1.00 0.00 ? 95  GLY A N    1  
ATOM 1308  C CA   . GLY A 1 95  ? -11.046 3.117   -4.348  1.00 0.00 ? 95  GLY A CA   1  
ATOM 1309  C C    . GLY A 1 95  ? -9.938  4.123   -4.032  1.00 0.00 ? 95  GLY A C    1  
ATOM 1310  O O    . GLY A 1 95  ? -9.746  5.091   -4.766  1.00 0.00 ? 95  GLY A O    1  
ATOM 1311  H H    . GLY A 1 95  ? -11.823 2.483   -2.522  1.00 0.00 ? 95  GLY A H    1  
ATOM 1312  H HA2  . GLY A 1 95  ? -10.803 2.579   -5.264  1.00 0.00 ? 95  GLY A HA2  1  
ATOM 1313  H HA3  . GLY A 1 95  ? -11.982 3.647   -4.528  1.00 0.00 ? 95  GLY A HA3  1  
ATOM 1314  N N    . LYS A 1 96  ? -9.239  3.859   -2.938  1.00 0.00 ? 96  LYS A N    1  
ATOM 1315  C CA   . LYS A 1 96  ? -8.154  4.729   -2.515  1.00 0.00 ? 96  LYS A CA   1  
ATOM 1316  C C    . LYS A 1 96  ? -6.874  4.338   -3.255  1.00 0.00 ? 96  LYS A C    1  
ATOM 1317  O O    . LYS A 1 96  ? -6.733  3.200   -3.700  1.00 0.00 ? 96  LYS A O    1  
ATOM 1318  C CB   . LYS A 1 96  ? -8.014  4.709   -0.991  1.00 0.00 ? 96  LYS A CB   1  
ATOM 1319  C CG   . LYS A 1 96  ? -9.193  5.423   -0.324  1.00 0.00 ? 96  LYS A CG   1  
ATOM 1320  C CD   . LYS A 1 96  ? -8.977  5.541   1.187   1.00 0.00 ? 96  LYS A CD   1  
ATOM 1321  C CE   . LYS A 1 96  ? -9.853  6.646   1.780   1.00 0.00 ? 96  LYS A CE   1  
ATOM 1322  N NZ   . LYS A 1 96  ? -9.362  7.978   1.362   1.00 0.00 ? 96  LYS A NZ   1  
ATOM 1323  H H    . LYS A 1 96  ? -9.402  3.069   -2.347  1.00 0.00 ? 96  LYS A H    1  
ATOM 1324  H HA   . LYS A 1 96  ? -8.421  5.746   -2.801  1.00 0.00 ? 96  LYS A HA   1  
ATOM 1325  H HB3  . LYS A 1 96  ? -7.082  5.193   -0.702  1.00 0.00 ? 96  LYS A HB3  1  
ATOM 1326  H HG3  . LYS A 1 96  ? -10.114 4.874   -0.521  1.00 0.00 ? 96  LYS A HG3  1  
ATOM 1327  H HD3  . LYS A 1 96  ? -7.929  5.754   1.392   1.00 0.00 ? 96  LYS A HD3  1  
ATOM 1328  H HE3  . LYS A 1 96  ? -9.850  6.575   2.868   1.00 0.00 ? 96  LYS A HE3  1  
ATOM 1329  H HZ1  . LYS A 1 96  ? -10.042 8.412   0.770   1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 1330  H HZ2  . LYS A 1 96  ? -9.212  8.547   2.170   1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 1331  H HZ3  . LYS A 1 96  ? -8.502  7.874   0.862   1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 1332  N N    . THR A 1 97  ? -5.971  5.303   -3.364  1.00 0.00 ? 97  THR A N    1  
ATOM 1333  C CA   . THR A 1 97  ? -4.708  5.073   -4.041  1.00 0.00 ? 97  THR A CA   1  
ATOM 1334  C C    . THR A 1 97  ? -3.596  4.811   -3.024  1.00 0.00 ? 97  THR A C    1  
ATOM 1335  O O    . THR A 1 97  ? -3.708  5.203   -1.863  1.00 0.00 ? 97  THR A O    1  
ATOM 1336  C CB   . THR A 1 97  ? -4.431  6.275   -4.947  1.00 0.00 ? 97  THR A CB   1  
ATOM 1337  O OG1  . THR A 1 97  ? -3.311  5.870   -5.729  1.00 0.00 ? 97  THR A OG1  1  
ATOM 1338  C CG2  . THR A 1 97  ? -3.923  7.490   -4.169  1.00 0.00 ? 97  THR A CG2  1  
ATOM 1339  H H    . THR A 1 97  ? -6.094  6.226   -2.998  1.00 0.00 ? 97  THR A H    1  
ATOM 1340  H HA   . THR A 1 97  ? -4.802  4.173   -4.650  1.00 0.00 ? 97  THR A HA   1  
ATOM 1341  H HB   . THR A 1 97  ? -5.313  6.530   -5.535  1.00 0.00 ? 97  THR A HB   1  
ATOM 1342  H HG1  . THR A 1 97  ? -2.517  5.724   -5.139  1.00 0.00 ? 97  THR A HG1  1  
ATOM 1343  H HG21 . THR A 1 97  ? -4.670  8.282   -4.203  1.00 0.00 ? 97  THR A HG21 1  
ATOM 1344  H HG22 . THR A 1 97  ? -3.741  7.207   -3.131  1.00 0.00 ? 97  THR A HG22 1  
ATOM 1345  H HG23 . THR A 1 97  ? -2.995  7.846   -4.617  1.00 0.00 ? 97  THR A HG23 1  
ATOM 1346  N N    . TYR A 1 98  ? -2.549  4.151   -3.495  1.00 0.00 ? 98  TYR A N    1  
ATOM 1347  C CA   . TYR A 1 98  ? -1.417  3.832   -2.640  1.00 0.00 ? 98  TYR A CA   1  
ATOM 1348  C C    . TYR A 1 98  ? -0.906  5.080   -1.920  1.00 0.00 ? 98  TYR A C    1  
ATOM 1349  O O    . TYR A 1 98  ? -0.376  4.991   -0.813  1.00 0.00 ? 98  TYR A O    1  
ATOM 1350  C CB   . TYR A 1 98  ? -0.321  3.309   -3.570  1.00 0.00 ? 98  TYR A CB   1  
ATOM 1351  C CG   . TYR A 1 98  ? 1.040   3.137   -2.892  1.00 0.00 ? 98  TYR A CG   1  
ATOM 1352  C CD1  . TYR A 1 98  ? 1.255   2.075   -2.039  1.00 0.00 ? 98  TYR A CD1  1  
ATOM 1353  C CD2  . TYR A 1 98  ? 2.051   4.045   -3.132  1.00 0.00 ? 98  TYR A CD2  1  
ATOM 1354  C CE1  . TYR A 1 98  ? 2.536   1.911   -1.400  1.00 0.00 ? 98  TYR A CE1  1  
ATOM 1355  C CE2  . TYR A 1 98  ? 3.331   3.882   -2.494  1.00 0.00 ? 98  TYR A CE2  1  
ATOM 1356  C CZ   . TYR A 1 98  ? 3.510   2.824   -1.659  1.00 0.00 ? 98  TYR A CZ   1  
ATOM 1357  O OH   . TYR A 1 98  ? 4.720   2.670   -1.056  1.00 0.00 ? 98  TYR A OH   1  
ATOM 1358  H H    . TYR A 1 98  ? -2.466  3.836   -4.442  1.00 0.00 ? 98  TYR A H    1  
ATOM 1359  H HA   . TYR A 1 98  ? -1.750  3.105   -1.900  1.00 0.00 ? 98  TYR A HA   1  
ATOM 1360  H HB3  . TYR A 1 98  ? -0.213  3.996   -4.409  1.00 0.00 ? 98  TYR A HB3  1  
ATOM 1361  H HD1  . TYR A 1 98  ? 0.456   1.357   -1.848  1.00 0.00 ? 98  TYR A HD1  1  
ATOM 1362  H HD2  . TYR A 1 98  ? 1.880   4.885   -3.807  1.00 0.00 ? 98  TYR A HD2  1  
ATOM 1363  H HE1  . TYR A 1 98  ? 2.720   1.077   -0.724  1.00 0.00 ? 98  TYR A HE1  1  
ATOM 1364  H HE2  . TYR A 1 98  ? 4.139   4.591   -2.676  1.00 0.00 ? 98  TYR A HE2  1  
ATOM 1365  H HH   . TYR A 1 98  ? 5.423   3.163   -1.570  1.00 0.00 ? 98  TYR A HH   1  
ATOM 1366  N N    . SER A 1 99  ? -1.084  6.218   -2.576  1.00 0.00 ? 99  SER A N    1  
ATOM 1367  C CA   . SER A 1 99  ? -0.647  7.484   -2.012  1.00 0.00 ? 99  SER A CA   1  
ATOM 1368  C C    . SER A 1 99  ? -1.573  7.892   -0.864  1.00 0.00 ? 99  SER A C    1  
ATOM 1369  O O    . SER A 1 99  ? -1.231  8.765   -0.067  1.00 0.00 ? 99  SER A O    1  
ATOM 1370  C CB   . SER A 1 99  ? -0.610  8.580   -3.079  1.00 0.00 ? 99  SER A CB   1  
ATOM 1371  O OG   . SER A 1 99  ? 0.260   9.648   -2.716  1.00 0.00 ? 99  SER A OG   1  
ATOM 1372  H H    . SER A 1 99  ? -1.516  6.283   -3.475  1.00 0.00 ? 99  SER A H    1  
ATOM 1373  H HA   . SER A 1 99  ? 0.363   7.303   -1.643  1.00 0.00 ? 99  SER A HA   1  
ATOM 1374  H HB3  . SER A 1 99  ? -1.616  8.969   -3.235  1.00 0.00 ? 99  SER A HB3  1  
ATOM 1375  H HG   . SER A 1 99  ? 1.212   9.375   -2.849  1.00 0.00 ? 99  SER A HG   1  
ATOM 1376  N N    . GLN A 1 100 ? -2.725  7.241   -0.815  1.00 0.00 ? 100 GLN A N    1  
ATOM 1377  C CA   . GLN A 1 100 ? -3.702  7.526   0.222   1.00 0.00 ? 100 GLN A CA   1  
ATOM 1378  C C    . GLN A 1 100 ? -3.442  6.651   1.451   1.00 0.00 ? 100 GLN A C    1  
ATOM 1379  O O    . GLN A 1 100 ? -3.197  7.164   2.542   1.00 0.00 ? 100 GLN A O    1  
ATOM 1380  C CB   . GLN A 1 100 ? -5.128  7.330   -0.299  1.00 0.00 ? 100 GLN A CB   1  
ATOM 1381  C CG   . GLN A 1 100 ? -5.505  8.432   -1.291  1.00 0.00 ? 100 GLN A CG   1  
ATOM 1382  C CD   . GLN A 1 100 ? -6.948  8.895   -1.073  1.00 0.00 ? 100 GLN A CD   1  
ATOM 1383  O OE1  . GLN A 1 100 ? -7.382  9.151   0.039   1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1384  N NE2  . GLN A 1 100 ? -7.661  8.989   -2.190  1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1385  H H    . GLN A 1 100 ? -2.995  6.533   -1.467  1.00 0.00 ? 100 GLN A H    1  
ATOM 1386  H HA   . GLN A 1 100 ? -3.557  8.575   0.477   1.00 0.00 ? 100 GLN A HA   1  
ATOM 1387  H HB3  . GLN A 1 100 ? -5.827  7.332   0.537   1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1388  H HG3  . GLN A 1 100 ? -5.388  8.065   -2.310  1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1389  H HE21 . GLN A 1 100 ? -7.242  8.763   -3.071  1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1390  H HE22 . GLN A 1 100 ? -8.615  9.284   -2.151  1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1391  N N    . VAL A 1 101 ? -3.504  5.346   1.232   1.00 0.00 ? 101 VAL A N    1  
ATOM 1392  C CA   . VAL A 1 101 ? -3.279  4.394   2.307   1.00 0.00 ? 101 VAL A CA   1  
ATOM 1393  C C    . VAL A 1 101 ? -1.968  4.738   3.019   1.00 0.00 ? 101 VAL A C    1  
ATOM 1394  O O    . VAL A 1 101 ? -1.831  4.508   4.219   1.00 0.00 ? 101 VAL A O    1  
ATOM 1395  C CB   . VAL A 1 101 ? -3.306  2.968   1.759   1.00 0.00 ? 101 VAL A CB   1  
ATOM 1396  C CG1  . VAL A 1 101 ? -4.707  2.593   1.272   1.00 0.00 ? 101 VAL A CG1  1  
ATOM 1397  C CG2  . VAL A 1 101 ? -2.273  2.789   0.643   1.00 0.00 ? 101 VAL A CG2  1  
ATOM 1398  H H    . VAL A 1 101 ? -3.705  4.937   0.342   1.00 0.00 ? 101 VAL A H    1  
ATOM 1399  H HA   . VAL A 1 101 ? -4.100  4.500   3.016   1.00 0.00 ? 101 VAL A HA   1  
ATOM 1400  H HB   . VAL A 1 101 ? -3.042  2.290   2.571   1.00 0.00 ? 101 VAL A HB   1  
ATOM 1401  H HG11 . VAL A 1 101 ? -5.195  1.964   2.017   1.00 0.00 ? 101 VAL A HG11 1  
ATOM 1402  H HG12 . VAL A 1 101 ? -5.295  3.500   1.123   1.00 0.00 ? 101 VAL A HG12 1  
ATOM 1403  H HG13 . VAL A 1 101 ? -4.632  2.050   0.330   1.00 0.00 ? 101 VAL A HG13 1  
ATOM 1404  H HG21 . VAL A 1 101 ? -2.782  2.537   -0.286  1.00 0.00 ? 101 VAL A HG21 1  
ATOM 1405  H HG22 . VAL A 1 101 ? -1.715  3.716   0.514   1.00 0.00 ? 101 VAL A HG22 1  
ATOM 1406  H HG23 . VAL A 1 101 ? -1.586  1.987   0.910   1.00 0.00 ? 101 VAL A HG23 1  
ATOM 1407  N N    . ILE A 1 102 ? -1.037  5.280   2.246   1.00 0.00 ? 102 ILE A N    1  
ATOM 1408  C CA   . ILE A 1 102 ? 0.257   5.656   2.787   1.00 0.00 ? 102 ILE A CA   1  
ATOM 1409  C C    . ILE A 1 102 ? 0.057   6.636   3.946   1.00 0.00 ? 102 ILE A C    1  
ATOM 1410  O O    . ILE A 1 102 ? 0.545   6.404   5.050   1.00 0.00 ? 102 ILE A O    1  
ATOM 1411  C CB   . ILE A 1 102 ? 1.165   6.193   1.679   1.00 0.00 ? 102 ILE A CB   1  
ATOM 1412  C CG1  . ILE A 1 102 ? 1.759   5.048   0.856   1.00 0.00 ? 102 ILE A CG1  1  
ATOM 1413  C CG2  . ILE A 1 102 ? 2.249   7.109   2.253   1.00 0.00 ? 102 ILE A CG2  1  
ATOM 1414  C CD1  . ILE A 1 102 ? 2.986   4.452   1.550   1.00 0.00 ? 102 ILE A CD1  1  
ATOM 1415  H H    . ILE A 1 102 ? -1.158  5.462   1.271   1.00 0.00 ? 102 ILE A H    1  
ATOM 1416  H HA   . ILE A 1 102 ? 0.723   4.751   3.176   1.00 0.00 ? 102 ILE A HA   1  
ATOM 1417  H HB   . ILE A 1 102 ? 0.559   6.796   1.002   1.00 0.00 ? 102 ILE A HB   1  
ATOM 1418  H HG13 . ILE A 1 102 ? 2.039   5.413   -0.133  1.00 0.00 ? 102 ILE A HG13 1  
ATOM 1419  H HG21 . ILE A 1 102 ? 3.084   7.164   1.556   1.00 0.00 ? 102 ILE A HG21 1  
ATOM 1420  H HG22 . ILE A 1 102 ? 1.837   8.107   2.405   1.00 0.00 ? 102 ILE A HG22 1  
ATOM 1421  H HG23 . ILE A 1 102 ? 2.595   6.710   3.206   1.00 0.00 ? 102 ILE A HG23 1  
ATOM 1422  H HD11 . ILE A 1 102 ? 2.866   3.372   1.636   1.00 0.00 ? 102 ILE A HD11 1  
ATOM 1423  H HD12 . ILE A 1 102 ? 3.878   4.674   0.964   1.00 0.00 ? 102 ILE A HD12 1  
ATOM 1424  H HD13 . ILE A 1 102 ? 3.087   4.887   2.544   1.00 0.00 ? 102 ILE A HD13 1  
ATOM 1425  N N    . ALA A 1 103 ? -0.663  7.710   3.653   1.00 0.00 ? 103 ALA A N    1  
ATOM 1426  C CA   . ALA A 1 103 ? -0.934  8.724   4.656   1.00 0.00 ? 103 ALA A CA   1  
ATOM 1427  C C    . ALA A 1 103 ? -1.575  8.067   5.880   1.00 0.00 ? 103 ALA A C    1  
ATOM 1428  O O    . ALA A 1 103 ? -1.273  8.434   7.015   1.00 0.00 ? 103 ALA A O    1  
ATOM 1429  C CB   . ALA A 1 103 ? -1.818  9.817   4.051   1.00 0.00 ? 103 ALA A CB   1  
ATOM 1430  H H    . ALA A 1 103 ? -1.056  7.890   2.750   1.00 0.00 ? 103 ALA A H    1  
ATOM 1431  H HA   . ALA A 1 103 ? 0.020   9.166   4.948   1.00 0.00 ? 103 ALA A HA   1  
ATOM 1432  H HB1  . ALA A 1 103 ? -1.877  9.680   2.972   1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1433  H HB2  . ALA A 1 103 ? -2.819  9.754   4.479   1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1434  H HB3  . ALA A 1 103 ? -1.389  10.795  4.272   1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1435  N N    . LEU A 1 104 ? -2.447  7.108   5.609   1.00 0.00 ? 104 LEU A N    1  
ATOM 1436  C CA   . LEU A 1 104 ? -3.134  6.396   6.673   1.00 0.00 ? 104 LEU A CA   1  
ATOM 1437  C C    . LEU A 1 104 ? -2.100  5.712   7.572   1.00 0.00 ? 104 LEU A C    1  
ATOM 1438  O O    . LEU A 1 104 ? -2.208  5.761   8.795   1.00 0.00 ? 104 LEU A O    1  
ATOM 1439  C CB   . LEU A 1 104 ? -4.175  5.438   6.093   1.00 0.00 ? 104 LEU A CB   1  
ATOM 1440  C CG   . LEU A 1 104 ? -5.380  6.090   5.414   1.00 0.00 ? 104 LEU A CG   1  
ATOM 1441  C CD1  . LEU A 1 104 ? -6.416  5.040   5.009   1.00 0.00 ? 104 LEU A CD1  1  
ATOM 1442  C CD2  . LEU A 1 104 ? -5.987  7.181   6.299   1.00 0.00 ? 104 LEU A CD2  1  
ATOM 1443  H H    . LEU A 1 104 ? -2.687  6.817   4.682   1.00 0.00 ? 104 LEU A H    1  
ATOM 1444  H HA   . LEU A 1 104 ? -3.671  7.137   7.267   1.00 0.00 ? 104 LEU A HA   1  
ATOM 1445  H HB3  . LEU A 1 104 ? -4.539  4.799   6.898   1.00 0.00 ? 104 LEU A HB3  1  
ATOM 1446  H HG   . LEU A 1 104 ? -5.037  6.572   4.498   1.00 0.00 ? 104 LEU A HG   1  
ATOM 1447  H HD11 . LEU A 1 104 ? -7.315  5.537   4.643   1.00 0.00 ? 104 LEU A HD11 1  
ATOM 1448  H HD12 . LEU A 1 104 ? -6.005  4.408   4.221   1.00 0.00 ? 104 LEU A HD12 1  
ATOM 1449  H HD13 . LEU A 1 104 ? -6.667  4.425   5.873   1.00 0.00 ? 104 LEU A HD13 1  
ATOM 1450  H HD21 . LEU A 1 104 ? -5.735  6.984   7.341   1.00 0.00 ? 104 LEU A HD21 1  
ATOM 1451  H HD22 . LEU A 1 104 ? -5.586  8.151   6.006   1.00 0.00 ? 104 LEU A HD22 1  
ATOM 1452  H HD23 . LEU A 1 104 ? -7.070  7.185   6.181   1.00 0.00 ? 104 LEU A HD23 1  
ATOM 1453  N N    . ILE A 1 105 ? -1.123  5.089   6.928   1.00 0.00 ? 105 ILE A N    1  
ATOM 1454  C CA   . ILE A 1 105 ? -0.072  4.395   7.652   1.00 0.00 ? 105 ILE A CA   1  
ATOM 1455  C C    . ILE A 1 105 ? 0.772   5.416   8.417   1.00 0.00 ? 105 ILE A C    1  
ATOM 1456  O O    . ILE A 1 105 ? 1.297   5.115   9.488   1.00 0.00 ? 105 ILE A O    1  
ATOM 1457  C CB   . ILE A 1 105 ? 0.741   3.514   6.702   1.00 0.00 ? 105 ILE A CB   1  
ATOM 1458  C CG1  . ILE A 1 105 ? -0.120  2.388   6.126   1.00 0.00 ? 105 ILE A CG1  1  
ATOM 1459  C CG2  . ILE A 1 105 ? 1.997   2.979   7.390   1.00 0.00 ? 105 ILE A CG2  1  
ATOM 1460  C CD1  . ILE A 1 105 ? 0.179   2.172   4.642   1.00 0.00 ? 105 ILE A CD1  1  
ATOM 1461  H H    . ILE A 1 105 ? -1.044  5.055   5.930   1.00 0.00 ? 105 ILE A H    1  
ATOM 1462  H HA   . ILE A 1 105 ? -0.554  3.736   8.372   1.00 0.00 ? 105 ILE A HA   1  
ATOM 1463  H HB   . ILE A 1 105 ? 1.070   4.128   5.864   1.00 0.00 ? 105 ILE A HB   1  
ATOM 1464  H HG13 . ILE A 1 105 ? -1.175  2.629   6.258   1.00 0.00 ? 105 ILE A HG13 1  
ATOM 1465  H HG21 . ILE A 1 105 ? 2.281   2.027   6.943   1.00 0.00 ? 105 ILE A HG21 1  
ATOM 1466  H HG22 . ILE A 1 105 ? 2.812   3.695   7.268   1.00 0.00 ? 105 ILE A HG22 1  
ATOM 1467  H HG23 . ILE A 1 105 ? 1.797   2.836   8.452   1.00 0.00 ? 105 ILE A HG23 1  
ATOM 1468  H HD11 . ILE A 1 105 ? 0.650   3.065   4.232   1.00 0.00 ? 105 ILE A HD11 1  
ATOM 1469  H HD12 . ILE A 1 105 ? 0.851   1.321   4.527   1.00 0.00 ? 105 ILE A HD12 1  
ATOM 1470  H HD13 . ILE A 1 105 ? -0.752  1.973   4.109   1.00 0.00 ? 105 ILE A HD13 1  
ATOM 1471  N N    . GLN A 1 106 ? 0.877   6.604   7.839   1.00 0.00 ? 106 GLN A N    1  
ATOM 1472  C CA   . GLN A 1 106 ? 1.648   7.670   8.455   1.00 0.00 ? 106 GLN A CA   1  
ATOM 1473  C C    . GLN A 1 106 ? 0.818   8.375   9.530   1.00 0.00 ? 106 GLN A C    1  
ATOM 1474  O O    . GLN A 1 106 ? 1.369   8.975   10.450  1.00 0.00 ? 106 GLN A O    1  
ATOM 1475  C CB   . GLN A 1 106 ? 2.141   8.667   7.402   1.00 0.00 ? 106 GLN A CB   1  
ATOM 1476  C CG   . GLN A 1 106 ? 3.098   7.994   6.415   1.00 0.00 ? 106 GLN A CG   1  
ATOM 1477  C CD   . GLN A 1 106 ? 4.283   8.906   6.094   1.00 0.00 ? 106 GLN A CD   1  
ATOM 1478  O OE1  . GLN A 1 106 ? 4.468   9.959   6.682   1.00 0.00 ? 106 GLN A OE1  1  
ATOM 1479  N NE2  . GLN A 1 106 ? 5.073   8.444   5.128   1.00 0.00 ? 106 GLN A NE2  1  
ATOM 1480  H H    . GLN A 1 106 ? 0.447   6.841   6.968   1.00 0.00 ? 106 GLN A H    1  
ATOM 1481  H HA   . GLN A 1 106 ? 2.507   7.180   8.912   1.00 0.00 ? 106 GLN A HA   1  
ATOM 1482  H HB3  . GLN A 1 106 ? 2.646   9.500   7.894   1.00 0.00 ? 106 GLN A HB3  1  
ATOM 1483  H HG3  . GLN A 1 106 ? 2.564   7.747   5.498   1.00 0.00 ? 106 GLN A HG3  1  
ATOM 1484  H HE21 . GLN A 1 106 ? 4.865   7.572   4.685   1.00 0.00 ? 106 GLN A HE21 1  
ATOM 1485  H HE22 . GLN A 1 106 ? 5.876   8.970   4.846   1.00 0.00 ? 106 GLN A HE22 1  
ATOM 1486  N N    . ASN A 1 107 ? -0.495  8.277   9.377   1.00 0.00 ? 107 ASN A N    1  
ATOM 1487  C CA   . ASN A 1 107 ? -1.406  8.896   10.323  1.00 0.00 ? 107 ASN A CA   1  
ATOM 1488  C C    . ASN A 1 107 ? -1.881  7.847   11.330  1.00 0.00 ? 107 ASN A C    1  
ATOM 1489  O O    . ASN A 1 107 ? -2.903  8.031   11.989  1.00 0.00 ? 107 ASN A O    1  
ATOM 1490  C CB   . ASN A 1 107 ? -2.638  9.460   9.613   1.00 0.00 ? 107 ASN A CB   1  
ATOM 1491  C CG   . ASN A 1 107 ? -2.368  10.871  9.085   1.00 0.00 ? 107 ASN A CG   1  
ATOM 1492  O OD1  . ASN A 1 107 ? -2.171  11.814  9.833   1.00 0.00 ? 107 ASN A OD1  1  
ATOM 1493  N ND2  . ASN A 1 107 ? -2.371  10.961  7.758   1.00 0.00 ? 107 ASN A ND2  1  
ATOM 1494  H H    . ASN A 1 107 ? -0.935  7.786   8.625   1.00 0.00 ? 107 ASN A H    1  
ATOM 1495  H HA   . ASN A 1 107 ? -0.832  9.695   10.793  1.00 0.00 ? 107 ASN A HA   1  
ATOM 1496  H HB3  . ASN A 1 107 ? -3.482  9.482   10.303  1.00 0.00 ? 107 ASN A HB3  1  
ATOM 1497  H HD21 . ASN A 1 107 ? -2.540  10.148  7.201   1.00 0.00 ? 107 ASN A HD21 1  
ATOM 1498  H HD22 . ASN A 1 107 ? -2.204  11.843  7.317   1.00 0.00 ? 107 ASN A HD22 1  
ATOM 1499  N N    . SER A 1 108 ? -1.115  6.768   11.417  1.00 0.00 ? 108 SER A N    1  
ATOM 1500  C CA   . SER A 1 108 ? -1.445  5.688   12.332  1.00 0.00 ? 108 SER A CA   1  
ATOM 1501  C C    . SER A 1 108 ? -1.396  6.194   13.776  1.00 0.00 ? 108 SER A C    1  
ATOM 1502  O O    . SER A 1 108 ? -1.866  5.518   14.691  1.00 0.00 ? 108 SER A O    1  
ATOM 1503  C CB   . SER A 1 108 ? -0.494  4.503   12.152  1.00 0.00 ? 108 SER A CB   1  
ATOM 1504  O OG   . SER A 1 108 ? 0.470   4.428   13.199  1.00 0.00 ? 108 SER A OG   1  
ATOM 1505  H H    . SER A 1 108 ? -0.285  6.626   10.877  1.00 0.00 ? 108 SER A H    1  
ATOM 1506  H HA   . SER A 1 108 ? -2.457  5.385   12.068  1.00 0.00 ? 108 SER A HA   1  
ATOM 1507  H HB3  . SER A 1 108 ? 0.018   4.593   11.193  1.00 0.00 ? 108 SER A HB3  1  
ATOM 1508  H HG   . SER A 1 108 ? 0.024   4.173   14.056  1.00 0.00 ? 108 SER A HG   1  
ATOM 1509  N N    . ASP A 1 109 ? -0.821  7.377   13.936  1.00 0.00 ? 109 ASP A N    1  
ATOM 1510  C CA   . ASP A 1 109 ? -0.705  7.980   15.253  1.00 0.00 ? 109 ASP A CA   1  
ATOM 1511  C C    . ASP A 1 109 ? 0.138   7.073   16.151  1.00 0.00 ? 109 ASP A C    1  
ATOM 1512  O O    . ASP A 1 109 ? 1.366   7.145   16.135  1.00 0.00 ? 109 ASP A O    1  
ATOM 1513  C CB   . ASP A 1 109 ? -2.078  8.148   15.906  1.00 0.00 ? 109 ASP A CB   1  
ATOM 1514  C CG   . ASP A 1 109 ? -2.050  8.426   17.410  1.00 0.00 ? 109 ASP A CG   1  
ATOM 1515  O OD1  . ASP A 1 109 ? -1.173  9.216   17.824  1.00 0.00 ? 109 ASP A OD1  1  
ATOM 1516  O OD2  . ASP A 1 109 ? -2.904  7.844   18.112  1.00 0.00 ? 109 ASP A OD2  1  
ATOM 1517  H H    . ASP A 1 109 ? -0.441  7.920   13.188  1.00 0.00 ? 109 ASP A H    1  
ATOM 1518  H HA   . ASP A 1 109 ? -0.238  8.950   15.084  1.00 0.00 ? 109 ASP A HA   1  
ATOM 1519  H HB3  . ASP A 1 109 ? -2.660  7.243   15.731  1.00 0.00 ? 109 ASP A HB3  1  
ATOM 1520  N N    . THR A 1 110 ? -0.554  6.241   16.914  1.00 0.00 ? 110 THR A N    1  
ATOM 1521  C CA   . THR A 1 110 ? 0.115   5.320   17.818  1.00 0.00 ? 110 THR A CA   1  
ATOM 1522  C C    . THR A 1 110 ? 0.342   3.971   17.134  1.00 0.00 ? 110 THR A C    1  
ATOM 1523  O O    . THR A 1 110 ? 1.481   3.553   16.938  1.00 0.00 ? 110 THR A O    1  
ATOM 1524  C CB   . THR A 1 110 ? -0.720  5.221   19.096  1.00 0.00 ? 110 THR A CB   1  
ATOM 1525  O OG1  . THR A 1 110 ? -0.548  6.490   19.723  1.00 0.00 ? 110 THR A OG1  1  
ATOM 1526  C CG2  . THR A 1 110 ? -0.136  4.227   20.102  1.00 0.00 ? 110 THR A CG2  1  
ATOM 1527  H H    . THR A 1 110 ? -1.552  6.189   16.923  1.00 0.00 ? 110 THR A H    1  
ATOM 1528  H HA   . THR A 1 110 ? 1.099   5.726   18.057  1.00 0.00 ? 110 THR A HA   1  
ATOM 1529  H HB   . THR A 1 110 ? -1.757  4.977   18.866  1.00 0.00 ? 110 THR A HB   1  
ATOM 1530  H HG1  . THR A 1 110 ? -0.985  7.204   19.175  1.00 0.00 ? 110 THR A HG1  1  
ATOM 1531  H HG21 . THR A 1 110 ? -0.304  4.592   21.115  1.00 0.00 ? 110 THR A HG21 1  
ATOM 1532  H HG22 . THR A 1 110 ? -0.621  3.259   19.980  1.00 0.00 ? 110 THR A HG22 1  
ATOM 1533  H HG23 . THR A 1 110 ? 0.935   4.121   19.928  1.00 0.00 ? 110 THR A HG23 1  
ATOM 1534  N N    . THR A 1 111 ? -0.764  3.325   16.789  1.00 0.00 ? 111 THR A N    1  
ATOM 1535  C CA   . THR A 1 111 ? -0.701  2.032   16.131  1.00 0.00 ? 111 THR A CA   1  
ATOM 1536  C C    . THR A 1 111 ? -1.123  2.158   14.666  1.00 0.00 ? 111 THR A C    1  
ATOM 1537  O O    . THR A 1 111 ? -1.624  3.200   14.248  1.00 0.00 ? 111 THR A O    1  
ATOM 1538  C CB   . THR A 1 111 ? -1.562  1.052   16.930  1.00 0.00 ? 111 THR A CB   1  
ATOM 1539  O OG1  . THR A 1 111 ? -2.552  1.877   17.537  1.00 0.00 ? 111 THR A OG1  1  
ATOM 1540  C CG2  . THR A 1 111 ? -0.809  0.441   18.114  1.00 0.00 ? 111 THR A CG2  1  
ATOM 1541  H H    . THR A 1 111 ? -1.687  3.672   16.951  1.00 0.00 ? 111 THR A H    1  
ATOM 1542  H HA   . THR A 1 111 ? 0.336   1.694   16.137  1.00 0.00 ? 111 THR A HA   1  
ATOM 1543  H HB   . THR A 1 111 ? -1.969  0.275   16.283  1.00 0.00 ? 111 THR A HB   1  
ATOM 1544  H HG1  . THR A 1 111 ? -3.466  1.564   17.274  1.00 0.00 ? 111 THR A HG1  1  
ATOM 1545  H HG21 . THR A 1 111 ? -0.534  -0.587  17.879  1.00 0.00 ? 111 THR A HG21 1  
ATOM 1546  H HG22 . THR A 1 111 ? 0.093   1.023   18.310  1.00 0.00 ? 111 THR A HG22 1  
ATOM 1547  H HG23 . THR A 1 111 ? -1.449  0.454   18.996  1.00 0.00 ? 111 THR A HG23 1  
ATOM 1548  N N    . LEU A 1 112 ? -0.903  1.081   13.926  1.00 0.00 ? 112 LEU A N    1  
ATOM 1549  C CA   . LEU A 1 112 ? -1.256  1.057   12.517  1.00 0.00 ? 112 LEU A CA   1  
ATOM 1550  C C    . LEU A 1 112 ? -1.930  -0.276  12.185  1.00 0.00 ? 112 LEU A C    1  
ATOM 1551  O O    . LEU A 1 112 ? -1.274  -1.317  12.156  1.00 0.00 ? 112 LEU A O    1  
ATOM 1552  C CB   . LEU A 1 112 ? -0.029  1.357   11.653  1.00 0.00 ? 112 LEU A CB   1  
ATOM 1553  C CG   . LEU A 1 112 ? -0.282  1.479   10.147  1.00 0.00 ? 112 LEU A CG   1  
ATOM 1554  C CD1  . LEU A 1 112 ? 0.156   0.211   9.415   1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1555  C CD2  . LEU A 1 112 ? -1.743  1.831   9.864   1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1556  H H    . LEU A 1 112 ? -0.495  0.237   14.273  1.00 0.00 ? 112 LEU A H    1  
ATOM 1557  H HA   . LEU A 1 112 ? -1.975  1.859   12.345  1.00 0.00 ? 112 LEU A HA   1  
ATOM 1558  H HB3  . LEU A 1 112 ? 0.706   0.570   11.815  1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1559  H HG   . LEU A 1 112 ? 0.327   2.298   9.765   1.00 0.00 ? 112 LEU A HG   1  
ATOM 1560  H HD11 . LEU A 1 112 ? -0.488  -0.619  9.709   1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1561  H HD12 . LEU A 1 112 ? 0.078   0.367   8.339   1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1562  H HD13 . LEU A 1 112 ? 1.189   -0.022  9.674   1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1563  H HD21 . LEU A 1 112 ? -2.008  2.744   10.396  1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1564  H HD22 . LEU A 1 112 ? -1.879  1.983   8.793   1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1565  H HD23 . LEU A 1 112 ? -2.385  1.017   10.201  1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1566  N N    . GLU A 1 113 ? -3.230  -0.202  11.944  1.00 0.00 ? 113 GLU A N    1  
ATOM 1567  C CA   . GLU A 1 113 ? -4.000  -1.390  11.616  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1568  C C    . GLU A 1 113 ? -4.021  -1.607  10.102  1.00 0.00 ? 113 GLU A C    1  
ATOM 1569  O O    . GLU A 1 113 ? -4.023  -0.648  9.332   1.00 0.00 ? 113 GLU A O    1  
ATOM 1570  C CB   . GLU A 1 113 ? -5.421  -1.296  12.176  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1571  C CG   . GLU A 1 113 ? -6.197  -2.589  11.923  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1572  C CD   . GLU A 1 113 ? -7.700  -2.372  12.114  1.00 0.00 ? 113 GLU A CD   1  
ATOM 1573  O OE1  . GLU A 1 113 ? -8.096  -2.144  13.277  1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1574  O OE2  . GLU A 1 113 ? -8.417  -2.440  11.092  1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1575  H H    . GLU A 1 113 ? -3.756  0.648   11.969  1.00 0.00 ? 113 GLU A H    1  
ATOM 1576  H HA   . GLU A 1 113 ? -3.479  -2.215  12.101  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1577  H HB3  . GLU A 1 113 ? -5.942  -0.457  11.714  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1578  H HG3  . GLU A 1 113 ? -5.848  -3.366  12.603  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1579  N N    . LEU A 1 114 ? -4.036  -2.875  9.718   1.00 0.00 ? 114 LEU A N    1  
ATOM 1580  C CA   . LEU A 1 114 ? -4.057  -3.231  8.310   1.00 0.00 ? 114 LEU A CA   1  
ATOM 1581  C C    . LEU A 1 114 ? -5.030  -4.393  8.096   1.00 0.00 ? 114 LEU A C    1  
ATOM 1582  O O    . LEU A 1 114 ? -5.753  -4.780  9.013   1.00 0.00 ? 114 LEU A O    1  
ATOM 1583  C CB   . LEU A 1 114 ? -2.640  -3.515  7.808   1.00 0.00 ? 114 LEU A CB   1  
ATOM 1584  C CG   . LEU A 1 114 ? -1.624  -2.386  7.991   1.00 0.00 ? 114 LEU A CG   1  
ATOM 1585  C CD1  . LEU A 1 114 ? -0.195  -2.933  8.020   1.00 0.00 ? 114 LEU A CD1  1  
ATOM 1586  C CD2  . LEU A 1 114 ? -1.804  -1.308  6.921   1.00 0.00 ? 114 LEU A CD2  1  
ATOM 1587  H H    . LEU A 1 114 ? -4.034  -3.651  10.350  1.00 0.00 ? 114 LEU A H    1  
ATOM 1588  H HA   . LEU A 1 114 ? -4.425  -2.366  7.759   1.00 0.00 ? 114 LEU A HA   1  
ATOM 1589  H HB3  . LEU A 1 114 ? -2.694  -3.761  6.747   1.00 0.00 ? 114 LEU A HB3  1  
ATOM 1590  H HG   . LEU A 1 114 ? -1.807  -1.915  8.957   1.00 0.00 ? 114 LEU A HG   1  
ATOM 1591  H HD11 . LEU A 1 114 ? -0.186  -3.898  8.525   1.00 0.00 ? 114 LEU A HD11 1  
ATOM 1592  H HD12 . LEU A 1 114 ? 0.168   -3.052  6.999   1.00 0.00 ? 114 LEU A HD12 1  
ATOM 1593  H HD13 . LEU A 1 114 ? 0.450   -2.236  8.556   1.00 0.00 ? 114 LEU A HD13 1  
ATOM 1594  H HD21 . LEU A 1 114 ? -1.857  -1.776  5.938   1.00 0.00 ? 114 LEU A HD21 1  
ATOM 1595  H HD22 . LEU A 1 114 ? -2.726  -0.757  7.110   1.00 0.00 ? 114 LEU A HD22 1  
ATOM 1596  H HD23 . LEU A 1 114 ? -0.958  -0.620  6.951   1.00 0.00 ? 114 LEU A HD23 1  
ATOM 1597  N N    . SER A 1 115 ? -5.017  -4.917  6.879   1.00 0.00 ? 115 SER A N    1  
ATOM 1598  C CA   . SER A 1 115 ? -5.888  -6.028  6.533   1.00 0.00 ? 115 SER A CA   1  
ATOM 1599  C C    . SER A 1 115 ? -5.466  -6.625  5.189   1.00 0.00 ? 115 SER A C    1  
ATOM 1600  O O    . SER A 1 115 ? -5.191  -5.893  4.240   1.00 0.00 ? 115 SER A O    1  
ATOM 1601  C CB   . SER A 1 115 ? -7.351  -5.583  6.481   1.00 0.00 ? 115 SER A CB   1  
ATOM 1602  O OG   . SER A 1 115 ? -7.639  -4.577  7.449   1.00 0.00 ? 115 SER A OG   1  
ATOM 1603  H H    . SER A 1 115 ? -4.426  -4.597  6.138   1.00 0.00 ? 115 SER A H    1  
ATOM 1604  H HA   . SER A 1 115 ? -5.758  -6.756  7.333   1.00 0.00 ? 115 SER A HA   1  
ATOM 1605  H HB3  . SER A 1 115 ? -7.998  -6.444  6.650   1.00 0.00 ? 115 SER A HB3  1  
ATOM 1606  H HG   . SER A 1 115 ? -7.179  -3.724  7.202   1.00 0.00 ? 115 SER A HG   1  
ATOM 1607  N N    . VAL A 1 116 ? -5.429  -7.949  5.153   1.00 0.00 ? 116 VAL A N    1  
ATOM 1608  C CA   . VAL A 1 116 ? -5.047  -8.654  3.940   1.00 0.00 ? 116 VAL A CA   1  
ATOM 1609  C C    . VAL A 1 116 ? -6.040  -9.787  3.678   1.00 0.00 ? 116 VAL A C    1  
ATOM 1610  O O    . VAL A 1 116 ? -7.128  -9.807  4.249   1.00 0.00 ? 116 VAL A O    1  
ATOM 1611  C CB   . VAL A 1 116 ? -3.600  -9.140  4.054   1.00 0.00 ? 116 VAL A CB   1  
ATOM 1612  C CG1  . VAL A 1 116 ? -2.688  -8.031  4.581   1.00 0.00 ? 116 VAL A CG1  1  
ATOM 1613  C CG2  . VAL A 1 116 ? -3.509  -10.389 4.933   1.00 0.00 ? 116 VAL A CG2  1  
ATOM 1614  H H    . VAL A 1 116 ? -5.654  -8.537  5.929   1.00 0.00 ? 116 VAL A H    1  
ATOM 1615  H HA   . VAL A 1 116 ? -5.098  -7.942  3.116   1.00 0.00 ? 116 VAL A HA   1  
ATOM 1616  H HB   . VAL A 1 116 ? -3.257  -9.407  3.054   1.00 0.00 ? 116 VAL A HB   1  
ATOM 1617  H HG11 . VAL A 1 116 ? -3.098  -7.634  5.510   1.00 0.00 ? 116 VAL A HG11 1  
ATOM 1618  H HG12 . VAL A 1 116 ? -1.692  -8.436  4.767   1.00 0.00 ? 116 VAL A HG12 1  
ATOM 1619  H HG13 . VAL A 1 116 ? -2.621  -7.232  3.841   1.00 0.00 ? 116 VAL A HG13 1  
ATOM 1620  H HG21 . VAL A 1 116 ? -3.105  -11.217 4.349   1.00 0.00 ? 116 VAL A HG21 1  
ATOM 1621  H HG22 . VAL A 1 116 ? -2.854  -10.189 5.780   1.00 0.00 ? 116 VAL A HG22 1  
ATOM 1622  H HG23 . VAL A 1 116 ? -4.503  -10.652 5.295   1.00 0.00 ? 116 VAL A HG23 1  
ATOM 1623  N N    . MET A 1 117 ? -5.628  -10.702 2.813   1.00 0.00 ? 117 MET A N    1  
ATOM 1624  C CA   . MET A 1 117 ? -6.470  -11.836 2.469   1.00 0.00 ? 117 MET A CA   1  
ATOM 1625  C C    . MET A 1 117 ? -5.631  -13.102 2.275   1.00 0.00 ? 117 MET A C    1  
ATOM 1626  O O    . MET A 1 117 ? -4.977  -13.266 1.245   1.00 0.00 ? 117 MET A O    1  
ATOM 1627  C CB   . MET A 1 117 ? -7.237  -11.531 1.182   1.00 0.00 ? 117 MET A CB   1  
ATOM 1628  C CG   . MET A 1 117 ? -8.594  -10.896 1.491   1.00 0.00 ? 117 MET A CG   1  
ATOM 1629  S SD   . MET A 1 117 ? -9.842  -12.164 1.634   1.00 0.00 ? 117 MET A SD   1  
ATOM 1630  C CE   . MET A 1 117 ? -10.524 -11.749 3.231   1.00 0.00 ? 117 MET A CE   1  
ATOM 1631  H H    . MET A 1 117 ? -4.741  -10.679 2.353   1.00 0.00 ? 117 MET A H    1  
ATOM 1632  H HA   . MET A 1 117 ? -7.145  -11.967 3.313   1.00 0.00 ? 117 MET A HA   1  
ATOM 1633  H HB3  . MET A 1 117 ? -7.382  -12.449 0.613   1.00 0.00 ? 117 MET A HB3  1  
ATOM 1634  H HG3  . MET A 1 117 ? -8.866  -10.194 0.701   1.00 0.00 ? 117 MET A HG3  1  
ATOM 1635  H HE1  . MET A 1 117 ? -11.528 -12.165 3.318   1.00 0.00 ? 117 MET A HE1  1  
ATOM 1636  H HE2  . MET A 1 117 ? -9.890  -12.163 4.015   1.00 0.00 ? 117 MET A HE2  1  
ATOM 1637  H HE3  . MET A 1 117 ? -10.570 -10.665 3.335   1.00 0.00 ? 117 MET A HE3  1  
ATOM 1638  N N    . PRO A 1 118 ? -5.676  -13.985 3.306   1.00 0.00 ? 118 PRO A N    1  
ATOM 1639  C CA   . PRO A 1 118 ? -4.930  -15.231 3.260   1.00 0.00 ? 118 PRO A CA   1  
ATOM 1640  C C    . PRO A 1 118 ? -5.599  -16.238 2.321   1.00 0.00 ? 118 PRO A C    1  
ATOM 1641  O O    . PRO A 1 118 ? -6.824  -16.359 2.306   1.00 0.00 ? 118 PRO A O    1  
ATOM 1642  C CB   . PRO A 1 118 ? -4.872  -15.710 4.701   1.00 0.00 ? 118 PRO A CB   1  
ATOM 1643  C CG   . PRO A 1 118 ? -5.978  -14.967 5.432   1.00 0.00 ? 118 PRO A CG   1  
ATOM 1644  C CD   . PRO A 1 118 ? -6.439  -13.825 4.542   1.00 0.00 ? 118 PRO A CD   1  
ATOM 1645  H HA   . PRO A 1 118 ? -4.017  -15.074 2.884   1.00 0.00 ? 118 PRO A HA   1  
ATOM 1646  H HB3  . PRO A 1 118 ? -3.899  -15.498 5.144   1.00 0.00 ? 118 PRO A HB3  1  
ATOM 1647  H HG3  . PRO A 1 118 ? -5.615  -14.584 6.386   1.00 0.00 ? 118 PRO A HG3  1  
ATOM 1648  H HD3  . PRO A 1 118 ? -6.244  -12.858 5.004   1.00 0.00 ? 118 PRO A HD3  1  
ATOM 1649  N N    . LYS A 1 119 ? -4.768  -16.934 1.561   1.00 0.00 ? 119 LYS A N    1  
ATOM 1650  C CA   . LYS A 1 119 ? -5.264  -17.926 0.621   1.00 0.00 ? 119 LYS A CA   1  
ATOM 1651  C C    . LYS A 1 119 ? -5.341  -19.286 1.319   1.00 0.00 ? 119 LYS A C    1  
ATOM 1652  O O    . LYS A 1 119 ? -4.790  -19.465 2.404   1.00 0.00 ? 119 LYS A O    1  
ATOM 1653  C CB   . LYS A 1 119 ? -4.414  -17.933 -0.650  1.00 0.00 ? 119 LYS A CB   1  
ATOM 1654  C CG   . LYS A 1 119 ? -5.292  -17.818 -1.897  1.00 0.00 ? 119 LYS A CG   1  
ATOM 1655  C CD   . LYS A 1 119 ? -4.490  -17.279 -3.084  1.00 0.00 ? 119 LYS A CD   1  
ATOM 1656  C CE   . LYS A 1 119 ? -5.041  -17.816 -4.406  1.00 0.00 ? 119 LYS A CE   1  
ATOM 1657  N NZ   . LYS A 1 119 ? -3.939  -18.304 -5.266  1.00 0.00 ? 119 LYS A NZ   1  
ATOM 1658  H H    . LYS A 1 119 ? -3.773  -16.830 1.579   1.00 0.00 ? 119 LYS A H    1  
ATOM 1659  H HA   . LYS A 1 119 ? -6.271  -17.628 0.334   1.00 0.00 ? 119 LYS A HA   1  
ATOM 1660  H HB3  . LYS A 1 119 ? -3.829  -18.852 -0.695  1.00 0.00 ? 119 LYS A HB3  1  
ATOM 1661  H HG3  . LYS A 1 119 ? -6.134  -17.156 -1.693  1.00 0.00 ? 119 LYS A HG3  1  
ATOM 1662  H HD3  . LYS A 1 119 ? -3.443  -17.565 -2.979  1.00 0.00 ? 119 LYS A HD3  1  
ATOM 1663  H HE3  . LYS A 1 119 ? -5.593  -17.031 -4.922  1.00 0.00 ? 119 LYS A HE3  1  
ATOM 1664  H HZ1  . LYS A 1 119 ? -3.165  -18.573 -4.695  1.00 0.00 ? 119 LYS A HZ1  1  
ATOM 1665  H HZ2  . LYS A 1 119 ? -4.253  -19.092 -5.795  1.00 0.00 ? 119 LYS A HZ2  1  
ATOM 1666  H HZ3  . LYS A 1 119 ? -3.657  -17.575 -5.890  1.00 0.00 ? 119 LYS A HZ3  1  
ATOM 1667  N N    . ASP A 1 120 ? -6.029  -20.211 0.665   1.00 0.00 ? 120 ASP A N    1  
ATOM 1668  C CA   . ASP A 1 120 ? -6.186  -21.549 1.207   1.00 0.00 ? 120 ASP A CA   1  
ATOM 1669  C C    . ASP A 1 120 ? -4.804  -22.166 1.439   1.00 0.00 ? 120 ASP A C    1  
ATOM 1670  O O    . ASP A 1 120 ? -3.979  -22.210 0.527   1.00 0.00 ? 120 ASP A O    1  
ATOM 1671  C CB   . ASP A 1 120 ? -6.949  -22.451 0.235   1.00 0.00 ? 120 ASP A CB   1  
ATOM 1672  C CG   . ASP A 1 120 ? -8.348  -21.958 -0.143  1.00 0.00 ? 120 ASP A CG   1  
ATOM 1673  O OD1  . ASP A 1 120 ? -9.277  -22.226 0.648   1.00 0.00 ? 120 ASP A OD1  1  
ATOM 1674  O OD2  . ASP A 1 120 ? -8.453  -21.322 -1.214  1.00 0.00 ? 120 ASP A OD2  1  
ATOM 1675  H H    . ASP A 1 120 ? -6.474  -20.058 -0.218  1.00 0.00 ? 120 ASP A H    1  
ATOM 1676  H HA   . ASP A 1 120 ? -6.745  -21.420 2.133   1.00 0.00 ? 120 ASP A HA   1  
ATOM 1677  H HB3  . ASP A 1 120 ? -7.039  -23.445 0.678   1.00 0.00 ? 120 ASP A HB3  1  
ATOM 1678  N N    . SER A 1 121 ? -4.595  -22.629 2.663   1.00 0.00 ? 121 SER A N    1  
ATOM 1679  C CA   . SER A 1 121 ? -3.328  -23.240 3.025   1.00 0.00 ? 121 SER A CA   1  
ATOM 1680  C C    . SER A 1 121 ? -3.546  -24.281 4.126   1.00 0.00 ? 121 SER A C    1  
ATOM 1681  O O    . SER A 1 121 ? -4.508  -24.193 4.886   1.00 0.00 ? 121 SER A O    1  
ATOM 1682  C CB   . SER A 1 121 ? -2.318  -22.186 3.483   1.00 0.00 ? 121 SER A CB   1  
ATOM 1683  O OG   . SER A 1 121 ? -0.974  -22.621 3.300   1.00 0.00 ? 121 SER A OG   1  
ATOM 1684  H H    . SER A 1 121 ? -5.271  -22.588 3.398   1.00 0.00 ? 121 SER A H    1  
ATOM 1685  H HA   . SER A 1 121 ? -2.967  -23.717 2.114   1.00 0.00 ? 121 SER A HA   1  
ATOM 1686  H HB3  . SER A 1 121 ? -2.485  -21.956 4.534   1.00 0.00 ? 121 SER A HB3  1  
ATOM 1687  H HG   . SER A 1 121 ? -0.357  -21.833 3.292   1.00 0.00 ? 121 SER A HG   1  
ATOM 1688  N N    . GLY A 1 122 ? -2.634  -25.241 4.177   1.00 0.00 ? 122 GLY A N    1  
ATOM 1689  C CA   . GLY A 1 122 ? -2.714  -26.295 5.172   1.00 0.00 ? 122 GLY A CA   1  
ATOM 1690  C C    . GLY A 1 122 ? -1.666  -27.378 4.909   1.00 0.00 ? 122 GLY A C    1  
ATOM 1691  O O    . GLY A 1 122 ? -1.934  -28.347 4.201   1.00 0.00 ? 122 GLY A O    1  
ATOM 1692  H H    . GLY A 1 122 ? -1.853  -25.304 3.555   1.00 0.00 ? 122 GLY A H    1  
ATOM 1693  H HA2  . GLY A 1 122 ? -2.565  -25.875 6.167   1.00 0.00 ? 122 GLY A HA2  1  
ATOM 1694  H HA3  . GLY A 1 122 ? -3.710  -26.737 5.159   1.00 0.00 ? 122 GLY A HA3  1  
ATOM 1695  N N    . PRO A 1 123 ? -0.462  -27.172 5.508   1.00 0.00 ? 123 PRO A N    1  
ATOM 1696  C CA   . PRO A 1 123 ? 0.627   -28.119 5.345   1.00 0.00 ? 123 PRO A CA   1  
ATOM 1697  C C    . PRO A 1 123 ? 0.389   -29.379 6.181   1.00 0.00 ? 123 PRO A C    1  
ATOM 1698  O O    . PRO A 1 123 ? 0.907   -30.447 5.861   1.00 0.00 ? 123 PRO A O    1  
ATOM 1699  C CB   . PRO A 1 123 ? 1.876   -27.357 5.761   1.00 0.00 ? 123 PRO A CB   1  
ATOM 1700  C CG   . PRO A 1 123 ? 1.387   -26.172 6.579   1.00 0.00 ? 123 PRO A CG   1  
ATOM 1701  C CD   . PRO A 1 123 ? -0.109  -26.035 6.353   1.00 0.00 ? 123 PRO A CD   1  
ATOM 1702  H HA   . PRO A 1 123 ? 0.681   -28.427 4.396   1.00 0.00 ? 123 PRO A HA   1  
ATOM 1703  H HB3  . PRO A 1 123 ? 2.439   -27.026 4.889   1.00 0.00 ? 123 PRO A HB3  1  
ATOM 1704  H HG3  . PRO A 1 123 ? 1.905   -25.262 6.276   1.00 0.00 ? 123 PRO A HG3  1  
ATOM 1705  H HD3  . PRO A 1 123 ? -0.351  -25.090 5.867   1.00 0.00 ? 123 PRO A HD3  1  
ATOM 1706  N N    . SER A 1 124 ? -0.395  -29.210 7.236   1.00 0.00 ? 124 SER A N    1  
ATOM 1707  C CA   . SER A 1 124 ? -0.708  -30.319 8.119   1.00 0.00 ? 124 SER A CA   1  
ATOM 1708  C C    . SER A 1 124 ? -2.221  -30.401 8.342   1.00 0.00 ? 124 SER A C    1  
ATOM 1709  O O    . SER A 1 124 ? -2.920  -29.394 8.240   1.00 0.00 ? 124 SER A O    1  
ATOM 1710  C CB   . SER A 1 124 ? 0.019   -30.181 9.457   1.00 0.00 ? 124 SER A CB   1  
ATOM 1711  O OG   . SER A 1 124 ? 0.471   -31.438 9.954   1.00 0.00 ? 124 SER A OG   1  
ATOM 1712  H H    . SER A 1 124 ? -0.812  -28.337 7.488   1.00 0.00 ? 124 SER A H    1  
ATOM 1713  H HA   . SER A 1 124 ? -0.350  -31.210 7.603   1.00 0.00 ? 124 SER A HA   1  
ATOM 1714  H HB3  . SER A 1 124 ? -0.649  -29.721 10.188  1.00 0.00 ? 124 SER A HB3  1  
ATOM 1715  H HG   . SER A 1 124 ? 1.390   -31.344 10.335  1.00 0.00 ? 124 SER A HG   1  
ATOM 1716  N N    . SER A 1 125 ? -2.678  -31.607 8.640   1.00 0.00 ? 125 SER A N    1  
ATOM 1717  C CA   . SER A 1 125 ? -4.094  -31.832 8.880   1.00 0.00 ? 125 SER A CA   1  
ATOM 1718  C C    . SER A 1 125 ? -4.395  -31.733 10.376  1.00 0.00 ? 125 SER A C    1  
ATOM 1719  O O    . SER A 1 125 ? -5.262  -30.964 10.788  1.00 0.00 ? 125 SER A O    1  
ATOM 1720  C CB   . SER A 1 125 ? -4.533  -33.194 8.339   1.00 0.00 ? 125 SER A CB   1  
ATOM 1721  O OG   . SER A 1 125 ? -5.461  -33.070 7.265   1.00 0.00 ? 125 SER A OG   1  
ATOM 1722  H H    . SER A 1 125 ? -2.101  -32.420 8.722   1.00 0.00 ? 125 SER A H    1  
ATOM 1723  H HA   . SER A 1 125 ? -4.608  -31.042 8.332   1.00 0.00 ? 125 SER A HA   1  
ATOM 1724  H HB3  . SER A 1 125 ? -4.985  -33.775 9.144   1.00 0.00 ? 125 SER A HB3  1  
ATOM 1725  H HG   . SER A 1 125 ? -5.046  -33.396 6.416   1.00 0.00 ? 125 SER A HG   1  
ATOM 1726  N N    . GLY A 1 126 ? -3.662  -32.521 11.149  1.00 0.00 ? 126 GLY A N    1  
ATOM 1727  C CA   . GLY A 1 126 ? -3.841  -32.530 12.591  1.00 0.00 ? 126 GLY A CA   1  
ATOM 1728  C C    . GLY A 1 126 ? -4.396  -33.874 13.066  1.00 0.00 ? 126 GLY A C    1  
ATOM 1729  O O    . GLY A 1 126 ? -4.779  -34.714 12.252  1.00 0.00 ? 126 GLY A O    1  
ATOM 1730  H H    . GLY A 1 126 ? -2.959  -33.143 10.805  1.00 0.00 ? 126 GLY A H    1  
ATOM 1731  H HA2  . GLY A 1 126 ? -2.886  -32.334 13.079  1.00 0.00 ? 126 GLY A HA2  1  
ATOM 1732  H HA3  . GLY A 1 126 ? -4.519  -31.728 12.882  1.00 0.00 ? 126 GLY A HA3  1  
ATOM 1733  N N    . GLY A 1 1   ? -29.630 -6.867  22.825  1.00 0.00 ? 1   GLY A N    2  
ATOM 1734  C CA   . GLY A 1 1   ? -29.701 -6.350  21.469  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1735  C C    . GLY A 1 1   ? -28.346 -5.796  21.022  1.00 0.00 ? 1   GLY A C    2  
ATOM 1736  O O    . GLY A 1 1   ? -28.131 -4.584  21.042  1.00 0.00 ? 1   GLY A O    2  
ATOM 1737  H H1   . GLY A 1 1   ? -30.414 -7.419  23.108  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1738  H HA2  . GLY A 1 1   ? -30.015 -7.142  20.790  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1739  H HA3  . GLY A 1 1   ? -30.455 -5.564  21.415  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1740  N N    . SER A 1 2   ? -27.470 -6.707  20.629  1.00 0.00 ? 2   SER A N    2  
ATOM 1741  C CA   . SER A 1 2   ? -26.143 -6.324  20.179  1.00 0.00 ? 2   SER A CA   2  
ATOM 1742  C C    . SER A 1 2   ? -25.902 -6.845  18.761  1.00 0.00 ? 2   SER A C    2  
ATOM 1743  O O    . SER A 1 2   ? -25.642 -6.066  17.845  1.00 0.00 ? 2   SER A O    2  
ATOM 1744  C CB   . SER A 1 2   ? -25.064 -6.851  21.128  1.00 0.00 ? 2   SER A CB   2  
ATOM 1745  O OG   . SER A 1 2   ? -23.937 -5.983  21.190  1.00 0.00 ? 2   SER A OG   2  
ATOM 1746  H H    . SER A 1 2   ? -27.653 -7.690  20.616  1.00 0.00 ? 2   SER A H    2  
ATOM 1747  H HA   . SER A 1 2   ? -26.136 -5.234  20.191  1.00 0.00 ? 2   SER A HA   2  
ATOM 1748  H HB3  . SER A 1 2   ? -24.744 -7.839  20.801  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1749  H HG   . SER A 1 2   ? -23.326 -6.161  20.419  1.00 0.00 ? 2   SER A HG   2  
ATOM 1750  N N    . SER A 1 3   ? -25.996 -8.159  18.623  1.00 0.00 ? 3   SER A N    2  
ATOM 1751  C CA   . SER A 1 3   ? -25.790 -8.794  17.332  1.00 0.00 ? 3   SER A CA   2  
ATOM 1752  C C    . SER A 1 3   ? -24.365 -8.531  16.842  1.00 0.00 ? 3   SER A C    2  
ATOM 1753  O O    . SER A 1 3   ? -24.038 -7.417  16.438  1.00 0.00 ? 3   SER A O    2  
ATOM 1754  C CB   . SER A 1 3   ? -26.806 -8.293  16.305  1.00 0.00 ? 3   SER A CB   2  
ATOM 1755  O OG   . SER A 1 3   ? -27.993 -9.079  16.301  1.00 0.00 ? 3   SER A OG   2  
ATOM 1756  H H    . SER A 1 3   ? -26.207 -8.787  19.373  1.00 0.00 ? 3   SER A H    2  
ATOM 1757  H HA   . SER A 1 3   ? -25.944 -9.859  17.507  1.00 0.00 ? 3   SER A HA   2  
ATOM 1758  H HB3  . SER A 1 3   ? -26.356 -8.309  15.311  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1759  H HG   . SER A 1 3   ? -28.779 -8.513  16.057  1.00 0.00 ? 3   SER A HG   2  
ATOM 1760  N N    . GLY A 1 4   ? -23.555 -9.578  16.890  1.00 0.00 ? 4   GLY A N    2  
ATOM 1761  C CA   . GLY A 1 4   ? -22.172 -9.475  16.455  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1762  C C    . GLY A 1 4   ? -21.321 -10.592 17.063  1.00 0.00 ? 4   GLY A C    2  
ATOM 1763  O O    . GLY A 1 4   ? -20.912 -10.507 18.220  1.00 0.00 ? 4   GLY A O    2  
ATOM 1764  H H    . GLY A 1 4   ? -23.827 -10.482 17.220  1.00 0.00 ? 4   GLY A H    2  
ATOM 1765  H HA2  . GLY A 1 4   ? -22.124 -9.528  15.368  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1766  H HA3  . GLY A 1 4   ? -21.766 -8.505  16.745  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1767  N N    . SER A 1 5   ? -21.079 -11.615 16.255  1.00 0.00 ? 5   SER A N    2  
ATOM 1768  C CA   . SER A 1 5   ? -20.284 -12.748 16.700  1.00 0.00 ? 5   SER A CA   2  
ATOM 1769  C C    . SER A 1 5   ? -19.989 -13.674 15.518  1.00 0.00 ? 5   SER A C    2  
ATOM 1770  O O    . SER A 1 5   ? -20.710 -14.642 15.289  1.00 0.00 ? 5   SER A O    2  
ATOM 1771  C CB   . SER A 1 5   ? -20.997 -13.517 17.812  1.00 0.00 ? 5   SER A CB   2  
ATOM 1772  O OG   . SER A 1 5   ? -20.098 -14.339 18.553  1.00 0.00 ? 5   SER A OG   2  
ATOM 1773  H H    . SER A 1 5   ? -21.416 -11.676 15.316  1.00 0.00 ? 5   SER A H    2  
ATOM 1774  H HA   . SER A 1 5   ? -19.362 -12.316 17.089  1.00 0.00 ? 5   SER A HA   2  
ATOM 1775  H HB3  . SER A 1 5   ? -21.782 -14.136 17.380  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1776  H HG   . SER A 1 5   ? -19.965 -15.212 18.081  1.00 0.00 ? 5   SER A HG   2  
ATOM 1777  N N    . SER A 1 6   ? -18.926 -13.343 14.799  1.00 0.00 ? 6   SER A N    2  
ATOM 1778  C CA   . SER A 1 6   ? -18.526 -14.132 13.647  1.00 0.00 ? 6   SER A CA   2  
ATOM 1779  C C    . SER A 1 6   ? -17.200 -13.612 13.090  1.00 0.00 ? 6   SER A C    2  
ATOM 1780  O O    . SER A 1 6   ? -16.891 -12.428 13.219  1.00 0.00 ? 6   SER A O    2  
ATOM 1781  C CB   . SER A 1 6   ? -19.605 -14.109 12.562  1.00 0.00 ? 6   SER A CB   2  
ATOM 1782  O OG   . SER A 1 6   ? -19.629 -15.318 11.807  1.00 0.00 ? 6   SER A OG   2  
ATOM 1783  H H    . SER A 1 6   ? -18.345 -12.552 14.992  1.00 0.00 ? 6   SER A H    2  
ATOM 1784  H HA   . SER A 1 6   ? -18.411 -15.150 14.021  1.00 0.00 ? 6   SER A HA   2  
ATOM 1785  H HB3  . SER A 1 6   ? -19.426 -13.267 11.892  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1786  H HG   . SER A 1 6   ? -20.509 -15.778 11.927  1.00 0.00 ? 6   SER A HG   2  
ATOM 1787  N N    . GLY A 1 7   ? -16.451 -14.521 12.482  1.00 0.00 ? 7   GLY A N    2  
ATOM 1788  C CA   . GLY A 1 7   ? -15.166 -14.167 11.906  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1789  C C    . GLY A 1 7   ? -15.337 -13.176 10.752  1.00 0.00 ? 7   GLY A C    2  
ATOM 1790  O O    . GLY A 1 7   ? -16.350 -12.485 10.667  1.00 0.00 ? 7   GLY A O    2  
ATOM 1791  H H    . GLY A 1 7   ? -16.711 -15.482 12.382  1.00 0.00 ? 7   GLY A H    2  
ATOM 1792  H HA2  . GLY A 1 7   ? -14.526 -13.732 12.672  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1793  H HA3  . GLY A 1 7   ? -14.665 -15.067 11.546  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1794  N N    . GLY A 1 8   ? -14.329 -13.141 9.892   1.00 0.00 ? 8   GLY A N    2  
ATOM 1795  C CA   . GLY A 1 8   ? -14.355 -12.246 8.746   1.00 0.00 ? 8   GLY A CA   2  
ATOM 1796  C C    . GLY A 1 8   ? -12.976 -12.157 8.089   1.00 0.00 ? 8   GLY A C    2  
ATOM 1797  O O    . GLY A 1 8   ? -12.302 -13.170 7.913   1.00 0.00 ? 8   GLY A O    2  
ATOM 1798  H H    . GLY A 1 8   ? -13.509 -13.708 9.967   1.00 0.00 ? 8   GLY A H    2  
ATOM 1799  H HA2  . GLY A 1 8   ? -15.086 -12.601 8.019   1.00 0.00 ? 8   GLY A HA2  2  
ATOM 1800  H HA3  . GLY A 1 8   ? -14.676 -11.253 9.062   1.00 0.00 ? 8   GLY A HA3  2  
ATOM 1801  N N    . PRO A 1 9   ? -12.588 -10.901 7.737   1.00 0.00 ? 9   PRO A N    2  
ATOM 1802  C CA   . PRO A 1 9   ? -11.302 -10.667 7.104   1.00 0.00 ? 9   PRO A CA   2  
ATOM 1803  C C    . PRO A 1 9   ? -10.163 -10.771 8.120   1.00 0.00 ? 9   PRO A C    2  
ATOM 1804  O O    . PRO A 1 9   ? -10.405 -10.879 9.322   1.00 0.00 ? 9   PRO A O    2  
ATOM 1805  C CB   . PRO A 1 9   ? -11.417 -9.285  6.481   1.00 0.00 ? 9   PRO A CB   2  
ATOM 1806  C CG   . PRO A 1 9   ? -12.586 -8.609  7.178   1.00 0.00 ? 9   PRO A CG   2  
ATOM 1807  C CD   . PRO A 1 9   ? -13.360 -9.679  7.931   1.00 0.00 ? 9   PRO A CD   2  
ATOM 1808  H HA   . PRO A 1 9   ? -11.120 -11.369 6.416   1.00 0.00 ? 9   PRO A HA   2  
ATOM 1809  H HB3  . PRO A 1 9   ? -11.590 -9.354  5.406   1.00 0.00 ? 9   PRO A HB3  2  
ATOM 1810  H HG3  . PRO A 1 9   ? -13.229 -8.112  6.451   1.00 0.00 ? 9   PRO A HG3  2  
ATOM 1811  H HD3  . PRO A 1 9   ? -14.372 -9.783  7.541   1.00 0.00 ? 9   PRO A HD3  2  
ATOM 1812  N N    . LYS A 1 10  ? -8.945  -10.734 7.602   1.00 0.00 ? 10  LYS A N    2  
ATOM 1813  C CA   . LYS A 1 10  ? -7.767  -10.822 8.449   1.00 0.00 ? 10  LYS A CA   2  
ATOM 1814  C C    . LYS A 1 10  ? -7.397  -9.424  8.949   1.00 0.00 ? 10  LYS A C    2  
ATOM 1815  O O    . LYS A 1 10  ? -7.455  -8.456  8.193   1.00 0.00 ? 10  LYS A O    2  
ATOM 1816  C CB   . LYS A 1 10  ? -6.630  -11.535 7.714   1.00 0.00 ? 10  LYS A CB   2  
ATOM 1817  C CG   . LYS A 1 10  ? -5.287  -11.279 8.402   1.00 0.00 ? 10  LYS A CG   2  
ATOM 1818  C CD   . LYS A 1 10  ? -4.537  -12.591 8.644   1.00 0.00 ? 10  LYS A CD   2  
ATOM 1819  C CE   . LYS A 1 10  ? -3.285  -12.674 7.768   1.00 0.00 ? 10  LYS A CE   2  
ATOM 1820  N NZ   . LYS A 1 10  ? -2.841  -14.080 7.634   1.00 0.00 ? 10  LYS A NZ   2  
ATOM 1821  H H    . LYS A 1 10  ? -8.755  -10.646 6.623   1.00 0.00 ? 10  LYS A H    2  
ATOM 1822  H HA   . LYS A 1 10  ? -8.030  -11.438 9.309   1.00 0.00 ? 10  LYS A HA   2  
ATOM 1823  H HB3  . LYS A 1 10  ? -6.586  -11.186 6.682   1.00 0.00 ? 10  LYS A HB3  2  
ATOM 1824  H HG3  . LYS A 1 10  ? -5.452  -10.771 9.352   1.00 0.00 ? 10  LYS A HG3  2  
ATOM 1825  H HD3  . LYS A 1 10  ? -5.193  -13.434 8.427   1.00 0.00 ? 10  LYS A HD3  2  
ATOM 1826  H HE3  . LYS A 1 10  ? -2.487  -12.075 8.208   1.00 0.00 ? 10  LYS A HE3  2  
ATOM 1827  H HZ1  . LYS A 1 10  ? -2.195  -14.297 8.365   1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 1828  H HZ2  . LYS A 1 10  ? -3.632  -14.688 7.695   1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 1829  H HZ3  . LYS A 1 10  ? -2.394  -14.204 6.748   1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 1830  N N    . THR A 1 11  ? -7.025  -9.365  10.218  1.00 0.00 ? 11  THR A N    2  
ATOM 1831  C CA   . THR A 1 11  ? -6.645  -8.100  10.828  1.00 0.00 ? 11  THR A CA   2  
ATOM 1832  C C    . THR A 1 11  ? -5.287  -8.230  11.520  1.00 0.00 ? 11  THR A C    2  
ATOM 1833  O O    . THR A 1 11  ? -5.006  -9.240  12.162  1.00 0.00 ? 11  THR A O    2  
ATOM 1834  C CB   . THR A 1 11  ? -7.770  -7.675  11.773  1.00 0.00 ? 11  THR A CB   2  
ATOM 1835  O OG1  . THR A 1 11  ? -8.959  -7.888  11.017  1.00 0.00 ? 11  THR A OG1  2  
ATOM 1836  C CG2  . THR A 1 11  ? -7.768  -6.170  12.046  1.00 0.00 ? 11  THR A CG2  2  
ATOM 1837  H H    . THR A 1 11  ? -6.981  -10.157 10.826  1.00 0.00 ? 11  THR A H    2  
ATOM 1838  H HA   . THR A 1 11  ? -6.533  -7.358  10.038  1.00 0.00 ? 11  THR A HA   2  
ATOM 1839  H HB   . THR A 1 11  ? -7.731  -8.240  12.704  1.00 0.00 ? 11  THR A HB   2  
ATOM 1840  H HG1  . THR A 1 11  ? -8.965  -7.293  10.215  1.00 0.00 ? 11  THR A HG1  2  
ATOM 1841  H HG21 . THR A 1 11  ? -7.523  -5.635  11.129  1.00 0.00 ? 11  THR A HG21 2  
ATOM 1842  H HG22 . THR A 1 11  ? -8.754  -5.862  12.395  1.00 0.00 ? 11  THR A HG22 2  
ATOM 1843  H HG23 . THR A 1 11  ? -7.024  -5.940  12.810  1.00 0.00 ? 11  THR A HG23 2  
ATOM 1844  N N    . VAL A 1 12  ? -4.478  -7.190  11.363  1.00 0.00 ? 12  VAL A N    2  
ATOM 1845  C CA   . VAL A 1 12  ? -3.156  -7.174  11.966  1.00 0.00 ? 12  VAL A CA   2  
ATOM 1846  C C    . VAL A 1 12  ? -2.842  -5.760  12.459  1.00 0.00 ? 12  VAL A C    2  
ATOM 1847  O O    . VAL A 1 12  ? -3.061  -4.786  11.743  1.00 0.00 ? 12  VAL A O    2  
ATOM 1848  C CB   . VAL A 1 12  ? -2.122  -7.702  10.969  1.00 0.00 ? 12  VAL A CB   2  
ATOM 1849  C CG1  . VAL A 1 12  ? -1.993  -9.224  11.068  1.00 0.00 ? 12  VAL A CG1  2  
ATOM 1850  C CG2  . VAL A 1 12  ? -2.467  -7.273  9.542   1.00 0.00 ? 12  VAL A CG2  2  
ATOM 1851  H H    . VAL A 1 12  ? -4.715  -6.373  10.840  1.00 0.00 ? 12  VAL A H    2  
ATOM 1852  H HA   . VAL A 1 12  ? -3.176  -7.849  12.821  1.00 0.00 ? 12  VAL A HA   2  
ATOM 1853  H HB   . VAL A 1 12  ? -1.156  -7.266  11.226  1.00 0.00 ? 12  VAL A HB   2  
ATOM 1854  H HG11 . VAL A 1 12  ? -1.090  -9.546  10.548  1.00 0.00 ? 12  VAL A HG11 2  
ATOM 1855  H HG12 . VAL A 1 12  ? -1.930  -9.516  12.116  1.00 0.00 ? 12  VAL A HG12 2  
ATOM 1856  H HG13 . VAL A 1 12  ? -2.862  -9.693  10.611  1.00 0.00 ? 12  VAL A HG13 2  
ATOM 1857  H HG21 . VAL A 1 12  ? -1.570  -6.903  9.047   1.00 0.00 ? 12  VAL A HG21 2  
ATOM 1858  H HG22 . VAL A 1 12  ? -2.860  -8.127  8.990   1.00 0.00 ? 12  VAL A HG22 2  
ATOM 1859  H HG23 . VAL A 1 12  ? -3.217  -6.483  9.571   1.00 0.00 ? 12  VAL A HG23 2  
ATOM 1860  N N    . THR A 1 13  ? -2.335  -5.694  13.682  1.00 0.00 ? 13  THR A N    2  
ATOM 1861  C CA   . THR A 1 13  ? -1.990  -4.417  14.281  1.00 0.00 ? 13  THR A CA   2  
ATOM 1862  C C    . THR A 1 13  ? -0.478  -4.191  14.218  1.00 0.00 ? 13  THR A C    2  
ATOM 1863  O O    . THR A 1 13  ? 0.298   -5.143  14.264  1.00 0.00 ? 13  THR A O    2  
ATOM 1864  C CB   . THR A 1 13  ? -2.549  -4.395  15.704  1.00 0.00 ? 13  THR A CB   2  
ATOM 1865  O OG1  . THR A 1 13  ? -3.822  -5.026  15.588  1.00 0.00 ? 13  THR A OG1  2  
ATOM 1866  C CG2  . THR A 1 13  ? -2.877  -2.979  16.183  1.00 0.00 ? 13  THR A CG2  2  
ATOM 1867  H H    . THR A 1 13  ? -2.161  -6.493  14.259  1.00 0.00 ? 13  THR A H    2  
ATOM 1868  H HA   . THR A 1 13  ? -2.456  -3.625  13.695  1.00 0.00 ? 13  THR A HA   2  
ATOM 1869  H HB   . THR A 1 13  ? -1.870  -4.894  16.398  1.00 0.00 ? 13  THR A HB   2  
ATOM 1870  H HG1  . THR A 1 13  ? -4.172  -5.261  16.494  1.00 0.00 ? 13  THR A HG1  2  
ATOM 1871  H HG21 . THR A 1 13  ? -1.989  -2.353  16.100  1.00 0.00 ? 13  THR A HG21 2  
ATOM 1872  H HG22 . THR A 1 13  ? -3.675  -2.564  15.567  1.00 0.00 ? 13  THR A HG22 2  
ATOM 1873  H HG23 . THR A 1 13  ? -3.203  -3.014  17.223  1.00 0.00 ? 13  THR A HG23 2  
ATOM 1874  N N    . LEU A 1 14  ? -0.105  -2.923  14.115  1.00 0.00 ? 14  LEU A N    2  
ATOM 1875  C CA   . LEU A 1 14  ? 1.299   -2.559  14.046  1.00 0.00 ? 14  LEU A CA   2  
ATOM 1876  C C    . LEU A 1 14  ? 1.535   -1.294  14.873  1.00 0.00 ? 14  LEU A C    2  
ATOM 1877  O O    . LEU A 1 14  ? 0.874   -0.278  14.662  1.00 0.00 ? 14  LEU A O    2  
ATOM 1878  C CB   . LEU A 1 14  ? 1.750   -2.435  12.590  1.00 0.00 ? 14  LEU A CB   2  
ATOM 1879  C CG   . LEU A 1 14  ? 1.693   -3.718  11.758  1.00 0.00 ? 14  LEU A CG   2  
ATOM 1880  C CD1  . LEU A 1 14  ? 0.350   -3.843  11.034  1.00 0.00 ? 14  LEU A CD1  2  
ATOM 1881  C CD2  . LEU A 1 14  ? 2.875   -3.796  10.789  1.00 0.00 ? 14  LEU A CD2  2  
ATOM 1882  H H    . LEU A 1 14  ? -0.743  -2.155  14.078  1.00 0.00 ? 14  LEU A H    2  
ATOM 1883  H HA   . LEU A 1 14  ? 1.870   -3.374  14.491  1.00 0.00 ? 14  LEU A HA   2  
ATOM 1884  H HB3  . LEU A 1 14  ? 2.775   -2.063  12.577  1.00 0.00 ? 14  LEU A HB3  2  
ATOM 1885  H HG   . LEU A 1 14  ? 1.774   -4.568  12.435  1.00 0.00 ? 14  LEU A HG   2  
ATOM 1886  H HD11 . LEU A 1 14  ? -0.436  -4.052  11.760  1.00 0.00 ? 14  LEU A HD11 2  
ATOM 1887  H HD12 . LEU A 1 14  ? 0.128   -2.909  10.517  1.00 0.00 ? 14  LEU A HD12 2  
ATOM 1888  H HD13 . LEU A 1 14  ? 0.402   -4.655  10.309  1.00 0.00 ? 14  LEU A HD13 2  
ATOM 1889  H HD21 . LEU A 1 14  ? 2.656   -4.524  10.007  1.00 0.00 ? 14  LEU A HD21 2  
ATOM 1890  H HD22 . LEU A 1 14  ? 3.041   -2.819  10.338  1.00 0.00 ? 14  LEU A HD22 2  
ATOM 1891  H HD23 . LEU A 1 14  ? 3.769   -4.105  11.332  1.00 0.00 ? 14  LEU A HD23 2  
ATOM 1892  N N    . LYS A 1 15  ? 2.480   -1.395  15.795  1.00 0.00 ? 15  LYS A N    2  
ATOM 1893  C CA   . LYS A 1 15  ? 2.811   -0.272  16.656  1.00 0.00 ? 15  LYS A CA   2  
ATOM 1894  C C    . LYS A 1 15  ? 4.045   0.444   16.099  1.00 0.00 ? 15  LYS A C    2  
ATOM 1895  O O    . LYS A 1 15  ? 5.121   -0.144  16.013  1.00 0.00 ? 15  LYS A O    2  
ATOM 1896  C CB   . LYS A 1 15  ? 2.971   -0.735  18.104  1.00 0.00 ? 15  LYS A CB   2  
ATOM 1897  C CG   . LYS A 1 15  ? 1.737   -1.509  18.572  1.00 0.00 ? 15  LYS A CG   2  
ATOM 1898  C CD   . LYS A 1 15  ? 1.775   -2.955  18.073  1.00 0.00 ? 15  LYS A CD   2  
ATOM 1899  C CE   . LYS A 1 15  ? 1.225   -3.914  19.130  1.00 0.00 ? 15  LYS A CE   2  
ATOM 1900  N NZ   . LYS A 1 15  ? 2.307   -4.369  20.032  1.00 0.00 ? 15  LYS A NZ   2  
ATOM 1901  H H    . LYS A 1 15  ? 3.014   -2.225  15.961  1.00 0.00 ? 15  LYS A H    2  
ATOM 1902  H HA   . LYS A 1 15  ? 1.969   0.419   16.628  1.00 0.00 ? 15  LYS A HA   2  
ATOM 1903  H HB3  . LYS A 1 15  ? 3.130   0.129   18.751  1.00 0.00 ? 15  LYS A HB3  2  
ATOM 1904  H HG3  . LYS A 1 15  ? 0.835   -1.018  18.207  1.00 0.00 ? 15  LYS A HG3  2  
ATOM 1905  H HD3  . LYS A 1 15  ? 2.801   -3.230  17.826  1.00 0.00 ? 15  LYS A HD3  2  
ATOM 1906  H HE3  . LYS A 1 15  ? 0.763   -4.774  18.645  1.00 0.00 ? 15  LYS A HE3  2  
ATOM 1907  H HZ1  . LYS A 1 15  ? 2.225   -5.354  20.180  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM 1908  H HZ2  . LYS A 1 15  ? 3.194   -4.166  19.616  1.00 0.00 ? 15  LYS A HZ2  2  
ATOM 1909  H HZ3  . LYS A 1 15  ? 2.233   -3.893  20.908  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM 1910  N N    . ARG A 1 16  ? 3.844   1.703   15.736  1.00 0.00 ? 16  ARG A N    2  
ATOM 1911  C CA   . ARG A 1 16  ? 4.926   2.505   15.190  1.00 0.00 ? 16  ARG A CA   2  
ATOM 1912  C C    . ARG A 1 16  ? 6.212   2.274   15.988  1.00 0.00 ? 16  ARG A C    2  
ATOM 1913  O O    . ARG A 1 16  ? 6.300   2.660   17.153  1.00 0.00 ? 16  ARG A O    2  
ATOM 1914  C CB   . ARG A 1 16  ? 4.576   3.994   15.219  1.00 0.00 ? 16  ARG A CB   2  
ATOM 1915  C CG   . ARG A 1 16  ? 5.654   4.824   14.519  1.00 0.00 ? 16  ARG A CG   2  
ATOM 1916  C CD   . ARG A 1 16  ? 5.037   5.755   13.473  1.00 0.00 ? 16  ARG A CD   2  
ATOM 1917  N NE   . ARG A 1 16  ? 5.935   6.905   13.227  1.00 0.00 ? 16  ARG A NE   2  
ATOM 1918  C CZ   . ARG A 1 16  ? 6.099   7.926   14.078  1.00 0.00 ? 16  ARG A CZ   2  
ATOM 1919  N NH1  . ARG A 1 16  ? 5.425   7.949   15.237  1.00 0.00 ? 16  ARG A NH1  2  
ATOM 1920  N NH2  . ARG A 1 16  ? 6.935   8.927   13.770  1.00 0.00 ? 16  ARG A NH2  2  
ATOM 1921  H H    . ARG A 1 16  ? 2.965   2.174   15.809  1.00 0.00 ? 16  ARG A H    2  
ATOM 1922  H HA   . ARG A 1 16  ? 5.035   2.162   14.161  1.00 0.00 ? 16  ARG A HA   2  
ATOM 1923  H HB3  . ARG A 1 16  ? 4.468   4.327   16.251  1.00 0.00 ? 16  ARG A HB3  2  
ATOM 1924  H HG3  . ARG A 1 16  ? 6.375   4.162   14.041  1.00 0.00 ? 16  ARG A HG3  2  
ATOM 1925  H HD3  . ARG A 1 16  ? 4.065   6.109   13.818  1.00 0.00 ? 16  ARG A HD3  2  
ATOM 1926  H HE   . ARG A 1 16  ? 6.452   6.920   12.371  1.00 0.00 ? 16  ARG A HE   2  
ATOM 1927  H HH11 . ARG A 1 16  ? 4.801   7.201   15.467  1.00 0.00 ? 16  ARG A HH11 2  
ATOM 1928  H HH12 . ARG A 1 16  ? 5.548   8.711   15.871  1.00 0.00 ? 16  ARG A HH12 2  
ATOM 1929  H HH21 . ARG A 1 16  ? 7.437   8.912   12.905  1.00 0.00 ? 16  ARG A HH21 2  
ATOM 1930  H HH22 . ARG A 1 16  ? 7.057   9.690   14.406  1.00 0.00 ? 16  ARG A HH22 2  
ATOM 1931  N N    . THR A 1 17  ? 7.174   1.649   15.328  1.00 0.00 ? 17  THR A N    2  
ATOM 1932  C CA   . THR A 1 17  ? 8.452   1.363   15.961  1.00 0.00 ? 17  THR A CA   2  
ATOM 1933  C C    . THR A 1 17  ? 9.281   2.643   16.090  1.00 0.00 ? 17  THR A C    2  
ATOM 1934  O O    . THR A 1 17  ? 9.946   2.855   17.102  1.00 0.00 ? 17  THR A O    2  
ATOM 1935  C CB   . THR A 1 17  ? 9.147   0.268   15.149  1.00 0.00 ? 17  THR A CB   2  
ATOM 1936  O OG1  . THR A 1 17  ? 9.643   0.949   14.000  1.00 0.00 ? 17  THR A OG1  2  
ATOM 1937  C CG2  . THR A 1 17  ? 8.160   -0.753  14.578  1.00 0.00 ? 17  THR A CG2  2  
ATOM 1938  H H    . THR A 1 17  ? 7.095   1.339   14.380  1.00 0.00 ? 17  THR A H    2  
ATOM 1939  H HA   . THR A 1 17  ? 8.261   1.001   16.970  1.00 0.00 ? 17  THR A HA   2  
ATOM 1940  H HB   . THR A 1 17  ? 9.919   -0.224  15.739  1.00 0.00 ? 17  THR A HB   2  
ATOM 1941  H HG1  . THR A 1 17  ? 8.888   1.383   13.506  1.00 0.00 ? 17  THR A HG1  2  
ATOM 1942  H HG21 . THR A 1 17  ? 8.671   -1.704  14.426  1.00 0.00 ? 17  THR A HG21 2  
ATOM 1943  H HG22 . THR A 1 17  ? 7.336   -0.893  15.278  1.00 0.00 ? 17  THR A HG22 2  
ATOM 1944  H HG23 . THR A 1 17  ? 7.773   -0.392  13.626  1.00 0.00 ? 17  THR A HG23 2  
ATOM 1945  N N    . SER A 1 18  ? 9.213   3.461   15.051  1.00 0.00 ? 18  SER A N    2  
ATOM 1946  C CA   . SER A 1 18  ? 9.949   4.713   15.035  1.00 0.00 ? 18  SER A CA   2  
ATOM 1947  C C    . SER A 1 18  ? 9.899   5.333   13.638  1.00 0.00 ? 18  SER A C    2  
ATOM 1948  O O    . SER A 1 18  ? 9.165   6.292   13.405  1.00 0.00 ? 18  SER A O    2  
ATOM 1949  C CB   . SER A 1 18  ? 11.401  4.505   15.472  1.00 0.00 ? 18  SER A CB   2  
ATOM 1950  O OG   . SER A 1 18  ? 11.630  4.967   16.801  1.00 0.00 ? 18  SER A OG   2  
ATOM 1951  H H    . SER A 1 18  ? 8.669   3.281   14.231  1.00 0.00 ? 18  SER A H    2  
ATOM 1952  H HA   . SER A 1 18  ? 9.443   5.355   15.756  1.00 0.00 ? 18  SER A HA   2  
ATOM 1953  H HB3  . SER A 1 18  ? 12.064  5.031   14.786  1.00 0.00 ? 18  SER A HB3  2  
ATOM 1954  H HG   . SER A 1 18  ? 11.243  4.321   17.459  1.00 0.00 ? 18  SER A HG   2  
ATOM 1955  N N    . GLN A 1 19  ? 10.691  4.760   12.742  1.00 0.00 ? 19  GLN A N    2  
ATOM 1956  C CA   . GLN A 1 19  ? 10.747  5.242   11.374  1.00 0.00 ? 19  GLN A CA   2  
ATOM 1957  C C    . GLN A 1 19  ? 10.250  4.164   10.408  1.00 0.00 ? 19  GLN A C    2  
ATOM 1958  O O    . GLN A 1 19  ? 10.981  3.226   10.092  1.00 0.00 ? 19  GLN A O    2  
ATOM 1959  C CB   . GLN A 1 19  ? 12.162  5.695   11.009  1.00 0.00 ? 19  GLN A CB   2  
ATOM 1960  C CG   . GLN A 1 19  ? 12.147  7.096   10.393  1.00 0.00 ? 19  GLN A CG   2  
ATOM 1961  C CD   . GLN A 1 19  ? 13.510  7.774   10.541  1.00 0.00 ? 19  GLN A CD   2  
ATOM 1962  O OE1  . GLN A 1 19  ? 14.433  7.246   11.138  1.00 0.00 ? 19  GLN A OE1  2  
ATOM 1963  N NE2  . GLN A 1 19  ? 13.584  8.972   9.967   1.00 0.00 ? 19  GLN A NE2  2  
ATOM 1964  H H    . GLN A 1 19  ? 11.285  3.979   12.940  1.00 0.00 ? 19  GLN A H    2  
ATOM 1965  H HA   . GLN A 1 19  ? 10.077  6.103   11.342  1.00 0.00 ? 19  GLN A HA   2  
ATOM 1966  H HB3  . GLN A 1 19  ? 12.604  4.989   10.306  1.00 0.00 ? 19  GLN A HB3  2  
ATOM 1967  H HG3  . GLN A 1 19  ? 11.381  7.702   10.874  1.00 0.00 ? 19  GLN A HG3  2  
ATOM 1968  H HE21 . GLN A 1 19  ? 12.789  9.349   9.491   1.00 0.00 ? 19  GLN A HE21 2  
ATOM 1969  H HE22 . GLN A 1 19  ? 14.435  9.495   10.009  1.00 0.00 ? 19  GLN A HE22 2  
ATOM 1970  N N    . GLY A 1 20  ? 9.012   4.331   9.968   1.00 0.00 ? 20  GLY A N    2  
ATOM 1971  C CA   . GLY A 1 20  ? 8.411   3.383   9.046   1.00 0.00 ? 20  GLY A CA   2  
ATOM 1972  C C    . GLY A 1 20  ? 8.178   2.031   9.725   1.00 0.00 ? 20  GLY A C    2  
ATOM 1973  O O    . GLY A 1 20  ? 9.096   1.462   10.312  1.00 0.00 ? 20  GLY A O    2  
ATOM 1974  H H    . GLY A 1 20  ? 8.425   5.097   10.231  1.00 0.00 ? 20  GLY A H    2  
ATOM 1975  H HA2  . GLY A 1 20  ? 7.464   3.779   8.680   1.00 0.00 ? 20  GLY A HA2  2  
ATOM 1976  H HA3  . GLY A 1 20  ? 9.059   3.253   8.179   1.00 0.00 ? 20  GLY A HA3  2  
ATOM 1977  N N    . PHE A 1 21  ? 6.946   1.557   9.618   1.00 0.00 ? 21  PHE A N    2  
ATOM 1978  C CA   . PHE A 1 21  ? 6.582   0.282   10.213  1.00 0.00 ? 21  PHE A CA   2  
ATOM 1979  C C    . PHE A 1 21  ? 7.490   -0.840  9.707   1.00 0.00 ? 21  PHE A C    2  
ATOM 1980  O O    . PHE A 1 21  ? 8.289   -0.632  8.795   1.00 0.00 ? 21  PHE A O    2  
ATOM 1981  C CB   . PHE A 1 21  ? 5.141   -0.014  9.789   1.00 0.00 ? 21  PHE A CB   2  
ATOM 1982  C CG   . PHE A 1 21  ? 4.098   0.883   10.455  1.00 0.00 ? 21  PHE A CG   2  
ATOM 1983  C CD1  . PHE A 1 21  ? 3.760   0.681   11.758  1.00 0.00 ? 21  PHE A CD1  2  
ATOM 1984  C CD2  . PHE A 1 21  ? 3.510   1.885   9.749   1.00 0.00 ? 21  PHE A CD2  2  
ATOM 1985  C CE1  . PHE A 1 21  ? 2.792   1.515   12.378  1.00 0.00 ? 21  PHE A CE1  2  
ATOM 1986  C CE2  . PHE A 1 21  ? 2.542   2.718   10.369  1.00 0.00 ? 21  PHE A CE2  2  
ATOM 1987  C CZ   . PHE A 1 21  ? 2.203   2.516   11.669  1.00 0.00 ? 21  PHE A CZ   2  
ATOM 1988  H H    . PHE A 1 21  ? 6.205   2.026   9.137   1.00 0.00 ? 21  PHE A H    2  
ATOM 1989  H HA   . PHE A 1 21  ? 6.698   0.385   11.291  1.00 0.00 ? 21  PHE A HA   2  
ATOM 1990  H HB3  . PHE A 1 21  ? 4.912   -1.055  10.020  1.00 0.00 ? 21  PHE A HB3  2  
ATOM 1991  H HD1  . PHE A 1 21  ? 4.232   -0.120  12.324  1.00 0.00 ? 21  PHE A HD1  2  
ATOM 1992  H HD2  . PHE A 1 21  ? 3.780   2.047   8.705   1.00 0.00 ? 21  PHE A HD2  2  
ATOM 1993  H HE1  . PHE A 1 21  ? 2.521   1.352   13.421  1.00 0.00 ? 21  PHE A HE1  2  
ATOM 1994  H HE2  . PHE A 1 21  ? 2.069   3.521   9.800   1.00 0.00 ? 21  PHE A HE2  2  
ATOM 1995  H HZ   . PHE A 1 21  ? 1.460   3.155   12.145  1.00 0.00 ? 21  PHE A HZ   2  
ATOM 1996  N N    . GLY A 1 22  ? 7.339   -2.004  10.322  1.00 0.00 ? 22  GLY A N    2  
ATOM 1997  C CA   . GLY A 1 22  ? 8.138   -3.158  9.947   1.00 0.00 ? 22  GLY A CA   2  
ATOM 1998  C C    . GLY A 1 22  ? 7.999   -3.456  8.453   1.00 0.00 ? 22  GLY A C    2  
ATOM 1999  O O    . GLY A 1 22  ? 8.841   -3.049  7.654   1.00 0.00 ? 22  GLY A O    2  
ATOM 2000  H H    . GLY A 1 22  ? 6.688   -2.163  11.064  1.00 0.00 ? 22  GLY A H    2  
ATOM 2001  H HA2  . GLY A 1 22  ? 9.185   -2.976  10.190  1.00 0.00 ? 22  GLY A HA2  2  
ATOM 2002  H HA3  . GLY A 1 22  ? 7.822   -4.026  10.525  1.00 0.00 ? 22  GLY A HA3  2  
ATOM 2003  N N    . PHE A 1 23  ? 6.930   -4.165  8.119   1.00 0.00 ? 23  PHE A N    2  
ATOM 2004  C CA   . PHE A 1 23  ? 6.671   -4.522  6.735   1.00 0.00 ? 23  PHE A CA   2  
ATOM 2005  C C    . PHE A 1 23  ? 6.840   -3.313  5.814   1.00 0.00 ? 23  PHE A C    2  
ATOM 2006  O O    . PHE A 1 23  ? 7.050   -2.196  6.286   1.00 0.00 ? 23  PHE A O    2  
ATOM 2007  C CB   . PHE A 1 23  ? 5.221   -5.006  6.663   1.00 0.00 ? 23  PHE A CB   2  
ATOM 2008  C CG   . PHE A 1 23  ? 4.190   -3.876  6.617   1.00 0.00 ? 23  PHE A CG   2  
ATOM 2009  C CD1  . PHE A 1 23  ? 3.769   -3.292  7.770   1.00 0.00 ? 23  PHE A CD1  2  
ATOM 2010  C CD2  . PHE A 1 23  ? 3.695   -3.454  5.423   1.00 0.00 ? 23  PHE A CD2  2  
ATOM 2011  C CE1  . PHE A 1 23  ? 2.813   -2.245  7.729   1.00 0.00 ? 23  PHE A CE1  2  
ATOM 2012  C CE2  . PHE A 1 23  ? 2.739   -2.406  5.380   1.00 0.00 ? 23  PHE A CE2  2  
ATOM 2013  C CZ   . PHE A 1 23  ? 2.317   -1.823  6.534   1.00 0.00 ? 23  PHE A CZ   2  
ATOM 2014  H H    . PHE A 1 23  ? 6.250   -4.492  8.774   1.00 0.00 ? 23  PHE A H    2  
ATOM 2015  H HA   . PHE A 1 23  ? 7.394   -5.291  6.458   1.00 0.00 ? 23  PHE A HA   2  
ATOM 2016  H HB3  . PHE A 1 23  ? 5.014   -5.637  7.526   1.00 0.00 ? 23  PHE A HB3  2  
ATOM 2017  H HD1  . PHE A 1 23  ? 4.164   -3.632  8.728   1.00 0.00 ? 23  PHE A HD1  2  
ATOM 2018  H HD2  . PHE A 1 23  ? 4.033   -3.921  4.497   1.00 0.00 ? 23  PHE A HD2  2  
ATOM 2019  H HE1  . PHE A 1 23  ? 2.475   -1.777  8.654   1.00 0.00 ? 23  PHE A HE1  2  
ATOM 2020  H HE2  . PHE A 1 23  ? 2.343   -2.068  4.423   1.00 0.00 ? 23  PHE A HE2  2  
ATOM 2021  H HZ   . PHE A 1 23  ? 1.583   -1.018  6.502   1.00 0.00 ? 23  PHE A HZ   2  
ATOM 2022  N N    . THR A 1 24  ? 6.740   -3.574  4.520   1.00 0.00 ? 24  THR A N    2  
ATOM 2023  C CA   . THR A 1 24  ? 6.877   -2.520  3.530   1.00 0.00 ? 24  THR A CA   2  
ATOM 2024  C C    . THR A 1 24  ? 6.002   -2.816  2.310   1.00 0.00 ? 24  THR A C    2  
ATOM 2025  O O    . THR A 1 24  ? 5.500   -3.928  2.158   1.00 0.00 ? 24  THR A O    2  
ATOM 2026  C CB   . THR A 1 24  ? 8.364   -2.382  3.191   1.00 0.00 ? 24  THR A CB   2  
ATOM 2027  O OG1  . THR A 1 24  ? 8.403   -1.345  2.215   1.00 0.00 ? 24  THR A OG1  2  
ATOM 2028  C CG2  . THR A 1 24  ? 8.914   -3.606  2.457   1.00 0.00 ? 24  THR A CG2  2  
ATOM 2029  H H    . THR A 1 24  ? 6.567   -4.486  4.146   1.00 0.00 ? 24  THR A H    2  
ATOM 2030  H HA   . THR A 1 24  ? 6.516   -1.589  3.966   1.00 0.00 ? 24  THR A HA   2  
ATOM 2031  H HB   . THR A 1 24  ? 8.949   -2.170  4.087   1.00 0.00 ? 24  THR A HB   2  
ATOM 2032  H HG1  . THR A 1 24  ? 9.350   -1.145  1.966   1.00 0.00 ? 24  THR A HG1  2  
ATOM 2033  H HG21 . THR A 1 24  ? 10.003  -3.598  2.501   1.00 0.00 ? 24  THR A HG21 2  
ATOM 2034  H HG22 . THR A 1 24  ? 8.539   -4.514  2.932   1.00 0.00 ? 24  THR A HG22 2  
ATOM 2035  H HG23 . THR A 1 24  ? 8.592   -3.580  1.416   1.00 0.00 ? 24  THR A HG23 2  
ATOM 2036  N N    . LEU A 1 25  ? 5.845   -1.800  1.474   1.00 0.00 ? 25  LEU A N    2  
ATOM 2037  C CA   . LEU A 1 25  ? 5.039   -1.936  0.274   1.00 0.00 ? 25  LEU A CA   2  
ATOM 2038  C C    . LEU A 1 25  ? 5.953   -1.916  -0.954  1.00 0.00 ? 25  LEU A C    2  
ATOM 2039  O O    . LEU A 1 25  ? 7.131   -1.577  -0.849  1.00 0.00 ? 25  LEU A O    2  
ATOM 2040  C CB   . LEU A 1 25  ? 3.943   -0.870  0.242   1.00 0.00 ? 25  LEU A CB   2  
ATOM 2041  C CG   . LEU A 1 25  ? 2.954   -0.889  1.409   1.00 0.00 ? 25  LEU A CG   2  
ATOM 2042  C CD1  . LEU A 1 25  ? 2.562   -2.323  1.773   1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2043  C CD2  . LEU A 1 25  ? 3.511   -0.124  2.611   1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2044  H H    . LEU A 1 25  ? 6.257   -0.899  1.608   1.00 0.00 ? 25  LEU A H    2  
ATOM 2045  H HA   . LEU A 1 25  ? 4.544   -2.907  0.321   1.00 0.00 ? 25  LEU A HA   2  
ATOM 2046  H HB3  . LEU A 1 25  ? 3.381   -0.984  -0.687  1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2047  H HG   . LEU A 1 25  ? 2.044   -0.378  1.094   1.00 0.00 ? 25  LEU A HG   2  
ATOM 2048  H HD11 . LEU A 1 25  ? 1.559   -2.329  2.199   1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2049  H HD12 . LEU A 1 25  ? 2.582   -2.943  0.877   1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2050  H HD13 . LEU A 1 25  ? 3.270   -2.718  2.502   1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2051  H HD21 . LEU A 1 25  ? 3.622   -0.805  3.454   1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2052  H HD22 . LEU A 1 25  ? 4.481   0.299   2.355   1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2053  H HD23 . LEU A 1 25  ? 2.823   0.678   2.880   1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2054  N N    . ARG A 1 26  ? 5.375   -2.284  -2.088  1.00 0.00 ? 26  ARG A N    2  
ATOM 2055  C CA   . ARG A 1 26  ? 6.122   -2.313  -3.333  1.00 0.00 ? 26  ARG A CA   2  
ATOM 2056  C C    . ARG A 1 26  ? 5.406   -1.483  -4.401  1.00 0.00 ? 26  ARG A C    2  
ATOM 2057  O O    . ARG A 1 26  ? 4.196   -1.273  -4.321  1.00 0.00 ? 26  ARG A O    2  
ATOM 2058  C CB   . ARG A 1 26  ? 6.292   -3.746  -3.841  1.00 0.00 ? 26  ARG A CB   2  
ATOM 2059  C CG   . ARG A 1 26  ? 7.631   -3.917  -4.562  1.00 0.00 ? 26  ARG A CG   2  
ATOM 2060  C CD   . ARG A 1 26  ? 7.418   -4.353  -6.013  1.00 0.00 ? 26  ARG A CD   2  
ATOM 2061  N NE   . ARG A 1 26  ? 7.530   -5.826  -6.120  1.00 0.00 ? 26  ARG A NE   2  
ATOM 2062  C CZ   . ARG A 1 26  ? 8.690   -6.496  -6.087  1.00 0.00 ? 26  ARG A CZ   2  
ATOM 2063  N NH1  . ARG A 1 26  ? 9.845   -5.831  -5.950  1.00 0.00 ? 26  ARG A NH1  2  
ATOM 2064  N NH2  . ARG A 1 26  ? 8.694   -7.833  -6.191  1.00 0.00 ? 26  ARG A NH2  2  
ATOM 2065  H H    . ARG A 1 26  ? 4.416   -2.559  -2.163  1.00 0.00 ? 26  ARG A H    2  
ATOM 2066  H HA   . ARG A 1 26  ? 7.092   -1.881  -3.086  1.00 0.00 ? 26  ARG A HA   2  
ATOM 2067  H HB3  . ARG A 1 26  ? 5.475   -3.997  -4.518  1.00 0.00 ? 26  ARG A HB3  2  
ATOM 2068  H HG3  . ARG A 1 26  ? 8.237   -4.658  -4.040  1.00 0.00 ? 26  ARG A HG3  2  
ATOM 2069  H HD3  . ARG A 1 26  ? 8.159   -3.878  -6.657  1.00 0.00 ? 26  ARG A HD3  2  
ATOM 2070  H HE   . ARG A 1 26  ? 6.686   -6.352  -6.225  1.00 0.00 ? 26  ARG A HE   2  
ATOM 2071  H HH11 . ARG A 1 26  ? 9.841   -4.834  -5.871  1.00 0.00 ? 26  ARG A HH11 2  
ATOM 2072  H HH12 . ARG A 1 26  ? 10.711  -6.331  -5.924  1.00 0.00 ? 26  ARG A HH12 2  
ATOM 2073  H HH21 . ARG A 1 26  ? 7.833   -8.328  -6.294  1.00 0.00 ? 26  ARG A HH21 2  
ATOM 2074  H HH22 . ARG A 1 26  ? 9.559   -8.333  -6.167  1.00 0.00 ? 26  ARG A HH22 2  
ATOM 2075  N N    . HIS A 1 27  ? 6.184   -1.035  -5.376  1.00 0.00 ? 27  HIS A N    2  
ATOM 2076  C CA   . HIS A 1 27  ? 5.638   -0.233  -6.459  1.00 0.00 ? 27  HIS A CA   2  
ATOM 2077  C C    . HIS A 1 27  ? 5.222   1.138   -5.922  1.00 0.00 ? 27  HIS A C    2  
ATOM 2078  O O    . HIS A 1 27  ? 4.766   1.251   -4.786  1.00 0.00 ? 27  HIS A O    2  
ATOM 2079  C CB   . HIS A 1 27  ? 4.492   -0.970  -7.156  1.00 0.00 ? 27  HIS A CB   2  
ATOM 2080  C CG   . HIS A 1 27  ? 4.814   -1.408  -8.566  1.00 0.00 ? 27  HIS A CG   2  
ATOM 2081  N ND1  . HIS A 1 27  ? 3.856   -1.486  -9.562  1.00 0.00 ? 27  HIS A ND1  2  
ATOM 2082  C CD2  . HIS A 1 27  ? 5.994   -1.792  -9.133  1.00 0.00 ? 27  HIS A CD2  2  
ATOM 2083  C CE1  . HIS A 1 27  ? 4.445   -1.899  -10.675 1.00 0.00 ? 27  HIS A CE1  2  
ATOM 2084  N NE2  . HIS A 1 27  ? 5.769   -2.087  -10.407 1.00 0.00 ? 27  HIS A NE2  2  
ATOM 2085  H H    . HIS A 1 27  ? 7.165   -1.210  -5.434  1.00 0.00 ? 27  HIS A H    2  
ATOM 2086  H HA   . HIS A 1 27  ? 6.440   -0.102  -7.185  1.00 0.00 ? 27  HIS A HA   2  
ATOM 2087  H HB3  . HIS A 1 27  ? 3.618   -0.320  -7.180  1.00 0.00 ? 27  HIS A HB3  2  
ATOM 2088  H HD1  . HIS A 1 27  ? 2.887   -1.268  -9.461  1.00 0.00 ? 27  HIS A HD1  2  
ATOM 2089  H HD2  . HIS A 1 27  ? 6.957   -1.844  -8.626  1.00 0.00 ? 27  HIS A HD2  2  
ATOM 2090  H HE1  . HIS A 1 27  ? 3.957   -2.060  -11.636 1.00 0.00 ? 27  HIS A HE1  2  
ATOM 2091  N N    . PHE A 1 28  ? 5.394   2.144   -6.766  1.00 0.00 ? 28  PHE A N    2  
ATOM 2092  C CA   . PHE A 1 28  ? 5.042   3.505   -6.390  1.00 0.00 ? 28  PHE A CA   2  
ATOM 2093  C C    . PHE A 1 28  ? 3.885   4.026   -7.244  1.00 0.00 ? 28  PHE A C    2  
ATOM 2094  O O    . PHE A 1 28  ? 2.903   4.546   -6.714  1.00 0.00 ? 28  PHE A O    2  
ATOM 2095  C CB   . PHE A 1 28  ? 6.276   4.371   -6.643  1.00 0.00 ? 28  PHE A CB   2  
ATOM 2096  C CG   . PHE A 1 28  ? 6.226   5.741   -5.962  1.00 0.00 ? 28  PHE A CG   2  
ATOM 2097  C CD1  . PHE A 1 28  ? 6.467   5.846   -4.628  1.00 0.00 ? 28  PHE A CD1  2  
ATOM 2098  C CD2  . PHE A 1 28  ? 5.937   6.852   -6.691  1.00 0.00 ? 28  PHE A CD2  2  
ATOM 2099  C CE1  . PHE A 1 28  ? 6.420   7.117   -3.995  1.00 0.00 ? 28  PHE A CE1  2  
ATOM 2100  C CE2  . PHE A 1 28  ? 5.889   8.122   -6.058  1.00 0.00 ? 28  PHE A CE2  2  
ATOM 2101  C CZ   . PHE A 1 28  ? 6.131   8.228   -4.725  1.00 0.00 ? 28  PHE A CZ   2  
ATOM 2102  H H    . PHE A 1 28  ? 5.767   2.044   -7.687  1.00 0.00 ? 28  PHE A H    2  
ATOM 2103  H HA   . PHE A 1 28  ? 4.740   3.482   -5.344  1.00 0.00 ? 28  PHE A HA   2  
ATOM 2104  H HB3  . PHE A 1 28  ? 6.393   4.516   -7.718  1.00 0.00 ? 28  PHE A HB3  2  
ATOM 2105  H HD1  . PHE A 1 28  ? 6.699   4.955   -4.045  1.00 0.00 ? 28  PHE A HD1  2  
ATOM 2106  H HD2  . PHE A 1 28  ? 5.742   6.767   -7.760  1.00 0.00 ? 28  PHE A HD2  2  
ATOM 2107  H HE1  . PHE A 1 28  ? 6.615   7.201   -2.927  1.00 0.00 ? 28  PHE A HE1  2  
ATOM 2108  H HE2  . PHE A 1 28  ? 5.658   9.014   -6.642  1.00 0.00 ? 28  PHE A HE2  2  
ATOM 2109  H HZ   . PHE A 1 28  ? 6.094   9.203   -4.240  1.00 0.00 ? 28  PHE A HZ   2  
ATOM 2110  N N    . ILE A 1 29  ? 4.036   3.868   -8.551  1.00 0.00 ? 29  ILE A N    2  
ATOM 2111  C CA   . ILE A 1 29  ? 3.015   4.316   -9.482  1.00 0.00 ? 29  ILE A CA   2  
ATOM 2112  C C    . ILE A 1 29  ? 2.461   5.664   -9.015  1.00 0.00 ? 29  ILE A C    2  
ATOM 2113  O O    . ILE A 1 29  ? 1.446   5.716   -8.320  1.00 0.00 ? 29  ILE A O    2  
ATOM 2114  C CB   . ILE A 1 29  ? 1.942   3.240   -9.660  1.00 0.00 ? 29  ILE A CB   2  
ATOM 2115  C CG1  . ILE A 1 29  ? 2.551   1.943   -10.197 1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2116  C CG2  . ILE A 1 29  ? 0.799   3.745   -10.544 1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2117  C CD1  . ILE A 1 29  ? 1.476   0.871   -10.392 1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2118  H H    . ILE A 1 29  ? 4.836   3.445   -8.974  1.00 0.00 ? 29  ILE A H    2  
ATOM 2119  H HA   . ILE A 1 29  ? 3.495   4.457   -10.450 1.00 0.00 ? 29  ILE A HA   2  
ATOM 2120  H HB   . ILE A 1 29  ? 1.517   3.016   -8.682  1.00 0.00 ? 29  ILE A HB   2  
ATOM 2121  H HG13 . ILE A 1 29  ? 3.311   1.579   -9.504  1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2122  H HG21 . ILE A 1 29  ? 0.752   3.146   -11.452 1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2123  H HG22 . ILE A 1 29  ? -0.143  3.661   -10.002 1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2124  H HG23 . ILE A 1 29  ? 0.977   4.789   -10.805 1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2125  H HD11 . ILE A 1 29  ? 1.626   0.376   -11.351 1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2126  H HD12 . ILE A 1 29  ? 1.546   0.138   -9.588  1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2127  H HD13 . ILE A 1 29  ? 0.491   1.339   -10.375 1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2128  N N    . VAL A 1 30  ? 3.152   6.723   -9.414  1.00 0.00 ? 30  VAL A N    2  
ATOM 2129  C CA   . VAL A 1 30  ? 2.742   8.066   -9.045  1.00 0.00 ? 30  VAL A CA   2  
ATOM 2130  C C    . VAL A 1 30  ? 1.670   8.554   -10.021 1.00 0.00 ? 30  VAL A C    2  
ATOM 2131  O O    . VAL A 1 30  ? 1.718   8.237   -11.209 1.00 0.00 ? 30  VAL A O    2  
ATOM 2132  C CB   . VAL A 1 30  ? 3.962   8.987   -8.986  1.00 0.00 ? 30  VAL A CB   2  
ATOM 2133  C CG1  . VAL A 1 30  ? 4.589   9.157   -10.372 1.00 0.00 ? 30  VAL A CG1  2  
ATOM 2134  C CG2  . VAL A 1 30  ? 3.597   10.344  -8.380  1.00 0.00 ? 30  VAL A CG2  2  
ATOM 2135  H H    . VAL A 1 30  ? 3.976   6.672   -9.978  1.00 0.00 ? 30  VAL A H    2  
ATOM 2136  H HA   . VAL A 1 30  ? 2.309   8.015   -8.045  1.00 0.00 ? 30  VAL A HA   2  
ATOM 2137  H HB   . VAL A 1 30  ? 4.705   8.521   -8.339  1.00 0.00 ? 30  VAL A HB   2  
ATOM 2138  H HG11 . VAL A 1 30  ? 3.804   9.139   -11.129 1.00 0.00 ? 30  VAL A HG11 2  
ATOM 2139  H HG12 . VAL A 1 30  ? 5.117   10.110  -10.418 1.00 0.00 ? 30  VAL A HG12 2  
ATOM 2140  H HG13 . VAL A 1 30  ? 5.290   8.344   -10.555 1.00 0.00 ? 30  VAL A HG13 2  
ATOM 2141  H HG21 . VAL A 1 30  ? 2.694   10.724  -8.857  1.00 0.00 ? 30  VAL A HG21 2  
ATOM 2142  H HG22 . VAL A 1 30  ? 3.421   10.229  -7.310  1.00 0.00 ? 30  VAL A HG22 2  
ATOM 2143  H HG23 . VAL A 1 30  ? 4.416   11.046  -8.539  1.00 0.00 ? 30  VAL A HG23 2  
ATOM 2144  N N    . TYR A 1 31  ? 0.730   9.318   -9.485  1.00 0.00 ? 31  TYR A N    2  
ATOM 2145  C CA   . TYR A 1 31  ? -0.352  9.853   -10.295 1.00 0.00 ? 31  TYR A CA   2  
ATOM 2146  C C    . TYR A 1 31  ? -0.381  11.382  -10.229 1.00 0.00 ? 31  TYR A C    2  
ATOM 2147  O O    . TYR A 1 31  ? -1.205  11.961  -9.523  1.00 0.00 ? 31  TYR A O    2  
ATOM 2148  C CB   . TYR A 1 31  ? -1.644  9.303   -9.689  1.00 0.00 ? 31  TYR A CB   2  
ATOM 2149  C CG   . TYR A 1 31  ? -1.559  7.835   -9.269  1.00 0.00 ? 31  TYR A CG   2  
ATOM 2150  C CD1  . TYR A 1 31  ? -1.056  7.501   -8.027  1.00 0.00 ? 31  TYR A CD1  2  
ATOM 2151  C CD2  . TYR A 1 31  ? -1.983  6.844   -10.130 1.00 0.00 ? 31  TYR A CD2  2  
ATOM 2152  C CE1  . TYR A 1 31  ? -0.976  6.118   -7.632  1.00 0.00 ? 31  TYR A CE1  2  
ATOM 2153  C CE2  . TYR A 1 31  ? -1.903  5.462   -9.734  1.00 0.00 ? 31  TYR A CE2  2  
ATOM 2154  C CZ   . TYR A 1 31  ? -1.403  5.167   -8.505  1.00 0.00 ? 31  TYR A CZ   2  
ATOM 2155  O OH   . TYR A 1 31  ? -1.327  3.862   -8.130  1.00 0.00 ? 31  TYR A OH   2  
ATOM 2156  H H    . TYR A 1 31  ? 0.700   9.572   -8.518  1.00 0.00 ? 31  TYR A H    2  
ATOM 2157  H HA   . TYR A 1 31  ? -0.183  9.545   -11.327 1.00 0.00 ? 31  TYR A HA   2  
ATOM 2158  H HB3  . TYR A 1 31  ? -2.450  9.416   -10.414 1.00 0.00 ? 31  TYR A HB3  2  
ATOM 2159  H HD1  . TYR A 1 31  ? -0.720  8.283   -7.346  1.00 0.00 ? 31  TYR A HD1  2  
ATOM 2160  H HD2  . TYR A 1 31  ? -2.380  7.108   -11.110 1.00 0.00 ? 31  TYR A HD2  2  
ATOM 2161  H HE1  . TYR A 1 31  ? -0.580  5.840   -6.654  1.00 0.00 ? 31  TYR A HE1  2  
ATOM 2162  H HE2  . TYR A 1 31  ? -2.235  4.669   -10.406 1.00 0.00 ? 31  TYR A HE2  2  
ATOM 2163  H HH   . TYR A 1 31  ? -0.526  3.719   -7.549  1.00 0.00 ? 31  TYR A HH   2  
ATOM 2164  N N    . PRO A 1 32  ? 0.553   12.008  -10.995 1.00 0.00 ? 32  PRO A N    2  
ATOM 2165  C CA   . PRO A 1 32  ? 0.641   13.459  -11.029 1.00 0.00 ? 32  PRO A CA   2  
ATOM 2166  C C    . PRO A 1 32  ? -0.495  14.057  -11.863 1.00 0.00 ? 32  PRO A C    2  
ATOM 2167  O O    . PRO A 1 32  ? -0.963  13.437  -12.816 1.00 0.00 ? 32  PRO A O    2  
ATOM 2168  C CB   . PRO A 1 32  ? 2.017   13.755  -11.601 1.00 0.00 ? 32  PRO A CB   2  
ATOM 2169  C CG   . PRO A 1 32  ? 2.465   12.478  -12.295 1.00 0.00 ? 32  PRO A CG   2  
ATOM 2170  C CD   . PRO A 1 32  ? 1.546   11.355  -11.842 1.00 0.00 ? 32  PRO A CD   2  
ATOM 2171  H HA   . PRO A 1 32  ? 0.532   13.835  -10.110 1.00 0.00 ? 32  PRO A HA   2  
ATOM 2172  H HB3  . PRO A 1 32  ? 2.715   14.036  -10.812 1.00 0.00 ? 32  PRO A HB3  2  
ATOM 2173  H HG3  . PRO A 1 32  ? 3.501   12.249  -12.042 1.00 0.00 ? 32  PRO A HG3  2  
ATOM 2174  H HD3  . PRO A 1 32  ? 2.094   10.590  -11.294 1.00 0.00 ? 32  PRO A HD3  2  
ATOM 2175  N N    . PRO A 1 33  ? -0.914  15.286  -11.463 1.00 0.00 ? 33  PRO A N    2  
ATOM 2176  C CA   . PRO A 1 33  ? -1.985  15.976  -12.162 1.00 0.00 ? 33  PRO A CA   2  
ATOM 2177  C C    . PRO A 1 33  ? -1.495  16.539  -13.498 1.00 0.00 ? 33  PRO A C    2  
ATOM 2178  O O    . PRO A 1 33  ? -0.292  16.671  -13.715 1.00 0.00 ? 33  PRO A O    2  
ATOM 2179  C CB   . PRO A 1 33  ? -2.454  17.053  -11.199 1.00 0.00 ? 33  PRO A CB   2  
ATOM 2180  C CG   . PRO A 1 33  ? -1.330  17.230  -10.192 1.00 0.00 ? 33  PRO A CG   2  
ATOM 2181  C CD   . PRO A 1 33  ? -0.383  16.051  -10.339 1.00 0.00 ? 33  PRO A CD   2  
ATOM 2182  H HA   . PRO A 1 33  ? -2.720  15.336  -12.389 1.00 0.00 ? 33  PRO A HA   2  
ATOM 2183  H HB3  . PRO A 1 33  ? -3.379  16.759  -10.703 1.00 0.00 ? 33  PRO A HB3  2  
ATOM 2184  H HG3  . PRO A 1 33  ? -1.728  17.277  -9.179  1.00 0.00 ? 33  PRO A HG3  2  
ATOM 2185  H HD3  . PRO A 1 33  ? -0.354  15.452  -9.430  1.00 0.00 ? 33  PRO A HD3  2  
ATOM 2186  N N    . GLU A 1 34  ? -2.452  16.857  -14.356 1.00 0.00 ? 34  GLU A N    2  
ATOM 2187  C CA   . GLU A 1 34  ? -2.132  17.405  -15.664 1.00 0.00 ? 34  GLU A CA   2  
ATOM 2188  C C    . GLU A 1 34  ? -1.597  18.831  -15.528 1.00 0.00 ? 34  GLU A C    2  
ATOM 2189  O O    . GLU A 1 34  ? -2.230  19.678  -14.902 1.00 0.00 ? 34  GLU A O    2  
ATOM 2190  C CB   . GLU A 1 34  ? -3.351  17.363  -16.588 1.00 0.00 ? 34  GLU A CB   2  
ATOM 2191  C CG   . GLU A 1 34  ? -3.044  16.584  -17.868 1.00 0.00 ? 34  GLU A CG   2  
ATOM 2192  C CD   . GLU A 1 34  ? -4.262  15.782  -18.329 1.00 0.00 ? 34  GLU A CD   2  
ATOM 2193  O OE1  . GLU A 1 34  ? -5.239  16.432  -18.761 1.00 0.00 ? 34  GLU A OE1  2  
ATOM 2194  O OE2  . GLU A 1 34  ? -4.190  14.537  -18.239 1.00 0.00 ? 34  GLU A OE2  2  
ATOM 2195  H H    . GLU A 1 34  ? -3.428  16.747  -14.171 1.00 0.00 ? 34  GLU A H    2  
ATOM 2196  H HA   . GLU A 1 34  ? -1.356  16.754  -16.068 1.00 0.00 ? 34  GLU A HA   2  
ATOM 2197  H HB3  . GLU A 1 34  ? -3.654  18.379  -16.841 1.00 0.00 ? 34  GLU A HB3  2  
ATOM 2198  H HG3  . GLU A 1 34  ? -2.205  15.911  -17.695 1.00 0.00 ? 34  GLU A HG3  2  
ATOM 2199  N N    . SER A 1 35  ? -0.433  19.050  -16.121 1.00 0.00 ? 35  SER A N    2  
ATOM 2200  C CA   . SER A 1 35  ? 0.196   20.359  -16.074 1.00 0.00 ? 35  SER A CA   2  
ATOM 2201  C C    . SER A 1 35  ? 0.636   20.677  -14.643 1.00 0.00 ? 35  SER A C    2  
ATOM 2202  O O    . SER A 1 35  ? 1.830   20.777  -14.365 1.00 0.00 ? 35  SER A O    2  
ATOM 2203  C CB   . SER A 1 35  ? -0.749  21.445  -16.591 1.00 0.00 ? 35  SER A CB   2  
ATOM 2204  O OG   . SER A 1 35  ? -0.124  22.725  -16.630 1.00 0.00 ? 35  SER A OG   2  
ATOM 2205  H H    . SER A 1 35  ? 0.077   18.355  -16.629 1.00 0.00 ? 35  SER A H    2  
ATOM 2206  H HA   . SER A 1 35  ? 1.061   20.289  -16.732 1.00 0.00 ? 35  SER A HA   2  
ATOM 2207  H HB3  . SER A 1 35  ? -1.632  21.492  -15.950 1.00 0.00 ? 35  SER A HB3  2  
ATOM 2208  H HG   . SER A 1 35  ? -0.377  23.203  -17.470 1.00 0.00 ? 35  SER A HG   2  
ATOM 2209  N N    . ALA A 1 36  ? -0.353  20.825  -13.773 1.00 0.00 ? 36  ALA A N    2  
ATOM 2210  C CA   . ALA A 1 36  ? -0.082  21.129  -12.378 1.00 0.00 ? 36  ALA A CA   2  
ATOM 2211  C C    . ALA A 1 36  ? 0.553   22.517  -12.277 1.00 0.00 ? 36  ALA A C    2  
ATOM 2212  O O    . ALA A 1 36  ? 1.212   22.971  -13.210 1.00 0.00 ? 36  ALA A O    2  
ATOM 2213  C CB   . ALA A 1 36  ? 0.805   20.035  -11.779 1.00 0.00 ? 36  ALA A CB   2  
ATOM 2214  H H    . ALA A 1 36  ? -1.322  20.742  -14.008 1.00 0.00 ? 36  ALA A H    2  
ATOM 2215  H HA   . ALA A 1 36  ? -1.036  21.135  -11.849 1.00 0.00 ? 36  ALA A HA   2  
ATOM 2216  H HB1  . ALA A 1 36  ? 1.848   20.240  -12.023 1.00 0.00 ? 36  ALA A HB1  2  
ATOM 2217  H HB2  . ALA A 1 36  ? 0.682   20.019  -10.698 1.00 0.00 ? 36  ALA A HB2  2  
ATOM 2218  H HB3  . ALA A 1 36  ? 0.518   19.068  -12.192 1.00 0.00 ? 36  ALA A HB3  2  
ATOM 2219  N N    . ILE A 1 37  ? 0.333   23.152  -11.134 1.00 0.00 ? 37  ILE A N    2  
ATOM 2220  C CA   . ILE A 1 37  ? 0.877   24.478  -10.898 1.00 0.00 ? 37  ILE A CA   2  
ATOM 2221  C C    . ILE A 1 37  ? 2.223   24.353  -10.181 1.00 0.00 ? 37  ILE A C    2  
ATOM 2222  O O    . ILE A 1 37  ? 3.240   24.060  -10.808 1.00 0.00 ? 37  ILE A O    2  
ATOM 2223  C CB   . ILE A 1 37  ? -0.138  25.348  -10.155 1.00 0.00 ? 37  ILE A CB   2  
ATOM 2224  C CG1  . ILE A 1 37  ? -1.435  25.485  -10.955 1.00 0.00 ? 37  ILE A CG1  2  
ATOM 2225  C CG2  . ILE A 1 37  ? 0.463   26.710  -9.801  1.00 0.00 ? 37  ILE A CG2  2  
ATOM 2226  C CD1  . ILE A 1 37  ? -2.656  25.400  -10.039 1.00 0.00 ? 37  ILE A CD1  2  
ATOM 2227  H H    . ILE A 1 37  ? -0.203  22.774  -10.379 1.00 0.00 ? 37  ILE A H    2  
ATOM 2228  H HA   . ILE A 1 37  ? 1.045   24.940  -11.871 1.00 0.00 ? 37  ILE A HA   2  
ATOM 2229  H HB   . ILE A 1 37  ? -0.389  24.854  -9.216  1.00 0.00 ? 37  ILE A HB   2  
ATOM 2230  H HG13 . ILE A 1 37  ? -1.485  24.699  -11.708 1.00 0.00 ? 37  ILE A HG13 2  
ATOM 2231  H HG21 . ILE A 1 37  ? 0.917   26.660  -8.810  1.00 0.00 ? 37  ILE A HG21 2  
ATOM 2232  H HG22 . ILE A 1 37  ? 1.224   26.974  -10.535 1.00 0.00 ? 37  ILE A HG22 2  
ATOM 2233  H HG23 . ILE A 1 37  ? -0.322  27.466  -9.802  1.00 0.00 ? 37  ILE A HG23 2  
ATOM 2234  H HD11 . ILE A 1 37  ? -2.331  25.391  -9.000  1.00 0.00 ? 37  ILE A HD11 2  
ATOM 2235  H HD12 . ILE A 1 37  ? -3.300  26.263  -10.211 1.00 0.00 ? 37  ILE A HD12 2  
ATOM 2236  H HD13 . ILE A 1 37  ? -3.209  24.486  -10.255 1.00 0.00 ? 37  ILE A HD13 2  
ATOM 2237  N N    . GLN A 1 38  ? 2.185   24.583  -8.877  1.00 0.00 ? 38  GLN A N    2  
ATOM 2238  C CA   . GLN A 1 38  ? 3.390   24.499  -8.068  1.00 0.00 ? 38  GLN A CA   2  
ATOM 2239  C C    . GLN A 1 38  ? 3.428   23.171  -7.309  1.00 0.00 ? 38  GLN A C    2  
ATOM 2240  O O    . GLN A 1 38  ? 4.349   22.377  -7.487  1.00 0.00 ? 38  GLN A O    2  
ATOM 2241  C CB   . GLN A 1 38  ? 3.485   25.684  -7.104  1.00 0.00 ? 38  GLN A CB   2  
ATOM 2242  C CG   . GLN A 1 38  ? 4.867   26.336  -7.173  1.00 0.00 ? 38  GLN A CG   2  
ATOM 2243  C CD   . GLN A 1 38  ? 4.765   27.791  -7.638  1.00 0.00 ? 38  GLN A CD   2  
ATOM 2244  O OE1  . GLN A 1 38  ? 4.830   28.725  -6.856  1.00 0.00 ? 38  GLN A OE1  2  
ATOM 2245  N NE2  . GLN A 1 38  ? 4.599   27.930  -8.950  1.00 0.00 ? 38  GLN A NE2  2  
ATOM 2246  H H    . GLN A 1 38  ? 1.354   24.820  -8.374  1.00 0.00 ? 38  GLN A H    2  
ATOM 2247  H HA   . GLN A 1 38  ? 4.218   24.546  -8.774  1.00 0.00 ? 38  GLN A HA   2  
ATOM 2248  H HB3  . GLN A 1 38  ? 3.289   25.346  -6.086  1.00 0.00 ? 38  GLN A HB3  2  
ATOM 2249  H HG3  . GLN A 1 38  ? 5.504   25.776  -7.858  1.00 0.00 ? 38  GLN A HG3  2  
ATOM 2250  H HE21 . GLN A 1 38  ? 4.552   27.120  -9.537  1.00 0.00 ? 38  GLN A HE21 2  
ATOM 2251  H HE22 . GLN A 1 38  ? 4.521   28.842  -9.350  1.00 0.00 ? 38  GLN A HE22 2  
ATOM 2252  N N    . PHE A 1 39  ? 2.416   22.971  -6.477  1.00 0.00 ? 39  PHE A N    2  
ATOM 2253  C CA   . PHE A 1 39  ? 2.323   21.753  -5.691  1.00 0.00 ? 39  PHE A CA   2  
ATOM 2254  C C    . PHE A 1 39  ? 3.571   21.562  -4.826  1.00 0.00 ? 39  PHE A C    2  
ATOM 2255  O O    . PHE A 1 39  ? 4.659   21.317  -5.346  1.00 0.00 ? 39  PHE A O    2  
ATOM 2256  C CB   . PHE A 1 39  ? 2.219   20.590  -6.679  1.00 0.00 ? 39  PHE A CB   2  
ATOM 2257  C CG   . PHE A 1 39  ? 2.018   19.225  -6.016  1.00 0.00 ? 39  PHE A CG   2  
ATOM 2258  C CD1  . PHE A 1 39  ? 3.097   18.477  -5.659  1.00 0.00 ? 39  PHE A CD1  2  
ATOM 2259  C CD2  . PHE A 1 39  ? 0.762   18.761  -5.781  1.00 0.00 ? 39  PHE A CD2  2  
ATOM 2260  C CE1  . PHE A 1 39  ? 2.911   17.211  -5.044  1.00 0.00 ? 39  PHE A CE1  2  
ATOM 2261  C CE2  . PHE A 1 39  ? 0.577   17.495  -5.165  1.00 0.00 ? 39  PHE A CE2  2  
ATOM 2262  C CZ   . PHE A 1 39  ? 1.655   16.747  -4.810  1.00 0.00 ? 39  PHE A CZ   2  
ATOM 2263  H H    . PHE A 1 39  ? 1.670   23.623  -6.339  1.00 0.00 ? 39  PHE A H    2  
ATOM 2264  H HA   . PHE A 1 39  ? 1.448   21.849  -5.048  1.00 0.00 ? 39  PHE A HA   2  
ATOM 2265  H HB3  . PHE A 1 39  ? 3.125   20.558  -7.285  1.00 0.00 ? 39  PHE A HB3  2  
ATOM 2266  H HD1  . PHE A 1 39  ? 4.104   18.850  -5.847  1.00 0.00 ? 39  PHE A HD1  2  
ATOM 2267  H HD2  . PHE A 1 39  ? -0.102  19.360  -6.066  1.00 0.00 ? 39  PHE A HD2  2  
ATOM 2268  H HE1  . PHE A 1 39  ? 3.776   16.612  -4.759  1.00 0.00 ? 39  PHE A HE1  2  
ATOM 2269  H HE2  . PHE A 1 39  ? -0.431  17.123  -4.977  1.00 0.00 ? 39  PHE A HE2  2  
ATOM 2270  H HZ   . PHE A 1 39  ? 1.512   15.775  -4.337  1.00 0.00 ? 39  PHE A HZ   2  
ATOM 2271  N N    . SER A 1 40  ? 3.372   21.681  -3.522  1.00 0.00 ? 40  SER A N    2  
ATOM 2272  C CA   . SER A 1 40  ? 4.467   21.525  -2.580  1.00 0.00 ? 40  SER A CA   2  
ATOM 2273  C C    . SER A 1 40  ? 4.111   20.466  -1.534  1.00 0.00 ? 40  SER A C    2  
ATOM 2274  O O    . SER A 1 40  ? 2.942   20.297  -1.190  1.00 0.00 ? 40  SER A O    2  
ATOM 2275  C CB   . SER A 1 40  ? 4.801   22.853  -1.898  1.00 0.00 ? 40  SER A CB   2  
ATOM 2276  O OG   . SER A 1 40  ? 5.714   23.633  -2.666  1.00 0.00 ? 40  SER A OG   2  
ATOM 2277  H H    . SER A 1 40  ? 2.484   21.880  -3.108  1.00 0.00 ? 40  SER A H    2  
ATOM 2278  H HA   . SER A 1 40  ? 5.318   21.200  -3.179  1.00 0.00 ? 40  SER A HA   2  
ATOM 2279  H HB3  . SER A 1 40  ? 5.228   22.659  -0.915  1.00 0.00 ? 40  SER A HB3  2  
ATOM 2280  H HG   . SER A 1 40  ? 5.701   23.334  -3.620  1.00 0.00 ? 40  SER A HG   2  
ATOM 2281  N N    . TYR A 1 41  ? 5.140   19.781  -1.059  1.00 0.00 ? 41  TYR A N    2  
ATOM 2282  C CA   . TYR A 1 41  ? 4.950   18.742  -0.060  1.00 0.00 ? 41  TYR A CA   2  
ATOM 2283  C C    . TYR A 1 41  ? 5.062   19.317  1.354   1.00 0.00 ? 41  TYR A C    2  
ATOM 2284  O O    . TYR A 1 41  ? 6.163   19.483  1.877   1.00 0.00 ? 41  TYR A O    2  
ATOM 2285  C CB   . TYR A 1 41  ? 6.081   17.736  -0.278  1.00 0.00 ? 41  TYR A CB   2  
ATOM 2286  C CG   . TYR A 1 41  ? 5.720   16.301  0.113   1.00 0.00 ? 41  TYR A CG   2  
ATOM 2287  C CD1  . TYR A 1 41  ? 4.596   16.056  0.874   1.00 0.00 ? 41  TYR A CD1  2  
ATOM 2288  C CD2  . TYR A 1 41  ? 6.519   15.253  -0.294  1.00 0.00 ? 41  TYR A CD2  2  
ATOM 2289  C CE1  . TYR A 1 41  ? 4.256   14.705  1.244   1.00 0.00 ? 41  TYR A CE1  2  
ATOM 2290  C CE2  . TYR A 1 41  ? 6.179   13.903  0.075   1.00 0.00 ? 41  TYR A CE2  2  
ATOM 2291  C CZ   . TYR A 1 41  ? 5.065   13.696  0.826   1.00 0.00 ? 41  TYR A CZ   2  
ATOM 2292  O OH   . TYR A 1 41  ? 4.745   12.421  1.174   1.00 0.00 ? 41  TYR A OH   2  
ATOM 2293  H H    . TYR A 1 41  ? 6.088   19.924  -1.345  1.00 0.00 ? 41  TYR A H    2  
ATOM 2294  H HA   . TYR A 1 41  ? 3.954   18.323  -0.197  1.00 0.00 ? 41  TYR A HA   2  
ATOM 2295  H HB3  . TYR A 1 41  ? 6.951   18.050  0.296   1.00 0.00 ? 41  TYR A HB3  2  
ATOM 2296  H HD1  . TYR A 1 41  ? 3.964   16.884  1.197   1.00 0.00 ? 41  TYR A HD1  2  
ATOM 2297  H HD2  . TYR A 1 41  ? 7.407   15.446  -0.895  1.00 0.00 ? 41  TYR A HD2  2  
ATOM 2298  H HE1  . TYR A 1 41  ? 3.370   14.499  1.844   1.00 0.00 ? 41  TYR A HE1  2  
ATOM 2299  H HE2  . TYR A 1 41  ? 6.802   13.065  -0.242  1.00 0.00 ? 41  TYR A HE2  2  
ATOM 2300  H HH   . TYR A 1 41  ? 5.501   12.003  1.676   1.00 0.00 ? 41  TYR A HH   2  
ATOM 2301  N N    . LYS A 1 42  ? 3.905   19.605  1.935   1.00 0.00 ? 42  LYS A N    2  
ATOM 2302  C CA   . LYS A 1 42  ? 3.859   20.156  3.279   1.00 0.00 ? 42  LYS A CA   2  
ATOM 2303  C C    . LYS A 1 42  ? 4.590   19.213  4.237   1.00 0.00 ? 42  LYS A C    2  
ATOM 2304  O O    . LYS A 1 42  ? 5.257   18.276  3.804   1.00 0.00 ? 42  LYS A O    2  
ATOM 2305  C CB   . LYS A 1 42  ? 2.415   20.450  3.687   1.00 0.00 ? 42  LYS A CB   2  
ATOM 2306  C CG   . LYS A 1 42  ? 2.069   21.923  3.458   1.00 0.00 ? 42  LYS A CG   2  
ATOM 2307  C CD   . LYS A 1 42  ? 1.355   22.118  2.120   1.00 0.00 ? 42  LYS A CD   2  
ATOM 2308  C CE   . LYS A 1 42  ? 0.879   23.563  1.958   1.00 0.00 ? 42  LYS A CE   2  
ATOM 2309  N NZ   . LYS A 1 42  ? 0.138   23.724  0.688   1.00 0.00 ? 42  LYS A NZ   2  
ATOM 2310  H H    . LYS A 1 42  ? 3.014   19.465  1.503   1.00 0.00 ? 42  LYS A H    2  
ATOM 2311  H HA   . LYS A 1 42  ? 4.389   21.107  3.258   1.00 0.00 ? 42  LYS A HA   2  
ATOM 2312  H HB3  . LYS A 1 42  ? 2.272   20.198  4.737   1.00 0.00 ? 42  LYS A HB3  2  
ATOM 2313  H HG3  . LYS A 1 42  ? 2.980   22.521  3.480   1.00 0.00 ? 42  LYS A HG3  2  
ATOM 2314  H HD3  . LYS A 1 42  ? 0.502   21.441  2.057   1.00 0.00 ? 42  LYS A HD3  2  
ATOM 2315  H HE3  . LYS A 1 42  ? 1.734   24.238  1.975   1.00 0.00 ? 42  LYS A HE3  2  
ATOM 2316  H HZ1  . LYS A 1 42  ? 0.785   23.752  -0.075  1.00 0.00 ? 42  LYS A HZ1  2  
ATOM 2317  H HZ2  . LYS A 1 42  ? -0.488  22.954  0.566   1.00 0.00 ? 42  LYS A HZ2  2  
ATOM 2318  H HZ3  . LYS A 1 42  ? -0.384  24.577  0.712   1.00 0.00 ? 42  LYS A HZ3  2  
ATOM 2319  N N    . ASP A 1 43  ? 4.439   19.497  5.522   1.00 0.00 ? 43  ASP A N    2  
ATOM 2320  C CA   . ASP A 1 43  ? 5.077   18.687  6.547   1.00 0.00 ? 43  ASP A CA   2  
ATOM 2321  C C    . ASP A 1 43  ? 4.175   18.629  7.781   1.00 0.00 ? 43  ASP A C    2  
ATOM 2322  O O    . ASP A 1 43  ? 3.866   17.549  8.279   1.00 0.00 ? 43  ASP A O    2  
ATOM 2323  C CB   . ASP A 1 43  ? 6.419   19.288  6.969   1.00 0.00 ? 43  ASP A CB   2  
ATOM 2324  C CG   . ASP A 1 43  ? 7.349   18.333  7.720   1.00 0.00 ? 43  ASP A CG   2  
ATOM 2325  O OD1  . ASP A 1 43  ? 7.508   17.195  7.229   1.00 0.00 ? 43  ASP A OD1  2  
ATOM 2326  O OD2  . ASP A 1 43  ? 7.880   18.763  8.767   1.00 0.00 ? 43  ASP A OD2  2  
ATOM 2327  H H    . ASP A 1 43  ? 3.896   20.262  5.867   1.00 0.00 ? 43  ASP A H    2  
ATOM 2328  H HA   . ASP A 1 43  ? 5.222   17.708  6.090   1.00 0.00 ? 43  ASP A HA   2  
ATOM 2329  H HB3  . ASP A 1 43  ? 6.228   20.156  7.601   1.00 0.00 ? 43  ASP A HB3  2  
ATOM 2330  N N    . GLU A 1 44  ? 3.776   19.808  8.238   1.00 0.00 ? 44  GLU A N    2  
ATOM 2331  C CA   . GLU A 1 44  ? 2.916   19.905  9.405   1.00 0.00 ? 44  GLU A CA   2  
ATOM 2332  C C    . GLU A 1 44  ? 1.682   20.750  9.084   1.00 0.00 ? 44  GLU A C    2  
ATOM 2333  O O    . GLU A 1 44  ? 1.751   21.978  9.072   1.00 0.00 ? 44  GLU A O    2  
ATOM 2334  C CB   . GLU A 1 44  ? 3.676   20.478  10.602  1.00 0.00 ? 44  GLU A CB   2  
ATOM 2335  C CG   . GLU A 1 44  ? 2.712   20.922  11.703  1.00 0.00 ? 44  GLU A CG   2  
ATOM 2336  C CD   . GLU A 1 44  ? 2.021   19.718  12.346  1.00 0.00 ? 44  GLU A CD   2  
ATOM 2337  O OE1  . GLU A 1 44  ? 2.615   19.163  13.296  1.00 0.00 ? 44  GLU A OE1  2  
ATOM 2338  O OE2  . GLU A 1 44  ? 0.916   19.379  11.871  1.00 0.00 ? 44  GLU A OE2  2  
ATOM 2339  H H    . GLU A 1 44  ? 4.031   20.682  7.827   1.00 0.00 ? 44  GLU A H    2  
ATOM 2340  H HA   . GLU A 1 44  ? 2.615   18.881  9.628   1.00 0.00 ? 44  GLU A HA   2  
ATOM 2341  H HB3  . GLU A 1 44  ? 4.282   21.326  10.279  1.00 0.00 ? 44  GLU A HB3  2  
ATOM 2342  H HG3  . GLU A 1 44  ? 1.963   21.595  11.285  1.00 0.00 ? 44  GLU A HG3  2  
ATOM 2343  N N    . GLU A 1 45  ? 0.579   20.059  8.831   1.00 0.00 ? 45  GLU A N    2  
ATOM 2344  C CA   . GLU A 1 45  ? -0.669  20.730  8.510   1.00 0.00 ? 45  GLU A CA   2  
ATOM 2345  C C    . GLU A 1 45  ? -1.837  19.747  8.592   1.00 0.00 ? 45  GLU A C    2  
ATOM 2346  O O    . GLU A 1 45  ? -2.764  19.942  9.377   1.00 0.00 ? 45  GLU A O    2  
ATOM 2347  C CB   . GLU A 1 45  ? -0.600  21.386  7.129   1.00 0.00 ? 45  GLU A CB   2  
ATOM 2348  C CG   . GLU A 1 45  ? -0.997  22.862  7.203   1.00 0.00 ? 45  GLU A CG   2  
ATOM 2349  C CD   . GLU A 1 45  ? -0.484  23.629  5.984   1.00 0.00 ? 45  GLU A CD   2  
ATOM 2350  O OE1  . GLU A 1 45  ? -1.184  23.585  4.948   1.00 0.00 ? 45  GLU A OE1  2  
ATOM 2351  O OE2  . GLU A 1 45  ? 0.596   24.244  6.113   1.00 0.00 ? 45  GLU A OE2  2  
ATOM 2352  H H    . GLU A 1 45  ? 0.531   19.061  8.841   1.00 0.00 ? 45  GLU A H    2  
ATOM 2353  H HA   . GLU A 1 45  ? -0.783  21.506  9.268   1.00 0.00 ? 45  GLU A HA   2  
ATOM 2354  H HB3  . GLU A 1 45  ? -1.261  20.861  6.440   1.00 0.00 ? 45  GLU A HB3  2  
ATOM 2355  H HG3  . GLU A 1 45  ? -0.594  23.306  8.114   1.00 0.00 ? 45  GLU A HG3  2  
ATOM 2356  N N    . ASN A 1 46  ? -1.755  18.710  7.772   1.00 0.00 ? 46  ASN A N    2  
ATOM 2357  C CA   . ASN A 1 46  ? -2.794  17.695  7.741   1.00 0.00 ? 46  ASN A CA   2  
ATOM 2358  C C    . ASN A 1 46  ? -2.371  16.565  6.801   1.00 0.00 ? 46  ASN A C    2  
ATOM 2359  O O    . ASN A 1 46  ? -2.299  15.407  7.209   1.00 0.00 ? 46  ASN A O    2  
ATOM 2360  C CB   . ASN A 1 46  ? -4.113  18.272  7.222   1.00 0.00 ? 46  ASN A CB   2  
ATOM 2361  C CG   . ASN A 1 46  ? -5.150  18.362  8.343   1.00 0.00 ? 46  ASN A CG   2  
ATOM 2362  O OD1  . ASN A 1 46  ? -4.942  17.908  9.455   1.00 0.00 ? 46  ASN A OD1  2  
ATOM 2363  N ND2  . ASN A 1 46  ? -6.279  18.972  7.988   1.00 0.00 ? 46  ASN A ND2  2  
ATOM 2364  H H    . ASN A 1 46  ? -0.998  18.558  7.136   1.00 0.00 ? 46  ASN A H    2  
ATOM 2365  H HA   . ASN A 1 46  ? -2.899  17.361  8.773   1.00 0.00 ? 46  ASN A HA   2  
ATOM 2366  H HB3  . ASN A 1 46  ? -4.496  17.646  6.416   1.00 0.00 ? 46  ASN A HB3  2  
ATOM 2367  H HD21 . ASN A 1 46  ? -6.386  19.322  7.057   1.00 0.00 ? 46  ASN A HD21 2  
ATOM 2368  H HD22 . ASN A 1 46  ? -7.018  19.081  8.652   1.00 0.00 ? 46  ASN A HD22 2  
ATOM 2369  N N    . GLY A 1 47  ? -2.102  16.941  5.560   1.00 0.00 ? 47  GLY A N    2  
ATOM 2370  C CA   . GLY A 1 47  ? -1.685  15.973  4.558   1.00 0.00 ? 47  GLY A CA   2  
ATOM 2371  C C    . GLY A 1 47  ? -2.159  16.390  3.164   1.00 0.00 ? 47  GLY A C    2  
ATOM 2372  O O    . GLY A 1 47  ? -1.540  17.237  2.522   1.00 0.00 ? 47  GLY A O    2  
ATOM 2373  H H    . GLY A 1 47  ? -2.162  17.885  5.235   1.00 0.00 ? 47  GLY A H    2  
ATOM 2374  H HA2  . GLY A 1 47  ? -0.600  15.881  4.565   1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2375  H HA3  . GLY A 1 47  ? -2.090  14.992  4.805   1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2376  N N    . ASN A 1 48  ? -3.253  15.776  2.737   1.00 0.00 ? 48  ASN A N    2  
ATOM 2377  C CA   . ASN A 1 48  ? -3.816  16.072  1.430   1.00 0.00 ? 48  ASN A CA   2  
ATOM 2378  C C    . ASN A 1 48  ? -5.110  15.279  1.246   1.00 0.00 ? 48  ASN A C    2  
ATOM 2379  O O    . ASN A 1 48  ? -5.278  14.212  1.835   1.00 0.00 ? 48  ASN A O    2  
ATOM 2380  C CB   . ASN A 1 48  ? -2.852  15.671  0.311   1.00 0.00 ? 48  ASN A CB   2  
ATOM 2381  C CG   . ASN A 1 48  ? -3.355  16.163  -1.048  1.00 0.00 ? 48  ASN A CG   2  
ATOM 2382  O OD1  . ASN A 1 48  ? -4.010  17.185  -1.163  1.00 0.00 ? 48  ASN A OD1  2  
ATOM 2383  N ND2  . ASN A 1 48  ? -3.013  15.380  -2.066  1.00 0.00 ? 48  ASN A ND2  2  
ATOM 2384  H H    . ASN A 1 48  ? -3.750  15.088  3.265   1.00 0.00 ? 48  ASN A H    2  
ATOM 2385  H HA   . ASN A 1 48  ? -3.981  17.149  1.428   1.00 0.00 ? 48  ASN A HA   2  
ATOM 2386  H HB3  . ASN A 1 48  ? -2.744  14.585  0.292   1.00 0.00 ? 48  ASN A HB3  2  
ATOM 2387  H HD21 . ASN A 1 48  ? -2.473  14.553  -1.903  1.00 0.00 ? 48  ASN A HD21 2  
ATOM 2388  H HD22 . ASN A 1 48  ? -3.294  15.617  -2.997  1.00 0.00 ? 48  ASN A HD22 2  
ATOM 2389  N N    . ARG A 1 49  ? -5.994  15.832  0.429   1.00 0.00 ? 49  ARG A N    2  
ATOM 2390  C CA   . ARG A 1 49  ? -7.269  15.190  0.159   1.00 0.00 ? 49  ARG A CA   2  
ATOM 2391  C C    . ARG A 1 49  ? -8.015  15.935  -0.949  1.00 0.00 ? 49  ARG A C    2  
ATOM 2392  O O    . ARG A 1 49  ? -8.069  17.163  -0.951  1.00 0.00 ? 49  ARG A O    2  
ATOM 2393  C CB   . ARG A 1 49  ? -8.143  15.152  1.416   1.00 0.00 ? 49  ARG A CB   2  
ATOM 2394  C CG   . ARG A 1 49  ? -8.414  13.711  1.851   1.00 0.00 ? 49  ARG A CG   2  
ATOM 2395  C CD   . ARG A 1 49  ? -9.409  13.669  3.013   1.00 0.00 ? 49  ARG A CD   2  
ATOM 2396  N NE   . ARG A 1 49  ? -8.765  14.158  4.252   1.00 0.00 ? 49  ARG A NE   2  
ATOM 2397  C CZ   . ARG A 1 49  ? -7.829  13.480  4.930   1.00 0.00 ? 49  ARG A CZ   2  
ATOM 2398  N NH1  . ARG A 1 49  ? -7.423  12.281  4.494   1.00 0.00 ? 49  ARG A NH1  2  
ATOM 2399  N NH2  . ARG A 1 49  ? -7.299  14.002  6.045   1.00 0.00 ? 49  ARG A NH2  2  
ATOM 2400  H H    . ARG A 1 49  ? -5.851  16.701  -0.046  1.00 0.00 ? 49  ARG A H    2  
ATOM 2401  H HA   . ARG A 1 49  ? -7.012  14.176  -0.151  1.00 0.00 ? 49  ARG A HA   2  
ATOM 2402  H HB3  . ARG A 1 49  ? -9.087  15.661  1.222   1.00 0.00 ? 49  ARG A HB3  2  
ATOM 2403  H HG3  . ARG A 1 49  ? -7.481  13.237  2.151   1.00 0.00 ? 49  ARG A HG3  2  
ATOM 2404  H HD3  . ARG A 1 49  ? -9.768  12.650  3.158   1.00 0.00 ? 49  ARG A HD3  2  
ATOM 2405  H HE   . ARG A 1 49  ? -9.046  15.051  4.604   1.00 0.00 ? 49  ARG A HE   2  
ATOM 2406  H HH11 . ARG A 1 49  ? -7.819  11.891  3.663   1.00 0.00 ? 49  ARG A HH11 2  
ATOM 2407  H HH12 . ARG A 1 49  ? -6.726  11.774  5.000   1.00 0.00 ? 49  ARG A HH12 2  
ATOM 2408  H HH21 . ARG A 1 49  ? -7.603  14.898  6.369   1.00 0.00 ? 49  ARG A HH21 2  
ATOM 2409  H HH22 . ARG A 1 49  ? -6.600  13.497  6.550   1.00 0.00 ? 49  ARG A HH22 2  
ATOM 2410  N N    . GLY A 1 50  ? -8.572  15.158  -1.868  1.00 0.00 ? 50  GLY A N    2  
ATOM 2411  C CA   . GLY A 1 50  ? -9.314  15.729  -2.980  1.00 0.00 ? 50  GLY A CA   2  
ATOM 2412  C C    . GLY A 1 50  ? -8.734  15.265  -4.319  1.00 0.00 ? 50  GLY A C    2  
ATOM 2413  O O    . GLY A 1 50  ? -7.669  14.653  -4.360  1.00 0.00 ? 50  GLY A O    2  
ATOM 2414  H H    . GLY A 1 50  ? -8.524  14.160  -1.861  1.00 0.00 ? 50  GLY A H    2  
ATOM 2415  H HA2  . GLY A 1 50  ? -10.361 15.437  -2.913  1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2416  H HA3  . GLY A 1 50  ? -9.281  16.817  -2.923  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2417  N N    . GLY A 1 51  ? -9.464  15.574  -5.381  1.00 0.00 ? 51  GLY A N    2  
ATOM 2418  C CA   . GLY A 1 51  ? -9.038  15.196  -6.717  1.00 0.00 ? 51  GLY A CA   2  
ATOM 2419  C C    . GLY A 1 51  ? -10.207 14.633  -7.528  1.00 0.00 ? 51  GLY A C    2  
ATOM 2420  O O    . GLY A 1 51  ? -10.711 13.552  -7.229  1.00 0.00 ? 51  GLY A O    2  
ATOM 2421  H H    . GLY A 1 51  ? -10.331 16.071  -5.339  1.00 0.00 ? 51  GLY A H    2  
ATOM 2422  H HA2  . GLY A 1 51  ? -8.620  16.063  -7.229  1.00 0.00 ? 51  GLY A HA2  2  
ATOM 2423  H HA3  . GLY A 1 51  ? -8.244  14.452  -6.653  1.00 0.00 ? 51  GLY A HA3  2  
ATOM 2424  N N    . LYS A 1 52  ? -10.604 15.392  -8.539  1.00 0.00 ? 52  LYS A N    2  
ATOM 2425  C CA   . LYS A 1 52  ? -11.704 14.984  -9.395  1.00 0.00 ? 52  LYS A CA   2  
ATOM 2426  C C    . LYS A 1 52  ? -11.743 15.881  -10.634 1.00 0.00 ? 52  LYS A C    2  
ATOM 2427  O O    . LYS A 1 52  ? -11.091 16.924  -10.669 1.00 0.00 ? 52  LYS A O    2  
ATOM 2428  C CB   . LYS A 1 52  ? -13.016 14.964  -8.608  1.00 0.00 ? 52  LYS A CB   2  
ATOM 2429  C CG   . LYS A 1 52  ? -14.060 14.086  -9.303  1.00 0.00 ? 52  LYS A CG   2  
ATOM 2430  C CD   . LYS A 1 52  ? -15.168 13.679  -8.332  1.00 0.00 ? 52  LYS A CD   2  
ATOM 2431  C CE   . LYS A 1 52  ? -16.517 14.260  -8.762  1.00 0.00 ? 52  LYS A CE   2  
ATOM 2432  N NZ   . LYS A 1 52  ? -17.544 14.013  -7.726  1.00 0.00 ? 52  LYS A NZ   2  
ATOM 2433  H H    . LYS A 1 52  ? -10.190 16.271  -8.776  1.00 0.00 ? 52  LYS A H    2  
ATOM 2434  H HA   . LYS A 1 52  ? -11.506 13.961  -9.715  1.00 0.00 ? 52  LYS A HA   2  
ATOM 2435  H HB3  . LYS A 1 52  ? -13.398 15.979  -8.507  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 2436  H HG3  . LYS A 1 52  ? -13.580 13.196  -9.707  1.00 0.00 ? 52  LYS A HG3  2  
ATOM 2437  H HD3  . LYS A 1 52  ? -14.923 14.027  -7.328  1.00 0.00 ? 52  LYS A HD3  2  
ATOM 2438  H HE3  . LYS A 1 52  ? -16.829 13.810  -9.706  1.00 0.00 ? 52  LYS A HE3  2  
ATOM 2439  H HZ1  . LYS A 1 52  ? -17.395 14.632  -6.955  1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 2440  H HZ2  . LYS A 1 52  ? -18.452 14.172  -8.112  1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 2441  H HZ3  . LYS A 1 52  ? -17.476 13.066  -7.409  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 2442  N N    . GLN A 1 53  ? -12.515 15.444  -11.618 1.00 0.00 ? 53  GLN A N    2  
ATOM 2443  C CA   . GLN A 1 53  ? -12.647 16.194  -12.855 1.00 0.00 ? 53  GLN A CA   2  
ATOM 2444  C C    . GLN A 1 53  ? -11.274 16.395  -13.502 1.00 0.00 ? 53  GLN A C    2  
ATOM 2445  O O    . GLN A 1 53  ? -10.245 16.208  -12.855 1.00 0.00 ? 53  GLN A O    2  
ATOM 2446  C CB   . GLN A 1 53  ? -13.340 17.536  -12.610 1.00 0.00 ? 53  GLN A CB   2  
ATOM 2447  C CG   . GLN A 1 53  ? -14.854 17.356  -12.491 1.00 0.00 ? 53  GLN A CG   2  
ATOM 2448  C CD   . GLN A 1 53  ? -15.476 18.481  -11.663 1.00 0.00 ? 53  GLN A CD   2  
ATOM 2449  O OE1  . GLN A 1 53  ? -15.042 18.793  -10.565 1.00 0.00 ? 53  GLN A OE1  2  
ATOM 2450  N NE2  . GLN A 1 53  ? -16.514 19.074  -12.247 1.00 0.00 ? 53  GLN A NE2  2  
ATOM 2451  H H    . GLN A 1 53  ? -13.041 14.595  -11.581 1.00 0.00 ? 53  GLN A H    2  
ATOM 2452  H HA   . GLN A 1 53  ? -13.274 15.580  -13.500 1.00 0.00 ? 53  GLN A HA   2  
ATOM 2453  H HB3  . GLN A 1 53  ? -13.115 18.219  -13.428 1.00 0.00 ? 53  GLN A HB3  2  
ATOM 2454  H HG3  . GLN A 1 53  ? -15.075 16.395  -12.029 1.00 0.00 ? 53  GLN A HG3  2  
ATOM 2455  H HE21 . GLN A 1 53  ? -16.820 18.770  -13.149 1.00 0.00 ? 53  GLN A HE21 2  
ATOM 2456  H HE22 . GLN A 1 53  ? -16.988 19.822  -11.783 1.00 0.00 ? 53  GLN A HE22 2  
ATOM 2457  N N    . ARG A 1 54  ? -11.305 16.775  -14.772 1.00 0.00 ? 54  ARG A N    2  
ATOM 2458  C CA   . ARG A 1 54  ? -10.076 17.005  -15.514 1.00 0.00 ? 54  ARG A CA   2  
ATOM 2459  C C    . ARG A 1 54  ? -9.280  15.704  -15.637 1.00 0.00 ? 54  ARG A C    2  
ATOM 2460  O O    . ARG A 1 54  ? -9.293  14.875  -14.727 1.00 0.00 ? 54  ARG A O    2  
ATOM 2461  C CB   . ARG A 1 54  ? -9.209  18.063  -14.830 1.00 0.00 ? 54  ARG A CB   2  
ATOM 2462  C CG   . ARG A 1 54  ? -7.904  18.282  -15.597 1.00 0.00 ? 54  ARG A CG   2  
ATOM 2463  C CD   . ARG A 1 54  ? -7.052  19.366  -14.933 1.00 0.00 ? 54  ARG A CD   2  
ATOM 2464  N NE   . ARG A 1 54  ? -7.777  20.655  -14.941 1.00 0.00 ? 54  ARG A NE   2  
ATOM 2465  C CZ   . ARG A 1 54  ? -7.306  21.785  -14.397 1.00 0.00 ? 54  ARG A CZ   2  
ATOM 2466  N NH1  . ARG A 1 54  ? -6.110  21.791  -13.795 1.00 0.00 ? 54  ARG A NH1  2  
ATOM 2467  N NH2  . ARG A 1 54  ? -8.035  22.909  -14.452 1.00 0.00 ? 54  ARG A NH2  2  
ATOM 2468  H H    . ARG A 1 54  ? -12.146 16.926  -15.290 1.00 0.00 ? 54  ARG A H    2  
ATOM 2469  H HA   . ARG A 1 54  ? -10.403 17.359  -16.492 1.00 0.00 ? 54  ARG A HA   2  
ATOM 2470  H HB3  . ARG A 1 54  ? -8.987  17.752  -13.809 1.00 0.00 ? 54  ARG A HB3  2  
ATOM 2471  H HG3  . ARG A 1 54  ? -8.125  18.567  -16.625 1.00 0.00 ? 54  ARG A HG3  2  
ATOM 2472  H HD3  . ARG A 1 54  ? -6.104  19.467  -15.460 1.00 0.00 ? 54  ARG A HD3  2  
ATOM 2473  H HE   . ARG A 1 54  ? -8.674  20.686  -15.383 1.00 0.00 ? 54  ARG A HE   2  
ATOM 2474  H HH11 . ARG A 1 54  ? -5.567  20.953  -13.754 1.00 0.00 ? 54  ARG A HH11 2  
ATOM 2475  H HH12 . ARG A 1 54  ? -5.759  22.634  -13.388 1.00 0.00 ? 54  ARG A HH12 2  
ATOM 2476  H HH21 . ARG A 1 54  ? -8.927  22.905  -14.901 1.00 0.00 ? 54  ARG A HH21 2  
ATOM 2477  H HH22 . ARG A 1 54  ? -7.683  23.753  -14.045 1.00 0.00 ? 54  ARG A HH22 2  
ATOM 2478  N N    . ASN A 1 55  ? -8.607  15.565  -16.769 1.00 0.00 ? 55  ASN A N    2  
ATOM 2479  C CA   . ASN A 1 55  ? -7.806  14.380  -17.023 1.00 0.00 ? 55  ASN A CA   2  
ATOM 2480  C C    . ASN A 1 55  ? -8.712  13.146  -17.014 1.00 0.00 ? 55  ASN A C    2  
ATOM 2481  O O    . ASN A 1 55  ? -9.697  13.101  -16.280 1.00 0.00 ? 55  ASN A O    2  
ATOM 2482  C CB   . ASN A 1 55  ? -6.741  14.191  -15.940 1.00 0.00 ? 55  ASN A CB   2  
ATOM 2483  C CG   . ASN A 1 55  ? -6.045  12.837  -16.087 1.00 0.00 ? 55  ASN A CG   2  
ATOM 2484  O OD1  . ASN A 1 55  ? -5.774  12.364  -17.179 1.00 0.00 ? 55  ASN A OD1  2  
ATOM 2485  N ND2  . ASN A 1 55  ? -5.770  12.243  -14.930 1.00 0.00 ? 55  ASN A ND2  2  
ATOM 2486  H H    . ASN A 1 55  ? -8.601  16.244  -17.504 1.00 0.00 ? 55  ASN A H    2  
ATOM 2487  H HA   . ASN A 1 55  ? -7.342  14.550  -17.995 1.00 0.00 ? 55  ASN A HA   2  
ATOM 2488  H HB3  . ASN A 1 55  ? -7.204  14.262  -14.955 1.00 0.00 ? 55  ASN A HB3  2  
ATOM 2489  H HD21 . ASN A 1 55  ? -6.018  12.685  -14.068 1.00 0.00 ? 55  ASN A HD21 2  
ATOM 2490  H HD22 . ASN A 1 55  ? -5.314  11.352  -14.921 1.00 0.00 ? 55  ASN A HD22 2  
ATOM 2491  N N    . ARG A 1 56  ? -8.346  12.176  -17.841 1.00 0.00 ? 56  ARG A N    2  
ATOM 2492  C CA   . ARG A 1 56  ? -9.113  10.947  -17.938 1.00 0.00 ? 56  ARG A CA   2  
ATOM 2493  C C    . ARG A 1 56  ? -9.122  10.218  -16.592 1.00 0.00 ? 56  ARG A C    2  
ATOM 2494  O O    . ARG A 1 56  ? -9.034  10.850  -15.539 1.00 0.00 ? 56  ARG A O    2  
ATOM 2495  C CB   . ARG A 1 56  ? -8.535  10.020  -19.009 1.00 0.00 ? 56  ARG A CB   2  
ATOM 2496  C CG   . ARG A 1 56  ? -9.650  9.323   -19.791 1.00 0.00 ? 56  ARG A CG   2  
ATOM 2497  C CD   . ARG A 1 56  ? -9.088  8.197   -20.659 1.00 0.00 ? 56  ARG A CD   2  
ATOM 2498  N NE   . ARG A 1 56  ? -8.372  7.215   -19.816 1.00 0.00 ? 56  ARG A NE   2  
ATOM 2499  C CZ   . ARG A 1 56  ? -7.443  6.365   -20.274 1.00 0.00 ? 56  ARG A CZ   2  
ATOM 2500  N NH1  . ARG A 1 56  ? -7.113  6.370   -21.573 1.00 0.00 ? 56  ARG A NH1  2  
ATOM 2501  N NH2  . ARG A 1 56  ? -6.845  5.508   -19.435 1.00 0.00 ? 56  ARG A NH2  2  
ATOM 2502  H H    . ARG A 1 56  ? -7.543  12.223  -18.435 1.00 0.00 ? 56  ARG A H    2  
ATOM 2503  H HA   . ARG A 1 56  ? -10.118 11.266  -18.216 1.00 0.00 ? 56  ARG A HA   2  
ATOM 2504  H HB3  . ARG A 1 56  ? -7.893  9.273   -18.541 1.00 0.00 ? 56  ARG A HB3  2  
ATOM 2505  H HG3  . ARG A 1 56  ? -10.167 10.049  -20.420 1.00 0.00 ? 56  ARG A HG3  2  
ATOM 2506  H HD3  . ARG A 1 56  ? -8.412  8.606   -21.409 1.00 0.00 ? 56  ARG A HD3  2  
ATOM 2507  H HE   . ARG A 1 56  ? -8.595  7.183   -18.841 1.00 0.00 ? 56  ARG A HE   2  
ATOM 2508  H HH11 . ARG A 1 56  ? -7.560  7.010   -22.201 1.00 0.00 ? 56  ARG A HH11 2  
ATOM 2509  H HH12 . ARG A 1 56  ? -6.421  5.736   -21.916 1.00 0.00 ? 56  ARG A HH12 2  
ATOM 2510  H HH21 . ARG A 1 56  ? -7.092  5.505   -18.466 1.00 0.00 ? 56  ARG A HH21 2  
ATOM 2511  H HH22 . ARG A 1 56  ? -6.152  4.874   -19.777 1.00 0.00 ? 56  ARG A HH22 2  
ATOM 2512  N N    . LEU A 1 57  ? -9.225  8.899   -16.670 1.00 0.00 ? 57  LEU A N    2  
ATOM 2513  C CA   . LEU A 1 57  ? -9.245  8.079   -15.471 1.00 0.00 ? 57  LEU A CA   2  
ATOM 2514  C C    . LEU A 1 57  ? -7.823  7.962   -14.915 1.00 0.00 ? 57  LEU A C    2  
ATOM 2515  O O    . LEU A 1 57  ? -6.994  8.844   -15.133 1.00 0.00 ? 57  LEU A O    2  
ATOM 2516  C CB   . LEU A 1 57  ? -9.906  6.729   -15.758 1.00 0.00 ? 57  LEU A CB   2  
ATOM 2517  C CG   . LEU A 1 57  ? -11.099 6.756   -16.714 1.00 0.00 ? 57  LEU A CG   2  
ATOM 2518  C CD1  . LEU A 1 57  ? -11.930 5.478   -16.591 1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2519  C CD2  . LEU A 1 57  ? -11.945 8.013   -16.501 1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2520  H H    . LEU A 1 57  ? -9.295  8.394   -17.530 1.00 0.00 ? 57  LEU A H    2  
ATOM 2521  H HA   . LEU A 1 57  ? -9.864  8.590   -14.735 1.00 0.00 ? 57  LEU A HA   2  
ATOM 2522  H HB3  . LEU A 1 57  ? -10.233 6.300   -14.811 1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2523  H HG   . LEU A 1 57  ? -10.718 6.795   -17.735 1.00 0.00 ? 57  LEU A HG   2  
ATOM 2524  H HD11 . LEU A 1 57  ? -11.942 5.151   -15.550 1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2525  H HD12 . LEU A 1 57  ? -12.950 5.673   -16.922 1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2526  H HD13 . LEU A 1 57  ? -11.491 4.696   -17.212 1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2527  H HD21 . LEU A 1 57  ? -11.959 8.265   -15.439 1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2528  H HD22 . LEU A 1 57  ? -11.515 8.840   -17.065 1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2529  H HD23 . LEU A 1 57  ? -12.964 7.829   -16.844 1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2530  N N    . GLU A 1 58  ? -7.588  6.867   -14.208 1.00 0.00 ? 58  GLU A N    2  
ATOM 2531  C CA   . GLU A 1 58  ? -6.282  6.624   -13.618 1.00 0.00 ? 58  GLU A CA   2  
ATOM 2532  C C    . GLU A 1 58  ? -6.133  5.146   -13.249 1.00 0.00 ? 58  GLU A C    2  
ATOM 2533  O O    . GLU A 1 58  ? -7.127  4.436   -13.104 1.00 0.00 ? 58  GLU A O    2  
ATOM 2534  C CB   . GLU A 1 58  ? -6.056  7.520   -12.399 1.00 0.00 ? 58  GLU A CB   2  
ATOM 2535  C CG   . GLU A 1 58  ? -5.834  8.974   -12.821 1.00 0.00 ? 58  GLU A CG   2  
ATOM 2536  C CD   . GLU A 1 58  ? -5.061  9.744   -11.748 1.00 0.00 ? 58  GLU A CD   2  
ATOM 2537  O OE1  . GLU A 1 58  ? -5.520  9.714   -10.586 1.00 0.00 ? 58  GLU A OE1  2  
ATOM 2538  O OE2  . GLU A 1 58  ? -4.027  10.345  -12.116 1.00 0.00 ? 58  GLU A OE2  2  
ATOM 2539  H H    . GLU A 1 58  ? -8.269  6.155   -14.036 1.00 0.00 ? 58  GLU A H    2  
ATOM 2540  H HA   . GLU A 1 58  ? -5.562  6.886   -14.393 1.00 0.00 ? 58  GLU A HA   2  
ATOM 2541  H HB3  . GLU A 1 58  ? -5.191  7.164   -11.838 1.00 0.00 ? 58  GLU A HB3  2  
ATOM 2542  H HG3  . GLU A 1 58  ? -6.796  9.456   -12.996 1.00 0.00 ? 58  GLU A HG3  2  
ATOM 2543  N N    . PRO A 1 59  ? -4.853  4.717   -13.103 1.00 0.00 ? 59  PRO A N    2  
ATOM 2544  C CA   . PRO A 1 59  ? -4.559  3.337   -12.753 1.00 0.00 ? 59  PRO A CA   2  
ATOM 2545  C C    . PRO A 1 59  ? -4.853  3.072   -11.274 1.00 0.00 ? 59  PRO A C    2  
ATOM 2546  O O    . PRO A 1 59  ? -5.584  3.830   -10.638 1.00 0.00 ? 59  PRO A O    2  
ATOM 2547  C CB   . PRO A 1 59  ? -3.096  3.141   -13.112 1.00 0.00 ? 59  PRO A CB   2  
ATOM 2548  C CG   . PRO A 1 59  ? -2.501  4.536   -13.213 1.00 0.00 ? 59  PRO A CG   2  
ATOM 2549  C CD   . PRO A 1 59  ? -3.651  5.530   -13.266 1.00 0.00 ? 59  PRO A CD   2  
ATOM 2550  H HA   . PRO A 1 59  ? -5.154  2.717   -13.265 1.00 0.00 ? 59  PRO A HA   2  
ATOM 2551  H HB3  . PRO A 1 59  ? -2.993  2.604   -14.055 1.00 0.00 ? 59  PRO A HB3  2  
ATOM 2552  H HG3  . PRO A 1 59  ? -1.880  4.623   -14.105 1.00 0.00 ? 59  PRO A HG3  2  
ATOM 2553  H HD3  . PRO A 1 59  ? -3.663  6.070   -14.213 1.00 0.00 ? 59  PRO A HD3  2  
ATOM 2554  N N    . MET A 1 60  ? -4.269  1.996   -10.772 1.00 0.00 ? 60  MET A N    2  
ATOM 2555  C CA   . MET A 1 60  ? -4.458  1.622   -9.380  1.00 0.00 ? 60  MET A CA   2  
ATOM 2556  C C    . MET A 1 60  ? -3.194  0.977   -8.808  1.00 0.00 ? 60  MET A C    2  
ATOM 2557  O O    . MET A 1 60  ? -2.142  0.992   -9.446  1.00 0.00 ? 60  MET A O    2  
ATOM 2558  C CB   . MET A 1 60  ? -5.626  0.639   -9.270  1.00 0.00 ? 60  MET A CB   2  
ATOM 2559  C CG   . MET A 1 60  ? -5.314  -0.668  -10.001 1.00 0.00 ? 60  MET A CG   2  
ATOM 2560  S SD   . MET A 1 60  ? -6.831  -1.512  -10.416 1.00 0.00 ? 60  MET A SD   2  
ATOM 2561  C CE   . MET A 1 60  ? -6.193  -2.781  -11.498 1.00 0.00 ? 60  MET A CE   2  
ATOM 2562  H H    . MET A 1 60  ? -3.676  1.385   -11.296 1.00 0.00 ? 60  MET A H    2  
ATOM 2563  H HA   . MET A 1 60  ? -4.670  2.552   -8.854  1.00 0.00 ? 60  MET A HA   2  
ATOM 2564  H HB3  . MET A 1 60  ? -6.526  1.089   -9.691  1.00 0.00 ? 60  MET A HB3  2  
ATOM 2565  H HG3  . MET A 1 60  ? -4.694  -1.306  -9.371  1.00 0.00 ? 60  MET A HG3  2  
ATOM 2566  H HE1  . MET A 1 60  ? -5.738  -3.572  -10.901 1.00 0.00 ? 60  MET A HE1  2  
ATOM 2567  H HE2  . MET A 1 60  ? -7.009  -3.197  -12.091 1.00 0.00 ? 60  MET A HE2  2  
ATOM 2568  H HE3  . MET A 1 60  ? -5.444  -2.349  -12.162 1.00 0.00 ? 60  MET A HE3  2  
ATOM 2569  N N    . ASP A 1 61  ? -3.339  0.428   -7.612  1.00 0.00 ? 61  ASP A N    2  
ATOM 2570  C CA   . ASP A 1 61  ? -2.220  -0.221  -6.946  1.00 0.00 ? 61  ASP A CA   2  
ATOM 2571  C C    . ASP A 1 61  ? -2.741  -1.033  -5.760  1.00 0.00 ? 61  ASP A C    2  
ATOM 2572  O O    . ASP A 1 61  ? -3.401  -0.492  -4.873  1.00 0.00 ? 61  ASP A O    2  
ATOM 2573  C CB   . ASP A 1 61  ? -1.224  0.811   -6.413  1.00 0.00 ? 61  ASP A CB   2  
ATOM 2574  C CG   . ASP A 1 61  ? -0.059  0.229   -5.609  1.00 0.00 ? 61  ASP A CG   2  
ATOM 2575  O OD1  . ASP A 1 61  ? 0.358   -0.899  -5.950  1.00 0.00 ? 61  ASP A OD1  2  
ATOM 2576  O OD2  . ASP A 1 61  ? 0.387   0.925   -4.672  1.00 0.00 ? 61  ASP A OD2  2  
ATOM 2577  H H    . ASP A 1 61  ? -4.198  0.420   -7.099  1.00 0.00 ? 61  ASP A H    2  
ATOM 2578  H HA   . ASP A 1 61  ? -1.756  -0.846  -7.709  1.00 0.00 ? 61  ASP A HA   2  
ATOM 2579  H HB3  . ASP A 1 61  ? -1.761  1.522   -5.784  1.00 0.00 ? 61  ASP A HB3  2  
ATOM 2580  N N    . THR A 1 62  ? -2.423  -2.320  -5.778  1.00 0.00 ? 62  THR A N    2  
ATOM 2581  C CA   . THR A 1 62  ? -2.850  -3.212  -4.715  1.00 0.00 ? 62  THR A CA   2  
ATOM 2582  C C    . THR A 1 62  ? -1.894  -3.120  -3.525  1.00 0.00 ? 62  THR A C    2  
ATOM 2583  O O    . THR A 1 62  ? -2.130  -3.732  -2.485  1.00 0.00 ? 62  THR A O    2  
ATOM 2584  C CB   . THR A 1 62  ? -2.961  -4.622  -5.298  1.00 0.00 ? 62  THR A CB   2  
ATOM 2585  O OG1  . THR A 1 62  ? -4.363  -4.819  -5.469  1.00 0.00 ? 62  THR A OG1  2  
ATOM 2586  C CG2  . THR A 1 62  ? -2.554  -5.703  -4.295  1.00 0.00 ? 62  THR A CG2  2  
ATOM 2587  H H    . THR A 1 62  ? -1.886  -2.752  -6.502  1.00 0.00 ? 62  THR A H    2  
ATOM 2588  H HA   . THR A 1 62  ? -3.829  -2.885  -4.365  1.00 0.00 ? 62  THR A HA   2  
ATOM 2589  H HB   . THR A 1 62  ? -2.386  -4.710  -6.219  1.00 0.00 ? 62  THR A HB   2  
ATOM 2590  H HG1  . THR A 1 62  ? -4.703  -4.234  -6.205  1.00 0.00 ? 62  THR A HG1  2  
ATOM 2591  H HG21 . THR A 1 62  ? -1.543  -5.506  -3.938  1.00 0.00 ? 62  THR A HG21 2  
ATOM 2592  H HG22 . THR A 1 62  ? -3.243  -5.696  -3.451  1.00 0.00 ? 62  THR A HG22 2  
ATOM 2593  H HG23 . THR A 1 62  ? -2.584  -6.680  -4.780  1.00 0.00 ? 62  THR A HG23 2  
ATOM 2594  N N    . ILE A 1 63  ? -0.833  -2.349  -3.718  1.00 0.00 ? 63  ILE A N    2  
ATOM 2595  C CA   . ILE A 1 63  ? 0.159   -2.168  -2.672  1.00 0.00 ? 63  ILE A CA   2  
ATOM 2596  C C    . ILE A 1 63  ? 0.901   -3.487  -2.446  1.00 0.00 ? 63  ILE A C    2  
ATOM 2597  O O    . ILE A 1 63  ? 2.085   -3.600  -2.757  1.00 0.00 ? 63  ILE A O    2  
ATOM 2598  C CB   . ILE A 1 63  ? -0.491  -1.602  -1.407  1.00 0.00 ? 63  ILE A CB   2  
ATOM 2599  C CG1  . ILE A 1 63  ? -0.928  -0.152  -1.619  1.00 0.00 ? 63  ILE A CG1  2  
ATOM 2600  C CG2  . ILE A 1 63  ? 0.439   -1.749  -0.201  1.00 0.00 ? 63  ILE A CG2  2  
ATOM 2601  C CD1  . ILE A 1 63  ? -2.450  -0.022  -1.536  1.00 0.00 ? 63  ILE A CD1  2  
ATOM 2602  H H    . ILE A 1 63  ? -0.650  -1.854  -4.566  1.00 0.00 ? 63  ILE A H    2  
ATOM 2603  H HA   . ILE A 1 63  ? 0.875   -1.426  -3.027  1.00 0.00 ? 63  ILE A HA   2  
ATOM 2604  H HB   . ILE A 1 63  ? -1.387  -2.182  -1.196  1.00 0.00 ? 63  ILE A HB   2  
ATOM 2605  H HG13 . ILE A 1 63  ? -0.583  0.199   -2.591  1.00 0.00 ? 63  ILE A HG13 2  
ATOM 2606  H HG21 . ILE A 1 63  ? 0.087   -1.110  0.609   1.00 0.00 ? 63  ILE A HG21 2  
ATOM 2607  H HG22 . ILE A 1 63  ? 0.441   -2.787  0.130   1.00 0.00 ? 63  ILE A HG22 2  
ATOM 2608  H HG23 . ILE A 1 63  ? 1.450   -1.455  -0.483  1.00 0.00 ? 63  ILE A HG23 2  
ATOM 2609  H HD11 . ILE A 1 63  ? -2.916  -0.867  -2.040  1.00 0.00 ? 63  ILE A HD11 2  
ATOM 2610  H HD12 . ILE A 1 63  ? -2.758  -0.008  -0.490  1.00 0.00 ? 63  ILE A HD12 2  
ATOM 2611  H HD13 . ILE A 1 63  ? -2.763  0.906   -2.017  1.00 0.00 ? 63  ILE A HD13 2  
ATOM 2612  N N    . PHE A 1 64  ? 0.171   -4.452  -1.903  1.00 0.00 ? 64  PHE A N    2  
ATOM 2613  C CA   . PHE A 1 64  ? 0.745   -5.759  -1.631  1.00 0.00 ? 64  PHE A CA   2  
ATOM 2614  C C    . PHE A 1 64  ? 1.954   -5.644  -0.700  1.00 0.00 ? 64  PHE A C    2  
ATOM 2615  O O    . PHE A 1 64  ? 2.556   -4.578  -0.587  1.00 0.00 ? 64  PHE A O    2  
ATOM 2616  C CB   . PHE A 1 64  ? 1.203   -6.336  -2.972  1.00 0.00 ? 64  PHE A CB   2  
ATOM 2617  C CG   . PHE A 1 64  ? 0.313   -7.460  -3.504  1.00 0.00 ? 64  PHE A CG   2  
ATOM 2618  C CD1  . PHE A 1 64  ? 0.076   -8.559  -2.738  1.00 0.00 ? 64  PHE A CD1  2  
ATOM 2619  C CD2  . PHE A 1 64  ? -0.244  -7.359  -4.741  1.00 0.00 ? 64  PHE A CD2  2  
ATOM 2620  C CE1  . PHE A 1 64  ? -0.752  -9.602  -3.232  1.00 0.00 ? 64  PHE A CE1  2  
ATOM 2621  C CE2  . PHE A 1 64  ? -1.071  -8.403  -5.233  1.00 0.00 ? 64  PHE A CE2  2  
ATOM 2622  C CZ   . PHE A 1 64  ? -1.308  -9.503  -4.469  1.00 0.00 ? 64  PHE A CZ   2  
ATOM 2623  H H    . PHE A 1 64  ? -0.791  -4.352  -1.652  1.00 0.00 ? 64  PHE A H    2  
ATOM 2624  H HA   . PHE A 1 64  ? -0.028  -6.358  -1.148  1.00 0.00 ? 64  PHE A HA   2  
ATOM 2625  H HB3  . PHE A 1 64  ? 2.221   -6.711  -2.867  1.00 0.00 ? 64  PHE A HB3  2  
ATOM 2626  H HD1  . PHE A 1 64  ? 0.521   -8.640  -1.747  1.00 0.00 ? 64  PHE A HD1  2  
ATOM 2627  H HD2  . PHE A 1 64  ? -0.054  -6.479  -5.355  1.00 0.00 ? 64  PHE A HD2  2  
ATOM 2628  H HE1  . PHE A 1 64  ? -0.941  -10.484 -2.619  1.00 0.00 ? 64  PHE A HE1  2  
ATOM 2629  H HE2  . PHE A 1 64  ? -1.516  -8.324  -6.226  1.00 0.00 ? 64  PHE A HE2  2  
ATOM 2630  H HZ   . PHE A 1 64  ? -1.943  -10.304 -4.847  1.00 0.00 ? 64  PHE A HZ   2  
ATOM 2631  N N    . VAL A 1 65  ? 2.270   -6.757  -0.055  1.00 0.00 ? 65  VAL A N    2  
ATOM 2632  C CA   . VAL A 1 65  ? 3.396   -6.796  0.864   1.00 0.00 ? 65  VAL A CA   2  
ATOM 2633  C C    . VAL A 1 65  ? 4.649   -7.246  0.109   1.00 0.00 ? 65  VAL A C    2  
ATOM 2634  O O    . VAL A 1 65  ? 4.560   -8.004  -0.854  1.00 0.00 ? 65  VAL A O    2  
ATOM 2635  C CB   . VAL A 1 65  ? 3.065   -7.689  2.060   1.00 0.00 ? 65  VAL A CB   2  
ATOM 2636  C CG1  . VAL A 1 65  ? 4.304   -7.927  2.926   1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2637  C CG2  . VAL A 1 65  ? 1.922   -7.096  2.888   1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2638  H H    . VAL A 1 65  ? 1.775   -7.620  -0.151  1.00 0.00 ? 65  VAL A H    2  
ATOM 2639  H HA   . VAL A 1 65  ? 3.554   -5.782  1.233   1.00 0.00 ? 65  VAL A HA   2  
ATOM 2640  H HB   . VAL A 1 65  ? 2.735   -8.655  1.677   1.00 0.00 ? 65  VAL A HB   2  
ATOM 2641  H HG11 . VAL A 1 65  ? 4.002   -8.058  3.965   1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2642  H HG12 . VAL A 1 65  ? 4.821   -8.823  2.583   1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2643  H HG13 . VAL A 1 65  ? 4.972   -7.069  2.849   1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2644  H HG21 . VAL A 1 65  ? 2.332   -6.424  3.641   1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2645  H HG22 . VAL A 1 65  ? 1.249   -6.545  2.233   1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2646  H HG23 . VAL A 1 65  ? 1.374   -7.902  3.379   1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2647  N N    . LYS A 1 66  ? 5.788   -6.758  0.577   1.00 0.00 ? 66  LYS A N    2  
ATOM 2648  C CA   . LYS A 1 66  ? 7.059   -7.102  -0.041  1.00 0.00 ? 66  LYS A CA   2  
ATOM 2649  C C    . LYS A 1 66  ? 7.926   -7.856  0.970   1.00 0.00 ? 66  LYS A C    2  
ATOM 2650  O O    . LYS A 1 66  ? 8.304   -9.002  0.735   1.00 0.00 ? 66  LYS A O    2  
ATOM 2651  C CB   . LYS A 1 66  ? 7.730   -5.852  -0.615  1.00 0.00 ? 66  LYS A CB   2  
ATOM 2652  C CG   . LYS A 1 66  ? 9.066   -6.200  -1.271  1.00 0.00 ? 66  LYS A CG   2  
ATOM 2653  C CD   . LYS A 1 66  ? 10.226  -5.503  -0.558  1.00 0.00 ? 66  LYS A CD   2  
ATOM 2654  C CE   . LYS A 1 66  ? 11.178  -4.854  -1.564  1.00 0.00 ? 66  LYS A CE   2  
ATOM 2655  N NZ   . LYS A 1 66  ? 11.732  -3.594  -1.015  1.00 0.00 ? 66  LYS A NZ   2  
ATOM 2656  H H    . LYS A 1 66  ? 5.854   -6.141  1.361   1.00 0.00 ? 66  LYS A H    2  
ATOM 2657  H HA   . LYS A 1 66  ? 6.846   -7.766  -0.878  1.00 0.00 ? 66  LYS A HA   2  
ATOM 2658  H HB3  . LYS A 1 66  ? 7.889   -5.123  0.179   1.00 0.00 ? 66  LYS A HB3  2  
ATOM 2659  H HG3  . LYS A 1 66  ? 9.050   -5.904  -2.321  1.00 0.00 ? 66  LYS A HG3  2  
ATOM 2660  H HD3  . LYS A 1 66  ? 10.772  -6.225  0.052   1.00 0.00 ? 66  LYS A HD3  2  
ATOM 2661  H HE3  . LYS A 1 66  ? 10.651  -4.651  -2.494  1.00 0.00 ? 66  LYS A HE3  2  
ATOM 2662  H HZ1  . LYS A 1 66  ? 11.151  -3.273  -0.268  1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 2663  H HZ2  . LYS A 1 66  ? 12.656  -3.760  -0.671  1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 2664  H HZ3  . LYS A 1 66  ? 11.764  -2.903  -1.737  1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 2665  N N    . GLN A 1 67  ? 8.217   -7.180  2.072   1.00 0.00 ? 67  GLN A N    2  
ATOM 2666  C CA   . GLN A 1 67  ? 9.032   -7.772  3.119   1.00 0.00 ? 67  GLN A CA   2  
ATOM 2667  C C    . GLN A 1 67  ? 8.409   -7.505  4.491   1.00 0.00 ? 67  GLN A C    2  
ATOM 2668  O O    . GLN A 1 67  ? 7.563   -6.623  4.632   1.00 0.00 ? 67  GLN A O    2  
ATOM 2669  C CB   . GLN A 1 67  ? 10.468  -7.247  3.058   1.00 0.00 ? 67  GLN A CB   2  
ATOM 2670  C CG   . GLN A 1 67  ? 11.362  -8.191  2.252   1.00 0.00 ? 67  GLN A CG   2  
ATOM 2671  C CD   . GLN A 1 67  ? 12.284  -8.994  3.173   1.00 0.00 ? 67  GLN A CD   2  
ATOM 2672  O OE1  . GLN A 1 67  ? 12.418  -8.716  4.352   1.00 0.00 ? 67  GLN A OE1  2  
ATOM 2673  N NE2  . GLN A 1 67  ? 12.909  -10.000 2.569   1.00 0.00 ? 67  GLN A NE2  2  
ATOM 2674  H H    . GLN A 1 67  ? 7.905   -6.247  2.255   1.00 0.00 ? 67  GLN A H    2  
ATOM 2675  H HA   . GLN A 1 67  ? 9.034   -8.842  2.915   1.00 0.00 ? 67  GLN A HA   2  
ATOM 2676  H HB3  . GLN A 1 67  ? 10.863  -7.140  4.067   1.00 0.00 ? 67  GLN A HB3  2  
ATOM 2677  H HG3  . GLN A 1 67  ? 11.960  -7.616  1.544   1.00 0.00 ? 67  GLN A HG3  2  
ATOM 2678  H HE21 . GLN A 1 67  ? 12.754  -10.173 1.595   1.00 0.00 ? 67  GLN A HE21 2  
ATOM 2679  H HE22 . GLN A 1 67  ? 13.533  -10.584 3.087   1.00 0.00 ? 67  GLN A HE22 2  
ATOM 2680  N N    . VAL A 1 68  ? 8.852   -8.284  5.468   1.00 0.00 ? 68  VAL A N    2  
ATOM 2681  C CA   . VAL A 1 68  ? 8.349   -8.143  6.823   1.00 0.00 ? 68  VAL A CA   2  
ATOM 2682  C C    . VAL A 1 68  ? 9.527   -8.101  7.798   1.00 0.00 ? 68  VAL A C    2  
ATOM 2683  O O    . VAL A 1 68  ? 10.292  -9.060  7.895   1.00 0.00 ? 68  VAL A O    2  
ATOM 2684  C CB   . VAL A 1 68  ? 7.357   -9.266  7.133   1.00 0.00 ? 68  VAL A CB   2  
ATOM 2685  C CG1  . VAL A 1 68  ? 7.029   -9.312  8.627   1.00 0.00 ? 68  VAL A CG1  2  
ATOM 2686  C CG2  . VAL A 1 68  ? 6.085   -9.119  6.296   1.00 0.00 ? 68  VAL A CG2  2  
ATOM 2687  H H    . VAL A 1 68  ? 9.540   -8.999  5.344   1.00 0.00 ? 68  VAL A H    2  
ATOM 2688  H HA   . VAL A 1 68  ? 7.814   -7.195  6.879   1.00 0.00 ? 68  VAL A HA   2  
ATOM 2689  H HB   . VAL A 1 68  ? 7.827   -10.212 6.863   1.00 0.00 ? 68  VAL A HB   2  
ATOM 2690  H HG11 . VAL A 1 68  ? 7.589   -8.534  9.145   1.00 0.00 ? 68  VAL A HG11 2  
ATOM 2691  H HG12 . VAL A 1 68  ? 5.962   -9.147  8.769   1.00 0.00 ? 68  VAL A HG12 2  
ATOM 2692  H HG13 . VAL A 1 68  ? 7.303   -10.287 9.029   1.00 0.00 ? 68  VAL A HG13 2  
ATOM 2693  H HG21 . VAL A 1 68  ? 5.215   -9.123  6.953   1.00 0.00 ? 68  VAL A HG21 2  
ATOM 2694  H HG22 . VAL A 1 68  ? 6.119   -8.179  5.744   1.00 0.00 ? 68  VAL A HG22 2  
ATOM 2695  H HG23 . VAL A 1 68  ? 6.015   -9.951  5.594   1.00 0.00 ? 68  VAL A HG23 2  
ATOM 2696  N N    . LYS A 1 69  ? 9.637   -6.981  8.497   1.00 0.00 ? 69  LYS A N    2  
ATOM 2697  C CA   . LYS A 1 69  ? 10.710  -6.801  9.461   1.00 0.00 ? 69  LYS A CA   2  
ATOM 2698  C C    . LYS A 1 69  ? 10.771  -8.021  10.381  1.00 0.00 ? 69  LYS A C    2  
ATOM 2699  O O    . LYS A 1 69  ? 10.023  -8.108  11.353  1.00 0.00 ? 69  LYS A O    2  
ATOM 2700  C CB   . LYS A 1 69  ? 10.543  -5.476  10.207  1.00 0.00 ? 69  LYS A CB   2  
ATOM 2701  C CG   . LYS A 1 69  ? 11.897  -4.799  10.432  1.00 0.00 ? 69  LYS A CG   2  
ATOM 2702  C CD   . LYS A 1 69  ? 11.992  -4.221  11.844  1.00 0.00 ? 69  LYS A CD   2  
ATOM 2703  C CE   . LYS A 1 69  ? 13.241  -3.350  11.997  1.00 0.00 ? 69  LYS A CE   2  
ATOM 2704  N NZ   . LYS A 1 69  ? 12.933  -2.135  12.784  1.00 0.00 ? 69  LYS A NZ   2  
ATOM 2705  H H    . LYS A 1 69  ? 9.010   -6.205  8.412   1.00 0.00 ? 69  LYS A H    2  
ATOM 2706  H HA   . LYS A 1 69  ? 11.644  -6.742  8.903   1.00 0.00 ? 69  LYS A HA   2  
ATOM 2707  H HB3  . LYS A 1 69  ? 10.057  -5.653  11.165  1.00 0.00 ? 69  LYS A HB3  2  
ATOM 2708  H HG3  . LYS A 1 69  ? 12.037  -4.005  9.698   1.00 0.00 ? 69  LYS A HG3  2  
ATOM 2709  H HD3  . LYS A 1 69  ? 12.019  -5.031  12.573  1.00 0.00 ? 69  LYS A HD3  2  
ATOM 2710  H HE3  . LYS A 1 69  ? 13.618  -3.067  11.014  1.00 0.00 ? 69  LYS A HE3  2  
ATOM 2711  H HZ1  . LYS A 1 69  ? 12.331  -2.374  13.546  1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 2712  H HZ2  . LYS A 1 69  ? 13.782  -1.745  13.141  1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 2713  H HZ3  . LYS A 1 69  ? 12.478  -1.464  12.197  1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 2714  N N    . GLU A 1 70  ? 11.671  -8.934  10.042  1.00 0.00 ? 70  GLU A N    2  
ATOM 2715  C CA   . GLU A 1 70  ? 11.840  -10.145 10.825  1.00 0.00 ? 70  GLU A CA   2  
ATOM 2716  C C    . GLU A 1 70  ? 12.205  -9.796  12.270  1.00 0.00 ? 70  GLU A C    2  
ATOM 2717  O O    . GLU A 1 70  ? 13.375  -9.592  12.587  1.00 0.00 ? 70  GLU A O    2  
ATOM 2718  C CB   . GLU A 1 70  ? 12.894  -11.061 10.200  1.00 0.00 ? 70  GLU A CB   2  
ATOM 2719  C CG   . GLU A 1 70  ? 12.746  -12.495 10.709  1.00 0.00 ? 70  GLU A CG   2  
ATOM 2720  C CD   . GLU A 1 70  ? 13.009  -13.504 9.589   1.00 0.00 ? 70  GLU A CD   2  
ATOM 2721  O OE1  . GLU A 1 70  ? 12.472  -13.276 8.483   1.00 0.00 ? 70  GLU A OE1  2  
ATOM 2722  O OE2  . GLU A 1 70  ? 13.740  -14.480 9.864   1.00 0.00 ? 70  GLU A OE2  2  
ATOM 2723  H H    . GLU A 1 70  ? 12.275  -8.855  9.249   1.00 0.00 ? 70  GLU A H    2  
ATOM 2724  H HA   . GLU A 1 70  ? 10.872  -10.645 10.799  1.00 0.00 ? 70  GLU A HA   2  
ATOM 2725  H HB3  . GLU A 1 70  ? 13.891  -10.689 10.436  1.00 0.00 ? 70  GLU A HB3  2  
ATOM 2726  H HG3  . GLU A 1 70  ? 11.742  -12.643 11.107  1.00 0.00 ? 70  GLU A HG3  2  
ATOM 2727  N N    . GLY A 1 71  ? 11.179  -9.738  13.108  1.00 0.00 ? 71  GLY A N    2  
ATOM 2728  C CA   . GLY A 1 71  ? 11.377  -9.418  14.511  1.00 0.00 ? 71  GLY A CA   2  
ATOM 2729  C C    . GLY A 1 71  ? 10.748  -8.066  14.859  1.00 0.00 ? 71  GLY A C    2  
ATOM 2730  O O    . GLY A 1 71  ? 11.001  -7.517  15.930  1.00 0.00 ? 71  GLY A O    2  
ATOM 2731  H H    . GLY A 1 71  ? 10.230  -9.904  12.843  1.00 0.00 ? 71  GLY A H    2  
ATOM 2732  H HA2  . GLY A 1 71  ? 10.937  -10.198 15.131  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 2733  H HA3  . GLY A 1 71  ? 12.444  -9.394  14.736  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 2734  N N    . GLY A 1 72  ? 9.941   -7.570  13.933  1.00 0.00 ? 72  GLY A N    2  
ATOM 2735  C CA   . GLY A 1 72  ? 9.274   -6.294  14.128  1.00 0.00 ? 72  GLY A CA   2  
ATOM 2736  C C    . GLY A 1 72  ? 7.806   -6.496  14.511  1.00 0.00 ? 72  GLY A C    2  
ATOM 2737  O O    . GLY A 1 72  ? 7.443   -7.528  15.072  1.00 0.00 ? 72  GLY A O    2  
ATOM 2738  H H    . GLY A 1 72  ? 9.740   -8.023  13.064  1.00 0.00 ? 72  GLY A H    2  
ATOM 2739  H HA2  . GLY A 1 72  ? 9.782   -5.728  14.909  1.00 0.00 ? 72  GLY A HA2  2  
ATOM 2740  H HA3  . GLY A 1 72  ? 9.336   -5.703  13.214  1.00 0.00 ? 72  GLY A HA3  2  
ATOM 2741  N N    . PRO A 1 73  ? 6.980   -5.465  14.187  1.00 0.00 ? 73  PRO A N    2  
ATOM 2742  C CA   . PRO A 1 73  ? 5.561   -5.519  14.491  1.00 0.00 ? 73  PRO A CA   2  
ATOM 2743  C C    . PRO A 1 73  ? 4.829   -6.456  13.527  1.00 0.00 ? 73  PRO A C    2  
ATOM 2744  O O    . PRO A 1 73  ? 4.295   -7.483  13.941  1.00 0.00 ? 73  PRO A O    2  
ATOM 2745  C CB   . PRO A 1 73  ? 5.084   -4.079  14.396  1.00 0.00 ? 73  PRO A CB   2  
ATOM 2746  C CG   . PRO A 1 73  ? 6.141   -3.341  13.593  1.00 0.00 ? 73  PRO A CG   2  
ATOM 2747  C CD   . PRO A 1 73  ? 7.375   -4.226  13.521  1.00 0.00 ? 73  PRO A CD   2  
ATOM 2748  H HA   . PRO A 1 73  ? 5.415   -5.898  15.404  1.00 0.00 ? 73  PRO A HA   2  
ATOM 2749  H HB3  . PRO A 1 73  ? 4.968   -3.640  15.389  1.00 0.00 ? 73  PRO A HB3  2  
ATOM 2750  H HG3  . PRO A 1 73  ? 6.382   -2.387  14.065  1.00 0.00 ? 73  PRO A HG3  2  
ATOM 2751  H HD3  . PRO A 1 73  ? 8.225   -3.762  14.021  1.00 0.00 ? 73  PRO A HD3  2  
ATOM 2752  N N    . ALA A 1 74  ? 4.827   -6.066  12.261  1.00 0.00 ? 74  ALA A N    2  
ATOM 2753  C CA   . ALA A 1 74  ? 4.169   -6.858  11.235  1.00 0.00 ? 74  ALA A CA   2  
ATOM 2754  C C    . ALA A 1 74  ? 4.475   -8.339  11.466  1.00 0.00 ? 74  ALA A C    2  
ATOM 2755  O O    . ALA A 1 74  ? 3.562   -9.152  11.604  1.00 0.00 ? 74  ALA A O    2  
ATOM 2756  C CB   . ALA A 1 74  ? 4.618   -6.378  9.853   1.00 0.00 ? 74  ALA A CB   2  
ATOM 2757  H H    . ALA A 1 74  ? 5.263   -5.228  11.932  1.00 0.00 ? 74  ALA A H    2  
ATOM 2758  H HA   . ALA A 1 74  ? 3.094   -6.699  11.331  1.00 0.00 ? 74  ALA A HA   2  
ATOM 2759  H HB1  . ALA A 1 74  ? 3.965   -6.805  9.091   1.00 0.00 ? 74  ALA A HB1  2  
ATOM 2760  H HB2  . ALA A 1 74  ? 4.563   -5.290  9.811   1.00 0.00 ? 74  ALA A HB2  2  
ATOM 2761  H HB3  . ALA A 1 74  ? 5.644   -6.698  9.672   1.00 0.00 ? 74  ALA A HB3  2  
ATOM 2762  N N    . PHE A 1 75  ? 5.764   -8.645  11.501  1.00 0.00 ? 75  PHE A N    2  
ATOM 2763  C CA   . PHE A 1 75  ? 6.202   -10.015 11.712  1.00 0.00 ? 75  PHE A CA   2  
ATOM 2764  C C    . PHE A 1 75  ? 5.403   -10.679 12.836  1.00 0.00 ? 75  PHE A C    2  
ATOM 2765  O O    . PHE A 1 75  ? 4.916   -11.797 12.679  1.00 0.00 ? 75  PHE A O    2  
ATOM 2766  C CB   . PHE A 1 75  ? 7.676   -9.955  12.119  1.00 0.00 ? 75  PHE A CB   2  
ATOM 2767  C CG   . PHE A 1 75  ? 8.142   -11.152 12.949  1.00 0.00 ? 75  PHE A CG   2  
ATOM 2768  C CD1  . PHE A 1 75  ? 8.059   -12.410 12.436  1.00 0.00 ? 75  PHE A CD1  2  
ATOM 2769  C CD2  . PHE A 1 75  ? 8.640   -10.960 14.200  1.00 0.00 ? 75  PHE A CD2  2  
ATOM 2770  C CE1  . PHE A 1 75  ? 8.491   -13.520 13.208  1.00 0.00 ? 75  PHE A CE1  2  
ATOM 2771  C CE2  . PHE A 1 75  ? 9.073   -12.070 14.971  1.00 0.00 ? 75  PHE A CE2  2  
ATOM 2772  C CZ   . PHE A 1 75  ? 8.989   -13.328 14.458  1.00 0.00 ? 75  PHE A CZ   2  
ATOM 2773  H H    . PHE A 1 75  ? 6.500   -7.979  11.388  1.00 0.00 ? 75  PHE A H    2  
ATOM 2774  H HA   . PHE A 1 75  ? 6.034   -10.556 10.781  1.00 0.00 ? 75  PHE A HA   2  
ATOM 2775  H HB3  . PHE A 1 75  ? 7.849   -9.041  12.687  1.00 0.00 ? 75  PHE A HB3  2  
ATOM 2776  H HD1  . PHE A 1 75  ? 7.660   -12.564 11.433  1.00 0.00 ? 75  PHE A HD1  2  
ATOM 2777  H HD2  . PHE A 1 75  ? 8.707   -9.952  14.610  1.00 0.00 ? 75  PHE A HD2  2  
ATOM 2778  H HE1  . PHE A 1 75  ? 8.425   -14.528 12.797  1.00 0.00 ? 75  PHE A HE1  2  
ATOM 2779  H HE2  . PHE A 1 75  ? 9.472   -11.917 15.973  1.00 0.00 ? 75  PHE A HE2  2  
ATOM 2780  H HZ   . PHE A 1 75  ? 9.321   -14.180 15.050  1.00 0.00 ? 75  PHE A HZ   2  
ATOM 2781  N N    . GLU A 1 76  ? 5.294   -9.961  13.945  1.00 0.00 ? 76  GLU A N    2  
ATOM 2782  C CA   . GLU A 1 76  ? 4.563   -10.467 15.094  1.00 0.00 ? 76  GLU A CA   2  
ATOM 2783  C C    . GLU A 1 76  ? 3.059   -10.466 14.809  1.00 0.00 ? 76  GLU A C    2  
ATOM 2784  O O    . GLU A 1 76  ? 2.394   -11.490 14.962  1.00 0.00 ? 76  GLU A O    2  
ATOM 2785  C CB   . GLU A 1 76  ? 4.882   -9.652  16.350  1.00 0.00 ? 76  GLU A CB   2  
ATOM 2786  C CG   . GLU A 1 76  ? 6.392   -9.598  16.598  1.00 0.00 ? 76  GLU A CG   2  
ATOM 2787  C CD   . GLU A 1 76  ? 6.794   -10.541 17.733  1.00 0.00 ? 76  GLU A CD   2  
ATOM 2788  O OE1  . GLU A 1 76  ? 6.277   -10.334 18.852  1.00 0.00 ? 76  GLU A OE1  2  
ATOM 2789  O OE2  . GLU A 1 76  ? 7.610   -11.446 17.457  1.00 0.00 ? 76  GLU A OE2  2  
ATOM 2790  H H    . GLU A 1 76  ? 5.693   -9.053  14.065  1.00 0.00 ? 76  GLU A H    2  
ATOM 2791  H HA   . GLU A 1 76  ? 4.912   -11.490 15.233  1.00 0.00 ? 76  GLU A HA   2  
ATOM 2792  H HB3  . GLU A 1 76  ? 4.385   -10.097 17.211  1.00 0.00 ? 76  GLU A HB3  2  
ATOM 2793  H HG3  . GLU A 1 76  ? 6.687   -8.579  16.843  1.00 0.00 ? 76  GLU A HG3  2  
ATOM 2794  N N    . ALA A 1 77  ? 2.567   -9.306  14.399  1.00 0.00 ? 77  ALA A N    2  
ATOM 2795  C CA   . ALA A 1 77  ? 1.154   -9.159  14.092  1.00 0.00 ? 77  ALA A CA   2  
ATOM 2796  C C    . ALA A 1 77  ? 0.660   -10.416 13.374  1.00 0.00 ? 77  ALA A C    2  
ATOM 2797  O O    . ALA A 1 77  ? -0.505  -10.790 13.498  1.00 0.00 ? 77  ALA A O    2  
ATOM 2798  C CB   . ALA A 1 77  ? 0.943   -7.892  13.260  1.00 0.00 ? 77  ALA A CB   2  
ATOM 2799  H H    . ALA A 1 77  ? 3.115   -8.478  14.277  1.00 0.00 ? 77  ALA A H    2  
ATOM 2800  H HA   . ALA A 1 77  ? 0.618   -9.054  15.034  1.00 0.00 ? 77  ALA A HA   2  
ATOM 2801  H HB1  . ALA A 1 77  ? 1.327   -8.049  12.252  1.00 0.00 ? 77  ALA A HB1  2  
ATOM 2802  H HB2  . ALA A 1 77  ? -0.121  -7.663  13.211  1.00 0.00 ? 77  ALA A HB2  2  
ATOM 2803  H HB3  . ALA A 1 77  ? 1.473   -7.060  13.726  1.00 0.00 ? 77  ALA A HB3  2  
ATOM 2804  N N    . GLY A 1 78  ? 1.571   -11.035 12.636  1.00 0.00 ? 78  GLY A N    2  
ATOM 2805  C CA   . GLY A 1 78  ? 1.241   -12.243 11.897  1.00 0.00 ? 78  GLY A CA   2  
ATOM 2806  C C    . GLY A 1 78  ? 1.347   -12.008 10.389  1.00 0.00 ? 78  GLY A C    2  
ATOM 2807  O O    . GLY A 1 78  ? 0.964   -12.869 9.597   1.00 0.00 ? 78  GLY A O    2  
ATOM 2808  H H    . GLY A 1 78  ? 2.517   -10.724 12.538  1.00 0.00 ? 78  GLY A H    2  
ATOM 2809  H HA2  . GLY A 1 78  ? 1.915   -13.047 12.191  1.00 0.00 ? 78  GLY A HA2  2  
ATOM 2810  H HA3  . GLY A 1 78  ? 0.231   -12.562 12.150  1.00 0.00 ? 78  GLY A HA3  2  
ATOM 2811  N N    . LEU A 1 79  ? 1.864   -10.841 10.038  1.00 0.00 ? 79  LEU A N    2  
ATOM 2812  C CA   . LEU A 1 79  ? 2.024   -10.483 8.638   1.00 0.00 ? 79  LEU A CA   2  
ATOM 2813  C C    . LEU A 1 79  ? 3.104   -11.366 8.011   1.00 0.00 ? 79  LEU A C    2  
ATOM 2814  O O    . LEU A 1 79  ? 3.728   -12.172 8.699   1.00 0.00 ? 79  LEU A O    2  
ATOM 2815  C CB   . LEU A 1 79  ? 2.294   -8.984  8.497   1.00 0.00 ? 79  LEU A CB   2  
ATOM 2816  C CG   . LEU A 1 79  ? 1.581   -8.280  7.338   1.00 0.00 ? 79  LEU A CG   2  
ATOM 2817  C CD1  . LEU A 1 79  ? 0.134   -7.949  7.706   1.00 0.00 ? 79  LEU A CD1  2  
ATOM 2818  C CD2  . LEU A 1 79  ? 2.358   -7.041  6.890   1.00 0.00 ? 79  LEU A CD2  2  
ATOM 2819  H H    . LEU A 1 79  ? 2.172   -10.147 10.688  1.00 0.00 ? 79  LEU A H    2  
ATOM 2820  H HA   . LEU A 1 79  ? 1.076   -10.688 8.140   1.00 0.00 ? 79  LEU A HA   2  
ATOM 2821  H HB3  . LEU A 1 79  ? 3.366   -8.839  8.378   1.00 0.00 ? 79  LEU A HB3  2  
ATOM 2822  H HG   . LEU A 1 79  ? 1.550   -8.964  6.491   1.00 0.00 ? 79  LEU A HG   2  
ATOM 2823  H HD11 . LEU A 1 79  ? -0.542  -8.504  7.055   1.00 0.00 ? 79  LEU A HD11 2  
ATOM 2824  H HD12 . LEU A 1 79  ? -0.051  -8.228  8.743   1.00 0.00 ? 79  LEU A HD12 2  
ATOM 2825  H HD13 . LEU A 1 79  ? -0.037  -6.880  7.581   1.00 0.00 ? 79  LEU A HD13 2  
ATOM 2826  H HD21 . LEU A 1 79  ? 1.978   -6.165  7.418   1.00 0.00 ? 79  LEU A HD21 2  
ATOM 2827  H HD22 . LEU A 1 79  ? 3.415   -7.172  7.116   1.00 0.00 ? 79  LEU A HD22 2  
ATOM 2828  H HD23 . LEU A 1 79  ? 2.230   -6.901  5.817   1.00 0.00 ? 79  LEU A HD23 2  
ATOM 2829  N N    . CYS A 1 80  ? 3.292   -11.182 6.712   1.00 0.00 ? 80  CYS A N    2  
ATOM 2830  C CA   . CYS A 1 80  ? 4.288   -11.951 5.985   1.00 0.00 ? 80  CYS A CA   2  
ATOM 2831  C C    . CYS A 1 80  ? 4.376   -11.397 4.561   1.00 0.00 ? 80  CYS A C    2  
ATOM 2832  O O    . CYS A 1 80  ? 4.047   -10.236 4.321   1.00 0.00 ? 80  CYS A O    2  
ATOM 2833  C CB   . CYS A 1 80  ? 3.966   -13.446 5.996   1.00 0.00 ? 80  CYS A CB   2  
ATOM 2834  S SG   . CYS A 1 80  ? 2.587   -13.800 4.846   1.00 0.00 ? 80  CYS A SG   2  
ATOM 2835  H H    . CYS A 1 80  ? 2.780   -10.523 6.160   1.00 0.00 ? 80  CYS A H    2  
ATOM 2836  H HA   . CYS A 1 80  ? 5.232   -11.818 6.511   1.00 0.00 ? 80  CYS A HA   2  
ATOM 2837  H HB3  . CYS A 1 80  ? 3.698   -13.761 7.004   1.00 0.00 ? 80  CYS A HB3  2  
ATOM 2838  H HG   . CYS A 1 80  ? 2.304   -15.004 5.332   1.00 0.00 ? 80  CYS A HG   2  
ATOM 2839  N N    . THR A 1 81  ? 4.822   -12.253 3.653   1.00 0.00 ? 81  THR A N    2  
ATOM 2840  C CA   . THR A 1 81  ? 4.958   -11.864 2.259   1.00 0.00 ? 81  THR A CA   2  
ATOM 2841  C C    . THR A 1 81  ? 3.814   -12.448 1.429   1.00 0.00 ? 81  THR A C    2  
ATOM 2842  O O    . THR A 1 81  ? 3.503   -13.634 1.540   1.00 0.00 ? 81  THR A O    2  
ATOM 2843  C CB   . THR A 1 81  ? 6.343   -12.301 1.780   1.00 0.00 ? 81  THR A CB   2  
ATOM 2844  O OG1  . THR A 1 81  ? 6.483   -13.626 2.284   1.00 0.00 ? 81  THR A OG1  2  
ATOM 2845  C CG2  . THR A 1 81  ? 7.471   -11.523 2.460   1.00 0.00 ? 81  THR A CG2  2  
ATOM 2846  H H    . THR A 1 81  ? 5.088   -13.196 3.857   1.00 0.00 ? 81  THR A H    2  
ATOM 2847  H HA   . THR A 1 81  ? 4.877   -10.779 2.197   1.00 0.00 ? 81  THR A HA   2  
ATOM 2848  H HB   . THR A 1 81  ? 6.419   -12.230 0.695   1.00 0.00 ? 81  THR A HB   2  
ATOM 2849  H HG1  . THR A 1 81  ? 7.058   -14.167 1.671   1.00 0.00 ? 81  THR A HG1  2  
ATOM 2850  H HG21 . THR A 1 81  ? 7.527   -11.807 3.510   1.00 0.00 ? 81  THR A HG21 2  
ATOM 2851  H HG22 . THR A 1 81  ? 8.418   -11.753 1.971   1.00 0.00 ? 81  THR A HG22 2  
ATOM 2852  H HG23 . THR A 1 81  ? 7.273   -10.454 2.382   1.00 0.00 ? 81  THR A HG23 2  
ATOM 2853  N N    . GLY A 1 82  ? 3.218   -11.590 0.614   1.00 0.00 ? 82  GLY A N    2  
ATOM 2854  C CA   . GLY A 1 82  ? 2.116   -12.007 -0.234  1.00 0.00 ? 82  GLY A CA   2  
ATOM 2855  C C    . GLY A 1 82  ? 0.826   -11.274 0.142   1.00 0.00 ? 82  GLY A C    2  
ATOM 2856  O O    . GLY A 1 82  ? 0.151   -10.715 -0.721  1.00 0.00 ? 82  GLY A O    2  
ATOM 2857  H H    . GLY A 1 82  ? 3.477   -10.628 0.530   1.00 0.00 ? 82  GLY A H    2  
ATOM 2858  H HA2  . GLY A 1 82  ? 2.359   -11.807 -1.278  1.00 0.00 ? 82  GLY A HA2  2  
ATOM 2859  H HA3  . GLY A 1 82  ? 1.966   -13.083 -0.143  1.00 0.00 ? 82  GLY A HA3  2  
ATOM 2860  N N    . ASP A 1 83  ? 0.522   -11.302 1.432   1.00 0.00 ? 83  ASP A N    2  
ATOM 2861  C CA   . ASP A 1 83  ? -0.674  -10.649 1.934   1.00 0.00 ? 83  ASP A CA   2  
ATOM 2862  C C    . ASP A 1 83  ? -0.721  -9.211  1.412   1.00 0.00 ? 83  ASP A C    2  
ATOM 2863  O O    . ASP A 1 83  ? 0.286   -8.507  1.430   1.00 0.00 ? 83  ASP A O    2  
ATOM 2864  C CB   . ASP A 1 83  ? -0.673  -10.597 3.462   1.00 0.00 ? 83  ASP A CB   2  
ATOM 2865  C CG   . ASP A 1 83  ? -0.975  -11.927 4.155   1.00 0.00 ? 83  ASP A CG   2  
ATOM 2866  O OD1  . ASP A 1 83  ? -1.449  -12.842 3.446   1.00 0.00 ? 83  ASP A OD1  2  
ATOM 2867  O OD2  . ASP A 1 83  ? -0.725  -12.001 5.377   1.00 0.00 ? 83  ASP A OD2  2  
ATOM 2868  H H    . ASP A 1 83  ? 1.076   -11.761 2.127   1.00 0.00 ? 83  ASP A H    2  
ATOM 2869  H HA   . ASP A 1 83  ? -1.505  -11.251 1.568   1.00 0.00 ? 83  ASP A HA   2  
ATOM 2870  H HB3  . ASP A 1 83  ? -1.410  -9.861  3.787   1.00 0.00 ? 83  ASP A HB3  2  
ATOM 2871  N N    . ARG A 1 84  ? -1.903  -8.818  0.959   1.00 0.00 ? 84  ARG A N    2  
ATOM 2872  C CA   . ARG A 1 84  ? -2.094  -7.477  0.432   1.00 0.00 ? 84  ARG A CA   2  
ATOM 2873  C C    . ARG A 1 84  ? -3.037  -6.681  1.338   1.00 0.00 ? 84  ARG A C    2  
ATOM 2874  O O    . ARG A 1 84  ? -3.971  -7.240  1.911   1.00 0.00 ? 84  ARG A O    2  
ATOM 2875  C CB   . ARG A 1 84  ? -2.672  -7.518  -0.984  1.00 0.00 ? 84  ARG A CB   2  
ATOM 2876  C CG   . ARG A 1 84  ? -4.176  -7.797  -0.955  1.00 0.00 ? 84  ARG A CG   2  
ATOM 2877  C CD   . ARG A 1 84  ? -4.597  -8.657  -2.147  1.00 0.00 ? 84  ARG A CD   2  
ATOM 2878  N NE   . ARG A 1 84  ? -6.056  -8.895  -2.111  1.00 0.00 ? 84  ARG A NE   2  
ATOM 2879  C CZ   . ARG A 1 84  ? -6.700  -9.749  -2.918  1.00 0.00 ? 84  ARG A CZ   2  
ATOM 2880  N NH1  . ARG A 1 84  ? -6.015  -10.452 -3.831  1.00 0.00 ? 84  ARG A NH1  2  
ATOM 2881  N NH2  . ARG A 1 84  ? -8.027  -9.902  -2.812  1.00 0.00 ? 84  ARG A NH2  2  
ATOM 2882  H H    . ARG A 1 84  ? -2.718  -9.397  0.948   1.00 0.00 ? 84  ARG A H    2  
ATOM 2883  H HA   . ARG A 1 84  ? -1.097  -7.037  0.423   1.00 0.00 ? 84  ARG A HA   2  
ATOM 2884  H HB3  . ARG A 1 84  ? -2.166  -8.289  -1.564  1.00 0.00 ? 84  ARG A HB3  2  
ATOM 2885  H HG3  . ARG A 1 84  ? -4.724  -6.856  -0.968  1.00 0.00 ? 84  ARG A HG3  2  
ATOM 2886  H HD3  . ARG A 1 84  ? -4.064  -9.608  -2.127  1.00 0.00 ? 84  ARG A HD3  2  
ATOM 2887  H HE   . ARG A 1 84  ? -6.597  -8.387  -1.439  1.00 0.00 ? 84  ARG A HE   2  
ATOM 2888  H HH11 . ARG A 1 84  ? -5.026  -10.338 -3.910  1.00 0.00 ? 84  ARG A HH11 2  
ATOM 2889  H HH12 . ARG A 1 84  ? -6.496  -11.088 -4.435  1.00 0.00 ? 84  ARG A HH12 2  
ATOM 2890  H HH21 . ARG A 1 84  ? -8.538  -9.378  -2.130  1.00 0.00 ? 84  ARG A HH21 2  
ATOM 2891  H HH22 . ARG A 1 84  ? -8.507  -10.538 -3.415  1.00 0.00 ? 84  ARG A HH22 2  
ATOM 2892  N N    . ILE A 1 85  ? -2.760  -5.391  1.438   1.00 0.00 ? 85  ILE A N    2  
ATOM 2893  C CA   . ILE A 1 85  ? -3.571  -4.512  2.264   1.00 0.00 ? 85  ILE A CA   2  
ATOM 2894  C C    . ILE A 1 85  ? -4.812  -4.084  1.478   1.00 0.00 ? 85  ILE A C    2  
ATOM 2895  O O    . ILE A 1 85  ? -4.700  -3.439  0.437   1.00 0.00 ? 85  ILE A O    2  
ATOM 2896  C CB   . ILE A 1 85  ? -2.736  -3.340  2.782   1.00 0.00 ? 85  ILE A CB   2  
ATOM 2897  C CG1  . ILE A 1 85  ? -1.928  -3.746  4.016   1.00 0.00 ? 85  ILE A CG1  2  
ATOM 2898  C CG2  . ILE A 1 85  ? -3.614  -2.116  3.049   1.00 0.00 ? 85  ILE A CG2  2  
ATOM 2899  C CD1  . ILE A 1 85  ? -1.111  -5.010  3.745   1.00 0.00 ? 85  ILE A CD1  2  
ATOM 2900  H H    . ILE A 1 85  ? -1.998  -4.944  0.968   1.00 0.00 ? 85  ILE A H    2  
ATOM 2901  H HA   . ILE A 1 85  ? -3.894  -5.087  3.133   1.00 0.00 ? 85  ILE A HA   2  
ATOM 2902  H HB   . ILE A 1 85  ? -2.022  -3.060  2.007   1.00 0.00 ? 85  ILE A HB   2  
ATOM 2903  H HG13 . ILE A 1 85  ? -2.601  -3.915  4.857   1.00 0.00 ? 85  ILE A HG13 2  
ATOM 2904  H HG21 . ILE A 1 85  ? -3.912  -1.669  2.100   1.00 0.00 ? 85  ILE A HG21 2  
ATOM 2905  H HG22 . ILE A 1 85  ? -4.504  -2.420  3.602   1.00 0.00 ? 85  ILE A HG22 2  
ATOM 2906  H HG23 . ILE A 1 85  ? -3.055  -1.387  3.635   1.00 0.00 ? 85  ILE A HG23 2  
ATOM 2907  H HD11 . ILE A 1 85  ? -1.787  -5.847  3.565   1.00 0.00 ? 85  ILE A HD11 2  
ATOM 2908  H HD12 . ILE A 1 85  ? -0.482  -4.856  2.870   1.00 0.00 ? 85  ILE A HD12 2  
ATOM 2909  H HD13 . ILE A 1 85  ? -0.485  -5.230  4.609   1.00 0.00 ? 85  ILE A HD13 2  
ATOM 2910  N N    . ILE A 1 86  ? -5.968  -4.460  2.007   1.00 0.00 ? 86  ILE A N    2  
ATOM 2911  C CA   . ILE A 1 86  ? -7.228  -4.122  1.368   1.00 0.00 ? 86  ILE A CA   2  
ATOM 2912  C C    . ILE A 1 86  ? -7.904  -2.993  2.149   1.00 0.00 ? 86  ILE A C    2  
ATOM 2913  O O    . ILE A 1 86  ? -8.660  -2.207  1.580   1.00 0.00 ? 86  ILE A O    2  
ATOM 2914  C CB   . ILE A 1 86  ? -8.101  -5.370  1.211   1.00 0.00 ? 86  ILE A CB   2  
ATOM 2915  C CG1  . ILE A 1 86  ? -8.344  -6.042  2.564   1.00 0.00 ? 86  ILE A CG1  2  
ATOM 2916  C CG2  . ILE A 1 86  ? -7.496  -6.336  0.191   1.00 0.00 ? 86  ILE A CG2  2  
ATOM 2917  C CD1  . ILE A 1 86  ? -9.377  -7.164  2.439   1.00 0.00 ? 86  ILE A CD1  2  
ATOM 2918  H H    . ILE A 1 86  ? -6.051  -4.983  2.854   1.00 0.00 ? 86  ILE A H    2  
ATOM 2919  H HA   . ILE A 1 86  ? -7.000  -3.760  0.366   1.00 0.00 ? 86  ILE A HA   2  
ATOM 2920  H HB   . ILE A 1 86  ? -9.072  -5.061  0.825   1.00 0.00 ? 86  ILE A HB   2  
ATOM 2921  H HG13 . ILE A 1 86  ? -8.690  -5.301  3.285   1.00 0.00 ? 86  ILE A HG13 2  
ATOM 2922  H HG21 . ILE A 1 86  ? -8.045  -6.264  -0.748  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 2923  H HG22 . ILE A 1 86  ? -6.450  -6.077  0.020   1.00 0.00 ? 86  ILE A HG22 2  
ATOM 2924  H HG23 . ILE A 1 86  ? -7.560  -7.355  0.573   1.00 0.00 ? 86  ILE A HG23 2  
ATOM 2925  H HD11 . ILE A 1 86  ? -8.894  -8.062  2.054   1.00 0.00 ? 86  ILE A HD11 2  
ATOM 2926  H HD12 . ILE A 1 86  ? -9.805  -7.373  3.420   1.00 0.00 ? 86  ILE A HD12 2  
ATOM 2927  H HD13 . ILE A 1 86  ? -10.169 -6.855  1.758   1.00 0.00 ? 86  ILE A HD13 2  
ATOM 2928  N N    . LYS A 1 87  ? -7.610  -2.950  3.440   1.00 0.00 ? 87  LYS A N    2  
ATOM 2929  C CA   . LYS A 1 87  ? -8.180  -1.932  4.305   1.00 0.00 ? 87  LYS A CA   2  
ATOM 2930  C C    . LYS A 1 87  ? -7.071  -1.313  5.157   1.00 0.00 ? 87  LYS A C    2  
ATOM 2931  O O    . LYS A 1 87  ? -5.969  -1.854  5.237   1.00 0.00 ? 87  LYS A O    2  
ATOM 2932  C CB   . LYS A 1 87  ? -9.335  -2.510  5.124   1.00 0.00 ? 87  LYS A CB   2  
ATOM 2933  C CG   . LYS A 1 87  ? -10.451 -3.025  4.212   1.00 0.00 ? 87  LYS A CG   2  
ATOM 2934  C CD   . LYS A 1 87  ? -11.099 -4.282  4.797   1.00 0.00 ? 87  LYS A CD   2  
ATOM 2935  C CE   . LYS A 1 87  ? -11.731 -5.135  3.695   1.00 0.00 ? 87  LYS A CE   2  
ATOM 2936  N NZ   . LYS A 1 87  ? -12.392 -6.325  4.275   1.00 0.00 ? 87  LYS A NZ   2  
ATOM 2937  H H    . LYS A 1 87  ? -6.995  -3.594  3.894   1.00 0.00 ? 87  LYS A H    2  
ATOM 2938  H HA   . LYS A 1 87  ? -8.598  -1.155  3.663   1.00 0.00 ? 87  LYS A HA   2  
ATOM 2939  H HB3  . LYS A 1 87  ? -9.731  -1.745  5.792   1.00 0.00 ? 87  LYS A HB3  2  
ATOM 2940  H HG3  . LYS A 1 87  ? -10.045 -3.246  3.224   1.00 0.00 ? 87  LYS A HG3  2  
ATOM 2941  H HD3  . LYS A 1 87  ? -11.860 -3.999  5.524   1.00 0.00 ? 87  LYS A HD3  2  
ATOM 2942  H HE3  . LYS A 1 87  ? -10.967 -5.447  2.983   1.00 0.00 ? 87  LYS A HE3  2  
ATOM 2943  H HZ1  . LYS A 1 87  ? -11.712 -6.889  4.746   1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 2944  H HZ2  . LYS A 1 87  ? -13.091 -6.033  4.929   1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 2945  H HZ3  . LYS A 1 87  ? -12.820 -6.859  3.546   1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 2946  N N    . VAL A 1 88  ? -7.399  -0.187  5.772   1.00 0.00 ? 88  VAL A N    2  
ATOM 2947  C CA   . VAL A 1 88  ? -6.445  0.512   6.615   1.00 0.00 ? 88  VAL A CA   2  
ATOM 2948  C C    . VAL A 1 88  ? -7.199  1.303   7.686   1.00 0.00 ? 88  VAL A C    2  
ATOM 2949  O O    . VAL A 1 88  ? -7.939  2.233   7.370   1.00 0.00 ? 88  VAL A O    2  
ATOM 2950  C CB   . VAL A 1 88  ? -5.531  1.390   5.756   1.00 0.00 ? 88  VAL A CB   2  
ATOM 2951  C CG1  . VAL A 1 88  ? -4.757  2.386   6.620   1.00 0.00 ? 88  VAL A CG1  2  
ATOM 2952  C CG2  . VAL A 1 88  ? -4.579  0.534   4.920   1.00 0.00 ? 88  VAL A CG2  2  
ATOM 2953  H H    . VAL A 1 88  ? -8.298  0.248   5.701   1.00 0.00 ? 88  VAL A H    2  
ATOM 2954  H HA   . VAL A 1 88  ? -5.826  -0.241  7.106   1.00 0.00 ? 88  VAL A HA   2  
ATOM 2955  H HB   . VAL A 1 88  ? -6.160  1.957   5.072   1.00 0.00 ? 88  VAL A HB   2  
ATOM 2956  H HG11 . VAL A 1 88  ? -5.444  2.884   7.307   1.00 0.00 ? 88  VAL A HG11 2  
ATOM 2957  H HG12 . VAL A 1 88  ? -3.995  1.857   7.193   1.00 0.00 ? 88  VAL A HG12 2  
ATOM 2958  H HG13 . VAL A 1 88  ? -4.281  3.130   5.982   1.00 0.00 ? 88  VAL A HG13 2  
ATOM 2959  H HG21 . VAL A 1 88  ? -3.786  1.164   4.514   1.00 0.00 ? 88  VAL A HG21 2  
ATOM 2960  H HG22 . VAL A 1 88  ? -4.139  -0.241  5.548   1.00 0.00 ? 88  VAL A HG22 2  
ATOM 2961  H HG23 . VAL A 1 88  ? -5.129  0.070   4.101   1.00 0.00 ? 88  VAL A HG23 2  
ATOM 2962  N N    . ASN A 1 89  ? -6.985  0.904   8.932   1.00 0.00 ? 89  ASN A N    2  
ATOM 2963  C CA   . ASN A 1 89  ? -7.635  1.564   10.051  1.00 0.00 ? 89  ASN A CA   2  
ATOM 2964  C C    . ASN A 1 89  ? -9.147  1.590   9.813   1.00 0.00 ? 89  ASN A C    2  
ATOM 2965  O O    . ASN A 1 89  ? -9.829  2.521   10.237  1.00 0.00 ? 89  ASN A O    2  
ATOM 2966  C CB   . ASN A 1 89  ? -7.155  3.010   10.193  1.00 0.00 ? 89  ASN A CB   2  
ATOM 2967  C CG   . ASN A 1 89  ? -5.630  3.072   10.306  1.00 0.00 ? 89  ASN A CG   2  
ATOM 2968  O OD1  . ASN A 1 89  ? -5.008  2.345   11.062  1.00 0.00 ? 89  ASN A OD1  2  
ATOM 2969  N ND2  . ASN A 1 89  ? -5.066  3.980   9.515   1.00 0.00 ? 89  ASN A ND2  2  
ATOM 2970  H H    . ASN A 1 89  ? -6.381  0.148   9.181   1.00 0.00 ? 89  ASN A H    2  
ATOM 2971  H HA   . ASN A 1 89  ? -7.361  0.978   10.928  1.00 0.00 ? 89  ASN A HA   2  
ATOM 2972  H HB3  . ASN A 1 89  ? -7.608  3.464   11.075  1.00 0.00 ? 89  ASN A HB3  2  
ATOM 2973  H HD21 . ASN A 1 89  ? -5.635  4.545   8.917   1.00 0.00 ? 89  ASN A HD21 2  
ATOM 2974  H HD22 . ASN A 1 89  ? -4.073  4.097   9.516   1.00 0.00 ? 89  ASN A HD22 2  
ATOM 2975  N N    . GLY A 1 90  ? -9.626  0.554   9.139   1.00 0.00 ? 90  GLY A N    2  
ATOM 2976  C CA   . GLY A 1 90  ? -11.043 0.446   8.841   1.00 0.00 ? 90  GLY A CA   2  
ATOM 2977  C C    . GLY A 1 90  ? -11.424 1.334   7.654   1.00 0.00 ? 90  GLY A C    2  
ATOM 2978  O O    . GLY A 1 90  ? -12.599 1.448   7.313   1.00 0.00 ? 90  GLY A O    2  
ATOM 2979  H H    . GLY A 1 90  ? -9.063  -0.200  8.798   1.00 0.00 ? 90  GLY A H    2  
ATOM 2980  H HA2  . GLY A 1 90  ? -11.294 -0.592  8.618   1.00 0.00 ? 90  GLY A HA2  2  
ATOM 2981  H HA3  . GLY A 1 90  ? -11.625 0.734   9.717   1.00 0.00 ? 90  GLY A HA3  2  
ATOM 2982  N N    . GLU A 1 91  ? -10.406 1.939   7.059   1.00 0.00 ? 91  GLU A N    2  
ATOM 2983  C CA   . GLU A 1 91  ? -10.619 2.813   5.918   1.00 0.00 ? 91  GLU A CA   2  
ATOM 2984  C C    . GLU A 1 91  ? -10.418 2.040   4.614   1.00 0.00 ? 91  GLU A C    2  
ATOM 2985  O O    . GLU A 1 91  ? -9.320  1.557   4.337   1.00 0.00 ? 91  GLU A O    2  
ATOM 2986  C CB   . GLU A 1 91  ? -9.697  4.033   5.982   1.00 0.00 ? 91  GLU A CB   2  
ATOM 2987  C CG   . GLU A 1 91  ? -10.475 5.322   5.718   1.00 0.00 ? 91  GLU A CG   2  
ATOM 2988  C CD   . GLU A 1 91  ? -9.560  6.545   5.822   1.00 0.00 ? 91  GLU A CD   2  
ATOM 2989  O OE1  . GLU A 1 91  ? -8.783  6.590   6.799   1.00 0.00 ? 91  GLU A OE1  2  
ATOM 2990  O OE2  . GLU A 1 91  ? -9.662  7.407   4.923   1.00 0.00 ? 91  GLU A OE2  2  
ATOM 2991  H H    . GLU A 1 91  ? -9.452  1.840   7.344   1.00 0.00 ? 91  GLU A H    2  
ATOM 2992  H HA   . GLU A 1 91  ? -11.655 3.144   5.996   1.00 0.00 ? 91  GLU A HA   2  
ATOM 2993  H HB3  . GLU A 1 91  ? -8.899  3.929   5.247   1.00 0.00 ? 91  GLU A HB3  2  
ATOM 2994  H HG3  . GLU A 1 91  ? -11.292 5.412   6.433   1.00 0.00 ? 91  GLU A HG3  2  
ATOM 2995  N N    . SER A 1 92  ? -11.494 1.948   3.844   1.00 0.00 ? 92  SER A N    2  
ATOM 2996  C CA   . SER A 1 92  ? -11.448 1.243   2.575   1.00 0.00 ? 92  SER A CA   2  
ATOM 2997  C C    . SER A 1 92  ? -10.492 1.954   1.615   1.00 0.00 ? 92  SER A C    2  
ATOM 2998  O O    . SER A 1 92  ? -10.591 3.164   1.417   1.00 0.00 ? 92  SER A O    2  
ATOM 2999  C CB   . SER A 1 92  ? -12.843 1.138   1.955   1.00 0.00 ? 92  SER A CB   2  
ATOM 3000  O OG   . SER A 1 92  ? -13.548 2.374   2.013   1.00 0.00 ? 92  SER A OG   2  
ATOM 3001  H H    . SER A 1 92  ? -12.381 2.345   4.078   1.00 0.00 ? 92  SER A H    2  
ATOM 3002  H HA   . SER A 1 92  ? -11.079 0.245   2.812   1.00 0.00 ? 92  SER A HA   2  
ATOM 3003  H HB3  . SER A 1 92  ? -13.414 0.368   2.474   1.00 0.00 ? 92  SER A HB3  2  
ATOM 3004  H HG   . SER A 1 92  ? -14.534 2.204   2.066   1.00 0.00 ? 92  SER A HG   2  
ATOM 3005  N N    . VAL A 1 93  ? -9.587  1.172   1.045   1.00 0.00 ? 93  VAL A N    2  
ATOM 3006  C CA   . VAL A 1 93  ? -8.614  1.711   0.111   1.00 0.00 ? 93  VAL A CA   2  
ATOM 3007  C C    . VAL A 1 93  ? -9.256  1.835   -1.273  1.00 0.00 ? 93  VAL A C    2  
ATOM 3008  O O    . VAL A 1 93  ? -8.815  2.634   -2.096  1.00 0.00 ? 93  VAL A O    2  
ATOM 3009  C CB   . VAL A 1 93  ? -7.353  0.844   0.109   1.00 0.00 ? 93  VAL A CB   2  
ATOM 3010  C CG1  . VAL A 1 93  ? -6.967  0.436   1.532   1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3011  C CG2  . VAL A 1 93  ? -7.534  -0.385  -0.783  1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3012  H H    . VAL A 1 93  ? -9.513  0.189   1.212   1.00 0.00 ? 93  VAL A H    2  
ATOM 3013  H HA   . VAL A 1 93  ? -8.340  2.707   0.459   1.00 0.00 ? 93  VAL A HA   2  
ATOM 3014  H HB   . VAL A 1 93  ? -6.538  1.440   -0.302  1.00 0.00 ? 93  VAL A HB   2  
ATOM 3015  H HG11 . VAL A 1 93  ? -5.918  0.678   1.707   1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3016  H HG12 . VAL A 1 93  ? -7.587  0.979   2.247   1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3017  H HG13 . VAL A 1 93  ? -7.120  -0.635  1.658   1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3018  H HG21 . VAL A 1 93  ? -8.384  -0.969  -0.430  1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3019  H HG22 . VAL A 1 93  ? -7.714  -0.066  -1.810  1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3020  H HG23 . VAL A 1 93  ? -6.633  -0.997  -0.745  1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3021  N N    . ILE A 1 94  ? -10.287 1.031   -1.485  1.00 0.00 ? 94  ILE A N    2  
ATOM 3022  C CA   . ILE A 1 94  ? -10.995 1.041   -2.755  1.00 0.00 ? 94  ILE A CA   2  
ATOM 3023  C C    . ILE A 1 94  ? -11.145 2.483   -3.239  1.00 0.00 ? 94  ILE A C    2  
ATOM 3024  O O    . ILE A 1 94  ? -11.800 3.296   -2.588  1.00 0.00 ? 94  ILE A O    2  
ATOM 3025  C CB   . ILE A 1 94  ? -12.322 0.290   -2.634  1.00 0.00 ? 94  ILE A CB   2  
ATOM 3026  C CG1  . ILE A 1 94  ? -12.090 -1.202  -2.393  1.00 0.00 ? 94  ILE A CG1  2  
ATOM 3027  C CG2  . ILE A 1 94  ? -13.207 0.542   -3.857  1.00 0.00 ? 94  ILE A CG2  2  
ATOM 3028  C CD1  . ILE A 1 94  ? -12.403 -1.579  -0.943  1.00 0.00 ? 94  ILE A CD1  2  
ATOM 3029  H H    . ILE A 1 94  ? -10.640 0.383   -0.810  1.00 0.00 ? 94  ILE A H    2  
ATOM 3030  H HA   . ILE A 1 94  ? -10.382 0.496   -3.473  1.00 0.00 ? 94  ILE A HA   2  
ATOM 3031  H HB   . ILE A 1 94  ? -12.855 0.677   -1.766  1.00 0.00 ? 94  ILE A HB   2  
ATOM 3032  H HG13 . ILE A 1 94  ? -11.054 -1.455  -2.622  1.00 0.00 ? 94  ILE A HG13 2  
ATOM 3033  H HG21 . ILE A 1 94  ? -13.492 1.593   -3.889  1.00 0.00 ? 94  ILE A HG21 2  
ATOM 3034  H HG22 . ILE A 1 94  ? -12.657 0.287   -4.763  1.00 0.00 ? 94  ILE A HG22 2  
ATOM 3035  H HG23 . ILE A 1 94  ? -14.103 -0.076  -3.791  1.00 0.00 ? 94  ILE A HG23 2  
ATOM 3036  H HD11 . ILE A 1 94  ? -12.177 -0.734  -0.292  1.00 0.00 ? 94  ILE A HD11 2  
ATOM 3037  H HD12 . ILE A 1 94  ? -13.458 -1.836  -0.854  1.00 0.00 ? 94  ILE A HD12 2  
ATOM 3038  H HD13 . ILE A 1 94  ? -11.795 -2.435  -0.651  1.00 0.00 ? 94  ILE A HD13 2  
ATOM 3039  N N    . GLY A 1 95  ? -10.526 2.759   -4.379  1.00 0.00 ? 95  GLY A N    2  
ATOM 3040  C CA   . GLY A 1 95  ? -10.583 4.090   -4.958  1.00 0.00 ? 95  GLY A CA   2  
ATOM 3041  C C    . GLY A 1 95  ? -9.379  4.929   -4.524  1.00 0.00 ? 95  GLY A C    2  
ATOM 3042  O O    . GLY A 1 95  ? -8.760  5.604   -5.346  1.00 0.00 ? 95  GLY A O    2  
ATOM 3043  H H    . GLY A 1 95  ? -9.995  2.094   -4.902  1.00 0.00 ? 95  GLY A H    2  
ATOM 3044  H HA2  . GLY A 1 95  ? -10.607 4.017   -6.045  1.00 0.00 ? 95  GLY A HA2  2  
ATOM 3045  H HA3  . GLY A 1 95  ? -11.504 4.585   -4.651  1.00 0.00 ? 95  GLY A HA3  2  
ATOM 3046  N N    . LYS A 1 96  ? -9.084  4.859   -3.235  1.00 0.00 ? 96  LYS A N    2  
ATOM 3047  C CA   . LYS A 1 96  ? -7.964  5.603   -2.682  1.00 0.00 ? 96  LYS A CA   2  
ATOM 3048  C C    . LYS A 1 96  ? -6.679  5.195   -3.405  1.00 0.00 ? 96  LYS A C    2  
ATOM 3049  O O    . LYS A 1 96  ? -6.523  4.041   -3.797  1.00 0.00 ? 96  LYS A O    2  
ATOM 3050  C CB   . LYS A 1 96  ? -7.900  5.425   -1.164  1.00 0.00 ? 96  LYS A CB   2  
ATOM 3051  C CG   . LYS A 1 96  ? -9.078  6.120   -0.480  1.00 0.00 ? 96  LYS A CG   2  
ATOM 3052  C CD   . LYS A 1 96  ? -8.817  6.296   1.019   1.00 0.00 ? 96  LYS A CD   2  
ATOM 3053  C CE   . LYS A 1 96  ? -9.545  7.526   1.562   1.00 0.00 ? 96  LYS A CE   2  
ATOM 3054  N NZ   . LYS A 1 96  ? -10.822 7.132   2.201   1.00 0.00 ? 96  LYS A NZ   2  
ATOM 3055  H H    . LYS A 1 96  ? -9.592  4.308   -2.573  1.00 0.00 ? 96  LYS A H    2  
ATOM 3056  H HA   . LYS A 1 96  ? -8.149  6.661   -2.874  1.00 0.00 ? 96  LYS A HA   2  
ATOM 3057  H HB3  . LYS A 1 96  ? -6.962  5.833   -0.786  1.00 0.00 ? 96  LYS A HB3  2  
ATOM 3058  H HG3  . LYS A 1 96  ? -9.986  5.536   -0.627  1.00 0.00 ? 96  LYS A HG3  2  
ATOM 3059  H HD3  . LYS A 1 96  ? -7.745  6.396   1.195   1.00 0.00 ? 96  LYS A HD3  2  
ATOM 3060  H HE3  . LYS A 1 96  ? -9.739  8.228   0.751   1.00 0.00 ? 96  LYS A HE3  2  
ATOM 3061  H HZ1  . LYS A 1 96  ? -11.021 6.176   1.983   1.00 0.00 ? 96  LYS A HZ1  2  
ATOM 3062  H HZ2  . LYS A 1 96  ? -10.745 7.240   3.191   1.00 0.00 ? 96  LYS A HZ2  2  
ATOM 3063  H HZ3  . LYS A 1 96  ? -11.559 7.713   1.857   1.00 0.00 ? 96  LYS A HZ3  2  
ATOM 3064  N N    . THR A 1 97  ? -5.791  6.167   -3.559  1.00 0.00 ? 97  THR A N    2  
ATOM 3065  C CA   . THR A 1 97  ? -4.525  5.923   -4.228  1.00 0.00 ? 97  THR A CA   2  
ATOM 3066  C C    . THR A 1 97  ? -3.463  5.486   -3.217  1.00 0.00 ? 97  THR A C    2  
ATOM 3067  O O    . THR A 1 97  ? -3.560  5.805   -2.032  1.00 0.00 ? 97  THR A O    2  
ATOM 3068  C CB   . THR A 1 97  ? -4.146  7.189   -4.999  1.00 0.00 ? 97  THR A CB   2  
ATOM 3069  O OG1  . THR A 1 97  ? -2.900  6.864   -5.611  1.00 0.00 ? 97  THR A OG1  2  
ATOM 3070  C CG2  . THR A 1 97  ? -3.811  8.359   -4.073  1.00 0.00 ? 97  THR A CG2  2  
ATOM 3071  H H    . THR A 1 97  ? -5.926  7.103   -3.238  1.00 0.00 ? 97  THR A H    2  
ATOM 3072  H HA   . THR A 1 97  ? -4.659  5.098   -4.927  1.00 0.00 ? 97  THR A HA   2  
ATOM 3073  H HB   . THR A 1 97  ? -4.929  7.463   -5.706  1.00 0.00 ? 97  THR A HB   2  
ATOM 3074  H HG1  . THR A 1 97  ? -2.646  7.573   -6.268  1.00 0.00 ? 97  THR A HG1  2  
ATOM 3075  H HG21 . THR A 1 97  ? -4.101  9.296   -4.551  1.00 0.00 ? 97  THR A HG21 2  
ATOM 3076  H HG22 . THR A 1 97  ? -4.353  8.247   -3.134  1.00 0.00 ? 97  THR A HG22 2  
ATOM 3077  H HG23 . THR A 1 97  ? -2.739  8.372   -3.874  1.00 0.00 ? 97  THR A HG23 2  
ATOM 3078  N N    . TYR A 1 98  ? -2.473  4.764   -3.721  1.00 0.00 ? 98  TYR A N    2  
ATOM 3079  C CA   . TYR A 1 98  ? -1.394  4.280   -2.875  1.00 0.00 ? 98  TYR A CA   2  
ATOM 3080  C C    . TYR A 1 98  ? -0.944  5.361   -1.890  1.00 0.00 ? 98  TYR A C    2  
ATOM 3081  O O    . TYR A 1 98  ? -0.709  5.075   -0.716  1.00 0.00 ? 98  TYR A O    2  
ATOM 3082  C CB   . TYR A 1 98  ? -0.235  3.953   -3.819  1.00 0.00 ? 98  TYR A CB   2  
ATOM 3083  C CG   . TYR A 1 98  ? 1.132   3.906   -3.133  1.00 0.00 ? 98  TYR A CG   2  
ATOM 3084  C CD1  . TYR A 1 98  ? 1.504   2.788   -2.415  1.00 0.00 ? 98  TYR A CD1  2  
ATOM 3085  C CD2  . TYR A 1 98  ? 1.990   4.981   -3.231  1.00 0.00 ? 98  TYR A CD2  2  
ATOM 3086  C CE1  . TYR A 1 98  ? 2.792   2.743   -1.768  1.00 0.00 ? 98  TYR A CE1  2  
ATOM 3087  C CE2  . TYR A 1 98  ? 3.277   4.937   -2.584  1.00 0.00 ? 98  TYR A CE2  2  
ATOM 3088  C CZ   . TYR A 1 98  ? 3.613   3.821   -1.885  1.00 0.00 ? 98  TYR A CZ   2  
ATOM 3089  O OH   . TYR A 1 98  ? 4.828   3.779   -1.275  1.00 0.00 ? 98  TYR A OH   2  
ATOM 3090  H H    . TYR A 1 98  ? -2.402  4.509   -4.686  1.00 0.00 ? 98  TYR A H    2  
ATOM 3091  H HA   . TYR A 1 98  ? -1.763  3.420   -2.318  1.00 0.00 ? 98  TYR A HA   2  
ATOM 3092  H HB3  . TYR A 1 98  ? -0.205  4.698   -4.614  1.00 0.00 ? 98  TYR A HB3  2  
ATOM 3093  H HD1  . TYR A 1 98  ? 0.826   1.939   -2.338  1.00 0.00 ? 98  TYR A HD1  2  
ATOM 3094  H HD2  . TYR A 1 98  ? 1.696   5.865   -3.797  1.00 0.00 ? 98  TYR A HD2  2  
ATOM 3095  H HE1  . TYR A 1 98  ? 3.099   1.868   -1.199  1.00 0.00 ? 98  TYR A HE1  2  
ATOM 3096  H HE2  . TYR A 1 98  ? 3.965   5.780   -2.654  1.00 0.00 ? 98  TYR A HE2  2  
ATOM 3097  H HH   . TYR A 1 98  ? 5.265   2.894   -1.443  1.00 0.00 ? 98  TYR A HH   2  
ATOM 3098  N N    . SER A 1 99  ? -0.837  6.577   -2.402  1.00 0.00 ? 99  SER A N    2  
ATOM 3099  C CA   . SER A 1 99  ? -0.419  7.700   -1.581  1.00 0.00 ? 99  SER A CA   2  
ATOM 3100  C C    . SER A 1 99  ? -1.397  7.892   -0.420  1.00 0.00 ? 99  SER A C    2  
ATOM 3101  O O    . SER A 1 99  ? -0.980  8.090   0.720   1.00 0.00 ? 99  SER A O    2  
ATOM 3102  C CB   . SER A 1 99  ? -0.323  8.983   -2.411  1.00 0.00 ? 99  SER A CB   2  
ATOM 3103  O OG   . SER A 1 99  ? 0.738   9.825   -1.970  1.00 0.00 ? 99  SER A OG   2  
ATOM 3104  H H    . SER A 1 99  ? -1.029  6.801   -3.358  1.00 0.00 ? 99  SER A H    2  
ATOM 3105  H HA   . SER A 1 99  ? 0.570   7.435   -1.210  1.00 0.00 ? 99  SER A HA   2  
ATOM 3106  H HB3  . SER A 1 99  ? -1.266  9.525   -2.351  1.00 0.00 ? 99  SER A HB3  2  
ATOM 3107  H HG   . SER A 1 99  ? 1.304   9.342   -1.301  1.00 0.00 ? 99  SER A HG   2  
ATOM 3108  N N    . GLN A 1 100 ? -2.679  7.828   -0.750  1.00 0.00 ? 100 GLN A N    2  
ATOM 3109  C CA   . GLN A 1 100 ? -3.718  7.992   0.251   1.00 0.00 ? 100 GLN A CA   2  
ATOM 3110  C C    . GLN A 1 100 ? -3.535  6.973   1.378   1.00 0.00 ? 100 GLN A C    2  
ATOM 3111  O O    . GLN A 1 100 ? -3.288  7.346   2.523   1.00 0.00 ? 100 GLN A O    2  
ATOM 3112  C CB   . GLN A 1 100 ? -5.108  7.872   -0.377  1.00 0.00 ? 100 GLN A CB   2  
ATOM 3113  C CG   . GLN A 1 100 ? -5.591  9.225   -0.902  1.00 0.00 ? 100 GLN A CG   2  
ATOM 3114  C CD   . GLN A 1 100 ? -6.928  9.613   -0.267  1.00 0.00 ? 100 GLN A CD   2  
ATOM 3115  O OE1  . GLN A 1 100 ? -7.053  9.764   0.937   1.00 0.00 ? 100 GLN A OE1  2  
ATOM 3116  N NE2  . GLN A 1 100 ? -7.919  9.767   -1.142  1.00 0.00 ? 100 GLN A NE2  2  
ATOM 3117  H H    . GLN A 1 100 ? -3.009  7.667   -1.680  1.00 0.00 ? 100 GLN A H    2  
ATOM 3118  H HA   . GLN A 1 100 ? -3.589  9.002   0.641   1.00 0.00 ? 100 GLN A HA   2  
ATOM 3119  H HB3  . GLN A 1 100 ? -5.813  7.491   0.362   1.00 0.00 ? 100 GLN A HB3  2  
ATOM 3120  H HG3  . GLN A 1 100 ? -5.698  9.182   -1.987  1.00 0.00 ? 100 GLN A HG3  2  
ATOM 3121  H HE21 . GLN A 1 100 ? -7.749  9.628   -2.118  1.00 0.00 ? 100 GLN A HE21 2  
ATOM 3122  H HE22 . GLN A 1 100 ? -8.832  10.020  -0.824  1.00 0.00 ? 100 GLN A HE22 2  
ATOM 3123  N N    . VAL A 1 101 ? -3.664  5.706   1.013   1.00 0.00 ? 101 VAL A N    2  
ATOM 3124  C CA   . VAL A 1 101 ? -3.517  4.630   1.979   1.00 0.00 ? 101 VAL A CA   2  
ATOM 3125  C C    . VAL A 1 101 ? -2.211  4.822   2.754   1.00 0.00 ? 101 VAL A C    2  
ATOM 3126  O O    . VAL A 1 101 ? -2.175  4.645   3.970   1.00 0.00 ? 101 VAL A O    2  
ATOM 3127  C CB   . VAL A 1 101 ? -3.599  3.276   1.271   1.00 0.00 ? 101 VAL A CB   2  
ATOM 3128  C CG1  . VAL A 1 101 ? -4.940  3.113   0.554   1.00 0.00 ? 101 VAL A CG1  2  
ATOM 3129  C CG2  . VAL A 1 101 ? -2.430  3.094   0.299   1.00 0.00 ? 101 VAL A CG2  2  
ATOM 3130  H H    . VAL A 1 101 ? -3.865  5.410   0.078   1.00 0.00 ? 101 VAL A H    2  
ATOM 3131  H HA   . VAL A 1 101 ? -4.351  4.698   2.676   1.00 0.00 ? 101 VAL A HA   2  
ATOM 3132  H HB   . VAL A 1 101 ? -3.527  2.498   2.030   1.00 0.00 ? 101 VAL A HB   2  
ATOM 3133  H HG11 . VAL A 1 101 ? -5.290  4.088   0.213   1.00 0.00 ? 101 VAL A HG11 2  
ATOM 3134  H HG12 . VAL A 1 101 ? -4.815  2.452   -0.305  1.00 0.00 ? 101 VAL A HG12 2  
ATOM 3135  H HG13 . VAL A 1 101 ? -5.669  2.684   1.240   1.00 0.00 ? 101 VAL A HG13 2  
ATOM 3136  H HG21 . VAL A 1 101 ? -2.512  3.823   -0.508  1.00 0.00 ? 101 VAL A HG21 2  
ATOM 3137  H HG22 . VAL A 1 101 ? -1.490  3.243   0.830   1.00 0.00 ? 101 VAL A HG22 2  
ATOM 3138  H HG23 . VAL A 1 101 ? -2.458  2.087   -0.117  1.00 0.00 ? 101 VAL A HG23 2  
ATOM 3139  N N    . ILE A 1 102 ? -1.171  5.181   2.017   1.00 0.00 ? 102 ILE A N    2  
ATOM 3140  C CA   . ILE A 1 102 ? 0.133   5.399   2.619   1.00 0.00 ? 102 ILE A CA   2  
ATOM 3141  C C    . ILE A 1 102 ? -0.011  6.351   3.808   1.00 0.00 ? 102 ILE A C    2  
ATOM 3142  O O    . ILE A 1 102 ? 0.484   6.069   4.898   1.00 0.00 ? 102 ILE A O    2  
ATOM 3143  C CB   . ILE A 1 102 ? 1.138   5.877   1.567   1.00 0.00 ? 102 ILE A CB   2  
ATOM 3144  C CG1  . ILE A 1 102 ? 1.562   4.727   0.652   1.00 0.00 ? 102 ILE A CG1  2  
ATOM 3145  C CG2  . ILE A 1 102 ? 2.338   6.559   2.224   1.00 0.00 ? 102 ILE A CG2  2  
ATOM 3146  C CD1  . ILE A 1 102 ? 2.798   4.013   1.206   1.00 0.00 ? 102 ILE A CD1  2  
ATOM 3147  H H    . ILE A 1 102 ? -1.207  5.323   1.028   1.00 0.00 ? 102 ILE A H    2  
ATOM 3148  H HA   . ILE A 1 102 ? 0.488   4.436   2.988   1.00 0.00 ? 102 ILE A HA   2  
ATOM 3149  H HB   . ILE A 1 102 ? 0.647   6.622   0.940   1.00 0.00 ? 102 ILE A HB   2  
ATOM 3150  H HG13 . ILE A 1 102 ? 1.776   5.109   -0.346  1.00 0.00 ? 102 ILE A HG13 2  
ATOM 3151  H HG21 . ILE A 1 102 ? 2.988   6.974   1.453   1.00 0.00 ? 102 ILE A HG21 2  
ATOM 3152  H HG22 . ILE A 1 102 ? 1.988   7.362   2.874   1.00 0.00 ? 102 ILE A HG22 2  
ATOM 3153  H HG23 . ILE A 1 102 ? 2.893   5.829   2.814   1.00 0.00 ? 102 ILE A HG23 2  
ATOM 3154  H HD11 . ILE A 1 102 ? 2.901   3.039   0.727   1.00 0.00 ? 102 ILE A HD11 2  
ATOM 3155  H HD12 . ILE A 1 102 ? 3.684   4.613   1.004   1.00 0.00 ? 102 ILE A HD12 2  
ATOM 3156  H HD13 . ILE A 1 102 ? 2.688   3.878   2.281   1.00 0.00 ? 102 ILE A HD13 2  
ATOM 3157  N N    . ALA A 1 103 ? -0.691  7.460   3.557   1.00 0.00 ? 103 ALA A N    2  
ATOM 3158  C CA   . ALA A 1 103 ? -0.907  8.456   4.593   1.00 0.00 ? 103 ALA A CA   2  
ATOM 3159  C C    . ALA A 1 103 ? -1.753  7.847   5.712   1.00 0.00 ? 103 ALA A C    2  
ATOM 3160  O O    . ALA A 1 103 ? -1.509  8.101   6.891   1.00 0.00 ? 103 ALA A O    2  
ATOM 3161  C CB   . ALA A 1 103 ? -1.557  9.697   3.981   1.00 0.00 ? 103 ALA A CB   2  
ATOM 3162  H H    . ALA A 1 103 ? -1.090  7.684   2.667   1.00 0.00 ? 103 ALA A H    2  
ATOM 3163  H HA   . ALA A 1 103 ? 0.068   8.733   4.995   1.00 0.00 ? 103 ALA A HA   2  
ATOM 3164  H HB1  . ALA A 1 103 ? -2.618  9.714   4.232   1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3165  H HB2  . ALA A 1 103 ? -1.076  10.593  4.375   1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3166  H HB3  . ALA A 1 103 ? -1.441  9.671   2.897   1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3167  N N    . LEU A 1 104 ? -2.731  7.051   5.304   1.00 0.00 ? 104 LEU A N    2  
ATOM 3168  C CA   . LEU A 1 104 ? -3.616  6.403   6.257   1.00 0.00 ? 104 LEU A CA   2  
ATOM 3169  C C    . LEU A 1 104 ? -2.783  5.574   7.236   1.00 0.00 ? 104 LEU A C    2  
ATOM 3170  O O    . LEU A 1 104 ? -3.244  5.250   8.330   1.00 0.00 ? 104 LEU A O    2  
ATOM 3171  C CB   . LEU A 1 104 ? -4.691  5.594   5.528   1.00 0.00 ? 104 LEU A CB   2  
ATOM 3172  C CG   . LEU A 1 104 ? -5.774  6.409   4.815   1.00 0.00 ? 104 LEU A CG   2  
ATOM 3173  C CD1  . LEU A 1 104 ? -6.768  5.491   4.103   1.00 0.00 ? 104 LEU A CD1  2  
ATOM 3174  C CD2  . LEU A 1 104 ? -6.469  7.364   5.786   1.00 0.00 ? 104 LEU A CD2  2  
ATOM 3175  H H    . LEU A 1 104 ? -2.925  6.849   4.344   1.00 0.00 ? 104 LEU A H    2  
ATOM 3176  H HA   . LEU A 1 104 ? -4.126  7.187   6.816   1.00 0.00 ? 104 LEU A HA   2  
ATOM 3177  H HB3  . LEU A 1 104 ? -5.175  4.936   6.249   1.00 0.00 ? 104 LEU A HB3  2  
ATOM 3178  H HG   . LEU A 1 104 ? -5.294  7.019   4.050   1.00 0.00 ? 104 LEU A HG   2  
ATOM 3179  H HD11 . LEU A 1 104 ? -6.373  5.216   3.125   1.00 0.00 ? 104 LEU A HD11 2  
ATOM 3180  H HD12 . LEU A 1 104 ? -6.924  4.591   4.698   1.00 0.00 ? 104 LEU A HD12 2  
ATOM 3181  H HD13 . LEU A 1 104 ? -7.718  6.011   3.976   1.00 0.00 ? 104 LEU A HD13 2  
ATOM 3182  H HD21 . LEU A 1 104 ? -5.867  8.265   5.904   1.00 0.00 ? 104 LEU A HD21 2  
ATOM 3183  H HD22 . LEU A 1 104 ? -7.450  7.632   5.393   1.00 0.00 ? 104 LEU A HD22 2  
ATOM 3184  H HD23 . LEU A 1 104 ? -6.587  6.877   6.755   1.00 0.00 ? 104 LEU A HD23 2  
ATOM 3185  N N    . ILE A 1 105 ? -1.569  5.255   6.810   1.00 0.00 ? 105 ILE A N    2  
ATOM 3186  C CA   . ILE A 1 105 ? -0.668  4.471   7.636   1.00 0.00 ? 105 ILE A CA   2  
ATOM 3187  C C    . ILE A 1 105 ? 0.208   5.412   8.466   1.00 0.00 ? 105 ILE A C    2  
ATOM 3188  O O    . ILE A 1 105 ? 0.324   5.249   9.679   1.00 0.00 ? 105 ILE A O    2  
ATOM 3189  C CB   . ILE A 1 105 ? 0.130   3.489   6.775   1.00 0.00 ? 105 ILE A CB   2  
ATOM 3190  C CG1  . ILE A 1 105 ? -0.756  2.339   6.291   1.00 0.00 ? 105 ILE A CG1  2  
ATOM 3191  C CG2  . ILE A 1 105 ? 1.367   2.985   7.521   1.00 0.00 ? 105 ILE A CG2  2  
ATOM 3192  C CD1  . ILE A 1 105 ? -0.167  1.683   5.041   1.00 0.00 ? 105 ILE A CD1  2  
ATOM 3193  H H    . ILE A 1 105 ? -1.201  5.523   5.919   1.00 0.00 ? 105 ILE A H    2  
ATOM 3194  H HA   . ILE A 1 105 ? -1.280  3.878   8.317   1.00 0.00 ? 105 ILE A HA   2  
ATOM 3195  H HB   . ILE A 1 105 ? 0.483   4.019   5.890   1.00 0.00 ? 105 ILE A HB   2  
ATOM 3196  H HG13 . ILE A 1 105 ? -1.757  2.713   6.073   1.00 0.00 ? 105 ILE A HG13 2  
ATOM 3197  H HG21 . ILE A 1 105 ? 1.056   2.421   8.401   1.00 0.00 ? 105 ILE A HG21 2  
ATOM 3198  H HG22 . ILE A 1 105 ? 1.949   2.339   6.864   1.00 0.00 ? 105 ILE A HG22 2  
ATOM 3199  H HG23 . ILE A 1 105 ? 1.976   3.835   7.831   1.00 0.00 ? 105 ILE A HG23 2  
ATOM 3200  H HD11 . ILE A 1 105 ? 0.528   2.372   4.561   1.00 0.00 ? 105 ILE A HD11 2  
ATOM 3201  H HD12 . ILE A 1 105 ? 0.360   0.771   5.321   1.00 0.00 ? 105 ILE A HD12 2  
ATOM 3202  H HD13 . ILE A 1 105 ? -0.972  1.438   4.346   1.00 0.00 ? 105 ILE A HD13 2  
ATOM 3203  N N    . GLN A 1 106 ? 0.798   6.378   7.778   1.00 0.00 ? 106 GLN A N    2  
ATOM 3204  C CA   . GLN A 1 106 ? 1.659   7.347   8.435   1.00 0.00 ? 106 GLN A CA   2  
ATOM 3205  C C    . GLN A 1 106 ? 0.860   8.160   9.457   1.00 0.00 ? 106 GLN A C    2  
ATOM 3206  O O    . GLN A 1 106 ? 1.338   8.422   10.558  1.00 0.00 ? 106 GLN A O    2  
ATOM 3207  C CB   . GLN A 1 106 ? 2.336   8.263   7.414   1.00 0.00 ? 106 GLN A CB   2  
ATOM 3208  C CG   . GLN A 1 106 ? 3.216   7.458   6.456   1.00 0.00 ? 106 GLN A CG   2  
ATOM 3209  C CD   . GLN A 1 106 ? 4.637   8.024   6.410   1.00 0.00 ? 106 GLN A CD   2  
ATOM 3210  O OE1  . GLN A 1 106 ? 5.302   8.185   7.421   1.00 0.00 ? 106 GLN A OE1  2  
ATOM 3211  N NE2  . GLN A 1 106 ? 5.064   8.318   5.185   1.00 0.00 ? 106 GLN A NE2  2  
ATOM 3212  H H    . GLN A 1 106 ? 0.698   6.505   6.791   1.00 0.00 ? 106 GLN A H    2  
ATOM 3213  H HA   . GLN A 1 106 ? 2.420   6.758   8.947   1.00 0.00 ? 106 GLN A HA   2  
ATOM 3214  H HB3  . GLN A 1 106 ? 2.941   9.006   7.932   1.00 0.00 ? 106 GLN A HB3  2  
ATOM 3215  H HG3  . GLN A 1 106 ? 2.783   7.475   5.456   1.00 0.00 ? 106 GLN A HG3  2  
ATOM 3216  H HE21 . GLN A 1 106 ? 4.467   8.161   4.397   1.00 0.00 ? 106 GLN A HE21 2  
ATOM 3217  H HE22 . GLN A 1 106 ? 5.980   8.694   5.052   1.00 0.00 ? 106 GLN A HE22 2  
ATOM 3218  N N    . ASN A 1 107 ? -0.345  8.537   9.053   1.00 0.00 ? 107 ASN A N    2  
ATOM 3219  C CA   . ASN A 1 107 ? -1.215  9.314   9.918   1.00 0.00 ? 107 ASN A CA   2  
ATOM 3220  C C    . ASN A 1 107 ? -2.032  8.366   10.798  1.00 0.00 ? 107 ASN A C    2  
ATOM 3221  O O    . ASN A 1 107 ? -2.971  8.792   11.471  1.00 0.00 ? 107 ASN A O    2  
ATOM 3222  C CB   . ASN A 1 107 ? -2.192  10.161  9.099   1.00 0.00 ? 107 ASN A CB   2  
ATOM 3223  C CG   . ASN A 1 107 ? -1.636  11.567  8.864   1.00 0.00 ? 107 ASN A CG   2  
ATOM 3224  O OD1  . ASN A 1 107 ? -1.116  12.214  9.758   1.00 0.00 ? 107 ASN A OD1  2  
ATOM 3225  N ND2  . ASN A 1 107 ? -1.775  12.001  7.616   1.00 0.00 ? 107 ASN A ND2  2  
ATOM 3226  H H    . ASN A 1 107 ? -0.727  8.319   8.154   1.00 0.00 ? 107 ASN A H    2  
ATOM 3227  H HA   . ASN A 1 107 ? -0.547  9.951   10.500  1.00 0.00 ? 107 ASN A HA   2  
ATOM 3228  H HB3  . ASN A 1 107 ? -3.148  10.226  9.621   1.00 0.00 ? 107 ASN A HB3  2  
ATOM 3229  H HD21 . ASN A 1 107 ? -2.212  11.421  6.930   1.00 0.00 ? 107 ASN A HD21 2  
ATOM 3230  H HD22 . ASN A 1 107 ? -1.443  12.910  7.362   1.00 0.00 ? 107 ASN A HD22 2  
ATOM 3231  N N    . SER A 1 108 ? -1.647  7.099   10.764  1.00 0.00 ? 108 SER A N    2  
ATOM 3232  C CA   . SER A 1 108 ? -2.333  6.088   11.550  1.00 0.00 ? 108 SER A CA   2  
ATOM 3233  C C    . SER A 1 108 ? -2.031  6.287   13.036  1.00 0.00 ? 108 SER A C    2  
ATOM 3234  O O    . SER A 1 108 ? -2.636  5.636   13.889  1.00 0.00 ? 108 SER A O    2  
ATOM 3235  C CB   . SER A 1 108 ? -1.927  4.680   11.109  1.00 0.00 ? 108 SER A CB   2  
ATOM 3236  O OG   . SER A 1 108 ? -2.731  3.676   11.722  1.00 0.00 ? 108 SER A OG   2  
ATOM 3237  H H    . SER A 1 108 ? -0.883  6.762   10.214  1.00 0.00 ? 108 SER A H    2  
ATOM 3238  H HA   . SER A 1 108 ? -3.394  6.237   11.351  1.00 0.00 ? 108 SER A HA   2  
ATOM 3239  H HB3  . SER A 1 108 ? -0.879  4.509   11.360  1.00 0.00 ? 108 SER A HB3  2  
ATOM 3240  H HG   . SER A 1 108 ? -3.276  4.076   12.460  1.00 0.00 ? 108 SER A HG   2  
ATOM 3241  N N    . ASP A 1 109 ? -1.097  7.187   13.302  1.00 0.00 ? 109 ASP A N    2  
ATOM 3242  C CA   . ASP A 1 109 ? -0.709  7.481   14.672  1.00 0.00 ? 109 ASP A CA   2  
ATOM 3243  C C    . ASP A 1 109 ? 0.284   6.420   15.154  1.00 0.00 ? 109 ASP A C    2  
ATOM 3244  O O    . ASP A 1 109 ? 0.924   5.751   14.343  1.00 0.00 ? 109 ASP A O    2  
ATOM 3245  C CB   . ASP A 1 109 ? -1.920  7.453   15.606  1.00 0.00 ? 109 ASP A CB   2  
ATOM 3246  C CG   . ASP A 1 109 ? -1.849  8.428   16.783  1.00 0.00 ? 109 ASP A CG   2  
ATOM 3247  O OD1  . ASP A 1 109 ? -1.301  9.532   16.575  1.00 0.00 ? 109 ASP A OD1  2  
ATOM 3248  O OD2  . ASP A 1 109 ? -2.345  8.046   17.866  1.00 0.00 ? 109 ASP A OD2  2  
ATOM 3249  H H    . ASP A 1 109 ? -0.611  7.712   12.605  1.00 0.00 ? 109 ASP A H    2  
ATOM 3250  H HA   . ASP A 1 109 ? -0.270  8.477   14.638  1.00 0.00 ? 109 ASP A HA   2  
ATOM 3251  H HB3  . ASP A 1 109 ? -2.035  6.442   15.997  1.00 0.00 ? 109 ASP A HB3  2  
ATOM 3252  N N    . THR A 1 110 ? 0.380   6.300   16.469  1.00 0.00 ? 110 THR A N    2  
ATOM 3253  C CA   . THR A 1 110 ? 1.284   5.331   17.068  1.00 0.00 ? 110 THR A CA   2  
ATOM 3254  C C    . THR A 1 110 ? 1.003   3.931   16.522  1.00 0.00 ? 110 THR A C    2  
ATOM 3255  O O    . THR A 1 110 ? 1.869   3.316   15.903  1.00 0.00 ? 110 THR A O    2  
ATOM 3256  C CB   . THR A 1 110 ? 1.142   5.430   18.589  1.00 0.00 ? 110 THR A CB   2  
ATOM 3257  O OG1  . THR A 1 110 ? 1.370   6.809   18.869  1.00 0.00 ? 110 THR A OG1  2  
ATOM 3258  C CG2  . THR A 1 110 ? 2.268   4.707   19.329  1.00 0.00 ? 110 THR A CG2  2  
ATOM 3259  H H    . THR A 1 110 ? -0.145  6.846   17.121  1.00 0.00 ? 110 THR A H    2  
ATOM 3260  H HA   . THR A 1 110 ? 2.302   5.589   16.780  1.00 0.00 ? 110 THR A HA   2  
ATOM 3261  H HB   . THR A 1 110 ? 0.167   5.067   18.913  1.00 0.00 ? 110 THR A HB   2  
ATOM 3262  H HG1  . THR A 1 110 ? 2.260   7.088   18.508  1.00 0.00 ? 110 THR A HG1  2  
ATOM 3263  H HG21 . THR A 1 110 ? 2.952   4.263   18.606  1.00 0.00 ? 110 THR A HG21 2  
ATOM 3264  H HG22 . THR A 1 110 ? 2.810   5.420   19.951  1.00 0.00 ? 110 THR A HG22 2  
ATOM 3265  H HG23 . THR A 1 110 ? 1.845   3.925   19.959  1.00 0.00 ? 110 THR A HG23 2  
ATOM 3266  N N    . THR A 1 111 ? -0.213  3.465   16.770  1.00 0.00 ? 111 THR A N    2  
ATOM 3267  C CA   . THR A 1 111 ? -0.619  2.149   16.310  1.00 0.00 ? 111 THR A CA   2  
ATOM 3268  C C    . THR A 1 111 ? -1.227  2.237   14.908  1.00 0.00 ? 111 THR A C    2  
ATOM 3269  O O    . THR A 1 111 ? -1.754  3.278   14.521  1.00 0.00 ? 111 THR A O    2  
ATOM 3270  C CB   . THR A 1 111 ? -1.574  1.559   17.350  1.00 0.00 ? 111 THR A CB   2  
ATOM 3271  O OG1  . THR A 1 111 ? -2.009  2.687   18.103  1.00 0.00 ? 111 THR A OG1  2  
ATOM 3272  C CG2  . THR A 1 111 ? -0.852  0.683   18.377  1.00 0.00 ? 111 THR A CG2  2  
ATOM 3273  H H    . THR A 1 111 ? -0.914  3.973   17.273  1.00 0.00 ? 111 THR A H    2  
ATOM 3274  H HA   . THR A 1 111 ? 0.269   1.522   16.234  1.00 0.00 ? 111 THR A HA   2  
ATOM 3275  H HB   . THR A 1 111 ? -2.383  1.010   16.869  1.00 0.00 ? 111 THR A HB   2  
ATOM 3276  H HG1  . THR A 1 111 ? -2.983  2.848   17.946  1.00 0.00 ? 111 THR A HG1  2  
ATOM 3277  H HG21 . THR A 1 111 ? -1.043  -0.368  18.154  1.00 0.00 ? 111 THR A HG21 2  
ATOM 3278  H HG22 . THR A 1 111 ? 0.219   0.874   18.329  1.00 0.00 ? 111 THR A HG22 2  
ATOM 3279  H HG23 . THR A 1 111 ? -1.221  0.915   19.375  1.00 0.00 ? 111 THR A HG23 2  
ATOM 3280  N N    . LEU A 1 112 ? -1.135  1.128   14.188  1.00 0.00 ? 112 LEU A N    2  
ATOM 3281  C CA   . LEU A 1 112 ? -1.669  1.069   12.837  1.00 0.00 ? 112 LEU A CA   2  
ATOM 3282  C C    . LEU A 1 112 ? -2.195  -0.344  12.566  1.00 0.00 ? 112 LEU A C    2  
ATOM 3283  O O    . LEU A 1 112 ? -1.460  -1.320  12.702  1.00 0.00 ? 112 LEU A O    2  
ATOM 3284  C CB   . LEU A 1 112 ? -0.624  1.540   11.826  1.00 0.00 ? 112 LEU A CB   2  
ATOM 3285  C CG   . LEU A 1 112 ? -0.871  1.140   10.370  1.00 0.00 ? 112 LEU A CG   2  
ATOM 3286  C CD1  . LEU A 1 112 ? -0.365  -0.279  10.099  1.00 0.00 ? 112 LEU A CD1  2  
ATOM 3287  C CD2  . LEU A 1 112 ? -2.344  1.304   9.998   1.00 0.00 ? 112 LEU A CD2  2  
ATOM 3288  H H    . LEU A 1 112 ? -0.706  0.286   14.511  1.00 0.00 ? 112 LEU A H    2  
ATOM 3289  H HA   . LEU A 1 112 ? -2.506  1.764   12.786  1.00 0.00 ? 112 LEU A HA   2  
ATOM 3290  H HB3  . LEU A 1 112 ? 0.348   1.152   12.130  1.00 0.00 ? 112 LEU A HB3  2  
ATOM 3291  H HG   . LEU A 1 112 ? -0.299  1.812   9.729   1.00 0.00 ? 112 LEU A HG   2  
ATOM 3292  H HD11 . LEU A 1 112 ? 0.625   -0.402  10.536  1.00 0.00 ? 112 LEU A HD11 2  
ATOM 3293  H HD12 . LEU A 1 112 ? -1.051  -1.000  10.545  1.00 0.00 ? 112 LEU A HD12 2  
ATOM 3294  H HD13 . LEU A 1 112 ? -0.311  -0.446  9.023   1.00 0.00 ? 112 LEU A HD13 2  
ATOM 3295  H HD21 . LEU A 1 112 ? -2.435  2.013   9.175   1.00 0.00 ? 112 LEU A HD21 2  
ATOM 3296  H HD22 . LEU A 1 112 ? -2.753  0.340   9.694   1.00 0.00 ? 112 LEU A HD22 2  
ATOM 3297  H HD23 . LEU A 1 112 ? -2.898  1.676   10.861  1.00 0.00 ? 112 LEU A HD23 2  
ATOM 3298  N N    . GLU A 1 113 ? -3.462  -0.405  12.185  1.00 0.00 ? 113 GLU A N    2  
ATOM 3299  C CA   . GLU A 1 113 ? -4.095  -1.679  11.892  1.00 0.00 ? 113 GLU A CA   2  
ATOM 3300  C C    . GLU A 1 113 ? -4.247  -1.862  10.381  1.00 0.00 ? 113 GLU A C    2  
ATOM 3301  O O    . GLU A 1 113 ? -4.627  -0.930  9.675   1.00 0.00 ? 113 GLU A O    2  
ATOM 3302  C CB   . GLU A 1 113 ? -5.449  -1.795  12.596  1.00 0.00 ? 113 GLU A CB   2  
ATOM 3303  C CG   . GLU A 1 113 ? -5.988  -3.224  12.516  1.00 0.00 ? 113 GLU A CG   2  
ATOM 3304  C CD   . GLU A 1 113 ? -7.462  -3.276  12.920  1.00 0.00 ? 113 GLU A CD   2  
ATOM 3305  O OE1  . GLU A 1 113 ? -7.714  -3.418  14.137  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 3306  O OE2  . GLU A 1 113 ? -8.307  -3.174  12.004  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 3307  H H    . GLU A 1 113 ? -4.053  0.396   12.076  1.00 0.00 ? 113 GLU A H    2  
ATOM 3308  H HA   . GLU A 1 113 ? -3.419  -2.436  12.291  1.00 0.00 ? 113 GLU A HA   2  
ATOM 3309  H HB3  . GLU A 1 113 ? -6.160  -1.108  12.141  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 3310  H HG3  . GLU A 1 113 ? -5.405  -3.874  13.168  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 3311  N N    . LEU A 1 114 ? -3.941  -3.070  9.930   1.00 0.00 ? 114 LEU A N    2  
ATOM 3312  C CA   . LEU A 1 114 ? -4.039  -3.387  8.515   1.00 0.00 ? 114 LEU A CA   2  
ATOM 3313  C C    . LEU A 1 114 ? -5.002  -4.560  8.325   1.00 0.00 ? 114 LEU A C    2  
ATOM 3314  O O    . LEU A 1 114 ? -5.376  -5.223  9.290   1.00 0.00 ? 114 LEU A O    2  
ATOM 3315  C CB   . LEU A 1 114 ? -2.649  -3.630  7.923   1.00 0.00 ? 114 LEU A CB   2  
ATOM 3316  C CG   . LEU A 1 114 ? -1.661  -2.466  8.029   1.00 0.00 ? 114 LEU A CG   2  
ATOM 3317  C CD1  . LEU A 1 114 ? -0.218  -2.972  8.065   1.00 0.00 ? 114 LEU A CD1  2  
ATOM 3318  C CD2  . LEU A 1 114 ? -1.886  -1.453  6.904   1.00 0.00 ? 114 LEU A CD2  2  
ATOM 3319  H H    . LEU A 1 114 ? -3.633  -3.823  10.511  1.00 0.00 ? 114 LEU A H    2  
ATOM 3320  H HA   . LEU A 1 114 ? -4.455  -2.513  8.012   1.00 0.00 ? 114 LEU A HA   2  
ATOM 3321  H HB3  . LEU A 1 114 ? -2.764  -3.889  6.870   1.00 0.00 ? 114 LEU A HB3  2  
ATOM 3322  H HG   . LEU A 1 114 ? -1.844  -1.947  8.970   1.00 0.00 ? 114 LEU A HG   2  
ATOM 3323  H HD11 . LEU A 1 114 ? 0.166   -3.049  7.048   1.00 0.00 ? 114 LEU A HD11 2  
ATOM 3324  H HD12 . LEU A 1 114 ? 0.397   -2.276  8.634   1.00 0.00 ? 114 LEU A HD12 2  
ATOM 3325  H HD13 . LEU A 1 114 ? -0.189  -3.954  8.538   1.00 0.00 ? 114 LEU A HD13 2  
ATOM 3326  H HD21 . LEU A 1 114 ? -1.511  -1.864  5.966   1.00 0.00 ? 114 LEU A HD21 2  
ATOM 3327  H HD22 . LEU A 1 114 ? -2.950  -1.244  6.810   1.00 0.00 ? 114 LEU A HD22 2  
ATOM 3328  H HD23 . LEU A 1 114 ? -1.352  -0.531  7.135   1.00 0.00 ? 114 LEU A HD23 2  
ATOM 3329  N N    . SER A 1 115 ? -5.376  -4.780  7.072   1.00 0.00 ? 115 SER A N    2  
ATOM 3330  C CA   . SER A 1 115 ? -6.289  -5.861  6.744   1.00 0.00 ? 115 SER A CA   2  
ATOM 3331  C C    . SER A 1 115 ? -5.842  -6.546  5.450   1.00 0.00 ? 115 SER A C    2  
ATOM 3332  O O    . SER A 1 115 ? -5.711  -5.898  4.413   1.00 0.00 ? 115 SER A O    2  
ATOM 3333  C CB   . SER A 1 115 ? -7.723  -5.349  6.604   1.00 0.00 ? 115 SER A CB   2  
ATOM 3334  O OG   . SER A 1 115 ? -7.991  -4.266  7.492   1.00 0.00 ? 115 SER A OG   2  
ATOM 3335  H H    . SER A 1 115 ? -5.067  -4.235  6.292   1.00 0.00 ? 115 SER A H    2  
ATOM 3336  H HA   . SER A 1 115 ? -6.230  -6.553  7.582   1.00 0.00 ? 115 SER A HA   2  
ATOM 3337  H HB3  . SER A 1 115 ? -8.420  -6.162  6.806   1.00 0.00 ? 115 SER A HB3  2  
ATOM 3338  H HG   . SER A 1 115 ? -7.185  -3.678  7.568   1.00 0.00 ? 115 SER A HG   2  
ATOM 3339  N N    . VAL A 1 116 ? -5.624  -7.850  5.553   1.00 0.00 ? 116 VAL A N    2  
ATOM 3340  C CA   . VAL A 1 116 ? -5.196  -8.629  4.405   1.00 0.00 ? 116 VAL A CA   2  
ATOM 3341  C C    . VAL A 1 116 ? -6.143  -9.818  4.218   1.00 0.00 ? 116 VAL A C    2  
ATOM 3342  O O    . VAL A 1 116 ? -7.134  -9.943  4.936   1.00 0.00 ? 116 VAL A O    2  
ATOM 3343  C CB   . VAL A 1 116 ? -3.735  -9.051  4.573   1.00 0.00 ? 116 VAL A CB   2  
ATOM 3344  C CG1  . VAL A 1 116 ? -2.829  -7.830  4.747   1.00 0.00 ? 116 VAL A CG1  2  
ATOM 3345  C CG2  . VAL A 1 116 ? -3.576  -10.023 5.744   1.00 0.00 ? 116 VAL A CG2  2  
ATOM 3346  H H    . VAL A 1 116 ? -5.733  -8.369  6.400   1.00 0.00 ? 116 VAL A H    2  
ATOM 3347  H HA   . VAL A 1 116 ? -5.264  -7.986  3.527   1.00 0.00 ? 116 VAL A HA   2  
ATOM 3348  H HB   . VAL A 1 116 ? -3.428  -9.569  3.664   1.00 0.00 ? 116 VAL A HB   2  
ATOM 3349  H HG11 . VAL A 1 116 ? -1.978  -7.909  4.069   1.00 0.00 ? 116 VAL A HG11 2  
ATOM 3350  H HG12 . VAL A 1 116 ? -3.391  -6.925  4.519   1.00 0.00 ? 116 VAL A HG12 2  
ATOM 3351  H HG13 . VAL A 1 116 ? -2.470  -7.787  5.775   1.00 0.00 ? 116 VAL A HG13 2  
ATOM 3352  H HG21 . VAL A 1 116 ? -3.473  -9.460  6.671   1.00 0.00 ? 116 VAL A HG21 2  
ATOM 3353  H HG22 . VAL A 1 116 ? -4.454  -10.665 5.805   1.00 0.00 ? 116 VAL A HG22 2  
ATOM 3354  H HG23 . VAL A 1 116 ? -2.688  -10.635 5.589   1.00 0.00 ? 116 VAL A HG23 2  
ATOM 3355  N N    . MET A 1 117 ? -5.803  -10.657 3.252   1.00 0.00 ? 117 MET A N    2  
ATOM 3356  C CA   . MET A 1 117 ? -6.611  -11.831 2.963   1.00 0.00 ? 117 MET A CA   2  
ATOM 3357  C C    . MET A 1 117 ? -5.740  -13.085 2.862   1.00 0.00 ? 117 MET A C    2  
ATOM 3358  O O    . MET A 1 117 ? -5.000  -13.254 1.894   1.00 0.00 ? 117 MET A O    2  
ATOM 3359  C CB   . MET A 1 117 ? -7.362  -11.623 1.645   1.00 0.00 ? 117 MET A CB   2  
ATOM 3360  C CG   . MET A 1 117 ? -8.060  -10.261 1.622   1.00 0.00 ? 117 MET A CG   2  
ATOM 3361  S SD   . MET A 1 117 ? -9.830  -10.484 1.570   1.00 0.00 ? 117 MET A SD   2  
ATOM 3362  C CE   . MET A 1 117 ? -10.176 -10.607 3.318   1.00 0.00 ? 117 MET A CE   2  
ATOM 3363  H H    . MET A 1 117 ? -4.995  -10.548 2.673   1.00 0.00 ? 117 MET A H    2  
ATOM 3364  H HA   . MET A 1 117 ? -7.302  -11.925 3.801   1.00 0.00 ? 117 MET A HA   2  
ATOM 3365  H HB3  . MET A 1 117 ? -8.097  -12.414 1.513   1.00 0.00 ? 117 MET A HB3  2  
ATOM 3366  H HG3  . MET A 1 117 ? -7.731  -9.689  0.754   1.00 0.00 ? 117 MET A HG3  2  
ATOM 3367  H HE1  . MET A 1 117 ? -10.738 -11.520 3.512   1.00 0.00 ? 117 MET A HE1  2  
ATOM 3368  H HE2  . MET A 1 117 ? -9.240  -10.630 3.874   1.00 0.00 ? 117 MET A HE2  2  
ATOM 3369  H HE3  . MET A 1 117 ? -10.765 -9.744  3.632   1.00 0.00 ? 117 MET A HE3  2  
ATOM 3370  N N    . PRO A 1 118 ? -5.860  -13.952 3.902   1.00 0.00 ? 118 PRO A N    2  
ATOM 3371  C CA   . PRO A 1 118 ? -5.094  -15.186 3.939   1.00 0.00 ? 118 PRO A CA   2  
ATOM 3372  C C    . PRO A 1 118 ? -5.667  -16.218 2.966   1.00 0.00 ? 118 PRO A C    2  
ATOM 3373  O O    . PRO A 1 118 ? -6.722  -16.000 2.376   1.00 0.00 ? 118 PRO A O    2  
ATOM 3374  C CB   . PRO A 1 118 ? -5.151  -15.641 5.389   1.00 0.00 ? 118 PRO A CB   2  
ATOM 3375  C CG   . PRO A 1 118 ? -6.327  -14.905 6.011   1.00 0.00 ? 118 PRO A CG   2  
ATOM 3376  C CD   . PRO A 1 118 ? -6.728  -13.785 5.065   1.00 0.00 ? 118 PRO A CD   2  
ATOM 3377  H HA   . PRO A 1 118 ? -4.154  -15.019 3.640   1.00 0.00 ? 118 PRO A HA   2  
ATOM 3378  H HB3  . PRO A 1 118 ? -4.224  -15.406 5.910   1.00 0.00 ? 118 PRO A HB3  2  
ATOM 3379  H HG3  . PRO A 1 118 ? -6.051  -14.501 6.984   1.00 0.00 ? 118 PRO A HG3  2  
ATOM 3380  H HD3  . PRO A 1 118 ? -6.587  -12.807 5.526   1.00 0.00 ? 118 PRO A HD3  2  
ATOM 3381  N N    . LYS A 1 119 ? -4.943  -17.319 2.829   1.00 0.00 ? 119 LYS A N    2  
ATOM 3382  C CA   . LYS A 1 119 ? -5.366  -18.386 1.937   1.00 0.00 ? 119 LYS A CA   2  
ATOM 3383  C C    . LYS A 1 119 ? -4.979  -19.736 2.543   1.00 0.00 ? 119 LYS A C    2  
ATOM 3384  O O    . LYS A 1 119 ? -5.846  -20.520 2.928   1.00 0.00 ? 119 LYS A O    2  
ATOM 3385  C CB   . LYS A 1 119 ? -4.807  -18.161 0.530   1.00 0.00 ? 119 LYS A CB   2  
ATOM 3386  C CG   . LYS A 1 119 ? -4.682  -19.484 -0.229  1.00 0.00 ? 119 LYS A CG   2  
ATOM 3387  C CD   . LYS A 1 119 ? -6.060  -20.081 -0.523  1.00 0.00 ? 119 LYS A CD   2  
ATOM 3388  C CE   . LYS A 1 119 ? -5.936  -21.394 -1.297  1.00 0.00 ? 119 LYS A CE   2  
ATOM 3389  N NZ   . LYS A 1 119 ? -7.199  -21.702 -2.001  1.00 0.00 ? 119 LYS A NZ   2  
ATOM 3390  H H    . LYS A 1 119 ? -4.085  -17.489 3.313   1.00 0.00 ? 119 LYS A H    2  
ATOM 3391  H HA   . LYS A 1 119 ? -6.452  -18.339 1.864   1.00 0.00 ? 119 LYS A HA   2  
ATOM 3392  H HB3  . LYS A 1 119 ? -3.832  -17.681 0.595   1.00 0.00 ? 119 LYS A HB3  2  
ATOM 3393  H HG3  . LYS A 1 119 ? -4.095  -20.189 0.359   1.00 0.00 ? 119 LYS A HG3  2  
ATOM 3394  H HD3  . LYS A 1 119 ? -6.652  -19.369 -1.099  1.00 0.00 ? 119 LYS A HD3  2  
ATOM 3395  H HE3  . LYS A 1 119 ? -5.688  -22.204 -0.611  1.00 0.00 ? 119 LYS A HE3  2  
ATOM 3396  H HZ1  . LYS A 1 119 ? -7.225  -21.210 -2.872  1.00 0.00 ? 119 LYS A HZ1  2  
ATOM 3397  H HZ2  . LYS A 1 119 ? -7.255  -22.685 -2.173  1.00 0.00 ? 119 LYS A HZ2  2  
ATOM 3398  H HZ3  . LYS A 1 119 ? -7.974  -21.419 -1.436  1.00 0.00 ? 119 LYS A HZ3  2  
ATOM 3399  N N    . ASP A 1 120 ? -3.675  -19.967 2.609   1.00 0.00 ? 120 ASP A N    2  
ATOM 3400  C CA   . ASP A 1 120 ? -3.163  -21.208 3.163   1.00 0.00 ? 120 ASP A CA   2  
ATOM 3401  C C    . ASP A 1 120 ? -2.990  -21.055 4.675   1.00 0.00 ? 120 ASP A C    2  
ATOM 3402  O O    . ASP A 1 120 ? -1.958  -20.572 5.139   1.00 0.00 ? 120 ASP A O    2  
ATOM 3403  C CB   . ASP A 1 120 ? -1.799  -21.557 2.564   1.00 0.00 ? 120 ASP A CB   2  
ATOM 3404  C CG   . ASP A 1 120 ? -1.618  -23.026 2.176   1.00 0.00 ? 120 ASP A CG   2  
ATOM 3405  O OD1  . ASP A 1 120 ? -2.462  -23.837 2.616   1.00 0.00 ? 120 ASP A OD1  2  
ATOM 3406  O OD2  . ASP A 1 120 ? -0.641  -23.306 1.451   1.00 0.00 ? 120 ASP A OD2  2  
ATOM 3407  H H    . ASP A 1 120 ? -2.978  -19.325 2.295   1.00 0.00 ? 120 ASP A H    2  
ATOM 3408  H HA   . ASP A 1 120 ? -3.904  -21.965 2.903   1.00 0.00 ? 120 ASP A HA   2  
ATOM 3409  H HB3  . ASP A 1 120 ? -1.023  -21.288 3.282   1.00 0.00 ? 120 ASP A HB3  2  
ATOM 3410  N N    . SER A 1 121 ? -4.014  -21.477 5.401   1.00 0.00 ? 121 SER A N    2  
ATOM 3411  C CA   . SER A 1 121 ? -3.989  -21.391 6.852   1.00 0.00 ? 121 SER A CA   2  
ATOM 3412  C C    . SER A 1 121 ? -2.647  -21.902 7.382   1.00 0.00 ? 121 SER A C    2  
ATOM 3413  O O    . SER A 1 121 ? -2.153  -22.936 6.936   1.00 0.00 ? 121 SER A O    2  
ATOM 3414  C CB   . SER A 1 121 ? -5.142  -22.184 7.471   1.00 0.00 ? 121 SER A CB   2  
ATOM 3415  O OG   . SER A 1 121 ? -6.410  -21.621 7.150   1.00 0.00 ? 121 SER A OG   2  
ATOM 3416  H H    . SER A 1 121 ? -4.850  -21.868 5.016   1.00 0.00 ? 121 SER A H    2  
ATOM 3417  H HA   . SER A 1 121 ? -4.112  -20.333 7.083   1.00 0.00 ? 121 SER A HA   2  
ATOM 3418  H HB3  . SER A 1 121 ? -5.020  -22.215 8.554   1.00 0.00 ? 121 SER A HB3  2  
ATOM 3419  H HG   . SER A 1 121 ? -6.550  -21.636 6.161   1.00 0.00 ? 121 SER A HG   2  
ATOM 3420  N N    . GLY A 1 122 ? -2.097  -21.154 8.326   1.00 0.00 ? 122 GLY A N    2  
ATOM 3421  C CA   . GLY A 1 122 ? -0.823  -21.518 8.923   1.00 0.00 ? 122 GLY A CA   2  
ATOM 3422  C C    . GLY A 1 122 ? -1.026  -22.232 10.261  1.00 0.00 ? 122 GLY A C    2  
ATOM 3423  O O    . GLY A 1 122 ? -2.155  -22.561 10.627  1.00 0.00 ? 122 GLY A O    2  
ATOM 3424  H H    . GLY A 1 122 ? -2.507  -20.314 8.684   1.00 0.00 ? 122 GLY A H    2  
ATOM 3425  H HA2  . GLY A 1 122 ? -0.271  -22.168 8.242   1.00 0.00 ? 122 GLY A HA2  2  
ATOM 3426  H HA3  . GLY A 1 122 ? -0.218  -20.625 9.071   1.00 0.00 ? 122 GLY A HA3  2  
ATOM 3427  N N    . PRO A 1 123 ? 0.110   -22.454 10.972  1.00 0.00 ? 123 PRO A N    2  
ATOM 3428  C CA   . PRO A 1 123 ? 0.067   -23.123 12.262  1.00 0.00 ? 123 PRO A CA   2  
ATOM 3429  C C    . PRO A 1 123 ? -0.470  -22.187 13.346  1.00 0.00 ? 123 PRO A C    2  
ATOM 3430  O O    . PRO A 1 123 ? -1.492  -22.472 13.969  1.00 0.00 ? 123 PRO A O    2  
ATOM 3431  C CB   . PRO A 1 123 ? 1.495   -23.574 12.520  1.00 0.00 ? 123 PRO A CB   2  
ATOM 3432  C CG   . PRO A 1 123 ? 2.368   -22.741 11.595  1.00 0.00 ? 123 PRO A CG   2  
ATOM 3433  C CD   . PRO A 1 123 ? 1.463   -22.079 10.570  1.00 0.00 ? 123 PRO A CD   2  
ATOM 3434  H HA   . PRO A 1 123 ? -0.566  -23.897 12.231  1.00 0.00 ? 123 PRO A HA   2  
ATOM 3435  H HB3  . PRO A 1 123 ? 1.613   -24.637 12.315  1.00 0.00 ? 123 PRO A HB3  2  
ATOM 3436  H HG3  . PRO A 1 123 ? 3.109   -23.371 11.099  1.00 0.00 ? 123 PRO A HG3  2  
ATOM 3437  H HD3  . PRO A 1 123 ? 1.685   -22.425 9.560   1.00 0.00 ? 123 PRO A HD3  2  
ATOM 3438  N N    . SER A 1 124 ? 0.243   -21.088 13.540  1.00 0.00 ? 124 SER A N    2  
ATOM 3439  C CA   . SER A 1 124 ? -0.147  -20.107 14.539  1.00 0.00 ? 124 SER A CA   2  
ATOM 3440  C C    . SER A 1 124 ? -0.129  -18.703 13.931  1.00 0.00 ? 124 SER A C    2  
ATOM 3441  O O    . SER A 1 124 ? 0.297   -18.523 12.791  1.00 0.00 ? 124 SER A O    2  
ATOM 3442  C CB   . SER A 1 124 ? 0.772   -20.168 15.760  1.00 0.00 ? 124 SER A CB   2  
ATOM 3443  O OG   . SER A 1 124 ? 0.279   -19.377 16.839  1.00 0.00 ? 124 SER A OG   2  
ATOM 3444  H H    . SER A 1 124 ? 1.074   -20.863 13.031  1.00 0.00 ? 124 SER A H    2  
ATOM 3445  H HA   . SER A 1 124 ? -1.160  -20.383 14.832  1.00 0.00 ? 124 SER A HA   2  
ATOM 3446  H HB3  . SER A 1 124 ? 1.768   -19.824 15.483  1.00 0.00 ? 124 SER A HB3  2  
ATOM 3447  H HG   . SER A 1 124 ? 0.963   -18.695 17.101  1.00 0.00 ? 124 SER A HG   2  
ATOM 3448  N N    . SER A 1 125 ? -0.595  -17.745 14.717  1.00 0.00 ? 125 SER A N    2  
ATOM 3449  C CA   . SER A 1 125 ? -0.637  -16.364 14.270  1.00 0.00 ? 125 SER A CA   2  
ATOM 3450  C C    . SER A 1 125 ? -1.069  -15.453 15.423  1.00 0.00 ? 125 SER A C    2  
ATOM 3451  O O    . SER A 1 125 ? -2.203  -15.534 15.890  1.00 0.00 ? 125 SER A O    2  
ATOM 3452  C CB   . SER A 1 125 ? -1.585  -16.198 13.081  1.00 0.00 ? 125 SER A CB   2  
ATOM 3453  O OG   . SER A 1 125 ? -1.853  -14.828 12.799  1.00 0.00 ? 125 SER A OG   2  
ATOM 3454  H H    . SER A 1 125 ? -0.940  -17.901 15.643  1.00 0.00 ? 125 SER A H    2  
ATOM 3455  H HA   . SER A 1 125 ? 0.381   -16.130 13.958  1.00 0.00 ? 125 SER A HA   2  
ATOM 3456  H HB3  . SER A 1 125 ? -2.521  -16.714 13.289  1.00 0.00 ? 125 SER A HB3  2  
ATOM 3457  H HG   . SER A 1 125 ? -2.724  -14.558 13.208  1.00 0.00 ? 125 SER A HG   2  
ATOM 3458  N N    . GLY A 1 126 ? -0.139  -14.610 15.847  1.00 0.00 ? 126 GLY A N    2  
ATOM 3459  C CA   . GLY A 1 126 ? -0.408  -13.686 16.936  1.00 0.00 ? 126 GLY A CA   2  
ATOM 3460  C C    . GLY A 1 126 ? -0.168  -14.351 18.292  1.00 0.00 ? 126 GLY A C    2  
ATOM 3461  O O    . GLY A 1 126 ? 0.084   -13.671 19.285  1.00 0.00 ? 126 GLY A O    2  
ATOM 3462  H H    . GLY A 1 126 ? 0.782   -14.551 15.460  1.00 0.00 ? 126 GLY A H    2  
ATOM 3463  H HA2  . GLY A 1 126 ? 0.231   -12.807 16.838  1.00 0.00 ? 126 GLY A HA2  2  
ATOM 3464  H HA3  . GLY A 1 126 ? -1.439  -13.337 16.875  1.00 0.00 ? 126 GLY A HA3  2  
ATOM 3465  N N    . GLY A 1 1   ? -0.987  -15.251 24.679  1.00 0.00 ? 1   GLY A N    3  
ATOM 3466  C CA   . GLY A 1 1   ? -0.992  -15.503 23.248  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3467  C C    . GLY A 1 1   ? -2.035  -16.560 22.880  1.00 0.00 ? 1   GLY A C    3  
ATOM 3468  O O    . GLY A 1 1   ? -1.975  -17.690 23.363  1.00 0.00 ? 1   GLY A O    3  
ATOM 3469  H H1   . GLY A 1 1   ? -1.587  -15.847 25.214  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3470  H HA2  . GLY A 1 1   ? -1.204  -14.576 22.713  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3471  H HA3  . GLY A 1 1   ? -0.003  -15.835 22.930  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3472  N N    . SER A 1 2   ? -2.965  -16.157 22.027  1.00 0.00 ? 2   SER A N    3  
ATOM 3473  C CA   . SER A 1 2   ? -4.018  -17.056 21.589  1.00 0.00 ? 2   SER A CA   3  
ATOM 3474  C C    . SER A 1 2   ? -4.564  -16.602 20.233  1.00 0.00 ? 2   SER A C    3  
ATOM 3475  O O    . SER A 1 2   ? -4.780  -15.412 20.014  1.00 0.00 ? 2   SER A O    3  
ATOM 3476  C CB   . SER A 1 2   ? -5.149  -17.123 22.619  1.00 0.00 ? 2   SER A CB   3  
ATOM 3477  O OG   . SER A 1 2   ? -5.127  -18.343 23.356  1.00 0.00 ? 2   SER A OG   3  
ATOM 3478  H H    . SER A 1 2   ? -3.006  -15.237 21.638  1.00 0.00 ? 2   SER A H    3  
ATOM 3479  H HA   . SER A 1 2   ? -3.546  -18.035 21.504  1.00 0.00 ? 2   SER A HA   3  
ATOM 3480  H HB3  . SER A 1 2   ? -6.108  -17.024 22.112  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3481  H HG   . SER A 1 2   ? -4.191  -18.553 23.642  1.00 0.00 ? 2   SER A HG   3  
ATOM 3482  N N    . SER A 1 3   ? -4.768  -17.575 19.358  1.00 0.00 ? 3   SER A N    3  
ATOM 3483  C CA   . SER A 1 3   ? -5.282  -17.292 18.029  1.00 0.00 ? 3   SER A CA   3  
ATOM 3484  C C    . SER A 1 3   ? -6.812  -17.326 18.043  1.00 0.00 ? 3   SER A C    3  
ATOM 3485  O O    . SER A 1 3   ? -7.412  -18.389 18.189  1.00 0.00 ? 3   SER A O    3  
ATOM 3486  C CB   . SER A 1 3   ? -4.738  -18.287 17.003  1.00 0.00 ? 3   SER A CB   3  
ATOM 3487  O OG   . SER A 1 3   ? -4.240  -17.635 15.838  1.00 0.00 ? 3   SER A OG   3  
ATOM 3488  H H    . SER A 1 3   ? -4.588  -18.542 19.544  1.00 0.00 ? 3   SER A H    3  
ATOM 3489  H HA   . SER A 1 3   ? -4.924  -16.291 17.789  1.00 0.00 ? 3   SER A HA   3  
ATOM 3490  H HB3  . SER A 1 3   ? -5.529  -18.983 16.719  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3491  H HG   . SER A 1 3   ? -3.249  -17.522 15.908  1.00 0.00 ? 3   SER A HG   3  
ATOM 3492  N N    . GLY A 1 4   ? -7.400  -16.148 17.887  1.00 0.00 ? 4   GLY A N    3  
ATOM 3493  C CA   . GLY A 1 4   ? -8.847  -16.029 17.880  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3494  C C    . GLY A 1 4   ? -9.358  -15.633 16.492  1.00 0.00 ? 4   GLY A C    3  
ATOM 3495  O O    . GLY A 1 4   ? -8.700  -14.880 15.776  1.00 0.00 ? 4   GLY A O    3  
ATOM 3496  H H    . GLY A 1 4   ? -6.905  -15.287 17.768  1.00 0.00 ? 4   GLY A H    3  
ATOM 3497  H HA2  . GLY A 1 4   ? -9.296  -16.975 18.179  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3498  H HA3  . GLY A 1 4   ? -9.159  -15.283 18.612  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3499  N N    . SER A 1 5   ? -10.527 -16.158 16.156  1.00 0.00 ? 5   SER A N    3  
ATOM 3500  C CA   . SER A 1 5   ? -11.133 -15.869 14.866  1.00 0.00 ? 5   SER A CA   3  
ATOM 3501  C C    . SER A 1 5   ? -12.656 -15.802 15.007  1.00 0.00 ? 5   SER A C    3  
ATOM 3502  O O    . SER A 1 5   ? -13.212 -16.279 15.997  1.00 0.00 ? 5   SER A O    3  
ATOM 3503  C CB   . SER A 1 5   ? -10.742 -16.921 13.826  1.00 0.00 ? 5   SER A CB   3  
ATOM 3504  O OG   . SER A 1 5   ? -10.511 -16.343 12.545  1.00 0.00 ? 5   SER A OG   3  
ATOM 3505  H H    . SER A 1 5   ? -11.057 -16.769 16.744  1.00 0.00 ? 5   SER A H    3  
ATOM 3506  H HA   . SER A 1 5   ? -10.734 -14.899 14.571  1.00 0.00 ? 5   SER A HA   3  
ATOM 3507  H HB3  . SER A 1 5   ? -11.533 -17.667 13.750  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3508  H HG   . SER A 1 5   ? -11.343 -16.392 11.991  1.00 0.00 ? 5   SER A HG   3  
ATOM 3509  N N    . SER A 1 6   ? -13.285 -15.208 14.004  1.00 0.00 ? 6   SER A N    3  
ATOM 3510  C CA   . SER A 1 6   ? -14.731 -15.072 14.005  1.00 0.00 ? 6   SER A CA   3  
ATOM 3511  C C    . SER A 1 6   ? -15.313 -15.666 12.719  1.00 0.00 ? 6   SER A C    3  
ATOM 3512  O O    . SER A 1 6   ? -16.224 -16.490 12.768  1.00 0.00 ? 6   SER A O    3  
ATOM 3513  C CB   . SER A 1 6   ? -15.148 -13.606 14.148  1.00 0.00 ? 6   SER A CB   3  
ATOM 3514  O OG   . SER A 1 6   ? -15.072 -13.160 15.500  1.00 0.00 ? 6   SER A OG   3  
ATOM 3515  H H    . SER A 1 6   ? -12.824 -14.823 13.204  1.00 0.00 ? 6   SER A H    3  
ATOM 3516  H HA   . SER A 1 6   ? -15.074 -15.634 14.874  1.00 0.00 ? 6   SER A HA   3  
ATOM 3517  H HB3  . SER A 1 6   ? -16.167 -13.482 13.782  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3518  H HG   . SER A 1 6   ? -14.726 -12.224 15.532  1.00 0.00 ? 6   SER A HG   3  
ATOM 3519  N N    . GLY A 1 7   ? -14.761 -15.222 11.599  1.00 0.00 ? 7   GLY A N    3  
ATOM 3520  C CA   . GLY A 1 7   ? -15.214 -15.698 10.303  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3521  C C    . GLY A 1 7   ? -15.433 -14.533 9.337   1.00 0.00 ? 7   GLY A C    3  
ATOM 3522  O O    . GLY A 1 7   ? -16.508 -13.936 9.313   1.00 0.00 ? 7   GLY A O    3  
ATOM 3523  H H    . GLY A 1 7   ? -14.020 -14.551 11.568  1.00 0.00 ? 7   GLY A H    3  
ATOM 3524  H HA2  . GLY A 1 7   ? -14.476 -16.387 9.888   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3525  H HA3  . GLY A 1 7   ? -16.141 -16.258 10.420  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3526  N N    . GLY A 1 8   ? -14.396 -14.244 8.563   1.00 0.00 ? 8   GLY A N    3  
ATOM 3527  C CA   . GLY A 1 8   ? -14.463 -13.160 7.597   1.00 0.00 ? 8   GLY A CA   3  
ATOM 3528  C C    . GLY A 1 8   ? -13.067 -12.793 7.089   1.00 0.00 ? 8   GLY A C    3  
ATOM 3529  O O    . GLY A 1 8   ? -12.260 -13.670 6.789   1.00 0.00 ? 8   GLY A O    3  
ATOM 3530  H H    . GLY A 1 8   ? -13.526 -14.735 8.589   1.00 0.00 ? 8   GLY A H    3  
ATOM 3531  H HA2  . GLY A 1 8   ? -15.093 -13.455 6.757   1.00 0.00 ? 8   GLY A HA2  3  
ATOM 3532  H HA3  . GLY A 1 8   ? -14.929 -12.288 8.055   1.00 0.00 ? 8   GLY A HA3  3  
ATOM 3533  N N    . PRO A 1 9   ? -12.820 -11.459 7.006   1.00 0.00 ? 9   PRO A N    3  
ATOM 3534  C CA   . PRO A 1 9   ? -11.535 -10.963 6.539   1.00 0.00 ? 9   PRO A CA   3  
ATOM 3535  C C    . PRO A 1 9   ? -10.459 -11.131 7.614   1.00 0.00 ? 9   PRO A C    3  
ATOM 3536  O O    . PRO A 1 9   ? -10.756 -11.543 8.736   1.00 0.00 ? 9   PRO A O    3  
ATOM 3537  C CB   . PRO A 1 9   ? -11.784 -9.509  6.171   1.00 0.00 ? 9   PRO A CB   3  
ATOM 3538  C CG   . PRO A 1 9   ? -13.072 -9.116  6.876   1.00 0.00 ? 9   PRO A CG   3  
ATOM 3539  C CD   . PRO A 1 9   ? -13.751 -10.389 7.353   1.00 0.00 ? 9   PRO A CD   3  
ATOM 3540  H HA   . PRO A 1 9   ? -11.222 -11.497 5.753   1.00 0.00 ? 9   PRO A HA   3  
ATOM 3541  H HB3  . PRO A 1 9   ? -11.877 -9.391  5.092   1.00 0.00 ? 9   PRO A HB3  3  
ATOM 3542  H HG3  . PRO A 1 9   ? -13.724 -8.566  6.199   1.00 0.00 ? 9   PRO A HG3  3  
ATOM 3543  H HD3  . PRO A 1 9   ? -14.715 -10.530 6.864   1.00 0.00 ? 9   PRO A HD3  3  
ATOM 3544  N N    . LYS A 1 10  ? -9.233  -10.806 7.235   1.00 0.00 ? 10  LYS A N    3  
ATOM 3545  C CA   . LYS A 1 10  ? -8.111  -10.916 8.152   1.00 0.00 ? 10  LYS A CA   3  
ATOM 3546  C C    . LYS A 1 10  ? -7.738  -9.523  8.664   1.00 0.00 ? 10  LYS A C    3  
ATOM 3547  O O    . LYS A 1 10  ? -7.749  -8.554  7.905   1.00 0.00 ? 10  LYS A O    3  
ATOM 3548  C CB   . LYS A 1 10  ? -6.949  -11.659 7.491   1.00 0.00 ? 10  LYS A CB   3  
ATOM 3549  C CG   . LYS A 1 10  ? -5.634  -11.383 8.223   1.00 0.00 ? 10  LYS A CG   3  
ATOM 3550  C CD   . LYS A 1 10  ? -4.843  -12.676 8.435   1.00 0.00 ? 10  LYS A CD   3  
ATOM 3551  C CE   . LYS A 1 10  ? -3.563  -12.678 7.596   1.00 0.00 ? 10  LYS A CE   3  
ATOM 3552  N NZ   . LYS A 1 10  ? -3.088  -14.064 7.381   1.00 0.00 ? 10  LYS A NZ   3  
ATOM 3553  H H    . LYS A 1 10  ? -9.000  -10.473 6.321   1.00 0.00 ? 10  LYS A H    3  
ATOM 3554  H HA   . LYS A 1 10  ? -8.439  -11.518 8.998   1.00 0.00 ? 10  LYS A HA   3  
ATOM 3555  H HB3  . LYS A 1 10  ? -6.862  -11.350 6.450   1.00 0.00 ? 10  LYS A HB3  3  
ATOM 3556  H HG3  . LYS A 1 10  ? -5.841  -10.917 9.187   1.00 0.00 ? 10  LYS A HG3  3  
ATOM 3557  H HD3  . LYS A 1 10  ? -5.460  -13.533 8.166   1.00 0.00 ? 10  LYS A HD3  3  
ATOM 3558  H HE3  . LYS A 1 10  ? -2.791  -12.096 8.098   1.00 0.00 ? 10  LYS A HE3  3  
ATOM 3559  H HZ1  . LYS A 1 10  ? -2.763  -14.442 8.247   1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 3560  H HZ2  . LYS A 1 10  ? -3.839  -14.624 7.032   1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 3561  H HZ3  . LYS A 1 10  ? -2.340  -14.059 6.717   1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 3562  N N    . THR A 1 11  ? -7.418  -9.466  9.949   1.00 0.00 ? 11  THR A N    3  
ATOM 3563  C CA   . THR A 1 11  ? -7.043  -8.208  10.571  1.00 0.00 ? 11  THR A CA   3  
ATOM 3564  C C    . THR A 1 11  ? -5.682  -8.337  11.258  1.00 0.00 ? 11  THR A C    3  
ATOM 3565  O O    . THR A 1 11  ? -5.389  -9.359  11.877  1.00 0.00 ? 11  THR A O    3  
ATOM 3566  C CB   . THR A 1 11  ? -8.167  -7.797  11.524  1.00 0.00 ? 11  THR A CB   3  
ATOM 3567  O OG1  . THR A 1 11  ? -9.310  -7.676  10.681  1.00 0.00 ? 11  THR A OG1  3  
ATOM 3568  C CG2  . THR A 1 11  ? -7.971  -6.390  12.091  1.00 0.00 ? 11  THR A CG2  3  
ATOM 3569  H H    . THR A 1 11  ? -7.413  -10.257 10.560  1.00 0.00 ? 11  THR A H    3  
ATOM 3570  H HA   . THR A 1 11  ? -6.935  -7.456  9.789   1.00 0.00 ? 11  THR A HA   3  
ATOM 3571  H HB   . THR A 1 11  ? -8.284  -8.528  12.326  1.00 0.00 ? 11  THR A HB   3  
ATOM 3572  H HG1  . THR A 1 11  ? -9.102  -7.075  9.909   1.00 0.00 ? 11  THR A HG1  3  
ATOM 3573  H HG21 . THR A 1 11  ? -7.459  -5.770  11.354  1.00 0.00 ? 11  THR A HG21 3  
ATOM 3574  H HG22 . THR A 1 11  ? -8.942  -5.952  12.321  1.00 0.00 ? 11  THR A HG22 3  
ATOM 3575  H HG23 . THR A 1 11  ? -7.371  -6.445  12.999  1.00 0.00 ? 11  THR A HG23 3  
ATOM 3576  N N    . VAL A 1 12  ? -4.885  -7.287  11.123  1.00 0.00 ? 12  VAL A N    3  
ATOM 3577  C CA   . VAL A 1 12  ? -3.561  -7.271  11.723  1.00 0.00 ? 12  VAL A CA   3  
ATOM 3578  C C    . VAL A 1 12  ? -3.267  -5.869  12.260  1.00 0.00 ? 12  VAL A C    3  
ATOM 3579  O O    . VAL A 1 12  ? -3.636  -4.873  11.642  1.00 0.00 ? 12  VAL A O    3  
ATOM 3580  C CB   . VAL A 1 12  ? -2.521  -7.753  10.710  1.00 0.00 ? 12  VAL A CB   3  
ATOM 3581  C CG1  . VAL A 1 12  ? -2.312  -9.266  10.816  1.00 0.00 ? 12  VAL A CG1  3  
ATOM 3582  C CG2  . VAL A 1 12  ? -2.917  -7.353  9.287   1.00 0.00 ? 12  VAL A CG2  3  
ATOM 3583  H H    . VAL A 1 12  ? -5.130  -6.460  10.618  1.00 0.00 ? 12  VAL A H    3  
ATOM 3584  H HA   . VAL A 1 12  ? -3.570  -7.972  12.558  1.00 0.00 ? 12  VAL A HA   3  
ATOM 3585  H HB   . VAL A 1 12  ? -1.575  -7.266  10.944  1.00 0.00 ? 12  VAL A HB   3  
ATOM 3586  H HG11 . VAL A 1 12  ? -3.178  -9.782  10.401  1.00 0.00 ? 12  VAL A HG11 3  
ATOM 3587  H HG12 . VAL A 1 12  ? -1.418  -9.548  10.260  1.00 0.00 ? 12  VAL A HG12 3  
ATOM 3588  H HG13 . VAL A 1 12  ? -2.192  -9.542  11.863  1.00 0.00 ? 12  VAL A HG13 3  
ATOM 3589  H HG21 . VAL A 1 12  ? -3.339  -8.214  8.771   1.00 0.00 ? 12  VAL A HG21 3  
ATOM 3590  H HG22 . VAL A 1 12  ? -3.657  -6.554  9.326   1.00 0.00 ? 12  VAL A HG22 3  
ATOM 3591  H HG23 . VAL A 1 12  ? -2.035  -7.005  8.750   1.00 0.00 ? 12  VAL A HG23 3  
ATOM 3592  N N    . THR A 1 13  ? -2.604  -5.837  13.408  1.00 0.00 ? 13  THR A N    3  
ATOM 3593  C CA   . THR A 1 13  ? -2.256  -4.573  14.036  1.00 0.00 ? 13  THR A CA   3  
ATOM 3594  C C    . THR A 1 13  ? -0.738  -4.375  14.028  1.00 0.00 ? 13  THR A C    3  
ATOM 3595  O O    . THR A 1 13  ? 0.016   -5.338  13.917  1.00 0.00 ? 13  THR A O    3  
ATOM 3596  C CB   . THR A 1 13  ? -2.864  -4.560  15.440  1.00 0.00 ? 13  THR A CB   3  
ATOM 3597  O OG1  . THR A 1 13  ? -4.173  -5.090  15.257  1.00 0.00 ? 13  THR A OG1  3  
ATOM 3598  C CG2  . THR A 1 13  ? -3.105  -3.142  15.960  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3599  H H    . THR A 1 13  ? -2.308  -6.652  13.905  1.00 0.00 ? 13  THR A H    3  
ATOM 3600  H HA   . THR A 1 13  ? -2.687  -3.765  13.444  1.00 0.00 ? 13  THR A HA   3  
ATOM 3601  H HB   . THR A 1 13  ? -2.248  -5.129  16.135  1.00 0.00 ? 13  THR A HB   3  
ATOM 3602  H HG1  . THR A 1 13  ? -4.736  -4.444  14.742  1.00 0.00 ? 13  THR A HG1  3  
ATOM 3603  H HG21 . THR A 1 13  ? -2.172  -2.733  16.346  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3604  H HG22 . THR A 1 13  ? -3.467  -2.514  15.145  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3605  H HG23 . THR A 1 13  ? -3.849  -3.169  16.756  1.00 0.00 ? 13  THR A HG23 3  
ATOM 3606  N N    . LEU A 1 14  ? -0.338  -3.117  14.147  1.00 0.00 ? 14  LEU A N    3  
ATOM 3607  C CA   . LEU A 1 14  ? 1.074   -2.779  14.156  1.00 0.00 ? 14  LEU A CA   3  
ATOM 3608  C C    . LEU A 1 14  ? 1.314   -1.631  15.138  1.00 0.00 ? 14  LEU A C    3  
ATOM 3609  O O    . LEU A 1 14  ? 0.534   -0.681  15.190  1.00 0.00 ? 14  LEU A O    3  
ATOM 3610  C CB   . LEU A 1 14  ? 1.563   -2.487  12.736  1.00 0.00 ? 14  LEU A CB   3  
ATOM 3611  C CG   . LEU A 1 14  ? 1.474   -3.645  11.742  1.00 0.00 ? 14  LEU A CG   3  
ATOM 3612  C CD1  . LEU A 1 14  ? 0.124   -3.647  11.022  1.00 0.00 ? 14  LEU A CD1  3  
ATOM 3613  C CD2  . LEU A 1 14  ? 2.647   -3.620  10.762  1.00 0.00 ? 14  LEU A CD2  3  
ATOM 3614  H H    . LEU A 1 14  ? -0.961  -2.339  14.237  1.00 0.00 ? 14  LEU A H    3  
ATOM 3615  H HA   . LEU A 1 14  ? 1.618   -3.656  14.509  1.00 0.00 ? 14  LEU A HA   3  
ATOM 3616  H HB3  . LEU A 1 14  ? 2.602   -2.161  12.791  1.00 0.00 ? 14  LEU A HB3  3  
ATOM 3617  H HG   . LEU A 1 14  ? 1.541   -4.580  12.300  1.00 0.00 ? 14  LEU A HG   3  
ATOM 3618  H HD11 . LEU A 1 14  ? -0.231  -2.622  10.914  1.00 0.00 ? 14  LEU A HD11 3  
ATOM 3619  H HD12 . LEU A 1 14  ? 0.239   -4.096  10.034  1.00 0.00 ? 14  LEU A HD12 3  
ATOM 3620  H HD13 . LEU A 1 14  ? -0.598  -4.223  11.601  1.00 0.00 ? 14  LEU A HD13 3  
ATOM 3621  H HD21 . LEU A 1 14  ? 3.576   -3.805  11.300  1.00 0.00 ? 14  LEU A HD21 3  
ATOM 3622  H HD22 . LEU A 1 14  ? 2.506   -4.392  10.004  1.00 0.00 ? 14  LEU A HD22 3  
ATOM 3623  H HD23 . LEU A 1 14  ? 2.697   -2.644  10.279  1.00 0.00 ? 14  LEU A HD23 3  
ATOM 3624  N N    . LYS A 1 15  ? 2.395   -1.758  15.892  1.00 0.00 ? 15  LYS A N    3  
ATOM 3625  C CA   . LYS A 1 15  ? 2.748   -0.742  16.871  1.00 0.00 ? 15  LYS A CA   3  
ATOM 3626  C C    . LYS A 1 15  ? 4.147   -0.207  16.563  1.00 0.00 ? 15  LYS A C    3  
ATOM 3627  O O    . LYS A 1 15  ? 5.132   -0.936  16.668  1.00 0.00 ? 15  LYS A O    3  
ATOM 3628  C CB   . LYS A 1 15  ? 2.599   -1.290  18.291  1.00 0.00 ? 15  LYS A CB   3  
ATOM 3629  C CG   . LYS A 1 15  ? 1.297   -2.082  18.439  1.00 0.00 ? 15  LYS A CG   3  
ATOM 3630  C CD   . LYS A 1 15  ? 0.624   -1.784  19.781  1.00 0.00 ? 15  LYS A CD   3  
ATOM 3631  C CE   . LYS A 1 15  ? -0.102  -3.020  20.316  1.00 0.00 ? 15  LYS A CE   3  
ATOM 3632  N NZ   . LYS A 1 15  ? 0.248   -3.253  21.735  1.00 0.00 ? 15  LYS A NZ   3  
ATOM 3633  H H    . LYS A 1 15  ? 3.024   -2.533  15.845  1.00 0.00 ? 15  LYS A H    3  
ATOM 3634  H HA   . LYS A 1 15  ? 2.034   0.076   16.766  1.00 0.00 ? 15  LYS A HA   3  
ATOM 3635  H HB3  . LYS A 1 15  ? 2.613   -0.469  19.006  1.00 0.00 ? 15  LYS A HB3  3  
ATOM 3636  H HG3  . LYS A 1 15  ? 1.505   -3.149  18.360  1.00 0.00 ? 15  LYS A HG3  3  
ATOM 3637  H HD3  . LYS A 1 15  ? -0.084  -0.963  19.662  1.00 0.00 ? 15  LYS A HD3  3  
ATOM 3638  H HE3  . LYS A 1 15  ? 0.166   -3.893  19.722  1.00 0.00 ? 15  LYS A HE3  3  
ATOM 3639  H HZ1  . LYS A 1 15  ? 0.592   -4.185  21.845  1.00 0.00 ? 15  LYS A HZ1  3  
ATOM 3640  H HZ2  . LYS A 1 15  ? 0.953   -2.602  22.015  1.00 0.00 ? 15  LYS A HZ2  3  
ATOM 3641  H HZ3  . LYS A 1 15  ? -0.565  -3.129  22.304  1.00 0.00 ? 15  LYS A HZ3  3  
ATOM 3642  N N    . ARG A 1 16  ? 4.192   1.064   16.188  1.00 0.00 ? 16  ARG A N    3  
ATOM 3643  C CA   . ARG A 1 16  ? 5.455   1.705   15.864  1.00 0.00 ? 16  ARG A CA   3  
ATOM 3644  C C    . ARG A 1 16  ? 6.533   1.288   16.864  1.00 0.00 ? 16  ARG A C    3  
ATOM 3645  O O    . ARG A 1 16  ? 6.448   1.611   18.047  1.00 0.00 ? 16  ARG A O    3  
ATOM 3646  C CB   . ARG A 1 16  ? 5.317   3.229   15.878  1.00 0.00 ? 16  ARG A CB   3  
ATOM 3647  C CG   . ARG A 1 16  ? 6.598   3.900   15.376  1.00 0.00 ? 16  ARG A CG   3  
ATOM 3648  C CD   . ARG A 1 16  ? 6.290   4.911   14.269  1.00 0.00 ? 16  ARG A CD   3  
ATOM 3649  N NE   . ARG A 1 16  ? 7.414   5.862   14.125  1.00 0.00 ? 16  ARG A NE   3  
ATOM 3650  C CZ   . ARG A 1 16  ? 7.398   6.926   13.312  1.00 0.00 ? 16  ARG A CZ   3  
ATOM 3651  N NH1  . ARG A 1 16  ? 6.316   7.181   12.562  1.00 0.00 ? 16  ARG A NH1  3  
ATOM 3652  N NH2  . ARG A 1 16  ? 8.464   7.735   13.247  1.00 0.00 ? 16  ARG A NH2  3  
ATOM 3653  H H    . ARG A 1 16  ? 3.386   1.650   16.105  1.00 0.00 ? 16  ARG A H    3  
ATOM 3654  H HA   . ARG A 1 16  ? 5.694   1.356   14.859  1.00 0.00 ? 16  ARG A HA   3  
ATOM 3655  H HB3  . ARG A 1 16  ? 5.098   3.568   16.890  1.00 0.00 ? 16  ARG A HB3  3  
ATOM 3656  H HG3  . ARG A 1 16  ? 7.286   3.142   15.000  1.00 0.00 ? 16  ARG A HG3  3  
ATOM 3657  H HD3  . ARG A 1 16  ? 5.373   5.449   14.504  1.00 0.00 ? 16  ARG A HD3  3  
ATOM 3658  H HE   . ARG A 1 16  ? 8.237   5.701   14.671  1.00 0.00 ? 16  ARG A HE   3  
ATOM 3659  H HH11 . ARG A 1 16  ? 5.522   6.576   12.611  1.00 0.00 ? 16  ARG A HH11 3  
ATOM 3660  H HH12 . ARG A 1 16  ? 6.306   7.975   11.955  1.00 0.00 ? 16  ARG A HH12 3  
ATOM 3661  H HH21 . ARG A 1 16  ? 9.271   7.546   13.807  1.00 0.00 ? 16  ARG A HH21 3  
ATOM 3662  H HH22 . ARG A 1 16  ? 8.452   8.531   12.639  1.00 0.00 ? 16  ARG A HH22 3  
ATOM 3663  N N    . THR A 1 17  ? 7.527   0.576   16.352  1.00 0.00 ? 17  THR A N    3  
ATOM 3664  C CA   . THR A 1 17  ? 8.621   0.111   17.187  1.00 0.00 ? 17  THR A CA   3  
ATOM 3665  C C    . THR A 1 17  ? 9.870   0.963   16.951  1.00 0.00 ? 17  THR A C    3  
ATOM 3666  O O    . THR A 1 17  ? 10.980  0.553   17.287  1.00 0.00 ? 17  THR A O    3  
ATOM 3667  C CB   . THR A 1 17  ? 8.838   -1.376  16.896  1.00 0.00 ? 17  THR A CB   3  
ATOM 3668  O OG1  . THR A 1 17  ? 10.055  -1.686  17.569  1.00 0.00 ? 17  THR A OG1  3  
ATOM 3669  C CG2  . THR A 1 17  ? 9.147   -1.646  15.422  1.00 0.00 ? 17  THR A CG2  3  
ATOM 3670  H H    . THR A 1 17  ? 7.590   0.316   15.389  1.00 0.00 ? 17  THR A H    3  
ATOM 3671  H HA   . THR A 1 17  ? 8.337   0.241   18.230  1.00 0.00 ? 17  THR A HA   3  
ATOM 3672  H HB   . THR A 1 17  ? 7.985   -1.966  17.230  1.00 0.00 ? 17  THR A HB   3  
ATOM 3673  H HG1  . THR A 1 17  ? 10.827  -1.261  17.094  1.00 0.00 ? 17  THR A HG1  3  
ATOM 3674  H HG21 . THR A 1 17  ? 8.250   -1.479  14.826  1.00 0.00 ? 17  THR A HG21 3  
ATOM 3675  H HG22 . THR A 1 17  ? 9.937   -0.974  15.087  1.00 0.00 ? 17  THR A HG22 3  
ATOM 3676  H HG23 . THR A 1 17  ? 9.475   -2.679  15.303  1.00 0.00 ? 17  THR A HG23 3  
ATOM 3677  N N    . SER A 1 18  ? 9.646   2.135   16.376  1.00 0.00 ? 18  SER A N    3  
ATOM 3678  C CA   . SER A 1 18  ? 10.740  3.050   16.090  1.00 0.00 ? 18  SER A CA   3  
ATOM 3679  C C    . SER A 1 18  ? 10.309  4.069   15.033  1.00 0.00 ? 18  SER A C    3  
ATOM 3680  O O    . SER A 1 18  ? 9.772   5.124   15.366  1.00 0.00 ? 18  SER A O    3  
ATOM 3681  C CB   . SER A 1 18  ? 11.984  2.293   15.624  1.00 0.00 ? 18  SER A CB   3  
ATOM 3682  O OG   . SER A 1 18  ? 12.900  2.059   16.690  1.00 0.00 ? 18  SER A OG   3  
ATOM 3683  H H    . SER A 1 18  ? 8.742   2.462   16.105  1.00 0.00 ? 18  SER A H    3  
ATOM 3684  H HA   . SER A 1 18  ? 10.953  3.547   17.038  1.00 0.00 ? 18  SER A HA   3  
ATOM 3685  H HB3  . SER A 1 18  ? 12.481  2.862   14.837  1.00 0.00 ? 18  SER A HB3  3  
ATOM 3686  H HG   . SER A 1 18  ? 12.465  1.502   17.397  1.00 0.00 ? 18  SER A HG   3  
ATOM 3687  N N    . GLN A 1 19  ? 10.560  3.716   13.781  1.00 0.00 ? 19  GLN A N    3  
ATOM 3688  C CA   . GLN A 1 19  ? 10.205  4.586   12.673  1.00 0.00 ? 19  GLN A CA   3  
ATOM 3689  C C    . GLN A 1 19  ? 9.321   3.838   11.674  1.00 0.00 ? 19  GLN A C    3  
ATOM 3690  O O    . GLN A 1 19  ? 9.475   2.632   11.484  1.00 0.00 ? 19  GLN A O    3  
ATOM 3691  C CB   . GLN A 1 19  ? 11.456  5.143   11.991  1.00 0.00 ? 19  GLN A CB   3  
ATOM 3692  C CG   . GLN A 1 19  ? 11.671  6.612   12.354  1.00 0.00 ? 19  GLN A CG   3  
ATOM 3693  C CD   . GLN A 1 19  ? 12.959  7.150   11.723  1.00 0.00 ? 19  GLN A CD   3  
ATOM 3694  O OE1  . GLN A 1 19  ? 14.062  6.782   12.092  1.00 0.00 ? 19  GLN A OE1  3  
ATOM 3695  N NE2  . GLN A 1 19  ? 12.756  8.039   10.754  1.00 0.00 ? 19  GLN A NE2  3  
ATOM 3696  H H    . GLN A 1 19  ? 10.998  2.856   13.520  1.00 0.00 ? 19  GLN A H    3  
ATOM 3697  H HA   . GLN A 1 19  ? 9.646   5.409   13.120  1.00 0.00 ? 19  GLN A HA   3  
ATOM 3698  H HB3  . GLN A 1 19  ? 11.359  5.041   10.909  1.00 0.00 ? 19  GLN A HB3  3  
ATOM 3699  H HG3  . GLN A 1 19  ? 11.722  6.720   13.437  1.00 0.00 ? 19  GLN A HG3  3  
ATOM 3700  H HE21 . GLN A 1 19  ? 11.824  8.297   10.499  1.00 0.00 ? 19  GLN A HE21 3  
ATOM 3701  H HE22 . GLN A 1 19  ? 13.535  8.448   10.281  1.00 0.00 ? 19  GLN A HE22 3  
ATOM 3702  N N    . GLY A 1 20  ? 8.414   4.586   11.061  1.00 0.00 ? 20  GLY A N    3  
ATOM 3703  C CA   . GLY A 1 20  ? 7.505   4.008   10.085  1.00 0.00 ? 20  GLY A CA   3  
ATOM 3704  C C    . GLY A 1 20  ? 6.904   2.699   10.604  1.00 0.00 ? 20  GLY A C    3  
ATOM 3705  O O    . GLY A 1 20  ? 6.167   2.698   11.589  1.00 0.00 ? 20  GLY A O    3  
ATOM 3706  H H    . GLY A 1 20  ? 8.296   5.566   11.221  1.00 0.00 ? 20  GLY A H    3  
ATOM 3707  H HA2  . GLY A 1 20  ? 6.707   4.716   9.863   1.00 0.00 ? 20  GLY A HA2  3  
ATOM 3708  H HA3  . GLY A 1 20  ? 8.036   3.824   9.152   1.00 0.00 ? 20  GLY A HA3  3  
ATOM 3709  N N    . PHE A 1 21  ? 7.238   1.618   9.915   1.00 0.00 ? 21  PHE A N    3  
ATOM 3710  C CA   . PHE A 1 21  ? 6.740   0.307   10.294  1.00 0.00 ? 21  PHE A CA   3  
ATOM 3711  C C    . PHE A 1 21  ? 7.551   -0.803  9.620   1.00 0.00 ? 21  PHE A C    3  
ATOM 3712  O O    . PHE A 1 21  ? 7.988   -0.653  8.481   1.00 0.00 ? 21  PHE A O    3  
ATOM 3713  C CB   . PHE A 1 21  ? 5.290   0.224   9.815   1.00 0.00 ? 21  PHE A CB   3  
ATOM 3714  C CG   . PHE A 1 21  ? 4.312   1.058   10.647  1.00 0.00 ? 21  PHE A CG   3  
ATOM 3715  C CD1  . PHE A 1 21  ? 4.010   0.683   11.919  1.00 0.00 ? 21  PHE A CD1  3  
ATOM 3716  C CD2  . PHE A 1 21  ? 3.744   2.171   10.113  1.00 0.00 ? 21  PHE A CD2  3  
ATOM 3717  C CE1  . PHE A 1 21  ? 3.102   1.455   12.691  1.00 0.00 ? 21  PHE A CE1  3  
ATOM 3718  C CE2  . PHE A 1 21  ? 2.836   2.946   10.885  1.00 0.00 ? 21  PHE A CE2  3  
ATOM 3719  C CZ   . PHE A 1 21  ? 2.534   2.571   12.157  1.00 0.00 ? 21  PHE A CZ   3  
ATOM 3720  H H    . PHE A 1 21  ? 7.837   1.628   9.115   1.00 0.00 ? 21  PHE A H    3  
ATOM 3721  H HA   . PHE A 1 21  ? 6.841   0.222   11.376  1.00 0.00 ? 21  PHE A HA   3  
ATOM 3722  H HB3  . PHE A 1 21  ? 4.969   -0.818  9.834   1.00 0.00 ? 21  PHE A HB3  3  
ATOM 3723  H HD1  . PHE A 1 21  ? 4.465   -0.210  12.346  1.00 0.00 ? 21  PHE A HD1  3  
ATOM 3724  H HD2  . PHE A 1 21  ? 3.986   2.472   9.094   1.00 0.00 ? 21  PHE A HD2  3  
ATOM 3725  H HE1  . PHE A 1 21  ? 2.860   1.156   13.710  1.00 0.00 ? 21  PHE A HE1  3  
ATOM 3726  H HE2  . PHE A 1 21  ? 2.381   3.839   10.457  1.00 0.00 ? 21  PHE A HE2  3  
ATOM 3727  H HZ   . PHE A 1 21  ? 1.839   3.165   12.749  1.00 0.00 ? 21  PHE A HZ   3  
ATOM 3728  N N    . GLY A 1 22  ? 7.727   -1.893  10.355  1.00 0.00 ? 22  GLY A N    3  
ATOM 3729  C CA   . GLY A 1 22  ? 8.477   -3.026  9.843   1.00 0.00 ? 22  GLY A CA   3  
ATOM 3730  C C    . GLY A 1 22  ? 8.171   -3.263  8.362   1.00 0.00 ? 22  GLY A C    3  
ATOM 3731  O O    . GLY A 1 22  ? 8.933   -2.843  7.492   1.00 0.00 ? 22  GLY A O    3  
ATOM 3732  H H    . GLY A 1 22  ? 7.366   -2.006  11.281  1.00 0.00 ? 22  GLY A H    3  
ATOM 3733  H HA2  . GLY A 1 22  ? 9.544   -2.849  9.974   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3734  H HA3  . GLY A 1 22  ? 8.228   -3.919  10.416  1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3735  N N    . PHE A 1 23  ? 7.054   -3.935  8.121   1.00 0.00 ? 23  PHE A N    3  
ATOM 3736  C CA   . PHE A 1 23  ? 6.639   -4.230  6.761   1.00 0.00 ? 23  PHE A CA   3  
ATOM 3737  C C    . PHE A 1 23  ? 6.696   -2.978  5.884   1.00 0.00 ? 23  PHE A C    3  
ATOM 3738  O O    . PHE A 1 23  ? 6.904   -1.875  6.385   1.00 0.00 ? 23  PHE A O    3  
ATOM 3739  C CB   . PHE A 1 23  ? 5.192   -4.723  6.832   1.00 0.00 ? 23  PHE A CB   3  
ATOM 3740  C CG   . PHE A 1 23  ? 4.154   -3.600  6.874   1.00 0.00 ? 23  PHE A CG   3  
ATOM 3741  C CD1  . PHE A 1 23  ? 4.064   -2.799  7.969   1.00 0.00 ? 23  PHE A CD1  3  
ATOM 3742  C CD2  . PHE A 1 23  ? 3.321   -3.403  5.817   1.00 0.00 ? 23  PHE A CD2  3  
ATOM 3743  C CE1  . PHE A 1 23  ? 3.100   -1.755  8.007   1.00 0.00 ? 23  PHE A CE1  3  
ATOM 3744  C CE2  . PHE A 1 23  ? 2.358   -2.361  5.856   1.00 0.00 ? 23  PHE A CE2  3  
ATOM 3745  C CZ   . PHE A 1 23  ? 2.268   -1.559  6.950   1.00 0.00 ? 23  PHE A CZ   3  
ATOM 3746  H H    . PHE A 1 23  ? 6.441   -4.272  8.834   1.00 0.00 ? 23  PHE A H    3  
ATOM 3747  H HA   . PHE A 1 23  ? 7.328   -4.979  6.368   1.00 0.00 ? 23  PHE A HA   3  
ATOM 3748  H HB3  . PHE A 1 23  ? 5.074   -5.346  7.719   1.00 0.00 ? 23  PHE A HB3  3  
ATOM 3749  H HD1  . PHE A 1 23  ? 4.732   -2.954  8.815   1.00 0.00 ? 23  PHE A HD1  3  
ATOM 3750  H HD2  . PHE A 1 23  ? 3.394   -4.046  4.939   1.00 0.00 ? 23  PHE A HD2  3  
ATOM 3751  H HE1  . PHE A 1 23  ? 3.028   -1.112  8.885   1.00 0.00 ? 23  PHE A HE1  3  
ATOM 3752  H HE2  . PHE A 1 23  ? 1.690   -2.204  5.008   1.00 0.00 ? 23  PHE A HE2  3  
ATOM 3753  H HZ   . PHE A 1 23  ? 1.529   -0.759  6.980   1.00 0.00 ? 23  PHE A HZ   3  
ATOM 3754  N N    . THR A 1 24  ? 6.508   -3.192  4.590   1.00 0.00 ? 24  THR A N    3  
ATOM 3755  C CA   . THR A 1 24  ? 6.535   -2.094  3.638   1.00 0.00 ? 24  THR A CA   3  
ATOM 3756  C C    . THR A 1 24  ? 5.788   -2.477  2.359   1.00 0.00 ? 24  THR A C    3  
ATOM 3757  O O    . THR A 1 24  ? 5.652   -3.659  2.046   1.00 0.00 ? 24  THR A O    3  
ATOM 3758  C CB   . THR A 1 24  ? 7.998   -1.713  3.397   1.00 0.00 ? 24  THR A CB   3  
ATOM 3759  O OG1  . THR A 1 24  ? 7.951   -0.855  2.261   1.00 0.00 ? 24  THR A OG1  3  
ATOM 3760  C CG2  . THR A 1 24  ? 8.843   -2.901  2.931   1.00 0.00 ? 24  THR A CG2  3  
ATOM 3761  H H    . THR A 1 24  ? 6.339   -4.093  4.190   1.00 0.00 ? 24  THR A H    3  
ATOM 3762  H HA   . THR A 1 24  ? 6.007   -1.247  4.076   1.00 0.00 ? 24  THR A HA   3  
ATOM 3763  H HB   . THR A 1 24  ? 8.431   -1.252  4.284   1.00 0.00 ? 24  THR A HB   3  
ATOM 3764  H HG1  . THR A 1 24  ? 8.866   -0.511  2.054   1.00 0.00 ? 24  THR A HG1  3  
ATOM 3765  H HG21 . THR A 1 24  ? 9.877   -2.756  3.241   1.00 0.00 ? 24  THR A HG21 3  
ATOM 3766  H HG22 . THR A 1 24  ? 8.456   -3.819  3.376   1.00 0.00 ? 24  THR A HG22 3  
ATOM 3767  H HG23 . THR A 1 24  ? 8.795   -2.977  1.845   1.00 0.00 ? 24  THR A HG23 3  
ATOM 3768  N N    . LEU A 1 25  ? 5.323   -1.455  1.655   1.00 0.00 ? 25  LEU A N    3  
ATOM 3769  C CA   . LEU A 1 25  ? 4.593   -1.672  0.417   1.00 0.00 ? 25  LEU A CA   3  
ATOM 3770  C C    . LEU A 1 25  ? 5.451   -1.210  -0.763  1.00 0.00 ? 25  LEU A C    3  
ATOM 3771  O O    . LEU A 1 25  ? 6.404   -0.452  -0.583  1.00 0.00 ? 25  LEU A O    3  
ATOM 3772  C CB   . LEU A 1 25  ? 3.222   -0.996  0.480   1.00 0.00 ? 25  LEU A CB   3  
ATOM 3773  C CG   . LEU A 1 25  ? 2.460   -1.144  1.799   1.00 0.00 ? 25  LEU A CG   3  
ATOM 3774  C CD1  . LEU A 1 25  ? 2.388   -2.610  2.229   1.00 0.00 ? 25  LEU A CD1  3  
ATOM 3775  C CD2  . LEU A 1 25  ? 3.073   -0.258  2.887   1.00 0.00 ? 25  LEU A CD2  3  
ATOM 3776  H H    . LEU A 1 25  ? 5.439   -0.498  1.917   1.00 0.00 ? 25  LEU A H    3  
ATOM 3777  H HA   . LEU A 1 25  ? 4.421   -2.744  0.322   1.00 0.00 ? 25  LEU A HA   3  
ATOM 3778  H HB3  . LEU A 1 25  ? 2.602   -1.401  -0.320  1.00 0.00 ? 25  LEU A HB3  3  
ATOM 3779  H HG   . LEU A 1 25  ? 1.437   -0.803  1.643   1.00 0.00 ? 25  LEU A HG   3  
ATOM 3780  H HD11 . LEU A 1 25  ? 3.102   -2.789  3.033   1.00 0.00 ? 25  LEU A HD11 3  
ATOM 3781  H HD12 . LEU A 1 25  ? 1.379   -2.837  2.579   1.00 0.00 ? 25  LEU A HD12 3  
ATOM 3782  H HD13 . LEU A 1 25  ? 2.630   -3.251  1.379   1.00 0.00 ? 25  LEU A HD13 3  
ATOM 3783  H HD21 . LEU A 1 25  ? 2.279   0.287   3.400   1.00 0.00 ? 25  LEU A HD21 3  
ATOM 3784  H HD22 . LEU A 1 25  ? 3.608   -0.880  3.603   1.00 0.00 ? 25  LEU A HD22 3  
ATOM 3785  H HD23 . LEU A 1 25  ? 3.763   0.451   2.432   1.00 0.00 ? 25  LEU A HD23 3  
ATOM 3786  N N    . ARG A 1 26  ? 5.085   -1.689  -1.942  1.00 0.00 ? 26  ARG A N    3  
ATOM 3787  C CA   . ARG A 1 26  ? 5.810   -1.336  -3.151  1.00 0.00 ? 26  ARG A CA   3  
ATOM 3788  C C    . ARG A 1 26  ? 4.835   -1.129  -4.312  1.00 0.00 ? 26  ARG A C    3  
ATOM 3789  O O    . ARG A 1 26  ? 3.847   -1.852  -4.435  1.00 0.00 ? 26  ARG A O    3  
ATOM 3790  C CB   . ARG A 1 26  ? 6.816   -2.425  -3.527  1.00 0.00 ? 26  ARG A CB   3  
ATOM 3791  C CG   . ARG A 1 26  ? 7.712   -1.969  -4.680  1.00 0.00 ? 26  ARG A CG   3  
ATOM 3792  C CD   . ARG A 1 26  ? 8.961   -1.256  -4.154  1.00 0.00 ? 26  ARG A CD   3  
ATOM 3793  N NE   . ARG A 1 26  ? 9.222   -0.037  -4.952  1.00 0.00 ? 26  ARG A NE   3  
ATOM 3794  C CZ   . ARG A 1 26  ? 9.678   -0.047  -6.212  1.00 0.00 ? 26  ARG A CZ   3  
ATOM 3795  N NH1  . ARG A 1 26  ? 9.929   -1.213  -6.823  1.00 0.00 ? 26  ARG A NH1  3  
ATOM 3796  N NH2  . ARG A 1 26  ? 9.886   1.108   -6.858  1.00 0.00 ? 26  ARG A NH2  3  
ATOM 3797  H H    . ARG A 1 26  ? 4.309   -2.306  -2.078  1.00 0.00 ? 26  ARG A H    3  
ATOM 3798  H HA   . ARG A 1 26  ? 6.328   -0.410  -2.905  1.00 0.00 ? 26  ARG A HA   3  
ATOM 3799  H HB3  . ARG A 1 26  ? 6.286   -3.333  -3.813  1.00 0.00 ? 26  ARG A HB3  3  
ATOM 3800  H HG3  . ARG A 1 26  ? 7.156   -1.298  -5.334  1.00 0.00 ? 26  ARG A HG3  3  
ATOM 3801  H HD3  . ARG A 1 26  ? 9.820   -1.925  -4.205  1.00 0.00 ? 26  ARG A HD3  3  
ATOM 3802  H HE   . ARG A 1 26  ? 9.046   0.850   -4.524  1.00 0.00 ? 26  ARG A HE   3  
ATOM 3803  H HH11 . ARG A 1 26  ? 9.773   -2.075  -6.341  1.00 0.00 ? 26  ARG A HH11 3  
ATOM 3804  H HH12 . ARG A 1 26  ? 10.270  -1.220  -7.764  1.00 0.00 ? 26  ARG A HH12 3  
ATOM 3805  H HH21 . ARG A 1 26  ? 9.701   1.976   -6.402  1.00 0.00 ? 26  ARG A HH21 3  
ATOM 3806  H HH22 . ARG A 1 26  ? 10.228  1.099   -7.799  1.00 0.00 ? 26  ARG A HH22 3  
ATOM 3807  N N    . HIS A 1 27  ? 5.149   -0.141  -5.137  1.00 0.00 ? 27  HIS A N    3  
ATOM 3808  C CA   . HIS A 1 27  ? 4.314   0.171   -6.285  1.00 0.00 ? 27  HIS A CA   3  
ATOM 3809  C C    . HIS A 1 27  ? 4.809   1.457   -6.947  1.00 0.00 ? 27  HIS A C    3  
ATOM 3810  O O    . HIS A 1 27  ? 5.376   1.418   -8.037  1.00 0.00 ? 27  HIS A O    3  
ATOM 3811  C CB   . HIS A 1 27  ? 2.839   0.243   -5.880  1.00 0.00 ? 27  HIS A CB   3  
ATOM 3812  C CG   . HIS A 1 27  ? 2.010   -0.920  -6.368  1.00 0.00 ? 27  HIS A CG   3  
ATOM 3813  N ND1  . HIS A 1 27  ? 2.559   -2.151  -6.686  1.00 0.00 ? 27  HIS A ND1  3  
ATOM 3814  C CD2  . HIS A 1 27  ? 0.668   -1.029  -6.589  1.00 0.00 ? 27  HIS A CD2  3  
ATOM 3815  C CE1  . HIS A 1 27  ? 1.583   -2.955  -7.079  1.00 0.00 ? 27  HIS A CE1  3  
ATOM 3816  N NE2  . HIS A 1 27  ? 0.412   -2.259  -7.019  1.00 0.00 ? 27  HIS A NE2  3  
ATOM 3817  H H    . HIS A 1 27  ? 5.954   0.442   -5.031  1.00 0.00 ? 27  HIS A H    3  
ATOM 3818  H HA   . HIS A 1 27  ? 4.424   -0.657  -6.986  1.00 0.00 ? 27  HIS A HA   3  
ATOM 3819  H HB3  . HIS A 1 27  ? 2.412   1.168   -6.267  1.00 0.00 ? 27  HIS A HB3  3  
ATOM 3820  H HD1  . HIS A 1 27  ? 3.528   -2.392  -6.628  1.00 0.00 ? 27  HIS A HD1  3  
ATOM 3821  H HD2  . HIS A 1 27  ? -0.068  -0.239  -6.437  1.00 0.00 ? 27  HIS A HD2  3  
ATOM 3822  H HE1  . HIS A 1 27  ? 1.695   -3.992  -7.395  1.00 0.00 ? 27  HIS A HE1  3  
ATOM 3823  N N    . PHE A 1 28  ? 4.579   2.565   -6.260  1.00 0.00 ? 28  PHE A N    3  
ATOM 3824  C CA   . PHE A 1 28  ? 4.996   3.861   -6.768  1.00 0.00 ? 28  PHE A CA   3  
ATOM 3825  C C    . PHE A 1 28  ? 4.602   4.026   -8.238  1.00 0.00 ? 28  PHE A C    3  
ATOM 3826  O O    . PHE A 1 28  ? 5.261   4.749   -8.984  1.00 0.00 ? 28  PHE A O    3  
ATOM 3827  C CB   . PHE A 1 28  ? 6.520   3.918   -6.653  1.00 0.00 ? 28  PHE A CB   3  
ATOM 3828  C CG   . PHE A 1 28  ? 7.059   5.266   -6.172  1.00 0.00 ? 28  PHE A CG   3  
ATOM 3829  C CD1  . PHE A 1 28  ? 6.849   6.387   -6.915  1.00 0.00 ? 28  PHE A CD1  3  
ATOM 3830  C CD2  . PHE A 1 28  ? 7.746   5.347   -5.000  1.00 0.00 ? 28  PHE A CD2  3  
ATOM 3831  C CE1  . PHE A 1 28  ? 7.348   7.638   -6.469  1.00 0.00 ? 28  PHE A CE1  3  
ATOM 3832  C CE2  . PHE A 1 28  ? 8.245   6.599   -4.554  1.00 0.00 ? 28  PHE A CE2  3  
ATOM 3833  C CZ   . PHE A 1 28  ? 8.035   7.718   -5.297  1.00 0.00 ? 28  PHE A CZ   3  
ATOM 3834  H H    . PHE A 1 28  ? 4.118   2.589   -5.374  1.00 0.00 ? 28  PHE A H    3  
ATOM 3835  H HA   . PHE A 1 28  ? 4.492   4.621   -6.171  1.00 0.00 ? 28  PHE A HA   3  
ATOM 3836  H HB3  . PHE A 1 28  ? 6.957   3.690   -7.624  1.00 0.00 ? 28  PHE A HB3  3  
ATOM 3837  H HD1  . PHE A 1 28  ? 6.297   6.323   -7.853  1.00 0.00 ? 28  PHE A HD1  3  
ATOM 3838  H HD2  . PHE A 1 28  ? 7.913   4.449   -4.404  1.00 0.00 ? 28  PHE A HD2  3  
ATOM 3839  H HE1  . PHE A 1 28  ? 7.180   8.538   -7.064  1.00 0.00 ? 28  PHE A HE1  3  
ATOM 3840  H HE2  . PHE A 1 28  ? 8.796   6.662   -3.616  1.00 0.00 ? 28  PHE A HE2  3  
ATOM 3841  H HZ   . PHE A 1 28  ? 8.418   8.680   -4.955  1.00 0.00 ? 28  PHE A HZ   3  
ATOM 3842  N N    . ILE A 1 29  ? 3.528   3.345   -8.609  1.00 0.00 ? 29  ILE A N    3  
ATOM 3843  C CA   . ILE A 1 29  ? 3.038   3.406   -9.976  1.00 0.00 ? 29  ILE A CA   3  
ATOM 3844  C C    . ILE A 1 29  ? 3.149   4.844   -10.488 1.00 0.00 ? 29  ILE A C    3  
ATOM 3845  O O    . ILE A 1 29  ? 2.931   5.793   -9.738  1.00 0.00 ? 29  ILE A O    3  
ATOM 3846  C CB   . ILE A 1 29  ? 1.624   2.830   -10.065 1.00 0.00 ? 29  ILE A CB   3  
ATOM 3847  C CG1  . ILE A 1 29  ? 0.754   3.330   -8.909  1.00 0.00 ? 29  ILE A CG1  3  
ATOM 3848  C CG2  . ILE A 1 29  ? 1.658   1.302   -10.138 1.00 0.00 ? 29  ILE A CG2  3  
ATOM 3849  C CD1  . ILE A 1 29  ? -0.345  4.266   -9.415  1.00 0.00 ? 29  ILE A CD1  3  
ATOM 3850  H H    . ILE A 1 29  ? 2.997   2.759   -7.996  1.00 0.00 ? 29  ILE A H    3  
ATOM 3851  H HA   . ILE A 1 29  ? 3.684   2.773   -10.584 1.00 0.00 ? 29  ILE A HA   3  
ATOM 3852  H HB   . ILE A 1 29  ? 1.167   3.185   -10.988 1.00 0.00 ? 29  ILE A HB   3  
ATOM 3853  H HG13 . ILE A 1 29  ? 1.376   3.853   -8.182  1.00 0.00 ? 29  ILE A HG13 3  
ATOM 3854  H HG21 . ILE A 1 29  ? 0.644   0.920   -10.254 1.00 0.00 ? 29  ILE A HG21 3  
ATOM 3855  H HG22 . ILE A 1 29  ? 2.264   0.992   -10.989 1.00 0.00 ? 29  ILE A HG22 3  
ATOM 3856  H HG23 . ILE A 1 29  ? 2.093   0.905   -9.220  1.00 0.00 ? 29  ILE A HG23 3  
ATOM 3857  H HD11 . ILE A 1 29  ? -1.279  3.712   -9.510  1.00 0.00 ? 29  ILE A HD11 3  
ATOM 3858  H HD12 . ILE A 1 29  ? -0.478  5.085   -8.710  1.00 0.00 ? 29  ILE A HD12 3  
ATOM 3859  H HD13 . ILE A 1 29  ? -0.061  4.668   -10.388 1.00 0.00 ? 29  ILE A HD13 3  
ATOM 3860  N N    . VAL A 1 30  ? 3.491   4.959   -11.764 1.00 0.00 ? 30  VAL A N    3  
ATOM 3861  C CA   . VAL A 1 30  ? 3.634   6.265   -12.385 1.00 0.00 ? 30  VAL A CA   3  
ATOM 3862  C C    . VAL A 1 30  ? 3.055   6.217   -13.801 1.00 0.00 ? 30  VAL A C    3  
ATOM 3863  O O    . VAL A 1 30  ? 3.354   5.301   -14.567 1.00 0.00 ? 30  VAL A O    3  
ATOM 3864  C CB   . VAL A 1 30  ? 5.099   6.703   -12.351 1.00 0.00 ? 30  VAL A CB   3  
ATOM 3865  C CG1  . VAL A 1 30  ? 5.394   7.717   -13.457 1.00 0.00 ? 30  VAL A CG1  3  
ATOM 3866  C CG2  . VAL A 1 30  ? 5.472   7.263   -10.978 1.00 0.00 ? 30  VAL A CG2  3  
ATOM 3867  H H    . VAL A 1 30  ? 3.666   4.183   -12.367 1.00 0.00 ? 30  VAL A H    3  
ATOM 3868  H HA   . VAL A 1 30  ? 3.055   6.976   -11.794 1.00 0.00 ? 30  VAL A HA   3  
ATOM 3869  H HB   . VAL A 1 30  ? 5.716   5.822   -12.533 1.00 0.00 ? 30  VAL A HB   3  
ATOM 3870  H HG11 . VAL A 1 30  ? 6.467   7.896   -13.511 1.00 0.00 ? 30  VAL A HG11 3  
ATOM 3871  H HG12 . VAL A 1 30  ? 5.042   7.327   -14.412 1.00 0.00 ? 30  VAL A HG12 3  
ATOM 3872  H HG13 . VAL A 1 30  ? 4.881   8.654   -13.237 1.00 0.00 ? 30  VAL A HG13 3  
ATOM 3873  H HG21 . VAL A 1 30  ? 5.417   8.352   -11.004 1.00 0.00 ? 30  VAL A HG21 3  
ATOM 3874  H HG22 . VAL A 1 30  ? 4.780   6.880   -10.229 1.00 0.00 ? 30  VAL A HG22 3  
ATOM 3875  H HG23 . VAL A 1 30  ? 6.487   6.957   -10.725 1.00 0.00 ? 30  VAL A HG23 3  
ATOM 3876  N N    . TYR A 1 31  ? 2.238   7.213   -14.107 1.00 0.00 ? 31  TYR A N    3  
ATOM 3877  C CA   . TYR A 1 31  ? 1.616   7.298   -15.417 1.00 0.00 ? 31  TYR A CA   3  
ATOM 3878  C C    . TYR A 1 31  ? 1.148   8.724   -15.713 1.00 0.00 ? 31  TYR A C    3  
ATOM 3879  O O    . TYR A 1 31  ? -0.051  8.985   -15.781 1.00 0.00 ? 31  TYR A O    3  
ATOM 3880  C CB   . TYR A 1 31  ? 0.399   6.374   -15.364 1.00 0.00 ? 31  TYR A CB   3  
ATOM 3881  C CG   . TYR A 1 31  ? 0.747   4.889   -15.240 1.00 0.00 ? 31  TYR A CG   3  
ATOM 3882  C CD1  . TYR A 1 31  ? 1.091   4.363   -14.011 1.00 0.00 ? 31  TYR A CD1  3  
ATOM 3883  C CD2  . TYR A 1 31  ? 0.718   4.077   -16.355 1.00 0.00 ? 31  TYR A CD2  3  
ATOM 3884  C CE1  . TYR A 1 31  ? 1.419   2.966   -13.893 1.00 0.00 ? 31  TYR A CE1  3  
ATOM 3885  C CE2  . TYR A 1 31  ? 1.048   2.680   -16.236 1.00 0.00 ? 31  TYR A CE2  3  
ATOM 3886  C CZ   . TYR A 1 31  ? 1.381   2.193   -15.011 1.00 0.00 ? 31  TYR A CZ   3  
ATOM 3887  O OH   . TYR A 1 31  ? 1.692   0.874   -14.899 1.00 0.00 ? 31  TYR A OH   3  
ATOM 3888  H H    . TYR A 1 31  ? 2.000   7.955   -13.478 1.00 0.00 ? 31  TYR A H    3  
ATOM 3889  H HA   . TYR A 1 31  ? 2.358   7.004   -16.160 1.00 0.00 ? 31  TYR A HA   3  
ATOM 3890  H HB3  . TYR A 1 31  ? -0.197  6.521   -16.267 1.00 0.00 ? 31  TYR A HB3  3  
ATOM 3891  H HD1  . TYR A 1 31  ? 1.114   5.004   -13.129 1.00 0.00 ? 31  TYR A HD1  3  
ATOM 3892  H HD2  . TYR A 1 31  ? 0.446   4.493   -17.325 1.00 0.00 ? 31  TYR A HD2  3  
ATOM 3893  H HE1  . TYR A 1 31  ? 1.693   2.536   -12.928 1.00 0.00 ? 31  TYR A HE1  3  
ATOM 3894  H HE2  . TYR A 1 31  ? 1.028   2.028   -17.109 1.00 0.00 ? 31  TYR A HE2  3  
ATOM 3895  H HH   . TYR A 1 31  ? 2.242   0.584   -15.683 1.00 0.00 ? 31  TYR A HH   3  
ATOM 3896  N N    . PRO A 1 32  ? 2.145   9.633   -15.882 1.00 0.00 ? 32  PRO A N    3  
ATOM 3897  C CA   . PRO A 1 32  ? 1.847   11.025  -16.168 1.00 0.00 ? 32  PRO A CA   3  
ATOM 3898  C C    . PRO A 1 32  ? 1.393   11.203  -17.618 1.00 0.00 ? 32  PRO A C    3  
ATOM 3899  O O    . PRO A 1 32  ? 1.451   10.263  -18.411 1.00 0.00 ? 32  PRO A O    3  
ATOM 3900  C CB   . PRO A 1 32  ? 3.132   11.775  -15.854 1.00 0.00 ? 32  PRO A CB   3  
ATOM 3901  C CG   . PRO A 1 32  ? 4.234   10.728  -15.850 1.00 0.00 ? 32  PRO A CG   3  
ATOM 3902  C CD   . PRO A 1 32  ? 3.577   9.359   -15.807 1.00 0.00 ? 32  PRO A CD   3  
ATOM 3903  H HA   . PRO A 1 32  ? 1.086   11.341  -15.602 1.00 0.00 ? 32  PRO A HA   3  
ATOM 3904  H HB3  . PRO A 1 32  ? 3.065   12.275  -14.888 1.00 0.00 ? 32  PRO A HB3  3  
ATOM 3905  H HG3  . PRO A 1 32  ? 4.889   10.866  -14.987 1.00 0.00 ? 32  PRO A HG3  3  
ATOM 3906  H HD3  . PRO A 1 32  ? 3.831   8.826   -14.891 1.00 0.00 ? 32  PRO A HD3  3  
ATOM 3907  N N    . PRO A 1 33  ? 0.935   12.445  -17.930 1.00 0.00 ? 33  PRO A N    3  
ATOM 3908  C CA   . PRO A 1 33  ? 0.469   12.757  -19.270 1.00 0.00 ? 33  PRO A CA   3  
ATOM 3909  C C    . PRO A 1 33  ? 1.645   12.909  -20.237 1.00 0.00 ? 33  PRO A C    3  
ATOM 3910  O O    . PRO A 1 33  ? 2.754   12.461  -19.948 1.00 0.00 ? 33  PRO A O    3  
ATOM 3911  C CB   . PRO A 1 33  ? -0.343  14.032  -19.118 1.00 0.00 ? 33  PRO A CB   3  
ATOM 3912  C CG   . PRO A 1 33  ? 0.081   14.640  -17.790 1.00 0.00 ? 33  PRO A CG   3  
ATOM 3913  C CD   . PRO A 1 33  ? 0.850   13.581  -17.017 1.00 0.00 ? 33  PRO A CD   3  
ATOM 3914  H HA   . PRO A 1 33  ? -0.084  12.005  -19.629 1.00 0.00 ? 33  PRO A HA   3  
ATOM 3915  H HB3  . PRO A 1 33  ? -1.412  13.818  -19.125 1.00 0.00 ? 33  PRO A HB3  3  
ATOM 3916  H HG3  . PRO A 1 33  ? -0.791  14.967  -17.224 1.00 0.00 ? 33  PRO A HG3  3  
ATOM 3917  H HD3  . PRO A 1 33  ? 0.334   13.312  -16.096 1.00 0.00 ? 33  PRO A HD3  3  
ATOM 3918  N N    . GLU A 1 34  ? 1.364   13.542  -21.366 1.00 0.00 ? 34  GLU A N    3  
ATOM 3919  C CA   . GLU A 1 34  ? 2.383   13.759  -22.378 1.00 0.00 ? 34  GLU A CA   3  
ATOM 3920  C C    . GLU A 1 34  ? 3.006   15.148  -22.215 1.00 0.00 ? 34  GLU A C    3  
ATOM 3921  O O    . GLU A 1 34  ? 4.098   15.280  -21.664 1.00 0.00 ? 34  GLU A O    3  
ATOM 3922  C CB   . GLU A 1 34  ? 1.809   13.577  -23.784 1.00 0.00 ? 34  GLU A CB   3  
ATOM 3923  C CG   . GLU A 1 34  ? 2.628   12.562  -24.584 1.00 0.00 ? 34  GLU A CG   3  
ATOM 3924  C CD   . GLU A 1 34  ? 3.778   13.247  -25.324 1.00 0.00 ? 34  GLU A CD   3  
ATOM 3925  O OE1  . GLU A 1 34  ? 4.196   14.326  -24.849 1.00 0.00 ? 34  GLU A OE1  3  
ATOM 3926  O OE2  . GLU A 1 34  ? 4.215   12.677  -26.347 1.00 0.00 ? 34  GLU A OE2  3  
ATOM 3927  H H    . GLU A 1 34  ? 0.459   13.902  -21.594 1.00 0.00 ? 34  GLU A H    3  
ATOM 3928  H HA   . GLU A 1 34  ? 3.138   12.993  -22.198 1.00 0.00 ? 34  GLU A HA   3  
ATOM 3929  H HB3  . GLU A 1 34  ? 1.802   14.535  -24.304 1.00 0.00 ? 34  GLU A HB3  3  
ATOM 3930  H HG3  . GLU A 1 34  ? 1.983   12.053  -25.300 1.00 0.00 ? 34  GLU A HG3  3  
ATOM 3931  N N    . SER A 1 35  ? 2.285   16.145  -22.704 1.00 0.00 ? 35  SER A N    3  
ATOM 3932  C CA   . SER A 1 35  ? 2.753   17.517  -22.620 1.00 0.00 ? 35  SER A CA   3  
ATOM 3933  C C    . SER A 1 35  ? 1.796   18.345  -21.757 1.00 0.00 ? 35  SER A C    3  
ATOM 3934  O O    . SER A 1 35  ? 1.305   19.385  -22.192 1.00 0.00 ? 35  SER A O    3  
ATOM 3935  C CB   . SER A 1 35  ? 2.886   18.142  -24.011 1.00 0.00 ? 35  SER A CB   3  
ATOM 3936  O OG   . SER A 1 35  ? 3.739   19.282  -24.005 1.00 0.00 ? 35  SER A OG   3  
ATOM 3937  H H    . SER A 1 35  ? 1.398   16.028  -23.151 1.00 0.00 ? 35  SER A H    3  
ATOM 3938  H HA   . SER A 1 35  ? 3.736   17.460  -22.153 1.00 0.00 ? 35  SER A HA   3  
ATOM 3939  H HB3  . SER A 1 35  ? 1.899   18.429  -24.375 1.00 0.00 ? 35  SER A HB3  3  
ATOM 3940  H HG   . SER A 1 35  ? 4.110   19.435  -24.921 1.00 0.00 ? 35  SER A HG   3  
ATOM 3941  N N    . ALA A 1 36  ? 1.562   17.850  -20.551 1.00 0.00 ? 36  ALA A N    3  
ATOM 3942  C CA   . ALA A 1 36  ? 0.674   18.529  -19.623 1.00 0.00 ? 36  ALA A CA   3  
ATOM 3943  C C    . ALA A 1 36  ? 1.406   18.763  -18.300 1.00 0.00 ? 36  ALA A C    3  
ATOM 3944  O O    . ALA A 1 36  ? 1.110   18.112  -17.299 1.00 0.00 ? 36  ALA A O    3  
ATOM 3945  C CB   . ALA A 1 36  ? -0.604  17.708  -19.445 1.00 0.00 ? 36  ALA A CB   3  
ATOM 3946  H H    . ALA A 1 36  ? 1.966   17.002  -20.205 1.00 0.00 ? 36  ALA A H    3  
ATOM 3947  H HA   . ALA A 1 36  ? 0.413   19.493  -20.059 1.00 0.00 ? 36  ALA A HA   3  
ATOM 3948  H HB1  . ALA A 1 36  ? -1.388  18.112  -20.087 1.00 0.00 ? 36  ALA A HB1  3  
ATOM 3949  H HB2  . ALA A 1 36  ? -0.410  16.671  -19.716 1.00 0.00 ? 36  ALA A HB2  3  
ATOM 3950  H HB3  . ALA A 1 36  ? -0.926  17.756  -18.404 1.00 0.00 ? 36  ALA A HB3  3  
ATOM 3951  N N    . ILE A 1 37  ? 2.349   19.693  -18.338 1.00 0.00 ? 37  ILE A N    3  
ATOM 3952  C CA   . ILE A 1 37  ? 3.126   20.020  -17.154 1.00 0.00 ? 37  ILE A CA   3  
ATOM 3953  C C    . ILE A 1 37  ? 2.258   20.824  -16.187 1.00 0.00 ? 37  ILE A C    3  
ATOM 3954  O O    . ILE A 1 37  ? 1.531   21.726  -16.600 1.00 0.00 ? 37  ILE A O    3  
ATOM 3955  C CB   . ILE A 1 37  ? 4.428   20.724  -17.545 1.00 0.00 ? 37  ILE A CB   3  
ATOM 3956  C CG1  . ILE A 1 37  ? 5.359   19.774  -18.300 1.00 0.00 ? 37  ILE A CG1  3  
ATOM 3957  C CG2  . ILE A 1 37  ? 5.106   21.341  -16.321 1.00 0.00 ? 37  ILE A CG2  3  
ATOM 3958  C CD1  . ILE A 1 37  ? 6.229   18.973  -17.331 1.00 0.00 ? 37  ILE A CD1  3  
ATOM 3959  H H    . ILE A 1 37  ? 2.584   20.217  -19.157 1.00 0.00 ? 37  ILE A H    3  
ATOM 3960  H HA   . ILE A 1 37  ? 3.400   19.080  -16.675 1.00 0.00 ? 37  ILE A HA   3  
ATOM 3961  H HB   . ILE A 1 37  ? 4.182   21.541  -18.224 1.00 0.00 ? 37  ILE A HB   3  
ATOM 3962  H HG13 . ILE A 1 37  ? 5.995   20.345  -18.978 1.00 0.00 ? 37  ILE A HG13 3  
ATOM 3963  H HG21 . ILE A 1 37  ? 4.433   22.059  -15.855 1.00 0.00 ? 37  ILE A HG21 3  
ATOM 3964  H HG22 . ILE A 1 37  ? 5.348   20.554  -15.606 1.00 0.00 ? 37  ILE A HG22 3  
ATOM 3965  H HG23 . ILE A 1 37  ? 6.021   21.846  -16.629 1.00 0.00 ? 37  ILE A HG23 3  
ATOM 3966  H HD11 . ILE A 1 37  ? 7.014   19.614  -16.930 1.00 0.00 ? 37  ILE A HD11 3  
ATOM 3967  H HD12 . ILE A 1 37  ? 5.612   18.602  -16.512 1.00 0.00 ? 37  ILE A HD12 3  
ATOM 3968  H HD13 . ILE A 1 37  ? 6.679   18.131  -17.856 1.00 0.00 ? 37  ILE A HD13 3  
ATOM 3969  N N    . GLN A 1 38  ? 2.363   20.471  -14.913 1.00 0.00 ? 38  GLN A N    3  
ATOM 3970  C CA   . GLN A 1 38  ? 1.596   21.148  -13.881 1.00 0.00 ? 38  GLN A CA   3  
ATOM 3971  C C    . GLN A 1 38  ? 2.131   22.565  -13.668 1.00 0.00 ? 38  GLN A C    3  
ATOM 3972  O O    . GLN A 1 38  ? 3.338   22.763  -13.538 1.00 0.00 ? 38  GLN A O    3  
ATOM 3973  C CB   . GLN A 1 38  ? 1.610   20.353  -12.576 1.00 0.00 ? 38  GLN A CB   3  
ATOM 3974  C CG   . GLN A 1 38  ? 0.613   19.195  -12.628 1.00 0.00 ? 38  GLN A CG   3  
ATOM 3975  C CD   . GLN A 1 38  ? 1.025   18.164  -13.682 1.00 0.00 ? 38  GLN A CD   3  
ATOM 3976  O OE1  . GLN A 1 38  ? 0.626   18.224  -14.835 1.00 0.00 ? 38  GLN A OE1  3  
ATOM 3977  N NE2  . GLN A 1 38  ? 1.839   17.218  -13.226 1.00 0.00 ? 38  GLN A NE2  3  
ATOM 3978  H H    . GLN A 1 38  ? 2.957   19.736  -14.585 1.00 0.00 ? 38  GLN A H    3  
ATOM 3979  H HA   . GLN A 1 38  ? 0.575   21.192  -14.263 1.00 0.00 ? 38  GLN A HA   3  
ATOM 3980  H HB3  . GLN A 1 38  ? 1.365   21.011  -11.742 1.00 0.00 ? 38  GLN A HB3  3  
ATOM 3981  H HG3  . GLN A 1 38  ? -0.382  19.576  -12.856 1.00 0.00 ? 38  GLN A HG3  3  
ATOM 3982  H HE21 . GLN A 1 38  ? 2.129   17.227  -12.268 1.00 0.00 ? 38  GLN A HE21 3  
ATOM 3983  H HE22 . GLN A 1 38  ? 2.165   16.499  -13.840 1.00 0.00 ? 38  GLN A HE22 3  
ATOM 3984  N N    . PHE A 1 39  ? 1.208   23.515  -13.639 1.00 0.00 ? 39  PHE A N    3  
ATOM 3985  C CA   . PHE A 1 39  ? 1.573   24.908  -13.442 1.00 0.00 ? 39  PHE A CA   3  
ATOM 3986  C C    . PHE A 1 39  ? 2.672   25.044  -12.386 1.00 0.00 ? 39  PHE A C    3  
ATOM 3987  O O    . PHE A 1 39  ? 3.730   25.610  -12.657 1.00 0.00 ? 39  PHE A O    3  
ATOM 3988  C CB   . PHE A 1 39  ? 0.319   25.633  -12.951 1.00 0.00 ? 39  PHE A CB   3  
ATOM 3989  C CG   . PHE A 1 39  ? 0.003   26.919  -13.719 1.00 0.00 ? 39  PHE A CG   3  
ATOM 3990  C CD1  . PHE A 1 39  ? 0.612   28.084  -13.374 1.00 0.00 ? 39  PHE A CD1  3  
ATOM 3991  C CD2  . PHE A 1 39  ? -0.889  26.895  -14.746 1.00 0.00 ? 39  PHE A CD2  3  
ATOM 3992  C CE1  . PHE A 1 39  ? 0.319   29.277  -14.087 1.00 0.00 ? 39  PHE A CE1  3  
ATOM 3993  C CE2  . PHE A 1 39  ? -1.182  28.088  -15.458 1.00 0.00 ? 39  PHE A CE2  3  
ATOM 3994  C CZ   . PHE A 1 39  ? -0.572  29.254  -15.115 1.00 0.00 ? 39  PHE A CZ   3  
ATOM 3995  H H    . PHE A 1 39  ? 0.228   23.346  -13.745 1.00 0.00 ? 39  PHE A H    3  
ATOM 3996  H HA   . PHE A 1 39  ? 1.940   25.284  -14.397 1.00 0.00 ? 39  PHE A HA   3  
ATOM 3997  H HB3  . PHE A 1 39  ? 0.441   25.874  -11.895 1.00 0.00 ? 39  PHE A HB3  3  
ATOM 3998  H HD1  . PHE A 1 39  ? 1.327   28.103  -12.551 1.00 0.00 ? 39  PHE A HD1  3  
ATOM 3999  H HD2  . PHE A 1 39  ? -1.377  25.961  -15.023 1.00 0.00 ? 39  PHE A HD2  3  
ATOM 4000  H HE1  . PHE A 1 39  ? 0.807   30.211  -13.811 1.00 0.00 ? 39  PHE A HE1  3  
ATOM 4001  H HE2  . PHE A 1 39  ? -1.896  28.069  -16.282 1.00 0.00 ? 39  PHE A HE2  3  
ATOM 4002  H HZ   . PHE A 1 39  ? -0.797  30.170  -15.662 1.00 0.00 ? 39  PHE A HZ   3  
ATOM 4003  N N    . SER A 1 40  ? 2.384   24.514  -11.208 1.00 0.00 ? 40  SER A N    3  
ATOM 4004  C CA   . SER A 1 40  ? 3.335   24.569  -10.110 1.00 0.00 ? 40  SER A CA   3  
ATOM 4005  C C    . SER A 1 40  ? 4.438   23.529  -10.321 1.00 0.00 ? 40  SER A C    3  
ATOM 4006  O O    . SER A 1 40  ? 4.563   22.964  -11.405 1.00 0.00 ? 40  SER A O    3  
ATOM 4007  C CB   . SER A 1 40  ? 2.639   24.339  -8.766  1.00 0.00 ? 40  SER A CB   3  
ATOM 4008  O OG   . SER A 1 40  ? 1.444   25.106  -8.646  1.00 0.00 ? 40  SER A OG   3  
ATOM 4009  H H    . SER A 1 40  ? 1.520   24.055  -10.995 1.00 0.00 ? 40  SER A H    3  
ATOM 4010  H HA   . SER A 1 40  ? 3.749   25.577  -10.137 1.00 0.00 ? 40  SER A HA   3  
ATOM 4011  H HB3  . SER A 1 40  ? 3.321   24.600  -7.956  1.00 0.00 ? 40  SER A HB3  3  
ATOM 4012  H HG   . SER A 1 40  ? 1.341   25.433  -7.707  1.00 0.00 ? 40  SER A HG   3  
ATOM 4013  N N    . TYR A 1 41  ? 5.210   23.310  -9.267  1.00 0.00 ? 41  TYR A N    3  
ATOM 4014  C CA   . TYR A 1 41  ? 6.297   22.348  -9.323  1.00 0.00 ? 41  TYR A CA   3  
ATOM 4015  C C    . TYR A 1 41  ? 6.115   21.250  -8.272  1.00 0.00 ? 41  TYR A C    3  
ATOM 4016  O O    . TYR A 1 41  ? 5.217   21.330  -7.435  1.00 0.00 ? 41  TYR A O    3  
ATOM 4017  C CB   . TYR A 1 41  ? 7.571   23.135  -9.005  1.00 0.00 ? 41  TYR A CB   3  
ATOM 4018  C CG   . TYR A 1 41  ? 7.345   24.343  -8.094  1.00 0.00 ? 41  TYR A CG   3  
ATOM 4019  C CD1  . TYR A 1 41  ? 7.024   25.568  -8.641  1.00 0.00 ? 41  TYR A CD1  3  
ATOM 4020  C CD2  . TYR A 1 41  ? 7.464   24.208  -6.726  1.00 0.00 ? 41  TYR A CD2  3  
ATOM 4021  C CE1  . TYR A 1 41  ? 6.811   26.706  -7.784  1.00 0.00 ? 41  TYR A CE1  3  
ATOM 4022  C CE2  . TYR A 1 41  ? 7.253   25.346  -5.869  1.00 0.00 ? 41  TYR A CE2  3  
ATOM 4023  C CZ   . TYR A 1 41  ? 6.937   26.538  -6.440  1.00 0.00 ? 41  TYR A CZ   3  
ATOM 4024  O OH   . TYR A 1 41  ? 6.737   27.612  -5.630  1.00 0.00 ? 41  TYR A OH   3  
ATOM 4025  H H    . TYR A 1 41  ? 5.099   23.773  -8.387  1.00 0.00 ? 41  TYR A H    3  
ATOM 4026  H HA   . TYR A 1 41  ? 6.295   21.896  -10.313 1.00 0.00 ? 41  TYR A HA   3  
ATOM 4027  H HB3  . TYR A 1 41  ? 8.018   23.474  -9.939  1.00 0.00 ? 41  TYR A HB3  3  
ATOM 4028  H HD1  . TYR A 1 41  ? 6.929   25.675  -9.722  1.00 0.00 ? 41  TYR A HD1  3  
ATOM 4029  H HD2  . TYR A 1 41  ? 7.719   23.240  -6.294  1.00 0.00 ? 41  TYR A HD2  3  
ATOM 4030  H HE1  . TYR A 1 41  ? 6.556   27.679  -8.202  1.00 0.00 ? 41  TYR A HE1  3  
ATOM 4031  H HE2  . TYR A 1 41  ? 7.344   25.252  -4.787  1.00 0.00 ? 41  TYR A HE2  3  
ATOM 4032  H HH   . TYR A 1 41  ? 7.395   28.333  -5.849  1.00 0.00 ? 41  TYR A HH   3  
ATOM 4033  N N    . LYS A 1 42  ? 6.980   20.251  -8.350  1.00 0.00 ? 42  LYS A N    3  
ATOM 4034  C CA   . LYS A 1 42  ? 6.926   19.139  -7.417  1.00 0.00 ? 42  LYS A CA   3  
ATOM 4035  C C    . LYS A 1 42  ? 5.585   18.418  -7.566  1.00 0.00 ? 42  LYS A C    3  
ATOM 4036  O O    . LYS A 1 42  ? 4.591   18.818  -6.960  1.00 0.00 ? 42  LYS A O    3  
ATOM 4037  C CB   . LYS A 1 42  ? 7.209   19.621  -5.993  1.00 0.00 ? 42  LYS A CB   3  
ATOM 4038  C CG   . LYS A 1 42  ? 8.710   19.825  -5.771  1.00 0.00 ? 42  LYS A CG   3  
ATOM 4039  C CD   . LYS A 1 42  ? 9.293   18.712  -4.898  1.00 0.00 ? 42  LYS A CD   3  
ATOM 4040  C CE   . LYS A 1 42  ? 10.290  19.275  -3.885  1.00 0.00 ? 42  LYS A CE   3  
ATOM 4041  N NZ   . LYS A 1 42  ? 11.325  18.267  -3.560  1.00 0.00 ? 42  LYS A NZ   3  
ATOM 4042  H H    . LYS A 1 42  ? 7.708   20.193  -9.035  1.00 0.00 ? 42  LYS A H    3  
ATOM 4043  H HA   . LYS A 1 42  ? 7.722   18.445  -7.687  1.00 0.00 ? 42  LYS A HA   3  
ATOM 4044  H HB3  . LYS A 1 42  ? 6.829   18.892  -5.276  1.00 0.00 ? 42  LYS A HB3  3  
ATOM 4045  H HG3  . LYS A 1 42  ? 8.883   20.791  -5.299  1.00 0.00 ? 42  LYS A HG3  3  
ATOM 4046  H HD3  . LYS A 1 42  ? 9.787   17.971  -5.527  1.00 0.00 ? 42  LYS A HD3  3  
ATOM 4047  H HE3  . LYS A 1 42  ? 9.766   19.574  -2.977  1.00 0.00 ? 42  LYS A HE3  3  
ATOM 4048  H HZ1  . LYS A 1 42  ? 10.995  17.358  -3.817  1.00 0.00 ? 42  LYS A HZ1  3  
ATOM 4049  H HZ2  . LYS A 1 42  ? 12.162  18.474  -4.065  1.00 0.00 ? 42  LYS A HZ2  3  
ATOM 4050  H HZ3  . LYS A 1 42  ? 11.513  18.288  -2.578  1.00 0.00 ? 42  LYS A HZ3  3  
ATOM 4051  N N    . ASP A 1 43  ? 5.599   17.371  -8.377  1.00 0.00 ? 43  ASP A N    3  
ATOM 4052  C CA   . ASP A 1 43  ? 4.396   16.591  -8.613  1.00 0.00 ? 43  ASP A CA   3  
ATOM 4053  C C    . ASP A 1 43  ? 3.697   16.322  -7.279  1.00 0.00 ? 43  ASP A C    3  
ATOM 4054  O O    . ASP A 1 43  ? 2.517   16.635  -7.118  1.00 0.00 ? 43  ASP A O    3  
ATOM 4055  C CB   . ASP A 1 43  ? 4.731   15.242  -9.252  1.00 0.00 ? 43  ASP A CB   3  
ATOM 4056  C CG   . ASP A 1 43  ? 5.051   15.295  -10.747 1.00 0.00 ? 43  ASP A CG   3  
ATOM 4057  O OD1  . ASP A 1 43  ? 5.174   16.428  -11.261 1.00 0.00 ? 43  ASP A OD1  3  
ATOM 4058  O OD2  . ASP A 1 43  ? 5.167   14.203  -11.342 1.00 0.00 ? 43  ASP A OD2  3  
ATOM 4059  H H    . ASP A 1 43  ? 6.411   17.053  -8.866  1.00 0.00 ? 43  ASP A H    3  
ATOM 4060  H HA   . ASP A 1 43  ? 3.790   17.197  -9.287  1.00 0.00 ? 43  ASP A HA   3  
ATOM 4061  H HB3  . ASP A 1 43  ? 3.889   14.567  -9.100  1.00 0.00 ? 43  ASP A HB3  3  
ATOM 4062  N N    . GLU A 1 44  ? 4.452   15.745  -6.357  1.00 0.00 ? 44  GLU A N    3  
ATOM 4063  C CA   . GLU A 1 44  ? 3.921   15.431  -5.042  1.00 0.00 ? 44  GLU A CA   3  
ATOM 4064  C C    . GLU A 1 44  ? 2.479   14.929  -5.159  1.00 0.00 ? 44  GLU A C    3  
ATOM 4065  O O    . GLU A 1 44  ? 1.535   15.702  -5.007  1.00 0.00 ? 44  GLU A O    3  
ATOM 4066  C CB   . GLU A 1 44  ? 4.005   16.644  -4.112  1.00 0.00 ? 44  GLU A CB   3  
ATOM 4067  C CG   . GLU A 1 44  ? 4.408   16.222  -2.698  1.00 0.00 ? 44  GLU A CG   3  
ATOM 4068  C CD   . GLU A 1 44  ? 3.180   16.092  -1.793  1.00 0.00 ? 44  GLU A CD   3  
ATOM 4069  O OE1  . GLU A 1 44  ? 2.729   17.146  -1.294  1.00 0.00 ? 44  GLU A OE1  3  
ATOM 4070  O OE2  . GLU A 1 44  ? 2.720   14.942  -1.623  1.00 0.00 ? 44  GLU A OE2  3  
ATOM 4071  H H    . GLU A 1 44  ? 5.410   15.494  -6.496  1.00 0.00 ? 44  GLU A H    3  
ATOM 4072  H HA   . GLU A 1 44  ? 4.558   14.637  -4.653  1.00 0.00 ? 44  GLU A HA   3  
ATOM 4073  H HB3  . GLU A 1 44  ? 3.042   17.152  -4.084  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 4074  H HG3  . GLU A 1 44  ? 5.097   16.955  -2.278  1.00 0.00 ? 44  GLU A HG3  3  
ATOM 4075  N N    . GLU A 1 45  ? 2.356   13.637  -5.427  1.00 0.00 ? 45  GLU A N    3  
ATOM 4076  C CA   . GLU A 1 45  ? 1.047   13.025  -5.565  1.00 0.00 ? 45  GLU A CA   3  
ATOM 4077  C C    . GLU A 1 45  ? 0.347   13.545  -6.822  1.00 0.00 ? 45  GLU A C    3  
ATOM 4078  O O    . GLU A 1 45  ? 0.768   14.544  -7.402  1.00 0.00 ? 45  GLU A O    3  
ATOM 4079  C CB   . GLU A 1 45  ? 0.192   13.267  -4.320  1.00 0.00 ? 45  GLU A CB   3  
ATOM 4080  C CG   . GLU A 1 45  ? 0.051   11.988  -3.492  1.00 0.00 ? 45  GLU A CG   3  
ATOM 4081  C CD   . GLU A 1 45  ? 1.241   11.814  -2.545  1.00 0.00 ? 45  GLU A CD   3  
ATOM 4082  O OE1  . GLU A 1 45  ? 2.339   11.517  -3.064  1.00 0.00 ? 45  GLU A OE1  3  
ATOM 4083  O OE2  . GLU A 1 45  ? 1.024   11.979  -1.326  1.00 0.00 ? 45  GLU A OE2  3  
ATOM 4084  H H    . GLU A 1 45  ? 3.130   13.015  -5.548  1.00 0.00 ? 45  GLU A H    3  
ATOM 4085  H HA   . GLU A 1 45  ? 1.237   11.954  -5.664  1.00 0.00 ? 45  GLU A HA   3  
ATOM 4086  H HB3  . GLU A 1 45  ? -0.793  13.625  -4.616  1.00 0.00 ? 45  GLU A HB3  3  
ATOM 4087  H HG3  . GLU A 1 45  ? -0.018  11.127  -4.157  1.00 0.00 ? 45  GLU A HG3  3  
ATOM 4088  N N    . ASN A 1 46  ? -0.711  12.845  -7.204  1.00 0.00 ? 46  ASN A N    3  
ATOM 4089  C CA   . ASN A 1 46  ? -1.473  13.225  -8.381  1.00 0.00 ? 46  ASN A CA   3  
ATOM 4090  C C    . ASN A 1 46  ? -1.699  14.737  -8.371  1.00 0.00 ? 46  ASN A C    3  
ATOM 4091  O O    . ASN A 1 46  ? -2.402  15.258  -7.506  1.00 0.00 ? 46  ASN A O    3  
ATOM 4092  C CB   . ASN A 1 46  ? -2.843  12.543  -8.393  1.00 0.00 ? 46  ASN A CB   3  
ATOM 4093  C CG   . ASN A 1 46  ? -2.963  11.576  -9.573  1.00 0.00 ? 46  ASN A CG   3  
ATOM 4094  O OD1  . ASN A 1 46  ? -2.136  10.704  -9.783  1.00 0.00 ? 46  ASN A OD1  3  
ATOM 4095  N ND2  . ASN A 1 46  ? -4.038  11.777  -10.330 1.00 0.00 ? 46  ASN A ND2  3  
ATOM 4096  H H    . ASN A 1 46  ? -1.047  12.033  -6.727  1.00 0.00 ? 46  ASN A H    3  
ATOM 4097  H HA   . ASN A 1 46  ? -0.873  12.898  -9.230  1.00 0.00 ? 46  ASN A HA   3  
ATOM 4098  H HB3  . ASN A 1 46  ? -3.628  13.296  -8.455  1.00 0.00 ? 46  ASN A HB3  3  
ATOM 4099  H HD21 . ASN A 1 46  ? -4.679  12.511  -10.104 1.00 0.00 ? 46  ASN A HD21 3  
ATOM 4100  H HD22 . ASN A 1 46  ? -4.205  11.197  -11.127 1.00 0.00 ? 46  ASN A HD22 3  
ATOM 4101  N N    . GLY A 1 47  ? -1.090  15.400  -9.343  1.00 0.00 ? 47  GLY A N    3  
ATOM 4102  C CA   . GLY A 1 47  ? -1.216  16.844  -9.457  1.00 0.00 ? 47  GLY A CA   3  
ATOM 4103  C C    . GLY A 1 47  ? -2.460  17.224  -10.263 1.00 0.00 ? 47  GLY A C    3  
ATOM 4104  O O    . GLY A 1 47  ? -2.380  17.432  -11.472 1.00 0.00 ? 47  GLY A O    3  
ATOM 4105  H H    . GLY A 1 47  ? -0.521  14.970  -10.042 1.00 0.00 ? 47  GLY A H    3  
ATOM 4106  H HA2  . GLY A 1 47  ? -1.272  17.287  -8.463  1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4107  H HA3  . GLY A 1 47  ? -0.326  17.253  -9.939  1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4108  N N    . ASN A 1 48  ? -3.579  17.304  -9.559  1.00 0.00 ? 48  ASN A N    3  
ATOM 4109  C CA   . ASN A 1 48  ? -4.838  17.656  -10.194 1.00 0.00 ? 48  ASN A CA   3  
ATOM 4110  C C    . ASN A 1 48  ? -5.855  18.047  -9.120  1.00 0.00 ? 48  ASN A C    3  
ATOM 4111  O O    . ASN A 1 48  ? -6.492  17.184  -8.518  1.00 0.00 ? 48  ASN A O    3  
ATOM 4112  C CB   . ASN A 1 48  ? -5.411  16.472  -10.977 1.00 0.00 ? 48  ASN A CB   3  
ATOM 4113  C CG   . ASN A 1 48  ? -4.606  16.217  -12.252 1.00 0.00 ? 48  ASN A CG   3  
ATOM 4114  O OD1  . ASN A 1 48  ? -4.482  17.067  -13.119 1.00 0.00 ? 48  ASN A OD1  3  
ATOM 4115  N ND2  . ASN A 1 48  ? -4.068  15.003  -12.321 1.00 0.00 ? 48  ASN A ND2  3  
ATOM 4116  H H    . ASN A 1 48  ? -3.635  17.133  -8.576  1.00 0.00 ? 48  ASN A H    3  
ATOM 4117  H HA   . ASN A 1 48  ? -4.600  18.481  -10.864 1.00 0.00 ? 48  ASN A HA   3  
ATOM 4118  H HB3  . ASN A 1 48  ? -6.452  16.668  -11.232 1.00 0.00 ? 48  ASN A HB3  3  
ATOM 4119  H HD21 . ASN A 1 48  ? -4.209  14.352  -11.574 1.00 0.00 ? 48  ASN A HD21 3  
ATOM 4120  H HD22 . ASN A 1 48  ? -3.523  14.741  -13.118 1.00 0.00 ? 48  ASN A HD22 3  
ATOM 4121  N N    . ARG A 1 49  ? -5.975  19.350  -8.911  1.00 0.00 ? 49  ARG A N    3  
ATOM 4122  C CA   . ARG A 1 49  ? -6.903  19.868  -7.920  1.00 0.00 ? 49  ARG A CA   3  
ATOM 4123  C C    . ARG A 1 49  ? -8.344  19.549  -8.324  1.00 0.00 ? 49  ARG A C    3  
ATOM 4124  O O    . ARG A 1 49  ? -8.846  20.079  -9.314  1.00 0.00 ? 49  ARG A O    3  
ATOM 4125  C CB   . ARG A 1 49  ? -6.748  21.381  -7.758  1.00 0.00 ? 49  ARG A CB   3  
ATOM 4126  C CG   . ARG A 1 49  ? -6.387  21.744  -6.317  1.00 0.00 ? 49  ARG A CG   3  
ATOM 4127  C CD   . ARG A 1 49  ? -7.559  22.433  -5.613  1.00 0.00 ? 49  ARG A CD   3  
ATOM 4128  N NE   . ARG A 1 49  ? -7.637  21.987  -4.204  1.00 0.00 ? 49  ARG A NE   3  
ATOM 4129  C CZ   . ARG A 1 49  ? -8.047  20.769  -3.824  1.00 0.00 ? 49  ARG A CZ   3  
ATOM 4130  N NH1  . ARG A 1 49  ? -8.418  19.869  -4.745  1.00 0.00 ? 49  ARG A NH1  3  
ATOM 4131  N NH2  . ARG A 1 49  ? -8.087  20.452  -2.523  1.00 0.00 ? 49  ARG A NH2  3  
ATOM 4132  H H    . ARG A 1 49  ? -5.452  20.046  -9.405  1.00 0.00 ? 49  ARG A H    3  
ATOM 4133  H HA   . ARG A 1 49  ? -6.632  19.359  -6.994  1.00 0.00 ? 49  ARG A HA   3  
ATOM 4134  H HB3  . ARG A 1 49  ? -7.677  21.878  -8.039  1.00 0.00 ? 49  ARG A HB3  3  
ATOM 4135  H HG3  . ARG A 1 49  ? -5.516  22.401  -6.310  1.00 0.00 ? 49  ARG A HG3  3  
ATOM 4136  H HD3  . ARG A 1 49  ? -8.489  22.201  -6.129  1.00 0.00 ? 49  ARG A HD3  3  
ATOM 4137  H HE   . ARG A 1 49  ? -7.368  22.634  -3.492  1.00 0.00 ? 49  ARG A HE   3  
ATOM 4138  H HH11 . ARG A 1 49  ? -8.389  20.106  -5.715  1.00 0.00 ? 49  ARG A HH11 3  
ATOM 4139  H HH12 . ARG A 1 49  ? -8.724  18.961  -4.461  1.00 0.00 ? 49  ARG A HH12 3  
ATOM 4140  H HH21 . ARG A 1 49  ? -7.809  21.123  -1.836  1.00 0.00 ? 49  ARG A HH21 3  
ATOM 4141  H HH22 . ARG A 1 49  ? -8.393  19.544  -2.239  1.00 0.00 ? 49  ARG A HH22 3  
ATOM 4142  N N    . GLY A 1 50  ? -8.967  18.684  -7.537  1.00 0.00 ? 50  GLY A N    3  
ATOM 4143  C CA   . GLY A 1 50  ? -10.340 18.288  -7.801  1.00 0.00 ? 50  GLY A CA   3  
ATOM 4144  C C    . GLY A 1 50  ? -10.391 17.063  -8.716  1.00 0.00 ? 50  GLY A C    3  
ATOM 4145  O O    . GLY A 1 50  ? -10.304 17.191  -9.936  1.00 0.00 ? 50  GLY A O    3  
ATOM 4146  H H    . GLY A 1 50  ? -8.551  18.258  -6.734  1.00 0.00 ? 50  GLY A H    3  
ATOM 4147  H HA2  . GLY A 1 50  ? -10.846 18.067  -6.862  1.00 0.00 ? 50  GLY A HA2  3  
ATOM 4148  H HA3  . GLY A 1 50  ? -10.879 19.115  -8.265  1.00 0.00 ? 50  GLY A HA3  3  
ATOM 4149  N N    . GLY A 1 51  ? -10.535 15.905  -8.090  1.00 0.00 ? 51  GLY A N    3  
ATOM 4150  C CA   . GLY A 1 51  ? -10.598 14.657  -8.832  1.00 0.00 ? 51  GLY A CA   3  
ATOM 4151  C C    . GLY A 1 51  ? -11.469 14.806  -10.082 1.00 0.00 ? 51  GLY A C    3  
ATOM 4152  O O    . GLY A 1 51  ? -12.695 14.799  -9.993  1.00 0.00 ? 51  GLY A O    3  
ATOM 4153  H H    . GLY A 1 51  ? -10.606 15.808  -7.097  1.00 0.00 ? 51  GLY A H    3  
ATOM 4154  H HA2  . GLY A 1 51  ? -9.594  14.348  -9.120  1.00 0.00 ? 51  GLY A HA2  3  
ATOM 4155  H HA3  . GLY A 1 51  ? -11.003 13.870  -8.195  1.00 0.00 ? 51  GLY A HA3  3  
ATOM 4156  N N    . LYS A 1 52  ? -10.801 14.937  -11.218 1.00 0.00 ? 52  LYS A N    3  
ATOM 4157  C CA   . LYS A 1 52  ? -11.497 15.087  -12.484 1.00 0.00 ? 52  LYS A CA   3  
ATOM 4158  C C    . LYS A 1 52  ? -10.505 14.903  -13.633 1.00 0.00 ? 52  LYS A C    3  
ATOM 4159  O O    . LYS A 1 52  ? -10.669 14.012  -14.465 1.00 0.00 ? 52  LYS A O    3  
ATOM 4160  C CB   . LYS A 1 52  ? -12.248 16.420  -12.526 1.00 0.00 ? 52  LYS A CB   3  
ATOM 4161  C CG   . LYS A 1 52  ? -13.702 16.217  -12.958 1.00 0.00 ? 52  LYS A CG   3  
ATOM 4162  C CD   . LYS A 1 52  ? -13.867 16.454  -14.460 1.00 0.00 ? 52  LYS A CD   3  
ATOM 4163  C CE   . LYS A 1 52  ? -15.074 15.688  -15.006 1.00 0.00 ? 52  LYS A CE   3  
ATOM 4164  N NZ   . LYS A 1 52  ? -16.331 16.236  -14.450 1.00 0.00 ? 52  LYS A NZ   3  
ATOM 4165  H H    . LYS A 1 52  ? -9.802  14.940  -11.282 1.00 0.00 ? 52  LYS A H    3  
ATOM 4166  H HA   . LYS A 1 52  ? -12.244 14.296  -12.543 1.00 0.00 ? 52  LYS A HA   3  
ATOM 4167  H HB3  . LYS A 1 52  ? -11.752 17.099  -13.220 1.00 0.00 ? 52  LYS A HB3  3  
ATOM 4168  H HG3  . LYS A 1 52  ? -14.348 16.899  -12.405 1.00 0.00 ? 52  LYS A HG3  3  
ATOM 4169  H HD3  . LYS A 1 52  ? -12.964 16.137  -14.983 1.00 0.00 ? 52  LYS A HD3  3  
ATOM 4170  H HE3  . LYS A 1 52  ? -14.987 14.632  -14.752 1.00 0.00 ? 52  LYS A HE3  3  
ATOM 4171  H HZ1  . LYS A 1 52  ? -16.160 16.596  -13.533 1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 4172  H HZ2  . LYS A 1 52  ? -16.664 16.973  -15.040 1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 4173  H HZ3  . LYS A 1 52  ? -17.018 15.512  -14.401 1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 4174  N N    . GLN A 1 53  ? -9.495  15.762  -13.644 1.00 0.00 ? 53  GLN A N    3  
ATOM 4175  C CA   . GLN A 1 53  ? -8.476  15.705  -14.677 1.00 0.00 ? 53  GLN A CA   3  
ATOM 4176  C C    . GLN A 1 53  ? -7.580  14.483  -14.472 1.00 0.00 ? 53  GLN A C    3  
ATOM 4177  O O    . GLN A 1 53  ? -6.476  14.600  -13.940 1.00 0.00 ? 53  GLN A O    3  
ATOM 4178  C CB   . GLN A 1 53  ? -7.649  16.994  -14.703 1.00 0.00 ? 53  GLN A CB   3  
ATOM 4179  C CG   . GLN A 1 53  ? -8.402  18.113  -15.426 1.00 0.00 ? 53  GLN A CG   3  
ATOM 4180  C CD   . GLN A 1 53  ? -7.768  19.475  -15.138 1.00 0.00 ? 53  GLN A CD   3  
ATOM 4181  O OE1  . GLN A 1 53  ? -6.559  19.636  -15.128 1.00 0.00 ? 53  GLN A OE1  3  
ATOM 4182  N NE2  . GLN A 1 53  ? -8.649  20.444  -14.905 1.00 0.00 ? 53  GLN A NE2  3  
ATOM 4183  H H    . GLN A 1 53  ? -9.368  16.485  -12.964 1.00 0.00 ? 53  GLN A H    3  
ATOM 4184  H HA   . GLN A 1 53  ? -9.019  15.611  -15.617 1.00 0.00 ? 53  GLN A HA   3  
ATOM 4185  H HB3  . GLN A 1 53  ? -6.698  16.809  -15.203 1.00 0.00 ? 53  GLN A HB3  3  
ATOM 4186  H HG3  . GLN A 1 53  ? -9.445  18.118  -15.109 1.00 0.00 ? 53  GLN A HG3  3  
ATOM 4187  H HE21 . GLN A 1 53  ? -9.629  20.244  -14.929 1.00 0.00 ? 53  GLN A HE21 3  
ATOM 4188  H HE22 . GLN A 1 53  ? -8.332  21.371  -14.707 1.00 0.00 ? 53  GLN A HE22 3  
ATOM 4189  N N    . ARG A 1 54  ? -8.086  13.338  -14.905 1.00 0.00 ? 54  ARG A N    3  
ATOM 4190  C CA   . ARG A 1 54  ? -7.344  12.095  -14.776 1.00 0.00 ? 54  ARG A CA   3  
ATOM 4191  C C    . ARG A 1 54  ? -6.225  12.033  -15.817 1.00 0.00 ? 54  ARG A C    3  
ATOM 4192  O O    . ARG A 1 54  ? -5.077  11.740  -15.485 1.00 0.00 ? 54  ARG A O    3  
ATOM 4193  C CB   . ARG A 1 54  ? -8.263  10.884  -14.952 1.00 0.00 ? 54  ARG A CB   3  
ATOM 4194  C CG   . ARG A 1 54  ? -7.738  9.680   -14.168 1.00 0.00 ? 54  ARG A CG   3  
ATOM 4195  C CD   . ARG A 1 54  ? -6.436  9.155   -14.775 1.00 0.00 ? 54  ARG A CD   3  
ATOM 4196  N NE   . ARG A 1 54  ? -5.305  9.423   -13.858 1.00 0.00 ? 54  ARG A NE   3  
ATOM 4197  C CZ   . ARG A 1 54  ? -4.035  9.084   -14.113 1.00 0.00 ? 54  ARG A CZ   3  
ATOM 4198  N NH1  . ARG A 1 54  ? -3.723  8.464   -15.258 1.00 0.00 ? 54  ARG A NH1  3  
ATOM 4199  N NH2  . ARG A 1 54  ? -3.074  9.367   -13.221 1.00 0.00 ? 54  ARG A NH2  3  
ATOM 4200  H H    . ARG A 1 54  ? -8.982  13.252  -15.337 1.00 0.00 ? 54  ARG A H    3  
ATOM 4201  H HA   . ARG A 1 54  ? -6.937  12.117  -13.764 1.00 0.00 ? 54  ARG A HA   3  
ATOM 4202  H HB3  . ARG A 1 54  ? -8.336  10.631  -16.009 1.00 0.00 ? 54  ARG A HB3  3  
ATOM 4203  H HG3  . ARG A 1 54  ? -8.487  8.888   -14.167 1.00 0.00 ? 54  ARG A HG3  3  
ATOM 4204  H HD3  . ARG A 1 54  ? -6.254  9.635   -15.737 1.00 0.00 ? 54  ARG A HD3  3  
ATOM 4205  H HE   . ARG A 1 54  ? -5.504  9.885   -12.992 1.00 0.00 ? 54  ARG A HE   3  
ATOM 4206  H HH11 . ARG A 1 54  ? -4.439  8.253   -15.923 1.00 0.00 ? 54  ARG A HH11 3  
ATOM 4207  H HH12 . ARG A 1 54  ? -2.774  8.211   -15.449 1.00 0.00 ? 54  ARG A HH12 3  
ATOM 4208  H HH21 . ARG A 1 54  ? -3.306  9.830   -12.365 1.00 0.00 ? 54  ARG A HH21 3  
ATOM 4209  H HH22 . ARG A 1 54  ? -2.125  9.114   -13.411 1.00 0.00 ? 54  ARG A HH22 3  
ATOM 4210  N N    . ASN A 1 55  ? -6.598  12.316  -17.057 1.00 0.00 ? 55  ASN A N    3  
ATOM 4211  C CA   . ASN A 1 55  ? -5.640  12.296  -18.150 1.00 0.00 ? 55  ASN A CA   3  
ATOM 4212  C C    . ASN A 1 55  ? -5.061  10.886  -18.290 1.00 0.00 ? 55  ASN A C    3  
ATOM 4213  O O    . ASN A 1 55  ? -4.511  10.340  -17.334 1.00 0.00 ? 55  ASN A O    3  
ATOM 4214  C CB   . ASN A 1 55  ? -4.481  13.259  -17.885 1.00 0.00 ? 55  ASN A CB   3  
ATOM 4215  C CG   . ASN A 1 55  ? -4.847  14.684  -18.304 1.00 0.00 ? 55  ASN A CG   3  
ATOM 4216  O OD1  . ASN A 1 55  ? -5.848  15.244  -17.887 1.00 0.00 ? 55  ASN A OD1  3  
ATOM 4217  N ND2  . ASN A 1 55  ? -3.982  15.238  -19.148 1.00 0.00 ? 55  ASN A ND2  3  
ATOM 4218  H H    . ASN A 1 55  ? -7.533  12.553  -17.319 1.00 0.00 ? 55  ASN A H    3  
ATOM 4219  H HA   . ASN A 1 55  ? -6.204  12.603  -19.030 1.00 0.00 ? 55  ASN A HA   3  
ATOM 4220  H HB3  . ASN A 1 55  ? -3.598  12.930  -18.431 1.00 0.00 ? 55  ASN A HB3  3  
ATOM 4221  H HD21 . ASN A 1 55  ? -3.180  14.723  -19.452 1.00 0.00 ? 55  ASN A HD21 3  
ATOM 4222  H HD22 . ASN A 1 55  ? -4.133  16.169  -19.481 1.00 0.00 ? 55  ASN A HD22 3  
ATOM 4223  N N    . ARG A 1 56  ? -5.202  10.338  -19.487 1.00 0.00 ? 56  ARG A N    3  
ATOM 4224  C CA   . ARG A 1 56  ? -4.701  9.003   -19.764 1.00 0.00 ? 56  ARG A CA   3  
ATOM 4225  C C    . ARG A 1 56  ? -5.355  7.985   -18.827 1.00 0.00 ? 56  ARG A C    3  
ATOM 4226  O O    . ARG A 1 56  ? -6.350  8.290   -18.171 1.00 0.00 ? 56  ARG A O    3  
ATOM 4227  C CB   . ARG A 1 56  ? -3.182  8.940   -19.591 1.00 0.00 ? 56  ARG A CB   3  
ATOM 4228  C CG   . ARG A 1 56  ? -2.523  8.251   -20.789 1.00 0.00 ? 56  ARG A CG   3  
ATOM 4229  C CD   . ARG A 1 56  ? -1.155  7.680   -20.409 1.00 0.00 ? 56  ARG A CD   3  
ATOM 4230  N NE   . ARG A 1 56  ? -0.142  8.087   -21.409 1.00 0.00 ? 56  ARG A NE   3  
ATOM 4231  C CZ   . ARG A 1 56  ? 1.147   7.721   -21.364 1.00 0.00 ? 56  ARG A CZ   3  
ATOM 4232  N NH1  . ARG A 1 56  ? 1.587   6.940   -20.369 1.00 0.00 ? 56  ARG A NH1  3  
ATOM 4233  N NH2  . ARG A 1 56  ? 1.995   8.138   -22.314 1.00 0.00 ? 56  ARG A NH2  3  
ATOM 4234  H H    . ARG A 1 56  ? -5.651  10.789  -20.259 1.00 0.00 ? 56  ARG A H    3  
ATOM 4235  H HA   . ARG A 1 56  ? -4.972  8.813   -20.801 1.00 0.00 ? 56  ARG A HA   3  
ATOM 4236  H HB3  . ARG A 1 56  ? -2.937  8.399   -18.678 1.00 0.00 ? 56  ARG A HB3  3  
ATOM 4237  H HG3  . ARG A 1 56  ? -2.410  8.965   -21.606 1.00 0.00 ? 56  ARG A HG3  3  
ATOM 4238  H HD3  . ARG A 1 56  ? -1.208  6.593   -20.355 1.00 0.00 ? 56  ARG A HD3  3  
ATOM 4239  H HE   . ARG A 1 56  ? -0.437  8.671   -22.165 1.00 0.00 ? 56  ARG A HE   3  
ATOM 4240  H HH11 . ARG A 1 56  ? 0.955   6.629   -19.659 1.00 0.00 ? 56  ARG A HH11 3  
ATOM 4241  H HH12 . ARG A 1 56  ? 2.549   6.667   -20.334 1.00 0.00 ? 56  ARG A HH12 3  
ATOM 4242  H HH21 . ARG A 1 56  ? 1.667   8.722   -23.056 1.00 0.00 ? 56  ARG A HH21 3  
ATOM 4243  H HH22 . ARG A 1 56  ? 2.956   7.866   -22.280 1.00 0.00 ? 56  ARG A HH22 3  
ATOM 4244  N N    . LEU A 1 57  ? -4.771  6.796   -18.796 1.00 0.00 ? 57  LEU A N    3  
ATOM 4245  C CA   . LEU A 1 57  ? -5.285  5.732   -17.951 1.00 0.00 ? 57  LEU A CA   3  
ATOM 4246  C C    . LEU A 1 57  ? -4.369  5.562   -16.737 1.00 0.00 ? 57  LEU A C    3  
ATOM 4247  O O    . LEU A 1 57  ? -3.435  6.340   -16.547 1.00 0.00 ? 57  LEU A O    3  
ATOM 4248  C CB   . LEU A 1 57  ? -5.476  4.450   -18.762 1.00 0.00 ? 57  LEU A CB   3  
ATOM 4249  C CG   . LEU A 1 57  ? -6.610  4.466   -19.789 1.00 0.00 ? 57  LEU A CG   3  
ATOM 4250  C CD1  . LEU A 1 57  ? -7.939  4.075   -19.143 1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4251  C CD2  . LEU A 1 57  ? -6.691  5.823   -20.492 1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4252  H H    . LEU A 1 57  ? -3.962  6.556   -19.333 1.00 0.00 ? 57  LEU A H    3  
ATOM 4253  H HA   . LEU A 1 57  ? -6.269  6.040   -17.600 1.00 0.00 ? 57  LEU A HA   3  
ATOM 4254  H HB3  . LEU A 1 57  ? -5.652  3.627   -18.068 1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4255  H HG   . LEU A 1 57  ? -6.391  3.720   -20.553 1.00 0.00 ? 57  LEU A HG   3  
ATOM 4256  H HD11 . LEU A 1 57  ? -8.090  2.999   -19.243 1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4257  H HD12 . LEU A 1 57  ? -7.924  4.344   -18.087 1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4258  H HD13 . LEU A 1 57  ? -8.754  4.602   -19.640 1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4259  H HD21 . LEU A 1 57  ? -7.387  5.756   -21.330 1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4260  H HD22 . LEU A 1 57  ? -7.042  6.578   -19.788 1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4261  H HD23 . LEU A 1 57  ? -5.704  6.101   -20.861 1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4262  N N    . GLU A 1 58  ? -4.667  4.540   -15.949 1.00 0.00 ? 58  GLU A N    3  
ATOM 4263  C CA   . GLU A 1 58  ? -3.882  4.259   -14.760 1.00 0.00 ? 58  GLU A CA   3  
ATOM 4264  C C    . GLU A 1 58  ? -4.228  2.872   -14.211 1.00 0.00 ? 58  GLU A C    3  
ATOM 4265  O O    . GLU A 1 58  ? -5.290  2.331   -14.511 1.00 0.00 ? 58  GLU A O    3  
ATOM 4266  C CB   . GLU A 1 58  ? -4.092  5.337   -13.696 1.00 0.00 ? 58  GLU A CB   3  
ATOM 4267  C CG   . GLU A 1 58  ? -5.319  5.029   -12.837 1.00 0.00 ? 58  GLU A CG   3  
ATOM 4268  C CD   . GLU A 1 58  ? -5.472  6.051   -11.709 1.00 0.00 ? 58  GLU A CD   3  
ATOM 4269  O OE1  . GLU A 1 58  ? -4.479  6.236   -10.973 1.00 0.00 ? 58  GLU A OE1  3  
ATOM 4270  O OE2  . GLU A 1 58  ? -6.577  6.627   -11.610 1.00 0.00 ? 58  GLU A OE2  3  
ATOM 4271  H H    . GLU A 1 58  ? -5.428  3.912   -16.112 1.00 0.00 ? 58  GLU A H    3  
ATOM 4272  H HA   . GLU A 1 58  ? -2.843  4.277   -15.087 1.00 0.00 ? 58  GLU A HA   3  
ATOM 4273  H HB3  . GLU A 1 58  ? -4.213  6.308   -14.176 1.00 0.00 ? 58  GLU A HB3  3  
ATOM 4274  H HG3  . GLU A 1 58  ? -5.231  4.028   -12.414 1.00 0.00 ? 58  GLU A HG3  3  
ATOM 4275  N N    . PRO A 1 59  ? -3.287  2.325   -13.396 1.00 0.00 ? 59  PRO A N    3  
ATOM 4276  C CA   . PRO A 1 59  ? -3.482  1.013   -12.803 1.00 0.00 ? 59  PRO A CA   3  
ATOM 4277  C C    . PRO A 1 59  ? -4.489  1.075   -11.655 1.00 0.00 ? 59  PRO A C    3  
ATOM 4278  O O    . PRO A 1 59  ? -5.686  0.881   -11.862 1.00 0.00 ? 59  PRO A O    3  
ATOM 4279  C CB   . PRO A 1 59  ? -2.096  0.574   -12.355 1.00 0.00 ? 59  PRO A CB   3  
ATOM 4280  C CG   . PRO A 1 59  ? -1.259  1.840   -12.290 1.00 0.00 ? 59  PRO A CG   3  
ATOM 4281  C CD   . PRO A 1 59  ? -2.016  2.938   -13.018 1.00 0.00 ? 59  PRO A CD   3  
ATOM 4282  H HA   . PRO A 1 59  ? -3.871  0.383   -13.475 1.00 0.00 ? 59  PRO A HA   3  
ATOM 4283  H HB3  . PRO A 1 59  ? -1.668  -0.142  -13.056 1.00 0.00 ? 59  PRO A HB3  3  
ATOM 4284  H HG3  . PRO A 1 59  ? -0.285  1.678   -12.753 1.00 0.00 ? 59  PRO A HG3  3  
ATOM 4285  H HD3  . PRO A 1 59  ? -1.468  3.285   -13.895 1.00 0.00 ? 59  PRO A HD3  3  
ATOM 4286  N N    . MET A 1 60  ? -3.969  1.346   -10.466 1.00 0.00 ? 60  MET A N    3  
ATOM 4287  C CA   . MET A 1 60  ? -4.809  1.436   -9.284  1.00 0.00 ? 60  MET A CA   3  
ATOM 4288  C C    . MET A 1 60  ? -5.721  0.213   -9.166  1.00 0.00 ? 60  MET A C    3  
ATOM 4289  O O    . MET A 1 60  ? -6.901  0.279   -9.504  1.00 0.00 ? 60  MET A O    3  
ATOM 4290  C CB   . MET A 1 60  ? -5.662  2.705   -9.358  1.00 0.00 ? 60  MET A CB   3  
ATOM 4291  C CG   . MET A 1 60  ? -5.722  3.404   -7.999  1.00 0.00 ? 60  MET A CG   3  
ATOM 4292  S SD   . MET A 1 60  ? -7.360  4.060   -7.725  1.00 0.00 ? 60  MET A SD   3  
ATOM 4293  C CE   . MET A 1 60  ? -7.074  5.780   -8.111  1.00 0.00 ? 60  MET A CE   3  
ATOM 4294  H H    . MET A 1 60  ? -2.994  1.502   -10.305 1.00 0.00 ? 60  MET A H    3  
ATOM 4295  H HA   . MET A 1 60  ? -4.122  1.469   -8.438  1.00 0.00 ? 60  MET A HA   3  
ATOM 4296  H HB3  . MET A 1 60  ? -6.669  2.450   -9.686  1.00 0.00 ? 60  MET A HB3  3  
ATOM 4297  H HG3  . MET A 1 60  ? -4.988  4.209   -7.962  1.00 0.00 ? 60  MET A HG3  3  
ATOM 4298  H HE1  . MET A 1 60  ? -6.006  5.946   -8.262  1.00 0.00 ? 60  MET A HE1  3  
ATOM 4299  H HE2  . MET A 1 60  ? -7.613  6.041   -9.021  1.00 0.00 ? 60  MET A HE2  3  
ATOM 4300  H HE3  . MET A 1 60  ? -7.426  6.401   -7.288  1.00 0.00 ? 60  MET A HE3  3  
ATOM 4301  N N    . ASP A 1 61  ? -5.138  -0.875  -8.682  1.00 0.00 ? 61  ASP A N    3  
ATOM 4302  C CA   . ASP A 1 61  ? -5.884  -2.110  -8.514  1.00 0.00 ? 61  ASP A CA   3  
ATOM 4303  C C    . ASP A 1 61  ? -5.949  -2.463  -7.027  1.00 0.00 ? 61  ASP A C    3  
ATOM 4304  O O    . ASP A 1 61  ? -7.015  -2.400  -6.415  1.00 0.00 ? 61  ASP A O    3  
ATOM 4305  C CB   . ASP A 1 61  ? -5.203  -3.269  -9.245  1.00 0.00 ? 61  ASP A CB   3  
ATOM 4306  C CG   . ASP A 1 61  ? -6.128  -4.114  -10.122 1.00 0.00 ? 61  ASP A CG   3  
ATOM 4307  O OD1  . ASP A 1 61  ? -7.086  -3.524  -10.669 1.00 0.00 ? 61  ASP A OD1  3  
ATOM 4308  O OD2  . ASP A 1 61  ? -5.857  -5.329  -10.228 1.00 0.00 ? 61  ASP A OD2  3  
ATOM 4309  H H    . ASP A 1 61  ? -4.177  -0.920  -8.408  1.00 0.00 ? 61  ASP A H    3  
ATOM 4310  H HA   . ASP A 1 61  ? -6.868  -1.912  -8.938  1.00 0.00 ? 61  ASP A HA   3  
ATOM 4311  H HB3  . ASP A 1 61  ? -4.733  -3.918  -8.506  1.00 0.00 ? 61  ASP A HB3  3  
ATOM 4312  N N    . THR A 1 62  ? -4.795  -2.828  -6.486  1.00 0.00 ? 62  THR A N    3  
ATOM 4313  C CA   . THR A 1 62  ? -4.708  -3.192  -5.081  1.00 0.00 ? 62  THR A CA   3  
ATOM 4314  C C    . THR A 1 62  ? -3.277  -3.010  -4.571  1.00 0.00 ? 62  THR A C    3  
ATOM 4315  O O    . THR A 1 62  ? -2.361  -2.768  -5.357  1.00 0.00 ? 62  THR A O    3  
ATOM 4316  C CB   . THR A 1 62  ? -5.230  -4.621  -4.930  1.00 0.00 ? 62  THR A CB   3  
ATOM 4317  O OG1  . THR A 1 62  ? -6.587  -4.543  -5.361  1.00 0.00 ? 62  THR A OG1  3  
ATOM 4318  C CG2  . THR A 1 62  ? -5.329  -5.056  -3.467  1.00 0.00 ? 62  THR A CG2  3  
ATOM 4319  H H    . THR A 1 62  ? -3.933  -2.878  -6.990  1.00 0.00 ? 62  THR A H    3  
ATOM 4320  H HA   . THR A 1 62  ? -5.340  -2.510  -4.511  1.00 0.00 ? 62  THR A HA   3  
ATOM 4321  H HB   . THR A 1 62  ? -4.624  -5.321  -5.504  1.00 0.00 ? 62  THR A HB   3  
ATOM 4322  H HG1  . THR A 1 62  ? -7.077  -3.856  -4.824  1.00 0.00 ? 62  THR A HG1  3  
ATOM 4323  H HG21 . THR A 1 62  ? -5.681  -4.221  -2.862  1.00 0.00 ? 62  THR A HG21 3  
ATOM 4324  H HG22 . THR A 1 62  ? -6.029  -5.888  -3.381  1.00 0.00 ? 62  THR A HG22 3  
ATOM 4325  H HG23 . THR A 1 62  ? -4.346  -5.371  -3.114  1.00 0.00 ? 62  THR A HG23 3  
ATOM 4326  N N    . ILE A 1 63  ? -3.130  -3.135  -3.261  1.00 0.00 ? 63  ILE A N    3  
ATOM 4327  C CA   . ILE A 1 63  ? -1.826  -2.987  -2.638  1.00 0.00 ? 63  ILE A CA   3  
ATOM 4328  C C    . ILE A 1 63  ? -1.276  -4.371  -2.285  1.00 0.00 ? 63  ILE A C    3  
ATOM 4329  O O    . ILE A 1 63  ? -2.038  -5.319  -2.105  1.00 0.00 ? 63  ILE A O    3  
ATOM 4330  C CB   . ILE A 1 63  ? -1.908  -2.035  -1.443  1.00 0.00 ? 63  ILE A CB   3  
ATOM 4331  C CG1  . ILE A 1 63  ? -1.858  -0.576  -1.901  1.00 0.00 ? 63  ILE A CG1  3  
ATOM 4332  C CG2  . ILE A 1 63  ? -0.819  -2.351  -0.415  1.00 0.00 ? 63  ILE A CG2  3  
ATOM 4333  C CD1  . ILE A 1 63  ? -3.140  0.164   -1.510  1.00 0.00 ? 63  ILE A CD1  3  
ATOM 4334  H H    . ILE A 1 63  ? -3.880  -3.332  -2.631  1.00 0.00 ? 63  ILE A H    3  
ATOM 4335  H HA   . ILE A 1 63  ? -1.163  -2.528  -3.371  1.00 0.00 ? 63  ILE A HA   3  
ATOM 4336  H HB   . ILE A 1 63  ? -2.869  -2.187  -0.951  1.00 0.00 ? 63  ILE A HB   3  
ATOM 4337  H HG13 . ILE A 1 63  ? -1.725  -0.535  -2.981  1.00 0.00 ? 63  ILE A HG13 3  
ATOM 4338  H HG21 . ILE A 1 63  ? 0.161   -2.251  -0.881  1.00 0.00 ? 63  ILE A HG21 3  
ATOM 4339  H HG22 . ILE A 1 63  ? -0.897  -1.655  0.421   1.00 0.00 ? 63  ILE A HG22 3  
ATOM 4340  H HG23 . ILE A 1 63  ? -0.946  -3.370  -0.052  1.00 0.00 ? 63  ILE A HG23 3  
ATOM 4341  H HD11 . ILE A 1 63  ? -3.097  1.187   -1.884  1.00 0.00 ? 63  ILE A HD11 3  
ATOM 4342  H HD12 . ILE A 1 63  ? -4.000  -0.345  -1.944  1.00 0.00 ? 63  ILE A HD12 3  
ATOM 4343  H HD13 . ILE A 1 63  ? -3.234  0.177   -0.425  1.00 0.00 ? 63  ILE A HD13 3  
ATOM 4344  N N    . PHE A 1 64  ? 0.045   -4.441  -2.197  1.00 0.00 ? 64  PHE A N    3  
ATOM 4345  C CA   . PHE A 1 64  ? 0.707   -5.693  -1.870  1.00 0.00 ? 64  PHE A CA   3  
ATOM 4346  C C    . PHE A 1 64  ? 1.938   -5.449  -0.995  1.00 0.00 ? 64  PHE A C    3  
ATOM 4347  O O    . PHE A 1 64  ? 2.661   -4.474  -1.193  1.00 0.00 ? 64  PHE A O    3  
ATOM 4348  C CB   . PHE A 1 64  ? 1.151   -6.324  -3.190  1.00 0.00 ? 64  PHE A CB   3  
ATOM 4349  C CG   . PHE A 1 64  ? 0.234   -7.445  -3.683  1.00 0.00 ? 64  PHE A CG   3  
ATOM 4350  C CD1  . PHE A 1 64  ? -1.026  -7.157  -4.107  1.00 0.00 ? 64  PHE A CD1  3  
ATOM 4351  C CD2  . PHE A 1 64  ? 0.680   -8.730  -3.698  1.00 0.00 ? 64  PHE A CD2  3  
ATOM 4352  C CE1  . PHE A 1 64  ? -1.877  -8.198  -4.564  1.00 0.00 ? 64  PHE A CE1  3  
ATOM 4353  C CE2  . PHE A 1 64  ? -0.171  -9.771  -4.155  1.00 0.00 ? 64  PHE A CE2  3  
ATOM 4354  C CZ   . PHE A 1 64  ? -1.432  -9.483  -4.580  1.00 0.00 ? 64  PHE A CZ   3  
ATOM 4355  H H    . PHE A 1 64  ? 0.658   -3.665  -2.345  1.00 0.00 ? 64  PHE A H    3  
ATOM 4356  H HA   . PHE A 1 64  ? -0.010  -6.305  -1.320  1.00 0.00 ? 64  PHE A HA   3  
ATOM 4357  H HB3  . PHE A 1 64  ? 2.159   -6.720  -3.073  1.00 0.00 ? 64  PHE A HB3  3  
ATOM 4358  H HD1  . PHE A 1 64  ? -1.382  -6.128  -4.096  1.00 0.00 ? 64  PHE A HD1  3  
ATOM 4359  H HD2  . PHE A 1 64  ? 1.689   -8.962  -3.359  1.00 0.00 ? 64  PHE A HD2  3  
ATOM 4360  H HE1  . PHE A 1 64  ? -2.886  -7.967  -4.904  1.00 0.00 ? 64  PHE A HE1  3  
ATOM 4361  H HE2  . PHE A 1 64  ? 0.185   -10.802 -4.168  1.00 0.00 ? 64  PHE A HE2  3  
ATOM 4362  H HZ   . PHE A 1 64  ? -2.085  -10.283 -4.930  1.00 0.00 ? 64  PHE A HZ   3  
ATOM 4363  N N    . VAL A 1 65  ? 2.140   -6.352  -0.047  1.00 0.00 ? 65  VAL A N    3  
ATOM 4364  C CA   . VAL A 1 65  ? 3.271   -6.248  0.858   1.00 0.00 ? 65  VAL A CA   3  
ATOM 4365  C C    . VAL A 1 65  ? 4.566   -6.494  0.080   1.00 0.00 ? 65  VAL A C    3  
ATOM 4366  O O    . VAL A 1 65  ? 4.560   -7.187  -0.937  1.00 0.00 ? 65  VAL A O    3  
ATOM 4367  C CB   . VAL A 1 65  ? 3.090   -7.207  2.036   1.00 0.00 ? 65  VAL A CB   3  
ATOM 4368  C CG1  . VAL A 1 65  ? 4.262   -7.102  3.014   1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4369  C CG2  . VAL A 1 65  ? 1.758   -6.956  2.747   1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4370  H H    . VAL A 1 65  ? 1.547   -7.143  0.108   1.00 0.00 ? 65  VAL A H    3  
ATOM 4371  H HA   . VAL A 1 65  ? 3.286   -5.231  1.250   1.00 0.00 ? 65  VAL A HA   3  
ATOM 4372  H HB   . VAL A 1 65  ? 3.073   -8.223  1.641   1.00 0.00 ? 65  VAL A HB   3  
ATOM 4373  H HG11 . VAL A 1 65  ? 3.939   -7.424  4.005   1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4374  H HG12 . VAL A 1 65  ? 5.077   -7.740  2.674   1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4375  H HG13 . VAL A 1 65  ? 4.604   -6.069  3.061   1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4376  H HG21 . VAL A 1 65  ? 0.936   -7.157  2.060   1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4377  H HG22 . VAL A 1 65  ? 1.678   -7.616  3.611   1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4378  H HG23 . VAL A 1 65  ? 1.713   -5.918  3.078   1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4379  N N    . LYS A 1 66  ? 5.643   -5.915  0.589   1.00 0.00 ? 66  LYS A N    3  
ATOM 4380  C CA   . LYS A 1 66  ? 6.942   -6.064  -0.047  1.00 0.00 ? 66  LYS A CA   3  
ATOM 4381  C C    . LYS A 1 66  ? 7.841   -6.930  0.838   1.00 0.00 ? 66  LYS A C    3  
ATOM 4382  O O    . LYS A 1 66  ? 8.136   -8.075  0.497   1.00 0.00 ? 66  LYS A O    3  
ATOM 4383  C CB   . LYS A 1 66  ? 7.539   -4.692  -0.372  1.00 0.00 ? 66  LYS A CB   3  
ATOM 4384  C CG   . LYS A 1 66  ? 8.750   -4.828  -1.298  1.00 0.00 ? 66  LYS A CG   3  
ATOM 4385  C CD   . LYS A 1 66  ? 9.638   -3.584  -1.224  1.00 0.00 ? 66  LYS A CD   3  
ATOM 4386  C CE   . LYS A 1 66  ? 10.932  -3.878  -0.464  1.00 0.00 ? 66  LYS A CE   3  
ATOM 4387  N NZ   . LYS A 1 66  ? 12.002  -2.945  -0.881  1.00 0.00 ? 66  LYS A NZ   3  
ATOM 4388  H H    . LYS A 1 66  ? 5.639   -5.353  1.416   1.00 0.00 ? 66  LYS A H    3  
ATOM 4389  H HA   . LYS A 1 66  ? 6.786   -6.580  -0.993  1.00 0.00 ? 66  LYS A HA   3  
ATOM 4390  H HB3  . LYS A 1 66  ? 7.835   -4.191  0.549   1.00 0.00 ? 66  LYS A HB3  3  
ATOM 4391  H HG3  . LYS A 1 66  ? 8.413   -4.979  -2.323  1.00 0.00 ? 66  LYS A HG3  3  
ATOM 4392  H HD3  . LYS A 1 66  ? 9.098   -2.776  -0.730  1.00 0.00 ? 66  LYS A HD3  3  
ATOM 4393  H HE3  . LYS A 1 66  ? 11.245  -4.905  -0.650  1.00 0.00 ? 66  LYS A HE3  3  
ATOM 4394  H HZ1  . LYS A 1 66  ? 12.751  -2.979  -0.219  1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 4395  H HZ2  . LYS A 1 66  ? 12.343  -3.209  -1.783  1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 4396  H HZ3  . LYS A 1 66  ? 11.636  -2.015  -0.922  1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 4397  N N    . GLN A 1 67  ? 8.251   -6.352  1.957   1.00 0.00 ? 67  GLN A N    3  
ATOM 4398  C CA   . GLN A 1 67  ? 9.110   -7.057  2.893   1.00 0.00 ? 67  GLN A CA   3  
ATOM 4399  C C    . GLN A 1 67  ? 8.531   -6.982  4.307   1.00 0.00 ? 67  GLN A C    3  
ATOM 4400  O O    . GLN A 1 67  ? 7.593   -6.225  4.558   1.00 0.00 ? 67  GLN A O    3  
ATOM 4401  C CB   . GLN A 1 67  ? 10.535  -6.501  2.855   1.00 0.00 ? 67  GLN A CB   3  
ATOM 4402  C CG   . GLN A 1 67  ? 11.453  -7.403  2.026   1.00 0.00 ? 67  GLN A CG   3  
ATOM 4403  C CD   . GLN A 1 67  ? 12.739  -7.726  2.792   1.00 0.00 ? 67  GLN A CD   3  
ATOM 4404  O OE1  . GLN A 1 67  ? 12.842  -7.537  3.991   1.00 0.00 ? 67  GLN A OE1  3  
ATOM 4405  N NE2  . GLN A 1 67  ? 13.711  -8.221  2.030   1.00 0.00 ? 67  GLN A NE2  3  
ATOM 4406  H H    . GLN A 1 67  ? 8.007   -5.420  2.228   1.00 0.00 ? 67  GLN A H    3  
ATOM 4407  H HA   . GLN A 1 67  ? 9.121   -8.093  2.552   1.00 0.00 ? 67  GLN A HA   3  
ATOM 4408  H HB3  . GLN A 1 67  ? 10.923  -6.415  3.870   1.00 0.00 ? 67  GLN A HB3  3  
ATOM 4409  H HG3  . GLN A 1 67  ? 11.699  -6.912  1.086   1.00 0.00 ? 67  GLN A HG3  3  
ATOM 4410  H HE21 . GLN A 1 67  ? 13.561  -8.351  1.050   1.00 0.00 ? 67  GLN A HE21 3  
ATOM 4411  H HE22 . GLN A 1 67  ? 14.592  -8.463  2.438   1.00 0.00 ? 67  GLN A HE22 3  
ATOM 4412  N N    . VAL A 1 68  ? 9.111   -7.778  5.194   1.00 0.00 ? 68  VAL A N    3  
ATOM 4413  C CA   . VAL A 1 68  ? 8.663   -7.809  6.575   1.00 0.00 ? 68  VAL A CA   3  
ATOM 4414  C C    . VAL A 1 68  ? 9.882   -7.820  7.502   1.00 0.00 ? 68  VAL A C    3  
ATOM 4415  O O    . VAL A 1 68  ? 10.733  -8.702  7.402   1.00 0.00 ? 68  VAL A O    3  
ATOM 4416  C CB   . VAL A 1 68  ? 7.734   -9.006  6.796   1.00 0.00 ? 68  VAL A CB   3  
ATOM 4417  C CG1  . VAL A 1 68  ? 7.469   -9.225  8.287   1.00 0.00 ? 68  VAL A CG1  3  
ATOM 4418  C CG2  . VAL A 1 68  ? 6.424   -8.830  6.027   1.00 0.00 ? 68  VAL A CG2  3  
ATOM 4419  H H    . VAL A 1 68  ? 9.873   -8.389  4.981   1.00 0.00 ? 68  VAL A H    3  
ATOM 4420  H HA   . VAL A 1 68  ? 8.092   -6.900  6.758   1.00 0.00 ? 68  VAL A HA   3  
ATOM 4421  H HB   . VAL A 1 68  ? 8.233   -9.894  6.410   1.00 0.00 ? 68  VAL A HB   3  
ATOM 4422  H HG11 . VAL A 1 68  ? 8.159   -9.977  8.671   1.00 0.00 ? 68  VAL A HG11 3  
ATOM 4423  H HG12 . VAL A 1 68  ? 7.616   -8.289  8.824   1.00 0.00 ? 68  VAL A HG12 3  
ATOM 4424  H HG13 . VAL A 1 68  ? 6.444   -9.569  8.427   1.00 0.00 ? 68  VAL A HG13 3  
ATOM 4425  H HG21 . VAL A 1 68  ? 6.508   -7.978  5.353   1.00 0.00 ? 68  VAL A HG21 3  
ATOM 4426  H HG22 . VAL A 1 68  ? 6.218   -9.732  5.449   1.00 0.00 ? 68  VAL A HG22 3  
ATOM 4427  H HG23 . VAL A 1 68  ? 5.609   -8.657  6.730   1.00 0.00 ? 68  VAL A HG23 3  
ATOM 4428  N N    . LYS A 1 69  ? 9.924   -6.830  8.380   1.00 0.00 ? 69  LYS A N    3  
ATOM 4429  C CA   . LYS A 1 69  ? 11.024  -6.715  9.324   1.00 0.00 ? 69  LYS A CA   3  
ATOM 4430  C C    . LYS A 1 69  ? 10.952  -7.867  10.329  1.00 0.00 ? 69  LYS A C    3  
ATOM 4431  O O    . LYS A 1 69  ? 10.018  -7.941  11.128  1.00 0.00 ? 69  LYS A O    3  
ATOM 4432  C CB   . LYS A 1 69  ? 11.028  -5.330  9.975   1.00 0.00 ? 69  LYS A CB   3  
ATOM 4433  C CG   . LYS A 1 69  ? 11.623  -5.389  11.383  1.00 0.00 ? 69  LYS A CG   3  
ATOM 4434  C CD   . LYS A 1 69  ? 13.101  -5.778  11.339  1.00 0.00 ? 69  LYS A CD   3  
ATOM 4435  C CE   . LYS A 1 69  ? 13.776  -5.527  12.689  1.00 0.00 ? 69  LYS A CE   3  
ATOM 4436  N NZ   . LYS A 1 69  ? 14.854  -4.523  12.550  1.00 0.00 ? 69  LYS A NZ   3  
ATOM 4437  H H    . LYS A 1 69  ? 9.227   -6.118  8.456   1.00 0.00 ? 69  LYS A H    3  
ATOM 4438  H HA   . LYS A 1 69  ? 11.950  -6.808  8.758   1.00 0.00 ? 69  LYS A HA   3  
ATOM 4439  H HB3  . LYS A 1 69  ? 10.010  -4.944  10.021  1.00 0.00 ? 69  LYS A HB3  3  
ATOM 4440  H HG3  . LYS A 1 69  ? 11.070  -6.111  11.985  1.00 0.00 ? 69  LYS A HG3  3  
ATOM 4441  H HD3  . LYS A 1 69  ? 13.609  -5.206  10.563  1.00 0.00 ? 69  LYS A HD3  3  
ATOM 4442  H HE3  . LYS A 1 69  ? 14.186  -6.459  13.077  1.00 0.00 ? 69  LYS A HE3  3  
ATOM 4443  H HZ1  . LYS A 1 69  ? 14.950  -4.016  13.408  1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 4444  H HZ2  . LYS A 1 69  ? 15.715  -4.986  12.339  1.00 0.00 ? 69  LYS A HZ2  3  
ATOM 4445  H HZ3  . LYS A 1 69  ? 14.626  -3.888  11.812  1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 4446  N N    . GLU A 1 70  ? 11.949  -8.736  10.257  1.00 0.00 ? 70  GLU A N    3  
ATOM 4447  C CA   . GLU A 1 70  ? 12.009  -9.881  11.149  1.00 0.00 ? 70  GLU A CA   3  
ATOM 4448  C C    . GLU A 1 70  ? 12.239  -9.418  12.589  1.00 0.00 ? 70  GLU A C    3  
ATOM 4449  O O    . GLU A 1 70  ? 13.377  -9.196  13.000  1.00 0.00 ? 70  GLU A O    3  
ATOM 4450  C CB   . GLU A 1 70  ? 13.097  -10.863 10.709  1.00 0.00 ? 70  GLU A CB   3  
ATOM 4451  C CG   . GLU A 1 70  ? 12.770  -12.285 11.170  1.00 0.00 ? 70  GLU A CG   3  
ATOM 4452  C CD   . GLU A 1 70  ? 13.265  -13.317 10.154  1.00 0.00 ? 70  GLU A CD   3  
ATOM 4453  O OE1  . GLU A 1 70  ? 13.113  -13.043 8.945   1.00 0.00 ? 70  GLU A OE1  3  
ATOM 4454  O OE2  . GLU A 1 70  ? 13.785  -14.359 10.611  1.00 0.00 ? 70  GLU A OE2  3  
ATOM 4455  H H    . GLU A 1 70  ? 12.702  -8.669  9.604   1.00 0.00 ? 70  GLU A H    3  
ATOM 4456  H HA   . GLU A 1 70  ? 11.037  -10.365 11.068  1.00 0.00 ? 70  GLU A HA   3  
ATOM 4457  H HB3  . GLU A 1 70  ? 14.059  -10.555 11.119  1.00 0.00 ? 70  GLU A HB3  3  
ATOM 4458  H HG3  . GLU A 1 70  ? 11.694  -12.389 11.305  1.00 0.00 ? 70  GLU A HG3  3  
ATOM 4459  N N    . GLY A 1 71  ? 11.140  -9.288  13.318  1.00 0.00 ? 71  GLY A N    3  
ATOM 4460  C CA   . GLY A 1 71  ? 11.208  -8.856  14.704  1.00 0.00 ? 71  GLY A CA   3  
ATOM 4461  C C    . GLY A 1 71  ? 10.599  -7.462  14.875  1.00 0.00 ? 71  GLY A C    3  
ATOM 4462  O O    . GLY A 1 71  ? 10.955  -6.734  15.799  1.00 0.00 ? 71  GLY A O    3  
ATOM 4463  H H    . GLY A 1 71  ? 10.218  -9.472  12.977  1.00 0.00 ? 71  GLY A H    3  
ATOM 4464  H HA2  . GLY A 1 71  ? 10.678  -9.568  15.337  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 4465  H HA3  . GLY A 1 71  ? 12.246  -8.846  15.035  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 4466  N N    . GLY A 1 72  ? 9.691   -7.134  13.967  1.00 0.00 ? 72  GLY A N    3  
ATOM 4467  C CA   . GLY A 1 72  ? 9.028   -5.841  14.006  1.00 0.00 ? 72  GLY A CA   3  
ATOM 4468  C C    . GLY A 1 72  ? 7.567   -5.986  14.434  1.00 0.00 ? 72  GLY A C    3  
ATOM 4469  O O    . GLY A 1 72  ? 7.199   -6.969  15.074  1.00 0.00 ? 72  GLY A O    3  
ATOM 4470  H H    . GLY A 1 72  ? 9.406   -7.733  13.218  1.00 0.00 ? 72  GLY A H    3  
ATOM 4471  H HA2  . GLY A 1 72  ? 9.550   -5.181  14.698  1.00 0.00 ? 72  GLY A HA2  3  
ATOM 4472  H HA3  . GLY A 1 72  ? 9.078   -5.374  13.022  1.00 0.00 ? 72  GLY A HA3  3  
ATOM 4473  N N    . PRO A 1 73  ? 6.752   -4.966  14.052  1.00 0.00 ? 73  PRO A N    3  
ATOM 4474  C CA   . PRO A 1 73  ? 5.340   -4.970  14.391  1.00 0.00 ? 73  PRO A CA   3  
ATOM 4475  C C    . PRO A 1 73  ? 4.569   -5.960  13.512  1.00 0.00 ? 73  PRO A C    3  
ATOM 4476  O O    . PRO A 1 73  ? 3.962   -6.902  14.019  1.00 0.00 ? 73  PRO A O    3  
ATOM 4477  C CB   . PRO A 1 73  ? 4.885   -3.532  14.203  1.00 0.00 ? 73  PRO A CB   3  
ATOM 4478  C CG   . PRO A 1 73  ? 5.937   -2.873  13.325  1.00 0.00 ? 73  PRO A CG   3  
ATOM 4479  C CD   . PRO A 1 73  ? 7.153   -3.787  13.292  1.00 0.00 ? 73  PRO A CD   3  
ATOM 4480  H HA   . PRO A 1 73  ? 5.208   -5.281  15.331  1.00 0.00 ? 73  PRO A HA   3  
ATOM 4481  H HB3  . PRO A 1 73  ? 4.800   -3.021  15.162  1.00 0.00 ? 73  PRO A HB3  3  
ATOM 4482  H HG3  . PRO A 1 73  ? 6.206   -1.894  13.721  1.00 0.00 ? 73  PRO A HG3  3  
ATOM 4483  H HD3  . PRO A 1 73  ? 8.023   -3.304  13.738  1.00 0.00 ? 73  PRO A HD3  3  
ATOM 4484  N N    . ALA A 1 74  ? 4.618   -5.711  12.212  1.00 0.00 ? 74  ALA A N    3  
ATOM 4485  C CA   . ALA A 1 74  ? 3.932   -6.569  11.260  1.00 0.00 ? 74  ALA A CA   3  
ATOM 4486  C C    . ALA A 1 74  ? 4.295   -8.028  11.541  1.00 0.00 ? 74  ALA A C    3  
ATOM 4487  O O    . ALA A 1 74  ? 3.415   -8.858  11.765  1.00 0.00 ? 74  ALA A O    3  
ATOM 4488  C CB   . ALA A 1 74  ? 4.295   -6.141  9.836   1.00 0.00 ? 74  ALA A CB   3  
ATOM 4489  H H    . ALA A 1 74  ? 5.113   -4.943  11.808  1.00 0.00 ? 74  ALA A H    3  
ATOM 4490  H HA   . ALA A 1 74  ? 2.860   -6.434  11.405  1.00 0.00 ? 74  ALA A HA   3  
ATOM 4491  H HB1  . ALA A 1 74  ? 4.831   -5.193  9.866   1.00 0.00 ? 74  ALA A HB1  3  
ATOM 4492  H HB2  . ALA A 1 74  ? 4.929   -6.902  9.379   1.00 0.00 ? 74  ALA A HB2  3  
ATOM 4493  H HB3  . ALA A 1 74  ? 3.384   -6.027  9.248   1.00 0.00 ? 74  ALA A HB3  3  
ATOM 4494  N N    . PHE A 1 75  ? 5.592   -8.297  11.521  1.00 0.00 ? 75  PHE A N    3  
ATOM 4495  C CA   . PHE A 1 75  ? 6.081   -9.641  11.771  1.00 0.00 ? 75  PHE A CA   3  
ATOM 4496  C C    . PHE A 1 75  ? 5.284   -10.317 12.889  1.00 0.00 ? 75  PHE A C    3  
ATOM 4497  O O    . PHE A 1 75  ? 4.899   -11.479 12.768  1.00 0.00 ? 75  PHE A O    3  
ATOM 4498  C CB   . PHE A 1 75  ? 7.542   -9.514  12.207  1.00 0.00 ? 75  PHE A CB   3  
ATOM 4499  C CG   . PHE A 1 75  ? 8.052   -10.696 13.033  1.00 0.00 ? 75  PHE A CG   3  
ATOM 4500  C CD1  . PHE A 1 75  ? 8.067   -11.945 12.494  1.00 0.00 ? 75  PHE A CD1  3  
ATOM 4501  C CD2  . PHE A 1 75  ? 8.491   -10.498 14.305  1.00 0.00 ? 75  PHE A CD2  3  
ATOM 4502  C CE1  . PHE A 1 75  ? 8.538   -13.043 13.260  1.00 0.00 ? 75  PHE A CE1  3  
ATOM 4503  C CE2  . PHE A 1 75  ? 8.964   -11.598 15.072  1.00 0.00 ? 75  PHE A CE2  3  
ATOM 4504  C CZ   . PHE A 1 75  ? 8.977   -12.846 14.532  1.00 0.00 ? 75  PHE A CZ   3  
ATOM 4505  H H    . PHE A 1 75  ? 6.301   -7.616  11.337  1.00 0.00 ? 75  PHE A H    3  
ATOM 4506  H HA   . PHE A 1 75  ? 5.958   -10.208 10.847  1.00 0.00 ? 75  PHE A HA   3  
ATOM 4507  H HB3  . PHE A 1 75  ? 7.655   -8.599  12.792  1.00 0.00 ? 75  PHE A HB3  3  
ATOM 4508  H HD1  . PHE A 1 75  ? 7.714   -12.103 11.475  1.00 0.00 ? 75  PHE A HD1  3  
ATOM 4509  H HD2  . PHE A 1 75  ? 8.479   -9.498  14.737  1.00 0.00 ? 75  PHE A HD2  3  
ATOM 4510  H HE1  . PHE A 1 75  ? 8.551   -14.043 12.829  1.00 0.00 ? 75  PHE A HE1  3  
ATOM 4511  H HE2  . PHE A 1 75  ? 9.315   -11.440 16.090  1.00 0.00 ? 75  PHE A HE2  3  
ATOM 4512  H HZ   . PHE A 1 75  ? 9.341   -13.689 15.120  1.00 0.00 ? 75  PHE A HZ   3  
ATOM 4513  N N    . GLU A 1 76  ? 5.061   -9.558  13.953  1.00 0.00 ? 76  GLU A N    3  
ATOM 4514  C CA   . GLU A 1 76  ? 4.317   -10.068 15.092  1.00 0.00 ? 76  GLU A CA   3  
ATOM 4515  C C    . GLU A 1 76  ? 2.856   -10.309 14.707  1.00 0.00 ? 76  GLU A C    3  
ATOM 4516  O O    . GLU A 1 76  ? 2.351   -11.423 14.843  1.00 0.00 ? 76  GLU A O    3  
ATOM 4517  C CB   . GLU A 1 76  ? 4.419   -9.114  16.284  1.00 0.00 ? 76  GLU A CB   3  
ATOM 4518  C CG   . GLU A 1 76  ? 5.879   -8.889  16.683  1.00 0.00 ? 76  GLU A CG   3  
ATOM 4519  C CD   . GLU A 1 76  ? 6.200   -9.585  18.008  1.00 0.00 ? 76  GLU A CD   3  
ATOM 4520  O OE1  . GLU A 1 76  ? 5.981   -10.814 18.069  1.00 0.00 ? 76  GLU A OE1  3  
ATOM 4521  O OE2  . GLU A 1 76  ? 6.658   -8.872  18.926  1.00 0.00 ? 76  GLU A OE2  3  
ATOM 4522  H H    . GLU A 1 76  ? 5.378   -8.614  14.043  1.00 0.00 ? 76  GLU A H    3  
ATOM 4523  H HA   . GLU A 1 76  ? 4.794   -11.014 15.349  1.00 0.00 ? 76  GLU A HA   3  
ATOM 4524  H HB3  . GLU A 1 76  ? 3.867   -9.525  17.130  1.00 0.00 ? 76  GLU A HB3  3  
ATOM 4525  H HG3  . GLU A 1 76  ? 6.075   -7.821  16.772  1.00 0.00 ? 76  GLU A HG3  3  
ATOM 4526  N N    . ALA A 1 77  ? 2.218   -9.248  14.235  1.00 0.00 ? 77  ALA A N    3  
ATOM 4527  C CA   . ALA A 1 77  ? 0.826   -9.331  13.829  1.00 0.00 ? 77  ALA A CA   3  
ATOM 4528  C C    . ALA A 1 77  ? 0.584   -10.664 13.119  1.00 0.00 ? 77  ALA A C    3  
ATOM 4529  O O    . ALA A 1 77  ? -0.506  -11.225 13.198  1.00 0.00 ? 77  ALA A O    3  
ATOM 4530  C CB   . ALA A 1 77  ? 0.479   -8.128  12.949  1.00 0.00 ? 77  ALA A CB   3  
ATOM 4531  H H    . ALA A 1 77  ? 2.637   -8.347  14.128  1.00 0.00 ? 77  ALA A H    3  
ATOM 4532  H HA   . ALA A 1 77  ? 0.215   -9.294  14.732  1.00 0.00 ? 77  ALA A HA   3  
ATOM 4533  H HB1  . ALA A 1 77  ? -0.526  -7.781  13.189  1.00 0.00 ? 77  ALA A HB1  3  
ATOM 4534  H HB2  . ALA A 1 77  ? 1.193   -7.326  13.130  1.00 0.00 ? 77  ALA A HB2  3  
ATOM 4535  H HB3  . ALA A 1 77  ? 0.519   -8.423  11.900  1.00 0.00 ? 77  ALA A HB3  3  
ATOM 4536  N N    . GLY A 1 78  ? 1.621   -11.132 12.438  1.00 0.00 ? 78  GLY A N    3  
ATOM 4537  C CA   . GLY A 1 78  ? 1.536   -12.388 11.714  1.00 0.00 ? 78  GLY A CA   3  
ATOM 4538  C C    . GLY A 1 78  ? 1.544   -12.150 10.202  1.00 0.00 ? 78  GLY A C    3  
ATOM 4539  O O    . GLY A 1 78  ? 1.366   -13.086 9.422   1.00 0.00 ? 78  GLY A O    3  
ATOM 4540  H H    . GLY A 1 78  ? 2.505   -10.668 12.378  1.00 0.00 ? 78  GLY A H    3  
ATOM 4541  H HA2  . GLY A 1 78  ? 2.373   -13.028 11.990  1.00 0.00 ? 78  GLY A HA2  3  
ATOM 4542  H HA3  . GLY A 1 78  ? 0.624   -12.914 11.997  1.00 0.00 ? 78  GLY A HA3  3  
ATOM 4543  N N    . LEU A 1 79  ? 1.751   -10.895 9.833   1.00 0.00 ? 79  LEU A N    3  
ATOM 4544  C CA   . LEU A 1 79  ? 1.785   -10.522 8.429   1.00 0.00 ? 79  LEU A CA   3  
ATOM 4545  C C    . LEU A 1 79  ? 2.770   -11.429 7.689   1.00 0.00 ? 79  LEU A C    3  
ATOM 4546  O O    . LEU A 1 79  ? 3.379   -12.313 8.292   1.00 0.00 ? 79  LEU A O    3  
ATOM 4547  C CB   . LEU A 1 79  ? 2.091   -9.031  8.277   1.00 0.00 ? 79  LEU A CB   3  
ATOM 4548  C CG   . LEU A 1 79  ? 1.293   -8.289  7.203   1.00 0.00 ? 79  LEU A CG   3  
ATOM 4549  C CD1  . LEU A 1 79  ? -0.121  -7.971  7.691   1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4550  C CD2  . LEU A 1 79  ? 2.036   -7.035  6.737   1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4551  H H    . LEU A 1 79  ? 1.895   -10.141 10.475  1.00 0.00 ? 79  LEU A H    3  
ATOM 4552  H HA   . LEU A 1 79  ? 0.787   -10.691 8.023   1.00 0.00 ? 79  LEU A HA   3  
ATOM 4553  H HB3  . LEU A 1 79  ? 3.152   -8.918  8.057   1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4554  H HG   . LEU A 1 79  ? 1.196   -8.945  6.336   1.00 0.00 ? 79  LEU A HG   3  
ATOM 4555  H HD11 . LEU A 1 79  ? -0.560  -8.863  8.136   1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4556  H HD12 . LEU A 1 79  ? -0.078  -7.175  8.433   1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4557  H HD13 . LEU A 1 79  ? -0.732  -7.647  6.847   1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4558  H HD21 . LEU A 1 79  ? 2.912   -6.877  7.365   1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4559  H HD22 . LEU A 1 79  ? 2.350   -7.163  5.701   1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4560  H HD23 . LEU A 1 79  ? 1.374   -6.172  6.813   1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4561  N N    . CYS A 1 80  ? 2.894   -11.182 6.394   1.00 0.00 ? 80  CYS A N    3  
ATOM 4562  C CA   . CYS A 1 80  ? 3.794   -11.966 5.565   1.00 0.00 ? 80  CYS A CA   3  
ATOM 4563  C C    . CYS A 1 80  ? 4.073   -11.180 4.282   1.00 0.00 ? 80  CYS A C    3  
ATOM 4564  O O    . CYS A 1 80  ? 3.705   -10.012 4.174   1.00 0.00 ? 80  CYS A O    3  
ATOM 4565  C CB   . CYS A 1 80  ? 3.226   -13.357 5.272   1.00 0.00 ? 80  CYS A CB   3  
ATOM 4566  S SG   . CYS A 1 80  ? 4.124   -14.618 6.246   1.00 0.00 ? 80  CYS A SG   3  
ATOM 4567  H H    . CYS A 1 80  ? 2.395   -10.463 5.911   1.00 0.00 ? 80  CYS A H    3  
ATOM 4568  H HA   . CYS A 1 80  ? 4.710   -12.104 6.141   1.00 0.00 ? 80  CYS A HA   3  
ATOM 4569  H HB3  . CYS A 1 80  ? 3.315   -13.576 4.208   1.00 0.00 ? 80  CYS A HB3  3  
ATOM 4570  H HG   . CYS A 1 80  ? 4.241   -15.501 5.260   1.00 0.00 ? 80  CYS A HG   3  
ATOM 4571  N N    . THR A 1 81  ? 4.719   -11.854 3.343   1.00 0.00 ? 81  THR A N    3  
ATOM 4572  C CA   . THR A 1 81  ? 5.052   -11.234 2.071   1.00 0.00 ? 81  THR A CA   3  
ATOM 4573  C C    . THR A 1 81  ? 4.096   -11.716 0.978   1.00 0.00 ? 81  THR A C    3  
ATOM 4574  O O    . THR A 1 81  ? 3.793   -12.904 0.891   1.00 0.00 ? 81  THR A O    3  
ATOM 4575  C CB   . THR A 1 81  ? 6.521   -11.533 1.768   1.00 0.00 ? 81  THR A CB   3  
ATOM 4576  O OG1  . THR A 1 81  ? 6.568   -12.952 1.647   1.00 0.00 ? 81  THR A OG1  3  
ATOM 4577  C CG2  . THR A 1 81  ? 7.437   -11.228 2.955   1.00 0.00 ? 81  THR A CG2  3  
ATOM 4578  H H    . THR A 1 81  ? 5.015   -12.805 3.438   1.00 0.00 ? 81  THR A H    3  
ATOM 4579  H HA   . THR A 1 81  ? 4.911   -10.157 2.167   1.00 0.00 ? 81  THR A HA   3  
ATOM 4580  H HB   . THR A 1 81  ? 6.851   -11.002 0.876   1.00 0.00 ? 81  THR A HB   3  
ATOM 4581  H HG1  . THR A 1 81  ? 7.493   -13.243 1.399   1.00 0.00 ? 81  THR A HG1  3  
ATOM 4582  H HG21 . THR A 1 81  ? 7.464   -12.091 3.623   1.00 0.00 ? 81  THR A HG21 3  
ATOM 4583  H HG22 . THR A 1 81  ? 8.442   -11.017 2.594   1.00 0.00 ? 81  THR A HG22 3  
ATOM 4584  H HG23 . THR A 1 81  ? 7.056   -10.363 3.496   1.00 0.00 ? 81  THR A HG23 3  
ATOM 4585  N N    . GLY A 1 82  ? 3.648   -10.766 0.169   1.00 0.00 ? 82  GLY A N    3  
ATOM 4586  C CA   . GLY A 1 82  ? 2.732   -11.078 -0.916  1.00 0.00 ? 82  GLY A CA   3  
ATOM 4587  C C    . GLY A 1 82  ? 1.277   -10.940 -0.463  1.00 0.00 ? 82  GLY A C    3  
ATOM 4588  O O    . GLY A 1 82  ? 0.357   -11.254 -1.216  1.00 0.00 ? 82  GLY A O    3  
ATOM 4589  H H    . GLY A 1 82  ? 3.898   -9.801  0.245   1.00 0.00 ? 82  GLY A H    3  
ATOM 4590  H HA2  . GLY A 1 82  ? 2.920   -10.412 -1.759  1.00 0.00 ? 82  GLY A HA2  3  
ATOM 4591  H HA3  . GLY A 1 82  ? 2.912   -12.094 -1.268  1.00 0.00 ? 82  GLY A HA3  3  
ATOM 4592  N N    . ASP A 1 83  ? 1.116   -10.471 0.765   1.00 0.00 ? 83  ASP A N    3  
ATOM 4593  C CA   . ASP A 1 83  ? -0.212  -10.287 1.327   1.00 0.00 ? 83  ASP A CA   3  
ATOM 4594  C C    . ASP A 1 83  ? -0.899  -9.113  0.628   1.00 0.00 ? 83  ASP A C    3  
ATOM 4595  O O    . ASP A 1 83  ? -0.273  -8.087  0.368   1.00 0.00 ? 83  ASP A O    3  
ATOM 4596  C CB   . ASP A 1 83  ? -0.137  -9.968  2.822   1.00 0.00 ? 83  ASP A CB   3  
ATOM 4597  C CG   . ASP A 1 83  ? 0.708   -10.938 3.650   1.00 0.00 ? 83  ASP A CG   3  
ATOM 4598  O OD1  . ASP A 1 83  ? 0.919   -12.068 3.157   1.00 0.00 ? 83  ASP A OD1  3  
ATOM 4599  O OD2  . ASP A 1 83  ? 1.123   -10.529 4.754   1.00 0.00 ? 83  ASP A OD2  3  
ATOM 4600  H H    . ASP A 1 83  ? 1.870   -10.218 1.371   1.00 0.00 ? 83  ASP A H    3  
ATOM 4601  H HA   . ASP A 1 83  ? -0.728  -11.232 1.160   1.00 0.00 ? 83  ASP A HA   3  
ATOM 4602  H HB3  . ASP A 1 83  ? -1.149  -9.955  3.226   1.00 0.00 ? 83  ASP A HB3  3  
ATOM 4603  N N    . ARG A 1 84  ? -2.179  -9.304  0.341   1.00 0.00 ? 84  ARG A N    3  
ATOM 4604  C CA   . ARG A 1 84  ? -2.958  -8.273  -0.323  1.00 0.00 ? 84  ARG A CA   3  
ATOM 4605  C C    . ARG A 1 84  ? -3.686  -7.408  0.710   1.00 0.00 ? 84  ARG A C    3  
ATOM 4606  O O    . ARG A 1 84  ? -4.363  -7.929  1.594   1.00 0.00 ? 84  ARG A O    3  
ATOM 4607  C CB   . ARG A 1 84  ? -3.986  -8.889  -1.276  1.00 0.00 ? 84  ARG A CB   3  
ATOM 4608  C CG   . ARG A 1 84  ? -5.084  -7.883  -1.623  1.00 0.00 ? 84  ARG A CG   3  
ATOM 4609  C CD   . ARG A 1 84  ? -5.943  -8.386  -2.785  1.00 0.00 ? 84  ARG A CD   3  
ATOM 4610  N NE   . ARG A 1 84  ? -7.322  -7.867  -2.657  1.00 0.00 ? 84  ARG A NE   3  
ATOM 4611  C CZ   . ARG A 1 84  ? -8.282  -8.048  -3.575  1.00 0.00 ? 84  ARG A CZ   3  
ATOM 4612  N NH1  . ARG A 1 84  ? -8.016  -8.736  -4.694  1.00 0.00 ? 84  ARG A NH1  3  
ATOM 4613  N NH2  . ARG A 1 84  ? -9.506  -7.542  -3.375  1.00 0.00 ? 84  ARG A NH2  3  
ATOM 4614  H H    . ARG A 1 84  ? -2.681  -10.140 0.558   1.00 0.00 ? 84  ARG A H    3  
ATOM 4615  H HA   . ARG A 1 84  ? -2.229  -7.688  -0.881  1.00 0.00 ? 84  ARG A HA   3  
ATOM 4616  H HB3  . ARG A 1 84  ? -4.429  -9.773  -0.817  1.00 0.00 ? 84  ARG A HB3  3  
ATOM 4617  H HG3  . ARG A 1 84  ? -4.635  -6.925  -1.886  1.00 0.00 ? 84  ARG A HG3  3  
ATOM 4618  H HD3  . ARG A 1 84  ? -5.953  -9.476  -2.794  1.00 0.00 ? 84  ARG A HD3  3  
ATOM 4619  H HE   . ARG A 1 84  ? -7.555  -7.350  -1.834  1.00 0.00 ? 84  ARG A HE   3  
ATOM 4620  H HH11 . ARG A 1 84  ? -7.102  -9.113  -4.845  1.00 0.00 ? 84  ARG A HH11 3  
ATOM 4621  H HH12 . ARG A 1 84  ? -8.731  -8.871  -5.380  1.00 0.00 ? 84  ARG A HH12 3  
ATOM 4622  H HH21 . ARG A 1 84  ? -9.704  -7.029  -2.540  1.00 0.00 ? 84  ARG A HH21 3  
ATOM 4623  H HH22 . ARG A 1 84  ? -10.222 -7.677  -4.059  1.00 0.00 ? 84  ARG A HH22 3  
ATOM 4624  N N    . ILE A 1 85  ? -3.520  -6.102  0.560   1.00 0.00 ? 85  ILE A N    3  
ATOM 4625  C CA   . ILE A 1 85  ? -4.153  -5.160  1.468   1.00 0.00 ? 85  ILE A CA   3  
ATOM 4626  C C    . ILE A 1 85  ? -5.597  -4.922  1.025   1.00 0.00 ? 85  ILE A C    3  
ATOM 4627  O O    . ILE A 1 85  ? -5.856  -4.670  -0.151  1.00 0.00 ? 85  ILE A O    3  
ATOM 4628  C CB   . ILE A 1 85  ? -3.323  -3.879  1.575   1.00 0.00 ? 85  ILE A CB   3  
ATOM 4629  C CG1  . ILE A 1 85  ? -1.885  -4.192  1.991   1.00 0.00 ? 85  ILE A CG1  3  
ATOM 4630  C CG2  . ILE A 1 85  ? -3.986  -2.873  2.518   1.00 0.00 ? 85  ILE A CG2  3  
ATOM 4631  C CD1  . ILE A 1 85  ? -1.846  -4.909  3.342   1.00 0.00 ? 85  ILE A CD1  3  
ATOM 4632  H H    . ILE A 1 85  ? -2.969  -5.686  -0.163  1.00 0.00 ? 85  ILE A H    3  
ATOM 4633  H HA   . ILE A 1 85  ? -4.167  -5.618  2.457   1.00 0.00 ? 85  ILE A HA   3  
ATOM 4634  H HB   . ILE A 1 85  ? -3.281  -3.417  0.589   1.00 0.00 ? 85  ILE A HB   3  
ATOM 4635  H HG13 . ILE A 1 85  ? -1.310  -3.267  2.049   1.00 0.00 ? 85  ILE A HG13 3  
ATOM 4636  H HG21 . ILE A 1 85  ? -3.677  -1.864  2.247   1.00 0.00 ? 85  ILE A HG21 3  
ATOM 4637  H HG22 . ILE A 1 85  ? -5.070  -2.957  2.434   1.00 0.00 ? 85  ILE A HG22 3  
ATOM 4638  H HG23 . ILE A 1 85  ? -3.684  -3.083  3.543   1.00 0.00 ? 85  ILE A HG23 3  
ATOM 4639  H HD11 . ILE A 1 85  ? -1.559  -5.949  3.193   1.00 0.00 ? 85  ILE A HD11 3  
ATOM 4640  H HD12 . ILE A 1 85  ? -1.121  -4.420  3.991   1.00 0.00 ? 85  ILE A HD12 3  
ATOM 4641  H HD13 . ILE A 1 85  ? -2.834  -4.866  3.803   1.00 0.00 ? 85  ILE A HD13 3  
ATOM 4642  N N    . ILE A 1 86  ? -6.501  -5.009  1.990   1.00 0.00 ? 86  ILE A N    3  
ATOM 4643  C CA   . ILE A 1 86  ? -7.912  -4.805  1.714   1.00 0.00 ? 86  ILE A CA   3  
ATOM 4644  C C    . ILE A 1 86  ? -8.403  -3.566  2.467   1.00 0.00 ? 86  ILE A C    3  
ATOM 4645  O O    . ILE A 1 86  ? -9.178  -2.777  1.931   1.00 0.00 ? 86  ILE A O    3  
ATOM 4646  C CB   . ILE A 1 86  ? -8.710  -6.072  2.031   1.00 0.00 ? 86  ILE A CB   3  
ATOM 4647  C CG1  . ILE A 1 86  ? -8.648  -6.399  3.524   1.00 0.00 ? 86  ILE A CG1  3  
ATOM 4648  C CG2  . ILE A 1 86  ? -8.239  -7.245  1.169   1.00 0.00 ? 86  ILE A CG2  3  
ATOM 4649  C CD1  . ILE A 1 86  ? -9.381  -7.706  3.830   1.00 0.00 ? 86  ILE A CD1  3  
ATOM 4650  H H    . ILE A 1 86  ? -6.283  -5.213  2.945   1.00 0.00 ? 86  ILE A H    3  
ATOM 4651  H HA   . ILE A 1 86  ? -8.013  -4.622  0.644   1.00 0.00 ? 86  ILE A HA   3  
ATOM 4652  H HB   . ILE A 1 86  ? -9.755  -5.890  1.784   1.00 0.00 ? 86  ILE A HB   3  
ATOM 4653  H HG13 . ILE A 1 86  ? -9.093  -5.585  4.097   1.00 0.00 ? 86  ILE A HG13 3  
ATOM 4654  H HG21 . ILE A 1 86  ? -7.597  -7.898  1.761   1.00 0.00 ? 86  ILE A HG21 3  
ATOM 4655  H HG22 . ILE A 1 86  ? -9.105  -7.808  0.818   1.00 0.00 ? 86  ILE A HG22 3  
ATOM 4656  H HG23 . ILE A 1 86  ? -7.681  -6.866  0.312   1.00 0.00 ? 86  ILE A HG23 3  
ATOM 4657  H HD11 . ILE A 1 86  ? -9.222  -8.412  3.016   1.00 0.00 ? 86  ILE A HD11 3  
ATOM 4658  H HD12 . ILE A 1 86  ? -8.997  -8.130  4.758   1.00 0.00 ? 86  ILE A HD12 3  
ATOM 4659  H HD13 . ILE A 1 86  ? -10.448 -7.508  3.936   1.00 0.00 ? 86  ILE A HD13 3  
ATOM 4660  N N    . LYS A 1 87  ? -7.929  -3.436  3.696   1.00 0.00 ? 87  LYS A N    3  
ATOM 4661  C CA   . LYS A 1 87  ? -8.308  -2.307  4.528   1.00 0.00 ? 87  LYS A CA   3  
ATOM 4662  C C    . LYS A 1 87  ? -7.062  -1.740  5.212   1.00 0.00 ? 87  LYS A C    3  
ATOM 4663  O O    . LYS A 1 87  ? -6.018  -2.389  5.242   1.00 0.00 ? 87  LYS A O    3  
ATOM 4664  C CB   . LYS A 1 87  ? -9.416  -2.709  5.506   1.00 0.00 ? 87  LYS A CB   3  
ATOM 4665  C CG   . LYS A 1 87  ? -10.683 -3.129  4.757   1.00 0.00 ? 87  LYS A CG   3  
ATOM 4666  C CD   . LYS A 1 87  ? -11.158 -4.509  5.214   1.00 0.00 ? 87  LYS A CD   3  
ATOM 4667  C CE   . LYS A 1 87  ? -11.800 -5.277  4.057   1.00 0.00 ? 87  LYS A CE   3  
ATOM 4668  N NZ   . LYS A 1 87  ? -12.633 -6.386  4.572   1.00 0.00 ? 87  LYS A NZ   3  
ATOM 4669  H H    . LYS A 1 87  ? -7.298  -4.083  4.125   1.00 0.00 ? 87  LYS A H    3  
ATOM 4670  H HA   . LYS A 1 87  ? -8.722  -1.541  3.872   1.00 0.00 ? 87  LYS A HA   3  
ATOM 4671  H HB3  . LYS A 1 87  ? -9.640  -1.875  6.170   1.00 0.00 ? 87  LYS A HB3  3  
ATOM 4672  H HG3  . LYS A 1 87  ? -10.487 -3.143  3.685   1.00 0.00 ? 87  LYS A HG3  3  
ATOM 4673  H HD3  . LYS A 1 87  ? -11.876 -4.399  6.026   1.00 0.00 ? 87  LYS A HD3  3  
ATOM 4674  H HE3  . LYS A 1 87  ? -11.025 -5.670  3.399   1.00 0.00 ? 87  LYS A HE3  3  
ATOM 4675  H HZ1  . LYS A 1 87  ? -13.261 -6.038  5.268   1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 4676  H HZ2  . LYS A 1 87  ? -13.160 -6.784  3.820   1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 4677  H HZ3  . LYS A 1 87  ? -12.044 -7.088  4.973   1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 4678  N N    . VAL A 1 88  ? -7.213  -0.535  5.742   1.00 0.00 ? 88  VAL A N    3  
ATOM 4679  C CA   . VAL A 1 88  ? -6.113  0.127   6.421   1.00 0.00 ? 88  VAL A CA   3  
ATOM 4680  C C    . VAL A 1 88  ? -6.671  1.055   7.502   1.00 0.00 ? 88  VAL A C    3  
ATOM 4681  O O    . VAL A 1 88  ? -7.121  2.161   7.205   1.00 0.00 ? 88  VAL A O    3  
ATOM 4682  C CB   . VAL A 1 88  ? -5.232  0.854   5.405   1.00 0.00 ? 88  VAL A CB   3  
ATOM 4683  C CG1  . VAL A 1 88  ? -4.491  2.023   6.059   1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4684  C CG2  . VAL A 1 88  ? -4.251  -0.111  4.738   1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4685  H H    . VAL A 1 88  ? -8.067  -0.014  5.713   1.00 0.00 ? 88  VAL A H    3  
ATOM 4686  H HA   . VAL A 1 88  ? -5.510  -0.646  6.900   1.00 0.00 ? 88  VAL A HA   3  
ATOM 4687  H HB   . VAL A 1 88  ? -5.880  1.263   4.630   1.00 0.00 ? 88  VAL A HB   3  
ATOM 4688  H HG11 . VAL A 1 88  ? -3.478  2.080   5.660   1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4689  H HG12 . VAL A 1 88  ? -5.018  2.953   5.846   1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4690  H HG13 . VAL A 1 88  ? -4.447  1.868   7.137   1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4691  H HG21 . VAL A 1 88  ? -4.582  -0.319  3.719   1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4692  H HG22 . VAL A 1 88  ? -3.259  0.337   4.713   1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4693  H HG23 . VAL A 1 88  ? -4.215  -1.041  5.305   1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4694  N N    . ASN A 1 89  ? -6.625  0.572   8.735   1.00 0.00 ? 89  ASN A N    3  
ATOM 4695  C CA   . ASN A 1 89  ? -7.120  1.343   9.861   1.00 0.00 ? 89  ASN A CA   3  
ATOM 4696  C C    . ASN A 1 89  ? -8.646  1.423   9.788   1.00 0.00 ? 89  ASN A C    3  
ATOM 4697  O O    . ASN A 1 89  ? -9.234  2.456   10.107  1.00 0.00 ? 89  ASN A O    3  
ATOM 4698  C CB   . ASN A 1 89  ? -6.571  2.772   9.834   1.00 0.00 ? 89  ASN A CB   3  
ATOM 4699  C CG   . ASN A 1 89  ? -5.106  2.788   9.395   1.00 0.00 ? 89  ASN A CG   3  
ATOM 4700  O OD1  . ASN A 1 89  ? -4.438  1.769   9.334   1.00 0.00 ? 89  ASN A OD1  3  
ATOM 4701  N ND2  . ASN A 1 89  ? -4.644  3.998   9.096   1.00 0.00 ? 89  ASN A ND2  3  
ATOM 4702  H H    . ASN A 1 89  ? -6.258  -0.329  8.969   1.00 0.00 ? 89  ASN A H    3  
ATOM 4703  H HA   . ASN A 1 89  ? -6.772  0.813   10.747  1.00 0.00 ? 89  ASN A HA   3  
ATOM 4704  H HB3  . ASN A 1 89  ? -6.664  3.220   10.824  1.00 0.00 ? 89  ASN A HB3  3  
ATOM 4705  H HD21 . ASN A 1 89  ? -5.245  4.794   9.168   1.00 0.00 ? 89  ASN A HD21 3  
ATOM 4706  H HD22 . ASN A 1 89  ? -3.696  4.112   8.797   1.00 0.00 ? 89  ASN A HD22 3  
ATOM 4707  N N    . GLY A 1 90  ? -9.244  0.318   9.367   1.00 0.00 ? 90  GLY A N    3  
ATOM 4708  C CA   . GLY A 1 90  ? -10.691 0.249   9.248   1.00 0.00 ? 90  GLY A CA   3  
ATOM 4709  C C    . GLY A 1 90  ? -11.188 1.121   8.093   1.00 0.00 ? 90  GLY A C    3  
ATOM 4710  O O    . GLY A 1 90  ? -12.379 1.418   8.003   1.00 0.00 ? 90  GLY A O    3  
ATOM 4711  H H    . GLY A 1 90  ? -8.758  -0.517  9.110   1.00 0.00 ? 90  GLY A H    3  
ATOM 4712  H HA2  . GLY A 1 90  ? -10.997 -0.784  9.086   1.00 0.00 ? 90  GLY A HA2  3  
ATOM 4713  H HA3  . GLY A 1 90  ? -11.152 0.577   10.181  1.00 0.00 ? 90  GLY A HA3  3  
ATOM 4714  N N    . GLU A 1 91  ? -10.251 1.505   7.239   1.00 0.00 ? 91  GLU A N    3  
ATOM 4715  C CA   . GLU A 1 91  ? -10.580 2.337   6.093   1.00 0.00 ? 91  GLU A CA   3  
ATOM 4716  C C    . GLU A 1 91  ? -10.549 1.506   4.809   1.00 0.00 ? 91  GLU A C    3  
ATOM 4717  O O    . GLU A 1 91  ? -9.694  0.638   4.648   1.00 0.00 ? 91  GLU A O    3  
ATOM 4718  C CB   . GLU A 1 91  ? -9.633  3.534   5.996   1.00 0.00 ? 91  GLU A CB   3  
ATOM 4719  C CG   . GLU A 1 91  ? -10.390 4.850   6.184   1.00 0.00 ? 91  GLU A CG   3  
ATOM 4720  C CD   . GLU A 1 91  ? -11.477 5.015   5.119   1.00 0.00 ? 91  GLU A CD   3  
ATOM 4721  O OE1  . GLU A 1 91  ? -11.099 5.098   3.930   1.00 0.00 ? 91  GLU A OE1  3  
ATOM 4722  O OE2  . GLU A 1 91  ? -12.662 5.051   5.517   1.00 0.00 ? 91  GLU A OE2  3  
ATOM 4723  H H    . GLU A 1 91  ? -9.286  1.258   7.318   1.00 0.00 ? 91  GLU A H    3  
ATOM 4724  H HA   . GLU A 1 91  ? -11.593 2.696   6.276   1.00 0.00 ? 91  GLU A HA   3  
ATOM 4725  H HB3  . GLU A 1 91  ? -9.137  3.533   5.025   1.00 0.00 ? 91  GLU A HB3  3  
ATOM 4726  H HG3  . GLU A 1 91  ? -9.695  5.686   6.130   1.00 0.00 ? 91  GLU A HG3  3  
ATOM 4727  N N    . SER A 1 92  ? -11.491 1.804   3.925   1.00 0.00 ? 92  SER A N    3  
ATOM 4728  C CA   . SER A 1 92  ? -11.582 1.096   2.660   1.00 0.00 ? 92  SER A CA   3  
ATOM 4729  C C    . SER A 1 92  ? -10.577 1.677   1.662   1.00 0.00 ? 92  SER A C    3  
ATOM 4730  O O    . SER A 1 92  ? -10.660 2.850   1.304   1.00 0.00 ? 92  SER A O    3  
ATOM 4731  C CB   . SER A 1 92  ? -13.000 1.170   2.089   1.00 0.00 ? 92  SER A CB   3  
ATOM 4732  O OG   . SER A 1 92  ? -13.975 0.702   3.017   1.00 0.00 ? 92  SER A OG   3  
ATOM 4733  H H    . SER A 1 92  ? -12.183 2.513   4.065   1.00 0.00 ? 92  SER A H    3  
ATOM 4734  H HA   . SER A 1 92  ? -11.337 0.059   2.892   1.00 0.00 ? 92  SER A HA   3  
ATOM 4735  H HB3  . SER A 1 92  ? -13.053 0.577   1.177   1.00 0.00 ? 92  SER A HB3  3  
ATOM 4736  H HG   . SER A 1 92  ? -13.999 -0.297  3.013   1.00 0.00 ? 92  SER A HG   3  
ATOM 4737  N N    . VAL A 1 93  ? -9.650  0.827   1.245   1.00 0.00 ? 93  VAL A N    3  
ATOM 4738  C CA   . VAL A 1 93  ? -8.631  1.241   0.296   1.00 0.00 ? 93  VAL A CA   3  
ATOM 4739  C C    . VAL A 1 93  ? -9.285  1.531   -1.057  1.00 0.00 ? 93  VAL A C    3  
ATOM 4740  O O    . VAL A 1 93  ? -8.824  2.393   -1.801  1.00 0.00 ? 93  VAL A O    3  
ATOM 4741  C CB   . VAL A 1 93  ? -7.532  0.178   0.212   1.00 0.00 ? 93  VAL A CB   3  
ATOM 4742  C CG1  . VAL A 1 93  ? -7.037  -0.209  1.607   1.00 0.00 ? 93  VAL A CG1  3  
ATOM 4743  C CG2  . VAL A 1 93  ? -8.016  -1.051  -0.559  1.00 0.00 ? 93  VAL A CG2  3  
ATOM 4744  H H    . VAL A 1 93  ? -9.590  -0.127  1.541   1.00 0.00 ? 93  VAL A H    3  
ATOM 4745  H HA   . VAL A 1 93  ? -8.183  2.159   0.673   1.00 0.00 ? 93  VAL A HA   3  
ATOM 4746  H HB   . VAL A 1 93  ? -6.692  0.608   -0.334  1.00 0.00 ? 93  VAL A HB   3  
ATOM 4747  H HG11 . VAL A 1 93  ? -6.848  0.693   2.190   1.00 0.00 ? 93  VAL A HG11 3  
ATOM 4748  H HG12 . VAL A 1 93  ? -7.796  -0.812  2.108   1.00 0.00 ? 93  VAL A HG12 3  
ATOM 4749  H HG13 . VAL A 1 93  ? -6.116  -0.785  1.520   1.00 0.00 ? 93  VAL A HG13 3  
ATOM 4750  H HG21 . VAL A 1 93  ? -7.160  -1.677  -0.817  1.00 0.00 ? 93  VAL A HG21 3  
ATOM 4751  H HG22 . VAL A 1 93  ? -8.708  -1.619  0.060   1.00 0.00 ? 93  VAL A HG22 3  
ATOM 4752  H HG23 . VAL A 1 93  ? -8.521  -0.731  -1.471  1.00 0.00 ? 93  VAL A HG23 3  
ATOM 4753  N N    . ILE A 1 94  ? -10.350 0.793   -1.332  1.00 0.00 ? 94  ILE A N    3  
ATOM 4754  C CA   . ILE A 1 94  ? -11.074 0.960   -2.582  1.00 0.00 ? 94  ILE A CA   3  
ATOM 4755  C C    . ILE A 1 94  ? -11.395 2.442   -2.786  1.00 0.00 ? 94  ILE A C    3  
ATOM 4756  O O    . ILE A 1 94  ? -12.290 2.981   -2.136  1.00 0.00 ? 94  ILE A O    3  
ATOM 4757  C CB   . ILE A 1 94  ? -12.306 0.053   -2.614  1.00 0.00 ? 94  ILE A CB   3  
ATOM 4758  C CG1  . ILE A 1 94  ? -11.904 -1.420  -2.509  1.00 0.00 ? 94  ILE A CG1  3  
ATOM 4759  C CG2  . ILE A 1 94  ? -13.157 0.328   -3.855  1.00 0.00 ? 94  ILE A CG2  3  
ATOM 4760  C CD1  . ILE A 1 94  ? -12.197 -1.970  -1.111  1.00 0.00 ? 94  ILE A CD1  3  
ATOM 4761  H H    . ILE A 1 94  ? -10.720 0.093   -0.721  1.00 0.00 ? 94  ILE A H    3  
ATOM 4762  H HA   . ILE A 1 94  ? -10.414 0.636   -3.387  1.00 0.00 ? 94  ILE A HA   3  
ATOM 4763  H HB   . ILE A 1 94  ? -12.921 0.282   -1.745  1.00 0.00 ? 94  ILE A HB   3  
ATOM 4764  H HG13 . ILE A 1 94  ? -10.842 -1.528  -2.731  1.00 0.00 ? 94  ILE A HG13 3  
ATOM 4765  H HG21 . ILE A 1 94  ? -13.254 -0.586  -4.440  1.00 0.00 ? 94  ILE A HG21 3  
ATOM 4766  H HG22 . ILE A 1 94  ? -14.146 0.669   -3.548  1.00 0.00 ? 94  ILE A HG22 3  
ATOM 4767  H HG23 . ILE A 1 94  ? -12.678 1.097   -4.460  1.00 0.00 ? 94  ILE A HG23 3  
ATOM 4768  H HD11 . ILE A 1 94  ? -11.439 -2.707  -0.845  1.00 0.00 ? 94  ILE A HD11 3  
ATOM 4769  H HD12 . ILE A 1 94  ? -12.181 -1.154  -0.389  1.00 0.00 ? 94  ILE A HD12 3  
ATOM 4770  H HD13 . ILE A 1 94  ? -13.180 -2.441  -1.106  1.00 0.00 ? 94  ILE A HD13 3  
ATOM 4771  N N    . GLY A 1 95  ? -10.649 3.059   -3.691  1.00 0.00 ? 95  GLY A N    3  
ATOM 4772  C CA   . GLY A 1 95  ? -10.845 4.467   -3.988  1.00 0.00 ? 95  GLY A CA   3  
ATOM 4773  C C    . GLY A 1 95  ? -9.627  5.290   -3.566  1.00 0.00 ? 95  GLY A C    3  
ATOM 4774  O O    . GLY A 1 95  ? -9.739  6.489   -3.317  1.00 0.00 ? 95  GLY A O    3  
ATOM 4775  H H    . GLY A 1 95  ? -9.925  2.612   -4.215  1.00 0.00 ? 95  GLY A H    3  
ATOM 4776  H HA2  . GLY A 1 95  ? -11.023 4.596   -5.055  1.00 0.00 ? 95  GLY A HA2  3  
ATOM 4777  H HA3  . GLY A 1 95  ? -11.731 4.831   -3.470  1.00 0.00 ? 95  GLY A HA3  3  
ATOM 4778  N N    . LYS A 1 96  ? -8.489  4.613   -3.499  1.00 0.00 ? 96  LYS A N    3  
ATOM 4779  C CA   . LYS A 1 96  ? -7.250  5.266   -3.111  1.00 0.00 ? 96  LYS A CA   3  
ATOM 4780  C C    . LYS A 1 96  ? -6.193  5.028   -4.190  1.00 0.00 ? 96  LYS A C    3  
ATOM 4781  O O    . LYS A 1 96  ? -6.398  4.224   -5.098  1.00 0.00 ? 96  LYS A O    3  
ATOM 4782  C CB   . LYS A 1 96  ? -6.818  4.812   -1.715  1.00 0.00 ? 96  LYS A CB   3  
ATOM 4783  C CG   . LYS A 1 96  ? -7.589  5.565   -0.629  1.00 0.00 ? 96  LYS A CG   3  
ATOM 4784  C CD   . LYS A 1 96  ? -7.264  5.011   0.759   1.00 0.00 ? 96  LYS A CD   3  
ATOM 4785  C CE   . LYS A 1 96  ? -8.286  5.488   1.794   1.00 0.00 ? 96  LYS A CE   3  
ATOM 4786  N NZ   . LYS A 1 96  ? -9.663  5.265   1.300   1.00 0.00 ? 96  LYS A NZ   3  
ATOM 4787  H H    . LYS A 1 96  ? -8.407  3.638   -3.702  1.00 0.00 ? 96  LYS A H    3  
ATOM 4788  H HA   . LYS A 1 96  ? -7.450  6.336   -3.053  1.00 0.00 ? 96  LYS A HA   3  
ATOM 4789  H HB3  . LYS A 1 96  ? -5.750  4.979   -1.589  1.00 0.00 ? 96  LYS A HB3  3  
ATOM 4790  H HG3  . LYS A 1 96  ? -8.661  5.481   -0.815  1.00 0.00 ? 96  LYS A HG3  3  
ATOM 4791  H HD3  . LYS A 1 96  ? -6.264  5.330   1.056   1.00 0.00 ? 96  LYS A HD3  3  
ATOM 4792  H HE3  . LYS A 1 96  ? -8.134  6.546   2.003   1.00 0.00 ? 96  LYS A HE3  3  
ATOM 4793  H HZ1  . LYS A 1 96  ? -9.655  4.560   0.593   1.00 0.00 ? 96  LYS A HZ1  3  
ATOM 4794  H HZ2  . LYS A 1 96  ? -10.244 4.970   2.059   1.00 0.00 ? 96  LYS A HZ2  3  
ATOM 4795  H HZ3  . LYS A 1 96  ? -10.022 6.116   0.918   1.00 0.00 ? 96  LYS A HZ3  3  
ATOM 4796  N N    . THR A 1 97  ? -5.085  5.741   -4.055  1.00 0.00 ? 97  THR A N    3  
ATOM 4797  C CA   . THR A 1 97  ? -3.995  5.616   -5.009  1.00 0.00 ? 97  THR A CA   3  
ATOM 4798  C C    . THR A 1 97  ? -2.661  5.455   -4.275  1.00 0.00 ? 97  THR A C    3  
ATOM 4799  O O    . THR A 1 97  ? -1.691  6.144   -4.586  1.00 0.00 ? 97  THR A O    3  
ATOM 4800  C CB   . THR A 1 97  ? -4.036  6.833   -5.936  1.00 0.00 ? 97  THR A CB   3  
ATOM 4801  O OG1  . THR A 1 97  ? -3.250  6.442   -7.058  1.00 0.00 ? 97  THR A OG1  3  
ATOM 4802  C CG2  . THR A 1 97  ? -3.285  8.034   -5.357  1.00 0.00 ? 97  THR A CG2  3  
ATOM 4803  H H    . THR A 1 97  ? -4.925  6.393   -3.313  1.00 0.00 ? 97  THR A H    3  
ATOM 4804  H HA   . THR A 1 97  ? -4.150  4.709   -5.592  1.00 0.00 ? 97  THR A HA   3  
ATOM 4805  H HB   . THR A 1 97  ? -5.062  7.098   -6.184  1.00 0.00 ? 97  THR A HB   3  
ATOM 4806  H HG1  . THR A 1 97  ? -3.613  5.598   -7.451  1.00 0.00 ? 97  THR A HG1  3  
ATOM 4807  H HG21 . THR A 1 97  ? -3.845  8.947   -5.564  1.00 0.00 ? 97  THR A HG21 3  
ATOM 4808  H HG22 . THR A 1 97  ? -3.178  7.912   -4.278  1.00 0.00 ? 97  THR A HG22 3  
ATOM 4809  H HG23 . THR A 1 97  ? -2.298  8.102   -5.813  1.00 0.00 ? 97  THR A HG23 3  
ATOM 4810  N N    . TYR A 1 98  ? -2.657  4.541   -3.316  1.00 0.00 ? 98  TYR A N    3  
ATOM 4811  C CA   . TYR A 1 98  ? -1.459  4.280   -2.537  1.00 0.00 ? 98  TYR A CA   3  
ATOM 4812  C C    . TYR A 1 98  ? -1.091  5.490   -1.676  1.00 0.00 ? 98  TYR A C    3  
ATOM 4813  O O    . TYR A 1 98  ? -1.093  5.406   -0.449  1.00 0.00 ? 98  TYR A O    3  
ATOM 4814  C CB   . TYR A 1 98  ? -0.342  4.033   -3.551  1.00 0.00 ? 98  TYR A CB   3  
ATOM 4815  C CG   . TYR A 1 98  ? 0.863   3.282   -2.979  1.00 0.00 ? 98  TYR A CG   3  
ATOM 4816  C CD1  . TYR A 1 98  ? 0.672   2.157   -2.204  1.00 0.00 ? 98  TYR A CD1  3  
ATOM 4817  C CD2  . TYR A 1 98  ? 2.143   3.732   -3.238  1.00 0.00 ? 98  TYR A CD2  3  
ATOM 4818  C CE1  . TYR A 1 98  ? 1.805   1.451   -1.665  1.00 0.00 ? 98  TYR A CE1  3  
ATOM 4819  C CE2  . TYR A 1 98  ? 3.276   3.026   -2.699  1.00 0.00 ? 98  TYR A CE2  3  
ATOM 4820  C CZ   . TYR A 1 98  ? 3.052   1.921   -1.941  1.00 0.00 ? 98  TYR A CZ   3  
ATOM 4821  O OH   . TYR A 1 98  ? 4.124   1.254   -1.432  1.00 0.00 ? 98  TYR A OH   3  
ATOM 4822  H H    . TYR A 1 98  ? -3.451  3.984   -3.070  1.00 0.00 ? 98  TYR A H    3  
ATOM 4823  H HA   . TYR A 1 98  ? -1.660  3.428   -1.886  1.00 0.00 ? 98  TYR A HA   3  
ATOM 4824  H HB3  . TYR A 1 98  ? -0.005  4.990   -3.947  1.00 0.00 ? 98  TYR A HB3  3  
ATOM 4825  H HD1  . TYR A 1 98  ? -0.338  1.802   -2.000  1.00 0.00 ? 98  TYR A HD1  3  
ATOM 4826  H HD2  . TYR A 1 98  ? 2.294   4.621   -3.851  1.00 0.00 ? 98  TYR A HD2  3  
ATOM 4827  H HE1  . TYR A 1 98  ? 1.668   0.560   -1.052  1.00 0.00 ? 98  TYR A HE1  3  
ATOM 4828  H HE2  . TYR A 1 98  ? 4.292   3.370   -2.895  1.00 0.00 ? 98  TYR A HE2  3  
ATOM 4829  H HH   . TYR A 1 98  ? 4.500   0.635   -2.121  1.00 0.00 ? 98  TYR A HH   3  
ATOM 4830  N N    . SER A 1 99  ? -0.785  6.587   -2.352  1.00 0.00 ? 99  SER A N    3  
ATOM 4831  C CA   . SER A 1 99  ? -0.415  7.813   -1.666  1.00 0.00 ? 99  SER A CA   3  
ATOM 4832  C C    . SER A 1 99  ? -1.424  8.114   -0.556  1.00 0.00 ? 99  SER A C    3  
ATOM 4833  O O    . SER A 1 99  ? -1.094  8.780   0.424   1.00 0.00 ? 99  SER A O    3  
ATOM 4834  C CB   . SER A 1 99  ? -0.332  8.988   -2.641  1.00 0.00 ? 99  SER A CB   3  
ATOM 4835  O OG   . SER A 1 99  ? -1.187  8.808   -3.767  1.00 0.00 ? 99  SER A OG   3  
ATOM 4836  H H    . SER A 1 99  ? -0.786  6.646   -3.351  1.00 0.00 ? 99  SER A H    3  
ATOM 4837  H HA   . SER A 1 99  ? 0.571   7.620   -1.244  1.00 0.00 ? 99  SER A HA   3  
ATOM 4838  H HB3  . SER A 1 99  ? 0.697   9.104   -2.983  1.00 0.00 ? 99  SER A HB3  3  
ATOM 4839  H HG   . SER A 1 99  ? -1.462  9.698   -4.134  1.00 0.00 ? 99  SER A HG   3  
ATOM 4840  N N    . GLN A 1 100 ? -2.634  7.611   -0.748  1.00 0.00 ? 100 GLN A N    3  
ATOM 4841  C CA   . GLN A 1 100 ? -3.694  7.817   0.226   1.00 0.00 ? 100 GLN A CA   3  
ATOM 4842  C C    . GLN A 1 100 ? -3.512  6.876   1.418   1.00 0.00 ? 100 GLN A C    3  
ATOM 4843  O O    . GLN A 1 100 ? -3.227  7.322   2.529   1.00 0.00 ? 100 GLN A O    3  
ATOM 4844  C CB   . GLN A 1 100 ? -5.071  7.631   -0.415  1.00 0.00 ? 100 GLN A CB   3  
ATOM 4845  C CG   . GLN A 1 100 ? -5.497  8.888   -1.175  1.00 0.00 ? 100 GLN A CG   3  
ATOM 4846  C CD   . GLN A 1 100 ? -6.746  8.623   -2.018  1.00 0.00 ? 100 GLN A CD   3  
ATOM 4847  O OE1  . GLN A 1 100 ? -7.865  8.616   -1.530  1.00 0.00 ? 100 GLN A OE1  3  
ATOM 4848  N NE2  . GLN A 1 100 ? -6.494  8.406   -3.305  1.00 0.00 ? 100 GLN A NE2  3  
ATOM 4849  H H    . GLN A 1 100 ? -2.895  7.070   -1.547  1.00 0.00 ? 100 GLN A H    3  
ATOM 4850  H HA   . GLN A 1 100 ? -3.589  8.852   0.551   1.00 0.00 ? 100 GLN A HA   3  
ATOM 4851  H HB3  . GLN A 1 100 ? -5.806  7.401   0.355   1.00 0.00 ? 100 GLN A HB3  3  
ATOM 4852  H HG3  . GLN A 1 100 ? -4.683  9.221   -1.820  1.00 0.00 ? 100 GLN A HG3  3  
ATOM 4853  H HE21 . GLN A 1 100 ? -5.552  8.426   -3.641  1.00 0.00 ? 100 GLN A HE21 3  
ATOM 4854  H HE22 . GLN A 1 100 ? -7.247  8.223   -3.938  1.00 0.00 ? 100 GLN A HE22 3  
ATOM 4855  N N    . VAL A 1 101 ? -3.682  5.590   1.147   1.00 0.00 ? 101 VAL A N    3  
ATOM 4856  C CA   . VAL A 1 101 ? -3.540  4.583   2.183   1.00 0.00 ? 101 VAL A CA   3  
ATOM 4857  C C    . VAL A 1 101 ? -2.212  4.791   2.913   1.00 0.00 ? 101 VAL A C    3  
ATOM 4858  O O    . VAL A 1 101 ? -2.129  4.599   4.127   1.00 0.00 ? 101 VAL A O    3  
ATOM 4859  C CB   . VAL A 1 101 ? -3.676  3.184   1.577   1.00 0.00 ? 101 VAL A CB   3  
ATOM 4860  C CG1  . VAL A 1 101 ? -5.111  2.919   1.122   1.00 0.00 ? 101 VAL A CG1  3  
ATOM 4861  C CG2  . VAL A 1 101 ? -2.691  2.992   0.420   1.00 0.00 ? 101 VAL A CG2  3  
ATOM 4862  H H    . VAL A 1 101 ? -3.912  5.235   0.241   1.00 0.00 ? 101 VAL A H    3  
ATOM 4863  H HA   . VAL A 1 101 ? -4.356  4.721   2.892   1.00 0.00 ? 101 VAL A HA   3  
ATOM 4864  H HB   . VAL A 1 101 ? -3.428  2.457   2.350   1.00 0.00 ? 101 VAL A HB   3  
ATOM 4865  H HG11 . VAL A 1 101 ? -5.343  3.550   0.263   1.00 0.00 ? 101 VAL A HG11 3  
ATOM 4866  H HG12 . VAL A 1 101 ? -5.217  1.871   0.842   1.00 0.00 ? 101 VAL A HG12 3  
ATOM 4867  H HG13 . VAL A 1 101 ? -5.798  3.150   1.936   1.00 0.00 ? 101 VAL A HG13 3  
ATOM 4868  H HG21 . VAL A 1 101 ? -2.507  1.928   0.274   1.00 0.00 ? 101 VAL A HG21 3  
ATOM 4869  H HG22 . VAL A 1 101 ? -3.112  3.417   -0.491  1.00 0.00 ? 101 VAL A HG22 3  
ATOM 4870  H HG23 . VAL A 1 101 ? -1.752  3.494   0.655   1.00 0.00 ? 101 VAL A HG23 3  
ATOM 4871  N N    . ILE A 1 102 ? -1.206  5.182   2.145   1.00 0.00 ? 102 ILE A N    3  
ATOM 4872  C CA   . ILE A 1 102 ? 0.114   5.419   2.704   1.00 0.00 ? 102 ILE A CA   3  
ATOM 4873  C C    . ILE A 1 102 ? 0.009   6.449   3.831   1.00 0.00 ? 102 ILE A C    3  
ATOM 4874  O O    . ILE A 1 102 ? 0.537   6.237   4.922   1.00 0.00 ? 102 ILE A O    3  
ATOM 4875  C CB   . ILE A 1 102 ? 1.100   5.813   1.602   1.00 0.00 ? 102 ILE A CB   3  
ATOM 4876  C CG1  . ILE A 1 102 ? 1.522   4.592   0.782   1.00 0.00 ? 102 ILE A CG1  3  
ATOM 4877  C CG2  . ILE A 1 102 ? 2.303   6.558   2.183   1.00 0.00 ? 102 ILE A CG2  3  
ATOM 4878  C CD1  . ILE A 1 102 ? 2.287   3.589   1.649   1.00 0.00 ? 102 ILE A CD1  3  
ATOM 4879  H H    . ILE A 1 102 ? -1.282  5.336   1.161   1.00 0.00 ? 102 ILE A H    3  
ATOM 4880  H HA   . ILE A 1 102 ? 0.463   4.478   3.128   1.00 0.00 ? 102 ILE A HA   3  
ATOM 4881  H HB   . ILE A 1 102 ? 0.594   6.498   0.922   1.00 0.00 ? 102 ILE A HB   3  
ATOM 4882  H HG13 . ILE A 1 102 ? 2.149   4.908   -0.051  1.00 0.00 ? 102 ILE A HG13 3  
ATOM 4883  H HG21 . ILE A 1 102 ? 3.136   6.507   1.483   1.00 0.00 ? 102 ILE A HG21 3  
ATOM 4884  H HG22 . ILE A 1 102 ? 2.036   7.602   2.353   1.00 0.00 ? 102 ILE A HG22 3  
ATOM 4885  H HG23 . ILE A 1 102 ? 2.593   6.099   3.128   1.00 0.00 ? 102 ILE A HG23 3  
ATOM 4886  H HD11 . ILE A 1 102 ? 2.741   4.109   2.492   1.00 0.00 ? 102 ILE A HD11 3  
ATOM 4887  H HD12 . ILE A 1 102 ? 1.597   2.830   2.019   1.00 0.00 ? 102 ILE A HD12 3  
ATOM 4888  H HD13 . ILE A 1 102 ? 3.065   3.112   1.052   1.00 0.00 ? 102 ILE A HD13 3  
ATOM 4889  N N    . ALA A 1 103 ? -0.678  7.540   3.530   1.00 0.00 ? 103 ALA A N    3  
ATOM 4890  C CA   . ALA A 1 103 ? -0.860  8.603   4.504   1.00 0.00 ? 103 ALA A CA   3  
ATOM 4891  C C    . ALA A 1 103 ? -1.622  8.056   5.712   1.00 0.00 ? 103 ALA A C    3  
ATOM 4892  O O    . ALA A 1 103 ? -1.332  8.418   6.851   1.00 0.00 ? 103 ALA A O    3  
ATOM 4893  C CB   . ALA A 1 103 ? -1.578  9.782   3.846   1.00 0.00 ? 103 ALA A CB   3  
ATOM 4894  H H    . ALA A 1 103 ? -1.106  7.705   2.641   1.00 0.00 ? 103 ALA A H    3  
ATOM 4895  H HA   . ALA A 1 103 ? 0.129   8.930   4.827   1.00 0.00 ? 103 ALA A HA   3  
ATOM 4896  H HB1  . ALA A 1 103 ? -1.407  9.756   2.770   1.00 0.00 ? 103 ALA A HB1  3  
ATOM 4897  H HB2  . ALA A 1 103 ? -2.647  9.713   4.046   1.00 0.00 ? 103 ALA A HB2  3  
ATOM 4898  H HB3  . ALA A 1 103 ? -1.191  10.717  4.253   1.00 0.00 ? 103 ALA A HB3  3  
ATOM 4899  N N    . LEU A 1 104 ? -2.585  7.193   5.423   1.00 0.00 ? 104 LEU A N    3  
ATOM 4900  C CA   . LEU A 1 104 ? -3.392  6.592   6.472   1.00 0.00 ? 104 LEU A CA   3  
ATOM 4901  C C    . LEU A 1 104 ? -2.480  5.851   7.449   1.00 0.00 ? 104 LEU A C    3  
ATOM 4902  O O    . LEU A 1 104 ? -2.794  5.740   8.634   1.00 0.00 ? 104 LEU A O    3  
ATOM 4903  C CB   . LEU A 1 104 ? -4.490  5.714   5.866   1.00 0.00 ? 104 LEU A CB   3  
ATOM 4904  C CG   . LEU A 1 104 ? -5.610  6.452   5.130   1.00 0.00 ? 104 LEU A CG   3  
ATOM 4905  C CD1  . LEU A 1 104 ? -6.585  5.466   4.486   1.00 0.00 ? 104 LEU A CD1  3  
ATOM 4906  C CD2  . LEU A 1 104 ? -6.321  7.438   6.060   1.00 0.00 ? 104 LEU A CD2  3  
ATOM 4907  H H    . LEU A 1 104 ? -2.816  6.903   4.494   1.00 0.00 ? 104 LEU A H    3  
ATOM 4908  H HA   . LEU A 1 104 ? -3.888  7.404   7.007   1.00 0.00 ? 104 LEU A HA   3  
ATOM 4909  H HB3  . LEU A 1 104 ? -4.935  5.122   6.665   1.00 0.00 ? 104 LEU A HB3  3  
ATOM 4910  H HG   . LEU A 1 104 ? -5.163  7.036   4.325   1.00 0.00 ? 104 LEU A HG   3  
ATOM 4911  H HD11 . LEU A 1 104 ? -6.301  5.300   3.447   1.00 0.00 ? 104 LEU A HD11 3  
ATOM 4912  H HD12 . LEU A 1 104 ? -6.555  4.519   5.027   1.00 0.00 ? 104 LEU A HD12 3  
ATOM 4913  H HD13 . LEU A 1 104 ? -7.596  5.873   4.526   1.00 0.00 ? 104 LEU A HD13 3  
ATOM 4914  H HD21 . LEU A 1 104 ? -6.130  8.456   5.724   1.00 0.00 ? 104 LEU A HD21 3  
ATOM 4915  H HD22 . LEU A 1 104 ? -7.394  7.244   6.043   1.00 0.00 ? 104 LEU A HD22 3  
ATOM 4916  H HD23 . LEU A 1 104 ? -5.947  7.313   7.076   1.00 0.00 ? 104 LEU A HD23 3  
ATOM 4917  N N    . ILE A 1 105 ? -1.369  5.361   6.919   1.00 0.00 ? 105 ILE A N    3  
ATOM 4918  C CA   . ILE A 1 105 ? -0.410  4.633   7.730   1.00 0.00 ? 105 ILE A CA   3  
ATOM 4919  C C    . ILE A 1 105 ? 0.495   5.628   8.458   1.00 0.00 ? 105 ILE A C    3  
ATOM 4920  O O    . ILE A 1 105 ? 0.732   5.496   9.658   1.00 0.00 ? 105 ILE A O    3  
ATOM 4921  C CB   . ILE A 1 105 ? 0.353   3.617   6.876   1.00 0.00 ? 105 ILE A CB   3  
ATOM 4922  C CG1  . ILE A 1 105 ? -0.558  2.465   6.450   1.00 0.00 ? 105 ILE A CG1  3  
ATOM 4923  C CG2  . ILE A 1 105 ? 1.605   3.121   7.602   1.00 0.00 ? 105 ILE A CG2  3  
ATOM 4924  C CD1  . ILE A 1 105 ? -0.117  1.886   5.104   1.00 0.00 ? 105 ILE A CD1  3  
ATOM 4925  H H    . ILE A 1 105 ? -1.122  5.456   5.954   1.00 0.00 ? 105 ILE A H    3  
ATOM 4926  H HA   . ILE A 1 105 ? -0.973  4.069   8.475   1.00 0.00 ? 105 ILE A HA   3  
ATOM 4927  H HB   . ILE A 1 105 ? 0.685   4.118   5.967   1.00 0.00 ? 105 ILE A HB   3  
ATOM 4928  H HG13 . ILE A 1 105 ? -1.587  2.818   6.379   1.00 0.00 ? 105 ILE A HG13 3  
ATOM 4929  H HG21 . ILE A 1 105 ? 2.469   3.697   7.272   1.00 0.00 ? 105 ILE A HG21 3  
ATOM 4930  H HG22 . ILE A 1 105 ? 1.475   3.244   8.678   1.00 0.00 ? 105 ILE A HG22 3  
ATOM 4931  H HG23 . ILE A 1 105 ? 1.762   2.067   7.374   1.00 0.00 ? 105 ILE A HG23 3  
ATOM 4932  H HD11 . ILE A 1 105 ? 0.465   2.631   4.562   1.00 0.00 ? 105 ILE A HD11 3  
ATOM 4933  H HD12 . ILE A 1 105 ? 0.493   1.000   5.271   1.00 0.00 ? 105 ILE A HD12 3  
ATOM 4934  H HD13 . ILE A 1 105 ? -0.997  1.616   4.519   1.00 0.00 ? 105 ILE A HD13 3  
ATOM 4935  N N    . GLN A 1 106 ? 0.979   6.603   7.700   1.00 0.00 ? 106 GLN A N    3  
ATOM 4936  C CA   . GLN A 1 106 ? 1.854   7.620   8.259   1.00 0.00 ? 106 GLN A CA   3  
ATOM 4937  C C    . GLN A 1 106 ? 1.095   8.469   9.281   1.00 0.00 ? 106 GLN A C    3  
ATOM 4938  O O    . GLN A 1 106 ? 1.697   9.026   10.200  1.00 0.00 ? 106 GLN A O    3  
ATOM 4939  C CB   . GLN A 1 106 ? 2.451   8.494   7.154   1.00 0.00 ? 106 GLN A CB   3  
ATOM 4940  C CG   . GLN A 1 106 ? 3.273   7.657   6.175   1.00 0.00 ? 106 GLN A CG   3  
ATOM 4941  C CD   . GLN A 1 106 ? 4.600   8.343   5.844   1.00 0.00 ? 106 GLN A CD   3  
ATOM 4942  O OE1  . GLN A 1 106 ? 5.220   8.987   6.675   1.00 0.00 ? 106 GLN A OE1  3  
ATOM 4943  N NE2  . GLN A 1 106 ? 4.998   8.172   4.587   1.00 0.00 ? 106 GLN A NE2  3  
ATOM 4944  H H    . GLN A 1 106 ? 0.781   6.703   6.725   1.00 0.00 ? 106 GLN A H    3  
ATOM 4945  H HA   . GLN A 1 106 ? 2.656   7.072   8.754   1.00 0.00 ? 106 GLN A HA   3  
ATOM 4946  H HB3  . GLN A 1 106 ? 3.080   9.266   7.598   1.00 0.00 ? 106 GLN A HB3  3  
ATOM 4947  H HG3  . GLN A 1 106 ? 2.704   7.496   5.259   1.00 0.00 ? 106 GLN A HG3  3  
ATOM 4948  H HE21 . GLN A 1 106 ? 4.442   7.634   3.955   1.00 0.00 ? 106 GLN A HE21 3  
ATOM 4949  H HE22 . GLN A 1 106 ? 5.854   8.584   4.275   1.00 0.00 ? 106 GLN A HE22 3  
ATOM 4950  N N    . ASN A 1 107 ? -0.214  8.540   9.089   1.00 0.00 ? 107 ASN A N    3  
ATOM 4951  C CA   . ASN A 1 107 ? -1.060  9.312   9.983   1.00 0.00 ? 107 ASN A CA   3  
ATOM 4952  C C    . ASN A 1 107 ? -1.886  8.358   10.848  1.00 0.00 ? 107 ASN A C    3  
ATOM 4953  O O    . ASN A 1 107 ? -2.952  8.724   11.339  1.00 0.00 ? 107 ASN A O    3  
ATOM 4954  C CB   . ASN A 1 107 ? -2.029  10.198  9.197   1.00 0.00 ? 107 ASN A CB   3  
ATOM 4955  C CG   . ASN A 1 107 ? -1.333  11.465  8.699   1.00 0.00 ? 107 ASN A CG   3  
ATOM 4956  O OD1  . ASN A 1 107 ? -0.980  12.352  9.460   1.00 0.00 ? 107 ASN A OD1  3  
ATOM 4957  N ND2  . ASN A 1 107 ? -1.156  11.503  7.381   1.00 0.00 ? 107 ASN A ND2  3  
ATOM 4958  H H    . ASN A 1 107 ? -0.695  8.085   8.340   1.00 0.00 ? 107 ASN A H    3  
ATOM 4959  H HA   . ASN A 1 107 ? -0.374  9.921   10.573  1.00 0.00 ? 107 ASN A HA   3  
ATOM 4960  H HB3  . ASN A 1 107 ? -2.875  10.467  9.830   1.00 0.00 ? 107 ASN A HB3  3  
ATOM 4961  H HD21 . ASN A 1 107 ? -1.469  10.742  6.813   1.00 0.00 ? 107 ASN A HD21 3  
ATOM 4962  H HD22 . ASN A 1 107 ? -0.710  12.292  6.958   1.00 0.00 ? 107 ASN A HD22 3  
ATOM 4963  N N    . SER A 1 108 ? -1.363  7.151   11.005  1.00 0.00 ? 108 SER A N    3  
ATOM 4964  C CA   . SER A 1 108 ? -2.038  6.140   11.801  1.00 0.00 ? 108 SER A CA   3  
ATOM 4965  C C    . SER A 1 108 ? -1.639  6.279   13.271  1.00 0.00 ? 108 SER A C    3  
ATOM 4966  O O    . SER A 1 108 ? -2.175  5.583   14.131  1.00 0.00 ? 108 SER A O    3  
ATOM 4967  C CB   . SER A 1 108 ? -1.716  4.734   11.294  1.00 0.00 ? 108 SER A CB   3  
ATOM 4968  O OG   . SER A 1 108 ? -2.880  3.915   11.213  1.00 0.00 ? 108 SER A OG   3  
ATOM 4969  H H    . SER A 1 108 ? -0.495  6.860   10.602  1.00 0.00 ? 108 SER A H    3  
ATOM 4970  H HA   . SER A 1 108 ? -3.103  6.336   11.674  1.00 0.00 ? 108 SER A HA   3  
ATOM 4971  H HB3  . SER A 1 108 ? -0.990  4.266   11.959  1.00 0.00 ? 108 SER A HB3  3  
ATOM 4972  H HG   . SER A 1 108 ? -3.694  4.486   11.111  1.00 0.00 ? 108 SER A HG   3  
ATOM 4973  N N    . ASP A 1 109 ? -0.702  7.183   13.515  1.00 0.00 ? 109 ASP A N    3  
ATOM 4974  C CA   . ASP A 1 109 ? -0.224  7.421   14.866  1.00 0.00 ? 109 ASP A CA   3  
ATOM 4975  C C    . ASP A 1 109 ? 0.823   6.365   15.227  1.00 0.00 ? 109 ASP A C    3  
ATOM 4976  O O    . ASP A 1 109 ? 1.430   5.762   14.345  1.00 0.00 ? 109 ASP A O    3  
ATOM 4977  C CB   . ASP A 1 109 ? -1.367  7.321   15.879  1.00 0.00 ? 109 ASP A CB   3  
ATOM 4978  C CG   . ASP A 1 109 ? -1.230  8.235   17.099  1.00 0.00 ? 109 ASP A CG   3  
ATOM 4979  O OD1  . ASP A 1 109 ? -0.467  9.218   16.989  1.00 0.00 ? 109 ASP A OD1  3  
ATOM 4980  O OD2  . ASP A 1 109 ? -1.893  7.928   18.113  1.00 0.00 ? 109 ASP A OD2  3  
ATOM 4981  H H    . ASP A 1 109 ? -0.270  7.745   12.808  1.00 0.00 ? 109 ASP A H    3  
ATOM 4982  H HA   . ASP A 1 109 ? 0.189   8.431   14.850  1.00 0.00 ? 109 ASP A HA   3  
ATOM 4983  H HB3  . ASP A 1 109 ? -1.438  6.289   16.223  1.00 0.00 ? 109 ASP A HB3  3  
ATOM 4984  N N    . THR A 1 110 ? 1.000   6.174   16.525  1.00 0.00 ? 110 THR A N    3  
ATOM 4985  C CA   . THR A 1 110 ? 1.961   5.202   17.015  1.00 0.00 ? 110 THR A CA   3  
ATOM 4986  C C    . THR A 1 110 ? 1.601   3.799   16.519  1.00 0.00 ? 110 THR A C    3  
ATOM 4987  O O    . THR A 1 110 ? 2.479   3.026   16.142  1.00 0.00 ? 110 THR A O    3  
ATOM 4988  C CB   . THR A 1 110 ? 2.013   5.312   18.540  1.00 0.00 ? 110 THR A CB   3  
ATOM 4989  O OG1  . THR A 1 110 ? 2.396   6.663   18.777  1.00 0.00 ? 110 THR A OG1  3  
ATOM 4990  C CG2  . THR A 1 110 ? 3.151   4.491   19.148  1.00 0.00 ? 110 THR A CG2  3  
ATOM 4991  H H    . THR A 1 110 ? 0.500   6.669   17.237  1.00 0.00 ? 110 THR A H    3  
ATOM 4992  H HA   . THR A 1 110 ? 2.939   5.446   16.598  1.00 0.00 ? 110 THR A HA   3  
ATOM 4993  H HB   . THR A 1 110 ? 1.056   5.038   18.983  1.00 0.00 ? 110 THR A HB   3  
ATOM 4994  H HG1  . THR A 1 110 ? 3.268   6.857   18.326  1.00 0.00 ? 110 THR A HG1  3  
ATOM 4995  H HG21 . THR A 1 110 ? 4.038   4.576   18.520  1.00 0.00 ? 110 THR A HG21 3  
ATOM 4996  H HG22 . THR A 1 110 ? 3.377   4.865   20.147  1.00 0.00 ? 110 THR A HG22 3  
ATOM 4997  H HG23 . THR A 1 110 ? 2.851   3.445   19.212  1.00 0.00 ? 110 THR A HG23 3  
ATOM 4998  N N    . THR A 1 111 ? 0.308   3.515   16.537  1.00 0.00 ? 111 THR A N    3  
ATOM 4999  C CA   . THR A 1 111 ? -0.180  2.219   16.093  1.00 0.00 ? 111 THR A CA   3  
ATOM 5000  C C    . THR A 1 111 ? -0.747  2.320   14.677  1.00 0.00 ? 111 THR A C    3  
ATOM 5001  O O    . THR A 1 111 ? -1.171  3.391   14.248  1.00 0.00 ? 111 THR A O    3  
ATOM 5002  C CB   . THR A 1 111 ? -1.197  1.721   17.122  1.00 0.00 ? 111 THR A CB   3  
ATOM 5003  O OG1  . THR A 1 111 ? -1.672  2.911   17.745  1.00 0.00 ? 111 THR A OG1  3  
ATOM 5004  C CG2  . THR A 1 111 ? -0.544  0.938   18.262  1.00 0.00 ? 111 THR A CG2  3  
ATOM 5005  H H    . THR A 1 111 ? -0.401  4.150   16.846  1.00 0.00 ? 111 THR A H    3  
ATOM 5006  H HA   . THR A 1 111 ? 0.663   1.531   16.053  1.00 0.00 ? 111 THR A HA   3  
ATOM 5007  H HB   . THR A 1 111 ? -1.978  1.130   16.642  1.00 0.00 ? 111 THR A HB   3  
ATOM 5008  H HG1  . THR A 1 111 ? -2.556  2.739   18.181  1.00 0.00 ? 111 THR A HG1  3  
ATOM 5009  H HG21 . THR A 1 111 ? 0.249   1.539   18.708  1.00 0.00 ? 111 THR A HG21 3  
ATOM 5010  H HG22 . THR A 1 111 ? -1.291  0.704   19.019  1.00 0.00 ? 111 THR A HG22 3  
ATOM 5011  H HG23 . THR A 1 111 ? -0.120  0.012   17.872  1.00 0.00 ? 111 THR A HG23 3  
ATOM 5012  N N    . LEU A 1 112 ? -0.737  1.187   13.989  1.00 0.00 ? 112 LEU A N    3  
ATOM 5013  C CA   . LEU A 1 112 ? -1.243  1.133   12.627  1.00 0.00 ? 112 LEU A CA   3  
ATOM 5014  C C    . LEU A 1 112 ? -1.857  -0.244  12.371  1.00 0.00 ? 112 LEU A C    3  
ATOM 5015  O O    . LEU A 1 112 ? -1.168  -1.260  12.453  1.00 0.00 ? 112 LEU A O    3  
ATOM 5016  C CB   . LEU A 1 112 ? -0.148  1.513   11.631  1.00 0.00 ? 112 LEU A CB   3  
ATOM 5017  C CG   . LEU A 1 112 ? -0.461  1.252   10.157  1.00 0.00 ? 112 LEU A CG   3  
ATOM 5018  C CD1  . LEU A 1 112 ? -0.185  -0.206  9.788   1.00 0.00 ? 112 LEU A CD1  3  
ATOM 5019  C CD2  . LEU A 1 112 ? -1.894  1.667   9.819   1.00 0.00 ? 112 LEU A CD2  3  
ATOM 5020  H H    . LEU A 1 112 ? -0.389  0.320   14.345  1.00 0.00 ? 112 LEU A H    3  
ATOM 5021  H HA   . LEU A 1 112 ? -2.031  1.883   12.542  1.00 0.00 ? 112 LEU A HA   3  
ATOM 5022  H HB3  . LEU A 1 112 ? 0.759   0.966   11.892  1.00 0.00 ? 112 LEU A HB3  3  
ATOM 5023  H HG   . LEU A 1 112 ? 0.204   1.870   9.550   1.00 0.00 ? 112 LEU A HG   3  
ATOM 5024  H HD11 . LEU A 1 112 ? -0.918  -0.849  10.274  1.00 0.00 ? 112 LEU A HD11 3  
ATOM 5025  H HD12 . LEU A 1 112 ? -0.256  -0.327  8.707   1.00 0.00 ? 112 LEU A HD12 3  
ATOM 5026  H HD13 . LEU A 1 112 ? 0.817   -0.481  10.119  1.00 0.00 ? 112 LEU A HD13 3  
ATOM 5027  H HD21 . LEU A 1 112 ? -2.548  1.435   10.661  1.00 0.00 ? 112 LEU A HD21 3  
ATOM 5028  H HD22 . LEU A 1 112 ? -1.925  2.739   9.620   1.00 0.00 ? 112 LEU A HD22 3  
ATOM 5029  H HD23 . LEU A 1 112 ? -2.232  1.126   8.937   1.00 0.00 ? 112 LEU A HD23 3  
ATOM 5030  N N    . GLU A 1 113 ? -3.146  -0.235  12.066  1.00 0.00 ? 113 GLU A N    3  
ATOM 5031  C CA   . GLU A 1 113 ? -3.861  -1.471  11.795  1.00 0.00 ? 113 GLU A CA   3  
ATOM 5032  C C    . GLU A 1 113 ? -4.034  -1.667  10.289  1.00 0.00 ? 113 GLU A C    3  
ATOM 5033  O O    . GLU A 1 113 ? -4.238  -0.703  9.553   1.00 0.00 ? 113 GLU A O    3  
ATOM 5034  C CB   . GLU A 1 113 ? -5.214  -1.491  12.509  1.00 0.00 ? 113 GLU A CB   3  
ATOM 5035  C CG   . GLU A 1 113 ? -5.971  -2.786  12.213  1.00 0.00 ? 113 GLU A CG   3  
ATOM 5036  C CD   . GLU A 1 113 ? -7.280  -2.497  11.475  1.00 0.00 ? 113 GLU A CD   3  
ATOM 5037  O OE1  . GLU A 1 113 ? -8.118  -1.780  12.062  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 5038  O OE2  . GLU A 1 113 ? -7.414  -3.001  10.338  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 5039  H H    . GLU A 1 113 ? -3.700  0.594   12.000  1.00 0.00 ? 113 GLU A H    3  
ATOM 5040  H HA   . GLU A 1 113 ? -3.231  -2.264  12.202  1.00 0.00 ? 113 GLU A HA   3  
ATOM 5041  H HB3  . GLU A 1 113 ? -5.809  -0.635  12.191  1.00 0.00 ? 113 GLU A HB3  3  
ATOM 5042  H HG3  . GLU A 1 113 ? -6.184  -3.308  13.146  1.00 0.00 ? 113 GLU A HG3  3  
ATOM 5043  N N    . LEU A 1 114 ? -3.944  -2.922  9.872   1.00 0.00 ? 114 LEU A N    3  
ATOM 5044  C CA   . LEU A 1 114 ? -4.087  -3.257  8.466   1.00 0.00 ? 114 LEU A CA   3  
ATOM 5045  C C    . LEU A 1 114 ? -5.121  -4.375  8.315   1.00 0.00 ? 114 LEU A C    3  
ATOM 5046  O O    . LEU A 1 114 ? -5.825  -4.707  9.268   1.00 0.00 ? 114 LEU A O    3  
ATOM 5047  C CB   . LEU A 1 114 ? -2.726  -3.591  7.852   1.00 0.00 ? 114 LEU A CB   3  
ATOM 5048  C CG   . LEU A 1 114 ? -1.668  -2.488  7.927   1.00 0.00 ? 114 LEU A CG   3  
ATOM 5049  C CD1  . LEU A 1 114 ? -0.258  -3.074  7.850   1.00 0.00 ? 114 LEU A CD1  3  
ATOM 5050  C CD2  . LEU A 1 114 ? -1.907  -1.425  6.852   1.00 0.00 ? 114 LEU A CD2  3  
ATOM 5051  H H    . LEU A 1 114 ? -3.777  -3.701  10.478  1.00 0.00 ? 114 LEU A H    3  
ATOM 5052  H HA   . LEU A 1 114 ? -4.462  -2.369  7.955   1.00 0.00 ? 114 LEU A HA   3  
ATOM 5053  H HB3  . LEU A 1 114 ? -2.876  -3.853  6.804   1.00 0.00 ? 114 LEU A HB3  3  
ATOM 5054  H HG   . LEU A 1 114 ? -1.758  -1.992  8.894   1.00 0.00 ? 114 LEU A HG   3  
ATOM 5055  H HD11 . LEU A 1 114 ? -0.296  -4.141  8.071   1.00 0.00 ? 114 LEU A HD11 3  
ATOM 5056  H HD12 . LEU A 1 114 ? 0.144   -2.926  6.848   1.00 0.00 ? 114 LEU A HD12 3  
ATOM 5057  H HD13 . LEU A 1 114 ? 0.384   -2.576  8.577   1.00 0.00 ? 114 LEU A HD13 3  
ATOM 5058  H HD21 . LEU A 1 114 ? -2.908  -1.011  6.966   1.00 0.00 ? 114 LEU A HD21 3  
ATOM 5059  H HD22 . LEU A 1 114 ? -1.170  -0.630  6.956   1.00 0.00 ? 114 LEU A HD22 3  
ATOM 5060  H HD23 . LEU A 1 114 ? -1.812  -1.879  5.865   1.00 0.00 ? 114 LEU A HD23 3  
ATOM 5061  N N    . SER A 1 115 ? -5.179  -4.926  7.112   1.00 0.00 ? 115 SER A N    3  
ATOM 5062  C CA   . SER A 1 115 ? -6.114  -6.000  6.823   1.00 0.00 ? 115 SER A CA   3  
ATOM 5063  C C    . SER A 1 115 ? -5.793  -6.622  5.462   1.00 0.00 ? 115 SER A C    3  
ATOM 5064  O O    . SER A 1 115 ? -5.582  -5.908  4.484   1.00 0.00 ? 115 SER A O    3  
ATOM 5065  C CB   . SER A 1 115 ? -7.557  -5.494  6.849   1.00 0.00 ? 115 SER A CB   3  
ATOM 5066  O OG   . SER A 1 115 ? -7.727  -4.405  7.753   1.00 0.00 ? 115 SER A OG   3  
ATOM 5067  H H    . SER A 1 115 ? -4.601  -4.650  6.343   1.00 0.00 ? 115 SER A H    3  
ATOM 5068  H HA   . SER A 1 115 ? -5.971  -6.728  7.621   1.00 0.00 ? 115 SER A HA   3  
ATOM 5069  H HB3  . SER A 1 115 ? -8.222  -6.310  7.135   1.00 0.00 ? 115 SER A HB3  3  
ATOM 5070  H HG   . SER A 1 115 ? -8.103  -4.734  8.618   1.00 0.00 ? 115 SER A HG   3  
ATOM 5071  N N    . VAL A 1 116 ? -5.767  -7.947  5.446   1.00 0.00 ? 116 VAL A N    3  
ATOM 5072  C CA   . VAL A 1 116 ? -5.476  -8.673  4.221   1.00 0.00 ? 116 VAL A CA   3  
ATOM 5073  C C    . VAL A 1 116 ? -6.464  -9.832  4.073   1.00 0.00 ? 116 VAL A C    3  
ATOM 5074  O O    . VAL A 1 116 ? -7.497  -9.860  4.741   1.00 0.00 ? 116 VAL A O    3  
ATOM 5075  C CB   . VAL A 1 116 ? -4.015  -9.129  4.218   1.00 0.00 ? 116 VAL A CB   3  
ATOM 5076  C CG1  . VAL A 1 116 ? -3.074  -7.954  4.486   1.00 0.00 ? 116 VAL A CG1  3  
ATOM 5077  C CG2  . VAL A 1 116 ? -3.790  -10.253 5.230   1.00 0.00 ? 116 VAL A CG2  3  
ATOM 5078  H H    . VAL A 1 116 ? -5.940  -8.520  6.247   1.00 0.00 ? 116 VAL A H    3  
ATOM 5079  H HA   . VAL A 1 116 ? -5.616  -7.985  3.388   1.00 0.00 ? 116 VAL A HA   3  
ATOM 5080  H HB   . VAL A 1 116 ? -3.789  -9.520  3.226   1.00 0.00 ? 116 VAL A HB   3  
ATOM 5081  H HG11 . VAL A 1 116 ? -2.147  -8.096  3.929   1.00 0.00 ? 116 VAL A HG11 3  
ATOM 5082  H HG12 . VAL A 1 116 ? -3.550  -7.026  4.166   1.00 0.00 ? 116 VAL A HG12 3  
ATOM 5083  H HG13 . VAL A 1 116 ? -2.853  -7.899  5.552   1.00 0.00 ? 116 VAL A HG13 3  
ATOM 5084  H HG21 . VAL A 1 116 ? -4.752  -10.604 5.603   1.00 0.00 ? 116 VAL A HG21 3  
ATOM 5085  H HG22 . VAL A 1 116 ? -3.265  -11.077 4.746   1.00 0.00 ? 116 VAL A HG22 3  
ATOM 5086  H HG23 . VAL A 1 116 ? -3.191  -9.880  6.061   1.00 0.00 ? 116 VAL A HG23 3  
ATOM 5087  N N    . MET A 1 117 ? -6.112  -10.759 3.195   1.00 0.00 ? 117 MET A N    3  
ATOM 5088  C CA   . MET A 1 117 ? -6.956  -11.917 2.952   1.00 0.00 ? 117 MET A CA   3  
ATOM 5089  C C    . MET A 1 117 ? -6.111  -13.165 2.692   1.00 0.00 ? 117 MET A C    3  
ATOM 5090  O O    . MET A 1 117 ? -5.458  -13.274 1.655   1.00 0.00 ? 117 MET A O    3  
ATOM 5091  C CB   . MET A 1 117 ? -7.854  -11.650 1.743   1.00 0.00 ? 117 MET A CB   3  
ATOM 5092  C CG   . MET A 1 117 ? -8.978  -10.674 2.100   1.00 0.00 ? 117 MET A CG   3  
ATOM 5093  S SD   . MET A 1 117 ? -10.564 -11.410 1.746   1.00 0.00 ? 117 MET A SD   3  
ATOM 5094  C CE   . MET A 1 117 ? -11.022 -11.958 3.382   1.00 0.00 ? 117 MET A CE   3  
ATOM 5095  H H    . MET A 1 117 ? -5.270  -10.728 2.655   1.00 0.00 ? 117 MET A H    3  
ATOM 5096  H HA   . MET A 1 117 ? -7.542  -12.050 3.861   1.00 0.00 ? 117 MET A HA   3  
ATOM 5097  H HB3  . MET A 1 117 ? -8.283  -12.587 1.388   1.00 0.00 ? 117 MET A HB3  3  
ATOM 5098  H HG3  . MET A 1 117 ? -8.861  -9.749  1.533   1.00 0.00 ? 117 MET A HG3  3  
ATOM 5099  H HE1  . MET A 1 117 ? -10.130 -12.038 4.002   1.00 0.00 ? 117 MET A HE1  3  
ATOM 5100  H HE2  . MET A 1 117 ? -11.711 -11.239 3.826   1.00 0.00 ? 117 MET A HE2  3  
ATOM 5101  H HE3  . MET A 1 117 ? -11.508 -12.932 3.315   1.00 0.00 ? 117 MET A HE3  3  
ATOM 5102  N N    . PRO A 1 118 ? -6.151  -14.101 3.679   1.00 0.00 ? 118 PRO A N    3  
ATOM 5103  C CA   . PRO A 1 118 ? -5.397  -15.339 3.567   1.00 0.00 ? 118 PRO A CA   3  
ATOM 5104  C C    . PRO A 1 118 ? -6.062  -16.301 2.580   1.00 0.00 ? 118 PRO A C    3  
ATOM 5105  O O    . PRO A 1 118 ? -7.280  -16.274 2.409   1.00 0.00 ? 118 PRO A O    3  
ATOM 5106  C CB   . PRO A 1 118 ? -5.334  -15.890 4.983   1.00 0.00 ? 118 PRO A CB   3  
ATOM 5107  C CG   . PRO A 1 118 ? -6.443  -15.190 5.751   1.00 0.00 ? 118 PRO A CG   3  
ATOM 5108  C CD   . PRO A 1 118 ? -6.912  -14.008 4.921   1.00 0.00 ? 118 PRO A CD   3  
ATOM 5109  H HA   . PRO A 1 118 ? -4.484  -15.158 3.200   1.00 0.00 ? 118 PRO A HA   3  
ATOM 5110  H HB3  . PRO A 1 118 ? -4.362  -15.694 5.435   1.00 0.00 ? 118 PRO A HB3  3  
ATOM 5111  H HG3  . PRO A 1 118 ? -6.081  -14.854 6.723   1.00 0.00 ? 118 PRO A HG3  3  
ATOM 5112  H HD3  . PRO A 1 118 ? -6.721  -13.064 5.432   1.00 0.00 ? 118 PRO A HD3  3  
ATOM 5113  N N    . LYS A 1 119 ? -5.234  -17.126 1.958   1.00 0.00 ? 119 LYS A N    3  
ATOM 5114  C CA   . LYS A 1 119 ? -5.727  -18.093 0.993   1.00 0.00 ? 119 LYS A CA   3  
ATOM 5115  C C    . LYS A 1 119 ? -5.679  -19.492 1.609   1.00 0.00 ? 119 LYS A C    3  
ATOM 5116  O O    . LYS A 1 119 ? -4.920  -19.736 2.547   1.00 0.00 ? 119 LYS A O    3  
ATOM 5117  C CB   . LYS A 1 119 ? -4.957  -17.976 -0.324  1.00 0.00 ? 119 LYS A CB   3  
ATOM 5118  C CG   . LYS A 1 119 ? -5.898  -17.625 -1.479  1.00 0.00 ? 119 LYS A CG   3  
ATOM 5119  C CD   . LYS A 1 119 ? -5.131  -17.524 -2.800  1.00 0.00 ? 119 LYS A CD   3  
ATOM 5120  C CE   . LYS A 1 119 ? -4.904  -16.063 -3.192  1.00 0.00 ? 119 LYS A CE   3  
ATOM 5121  N NZ   . LYS A 1 119 ? -4.125  -15.978 -4.447  1.00 0.00 ? 119 LYS A NZ   3  
ATOM 5122  H H    . LYS A 1 119 ? -4.245  -17.140 2.104   1.00 0.00 ? 119 LYS A H    3  
ATOM 5123  H HA   . LYS A 1 119 ? -6.766  -17.843 0.782   1.00 0.00 ? 119 LYS A HA   3  
ATOM 5124  H HB3  . LYS A 1 119 ? -4.448  -18.916 -0.538  1.00 0.00 ? 119 LYS A HB3  3  
ATOM 5125  H HG3  . LYS A 1 119 ? -6.399  -16.679 -1.272  1.00 0.00 ? 119 LYS A HG3  3  
ATOM 5126  H HD3  . LYS A 1 119 ? -5.687  -18.033 -3.587  1.00 0.00 ? 119 LYS A HD3  3  
ATOM 5127  H HE3  . LYS A 1 119 ? -4.376  -15.543 -2.392  1.00 0.00 ? 119 LYS A HE3  3  
ATOM 5128  H HZ1  . LYS A 1 119 ? -4.004  -15.017 -4.699  1.00 0.00 ? 119 LYS A HZ1  3  
ATOM 5129  H HZ2  . LYS A 1 119 ? -3.230  -16.403 -4.313  1.00 0.00 ? 119 LYS A HZ2  3  
ATOM 5130  H HZ3  . LYS A 1 119 ? -4.615  -16.455 -5.177  1.00 0.00 ? 119 LYS A HZ3  3  
ATOM 5131  N N    . ASP A 1 120 ? -6.499  -20.375 1.059   1.00 0.00 ? 120 ASP A N    3  
ATOM 5132  C CA   . ASP A 1 120 ? -6.560  -21.744 1.543   1.00 0.00 ? 120 ASP A CA   3  
ATOM 5133  C C    . ASP A 1 120 ? -5.248  -22.457 1.209   1.00 0.00 ? 120 ASP A C    3  
ATOM 5134  O O    . ASP A 1 120 ? -4.576  -22.976 2.099   1.00 0.00 ? 120 ASP A O    3  
ATOM 5135  C CB   . ASP A 1 120 ? -7.701  -22.515 0.876   1.00 0.00 ? 120 ASP A CB   3  
ATOM 5136  C CG   . ASP A 1 120 ? -9.084  -22.276 1.485   1.00 0.00 ? 120 ASP A CG   3  
ATOM 5137  O OD1  . ASP A 1 120 ? -9.381  -22.943 2.500   1.00 0.00 ? 120 ASP A OD1  3  
ATOM 5138  O OD2  . ASP A 1 120 ? -9.814  -21.432 0.922   1.00 0.00 ? 120 ASP A OD2  3  
ATOM 5139  H H    . ASP A 1 120 ? -7.113  -20.169 0.297   1.00 0.00 ? 120 ASP A H    3  
ATOM 5140  H HA   . ASP A 1 120 ? -6.727  -21.660 2.618   1.00 0.00 ? 120 ASP A HA   3  
ATOM 5141  H HB3  . ASP A 1 120 ? -7.478  -23.580 0.927   1.00 0.00 ? 120 ASP A HB3  3  
ATOM 5142  N N    . SER A 1 121 ? -4.924  -22.461 -0.075  1.00 0.00 ? 121 SER A N    3  
ATOM 5143  C CA   . SER A 1 121 ? -3.705  -23.102 -0.539  1.00 0.00 ? 121 SER A CA   3  
ATOM 5144  C C    . SER A 1 121 ? -2.484  -22.376 0.028   1.00 0.00 ? 121 SER A C    3  
ATOM 5145  O O    . SER A 1 121 ? -2.573  -21.209 0.410   1.00 0.00 ? 121 SER A O    3  
ATOM 5146  C CB   . SER A 1 121 ? -3.646  -23.131 -2.067  1.00 0.00 ? 121 SER A CB   3  
ATOM 5147  O OG   . SER A 1 121 ? -3.327  -24.429 -2.564  1.00 0.00 ? 121 SER A OG   3  
ATOM 5148  H H    . SER A 1 121 ? -5.478  -22.037 -0.793  1.00 0.00 ? 121 SER A H    3  
ATOM 5149  H HA   . SER A 1 121 ? -3.753  -24.123 -0.158  1.00 0.00 ? 121 SER A HA   3  
ATOM 5150  H HB3  . SER A 1 121 ? -2.899  -22.417 -2.414  1.00 0.00 ? 121 SER A HB3  3  
ATOM 5151  H HG   . SER A 1 121 ? -2.438  -24.722 -2.213  1.00 0.00 ? 121 SER A HG   3  
ATOM 5152  N N    . GLY A 1 122 ? -1.370  -23.094 0.062   1.00 0.00 ? 122 GLY A N    3  
ATOM 5153  C CA   . GLY A 1 122 ? -0.134  -22.531 0.575   1.00 0.00 ? 122 GLY A CA   3  
ATOM 5154  C C    . GLY A 1 122 ? 0.570   -23.516 1.511   1.00 0.00 ? 122 GLY A C    3  
ATOM 5155  O O    . GLY A 1 122 ? 0.145   -23.706 2.650   1.00 0.00 ? 122 GLY A O    3  
ATOM 5156  H H    . GLY A 1 122 ? -1.308  -24.042 -0.251  1.00 0.00 ? 122 GLY A H    3  
ATOM 5157  H HA2  . GLY A 1 122 ? 0.526   -22.278 -0.255  1.00 0.00 ? 122 GLY A HA2  3  
ATOM 5158  H HA3  . GLY A 1 122 ? -0.345  -21.604 1.108   1.00 0.00 ? 122 GLY A HA3  3  
ATOM 5159  N N    . PRO A 1 123 ? 1.661   -24.131 0.984   1.00 0.00 ? 123 PRO A N    3  
ATOM 5160  C CA   . PRO A 1 123 ? 2.427   -25.092 1.759   1.00 0.00 ? 123 PRO A CA   3  
ATOM 5161  C C    . PRO A 1 123 ? 3.290   -24.386 2.808   1.00 0.00 ? 123 PRO A C    3  
ATOM 5162  O O    . PRO A 1 123 ? 3.472   -23.170 2.752   1.00 0.00 ? 123 PRO A O    3  
ATOM 5163  C CB   . PRO A 1 123 ? 3.247   -25.860 0.736   1.00 0.00 ? 123 PRO A CB   3  
ATOM 5164  C CG   . PRO A 1 123 ? 3.263   -24.999 -0.517  1.00 0.00 ? 123 PRO A CG   3  
ATOM 5165  C CD   . PRO A 1 123 ? 2.193   -23.931 -0.360  1.00 0.00 ? 123 PRO A CD   3  
ATOM 5166  H HA   . PRO A 1 123 ? 1.814   -25.694 2.270   1.00 0.00 ? 123 PRO A HA   3  
ATOM 5167  H HB3  . PRO A 1 123 ? 2.805   -26.835 0.534   1.00 0.00 ? 123 PRO A HB3  3  
ATOM 5168  H HG3  . PRO A 1 123 ? 3.068   -25.608 -1.400  1.00 0.00 ? 123 PRO A HG3  3  
ATOM 5169  H HD3  . PRO A 1 123 ? 1.414   -24.037 -1.116  1.00 0.00 ? 123 PRO A HD3  3  
ATOM 5170  N N    . SER A 1 124 ? 3.797   -25.178 3.741   1.00 0.00 ? 124 SER A N    3  
ATOM 5171  C CA   . SER A 1 124 ? 4.636   -24.644 4.801   1.00 0.00 ? 124 SER A CA   3  
ATOM 5172  C C    . SER A 1 124 ? 3.812   -23.730 5.709   1.00 0.00 ? 124 SER A C    3  
ATOM 5173  O O    . SER A 1 124 ? 2.942   -22.999 5.237   1.00 0.00 ? 124 SER A O    3  
ATOM 5174  C CB   . SER A 1 124 ? 5.832   -23.884 4.226   1.00 0.00 ? 124 SER A CB   3  
ATOM 5175  O OG   . SER A 1 124 ? 6.650   -24.716 3.408   1.00 0.00 ? 124 SER A OG   3  
ATOM 5176  H H    . SER A 1 124 ? 3.645   -26.165 3.780   1.00 0.00 ? 124 SER A H    3  
ATOM 5177  H HA   . SER A 1 124 ? 4.991   -25.514 5.354   1.00 0.00 ? 124 SER A HA   3  
ATOM 5178  H HB3  . SER A 1 124 ? 6.430   -23.479 5.042   1.00 0.00 ? 124 SER A HB3  3  
ATOM 5179  H HG   . SER A 1 124 ? 7.430   -24.193 3.061   1.00 0.00 ? 124 SER A HG   3  
ATOM 5180  N N    . SER A 1 125 ? 4.117   -23.798 6.997   1.00 0.00 ? 125 SER A N    3  
ATOM 5181  C CA   . SER A 1 125 ? 3.414   -22.984 7.976   1.00 0.00 ? 125 SER A CA   3  
ATOM 5182  C C    . SER A 1 125 ? 4.272   -21.778 8.366   1.00 0.00 ? 125 SER A C    3  
ATOM 5183  O O    . SER A 1 125 ? 3.864   -20.635 8.175   1.00 0.00 ? 125 SER A O    3  
ATOM 5184  C CB   . SER A 1 125 ? 3.055   -23.805 9.217   1.00 0.00 ? 125 SER A CB   3  
ATOM 5185  O OG   . SER A 1 125 ? 2.354   -23.028 10.184  1.00 0.00 ? 125 SER A OG   3  
ATOM 5186  H H    . SER A 1 125 ? 4.825   -24.394 7.373   1.00 0.00 ? 125 SER A H    3  
ATOM 5187  H HA   . SER A 1 125 ? 2.501   -22.659 7.478   1.00 0.00 ? 125 SER A HA   3  
ATOM 5188  H HB3  . SER A 1 125 ? 3.965   -24.205 9.663   1.00 0.00 ? 125 SER A HB3  3  
ATOM 5189  H HG   . SER A 1 125 ? 2.917   -22.914 11.003  1.00 0.00 ? 125 SER A HG   3  
ATOM 5190  N N    . GLY A 1 126 ? 5.445   -22.078 8.905   1.00 0.00 ? 126 GLY A N    3  
ATOM 5191  C CA   . GLY A 1 126 ? 6.364   -21.033 9.323   1.00 0.00 ? 126 GLY A CA   3  
ATOM 5192  C C    . GLY A 1 126 ? 7.644   -21.631 9.910   1.00 0.00 ? 126 GLY A C    3  
ATOM 5193  O O    . GLY A 1 126 ? 8.378   -22.335 9.219   1.00 0.00 ? 126 GLY A O    3  
ATOM 5194  H H    . GLY A 1 126 ? 5.769   -23.011 9.057   1.00 0.00 ? 126 GLY A H    3  
ATOM 5195  H HA2  . GLY A 1 126 ? 6.612   -20.400 8.472   1.00 0.00 ? 126 GLY A HA2  3  
ATOM 5196  H HA3  . GLY A 1 126 ? 5.883   -20.396 10.065  1.00 0.00 ? 126 GLY A HA3  3  
ATOM 5197  N N    . GLY A 1 1   ? -18.527 -9.218  28.616  1.00 0.00 ? 1   GLY A N    4  
ATOM 5198  C CA   . GLY A 1 1   ? -17.802 -8.777  27.435  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5199  C C    . GLY A 1 1   ? -17.554 -9.945  26.477  1.00 0.00 ? 1   GLY A C    4  
ATOM 5200  O O    . GLY A 1 1   ? -17.529 -11.101 26.896  1.00 0.00 ? 1   GLY A O    4  
ATOM 5201  H H1   . GLY A 1 1   ? -18.844 -10.165 28.587  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5202  H HA2  . GLY A 1 1   ? -18.370 -7.999  26.925  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5203  H HA3  . GLY A 1 1   ? -16.850 -8.337  27.731  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5204  N N    . SER A 1 2   ? -17.375 -9.601  25.211  1.00 0.00 ? 2   SER A N    4  
ATOM 5205  C CA   . SER A 1 2   ? -17.129 -10.605 24.190  1.00 0.00 ? 2   SER A CA   4  
ATOM 5206  C C    . SER A 1 2   ? -16.629 -9.936  22.907  1.00 0.00 ? 2   SER A C    4  
ATOM 5207  O O    . SER A 1 2   ? -16.821 -8.737  22.713  1.00 0.00 ? 2   SER A O    4  
ATOM 5208  C CB   . SER A 1 2   ? -18.390 -11.422 23.905  1.00 0.00 ? 2   SER A CB   4  
ATOM 5209  O OG   . SER A 1 2   ? -18.318 -12.729 24.469  1.00 0.00 ? 2   SER A OG   4  
ATOM 5210  H H    . SER A 1 2   ? -17.396 -8.657  24.879  1.00 0.00 ? 2   SER A H    4  
ATOM 5211  H HA   . SER A 1 2   ? -16.359 -11.256 24.606  1.00 0.00 ? 2   SER A HA   4  
ATOM 5212  H HB3  . SER A 1 2   ? -18.538 -11.498 22.828  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5213  H HG   . SER A 1 2   ? -18.464 -13.416 23.757  1.00 0.00 ? 2   SER A HG   4  
ATOM 5214  N N    . SER A 1 3   ? -15.998 -10.741 22.065  1.00 0.00 ? 3   SER A N    4  
ATOM 5215  C CA   . SER A 1 3   ? -15.470 -10.243 20.807  1.00 0.00 ? 3   SER A CA   4  
ATOM 5216  C C    . SER A 1 3   ? -15.891 -11.164 19.661  1.00 0.00 ? 3   SER A C    4  
ATOM 5217  O O    . SER A 1 3   ? -16.501 -10.714 18.691  1.00 0.00 ? 3   SER A O    4  
ATOM 5218  C CB   . SER A 1 3   ? -13.945 -10.124 20.859  1.00 0.00 ? 3   SER A CB   4  
ATOM 5219  O OG   . SER A 1 3   ? -13.426 -9.411  19.739  1.00 0.00 ? 3   SER A OG   4  
ATOM 5220  H H    . SER A 1 3   ? -15.846 -11.716 22.232  1.00 0.00 ? 3   SER A H    4  
ATOM 5221  H HA   . SER A 1 3   ? -15.906 -9.253  20.684  1.00 0.00 ? 3   SER A HA   4  
ATOM 5222  H HB3  . SER A 1 3   ? -13.504 -11.121 20.889  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5223  H HG   . SER A 1 3   ? -12.427 -9.404  19.770  1.00 0.00 ? 3   SER A HG   4  
ATOM 5224  N N    . GLY A 1 4   ? -15.551 -12.436 19.810  1.00 0.00 ? 4   GLY A N    4  
ATOM 5225  C CA   . GLY A 1 4   ? -15.887 -13.423 18.799  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5226  C C    . GLY A 1 4   ? -14.647 -14.202 18.358  1.00 0.00 ? 4   GLY A C    4  
ATOM 5227  O O    . GLY A 1 4   ? -13.673 -14.299 19.104  1.00 0.00 ? 4   GLY A O    4  
ATOM 5228  H H    . GLY A 1 4   ? -15.054 -12.793 20.601  1.00 0.00 ? 4   GLY A H    4  
ATOM 5229  H HA2  . GLY A 1 4   ? -16.633 -14.114 19.193  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5230  H HA3  . GLY A 1 4   ? -16.336 -12.930 17.936  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5231  N N    . SER A 1 5   ? -14.720 -14.739 17.148  1.00 0.00 ? 5   SER A N    4  
ATOM 5232  C CA   . SER A 1 5   ? -13.616 -15.505 16.600  1.00 0.00 ? 5   SER A CA   4  
ATOM 5233  C C    . SER A 1 5   ? -13.865 -15.798 15.119  1.00 0.00 ? 5   SER A C    4  
ATOM 5234  O O    . SER A 1 5   ? -15.011 -15.917 14.692  1.00 0.00 ? 5   SER A O    4  
ATOM 5235  C CB   . SER A 1 5   ? -13.414 -16.810 17.373  1.00 0.00 ? 5   SER A CB   4  
ATOM 5236  O OG   . SER A 1 5   ? -12.250 -16.771 18.192  1.00 0.00 ? 5   SER A OG   4  
ATOM 5237  H H    . SER A 1 5   ? -15.516 -14.655 16.549  1.00 0.00 ? 5   SER A H    4  
ATOM 5238  H HA   . SER A 1 5   ? -12.736 -14.871 16.723  1.00 0.00 ? 5   SER A HA   4  
ATOM 5239  H HB3  . SER A 1 5   ? -13.334 -17.639 16.668  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5240  H HG   . SER A 1 5   ? -11.462 -16.471 17.655  1.00 0.00 ? 5   SER A HG   4  
ATOM 5241  N N    . SER A 1 6   ? -12.773 -15.904 14.378  1.00 0.00 ? 6   SER A N    4  
ATOM 5242  C CA   . SER A 1 6   ? -12.860 -16.180 12.954  1.00 0.00 ? 6   SER A CA   4  
ATOM 5243  C C    . SER A 1 6   ? -13.654 -15.077 12.254  1.00 0.00 ? 6   SER A C    4  
ATOM 5244  O O    . SER A 1 6   ? -14.303 -14.264 12.910  1.00 0.00 ? 6   SER A O    4  
ATOM 5245  C CB   . SER A 1 6   ? -13.503 -17.544 12.694  1.00 0.00 ? 6   SER A CB   4  
ATOM 5246  O OG   . SER A 1 6   ? -12.535 -18.587 12.630  1.00 0.00 ? 6   SER A OG   4  
ATOM 5247  H H    . SER A 1 6   ? -11.843 -15.805 14.733  1.00 0.00 ? 6   SER A H    4  
ATOM 5248  H HA   . SER A 1 6   ? -11.829 -16.193 12.599  1.00 0.00 ? 6   SER A HA   4  
ATOM 5249  H HB3  . SER A 1 6   ? -14.062 -17.509 11.760  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5250  H HG   . SER A 1 6   ? -11.765 -18.379 13.233  1.00 0.00 ? 6   SER A HG   4  
ATOM 5251  N N    . GLY A 1 7   ? -13.577 -15.083 10.931  1.00 0.00 ? 7   GLY A N    4  
ATOM 5252  C CA   . GLY A 1 7   ? -14.281 -14.093 10.135  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5253  C C    . GLY A 1 7   ? -14.087 -14.351 8.640   1.00 0.00 ? 7   GLY A C    4  
ATOM 5254  O O    . GLY A 1 7   ? -14.144 -15.495 8.192   1.00 0.00 ? 7   GLY A O    4  
ATOM 5255  H H    . GLY A 1 7   ? -13.046 -15.748 10.406  1.00 0.00 ? 7   GLY A H    4  
ATOM 5256  H HA2  . GLY A 1 7   ? -15.344 -14.116 10.377  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5257  H HA3  . GLY A 1 7   ? -13.919 -13.095 10.386  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5258  N N    . GLY A 1 8   ? -13.861 -13.270 7.908   1.00 0.00 ? 8   GLY A N    4  
ATOM 5259  C CA   . GLY A 1 8   ? -13.658 -13.364 6.474   1.00 0.00 ? 8   GLY A CA   4  
ATOM 5260  C C    . GLY A 1 8   ? -12.269 -12.857 6.082   1.00 0.00 ? 8   GLY A C    4  
ATOM 5261  O O    . GLY A 1 8   ? -11.365 -13.650 5.824   1.00 0.00 ? 8   GLY A O    4  
ATOM 5262  H H    . GLY A 1 8   ? -13.817 -12.343 8.282   1.00 0.00 ? 8   GLY A H    4  
ATOM 5263  H HA2  . GLY A 1 8   ? -13.774 -14.401 6.155   1.00 0.00 ? 8   GLY A HA2  4  
ATOM 5264  H HA3  . GLY A 1 8   ? -14.421 -12.785 5.955   1.00 0.00 ? 8   GLY A HA3  4  
ATOM 5265  N N    . PRO A 1 9   ? -12.141 -11.505 6.046   1.00 0.00 ? 9   PRO A N    4  
ATOM 5266  C CA   . PRO A 1 9   ? -10.877 -10.882 5.689   1.00 0.00 ? 9   PRO A CA   4  
ATOM 5267  C C    . PRO A 1 9   ? -9.873  -10.982 6.839   1.00 0.00 ? 9   PRO A C    4  
ATOM 5268  O O    . PRO A 1 9   ? -10.253 -11.244 7.980   1.00 0.00 ? 9   PRO A O    4  
ATOM 5269  C CB   . PRO A 1 9   ? -11.232 -9.447  5.334   1.00 0.00 ? 9   PRO A CB   4  
ATOM 5270  C CG   . PRO A 1 9   ? -12.599 -9.191  5.948   1.00 0.00 ? 9   PRO A CG   4  
ATOM 5271  C CD   . PRO A 1 9   ? -13.190 -10.534 6.344   1.00 0.00 ? 9   PRO A CD   4  
ATOM 5272  H HA   . PRO A 1 9   ? -10.458 -11.361 4.919   1.00 0.00 ? 9   PRO A HA   4  
ATOM 5273  H HB3  . PRO A 1 9   ? -11.256 -9.307  4.254   1.00 0.00 ? 9   PRO A HB3  4  
ATOM 5274  H HG3  . PRO A 1 9   ? -13.249 -8.684  5.234   1.00 0.00 ? 9   PRO A HG3  4  
ATOM 5275  H HD3  . PRO A 1 9   ? -14.098 -10.748 5.780   1.00 0.00 ? 9   PRO A HD3  4  
ATOM 5276  N N    . LYS A 1 10  ? -8.610  -10.765 6.501   1.00 0.00 ? 10  LYS A N    4  
ATOM 5277  C CA   . LYS A 1 10  ? -7.549  -10.828 7.491   1.00 0.00 ? 10  LYS A CA   4  
ATOM 5278  C C    . LYS A 1 10  ? -7.355  -9.444  8.112   1.00 0.00 ? 10  LYS A C    4  
ATOM 5279  O O    . LYS A 1 10  ? -7.538  -8.427  7.444   1.00 0.00 ? 10  LYS A O    4  
ATOM 5280  C CB   . LYS A 1 10  ? -6.276  -11.409 6.874   1.00 0.00 ? 10  LYS A CB   4  
ATOM 5281  C CG   . LYS A 1 10  ? -5.074  -11.203 7.800   1.00 0.00 ? 10  LYS A CG   4  
ATOM 5282  C CD   . LYS A 1 10  ? -5.060  -12.246 8.921   1.00 0.00 ? 10  LYS A CD   4  
ATOM 5283  C CE   . LYS A 1 10  ? -3.627  -12.641 9.283   1.00 0.00 ? 10  LYS A CE   4  
ATOM 5284  N NZ   . LYS A 1 10  ? -3.625  -13.842 10.149  1.00 0.00 ? 10  LYS A NZ   4  
ATOM 5285  H H    . LYS A 1 10  ? -8.309  -10.552 5.572   1.00 0.00 ? 10  LYS A H    4  
ATOM 5286  H HA   . LYS A 1 10  ? -7.871  -11.515 8.273   1.00 0.00 ? 10  LYS A HA   4  
ATOM 5287  H HB3  . LYS A 1 10  ? -6.082  -10.935 5.913   1.00 0.00 ? 10  LYS A HB3  4  
ATOM 5288  H HG3  . LYS A 1 10  ? -5.109  -10.202 8.230   1.00 0.00 ? 10  LYS A HG3  4  
ATOM 5289  H HD3  . LYS A 1 10  ? -5.617  -13.129 8.608   1.00 0.00 ? 10  LYS A HD3  4  
ATOM 5290  H HE3  . LYS A 1 10  ? -3.134  -11.815 9.796   1.00 0.00 ? 10  LYS A HE3  4  
ATOM 5291  H HZ1  . LYS A 1 10  ? -2.961  -14.503 9.799   1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 5292  H HZ2  . LYS A 1 10  ? -3.376  -13.580 11.081  1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 5293  H HZ3  . LYS A 1 10  ? -4.536  -14.253 10.150  1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 5294  N N    . THR A 1 11  ? -6.986  -9.447  9.384   1.00 0.00 ? 11  THR A N    4  
ATOM 5295  C CA   . THR A 1 11  ? -6.765  -8.205  10.104  1.00 0.00 ? 11  THR A CA   4  
ATOM 5296  C C    . THR A 1 11  ? -5.478  -8.287  10.928  1.00 0.00 ? 11  THR A C    4  
ATOM 5297  O O    . THR A 1 11  ? -5.235  -9.282  11.609  1.00 0.00 ? 11  THR A O    4  
ATOM 5298  C CB   . THR A 1 11  ? -8.009  -7.918  10.947  1.00 0.00 ? 11  THR A CB   4  
ATOM 5299  O OG1  . THR A 1 11  ? -9.086  -8.017  10.020  1.00 0.00 ? 11  THR A OG1  4  
ATOM 5300  C CG2  . THR A 1 11  ? -8.067  -6.468  11.432  1.00 0.00 ? 11  THR A CG2  4  
ATOM 5301  H H    . THR A 1 11  ? -6.840  -10.277 9.922   1.00 0.00 ? 11  THR A H    4  
ATOM 5302  H HA   . THR A 1 11  ? -6.628  -7.405  9.376   1.00 0.00 ? 11  THR A HA   4  
ATOM 5303  H HB   . THR A 1 11  ? -8.080  -8.612  11.785  1.00 0.00 ? 11  THR A HB   4  
ATOM 5304  H HG1  . THR A 1 11  ? -9.456  -8.947  10.022  1.00 0.00 ? 11  THR A HG1  4  
ATOM 5305  H HG21 . THR A 1 11  ? -7.605  -6.395  12.417  1.00 0.00 ? 11  THR A HG21 4  
ATOM 5306  H HG22 . THR A 1 11  ? -7.531  -5.829  10.730  1.00 0.00 ? 11  THR A HG22 4  
ATOM 5307  H HG23 . THR A 1 11  ? -9.106  -6.148  11.494  1.00 0.00 ? 11  THR A HG23 4  
ATOM 5308  N N    . VAL A 1 12  ? -4.688  -7.227  10.840  1.00 0.00 ? 12  VAL A N    4  
ATOM 5309  C CA   . VAL A 1 12  ? -3.432  -7.166  11.568  1.00 0.00 ? 12  VAL A CA   4  
ATOM 5310  C C    . VAL A 1 12  ? -3.246  -5.758  12.138  1.00 0.00 ? 12  VAL A C    4  
ATOM 5311  O O    . VAL A 1 12  ? -3.621  -4.773  11.503  1.00 0.00 ? 12  VAL A O    4  
ATOM 5312  C CB   . VAL A 1 12  ? -2.280  -7.602  10.662  1.00 0.00 ? 12  VAL A CB   4  
ATOM 5313  C CG1  . VAL A 1 12  ? -2.112  -9.123  10.682  1.00 0.00 ? 12  VAL A CG1  4  
ATOM 5314  C CG2  . VAL A 1 12  ? -2.482  -7.092  9.234   1.00 0.00 ? 12  VAL A CG2  4  
ATOM 5315  H H    . VAL A 1 12  ? -4.894  -6.421  10.285  1.00 0.00 ? 12  VAL A H    4  
ATOM 5316  H HA   . VAL A 1 12  ? -3.498  -7.874  12.395  1.00 0.00 ? 12  VAL A HA   4  
ATOM 5317  H HB   . VAL A 1 12  ? -1.362  -7.158  11.050  1.00 0.00 ? 12  VAL A HB   4  
ATOM 5318  H HG11 . VAL A 1 12  ? -2.909  -9.585  10.099  1.00 0.00 ? 12  VAL A HG11 4  
ATOM 5319  H HG12 . VAL A 1 12  ? -1.146  -9.387  10.251  1.00 0.00 ? 12  VAL A HG12 4  
ATOM 5320  H HG13 . VAL A 1 12  ? -2.161  -9.481  11.710  1.00 0.00 ? 12  VAL A HG13 4  
ATOM 5321  H HG21 . VAL A 1 12  ? -1.553  -6.651  8.871   1.00 0.00 ? 12  VAL A HG21 4  
ATOM 5322  H HG22 . VAL A 1 12  ? -2.767  -7.922  8.588   1.00 0.00 ? 12  VAL A HG22 4  
ATOM 5323  H HG23 . VAL A 1 12  ? -3.269  -6.339  9.225   1.00 0.00 ? 12  VAL A HG23 4  
ATOM 5324  N N    . THR A 1 13  ? -2.665  -5.708  13.328  1.00 0.00 ? 13  THR A N    4  
ATOM 5325  C CA   . THR A 1 13  ? -2.424  -4.437  13.989  1.00 0.00 ? 13  THR A CA   4  
ATOM 5326  C C    . THR A 1 13  ? -0.923  -4.217  14.191  1.00 0.00 ? 13  THR A C    4  
ATOM 5327  O O    . THR A 1 13  ? -0.178  -5.170  14.413  1.00 0.00 ? 13  THR A O    4  
ATOM 5328  C CB   . THR A 1 13  ? -3.222  -4.425  15.295  1.00 0.00 ? 13  THR A CB   4  
ATOM 5329  O OG1  . THR A 1 13  ? -4.561  -4.687  14.886  1.00 0.00 ? 13  THR A OG1  4  
ATOM 5330  C CG2  . THR A 1 13  ? -3.290  -3.034  15.927  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5331  H H    . THR A 1 13  ? -2.363  -6.513  13.837  1.00 0.00 ? 13  THR A H    4  
ATOM 5332  H HA   . THR A 1 13  ? -2.779  -3.638  13.339  1.00 0.00 ? 13  THR A HA   4  
ATOM 5333  H HB   . THR A 1 13  ? -2.823  -5.154  16.001  1.00 0.00 ? 13  THR A HB   4  
ATOM 5334  H HG1  . THR A 1 13  ? -4.924  -3.904  14.383  1.00 0.00 ? 13  THR A HG1  4  
ATOM 5335  H HG21 . THR A 1 13  ? -2.302  -2.749  16.289  1.00 0.00 ? 13  THR A HG21 4  
ATOM 5336  H HG22 . THR A 1 13  ? -3.625  -2.313  15.182  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5337  H HG23 . THR A 1 13  ? -3.992  -3.047  16.761  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5338  N N    . LEU A 1 14  ? -0.526  -2.956  14.109  1.00 0.00 ? 14  LEU A N    4  
ATOM 5339  C CA   . LEU A 1 14  ? 0.872   -2.599  14.279  1.00 0.00 ? 14  LEU A CA   4  
ATOM 5340  C C    . LEU A 1 14  ? 0.984   -1.486  15.322  1.00 0.00 ? 14  LEU A C    4  
ATOM 5341  O O    . LEU A 1 14  ? 0.006   -0.798  15.610  1.00 0.00 ? 14  LEU A O    4  
ATOM 5342  C CB   . LEU A 1 14  ? 1.503   -2.247  12.932  1.00 0.00 ? 14  LEU A CB   4  
ATOM 5343  C CG   . LEU A 1 14  ? 1.655   -3.402  11.940  1.00 0.00 ? 14  LEU A CG   4  
ATOM 5344  C CD1  . LEU A 1 14  ? 0.361   -3.625  11.155  1.00 0.00 ? 14  LEU A CD1  4  
ATOM 5345  C CD2  . LEU A 1 14  ? 2.854   -3.178  11.016  1.00 0.00 ? 14  LEU A CD2  4  
ATOM 5346  H H    . LEU A 1 14  ? -1.141  -2.188  13.929  1.00 0.00 ? 14  LEU A H    4  
ATOM 5347  H HA   . LEU A 1 14  ? 1.389   -3.480  14.658  1.00 0.00 ? 14  LEU A HA   4  
ATOM 5348  H HB3  . LEU A 1 14  ? 2.489   -1.820  13.116  1.00 0.00 ? 14  LEU A HB3  4  
ATOM 5349  H HG   . LEU A 1 14  ? 1.851   -4.314  12.505  1.00 0.00 ? 14  LEU A HG   4  
ATOM 5350  H HD11 . LEU A 1 14  ? 0.435   -4.554  10.589  1.00 0.00 ? 14  LEU A HD11 4  
ATOM 5351  H HD12 . LEU A 1 14  ? -0.478  -3.686  11.848  1.00 0.00 ? 14  LEU A HD12 4  
ATOM 5352  H HD13 . LEU A 1 14  ? 0.205   -2.793  10.468  1.00 0.00 ? 14  LEU A HD13 4  
ATOM 5353  H HD21 . LEU A 1 14  ? 3.304   -2.209  11.235  1.00 0.00 ? 14  LEU A HD21 4  
ATOM 5354  H HD22 . LEU A 1 14  ? 3.590   -3.966  11.178  1.00 0.00 ? 14  LEU A HD22 4  
ATOM 5355  H HD23 . LEU A 1 14  ? 2.523   -3.198  9.978   1.00 0.00 ? 14  LEU A HD23 4  
ATOM 5356  N N    . LYS A 1 15  ? 2.188   -1.342  15.859  1.00 0.00 ? 15  LYS A N    4  
ATOM 5357  C CA   . LYS A 1 15  ? 2.441   -0.322  16.863  1.00 0.00 ? 15  LYS A CA   4  
ATOM 5358  C C    . LYS A 1 15  ? 3.586   0.578   16.392  1.00 0.00 ? 15  LYS A C    4  
ATOM 5359  O O    . LYS A 1 15  ? 4.647   0.088   16.008  1.00 0.00 ? 15  LYS A O    4  
ATOM 5360  C CB   . LYS A 1 15  ? 2.688   -0.966  18.229  1.00 0.00 ? 15  LYS A CB   4  
ATOM 5361  C CG   . LYS A 1 15  ? 1.432   -1.681  18.733  1.00 0.00 ? 15  LYS A CG   4  
ATOM 5362  C CD   . LYS A 1 15  ? 0.970   -1.099  20.070  1.00 0.00 ? 15  LYS A CD   4  
ATOM 5363  C CE   . LYS A 1 15  ? 0.248   -2.159  20.908  1.00 0.00 ? 15  LYS A CE   4  
ATOM 5364  N NZ   . LYS A 1 15  ? -0.701  -2.924  20.071  1.00 0.00 ? 15  LYS A NZ   4  
ATOM 5365  H H    . LYS A 1 15  ? 2.978   -1.904  15.619  1.00 0.00 ? 15  LYS A H    4  
ATOM 5366  H HA   . LYS A 1 15  ? 1.540   0.283   16.949  1.00 0.00 ? 15  LYS A HA   4  
ATOM 5367  H HB3  . LYS A 1 15  ? 2.989   -0.202  18.947  1.00 0.00 ? 15  LYS A HB3  4  
ATOM 5368  H HG3  . LYS A 1 15  ? 1.636   -2.745  18.845  1.00 0.00 ? 15  LYS A HG3  4  
ATOM 5369  H HD3  . LYS A 1 15  ? 0.304   -0.255  19.894  1.00 0.00 ? 15  LYS A HD3  4  
ATOM 5370  H HE3  . LYS A 1 15  ? -0.283  -1.680  21.729  1.00 0.00 ? 15  LYS A HE3  4  
ATOM 5371  H HZ1  . LYS A 1 15  ? -0.196  -3.580  19.509  1.00 0.00 ? 15  LYS A HZ1  4  
ATOM 5372  H HZ2  . LYS A 1 15  ? -1.344  -3.414  20.659  1.00 0.00 ? 15  LYS A HZ2  4  
ATOM 5373  H HZ3  . LYS A 1 15  ? -1.204  -2.294  19.477  1.00 0.00 ? 15  LYS A HZ3  4  
ATOM 5374  N N    . ARG A 1 16  ? 3.332   1.877   16.437  1.00 0.00 ? 16  ARG A N    4  
ATOM 5375  C CA   . ARG A 1 16  ? 4.328   2.850   16.020  1.00 0.00 ? 16  ARG A CA   4  
ATOM 5376  C C    . ARG A 1 16  ? 5.686   2.518   16.643  1.00 0.00 ? 16  ARG A C    4  
ATOM 5377  O O    . ARG A 1 16  ? 5.869   2.657   17.852  1.00 0.00 ? 16  ARG A O    4  
ATOM 5378  C CB   . ARG A 1 16  ? 3.919   4.266   16.430  1.00 0.00 ? 16  ARG A CB   4  
ATOM 5379  C CG   . ARG A 1 16  ? 4.939   5.295   15.935  1.00 0.00 ? 16  ARG A CG   4  
ATOM 5380  C CD   . ARG A 1 16  ? 4.242   6.478   15.262  1.00 0.00 ? 16  ARG A CD   4  
ATOM 5381  N NE   . ARG A 1 16  ? 5.046   7.708   15.442  1.00 0.00 ? 16  ARG A NE   4  
ATOM 5382  C CZ   . ARG A 1 16  ? 4.879   8.826   14.723  1.00 0.00 ? 16  ARG A CZ   4  
ATOM 5383  N NH1  . ARG A 1 16  ? 3.936   8.878   13.772  1.00 0.00 ? 16  ARG A NH1  4  
ATOM 5384  N NH2  . ARG A 1 16  ? 5.656   9.895   14.956  1.00 0.00 ? 16  ARG A NH2  4  
ATOM 5385  H H    . ARG A 1 16  ? 2.466   2.267   16.752  1.00 0.00 ? 16  ARG A H    4  
ATOM 5386  H HA   . ARG A 1 16  ? 4.362   2.764   14.934  1.00 0.00 ? 16  ARG A HA   4  
ATOM 5387  H HB3  . ARG A 1 16  ? 3.832   4.325   17.514  1.00 0.00 ? 16  ARG A HB3  4  
ATOM 5388  H HG3  . ARG A 1 16  ? 5.625   4.823   15.231  1.00 0.00 ? 16  ARG A HG3  4  
ATOM 5389  H HD3  . ARG A 1 16  ? 3.250   6.618   15.689  1.00 0.00 ? 16  ARG A HD3  4  
ATOM 5390  H HE   . ARG A 1 16  ? 5.759   7.703   16.143  1.00 0.00 ? 16  ARG A HE   4  
ATOM 5391  H HH11 . ARG A 1 16  ? 3.357   8.081   13.598  1.00 0.00 ? 16  ARG A HH11 4  
ATOM 5392  H HH12 . ARG A 1 16  ? 3.813   9.713   13.235  1.00 0.00 ? 16  ARG A HH12 4  
ATOM 5393  H HH21 . ARG A 1 16  ? 6.358   9.857   15.664  1.00 0.00 ? 16  ARG A HH21 4  
ATOM 5394  H HH22 . ARG A 1 16  ? 5.531   10.729  14.418  1.00 0.00 ? 16  ARG A HH22 4  
ATOM 5395  N N    . THR A 1 17  ? 6.602   2.088   15.789  1.00 0.00 ? 17  THR A N    4  
ATOM 5396  C CA   . THR A 1 17  ? 7.939   1.737   16.239  1.00 0.00 ? 17  THR A CA   4  
ATOM 5397  C C    . THR A 1 17  ? 8.938   1.849   15.086  1.00 0.00 ? 17  THR A C    4  
ATOM 5398  O O    . THR A 1 17  ? 8.639   1.450   13.961  1.00 0.00 ? 17  THR A O    4  
ATOM 5399  C CB   . THR A 1 17  ? 7.877   0.337   16.856  1.00 0.00 ? 17  THR A CB   4  
ATOM 5400  O OG1  . THR A 1 17  ? 9.186   0.131   17.379  1.00 0.00 ? 17  THR A OG1  4  
ATOM 5401  C CG2  . THR A 1 17  ? 7.719   -0.759  15.802  1.00 0.00 ? 17  THR A CG2  4  
ATOM 5402  H H    . THR A 1 17  ? 6.445   1.978   14.807  1.00 0.00 ? 17  THR A H    4  
ATOM 5403  H HA   . THR A 1 17  ? 8.246   2.456   16.999  1.00 0.00 ? 17  THR A HA   4  
ATOM 5404  H HB   . THR A 1 17  ? 7.086   0.277   17.603  1.00 0.00 ? 17  THR A HB   4  
ATOM 5405  H HG1  . THR A 1 17  ? 9.159   -0.556  18.105  1.00 0.00 ? 17  THR A HG1  4  
ATOM 5406  H HG21 . THR A 1 17  ? 8.637   -1.347  15.748  1.00 0.00 ? 17  THR A HG21 4  
ATOM 5407  H HG22 . THR A 1 17  ? 6.888   -1.410  16.075  1.00 0.00 ? 17  THR A HG22 4  
ATOM 5408  H HG23 . THR A 1 17  ? 7.522   -0.306  14.831  1.00 0.00 ? 17  THR A HG23 4  
ATOM 5409  N N    . SER A 1 18  ? 10.102  2.395   15.405  1.00 0.00 ? 18  SER A N    4  
ATOM 5410  C CA   . SER A 1 18  ? 11.147  2.565   14.409  1.00 0.00 ? 18  SER A CA   4  
ATOM 5411  C C    . SER A 1 18  ? 10.591  3.302   13.189  1.00 0.00 ? 18  SER A C    4  
ATOM 5412  O O    . SER A 1 18  ? 10.257  2.679   12.182  1.00 0.00 ? 18  SER A O    4  
ATOM 5413  C CB   . SER A 1 18  ? 11.735  1.214   13.992  1.00 0.00 ? 18  SER A CB   4  
ATOM 5414  O OG   . SER A 1 18  ? 13.107  1.322   13.623  1.00 0.00 ? 18  SER A OG   4  
ATOM 5415  H H    . SER A 1 18  ? 10.337  2.717   16.321  1.00 0.00 ? 18  SER A H    4  
ATOM 5416  H HA   . SER A 1 18  ? 11.917  3.160   14.897  1.00 0.00 ? 18  SER A HA   4  
ATOM 5417  H HB3  . SER A 1 18  ? 11.164  0.815   13.153  1.00 0.00 ? 18  SER A HB3  4  
ATOM 5418  H HG   . SER A 1 18  ? 13.190  1.799   12.750  1.00 0.00 ? 18  SER A HG   4  
ATOM 5419  N N    . GLN A 1 19  ? 10.510  4.618   13.318  1.00 0.00 ? 19  GLN A N    4  
ATOM 5420  C CA   . GLN A 1 19  ? 10.001  5.446   12.239  1.00 0.00 ? 19  GLN A CA   4  
ATOM 5421  C C    . GLN A 1 19  ? 8.772   4.792   11.603  1.00 0.00 ? 19  GLN A C    4  
ATOM 5422  O O    . GLN A 1 19  ? 8.899   3.990   10.679  1.00 0.00 ? 19  GLN A O    4  
ATOM 5423  C CB   . GLN A 1 19  ? 11.085  5.710   11.192  1.00 0.00 ? 19  GLN A CB   4  
ATOM 5424  C CG   . GLN A 1 19  ? 12.019  6.835   11.642  1.00 0.00 ? 19  GLN A CG   4  
ATOM 5425  C CD   . GLN A 1 19  ? 13.238  6.936   10.724  1.00 0.00 ? 19  GLN A CD   4  
ATOM 5426  O OE1  . GLN A 1 19  ? 13.894  5.956   10.408  1.00 0.00 ? 19  GLN A OE1  4  
ATOM 5427  N NE2  . GLN A 1 19  ? 13.506  8.172   10.313  1.00 0.00 ? 19  GLN A NE2  4  
ATOM 5428  H H    . GLN A 1 19  ? 10.783  5.117   14.141  1.00 0.00 ? 19  GLN A H    4  
ATOM 5429  H HA   . GLN A 1 19  ? 9.718   6.389   12.706  1.00 0.00 ? 19  GLN A HA   4  
ATOM 5430  H HB3  . GLN A 1 19  ? 10.621  5.976   10.242  1.00 0.00 ? 19  GLN A HB3  4  
ATOM 5431  H HG3  . GLN A 1 19  ? 12.346  6.654   12.666  1.00 0.00 ? 19  GLN A HG3  4  
ATOM 5432  H HE21 . GLN A 1 19  ? 12.927  8.934   10.608  1.00 0.00 ? 19  GLN A HE21 4  
ATOM 5433  H HE22 . GLN A 1 19  ? 14.283  8.341   9.708   1.00 0.00 ? 19  GLN A HE22 4  
ATOM 5434  N N    . GLY A 1 20  ? 7.610   5.161   12.122  1.00 0.00 ? 20  GLY A N    4  
ATOM 5435  C CA   . GLY A 1 20  ? 6.359   4.621   11.615  1.00 0.00 ? 20  GLY A CA   4  
ATOM 5436  C C    . GLY A 1 20  ? 6.174   3.167   12.054  1.00 0.00 ? 20  GLY A C    4  
ATOM 5437  O O    . GLY A 1 20  ? 5.717   2.903   13.166  1.00 0.00 ? 20  GLY A O    4  
ATOM 5438  H H    . GLY A 1 20  ? 7.515   5.815   12.873  1.00 0.00 ? 20  GLY A H    4  
ATOM 5439  H HA2  . GLY A 1 20  ? 5.527   5.224   11.978  1.00 0.00 ? 20  GLY A HA2  4  
ATOM 5440  H HA3  . GLY A 1 20  ? 6.347   4.681   10.528  1.00 0.00 ? 20  GLY A HA3  4  
ATOM 5441  N N    . PHE A 1 21  ? 6.535   2.262   11.156  1.00 0.00 ? 21  PHE A N    4  
ATOM 5442  C CA   . PHE A 1 21  ? 6.413   0.841   11.438  1.00 0.00 ? 21  PHE A CA   4  
ATOM 5443  C C    . PHE A 1 21  ? 7.367   0.026   10.562  1.00 0.00 ? 21  PHE A C    4  
ATOM 5444  O O    . PHE A 1 21  ? 8.117   0.587   9.765   1.00 0.00 ? 21  PHE A O    4  
ATOM 5445  C CB   . PHE A 1 21  ? 4.973   0.442   11.111  1.00 0.00 ? 21  PHE A CB   4  
ATOM 5446  C CG   . PHE A 1 21  ? 3.917   1.251   11.865  1.00 0.00 ? 21  PHE A CG   4  
ATOM 5447  C CD1  . PHE A 1 21  ? 3.484   2.440   11.365  1.00 0.00 ? 21  PHE A CD1  4  
ATOM 5448  C CD2  . PHE A 1 21  ? 3.410   0.783   13.037  1.00 0.00 ? 21  PHE A CD2  4  
ATOM 5449  C CE1  . PHE A 1 21  ? 2.505   3.191   12.066  1.00 0.00 ? 21  PHE A CE1  4  
ATOM 5450  C CE2  . PHE A 1 21  ? 2.429   1.533   13.737  1.00 0.00 ? 21  PHE A CE2  4  
ATOM 5451  C CZ   . PHE A 1 21  ? 1.997   2.723   13.237  1.00 0.00 ? 21  PHE A CZ   4  
ATOM 5452  H H    . PHE A 1 21  ? 6.905   2.484   10.255  1.00 0.00 ? 21  PHE A H    4  
ATOM 5453  H HA   . PHE A 1 21  ? 6.672   0.695   12.487  1.00 0.00 ? 21  PHE A HA   4  
ATOM 5454  H HB3  . PHE A 1 21  ? 4.838   -0.615  11.340  1.00 0.00 ? 21  PHE A HB3  4  
ATOM 5455  H HD1  . PHE A 1 21  ? 3.891   2.816   10.426  1.00 0.00 ? 21  PHE A HD1  4  
ATOM 5456  H HD2  . PHE A 1 21  ? 3.754   -0.170  13.437  1.00 0.00 ? 21  PHE A HD2  4  
ATOM 5457  H HE1  . PHE A 1 21  ? 2.159   4.145   11.665  1.00 0.00 ? 21  PHE A HE1  4  
ATOM 5458  H HE2  . PHE A 1 21  ? 2.022   1.156   14.676  1.00 0.00 ? 21  PHE A HE2  4  
ATOM 5459  H HZ   . PHE A 1 21  ? 1.244   3.299   13.774  1.00 0.00 ? 21  PHE A HZ   4  
ATOM 5460  N N    . GLY A 1 22  ? 7.306   -1.286  10.740  1.00 0.00 ? 22  GLY A N    4  
ATOM 5461  C CA   . GLY A 1 22  ? 8.156   -2.184  9.977   1.00 0.00 ? 22  GLY A CA   4  
ATOM 5462  C C    . GLY A 1 22  ? 7.562   -2.457  8.593   1.00 0.00 ? 22  GLY A C    4  
ATOM 5463  O O    . GLY A 1 22  ? 6.784   -1.654  8.078   1.00 0.00 ? 22  GLY A O    4  
ATOM 5464  H H    . GLY A 1 22  ? 6.694   -1.735  11.389  1.00 0.00 ? 22  GLY A H    4  
ATOM 5465  H HA2  . GLY A 1 22  ? 9.150   -1.749  9.869   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 5466  H HA3  . GLY A 1 22  ? 8.276   -3.123  10.516  1.00 0.00 ? 22  GLY A HA3  4  
ATOM 5467  N N    . PHE A 1 23  ? 7.951   -3.591  8.029   1.00 0.00 ? 23  PHE A N    4  
ATOM 5468  C CA   . PHE A 1 23  ? 7.467   -3.979  6.717   1.00 0.00 ? 23  PHE A CA   4  
ATOM 5469  C C    . PHE A 1 23  ? 7.544   -2.809  5.734   1.00 0.00 ? 23  PHE A C    4  
ATOM 5470  O O    . PHE A 1 23  ? 7.945   -1.707  6.107   1.00 0.00 ? 23  PHE A O    4  
ATOM 5471  C CB   . PHE A 1 23  ? 6.003   -4.393  6.883   1.00 0.00 ? 23  PHE A CB   4  
ATOM 5472  C CG   . PHE A 1 23  ? 5.036   -3.216  7.027   1.00 0.00 ? 23  PHE A CG   4  
ATOM 5473  C CD1  . PHE A 1 23  ? 4.609   -2.547  5.922   1.00 0.00 ? 23  PHE A CD1  4  
ATOM 5474  C CD2  . PHE A 1 23  ? 4.604   -2.838  8.259   1.00 0.00 ? 23  PHE A CD2  4  
ATOM 5475  C CE1  . PHE A 1 23  ? 3.712   -1.455  6.056   1.00 0.00 ? 23  PHE A CE1  4  
ATOM 5476  C CE2  . PHE A 1 23  ? 3.707   -1.747  8.394   1.00 0.00 ? 23  PHE A CE2  4  
ATOM 5477  C CZ   . PHE A 1 23  ? 3.279   -1.077  7.289   1.00 0.00 ? 23  PHE A CZ   4  
ATOM 5478  H H    . PHE A 1 23  ? 8.584   -4.238  8.455   1.00 0.00 ? 23  PHE A H    4  
ATOM 5479  H HA   . PHE A 1 23  ? 8.104   -4.789  6.362   1.00 0.00 ? 23  PHE A HA   4  
ATOM 5480  H HB3  . PHE A 1 23  ? 5.914   -5.032  7.763   1.00 0.00 ? 23  PHE A HB3  4  
ATOM 5481  H HD1  . PHE A 1 23  ? 4.955   -2.850  4.934   1.00 0.00 ? 23  PHE A HD1  4  
ATOM 5482  H HD2  . PHE A 1 23  ? 4.946   -3.374  9.146   1.00 0.00 ? 23  PHE A HD2  4  
ATOM 5483  H HE1  . PHE A 1 23  ? 3.370   -0.919  5.171   1.00 0.00 ? 23  PHE A HE1  4  
ATOM 5484  H HE2  . PHE A 1 23  ? 3.361   -1.443  9.382   1.00 0.00 ? 23  PHE A HE2  4  
ATOM 5485  H HZ   . PHE A 1 23  ? 2.591   -0.240  7.391   1.00 0.00 ? 23  PHE A HZ   4  
ATOM 5486  N N    . THR A 1 24  ? 7.153   -3.085  4.499   1.00 0.00 ? 24  THR A N    4  
ATOM 5487  C CA   . THR A 1 24  ? 7.174   -2.068  3.462   1.00 0.00 ? 24  THR A CA   4  
ATOM 5488  C C    . THR A 1 24  ? 6.222   -2.447  2.325   1.00 0.00 ? 24  THR A C    4  
ATOM 5489  O O    . THR A 1 24  ? 5.825   -3.605  2.202   1.00 0.00 ? 24  THR A O    4  
ATOM 5490  C CB   . THR A 1 24  ? 8.623   -1.887  3.006   1.00 0.00 ? 24  THR A CB   4  
ATOM 5491  O OG1  . THR A 1 24  ? 8.517   -1.118  1.810   1.00 0.00 ? 24  THR A OG1  4  
ATOM 5492  C CG2  . THR A 1 24  ? 9.262   -3.200  2.549   1.00 0.00 ? 24  THR A CG2  4  
ATOM 5493  H H    . THR A 1 24  ? 6.829   -3.983  4.205   1.00 0.00 ? 24  THR A H    4  
ATOM 5494  H HA   . THR A 1 24  ? 6.806   -1.135  3.889   1.00 0.00 ? 24  THR A HA   4  
ATOM 5495  H HB   . THR A 1 24  ? 9.220   -1.413  3.785   1.00 0.00 ? 24  THR A HB   4  
ATOM 5496  H HG1  . THR A 1 24  ? 9.289   -0.487  1.740   1.00 0.00 ? 24  THR A HG1  4  
ATOM 5497  H HG21 . THR A 1 24  ? 8.511   -3.991  2.556   1.00 0.00 ? 24  THR A HG21 4  
ATOM 5498  H HG22 . THR A 1 24  ? 9.655   -3.081  1.540   1.00 0.00 ? 24  THR A HG22 4  
ATOM 5499  H HG23 . THR A 1 24  ? 10.073  -3.464  3.227   1.00 0.00 ? 24  THR A HG23 4  
ATOM 5500  N N    . LEU A 1 25  ? 5.883   -1.448  1.522   1.00 0.00 ? 25  LEU A N    4  
ATOM 5501  C CA   . LEU A 1 25  ? 4.986   -1.662  0.400   1.00 0.00 ? 25  LEU A CA   4  
ATOM 5502  C C    . LEU A 1 25  ? 5.759   -1.480  -0.908  1.00 0.00 ? 25  LEU A C    4  
ATOM 5503  O O    . LEU A 1 25  ? 6.897   -1.013  -0.900  1.00 0.00 ? 25  LEU A O    4  
ATOM 5504  C CB   . LEU A 1 25  ? 3.757   -0.761  0.518   1.00 0.00 ? 25  LEU A CB   4  
ATOM 5505  C CG   . LEU A 1 25  ? 2.957   -0.881  1.816   1.00 0.00 ? 25  LEU A CG   4  
ATOM 5506  C CD1  . LEU A 1 25  ? 2.827   -2.345  2.245   1.00 0.00 ? 25  LEU A CD1  4  
ATOM 5507  C CD2  . LEU A 1 25  ? 3.566   -0.014  2.919   1.00 0.00 ? 25  LEU A CD2  4  
ATOM 5508  H H    . LEU A 1 25  ? 6.211   -0.509  1.629   1.00 0.00 ? 25  LEU A H    4  
ATOM 5509  H HA   . LEU A 1 25  ? 4.635   -2.693  0.454   1.00 0.00 ? 25  LEU A HA   4  
ATOM 5510  H HB3  . LEU A 1 25  ? 3.090   -0.977  -0.318  1.00 0.00 ? 25  LEU A HB3  4  
ATOM 5511  H HG   . LEU A 1 25  ? 1.949   -0.510  1.634   1.00 0.00 ? 25  LEU A HG   4  
ATOM 5512  H HD11 . LEU A 1 25  ? 3.654   -2.604  2.906   1.00 0.00 ? 25  LEU A HD11 4  
ATOM 5513  H HD12 . LEU A 1 25  ? 1.883   -2.488  2.771   1.00 0.00 ? 25  LEU A HD12 4  
ATOM 5514  H HD13 . LEU A 1 25  ? 2.852   -2.987  1.363   1.00 0.00 ? 25  LEU A HD13 4  
ATOM 5515  H HD21 . LEU A 1 25  ? 4.330   -0.582  3.449   1.00 0.00 ? 25  LEU A HD21 4  
ATOM 5516  H HD22 . LEU A 1 25  ? 4.016   0.875   2.475   1.00 0.00 ? 25  LEU A HD22 4  
ATOM 5517  H HD23 . LEU A 1 25  ? 2.786   0.286   3.619   1.00 0.00 ? 25  LEU A HD23 4  
ATOM 5518  N N    . ARG A 1 26  ? 5.110   -1.858  -1.999  1.00 0.00 ? 26  ARG A N    4  
ATOM 5519  C CA   . ARG A 1 26  ? 5.723   -1.743  -3.312  1.00 0.00 ? 26  ARG A CA   4  
ATOM 5520  C C    . ARG A 1 26  ? 4.645   -1.641  -4.393  1.00 0.00 ? 26  ARG A C    4  
ATOM 5521  O O    . ARG A 1 26  ? 3.561   -2.203  -4.249  1.00 0.00 ? 26  ARG A O    4  
ATOM 5522  C CB   . ARG A 1 26  ? 6.621   -2.946  -3.608  1.00 0.00 ? 26  ARG A CB   4  
ATOM 5523  C CG   . ARG A 1 26  ? 8.094   -2.534  -3.645  1.00 0.00 ? 26  ARG A CG   4  
ATOM 5524  C CD   . ARG A 1 26  ? 8.601   -2.442  -5.086  1.00 0.00 ? 26  ARG A CD   4  
ATOM 5525  N NE   . ARG A 1 26  ? 10.029  -2.048  -5.094  1.00 0.00 ? 26  ARG A NE   4  
ATOM 5526  C CZ   . ARG A 1 26  ? 10.753  -1.878  -6.209  1.00 0.00 ? 26  ARG A CZ   4  
ATOM 5527  N NH1  . ARG A 1 26  ? 10.191  -2.066  -7.410  1.00 0.00 ? 26  ARG A NH1  4  
ATOM 5528  N NH2  . ARG A 1 26  ? 12.041  -1.520  -6.121  1.00 0.00 ? 26  ARG A NH2  4  
ATOM 5529  H H    . ARG A 1 26  ? 4.185   -2.237  -1.997  1.00 0.00 ? 26  ARG A H    4  
ATOM 5530  H HA   . ARG A 1 26  ? 6.317   -0.831  -3.263  1.00 0.00 ? 26  ARG A HA   4  
ATOM 5531  H HB3  . ARG A 1 26  ? 6.338   -3.388  -4.564  1.00 0.00 ? 26  ARG A HB3  4  
ATOM 5532  H HG3  . ARG A 1 26  ? 8.691   -3.258  -3.091  1.00 0.00 ? 26  ARG A HG3  4  
ATOM 5533  H HD3  . ARG A 1 26  ? 8.011   -1.714  -5.643  1.00 0.00 ? 26  ARG A HD3  4  
ATOM 5534  H HE   . ARG A 1 26  ? 10.479  -1.900  -4.215  1.00 0.00 ? 26  ARG A HE   4  
ATOM 5535  H HH11 . ARG A 1 26  ? 9.229   -2.334  -7.475  1.00 0.00 ? 26  ARG A HH11 4  
ATOM 5536  H HH12 . ARG A 1 26  ? 10.732  -1.939  -8.242  1.00 0.00 ? 26  ARG A HH12 4  
ATOM 5537  H HH21 . ARG A 1 26  ? 12.461  -1.379  -5.226  1.00 0.00 ? 26  ARG A HH21 4  
ATOM 5538  H HH22 . ARG A 1 26  ? 12.583  -1.393  -6.953  1.00 0.00 ? 26  ARG A HH22 4  
ATOM 5539  N N    . HIS A 1 27  ? 4.981   -0.919  -5.453  1.00 0.00 ? 27  HIS A N    4  
ATOM 5540  C CA   . HIS A 1 27  ? 4.056   -0.735  -6.557  1.00 0.00 ? 27  HIS A CA   4  
ATOM 5541  C C    . HIS A 1 27  ? 4.746   0.037   -7.683  1.00 0.00 ? 27  HIS A C    4  
ATOM 5542  O O    . HIS A 1 27  ? 4.968   1.242   -7.568  1.00 0.00 ? 27  HIS A O    4  
ATOM 5543  C CB   . HIS A 1 27  ? 2.766   -0.064  -6.081  1.00 0.00 ? 27  HIS A CB   4  
ATOM 5544  C CG   . HIS A 1 27  ? 2.863   1.438   -5.965  1.00 0.00 ? 27  HIS A CG   4  
ATOM 5545  N ND1  . HIS A 1 27  ? 1.915   2.295   -6.497  1.00 0.00 ? 27  HIS A ND1  4  
ATOM 5546  C CD2  . HIS A 1 27  ? 3.806   2.227   -5.373  1.00 0.00 ? 27  HIS A CD2  4  
ATOM 5547  C CE1  . HIS A 1 27  ? 2.280   3.541   -6.231  1.00 0.00 ? 27  HIS A CE1  4  
ATOM 5548  N NE2  . HIS A 1 27  ? 3.451   3.497   -5.535  1.00 0.00 ? 27  HIS A NE2  4  
ATOM 5549  H H    . HIS A 1 27  ? 5.865   -0.464  -5.561  1.00 0.00 ? 27  HIS A H    4  
ATOM 5550  H HA   . HIS A 1 27  ? 3.799   -1.732  -6.918  1.00 0.00 ? 27  HIS A HA   4  
ATOM 5551  H HB3  . HIS A 1 27  ? 2.491   -0.476  -5.109  1.00 0.00 ? 27  HIS A HB3  4  
ATOM 5552  H HD1  . HIS A 1 27  ? 1.094   2.020   -6.997  1.00 0.00 ? 27  HIS A HD1  4  
ATOM 5553  H HD2  . HIS A 1 27  ? 4.698   1.876   -4.853  1.00 0.00 ? 27  HIS A HD2  4  
ATOM 5554  H HE1  . HIS A 1 27  ? 1.738   4.441   -6.518  1.00 0.00 ? 27  HIS A HE1  4  
ATOM 5555  N N    . PHE A 1 28  ? 5.068   -0.687  -8.745  1.00 0.00 ? 28  PHE A N    4  
ATOM 5556  C CA   . PHE A 1 28  ? 5.730   -0.084  -9.888  1.00 0.00 ? 28  PHE A CA   4  
ATOM 5557  C C    . PHE A 1 28  ? 4.711   0.358   -10.941 1.00 0.00 ? 28  PHE A C    4  
ATOM 5558  O O    . PHE A 1 28  ? 4.870   1.406   -11.563 1.00 0.00 ? 28  PHE A O    4  
ATOM 5559  C CB   . PHE A 1 28  ? 6.639   -1.154  -10.494 1.00 0.00 ? 28  PHE A CB   4  
ATOM 5560  C CG   . PHE A 1 28  ? 7.837   -0.592  -11.261 1.00 0.00 ? 28  PHE A CG   4  
ATOM 5561  C CD1  . PHE A 1 28  ? 7.641   0.280   -12.287 1.00 0.00 ? 28  PHE A CD1  4  
ATOM 5562  C CD2  . PHE A 1 28  ? 9.100   -0.963  -10.918 1.00 0.00 ? 28  PHE A CD2  4  
ATOM 5563  C CE1  . PHE A 1 28  ? 8.754   0.802   -12.998 1.00 0.00 ? 28  PHE A CE1  4  
ATOM 5564  C CE2  . PHE A 1 28  ? 10.212  -0.442  -11.629 1.00 0.00 ? 28  PHE A CE2  4  
ATOM 5565  C CZ   . PHE A 1 28  ? 10.015  0.431   -12.654 1.00 0.00 ? 28  PHE A CZ   4  
ATOM 5566  H H    . PHE A 1 28  ? 4.886   -1.666  -8.829  1.00 0.00 ? 28  PHE A H    4  
ATOM 5567  H HA   . PHE A 1 28  ? 6.276   0.787   -9.526  1.00 0.00 ? 28  PHE A HA   4  
ATOM 5568  H HB3  . PHE A 1 28  ? 6.051   -1.778  -11.168 1.00 0.00 ? 28  PHE A HB3  4  
ATOM 5569  H HD1  . PHE A 1 28  ? 6.629   0.578   -12.561 1.00 0.00 ? 28  PHE A HD1  4  
ATOM 5570  H HD2  . PHE A 1 28  ? 9.257   -1.662  -10.096 1.00 0.00 ? 28  PHE A HD2  4  
ATOM 5571  H HE1  . PHE A 1 28  ? 8.595   1.501   -13.820 1.00 0.00 ? 28  PHE A HE1  4  
ATOM 5572  H HE2  . PHE A 1 28  ? 11.223  -0.740  -11.354 1.00 0.00 ? 28  PHE A HE2  4  
ATOM 5573  H HZ   . PHE A 1 28  ? 10.869  0.832   -13.201 1.00 0.00 ? 28  PHE A HZ   4  
ATOM 5574  N N    . ILE A 1 29  ? 3.685   -0.464  -11.106 1.00 0.00 ? 29  ILE A N    4  
ATOM 5575  C CA   . ILE A 1 29  ? 2.640   -0.171  -12.073 1.00 0.00 ? 29  ILE A CA   4  
ATOM 5576  C C    . ILE A 1 29  ? 2.354   1.332   -12.069 1.00 0.00 ? 29  ILE A C    4  
ATOM 5577  O O    . ILE A 1 29  ? 1.871   1.873   -11.075 1.00 0.00 ? 29  ILE A O    4  
ATOM 5578  C CB   . ILE A 1 29  ? 1.404   -1.033  -11.803 1.00 0.00 ? 29  ILE A CB   4  
ATOM 5579  C CG1  . ILE A 1 29  ? 1.737   -2.521  -11.913 1.00 0.00 ? 29  ILE A CG1  4  
ATOM 5580  C CG2  . ILE A 1 29  ? 0.246   -0.635  -12.720 1.00 0.00 ? 29  ILE A CG2  4  
ATOM 5581  C CD1  . ILE A 1 29  ? 0.470   -3.376  -11.828 1.00 0.00 ? 29  ILE A CD1  4  
ATOM 5582  H H    . ILE A 1 29  ? 3.561   -1.316  -10.597 1.00 0.00 ? 29  ILE A H    4  
ATOM 5583  H HA   . ILE A 1 29  ? 3.016   -0.450  -13.057 1.00 0.00 ? 29  ILE A HA   4  
ATOM 5584  H HB   . ILE A 1 29  ? 1.078   -0.851  -10.778 1.00 0.00 ? 29  ILE A HB   4  
ATOM 5585  H HG13 . ILE A 1 29  ? 2.426   -2.804  -11.117 1.00 0.00 ? 29  ILE A HG13 4  
ATOM 5586  H HG21 . ILE A 1 29  ? 0.098   -1.407  -13.474 1.00 0.00 ? 29  ILE A HG21 4  
ATOM 5587  H HG22 . ILE A 1 29  ? -0.663  -0.522  -12.130 1.00 0.00 ? 29  ILE A HG22 4  
ATOM 5588  H HG23 . ILE A 1 29  ? 0.480   0.310   -13.211 1.00 0.00 ? 29  ILE A HG23 4  
ATOM 5589  H HD11 . ILE A 1 29  ? 0.667   -4.255  -11.215 1.00 0.00 ? 29  ILE A HD11 4  
ATOM 5590  H HD12 . ILE A 1 29  ? -0.331  -2.791  -11.378 1.00 0.00 ? 29  ILE A HD12 4  
ATOM 5591  H HD13 . ILE A 1 29  ? 0.176   -3.688  -12.830 1.00 0.00 ? 29  ILE A HD13 4  
ATOM 5592  N N    . VAL A 1 30  ? 2.664   1.963   -13.191 1.00 0.00 ? 30  VAL A N    4  
ATOM 5593  C CA   . VAL A 1 30  ? 2.447   3.393   -13.330 1.00 0.00 ? 30  VAL A CA   4  
ATOM 5594  C C    . VAL A 1 30  ? 1.087   3.637   -13.985 1.00 0.00 ? 30  VAL A C    4  
ATOM 5595  O O    . VAL A 1 30  ? 0.668   2.876   -14.858 1.00 0.00 ? 30  VAL A O    4  
ATOM 5596  C CB   . VAL A 1 30  ? 3.606   4.026   -14.104 1.00 0.00 ? 30  VAL A CB   4  
ATOM 5597  C CG1  . VAL A 1 30  ? 3.218   5.406   -14.640 1.00 0.00 ? 30  VAL A CG1  4  
ATOM 5598  C CG2  . VAL A 1 30  ? 4.864   4.108   -13.237 1.00 0.00 ? 30  VAL A CG2  4  
ATOM 5599  H H    . VAL A 1 30  ? 3.056   1.516   -13.996 1.00 0.00 ? 30  VAL A H    4  
ATOM 5600  H HA   . VAL A 1 30  ? 2.437   3.823   -12.329 1.00 0.00 ? 30  VAL A HA   4  
ATOM 5601  H HB   . VAL A 1 30  ? 3.828   3.386   -14.957 1.00 0.00 ? 30  VAL A HB   4  
ATOM 5602  H HG11 . VAL A 1 30  ? 3.973   5.745   -15.350 1.00 0.00 ? 30  VAL A HG11 4  
ATOM 5603  H HG12 . VAL A 1 30  ? 2.252   5.342   -15.141 1.00 0.00 ? 30  VAL A HG12 4  
ATOM 5604  H HG13 . VAL A 1 30  ? 3.154   6.111   -13.813 1.00 0.00 ? 30  VAL A HG13 4  
ATOM 5605  H HG21 . VAL A 1 30  ? 5.256   3.104   -13.069 1.00 0.00 ? 30  VAL A HG21 4  
ATOM 5606  H HG22 . VAL A 1 30  ? 5.617   4.710   -13.746 1.00 0.00 ? 30  VAL A HG22 4  
ATOM 5607  H HG23 . VAL A 1 30  ? 4.617   4.566   -12.281 1.00 0.00 ? 30  VAL A HG23 4  
ATOM 5608  N N    . TYR A 1 31  ? 0.433   4.700   -13.541 1.00 0.00 ? 31  TYR A N    4  
ATOM 5609  C CA   . TYR A 1 31  ? -0.872  5.054   -14.073 1.00 0.00 ? 31  TYR A CA   4  
ATOM 5610  C C    . TYR A 1 31  ? -1.413  6.320   -13.405 1.00 0.00 ? 31  TYR A C    4  
ATOM 5611  O O    . TYR A 1 31  ? -2.455  6.286   -12.755 1.00 0.00 ? 31  TYR A O    4  
ATOM 5612  C CB   . TYR A 1 31  ? -1.796  3.880   -13.738 1.00 0.00 ? 31  TYR A CB   4  
ATOM 5613  C CG   . TYR A 1 31  ? -1.512  3.232   -12.381 1.00 0.00 ? 31  TYR A CG   4  
ATOM 5614  C CD1  . TYR A 1 31  ? -0.928  3.971   -11.373 1.00 0.00 ? 31  TYR A CD1  4  
ATOM 5615  C CD2  . TYR A 1 31  ? -1.839  1.910   -12.166 1.00 0.00 ? 31  TYR A CD2  4  
ATOM 5616  C CE1  . TYR A 1 31  ? -0.660  3.361   -10.096 1.00 0.00 ? 31  TYR A CE1  4  
ATOM 5617  C CE2  . TYR A 1 31  ? -1.571  1.298   -10.891 1.00 0.00 ? 31  TYR A CE2  4  
ATOM 5618  C CZ   . TYR A 1 31  ? -0.995  2.055   -9.917  1.00 0.00 ? 31  TYR A CZ   4  
ATOM 5619  O OH   . TYR A 1 31  ? -0.743  1.479   -8.712  1.00 0.00 ? 31  TYR A OH   4  
ATOM 5620  H H    . TYR A 1 31  ? 0.780   5.313   -12.830 1.00 0.00 ? 31  TYR A H    4  
ATOM 5621  H HA   . TYR A 1 31  ? -0.762  5.235   -15.142 1.00 0.00 ? 31  TYR A HA   4  
ATOM 5622  H HB3  . TYR A 1 31  ? -1.704  3.125   -14.517 1.00 0.00 ? 31  TYR A HB3  4  
ATOM 5623  H HD1  . TYR A 1 31  ? -0.669  5.017   -11.542 1.00 0.00 ? 31  TYR A HD1  4  
ATOM 5624  H HD2  . TYR A 1 31  ? -2.299  1.326   -12.964 1.00 0.00 ? 31  TYR A HD2  4  
ATOM 5625  H HE1  . TYR A 1 31  ? -0.199  3.933   -9.291  1.00 0.00 ? 31  TYR A HE1  4  
ATOM 5626  H HE2  . TYR A 1 31  ? -1.824  0.255   -10.707 1.00 0.00 ? 31  TYR A HE2  4  
ATOM 5627  H HH   . TYR A 1 31  ? -1.386  1.820   -8.028  1.00 0.00 ? 31  TYR A HH   4  
ATOM 5628  N N    . PRO A 1 32  ? -0.657  7.435   -13.594 1.00 0.00 ? 32  PRO A N    4  
ATOM 5629  C CA   . PRO A 1 32  ? -1.050  8.711   -13.018 1.00 0.00 ? 32  PRO A CA   4  
ATOM 5630  C C    . PRO A 1 32  ? -2.216  9.326   -13.792 1.00 0.00 ? 32  PRO A C    4  
ATOM 5631  O O    . PRO A 1 32  ? -2.421  9.015   -14.964 1.00 0.00 ? 32  PRO A O    4  
ATOM 5632  C CB   . PRO A 1 32  ? 0.208   9.564   -13.060 1.00 0.00 ? 32  PRO A CB   4  
ATOM 5633  C CG   . PRO A 1 32  ? 1.126   8.904   -14.074 1.00 0.00 ? 32  PRO A CG   4  
ATOM 5634  C CD   . PRO A 1 32  ? 0.584   7.512   -14.358 1.00 0.00 ? 32  PRO A CD   4  
ATOM 5635  H HA   . PRO A 1 32  ? -1.379  8.581   -12.082 1.00 0.00 ? 32  PRO A HA   4  
ATOM 5636  H HB3  . PRO A 1 32  ? 0.680   9.612   -12.078 1.00 0.00 ? 32  PRO A HB3  4  
ATOM 5637  H HG3  . PRO A 1 32  ? 2.144   8.846   -13.688 1.00 0.00 ? 32  PRO A HG3  4  
ATOM 5638  H HD3  . PRO A 1 32  ? 1.289   6.742   -14.047 1.00 0.00 ? 32  PRO A HD3  4  
ATOM 5639  N N    . PRO A 1 33  ? -2.969  10.213  -13.088 1.00 0.00 ? 33  PRO A N    4  
ATOM 5640  C CA   . PRO A 1 33  ? -4.109  10.876  -13.696 1.00 0.00 ? 33  PRO A CA   4  
ATOM 5641  C C    . PRO A 1 33  ? -3.656  11.974  -14.660 1.00 0.00 ? 33  PRO A C    4  
ATOM 5642  O O    . PRO A 1 33  ? -4.481  12.614  -15.310 1.00 0.00 ? 33  PRO A O    4  
ATOM 5643  C CB   . PRO A 1 33  ? -4.924  11.410  -12.528 1.00 0.00 ? 33  PRO A CB   4  
ATOM 5644  C CG   . PRO A 1 33  ? -3.980  11.433  -11.338 1.00 0.00 ? 33  PRO A CG   4  
ATOM 5645  C CD   . PRO A 1 33  ? -2.755  10.607  -11.698 1.00 0.00 ? 33  PRO A CD   4  
ATOM 5646  H HA   . PRO A 1 33  ? -4.634  10.227  -14.248 1.00 0.00 ? 33  PRO A HA   4  
ATOM 5647  H HB3  . PRO A 1 33  ? -5.786  10.773  -12.330 1.00 0.00 ? 33  PRO A HB3  4  
ATOM 5648  H HG3  . PRO A 1 33  ? -4.469  11.024  -10.453 1.00 0.00 ? 33  PRO A HG3  4  
ATOM 5649  H HD3  . PRO A 1 33  ? -2.660  9.736   -11.050 1.00 0.00 ? 33  PRO A HD3  4  
ATOM 5650  N N    . GLU A 1 34  ? -2.346  12.158  -14.722 1.00 0.00 ? 34  GLU A N    4  
ATOM 5651  C CA   . GLU A 1 34  ? -1.772  13.169  -15.594 1.00 0.00 ? 34  GLU A CA   4  
ATOM 5652  C C    . GLU A 1 34  ? -2.247  14.562  -15.178 1.00 0.00 ? 34  GLU A C    4  
ATOM 5653  O O    . GLU A 1 34  ? -3.367  14.723  -14.696 1.00 0.00 ? 34  GLU A O    4  
ATOM 5654  C CB   . GLU A 1 34  ? -2.117  12.887  -17.058 1.00 0.00 ? 34  GLU A CB   4  
ATOM 5655  C CG   . GLU A 1 34  ? -2.483  11.416  -17.263 1.00 0.00 ? 34  GLU A CG   4  
ATOM 5656  C CD   . GLU A 1 34  ? -2.303  11.003  -18.725 1.00 0.00 ? 34  GLU A CD   4  
ATOM 5657  O OE1  . GLU A 1 34  ? -1.131  10.864  -19.135 1.00 0.00 ? 34  GLU A OE1  4  
ATOM 5658  O OE2  . GLU A 1 34  ? -3.342  10.838  -19.399 1.00 0.00 ? 34  GLU A OE2  4  
ATOM 5659  H H    . GLU A 1 34  ? -1.682  11.634  -14.190 1.00 0.00 ? 34  GLU A H    4  
ATOM 5660  H HA   . GLU A 1 34  ? -0.693  13.090  -15.460 1.00 0.00 ? 34  GLU A HA   4  
ATOM 5661  H HB3  . GLU A 1 34  ? -1.268  13.145  -17.692 1.00 0.00 ? 34  GLU A HB3  4  
ATOM 5662  H HG3  . GLU A 1 34  ? -3.517  11.250  -16.959 1.00 0.00 ? 34  GLU A HG3  4  
ATOM 5663  N N    . SER A 1 35  ? -1.371  15.536  -15.379 1.00 0.00 ? 35  SER A N    4  
ATOM 5664  C CA   . SER A 1 35  ? -1.686  16.910  -15.030 1.00 0.00 ? 35  SER A CA   4  
ATOM 5665  C C    . SER A 1 35  ? -2.120  16.993  -13.566 1.00 0.00 ? 35  SER A C    4  
ATOM 5666  O O    . SER A 1 35  ? -2.816  17.928  -13.173 1.00 0.00 ? 35  SER A O    4  
ATOM 5667  C CB   . SER A 1 35  ? -2.780  17.473  -15.941 1.00 0.00 ? 35  SER A CB   4  
ATOM 5668  O OG   . SER A 1 35  ? -2.959  18.874  -15.758 1.00 0.00 ? 35  SER A OG   4  
ATOM 5669  H H    . SER A 1 35  ? -0.461  15.397  -15.771 1.00 0.00 ? 35  SER A H    4  
ATOM 5670  H HA   . SER A 1 35  ? -0.762  17.467  -15.186 1.00 0.00 ? 35  SER A HA   4  
ATOM 5671  H HB3  . SER A 1 35  ? -3.718  16.957  -15.740 1.00 0.00 ? 35  SER A HB3  4  
ATOM 5672  H HG   . SER A 1 35  ? -3.927  19.080  -15.616 1.00 0.00 ? 35  SER A HG   4  
ATOM 5673  N N    . ALA A 1 36  ? -1.693  16.001  -12.798 1.00 0.00 ? 36  ALA A N    4  
ATOM 5674  C CA   . ALA A 1 36  ? -2.030  15.948  -11.385 1.00 0.00 ? 36  ALA A CA   4  
ATOM 5675  C C    . ALA A 1 36  ? -0.789  15.547  -10.585 1.00 0.00 ? 36  ALA A C    4  
ATOM 5676  O O    . ALA A 1 36  ? 0.232   15.175  -11.161 1.00 0.00 ? 36  ALA A O    4  
ATOM 5677  C CB   . ALA A 1 36  ? -3.198  14.984  -11.174 1.00 0.00 ? 36  ALA A CB   4  
ATOM 5678  H H    . ALA A 1 36  ? -1.127  15.243  -13.126 1.00 0.00 ? 36  ALA A H    4  
ATOM 5679  H HA   . ALA A 1 36  ? -2.341  16.948  -11.081 1.00 0.00 ? 36  ALA A HA   4  
ATOM 5680  H HB1  . ALA A 1 36  ? -3.105  14.509  -10.198 1.00 0.00 ? 36  ALA A HB1  4  
ATOM 5681  H HB2  . ALA A 1 36  ? -4.138  15.536  -11.222 1.00 0.00 ? 36  ALA A HB2  4  
ATOM 5682  H HB3  . ALA A 1 36  ? -3.185  14.221  -11.953 1.00 0.00 ? 36  ALA A HB3  4  
ATOM 5683  N N    . ILE A 1 37  ? -0.920  15.634  -9.269  1.00 0.00 ? 37  ILE A N    4  
ATOM 5684  C CA   . ILE A 1 37  ? 0.177   15.284  -8.383  1.00 0.00 ? 37  ILE A CA   4  
ATOM 5685  C C    . ILE A 1 37  ? 1.363   16.212  -8.656  1.00 0.00 ? 37  ILE A C    4  
ATOM 5686  O O    . ILE A 1 37  ? 1.871   16.264  -9.774  1.00 0.00 ? 37  ILE A O    4  
ATOM 5687  C CB   . ILE A 1 37  ? 0.518   13.798  -8.514  1.00 0.00 ? 37  ILE A CB   4  
ATOM 5688  C CG1  . ILE A 1 37  ? -0.602  12.926  -7.942  1.00 0.00 ? 37  ILE A CG1  4  
ATOM 5689  C CG2  . ILE A 1 37  ? 1.871   13.487  -7.870  1.00 0.00 ? 37  ILE A CG2  4  
ATOM 5690  C CD1  . ILE A 1 37  ? -0.469  11.479  -8.418  1.00 0.00 ? 37  ILE A CD1  4  
ATOM 5691  H H    . ILE A 1 37  ? -1.754  15.936  -8.809  1.00 0.00 ? 37  ILE A H    4  
ATOM 5692  H HA   . ILE A 1 37  ? -0.162  15.449  -7.361  1.00 0.00 ? 37  ILE A HA   4  
ATOM 5693  H HB   . ILE A 1 37  ? 0.603   13.559  -9.574  1.00 0.00 ? 37  ILE A HB   4  
ATOM 5694  H HG13 . ILE A 1 37  ? -1.571  13.326  -8.248  1.00 0.00 ? 37  ILE A HG13 4  
ATOM 5695  H HG21 . ILE A 1 37  ? 2.237   14.371  -7.348  1.00 0.00 ? 37  ILE A HG21 4  
ATOM 5696  H HG22 . ILE A 1 37  ? 1.756   12.669  -7.160  1.00 0.00 ? 37  ILE A HG22 4  
ATOM 5697  H HG23 . ILE A 1 37  ? 2.583   13.200  -8.643  1.00 0.00 ? 37  ILE A HG23 4  
ATOM 5698  H HD11 . ILE A 1 37  ? -1.215  11.279  -9.187  1.00 0.00 ? 37  ILE A HD11 4  
ATOM 5699  H HD12 . ILE A 1 37  ? 0.528   11.323  -8.832  1.00 0.00 ? 37  ILE A HD12 4  
ATOM 5700  H HD13 . ILE A 1 37  ? -0.622  10.805  -7.576  1.00 0.00 ? 37  ILE A HD13 4  
ATOM 5701  N N    . GLN A 1 38  ? 1.768   16.924  -7.613  1.00 0.00 ? 38  GLN A N    4  
ATOM 5702  C CA   . GLN A 1 38  ? 2.884   17.847  -7.726  1.00 0.00 ? 38  GLN A CA   4  
ATOM 5703  C C    . GLN A 1 38  ? 3.210   18.455  -6.361  1.00 0.00 ? 38  GLN A C    4  
ATOM 5704  O O    . GLN A 1 38  ? 3.349   19.670  -6.236  1.00 0.00 ? 38  GLN A O    4  
ATOM 5705  C CB   . GLN A 1 38  ? 2.590   18.939  -8.756  1.00 0.00 ? 38  GLN A CB   4  
ATOM 5706  C CG   . GLN A 1 38  ? 1.386   19.782  -8.333  1.00 0.00 ? 38  GLN A CG   4  
ATOM 5707  C CD   . GLN A 1 38  ? 1.819   21.191  -7.922  1.00 0.00 ? 38  GLN A CD   4  
ATOM 5708  O OE1  . GLN A 1 38  ? 2.727   21.777  -8.486  1.00 0.00 ? 38  GLN A OE1  4  
ATOM 5709  N NE2  . GLN A 1 38  ? 1.118   21.698  -6.912  1.00 0.00 ? 38  GLN A NE2  4  
ATOM 5710  H H    . GLN A 1 38  ? 1.350   16.876  -6.707  1.00 0.00 ? 38  GLN A H    4  
ATOM 5711  H HA   . GLN A 1 38  ? 3.724   17.245  -8.073  1.00 0.00 ? 38  GLN A HA   4  
ATOM 5712  H HB3  . GLN A 1 38  ? 2.398   18.485  -9.728  1.00 0.00 ? 38  GLN A HB3  4  
ATOM 5713  H HG3  . GLN A 1 38  ? 0.871   19.297  -7.502  1.00 0.00 ? 38  GLN A HG3  4  
ATOM 5714  H HE21 . GLN A 1 38  ? 0.384   21.162  -6.494  1.00 0.00 ? 38  GLN A HE21 4  
ATOM 5715  H HE22 . GLN A 1 38  ? 1.326   22.614  -6.570  1.00 0.00 ? 38  GLN A HE22 4  
ATOM 5716  N N    . PHE A 1 39  ? 3.322   17.581  -5.371  1.00 0.00 ? 39  PHE A N    4  
ATOM 5717  C CA   . PHE A 1 39  ? 3.631   18.017  -4.019  1.00 0.00 ? 39  PHE A CA   4  
ATOM 5718  C C    . PHE A 1 39  ? 4.045   16.833  -3.143  1.00 0.00 ? 39  PHE A C    4  
ATOM 5719  O O    . PHE A 1 39  ? 4.112   15.699  -3.616  1.00 0.00 ? 39  PHE A O    4  
ATOM 5720  C CB   . PHE A 1 39  ? 2.353   18.634  -3.448  1.00 0.00 ? 39  PHE A CB   4  
ATOM 5721  C CG   . PHE A 1 39  ? 1.449   17.637  -2.722  1.00 0.00 ? 39  PHE A CG   4  
ATOM 5722  C CD1  . PHE A 1 39  ? 0.884   16.608  -3.409  1.00 0.00 ? 39  PHE A CD1  4  
ATOM 5723  C CD2  . PHE A 1 39  ? 1.210   17.779  -1.391  1.00 0.00 ? 39  PHE A CD2  4  
ATOM 5724  C CE1  . PHE A 1 39  ? 0.044   15.681  -2.735  1.00 0.00 ? 39  PHE A CE1  4  
ATOM 5725  C CE2  . PHE A 1 39  ? 0.371   16.852  -0.718  1.00 0.00 ? 39  PHE A CE2  4  
ATOM 5726  C CZ   . PHE A 1 39  ? -0.195  15.823  -1.404  1.00 0.00 ? 39  PHE A CZ   4  
ATOM 5727  H H    . PHE A 1 39  ? 3.210   16.594  -5.482  1.00 0.00 ? 39  PHE A H    4  
ATOM 5728  H HA   . PHE A 1 39  ? 4.457   18.724  -4.087  1.00 0.00 ? 39  PHE A HA   4  
ATOM 5729  H HB3  . PHE A 1 39  ? 1.790   19.096  -4.260  1.00 0.00 ? 39  PHE A HB3  4  
ATOM 5730  H HD1  . PHE A 1 39  ? 1.074   16.494  -4.476  1.00 0.00 ? 39  PHE A HD1  4  
ATOM 5731  H HD2  . PHE A 1 39  ? 1.664   18.603  -0.841  1.00 0.00 ? 39  PHE A HD2  4  
ATOM 5732  H HE1  . PHE A 1 39  ? -0.409  14.856  -3.286  1.00 0.00 ? 39  PHE A HE1  4  
ATOM 5733  H HE2  . PHE A 1 39  ? 0.180   16.964  0.350   1.00 0.00 ? 39  PHE A HE2  4  
ATOM 5734  H HZ   . PHE A 1 39  ? -0.839  15.112  -0.886  1.00 0.00 ? 39  PHE A HZ   4  
ATOM 5735  N N    . SER A 1 40  ? 4.315   17.137  -1.882  1.00 0.00 ? 40  SER A N    4  
ATOM 5736  C CA   . SER A 1 40  ? 4.721   16.113  -0.935  1.00 0.00 ? 40  SER A CA   4  
ATOM 5737  C C    . SER A 1 40  ? 5.085   16.754  0.405   1.00 0.00 ? 40  SER A C    4  
ATOM 5738  O O    . SER A 1 40  ? 6.108   17.427  0.520   1.00 0.00 ? 40  SER A O    4  
ATOM 5739  C CB   . SER A 1 40  ? 5.904   15.304  -1.474  1.00 0.00 ? 40  SER A CB   4  
ATOM 5740  O OG   . SER A 1 40  ? 5.731   13.904  -1.267  1.00 0.00 ? 40  SER A OG   4  
ATOM 5741  H H    . SER A 1 40  ? 4.259   18.062  -1.506  1.00 0.00 ? 40  SER A H    4  
ATOM 5742  H HA   . SER A 1 40  ? 3.856   15.460  -0.826  1.00 0.00 ? 40  SER A HA   4  
ATOM 5743  H HB3  . SER A 1 40  ? 6.820   15.633  -0.985  1.00 0.00 ? 40  SER A HB3  4  
ATOM 5744  H HG   . SER A 1 40  ? 5.087   13.537  -1.938  1.00 0.00 ? 40  SER A HG   4  
ATOM 5745  N N    . TYR A 1 41  ? 4.226   16.522  1.387   1.00 0.00 ? 41  TYR A N    4  
ATOM 5746  C CA   . TYR A 1 41  ? 4.443   17.069  2.716   1.00 0.00 ? 41  TYR A CA   4  
ATOM 5747  C C    . TYR A 1 41  ? 3.481   16.445  3.730   1.00 0.00 ? 41  TYR A C    4  
ATOM 5748  O O    . TYR A 1 41  ? 2.529   15.764  3.350   1.00 0.00 ? 41  TYR A O    4  
ATOM 5749  C CB   . TYR A 1 41  ? 4.152   18.566  2.609   1.00 0.00 ? 41  TYR A CB   4  
ATOM 5750  C CG   . TYR A 1 41  ? 5.405   19.444  2.582   1.00 0.00 ? 41  TYR A CG   4  
ATOM 5751  C CD1  . TYR A 1 41  ? 6.198   19.548  3.708   1.00 0.00 ? 41  TYR A CD1  4  
ATOM 5752  C CD2  . TYR A 1 41  ? 5.742   20.131  1.434   1.00 0.00 ? 41  TYR A CD2  4  
ATOM 5753  C CE1  . TYR A 1 41  ? 7.377   20.375  3.683   1.00 0.00 ? 41  TYR A CE1  4  
ATOM 5754  C CE2  . TYR A 1 41  ? 6.923   20.957  1.409   1.00 0.00 ? 41  TYR A CE2  4  
ATOM 5755  C CZ   . TYR A 1 41  ? 7.681   21.037  2.536   1.00 0.00 ? 41  TYR A CZ   4  
ATOM 5756  O OH   . TYR A 1 41  ? 8.795   21.818  2.511   1.00 0.00 ? 41  TYR A OH   4  
ATOM 5757  H H    . TYR A 1 41  ? 3.396   15.974  1.287   1.00 0.00 ? 41  TYR A H    4  
ATOM 5758  H HA   . TYR A 1 41  ? 5.468   16.840  3.011   1.00 0.00 ? 41  TYR A HA   4  
ATOM 5759  H HB3  . TYR A 1 41  ? 3.528   18.866  3.452   1.00 0.00 ? 41  TYR A HB3  4  
ATOM 5760  H HD1  . TYR A 1 41  ? 5.931   19.006  4.614   1.00 0.00 ? 41  TYR A HD1  4  
ATOM 5761  H HD2  . TYR A 1 41  ? 5.116   20.048  0.546   1.00 0.00 ? 41  TYR A HD2  4  
ATOM 5762  H HE1  . TYR A 1 41  ? 8.012   20.465  4.564   1.00 0.00 ? 41  TYR A HE1  4  
ATOM 5763  H HE2  . TYR A 1 41  ? 7.200   21.505  0.509   1.00 0.00 ? 41  TYR A HE2  4  
ATOM 5764  H HH   . TYR A 1 41  ? 9.575   21.312  2.880   1.00 0.00 ? 41  TYR A HH   4  
ATOM 5765  N N    . LYS A 1 42  ? 3.762   16.700  4.999   1.00 0.00 ? 42  LYS A N    4  
ATOM 5766  C CA   . LYS A 1 42  ? 2.934   16.172  6.069   1.00 0.00 ? 42  LYS A CA   4  
ATOM 5767  C C    . LYS A 1 42  ? 1.673   17.028  6.203   1.00 0.00 ? 42  LYS A C    4  
ATOM 5768  O O    . LYS A 1 42  ? 1.757   18.224  6.485   1.00 0.00 ? 42  LYS A O    4  
ATOM 5769  C CB   . LYS A 1 42  ? 3.741   16.059  7.364   1.00 0.00 ? 42  LYS A CB   4  
ATOM 5770  C CG   . LYS A 1 42  ? 3.460   14.731  8.072   1.00 0.00 ? 42  LYS A CG   4  
ATOM 5771  C CD   . LYS A 1 42  ? 2.772   14.962  9.419   1.00 0.00 ? 42  LYS A CD   4  
ATOM 5772  C CE   . LYS A 1 42  ? 3.622   14.418  10.569  1.00 0.00 ? 42  LYS A CE   4  
ATOM 5773  N NZ   . LYS A 1 42  ? 2.885   14.515  11.849  1.00 0.00 ? 42  LYS A NZ   4  
ATOM 5774  H H    . LYS A 1 42  ? 4.539   17.254  5.299   1.00 0.00 ? 42  LYS A H    4  
ATOM 5775  H HA   . LYS A 1 42  ? 2.638   15.162  5.786   1.00 0.00 ? 42  LYS A HA   4  
ATOM 5776  H HB3  . LYS A 1 42  ? 3.489   16.888  8.027   1.00 0.00 ? 42  LYS A HB3  4  
ATOM 5777  H HG3  . LYS A 1 42  ? 4.394   14.192  8.223   1.00 0.00 ? 42  LYS A HG3  4  
ATOM 5778  H HD3  . LYS A 1 42  ? 1.797   14.475  9.421   1.00 0.00 ? 42  LYS A HD3  4  
ATOM 5779  H HE3  . LYS A 1 42  ? 4.555   14.978  10.636  1.00 0.00 ? 42  LYS A HE3  4  
ATOM 5780  H HZ1  . LYS A 1 42  ? 2.700   13.594  12.196  1.00 0.00 ? 42  LYS A HZ1  4  
ATOM 5781  H HZ2  . LYS A 1 42  ? 3.438   15.017  12.514  1.00 0.00 ? 42  LYS A HZ2  4  
ATOM 5782  H HZ3  . LYS A 1 42  ? 2.022   14.995  11.700  1.00 0.00 ? 42  LYS A HZ3  4  
ATOM 5783  N N    . ASP A 1 43  ? 0.534   16.386  5.993   1.00 0.00 ? 43  ASP A N    4  
ATOM 5784  C CA   . ASP A 1 43  ? -0.742  17.074  6.086   1.00 0.00 ? 43  ASP A CA   4  
ATOM 5785  C C    . ASP A 1 43  ? -1.492  16.583  7.325   1.00 0.00 ? 43  ASP A C    4  
ATOM 5786  O O    . ASP A 1 43  ? -1.644  15.379  7.529   1.00 0.00 ? 43  ASP A O    4  
ATOM 5787  C CB   . ASP A 1 43  ? -1.614  16.785  4.862   1.00 0.00 ? 43  ASP A CB   4  
ATOM 5788  C CG   . ASP A 1 43  ? -1.645  15.320  4.421   1.00 0.00 ? 43  ASP A CG   4  
ATOM 5789  O OD1  . ASP A 1 43  ? -1.507  14.456  5.313   1.00 0.00 ? 43  ASP A OD1  4  
ATOM 5790  O OD2  . ASP A 1 43  ? -1.805  15.098  3.201   1.00 0.00 ? 43  ASP A OD2  4  
ATOM 5791  H H    . ASP A 1 43  ? 0.475   15.413  5.764   1.00 0.00 ? 43  ASP A H    4  
ATOM 5792  H HA   . ASP A 1 43  ? -0.493  18.133  6.141   1.00 0.00 ? 43  ASP A HA   4  
ATOM 5793  H HB3  . ASP A 1 43  ? -1.257  17.392  4.029   1.00 0.00 ? 43  ASP A HB3  4  
ATOM 5794  N N    . GLU A 1 44  ? -1.940  17.541  8.125   1.00 0.00 ? 44  GLU A N    4  
ATOM 5795  C CA   . GLU A 1 44  ? -2.670  17.222  9.339   1.00 0.00 ? 44  GLU A CA   4  
ATOM 5796  C C    . GLU A 1 44  ? -3.984  16.517  8.999   1.00 0.00 ? 44  GLU A C    4  
ATOM 5797  O O    . GLU A 1 44  ? -4.204  16.125  7.854   1.00 0.00 ? 44  GLU A O    4  
ATOM 5798  C CB   . GLU A 1 44  ? -2.923  18.480  10.174  1.00 0.00 ? 44  GLU A CB   4  
ATOM 5799  C CG   . GLU A 1 44  ? -2.021  18.508  11.410  1.00 0.00 ? 44  GLU A CG   4  
ATOM 5800  C CD   . GLU A 1 44  ? -1.600  19.940  11.748  1.00 0.00 ? 44  GLU A CD   4  
ATOM 5801  O OE1  . GLU A 1 44  ? -2.474  20.687  12.240  1.00 0.00 ? 44  GLU A OE1  4  
ATOM 5802  O OE2  . GLU A 1 44  ? -0.415  20.255  11.509  1.00 0.00 ? 44  GLU A OE2  4  
ATOM 5803  H H    . GLU A 1 44  ? -1.812  18.518  7.952   1.00 0.00 ? 44  GLU A H    4  
ATOM 5804  H HA   . GLU A 1 44  ? -2.021  16.547  9.898   1.00 0.00 ? 44  GLU A HA   4  
ATOM 5805  H HB3  . GLU A 1 44  ? -3.967  18.513  10.481  1.00 0.00 ? 44  GLU A HB3  4  
ATOM 5806  H HG3  . GLU A 1 44  ? -1.135  17.898  11.232  1.00 0.00 ? 44  GLU A HG3  4  
ATOM 5807  N N    . GLU A 1 45  ? -4.824  16.377  10.014  1.00 0.00 ? 45  GLU A N    4  
ATOM 5808  C CA   . GLU A 1 45  ? -6.110  15.725  9.837   1.00 0.00 ? 45  GLU A CA   4  
ATOM 5809  C C    . GLU A 1 45  ? -7.247  16.723  10.070  1.00 0.00 ? 45  GLU A C    4  
ATOM 5810  O O    . GLU A 1 45  ? -7.630  16.978  11.210  1.00 0.00 ? 45  GLU A O    4  
ATOM 5811  C CB   . GLU A 1 45  ? -6.245  14.515  10.765  1.00 0.00 ? 45  GLU A CB   4  
ATOM 5812  C CG   . GLU A 1 45  ? -6.136  14.935  12.232  1.00 0.00 ? 45  GLU A CG   4  
ATOM 5813  C CD   . GLU A 1 45  ? -7.420  14.599  12.994  1.00 0.00 ? 45  GLU A CD   4  
ATOM 5814  O OE1  . GLU A 1 45  ? -7.770  13.399  13.016  1.00 0.00 ? 45  GLU A OE1  4  
ATOM 5815  O OE2  . GLU A 1 45  ? -8.021  15.550  13.538  1.00 0.00 ? 45  GLU A OE2  4  
ATOM 5816  H H    . GLU A 1 45  ? -4.638  16.698  10.943  1.00 0.00 ? 45  GLU A H    4  
ATOM 5817  H HA   . GLU A 1 45  ? -6.124  15.385  8.802   1.00 0.00 ? 45  GLU A HA   4  
ATOM 5818  H HB3  . GLU A 1 45  ? -5.468  13.786  10.532  1.00 0.00 ? 45  GLU A HB3  4  
ATOM 5819  H HG3  . GLU A 1 45  ? -5.940  16.005  12.295  1.00 0.00 ? 45  GLU A HG3  4  
ATOM 5820  N N    . ASN A 1 46  ? -7.755  17.260  8.970   1.00 0.00 ? 46  ASN A N    4  
ATOM 5821  C CA   . ASN A 1 46  ? -8.840  18.224  9.039   1.00 0.00 ? 46  ASN A CA   4  
ATOM 5822  C C    . ASN A 1 46  ? -9.391  18.467  7.634   1.00 0.00 ? 46  ASN A C    4  
ATOM 5823  O O    . ASN A 1 46  ? -8.670  18.325  6.646   1.00 0.00 ? 46  ASN A O    4  
ATOM 5824  C CB   . ASN A 1 46  ? -8.352  19.563  9.594   1.00 0.00 ? 46  ASN A CB   4  
ATOM 5825  C CG   . ASN A 1 46  ? -7.354  20.221  8.640   1.00 0.00 ? 46  ASN A CG   4  
ATOM 5826  O OD1  . ASN A 1 46  ? -7.478  21.377  8.269   1.00 0.00 ? 46  ASN A OD1  4  
ATOM 5827  N ND2  . ASN A 1 46  ? -6.357  19.424  8.264   1.00 0.00 ? 46  ASN A ND2  4  
ATOM 5828  H H    . ASN A 1 46  ? -7.437  17.047  8.046   1.00 0.00 ? 46  ASN A H    4  
ATOM 5829  H HA   . ASN A 1 46  ? -9.577  17.777  9.704   1.00 0.00 ? 46  ASN A HA   4  
ATOM 5830  H HB3  . ASN A 1 46  ? -7.883  19.409  10.567  1.00 0.00 ? 46  ASN A HB3  4  
ATOM 5831  H HD21 . ASN A 1 46  ? -6.314  18.485  8.605   1.00 0.00 ? 46  ASN A HD21 4  
ATOM 5832  H HD22 . ASN A 1 46  ? -5.654  19.762  7.640   1.00 0.00 ? 46  ASN A HD22 4  
ATOM 5833  N N    . GLY A 1 47  ? -10.664 18.830  7.586   1.00 0.00 ? 47  GLY A N    4  
ATOM 5834  C CA   . GLY A 1 47  ? -11.320 19.095  6.317   1.00 0.00 ? 47  GLY A CA   4  
ATOM 5835  C C    . GLY A 1 47  ? -11.801 17.796  5.667   1.00 0.00 ? 47  GLY A C    4  
ATOM 5836  O O    . GLY A 1 47  ? -11.098 16.787  5.694   1.00 0.00 ? 47  GLY A O    4  
ATOM 5837  H H    . GLY A 1 47  ? -11.243 18.943  8.393   1.00 0.00 ? 47  GLY A H    4  
ATOM 5838  H HA2  . GLY A 1 47  ? -12.168 19.763  6.473   1.00 0.00 ? 47  GLY A HA2  4  
ATOM 5839  H HA3  . GLY A 1 47  ? -10.630 19.607  5.647   1.00 0.00 ? 47  GLY A HA3  4  
ATOM 5840  N N    . ASN A 1 48  ? -12.995 17.862  5.095   1.00 0.00 ? 48  ASN A N    4  
ATOM 5841  C CA   . ASN A 1 48  ? -13.577 16.705  4.441   1.00 0.00 ? 48  ASN A CA   4  
ATOM 5842  C C    . ASN A 1 48  ? -14.886 17.113  3.761   1.00 0.00 ? 48  ASN A C    4  
ATOM 5843  O O    . ASN A 1 48  ? -15.833 17.525  4.429   1.00 0.00 ? 48  ASN A O    4  
ATOM 5844  C CB   . ASN A 1 48  ? -13.892 15.600  5.451   1.00 0.00 ? 48  ASN A CB   4  
ATOM 5845  C CG   . ASN A 1 48  ? -14.458 14.362  4.751   1.00 0.00 ? 48  ASN A CG   4  
ATOM 5846  O OD1  . ASN A 1 48  ? -13.961 13.913  3.731   1.00 0.00 ? 48  ASN A OD1  4  
ATOM 5847  N ND2  . ASN A 1 48  ? -15.521 13.840  5.354   1.00 0.00 ? 48  ASN A ND2  4  
ATOM 5848  H H    . ASN A 1 48  ? -13.560 18.687  5.078   1.00 0.00 ? 48  ASN A H    4  
ATOM 5849  H HA   . ASN A 1 48  ? -12.823 16.371  3.726   1.00 0.00 ? 48  ASN A HA   4  
ATOM 5850  H HB3  . ASN A 1 48  ? -14.610 15.967  6.185   1.00 0.00 ? 48  ASN A HB3  4  
ATOM 5851  H HD21 . ASN A 1 48  ? -15.878 14.257  6.189   1.00 0.00 ? 48  ASN A HD21 4  
ATOM 5852  H HD22 . ASN A 1 48  ? -15.963 13.027  4.972   1.00 0.00 ? 48  ASN A HD22 4  
ATOM 5853  N N    . ARG A 1 49  ? -14.898 16.984  2.443   1.00 0.00 ? 49  ARG A N    4  
ATOM 5854  C CA   . ARG A 1 49  ? -16.074 17.334  1.667   1.00 0.00 ? 49  ARG A CA   4  
ATOM 5855  C C    . ARG A 1 49  ? -16.327 16.285  0.583   1.00 0.00 ? 49  ARG A C    4  
ATOM 5856  O O    . ARG A 1 49  ? -17.404 15.692  0.526   1.00 0.00 ? 49  ARG A O    4  
ATOM 5857  C CB   . ARG A 1 49  ? -15.913 18.707  1.011   1.00 0.00 ? 49  ARG A CB   4  
ATOM 5858  C CG   . ARG A 1 49  ? -16.905 19.714  1.596   1.00 0.00 ? 49  ARG A CG   4  
ATOM 5859  C CD   . ARG A 1 49  ? -16.429 21.150  1.363   1.00 0.00 ? 49  ARG A CD   4  
ATOM 5860  N NE   . ARG A 1 49  ? -16.555 21.934  2.612   1.00 0.00 ? 49  ARG A NE   4  
ATOM 5861  C CZ   . ARG A 1 49  ? -15.923 21.634  3.754   1.00 0.00 ? 49  ARG A CZ   4  
ATOM 5862  N NH1  . ARG A 1 49  ? -15.116 20.565  3.813   1.00 0.00 ? 49  ARG A NH1  4  
ATOM 5863  N NH2  . ARG A 1 49  ? -16.097 22.401  4.838   1.00 0.00 ? 49  ARG A NH2  4  
ATOM 5864  H H    . ARG A 1 49  ? -14.123 16.648  1.908   1.00 0.00 ? 49  ARG A H    4  
ATOM 5865  H HA   . ARG A 1 49  ? -16.890 17.355  2.391   1.00 0.00 ? 49  ARG A HA   4  
ATOM 5866  H HB3  . ARG A 1 49  ? -16.069 18.621  -0.066  1.00 0.00 ? 49  ARG A HB3  4  
ATOM 5867  H HG3  . ARG A 1 49  ? -17.023 19.536  2.664   1.00 0.00 ? 49  ARG A HG3  4  
ATOM 5868  H HD3  . ARG A 1 49  ? -17.018 21.614  0.572   1.00 0.00 ? 49  ARG A HD3  4  
ATOM 5869  H HE   . ARG A 1 49  ? -17.149 22.738  2.603   1.00 0.00 ? 49  ARG A HE   4  
ATOM 5870  H HH11 . ARG A 1 49  ? -14.987 19.990  3.004   1.00 0.00 ? 49  ARG A HH11 4  
ATOM 5871  H HH12 . ARG A 1 49  ? -14.645 20.340  4.665   1.00 0.00 ? 49  ARG A HH12 4  
ATOM 5872  H HH21 . ARG A 1 49  ? -16.698 23.199  4.794   1.00 0.00 ? 49  ARG A HH21 4  
ATOM 5873  H HH22 . ARG A 1 49  ? -15.624 22.176  5.691   1.00 0.00 ? 49  ARG A HH22 4  
ATOM 5874  N N    . GLY A 1 50  ? -15.318 16.086  -0.251  1.00 0.00 ? 50  GLY A N    4  
ATOM 5875  C CA   . GLY A 1 50  ? -15.416 15.119  -1.330  1.00 0.00 ? 50  GLY A CA   4  
ATOM 5876  C C    . GLY A 1 50  ? -14.211 15.215  -2.265  1.00 0.00 ? 50  GLY A C    4  
ATOM 5877  O O    . GLY A 1 50  ? -13.185 15.791  -1.905  1.00 0.00 ? 50  GLY A O    4  
ATOM 5878  H H    . GLY A 1 50  ? -14.445 16.572  -0.198  1.00 0.00 ? 50  GLY A H    4  
ATOM 5879  H HA2  . GLY A 1 50  ? -15.481 14.113  -0.916  1.00 0.00 ? 50  GLY A HA2  4  
ATOM 5880  H HA3  . GLY A 1 50  ? -16.333 15.290  -1.895  1.00 0.00 ? 50  GLY A HA3  4  
ATOM 5881  N N    . GLY A 1 51  ? -14.372 14.641  -3.449  1.00 0.00 ? 51  GLY A N    4  
ATOM 5882  C CA   . GLY A 1 51  ? -13.308 14.655  -4.439  1.00 0.00 ? 51  GLY A CA   4  
ATOM 5883  C C    . GLY A 1 51  ? -13.876 14.532  -5.854  1.00 0.00 ? 51  GLY A C    4  
ATOM 5884  O O    . GLY A 1 51  ? -15.064 14.270  -6.031  1.00 0.00 ? 51  GLY A O    4  
ATOM 5885  H H    . GLY A 1 51  ? -15.209 14.175  -3.735  1.00 0.00 ? 51  GLY A H    4  
ATOM 5886  H HA2  . GLY A 1 51  ? -12.736 15.579  -4.351  1.00 0.00 ? 51  GLY A HA2  4  
ATOM 5887  H HA3  . GLY A 1 51  ? -12.618 13.833  -4.247  1.00 0.00 ? 51  GLY A HA3  4  
ATOM 5888  N N    . LYS A 1 52  ? -12.998 14.730  -6.828  1.00 0.00 ? 52  LYS A N    4  
ATOM 5889  C CA   . LYS A 1 52  ? -13.398 14.645  -8.223  1.00 0.00 ? 52  LYS A CA   4  
ATOM 5890  C C    . LYS A 1 52  ? -12.681 13.464  -8.883  1.00 0.00 ? 52  LYS A C    4  
ATOM 5891  O O    . LYS A 1 52  ? -11.728 12.922  -8.325  1.00 0.00 ? 52  LYS A O    4  
ATOM 5892  C CB   . LYS A 1 52  ? -13.161 15.981  -8.930  1.00 0.00 ? 52  LYS A CB   4  
ATOM 5893  C CG   . LYS A 1 52  ? -14.435 16.470  -9.620  1.00 0.00 ? 52  LYS A CG   4  
ATOM 5894  C CD   . LYS A 1 52  ? -14.414 17.989  -9.800  1.00 0.00 ? 52  LYS A CD   4  
ATOM 5895  C CE   . LYS A 1 52  ? -15.834 18.547  -9.918  1.00 0.00 ? 52  LYS A CE   4  
ATOM 5896  N NZ   . LYS A 1 52  ? -15.881 19.639  -10.914 1.00 0.00 ? 52  LYS A NZ   4  
ATOM 5897  H H    . LYS A 1 52  ? -12.033 14.943  -6.677  1.00 0.00 ? 52  LYS A H    4  
ATOM 5898  H HA   . LYS A 1 52  ? -14.470 14.455  -8.245  1.00 0.00 ? 52  LYS A HA   4  
ATOM 5899  H HB3  . LYS A 1 52  ? -12.364 15.871  -9.666  1.00 0.00 ? 52  LYS A HB3  4  
ATOM 5900  H HG3  . LYS A 1 52  ? -15.305 16.182  -9.030  1.00 0.00 ? 52  LYS A HG3  4  
ATOM 5901  H HD3  . LYS A 1 52  ? -13.844 18.245  -10.692 1.00 0.00 ? 52  LYS A HD3  4  
ATOM 5902  H HE3  . LYS A 1 52  ? -16.168 18.917  -8.949  1.00 0.00 ? 52  LYS A HE3  4  
ATOM 5903  H HZ1  . LYS A 1 52  ? -15.137 20.284  -10.738 1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 5904  H HZ2  . LYS A 1 52  ? -15.778 19.257  -11.833 1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 5905  H HZ3  . LYS A 1 52  ? -16.757 20.115  -10.847 1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 5906  N N    . GLN A 1 53  ? -13.167 13.102  -10.061 1.00 0.00 ? 53  GLN A N    4  
ATOM 5907  C CA   . GLN A 1 53  ? -12.585 11.997  -10.802 1.00 0.00 ? 53  GLN A CA   4  
ATOM 5908  C C    . GLN A 1 53  ? -12.833 10.677  -10.069 1.00 0.00 ? 53  GLN A C    4  
ATOM 5909  O O    . GLN A 1 53  ? -13.266 10.674  -8.917  1.00 0.00 ? 53  GLN A O    4  
ATOM 5910  C CB   . GLN A 1 53  ? -11.089 12.221  -11.037 1.00 0.00 ? 53  GLN A CB   4  
ATOM 5911  C CG   . GLN A 1 53  ? -10.826 12.722  -12.458 1.00 0.00 ? 53  GLN A CG   4  
ATOM 5912  C CD   . GLN A 1 53  ? -10.920 14.247  -12.529 1.00 0.00 ? 53  GLN A CD   4  
ATOM 5913  O OE1  . GLN A 1 53  ? -9.929  14.958  -12.486 1.00 0.00 ? 53  GLN A OE1  4  
ATOM 5914  N NE2  . GLN A 1 53  ? -12.162 14.709  -12.638 1.00 0.00 ? 53  GLN A NE2  4  
ATOM 5915  H H    . GLN A 1 53  ? -13.941 13.549  -10.508 1.00 0.00 ? 53  GLN A H    4  
ATOM 5916  H HA   . GLN A 1 53  ? -13.099 11.989  -11.763 1.00 0.00 ? 53  GLN A HA   4  
ATOM 5917  H HB3  . GLN A 1 53  ? -10.548 11.289  -10.869 1.00 0.00 ? 53  GLN A HB3  4  
ATOM 5918  H HG3  . GLN A 1 53  ? -11.548 12.277  -13.143 1.00 0.00 ? 53  GLN A HG3  4  
ATOM 5919  H HE21 . GLN A 1 53  ? -12.932 14.071  -12.667 1.00 0.00 ? 53  GLN A HE21 4  
ATOM 5920  H HE22 . GLN A 1 53  ? -12.327 15.693  -12.690 1.00 0.00 ? 53  GLN A HE22 4  
ATOM 5921  N N    . ARG A 1 54  ? -12.549 9.586   -10.767 1.00 0.00 ? 54  ARG A N    4  
ATOM 5922  C CA   . ARG A 1 54  ? -12.736 8.263   -10.197 1.00 0.00 ? 54  ARG A CA   4  
ATOM 5923  C C    . ARG A 1 54  ? -12.181 7.195   -11.142 1.00 0.00 ? 54  ARG A C    4  
ATOM 5924  O O    . ARG A 1 54  ? -11.542 6.243   -10.699 1.00 0.00 ? 54  ARG A O    4  
ATOM 5925  C CB   . ARG A 1 54  ? -14.218 7.982   -9.934  1.00 0.00 ? 54  ARG A CB   4  
ATOM 5926  C CG   . ARG A 1 54  ? -15.069 8.344   -11.151 1.00 0.00 ? 54  ARG A CG   4  
ATOM 5927  C CD   . ARG A 1 54  ? -16.523 8.599   -10.747 1.00 0.00 ? 54  ARG A CD   4  
ATOM 5928  N NE   . ARG A 1 54  ? -17.437 7.915   -11.688 1.00 0.00 ? 54  ARG A NE   4  
ATOM 5929  C CZ   . ARG A 1 54  ? -17.457 6.591   -11.889 1.00 0.00 ? 54  ARG A CZ   4  
ATOM 5930  N NH1  . ARG A 1 54  ? -16.613 5.799   -11.213 1.00 0.00 ? 54  ARG A NH1  4  
ATOM 5931  N NH2  . ARG A 1 54  ? -18.321 6.058   -12.761 1.00 0.00 ? 54  ARG A NH2  4  
ATOM 5932  H H    . ARG A 1 54  ? -12.198 9.598   -11.703 1.00 0.00 ? 54  ARG A H    4  
ATOM 5933  H HA   . ARG A 1 54  ? -12.182 8.283   -9.259  1.00 0.00 ? 54  ARG A HA   4  
ATOM 5934  H HB3  . ARG A 1 54  ? -14.551 8.554   -9.068  1.00 0.00 ? 54  ARG A HB3  4  
ATOM 5935  H HG3  . ARG A 1 54  ? -15.027 7.537   -11.882 1.00 0.00 ? 54  ARG A HG3  4  
ATOM 5936  H HD3  . ARG A 1 54  ? -16.726 9.669   -10.743 1.00 0.00 ? 54  ARG A HD3  4  
ATOM 5937  H HE   . ARG A 1 54  ? -18.081 8.478   -12.209 1.00 0.00 ? 54  ARG A HE   4  
ATOM 5938  H HH11 . ARG A 1 54  ? -15.968 6.197   -10.559 1.00 0.00 ? 54  ARG A HH11 4  
ATOM 5939  H HH12 . ARG A 1 54  ? -16.629 4.809   -11.362 1.00 0.00 ? 54  ARG A HH12 4  
ATOM 5940  H HH21 . ARG A 1 54  ? -18.951 6.649   -13.266 1.00 0.00 ? 54  ARG A HH21 4  
ATOM 5941  H HH22 . ARG A 1 54  ? -18.337 5.068   -12.911 1.00 0.00 ? 54  ARG A HH22 4  
ATOM 5942  N N    . ASN A 1 55  ? -12.446 7.391   -12.426 1.00 0.00 ? 55  ASN A N    4  
ATOM 5943  C CA   . ASN A 1 55  ? -11.982 6.456   -13.436 1.00 0.00 ? 55  ASN A CA   4  
ATOM 5944  C C    . ASN A 1 55  ? -12.617 5.086   -13.187 1.00 0.00 ? 55  ASN A C    4  
ATOM 5945  O O    . ASN A 1 55  ? -13.109 4.814   -12.094 1.00 0.00 ? 55  ASN A O    4  
ATOM 5946  C CB   . ASN A 1 55  ? -10.461 6.291   -13.376 1.00 0.00 ? 55  ASN A CB   4  
ATOM 5947  C CG   . ASN A 1 55  ? -9.763  7.652   -13.354 1.00 0.00 ? 55  ASN A CG   4  
ATOM 5948  O OD1  . ASN A 1 55  ? -10.383 8.699   -13.449 1.00 0.00 ? 55  ASN A OD1  4  
ATOM 5949  N ND2  . ASN A 1 55  ? -8.441  7.580   -13.223 1.00 0.00 ? 55  ASN A ND2  4  
ATOM 5950  H H    . ASN A 1 55  ? -12.968 8.169   -12.776 1.00 0.00 ? 55  ASN A H    4  
ATOM 5951  H HA   . ASN A 1 55  ? -12.285 6.889   -14.388 1.00 0.00 ? 55  ASN A HA   4  
ATOM 5952  H HB3  . ASN A 1 55  ? -10.120 5.717   -14.238 1.00 0.00 ? 55  ASN A HB3  4  
ATOM 5953  H HD21 . ASN A 1 55  ? -7.994  6.687   -13.150 1.00 0.00 ? 55  ASN A HD21 4  
ATOM 5954  H HD22 . ASN A 1 55  ? -7.894  8.416   -13.197 1.00 0.00 ? 55  ASN A HD22 4  
ATOM 5955  N N    . ARG A 1 56  ? -12.582 4.258   -14.221 1.00 0.00 ? 56  ARG A N    4  
ATOM 5956  C CA   . ARG A 1 56  ? -13.149 2.923   -14.130 1.00 0.00 ? 56  ARG A CA   4  
ATOM 5957  C C    . ARG A 1 56  ? -12.441 1.978   -15.104 1.00 0.00 ? 56  ARG A C    4  
ATOM 5958  O O    . ARG A 1 56  ? -13.046 1.505   -16.064 1.00 0.00 ? 56  ARG A O    4  
ATOM 5959  C CB   . ARG A 1 56  ? -14.646 2.937   -14.440 1.00 0.00 ? 56  ARG A CB   4  
ATOM 5960  C CG   . ARG A 1 56  ? -15.257 1.545   -14.261 1.00 0.00 ? 56  ARG A CG   4  
ATOM 5961  C CD   . ARG A 1 56  ? -16.583 1.427   -15.014 1.00 0.00 ? 56  ARG A CD   4  
ATOM 5962  N NE   . ARG A 1 56  ? -16.380 1.729   -16.448 1.00 0.00 ? 56  ARG A NE   4  
ATOM 5963  C CZ   . ARG A 1 56  ? -17.354 1.704   -17.367 1.00 0.00 ? 56  ARG A CZ   4  
ATOM 5964  N NH1  . ARG A 1 56  ? -18.607 1.389   -17.006 1.00 0.00 ? 56  ARG A NH1  4  
ATOM 5965  N NH2  . ARG A 1 56  ? -17.078 1.991   -18.646 1.00 0.00 ? 56  ARG A NH2  4  
ATOM 5966  H H    . ARG A 1 56  ? -12.180 4.485   -15.107 1.00 0.00 ? 56  ARG A H    4  
ATOM 5967  H HA   . ARG A 1 56  ? -12.980 2.620   -13.096 1.00 0.00 ? 56  ARG A HA   4  
ATOM 5968  H HB3  . ARG A 1 56  ? -14.806 3.279   -15.462 1.00 0.00 ? 56  ARG A HB3  4  
ATOM 5969  H HG3  . ARG A 1 56  ? -15.417 1.348   -13.201 1.00 0.00 ? 56  ARG A HG3  4  
ATOM 5970  H HD3  . ARG A 1 56  ? -17.315 2.114   -14.589 1.00 0.00 ? 56  ARG A HD3  4  
ATOM 5971  H HE   . ARG A 1 56  ? -15.458 1.968   -16.750 1.00 0.00 ? 56  ARG A HE   4  
ATOM 5972  H HH11 . ARG A 1 56  ? -18.814 1.172   -16.052 1.00 0.00 ? 56  ARG A HH11 4  
ATOM 5973  H HH12 . ARG A 1 56  ? -19.334 1.370   -17.693 1.00 0.00 ? 56  ARG A HH12 4  
ATOM 5974  H HH21 . ARG A 1 56  ? -16.144 2.227   -18.914 1.00 0.00 ? 56  ARG A HH21 4  
ATOM 5975  H HH22 . ARG A 1 56  ? -17.805 1.972   -19.331 1.00 0.00 ? 56  ARG A HH22 4  
ATOM 5976  N N    . LEU A 1 57  ? -11.171 1.732   -14.821 1.00 0.00 ? 57  LEU A N    4  
ATOM 5977  C CA   . LEU A 1 57  ? -10.374 0.852   -15.661 1.00 0.00 ? 57  LEU A CA   4  
ATOM 5978  C C    . LEU A 1 57  ? -8.925  0.857   -15.167 1.00 0.00 ? 57  LEU A C    4  
ATOM 5979  O O    . LEU A 1 57  ? -8.051  1.437   -15.807 1.00 0.00 ? 57  LEU A O    4  
ATOM 5980  C CB   . LEU A 1 57  ? -10.523 1.237   -17.134 1.00 0.00 ? 57  LEU A CB   4  
ATOM 5981  C CG   . LEU A 1 57  ? -10.977 0.122   -18.077 1.00 0.00 ? 57  LEU A CG   4  
ATOM 5982  C CD1  . LEU A 1 57  ? -9.950  -1.011  -18.120 1.00 0.00 ? 57  LEU A CD1  4  
ATOM 5983  C CD2  . LEU A 1 57  ? -12.371 -0.382  -17.697 1.00 0.00 ? 57  LEU A CD2  4  
ATOM 5984  H H    . LEU A 1 57  ? -10.686 2.121   -14.038 1.00 0.00 ? 57  LEU A H    4  
ATOM 5985  H HA   . LEU A 1 57  ? -10.775 -0.155  -15.549 1.00 0.00 ? 57  LEU A HA   4  
ATOM 5986  H HB3  . LEU A 1 57  ? -9.566  1.619   -17.488 1.00 0.00 ? 57  LEU A HB3  4  
ATOM 5987  H HG   . LEU A 1 57  ? -11.046 0.533   -19.084 1.00 0.00 ? 57  LEU A HG   4  
ATOM 5988  H HD11 . LEU A 1 57  ? -9.031  -0.686  -17.634 1.00 0.00 ? 57  LEU A HD11 4  
ATOM 5989  H HD12 . LEU A 1 57  ? -10.348 -1.883  -17.602 1.00 0.00 ? 57  LEU A HD12 4  
ATOM 5990  H HD13 . LEU A 1 57  ? -9.740  -1.270  -19.158 1.00 0.00 ? 57  LEU A HD13 4  
ATOM 5991  H HD21 . LEU A 1 57  ? -13.118 0.352   -17.998 1.00 0.00 ? 57  LEU A HD21 4  
ATOM 5992  H HD22 . LEU A 1 57  ? -12.566 -1.328  -18.205 1.00 0.00 ? 57  LEU A HD22 4  
ATOM 5993  H HD23 . LEU A 1 57  ? -12.422 -0.533  -16.619 1.00 0.00 ? 57  LEU A HD23 4  
ATOM 5994  N N    . GLU A 1 58  ? -8.719  0.203   -14.034 1.00 0.00 ? 58  GLU A N    4  
ATOM 5995  C CA   . GLU A 1 58  ? -7.392  0.123   -13.447 1.00 0.00 ? 58  GLU A CA   4  
ATOM 5996  C C    . GLU A 1 58  ? -6.820  -1.285  -13.616 1.00 0.00 ? 58  GLU A C    4  
ATOM 5997  O O    . GLU A 1 58  ? -7.564  -2.239  -13.839 1.00 0.00 ? 58  GLU A O    4  
ATOM 5998  C CB   . GLU A 1 58  ? -7.418  0.532   -11.973 1.00 0.00 ? 58  GLU A CB   4  
ATOM 5999  C CG   . GLU A 1 58  ? -8.155  1.860   -11.785 1.00 0.00 ? 58  GLU A CG   4  
ATOM 6000  C CD   . GLU A 1 58  ? -8.339  2.179   -10.300 1.00 0.00 ? 58  GLU A CD   4  
ATOM 6001  O OE1  . GLU A 1 58  ? -7.351  2.649   -9.693  1.00 0.00 ? 58  GLU A OE1  4  
ATOM 6002  O OE2  . GLU A 1 58  ? -9.462  1.946   -9.804  1.00 0.00 ? 58  GLU A OE2  4  
ATOM 6003  H H    . GLU A 1 58  ? -9.436  -0.267  -13.521 1.00 0.00 ? 58  GLU A H    4  
ATOM 6004  H HA   . GLU A 1 58  ? -6.786  0.838   -14.004 1.00 0.00 ? 58  GLU A HA   4  
ATOM 6005  H HB3  . GLU A 1 58  ? -6.400  0.620   -11.597 1.00 0.00 ? 58  GLU A HB3  4  
ATOM 6006  H HG3  . GLU A 1 58  ? -9.128  1.814   -12.273 1.00 0.00 ? 58  GLU A HG3  4  
ATOM 6007  N N    . PRO A 1 59  ? -5.468  -1.375  -13.499 1.00 0.00 ? 59  PRO A N    4  
ATOM 6008  C CA   . PRO A 1 59  ? -4.787  -2.651  -13.635 1.00 0.00 ? 59  PRO A CA   4  
ATOM 6009  C C    . PRO A 1 59  ? -4.987  -3.516  -12.388 1.00 0.00 ? 59  PRO A C    4  
ATOM 6010  O O    . PRO A 1 59  ? -5.734  -4.493  -12.420 1.00 0.00 ? 59  PRO A O    4  
ATOM 6011  C CB   . PRO A 1 59  ? -3.330  -2.296  -13.884 1.00 0.00 ? 59  PRO A CB   4  
ATOM 6012  C CG   . PRO A 1 59  ? -3.167  -0.858  -13.417 1.00 0.00 ? 59  PRO A CG   4  
ATOM 6013  C CD   . PRO A 1 59  ? -4.554  -0.267  -13.233 1.00 0.00 ? 59  PRO A CD   4  
ATOM 6014  H HA   . PRO A 1 59  ? -5.176  -3.172  -14.395 1.00 0.00 ? 59  PRO A HA   4  
ATOM 6015  H HB3  . PRO A 1 59  ? -3.079  -2.395  -14.940 1.00 0.00 ? 59  PRO A HB3  4  
ATOM 6016  H HG3  . PRO A 1 59  ? -2.600  -0.282  -14.148 1.00 0.00 ? 59  PRO A HG3  4  
ATOM 6017  H HD3  . PRO A 1 59  ? -4.727  0.561   -13.920 1.00 0.00 ? 59  PRO A HD3  4  
ATOM 6018  N N    . MET A 1 60  ? -4.308  -3.125  -11.321 1.00 0.00 ? 60  MET A N    4  
ATOM 6019  C CA   . MET A 1 60  ? -4.400  -3.851  -10.066 1.00 0.00 ? 60  MET A CA   4  
ATOM 6020  C C    . MET A 1 60  ? -4.526  -2.890  -8.883  1.00 0.00 ? 60  MET A C    4  
ATOM 6021  O O    . MET A 1 60  ? -5.354  -3.094  -7.997  1.00 0.00 ? 60  MET A O    4  
ATOM 6022  C CB   . MET A 1 60  ? -3.156  -4.723  -9.888  1.00 0.00 ? 60  MET A CB   4  
ATOM 6023  C CG   . MET A 1 60  ? -3.352  -6.099  -10.529 1.00 0.00 ? 60  MET A CG   4  
ATOM 6024  S SD   . MET A 1 60  ? -2.653  -7.365  -9.483  1.00 0.00 ? 60  MET A SD   4  
ATOM 6025  C CE   . MET A 1 60  ? -4.040  -8.485  -9.385  1.00 0.00 ? 60  MET A CE   4  
ATOM 6026  H H    . MET A 1 60  ? -3.701  -2.329  -11.304 1.00 0.00 ? 60  MET A H    4  
ATOM 6027  H HA   . MET A 1 60  ? -5.302  -4.459  -10.147 1.00 0.00 ? 60  MET A HA   4  
ATOM 6028  H HB3  . MET A 1 60  ? -2.940  -4.841  -8.826  1.00 0.00 ? 60  MET A HB3  4  
ATOM 6029  H HG3  . MET A 1 60  ? -2.876  -6.122  -11.510 1.00 0.00 ? 60  MET A HG3  4  
ATOM 6030  H HE1  . MET A 1 60  ? -4.968  -7.914  -9.354  1.00 0.00 ? 60  MET A HE1  4  
ATOM 6031  H HE2  . MET A 1 60  ? -4.043  -9.137  -10.259 1.00 0.00 ? 60  MET A HE2  4  
ATOM 6032  H HE3  . MET A 1 60  ? -3.956  -9.089  -8.482  1.00 0.00 ? 60  MET A HE3  4  
ATOM 6033  N N    . ASP A 1 61  ? -3.690  -1.862  -8.907  1.00 0.00 ? 61  ASP A N    4  
ATOM 6034  C CA   . ASP A 1 61  ? -3.697  -0.868  -7.848  1.00 0.00 ? 61  ASP A CA   4  
ATOM 6035  C C    . ASP A 1 61  ? -3.805  -1.573  -6.493  1.00 0.00 ? 61  ASP A C    4  
ATOM 6036  O O    . ASP A 1 61  ? -4.810  -1.436  -5.797  1.00 0.00 ? 61  ASP A O    4  
ATOM 6037  C CB   . ASP A 1 61  ? -4.892  0.076   -7.986  1.00 0.00 ? 61  ASP A CB   4  
ATOM 6038  C CG   . ASP A 1 61  ? -4.754  1.409   -7.247  1.00 0.00 ? 61  ASP A CG   4  
ATOM 6039  O OD1  . ASP A 1 61  ? -3.622  1.694   -6.800  1.00 0.00 ? 61  ASP A OD1  4  
ATOM 6040  O OD2  . ASP A 1 61  ? -5.782  2.112   -7.145  1.00 0.00 ? 61  ASP A OD2  4  
ATOM 6041  H H    . ASP A 1 61  ? -3.020  -1.702  -9.631  1.00 0.00 ? 61  ASP A H    4  
ATOM 6042  H HA   . ASP A 1 61  ? -2.760  -0.322  -7.961  1.00 0.00 ? 61  ASP A HA   4  
ATOM 6043  H HB3  . ASP A 1 61  ? -5.783  -0.434  -7.619  1.00 0.00 ? 61  ASP A HB3  4  
ATOM 6044  N N    . THR A 1 62  ? -2.756  -2.310  -6.162  1.00 0.00 ? 62  THR A N    4  
ATOM 6045  C CA   . THR A 1 62  ? -2.720  -3.035  -4.903  1.00 0.00 ? 62  THR A CA   4  
ATOM 6046  C C    . THR A 1 62  ? -1.516  -2.594  -4.067  1.00 0.00 ? 62  THR A C    4  
ATOM 6047  O O    . THR A 1 62  ? -0.716  -1.772  -4.510  1.00 0.00 ? 62  THR A O    4  
ATOM 6048  C CB   . THR A 1 62  ? -2.721  -4.533  -5.222  1.00 0.00 ? 62  THR A CB   4  
ATOM 6049  O OG1  . THR A 1 62  ? -2.761  -4.585  -6.645  1.00 0.00 ? 62  THR A OG1  4  
ATOM 6050  C CG2  . THR A 1 62  ? -4.017  -5.220  -4.787  1.00 0.00 ? 62  THR A CG2  4  
ATOM 6051  H H    . THR A 1 62  ? -1.942  -2.415  -6.734  1.00 0.00 ? 62  THR A H    4  
ATOM 6052  H HA   . THR A 1 62  ? -3.614  -2.782  -4.335  1.00 0.00 ? 62  THR A HA   4  
ATOM 6053  H HB   . THR A 1 62  ? -1.854  -5.025  -4.783  1.00 0.00 ? 62  THR A HB   4  
ATOM 6054  H HG1  . THR A 1 62  ? -3.511  -4.020  -6.988  1.00 0.00 ? 62  THR A HG1  4  
ATOM 6055  H HG21 . THR A 1 62  ? -4.057  -6.223  -5.212  1.00 0.00 ? 62  THR A HG21 4  
ATOM 6056  H HG22 . THR A 1 62  ? -4.049  -5.286  -3.700  1.00 0.00 ? 62  THR A HG22 4  
ATOM 6057  H HG23 . THR A 1 62  ? -4.873  -4.643  -5.140  1.00 0.00 ? 62  THR A HG23 4  
ATOM 6058  N N    . ILE A 1 63  ? -1.428  -3.161  -2.873  1.00 0.00 ? 63  ILE A N    4  
ATOM 6059  C CA   . ILE A 1 63  ? -0.336  -2.835  -1.970  1.00 0.00 ? 63  ILE A CA   4  
ATOM 6060  C C    . ILE A 1 63  ? 0.317   -4.130  -1.480  1.00 0.00 ? 63  ILE A C    4  
ATOM 6061  O O    . ILE A 1 63  ? -0.085  -4.683  -0.458  1.00 0.00 ? 63  ILE A O    4  
ATOM 6062  C CB   . ILE A 1 63  ? -0.826  -1.928  -0.841  1.00 0.00 ? 63  ILE A CB   4  
ATOM 6063  C CG1  . ILE A 1 63  ? -1.284  -0.573  -1.385  1.00 0.00 ? 63  ILE A CG1  4  
ATOM 6064  C CG2  . ILE A 1 63  ? 0.241   -1.778  0.245   1.00 0.00 ? 63  ILE A CG2  4  
ATOM 6065  C CD1  . ILE A 1 63  ? -2.789  -0.384  -1.191  1.00 0.00 ? 63  ILE A CD1  4  
ATOM 6066  H H    . ILE A 1 63  ? -2.083  -3.828  -2.520  1.00 0.00 ? 63  ILE A H    4  
ATOM 6067  H HA   . ILE A 1 63  ? 0.402   -2.272  -2.540  1.00 0.00 ? 63  ILE A HA   4  
ATOM 6068  H HB   . ILE A 1 63  ? -1.693  -2.399  -0.377  1.00 0.00 ? 63  ILE A HB   4  
ATOM 6069  H HG13 . ILE A 1 63  ? -1.039  -0.502  -2.445  1.00 0.00 ? 63  ILE A HG13 4  
ATOM 6070  H HG21 . ILE A 1 63  ? -0.155  -1.175  1.062   1.00 0.00 ? 63  ILE A HG21 4  
ATOM 6071  H HG22 . ILE A 1 63  ? 0.518   -2.763  0.622   1.00 0.00 ? 63  ILE A HG22 4  
ATOM 6072  H HG23 . ILE A 1 63  ? 1.119   -1.290  -0.174  1.00 0.00 ? 63  ILE A HG23 4  
ATOM 6073  H HD11 . ILE A 1 63  ? -3.311  -1.294  -1.487  1.00 0.00 ? 63  ILE A HD11 4  
ATOM 6074  H HD12 . ILE A 1 63  ? -2.996  -0.172  -0.142  1.00 0.00 ? 63  ILE A HD12 4  
ATOM 6075  H HD13 . ILE A 1 63  ? -3.133  0.448   -1.805  1.00 0.00 ? 63  ILE A HD13 4  
ATOM 6076  N N    . PHE A 1 64  ? 1.313   -4.575  -2.232  1.00 0.00 ? 64  PHE A N    4  
ATOM 6077  C CA   . PHE A 1 64  ? 2.024   -5.794  -1.887  1.00 0.00 ? 64  PHE A CA   4  
ATOM 6078  C C    . PHE A 1 64  ? 3.102   -5.519  -0.835  1.00 0.00 ? 64  PHE A C    4  
ATOM 6079  O O    . PHE A 1 64  ? 3.895   -4.590  -0.981  1.00 0.00 ? 64  PHE A O    4  
ATOM 6080  C CB   . PHE A 1 64  ? 2.693   -6.298  -3.166  1.00 0.00 ? 64  PHE A CB   4  
ATOM 6081  C CG   . PHE A 1 64  ? 1.710   -6.656  -4.283  1.00 0.00 ? 64  PHE A CG   4  
ATOM 6082  C CD1  . PHE A 1 64  ? 0.753   -7.598  -4.069  1.00 0.00 ? 64  PHE A CD1  4  
ATOM 6083  C CD2  . PHE A 1 64  ? 1.794   -6.033  -5.488  1.00 0.00 ? 64  PHE A CD2  4  
ATOM 6084  C CE1  . PHE A 1 64  ? -0.159  -7.931  -5.107  1.00 0.00 ? 64  PHE A CE1  4  
ATOM 6085  C CE2  . PHE A 1 64  ? 0.883   -6.366  -6.525  1.00 0.00 ? 64  PHE A CE2  4  
ATOM 6086  C CZ   . PHE A 1 64  ? -0.075  -7.308  -6.312  1.00 0.00 ? 64  PHE A CZ   4  
ATOM 6087  H H    . PHE A 1 64  ? 1.633   -4.119  -3.062  1.00 0.00 ? 64  PHE A H    4  
ATOM 6088  H HA   . PHE A 1 64  ? 1.292   -6.492  -1.481  1.00 0.00 ? 64  PHE A HA   4  
ATOM 6089  H HB3  . PHE A 1 64  ? 3.293   -7.177  -2.929  1.00 0.00 ? 64  PHE A HB3  4  
ATOM 6090  H HD1  . PHE A 1 64  ? 0.687   -8.099  -3.104  1.00 0.00 ? 64  PHE A HD1  4  
ATOM 6091  H HD2  . PHE A 1 64  ? 2.562   -5.278  -5.660  1.00 0.00 ? 64  PHE A HD2  4  
ATOM 6092  H HE1  . PHE A 1 64  ? -0.927  -8.686  -4.935  1.00 0.00 ? 64  PHE A HE1  4  
ATOM 6093  H HE2  . PHE A 1 64  ? 0.949   -5.866  -7.491  1.00 0.00 ? 64  PHE A HE2  4  
ATOM 6094  H HZ   . PHE A 1 64  ? -0.776  -7.563  -7.108  1.00 0.00 ? 64  PHE A HZ   4  
ATOM 6095  N N    . VAL A 1 65  ? 3.097   -6.346  0.200   1.00 0.00 ? 65  VAL A N    4  
ATOM 6096  C CA   . VAL A 1 65  ? 4.063   -6.204  1.275   1.00 0.00 ? 65  VAL A CA   4  
ATOM 6097  C C    . VAL A 1 65  ? 5.446   -6.621  0.770   1.00 0.00 ? 65  VAL A C    4  
ATOM 6098  O O    . VAL A 1 65  ? 5.762   -7.810  0.724   1.00 0.00 ? 65  VAL A O    4  
ATOM 6099  C CB   . VAL A 1 65  ? 3.609   -7.002  2.498   1.00 0.00 ? 65  VAL A CB   4  
ATOM 6100  C CG1  . VAL A 1 65  ? 4.744   -7.146  3.514   1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6101  C CG2  . VAL A 1 65  ? 2.375   -6.365  3.141   1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6102  H H    . VAL A 1 65  ? 2.448   -7.098  0.311   1.00 0.00 ? 65  VAL A H    4  
ATOM 6103  H HA   . VAL A 1 65  ? 4.096   -5.150  1.553   1.00 0.00 ? 65  VAL A HA   4  
ATOM 6104  H HB   . VAL A 1 65  ? 3.331   -8.001  2.161   1.00 0.00 ? 65  VAL A HB   4  
ATOM 6105  H HG11 . VAL A 1 65  ? 5.165   -6.164  3.728   1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6106  H HG12 . VAL A 1 65  ? 4.355   -7.584  4.434   1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6107  H HG13 . VAL A 1 65  ? 5.519   -7.793  3.103   1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6108  H HG21 . VAL A 1 65  ? 1.728   -5.959  2.363   1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6109  H HG22 . VAL A 1 65  ? 1.830   -7.118  3.710   1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6110  H HG23 . VAL A 1 65  ? 2.687   -5.562  3.808   1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6111  N N    . LYS A 1 66  ? 6.234   -5.622  0.403   1.00 0.00 ? 66  LYS A N    4  
ATOM 6112  C CA   . LYS A 1 66  ? 7.576   -5.871  -0.097  1.00 0.00 ? 66  LYS A CA   4  
ATOM 6113  C C    . LYS A 1 66  ? 8.261   -6.912  0.789   1.00 0.00 ? 66  LYS A C    4  
ATOM 6114  O O    . LYS A 1 66  ? 8.766   -7.917  0.294   1.00 0.00 ? 66  LYS A O    4  
ATOM 6115  C CB   . LYS A 1 66  ? 8.354   -4.559  -0.219  1.00 0.00 ? 66  LYS A CB   4  
ATOM 6116  C CG   . LYS A 1 66  ? 9.861   -4.804  -0.123  1.00 0.00 ? 66  LYS A CG   4  
ATOM 6117  C CD   . LYS A 1 66  ? 10.329  -5.773  -1.211  1.00 0.00 ? 66  LYS A CD   4  
ATOM 6118  C CE   . LYS A 1 66  ? 11.721  -5.395  -1.720  1.00 0.00 ? 66  LYS A CE   4  
ATOM 6119  N NZ   . LYS A 1 66  ? 12.570  -6.599  -1.850  1.00 0.00 ? 66  LYS A NZ   4  
ATOM 6120  H H    . LYS A 1 66  ? 5.969   -4.658  0.443   1.00 0.00 ? 66  LYS A H    4  
ATOM 6121  H HA   . LYS A 1 66  ? 7.478   -6.281  -1.102  1.00 0.00 ? 66  LYS A HA   4  
ATOM 6122  H HB3  . LYS A 1 66  ? 8.042   -3.873  0.568   1.00 0.00 ? 66  LYS A HB3  4  
ATOM 6123  H HG3  . LYS A 1 66  ? 10.105  -5.209  0.860   1.00 0.00 ? 66  LYS A HG3  4  
ATOM 6124  H HD3  . LYS A 1 66  ? 9.620   -5.766  -2.039  1.00 0.00 ? 66  LYS A HD3  4  
ATOM 6125  H HE3  . LYS A 1 66  ? 12.184  -4.686  -1.035  1.00 0.00 ? 66  LYS A HE3  4  
ATOM 6126  H HZ1  . LYS A 1 66  ? 11.994  -7.415  -1.853  1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 6127  H HZ2  . LYS A 1 66  ? 13.088  -6.552  -2.704  1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 6128  H HZ3  . LYS A 1 66  ? 13.205  -6.643  -1.078  1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 6129  N N    . GLN A 1 67  ? 8.255   -6.635  2.085   1.00 0.00 ? 67  GLN A N    4  
ATOM 6130  C CA   . GLN A 1 67  ? 8.870   -7.536  3.045   1.00 0.00 ? 67  GLN A CA   4  
ATOM 6131  C C    . GLN A 1 67  ? 8.315   -7.277  4.447   1.00 0.00 ? 67  GLN A C    4  
ATOM 6132  O O    . GLN A 1 67  ? 7.438   -6.433  4.624   1.00 0.00 ? 67  GLN A O    4  
ATOM 6133  C CB   . GLN A 1 67  ? 10.394  -7.400  3.026   1.00 0.00 ? 67  GLN A CB   4  
ATOM 6134  C CG   . GLN A 1 67  ? 11.022  -8.416  2.070   1.00 0.00 ? 67  GLN A CG   4  
ATOM 6135  C CD   . GLN A 1 67  ? 12.097  -9.244  2.777   1.00 0.00 ? 67  GLN A CD   4  
ATOM 6136  O OE1  . GLN A 1 67  ? 11.836  -9.962  3.729   1.00 0.00 ? 67  GLN A OE1  4  
ATOM 6137  N NE2  . GLN A 1 67  ? 13.315  -9.106  2.261   1.00 0.00 ? 67  GLN A NE2  4  
ATOM 6138  H H    . GLN A 1 67  ? 7.842   -5.814  2.479   1.00 0.00 ? 67  GLN A H    4  
ATOM 6139  H HA   . GLN A 1 67  ? 8.597   -8.539  2.717   1.00 0.00 ? 67  GLN A HA   4  
ATOM 6140  H HB3  . GLN A 1 67  ? 10.790  -7.549  4.031   1.00 0.00 ? 67  GLN A HB3  4  
ATOM 6141  H HG3  . GLN A 1 67  ? 11.462  -7.896  1.218   1.00 0.00 ? 67  GLN A HG3  4  
ATOM 6142  H HE21 . GLN A 1 67  ? 13.460  -8.500  1.479   1.00 0.00 ? 67  GLN A HE21 4  
ATOM 6143  H HE22 . GLN A 1 67  ? 14.085  -9.607  2.656   1.00 0.00 ? 67  GLN A HE22 4  
ATOM 6144  N N    . VAL A 1 68  ? 8.849   -8.019  5.406   1.00 0.00 ? 68  VAL A N    4  
ATOM 6145  C CA   . VAL A 1 68  ? 8.417   -7.880  6.787   1.00 0.00 ? 68  VAL A CA   4  
ATOM 6146  C C    . VAL A 1 68  ? 9.640   -7.915  7.705   1.00 0.00 ? 68  VAL A C    4  
ATOM 6147  O O    . VAL A 1 68  ? 10.289  -8.952  7.843   1.00 0.00 ? 68  VAL A O    4  
ATOM 6148  C CB   . VAL A 1 68  ? 7.386   -8.958  7.124   1.00 0.00 ? 68  VAL A CB   4  
ATOM 6149  C CG1  . VAL A 1 68  ? 7.127   -9.018  8.630   1.00 0.00 ? 68  VAL A CG1  4  
ATOM 6150  C CG2  . VAL A 1 68  ? 6.084   -8.733  6.352   1.00 0.00 ? 68  VAL A CG2  4  
ATOM 6151  H H    . VAL A 1 68  ? 9.562   -8.703  5.253   1.00 0.00 ? 68  VAL A H    4  
ATOM 6152  H HA   . VAL A 1 68  ? 7.933   -6.908  6.884   1.00 0.00 ? 68  VAL A HA   4  
ATOM 6153  H HB   . VAL A 1 68  ? 7.795   -9.920  6.816   1.00 0.00 ? 68  VAL A HB   4  
ATOM 6154  H HG11 . VAL A 1 68  ? 6.070   -8.839  8.824   1.00 0.00 ? 68  VAL A HG11 4  
ATOM 6155  H HG12 . VAL A 1 68  ? 7.404   -10.003 9.007   1.00 0.00 ? 68  VAL A HG12 4  
ATOM 6156  H HG13 . VAL A 1 68  ? 7.724   -8.257  9.132   1.00 0.00 ? 68  VAL A HG13 4  
ATOM 6157  H HG21 . VAL A 1 68  ? 6.024   -7.691  6.038   1.00 0.00 ? 68  VAL A HG21 4  
ATOM 6158  H HG22 . VAL A 1 68  ? 6.066   -9.378  5.474   1.00 0.00 ? 68  VAL A HG22 4  
ATOM 6159  H HG23 . VAL A 1 68  ? 5.235   -8.969  6.993   1.00 0.00 ? 68  VAL A HG23 4  
ATOM 6160  N N    . LYS A 1 69  ? 9.919   -6.769  8.310   1.00 0.00 ? 69  LYS A N    4  
ATOM 6161  C CA   . LYS A 1 69  ? 11.053  -6.657  9.211   1.00 0.00 ? 69  LYS A CA   4  
ATOM 6162  C C    . LYS A 1 69  ? 11.064  -7.853  10.164  1.00 0.00 ? 69  LYS A C    4  
ATOM 6163  O O    . LYS A 1 69  ? 10.064  -8.134  10.824  1.00 0.00 ? 69  LYS A O    4  
ATOM 6164  C CB   . LYS A 1 69  ? 11.039  -5.304  9.924   1.00 0.00 ? 69  LYS A CB   4  
ATOM 6165  C CG   . LYS A 1 69  ? 12.460  -4.816  10.208  1.00 0.00 ? 69  LYS A CG   4  
ATOM 6166  C CD   . LYS A 1 69  ? 12.483  -3.309  10.467  1.00 0.00 ? 69  LYS A CD   4  
ATOM 6167  C CE   . LYS A 1 69  ? 13.919  -2.796  10.602  1.00 0.00 ? 69  LYS A CE   4  
ATOM 6168  N NZ   . LYS A 1 69  ? 14.431  -2.336  9.293   1.00 0.00 ? 69  LYS A NZ   4  
ATOM 6169  H H    . LYS A 1 69  ? 9.387   -5.932  8.193   1.00 0.00 ? 69  LYS A H    4  
ATOM 6170  H HA   . LYS A 1 69  ? 11.958  -6.691  8.604   1.00 0.00 ? 69  LYS A HA   4  
ATOM 6171  H HB3  . LYS A 1 69  ? 10.485  -5.387  10.860  1.00 0.00 ? 69  LYS A HB3  4  
ATOM 6172  H HG3  . LYS A 1 69  ? 13.106  -5.054  9.363   1.00 0.00 ? 69  LYS A HG3  4  
ATOM 6173  H HD3  . LYS A 1 69  ? 11.925  -3.082  11.374  1.00 0.00 ? 69  LYS A HD3  4  
ATOM 6174  H HE3  . LYS A 1 69  ? 14.559  -3.590  10.990  1.00 0.00 ? 69  LYS A HE3  4  
ATOM 6175  H HZ1  . LYS A 1 69  ? 13.738  -2.495  8.588   1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 6176  H HZ2  . LYS A 1 69  ? 14.639  -1.359  9.341   1.00 0.00 ? 69  LYS A HZ2  4  
ATOM 6177  H HZ3  . LYS A 1 69  ? 15.262  -2.843  9.063   1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 6178  N N    . GLU A 1 70  ? 12.204  -8.527  10.205  1.00 0.00 ? 70  GLU A N    4  
ATOM 6179  C CA   . GLU A 1 70  ? 12.357  -9.687  11.066  1.00 0.00 ? 70  GLU A CA   4  
ATOM 6180  C C    . GLU A 1 70  ? 12.446  -9.253  12.531  1.00 0.00 ? 70  GLU A C    4  
ATOM 6181  O O    . GLU A 1 70  ? 13.538  -9.025  13.049  1.00 0.00 ? 70  GLU A O    4  
ATOM 6182  C CB   . GLU A 1 70  ? 13.581  -10.511 10.664  1.00 0.00 ? 70  GLU A CB   4  
ATOM 6183  C CG   . GLU A 1 70  ? 13.436  -11.966 11.112  1.00 0.00 ? 70  GLU A CG   4  
ATOM 6184  C CD   . GLU A 1 70  ? 14.310  -12.253 12.335  1.00 0.00 ? 70  GLU A CD   4  
ATOM 6185  O OE1  . GLU A 1 70  ? 14.096  -11.568 13.358  1.00 0.00 ? 70  GLU A OE1  4  
ATOM 6186  O OE2  . GLU A 1 70  ? 15.172  -13.151 12.219  1.00 0.00 ? 70  GLU A OE2  4  
ATOM 6187  H H    . GLU A 1 70  ? 13.012  -8.292  9.664   1.00 0.00 ? 70  GLU A H    4  
ATOM 6188  H HA   . GLU A 1 70  ? 11.458  -10.284 10.911  1.00 0.00 ? 70  GLU A HA   4  
ATOM 6189  H HB3  . GLU A 1 70  ? 14.479  -10.078 11.108  1.00 0.00 ? 70  GLU A HB3  4  
ATOM 6190  H HG3  . GLU A 1 70  ? 13.716  -12.632 10.296  1.00 0.00 ? 70  GLU A HG3  4  
ATOM 6191  N N    . GLY A 1 71  ? 11.282  -9.153  13.157  1.00 0.00 ? 71  GLY A N    4  
ATOM 6192  C CA   . GLY A 1 71  ? 11.215  -8.750  14.552  1.00 0.00 ? 71  GLY A CA   4  
ATOM 6193  C C    . GLY A 1 71  ? 10.522  -7.393  14.697  1.00 0.00 ? 71  GLY A C    4  
ATOM 6194  O O    . GLY A 1 71  ? 10.745  -6.680  15.674  1.00 0.00 ? 71  GLY A O    4  
ATOM 6195  H H    . GLY A 1 71  ? 10.399  -9.341  12.728  1.00 0.00 ? 71  GLY A H    4  
ATOM 6196  H HA2  . GLY A 1 71  ? 10.673  -9.503  15.124  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 6197  H HA3  . GLY A 1 71  ? 12.220  -8.695  14.966  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 6198  N N    . GLY A 1 72  ? 9.694   -7.079  13.711  1.00 0.00 ? 72  GLY A N    4  
ATOM 6199  C CA   . GLY A 1 72  ? 8.968   -5.822  13.717  1.00 0.00 ? 72  GLY A CA   4  
ATOM 6200  C C    . GLY A 1 72  ? 7.528   -6.022  14.198  1.00 0.00 ? 72  GLY A C    4  
ATOM 6201  O O    . GLY A 1 72  ? 7.181   -7.089  14.702  1.00 0.00 ? 72  GLY A O    4  
ATOM 6202  H H    . GLY A 1 72  ? 9.518   -7.664  12.920  1.00 0.00 ? 72  GLY A H    4  
ATOM 6203  H HA2  . GLY A 1 72  ? 9.474   -5.106  14.367  1.00 0.00 ? 72  GLY A HA2  4  
ATOM 6204  H HA3  . GLY A 1 72  ? 8.963   -5.394  12.714  1.00 0.00 ? 72  GLY A HA3  4  
ATOM 6205  N N    . PRO A 1 73  ? 6.707   -4.952  14.019  1.00 0.00 ? 73  PRO A N    4  
ATOM 6206  C CA   . PRO A 1 73  ? 5.314   -5.001  14.428  1.00 0.00 ? 73  PRO A CA   4  
ATOM 6207  C C    . PRO A 1 73  ? 4.487   -5.841  13.455  1.00 0.00 ? 73  PRO A C    4  
ATOM 6208  O O    . PRO A 1 73  ? 3.611   -6.599  13.872  1.00 0.00 ? 73  PRO A O    4  
ATOM 6209  C CB   . PRO A 1 73  ? 4.870   -3.548  14.484  1.00 0.00 ? 73  PRO A CB   4  
ATOM 6210  C CG   . PRO A 1 73  ? 5.884   -2.770  13.662  1.00 0.00 ? 73  PRO A CG   4  
ATOM 6211  C CD   . PRO A 1 73  ? 7.084   -3.672  13.426  1.00 0.00 ? 73  PRO A CD   4  
ATOM 6212  H HA   . PRO A 1 73  ? 5.229   -5.449  15.317  1.00 0.00 ? 73  PRO A HA   4  
ATOM 6213  H HB3  . PRO A 1 73  ? 4.842   -3.188  15.513  1.00 0.00 ? 73  PRO A HB3  4  
ATOM 6214  H HG3  . PRO A 1 73  ? 6.186   -1.863  14.186  1.00 0.00 ? 73  PRO A HG3  4  
ATOM 6215  H HD3  . PRO A 1 73  ? 7.982   -3.268  13.892  1.00 0.00 ? 73  PRO A HD3  4  
ATOM 6216  N N    . ALA A 1 74  ? 4.792   -5.680  12.176  1.00 0.00 ? 74  ALA A N    4  
ATOM 6217  C CA   . ALA A 1 74  ? 4.087   -6.415  11.139  1.00 0.00 ? 74  ALA A CA   4  
ATOM 6218  C C    . ALA A 1 74  ? 4.423   -7.904  11.257  1.00 0.00 ? 74  ALA A C    4  
ATOM 6219  O O    . ALA A 1 74  ? 3.528   -8.748  11.253  1.00 0.00 ? 74  ALA A O    4  
ATOM 6220  C CB   . ALA A 1 74  ? 4.451   -5.842  9.769   1.00 0.00 ? 74  ALA A CB   4  
ATOM 6221  H H    . ALA A 1 74  ? 5.504   -5.061  11.844  1.00 0.00 ? 74  ALA A H    4  
ATOM 6222  H HA   . ALA A 1 74  ? 3.017   -6.278  11.304  1.00 0.00 ? 74  ALA A HA   4  
ATOM 6223  H HB1  . ALA A 1 74  ? 3.658   -5.175  9.432   1.00 0.00 ? 74  ALA A HB1  4  
ATOM 6224  H HB2  . ALA A 1 74  ? 5.385   -5.286  9.845   1.00 0.00 ? 74  ALA A HB2  4  
ATOM 6225  H HB3  . ALA A 1 74  ? 4.568   -6.657  9.054   1.00 0.00 ? 74  ALA A HB3  4  
ATOM 6226  N N    . PHE A 1 75  ? 5.715   -8.179  11.359  1.00 0.00 ? 75  PHE A N    4  
ATOM 6227  C CA   . PHE A 1 75  ? 6.179   -9.550  11.478  1.00 0.00 ? 75  PHE A CA   4  
ATOM 6228  C C    . PHE A 1 75  ? 5.429   -10.290 12.587  1.00 0.00 ? 75  PHE A C    4  
ATOM 6229  O O    . PHE A 1 75  ? 5.038   -11.443 12.413  1.00 0.00 ? 75  PHE A O    4  
ATOM 6230  C CB   . PHE A 1 75  ? 7.666   -9.489  11.837  1.00 0.00 ? 75  PHE A CB   4  
ATOM 6231  C CG   . PHE A 1 75  ? 8.177   -10.725 12.579  1.00 0.00 ? 75  PHE A CG   4  
ATOM 6232  C CD1  . PHE A 1 75  ? 8.171   -11.938 11.964  1.00 0.00 ? 75  PHE A CD1  4  
ATOM 6233  C CD2  . PHE A 1 75  ? 8.641   -10.610 13.852  1.00 0.00 ? 75  PHE A CD2  4  
ATOM 6234  C CE1  . PHE A 1 75  ? 8.646   -13.086 12.653  1.00 0.00 ? 75  PHE A CE1  4  
ATOM 6235  C CE2  . PHE A 1 75  ? 9.117   -11.758 14.540  1.00 0.00 ? 75  PHE A CE2  4  
ATOM 6236  C CZ   . PHE A 1 75  ? 9.109   -12.972 13.926  1.00 0.00 ? 75  PHE A CZ   4  
ATOM 6237  H H    . PHE A 1 75  ? 6.435   -7.486  11.361  1.00 0.00 ? 75  PHE A H    4  
ATOM 6238  H HA   . PHE A 1 75  ? 5.989   -10.040 10.523  1.00 0.00 ? 75  PHE A HA   4  
ATOM 6239  H HB3  . PHE A 1 75  ? 7.843   -8.609  12.454  1.00 0.00 ? 75  PHE A HB3  4  
ATOM 6240  H HD1  . PHE A 1 75  ? 7.799   -12.031 10.944  1.00 0.00 ? 75  PHE A HD1  4  
ATOM 6241  H HD2  . PHE A 1 75  ? 8.648   -9.638  14.344  1.00 0.00 ? 75  PHE A HD2  4  
ATOM 6242  H HE1  . PHE A 1 75  ? 8.640   -14.059 12.160  1.00 0.00 ? 75  PHE A HE1  4  
ATOM 6243  H HE2  . PHE A 1 75  ? 9.488   -11.667 15.561  1.00 0.00 ? 75  PHE A HE2  4  
ATOM 6244  H HZ   . PHE A 1 75  ? 9.474   -13.852 14.454  1.00 0.00 ? 75  PHE A HZ   4  
ATOM 6245  N N    . GLU A 1 76  ? 5.251   -9.597  13.701  1.00 0.00 ? 76  GLU A N    4  
ATOM 6246  C CA   . GLU A 1 76  ? 4.554   -10.173 14.838  1.00 0.00 ? 76  GLU A CA   4  
ATOM 6247  C C    . GLU A 1 76  ? 3.077   -10.387 14.503  1.00 0.00 ? 76  GLU A C    4  
ATOM 6248  O O    . GLU A 1 76  ? 2.554   -11.490 14.664  1.00 0.00 ? 76  GLU A O    4  
ATOM 6249  C CB   . GLU A 1 76  ? 4.713   -9.295  16.082  1.00 0.00 ? 76  GLU A CB   4  
ATOM 6250  C CG   . GLU A 1 76  ? 6.190   -9.046  16.392  1.00 0.00 ? 76  GLU A CG   4  
ATOM 6251  C CD   . GLU A 1 76  ? 6.624   -9.815  17.642  1.00 0.00 ? 76  GLU A CD   4  
ATOM 6252  O OE1  . GLU A 1 76  ? 6.884   -11.030 17.500  1.00 0.00 ? 76  GLU A OE1  4  
ATOM 6253  O OE2  . GLU A 1 76  ? 6.685   -9.171  18.712  1.00 0.00 ? 76  GLU A OE2  4  
ATOM 6254  H H    . GLU A 1 76  ? 5.572   -8.659  13.834  1.00 0.00 ? 76  GLU A H    4  
ATOM 6255  H HA   . GLU A 1 76  ? 5.036   -11.134 15.016  1.00 0.00 ? 76  GLU A HA   4  
ATOM 6256  H HB3  . GLU A 1 76  ? 4.233   -9.776  16.934  1.00 0.00 ? 76  GLU A HB3  4  
ATOM 6257  H HG3  . GLU A 1 76  ? 6.360   -7.979  16.539  1.00 0.00 ? 76  GLU A HG3  4  
ATOM 6258  N N    . ALA A 1 77  ? 2.447   -9.317  14.042  1.00 0.00 ? 77  ALA A N    4  
ATOM 6259  C CA   . ALA A 1 77  ? 1.039   -9.374  13.683  1.00 0.00 ? 77  ALA A CA   4  
ATOM 6260  C C    . ALA A 1 77  ? 0.772   -10.655 12.889  1.00 0.00 ? 77  ALA A C    4  
ATOM 6261  O O    . ALA A 1 77  ? -0.340  -11.179 12.906  1.00 0.00 ? 77  ALA A O    4  
ATOM 6262  C CB   . ALA A 1 77  ? 0.661   -8.115  12.901  1.00 0.00 ? 77  ALA A CB   4  
ATOM 6263  H H    . ALA A 1 77  ? 2.879   -8.425  13.914  1.00 0.00 ? 77  ALA A H    4  
ATOM 6264  H HA   . ALA A 1 77  ? 0.462   -9.401  14.606  1.00 0.00 ? 77  ALA A HA   4  
ATOM 6265  H HB1  . ALA A 1 77  ? -0.405  -7.918  13.024  1.00 0.00 ? 77  ALA A HB1  4  
ATOM 6266  H HB2  . ALA A 1 77  ? 1.233   -7.267  13.278  1.00 0.00 ? 77  ALA A HB2  4  
ATOM 6267  H HB3  . ALA A 1 77  ? 0.884   -8.262  11.844  1.00 0.00 ? 77  ALA A HB3  4  
ATOM 6268  N N    . GLY A 1 78  ? 1.811   -11.123 12.213  1.00 0.00 ? 78  GLY A N    4  
ATOM 6269  C CA   . GLY A 1 78  ? 1.703   -12.332 11.415  1.00 0.00 ? 78  GLY A CA   4  
ATOM 6270  C C    . GLY A 1 78  ? 1.730   -12.008 9.920   1.00 0.00 ? 78  GLY A C    4  
ATOM 6271  O O    . GLY A 1 78  ? 1.526   -12.888 9.086   1.00 0.00 ? 78  GLY A O    4  
ATOM 6272  H H    . GLY A 1 78  ? 2.714   -10.690 12.205  1.00 0.00 ? 78  GLY A H    4  
ATOM 6273  H HA2  . GLY A 1 78  ? 2.522   -13.009 11.660  1.00 0.00 ? 78  GLY A HA2  4  
ATOM 6274  H HA3  . GLY A 1 78  ? 0.778   -12.852 11.661  1.00 0.00 ? 78  GLY A HA3  4  
ATOM 6275  N N    . LEU A 1 79  ? 1.985   -10.740 9.628   1.00 0.00 ? 79  LEU A N    4  
ATOM 6276  C CA   . LEU A 1 79  ? 2.042   -10.288 8.248   1.00 0.00 ? 79  LEU A CA   4  
ATOM 6277  C C    . LEU A 1 79  ? 3.064   -11.131 7.482   1.00 0.00 ? 79  LEU A C    4  
ATOM 6278  O O    . LEU A 1 79  ? 3.915   -11.780 8.085   1.00 0.00 ? 79  LEU A O    4  
ATOM 6279  C CB   . LEU A 1 79  ? 2.316   -8.785  8.188   1.00 0.00 ? 79  LEU A CB   4  
ATOM 6280  C CG   . LEU A 1 79  ? 1.587   -8.014  7.085   1.00 0.00 ? 79  LEU A CG   4  
ATOM 6281  C CD1  . LEU A 1 79  ? 0.172   -7.631  7.528   1.00 0.00 ? 79  LEU A CD1  4  
ATOM 6282  C CD2  . LEU A 1 79  ? 2.398   -6.794  6.640   1.00 0.00 ? 79  LEU A CD2  4  
ATOM 6283  H H    . LEU A 1 79  ? 2.150   -10.031 10.313  1.00 0.00 ? 79  LEU A H    4  
ATOM 6284  H HA   . LEU A 1 79  ? 1.058   -10.454 7.808   1.00 0.00 ? 79  LEU A HA   4  
ATOM 6285  H HB3  . LEU A 1 79  ? 3.387   -8.635  8.060   1.00 0.00 ? 79  LEU A HB3  4  
ATOM 6286  H HG   . LEU A 1 79  ? 1.487   -8.667  6.219   1.00 0.00 ? 79  LEU A HG   4  
ATOM 6287  H HD11 . LEU A 1 79  ? -0.548  -7.997  6.796   1.00 0.00 ? 79  LEU A HD11 4  
ATOM 6288  H HD12 . LEU A 1 79  ? -0.038  -8.076  8.499   1.00 0.00 ? 79  LEU A HD12 4  
ATOM 6289  H HD13 . LEU A 1 79  ? 0.097   -6.545  7.600   1.00 0.00 ? 79  LEU A HD13 4  
ATOM 6290  H HD21 . LEU A 1 79  ? 2.645   -6.889  5.582   1.00 0.00 ? 79  LEU A HD21 4  
ATOM 6291  H HD22 . LEU A 1 79  ? 1.811   -5.889  6.798   1.00 0.00 ? 79  LEU A HD22 4  
ATOM 6292  H HD23 . LEU A 1 79  ? 3.318   -6.737  7.224   1.00 0.00 ? 79  LEU A HD23 4  
ATOM 6293  N N    . CYS A 1 80  ? 2.944   -11.092 6.162   1.00 0.00 ? 80  CYS A N    4  
ATOM 6294  C CA   . CYS A 1 80  ? 3.846   -11.843 5.307   1.00 0.00 ? 80  CYS A CA   4  
ATOM 6295  C C    . CYS A 1 80  ? 4.292   -10.934 4.161   1.00 0.00 ? 80  CYS A C    4  
ATOM 6296  O O    . CYS A 1 80  ? 4.002   -9.739  4.165   1.00 0.00 ? 80  CYS A O    4  
ATOM 6297  C CB   . CYS A 1 80  ? 3.200   -13.132 4.795   1.00 0.00 ? 80  CYS A CB   4  
ATOM 6298  S SG   . CYS A 1 80  ? 4.439   -14.476 4.741   1.00 0.00 ? 80  CYS A SG   4  
ATOM 6299  H H    . CYS A 1 80  ? 2.249   -10.561 5.679   1.00 0.00 ? 80  CYS A H    4  
ATOM 6300  H HA   . CYS A 1 80  ? 4.697   -12.132 5.926   1.00 0.00 ? 80  CYS A HA   4  
ATOM 6301  H HB3  . CYS A 1 80  ? 2.784   -12.969 3.800   1.00 0.00 ? 80  CYS A HB3  4  
ATOM 6302  H HG   . CYS A 1 80  ? 3.857   -15.162 3.760   1.00 0.00 ? 80  CYS A HG   4  
ATOM 6303  N N    . THR A 1 81  ? 4.991   -11.533 3.208   1.00 0.00 ? 81  THR A N    4  
ATOM 6304  C CA   . THR A 1 81  ? 5.479   -10.793 2.058   1.00 0.00 ? 81  THR A CA   4  
ATOM 6305  C C    . THR A 1 81  ? 4.617   -11.085 0.829   1.00 0.00 ? 81  THR A C    4  
ATOM 6306  O O    . THR A 1 81  ? 4.269   -12.236 0.569   1.00 0.00 ? 81  THR A O    4  
ATOM 6307  C CB   . THR A 1 81  ? 6.954   -11.143 1.862   1.00 0.00 ? 81  THR A CB   4  
ATOM 6308  O OG1  . THR A 1 81  ? 6.974   -12.566 1.843   1.00 0.00 ? 81  THR A OG1  4  
ATOM 6309  C CG2  . THR A 1 81  ? 7.811   -10.774 3.077   1.00 0.00 ? 81  THR A CG2  4  
ATOM 6310  H H    . THR A 1 81  ? 5.222   -12.506 3.212   1.00 0.00 ? 81  THR A H    4  
ATOM 6311  H HA   . THR A 1 81  ? 5.383   -9.728  2.270   1.00 0.00 ? 81  THR A HA   4  
ATOM 6312  H HB   . THR A 1 81  ? 7.347   -10.681 0.956   1.00 0.00 ? 81  THR A HB   4  
ATOM 6313  H HG1  . THR A 1 81  ? 7.900   -12.894 1.654   1.00 0.00 ? 81  THR A HG1  4  
ATOM 6314  H HG21 . THR A 1 81  ? 8.829   -10.563 2.752   1.00 0.00 ? 81  THR A HG21 4  
ATOM 6315  H HG22 . THR A 1 81  ? 7.394   -9.892  3.561   1.00 0.00 ? 81  THR A HG22 4  
ATOM 6316  H HG23 . THR A 1 81  ? 7.818   -11.607 3.781   1.00 0.00 ? 81  THR A HG23 4  
ATOM 6317  N N    . GLY A 1 82  ? 4.295   -10.023 0.104   1.00 0.00 ? 82  GLY A N    4  
ATOM 6318  C CA   . GLY A 1 82  ? 3.480   -10.152 -1.091  1.00 0.00 ? 82  GLY A CA   4  
ATOM 6319  C C    . GLY A 1 82  ? 1.989   -10.113 -0.745  1.00 0.00 ? 82  GLY A C    4  
ATOM 6320  O O    . GLY A 1 82  ? 1.148   -10.482 -1.564  1.00 0.00 ? 82  GLY A O    4  
ATOM 6321  H H    . GLY A 1 82  ? 4.582   -9.090  0.322   1.00 0.00 ? 82  GLY A H    4  
ATOM 6322  H HA2  . GLY A 1 82  ? 3.716   -9.347  -1.786  1.00 0.00 ? 82  GLY A HA2  4  
ATOM 6323  H HA3  . GLY A 1 82  ? 3.715   -11.088 -1.596  1.00 0.00 ? 82  GLY A HA3  4  
ATOM 6324  N N    . ASP A 1 83  ? 1.707   -9.661  0.468   1.00 0.00 ? 83  ASP A N    4  
ATOM 6325  C CA   . ASP A 1 83  ? 0.334   -9.569  0.932   1.00 0.00 ? 83  ASP A CA   4  
ATOM 6326  C C    . ASP A 1 83  ? -0.289  -8.273  0.411   1.00 0.00 ? 83  ASP A C    4  
ATOM 6327  O O    . ASP A 1 83  ? 0.344   -7.218  0.440   1.00 0.00 ? 83  ASP A O    4  
ATOM 6328  C CB   . ASP A 1 83  ? 0.270   -9.543  2.459   1.00 0.00 ? 83  ASP A CB   4  
ATOM 6329  C CG   . ASP A 1 83  ? 0.712   -10.835 3.148   1.00 0.00 ? 83  ASP A CG   4  
ATOM 6330  O OD1  . ASP A 1 83  ? 0.034   -11.861 2.922   1.00 0.00 ? 83  ASP A OD1  4  
ATOM 6331  O OD2  . ASP A 1 83  ? 1.720   -10.769 3.885   1.00 0.00 ? 83  ASP A OD2  4  
ATOM 6332  H H    . ASP A 1 83  ? 2.397   -9.362  1.128   1.00 0.00 ? 83  ASP A H    4  
ATOM 6333  H HA   . ASP A 1 83  ? -0.161  -10.456 0.540   1.00 0.00 ? 83  ASP A HA   4  
ATOM 6334  H HB3  . ASP A 1 83  ? -0.755  -9.321  2.762   1.00 0.00 ? 83  ASP A HB3  4  
ATOM 6335  N N    . ARG A 1 84  ? -1.524  -8.393  -0.056  1.00 0.00 ? 84  ARG A N    4  
ATOM 6336  C CA   . ARG A 1 84  ? -2.241  -7.244  -0.583  1.00 0.00 ? 84  ARG A CA   4  
ATOM 6337  C C    . ARG A 1 84  ? -3.099  -6.606  0.510   1.00 0.00 ? 84  ARG A C    4  
ATOM 6338  O O    . ARG A 1 84  ? -3.833  -7.299  1.212   1.00 0.00 ? 84  ARG A O    4  
ATOM 6339  C CB   . ARG A 1 84  ? -3.137  -7.644  -1.757  1.00 0.00 ? 84  ARG A CB   4  
ATOM 6340  C CG   . ARG A 1 84  ? -2.399  -7.490  -3.088  1.00 0.00 ? 84  ARG A CG   4  
ATOM 6341  C CD   . ARG A 1 84  ? -3.134  -8.225  -4.210  1.00 0.00 ? 84  ARG A CD   4  
ATOM 6342  N NE   . ARG A 1 84  ? -4.597  -8.111  -4.019  1.00 0.00 ? 84  ARG A NE   4  
ATOM 6343  C CZ   . ARG A 1 84  ? -5.495  -8.944  -4.562  1.00 0.00 ? 84  ARG A CZ   4  
ATOM 6344  N NH1  . ARG A 1 84  ? -5.083  -9.957  -5.336  1.00 0.00 ? 84  ARG A NH1  4  
ATOM 6345  N NH2  . ARG A 1 84  ? -6.802  -8.764  -4.333  1.00 0.00 ? 84  ARG A NH2  4  
ATOM 6346  H H    . ARG A 1 84  ? -2.031  -9.254  -0.077  1.00 0.00 ? 84  ARG A H    4  
ATOM 6347  H HA   . ARG A 1 84  ? -1.461  -6.560  -0.919  1.00 0.00 ? 84  ARG A HA   4  
ATOM 6348  H HB3  . ARG A 1 84  ? -4.035  -7.028  -1.760  1.00 0.00 ? 84  ARG A HB3  4  
ATOM 6349  H HG3  . ARG A 1 84  ? -1.386  -7.881  -2.995  1.00 0.00 ? 84  ARG A HG3  4  
ATOM 6350  H HD3  . ARG A 1 84  ? -2.842  -9.275  -4.221  1.00 0.00 ? 84  ARG A HD3  4  
ATOM 6351  H HE   . ARG A 1 84  ? -4.936  -7.364  -3.446  1.00 0.00 ? 84  ARG A HE   4  
ATOM 6352  H HH11 . ARG A 1 84  ? -4.107  -10.092 -5.508  1.00 0.00 ? 84  ARG A HH11 4  
ATOM 6353  H HH12 . ARG A 1 84  ? -5.754  -10.580 -5.742  1.00 0.00 ? 84  ARG A HH12 4  
ATOM 6354  H HH21 . ARG A 1 84  ? -7.109  -8.007  -3.755  1.00 0.00 ? 84  ARG A HH21 4  
ATOM 6355  H HH22 . ARG A 1 84  ? -7.472  -9.386  -4.739  1.00 0.00 ? 84  ARG A HH22 4  
ATOM 6356  N N    . ILE A 1 85  ? -2.978  -5.291  0.622   1.00 0.00 ? 85  ILE A N    4  
ATOM 6357  C CA   . ILE A 1 85  ? -3.734  -4.551  1.618   1.00 0.00 ? 85  ILE A CA   4  
ATOM 6358  C C    . ILE A 1 85  ? -5.137  -4.267  1.080   1.00 0.00 ? 85  ILE A C    4  
ATOM 6359  O O    . ILE A 1 85  ? -5.298  -3.912  -0.086  1.00 0.00 ? 85  ILE A O    4  
ATOM 6360  C CB   . ILE A 1 85  ? -2.972  -3.294  2.043   1.00 0.00 ? 85  ILE A CB   4  
ATOM 6361  C CG1  . ILE A 1 85  ? -1.498  -3.610  2.309   1.00 0.00 ? 85  ILE A CG1  4  
ATOM 6362  C CG2  . ILE A 1 85  ? -3.642  -2.630  3.248   1.00 0.00 ? 85  ILE A CG2  4  
ATOM 6363  C CD1  . ILE A 1 85  ? -1.351  -4.621  3.448   1.00 0.00 ? 85  ILE A CD1  4  
ATOM 6364  H H    . ILE A 1 85  ? -2.378  -4.735  0.047   1.00 0.00 ? 85  ILE A H    4  
ATOM 6365  H HA   . ILE A 1 85  ? -3.823  -5.188  2.498   1.00 0.00 ? 85  ILE A HA   4  
ATOM 6366  H HB   . ILE A 1 85  ? -3.006  -2.581  1.222   1.00 0.00 ? 85  ILE A HB   4  
ATOM 6367  H HG13 . ILE A 1 85  ? -0.966  -2.693  2.561   1.00 0.00 ? 85  ILE A HG13 4  
ATOM 6368  H HG21 . ILE A 1 85  ? -3.518  -1.549  3.182   1.00 0.00 ? 85  ILE A HG21 4  
ATOM 6369  H HG22 . ILE A 1 85  ? -4.704  -2.874  3.254   1.00 0.00 ? 85  ILE A HG22 4  
ATOM 6370  H HG23 . ILE A 1 85  ? -3.180  -2.993  4.167   1.00 0.00 ? 85  ILE A HG23 4  
ATOM 6371  H HD11 . ILE A 1 85  ? -1.582  -4.136  4.396   1.00 0.00 ? 85  ILE A HD11 4  
ATOM 6372  H HD12 . ILE A 1 85  ? -2.036  -5.452  3.288   1.00 0.00 ? 85  ILE A HD12 4  
ATOM 6373  H HD13 . ILE A 1 85  ? -0.327  -4.993  3.472   1.00 0.00 ? 85  ILE A HD13 4  
ATOM 6374  N N    . ILE A 1 86  ? -6.117  -4.435  1.955   1.00 0.00 ? 86  ILE A N    4  
ATOM 6375  C CA   . ILE A 1 86  ? -7.502  -4.201  1.583   1.00 0.00 ? 86  ILE A CA   4  
ATOM 6376  C C    . ILE A 1 86  ? -8.079  -3.084  2.455   1.00 0.00 ? 86  ILE A C    4  
ATOM 6377  O O    . ILE A 1 86  ? -8.816  -2.229  1.969   1.00 0.00 ? 86  ILE A O    4  
ATOM 6378  C CB   . ILE A 1 86  ? -8.301  -5.503  1.644   1.00 0.00 ? 86  ILE A CB   4  
ATOM 6379  C CG1  . ILE A 1 86  ? -8.294  -6.085  3.060   1.00 0.00 ? 86  ILE A CG1  4  
ATOM 6380  C CG2  . ILE A 1 86  ? -7.792  -6.509  0.609   1.00 0.00 ? 86  ILE A CG2  4  
ATOM 6381  C CD1  . ILE A 1 86  ? -9.115  -7.375  3.126   1.00 0.00 ? 86  ILE A CD1  4  
ATOM 6382  H H    . ILE A 1 86  ? -5.978  -4.724  2.903   1.00 0.00 ? 86  ILE A H    4  
ATOM 6383  H HA   . ILE A 1 86  ? -7.509  -3.867  0.545   1.00 0.00 ? 86  ILE A HA   4  
ATOM 6384  H HB   . ILE A 1 86  ? -9.338  -5.281  1.392   1.00 0.00 ? 86  ILE A HB   4  
ATOM 6385  H HG13 . ILE A 1 86  ? -8.702  -5.355  3.758   1.00 0.00 ? 86  ILE A HG13 4  
ATOM 6386  H HG21 . ILE A 1 86  ? -7.688  -7.489  1.075   1.00 0.00 ? 86  ILE A HG21 4  
ATOM 6387  H HG22 . ILE A 1 86  ? -8.499  -6.572  -0.217  1.00 0.00 ? 86  ILE A HG22 4  
ATOM 6388  H HG23 . ILE A 1 86  ? -6.822  -6.183  0.233   1.00 0.00 ? 86  ILE A HG23 4  
ATOM 6389  H HD11 . ILE A 1 86  ? -8.455  -8.215  3.346   1.00 0.00 ? 86  ILE A HD11 4  
ATOM 6390  H HD12 . ILE A 1 86  ? -9.866  -7.288  3.911   1.00 0.00 ? 86  ILE A HD12 4  
ATOM 6391  H HD13 . ILE A 1 86  ? -9.608  -7.541  2.169   1.00 0.00 ? 86  ILE A HD13 4  
ATOM 6392  N N    . LYS A 1 87  ? -7.720  -3.128  3.729   1.00 0.00 ? 87  LYS A N    4  
ATOM 6393  C CA   . LYS A 1 87  ? -8.193  -2.131  4.676   1.00 0.00 ? 87  LYS A CA   4  
ATOM 6394  C C    . LYS A 1 87  ? -7.002  -1.560  5.447   1.00 0.00 ? 87  LYS A C    4  
ATOM 6395  O O    . LYS A 1 87  ? -5.945  -2.188  5.518   1.00 0.00 ? 87  LYS A O    4  
ATOM 6396  C CB   . LYS A 1 87  ? -9.283  -2.719  5.574   1.00 0.00 ? 87  LYS A CB   4  
ATOM 6397  C CG   . LYS A 1 87  ? -10.491 -3.166  4.750   1.00 0.00 ? 87  LYS A CG   4  
ATOM 6398  C CD   . LYS A 1 87  ? -10.892 -4.601  5.098   1.00 0.00 ? 87  LYS A CD   4  
ATOM 6399  C CE   . LYS A 1 87  ? -11.543 -5.296  3.902   1.00 0.00 ? 87  LYS A CE   4  
ATOM 6400  N NZ   . LYS A 1 87  ? -12.216 -6.543  4.328   1.00 0.00 ? 87  LYS A NZ   4  
ATOM 6401  H H    . LYS A 1 87  ? -7.120  -3.827  4.119   1.00 0.00 ? 87  LYS A H    4  
ATOM 6402  H HA   . LYS A 1 87  ? -8.649  -1.326  4.100   1.00 0.00 ? 87  LYS A HA   4  
ATOM 6403  H HB3  . LYS A 1 87  ? -9.595  -1.975  6.307   1.00 0.00 ? 87  LYS A HB3  4  
ATOM 6404  H HG3  . LYS A 1 87  ? -10.256 -3.099  3.687   1.00 0.00 ? 87  LYS A HG3  4  
ATOM 6405  H HD3  . LYS A 1 87  ? -11.584 -4.595  5.940   1.00 0.00 ? 87  LYS A HD3  4  
ATOM 6406  H HE3  . LYS A 1 87  ? -10.787 -5.523  3.148   1.00 0.00 ? 87  LYS A HE3  4  
ATOM 6407  H HZ1  . LYS A 1 87  ? -13.189 -6.489  4.102   1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 6408  H HZ2  . LYS A 1 87  ? -11.805 -7.322  3.854   1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 6409  H HZ3  . LYS A 1 87  ? -12.109 -6.657  5.315   1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 6410  N N    . VAL A 1 88  ? -7.210  -0.376  6.004   1.00 0.00 ? 88  VAL A N    4  
ATOM 6411  C CA   . VAL A 1 88  ? -6.166  0.285   6.768   1.00 0.00 ? 88  VAL A CA   4  
ATOM 6412  C C    . VAL A 1 88  ? -6.803  1.285   7.734   1.00 0.00 ? 88  VAL A C    4  
ATOM 6413  O O    . VAL A 1 88  ? -7.611  2.118   7.328   1.00 0.00 ? 88  VAL A O    4  
ATOM 6414  C CB   . VAL A 1 88  ? -5.154  0.933   5.819   1.00 0.00 ? 88  VAL A CB   4  
ATOM 6415  C CG1  . VAL A 1 88  ? -4.111  1.738   6.596   1.00 0.00 ? 88  VAL A CG1  4  
ATOM 6416  C CG2  . VAL A 1 88  ? -4.485  -0.118  4.931   1.00 0.00 ? 88  VAL A CG2  4  
ATOM 6417  H H    . VAL A 1 88  ? -8.071  0.127   5.942   1.00 0.00 ? 88  VAL A H    4  
ATOM 6418  H HA   . VAL A 1 88  ? -5.646  -0.478  7.346   1.00 0.00 ? 88  VAL A HA   4  
ATOM 6419  H HB   . VAL A 1 88  ? -5.695  1.621   5.172   1.00 0.00 ? 88  VAL A HB   4  
ATOM 6420  H HG11 . VAL A 1 88  ? -3.337  1.067   6.968   1.00 0.00 ? 88  VAL A HG11 4  
ATOM 6421  H HG12 . VAL A 1 88  ? -3.662  2.481   5.937   1.00 0.00 ? 88  VAL A HG12 4  
ATOM 6422  H HG13 . VAL A 1 88  ? -4.592  2.239   7.437   1.00 0.00 ? 88  VAL A HG13 4  
ATOM 6423  H HG21 . VAL A 1 88  ? -5.215  -0.518  4.226   1.00 0.00 ? 88  VAL A HG21 4  
ATOM 6424  H HG22 . VAL A 1 88  ? -3.662  0.340   4.382   1.00 0.00 ? 88  VAL A HG22 4  
ATOM 6425  H HG23 . VAL A 1 88  ? -4.101  -0.928  5.552   1.00 0.00 ? 88  VAL A HG23 4  
ATOM 6426  N N    . ASN A 1 89  ? -6.414  1.170   8.995   1.00 0.00 ? 89  ASN A N    4  
ATOM 6427  C CA   . ASN A 1 89  ? -6.938  2.055   10.023  1.00 0.00 ? 89  ASN A CA   4  
ATOM 6428  C C    . ASN A 1 89  ? -8.465  2.080   9.938   1.00 0.00 ? 89  ASN A C    4  
ATOM 6429  O O    . ASN A 1 89  ? -9.095  3.067   10.318  1.00 0.00 ? 89  ASN A O    4  
ATOM 6430  C CB   . ASN A 1 89  ? -6.429  3.485   9.831   1.00 0.00 ? 89  ASN A CB   4  
ATOM 6431  C CG   . ASN A 1 89  ? -4.899  3.527   9.831   1.00 0.00 ? 89  ASN A CG   4  
ATOM 6432  O OD1  . ASN A 1 89  ? -4.268  4.095   8.953   1.00 0.00 ? 89  ASN A OD1  4  
ATOM 6433  N ND2  . ASN A 1 89  ? -4.340  2.896   10.858  1.00 0.00 ? 89  ASN A ND2  4  
ATOM 6434  H H    . ASN A 1 89  ? -5.756  0.491   9.319   1.00 0.00 ? 89  ASN A H    4  
ATOM 6435  H HA   . ASN A 1 89  ? -6.579  1.640   10.966  1.00 0.00 ? 89  ASN A HA   4  
ATOM 6436  H HB3  . ASN A 1 89  ? -6.813  4.121   10.628  1.00 0.00 ? 89  ASN A HB3  4  
ATOM 6437  H HD21 . ASN A 1 89  ? -4.915  2.450   11.546  1.00 0.00 ? 89  ASN A HD21 4  
ATOM 6438  H HD22 . ASN A 1 89  ? -3.344  2.868   10.946  1.00 0.00 ? 89  ASN A HD22 4  
ATOM 6439  N N    . GLY A 1 90  ? -9.016  0.985   9.437   1.00 0.00 ? 90  GLY A N    4  
ATOM 6440  C CA   . GLY A 1 90  ? -10.458 0.870   9.297   1.00 0.00 ? 90  GLY A CA   4  
ATOM 6441  C C    . GLY A 1 90  ? -11.026 2.038   8.487   1.00 0.00 ? 90  GLY A C    4  
ATOM 6442  O O    . GLY A 1 90  ? -12.081 2.574   8.821   1.00 0.00 ? 90  GLY A O    4  
ATOM 6443  H H    . GLY A 1 90  ? -8.497  0.187   9.131   1.00 0.00 ? 90  GLY A H    4  
ATOM 6444  H HA2  . GLY A 1 90  ? -10.705 -0.072  8.806   1.00 0.00 ? 90  GLY A HA2  4  
ATOM 6445  H HA3  . GLY A 1 90  ? -10.922 0.847   10.284  1.00 0.00 ? 90  GLY A HA3  4  
ATOM 6446  N N    . GLU A 1 91  ? -10.300 2.398   7.440   1.00 0.00 ? 91  GLU A N    4  
ATOM 6447  C CA   . GLU A 1 91  ? -10.717 3.493   6.581   1.00 0.00 ? 91  GLU A CA   4  
ATOM 6448  C C    . GLU A 1 91  ? -11.200 2.955   5.232   1.00 0.00 ? 91  GLU A C    4  
ATOM 6449  O O    . GLU A 1 91  ? -11.667 3.717   4.388   1.00 0.00 ? 91  GLU A O    4  
ATOM 6450  C CB   . GLU A 1 91  ? -9.585  4.505   6.394   1.00 0.00 ? 91  GLU A CB   4  
ATOM 6451  C CG   . GLU A 1 91  ? -9.768  5.709   7.321   1.00 0.00 ? 91  GLU A CG   4  
ATOM 6452  C CD   . GLU A 1 91  ? -11.036 6.487   6.966   1.00 0.00 ? 91  GLU A CD   4  
ATOM 6453  O OE1  . GLU A 1 91  ? -11.460 6.377   5.796   1.00 0.00 ? 91  GLU A OE1  4  
ATOM 6454  O OE2  . GLU A 1 91  ? -11.553 7.175   7.873   1.00 0.00 ? 91  GLU A OE2  4  
ATOM 6455  H H    . GLU A 1 91  ? -9.442  1.957   7.176   1.00 0.00 ? 91  GLU A H    4  
ATOM 6456  H HA   . GLU A 1 91  ? -11.543 3.973   7.105   1.00 0.00 ? 91  GLU A HA   4  
ATOM 6457  H HB3  . GLU A 1 91  ? -9.560  4.841   5.356   1.00 0.00 ? 91  GLU A HB3  4  
ATOM 6458  H HG3  . GLU A 1 91  ? -8.900  6.365   7.245   1.00 0.00 ? 91  GLU A HG3  4  
ATOM 6459  N N    . SER A 1 92  ? -11.070 1.646   5.073   1.00 0.00 ? 92  SER A N    4  
ATOM 6460  C CA   . SER A 1 92  ? -11.486 0.997   3.842   1.00 0.00 ? 92  SER A CA   4  
ATOM 6461  C C    . SER A 1 92  ? -10.722 1.586   2.654   1.00 0.00 ? 92  SER A C    4  
ATOM 6462  O O    . SER A 1 92  ? -11.128 2.602   2.092   1.00 0.00 ? 92  SER A O    4  
ATOM 6463  C CB   . SER A 1 92  ? -12.995 1.142   3.626   1.00 0.00 ? 92  SER A CB   4  
ATOM 6464  O OG   . SER A 1 92  ? -13.356 0.978   2.258   1.00 0.00 ? 92  SER A OG   4  
ATOM 6465  H H    . SER A 1 92  ? -10.688 1.033   5.765   1.00 0.00 ? 92  SER A H    4  
ATOM 6466  H HA   . SER A 1 92  ? -11.240 -0.056  3.972   1.00 0.00 ? 92  SER A HA   4  
ATOM 6467  H HB3  . SER A 1 92  ? -13.318 2.124   3.971   1.00 0.00 ? 92  SER A HB3  4  
ATOM 6468  H HG   . SER A 1 92  ? -13.661 1.851   1.877   1.00 0.00 ? 92  SER A HG   4  
ATOM 6469  N N    . VAL A 1 93  ? -9.629  0.923   2.309   1.00 0.00 ? 93  VAL A N    4  
ATOM 6470  C CA   . VAL A 1 93  ? -8.803  1.368   1.199   1.00 0.00 ? 93  VAL A CA   4  
ATOM 6471  C C    . VAL A 1 93  ? -9.236  0.641   -0.076  1.00 0.00 ? 93  VAL A C    4  
ATOM 6472  O O    . VAL A 1 93  ? -8.522  0.659   -1.078  1.00 0.00 ? 93  VAL A O    4  
ATOM 6473  C CB   . VAL A 1 93  ? -7.323  1.161   1.531   1.00 0.00 ? 93  VAL A CB   4  
ATOM 6474  C CG1  . VAL A 1 93  ? -6.970  1.801   2.876   1.00 0.00 ? 93  VAL A CG1  4  
ATOM 6475  C CG2  . VAL A 1 93  ? -6.960  -0.324  1.519   1.00 0.00 ? 93  VAL A CG2  4  
ATOM 6476  H H    . VAL A 1 93  ? -9.305  0.098   2.772   1.00 0.00 ? 93  VAL A H    4  
ATOM 6477  H HA   . VAL A 1 93  ? -8.974  2.437   1.070   1.00 0.00 ? 93  VAL A HA   4  
ATOM 6478  H HB   . VAL A 1 93  ? -6.735  1.656   0.759   1.00 0.00 ? 93  VAL A HB   4  
ATOM 6479  H HG11 . VAL A 1 93  ? -7.345  1.177   3.685   1.00 0.00 ? 93  VAL A HG11 4  
ATOM 6480  H HG12 . VAL A 1 93  ? -5.887  1.894   2.959   1.00 0.00 ? 93  VAL A HG12 4  
ATOM 6481  H HG13 . VAL A 1 93  ? -7.425  2.789   2.939   1.00 0.00 ? 93  VAL A HG13 4  
ATOM 6482  H HG21 . VAL A 1 93  ? -7.201  -0.767  2.486   1.00 0.00 ? 93  VAL A HG21 4  
ATOM 6483  H HG22 . VAL A 1 93  ? -7.529  -0.830  0.737   1.00 0.00 ? 93  VAL A HG22 4  
ATOM 6484  H HG23 . VAL A 1 93  ? -5.894  -0.436  1.322   1.00 0.00 ? 93  VAL A HG23 4  
ATOM 6485  N N    . ILE A 1 94  ? -10.403 0.019   0.002   1.00 0.00 ? 94  ILE A N    4  
ATOM 6486  C CA   . ILE A 1 94  ? -10.940 -0.712  -1.133  1.00 0.00 ? 94  ILE A CA   4  
ATOM 6487  C C    . ILE A 1 94  ? -11.312 0.275   -2.240  1.00 0.00 ? 94  ILE A C    4  
ATOM 6488  O O    . ILE A 1 94  ? -12.438 0.767   -2.286  1.00 0.00 ? 94  ILE A O    4  
ATOM 6489  C CB   . ILE A 1 94  ? -12.099 -1.609  -0.694  1.00 0.00 ? 94  ILE A CB   4  
ATOM 6490  C CG1  . ILE A 1 94  ? -11.671 -2.543  0.440   1.00 0.00 ? 94  ILE A CG1  4  
ATOM 6491  C CG2  . ILE A 1 94  ? -12.678 -2.378  -1.882  1.00 0.00 ? 94  ILE A CG2  4  
ATOM 6492  C CD1  . ILE A 1 94  ? -12.063 -1.966  1.803   1.00 0.00 ? 94  ILE A CD1  4  
ATOM 6493  H H    . ILE A 1 94  ? -10.977 0.009   0.822   1.00 0.00 ? 94  ILE A H    4  
ATOM 6494  H HA   . ILE A 1 94  ? -10.149 -1.365  -1.504  1.00 0.00 ? 94  ILE A HA   4  
ATOM 6495  H HB   . ILE A 1 94  ? -12.894 -0.973  -0.304  1.00 0.00 ? 94  ILE A HB   4  
ATOM 6496  H HG13 . ILE A 1 94  ? -10.592 -2.696  0.402   1.00 0.00 ? 94  ILE A HG13 4  
ATOM 6497  H HG21 . ILE A 1 94  ? -13.266 -1.702  -2.502  1.00 0.00 ? 94  ILE A HG21 4  
ATOM 6498  H HG22 . ILE A 1 94  ? -11.863 -2.798  -2.474  1.00 0.00 ? 94  ILE A HG22 4  
ATOM 6499  H HG23 . ILE A 1 94  ? -13.314 -3.184  -1.518  1.00 0.00 ? 94  ILE A HG23 4  
ATOM 6500  H HD11 . ILE A 1 94  ? -11.212 -1.435  2.231   1.00 0.00 ? 94  ILE A HD11 4  
ATOM 6501  H HD12 . ILE A 1 94  ? -12.896 -1.276  1.679   1.00 0.00 ? 94  ILE A HD12 4  
ATOM 6502  H HD13 . ILE A 1 94  ? -12.357 -2.776  2.470   1.00 0.00 ? 94  ILE A HD13 4  
ATOM 6503  N N    . GLY A 1 95  ? -10.344 0.537   -3.105  1.00 0.00 ? 95  GLY A N    4  
ATOM 6504  C CA   . GLY A 1 95  ? -10.555 1.458   -4.210  1.00 0.00 ? 95  GLY A CA   4  
ATOM 6505  C C    . GLY A 1 95  ? -9.721  2.728   -4.032  1.00 0.00 ? 95  GLY A C    4  
ATOM 6506  O O    . GLY A 1 95  ? -9.849  3.672   -4.810  1.00 0.00 ? 95  GLY A O    4  
ATOM 6507  H H    . GLY A 1 95  ? -9.430  0.133   -3.062  1.00 0.00 ? 95  GLY A H    4  
ATOM 6508  H HA2  . GLY A 1 95  ? -10.289 0.972   -5.149  1.00 0.00 ? 95  GLY A HA2  4  
ATOM 6509  H HA3  . GLY A 1 95  ? -11.612 1.718   -4.273  1.00 0.00 ? 95  GLY A HA3  4  
ATOM 6510  N N    . LYS A 1 96  ? -8.885  2.710   -3.005  1.00 0.00 ? 96  LYS A N    4  
ATOM 6511  C CA   . LYS A 1 96  ? -8.030  3.850   -2.716  1.00 0.00 ? 96  LYS A CA   4  
ATOM 6512  C C    . LYS A 1 96  ? -6.733  3.725   -3.519  1.00 0.00 ? 96  LYS A C    4  
ATOM 6513  O O    . LYS A 1 96  ? -6.603  2.838   -4.360  1.00 0.00 ? 96  LYS A O    4  
ATOM 6514  C CB   . LYS A 1 96  ? -7.808  3.982   -1.208  1.00 0.00 ? 96  LYS A CB   4  
ATOM 6515  C CG   . LYS A 1 96  ? -8.887  4.861   -0.570  1.00 0.00 ? 96  LYS A CG   4  
ATOM 6516  C CD   . LYS A 1 96  ? -8.529  5.208   0.875   1.00 0.00 ? 96  LYS A CD   4  
ATOM 6517  C CE   . LYS A 1 96  ? -9.783  5.535   1.688   1.00 0.00 ? 96  LYS A CE   4  
ATOM 6518  N NZ   . LYS A 1 96  ? -10.421 6.770   1.182   1.00 0.00 ? 96  LYS A NZ   4  
ATOM 6519  H H    . LYS A 1 96  ? -8.788  1.939   -2.377  1.00 0.00 ? 96  LYS A H    4  
ATOM 6520  H HA   . LYS A 1 96  ? -8.557  4.744   -3.045  1.00 0.00 ? 96  LYS A HA   4  
ATOM 6521  H HB3  . LYS A 1 96  ? -6.825  4.413   -1.018  1.00 0.00 ? 96  LYS A HB3  4  
ATOM 6522  H HG3  . LYS A 1 96  ? -9.846  4.343   -0.598  1.00 0.00 ? 96  LYS A HG3  4  
ATOM 6523  H HD3  . LYS A 1 96  ? -7.849  6.060   0.892   1.00 0.00 ? 96  LYS A HD3  4  
ATOM 6524  H HE3  . LYS A 1 96  ? -9.521  5.659   2.739   1.00 0.00 ? 96  LYS A HE3  4  
ATOM 6525  H HZ1  . LYS A 1 96  ? -11.341 6.560   0.853   1.00 0.00 ? 96  LYS A HZ1  4  
ATOM 6526  H HZ2  . LYS A 1 96  ? -10.477 7.443   1.920   1.00 0.00 ? 96  LYS A HZ2  4  
ATOM 6527  H HZ3  . LYS A 1 96  ? -9.877  7.143   0.431   1.00 0.00 ? 96  LYS A HZ3  4  
ATOM 6528  N N    . THR A 1 97  ? -5.809  4.629   -3.231  1.00 0.00 ? 97  THR A N    4  
ATOM 6529  C CA   . THR A 1 97  ? -4.528  4.633   -3.917  1.00 0.00 ? 97  THR A CA   4  
ATOM 6530  C C    . THR A 1 97  ? -3.382  4.540   -2.907  1.00 0.00 ? 97  THR A C    4  
ATOM 6531  O O    . THR A 1 97  ? -3.558  4.861   -1.732  1.00 0.00 ? 97  THR A O    4  
ATOM 6532  C CB   . THR A 1 97  ? -4.465  5.883   -4.795  1.00 0.00 ? 97  THR A CB   4  
ATOM 6533  O OG1  . THR A 1 97  ? -3.089  5.988   -5.152  1.00 0.00 ? 97  THR A OG1  4  
ATOM 6534  C CG2  . THR A 1 97  ? -4.744  7.166   -4.008  1.00 0.00 ? 97  THR A CG2  4  
ATOM 6535  H H    . THR A 1 97  ? -5.923  5.349   -2.546  1.00 0.00 ? 97  THR A H    4  
ATOM 6536  H HA   . THR A 1 97  ? -4.472  3.744   -4.546  1.00 0.00 ? 97  THR A HA   4  
ATOM 6537  H HB   . THR A 1 97  ? -5.138  5.796   -5.647  1.00 0.00 ? 97  THR A HB   4  
ATOM 6538  H HG1  . THR A 1 97  ? -3.002  6.386   -6.064  1.00 0.00 ? 97  THR A HG1  4  
ATOM 6539  H HG21 . THR A 1 97  ? -5.684  7.064   -3.468  1.00 0.00 ? 97  THR A HG21 4  
ATOM 6540  H HG22 . THR A 1 97  ? -3.934  7.339   -3.297  1.00 0.00 ? 97  THR A HG22 4  
ATOM 6541  H HG23 . THR A 1 97  ? -4.808  8.008   -4.697  1.00 0.00 ? 97  THR A HG23 4  
ATOM 6542  N N    . TYR A 1 98  ? -2.234  4.100   -3.401  1.00 0.00 ? 98  TYR A N    4  
ATOM 6543  C CA   . TYR A 1 98  ? -1.060  3.962   -2.556  1.00 0.00 ? 98  TYR A CA   4  
ATOM 6544  C C    . TYR A 1 98  ? -0.880  5.190   -1.661  1.00 0.00 ? 98  TYR A C    4  
ATOM 6545  O O    . TYR A 1 98  ? -0.805  5.066   -0.440  1.00 0.00 ? 98  TYR A O    4  
ATOM 6546  C CB   . TYR A 1 98  ? 0.134   3.859   -3.507  1.00 0.00 ? 98  TYR A CB   4  
ATOM 6547  C CG   . TYR A 1 98  ? 1.416   3.354   -2.845  1.00 0.00 ? 98  TYR A CG   4  
ATOM 6548  C CD1  . TYR A 1 98  ? 1.375   2.253   -2.012  1.00 0.00 ? 98  TYR A CD1  4  
ATOM 6549  C CD2  . TYR A 1 98  ? 2.615   3.997   -3.077  1.00 0.00 ? 98  TYR A CD2  4  
ATOM 6550  C CE1  . TYR A 1 98  ? 2.581   1.777   -1.388  1.00 0.00 ? 98  TYR A CE1  4  
ATOM 6551  C CE2  . TYR A 1 98  ? 3.822   3.519   -2.454  1.00 0.00 ? 98  TYR A CE2  4  
ATOM 6552  C CZ   . TYR A 1 98  ? 3.746   2.433   -1.639  1.00 0.00 ? 98  TYR A CZ   4  
ATOM 6553  O OH   . TYR A 1 98  ? 4.886   1.982   -1.049  1.00 0.00 ? 98  TYR A OH   4  
ATOM 6554  H H    . TYR A 1 98  ? -2.100  3.841   -4.358  1.00 0.00 ? 98  TYR A H    4  
ATOM 6555  H HA   . TYR A 1 98  ? -1.199  3.081   -1.929  1.00 0.00 ? 98  TYR A HA   4  
ATOM 6556  H HB3  . TYR A 1 98  ? 0.326   4.842   -3.941  1.00 0.00 ? 98  TYR A HB3  4  
ATOM 6557  H HD1  . TYR A 1 98  ? 0.428   1.745   -1.826  1.00 0.00 ? 98  TYR A HD1  4  
ATOM 6558  H HD2  . TYR A 1 98  ? 2.649   4.866   -3.735  1.00 0.00 ? 98  TYR A HD2  4  
ATOM 6559  H HE1  . TYR A 1 98  ? 2.563   0.908   -0.729  1.00 0.00 ? 98  TYR A HE1  4  
ATOM 6560  H HE2  . TYR A 1 98  ? 4.774   4.018   -2.629  1.00 0.00 ? 98  TYR A HE2  4  
ATOM 6561  H HH   . TYR A 1 98  ? 5.365   2.741   -0.607  1.00 0.00 ? 98  TYR A HH   4  
ATOM 6562  N N    . SER A 1 99  ? -0.818  6.347   -2.304  1.00 0.00 ? 99  SER A N    4  
ATOM 6563  C CA   . SER A 1 99  ? -0.649  7.596   -1.581  1.00 0.00 ? 99  SER A CA   4  
ATOM 6564  C C    . SER A 1 99  ? -1.600  7.641   -0.384  1.00 0.00 ? 99  SER A C    4  
ATOM 6565  O O    . SER A 1 99  ? -1.198  8.001   0.720   1.00 0.00 ? 99  SER A O    4  
ATOM 6566  C CB   . SER A 1 99  ? -0.889  8.798   -2.495  1.00 0.00 ? 99  SER A CB   4  
ATOM 6567  O OG   . SER A 1 99  ? 0.061   9.838   -2.273  1.00 0.00 ? 99  SER A OG   4  
ATOM 6568  H H    . SER A 1 99  ? -0.880  6.439   -3.298  1.00 0.00 ? 99  SER A H    4  
ATOM 6569  H HA   . SER A 1 99  ? 0.389   7.597   -1.245  1.00 0.00 ? 99  SER A HA   4  
ATOM 6570  H HB3  . SER A 1 99  ? -1.895  9.186   -2.330  1.00 0.00 ? 99  SER A HB3  4  
ATOM 6571  H HG   . SER A 1 99  ? 0.806   9.767   -2.936  1.00 0.00 ? 99  SER A HG   4  
ATOM 6572  N N    . GLN A 1 100 ? -2.846  7.271   -0.645  1.00 0.00 ? 100 GLN A N    4  
ATOM 6573  C CA   . GLN A 1 100 ? -3.859  7.264   0.398   1.00 0.00 ? 100 GLN A CA   4  
ATOM 6574  C C    . GLN A 1 100 ? -3.461  6.302   1.519   1.00 0.00 ? 100 GLN A C    4  
ATOM 6575  O O    . GLN A 1 100 ? -3.144  6.732   2.626   1.00 0.00 ? 100 GLN A O    4  
ATOM 6576  C CB   . GLN A 1 100 ? -5.231  6.903   -0.174  1.00 0.00 ? 100 GLN A CB   4  
ATOM 6577  C CG   . GLN A 1 100 ? -6.002  8.158   -0.587  1.00 0.00 ? 100 GLN A CG   4  
ATOM 6578  C CD   . GLN A 1 100 ? -7.299  8.293   0.211   1.00 0.00 ? 100 GLN A CD   4  
ATOM 6579  O OE1  . GLN A 1 100 ? -8.395  8.192   -0.315  1.00 0.00 ? 100 GLN A OE1  4  
ATOM 6580  N NE2  . GLN A 1 100 ? -7.115  8.528   1.508   1.00 0.00 ? 100 GLN A NE2  4  
ATOM 6581  H H    . GLN A 1 100 ? -3.166  6.979   -1.547  1.00 0.00 ? 100 GLN A H    4  
ATOM 6582  H HA   . GLN A 1 100 ? -3.888  8.285   0.779   1.00 0.00 ? 100 GLN A HA   4  
ATOM 6583  H HB3  . GLN A 1 100 ? -5.804  6.349   0.570   1.00 0.00 ? 100 GLN A HB3  4  
ATOM 6584  H HG3  . GLN A 1 100 ? -6.229  8.116   -1.653  1.00 0.00 ? 100 GLN A HG3  4  
ATOM 6585  H HE21 . GLN A 1 100 ? -6.187  8.602   1.875   1.00 0.00 ? 100 GLN A HE21 4  
ATOM 6586  H HE22 . GLN A 1 100 ? -7.904  8.633   2.114   1.00 0.00 ? 100 GLN A HE22 4  
ATOM 6587  N N    . VAL A 1 101 ? -3.489  5.019   1.191   1.00 0.00 ? 101 VAL A N    4  
ATOM 6588  C CA   . VAL A 1 101 ? -3.136  3.992   2.157   1.00 0.00 ? 101 VAL A CA   4  
ATOM 6589  C C    . VAL A 1 101 ? -1.839  4.390   2.865   1.00 0.00 ? 101 VAL A C    4  
ATOM 6590  O O    . VAL A 1 101 ? -1.660  4.105   4.048   1.00 0.00 ? 101 VAL A O    4  
ATOM 6591  C CB   . VAL A 1 101 ? -3.045  2.630   1.465   1.00 0.00 ? 101 VAL A CB   4  
ATOM 6592  C CG1  . VAL A 1 101 ? -4.435  2.125   1.068   1.00 0.00 ? 101 VAL A CG1  4  
ATOM 6593  C CG2  . VAL A 1 101 ? -2.117  2.693   0.250   1.00 0.00 ? 101 VAL A CG2  4  
ATOM 6594  H H    . VAL A 1 101 ? -3.747  4.678   0.288   1.00 0.00 ? 101 VAL A H    4  
ATOM 6595  H HA   . VAL A 1 101 ? -3.936  3.944   2.893   1.00 0.00 ? 101 VAL A HA   4  
ATOM 6596  H HB   . VAL A 1 101 ? -2.622  1.920   2.174   1.00 0.00 ? 101 VAL A HB   4  
ATOM 6597  H HG11 . VAL A 1 101 ? -4.471  1.973   -0.011  1.00 0.00 ? 101 VAL A HG11 4  
ATOM 6598  H HG12 . VAL A 1 101 ? -4.636  1.181   1.575   1.00 0.00 ? 101 VAL A HG12 4  
ATOM 6599  H HG13 . VAL A 1 101 ? -5.185  2.860   1.357   1.00 0.00 ? 101 VAL A HG13 4  
ATOM 6600  H HG21 . VAL A 1 101 ? -1.999  1.695   -0.169  1.00 0.00 ? 101 VAL A HG21 4  
ATOM 6601  H HG22 . VAL A 1 101 ? -2.547  3.355   -0.502  1.00 0.00 ? 101 VAL A HG22 4  
ATOM 6602  H HG23 . VAL A 1 101 ? -1.143  3.076   0.556   1.00 0.00 ? 101 VAL A HG23 4  
ATOM 6603  N N    . ILE A 1 102 ? -0.966  5.042   2.110   1.00 0.00 ? 102 ILE A N    4  
ATOM 6604  C CA   . ILE A 1 102 ? 0.309   5.482   2.651   1.00 0.00 ? 102 ILE A CA   4  
ATOM 6605  C C    . ILE A 1 102 ? 0.061   6.459   3.802   1.00 0.00 ? 102 ILE A C    4  
ATOM 6606  O O    . ILE A 1 102 ? 0.462   6.203   4.936   1.00 0.00 ? 102 ILE A O    4  
ATOM 6607  C CB   . ILE A 1 102 ? 1.194   6.051   1.540   1.00 0.00 ? 102 ILE A CB   4  
ATOM 6608  C CG1  . ILE A 1 102 ? 1.817   4.929   0.705   1.00 0.00 ? 102 ILE A CG1  4  
ATOM 6609  C CG2  . ILE A 1 102 ? 2.253   6.994   2.113   1.00 0.00 ? 102 ILE A CG2  4  
ATOM 6610  C CD1  . ILE A 1 102 ? 2.950   4.241   1.470   1.00 0.00 ? 102 ILE A CD1  4  
ATOM 6611  H H    . ILE A 1 102 ? -1.119  5.271   1.149   1.00 0.00 ? 102 ILE A H    4  
ATOM 6612  H HA   . ILE A 1 102 ? 0.816   4.602   3.047   1.00 0.00 ? 102 ILE A HA   4  
ATOM 6613  H HB   . ILE A 1 102 ? 0.567   6.639   0.871   1.00 0.00 ? 102 ILE A HB   4  
ATOM 6614  H HG13 . ILE A 1 102 ? 2.199   5.336   -0.229  1.00 0.00 ? 102 ILE A HG13 4  
ATOM 6615  H HG21 . ILE A 1 102 ? 2.969   7.255   1.332   1.00 0.00 ? 102 ILE A HG21 4  
ATOM 6616  H HG22 . ILE A 1 102 ? 1.771   7.901   2.481   1.00 0.00 ? 102 ILE A HG22 4  
ATOM 6617  H HG23 . ILE A 1 102 ? 2.774   6.500   2.933   1.00 0.00 ? 102 ILE A HG23 4  
ATOM 6618  H HD11 . ILE A 1 102 ? 3.427   3.504   0.825   1.00 0.00 ? 102 ILE A HD11 4  
ATOM 6619  H HD12 . ILE A 1 102 ? 3.684   4.985   1.777   1.00 0.00 ? 102 ILE A HD12 4  
ATOM 6620  H HD13 . ILE A 1 102 ? 2.544   3.745   2.351   1.00 0.00 ? 102 ILE A HD13 4  
ATOM 6621  N N    . ALA A 1 103 ? -0.598  7.559   3.470   1.00 0.00 ? 103 ALA A N    4  
ATOM 6622  C CA   . ALA A 1 103 ? -0.904  8.577   4.460   1.00 0.00 ? 103 ALA A CA   4  
ATOM 6623  C C    . ALA A 1 103 ? -1.499  7.910   5.702   1.00 0.00 ? 103 ALA A C    4  
ATOM 6624  O O    . ALA A 1 103 ? -1.159  8.271   6.828   1.00 0.00 ? 103 ALA A O    4  
ATOM 6625  C CB   . ALA A 1 103 ? -1.845  9.617   3.850   1.00 0.00 ? 103 ALA A CB   4  
ATOM 6626  H H    . ALA A 1 103 ? -0.920  7.760   2.544   1.00 0.00 ? 103 ALA A H    4  
ATOM 6627  H HA   . ALA A 1 103 ? 0.030   9.066   4.733   1.00 0.00 ? 103 ALA A HA   4  
ATOM 6628  H HB1  . ALA A 1 103 ? -1.763  9.588   2.763   1.00 0.00 ? 103 ALA A HB1  4  
ATOM 6629  H HB2  . ALA A 1 103 ? -2.871  9.395   4.143   1.00 0.00 ? 103 ALA A HB2  4  
ATOM 6630  H HB3  . ALA A 1 103 ? -1.572  10.610  4.209   1.00 0.00 ? 103 ALA A HB3  4  
ATOM 6631  N N    . LEU A 1 104 ? -2.377  6.948   5.455   1.00 0.00 ? 104 LEU A N    4  
ATOM 6632  C CA   . LEU A 1 104 ? -3.022  6.227   6.539   1.00 0.00 ? 104 LEU A CA   4  
ATOM 6633  C C    . LEU A 1 104 ? -1.954  5.666   7.480   1.00 0.00 ? 104 LEU A C    4  
ATOM 6634  O O    . LEU A 1 104 ? -2.041  5.833   8.696   1.00 0.00 ? 104 LEU A O    4  
ATOM 6635  C CB   . LEU A 1 104 ? -3.973  5.165   5.986   1.00 0.00 ? 104 LEU A CB   4  
ATOM 6636  C CG   . LEU A 1 104 ? -5.114  5.680   5.106   1.00 0.00 ? 104 LEU A CG   4  
ATOM 6637  C CD1  . LEU A 1 104 ? -6.170  4.595   4.887   1.00 0.00 ? 104 LEU A CD1  4  
ATOM 6638  C CD2  . LEU A 1 104 ? -5.720  6.960   5.684   1.00 0.00 ? 104 LEU A CD2  4  
ATOM 6639  H H    . LEU A 1 104 ? -2.647  6.661   4.537   1.00 0.00 ? 104 LEU A H    4  
ATOM 6640  H HA   . LEU A 1 104 ? -3.627  6.944   7.093   1.00 0.00 ? 104 LEU A HA   4  
ATOM 6641  H HB3  . LEU A 1 104 ? -4.405  4.619   6.824   1.00 0.00 ? 104 LEU A HB3  4  
ATOM 6642  H HG   . LEU A 1 104 ? -4.704  5.931   4.127   1.00 0.00 ? 104 LEU A HG   4  
ATOM 6643  H HD11 . LEU A 1 104 ? -5.746  3.620   5.132   1.00 0.00 ? 104 LEU A HD11 4  
ATOM 6644  H HD12 . LEU A 1 104 ? -7.029  4.788   5.530   1.00 0.00 ? 104 LEU A HD12 4  
ATOM 6645  H HD13 . LEU A 1 104 ? -6.488  4.600   3.844   1.00 0.00 ? 104 LEU A HD13 4  
ATOM 6646  H HD21 . LEU A 1 104 ? -5.077  7.806   5.442   1.00 0.00 ? 104 LEU A HD21 4  
ATOM 6647  H HD22 . LEU A 1 104 ? -6.709  7.120   5.258   1.00 0.00 ? 104 LEU A HD22 4  
ATOM 6648  H HD23 . LEU A 1 104 ? -5.802  6.864   6.767   1.00 0.00 ? 104 LEU A HD23 4  
ATOM 6649  N N    . ILE A 1 105 ? -0.970  5.011   6.882   1.00 0.00 ? 105 ILE A N    4  
ATOM 6650  C CA   . ILE A 1 105 ? 0.115   4.425   7.651   1.00 0.00 ? 105 ILE A CA   4  
ATOM 6651  C C    . ILE A 1 105 ? 0.850   5.529   8.412   1.00 0.00 ? 105 ILE A C    4  
ATOM 6652  O O    . ILE A 1 105 ? 1.266   5.330   9.553   1.00 0.00 ? 105 ILE A O    4  
ATOM 6653  C CB   . ILE A 1 105 ? 1.025   3.592   6.746   1.00 0.00 ? 105 ILE A CB   4  
ATOM 6654  C CG1  . ILE A 1 105 ? 0.314   2.322   6.273   1.00 0.00 ? 105 ILE A CG1  4  
ATOM 6655  C CG2  . ILE A 1 105 ? 2.353   3.281   7.439   1.00 0.00 ? 105 ILE A CG2  4  
ATOM 6656  C CD1  . ILE A 1 105 ? 0.757   1.938   4.861   1.00 0.00 ? 105 ILE A CD1  4  
ATOM 6657  H H    . ILE A 1 105 ? -0.905  4.880   5.892   1.00 0.00 ? 105 ILE A H    4  
ATOM 6658  H HA   . ILE A 1 105 ? -0.330  3.743   8.375   1.00 0.00 ? 105 ILE A HA   4  
ATOM 6659  H HB   . ILE A 1 105 ? 1.255   4.181   5.858   1.00 0.00 ? 105 ILE A HB   4  
ATOM 6660  H HG13 . ILE A 1 105 ? -0.765  2.477   6.290   1.00 0.00 ? 105 ILE A HG13 4  
ATOM 6661  H HG21 . ILE A 1 105 ? 2.874   2.496   6.891   1.00 0.00 ? 105 ILE A HG21 4  
ATOM 6662  H HG22 . ILE A 1 105 ? 2.969   4.181   7.463   1.00 0.00 ? 105 ILE A HG22 4  
ATOM 6663  H HG23 . ILE A 1 105 ? 2.160   2.945   8.459   1.00 0.00 ? 105 ILE A HG23 4  
ATOM 6664  H HD11 . ILE A 1 105 ? 1.234   2.796   4.384   1.00 0.00 ? 105 ILE A HD11 4  
ATOM 6665  H HD12 . ILE A 1 105 ? 1.466   1.112   4.914   1.00 0.00 ? 105 ILE A HD12 4  
ATOM 6666  H HD13 . ILE A 1 105 ? -0.111  1.635   4.277   1.00 0.00 ? 105 ILE A HD13 4  
ATOM 6667  N N    . GLN A 1 106 ? 0.988   6.669   7.752   1.00 0.00 ? 106 GLN A N    4  
ATOM 6668  C CA   . GLN A 1 106 ? 1.664   7.806   8.353   1.00 0.00 ? 106 GLN A CA   4  
ATOM 6669  C C    . GLN A 1 106 ? 0.754   8.489   9.373   1.00 0.00 ? 106 GLN A C    4  
ATOM 6670  O O    . GLN A 1 106 ? 1.225   9.222   10.241  1.00 0.00 ? 106 GLN A O    4  
ATOM 6671  C CB   . GLN A 1 106 ? 2.129   8.797   7.282   1.00 0.00 ? 106 GLN A CB   4  
ATOM 6672  C CG   . GLN A 1 106 ? 3.169   8.159   6.359   1.00 0.00 ? 106 GLN A CG   4  
ATOM 6673  C CD   . GLN A 1 106 ? 4.468   8.966   6.356   1.00 0.00 ? 106 GLN A CD   4  
ATOM 6674  O OE1  . GLN A 1 106 ? 5.254   8.930   7.290   1.00 0.00 ? 106 GLN A OE1  4  
ATOM 6675  N NE2  . GLN A 1 106 ? 4.649   9.697   5.260   1.00 0.00 ? 106 GLN A NE2  4  
ATOM 6676  H H    . GLN A 1 106 ? 0.645   6.823   6.825   1.00 0.00 ? 106 GLN A H    4  
ATOM 6677  H HA   . GLN A 1 106 ? 2.537   7.389   8.856   1.00 0.00 ? 106 GLN A HA   4  
ATOM 6678  H HB3  . GLN A 1 106 ? 2.553   9.680   7.759   1.00 0.00 ? 106 GLN A HB3  4  
ATOM 6679  H HG3  . GLN A 1 106 ? 2.772   8.098   5.346   1.00 0.00 ? 106 GLN A HG3  4  
ATOM 6680  H HE21 . GLN A 1 106 ? 3.965   9.682   4.531   1.00 0.00 ? 106 GLN A HE21 4  
ATOM 6681  H HE22 . GLN A 1 106 ? 5.469   10.259  5.164   1.00 0.00 ? 106 GLN A HE22 4  
ATOM 6682  N N    . ASN A 1 107 ? -0.538  8.225   9.236   1.00 0.00 ? 107 ASN A N    4  
ATOM 6683  C CA   . ASN A 1 107 ? -1.521  8.804   10.136  1.00 0.00 ? 107 ASN A CA   4  
ATOM 6684  C C    . ASN A 1 107 ? -2.013  7.730   11.109  1.00 0.00 ? 107 ASN A C    4  
ATOM 6685  O O    . ASN A 1 107 ? -3.083  7.864   11.699  1.00 0.00 ? 107 ASN A O    4  
ATOM 6686  C CB   . ASN A 1 107 ? -2.731  9.332   9.364   1.00 0.00 ? 107 ASN A CB   4  
ATOM 6687  C CG   . ASN A 1 107 ? -2.427  10.692  8.732   1.00 0.00 ? 107 ASN A CG   4  
ATOM 6688  O OD1  . ASN A 1 107 ? -1.894  11.592  9.360   1.00 0.00 ? 107 ASN A OD1  4  
ATOM 6689  N ND2  . ASN A 1 107 ? -2.795  10.789  7.458   1.00 0.00 ? 107 ASN A ND2  4  
ATOM 6690  H H    . ASN A 1 107 ? -0.915  7.626   8.529   1.00 0.00 ? 107 ASN A H    4  
ATOM 6691  H HA   . ASN A 1 107 ? -1.001  9.618   10.642  1.00 0.00 ? 107 ASN A HA   4  
ATOM 6692  H HB3  . ASN A 1 107 ? -3.585  9.423   10.036  1.00 0.00 ? 107 ASN A HB3  4  
ATOM 6693  H HD21 . ASN A 1 107 ? -3.228  10.013  7.000   1.00 0.00 ? 107 ASN A HD21 4  
ATOM 6694  H HD22 . ASN A 1 107 ? -2.638  11.641  6.956   1.00 0.00 ? 107 ASN A HD22 4  
ATOM 6695  N N    . SER A 1 108 ? -1.206  6.688   11.247  1.00 0.00 ? 108 SER A N    4  
ATOM 6696  C CA   . SER A 1 108 ? -1.545  5.590   12.138  1.00 0.00 ? 108 SER A CA   4  
ATOM 6697  C C    . SER A 1 108 ? -1.642  6.097   13.578  1.00 0.00 ? 108 SER A C    4  
ATOM 6698  O O    . SER A 1 108 ? -2.157  5.402   14.452  1.00 0.00 ? 108 SER A O    4  
ATOM 6699  C CB   . SER A 1 108 ? -0.516  4.464   12.039  1.00 0.00 ? 108 SER A CB   4  
ATOM 6700  O OG   . SER A 1 108 ? -0.342  4.015   10.698  1.00 0.00 ? 108 SER A OG   4  
ATOM 6701  H H    . SER A 1 108 ? -0.336  6.586   10.764  1.00 0.00 ? 108 SER A H    4  
ATOM 6702  H HA   . SER A 1 108 ? -2.514  5.228   11.793  1.00 0.00 ? 108 SER A HA   4  
ATOM 6703  H HB3  . SER A 1 108 ? -0.834  3.627   12.662  1.00 0.00 ? 108 SER A HB3  4  
ATOM 6704  H HG   . SER A 1 108 ? -0.972  4.500   10.091  1.00 0.00 ? 108 SER A HG   4  
ATOM 6705  N N    . ASP A 1 109 ? -1.137  7.305   13.782  1.00 0.00 ? 109 ASP A N    4  
ATOM 6706  C CA   . ASP A 1 109 ? -1.159  7.913   15.102  1.00 0.00 ? 109 ASP A CA   4  
ATOM 6707  C C    . ASP A 1 109 ? -0.379  7.030   16.078  1.00 0.00 ? 109 ASP A C    4  
ATOM 6708  O O    . ASP A 1 109 ? 0.845   7.123   16.164  1.00 0.00 ? 109 ASP A O    4  
ATOM 6709  C CB   . ASP A 1 109 ? -2.591  8.044   15.623  1.00 0.00 ? 109 ASP A CB   4  
ATOM 6710  C CG   . ASP A 1 109 ? -2.709  8.349   17.118  1.00 0.00 ? 109 ASP A CG   4  
ATOM 6711  O OD1  . ASP A 1 109 ? -1.657  8.643   17.723  1.00 0.00 ? 109 ASP A OD1  4  
ATOM 6712  O OD2  . ASP A 1 109 ? -3.851  8.282   17.621  1.00 0.00 ? 109 ASP A OD2  4  
ATOM 6713  H H    . ASP A 1 109 ? -0.719  7.865   13.067  1.00 0.00 ? 109 ASP A H    4  
ATOM 6714  H HA   . ASP A 1 109 ? -0.704  8.895   14.973  1.00 0.00 ? 109 ASP A HA   4  
ATOM 6715  H HB3  . ASP A 1 109 ? -3.124  7.117   15.413  1.00 0.00 ? 109 ASP A HB3  4  
ATOM 6716  N N    . THR A 1 110 ? -1.119  6.193   16.790  1.00 0.00 ? 110 THR A N    4  
ATOM 6717  C CA   . THR A 1 110 ? -0.514  5.295   17.757  1.00 0.00 ? 110 THR A CA   4  
ATOM 6718  C C    . THR A 1 110 ? -0.204  3.944   17.109  1.00 0.00 ? 110 THR A C    4  
ATOM 6719  O O    . THR A 1 110 ? 0.956   3.547   17.017  1.00 0.00 ? 110 THR A O    4  
ATOM 6720  C CB   . THR A 1 110 ? -1.453  5.191   18.961  1.00 0.00 ? 110 THR A CB   4  
ATOM 6721  O OG1  . THR A 1 110 ? -1.563  6.531   19.432  1.00 0.00 ? 110 THR A OG1  4  
ATOM 6722  C CG2  . THR A 1 110 ? -0.823  4.436   20.132  1.00 0.00 ? 110 THR A CG2  4  
ATOM 6723  H H    . THR A 1 110 ? -2.114  6.124   16.715  1.00 0.00 ? 110 THR A H    4  
ATOM 6724  H HA   . THR A 1 110 ? 0.438   5.723   18.074  1.00 0.00 ? 110 THR A HA   4  
ATOM 6725  H HB   . THR A 1 110 ? -2.404  4.742   18.673  1.00 0.00 ? 110 THR A HB   4  
ATOM 6726  H HG1  . THR A 1 110 ? -0.653  6.926   19.558  1.00 0.00 ? 110 THR A HG1  4  
ATOM 6727  H HG21 . THR A 1 110 ? -0.817  3.368   19.914  1.00 0.00 ? 110 THR A HG21 4  
ATOM 6728  H HG22 . THR A 1 110 ? 0.200   4.782   20.280  1.00 0.00 ? 110 THR A HG22 4  
ATOM 6729  H HG23 . THR A 1 110 ? -1.403  4.619   21.036  1.00 0.00 ? 110 THR A HG23 4  
ATOM 6730  N N    . THR A 1 111 ? -1.263  3.274   16.678  1.00 0.00 ? 111 THR A N    4  
ATOM 6731  C CA   . THR A 1 111 ? -1.120  1.976   16.041  1.00 0.00 ? 111 THR A CA   4  
ATOM 6732  C C    . THR A 1 111 ? -1.542  2.052   14.573  1.00 0.00 ? 111 THR A C    4  
ATOM 6733  O O    . THR A 1 111 ? -2.243  2.981   14.171  1.00 0.00 ? 111 THR A O    4  
ATOM 6734  C CB   . THR A 1 111 ? -1.926  0.961   16.852  1.00 0.00 ? 111 THR A CB   4  
ATOM 6735  O OG1  . THR A 1 111 ? -2.952  1.738   17.463  1.00 0.00 ? 111 THR A OG1  4  
ATOM 6736  C CG2  . THR A 1 111 ? -1.134  0.393   18.033  1.00 0.00 ? 111 THR A CG2  4  
ATOM 6737  H H    . THR A 1 111 ? -2.203  3.605   16.757  1.00 0.00 ? 111 THR A H    4  
ATOM 6738  H HA   . THR A 1 111 ? -0.065  1.701   16.056  1.00 0.00 ? 111 THR A HA   4  
ATOM 6739  H HB   . THR A 1 111 ? -2.298  0.159   16.214  1.00 0.00 ? 111 THR A HB   4  
ATOM 6740  H HG1  . THR A 1 111 ? -3.802  1.652   16.944  1.00 0.00 ? 111 THR A HG1  4  
ATOM 6741  H HG21 . THR A 1 111 ? -1.168  -0.694  18.005  1.00 0.00 ? 111 THR A HG21 4  
ATOM 6742  H HG22 . THR A 1 111 ? -0.099  0.727   17.969  1.00 0.00 ? 111 THR A HG22 4  
ATOM 6743  H HG23 . THR A 1 111 ? -1.572  0.747   18.967  1.00 0.00 ? 111 THR A HG23 4  
ATOM 6744  N N    . LEU A 1 112 ? -1.099  1.064   13.810  1.00 0.00 ? 112 LEU A N    4  
ATOM 6745  C CA   . LEU A 1 112 ? -1.421  1.008   12.395  1.00 0.00 ? 112 LEU A CA   4  
ATOM 6746  C C    . LEU A 1 112 ? -2.134  -0.310  12.091  1.00 0.00 ? 112 LEU A C    4  
ATOM 6747  O O    . LEU A 1 112 ? -1.516  -1.373  12.114  1.00 0.00 ? 112 LEU A O    4  
ATOM 6748  C CB   . LEU A 1 112 ? -0.167  1.238   11.549  1.00 0.00 ? 112 LEU A CB   4  
ATOM 6749  C CG   . LEU A 1 112 ? -0.358  1.170   10.033  1.00 0.00 ? 112 LEU A CG   4  
ATOM 6750  C CD1  . LEU A 1 112 ? -0.060  -0.235  9.506   1.00 0.00 ? 112 LEU A CD1  4  
ATOM 6751  C CD2  . LEU A 1 112 ? -1.756  1.646   9.634   1.00 0.00 ? 112 LEU A CD2  4  
ATOM 6752  H H    . LEU A 1 112 ? -0.529  0.313   14.144  1.00 0.00 ? 112 LEU A H    4  
ATOM 6753  H HA   . LEU A 1 112 ? -2.108  1.829   12.183  1.00 0.00 ? 112 LEU A HA   4  
ATOM 6754  H HB3  . LEU A 1 112 ? 0.581   0.500   11.836  1.00 0.00 ? 112 LEU A HB3  4  
ATOM 6755  H HG   . LEU A 1 112 ? 0.358   1.846   9.567   1.00 0.00 ? 112 LEU A HG   4  
ATOM 6756  H HD11 . LEU A 1 112 ? -0.574  -0.972  10.123  1.00 0.00 ? 112 LEU A HD11 4  
ATOM 6757  H HD12 . LEU A 1 112 ? -0.408  -0.319  8.477   1.00 0.00 ? 112 LEU A HD12 4  
ATOM 6758  H HD13 . LEU A 1 112 ? 1.014   -0.417  9.542   1.00 0.00 ? 112 LEU A HD13 4  
ATOM 6759  H HD21 . LEU A 1 112 ? -1.949  1.380   8.595   1.00 0.00 ? 112 LEU A HD21 4  
ATOM 6760  H HD22 . LEU A 1 112 ? -2.499  1.169   10.273  1.00 0.00 ? 112 LEU A HD22 4  
ATOM 6761  H HD23 . LEU A 1 112 ? -1.818  2.729   9.750   1.00 0.00 ? 112 LEU A HD23 4  
ATOM 6762  N N    . GLU A 1 113 ? -3.425  -0.199  11.813  1.00 0.00 ? 113 GLU A N    4  
ATOM 6763  C CA   . GLU A 1 113 ? -4.228  -1.370  11.504  1.00 0.00 ? 113 GLU A CA   4  
ATOM 6764  C C    . GLU A 1 113 ? -4.194  -1.656  10.001  1.00 0.00 ? 113 GLU A C    4  
ATOM 6765  O O    . GLU A 1 113 ? -4.389  -0.753  9.189   1.00 0.00 ? 113 GLU A O    4  
ATOM 6766  C CB   . GLU A 1 113 ? -5.666  -1.192  11.996  1.00 0.00 ? 113 GLU A CB   4  
ATOM 6767  C CG   . GLU A 1 113 ? -6.449  -2.502  11.882  1.00 0.00 ? 113 GLU A CG   4  
ATOM 6768  C CD   . GLU A 1 113 ? -7.871  -2.340  12.423  1.00 0.00 ? 113 GLU A CD   4  
ATOM 6769  O OE1  . GLU A 1 113 ? -8.039  -2.545  13.644  1.00 0.00 ? 113 GLU A OE1  4  
ATOM 6770  O OE2  . GLU A 1 113 ? -8.756  -2.012  11.604  1.00 0.00 ? 113 GLU A OE2  4  
ATOM 6771  H H    . GLU A 1 113 ? -3.920  0.670   11.796  1.00 0.00 ? 113 GLU A H    4  
ATOM 6772  H HA   . GLU A 1 113 ? -3.763  -2.192  12.048  1.00 0.00 ? 113 GLU A HA   4  
ATOM 6773  H HB3  . GLU A 1 113 ? -6.161  -0.416  11.414  1.00 0.00 ? 113 GLU A HB3  4  
ATOM 6774  H HG3  . GLU A 1 113 ? -5.934  -3.288  12.433  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 6775  N N    . LEU A 1 114 ? -3.946  -2.916  9.678   1.00 0.00 ? 114 LEU A N    4  
ATOM 6776  C CA   . LEU A 1 114 ? -3.884  -3.334  8.288   1.00 0.00 ? 114 LEU A CA   4  
ATOM 6777  C C    . LEU A 1 114 ? -4.871  -4.480  8.058   1.00 0.00 ? 114 LEU A C    4  
ATOM 6778  O O    . LEU A 1 114 ? -5.550  -4.914  8.988   1.00 0.00 ? 114 LEU A O    4  
ATOM 6779  C CB   . LEU A 1 114 ? -2.445  -3.673  7.893   1.00 0.00 ? 114 LEU A CB   4  
ATOM 6780  C CG   . LEU A 1 114 ? -1.464  -2.499  7.857   1.00 0.00 ? 114 LEU A CG   4  
ATOM 6781  C CD1  . LEU A 1 114 ? -0.019  -2.988  7.974   1.00 0.00 ? 114 LEU A CD1  4  
ATOM 6782  C CD2  . LEU A 1 114 ? -1.679  -1.643  6.607   1.00 0.00 ? 114 LEU A CD2  4  
ATOM 6783  H H    . LEU A 1 114 ? -3.788  -3.645  10.345  1.00 0.00 ? 114 LEU A H    4  
ATOM 6784  H HA   . LEU A 1 114 ? -4.192  -2.484  7.677   1.00 0.00 ? 114 LEU A HA   4  
ATOM 6785  H HB3  . LEU A 1 114 ? -2.459  -4.138  6.908   1.00 0.00 ? 114 LEU A HB3  4  
ATOM 6786  H HG   . LEU A 1 114 ? -1.659  -1.864  8.720   1.00 0.00 ? 114 LEU A HG   4  
ATOM 6787  H HD11 . LEU A 1 114 ? 0.625   -2.155  8.259   1.00 0.00 ? 114 LEU A HD11 4  
ATOM 6788  H HD12 . LEU A 1 114 ? 0.041   -3.768  8.734   1.00 0.00 ? 114 LEU A HD12 4  
ATOM 6789  H HD13 . LEU A 1 114 ? 0.308   -3.389  7.014   1.00 0.00 ? 114 LEU A HD13 4  
ATOM 6790  H HD21 . LEU A 1 114 ? -1.895  -0.616  6.904   1.00 0.00 ? 114 LEU A HD21 4  
ATOM 6791  H HD22 . LEU A 1 114 ? -0.778  -1.662  5.994   1.00 0.00 ? 114 LEU A HD22 4  
ATOM 6792  H HD23 . LEU A 1 114 ? -2.518  -2.041  6.035   1.00 0.00 ? 114 LEU A HD23 4  
ATOM 6793  N N    . SER A 1 115 ? -4.919  -4.936  6.816   1.00 0.00 ? 115 SER A N    4  
ATOM 6794  C CA   . SER A 1 115 ? -5.813  -6.024  6.453   1.00 0.00 ? 115 SER A CA   4  
ATOM 6795  C C    . SER A 1 115 ? -5.442  -6.567  5.072   1.00 0.00 ? 115 SER A C    4  
ATOM 6796  O O    . SER A 1 115 ? -5.274  -5.801  4.124   1.00 0.00 ? 115 SER A O    4  
ATOM 6797  C CB   . SER A 1 115 ? -7.273  -5.566  6.468   1.00 0.00 ? 115 SER A CB   4  
ATOM 6798  O OG   . SER A 1 115 ? -7.521  -4.609  7.495   1.00 0.00 ? 115 SER A OG   4  
ATOM 6799  H H    . SER A 1 115 ? -4.365  -4.578  6.065   1.00 0.00 ? 115 SER A H    4  
ATOM 6800  H HA   . SER A 1 115 ? -5.664  -6.787  7.217   1.00 0.00 ? 115 SER A HA   4  
ATOM 6801  H HB3  . SER A 1 115 ? -7.922  -6.430  6.612   1.00 0.00 ? 115 SER A HB3  4  
ATOM 6802  H HG   . SER A 1 115 ? -8.262  -4.927  8.086   1.00 0.00 ? 115 SER A HG   4  
ATOM 6803  N N    . VAL A 1 116 ? -5.324  -7.885  5.001   1.00 0.00 ? 116 VAL A N    4  
ATOM 6804  C CA   . VAL A 1 116 ? -4.975  -8.539  3.751   1.00 0.00 ? 116 VAL A CA   4  
ATOM 6805  C C    . VAL A 1 116 ? -5.966  -9.673  3.481   1.00 0.00 ? 116 VAL A C    4  
ATOM 6806  O O    . VAL A 1 116 ? -6.946  -9.833  4.208   1.00 0.00 ? 116 VAL A O    4  
ATOM 6807  C CB   . VAL A 1 116 ? -3.521  -9.015  3.797   1.00 0.00 ? 116 VAL A CB   4  
ATOM 6808  C CG1  . VAL A 1 116 ? -2.580  -7.864  4.157   1.00 0.00 ? 116 VAL A CG1  4  
ATOM 6809  C CG2  . VAL A 1 116 ? -3.357  -10.183 4.770   1.00 0.00 ? 116 VAL A CG2  4  
ATOM 6810  H H    . VAL A 1 116 ? -5.461  -8.501  5.778   1.00 0.00 ? 116 VAL A H    4  
ATOM 6811  H HA   . VAL A 1 116 ? -5.065  -7.799  2.957   1.00 0.00 ? 116 VAL A HA   4  
ATOM 6812  H HB   . VAL A 1 116 ? -3.253  -9.368  2.801   1.00 0.00 ? 116 VAL A HB   4  
ATOM 6813  H HG11 . VAL A 1 116 ? -2.169  -7.431  3.245   1.00 0.00 ? 116 VAL A HG11 4  
ATOM 6814  H HG12 . VAL A 1 116 ? -3.133  -7.099  4.705   1.00 0.00 ? 116 VAL A HG12 4  
ATOM 6815  H HG13 . VAL A 1 116 ? -1.768  -8.239  4.780   1.00 0.00 ? 116 VAL A HG13 4  
ATOM 6816  H HG21 . VAL A 1 116 ? -2.732  -10.951 4.315   1.00 0.00 ? 116 VAL A HG21 4  
ATOM 6817  H HG22 . VAL A 1 116 ? -2.886  -9.829  5.688   1.00 0.00 ? 116 VAL A HG22 4  
ATOM 6818  H HG23 . VAL A 1 116 ? -4.336  -10.603 5.003   1.00 0.00 ? 116 VAL A HG23 4  
ATOM 6819  N N    . MET A 1 117 ? -5.677  -10.431 2.434   1.00 0.00 ? 117 MET A N    4  
ATOM 6820  C CA   . MET A 1 117 ? -6.530  -11.546 2.059   1.00 0.00 ? 117 MET A CA   4  
ATOM 6821  C C    . MET A 1 117 ? -5.707  -12.814 1.825   1.00 0.00 ? 117 MET A C    4  
ATOM 6822  O O    . MET A 1 117 ? -5.145  -13.003 0.748   1.00 0.00 ? 117 MET A O    4  
ATOM 6823  C CB   . MET A 1 117 ? -7.300  -11.195 0.784   1.00 0.00 ? 117 MET A CB   4  
ATOM 6824  C CG   . MET A 1 117 ? -8.365  -10.132 1.062   1.00 0.00 ? 117 MET A CG   4  
ATOM 6825  S SD   . MET A 1 117 ? -9.994  -10.841 0.888   1.00 0.00 ? 117 MET A SD   4  
ATOM 6826  C CE   . MET A 1 117 ? -10.108 -11.737 2.426   1.00 0.00 ? 117 MET A CE   4  
ATOM 6827  H H    . MET A 1 117 ? -4.879  -10.296 1.848   1.00 0.00 ? 117 MET A H    4  
ATOM 6828  H HA   . MET A 1 117 ? -7.206  -11.694 2.902   1.00 0.00 ? 117 MET A HA   4  
ATOM 6829  H HB3  . MET A 1 117 ? -7.771  -12.090 0.380   1.00 0.00 ? 117 MET A HB3  4  
ATOM 6830  H HG3  . MET A 1 117 ? -8.246  -9.298  0.371   1.00 0.00 ? 117 MET A HG3  4  
ATOM 6831  H HE1  . MET A 1 117 ? -10.172 -12.806 2.221   1.00 0.00 ? 117 MET A HE1  4  
ATOM 6832  H HE2  . MET A 1 117 ? -9.224  -11.536 3.031   1.00 0.00 ? 117 MET A HE2  4  
ATOM 6833  H HE3  . MET A 1 117 ? -10.999 -11.417 2.969   1.00 0.00 ? 117 MET A HE3  4  
ATOM 6834  N N    . PRO A 1 118 ? -5.660  -13.671 2.880   1.00 0.00 ? 118 PRO A N    4  
ATOM 6835  C CA   . PRO A 1 118 ? -4.914  -14.916 2.799   1.00 0.00 ? 118 PRO A CA   4  
ATOM 6836  C C    . PRO A 1 118 ? -5.657  -15.948 1.948   1.00 0.00 ? 118 PRO A C    4  
ATOM 6837  O O    . PRO A 1 118 ? -6.887  -15.952 1.906   1.00 0.00 ? 118 PRO A O    4  
ATOM 6838  C CB   . PRO A 1 118 ? -4.728  -15.357 4.242   1.00 0.00 ? 118 PRO A CB   4  
ATOM 6839  C CG   . PRO A 1 118 ? -5.770  -14.598 5.047   1.00 0.00 ? 118 PRO A CG   4  
ATOM 6840  C CD   . PRO A 1 118 ? -6.312  -13.480 4.171   1.00 0.00 ? 118 PRO A CD   4  
ATOM 6841  H HA   . PRO A 1 118 ? -4.036  -14.765 2.342   1.00 0.00 ? 118 PRO A HA   4  
ATOM 6842  H HB3  . PRO A 1 118 ? -3.722  -15.130 4.594   1.00 0.00 ? 118 PRO A HB3  4  
ATOM 6843  H HG3  . PRO A 1 118 ? -5.327  -14.189 5.956   1.00 0.00 ? 118 PRO A HG3  4  
ATOM 6844  H HD3  . PRO A 1 118 ? -6.082  -12.501 4.590   1.00 0.00 ? 118 PRO A HD3  4  
ATOM 6845  N N    . LYS A 1 119 ? -4.881  -16.798 1.294   1.00 0.00 ? 119 LYS A N    4  
ATOM 6846  C CA   . LYS A 1 119 ? -5.450  -17.832 0.448   1.00 0.00 ? 119 LYS A CA   4  
ATOM 6847  C C    . LYS A 1 119 ? -5.047  -19.206 0.986   1.00 0.00 ? 119 LYS A C    4  
ATOM 6848  O O    . LYS A 1 119 ? -4.118  -19.315 1.784   1.00 0.00 ? 119 LYS A O    4  
ATOM 6849  C CB   . LYS A 1 119 ? -5.056  -17.605 -1.015  1.00 0.00 ? 119 LYS A CB   4  
ATOM 6850  C CG   . LYS A 1 119 ? -6.230  -17.039 -1.817  1.00 0.00 ? 119 LYS A CG   4  
ATOM 6851  C CD   . LYS A 1 119 ? -6.817  -18.099 -2.751  1.00 0.00 ? 119 LYS A CD   4  
ATOM 6852  C CE   . LYS A 1 119 ? -6.943  -17.563 -4.178  1.00 0.00 ? 119 LYS A CE   4  
ATOM 6853  N NZ   . LYS A 1 119 ? -5.741  -17.907 -4.969  1.00 0.00 ? 119 LYS A NZ   4  
ATOM 6854  H H    . LYS A 1 119 ? -3.881  -16.787 1.334   1.00 0.00 ? 119 LYS A H    4  
ATOM 6855  H HA   . LYS A 1 119 ? -6.535  -17.742 0.506   1.00 0.00 ? 119 LYS A HA   4  
ATOM 6856  H HB3  . LYS A 1 119 ? -4.729  -18.546 -1.457  1.00 0.00 ? 119 LYS A HB3  4  
ATOM 6857  H HG3  . LYS A 1 119 ? -5.896  -16.181 -2.399  1.00 0.00 ? 119 LYS A HG3  4  
ATOM 6858  H HD3  . LYS A 1 119 ? -7.797  -18.408 -2.387  1.00 0.00 ? 119 LYS A HD3  4  
ATOM 6859  H HE3  . LYS A 1 119 ? -7.073  -16.481 -4.156  1.00 0.00 ? 119 LYS A HE3  4  
ATOM 6860  H HZ1  . LYS A 1 119 ? -5.194  -17.083 -5.120  1.00 0.00 ? 119 LYS A HZ1  4  
ATOM 6861  H HZ2  . LYS A 1 119 ? -5.196  -18.583 -4.472  1.00 0.00 ? 119 LYS A HZ2  4  
ATOM 6862  H HZ3  . LYS A 1 119 ? -6.021  -18.287 -5.851  1.00 0.00 ? 119 LYS A HZ3  4  
ATOM 6863  N N    . ASP A 1 120 ? -5.767  -20.220 0.529   1.00 0.00 ? 120 ASP A N    4  
ATOM 6864  C CA   . ASP A 1 120 ? -5.497  -21.582 0.955   1.00 0.00 ? 120 ASP A CA   4  
ATOM 6865  C C    . ASP A 1 120 ? -4.005  -21.879 0.785   1.00 0.00 ? 120 ASP A C    4  
ATOM 6866  O O    . ASP A 1 120 ? -3.520  -22.012 -0.338  1.00 0.00 ? 120 ASP A O    4  
ATOM 6867  C CB   . ASP A 1 120 ? -6.278  -22.589 0.111   1.00 0.00 ? 120 ASP A CB   4  
ATOM 6868  C CG   . ASP A 1 120 ? -6.975  -23.696 0.903   1.00 0.00 ? 120 ASP A CG   4  
ATOM 6869  O OD1  . ASP A 1 120 ? -6.796  -23.706 2.141   1.00 0.00 ? 120 ASP A OD1  4  
ATOM 6870  O OD2  . ASP A 1 120 ? -7.671  -24.508 0.256   1.00 0.00 ? 120 ASP A OD2  4  
ATOM 6871  H H    . ASP A 1 120 ? -6.521  -20.122 -0.121  1.00 0.00 ? 120 ASP A H    4  
ATOM 6872  H HA   . ASP A 1 120 ? -5.813  -21.625 1.997   1.00 0.00 ? 120 ASP A HA   4  
ATOM 6873  H HB3  . ASP A 1 120 ? -5.596  -23.050 -0.604  1.00 0.00 ? 120 ASP A HB3  4  
ATOM 6874  N N    . SER A 1 121 ? -3.320  -21.973 1.914   1.00 0.00 ? 121 SER A N    4  
ATOM 6875  C CA   . SER A 1 121 ? -1.894  -22.251 1.903   1.00 0.00 ? 121 SER A CA   4  
ATOM 6876  C C    . SER A 1 121 ? -1.126  -21.031 1.389   1.00 0.00 ? 121 SER A C    4  
ATOM 6877  O O    . SER A 1 121 ? -1.559  -20.375 0.443   1.00 0.00 ? 121 SER A O    4  
ATOM 6878  C CB   . SER A 1 121 ? -1.578  -23.477 1.045   1.00 0.00 ? 121 SER A CB   4  
ATOM 6879  O OG   . SER A 1 121 ? -1.030  -24.543 1.816   1.00 0.00 ? 121 SER A OG   4  
ATOM 6880  H H    . SER A 1 121 ? -3.722  -21.863 2.822   1.00 0.00 ? 121 SER A H    4  
ATOM 6881  H HA   . SER A 1 121 ? -1.632  -22.459 2.940   1.00 0.00 ? 121 SER A HA   4  
ATOM 6882  H HB3  . SER A 1 121 ? -0.875  -23.199 0.259   1.00 0.00 ? 121 SER A HB3  4  
ATOM 6883  H HG   . SER A 1 121 ? -0.429  -25.104 1.246   1.00 0.00 ? 121 SER A HG   4  
ATOM 6884  N N    . GLY A 1 122 ? 0.000   -20.766 2.035   1.00 0.00 ? 122 GLY A N    4  
ATOM 6885  C CA   . GLY A 1 122 ? 0.832   -19.637 1.654   1.00 0.00 ? 122 GLY A CA   4  
ATOM 6886  C C    . GLY A 1 122 ? 2.029   -19.496 2.596   1.00 0.00 ? 122 GLY A C    4  
ATOM 6887  O O    . GLY A 1 122 ? 3.157   -19.810 2.224   1.00 0.00 ? 122 GLY A O    4  
ATOM 6888  H H    . GLY A 1 122 ? 0.346   -21.306 2.802   1.00 0.00 ? 122 GLY A H    4  
ATOM 6889  H HA2  . GLY A 1 122 ? 1.184   -19.768 0.630   1.00 0.00 ? 122 GLY A HA2  4  
ATOM 6890  H HA3  . GLY A 1 122 ? 0.240   -18.722 1.672   1.00 0.00 ? 122 GLY A HA3  4  
ATOM 6891  N N    . PRO A 1 123 ? 1.733   -19.008 3.831   1.00 0.00 ? 123 PRO A N    4  
ATOM 6892  C CA   . PRO A 1 123 ? 2.772   -18.821 4.830   1.00 0.00 ? 123 PRO A CA   4  
ATOM 6893  C C    . PRO A 1 123 ? 3.208   -20.161 5.426   1.00 0.00 ? 123 PRO A C    4  
ATOM 6894  O O    . PRO A 1 123 ? 2.523   -21.170 5.260   1.00 0.00 ? 123 PRO A O    4  
ATOM 6895  C CB   . PRO A 1 123 ? 2.163   -17.882 5.859   1.00 0.00 ? 123 PRO A CB   4  
ATOM 6896  C CG   . PRO A 1 123 ? 0.660   -17.949 5.647   1.00 0.00 ? 123 PRO A CG   4  
ATOM 6897  C CD   . PRO A 1 123 ? 0.408   -18.623 4.307   1.00 0.00 ? 123 PRO A CD   4  
ATOM 6898  H HA   . PRO A 1 123 ? 3.591   -18.429 4.411   1.00 0.00 ? 123 PRO A HA   4  
ATOM 6899  H HB3  . PRO A 1 123 ? 2.532   -16.866 5.728   1.00 0.00 ? 123 PRO A HB3  4  
ATOM 6900  H HG3  . PRO A 1 123 ? 0.228   -16.948 5.658   1.00 0.00 ? 123 PRO A HG3  4  
ATOM 6901  H HD3  . PRO A 1 123 ? -0.082  -17.945 3.610   1.00 0.00 ? 123 PRO A HD3  4  
ATOM 6902  N N    . SER A 1 124 ? 4.344   -20.129 6.107   1.00 0.00 ? 124 SER A N    4  
ATOM 6903  C CA   . SER A 1 124 ? 4.879   -21.328 6.728   1.00 0.00 ? 124 SER A CA   4  
ATOM 6904  C C    . SER A 1 124 ? 6.209   -21.012 7.414   1.00 0.00 ? 124 SER A C    4  
ATOM 6905  O O    . SER A 1 124 ? 7.276   -21.273 6.858   1.00 0.00 ? 124 SER A O    4  
ATOM 6906  C CB   . SER A 1 124 ? 5.065   -22.445 5.699   1.00 0.00 ? 124 SER A CB   4  
ATOM 6907  O OG   . SER A 1 124 ? 4.389   -23.640 6.082   1.00 0.00 ? 124 SER A OG   4  
ATOM 6908  H H    . SER A 1 124 ? 4.894   -19.304 6.236   1.00 0.00 ? 124 SER A H    4  
ATOM 6909  H HA   . SER A 1 124 ? 4.132   -21.631 7.462   1.00 0.00 ? 124 SER A HA   4  
ATOM 6910  H HB3  . SER A 1 124 ? 6.127   -22.652 5.576   1.00 0.00 ? 124 SER A HB3  4  
ATOM 6911  H HG   . SER A 1 124 ? 5.039   -24.398 6.131   1.00 0.00 ? 124 SER A HG   4  
ATOM 6912  N N    . SER A 1 125 ? 6.103   -20.458 8.612   1.00 0.00 ? 125 SER A N    4  
ATOM 6913  C CA   . SER A 1 125 ? 7.285   -20.104 9.381   1.00 0.00 ? 125 SER A CA   4  
ATOM 6914  C C    . SER A 1 125 ? 7.033   -20.346 10.870  1.00 0.00 ? 125 SER A C    4  
ATOM 6915  O O    . SER A 1 125 ? 5.884   -20.431 11.303  1.00 0.00 ? 125 SER A O    4  
ATOM 6916  C CB   . SER A 1 125 ? 7.684   -18.646 9.139   1.00 0.00 ? 125 SER A CB   4  
ATOM 6917  O OG   . SER A 1 125 ? 8.915   -18.317 9.776   1.00 0.00 ? 125 SER A OG   4  
ATOM 6918  H H    . SER A 1 125 ? 5.233   -20.250 9.057   1.00 0.00 ? 125 SER A H    4  
ATOM 6919  H HA   . SER A 1 125 ? 8.075   -20.761 9.015   1.00 0.00 ? 125 SER A HA   4  
ATOM 6920  H HB3  . SER A 1 125 ? 6.897   -17.990 9.509   1.00 0.00 ? 125 SER A HB3  4  
ATOM 6921  H HG   . SER A 1 125 ? 9.555   -17.939 9.109   1.00 0.00 ? 125 SER A HG   4  
ATOM 6922  N N    . GLY A 1 126 ? 8.124   -20.450 11.614  1.00 0.00 ? 126 GLY A N    4  
ATOM 6923  C CA   . GLY A 1 126 ? 8.035   -20.679 13.045  1.00 0.00 ? 126 GLY A CA   4  
ATOM 6924  C C    . GLY A 1 126 ? 8.642   -22.034 13.421  1.00 0.00 ? 126 GLY A C    4  
ATOM 6925  O O    . GLY A 1 126 ? 8.671   -22.399 14.596  1.00 0.00 ? 126 GLY A O    4  
ATOM 6926  H H    . GLY A 1 126 ? 9.054   -20.379 11.254  1.00 0.00 ? 126 GLY A H    4  
ATOM 6927  H HA2  . GLY A 1 126 ? 8.555   -19.884 13.578  1.00 0.00 ? 126 GLY A HA2  4  
ATOM 6928  H HA3  . GLY A 1 126 ? 6.992   -20.645 13.359  1.00 0.00 ? 126 GLY A HA3  4  
ATOM 6929  N N    . GLY A 1 1   ? -18.721 3.832   10.006  1.00 0.00 ? 1   GLY A N    5  
ATOM 6930  C CA   . GLY A 1 1   ? -18.404 2.949   11.117  1.00 0.00 ? 1   GLY A CA   5  
ATOM 6931  C C    . GLY A 1 1   ? -19.373 1.768   11.173  1.00 0.00 ? 1   GLY A C    5  
ATOM 6932  O O    . GLY A 1 1   ? -20.259 1.647   10.330  1.00 0.00 ? 1   GLY A O    5  
ATOM 6933  H H1   . GLY A 1 1   ? -18.596 3.429   9.099   1.00 0.00 ? 1   GLY A H1   5  
ATOM 6934  H HA2  . GLY A 1 1   ? -17.383 2.584   11.016  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6935  H HA3  . GLY A 1 1   ? -18.451 3.508   12.054  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6936  N N    . SER A 1 2   ? -19.170 0.925   12.175  1.00 0.00 ? 2   SER A N    5  
ATOM 6937  C CA   . SER A 1 2   ? -20.014 -0.244  12.352  1.00 0.00 ? 2   SER A CA   5  
ATOM 6938  C C    . SER A 1 2   ? -20.244 -0.932  11.005  1.00 0.00 ? 2   SER A C    5  
ATOM 6939  O O    . SER A 1 2   ? -21.210 -0.629  10.306  1.00 0.00 ? 2   SER A O    5  
ATOM 6940  C CB   . SER A 1 2   ? -21.353 0.134   12.990  1.00 0.00 ? 2   SER A CB   5  
ATOM 6941  O OG   . SER A 1 2   ? -21.326 0.002   14.409  1.00 0.00 ? 2   SER A OG   5  
ATOM 6942  H H    . SER A 1 2   ? -18.446 1.030   12.857  1.00 0.00 ? 2   SER A H    5  
ATOM 6943  H HA   . SER A 1 2   ? -19.464 -0.899  13.028  1.00 0.00 ? 2   SER A HA   5  
ATOM 6944  H HB3  . SER A 1 2   ? -22.142 -0.498  12.582  1.00 0.00 ? 2   SER A HB3  5  
ATOM 6945  H HG   . SER A 1 2   ? -22.248 0.102   14.779  1.00 0.00 ? 2   SER A HG   5  
ATOM 6946  N N    . SER A 1 3   ? -19.341 -1.846  10.681  1.00 0.00 ? 3   SER A N    5  
ATOM 6947  C CA   . SER A 1 3   ? -19.433 -2.579  9.430   1.00 0.00 ? 3   SER A CA   5  
ATOM 6948  C C    . SER A 1 3   ? -19.371 -4.084  9.700   1.00 0.00 ? 3   SER A C    5  
ATOM 6949  O O    . SER A 1 3   ? -18.653 -4.528  10.595  1.00 0.00 ? 3   SER A O    5  
ATOM 6950  C CB   . SER A 1 3   ? -18.319 -2.166  8.466   1.00 0.00 ? 3   SER A CB   5  
ATOM 6951  O OG   . SER A 1 3   ? -18.161 -3.101  7.403   1.00 0.00 ? 3   SER A OG   5  
ATOM 6952  H H    . SER A 1 3   ? -18.558 -2.086  11.256  1.00 0.00 ? 3   SER A H    5  
ATOM 6953  H HA   . SER A 1 3   ? -20.399 -2.306  9.007   1.00 0.00 ? 3   SER A HA   5  
ATOM 6954  H HB3  . SER A 1 3   ? -17.381 -2.078  9.013   1.00 0.00 ? 3   SER A HB3  5  
ATOM 6955  H HG   . SER A 1 3   ? -18.912 -3.006  6.750   1.00 0.00 ? 3   SER A HG   5  
ATOM 6956  N N    . GLY A 1 4   ? -20.133 -4.827  8.911   1.00 0.00 ? 4   GLY A N    5  
ATOM 6957  C CA   . GLY A 1 4   ? -20.174 -6.271  9.053   1.00 0.00 ? 4   GLY A CA   5  
ATOM 6958  C C    . GLY A 1 4   ? -20.655 -6.937  7.762   1.00 0.00 ? 4   GLY A C    5  
ATOM 6959  O O    . GLY A 1 4   ? -20.514 -6.372  6.679   1.00 0.00 ? 4   GLY A O    5  
ATOM 6960  H H    . GLY A 1 4   ? -20.714 -4.457  8.185   1.00 0.00 ? 4   GLY A H    5  
ATOM 6961  H HA2  . GLY A 1 4   ? -19.182 -6.643  9.310   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6962  H HA3  . GLY A 1 4   ? -20.838 -6.542  9.874   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6963  N N    . SER A 1 5   ? -21.214 -8.127  7.921   1.00 0.00 ? 5   SER A N    5  
ATOM 6964  C CA   . SER A 1 5   ? -21.717 -8.876  6.780   1.00 0.00 ? 5   SER A CA   5  
ATOM 6965  C C    . SER A 1 5   ? -20.723 -8.792  5.620   1.00 0.00 ? 5   SER A C    5  
ATOM 6966  O O    . SER A 1 5   ? -20.835 -7.918  4.764   1.00 0.00 ? 5   SER A O    5  
ATOM 6967  C CB   . SER A 1 5   ? -23.089 -8.357  6.343   1.00 0.00 ? 5   SER A CB   5  
ATOM 6968  O OG   . SER A 1 5   ? -24.149 -8.976  7.064   1.00 0.00 ? 5   SER A OG   5  
ATOM 6969  H H    . SER A 1 5   ? -21.326 -8.580  8.805   1.00 0.00 ? 5   SER A H    5  
ATOM 6970  H HA   . SER A 1 5   ? -21.812 -9.904  7.130   1.00 0.00 ? 5   SER A HA   5  
ATOM 6971  H HB3  . SER A 1 5   ? -23.220 -8.537  5.276   1.00 0.00 ? 5   SER A HB3  5  
ATOM 6972  H HG   . SER A 1 5   ? -23.799 -9.375  7.912   1.00 0.00 ? 5   SER A HG   5  
ATOM 6973  N N    . SER A 1 6   ? -19.772 -9.716  5.630   1.00 0.00 ? 6   SER A N    5  
ATOM 6974  C CA   . SER A 1 6   ? -18.758 -9.757  4.590   1.00 0.00 ? 6   SER A CA   5  
ATOM 6975  C C    . SER A 1 6   ? -18.293 -11.198 4.371   1.00 0.00 ? 6   SER A C    5  
ATOM 6976  O O    . SER A 1 6   ? -18.283 -11.686 3.242   1.00 0.00 ? 6   SER A O    5  
ATOM 6977  C CB   . SER A 1 6   ? -17.569 -8.863  4.942   1.00 0.00 ? 6   SER A CB   5  
ATOM 6978  O OG   . SER A 1 6   ? -16.425 -9.159  4.146   1.00 0.00 ? 6   SER A OG   5  
ATOM 6979  H H    . SER A 1 6   ? -19.688 -10.424 6.332   1.00 0.00 ? 6   SER A H    5  
ATOM 6980  H HA   . SER A 1 6   ? -19.248 -9.373  3.695   1.00 0.00 ? 6   SER A HA   5  
ATOM 6981  H HB3  . SER A 1 6   ? -17.320 -8.991  5.997   1.00 0.00 ? 6   SER A HB3  5  
ATOM 6982  H HG   . SER A 1 6   ? -16.314 -8.461  3.437   1.00 0.00 ? 6   SER A HG   5  
ATOM 6983  N N    . GLY A 1 7   ? -17.919 -11.839 5.469   1.00 0.00 ? 7   GLY A N    5  
ATOM 6984  C CA   . GLY A 1 7   ? -17.454 -13.214 5.411   1.00 0.00 ? 7   GLY A CA   5  
ATOM 6985  C C    . GLY A 1 7   ? -16.469 -13.508 6.545   1.00 0.00 ? 7   GLY A C    5  
ATOM 6986  O O    . GLY A 1 7   ? -16.801 -14.219 7.491   1.00 0.00 ? 7   GLY A O    5  
ATOM 6987  H H    . GLY A 1 7   ? -17.930 -11.434 6.384   1.00 0.00 ? 7   GLY A H    5  
ATOM 6988  H HA2  . GLY A 1 7   ? -18.304 -13.892 5.479   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6989  H HA3  . GLY A 1 7   ? -16.973 -13.400 4.450   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6990  N N    . GLY A 1 8   ? -15.277 -12.945 6.412   1.00 0.00 ? 8   GLY A N    5  
ATOM 6991  C CA   . GLY A 1 8   ? -14.242 -13.137 7.413   1.00 0.00 ? 8   GLY A CA   5  
ATOM 6992  C C    . GLY A 1 8   ? -12.911 -12.546 6.946   1.00 0.00 ? 8   GLY A C    5  
ATOM 6993  O O    . GLY A 1 8   ? -12.024 -13.275 6.506   1.00 0.00 ? 8   GLY A O    5  
ATOM 6994  H H    . GLY A 1 8   ? -15.015 -12.367 5.639   1.00 0.00 ? 8   GLY A H    5  
ATOM 6995  H HA2  . GLY A 1 8   ? -14.545 -12.668 8.350   1.00 0.00 ? 8   GLY A HA2  5  
ATOM 6996  H HA3  . GLY A 1 8   ? -14.121 -14.201 7.616   1.00 0.00 ? 8   GLY A HA3  5  
ATOM 6997  N N    . PRO A 1 9   ? -12.810 -11.194 7.062   1.00 0.00 ? 9   PRO A N    5  
ATOM 6998  C CA   . PRO A 1 9   ? -11.602 -10.496 6.657   1.00 0.00 ? 9   PRO A CA   5  
ATOM 6999  C C    . PRO A 1 9   ? -10.482 -10.701 7.678   1.00 0.00 ? 9   PRO A C    5  
ATOM 7000  O O    . PRO A 1 9   ? -10.746 -10.997 8.842   1.00 0.00 ? 9   PRO A O    5  
ATOM 7001  C CB   . PRO A 1 9   ? -12.018 -9.041  6.515   1.00 0.00 ? 9   PRO A CB   5  
ATOM 7002  C CG   . PRO A 1 9   ? -13.318 -8.901  7.289   1.00 0.00 ? 9   PRO A CG   5  
ATOM 7003  C CD   . PRO A 1 9   ? -13.841 -10.298 7.578   1.00 0.00 ? 9   PRO A CD   5  
ATOM 7004  H HA   . PRO A 1 9   ? -11.258 -10.869 5.795   1.00 0.00 ? 9   PRO A HA   5  
ATOM 7005  H HB3  . PRO A 1 9   ? -12.157 -8.775  5.466   1.00 0.00 ? 9   PRO A HB3  5  
ATOM 7006  H HG3  . PRO A 1 9   ? -14.047 -8.332  6.712   1.00 0.00 ? 9   PRO A HG3  5  
ATOM 7007  H HD3  . PRO A 1 9   ? -14.799 -10.471 7.088   1.00 0.00 ? 9   PRO A HD3  5  
ATOM 7008  N N    . LYS A 1 10  ? -9.256  -10.535 7.205   1.00 0.00 ? 10  LYS A N    5  
ATOM 7009  C CA   . LYS A 1 10  ? -8.094  -10.696 8.063   1.00 0.00 ? 10  LYS A CA   5  
ATOM 7010  C C    . LYS A 1 10  ? -7.665  -9.330  8.598   1.00 0.00 ? 10  LYS A C    5  
ATOM 7011  O O    . LYS A 1 10  ? -7.677  -8.341  7.867   1.00 0.00 ? 10  LYS A O    5  
ATOM 7012  C CB   . LYS A 1 10  ? -6.983  -11.445 7.325   1.00 0.00 ? 10  LYS A CB   5  
ATOM 7013  C CG   . LYS A 1 10  ? -5.625  -11.202 7.986   1.00 0.00 ? 10  LYS A CG   5  
ATOM 7014  C CD   . LYS A 1 10  ? -5.517  -11.961 9.310   1.00 0.00 ? 10  LYS A CD   5  
ATOM 7015  C CE   . LYS A 1 10  ? -4.103  -12.505 9.519   1.00 0.00 ? 10  LYS A CE   5  
ATOM 7016  N NZ   . LYS A 1 10  ? -4.082  -13.481 10.631  1.00 0.00 ? 10  LYS A NZ   5  
ATOM 7017  H H    . LYS A 1 10  ? -9.050  -10.293 6.257   1.00 0.00 ? 10  LYS A H    5  
ATOM 7018  H HA   . LYS A 1 10  ? -8.396  -11.319 8.906   1.00 0.00 ? 10  LYS A HA   5  
ATOM 7019  H HB3  . LYS A 1 10  ? -6.949  -11.118 6.285   1.00 0.00 ? 10  LYS A HB3  5  
ATOM 7020  H HG3  . LYS A 1 10  ? -5.486  -10.136 8.160   1.00 0.00 ? 10  LYS A HG3  5  
ATOM 7021  H HD3  . LYS A 1 10  ? -6.234  -12.782 9.323   1.00 0.00 ? 10  LYS A HD3  5  
ATOM 7022  H HE3  . LYS A 1 10  ? -3.419  -11.685 9.734   1.00 0.00 ? 10  LYS A HE3  5  
ATOM 7023  H HZ1  . LYS A 1 10  ? -3.155  -13.837 10.744  1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 7024  H HZ2  . LYS A 1 10  ? -4.372  -13.031 11.475  1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 7025  H HZ3  . LYS A 1 10  ? -4.705  -14.237 10.424  1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 7026  N N    . THR A 1 11  ? -7.295  -9.317  9.871   1.00 0.00 ? 11  THR A N    5  
ATOM 7027  C CA   . THR A 1 11  ? -6.863  -8.087  10.512  1.00 0.00 ? 11  THR A CA   5  
ATOM 7028  C C    . THR A 1 11  ? -5.474  -8.267  11.129  1.00 0.00 ? 11  THR A C    5  
ATOM 7029  O O    . THR A 1 11  ? -5.153  -9.337  11.644  1.00 0.00 ? 11  THR A O    5  
ATOM 7030  C CB   . THR A 1 11  ? -7.932  -7.684  11.530  1.00 0.00 ? 11  THR A CB   5  
ATOM 7031  O OG1  . THR A 1 11  ? -9.073  -7.382  10.732  1.00 0.00 ? 11  THR A OG1  5  
ATOM 7032  C CG2  . THR A 1 11  ? -7.606  -6.362  12.228  1.00 0.00 ? 11  THR A CG2  5  
ATOM 7033  H H    . THR A 1 11  ? -7.289  -10.126 10.459  1.00 0.00 ? 11  THR A H    5  
ATOM 7034  H HA   . THR A 1 11  ? -6.777  -7.313  9.749   1.00 0.00 ? 11  THR A HA   5  
ATOM 7035  H HB   . THR A 1 11  ? -8.097  -8.479  12.257  1.00 0.00 ? 11  THR A HB   5  
ATOM 7036  H HG1  . THR A 1 11  ? -9.439  -8.219  10.326  1.00 0.00 ? 11  THR A HG1  5  
ATOM 7037  H HG21 . THR A 1 11  ? -7.056  -6.564  13.148  1.00 0.00 ? 11  THR A HG21 5  
ATOM 7038  H HG22 . THR A 1 11  ? -6.997  -5.743  11.569  1.00 0.00 ? 11  THR A HG22 5  
ATOM 7039  H HG23 . THR A 1 11  ? -8.532  -5.839  12.466  1.00 0.00 ? 11  THR A HG23 5  
ATOM 7040  N N    . VAL A 1 12  ? -4.687  -7.203  11.055  1.00 0.00 ? 12  VAL A N    5  
ATOM 7041  C CA   . VAL A 1 12  ? -3.341  -7.231  11.600  1.00 0.00 ? 12  VAL A CA   5  
ATOM 7042  C C    . VAL A 1 12  ? -3.001  -5.855  12.177  1.00 0.00 ? 12  VAL A C    5  
ATOM 7043  O O    . VAL A 1 12  ? -3.076  -4.848  11.474  1.00 0.00 ? 12  VAL A O    5  
ATOM 7044  C CB   . VAL A 1 12  ? -2.352  -7.690  10.527  1.00 0.00 ? 12  VAL A CB   5  
ATOM 7045  C CG1  . VAL A 1 12  ? -2.126  -9.201  10.601  1.00 0.00 ? 12  VAL A CG1  5  
ATOM 7046  C CG2  . VAL A 1 12  ? -2.823  -7.272  9.133   1.00 0.00 ? 12  VAL A CG2  5  
ATOM 7047  H H    . VAL A 1 12  ? -4.955  -6.337  10.636  1.00 0.00 ? 12  VAL A H    5  
ATOM 7048  H HA   . VAL A 1 12  ? -3.327  -7.963  12.408  1.00 0.00 ? 12  VAL A HA   5  
ATOM 7049  H HB   . VAL A 1 12  ? -1.398  -7.198  10.719  1.00 0.00 ? 12  VAL A HB   5  
ATOM 7050  H HG11 . VAL A 1 12  ? -2.103  -9.515  11.644  1.00 0.00 ? 12  VAL A HG11 5  
ATOM 7051  H HG12 . VAL A 1 12  ? -2.937  -9.715  10.084  1.00 0.00 ? 12  VAL A HG12 5  
ATOM 7052  H HG13 . VAL A 1 12  ? -1.177  -9.451  10.126  1.00 0.00 ? 12  VAL A HG13 5  
ATOM 7053  H HG21 . VAL A 1 12  ? -3.518  -6.437  9.218   1.00 0.00 ? 12  VAL A HG21 5  
ATOM 7054  H HG22 . VAL A 1 12  ? -1.963  -6.970  8.534   1.00 0.00 ? 12  VAL A HG22 5  
ATOM 7055  H HG23 . VAL A 1 12  ? -3.323  -8.113  8.652   1.00 0.00 ? 12  VAL A HG23 5  
ATOM 7056  N N    . THR A 1 13  ? -2.635  -5.856  13.450  1.00 0.00 ? 13  THR A N    5  
ATOM 7057  C CA   . THR A 1 13  ? -2.283  -4.620  14.130  1.00 0.00 ? 13  THR A CA   5  
ATOM 7058  C C    . THR A 1 13  ? -0.768  -4.410  14.103  1.00 0.00 ? 13  THR A C    5  
ATOM 7059  O O    . THR A 1 13  ? -0.008  -5.364  13.948  1.00 0.00 ? 13  THR A O    5  
ATOM 7060  C CB   . THR A 1 13  ? -2.865  -4.677  15.544  1.00 0.00 ? 13  THR A CB   5  
ATOM 7061  O OG1  . THR A 1 13  ? -4.231  -5.025  15.345  1.00 0.00 ? 13  THR A OG1  5  
ATOM 7062  C CG2  . THR A 1 13  ? -2.922  -3.300  16.209  1.00 0.00 ? 13  THR A CG2  5  
ATOM 7063  H H    . THR A 1 13  ? -2.577  -6.680  14.015  1.00 0.00 ? 13  THR A H    5  
ATOM 7064  H HA   . THR A 1 13  ? -2.732  -3.789  13.585  1.00 0.00 ? 13  THR A HA   5  
ATOM 7065  H HB   . THR A 1 13  ? -2.312  -5.384  16.164  1.00 0.00 ? 13  THR A HB   5  
ATOM 7066  H HG1  . THR A 1 13  ? -4.594  -5.467  16.165  1.00 0.00 ? 13  THR A HG1  5  
ATOM 7067  H HG21 . THR A 1 13  ? -3.318  -2.572  15.500  1.00 0.00 ? 13  THR A HG21 5  
ATOM 7068  H HG22 . THR A 1 13  ? -3.573  -3.345  17.082  1.00 0.00 ? 13  THR A HG22 5  
ATOM 7069  H HG23 . THR A 1 13  ? -1.921  -3.002  16.515  1.00 0.00 ? 13  THR A HG23 5  
ATOM 7070  N N    . LEU A 1 14  ? -0.375  -3.154  14.256  1.00 0.00 ? 14  LEU A N    5  
ATOM 7071  C CA   . LEU A 1 14  ? 1.035   -2.806  14.251  1.00 0.00 ? 14  LEU A CA   5  
ATOM 7072  C C    . LEU A 1 14  ? 1.293   -1.724  15.301  1.00 0.00 ? 14  LEU A C    5  
ATOM 7073  O O    . LEU A 1 14  ? 0.379   -0.995  15.684  1.00 0.00 ? 14  LEU A O    5  
ATOM 7074  C CB   . LEU A 1 14  ? 1.486   -2.414  12.842  1.00 0.00 ? 14  LEU A CB   5  
ATOM 7075  C CG   . LEU A 1 14  ? 1.430   -3.521  11.788  1.00 0.00 ? 14  LEU A CG   5  
ATOM 7076  C CD1  . LEU A 1 14  ? 0.041   -3.604  11.152  1.00 0.00 ? 14  LEU A CD1  5  
ATOM 7077  C CD2  . LEU A 1 14  ? 2.529   -3.337  10.740  1.00 0.00 ? 14  LEU A CD2  5  
ATOM 7078  H H    . LEU A 1 14  ? -1.000  -2.382  14.380  1.00 0.00 ? 14  LEU A H    5  
ATOM 7079  H HA   . LEU A 1 14  ? 1.594   -3.699  14.530  1.00 0.00 ? 14  LEU A HA   5  
ATOM 7080  H HB3  . LEU A 1 14  ? 2.510   -2.045  12.899  1.00 0.00 ? 14  LEU A HB3  5  
ATOM 7081  H HG   . LEU A 1 14  ? 1.614   -4.474  12.284  1.00 0.00 ? 14  LEU A HG   5  
ATOM 7082  H HD11 . LEU A 1 14  ? 0.132   -3.950  10.123  1.00 0.00 ? 14  LEU A HD11 5  
ATOM 7083  H HD12 . LEU A 1 14  ? -0.576  -4.302  11.717  1.00 0.00 ? 14  LEU A HD12 5  
ATOM 7084  H HD13 . LEU A 1 14  ? -0.423  -2.618  11.164  1.00 0.00 ? 14  LEU A HD13 5  
ATOM 7085  H HD21 . LEU A 1 14  ? 2.241   -3.844  9.818   1.00 0.00 ? 14  LEU A HD21 5  
ATOM 7086  H HD22 . LEU A 1 14  ? 2.669   -2.274  10.542  1.00 0.00 ? 14  LEU A HD22 5  
ATOM 7087  H HD23 . LEU A 1 14  ? 3.462   -3.762  11.113  1.00 0.00 ? 14  LEU A HD23 5  
ATOM 7088  N N    . LYS A 1 15  ? 2.542   -1.653  15.738  1.00 0.00 ? 15  LYS A N    5  
ATOM 7089  C CA   . LYS A 1 15  ? 2.931   -0.671  16.736  1.00 0.00 ? 15  LYS A CA   5  
ATOM 7090  C C    . LYS A 1 15  ? 4.184   0.065   16.261  1.00 0.00 ? 15  LYS A C    5  
ATOM 7091  O O    . LYS A 1 15  ? 5.238   -0.543  16.088  1.00 0.00 ? 15  LYS A O    5  
ATOM 7092  C CB   . LYS A 1 15  ? 3.092   -1.336  18.106  1.00 0.00 ? 15  LYS A CB   5  
ATOM 7093  C CG   . LYS A 1 15  ? 1.741   -1.807  18.649  1.00 0.00 ? 15  LYS A CG   5  
ATOM 7094  C CD   . LYS A 1 15  ? 1.440   -1.166  20.005  1.00 0.00 ? 15  LYS A CD   5  
ATOM 7095  C CE   . LYS A 1 15  ? 0.582   -2.090  20.871  1.00 0.00 ? 15  LYS A CE   5  
ATOM 7096  N NZ   . LYS A 1 15  ? -0.586  -2.580  20.106  1.00 0.00 ? 15  LYS A NZ   5  
ATOM 7097  H H    . LYS A 1 15  ? 3.280   -2.249  15.422  1.00 0.00 ? 15  LYS A H    5  
ATOM 7098  H HA   . LYS A 1 15  ? 2.117   0.049   16.822  1.00 0.00 ? 15  LYS A HA   5  
ATOM 7099  H HB3  . LYS A 1 15  ? 3.543   -0.633  18.806  1.00 0.00 ? 15  LYS A HB3  5  
ATOM 7100  H HG3  . LYS A 1 15  ? 1.742   -2.892  18.747  1.00 0.00 ? 15  LYS A HG3  5  
ATOM 7101  H HD3  . LYS A 1 15  ? 0.924   -0.217  19.858  1.00 0.00 ? 15  LYS A HD3  5  
ATOM 7102  H HE3  . LYS A 1 15  ? 0.246   -1.558  21.761  1.00 0.00 ? 15  LYS A HE3  5  
ATOM 7103  H HZ1  . LYS A 1 15  ? -0.413  -3.514  19.793  1.00 0.00 ? 15  LYS A HZ1  5  
ATOM 7104  H HZ2  . LYS A 1 15  ? -1.397  -2.570  20.693  1.00 0.00 ? 15  LYS A HZ2  5  
ATOM 7105  H HZ3  . LYS A 1 15  ? -0.738  -1.987  19.315  1.00 0.00 ? 15  LYS A HZ3  5  
ATOM 7106  N N    . ARG A 1 16  ? 4.027   1.366   16.062  1.00 0.00 ? 16  ARG A N    5  
ATOM 7107  C CA   . ARG A 1 16  ? 5.133   2.192   15.610  1.00 0.00 ? 16  ARG A CA   5  
ATOM 7108  C C    . ARG A 1 16  ? 6.396   1.877   16.413  1.00 0.00 ? 16  ARG A C    5  
ATOM 7109  O O    . ARG A 1 16  ? 6.452   2.138   17.614  1.00 0.00 ? 16  ARG A O    5  
ATOM 7110  C CB   . ARG A 1 16  ? 4.803   3.680   15.752  1.00 0.00 ? 16  ARG A CB   5  
ATOM 7111  C CG   . ARG A 1 16  ? 5.984   4.547   15.313  1.00 0.00 ? 16  ARG A CG   5  
ATOM 7112  C CD   . ARG A 1 16  ? 5.523   5.675   14.389  1.00 0.00 ? 16  ARG A CD   5  
ATOM 7113  N NE   . ARG A 1 16  ? 6.653   6.586   14.098  1.00 0.00 ? 16  ARG A NE   5  
ATOM 7114  C CZ   . ARG A 1 16  ? 7.181   7.435   14.990  1.00 0.00 ? 16  ARG A CZ   5  
ATOM 7115  N NH1  . ARG A 1 16  ? 6.686   7.497   16.232  1.00 0.00 ? 16  ARG A NH1  5  
ATOM 7116  N NH2  . ARG A 1 16  ? 8.206   8.225   14.636  1.00 0.00 ? 16  ARG A NH2  5  
ATOM 7117  H H    . ARG A 1 16  ? 3.167   1.852   16.205  1.00 0.00 ? 16  ARG A H    5  
ATOM 7118  H HA   . ARG A 1 16  ? 5.262   1.934   14.559  1.00 0.00 ? 16  ARG A HA   5  
ATOM 7119  H HB3  . ARG A 1 16  ? 4.550   3.902   16.789  1.00 0.00 ? 16  ARG A HB3  5  
ATOM 7120  H HG3  . ARG A 1 16  ? 6.723   3.931   14.801  1.00 0.00 ? 16  ARG A HG3  5  
ATOM 7121  H HD3  . ARG A 1 16  ? 4.710   6.230   14.856  1.00 0.00 ? 16  ARG A HD3  5  
ATOM 7122  H HE   . ARG A 1 16  ? 7.046   6.566   13.179  1.00 0.00 ? 16  ARG A HE   5  
ATOM 7123  H HH11 . ARG A 1 16  ? 5.923   6.908   16.495  1.00 0.00 ? 16  ARG A HH11 5  
ATOM 7124  H HH12 . ARG A 1 16  ? 7.082   8.131   16.897  1.00 0.00 ? 16  ARG A HH12 5  
ATOM 7125  H HH21 . ARG A 1 16  ? 8.576   8.179   13.708  1.00 0.00 ? 16  ARG A HH21 5  
ATOM 7126  H HH22 . ARG A 1 16  ? 8.601   8.858   15.300  1.00 0.00 ? 16  ARG A HH22 5  
ATOM 7127  N N    . THR A 1 17  ? 7.377   1.320   15.719  1.00 0.00 ? 17  THR A N    5  
ATOM 7128  C CA   . THR A 1 17  ? 8.636   0.966   16.353  1.00 0.00 ? 17  THR A CA   5  
ATOM 7129  C C    . THR A 1 17  ? 9.805   1.224   15.402  1.00 0.00 ? 17  THR A C    5  
ATOM 7130  O O    . THR A 1 17  ? 9.871   0.640   14.321  1.00 0.00 ? 17  THR A O    5  
ATOM 7131  C CB   . THR A 1 17  ? 8.539   -0.489  16.816  1.00 0.00 ? 17  THR A CB   5  
ATOM 7132  O OG1  . THR A 1 17  ? 9.592   -0.621  17.768  1.00 0.00 ? 17  THR A OG1  5  
ATOM 7133  C CG2  . THR A 1 17  ? 8.909   -1.480  15.711  1.00 0.00 ? 17  THR A CG2  5  
ATOM 7134  H H    . THR A 1 17  ? 7.323   1.111   14.744  1.00 0.00 ? 17  THR A H    5  
ATOM 7135  H HA   . THR A 1 17  ? 8.778   1.615   17.218  1.00 0.00 ? 17  THR A HA   5  
ATOM 7136  H HB   . THR A 1 17  ? 7.550   -0.705  17.218  1.00 0.00 ? 17  THR A HB   5  
ATOM 7137  H HG1  . THR A 1 17  ? 10.478  -0.551  17.309  1.00 0.00 ? 17  THR A HG1  5  
ATOM 7138  H HG21 . THR A 1 17  ? 8.518   -2.467  15.962  1.00 0.00 ? 17  THR A HG21 5  
ATOM 7139  H HG22 . THR A 1 17  ? 8.477   -1.149  14.766  1.00 0.00 ? 17  THR A HG22 5  
ATOM 7140  H HG23 . THR A 1 17  ? 9.993   -1.531  15.616  1.00 0.00 ? 17  THR A HG23 5  
ATOM 7141  N N    . SER A 1 18  ? 10.698  2.101   15.836  1.00 0.00 ? 18  SER A N    5  
ATOM 7142  C CA   . SER A 1 18  ? 11.861  2.444   15.036  1.00 0.00 ? 18  SER A CA   5  
ATOM 7143  C C    . SER A 1 18  ? 11.422  3.150   13.750  1.00 0.00 ? 18  SER A C    5  
ATOM 7144  O O    . SER A 1 18  ? 10.228  3.328   13.513  1.00 0.00 ? 18  SER A O    5  
ATOM 7145  C CB   . SER A 1 18  ? 12.687  1.200   14.703  1.00 0.00 ? 18  SER A CB   5  
ATOM 7146  O OG   . SER A 1 18  ? 13.084  0.495   15.876  1.00 0.00 ? 18  SER A OG   5  
ATOM 7147  H H    . SER A 1 18  ? 10.636  2.573   16.716  1.00 0.00 ? 18  SER A H    5  
ATOM 7148  H HA   . SER A 1 18  ? 12.451  3.117   15.658  1.00 0.00 ? 18  SER A HA   5  
ATOM 7149  H HB3  . SER A 1 18  ? 13.573  1.495   14.140  1.00 0.00 ? 18  SER A HB3  5  
ATOM 7150  H HG   . SER A 1 18  ? 12.968  -0.489  15.738  1.00 0.00 ? 18  SER A HG   5  
ATOM 7151  N N    . GLN A 1 19  ? 12.410  3.532   12.956  1.00 0.00 ? 19  GLN A N    5  
ATOM 7152  C CA   . GLN A 1 19  ? 12.141  4.213   11.701  1.00 0.00 ? 19  GLN A CA   5  
ATOM 7153  C C    . GLN A 1 19  ? 10.990  3.527   10.961  1.00 0.00 ? 19  GLN A C    5  
ATOM 7154  O O    . GLN A 1 19  ? 11.110  2.373   10.555  1.00 0.00 ? 19  GLN A O    5  
ATOM 7155  C CB   . GLN A 1 19  ? 13.396  4.270   10.828  1.00 0.00 ? 19  GLN A CB   5  
ATOM 7156  C CG   . GLN A 1 19  ? 13.464  5.587   10.051  1.00 0.00 ? 19  GLN A CG   5  
ATOM 7157  C CD   . GLN A 1 19  ? 14.834  5.767   9.395   1.00 0.00 ? 19  GLN A CD   5  
ATOM 7158  O OE1  . GLN A 1 19  ? 15.588  4.827   9.204   1.00 0.00 ? 19  GLN A OE1  5  
ATOM 7159  N NE2  . GLN A 1 19  ? 15.114  7.023   9.062   1.00 0.00 ? 19  GLN A NE2  5  
ATOM 7160  H H    . GLN A 1 19  ? 13.379  3.382   13.157  1.00 0.00 ? 19  GLN A H    5  
ATOM 7161  H HA   . GLN A 1 19  ? 11.852  5.226   11.977  1.00 0.00 ? 19  GLN A HA   5  
ATOM 7162  H HB3  . GLN A 1 19  ? 13.399  3.432   10.132  1.00 0.00 ? 19  GLN A HB3  5  
ATOM 7163  H HG3  . GLN A 1 19  ? 13.267  6.422   10.724  1.00 0.00 ? 19  GLN A HG3  5  
ATOM 7164  H HE21 . GLN A 1 19  ? 14.452  7.749   9.247   1.00 0.00 ? 19  GLN A HE21 5  
ATOM 7165  H HE22 . GLN A 1 19  ? 15.987  7.243   8.626   1.00 0.00 ? 19  GLN A HE22 5  
ATOM 7166  N N    . GLY A 1 20  ? 9.902   4.269   10.809  1.00 0.00 ? 20  GLY A N    5  
ATOM 7167  C CA   . GLY A 1 20  ? 8.731   3.746   10.125  1.00 0.00 ? 20  GLY A CA   5  
ATOM 7168  C C    . GLY A 1 20  ? 8.343   2.371   10.673  1.00 0.00 ? 20  GLY A C    5  
ATOM 7169  O O    . GLY A 1 20  ? 8.974   1.870   11.603  1.00 0.00 ? 20  GLY A O    5  
ATOM 7170  H H    . GLY A 1 20  ? 9.814   5.206   11.143  1.00 0.00 ? 20  GLY A H    5  
ATOM 7171  H HA2  . GLY A 1 20  ? 7.898   4.439   10.245  1.00 0.00 ? 20  GLY A HA2  5  
ATOM 7172  H HA3  . GLY A 1 20  ? 8.932   3.672   9.057   1.00 0.00 ? 20  GLY A HA3  5  
ATOM 7173  N N    . PHE A 1 21  ? 7.308   1.802   10.075  1.00 0.00 ? 21  PHE A N    5  
ATOM 7174  C CA   . PHE A 1 21  ? 6.828   0.496   10.492  1.00 0.00 ? 21  PHE A CA   5  
ATOM 7175  C C    . PHE A 1 21  ? 7.749   -0.616  9.982   1.00 0.00 ? 21  PHE A C    5  
ATOM 7176  O O    . PHE A 1 21  ? 8.799   -0.340  9.403   1.00 0.00 ? 21  PHE A O    5  
ATOM 7177  C CB   . PHE A 1 21  ? 5.439   0.311   9.878   1.00 0.00 ? 21  PHE A CB   5  
ATOM 7178  C CG   . PHE A 1 21  ? 4.338   1.108   10.580  1.00 0.00 ? 21  PHE A CG   5  
ATOM 7179  C CD1  . PHE A 1 21  ? 3.954   0.772   11.840  1.00 0.00 ? 21  PHE A CD1  5  
ATOM 7180  C CD2  . PHE A 1 21  ? 3.743   2.153   9.944   1.00 0.00 ? 21  PHE A CD2  5  
ATOM 7181  C CE1  . PHE A 1 21  ? 2.932   1.512   12.493  1.00 0.00 ? 21  PHE A CE1  5  
ATOM 7182  C CE2  . PHE A 1 21  ? 2.721   2.892   10.598  1.00 0.00 ? 21  PHE A CE2  5  
ATOM 7183  C CZ   . PHE A 1 21  ? 2.338   2.556   11.858  1.00 0.00 ? 21  PHE A CZ   5  
ATOM 7184  H H    . PHE A 1 21  ? 6.801   2.217   9.319   1.00 0.00 ? 21  PHE A H    5  
ATOM 7185  H HA   . PHE A 1 21  ? 6.820   0.487   11.582  1.00 0.00 ? 21  PHE A HA   5  
ATOM 7186  H HB3  . PHE A 1 21  ? 5.179   -0.746  9.903   1.00 0.00 ? 21  PHE A HB3  5  
ATOM 7187  H HD1  . PHE A 1 21  ? 4.431   -0.065  12.351  1.00 0.00 ? 21  PHE A HD1  5  
ATOM 7188  H HD2  . PHE A 1 21  ? 4.051   2.423   8.934   1.00 0.00 ? 21  PHE A HD2  5  
ATOM 7189  H HE1  . PHE A 1 21  ? 2.624   1.242   13.503  1.00 0.00 ? 21  PHE A HE1  5  
ATOM 7190  H HE2  . PHE A 1 21  ? 2.244   3.729   10.088  1.00 0.00 ? 21  PHE A HE2  5  
ATOM 7191  H HZ   . PHE A 1 21  ? 1.553   3.124   12.358  1.00 0.00 ? 21  PHE A HZ   5  
ATOM 7192  N N    . GLY A 1 22  ? 7.322   -1.849  10.216  1.00 0.00 ? 22  GLY A N    5  
ATOM 7193  C CA   . GLY A 1 22  ? 8.096   -3.000  9.788   1.00 0.00 ? 22  GLY A CA   5  
ATOM 7194  C C    . GLY A 1 22  ? 7.910   -3.259  8.291   1.00 0.00 ? 22  GLY A C    5  
ATOM 7195  O O    . GLY A 1 22  ? 8.714   -2.810  7.476   1.00 0.00 ? 22  GLY A O    5  
ATOM 7196  H H    . GLY A 1 22  ? 6.468   -2.064  10.688  1.00 0.00 ? 22  GLY A H    5  
ATOM 7197  H HA2  . GLY A 1 22  ? 9.151   -2.836  10.004  1.00 0.00 ? 22  GLY A HA2  5  
ATOM 7198  H HA3  . GLY A 1 22  ? 7.787   -3.880  10.353  1.00 0.00 ? 22  GLY A HA3  5  
ATOM 7199  N N    . PHE A 1 23  ? 6.847   -3.984  7.975   1.00 0.00 ? 23  PHE A N    5  
ATOM 7200  C CA   . PHE A 1 23  ? 6.546   -4.308  6.591   1.00 0.00 ? 23  PHE A CA   5  
ATOM 7201  C C    . PHE A 1 23  ? 6.668   -3.070  5.699   1.00 0.00 ? 23  PHE A C    5  
ATOM 7202  O O    . PHE A 1 23  ? 6.795   -1.953  6.196   1.00 0.00 ? 23  PHE A O    5  
ATOM 7203  C CB   . PHE A 1 23  ? 5.101   -4.809  6.552   1.00 0.00 ? 23  PHE A CB   5  
ATOM 7204  C CG   . PHE A 1 23  ? 4.055   -3.692  6.528   1.00 0.00 ? 23  PHE A CG   5  
ATOM 7205  C CD1  . PHE A 1 23  ? 3.886   -2.895  7.617   1.00 0.00 ? 23  PHE A CD1  5  
ATOM 7206  C CD2  . PHE A 1 23  ? 3.295   -3.495  5.418   1.00 0.00 ? 23  PHE A CD2  5  
ATOM 7207  C CE1  . PHE A 1 23  ? 2.916   -1.858  7.595   1.00 0.00 ? 23  PHE A CE1  5  
ATOM 7208  C CE2  . PHE A 1 23  ? 2.326   -2.459  5.394   1.00 0.00 ? 23  PHE A CE2  5  
ATOM 7209  C CZ   . PHE A 1 23  ? 2.156   -1.662  6.484   1.00 0.00 ? 23  PHE A CZ   5  
ATOM 7210  H H    . PHE A 1 23  ? 6.198   -4.346  8.644   1.00 0.00 ? 23  PHE A H    5  
ATOM 7211  H HA   . PHE A 1 23  ? 7.268   -5.058  6.271   1.00 0.00 ? 23  PHE A HA   5  
ATOM 7212  H HB3  . PHE A 1 23  ? 4.922   -5.440  7.424   1.00 0.00 ? 23  PHE A HB3  5  
ATOM 7213  H HD1  . PHE A 1 23  ? 4.494   -3.052  8.508   1.00 0.00 ? 23  PHE A HD1  5  
ATOM 7214  H HD2  . PHE A 1 23  ? 3.432   -4.134  4.545   1.00 0.00 ? 23  PHE A HD2  5  
ATOM 7215  H HE1  . PHE A 1 23  ? 2.780   -1.221  8.468   1.00 0.00 ? 23  PHE A HE1  5  
ATOM 7216  H HE2  . PHE A 1 23  ? 1.717   -2.302  4.505   1.00 0.00 ? 23  PHE A HE2  5  
ATOM 7217  H HZ   . PHE A 1 23  ? 1.411   -0.866  6.466   1.00 0.00 ? 23  PHE A HZ   5  
ATOM 7218  N N    . THR A 1 24  ? 6.627   -3.313  4.397   1.00 0.00 ? 24  THR A N    5  
ATOM 7219  C CA   . THR A 1 24  ? 6.731   -2.233  3.431   1.00 0.00 ? 24  THR A CA   5  
ATOM 7220  C C    . THR A 1 24  ? 6.094   -2.643  2.102   1.00 0.00 ? 24  THR A C    5  
ATOM 7221  O O    . THR A 1 24  ? 5.987   -3.830  1.801   1.00 0.00 ? 24  THR A O    5  
ATOM 7222  C CB   . THR A 1 24  ? 8.208   -1.852  3.306   1.00 0.00 ? 24  THR A CB   5  
ATOM 7223  O OG1  . THR A 1 24  ? 8.217   -0.821  2.322   1.00 0.00 ? 24  THR A OG1  5  
ATOM 7224  C CG2  . THR A 1 24  ? 9.049   -2.968  2.686   1.00 0.00 ? 24  THR A CG2  5  
ATOM 7225  H H    . THR A 1 24  ? 6.523   -4.226  4.001   1.00 0.00 ? 24  THR A H    5  
ATOM 7226  H HA   . THR A 1 24  ? 6.166   -1.380  3.808   1.00 0.00 ? 24  THR A HA   5  
ATOM 7227  H HB   . THR A 1 24  ? 8.614   -1.547  4.270   1.00 0.00 ? 24  THR A HB   5  
ATOM 7228  H HG1  . THR A 1 24  ? 9.157   -0.535  2.137   1.00 0.00 ? 24  THR A HG1  5  
ATOM 7229  H HG21 . THR A 1 24  ? 8.658   -3.213  1.698   1.00 0.00 ? 24  THR A HG21 5  
ATOM 7230  H HG22 . THR A 1 24  ? 10.083  -2.636  2.594   1.00 0.00 ? 24  THR A HG22 5  
ATOM 7231  H HG23 . THR A 1 24  ? 9.007   -3.853  3.322   1.00 0.00 ? 24  THR A HG23 5  
ATOM 7232  N N    . LEU A 1 25  ? 5.689   -1.635  1.342   1.00 0.00 ? 25  LEU A N    5  
ATOM 7233  C CA   . LEU A 1 25  ? 5.065   -1.876  0.051   1.00 0.00 ? 25  LEU A CA   5  
ATOM 7234  C C    . LEU A 1 25  ? 6.025   -1.453  -1.061  1.00 0.00 ? 25  LEU A C    5  
ATOM 7235  O O    . LEU A 1 25  ? 7.043   -0.815  -0.797  1.00 0.00 ? 25  LEU A O    5  
ATOM 7236  C CB   . LEU A 1 25  ? 3.699   -1.189  -0.020  1.00 0.00 ? 25  LEU A CB   5  
ATOM 7237  C CG   . LEU A 1 25  ? 2.876   -1.196  1.271   1.00 0.00 ? 25  LEU A CG   5  
ATOM 7238  C CD1  . LEU A 1 25  ? 2.809   -2.601  1.869   1.00 0.00 ? 25  LEU A CD1  5  
ATOM 7239  C CD2  . LEU A 1 25  ? 3.417   -0.172  2.270   1.00 0.00 ? 25  LEU A CD2  5  
ATOM 7240  H H    . LEU A 1 25  ? 5.779   -0.673  1.595   1.00 0.00 ? 25  LEU A H    5  
ATOM 7241  H HA   . LEU A 1 25  ? 4.890   -2.948  -0.032  1.00 0.00 ? 25  LEU A HA   5  
ATOM 7242  H HB3  . LEU A 1 25  ? 3.114   -1.670  -0.803  1.00 0.00 ? 25  LEU A HB3  5  
ATOM 7243  H HG   . LEU A 1 25  ? 1.855   -0.900  1.026   1.00 0.00 ? 25  LEU A HG   5  
ATOM 7244  H HD11 . LEU A 1 25  ? 3.497   -2.671  2.712   1.00 0.00 ? 25  LEU A HD11 5  
ATOM 7245  H HD12 . LEU A 1 25  ? 1.793   -2.801  2.213   1.00 0.00 ? 25  LEU A HD12 5  
ATOM 7246  H HD13 . LEU A 1 25  ? 3.085   -3.334  1.111   1.00 0.00 ? 25  LEU A HD13 5  
ATOM 7247  H HD21 . LEU A 1 25  ? 3.899   -0.692  3.098   1.00 0.00 ? 25  LEU A HD21 5  
ATOM 7248  H HD22 . LEU A 1 25  ? 4.141   0.474   1.774   1.00 0.00 ? 25  LEU A HD22 5  
ATOM 7249  H HD23 . LEU A 1 25  ? 2.594   0.433   2.651   1.00 0.00 ? 25  LEU A HD23 5  
ATOM 7250  N N    . ARG A 1 26  ? 5.667   -1.824  -2.282  1.00 0.00 ? 26  ARG A N    5  
ATOM 7251  C CA   . ARG A 1 26  ? 6.485   -1.490  -3.436  1.00 0.00 ? 26  ARG A CA   5  
ATOM 7252  C C    . ARG A 1 26  ? 5.631   -1.480  -4.705  1.00 0.00 ? 26  ARG A C    5  
ATOM 7253  O O    . ARG A 1 26  ? 4.447   -1.807  -4.663  1.00 0.00 ? 26  ARG A O    5  
ATOM 7254  C CB   . ARG A 1 26  ? 7.630   -2.490  -3.605  1.00 0.00 ? 26  ARG A CB   5  
ATOM 7255  C CG   . ARG A 1 26  ? 8.969   -1.767  -3.762  1.00 0.00 ? 26  ARG A CG   5  
ATOM 7256  C CD   . ARG A 1 26  ? 9.689   -2.216  -5.037  1.00 0.00 ? 26  ARG A CD   5  
ATOM 7257  N NE   . ARG A 1 26  ? 11.151  -2.242  -4.810  1.00 0.00 ? 26  ARG A NE   5  
ATOM 7258  C CZ   . ARG A 1 26  ? 12.017  -2.920  -5.574  1.00 0.00 ? 26  ARG A CZ   5  
ATOM 7259  N NH1  . ARG A 1 26  ? 11.575  -3.631  -6.621  1.00 0.00 ? 26  ARG A NH1  5  
ATOM 7260  N NH2  . ARG A 1 26  ? 13.327  -2.887  -5.294  1.00 0.00 ? 26  ARG A NH2  5  
ATOM 7261  H H    . ARG A 1 26  ? 4.837   -2.341  -2.486  1.00 0.00 ? 26  ARG A H    5  
ATOM 7262  H HA   . ARG A 1 26  ? 6.879   -0.497  -3.220  1.00 0.00 ? 26  ARG A HA   5  
ATOM 7263  H HB3  . ARG A 1 26  ? 7.446   -3.115  -4.479  1.00 0.00 ? 26  ARG A HB3  5  
ATOM 7264  H HG3  . ARG A 1 26  ? 9.600   -1.968  -2.895  1.00 0.00 ? 26  ARG A HG3  5  
ATOM 7265  H HD3  . ARG A 1 26  ? 9.451   -1.537  -5.856  1.00 0.00 ? 26  ARG A HD3  5  
ATOM 7266  H HE   . ARG A 1 26  ? 11.515  -1.721  -4.038  1.00 0.00 ? 26  ARG A HE   5  
ATOM 7267  H HH11 . ARG A 1 26  ? 10.597  -3.657  -6.829  1.00 0.00 ? 26  ARG A HH11 5  
ATOM 7268  H HH12 . ARG A 1 26  ? 12.221  -4.138  -7.190  1.00 0.00 ? 26  ARG A HH12 5  
ATOM 7269  H HH21 . ARG A 1 26  ? 13.658  -2.356  -4.514  1.00 0.00 ? 26  ARG A HH21 5  
ATOM 7270  H HH22 . ARG A 1 26  ? 13.974  -3.393  -5.865  1.00 0.00 ? 26  ARG A HH22 5  
ATOM 7271  N N    . HIS A 1 27  ? 6.268   -1.104  -5.804  1.00 0.00 ? 27  HIS A N    5  
ATOM 7272  C CA   . HIS A 1 27  ? 5.583   -1.048  -7.084  1.00 0.00 ? 27  HIS A CA   5  
ATOM 7273  C C    . HIS A 1 27  ? 4.510   0.043   -7.045  1.00 0.00 ? 27  HIS A C    5  
ATOM 7274  O O    . HIS A 1 27  ? 3.539   -0.064  -6.299  1.00 0.00 ? 27  HIS A O    5  
ATOM 7275  C CB   . HIS A 1 27  ? 5.020   -2.420  -7.459  1.00 0.00 ? 27  HIS A CB   5  
ATOM 7276  C CG   . HIS A 1 27  ? 6.049   -3.377  -8.009  1.00 0.00 ? 27  HIS A CG   5  
ATOM 7277  N ND1  . HIS A 1 27  ? 6.293   -3.519  -9.365  1.00 0.00 ? 27  HIS A ND1  5  
ATOM 7278  C CD2  . HIS A 1 27  ? 6.896   -4.238  -7.374  1.00 0.00 ? 27  HIS A CD2  5  
ATOM 7279  C CE1  . HIS A 1 27  ? 7.245   -4.427  -9.526  1.00 0.00 ? 27  HIS A CE1  5  
ATOM 7280  N NE2  . HIS A 1 27  ? 7.616   -4.872  -8.292  1.00 0.00 ? 27  HIS A NE2  5  
ATOM 7281  H H    . HIS A 1 27  ? 7.233   -0.840  -5.829  1.00 0.00 ? 27  HIS A H    5  
ATOM 7282  H HA   . HIS A 1 27  ? 6.333   -0.782  -7.829  1.00 0.00 ? 27  HIS A HA   5  
ATOM 7283  H HB3  . HIS A 1 27  ? 4.230   -2.287  -8.199  1.00 0.00 ? 27  HIS A HB3  5  
ATOM 7284  H HD1  . HIS A 1 27  ? 5.830   -3.021  -10.097 1.00 0.00 ? 27  HIS A HD1  5  
ATOM 7285  H HD2  . HIS A 1 27  ? 6.968   -4.381  -6.295  1.00 0.00 ? 27  HIS A HD2  5  
ATOM 7286  H HE1  . HIS A 1 27  ? 7.658   -4.760  -10.478 1.00 0.00 ? 27  HIS A HE1  5  
ATOM 7287  N N    . PHE A 1 28  ? 4.724   1.067   -7.857  1.00 0.00 ? 28  PHE A N    5  
ATOM 7288  C CA   . PHE A 1 28  ? 3.787   2.176   -7.926  1.00 0.00 ? 28  PHE A CA   5  
ATOM 7289  C C    . PHE A 1 28  ? 3.888   2.897   -9.271  1.00 0.00 ? 28  PHE A C    5  
ATOM 7290  O O    . PHE A 1 28  ? 4.904   2.800   -9.957  1.00 0.00 ? 28  PHE A O    5  
ATOM 7291  C CB   . PHE A 1 28  ? 4.167   3.150   -6.808  1.00 0.00 ? 28  PHE A CB   5  
ATOM 7292  C CG   . PHE A 1 28  ? 5.440   3.951   -7.087  1.00 0.00 ? 28  PHE A CG   5  
ATOM 7293  C CD1  . PHE A 1 28  ? 6.648   3.463   -6.698  1.00 0.00 ? 28  PHE A CD1  5  
ATOM 7294  C CD2  . PHE A 1 28  ? 5.362   5.151   -7.725  1.00 0.00 ? 28  PHE A CD2  5  
ATOM 7295  C CE1  . PHE A 1 28  ? 7.831   4.208   -6.958  1.00 0.00 ? 28  PHE A CE1  5  
ATOM 7296  C CE2  . PHE A 1 28  ? 6.545   5.894   -7.983  1.00 0.00 ? 28  PHE A CE2  5  
ATOM 7297  C CZ   . PHE A 1 28  ? 7.753   5.406   -7.594  1.00 0.00 ? 28  PHE A CZ   5  
ATOM 7298  H H    . PHE A 1 28  ? 5.516   1.146   -8.462  1.00 0.00 ? 28  PHE A H    5  
ATOM 7299  H HA   . PHE A 1 28  ? 2.785   1.760   -7.811  1.00 0.00 ? 28  PHE A HA   5  
ATOM 7300  H HB3  . PHE A 1 28  ? 4.296   2.592   -5.882  1.00 0.00 ? 28  PHE A HB3  5  
ATOM 7301  H HD1  . PHE A 1 28  ? 6.710   2.503   -6.188  1.00 0.00 ? 28  PHE A HD1  5  
ATOM 7302  H HD2  . PHE A 1 28  ? 4.395   5.541   -8.036  1.00 0.00 ? 28  PHE A HD2  5  
ATOM 7303  H HE1  . PHE A 1 28  ? 8.799   3.817   -6.646  1.00 0.00 ? 28  PHE A HE1  5  
ATOM 7304  H HE2  . PHE A 1 28  ? 6.483   6.855   -8.493  1.00 0.00 ? 28  PHE A HE2  5  
ATOM 7305  H HZ   . PHE A 1 28  ? 8.661   5.977   -7.793  1.00 0.00 ? 28  PHE A HZ   5  
ATOM 7306  N N    . ILE A 1 29  ? 2.819   3.604   -9.609  1.00 0.00 ? 29  ILE A N    5  
ATOM 7307  C CA   . ILE A 1 29  ? 2.774   4.341   -10.859 1.00 0.00 ? 29  ILE A CA   5  
ATOM 7308  C C    . ILE A 1 29  ? 2.476   5.814   -10.569 1.00 0.00 ? 29  ILE A C    5  
ATOM 7309  O O    . ILE A 1 29  ? 3.214   6.697   -11.003 1.00 0.00 ? 29  ILE A O    5  
ATOM 7310  C CB   . ILE A 1 29  ? 1.783   3.693   -11.828 1.00 0.00 ? 29  ILE A CB   5  
ATOM 7311  C CG1  . ILE A 1 29  ? 2.283   2.324   -12.291 1.00 0.00 ? 29  ILE A CG1  5  
ATOM 7312  C CG2  . ILE A 1 29  ? 1.479   4.622   -13.006 1.00 0.00 ? 29  ILE A CG2  5  
ATOM 7313  C CD1  . ILE A 1 29  ? 1.226   1.608   -13.133 1.00 0.00 ? 29  ILE A CD1  5  
ATOM 7314  H H    . ILE A 1 29  ? 1.996   3.678   -9.046  1.00 0.00 ? 29  ILE A H    5  
ATOM 7315  H HA   . ILE A 1 29  ? 3.762   4.272   -11.316 1.00 0.00 ? 29  ILE A HA   5  
ATOM 7316  H HB   . ILE A 1 29  ? 0.845   3.529   -11.297 1.00 0.00 ? 29  ILE A HB   5  
ATOM 7317  H HG13 . ILE A 1 29  ? 2.540   1.714   -11.426 1.00 0.00 ? 29  ILE A HG13 5  
ATOM 7318  H HG21 . ILE A 1 29  ? 0.427   4.905   -12.983 1.00 0.00 ? 29  ILE A HG21 5  
ATOM 7319  H HG22 . ILE A 1 29  ? 2.098   5.516   -12.931 1.00 0.00 ? 29  ILE A HG22 5  
ATOM 7320  H HG23 . ILE A 1 29  ? 1.698   4.106   -13.940 1.00 0.00 ? 29  ILE A HG23 5  
ATOM 7321  H HD11 . ILE A 1 29  ? 1.714   0.929   -13.831 1.00 0.00 ? 29  ILE A HD11 5  
ATOM 7322  H HD12 . ILE A 1 29  ? 0.563   1.042   -12.478 1.00 0.00 ? 29  ILE A HD12 5  
ATOM 7323  H HD13 . ILE A 1 29  ? 0.646   2.345   -13.689 1.00 0.00 ? 29  ILE A HD13 5  
ATOM 7324  N N    . VAL A 1 30  ? 1.393   6.032   -9.836  1.00 0.00 ? 30  VAL A N    5  
ATOM 7325  C CA   . VAL A 1 30  ? 0.990   7.382   -9.482  1.00 0.00 ? 30  VAL A CA   5  
ATOM 7326  C C    . VAL A 1 30  ? 0.865   8.222   -10.753 1.00 0.00 ? 30  VAL A C    5  
ATOM 7327  O O    . VAL A 1 30  ? 1.248   7.778   -11.835 1.00 0.00 ? 30  VAL A O    5  
ATOM 7328  C CB   . VAL A 1 30  ? 1.972   7.974   -8.470  1.00 0.00 ? 30  VAL A CB   5  
ATOM 7329  C CG1  . VAL A 1 30  ? 1.438   9.285   -7.890  1.00 0.00 ? 30  VAL A CG1  5  
ATOM 7330  C CG2  . VAL A 1 30  ? 2.284   6.970   -7.357  1.00 0.00 ? 30  VAL A CG2  5  
ATOM 7331  H H    . VAL A 1 30  ? 0.800   5.308   -9.487  1.00 0.00 ? 30  VAL A H    5  
ATOM 7332  H HA   . VAL A 1 30  ? 0.012   7.318   -9.006  1.00 0.00 ? 30  VAL A HA   5  
ATOM 7333  H HB   . VAL A 1 30  ? 2.903   8.192   -8.992  1.00 0.00 ? 30  VAL A HB   5  
ATOM 7334  H HG11 . VAL A 1 30  ? 1.748   10.115  -8.525  1.00 0.00 ? 30  VAL A HG11 5  
ATOM 7335  H HG12 . VAL A 1 30  ? 0.350   9.247   -7.846  1.00 0.00 ? 30  VAL A HG12 5  
ATOM 7336  H HG13 . VAL A 1 30  ? 1.838   9.428   -6.884  1.00 0.00 ? 30  VAL A HG13 5  
ATOM 7337  H HG21 . VAL A 1 30  ? 2.384   5.972   -7.785  1.00 0.00 ? 30  VAL A HG21 5  
ATOM 7338  H HG22 . VAL A 1 30  ? 3.216   7.249   -6.867  1.00 0.00 ? 30  VAL A HG22 5  
ATOM 7339  H HG23 . VAL A 1 30  ? 1.475   6.973   -6.627  1.00 0.00 ? 30  VAL A HG23 5  
ATOM 7340  N N    . TYR A 1 31  ? 0.327   9.421   -10.583 1.00 0.00 ? 31  TYR A N    5  
ATOM 7341  C CA   . TYR A 1 31  ? 0.146   10.327  -11.703 1.00 0.00 ? 31  TYR A CA   5  
ATOM 7342  C C    . TYR A 1 31  ? 0.554   11.753  -11.327 1.00 0.00 ? 31  TYR A C    5  
ATOM 7343  O O    . TYR A 1 31  ? -0.270  12.667  -11.352 1.00 0.00 ? 31  TYR A O    5  
ATOM 7344  C CB   . TYR A 1 31  ? -1.349  10.305  -12.027 1.00 0.00 ? 31  TYR A CB   5  
ATOM 7345  C CG   . TYR A 1 31  ? -1.770  9.165   -12.956 1.00 0.00 ? 31  TYR A CG   5  
ATOM 7346  C CD1  . TYR A 1 31  ? -1.694  7.858   -12.520 1.00 0.00 ? 31  TYR A CD1  5  
ATOM 7347  C CD2  . TYR A 1 31  ? -2.223  9.444   -14.228 1.00 0.00 ? 31  TYR A CD2  5  
ATOM 7348  C CE1  . TYR A 1 31  ? -2.090  6.784   -13.394 1.00 0.00 ? 31  TYR A CE1  5  
ATOM 7349  C CE2  . TYR A 1 31  ? -2.618  8.369   -15.102 1.00 0.00 ? 31  TYR A CE2  5  
ATOM 7350  C CZ   . TYR A 1 31  ? -2.532  7.092   -14.642 1.00 0.00 ? 31  TYR A CZ   5  
ATOM 7351  O OH   . TYR A 1 31  ? -2.906  6.078   -15.467 1.00 0.00 ? 31  TYR A OH   5  
ATOM 7352  H H    . TYR A 1 31  ? 0.017   9.775   -9.699  1.00 0.00 ? 31  TYR A H    5  
ATOM 7353  H HA   . TYR A 1 31  ? 0.778   9.980   -12.522 1.00 0.00 ? 31  TYR A HA   5  
ATOM 7354  H HB3  . TYR A 1 31  ? -1.625  11.255  -12.487 1.00 0.00 ? 31  TYR A HB3  5  
ATOM 7355  H HD1  . TYR A 1 31  ? -1.335  7.638   -11.514 1.00 0.00 ? 31  TYR A HD1  5  
ATOM 7356  H HD2  . TYR A 1 31  ? -2.284  10.476  -14.573 1.00 0.00 ? 31  TYR A HD2  5  
ATOM 7357  H HE1  . TYR A 1 31  ? -2.036  5.747   -13.063 1.00 0.00 ? 31  TYR A HE1  5  
ATOM 7358  H HE2  . TYR A 1 31  ? -2.980  8.576   -16.111 1.00 0.00 ? 31  TYR A HE2  5  
ATOM 7359  H HH   . TYR A 1 31  ? -3.896  5.946   -15.421 1.00 0.00 ? 31  TYR A HH   5  
ATOM 7360  N N    . PRO A 1 32  ? 1.861   11.904  -10.979 1.00 0.00 ? 32  PRO A N    5  
ATOM 7361  C CA   . PRO A 1 32  ? 2.389   13.203  -10.598 1.00 0.00 ? 32  PRO A CA   5  
ATOM 7362  C C    . PRO A 1 32  ? 2.576   14.100  -11.824 1.00 0.00 ? 32  PRO A C    5  
ATOM 7363  O O    . PRO A 1 32  ? 2.550   13.621  -12.957 1.00 0.00 ? 32  PRO A O    5  
ATOM 7364  C CB   . PRO A 1 32  ? 3.692   12.902  -9.877  1.00 0.00 ? 32  PRO A CB   5  
ATOM 7365  C CG   . PRO A 1 32  ? 4.078   11.490  -10.287 1.00 0.00 ? 32  PRO A CG   5  
ATOM 7366  C CD   . PRO A 1 32  ? 2.866   10.847  -10.940 1.00 0.00 ? 32  PRO A CD   5  
ATOM 7367  H HA   . PRO A 1 32  ? 1.740   13.681  -10.007 1.00 0.00 ? 32  PRO A HA   5  
ATOM 7368  H HB3  . PRO A 1 32  ? 3.568   12.976  -8.797  1.00 0.00 ? 32  PRO A HB3  5  
ATOM 7369  H HG3  . PRO A 1 32  ? 4.394   10.914  -9.417  1.00 0.00 ? 32  PRO A HG3  5  
ATOM 7370  H HD3  . PRO A 1 32  ? 2.515   9.989   -10.365 1.00 0.00 ? 32  PRO A HD3  5  
ATOM 7371  N N    . PRO A 1 33  ? 2.765   15.418  -11.548 1.00 0.00 ? 33  PRO A N    5  
ATOM 7372  C CA   . PRO A 1 33  ? 2.956   16.387  -12.615 1.00 0.00 ? 33  PRO A CA   5  
ATOM 7373  C C    . PRO A 1 33  ? 4.359   16.274  -13.212 1.00 0.00 ? 33  PRO A C    5  
ATOM 7374  O O    . PRO A 1 33  ? 5.140   15.410  -12.813 1.00 0.00 ? 33  PRO A O    5  
ATOM 7375  C CB   . PRO A 1 33  ? 2.689   17.736  -11.973 1.00 0.00 ? 33  PRO A CB   5  
ATOM 7376  C CG   . PRO A 1 33  ? 2.814   17.519  -10.473 1.00 0.00 ? 33  PRO A CG   5  
ATOM 7377  C CD   . PRO A 1 33  ? 2.800   16.020  -10.219 1.00 0.00 ? 33  PRO A CD   5  
ATOM 7378  H HA   . PRO A 1 33  ? 2.323   16.202  -13.367 1.00 0.00 ? 33  PRO A HA   5  
ATOM 7379  H HB3  . PRO A 1 33  ? 1.695   18.105  -12.231 1.00 0.00 ? 33  PRO A HB3  5  
ATOM 7380  H HG3  . PRO A 1 33  ? 1.992   18.004  -9.947  1.00 0.00 ? 33  PRO A HG3  5  
ATOM 7381  H HD3  . PRO A 1 33  ? 1.933   15.727  -9.627  1.00 0.00 ? 33  PRO A HD3  5  
ATOM 7382  N N    . GLU A 1 34  ? 4.639   17.160  -14.156 1.00 0.00 ? 34  GLU A N    5  
ATOM 7383  C CA   . GLU A 1 34  ? 5.935   17.172  -14.812 1.00 0.00 ? 34  GLU A CA   5  
ATOM 7384  C C    . GLU A 1 34  ? 6.969   17.883  -13.933 1.00 0.00 ? 34  GLU A C    5  
ATOM 7385  O O    . GLU A 1 34  ? 7.968   17.285  -13.538 1.00 0.00 ? 34  GLU A O    5  
ATOM 7386  C CB   . GLU A 1 34  ? 5.847   17.824  -16.191 1.00 0.00 ? 34  GLU A CB   5  
ATOM 7387  C CG   . GLU A 1 34  ? 4.666   17.265  -16.988 1.00 0.00 ? 34  GLU A CG   5  
ATOM 7388  C CD   . GLU A 1 34  ? 5.091   16.053  -17.819 1.00 0.00 ? 34  GLU A CD   5  
ATOM 7389  O OE1  . GLU A 1 34  ? 6.074   16.201  -18.577 1.00 0.00 ? 34  GLU A OE1  5  
ATOM 7390  O OE2  . GLU A 1 34  ? 4.424   15.006  -17.678 1.00 0.00 ? 34  GLU A OE2  5  
ATOM 7391  H H    . GLU A 1 34  ? 3.999   17.859  -14.474 1.00 0.00 ? 34  GLU A H    5  
ATOM 7392  H HA   . GLU A 1 34  ? 6.210   16.123  -14.930 1.00 0.00 ? 34  GLU A HA   5  
ATOM 7393  H HB3  . GLU A 1 34  ? 6.774   17.654  -16.740 1.00 0.00 ? 34  GLU A HB3  5  
ATOM 7394  H HG3  . GLU A 1 34  ? 4.267   18.039  -17.644 1.00 0.00 ? 34  GLU A HG3  5  
ATOM 7395  N N    . SER A 1 35  ? 6.689   19.147  -13.654 1.00 0.00 ? 35  SER A N    5  
ATOM 7396  C CA   . SER A 1 35  ? 7.582   19.946  -12.830 1.00 0.00 ? 35  SER A CA   5  
ATOM 7397  C C    . SER A 1 35  ? 6.847   20.423  -11.576 1.00 0.00 ? 35  SER A C    5  
ATOM 7398  O O    . SER A 1 35  ? 7.250   20.104  -10.458 1.00 0.00 ? 35  SER A O    5  
ATOM 7399  C CB   . SER A 1 35  ? 8.131   21.142  -13.612 1.00 0.00 ? 35  SER A CB   5  
ATOM 7400  O OG   . SER A 1 35  ? 9.015   21.933  -12.824 1.00 0.00 ? 35  SER A OG   5  
ATOM 7401  H H    . SER A 1 35  ? 5.874   19.625  -13.980 1.00 0.00 ? 35  SER A H    5  
ATOM 7402  H HA   . SER A 1 35  ? 8.402   19.279  -12.564 1.00 0.00 ? 35  SER A HA   5  
ATOM 7403  H HB3  . SER A 1 35  ? 7.301   21.759  -13.957 1.00 0.00 ? 35  SER A HB3  5  
ATOM 7404  H HG   . SER A 1 35  ? 8.796   22.903  -12.934 1.00 0.00 ? 35  SER A HG   5  
ATOM 7405  N N    . ALA A 1 36  ? 5.783   21.179  -11.803 1.00 0.00 ? 36  ALA A N    5  
ATOM 7406  C CA   . ALA A 1 36  ? 4.989   21.703  -10.705 1.00 0.00 ? 36  ALA A CA   5  
ATOM 7407  C C    . ALA A 1 36  ? 5.906   22.443  -9.728  1.00 0.00 ? 36  ALA A C    5  
ATOM 7408  O O    . ALA A 1 36  ? 6.473   21.835  -8.821  1.00 0.00 ? 36  ALA A O    5  
ATOM 7409  C CB   . ALA A 1 36  ? 4.225   20.560  -10.035 1.00 0.00 ? 36  ALA A CB   5  
ATOM 7410  H H    . ALA A 1 36  ? 5.463   21.434  -12.715 1.00 0.00 ? 36  ALA A H    5  
ATOM 7411  H HA   . ALA A 1 36  ? 4.272   22.409  -11.121 1.00 0.00 ? 36  ALA A HA   5  
ATOM 7412  H HB1  . ALA A 1 36  ? 3.416   20.233  -10.688 1.00 0.00 ? 36  ALA A HB1  5  
ATOM 7413  H HB2  . ALA A 1 36  ? 4.905   19.727  -9.853  1.00 0.00 ? 36  ALA A HB2  5  
ATOM 7414  H HB3  . ALA A 1 36  ? 3.812   20.904  -9.088  1.00 0.00 ? 36  ALA A HB3  5  
ATOM 7415  N N    . ILE A 1 37  ? 6.020   23.745  -9.944  1.00 0.00 ? 37  ILE A N    5  
ATOM 7416  C CA   . ILE A 1 37  ? 6.858   24.575  -9.094  1.00 0.00 ? 37  ILE A CA   5  
ATOM 7417  C C    . ILE A 1 37  ? 6.183   24.742  -7.731  1.00 0.00 ? 37  ILE A C    5  
ATOM 7418  O O    . ILE A 1 37  ? 5.688   25.821  -7.408  1.00 0.00 ? 37  ILE A O    5  
ATOM 7419  C CB   . ILE A 1 37  ? 7.180   25.900  -9.788  1.00 0.00 ? 37  ILE A CB   5  
ATOM 7420  C CG1  . ILE A 1 37  ? 7.509   25.680  -11.266 1.00 0.00 ? 37  ILE A CG1  5  
ATOM 7421  C CG2  . ILE A 1 37  ? 8.298   26.644  -9.057  1.00 0.00 ? 37  ILE A CG2  5  
ATOM 7422  C CD1  . ILE A 1 37  ? 6.280   25.925  -12.144 1.00 0.00 ? 37  ILE A CD1  5  
ATOM 7423  H H    . ILE A 1 37  ? 5.556   24.233  -10.684 1.00 0.00 ? 37  ILE A H    5  
ATOM 7424  H HA   . ILE A 1 37  ? 7.801   24.048  -8.951  1.00 0.00 ? 37  ILE A HA   5  
ATOM 7425  H HB   . ILE A 1 37  ? 6.292   26.532  -9.747  1.00 0.00 ? 37  ILE A HB   5  
ATOM 7426  H HG13 . ILE A 1 37  ? 7.868   24.661  -11.414 1.00 0.00 ? 37  ILE A HG13 5  
ATOM 7427  H HG21 . ILE A 1 37  ? 9.219   26.578  -9.637  1.00 0.00 ? 37  ILE A HG21 5  
ATOM 7428  H HG22 . ILE A 1 37  ? 8.021   27.691  -8.934  1.00 0.00 ? 37  ILE A HG22 5  
ATOM 7429  H HG23 . ILE A 1 37  ? 8.454   26.193  -8.076  1.00 0.00 ? 37  ILE A HG23 5  
ATOM 7430  H HD11 . ILE A 1 37  ? 6.101   25.053  -12.772 1.00 0.00 ? 37  ILE A HD11 5  
ATOM 7431  H HD12 . ILE A 1 37  ? 5.410   26.102  -11.511 1.00 0.00 ? 37  ILE A HD12 5  
ATOM 7432  H HD13 . ILE A 1 37  ? 6.454   26.797  -12.775 1.00 0.00 ? 37  ILE A HD13 5  
ATOM 7433  N N    . GLN A 1 38  ? 6.187   23.659  -6.968  1.00 0.00 ? 38  GLN A N    5  
ATOM 7434  C CA   . GLN A 1 38  ? 5.582   23.673  -5.647  1.00 0.00 ? 38  GLN A CA   5  
ATOM 7435  C C    . GLN A 1 38  ? 5.772   22.317  -4.962  1.00 0.00 ? 38  GLN A C    5  
ATOM 7436  O O    . GLN A 1 38  ? 4.904   21.450  -5.046  1.00 0.00 ? 38  GLN A O    5  
ATOM 7437  C CB   . GLN A 1 38  ? 4.101   24.046  -5.725  1.00 0.00 ? 38  GLN A CB   5  
ATOM 7438  C CG   . GLN A 1 38  ? 3.537   24.350  -4.335  1.00 0.00 ? 38  GLN A CG   5  
ATOM 7439  C CD   . GLN A 1 38  ? 2.270   23.536  -4.068  1.00 0.00 ? 38  GLN A CD   5  
ATOM 7440  O OE1  . GLN A 1 38  ? 1.209   24.065  -3.782  1.00 0.00 ? 38  GLN A OE1  5  
ATOM 7441  N NE2  . GLN A 1 38  ? 2.440   22.221  -4.174  1.00 0.00 ? 38  GLN A NE2  5  
ATOM 7442  H H    . GLN A 1 38  ? 6.593   22.786  -7.237  1.00 0.00 ? 38  GLN A H    5  
ATOM 7443  H HA   . GLN A 1 38  ? 6.117   24.445  -5.092  1.00 0.00 ? 38  GLN A HA   5  
ATOM 7444  H HB3  . GLN A 1 38  ? 3.541   23.229  -6.179  1.00 0.00 ? 38  GLN A HB3  5  
ATOM 7445  H HG3  . GLN A 1 38  ? 3.314   25.414  -4.255  1.00 0.00 ? 38  GLN A HG3  5  
ATOM 7446  H HE21 . GLN A 1 38  ? 3.338   21.850  -4.411  1.00 0.00 ? 38  GLN A HE21 5  
ATOM 7447  H HE22 . GLN A 1 38  ? 1.670   21.603  -4.018  1.00 0.00 ? 38  GLN A HE22 5  
ATOM 7448  N N    . PHE A 1 39  ? 6.911   22.178  -4.300  1.00 0.00 ? 39  PHE A N    5  
ATOM 7449  C CA   . PHE A 1 39  ? 7.225   20.943  -3.602  1.00 0.00 ? 39  PHE A CA   5  
ATOM 7450  C C    . PHE A 1 39  ? 6.400   20.814  -2.320  1.00 0.00 ? 39  PHE A C    5  
ATOM 7451  O O    . PHE A 1 39  ? 5.607   19.885  -2.179  1.00 0.00 ? 39  PHE A O    5  
ATOM 7452  C CB   . PHE A 1 39  ? 8.710   21.001  -3.237  1.00 0.00 ? 39  PHE A CB   5  
ATOM 7453  C CG   . PHE A 1 39  ? 9.463   19.693  -3.487  1.00 0.00 ? 39  PHE A CG   5  
ATOM 7454  C CD1  . PHE A 1 39  ? 9.207   18.603  -2.715  1.00 0.00 ? 39  PHE A CD1  5  
ATOM 7455  C CD2  . PHE A 1 39  ? 10.388  19.619  -4.481  1.00 0.00 ? 39  PHE A CD2  5  
ATOM 7456  C CE1  . PHE A 1 39  ? 9.906   17.388  -2.945  1.00 0.00 ? 39  PHE A CE1  5  
ATOM 7457  C CE2  . PHE A 1 39  ? 11.087  18.405  -4.712  1.00 0.00 ? 39  PHE A CE2  5  
ATOM 7458  C CZ   . PHE A 1 39  ? 10.832  17.315  -3.939  1.00 0.00 ? 39  PHE A CZ   5  
ATOM 7459  H H    . PHE A 1 39  ? 7.612   22.889  -4.237  1.00 0.00 ? 39  PHE A H    5  
ATOM 7460  H HA   . PHE A 1 39  ? 6.980   20.120  -4.275  1.00 0.00 ? 39  PHE A HA   5  
ATOM 7461  H HB3  . PHE A 1 39  ? 8.803   21.267  -2.185  1.00 0.00 ? 39  PHE A HB3  5  
ATOM 7462  H HD1  . PHE A 1 39  ? 8.465   18.661  -1.918  1.00 0.00 ? 39  PHE A HD1  5  
ATOM 7463  H HD2  . PHE A 1 39  ? 10.593  20.493  -5.100  1.00 0.00 ? 39  PHE A HD2  5  
ATOM 7464  H HE1  . PHE A 1 39  ? 9.700   16.516  -2.326  1.00 0.00 ? 39  PHE A HE1  5  
ATOM 7465  H HE2  . PHE A 1 39  ? 11.829  18.346  -5.508  1.00 0.00 ? 39  PHE A HE2  5  
ATOM 7466  H HZ   . PHE A 1 39  ? 11.367  16.383  -4.116  1.00 0.00 ? 39  PHE A HZ   5  
ATOM 7467  N N    . SER A 1 40  ? 6.617   21.759  -1.418  1.00 0.00 ? 40  SER A N    5  
ATOM 7468  C CA   . SER A 1 40  ? 5.904   21.763  -0.152  1.00 0.00 ? 40  SER A CA   5  
ATOM 7469  C C    . SER A 1 40  ? 6.013   20.389  0.515   1.00 0.00 ? 40  SER A C    5  
ATOM 7470  O O    . SER A 1 40  ? 5.288   19.463  0.156   1.00 0.00 ? 40  SER A O    5  
ATOM 7471  C CB   . SER A 1 40  ? 4.435   22.142  -0.348  1.00 0.00 ? 40  SER A CB   5  
ATOM 7472  O OG   . SER A 1 40  ? 4.054   23.245  0.469   1.00 0.00 ? 40  SER A OG   5  
ATOM 7473  H H    . SER A 1 40  ? 7.264   22.511  -1.541  1.00 0.00 ? 40  SER A H    5  
ATOM 7474  H HA   . SER A 1 40  ? 6.397   22.523  0.454   1.00 0.00 ? 40  SER A HA   5  
ATOM 7475  H HB3  . SER A 1 40  ? 3.804   21.284  -0.115  1.00 0.00 ? 40  SER A HB3  5  
ATOM 7476  H HG   . SER A 1 40  ? 4.678   24.013  0.319   1.00 0.00 ? 40  SER A HG   5  
ATOM 7477  N N    . TYR A 1 41  ? 6.926   20.303  1.471   1.00 0.00 ? 41  TYR A N    5  
ATOM 7478  C CA   . TYR A 1 41  ? 7.140   19.058  2.189   1.00 0.00 ? 41  TYR A CA   5  
ATOM 7479  C C    . TYR A 1 41  ? 8.081   19.266  3.378   1.00 0.00 ? 41  TYR A C    5  
ATOM 7480  O O    . TYR A 1 41  ? 9.195   19.761  3.212   1.00 0.00 ? 41  TYR A O    5  
ATOM 7481  C CB   . TYR A 1 41  ? 7.800   18.102  1.192   1.00 0.00 ? 41  TYR A CB   5  
ATOM 7482  C CG   . TYR A 1 41  ? 9.323   18.219  1.135   1.00 0.00 ? 41  TYR A CG   5  
ATOM 7483  C CD1  . TYR A 1 41  ? 9.913   19.428  0.825   1.00 0.00 ? 41  TYR A CD1  5  
ATOM 7484  C CD2  . TYR A 1 41  ? 10.110  17.114  1.394   1.00 0.00 ? 41  TYR A CD2  5  
ATOM 7485  C CE1  . TYR A 1 41  ? 11.348  19.537  0.770   1.00 0.00 ? 41  TYR A CE1  5  
ATOM 7486  C CE2  . TYR A 1 41  ? 11.545  17.222  1.339   1.00 0.00 ? 41  TYR A CE2  5  
ATOM 7487  C CZ   . TYR A 1 41  ? 12.093  18.429  1.030   1.00 0.00 ? 41  TYR A CZ   5  
ATOM 7488  O OH   . TYR A 1 41  ? 13.448  18.531  0.979   1.00 0.00 ? 41  TYR A OH   5  
ATOM 7489  H H    . TYR A 1 41  ? 7.512   21.061  1.755   1.00 0.00 ? 41  TYR A H    5  
ATOM 7490  H HA   . TYR A 1 41  ? 6.175   18.712  2.557   1.00 0.00 ? 41  TYR A HA   5  
ATOM 7491  H HB3  . TYR A 1 41  ? 7.393   18.294  0.199   1.00 0.00 ? 41  TYR A HB3  5  
ATOM 7492  H HD1  . TYR A 1 41  ? 9.292   20.300  0.621   1.00 0.00 ? 41  TYR A HD1  5  
ATOM 7493  H HD2  . TYR A 1 41  ? 9.645   16.159  1.638   1.00 0.00 ? 41  TYR A HD2  5  
ATOM 7494  H HE1  . TYR A 1 41  ? 11.826  20.485  0.527   1.00 0.00 ? 41  TYR A HE1  5  
ATOM 7495  H HE2  . TYR A 1 41  ? 12.177  16.359  1.540   1.00 0.00 ? 41  TYR A HE2  5  
ATOM 7496  H HH   . TYR A 1 41  ? 13.806  17.968  0.234   1.00 0.00 ? 41  TYR A HH   5  
ATOM 7497  N N    . LYS A 1 42  ? 7.600   18.877  4.549   1.00 0.00 ? 42  LYS A N    5  
ATOM 7498  C CA   . LYS A 1 42  ? 8.384   19.014  5.764   1.00 0.00 ? 42  LYS A CA   5  
ATOM 7499  C C    . LYS A 1 42  ? 7.589   18.456  6.945   1.00 0.00 ? 42  LYS A C    5  
ATOM 7500  O O    . LYS A 1 42  ? 6.360   18.513  6.953   1.00 0.00 ? 42  LYS A O    5  
ATOM 7501  C CB   . LYS A 1 42  ? 8.829   20.466  5.953   1.00 0.00 ? 42  LYS A CB   5  
ATOM 7502  C CG   . LYS A 1 42  ? 10.211  20.536  6.606   1.00 0.00 ? 42  LYS A CG   5  
ATOM 7503  C CD   . LYS A 1 42  ? 11.315  20.573  5.547   1.00 0.00 ? 42  LYS A CD   5  
ATOM 7504  C CE   . LYS A 1 42  ? 12.412  19.553  5.862   1.00 0.00 ? 42  LYS A CE   5  
ATOM 7505  N NZ   . LYS A 1 42  ? 13.728  20.045  5.395   1.00 0.00 ? 42  LYS A NZ   5  
ATOM 7506  H H    . LYS A 1 42  ? 6.692   18.474  4.675   1.00 0.00 ? 42  LYS A H    5  
ATOM 7507  H HA   . LYS A 1 42  ? 9.286   18.414  5.640   1.00 0.00 ? 42  LYS A HA   5  
ATOM 7508  H HB3  . LYS A 1 42  ? 8.104   20.995  6.571   1.00 0.00 ? 42  LYS A HB3  5  
ATOM 7509  H HG3  . LYS A 1 42  ? 10.354  19.672  7.255   1.00 0.00 ? 42  LYS A HG3  5  
ATOM 7510  H HD3  . LYS A 1 42  ? 11.747  21.572  5.502   1.00 0.00 ? 42  LYS A HD3  5  
ATOM 7511  H HE3  . LYS A 1 42  ? 12.182  18.603  5.381   1.00 0.00 ? 42  LYS A HE3  5  
ATOM 7512  H HZ1  . LYS A 1 42  ? 14.026  20.800  5.979   1.00 0.00 ? 42  LYS A HZ1  5  
ATOM 7513  H HZ2  . LYS A 1 42  ? 14.396  19.304  5.442   1.00 0.00 ? 42  LYS A HZ2  5  
ATOM 7514  H HZ3  . LYS A 1 42  ? 13.649  20.363  4.451   1.00 0.00 ? 42  LYS A HZ3  5  
ATOM 7515  N N    . ASP A 1 43  ? 8.323   17.928  7.914   1.00 0.00 ? 43  ASP A N    5  
ATOM 7516  C CA   . ASP A 1 43  ? 7.700   17.360  9.098   1.00 0.00 ? 43  ASP A CA   5  
ATOM 7517  C C    . ASP A 1 43  ? 6.776   16.212  8.683   1.00 0.00 ? 43  ASP A C    5  
ATOM 7518  O O    . ASP A 1 43  ? 5.735   16.440  8.068   1.00 0.00 ? 43  ASP A O    5  
ATOM 7519  C CB   . ASP A 1 43  ? 6.856   18.403  9.833   1.00 0.00 ? 43  ASP A CB   5  
ATOM 7520  C CG   . ASP A 1 43  ? 7.607   19.212  10.893  1.00 0.00 ? 43  ASP A CG   5  
ATOM 7521  O OD1  . ASP A 1 43  ? 8.358   18.577  11.664  1.00 0.00 ? 43  ASP A OD1  5  
ATOM 7522  O OD2  . ASP A 1 43  ? 7.413   20.447  10.908  1.00 0.00 ? 43  ASP A OD2  5  
ATOM 7523  H H    . ASP A 1 43  ? 9.321   17.884  7.900   1.00 0.00 ? 43  ASP A H    5  
ATOM 7524  H HA   . ASP A 1 43  ? 8.527   17.025  9.723   1.00 0.00 ? 43  ASP A HA   5  
ATOM 7525  H HB3  . ASP A 1 43  ? 6.016   17.900  10.310  1.00 0.00 ? 43  ASP A HB3  5  
ATOM 7526  N N    . GLU A 1 44  ? 7.190   15.004  9.037   1.00 0.00 ? 44  GLU A N    5  
ATOM 7527  C CA   . GLU A 1 44  ? 6.412   13.822  8.709   1.00 0.00 ? 44  GLU A CA   5  
ATOM 7528  C C    . GLU A 1 44  ? 5.141   13.770  9.559   1.00 0.00 ? 44  GLU A C    5  
ATOM 7529  O O    . GLU A 1 44  ? 5.120   14.273  10.681  1.00 0.00 ? 44  GLU A O    5  
ATOM 7530  C CB   . GLU A 1 44  ? 7.245   12.551  8.889   1.00 0.00 ? 44  GLU A CB   5  
ATOM 7531  C CG   . GLU A 1 44  ? 8.140   12.305  7.671   1.00 0.00 ? 44  GLU A CG   5  
ATOM 7532  C CD   . GLU A 1 44  ? 9.455   13.076  7.795   1.00 0.00 ? 44  GLU A CD   5  
ATOM 7533  O OE1  . GLU A 1 44  ? 10.075  12.974  8.876   1.00 0.00 ? 44  GLU A OE1  5  
ATOM 7534  O OE2  . GLU A 1 44  ? 9.812   13.751  6.805   1.00 0.00 ? 44  GLU A OE2  5  
ATOM 7535  H H    . GLU A 1 44  ? 8.037   14.829  9.538   1.00 0.00 ? 44  GLU A H    5  
ATOM 7536  H HA   . GLU A 1 44  ? 6.149   13.931  7.656   1.00 0.00 ? 44  GLU A HA   5  
ATOM 7537  H HB3  . GLU A 1 44  ? 6.584   11.697  9.037   1.00 0.00 ? 44  GLU A HB3  5  
ATOM 7538  H HG3  . GLU A 1 44  ? 7.619   12.610  6.765   1.00 0.00 ? 44  GLU A HG3  5  
ATOM 7539  N N    . GLU A 1 45  ? 4.113   13.156  8.992   1.00 0.00 ? 45  GLU A N    5  
ATOM 7540  C CA   . GLU A 1 45  ? 2.842   13.030  9.684   1.00 0.00 ? 45  GLU A CA   5  
ATOM 7541  C C    . GLU A 1 45  ? 2.665   14.178  10.681  1.00 0.00 ? 45  GLU A C    5  
ATOM 7542  O O    . GLU A 1 45  ? 2.942   14.021  11.868  1.00 0.00 ? 45  GLU A O    5  
ATOM 7543  C CB   . GLU A 1 45  ? 2.729   11.674  10.384  1.00 0.00 ? 45  GLU A CB   5  
ATOM 7544  C CG   . GLU A 1 45  ? 3.877   11.471  11.374  1.00 0.00 ? 45  GLU A CG   5  
ATOM 7545  C CD   . GLU A 1 45  ? 3.355   10.979  12.724  1.00 0.00 ? 45  GLU A CD   5  
ATOM 7546  O OE1  . GLU A 1 45  ? 2.641   9.952   12.718  1.00 0.00 ? 45  GLU A OE1  5  
ATOM 7547  O OE2  . GLU A 1 45  ? 3.680   11.640  13.735  1.00 0.00 ? 45  GLU A OE2  5  
ATOM 7548  H H    . GLU A 1 45  ? 4.138   12.749  8.079   1.00 0.00 ? 45  GLU A H    5  
ATOM 7549  H HA   . GLU A 1 45  ? 2.081   13.096  8.906   1.00 0.00 ? 45  GLU A HA   5  
ATOM 7550  H HB3  . GLU A 1 45  ? 2.737   10.877  9.642   1.00 0.00 ? 45  GLU A HB3  5  
ATOM 7551  H HG3  . GLU A 1 45  ? 4.416   12.409  11.507  1.00 0.00 ? 45  GLU A HG3  5  
ATOM 7552  N N    . ASN A 1 46  ? 2.205   15.306  10.160  1.00 0.00 ? 46  ASN A N    5  
ATOM 7553  C CA   . ASN A 1 46  ? 1.987   16.479  10.989  1.00 0.00 ? 46  ASN A CA   5  
ATOM 7554  C C    . ASN A 1 46  ? 1.231   17.536  10.183  1.00 0.00 ? 46  ASN A C    5  
ATOM 7555  O O    . ASN A 1 46  ? 1.358   17.600  8.961   1.00 0.00 ? 46  ASN A O    5  
ATOM 7556  C CB   . ASN A 1 46  ? 3.316   17.090  11.438  1.00 0.00 ? 46  ASN A CB   5  
ATOM 7557  C CG   . ASN A 1 46  ? 3.088   18.213  12.451  1.00 0.00 ? 46  ASN A CG   5  
ATOM 7558  O OD1  . ASN A 1 46  ? 1.980   18.477  12.887  1.00 0.00 ? 46  ASN A OD1  5  
ATOM 7559  N ND2  . ASN A 1 46  ? 4.198   18.859  12.801  1.00 0.00 ? 46  ASN A ND2  5  
ATOM 7560  H H    . ASN A 1 46  ? 1.980   15.426  9.192   1.00 0.00 ? 46  ASN A H    5  
ATOM 7561  H HA   . ASN A 1 46  ? 1.418   16.122  11.847  1.00 0.00 ? 46  ASN A HA   5  
ATOM 7562  H HB3  . ASN A 1 46  ? 3.853   17.480  10.573  1.00 0.00 ? 46  ASN A HB3  5  
ATOM 7563  H HD21 . ASN A 1 46  ? 5.077   18.594  12.406  1.00 0.00 ? 46  ASN A HD21 5  
ATOM 7564  H HD22 . ASN A 1 46  ? 4.152   19.611  13.459  1.00 0.00 ? 46  ASN A HD22 5  
ATOM 7565  N N    . GLY A 1 47  ? 0.457   18.340  10.897  1.00 0.00 ? 47  GLY A N    5  
ATOM 7566  C CA   . GLY A 1 47  ? -0.321  19.390  10.263  1.00 0.00 ? 47  GLY A CA   5  
ATOM 7567  C C    . GLY A 1 47  ? -1.771  18.950  10.055  1.00 0.00 ? 47  GLY A C    5  
ATOM 7568  O O    . GLY A 1 47  ? -2.189  17.915  10.573  1.00 0.00 ? 47  GLY A O    5  
ATOM 7569  H H    . GLY A 1 47  ? 0.359   18.282  11.892  1.00 0.00 ? 47  GLY A H    5  
ATOM 7570  H HA2  . GLY A 1 47  ? -0.296  20.289  10.881  1.00 0.00 ? 47  GLY A HA2  5  
ATOM 7571  H HA3  . GLY A 1 47  ? 0.127   19.650  9.304   1.00 0.00 ? 47  GLY A HA3  5  
ATOM 7572  N N    . ASN A 1 48  ? -2.498  19.756  9.296   1.00 0.00 ? 48  ASN A N    5  
ATOM 7573  C CA   . ASN A 1 48  ? -3.891  19.461  9.012   1.00 0.00 ? 48  ASN A CA   5  
ATOM 7574  C C    . ASN A 1 48  ? -4.335  20.251  7.778   1.00 0.00 ? 48  ASN A C    5  
ATOM 7575  O O    . ASN A 1 48  ? -4.689  21.423  7.882   1.00 0.00 ? 48  ASN A O    5  
ATOM 7576  C CB   . ASN A 1 48  ? -4.790  19.868  10.181  1.00 0.00 ? 48  ASN A CB   5  
ATOM 7577  C CG   . ASN A 1 48  ? -6.185  19.256  10.039  1.00 0.00 ? 48  ASN A CG   5  
ATOM 7578  O OD1  . ASN A 1 48  ? -7.138  19.905  9.637   1.00 0.00 ? 48  ASN A OD1  5  
ATOM 7579  N ND2  . ASN A 1 48  ? -6.253  17.975  10.391  1.00 0.00 ? 48  ASN A ND2  5  
ATOM 7580  H H    . ASN A 1 48  ? -2.150  20.595  8.878   1.00 0.00 ? 48  ASN A H    5  
ATOM 7581  H HA   . ASN A 1 48  ? -3.929  18.383  8.852   1.00 0.00 ? 48  ASN A HA   5  
ATOM 7582  H HB3  . ASN A 1 48  ? -4.868  20.954  10.223  1.00 0.00 ? 48  ASN A HB3  5  
ATOM 7583  H HD21 . ASN A 1 48  ? -5.434  17.502  10.713  1.00 0.00 ? 48  ASN A HD21 5  
ATOM 7584  H HD22 . ASN A 1 48  ? -7.124  17.487  10.334  1.00 0.00 ? 48  ASN A HD22 5  
ATOM 7585  N N    . ARG A 1 49  ? -4.298  19.576  6.638   1.00 0.00 ? 49  ARG A N    5  
ATOM 7586  C CA   . ARG A 1 49  ? -4.691  20.200  5.386   1.00 0.00 ? 49  ARG A CA   5  
ATOM 7587  C C    . ARG A 1 49  ? -5.272  19.154  4.432   1.00 0.00 ? 49  ARG A C    5  
ATOM 7588  O O    . ARG A 1 49  ? -5.168  17.955  4.683   1.00 0.00 ? 49  ARG A O    5  
ATOM 7589  C CB   . ARG A 1 49  ? -3.499  20.887  4.716   1.00 0.00 ? 49  ARG A CB   5  
ATOM 7590  C CG   . ARG A 1 49  ? -3.341  22.324  5.221   1.00 0.00 ? 49  ARG A CG   5  
ATOM 7591  C CD   . ARG A 1 49  ? -1.994  22.512  5.922   1.00 0.00 ? 49  ARG A CD   5  
ATOM 7592  N NE   . ARG A 1 49  ? -1.125  23.400  5.116   1.00 0.00 ? 49  ARG A NE   5  
ATOM 7593  C CZ   . ARG A 1 49  ? 0.145   23.691  5.428   1.00 0.00 ? 49  ARG A CZ   5  
ATOM 7594  N NH1  . ARG A 1 49  ? 0.702   23.168  6.529   1.00 0.00 ? 49  ARG A NH1  5  
ATOM 7595  N NH2  . ARG A 1 49  ? 0.859   24.508  4.640   1.00 0.00 ? 49  ARG A NH2  5  
ATOM 7596  H H    . ARG A 1 49  ? -4.009  18.622  6.562   1.00 0.00 ? 49  ARG A H    5  
ATOM 7597  H HA   . ARG A 1 49  ? -5.445  20.936  5.667   1.00 0.00 ? 49  ARG A HA   5  
ATOM 7598  H HB3  . ARG A 1 49  ? -3.639  20.892  3.635   1.00 0.00 ? 49  ARG A HB3  5  
ATOM 7599  H HG3  . ARG A 1 49  ? -4.150  22.563  5.911   1.00 0.00 ? 49  ARG A HG3  5  
ATOM 7600  H HD3  . ARG A 1 49  ? -1.510  21.546  6.061   1.00 0.00 ? 49  ARG A HD3  5  
ATOM 7601  H HE   . ARG A 1 49  ? -1.509  23.808  4.289   1.00 0.00 ? 49  ARG A HE   5  
ATOM 7602  H HH11 . ARG A 1 49  ? 0.170   22.560  7.117   1.00 0.00 ? 49  ARG A HH11 5  
ATOM 7603  H HH12 . ARG A 1 49  ? 1.650   23.386  6.761   1.00 0.00 ? 49  ARG A HH12 5  
ATOM 7604  H HH21 . ARG A 1 49  ? 0.442   24.898  3.819   1.00 0.00 ? 49  ARG A HH21 5  
ATOM 7605  H HH22 . ARG A 1 49  ? 1.807   24.724  4.872   1.00 0.00 ? 49  ARG A HH22 5  
ATOM 7606  N N    . GLY A 1 50  ? -5.870  19.649  3.358   1.00 0.00 ? 50  GLY A N    5  
ATOM 7607  C CA   . GLY A 1 50  ? -6.466  18.773  2.363   1.00 0.00 ? 50  GLY A CA   5  
ATOM 7608  C C    . GLY A 1 50  ? -7.258  19.575  1.329   1.00 0.00 ? 50  GLY A C    5  
ATOM 7609  O O    . GLY A 1 50  ? -7.020  20.768  1.150   1.00 0.00 ? 50  GLY A O    5  
ATOM 7610  H H    . GLY A 1 50  ? -5.949  20.627  3.161   1.00 0.00 ? 50  GLY A H    5  
ATOM 7611  H HA2  . GLY A 1 50  ? -5.686  18.198  1.864   1.00 0.00 ? 50  GLY A HA2  5  
ATOM 7612  H HA3  . GLY A 1 50  ? -7.124  18.056  2.855   1.00 0.00 ? 50  GLY A HA3  5  
ATOM 7613  N N    . GLY A 1 51  ? -8.183  18.888  0.675   1.00 0.00 ? 51  GLY A N    5  
ATOM 7614  C CA   . GLY A 1 51  ? -9.011  19.522  -0.337  1.00 0.00 ? 51  GLY A CA   5  
ATOM 7615  C C    . GLY A 1 51  ? -9.817  18.481  -1.117  1.00 0.00 ? 51  GLY A C    5  
ATOM 7616  O O    . GLY A 1 51  ? -10.063 17.383  -0.620  1.00 0.00 ? 51  GLY A O    5  
ATOM 7617  H H    . GLY A 1 51  ? -8.369  17.917  0.827   1.00 0.00 ? 51  GLY A H    5  
ATOM 7618  H HA2  . GLY A 1 51  ? -9.689  20.232  0.137   1.00 0.00 ? 51  GLY A HA2  5  
ATOM 7619  H HA3  . GLY A 1 51  ? -8.382  20.089  -1.023  1.00 0.00 ? 51  GLY A HA3  5  
ATOM 7620  N N    . LYS A 1 52  ? -10.205 18.864  -2.325  1.00 0.00 ? 52  LYS A N    5  
ATOM 7621  C CA   . LYS A 1 52  ? -10.977 17.978  -3.177  1.00 0.00 ? 52  LYS A CA   5  
ATOM 7622  C C    . LYS A 1 52  ? -10.706 18.322  -4.644  1.00 0.00 ? 52  LYS A C    5  
ATOM 7623  O O    . LYS A 1 52  ? -10.289 19.437  -4.954  1.00 0.00 ? 52  LYS A O    5  
ATOM 7624  C CB   . LYS A 1 52  ? -12.458 18.027  -2.799  1.00 0.00 ? 52  LYS A CB   5  
ATOM 7625  C CG   . LYS A 1 52  ? -12.954 19.472  -2.706  1.00 0.00 ? 52  LYS A CG   5  
ATOM 7626  C CD   . LYS A 1 52  ? -12.811 20.010  -1.280  1.00 0.00 ? 52  LYS A CD   5  
ATOM 7627  C CE   . LYS A 1 52  ? -14.177 20.359  -0.687  1.00 0.00 ? 52  LYS A CE   5  
ATOM 7628  N NZ   . LYS A 1 52  ? -14.254 19.930  0.726   1.00 0.00 ? 52  LYS A NZ   5  
ATOM 7629  H H    . LYS A 1 52  ? -10.000 19.760  -2.719  1.00 0.00 ? 52  LYS A H    5  
ATOM 7630  H HA   . LYS A 1 52  ? -10.631 16.961  -2.991  1.00 0.00 ? 52  LYS A HA   5  
ATOM 7631  H HB3  . LYS A 1 52  ? -12.611 17.525  -1.844  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 7632  H HG3  . LYS A 1 52  ? -13.997 19.523  -3.016  1.00 0.00 ? 52  LYS A HG3  5  
ATOM 7633  H HD3  . LYS A 1 52  ? -12.175 20.894  -1.284  1.00 0.00 ? 52  LYS A HD3  5  
ATOM 7634  H HE3  . LYS A 1 52  ? -14.966 19.874  -1.264  1.00 0.00 ? 52  LYS A HE3  5  
ATOM 7635  H HZ1  . LYS A 1 52  ? -13.427 20.220  1.208   1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 7636  H HZ2  . LYS A 1 52  ? -15.054 20.348  1.158   1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 7637  H HZ3  . LYS A 1 52  ? -14.333 18.935  0.769   1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 7638  N N    . GLN A 1 53  ? -10.952 17.346  -5.503  1.00 0.00 ? 53  GLN A N    5  
ATOM 7639  C CA   . GLN A 1 53  ? -10.738 17.533  -6.928  1.00 0.00 ? 53  GLN A CA   5  
ATOM 7640  C C    . GLN A 1 53  ? -11.370 16.381  -7.715  1.00 0.00 ? 53  GLN A C    5  
ATOM 7641  O O    . GLN A 1 53  ? -11.752 15.365  -7.136  1.00 0.00 ? 53  GLN A O    5  
ATOM 7642  C CB   . GLN A 1 53  ? -9.248  17.662  -7.247  1.00 0.00 ? 53  GLN A CB   5  
ATOM 7643  C CG   . GLN A 1 53  ? -8.938  19.021  -7.878  1.00 0.00 ? 53  GLN A CG   5  
ATOM 7644  C CD   . GLN A 1 53  ? -7.732  18.929  -8.815  1.00 0.00 ? 53  GLN A CD   5  
ATOM 7645  O OE1  . GLN A 1 53  ? -6.586  18.986  -8.400  1.00 0.00 ? 53  GLN A OE1  5  
ATOM 7646  N NE2  . GLN A 1 53  ? -8.053  18.785  -10.098 1.00 0.00 ? 53  GLN A NE2  5  
ATOM 7647  H H    . GLN A 1 53  ? -11.291 16.442  -5.242  1.00 0.00 ? 53  GLN A H    5  
ATOM 7648  H HA   . GLN A 1 53  ? -11.239 18.467  -7.177  1.00 0.00 ? 53  GLN A HA   5  
ATOM 7649  H HB3  . GLN A 1 53  ? -8.947  16.865  -7.927  1.00 0.00 ? 53  GLN A HB3  5  
ATOM 7650  H HG3  . GLN A 1 53  ? -8.741  19.753  -7.094  1.00 0.00 ? 53  GLN A HG3  5  
ATOM 7651  H HE21 . GLN A 1 53  ? -9.014  18.746  -10.371 1.00 0.00 ? 53  GLN A HE21 5  
ATOM 7652  H HE22 . GLN A 1 53  ? -7.332  18.715  -10.787 1.00 0.00 ? 53  GLN A HE22 5  
ATOM 7653  N N    . ARG A 1 54  ? -11.458 16.578  -9.022  1.00 0.00 ? 54  ARG A N    5  
ATOM 7654  C CA   . ARG A 1 54  ? -12.037 15.570  -9.893  1.00 0.00 ? 54  ARG A CA   5  
ATOM 7655  C C    . ARG A 1 54  ? -10.972 14.553  -10.308 1.00 0.00 ? 54  ARG A C    5  
ATOM 7656  O O    . ARG A 1 54  ? -10.244 14.771  -11.277 1.00 0.00 ? 54  ARG A O    5  
ATOM 7657  C CB   . ARG A 1 54  ? -12.641 16.206  -11.147 1.00 0.00 ? 54  ARG A CB   5  
ATOM 7658  C CG   . ARG A 1 54  ? -14.165 16.295  -11.036 1.00 0.00 ? 54  ARG A CG   5  
ATOM 7659  C CD   . ARG A 1 54  ? -14.693 17.550  -11.732 1.00 0.00 ? 54  ARG A CD   5  
ATOM 7660  N NE   . ARG A 1 54  ? -15.832 18.110  -10.971 1.00 0.00 ? 54  ARG A NE   5  
ATOM 7661  C CZ   . ARG A 1 54  ? -16.439 19.266  -11.269 1.00 0.00 ? 54  ARG A CZ   5  
ATOM 7662  N NH1  . ARG A 1 54  ? -16.023 19.991  -12.316 1.00 0.00 ? 54  ARG A NH1  5  
ATOM 7663  N NH2  . ARG A 1 54  ? -17.465 19.697  -10.522 1.00 0.00 ? 54  ARG A NH2  5  
ATOM 7664  H H    . ARG A 1 54  ? -11.146 17.408  -9.485  1.00 0.00 ? 54  ARG A H    5  
ATOM 7665  H HA   . ARG A 1 54  ? -12.817 15.099  -9.295  1.00 0.00 ? 54  ARG A HA   5  
ATOM 7666  H HB3  . ARG A 1 54  ? -12.371 15.617  -12.023 1.00 0.00 ? 54  ARG A HB3  5  
ATOM 7667  H HG3  . ARG A 1 54  ? -14.456 16.306  -9.986  1.00 0.00 ? 54  ARG A HG3  5  
ATOM 7668  H HD3  . ARG A 1 54  ? -15.007 17.309  -12.747 1.00 0.00 ? 54  ARG A HD3  5  
ATOM 7669  H HE   . ARG A 1 54  ? -16.166 17.594  -10.182 1.00 0.00 ? 54  ARG A HE   5  
ATOM 7670  H HH11 . ARG A 1 54  ? -15.257 19.670  -12.873 1.00 0.00 ? 54  ARG A HH11 5  
ATOM 7671  H HH12 . ARG A 1 54  ? -16.477 20.854  -12.540 1.00 0.00 ? 54  ARG A HH12 5  
ATOM 7672  H HH21 . ARG A 1 54  ? -17.776 19.156  -9.742  1.00 0.00 ? 54  ARG A HH21 5  
ATOM 7673  H HH22 . ARG A 1 54  ? -17.919 20.559  -10.746 1.00 0.00 ? 54  ARG A HH22 5  
ATOM 7674  N N    . ASN A 1 55  ? -10.912 13.464  -9.556  1.00 0.00 ? 55  ASN A N    5  
ATOM 7675  C CA   . ASN A 1 55  ? -9.948  12.414  -9.834  1.00 0.00 ? 55  ASN A CA   5  
ATOM 7676  C C    . ASN A 1 55  ? -10.620 11.051  -9.662  1.00 0.00 ? 55  ASN A C    5  
ATOM 7677  O O    . ASN A 1 55  ? -10.888 10.624  -8.539  1.00 0.00 ? 55  ASN A O    5  
ATOM 7678  C CB   . ASN A 1 55  ? -8.765  12.483  -8.866  1.00 0.00 ? 55  ASN A CB   5  
ATOM 7679  C CG   . ASN A 1 55  ? -7.436  12.353  -9.615  1.00 0.00 ? 55  ASN A CG   5  
ATOM 7680  O OD1  . ASN A 1 55  ? -7.388  12.161  -10.819 1.00 0.00 ? 55  ASN A OD1  5  
ATOM 7681  N ND2  . ASN A 1 55  ? -6.363  12.466  -8.837  1.00 0.00 ? 55  ASN A ND2  5  
ATOM 7682  H H    . ASN A 1 55  ? -11.507 13.295  -8.770  1.00 0.00 ? 55  ASN A H    5  
ATOM 7683  H HA   . ASN A 1 55  ? -9.619  12.590  -10.857 1.00 0.00 ? 55  ASN A HA   5  
ATOM 7684  H HB3  . ASN A 1 55  ? -8.848  11.687  -8.126  1.00 0.00 ? 55  ASN A HB3  5  
ATOM 7685  H HD21 . ASN A 1 55  ? -6.472  12.622  -7.854  1.00 0.00 ? 55  ASN A HD21 5  
ATOM 7686  H HD22 . ASN A 1 55  ? -5.449  12.394  -9.233  1.00 0.00 ? 55  ASN A HD22 5  
ATOM 7687  N N    . ARG A 1 56  ? -10.875 10.405  -10.789 1.00 0.00 ? 56  ARG A N    5  
ATOM 7688  C CA   . ARG A 1 56  ? -11.512 9.099   -10.777 1.00 0.00 ? 56  ARG A CA   5  
ATOM 7689  C C    . ARG A 1 56  ? -10.832 8.169   -11.784 1.00 0.00 ? 56  ARG A C    5  
ATOM 7690  O O    . ARG A 1 56  ? -11.451 7.749   -12.761 1.00 0.00 ? 56  ARG A O    5  
ATOM 7691  C CB   . ARG A 1 56  ? -12.999 9.208   -11.118 1.00 0.00 ? 56  ARG A CB   5  
ATOM 7692  C CG   . ARG A 1 56  ? -13.794 8.069   -10.477 1.00 0.00 ? 56  ARG A CG   5  
ATOM 7693  C CD   . ARG A 1 56  ? -15.197 7.972   -11.080 1.00 0.00 ? 56  ARG A CD   5  
ATOM 7694  N NE   . ARG A 1 56  ? -16.142 7.430   -10.078 1.00 0.00 ? 56  ARG A NE   5  
ATOM 7695  C CZ   . ARG A 1 56  ? -17.474 7.424   -10.228 1.00 0.00 ? 56  ARG A CZ   5  
ATOM 7696  N NH1  . ARG A 1 56  ? -18.025 7.929   -11.340 1.00 0.00 ? 56  ARG A NH1  5  
ATOM 7697  N NH2  . ARG A 1 56  ? -18.254 6.913   -9.266  1.00 0.00 ? 56  ARG A NH2  5  
ATOM 7698  H H    . ARG A 1 56  ? -10.655 10.760  -11.698 1.00 0.00 ? 56  ARG A H    5  
ATOM 7699  H HA   . ARG A 1 56  ? -11.383 8.736   -9.758  1.00 0.00 ? 56  ARG A HA   5  
ATOM 7700  H HB3  . ARG A 1 56  ? -13.132 9.185   -12.199 1.00 0.00 ? 56  ARG A HB3  5  
ATOM 7701  H HG3  . ARG A 1 56  ? -13.867 8.231   -9.401  1.00 0.00 ? 56  ARG A HG3  5  
ATOM 7702  H HD3  . ARG A 1 56  ? -15.179 7.327   -11.959 1.00 0.00 ? 56  ARG A HD3  5  
ATOM 7703  H HE   . ARG A 1 56  ? -15.763 7.046   -9.236  1.00 0.00 ? 56  ARG A HE   5  
ATOM 7704  H HH11 . ARG A 1 56  ? -17.443 8.310   -12.058 1.00 0.00 ? 56  ARG A HH11 5  
ATOM 7705  H HH12 . ARG A 1 56  ? -19.018 7.924   -11.451 1.00 0.00 ? 56  ARG A HH12 5  
ATOM 7706  H HH21 . ARG A 1 56  ? -17.842 6.537   -8.436  1.00 0.00 ? 56  ARG A HH21 5  
ATOM 7707  H HH22 . ARG A 1 56  ? -19.248 6.909   -9.378  1.00 0.00 ? 56  ARG A HH22 5  
ATOM 7708  N N    . LEU A 1 57  ? -9.571  7.872   -11.509 1.00 0.00 ? 57  LEU A N    5  
ATOM 7709  C CA   . LEU A 1 57  ? -8.800  6.999   -12.379 1.00 0.00 ? 57  LEU A CA   5  
ATOM 7710  C C    . LEU A 1 57  ? -7.354  6.942   -11.885 1.00 0.00 ? 57  LEU A C    5  
ATOM 7711  O O    . LEU A 1 57  ? -6.550  7.818   -12.205 1.00 0.00 ? 57  LEU A O    5  
ATOM 7712  C CB   . LEU A 1 57  ? -8.936  7.439   -13.837 1.00 0.00 ? 57  LEU A CB   5  
ATOM 7713  C CG   . LEU A 1 57  ? -9.418  6.369   -14.818 1.00 0.00 ? 57  LEU A CG   5  
ATOM 7714  C CD1  . LEU A 1 57  ? -10.837 5.910   -14.474 1.00 0.00 ? 57  LEU A CD1  5  
ATOM 7715  C CD2  . LEU A 1 57  ? -9.310  6.862   -16.263 1.00 0.00 ? 57  LEU A CD2  5  
ATOM 7716  H H    . LEU A 1 57  ? -9.076  8.218   -10.711 1.00 0.00 ? 57  LEU A H    5  
ATOM 7717  H HA   . LEU A 1 57  ? -9.231  6.000   -12.302 1.00 0.00 ? 57  LEU A HA   5  
ATOM 7718  H HB3  . LEU A 1 57  ? -7.967  7.805   -14.178 1.00 0.00 ? 57  LEU A HB3  5  
ATOM 7719  H HG   . LEU A 1 57  ? -8.767  5.501   -14.724 1.00 0.00 ? 57  LEU A HG   5  
ATOM 7720  H HD11 . LEU A 1 57  ? -10.900 5.694   -13.409 1.00 0.00 ? 57  LEU A HD11 5  
ATOM 7721  H HD12 . LEU A 1 57  ? -11.546 6.698   -14.729 1.00 0.00 ? 57  LEU A HD12 5  
ATOM 7722  H HD13 . LEU A 1 57  ? -11.075 5.009   -15.042 1.00 0.00 ? 57  LEU A HD13 5  
ATOM 7723  H HD21 . LEU A 1 57  ? -8.956  6.049   -16.898 1.00 0.00 ? 57  LEU A HD21 5  
ATOM 7724  H HD22 . LEU A 1 57  ? -10.290 7.193   -16.610 1.00 0.00 ? 57  LEU A HD22 5  
ATOM 7725  H HD23 . LEU A 1 57  ? -8.608  7.693   -16.311 1.00 0.00 ? 57  LEU A HD23 5  
ATOM 7726  N N    . GLU A 1 58  ? -7.065  5.905   -11.113 1.00 0.00 ? 58  GLU A N    5  
ATOM 7727  C CA   . GLU A 1 58  ? -5.729  5.722   -10.573 1.00 0.00 ? 58  GLU A CA   5  
ATOM 7728  C C    . GLU A 1 58  ? -5.196  4.334   -10.930 1.00 0.00 ? 58  GLU A C    5  
ATOM 7729  O O    . GLU A 1 58  ? -5.968  3.435   -11.260 1.00 0.00 ? 58  GLU A O    5  
ATOM 7730  C CB   . GLU A 1 58  ? -5.716  5.942   -9.059  1.00 0.00 ? 58  GLU A CB   5  
ATOM 7731  C CG   . GLU A 1 58  ? -6.418  7.249   -8.688  1.00 0.00 ? 58  GLU A CG   5  
ATOM 7732  C CD   . GLU A 1 58  ? -6.739  7.294   -7.193  1.00 0.00 ? 58  GLU A CD   5  
ATOM 7733  O OE1  . GLU A 1 58  ? -6.842  6.198   -6.602  1.00 0.00 ? 58  GLU A OE1  5  
ATOM 7734  O OE2  . GLU A 1 58  ? -6.873  8.424   -6.674  1.00 0.00 ? 58  GLU A OE2  5  
ATOM 7735  H H    . GLU A 1 58  ? -7.725  5.197   -10.858 1.00 0.00 ? 58  GLU A H    5  
ATOM 7736  H HA   . GLU A 1 58  ? -5.116  6.487   -11.050 1.00 0.00 ? 58  GLU A HA   5  
ATOM 7737  H HB3  . GLU A 1 58  ? -4.686  5.965   -8.700  1.00 0.00 ? 58  GLU A HB3  5  
ATOM 7738  H HG3  . GLU A 1 58  ? -7.339  7.347   -9.264  1.00 0.00 ? 58  GLU A HG3  5  
ATOM 7739  N N    . PRO A 1 59  ? -3.845  4.199   -10.853 1.00 0.00 ? 59  PRO A N    5  
ATOM 7740  C CA   . PRO A 1 59  ? -3.200  2.933   -11.163 1.00 0.00 ? 59  PRO A CA   5  
ATOM 7741  C C    . PRO A 1 59  ? -3.402  1.922   -10.033 1.00 0.00 ? 59  PRO A C    5  
ATOM 7742  O O    . PRO A 1 59  ? -4.288  1.073   -10.107 1.00 0.00 ? 59  PRO A O    5  
ATOM 7743  C CB   . PRO A 1 59  ? -1.739  3.284   -11.393 1.00 0.00 ? 59  PRO A CB   5  
ATOM 7744  C CG   . PRO A 1 59  ? -1.530  4.646   -10.751 1.00 0.00 ? 59  PRO A CG   5  
ATOM 7745  C CD   . PRO A 1 59  ? -2.899  5.242   -10.466 1.00 0.00 ? 59  PRO A CD   5  
ATOM 7746  H HA   . PRO A 1 59  ? -3.615  2.523   -11.975 1.00 0.00 ? 59  PRO A HA   5  
ATOM 7747  H HB3  . PRO A 1 59  ? -1.508  3.315   -12.458 1.00 0.00 ? 59  PRO A HB3  5  
ATOM 7748  H HG3  . PRO A 1 59  ? -0.960  5.297   -11.413 1.00 0.00 ? 59  PRO A HG3  5  
ATOM 7749  H HD3  . PRO A 1 59  ? -3.061  6.154   -11.039 1.00 0.00 ? 59  PRO A HD3  5  
ATOM 7750  N N    . MET A 1 60  ? -2.565  2.048   -9.013  1.00 0.00 ? 60  MET A N    5  
ATOM 7751  C CA   . MET A 1 60  ? -2.639  1.155   -7.869  1.00 0.00 ? 60  MET A CA   5  
ATOM 7752  C C    . MET A 1 60  ? -2.452  -0.301  -8.297  1.00 0.00 ? 60  MET A C    5  
ATOM 7753  O O    . MET A 1 60  ? -2.514  -0.617  -9.485  1.00 0.00 ? 60  MET A O    5  
ATOM 7754  C CB   . MET A 1 60  ? -3.999  1.316   -7.185  1.00 0.00 ? 60  MET A CB   5  
ATOM 7755  C CG   . MET A 1 60  ? -4.058  2.617   -6.383  1.00 0.00 ? 60  MET A CG   5  
ATOM 7756  S SD   . MET A 1 60  ? -5.742  3.206   -6.300  1.00 0.00 ? 60  MET A SD   5  
ATOM 7757  C CE   . MET A 1 60  ? -6.475  1.909   -5.317  1.00 0.00 ? 60  MET A CE   5  
ATOM 7758  H H    . MET A 1 60  ? -1.847  2.743   -8.961  1.00 0.00 ? 60  MET A H    5  
ATOM 7759  H HA   . MET A 1 60  ? -1.825  1.456   -7.209  1.00 0.00 ? 60  MET A HA   5  
ATOM 7760  H HB3  . MET A 1 60  ? -4.179  0.469   -6.525  1.00 0.00 ? 60  MET A HB3  5  
ATOM 7761  H HG3  . MET A 1 60  ? -3.424  3.371   -6.849  1.00 0.00 ? 60  MET A HG3  5  
ATOM 7762  H HE1  . MET A 1 60  ? -7.530  2.130   -5.154  1.00 0.00 ? 60  MET A HE1  5  
ATOM 7763  H HE2  . MET A 1 60  ? -6.381  0.958   -5.840  1.00 0.00 ? 60  MET A HE2  5  
ATOM 7764  H HE3  . MET A 1 60  ? -5.964  1.848   -4.356  1.00 0.00 ? 60  MET A HE3  5  
ATOM 7765  N N    . ASP A 1 61  ? -2.226  -1.152  -7.306  1.00 0.00 ? 61  ASP A N    5  
ATOM 7766  C CA   . ASP A 1 61  ? -2.029  -2.568  -7.566  1.00 0.00 ? 61  ASP A CA   5  
ATOM 7767  C C    . ASP A 1 61  ? -2.552  -3.376  -6.377  1.00 0.00 ? 61  ASP A C    5  
ATOM 7768  O O    . ASP A 1 61  ? -2.023  -4.442  -6.066  1.00 0.00 ? 61  ASP A O    5  
ATOM 7769  C CB   . ASP A 1 61  ? -0.545  -2.893  -7.743  1.00 0.00 ? 61  ASP A CB   5  
ATOM 7770  C CG   . ASP A 1 61  ? -0.005  -2.702  -9.162  1.00 0.00 ? 61  ASP A CG   5  
ATOM 7771  O OD1  . ASP A 1 61  ? -0.849  -2.555  -10.074 1.00 0.00 ? 61  ASP A OD1  5  
ATOM 7772  O OD2  . ASP A 1 61  ? 1.236   -2.707  -9.303  1.00 0.00 ? 61  ASP A OD2  5  
ATOM 7773  H H    . ASP A 1 61  ? -2.177  -0.887  -6.344  1.00 0.00 ? 61  ASP A H    5  
ATOM 7774  H HA   . ASP A 1 61  ? -2.581  -2.771  -8.483  1.00 0.00 ? 61  ASP A HA   5  
ATOM 7775  H HB3  . ASP A 1 61  ? -0.377  -3.928  -7.443  1.00 0.00 ? 61  ASP A HB3  5  
ATOM 7776  N N    . THR A 1 62  ? -3.585  -2.839  -5.746  1.00 0.00 ? 62  THR A N    5  
ATOM 7777  C CA   . THR A 1 62  ? -4.184  -3.497  -4.597  1.00 0.00 ? 62  THR A CA   5  
ATOM 7778  C C    . THR A 1 62  ? -3.262  -3.397  -3.381  1.00 0.00 ? 62  THR A C    5  
ATOM 7779  O O    . THR A 1 62  ? -3.598  -3.878  -2.301  1.00 0.00 ? 62  THR A O    5  
ATOM 7780  C CB   . THR A 1 62  ? -4.510  -4.939  -4.996  1.00 0.00 ? 62  THR A CB   5  
ATOM 7781  O OG1  . THR A 1 62  ? -5.934  -4.970  -5.054  1.00 0.00 ? 62  THR A OG1  5  
ATOM 7782  C CG2  . THR A 1 62  ? -4.161  -5.944  -3.896  1.00 0.00 ? 62  THR A CG2  5  
ATOM 7783  H H    . THR A 1 62  ? -4.010  -1.972  -6.004  1.00 0.00 ? 62  THR A H    5  
ATOM 7784  H HA   . THR A 1 62  ? -5.106  -2.975  -4.343  1.00 0.00 ? 62  THR A HA   5  
ATOM 7785  H HB   . THR A 1 62  ? -4.022  -5.203  -5.934  1.00 0.00 ? 62  THR A HB   5  
ATOM 7786  H HG1  . THR A 1 62  ? -6.236  -5.773  -5.567  1.00 0.00 ? 62  THR A HG1  5  
ATOM 7787  H HG21 . THR A 1 62  ? -3.109  -5.838  -3.627  1.00 0.00 ? 62  THR A HG21 5  
ATOM 7788  H HG22 . THR A 1 62  ? -4.779  -5.753  -3.018  1.00 0.00 ? 62  THR A HG22 5  
ATOM 7789  H HG23 . THR A 1 62  ? -4.344  -6.955  -4.256  1.00 0.00 ? 62  THR A HG23 5  
ATOM 7790  N N    . ILE A 1 63  ? -2.116  -2.768  -3.599  1.00 0.00 ? 63  ILE A N    5  
ATOM 7791  C CA   . ILE A 1 63  ? -1.142  -2.598  -2.534  1.00 0.00 ? 63  ILE A CA   5  
ATOM 7792  C C    . ILE A 1 63  ? -0.747  -3.971  -1.985  1.00 0.00 ? 63  ILE A C    5  
ATOM 7793  O O    . ILE A 1 63  ? -1.480  -4.560  -1.193  1.00 0.00 ? 63  ILE A O    5  
ATOM 7794  C CB   . ILE A 1 63  ? -1.676  -1.639  -1.468  1.00 0.00 ? 63  ILE A CB   5  
ATOM 7795  C CG1  . ILE A 1 63  ? -1.813  -0.221  -2.024  1.00 0.00 ? 63  ILE A CG1  5  
ATOM 7796  C CG2  . ILE A 1 63  ? -0.806  -1.680  -0.209  1.00 0.00 ? 63  ILE A CG2  5  
ATOM 7797  C CD1  . ILE A 1 63  ? -3.281  0.209   -2.074  1.00 0.00 ? 63  ILE A CD1  5  
ATOM 7798  H H    . ILE A 1 63  ? -1.851  -2.379  -4.482  1.00 0.00 ? 63  ILE A H    5  
ATOM 7799  H HA   . ILE A 1 63  ? -0.257  -2.134  -2.971  1.00 0.00 ? 63  ILE A HA   5  
ATOM 7800  H HB   . ILE A 1 63  ? -2.674  -1.971  -1.180  1.00 0.00 ? 63  ILE A HB   5  
ATOM 7801  H HG13 . ILE A 1 63  ? -1.383  -0.176  -3.025  1.00 0.00 ? 63  ILE A HG13 5  
ATOM 7802  H HG21 . ILE A 1 63  ? -0.582  -2.717  0.045   1.00 0.00 ? 63  ILE A HG21 5  
ATOM 7803  H HG22 . ILE A 1 63  ? 0.123   -1.141  -0.393  1.00 0.00 ? 63  ILE A HG22 5  
ATOM 7804  H HG23 . ILE A 1 63  ? -1.340  -1.212  0.617   1.00 0.00 ? 63  ILE A HG23 5  
ATOM 7805  H HD11 . ILE A 1 63  ? -3.348  1.226   -2.461  1.00 0.00 ? 63  ILE A HD11 5  
ATOM 7806  H HD12 . ILE A 1 63  ? -3.834  -0.464  -2.726  1.00 0.00 ? 63  ILE A HD12 5  
ATOM 7807  H HD13 . ILE A 1 63  ? -3.703  0.173   -1.070  1.00 0.00 ? 63  ILE A HD13 5  
ATOM 7808  N N    . PHE A 1 64  ? 0.410   -4.440  -2.429  1.00 0.00 ? 64  PHE A N    5  
ATOM 7809  C CA   . PHE A 1 64  ? 0.911   -5.732  -1.992  1.00 0.00 ? 64  PHE A CA   5  
ATOM 7810  C C    . PHE A 1 64  ? 2.121   -5.568  -1.072  1.00 0.00 ? 64  PHE A C    5  
ATOM 7811  O O    . PHE A 1 64  ? 2.801   -4.543  -1.111  1.00 0.00 ? 64  PHE A O    5  
ATOM 7812  C CB   . PHE A 1 64  ? 1.338   -6.493  -3.248  1.00 0.00 ? 64  PHE A CB   5  
ATOM 7813  C CG   . PHE A 1 64  ? 0.318   -7.528  -3.727  1.00 0.00 ? 64  PHE A CG   5  
ATOM 7814  C CD1  . PHE A 1 64  ? -0.817  -7.124  -4.356  1.00 0.00 ? 64  PHE A CD1  5  
ATOM 7815  C CD2  . PHE A 1 64  ? 0.546   -8.853  -3.520  1.00 0.00 ? 64  PHE A CD2  5  
ATOM 7816  C CE1  . PHE A 1 64  ? -1.763  -8.085  -4.800  1.00 0.00 ? 64  PHE A CE1  5  
ATOM 7817  C CE2  . PHE A 1 64  ? -0.401  -9.814  -3.963  1.00 0.00 ? 64  PHE A CE2  5  
ATOM 7818  C CZ   . PHE A 1 64  ? -1.536  -9.409  -4.595  1.00 0.00 ? 64  PHE A CZ   5  
ATOM 7819  H H    . PHE A 1 64  ? 1.000   -3.953  -3.073  1.00 0.00 ? 64  PHE A H    5  
ATOM 7820  H HA   . PHE A 1 64  ? 0.105   -6.223  -1.446  1.00 0.00 ? 64  PHE A HA   5  
ATOM 7821  H HB3  . PHE A 1 64  ? 2.285   -6.995  -3.051  1.00 0.00 ? 64  PHE A HB3  5  
ATOM 7822  H HD1  . PHE A 1 64  ? -1.000  -6.061  -4.522  1.00 0.00 ? 64  PHE A HD1  5  
ATOM 7823  H HD2  . PHE A 1 64  ? 1.455   -9.177  -3.013  1.00 0.00 ? 64  PHE A HD2  5  
ATOM 7824  H HE1  . PHE A 1 64  ? -2.673  -7.760  -5.306  1.00 0.00 ? 64  PHE A HE1  5  
ATOM 7825  H HE2  . PHE A 1 64  ? -0.218  -10.876 -3.798  1.00 0.00 ? 64  PHE A HE2  5  
ATOM 7826  H HZ   . PHE A 1 64  ? -2.262  -10.147 -4.934  1.00 0.00 ? 64  PHE A HZ   5  
ATOM 7827  N N    . VAL A 1 65  ? 2.356   -6.593  -0.266  1.00 0.00 ? 65  VAL A N    5  
ATOM 7828  C CA   . VAL A 1 65  ? 3.474   -6.575  0.662   1.00 0.00 ? 65  VAL A CA   5  
ATOM 7829  C C    . VAL A 1 65  ? 4.761   -6.917  -0.090  1.00 0.00 ? 65  VAL A C    5  
ATOM 7830  O O    . VAL A 1 65  ? 4.734   -7.665  -1.067  1.00 0.00 ? 65  VAL A O    5  
ATOM 7831  C CB   . VAL A 1 65  ? 3.196   -7.522  1.833   1.00 0.00 ? 65  VAL A CB   5  
ATOM 7832  C CG1  . VAL A 1 65  ? 4.414   -7.628  2.753   1.00 0.00 ? 65  VAL A CG1  5  
ATOM 7833  C CG2  . VAL A 1 65  ? 1.956   -7.079  2.614   1.00 0.00 ? 65  VAL A CG2  5  
ATOM 7834  H H    . VAL A 1 65  ? 1.798   -7.423  -0.241  1.00 0.00 ? 65  VAL A H    5  
ATOM 7835  H HA   . VAL A 1 65  ? 3.555   -5.563  1.058   1.00 0.00 ? 65  VAL A HA   5  
ATOM 7836  H HB   . VAL A 1 65  ? 2.998   -8.513  1.423   1.00 0.00 ? 65  VAL A HB   5  
ATOM 7837  H HG11 . VAL A 1 65  ? 4.083   -7.822  3.773   1.00 0.00 ? 65  VAL A HG11 5  
ATOM 7838  H HG12 . VAL A 1 65  ? 5.054   -8.443  2.416   1.00 0.00 ? 65  VAL A HG12 5  
ATOM 7839  H HG13 . VAL A 1 65  ? 4.973   -6.692  2.725   1.00 0.00 ? 65  VAL A HG13 5  
ATOM 7840  H HG21 . VAL A 1 65  ? 1.348   -7.951  2.854   1.00 0.00 ? 65  VAL A HG21 5  
ATOM 7841  H HG22 . VAL A 1 65  ? 2.263   -6.585  3.535   1.00 0.00 ? 65  VAL A HG22 5  
ATOM 7842  H HG23 . VAL A 1 65  ? 1.373   -6.386  2.007   1.00 0.00 ? 65  VAL A HG23 5  
ATOM 7843  N N    . LYS A 1 66  ? 5.858   -6.353  0.394   1.00 0.00 ? 66  LYS A N    5  
ATOM 7844  C CA   . LYS A 1 66  ? 7.154   -6.588  -0.222  1.00 0.00 ? 66  LYS A CA   5  
ATOM 7845  C C    . LYS A 1 66  ? 8.031   -7.391  0.741   1.00 0.00 ? 66  LYS A C    5  
ATOM 7846  O O    . LYS A 1 66  ? 8.395   -8.530  0.451   1.00 0.00 ? 66  LYS A O    5  
ATOM 7847  C CB   . LYS A 1 66  ? 7.782   -5.267  -0.669  1.00 0.00 ? 66  LYS A CB   5  
ATOM 7848  C CG   . LYS A 1 66  ? 9.221   -5.477  -1.144  1.00 0.00 ? 66  LYS A CG   5  
ATOM 7849  C CD   . LYS A 1 66  ? 10.177  -4.511  -0.443  1.00 0.00 ? 66  LYS A CD   5  
ATOM 7850  C CE   . LYS A 1 66  ? 11.634  -4.861  -0.751  1.00 0.00 ? 66  LYS A CE   5  
ATOM 7851  N NZ   . LYS A 1 66  ? 12.490  -4.600  0.428   1.00 0.00 ? 66  LYS A NZ   5  
ATOM 7852  H H    . LYS A 1 66  ? 5.871   -5.746  1.188   1.00 0.00 ? 66  LYS A H    5  
ATOM 7853  H HA   . LYS A 1 66  ? 6.986   -7.185  -1.118  1.00 0.00 ? 66  LYS A HA   5  
ATOM 7854  H HB3  . LYS A 1 66  ? 7.768   -4.555  0.157   1.00 0.00 ? 66  LYS A HB3  5  
ATOM 7855  H HG3  . LYS A 1 66  ? 9.276   -5.331  -2.223  1.00 0.00 ? 66  LYS A HG3  5  
ATOM 7856  H HD3  . LYS A 1 66  ? 10.011  -4.547  0.634   1.00 0.00 ? 66  LYS A HD3  5  
ATOM 7857  H HE3  . LYS A 1 66  ? 11.984  -4.272  -1.599  1.00 0.00 ? 66  LYS A HE3  5  
ATOM 7858  H HZ1  . LYS A 1 66  ? 12.401  -5.356  1.077   1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 7859  H HZ2  . LYS A 1 66  ? 13.444  -4.522  0.136   1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 7860  H HZ3  . LYS A 1 66  ? 12.204  -3.748  0.865   1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 7861  N N    . GLN A 1 67  ? 8.345   -6.768  1.867   1.00 0.00 ? 67  GLN A N    5  
ATOM 7862  C CA   . GLN A 1 67  ? 9.173   -7.409  2.873   1.00 0.00 ? 67  GLN A CA   5  
ATOM 7863  C C    . GLN A 1 67  ? 8.590   -7.177  4.268   1.00 0.00 ? 67  GLN A C    5  
ATOM 7864  O O    . GLN A 1 67  ? 7.765   -6.284  4.460   1.00 0.00 ? 67  GLN A O    5  
ATOM 7865  C CB   . GLN A 1 67  ? 10.618  -6.914  2.793   1.00 0.00 ? 67  GLN A CB   5  
ATOM 7866  C CG   . GLN A 1 67  ? 11.455  -7.807  1.874   1.00 0.00 ? 67  GLN A CG   5  
ATOM 7867  C CD   . GLN A 1 67  ? 12.724  -8.285  2.582   1.00 0.00 ? 67  GLN A CD   5  
ATOM 7868  O OE1  . GLN A 1 67  ? 12.702  -8.738  3.714   1.00 0.00 ? 67  GLN A OE1  5  
ATOM 7869  N NE2  . GLN A 1 67  ? 13.829  -8.159  1.853   1.00 0.00 ? 67  GLN A NE2  5  
ATOM 7870  H H    . GLN A 1 67  ? 8.045   -5.841  2.094   1.00 0.00 ? 67  GLN A H    5  
ATOM 7871  H HA   . GLN A 1 67  ? 9.147   -8.473  2.634   1.00 0.00 ? 67  GLN A HA   5  
ATOM 7872  H HB3  . GLN A 1 67  ? 11.058  -6.899  3.790   1.00 0.00 ? 67  GLN A HB3  5  
ATOM 7873  H HG3  . GLN A 1 67  ? 11.721  -7.258  0.971   1.00 0.00 ? 67  GLN A HG3  5  
ATOM 7874  H HE21 . GLN A 1 67  ? 13.779  -7.779  0.930   1.00 0.00 ? 67  GLN A HE21 5  
ATOM 7875  H HE22 . GLN A 1 67  ? 14.711  -8.445  2.229   1.00 0.00 ? 67  GLN A HE22 5  
ATOM 7876  N N    . VAL A 1 68  ? 9.043   -7.993  5.208   1.00 0.00 ? 68  VAL A N    5  
ATOM 7877  C CA   . VAL A 1 68  ? 8.576   -7.887  6.580   1.00 0.00 ? 68  VAL A CA   5  
ATOM 7878  C C    . VAL A 1 68  ? 9.777   -7.905  7.526   1.00 0.00 ? 68  VAL A C    5  
ATOM 7879  O O    . VAL A 1 68  ? 10.551  -8.862  7.535   1.00 0.00 ? 68  VAL A O    5  
ATOM 7880  C CB   . VAL A 1 68  ? 7.565   -8.997  6.876   1.00 0.00 ? 68  VAL A CB   5  
ATOM 7881  C CG1  . VAL A 1 68  ? 7.282   -9.094  8.377   1.00 0.00 ? 68  VAL A CG1  5  
ATOM 7882  C CG2  . VAL A 1 68  ? 6.272   -8.788  6.087   1.00 0.00 ? 68  VAL A CG2  5  
ATOM 7883  H H    . VAL A 1 68  ? 9.714   -8.717  5.044   1.00 0.00 ? 68  VAL A H    5  
ATOM 7884  H HA   . VAL A 1 68  ? 8.064   -6.929  6.680   1.00 0.00 ? 68  VAL A HA   5  
ATOM 7885  H HB   . VAL A 1 68  ? 8.002   -9.943  6.557   1.00 0.00 ? 68  VAL A HB   5  
ATOM 7886  H HG11 . VAL A 1 68  ? 7.861   -8.338  8.905   1.00 0.00 ? 68  VAL A HG11 5  
ATOM 7887  H HG12 . VAL A 1 68  ? 6.219   -8.931  8.558   1.00 0.00 ? 68  VAL A HG12 5  
ATOM 7888  H HG13 . VAL A 1 68  ? 7.564   -10.084 8.736   1.00 0.00 ? 68  VAL A HG13 5  
ATOM 7889  H HG21 . VAL A 1 68  ? 5.968   -9.729  5.629   1.00 0.00 ? 68  VAL A HG21 5  
ATOM 7890  H HG22 . VAL A 1 68  ? 5.488   -8.440  6.760   1.00 0.00 ? 68  VAL A HG22 5  
ATOM 7891  H HG23 . VAL A 1 68  ? 6.438   -8.042  5.309   1.00 0.00 ? 68  VAL A HG23 5  
ATOM 7892  N N    . LYS A 1 69  ? 9.899   -6.837  8.298   1.00 0.00 ? 69  LYS A N    5  
ATOM 7893  C CA   . LYS A 1 69  ? 10.994  -6.716  9.244   1.00 0.00 ? 69  LYS A CA   5  
ATOM 7894  C C    . LYS A 1 69  ? 11.001  -7.938  10.167  1.00 0.00 ? 69  LYS A C    5  
ATOM 7895  O O    . LYS A 1 69  ? 10.052  -8.161  10.915  1.00 0.00 ? 69  LYS A O    5  
ATOM 7896  C CB   . LYS A 1 69  ? 10.913  -5.384  9.992   1.00 0.00 ? 69  LYS A CB   5  
ATOM 7897  C CG   . LYS A 1 69  ? 12.308  -4.801  10.226  1.00 0.00 ? 69  LYS A CG   5  
ATOM 7898  C CD   . LYS A 1 69  ? 12.231  -3.307  10.552  1.00 0.00 ? 69  LYS A CD   5  
ATOM 7899  C CE   . LYS A 1 69  ? 13.629  -2.716  10.744  1.00 0.00 ? 69  LYS A CE   5  
ATOM 7900  N NZ   . LYS A 1 69  ? 13.811  -1.526  9.882   1.00 0.00 ? 69  LYS A NZ   5  
ATOM 7901  H H    . LYS A 1 69  ? 9.265   -6.062  8.283   1.00 0.00 ? 69  LYS A H    5  
ATOM 7902  H HA   . LYS A 1 69  ? 11.921  -6.709  8.673   1.00 0.00 ? 69  LYS A HA   5  
ATOM 7903  H HB3  . LYS A 1 69  ? 10.411  -5.529  10.949  1.00 0.00 ? 69  LYS A HB3  5  
ATOM 7904  H HG3  . LYS A 1 69  ? 12.923  -4.952  9.338   1.00 0.00 ? 69  LYS A HG3  5  
ATOM 7905  H HD3  . LYS A 1 69  ? 11.641  -3.158  11.455  1.00 0.00 ? 69  LYS A HD3  5  
ATOM 7906  H HE3  . LYS A 1 69  ? 14.383  -3.463  10.505  1.00 0.00 ? 69  LYS A HE3  5  
ATOM 7907  H HZ1  . LYS A 1 69  ? 13.056  -1.470  9.228   1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 7908  H HZ2  . LYS A 1 69  ? 13.822  -0.702  10.448  1.00 0.00 ? 69  LYS A HZ2  5  
ATOM 7909  H HZ3  . LYS A 1 69  ? 14.677  -1.602  9.387   1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 7910  N N    . GLU A 1 70  ? 12.083  -8.698  10.079  1.00 0.00 ? 70  GLU A N    5  
ATOM 7911  C CA   . GLU A 1 70  ? 12.228  -9.892  10.894  1.00 0.00 ? 70  GLU A CA   5  
ATOM 7912  C C    . GLU A 1 70  ? 12.452  -9.510  12.359  1.00 0.00 ? 70  GLU A C    5  
ATOM 7913  O O    . GLU A 1 70  ? 13.587  -9.300  12.782  1.00 0.00 ? 70  GLU A O    5  
ATOM 7914  C CB   . GLU A 1 70  ? 13.365  -10.775 10.377  1.00 0.00 ? 70  GLU A CB   5  
ATOM 7915  C CG   . GLU A 1 70  ? 13.178  -12.226 10.826  1.00 0.00 ? 70  GLU A CG   5  
ATOM 7916  C CD   . GLU A 1 70  ? 13.660  -13.198 9.747   1.00 0.00 ? 70  GLU A CD   5  
ATOM 7917  O OE1  . GLU A 1 70  ? 12.891  -13.406 8.783   1.00 0.00 ? 70  GLU A OE1  5  
ATOM 7918  O OE2  . GLU A 1 70  ? 14.788  -13.714 9.909   1.00 0.00 ? 70  GLU A OE2  5  
ATOM 7919  H H    . GLU A 1 70  ? 12.851  -8.510  9.466   1.00 0.00 ? 70  GLU A H    5  
ATOM 7920  H HA   . GLU A 1 70  ? 11.284  -10.428 10.792  1.00 0.00 ? 70  GLU A HA   5  
ATOM 7921  H HB3  . GLU A 1 70  ? 14.320  -10.398 10.746  1.00 0.00 ? 70  GLU A HB3  5  
ATOM 7922  H HG3  . GLU A 1 70  ? 12.126  -12.412 11.042  1.00 0.00 ? 70  GLU A HG3  5  
ATOM 7923  N N    . GLY A 1 71  ? 11.351  -9.431  13.093  1.00 0.00 ? 71  GLY A N    5  
ATOM 7924  C CA   . GLY A 1 71  ? 11.412  -9.078  14.500  1.00 0.00 ? 71  GLY A CA   5  
ATOM 7925  C C    . GLY A 1 71  ? 10.837  -7.682  14.741  1.00 0.00 ? 71  GLY A C    5  
ATOM 7926  O O    . GLY A 1 71  ? 11.302  -6.958  15.621  1.00 0.00 ? 71  GLY A O    5  
ATOM 7927  H H    . GLY A 1 71  ? 10.430  -9.604  12.741  1.00 0.00 ? 71  GLY A H    5  
ATOM 7928  H HA2  . GLY A 1 71  ? 10.858  -9.811  15.088  1.00 0.00 ? 71  GLY A HA2  5  
ATOM 7929  H HA3  . GLY A 1 71  ? 12.447  -9.112  14.842  1.00 0.00 ? 71  GLY A HA3  5  
ATOM 7930  N N    . GLY A 1 72  ? 9.832   -7.345  13.946  1.00 0.00 ? 72  GLY A N    5  
ATOM 7931  C CA   . GLY A 1 72  ? 9.187   -6.049  14.062  1.00 0.00 ? 72  GLY A CA   5  
ATOM 7932  C C    . GLY A 1 72  ? 7.707   -6.203  14.419  1.00 0.00 ? 72  GLY A C    5  
ATOM 7933  O O    . GLY A 1 72  ? 7.307   -7.207  15.005  1.00 0.00 ? 72  GLY A O    5  
ATOM 7934  H H    . GLY A 1 72  ? 9.460   -7.941  13.233  1.00 0.00 ? 72  GLY A H    5  
ATOM 7935  H HA2  . GLY A 1 72  ? 9.690   -5.456  14.825  1.00 0.00 ? 72  GLY A HA2  5  
ATOM 7936  H HA3  . GLY A 1 72  ? 9.283   -5.506  13.122  1.00 0.00 ? 72  GLY A HA3  5  
ATOM 7937  N N    . PRO A 1 73  ? 6.914   -5.165  14.040  1.00 0.00 ? 73  PRO A N    5  
ATOM 7938  C CA   . PRO A 1 73  ? 5.487   -5.175  14.314  1.00 0.00 ? 73  PRO A CA   5  
ATOM 7939  C C    . PRO A 1 73  ? 4.753   -6.126  13.366  1.00 0.00 ? 73  PRO A C    5  
ATOM 7940  O O    . PRO A 1 73  ? 4.236   -7.156  13.793  1.00 0.00 ? 73  PRO A O    5  
ATOM 7941  C CB   . PRO A 1 73  ? 5.047   -3.727  14.161  1.00 0.00 ? 73  PRO A CB   5  
ATOM 7942  C CG   . PRO A 1 73  ? 6.141   -3.042  13.358  1.00 0.00 ? 73  PRO A CG   5  
ATOM 7943  C CD   . PRO A 1 73  ? 7.353   -3.958  13.344  1.00 0.00 ? 73  PRO A CD   5  
ATOM 7944  H HA   . PRO A 1 73  ? 5.313   -5.520  15.236  1.00 0.00 ? 73  PRO A HA   5  
ATOM 7945  H HB3  . PRO A 1 73  ? 4.921   -3.253  15.134  1.00 0.00 ? 73  PRO A HB3  5  
ATOM 7946  H HG3  . PRO A 1 73  ? 6.394   -2.079  13.803  1.00 0.00 ? 73  PRO A HG3  5  
ATOM 7947  H HD3  . PRO A 1 73  ? 8.203   -3.497  13.847  1.00 0.00 ? 73  PRO A HD3  5  
ATOM 7948  N N    . ALA A 1 74  ? 4.732   -5.745  12.097  1.00 0.00 ? 74  ALA A N    5  
ATOM 7949  C CA   . ALA A 1 74  ? 4.071   -6.552  11.085  1.00 0.00 ? 74  ALA A CA   5  
ATOM 7950  C C    . ALA A 1 74  ? 4.382   -8.029  11.334  1.00 0.00 ? 74  ALA A C    5  
ATOM 7951  O O    . ALA A 1 74  ? 3.475   -8.858  11.381  1.00 0.00 ? 74  ALA A O    5  
ATOM 7952  C CB   . ALA A 1 74  ? 4.510   -6.088  9.695   1.00 0.00 ? 74  ALA A CB   5  
ATOM 7953  H H    . ALA A 1 74  ? 5.156   -4.906  11.758  1.00 0.00 ? 74  ALA A H    5  
ATOM 7954  H HA   . ALA A 1 74  ? 2.997   -6.394  11.186  1.00 0.00 ? 74  ALA A HA   5  
ATOM 7955  H HB1  . ALA A 1 74  ? 4.599   -5.002  9.685   1.00 0.00 ? 74  ALA A HB1  5  
ATOM 7956  H HB2  . ALA A 1 74  ? 5.475   -6.534  9.453   1.00 0.00 ? 74  ALA A HB2  5  
ATOM 7957  H HB3  . ALA A 1 74  ? 3.772   -6.400  8.959   1.00 0.00 ? 74  ALA A HB3  5  
ATOM 7958  N N    . PHE A 1 75  ? 5.667   -8.314  11.486  1.00 0.00 ? 75  PHE A N    5  
ATOM 7959  C CA   . PHE A 1 75  ? 6.109   -9.677  11.727  1.00 0.00 ? 75  PHE A CA   5  
ATOM 7960  C C    . PHE A 1 75  ? 5.263   -10.342 12.815  1.00 0.00 ? 75  PHE A C    5  
ATOM 7961  O O    . PHE A 1 75  ? 4.830   -11.482 12.658  1.00 0.00 ? 75  PHE A O    5  
ATOM 7962  C CB   . PHE A 1 75  ? 7.560   -9.598  12.203  1.00 0.00 ? 75  PHE A CB   5  
ATOM 7963  C CG   . PHE A 1 75  ? 8.083   -10.894 12.826  1.00 0.00 ? 75  PHE A CG   5  
ATOM 7964  C CD1  . PHE A 1 75  ? 8.117   -12.037 12.089  1.00 0.00 ? 75  PHE A CD1  5  
ATOM 7965  C CD2  . PHE A 1 75  ? 8.513   -10.905 14.116  1.00 0.00 ? 75  PHE A CD2  5  
ATOM 7966  C CE1  . PHE A 1 75  ? 8.601   -13.240 12.666  1.00 0.00 ? 75  PHE A CE1  5  
ATOM 7967  C CE2  . PHE A 1 75  ? 8.996   -12.108 14.694  1.00 0.00 ? 75  PHE A CE2  5  
ATOM 7968  C CZ   . PHE A 1 75  ? 9.031   -13.251 13.957  1.00 0.00 ? 75  PHE A CZ   5  
ATOM 7969  H H    . PHE A 1 75  ? 6.399   -7.632  11.445  1.00 0.00 ? 75  PHE A H    5  
ATOM 7970  H HA   . PHE A 1 75  ? 5.993   -10.225 10.791  1.00 0.00 ? 75  PHE A HA   5  
ATOM 7971  H HB3  . PHE A 1 75  ? 7.650   -8.795  12.935  1.00 0.00 ? 75  PHE A HB3  5  
ATOM 7972  H HD1  . PHE A 1 75  ? 7.772   -12.028 11.054  1.00 0.00 ? 75  PHE A HD1  5  
ATOM 7973  H HD2  . PHE A 1 75  ? 8.484   -9.989  14.707  1.00 0.00 ? 75  PHE A HD2  5  
ATOM 7974  H HE1  . PHE A 1 75  ? 8.628   -14.156 12.075  1.00 0.00 ? 75  PHE A HE1  5  
ATOM 7975  H HE2  . PHE A 1 75  ? 9.340   -12.117 15.728  1.00 0.00 ? 75  PHE A HE2  5  
ATOM 7976  H HZ   . PHE A 1 75  ? 9.402   -14.174 14.400  1.00 0.00 ? 75  PHE A HZ   5  
ATOM 7977  N N    . GLU A 1 76  ? 5.055   -9.602  13.893  1.00 0.00 ? 76  GLU A N    5  
ATOM 7978  C CA   . GLU A 1 76  ? 4.268   -10.106 15.005  1.00 0.00 ? 76  GLU A CA   5  
ATOM 7979  C C    . GLU A 1 76  ? 2.794   -10.215 14.608  1.00 0.00 ? 76  GLU A C    5  
ATOM 7980  O O    . GLU A 1 76  ? 2.185   -11.273 14.758  1.00 0.00 ? 76  GLU A O    5  
ATOM 7981  C CB   . GLU A 1 76  ? 4.439   -9.222  16.244  1.00 0.00 ? 76  GLU A CB   5  
ATOM 7982  C CG   . GLU A 1 76  ? 5.915   -9.095  16.626  1.00 0.00 ? 76  GLU A CG   5  
ATOM 7983  C CD   . GLU A 1 76  ? 6.199   -9.805  17.952  1.00 0.00 ? 76  GLU A CD   5  
ATOM 7984  O OE1  . GLU A 1 76  ? 5.349   -9.677  18.858  1.00 0.00 ? 76  GLU A OE1  5  
ATOM 7985  O OE2  . GLU A 1 76  ? 7.263   -10.457 18.028  1.00 0.00 ? 76  GLU A OE2  5  
ATOM 7986  H H    . GLU A 1 76  ? 5.411   -8.676  14.013  1.00 0.00 ? 76  GLU A H    5  
ATOM 7987  H HA   . GLU A 1 76  ? 4.668   -11.097 15.217  1.00 0.00 ? 76  GLU A HA   5  
ATOM 7988  H HB3  . GLU A 1 76  ? 3.878   -9.645  17.077  1.00 0.00 ? 76  GLU A HB3  5  
ATOM 7989  H HG3  . GLU A 1 76  ? 6.183   -8.041  16.708  1.00 0.00 ? 76  GLU A HG3  5  
ATOM 7990  N N    . ALA A 1 77  ? 2.266   -9.107  14.111  1.00 0.00 ? 77  ALA A N    5  
ATOM 7991  C CA   . ALA A 1 77  ? 0.875   -9.064  13.691  1.00 0.00 ? 77  ALA A CA   5  
ATOM 7992  C C    . ALA A 1 77  ? 0.524   -10.369 12.972  1.00 0.00 ? 77  ALA A C    5  
ATOM 7993  O O    . ALA A 1 77  ? -0.623  -10.811 13.008  1.00 0.00 ? 77  ALA A O    5  
ATOM 7994  C CB   . ALA A 1 77  ? 0.644   -7.833  12.813  1.00 0.00 ? 77  ALA A CB   5  
ATOM 7995  H H    . ALA A 1 77  ? 2.769   -8.250  13.994  1.00 0.00 ? 77  ALA A H    5  
ATOM 7996  H HA   . ALA A 1 77  ? 0.260   -8.977  14.588  1.00 0.00 ? 77  ALA A HA   5  
ATOM 7997  H HB1  . ALA A 1 77  ? 0.703   -8.120  11.764  1.00 0.00 ? 77  ALA A HB1  5  
ATOM 7998  H HB2  . ALA A 1 77  ? -0.342  -7.418  13.022  1.00 0.00 ? 77  ALA A HB2  5  
ATOM 7999  H HB3  . ALA A 1 77  ? 1.407   -7.085  13.029  1.00 0.00 ? 77  ALA A HB3  5  
ATOM 8000  N N    . GLY A 1 78  ? 1.533   -10.946 12.336  1.00 0.00 ? 78  GLY A N    5  
ATOM 8001  C CA   . GLY A 1 78  ? 1.345   -12.190 11.610  1.00 0.00 ? 78  GLY A CA   5  
ATOM 8002  C C    . GLY A 1 78  ? 1.452   -11.965 10.099  1.00 0.00 ? 78  GLY A C    5  
ATOM 8003  O O    . GLY A 1 78  ? 1.249   -12.890 9.315   1.00 0.00 ? 78  GLY A O    5  
ATOM 8004  H H    . GLY A 1 78  ? 2.462   -10.579 12.313  1.00 0.00 ? 78  GLY A H    5  
ATOM 8005  H HA2  . GLY A 1 78  ? 2.092   -12.917 11.926  1.00 0.00 ? 78  GLY A HA2  5  
ATOM 8006  H HA3  . GLY A 1 78  ? 0.369   -12.611 11.849  1.00 0.00 ? 78  GLY A HA3  5  
ATOM 8007  N N    . LEU A 1 79  ? 1.770   -10.730 9.740   1.00 0.00 ? 79  LEU A N    5  
ATOM 8008  C CA   . LEU A 1 79  ? 1.907   -10.371 8.337   1.00 0.00 ? 79  LEU A CA   5  
ATOM 8009  C C    . LEU A 1 79  ? 2.915   -11.310 7.672   1.00 0.00 ? 79  LEU A C    5  
ATOM 8010  O O    . LEU A 1 79  ? 3.433   -12.224 8.311   1.00 0.00 ? 79  LEU A O    5  
ATOM 8011  C CB   . LEU A 1 79  ? 2.259   -8.889  8.196   1.00 0.00 ? 79  LEU A CB   5  
ATOM 8012  C CG   . LEU A 1 79  ? 1.487   -8.115  7.127   1.00 0.00 ? 79  LEU A CG   5  
ATOM 8013  C CD1  . LEU A 1 79  ? 0.038   -7.879  7.560   1.00 0.00 ? 79  LEU A CD1  5  
ATOM 8014  C CD2  . LEU A 1 79  ? 2.200   -6.808  6.773   1.00 0.00 ? 79  LEU A CD2  5  
ATOM 8015  H H    . LEU A 1 79  ? 1.933   -9.984  10.384  1.00 0.00 ? 79  LEU A H    5  
ATOM 8016  H HA   . LEU A 1 79  ? 0.935   -10.518 7.867   1.00 0.00 ? 79  LEU A HA   5  
ATOM 8017  H HB3  . LEU A 1 79  ? 3.325   -8.809  7.976   1.00 0.00 ? 79  LEU A HB3  5  
ATOM 8018  H HG   . LEU A 1 79  ? 1.457   -8.721  6.221   1.00 0.00 ? 79  LEU A HG   5  
ATOM 8019  H HD11 . LEU A 1 79  ? -0.362  -8.792  7.998   1.00 0.00 ? 79  LEU A HD11 5  
ATOM 8020  H HD12 . LEU A 1 79  ? 0.007   -7.077  8.297   1.00 0.00 ? 79  LEU A HD12 5  
ATOM 8021  H HD13 . LEU A 1 79  ? -0.559  -7.599  6.691   1.00 0.00 ? 79  LEU A HD13 5  
ATOM 8022  H HD21 . LEU A 1 79  ? 1.761   -5.990  7.342   1.00 0.00 ? 79  LEU A HD21 5  
ATOM 8023  H HD22 . LEU A 1 79  ? 3.258   -6.894  7.016   1.00 0.00 ? 79  LEU A HD22 5  
ATOM 8024  H HD23 . LEU A 1 79  ? 2.088   -6.611  5.707   1.00 0.00 ? 79  LEU A HD23 5  
ATOM 8025  N N    . CYS A 1 80  ? 3.162   -11.053 6.396   1.00 0.00 ? 80  CYS A N    5  
ATOM 8026  C CA   . CYS A 1 80  ? 4.098   -11.863 5.635   1.00 0.00 ? 80  CYS A CA   5  
ATOM 8027  C C    . CYS A 1 80  ? 4.304   -11.206 4.270   1.00 0.00 ? 80  CYS A C    5  
ATOM 8028  O O    . CYS A 1 80  ? 3.952   -10.043 4.077   1.00 0.00 ? 80  CYS A O    5  
ATOM 8029  C CB   . CYS A 1 80  ? 3.619   -13.310 5.507   1.00 0.00 ? 80  CYS A CB   5  
ATOM 8030  S SG   . CYS A 1 80  ? 5.008   -14.460 5.813   1.00 0.00 ? 80  CYS A SG   5  
ATOM 8031  H H    . CYS A 1 80  ? 2.735   -10.307 5.883   1.00 0.00 ? 80  CYS A H    5  
ATOM 8032  H HA   . CYS A 1 80  ? 5.030   -11.880 6.202   1.00 0.00 ? 80  CYS A HA   5  
ATOM 8033  H HB3  . CYS A 1 80  ? 3.209   -13.478 4.510   1.00 0.00 ? 80  CYS A HB3  5  
ATOM 8034  H HG   . CYS A 1 80  ? 4.520   -14.971 6.938   1.00 0.00 ? 80  CYS A HG   5  
ATOM 8035  N N    . THR A 1 81  ? 4.874   -11.979 3.357   1.00 0.00 ? 81  THR A N    5  
ATOM 8036  C CA   . THR A 1 81  ? 5.131   -11.486 2.014   1.00 0.00 ? 81  THR A CA   5  
ATOM 8037  C C    . THR A 1 81  ? 4.107   -12.057 1.031   1.00 0.00 ? 81  THR A C    5  
ATOM 8038  O O    . THR A 1 81  ? 3.836   -13.257 1.041   1.00 0.00 ? 81  THR A O    5  
ATOM 8039  C CB   . THR A 1 81  ? 6.578   -11.828 1.654   1.00 0.00 ? 81  THR A CB   5  
ATOM 8040  O OG1  . THR A 1 81  ? 6.792   -13.103 2.254   1.00 0.00 ? 81  THR A OG1  5  
ATOM 8041  C CG2  . THR A 1 81  ? 7.587   -10.914 2.350   1.00 0.00 ? 81  THR A CG2  5  
ATOM 8042  H H    . THR A 1 81  ? 5.157   -12.923 3.521   1.00 0.00 ? 81  THR A H    5  
ATOM 8043  H HA   . THR A 1 81  ? 5.003   -10.403 2.015   1.00 0.00 ? 81  THR A HA   5  
ATOM 8044  H HB   . THR A 1 81  ? 6.722   -11.817 0.574   1.00 0.00 ? 81  THR A HB   5  
ATOM 8045  H HG1  . THR A 1 81  ? 7.679   -13.471 1.970   1.00 0.00 ? 81  THR A HG1  5  
ATOM 8046  H HG21 . THR A 1 81  ? 7.441   -10.966 3.429   1.00 0.00 ? 81  THR A HG21 5  
ATOM 8047  H HG22 . THR A 1 81  ? 8.599   -11.237 2.105   1.00 0.00 ? 81  THR A HG22 5  
ATOM 8048  H HG23 . THR A 1 81  ? 7.441   -9.889  2.013   1.00 0.00 ? 81  THR A HG23 5  
ATOM 8049  N N    . GLY A 1 82  ? 3.568   -11.173 0.207   1.00 0.00 ? 82  GLY A N    5  
ATOM 8050  C CA   . GLY A 1 82  ? 2.580   -11.574 -0.782  1.00 0.00 ? 82  GLY A CA   5  
ATOM 8051  C C    . GLY A 1 82  ? 1.201   -11.011 -0.437  1.00 0.00 ? 82  GLY A C    5  
ATOM 8052  O O    . GLY A 1 82  ? 0.414   -10.696 -1.329  1.00 0.00 ? 82  GLY A O    5  
ATOM 8053  H H    . GLY A 1 82  ? 3.795   -10.198 0.205   1.00 0.00 ? 82  GLY A H    5  
ATOM 8054  H HA2  . GLY A 1 82  ? 2.884   -11.224 -1.768  1.00 0.00 ? 82  GLY A HA2  5  
ATOM 8055  H HA3  . GLY A 1 82  ? 2.532   -12.662 -0.830  1.00 0.00 ? 82  GLY A HA3  5  
ATOM 8056  N N    . ASP A 1 83  ? 0.947   -10.901 0.859   1.00 0.00 ? 83  ASP A N    5  
ATOM 8057  C CA   . ASP A 1 83  ? -0.324  -10.382 1.332   1.00 0.00 ? 83  ASP A CA   5  
ATOM 8058  C C    . ASP A 1 83  ? -0.505  -8.950  0.827   1.00 0.00 ? 83  ASP A C    5  
ATOM 8059  O O    . ASP A 1 83  ? 0.473   -8.247  0.579   1.00 0.00 ? 83  ASP A O    5  
ATOM 8060  C CB   . ASP A 1 83  ? -0.373  -10.354 2.862   1.00 0.00 ? 83  ASP A CB   5  
ATOM 8061  C CG   . ASP A 1 83  ? -0.608  -11.712 3.527   1.00 0.00 ? 83  ASP A CG   5  
ATOM 8062  O OD1  . ASP A 1 83  ? -1.488  -12.444 3.026   1.00 0.00 ? 83  ASP A OD1  5  
ATOM 8063  O OD2  . ASP A 1 83  ? 0.099   -11.985 4.521   1.00 0.00 ? 83  ASP A OD2  5  
ATOM 8064  H H    . ASP A 1 83  ? 1.592   -11.160 1.578   1.00 0.00 ? 83  ASP A H    5  
ATOM 8065  H HA   . ASP A 1 83  ? -1.078  -11.063 0.936   1.00 0.00 ? 83  ASP A HA   5  
ATOM 8066  H HB3  . ASP A 1 83  ? -1.164  -9.673  3.172   1.00 0.00 ? 83  ASP A HB3  5  
ATOM 8067  N N    . ARG A 1 84  ? -1.763  -8.560  0.689   1.00 0.00 ? 84  ARG A N    5  
ATOM 8068  C CA   . ARG A 1 84  ? -2.085  -7.223  0.216   1.00 0.00 ? 84  ARG A CA   5  
ATOM 8069  C C    . ARG A 1 84  ? -3.001  -6.514  1.215   1.00 0.00 ? 84  ARG A C    5  
ATOM 8070  O O    . ARG A 1 84  ? -3.865  -7.143  1.826   1.00 0.00 ? 84  ARG A O    5  
ATOM 8071  C CB   . ARG A 1 84  ? -2.771  -7.272  -1.149  1.00 0.00 ? 84  ARG A CB   5  
ATOM 8072  C CG   . ARG A 1 84  ? -4.065  -8.089  -1.086  1.00 0.00 ? 84  ARG A CG   5  
ATOM 8073  C CD   . ARG A 1 84  ? -4.109  -9.132  -2.204  1.00 0.00 ? 84  ARG A CD   5  
ATOM 8074  N NE   . ARG A 1 84  ? -5.514  -9.413  -2.578  1.00 0.00 ? 84  ARG A NE   5  
ATOM 8075  C CZ   . ARG A 1 84  ? -5.915  -10.525 -3.207  1.00 0.00 ? 84  ARG A CZ   5  
ATOM 8076  N NH1  . ARG A 1 84  ? -5.022  -11.469 -3.537  1.00 0.00 ? 84  ARG A NH1  5  
ATOM 8077  N NH2  . ARG A 1 84  ? -7.210  -10.695 -3.506  1.00 0.00 ? 84  ARG A NH2  5  
ATOM 8078  H H    . ARG A 1 84  ? -2.554  -9.137  0.892   1.00 0.00 ? 84  ARG A H    5  
ATOM 8079  H HA   . ARG A 1 84  ? -1.124  -6.717  0.139   1.00 0.00 ? 84  ARG A HA   5  
ATOM 8080  H HB3  . ARG A 1 84  ? -2.096  -7.711  -1.885  1.00 0.00 ? 84  ARG A HB3  5  
ATOM 8081  H HG3  . ARG A 1 84  ? -4.922  -7.423  -1.169  1.00 0.00 ? 84  ARG A HG3  5  
ATOM 8082  H HD3  . ARG A 1 84  ? -3.622  -10.050 -1.875  1.00 0.00 ? 84  ARG A HD3  5  
ATOM 8083  H HE   . ARG A 1 84  ? -6.206  -8.730  -2.346  1.00 0.00 ? 84  ARG A HE   5  
ATOM 8084  H HH11 . ARG A 1 84  ? -4.056  -11.341 -3.314  1.00 0.00 ? 84  ARG A HH11 5  
ATOM 8085  H HH12 . ARG A 1 84  ? -5.323  -12.299 -4.006  1.00 0.00 ? 84  ARG A HH12 5  
ATOM 8086  H HH21 . ARG A 1 84  ? -7.876  -9.992  -3.261  1.00 0.00 ? 84  ARG A HH21 5  
ATOM 8087  H HH22 . ARG A 1 84  ? -7.509  -11.525 -3.977  1.00 0.00 ? 84  ARG A HH22 5  
ATOM 8088  N N    . ILE A 1 85  ? -2.784  -5.214  1.350   1.00 0.00 ? 85  ILE A N    5  
ATOM 8089  C CA   . ILE A 1 85  ? -3.580  -4.413  2.263   1.00 0.00 ? 85  ILE A CA   5  
ATOM 8090  C C    . ILE A 1 85  ? -4.897  -4.030  1.585   1.00 0.00 ? 85  ILE A C    5  
ATOM 8091  O O    . ILE A 1 85  ? -4.896  -3.365  0.551   1.00 0.00 ? 85  ILE A O    5  
ATOM 8092  C CB   . ILE A 1 85  ? -2.775  -3.211  2.763   1.00 0.00 ? 85  ILE A CB   5  
ATOM 8093  C CG1  . ILE A 1 85  ? -1.871  -3.607  3.934   1.00 0.00 ? 85  ILE A CG1  5  
ATOM 8094  C CG2  . ILE A 1 85  ? -3.696  -2.044  3.120   1.00 0.00 ? 85  ILE A CG2  5  
ATOM 8095  C CD1  . ILE A 1 85  ? -1.174  -4.942  3.663   1.00 0.00 ? 85  ILE A CD1  5  
ATOM 8096  H H    . ILE A 1 85  ? -2.081  -4.710  0.849   1.00 0.00 ? 85  ILE A H    5  
ATOM 8097  H HA   . ILE A 1 85  ? -3.806  -5.033  3.131   1.00 0.00 ? 85  ILE A HA   5  
ATOM 8098  H HB   . ILE A 1 85  ? -2.126  -2.876  1.955   1.00 0.00 ? 85  ILE A HB   5  
ATOM 8099  H HG13 . ILE A 1 85  ? -2.462  -3.679  4.847   1.00 0.00 ? 85  ILE A HG13 5  
ATOM 8100  H HG21 . ILE A 1 85  ? -4.406  -2.361  3.885   1.00 0.00 ? 85  ILE A HG21 5  
ATOM 8101  H HG22 . ILE A 1 85  ? -3.100  -1.214  3.499   1.00 0.00 ? 85  ILE A HG22 5  
ATOM 8102  H HG23 . ILE A 1 85  ? -4.238  -1.725  2.230   1.00 0.00 ? 85  ILE A HG23 5  
ATOM 8103  H HD11 . ILE A 1 85  ? -1.909  -5.747  3.691   1.00 0.00 ? 85  ILE A HD11 5  
ATOM 8104  H HD12 . ILE A 1 85  ? -0.704  -4.914  2.681   1.00 0.00 ? 85  ILE A HD12 5  
ATOM 8105  H HD13 . ILE A 1 85  ? -0.415  -5.116  4.425   1.00 0.00 ? 85  ILE A HD13 5  
ATOM 8106  N N    . ILE A 1 86  ? -5.990  -4.468  2.196   1.00 0.00 ? 86  ILE A N    5  
ATOM 8107  C CA   . ILE A 1 86  ? -7.309  -4.180  1.664   1.00 0.00 ? 86  ILE A CA   5  
ATOM 8108  C C    . ILE A 1 86  ? -7.902  -2.980  2.403   1.00 0.00 ? 86  ILE A C    5  
ATOM 8109  O O    . ILE A 1 86  ? -8.606  -2.165  1.809   1.00 0.00 ? 86  ILE A O    5  
ATOM 8110  C CB   . ILE A 1 86  ? -8.192  -5.430  1.713   1.00 0.00 ? 86  ILE A CB   5  
ATOM 8111  C CG1  . ILE A 1 86  ? -8.396  -5.898  3.155   1.00 0.00 ? 86  ILE A CG1  5  
ATOM 8112  C CG2  . ILE A 1 86  ? -7.623  -6.538  0.826   1.00 0.00 ? 86  ILE A CG2  5  
ATOM 8113  C CD1  . ILE A 1 86  ? -9.440  -7.015  3.225   1.00 0.00 ? 86  ILE A CD1  5  
ATOM 8114  H H    . ILE A 1 86  ? -5.981  -5.009  3.037   1.00 0.00 ? 86  ILE A H    5  
ATOM 8115  H HA   . ILE A 1 86  ? -7.188  -3.913  0.613   1.00 0.00 ? 86  ILE A HA   5  
ATOM 8116  H HB   . ILE A 1 86  ? -9.173  -5.171  1.315   1.00 0.00 ? 86  ILE A HB   5  
ATOM 8117  H HG13 . ILE A 1 86  ? -8.717  -5.058  3.772   1.00 0.00 ? 86  ILE A HG13 5  
ATOM 8118  H HG21 . ILE A 1 86  ? -6.584  -6.312  0.584   1.00 0.00 ? 86  ILE A HG21 5  
ATOM 8119  H HG22 . ILE A 1 86  ? -7.675  -7.490  1.355   1.00 0.00 ? 86  ILE A HG22 5  
ATOM 8120  H HG23 . ILE A 1 86  ? -8.204  -6.602  -0.093  1.00 0.00 ? 86  ILE A HG23 5  
ATOM 8121  H HD11 . ILE A 1 86  ? -8.985  -7.912  3.648   1.00 0.00 ? 86  ILE A HD11 5  
ATOM 8122  H HD12 . ILE A 1 86  ? -10.270 -6.698  3.855   1.00 0.00 ? 86  ILE A HD12 5  
ATOM 8123  H HD13 . ILE A 1 86  ? -9.808  -7.233  2.223   1.00 0.00 ? 86  ILE A HD13 5  
ATOM 8124  N N    . LYS A 1 87  ? -7.596  -2.907  3.690   1.00 0.00 ? 87  LYS A N    5  
ATOM 8125  C CA   . LYS A 1 87  ? -8.089  -1.819  4.518   1.00 0.00 ? 87  LYS A CA   5  
ATOM 8126  C C    . LYS A 1 87  ? -6.937  -1.257  5.353   1.00 0.00 ? 87  LYS A C    5  
ATOM 8127  O O    . LYS A 1 87  ? -5.912  -1.915  5.528   1.00 0.00 ? 87  LYS A O    5  
ATOM 8128  C CB   . LYS A 1 87  ? -9.285  -2.280  5.352   1.00 0.00 ? 87  LYS A CB   5  
ATOM 8129  C CG   . LYS A 1 87  ? -10.495 -2.568  4.462   1.00 0.00 ? 87  LYS A CG   5  
ATOM 8130  C CD   . LYS A 1 87  ? -11.002 -3.997  4.669   1.00 0.00 ? 87  LYS A CD   5  
ATOM 8131  C CE   . LYS A 1 87  ? -11.538 -4.584  3.362   1.00 0.00 ? 87  LYS A CE   5  
ATOM 8132  N NZ   . LYS A 1 87  ? -12.580 -5.598  3.638   1.00 0.00 ? 87  LYS A NZ   5  
ATOM 8133  H H    . LYS A 1 87  ? -7.022  -3.574  4.166   1.00 0.00 ? 87  LYS A H    5  
ATOM 8134  H HA   . LYS A 1 87  ? -8.445  -1.036  3.849   1.00 0.00 ? 87  LYS A HA   5  
ATOM 8135  H HB3  . LYS A 1 87  ? -9.540  -1.515  6.084   1.00 0.00 ? 87  LYS A HB3  5  
ATOM 8136  H HG3  . LYS A 1 87  ? -10.225 -2.422  3.417   1.00 0.00 ? 87  LYS A HG3  5  
ATOM 8137  H HD3  . LYS A 1 87  ? -11.789 -4.002  5.425   1.00 0.00 ? 87  LYS A HD3  5  
ATOM 8138  H HE3  . LYS A 1 87  ? -10.722 -5.036  2.798   1.00 0.00 ? 87  LYS A HE3  5  
ATOM 8139  H HZ1  . LYS A 1 87  ? -13.379 -5.419  3.065   1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 8140  H HZ2  . LYS A 1 87  ? -12.220 -6.509  3.436   1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 8141  H HZ3  . LYS A 1 87  ? -12.844 -5.551  4.602   1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 8142  N N    . VAL A 1 88  ? -7.143  -0.045  5.847   1.00 0.00 ? 88  VAL A N    5  
ATOM 8143  C CA   . VAL A 1 88  ? -6.134  0.613   6.659   1.00 0.00 ? 88  VAL A CA   5  
ATOM 8144  C C    . VAL A 1 88  ? -6.813  1.616   7.595   1.00 0.00 ? 88  VAL A C    5  
ATOM 8145  O O    . VAL A 1 88  ? -7.194  2.706   7.172   1.00 0.00 ? 88  VAL A O    5  
ATOM 8146  C CB   . VAL A 1 88  ? -5.077  1.258   5.760   1.00 0.00 ? 88  VAL A CB   5  
ATOM 8147  C CG1  . VAL A 1 88  ? -4.211  2.241   6.551   1.00 0.00 ? 88  VAL A CG1  5  
ATOM 8148  C CG2  . VAL A 1 88  ? -4.214  0.194   5.080   1.00 0.00 ? 88  VAL A CG2  5  
ATOM 8149  H H    . VAL A 1 88  ? -7.978  0.484   5.699   1.00 0.00 ? 88  VAL A H    5  
ATOM 8150  H HA   . VAL A 1 88  ? -5.645  -0.152  7.261   1.00 0.00 ? 88  VAL A HA   5  
ATOM 8151  H HB   . VAL A 1 88  ? -5.594  1.818   4.981   1.00 0.00 ? 88  VAL A HB   5  
ATOM 8152  H HG11 . VAL A 1 88  ? -3.631  2.852   5.857   1.00 0.00 ? 88  VAL A HG11 5  
ATOM 8153  H HG12 . VAL A 1 88  ? -4.851  2.886   7.152   1.00 0.00 ? 88  VAL A HG12 5  
ATOM 8154  H HG13 . VAL A 1 88  ? -3.536  1.688   7.202   1.00 0.00 ? 88  VAL A HG13 5  
ATOM 8155  H HG21 . VAL A 1 88  ? -4.114  -0.670  5.738   1.00 0.00 ? 88  VAL A HG21 5  
ATOM 8156  H HG22 . VAL A 1 88  ? -4.686  -0.114  4.146   1.00 0.00 ? 88  VAL A HG22 5  
ATOM 8157  H HG23 . VAL A 1 88  ? -3.226  0.605   4.869   1.00 0.00 ? 88  VAL A HG23 5  
ATOM 8158  N N    . ASN A 1 89  ? -6.945  1.210   8.850   1.00 0.00 ? 89  ASN A N    5  
ATOM 8159  C CA   . ASN A 1 89  ? -7.571  2.058   9.849   1.00 0.00 ? 89  ASN A CA   5  
ATOM 8160  C C    . ASN A 1 89  ? -9.060  2.205   9.527   1.00 0.00 ? 89  ASN A C    5  
ATOM 8161  O O    . ASN A 1 89  ? -9.506  3.271   9.105   1.00 0.00 ? 89  ASN A O    5  
ATOM 8162  C CB   . ASN A 1 89  ? -6.949  3.456   9.853   1.00 0.00 ? 89  ASN A CB   5  
ATOM 8163  C CG   . ASN A 1 89  ? -5.421  3.375   9.842   1.00 0.00 ? 89  ASN A CG   5  
ATOM 8164  O OD1  . ASN A 1 89  ? -4.818  2.446   10.353  1.00 0.00 ? 89  ASN A OD1  5  
ATOM 8165  N ND2  . ASN A 1 89  ? -4.830  4.399   9.233   1.00 0.00 ? 89  ASN A ND2  5  
ATOM 8166  H H    . ASN A 1 89  ? -6.632  0.321   9.185   1.00 0.00 ? 89  ASN A H    5  
ATOM 8167  H HA   . ASN A 1 89  ? -7.398  1.556   10.800  1.00 0.00 ? 89  ASN A HA   5  
ATOM 8168  H HB3  . ASN A 1 89  ? -7.282  4.003   10.735  1.00 0.00 ? 89  ASN A HB3  5  
ATOM 8169  H HD21 . ASN A 1 89  ? -5.383  5.131   8.835   1.00 0.00 ? 89  ASN A HD21 5  
ATOM 8170  H HD22 . ASN A 1 89  ? -3.833  4.438   9.175   1.00 0.00 ? 89  ASN A HD22 5  
ATOM 8171  N N    . GLY A 1 90  ? -9.788  1.117   9.736   1.00 0.00 ? 90  GLY A N    5  
ATOM 8172  C CA   . GLY A 1 90  ? -11.217 1.111   9.472   1.00 0.00 ? 90  GLY A CA   5  
ATOM 8173  C C    . GLY A 1 90  ? -11.530 1.788   8.136   1.00 0.00 ? 90  GLY A C    5  
ATOM 8174  O O    . GLY A 1 90  ? -12.634 2.294   7.937   1.00 0.00 ? 90  GLY A O    5  
ATOM 8175  H H    . GLY A 1 90  ? -9.417  0.254   10.077  1.00 0.00 ? 90  GLY A H    5  
ATOM 8176  H HA2  . GLY A 1 90  ? -11.583 0.085   9.459   1.00 0.00 ? 90  GLY A HA2  5  
ATOM 8177  H HA3  . GLY A 1 90  ? -11.741 1.627   10.276  1.00 0.00 ? 90  GLY A HA3  5  
ATOM 8178  N N    . GLU A 1 91  ? -10.540 1.774   7.255   1.00 0.00 ? 91  GLU A N    5  
ATOM 8179  C CA   . GLU A 1 91  ? -10.698 2.381   5.944   1.00 0.00 ? 91  GLU A CA   5  
ATOM 8180  C C    . GLU A 1 91  ? -10.493 1.333   4.847   1.00 0.00 ? 91  GLU A C    5  
ATOM 8181  O O    . GLU A 1 91  ? -9.487  0.624   4.841   1.00 0.00 ? 91  GLU A O    5  
ATOM 8182  C CB   . GLU A 1 91  ? -9.737  3.557   5.764   1.00 0.00 ? 91  GLU A CB   5  
ATOM 8183  C CG   . GLU A 1 91  ? -10.503 4.864   5.552   1.00 0.00 ? 91  GLU A CG   5  
ATOM 8184  C CD   . GLU A 1 91  ? -11.607 4.688   4.506   1.00 0.00 ? 91  GLU A CD   5  
ATOM 8185  O OE1  . GLU A 1 91  ? -11.256 4.677   3.306   1.00 0.00 ? 91  GLU A OE1  5  
ATOM 8186  O OE2  . GLU A 1 91  ? -12.777 4.566   4.930   1.00 0.00 ? 91  GLU A OE2  5  
ATOM 8187  H H    . GLU A 1 91  ? -9.647  1.361   7.425   1.00 0.00 ? 91  GLU A H    5  
ATOM 8188  H HA   . GLU A 1 91  ? -11.723 2.749   5.915   1.00 0.00 ? 91  GLU A HA   5  
ATOM 8189  H HB3  . GLU A 1 91  ? -9.084  3.372   4.912   1.00 0.00 ? 91  GLU A HB3  5  
ATOM 8190  H HG3  . GLU A 1 91  ? -9.816  5.645   5.230   1.00 0.00 ? 91  GLU A HG3  5  
ATOM 8191  N N    . SER A 1 92  ? -11.462 1.268   3.946   1.00 0.00 ? 92  SER A N    5  
ATOM 8192  C CA   . SER A 1 92  ? -11.400 0.319   2.848   1.00 0.00 ? 92  SER A CA   5  
ATOM 8193  C C    . SER A 1 92  ? -10.723 0.965   1.636   1.00 0.00 ? 92  SER A C    5  
ATOM 8194  O O    . SER A 1 92  ? -11.030 0.627   0.495   1.00 0.00 ? 92  SER A O    5  
ATOM 8195  C CB   . SER A 1 92  ? -12.796 -0.178  2.471   1.00 0.00 ? 92  SER A CB   5  
ATOM 8196  O OG   . SER A 1 92  ? -13.167 -1.338  3.211   1.00 0.00 ? 92  SER A OG   5  
ATOM 8197  H H    . SER A 1 92  ? -12.277 1.849   3.958   1.00 0.00 ? 92  SER A H    5  
ATOM 8198  H HA   . SER A 1 92  ? -10.805 -0.514  3.219   1.00 0.00 ? 92  SER A HA   5  
ATOM 8199  H HB3  . SER A 1 92  ? -12.826 -0.405  1.405   1.00 0.00 ? 92  SER A HB3  5  
ATOM 8200  H HG   . SER A 1 92  ? -13.725 -1.944  2.644   1.00 0.00 ? 92  SER A HG   5  
ATOM 8201  N N    . VAL A 1 93  ? -9.810  1.881   1.927   1.00 0.00 ? 93  VAL A N    5  
ATOM 8202  C CA   . VAL A 1 93  ? -9.086  2.576   0.877   1.00 0.00 ? 93  VAL A CA   5  
ATOM 8203  C C    . VAL A 1 93  ? -10.049 2.916   -0.262  1.00 0.00 ? 93  VAL A C    5  
ATOM 8204  O O    . VAL A 1 93  ? -9.654  2.948   -1.426  1.00 0.00 ? 93  VAL A O    5  
ATOM 8205  C CB   . VAL A 1 93  ? -7.893  1.734   0.418   1.00 0.00 ? 93  VAL A CB   5  
ATOM 8206  C CG1  . VAL A 1 93  ? -7.040  1.298   1.612   1.00 0.00 ? 93  VAL A CG1  5  
ATOM 8207  C CG2  . VAL A 1 93  ? -8.356  0.525   -0.396  1.00 0.00 ? 93  VAL A CG2  5  
ATOM 8208  H H    . VAL A 1 93  ? -9.564  2.149   2.859   1.00 0.00 ? 93  VAL A H    5  
ATOM 8209  H HA   . VAL A 1 93  ? -8.702  3.504   1.301   1.00 0.00 ? 93  VAL A HA   5  
ATOM 8210  H HB   . VAL A 1 93  ? -7.273  2.356   -0.227  1.00 0.00 ? 93  VAL A HB   5  
ATOM 8211  H HG11 . VAL A 1 93  ? -7.690  1.036   2.446   1.00 0.00 ? 93  VAL A HG11 5  
ATOM 8212  H HG12 . VAL A 1 93  ? -6.439  0.433   1.332   1.00 0.00 ? 93  VAL A HG12 5  
ATOM 8213  H HG13 . VAL A 1 93  ? -6.382  2.116   1.906   1.00 0.00 ? 93  VAL A HG13 5  
ATOM 8214  H HG21 . VAL A 1 93  ? -8.646  -0.279  0.280   1.00 0.00 ? 93  VAL A HG21 5  
ATOM 8215  H HG22 . VAL A 1 93  ? -9.209  0.807   -1.012  1.00 0.00 ? 93  VAL A HG22 5  
ATOM 8216  H HG23 . VAL A 1 93  ? -7.541  0.186   -1.036  1.00 0.00 ? 93  VAL A HG23 5  
ATOM 8217  N N    . ILE A 1 94  ? -11.297 3.162   0.115   1.00 0.00 ? 94  ILE A N    5  
ATOM 8218  C CA   . ILE A 1 94  ? -12.320 3.498   -0.860  1.00 0.00 ? 94  ILE A CA   5  
ATOM 8219  C C    . ILE A 1 94  ? -11.887 4.742   -1.639  1.00 0.00 ? 94  ILE A C    5  
ATOM 8220  O O    . ILE A 1 94  ? -12.041 5.864   -1.158  1.00 0.00 ? 94  ILE A O    5  
ATOM 8221  C CB   . ILE A 1 94  ? -13.682 3.641   -0.180  1.00 0.00 ? 94  ILE A CB   5  
ATOM 8222  C CG1  . ILE A 1 94  ? -14.113 2.323   0.466   1.00 0.00 ? 94  ILE A CG1  5  
ATOM 8223  C CG2  . ILE A 1 94  ? -14.731 4.169   -1.160  1.00 0.00 ? 94  ILE A CG2  5  
ATOM 8224  C CD1  . ILE A 1 94  ? -14.307 1.232   -0.589  1.00 0.00 ? 94  ILE A CD1  5  
ATOM 8225  H H    . ILE A 1 94  ? -11.610 3.133   1.064   1.00 0.00 ? 94  ILE A H    5  
ATOM 8226  H HA   . ILE A 1 94  ? -12.394 2.663   -1.558  1.00 0.00 ? 94  ILE A HA   5  
ATOM 8227  H HB   . ILE A 1 94  ? -13.588 4.376   0.619   1.00 0.00 ? 94  ILE A HB   5  
ATOM 8228  H HG13 . ILE A 1 94  ? -15.042 2.471   1.017   1.00 0.00 ? 94  ILE A HG13 5  
ATOM 8229  H HG21 . ILE A 1 94  ? -14.992 5.194   -0.896  1.00 0.00 ? 94  ILE A HG21 5  
ATOM 8230  H HG22 . ILE A 1 94  ? -14.330 4.146   -2.172  1.00 0.00 ? 94  ILE A HG22 5  
ATOM 8231  H HG23 . ILE A 1 94  ? -15.624 3.544   -1.108  1.00 0.00 ? 94  ILE A HG23 5  
ATOM 8232  H HD11 . ILE A 1 94  ? -14.154 1.656   -1.581  1.00 0.00 ? 94  ILE A HD11 5  
ATOM 8233  H HD12 . ILE A 1 94  ? -13.585 0.431   -0.420  1.00 0.00 ? 94  ILE A HD12 5  
ATOM 8234  H HD13 . ILE A 1 94  ? -15.318 0.832   -0.517  1.00 0.00 ? 94  ILE A HD13 5  
ATOM 8235  N N    . GLY A 1 95  ? -11.354 4.503   -2.827  1.00 0.00 ? 95  GLY A N    5  
ATOM 8236  C CA   . GLY A 1 95  ? -10.898 5.590   -3.676  1.00 0.00 ? 95  GLY A CA   5  
ATOM 8237  C C    . GLY A 1 95  ? -9.461  5.988   -3.334  1.00 0.00 ? 95  GLY A C    5  
ATOM 8238  O O    . GLY A 1 95  ? -8.642  6.200   -4.228  1.00 0.00 ? 95  GLY A O    5  
ATOM 8239  H H    . GLY A 1 95  ? -11.232 3.587   -3.211  1.00 0.00 ? 95  GLY A H    5  
ATOM 8240  H HA2  . GLY A 1 95  ? -10.957 5.289   -4.722  1.00 0.00 ? 95  GLY A HA2  5  
ATOM 8241  H HA3  . GLY A 1 95  ? -11.556 6.450   -3.556  1.00 0.00 ? 95  GLY A HA3  5  
ATOM 8242  N N    . LYS A 1 96  ? -9.198  6.077   -2.038  1.00 0.00 ? 96  LYS A N    5  
ATOM 8243  C CA   . LYS A 1 96  ? -7.874  6.446   -1.567  1.00 0.00 ? 96  LYS A CA   5  
ATOM 8244  C C    . LYS A 1 96  ? -6.819  5.745   -2.424  1.00 0.00 ? 96  LYS A C    5  
ATOM 8245  O O    . LYS A 1 96  ? -6.825  4.520   -2.546  1.00 0.00 ? 96  LYS A O    5  
ATOM 8246  C CB   . LYS A 1 96  ? -7.740  6.157   -0.070  1.00 0.00 ? 96  LYS A CB   5  
ATOM 8247  C CG   . LYS A 1 96  ? -8.639  7.084   0.750   1.00 0.00 ? 96  LYS A CG   5  
ATOM 8248  C CD   . LYS A 1 96  ? -8.251  7.058   2.229   1.00 0.00 ? 96  LYS A CD   5  
ATOM 8249  C CE   . LYS A 1 96  ? -8.760  8.307   2.952   1.00 0.00 ? 96  LYS A CE   5  
ATOM 8250  N NZ   . LYS A 1 96  ? -7.702  8.871   3.819   1.00 0.00 ? 96  LYS A NZ   5  
ATOM 8251  H H    . LYS A 1 96  ? -9.870  5.903   -1.318  1.00 0.00 ? 96  LYS A H    5  
ATOM 8252  H HA   . LYS A 1 96  ? -7.767  7.522   -1.699  1.00 0.00 ? 96  LYS A HA   5  
ATOM 8253  H HB3  . LYS A 1 96  ? -6.701  6.288   0.237   1.00 0.00 ? 96  LYS A HB3  5  
ATOM 8254  H HG3  . LYS A 1 96  ? -9.679  6.780   0.637   1.00 0.00 ? 96  LYS A HG3  5  
ATOM 8255  H HD3  . LYS A 1 96  ? -7.168  6.995   2.324   1.00 0.00 ? 96  LYS A HD3  5  
ATOM 8256  H HE3  . LYS A 1 96  ? -9.635  8.056   3.552   1.00 0.00 ? 96  LYS A HE3  5  
ATOM 8257  H HZ1  . LYS A 1 96  ? -8.010  8.863   4.771   1.00 0.00 ? 96  LYS A HZ1  5  
ATOM 8258  H HZ2  . LYS A 1 96  ? -6.871  8.320   3.734   1.00 0.00 ? 96  LYS A HZ2  5  
ATOM 8259  H HZ3  . LYS A 1 96  ? -7.509  9.811   3.540   1.00 0.00 ? 96  LYS A HZ3  5  
ATOM 8260  N N    . THR A 1 97  ? -5.937  6.551   -2.999  1.00 0.00 ? 97  THR A N    5  
ATOM 8261  C CA   . THR A 1 97  ? -4.877  6.023   -3.841  1.00 0.00 ? 97  THR A CA   5  
ATOM 8262  C C    . THR A 1 97  ? -3.775  5.399   -2.984  1.00 0.00 ? 97  THR A C    5  
ATOM 8263  O O    . THR A 1 97  ? -3.791  5.522   -1.761  1.00 0.00 ? 97  THR A O    5  
ATOM 8264  C CB   . THR A 1 97  ? -4.380  7.158   -4.740  1.00 0.00 ? 97  THR A CB   5  
ATOM 8265  O OG1  . THR A 1 97  ? -3.317  6.568   -5.485  1.00 0.00 ? 97  THR A OG1  5  
ATOM 8266  C CG2  . THR A 1 97  ? -3.704  8.278   -3.947  1.00 0.00 ? 97  THR A CG2  5  
ATOM 8267  H H    . THR A 1 97  ? -5.939  7.545   -2.894  1.00 0.00 ? 97  THR A H    5  
ATOM 8268  H HA   . THR A 1 97  ? -5.295  5.226   -4.457  1.00 0.00 ? 97  THR A HA   5  
ATOM 8269  H HB   . THR A 1 97  ? -5.189  7.550   -5.356  1.00 0.00 ? 97  THR A HB   5  
ATOM 8270  H HG1  . THR A 1 97  ? -3.612  6.399   -6.424  1.00 0.00 ? 97  THR A HG1  5  
ATOM 8271  H HG21 . THR A 1 97  ? -2.636  8.078   -3.874  1.00 0.00 ? 97  THR A HG21 5  
ATOM 8272  H HG22 . THR A 1 97  ? -3.862  9.229   -4.458  1.00 0.00 ? 97  THR A HG22 5  
ATOM 8273  H HG23 . THR A 1 97  ? -4.135  8.326   -2.946  1.00 0.00 ? 97  THR A HG23 5  
ATOM 8274  N N    . TYR A 1 98  ? -2.845  4.741   -3.662  1.00 0.00 ? 98  TYR A N    5  
ATOM 8275  C CA   . TYR A 1 98  ? -1.738  4.097   -2.977  1.00 0.00 ? 98  TYR A CA   5  
ATOM 8276  C C    . TYR A 1 98  ? -1.020  5.078   -2.049  1.00 0.00 ? 98  TYR A C    5  
ATOM 8277  O O    . TYR A 1 98  ? -0.518  4.689   -0.996  1.00 0.00 ? 98  TYR A O    5  
ATOM 8278  C CB   . TYR A 1 98  ? -0.768  3.649   -4.073  1.00 0.00 ? 98  TYR A CB   5  
ATOM 8279  C CG   . TYR A 1 98  ? 0.064   2.420   -3.704  1.00 0.00 ? 98  TYR A CG   5  
ATOM 8280  C CD1  . TYR A 1 98  ? 0.946   2.476   -2.644  1.00 0.00 ? 98  TYR A CD1  5  
ATOM 8281  C CD2  . TYR A 1 98  ? -0.065  1.254   -4.431  1.00 0.00 ? 98  TYR A CD2  5  
ATOM 8282  C CE1  . TYR A 1 98  ? 1.729   1.319   -2.296  1.00 0.00 ? 98  TYR A CE1  5  
ATOM 8283  C CE2  . TYR A 1 98  ? 0.717   0.097   -4.084  1.00 0.00 ? 98  TYR A CE2  5  
ATOM 8284  C CZ   . TYR A 1 98  ? 1.577   0.187   -3.033  1.00 0.00 ? 98  TYR A CZ   5  
ATOM 8285  O OH   . TYR A 1 98  ? 2.317   -0.907  -2.706  1.00 0.00 ? 98  TYR A OH   5  
ATOM 8286  H H    . TYR A 1 98  ? -2.841  4.645   -4.657  1.00 0.00 ? 98  TYR A H    5  
ATOM 8287  H HA   . TYR A 1 98  ? -2.140  3.275   -2.385  1.00 0.00 ? 98  TYR A HA   5  
ATOM 8288  H HB3  . TYR A 1 98  ? -0.095  4.474   -4.308  1.00 0.00 ? 98  TYR A HB3  5  
ATOM 8289  H HD1  . TYR A 1 98  ? 1.049   3.397   -2.069  1.00 0.00 ? 98  TYR A HD1  5  
ATOM 8290  H HD2  . TYR A 1 98  ? -0.763  1.209   -5.270  1.00 0.00 ? 98  TYR A HD2  5  
ATOM 8291  H HE1  . TYR A 1 98  ? 2.430   1.351   -1.461  1.00 0.00 ? 98  TYR A HE1  5  
ATOM 8292  H HE2  . TYR A 1 98  ? 0.624   -0.831  -4.650  1.00 0.00 ? 98  TYR A HE2  5  
ATOM 8293  H HH   . TYR A 1 98  ? 1.718   -1.647  -2.402  1.00 0.00 ? 98  TYR A HH   5  
ATOM 8294  N N    . SER A 1 99  ? -0.996  6.333   -2.471  1.00 0.00 ? 99  SER A N    5  
ATOM 8295  C CA   . SER A 1 99  ? -0.349  7.374   -1.690  1.00 0.00 ? 99  SER A CA   5  
ATOM 8296  C C    . SER A 1 99  ? -1.232  7.764   -0.504  1.00 0.00 ? 99  SER A C    5  
ATOM 8297  O O    . SER A 1 99  ? -0.730  8.049   0.581   1.00 0.00 ? 99  SER A O    5  
ATOM 8298  C CB   . SER A 1 99  ? -0.048  8.602   -2.553  1.00 0.00 ? 99  SER A CB   5  
ATOM 8299  O OG   . SER A 1 99  ? 1.247   9.135   -2.287  1.00 0.00 ? 99  SER A OG   5  
ATOM 8300  H H    . SER A 1 99  ? -1.408  6.643   -3.329  1.00 0.00 ? 99  SER A H    5  
ATOM 8301  H HA   . SER A 1 99  ? 0.585   6.936   -1.344  1.00 0.00 ? 99  SER A HA   5  
ATOM 8302  H HB3  . SER A 1 99  ? -0.800  9.368   -2.369  1.00 0.00 ? 99  SER A HB3  5  
ATOM 8303  H HG   . SER A 1 99  ? 1.944   8.587   -2.750  1.00 0.00 ? 99  SER A HG   5  
ATOM 8304  N N    . GLN A 1 100 ? -2.535  7.763   -0.751  1.00 0.00 ? 100 GLN A N    5  
ATOM 8305  C CA   . GLN A 1 100 ? -3.493  8.112   0.284   1.00 0.00 ? 100 GLN A CA   5  
ATOM 8306  C C    . GLN A 1 100 ? -3.480  7.062   1.397   1.00 0.00 ? 100 GLN A C    5  
ATOM 8307  O O    . GLN A 1 100 ? -3.361  7.399   2.573   1.00 0.00 ? 100 GLN A O    5  
ATOM 8308  C CB   . GLN A 1 100 ? -4.897  8.273   -0.300  1.00 0.00 ? 100 GLN A CB   5  
ATOM 8309  C CG   . GLN A 1 100 ? -5.147  9.719   -0.736  1.00 0.00 ? 100 GLN A CG   5  
ATOM 8310  C CD   . GLN A 1 100 ? -6.529  10.197  -0.286  1.00 0.00 ? 100 GLN A CD   5  
ATOM 8311  O OE1  . GLN A 1 100 ? -6.770  10.471  0.878   1.00 0.00 ? 100 GLN A OE1  5  
ATOM 8312  N NE2  . GLN A 1 100 ? -7.420  10.280  -1.269  1.00 0.00 ? 100 GLN A NE2  5  
ATOM 8313  H H    . GLN A 1 100 ? -2.936  7.529   -1.637  1.00 0.00 ? 100 GLN A H    5  
ATOM 8314  H HA   . GLN A 1 100 ? -3.157  9.071   0.677   1.00 0.00 ? 100 GLN A HA   5  
ATOM 8315  H HB3  . GLN A 1 100 ? -5.640  7.981   0.441   1.00 0.00 ? 100 GLN A HB3  5  
ATOM 8316  H HG3  . GLN A 1 100 ? -5.069  9.794   -1.821  1.00 0.00 ? 100 GLN A HG3  5  
ATOM 8317  H HE21 . GLN A 1 100 ? -7.157  10.039  -2.204  1.00 0.00 ? 100 GLN A HE21 5  
ATOM 8318  H HE22 . GLN A 1 100 ? -8.354  10.583  -1.075  1.00 0.00 ? 100 GLN A HE22 5  
ATOM 8319  N N    . VAL A 1 101 ? -3.602  5.808   0.984   1.00 0.00 ? 101 VAL A N    5  
ATOM 8320  C CA   . VAL A 1 101 ? -3.606  4.706   1.932   1.00 0.00 ? 101 VAL A CA   5  
ATOM 8321  C C    . VAL A 1 101 ? -2.308  4.731   2.741   1.00 0.00 ? 101 VAL A C    5  
ATOM 8322  O O    . VAL A 1 101 ? -2.299  4.374   3.917   1.00 0.00 ? 101 VAL A O    5  
ATOM 8323  C CB   . VAL A 1 101 ? -3.825  3.384   1.194   1.00 0.00 ? 101 VAL A CB   5  
ATOM 8324  C CG1  . VAL A 1 101 ? -5.087  3.440   0.330   1.00 0.00 ? 101 VAL A CG1  5  
ATOM 8325  C CG2  . VAL A 1 101 ? -2.601  3.015   0.352   1.00 0.00 ? 101 VAL A CG2  5  
ATOM 8326  H H    . VAL A 1 101 ? -3.698  5.542   0.025   1.00 0.00 ? 101 VAL A H    5  
ATOM 8327  H HA   . VAL A 1 101 ? -4.445  4.859   2.609   1.00 0.00 ? 101 VAL A HA   5  
ATOM 8328  H HB   . VAL A 1 101 ? -3.965  2.602   1.942   1.00 0.00 ? 101 VAL A HB   5  
ATOM 8329  H HG11 . VAL A 1 101 ? -4.926  4.122   -0.504  1.00 0.00 ? 101 VAL A HG11 5  
ATOM 8330  H HG12 . VAL A 1 101 ? -5.310  2.445   -0.052  1.00 0.00 ? 101 VAL A HG12 5  
ATOM 8331  H HG13 . VAL A 1 101 ? -5.923  3.794   0.933   1.00 0.00 ? 101 VAL A HG13 5  
ATOM 8332  H HG21 . VAL A 1 101 ? -2.428  3.788   -0.395  1.00 0.00 ? 101 VAL A HG21 5  
ATOM 8333  H HG22 . VAL A 1 101 ? -1.727  2.932   0.999   1.00 0.00 ? 101 VAL A HG22 5  
ATOM 8334  H HG23 . VAL A 1 101 ? -2.776  2.061   -0.145  1.00 0.00 ? 101 VAL A HG23 5  
ATOM 8335  N N    . ILE A 1 102 ? -1.242  5.155   2.077   1.00 0.00 ? 102 ILE A N    5  
ATOM 8336  C CA   . ILE A 1 102 ? 0.059   5.231   2.721   1.00 0.00 ? 102 ILE A CA   5  
ATOM 8337  C C    . ILE A 1 102 ? -0.001  6.247   3.863   1.00 0.00 ? 102 ILE A C    5  
ATOM 8338  O O    . ILE A 1 102 ? 0.407   5.949   4.985   1.00 0.00 ? 102 ILE A O    5  
ATOM 8339  C CB   . ILE A 1 102 ? 1.149   5.529   1.691   1.00 0.00 ? 102 ILE A CB   5  
ATOM 8340  C CG1  . ILE A 1 102 ? 1.446   4.295   0.834   1.00 0.00 ? 102 ILE A CG1  5  
ATOM 8341  C CG2  . ILE A 1 102 ? 2.409   6.074   2.368   1.00 0.00 ? 102 ILE A CG2  5  
ATOM 8342  C CD1  . ILE A 1 102 ? 2.532   3.429   1.478   1.00 0.00 ? 102 ILE A CD1  5  
ATOM 8343  H H    . ILE A 1 102 ? -1.258  5.443   1.121   1.00 0.00 ? 102 ILE A H    5  
ATOM 8344  H HA   . ILE A 1 102 ? 0.272   4.249   3.144   1.00 0.00 ? 102 ILE A HA   5  
ATOM 8345  H HB   . ILE A 1 102 ? 0.783   6.305   1.020   1.00 0.00 ? 102 ILE A HB   5  
ATOM 8346  H HG13 . ILE A 1 102 ? 1.766   4.607   -0.159  1.00 0.00 ? 102 ILE A HG13 5  
ATOM 8347  H HG21 . ILE A 1 102 ? 2.533   5.598   3.341   1.00 0.00 ? 102 ILE A HG21 5  
ATOM 8348  H HG22 . ILE A 1 102 ? 3.278   5.859   1.746   1.00 0.00 ? 102 ILE A HG22 5  
ATOM 8349  H HG23 . ILE A 1 102 ? 2.313   7.151   2.499   1.00 0.00 ? 102 ILE A HG23 5  
ATOM 8350  H HD11 . ILE A 1 102 ? 2.494   3.546   2.561   1.00 0.00 ? 102 ILE A HD11 5  
ATOM 8351  H HD12 . ILE A 1 102 ? 2.363   2.384   1.220   1.00 0.00 ? 102 ILE A HD12 5  
ATOM 8352  H HD13 . ILE A 1 102 ? 3.510   3.741   1.112   1.00 0.00 ? 102 ILE A HD13 5  
ATOM 8353  N N    . ALA A 1 103 ? -0.514  7.425   3.540   1.00 0.00 ? 103 ALA A N    5  
ATOM 8354  C CA   . ALA A 1 103 ? -0.633  8.486   4.526   1.00 0.00 ? 103 ALA A CA   5  
ATOM 8355  C C    . ALA A 1 103 ? -1.451  7.982   5.715   1.00 0.00 ? 103 ALA A C    5  
ATOM 8356  O O    . ALA A 1 103 ? -1.154  8.311   6.863   1.00 0.00 ? 103 ALA A O    5  
ATOM 8357  C CB   . ALA A 1 103 ? -1.253  9.723   3.873   1.00 0.00 ? 103 ALA A CB   5  
ATOM 8358  H H    . ALA A 1 103 ? -0.844  7.659   2.626   1.00 0.00 ? 103 ALA A H    5  
ATOM 8359  H HA   . ALA A 1 103 ? 0.373   8.736   4.866   1.00 0.00 ? 103 ALA A HA   5  
ATOM 8360  H HB1  . ALA A 1 103 ? -2.320  9.756   4.097   1.00 0.00 ? 103 ALA A HB1  5  
ATOM 8361  H HB2  . ALA A 1 103 ? -0.773  10.619  4.264   1.00 0.00 ? 103 ALA A HB2  5  
ATOM 8362  H HB3  . ALA A 1 103 ? -1.110  9.674   2.793   1.00 0.00 ? 103 ALA A HB3  5  
ATOM 8363  N N    . LEU A 1 104 ? -2.467  7.191   5.402   1.00 0.00 ? 104 LEU A N    5  
ATOM 8364  C CA   . LEU A 1 104 ? -3.331  6.637   6.430   1.00 0.00 ? 104 LEU A CA   5  
ATOM 8365  C C    . LEU A 1 104 ? -2.482  5.871   7.445   1.00 0.00 ? 104 LEU A C    5  
ATOM 8366  O O    . LEU A 1 104 ? -2.822  5.812   8.626   1.00 0.00 ? 104 LEU A O    5  
ATOM 8367  C CB   . LEU A 1 104 ? -4.445  5.798   5.801   1.00 0.00 ? 104 LEU A CB   5  
ATOM 8368  C CG   . LEU A 1 104 ? -5.497  6.571   5.002   1.00 0.00 ? 104 LEU A CG   5  
ATOM 8369  C CD1  . LEU A 1 104 ? -6.497  5.617   4.346   1.00 0.00 ? 104 LEU A CD1  5  
ATOM 8370  C CD2  . LEU A 1 104 ? -6.192  7.615   5.878   1.00 0.00 ? 104 LEU A CD2  5  
ATOM 8371  H H    . LEU A 1 104 ? -2.703  6.927   4.466   1.00 0.00 ? 104 LEU A H    5  
ATOM 8372  H HA   . LEU A 1 104 ? -3.808  7.476   6.941   1.00 0.00 ? 104 LEU A HA   5  
ATOM 8373  H HB3  . LEU A 1 104 ? -4.951  5.249   6.594   1.00 0.00 ? 104 LEU A HB3  5  
ATOM 8374  H HG   . LEU A 1 104 ? -4.990  7.108   4.201   1.00 0.00 ? 104 LEU A HG   5  
ATOM 8375  H HD11 . LEU A 1 104 ? -6.445  4.643   4.834   1.00 0.00 ? 104 LEU A HD11 5  
ATOM 8376  H HD12 . LEU A 1 104 ? -7.505  6.020   4.446   1.00 0.00 ? 104 LEU A HD12 5  
ATOM 8377  H HD13 . LEU A 1 104 ? -6.254  5.505   3.289   1.00 0.00 ? 104 LEU A HD13 5  
ATOM 8378  H HD21 . LEU A 1 104 ? -5.818  7.540   6.899   1.00 0.00 ? 104 LEU A HD21 5  
ATOM 8379  H HD22 . LEU A 1 104 ? -5.987  8.612   5.488   1.00 0.00 ? 104 LEU A HD22 5  
ATOM 8380  H HD23 . LEU A 1 104 ? -7.268  7.436   5.872   1.00 0.00 ? 104 LEU A HD23 5  
ATOM 8381  N N    . ILE A 1 105 ? -1.393  5.302   6.949   1.00 0.00 ? 105 ILE A N    5  
ATOM 8382  C CA   . ILE A 1 105 ? -0.492  4.540   7.798   1.00 0.00 ? 105 ILE A CA   5  
ATOM 8383  C C    . ILE A 1 105 ? 0.427   5.504   8.550   1.00 0.00 ? 105 ILE A C    5  
ATOM 8384  O O    . ILE A 1 105 ? 0.561   5.414   9.769   1.00 0.00 ? 105 ILE A O    5  
ATOM 8385  C CB   . ILE A 1 105 ? 0.256   3.488   6.977   1.00 0.00 ? 105 ILE A CB   5  
ATOM 8386  C CG1  . ILE A 1 105 ? -0.668  2.331   6.595   1.00 0.00 ? 105 ILE A CG1  5  
ATOM 8387  C CG2  . ILE A 1 105 ? 1.506   3.005   7.715   1.00 0.00 ? 105 ILE A CG2  5  
ATOM 8388  C CD1  . ILE A 1 105 ? -0.167  1.623   5.335   1.00 0.00 ? 105 ILE A CD1  5  
ATOM 8389  H H    . ILE A 1 105 ? -1.124  5.355   5.987   1.00 0.00 ? 105 ILE A H    5  
ATOM 8390  H HA   . ILE A 1 105 ? -1.104  4.007   8.525   1.00 0.00 ? 105 ILE A HA   5  
ATOM 8391  H HB   . ILE A 1 105 ? 0.591   3.954   6.049   1.00 0.00 ? 105 ILE A HB   5  
ATOM 8392  H HG13 . ILE A 1 105 ? -1.677  2.706   6.430   1.00 0.00 ? 105 ILE A HG13 5  
ATOM 8393  H HG21 . ILE A 1 105 ? 1.232   2.685   8.721   1.00 0.00 ? 105 ILE A HG21 5  
ATOM 8394  H HG22 . ILE A 1 105 ? 1.946   2.166   7.175   1.00 0.00 ? 105 ILE A HG22 5  
ATOM 8395  H HG23 . ILE A 1 105 ? 2.229   3.818   7.777   1.00 0.00 ? 105 ILE A HG23 5  
ATOM 8396  H HD11 . ILE A 1 105 ? 0.537   2.269   4.809   1.00 0.00 ? 105 ILE A HD11 5  
ATOM 8397  H HD12 . ILE A 1 105 ? 0.328   0.694   5.612   1.00 0.00 ? 105 ILE A HD12 5  
ATOM 8398  H HD13 . ILE A 1 105 ? -1.013  1.402   4.681   1.00 0.00 ? 105 ILE A HD13 5  
ATOM 8399  N N    . GLN A 1 106 ? 1.038   6.401   7.791   1.00 0.00 ? 106 GLN A N    5  
ATOM 8400  C CA   . GLN A 1 106 ? 1.942   7.381   8.372   1.00 0.00 ? 106 GLN A CA   5  
ATOM 8401  C C    . GLN A 1 106 ? 1.206   8.236   9.404   1.00 0.00 ? 106 GLN A C    5  
ATOM 8402  O O    . GLN A 1 106 ? 1.769   8.587   10.439  1.00 0.00 ? 106 GLN A O    5  
ATOM 8403  C CB   . GLN A 1 106 ? 2.576   8.254   7.286   1.00 0.00 ? 106 GLN A CB   5  
ATOM 8404  C CG   . GLN A 1 106 ? 3.476   7.423   6.370   1.00 0.00 ? 106 GLN A CG   5  
ATOM 8405  C CD   . GLN A 1 106 ? 4.862   8.056   6.242   1.00 0.00 ? 106 GLN A CD   5  
ATOM 8406  O OE1  . GLN A 1 106 ? 5.396   8.636   7.171   1.00 0.00 ? 106 GLN A OE1  5  
ATOM 8407  N NE2  . GLN A 1 106 ? 5.413   7.913   5.040   1.00 0.00 ? 106 GLN A NE2  5  
ATOM 8408  H H    . GLN A 1 106 ? 0.924   6.467   6.800   1.00 0.00 ? 106 GLN A H    5  
ATOM 8409  H HA   . GLN A 1 106 ? 2.724   6.799   8.862   1.00 0.00 ? 106 GLN A HA   5  
ATOM 8410  H HB3  . GLN A 1 106 ? 3.158   9.050   7.748   1.00 0.00 ? 106 GLN A HB3  5  
ATOM 8411  H HG3  . GLN A 1 106 ? 3.018   7.337   5.384   1.00 0.00 ? 106 GLN A HG3  5  
ATOM 8412  H HE21 . GLN A 1 106 ? 4.921   7.426   4.319   1.00 0.00 ? 106 GLN A HE21 5  
ATOM 8413  H HE22 . GLN A 1 106 ? 6.320   8.293   4.856   1.00 0.00 ? 106 GLN A HE22 5  
ATOM 8414  N N    . ASN A 1 107 ? -0.041  8.550   9.084   1.00 0.00 ? 107 ASN A N    5  
ATOM 8415  C CA   . ASN A 1 107 ? -0.860  9.359   9.971   1.00 0.00 ? 107 ASN A CA   5  
ATOM 8416  C C    . ASN A 1 107 ? -1.753  8.443   10.811  1.00 0.00 ? 107 ASN A C    5  
ATOM 8417  O O    . ASN A 1 107 ? -2.803  8.865   11.292  1.00 0.00 ? 107 ASN A O    5  
ATOM 8418  C CB   . ASN A 1 107 ? -1.764  10.303  9.177   1.00 0.00 ? 107 ASN A CB   5  
ATOM 8419  C CG   . ASN A 1 107 ? -1.039  11.610  8.849   1.00 0.00 ? 107 ASN A CG   5  
ATOM 8420  O OD1  . ASN A 1 107 ? -0.628  12.358  9.721   1.00 0.00 ? 107 ASN A OD1  5  
ATOM 8421  N ND2  . ASN A 1 107 ? -0.905  11.842  7.547   1.00 0.00 ? 107 ASN A ND2  5  
ATOM 8422  H H    . ASN A 1 107 ? -0.491  8.261   8.240   1.00 0.00 ? 107 ASN A H    5  
ATOM 8423  H HA   . ASN A 1 107 ? -0.153  9.922   10.579  1.00 0.00 ? 107 ASN A HA   5  
ATOM 8424  H HB3  . ASN A 1 107 ? -2.665  10.518  9.751   1.00 0.00 ? 107 ASN A HB3  5  
ATOM 8425  H HD21 . ASN A 1 107 ? -1.266  11.187  6.882   1.00 0.00 ? 107 ASN A HD21 5  
ATOM 8426  H HD22 . ASN A 1 107 ? -0.444  12.672  7.231   1.00 0.00 ? 107 ASN A HD22 5  
ATOM 8427  N N    . SER A 1 108 ? -1.303  7.205   10.960  1.00 0.00 ? 108 SER A N    5  
ATOM 8428  C CA   . SER A 1 108 ? -2.049  6.227   11.732  1.00 0.00 ? 108 SER A CA   5  
ATOM 8429  C C    . SER A 1 108 ? -1.780  6.422   13.226  1.00 0.00 ? 108 SER A C    5  
ATOM 8430  O O    . SER A 1 108 ? -2.416  5.786   14.064  1.00 0.00 ? 108 SER A O    5  
ATOM 8431  C CB   . SER A 1 108 ? -1.688  4.801   11.310  1.00 0.00 ? 108 SER A CB   5  
ATOM 8432  O OG   . SER A 1 108 ? -2.444  3.826   12.023  1.00 0.00 ? 108 SER A OG   5  
ATOM 8433  H H    . SER A 1 108 ? -0.448  6.869   10.564  1.00 0.00 ? 108 SER A H    5  
ATOM 8434  H HA   . SER A 1 108 ? -3.097  6.417   11.504  1.00 0.00 ? 108 SER A HA   5  
ATOM 8435  H HB3  . SER A 1 108 ? -0.624  4.631   11.480  1.00 0.00 ? 108 SER A HB3  5  
ATOM 8436  H HG   . SER A 1 108 ? -3.394  4.123   12.106  1.00 0.00 ? 108 SER A HG   5  
ATOM 8437  N N    . ASP A 1 109 ? -0.835  7.306   13.513  1.00 0.00 ? 109 ASP A N    5  
ATOM 8438  C CA   . ASP A 1 109 ? -0.474  7.595   14.890  1.00 0.00 ? 109 ASP A CA   5  
ATOM 8439  C C    . ASP A 1 109 ? 0.493   6.522   15.395  1.00 0.00 ? 109 ASP A C    5  
ATOM 8440  O O    . ASP A 1 109 ? 1.180   5.878   14.602  1.00 0.00 ? 109 ASP A O    5  
ATOM 8441  C CB   . ASP A 1 109 ? -1.706  7.583   15.796  1.00 0.00 ? 109 ASP A CB   5  
ATOM 8442  C CG   . ASP A 1 109 ? -1.647  8.552   16.979  1.00 0.00 ? 109 ASP A CG   5  
ATOM 8443  O OD1  . ASP A 1 109 ? -0.874  9.528   16.876  1.00 0.00 ? 109 ASP A OD1  5  
ATOM 8444  O OD2  . ASP A 1 109 ? -2.377  8.294   17.961  1.00 0.00 ? 109 ASP A OD2  5  
ATOM 8445  H H    . ASP A 1 109 ? -0.322  7.821   12.824  1.00 0.00 ? 109 ASP A H    5  
ATOM 8446  H HA   . ASP A 1 109 ? -0.022  8.586   14.866  1.00 0.00 ? 109 ASP A HA   5  
ATOM 8447  H HB3  . ASP A 1 109 ? -1.847  6.572   16.180  1.00 0.00 ? 109 ASP A HB3  5  
ATOM 8448  N N    . THR A 1 110 ? 0.516   6.362   16.710  1.00 0.00 ? 110 THR A N    5  
ATOM 8449  C CA   . THR A 1 110 ? 1.389   5.377   17.327  1.00 0.00 ? 110 THR A CA   5  
ATOM 8450  C C    . THR A 1 110 ? 1.104   3.984   16.764  1.00 0.00 ? 110 THR A C    5  
ATOM 8451  O O    . THR A 1 110 ? 1.986   3.357   16.177  1.00 0.00 ? 110 THR A O    5  
ATOM 8452  C CB   . THR A 1 110 ? 1.204   5.469   18.844  1.00 0.00 ? 110 THR A CB   5  
ATOM 8453  O OG1  . THR A 1 110 ? 1.530   6.821   19.152  1.00 0.00 ? 110 THR A OG1  5  
ATOM 8454  C CG2  . THR A 1 110 ? 2.243   4.650   19.612  1.00 0.00 ? 110 THR A CG2  5  
ATOM 8455  H H    . THR A 1 110 ? -0.045  6.889   17.347  1.00 0.00 ? 110 THR A H    5  
ATOM 8456  H HA   . THR A 1 110 ? 2.420   5.623   17.071  1.00 0.00 ? 110 THR A HA   5  
ATOM 8457  H HB   . THR A 1 110 ? 0.193   5.180   19.130  1.00 0.00 ? 110 THR A HB   5  
ATOM 8458  H HG1  . THR A 1 110 ? 2.401   7.069   18.730  1.00 0.00 ? 110 THR A HG1  5  
ATOM 8459  H HG21 . THR A 1 110 ? 1.848   3.654   19.810  1.00 0.00 ? 110 THR A HG21 5  
ATOM 8460  H HG22 . THR A 1 110 ? 3.153   4.569   19.016  1.00 0.00 ? 110 THR A HG22 5  
ATOM 8461  H HG23 . THR A 1 110 ? 2.471   5.146   20.555  1.00 0.00 ? 110 THR A HG23 5  
ATOM 8462  N N    . THR A 1 111 ? -0.128  3.540   16.962  1.00 0.00 ? 111 THR A N    5  
ATOM 8463  C CA   . THR A 1 111 ? -0.538  2.232   16.482  1.00 0.00 ? 111 THR A CA   5  
ATOM 8464  C C    . THR A 1 111 ? -1.107  2.339   15.065  1.00 0.00 ? 111 THR A C    5  
ATOM 8465  O O    . THR A 1 111 ? -1.512  3.419   14.635  1.00 0.00 ? 111 THR A O    5  
ATOM 8466  C CB   . THR A 1 111 ? -1.528  1.646   17.491  1.00 0.00 ? 111 THR A CB   5  
ATOM 8467  O OG1  . THR A 1 111 ? -2.010  2.781   18.204  1.00 0.00 ? 111 THR A OG1  5  
ATOM 8468  C CG2  . THR A 1 111 ? -0.838  0.799   18.562  1.00 0.00 ? 111 THR A CG2  5  
ATOM 8469  H H    . THR A 1 111 ? -0.838  4.055   17.442  1.00 0.00 ? 111 THR A H    5  
ATOM 8470  H HA   . THR A 1 111 ? 0.344   1.594   16.425  1.00 0.00 ? 111 THR A HA   5  
ATOM 8471  H HB   . THR A 1 111 ? -2.307  1.075   16.986  1.00 0.00 ? 111 THR A HB   5  
ATOM 8472  H HG1  . THR A 1 111 ? -2.727  2.505   18.843  1.00 0.00 ? 111 THR A HG1  5  
ATOM 8473  H HG21 . THR A 1 111 ? -1.582  0.427   19.267  1.00 0.00 ? 111 THR A HG21 5  
ATOM 8474  H HG22 . THR A 1 111 ? -0.332  -0.043  18.090  1.00 0.00 ? 111 THR A HG22 5  
ATOM 8475  H HG23 . THR A 1 111 ? -0.108  1.409   19.094  1.00 0.00 ? 111 THR A HG23 5  
ATOM 8476  N N    . LEU A 1 112 ? -1.121  1.206   14.380  1.00 0.00 ? 112 LEU A N    5  
ATOM 8477  C CA   . LEU A 1 112 ? -1.633  1.159   13.021  1.00 0.00 ? 112 LEU A CA   5  
ATOM 8478  C C    . LEU A 1 112 ? -2.140  -0.252  12.720  1.00 0.00 ? 112 LEU A C    5  
ATOM 8479  O O    . LEU A 1 112 ? -1.414  -1.229  12.905  1.00 0.00 ? 112 LEU A O    5  
ATOM 8480  C CB   . LEU A 1 112 ? -0.578  1.658   12.032  1.00 0.00 ? 112 LEU A CB   5  
ATOM 8481  C CG   . LEU A 1 112 ? -0.802  1.284   10.566  1.00 0.00 ? 112 LEU A CG   5  
ATOM 8482  C CD1  . LEU A 1 112 ? -0.368  -0.158  10.294  1.00 0.00 ? 112 LEU A CD1  5  
ATOM 8483  C CD2  . LEU A 1 112 ? -2.255  1.532   10.153  1.00 0.00 ? 112 LEU A CD2  5  
ATOM 8484  H H    . LEU A 1 112 ? -0.789  0.333   14.737  1.00 0.00 ? 112 LEU A H    5  
ATOM 8485  H HA   . LEU A 1 112 ? -2.477  1.847   12.967  1.00 0.00 ? 112 LEU A HA   5  
ATOM 8486  H HB3  . LEU A 1 112 ? 0.393   1.270   12.341  1.00 0.00 ? 112 LEU A HB3  5  
ATOM 8487  H HG   . LEU A 1 112 ? -0.178  1.929   9.949   1.00 0.00 ? 112 LEU A HG   5  
ATOM 8488  H HD11 . LEU A 1 112 ? -0.203  -0.292  9.226   1.00 0.00 ? 112 LEU A HD11 5  
ATOM 8489  H HD12 . LEU A 1 112 ? 0.556   -0.366  10.834  1.00 0.00 ? 112 LEU A HD12 5  
ATOM 8490  H HD13 . LEU A 1 112 ? -1.147  -0.841  10.631  1.00 0.00 ? 112 LEU A HD13 5  
ATOM 8491  H HD21 . LEU A 1 112 ? -2.630  0.665   9.608   1.00 0.00 ? 112 LEU A HD21 5  
ATOM 8492  H HD22 . LEU A 1 112 ? -2.863  1.693   11.043  1.00 0.00 ? 112 LEU A HD22 5  
ATOM 8493  H HD23 . LEU A 1 112 ? -2.306  2.413   9.514   1.00 0.00 ? 112 LEU A HD23 5  
ATOM 8494  N N    . GLU A 1 113 ? -3.379  -0.317  12.260  1.00 0.00 ? 113 GLU A N    5  
ATOM 8495  C CA   . GLU A 1 113 ? -3.991  -1.594  11.931  1.00 0.00 ? 113 GLU A CA   5  
ATOM 8496  C C    . GLU A 1 113 ? -4.172  -1.722  10.417  1.00 0.00 ? 113 GLU A C    5  
ATOM 8497  O O    . GLU A 1 113 ? -4.521  -0.752  9.746   1.00 0.00 ? 113 GLU A O    5  
ATOM 8498  C CB   . GLU A 1 113 ? -5.326  -1.766  12.659  1.00 0.00 ? 113 GLU A CB   5  
ATOM 8499  C CG   . GLU A 1 113 ? -5.991  -3.091  12.278  1.00 0.00 ? 113 GLU A CG   5  
ATOM 8500  C CD   . GLU A 1 113 ? -7.465  -3.103  12.688  1.00 0.00 ? 113 GLU A CD   5  
ATOM 8501  O OE1  . GLU A 1 113 ? -7.715  -3.244  13.905  1.00 0.00 ? 113 GLU A OE1  5  
ATOM 8502  O OE2  . GLU A 1 113 ? -8.308  -2.969  11.775  1.00 0.00 ? 113 GLU A OE2  5  
ATOM 8503  H H    . GLU A 1 113 ? -3.964  0.481   12.111  1.00 0.00 ? 113 GLU A H    5  
ATOM 8504  H HA   . GLU A 1 113 ? -3.290  -2.350  12.285  1.00 0.00 ? 113 GLU A HA   5  
ATOM 8505  H HB3  . GLU A 1 113 ? -5.989  -0.938  12.411  1.00 0.00 ? 113 GLU A HB3  5  
ATOM 8506  H HG3  . GLU A 1 113 ? -5.469  -3.916  12.762  1.00 0.00 ? 113 GLU A HG3  5  
ATOM 8507  N N    . LEU A 1 114 ? -3.926  -2.927  9.923   1.00 0.00 ? 114 LEU A N    5  
ATOM 8508  C CA   . LEU A 1 114 ? -4.057  -3.194  8.501   1.00 0.00 ? 114 LEU A CA   5  
ATOM 8509  C C    . LEU A 1 114 ? -5.063  -4.327  8.290   1.00 0.00 ? 114 LEU A C    5  
ATOM 8510  O O    . LEU A 1 114 ? -5.659  -4.818  9.247   1.00 0.00 ? 114 LEU A O    5  
ATOM 8511  C CB   . LEU A 1 114 ? -2.687  -3.465  7.878   1.00 0.00 ? 114 LEU A CB   5  
ATOM 8512  C CG   . LEU A 1 114 ? -1.628  -2.380  8.087   1.00 0.00 ? 114 LEU A CG   5  
ATOM 8513  C CD1  . LEU A 1 114 ? -0.217  -2.955  7.950   1.00 0.00 ? 114 LEU A CD1  5  
ATOM 8514  C CD2  . LEU A 1 114 ? -1.859  -1.198  7.141   1.00 0.00 ? 114 LEU A CD2  5  
ATOM 8515  H H    . LEU A 1 114 ? -3.642  -3.710  10.475  1.00 0.00 ? 114 LEU A H    5  
ATOM 8516  H HA   . LEU A 1 114 ? -4.451  -2.290  8.033   1.00 0.00 ? 114 LEU A HA   5  
ATOM 8517  H HB3  . LEU A 1 114 ? -2.819  -3.613  6.806   1.00 0.00 ? 114 LEU A HB3  5  
ATOM 8518  H HG   . LEU A 1 114 ? -1.724  -2.001  9.105   1.00 0.00 ? 114 LEU A HG   5  
ATOM 8519  H HD11 . LEU A 1 114 ? 0.448   -2.456  8.653   1.00 0.00 ? 114 LEU A HD11 5  
ATOM 8520  H HD12 . LEU A 1 114 ? -0.238  -4.025  8.164   1.00 0.00 ? 114 LEU A HD12 5  
ATOM 8521  H HD13 . LEU A 1 114 ? 0.143   -2.796  6.933   1.00 0.00 ? 114 LEU A HD13 5  
ATOM 8522  H HD21 . LEU A 1 114 ? -2.869  -0.813  7.284   1.00 0.00 ? 114 LEU A HD21 5  
ATOM 8523  H HD22 . LEU A 1 114 ? -1.136  -0.413  7.358   1.00 0.00 ? 114 LEU A HD22 5  
ATOM 8524  H HD23 . LEU A 1 114 ? -1.740  -1.530  6.110   1.00 0.00 ? 114 LEU A HD23 5  
ATOM 8525  N N    . SER A 1 115 ? -5.222  -4.708  7.031   1.00 0.00 ? 115 SER A N    5  
ATOM 8526  C CA   . SER A 1 115 ? -6.146  -5.773  6.681   1.00 0.00 ? 115 SER A CA   5  
ATOM 8527  C C    . SER A 1 115 ? -5.736  -6.406  5.351   1.00 0.00 ? 115 SER A C    5  
ATOM 8528  O O    . SER A 1 115 ? -5.483  -5.700  4.376   1.00 0.00 ? 115 SER A O    5  
ATOM 8529  C CB   . SER A 1 115 ? -7.582  -5.252  6.603   1.00 0.00 ? 115 SER A CB   5  
ATOM 8530  O OG   . SER A 1 115 ? -7.810  -4.172  7.503   1.00 0.00 ? 115 SER A OG   5  
ATOM 8531  H H    . SER A 1 115 ? -4.734  -4.302  6.258   1.00 0.00 ? 115 SER A H    5  
ATOM 8532  H HA   . SER A 1 115 ? -6.067  -6.500  7.491   1.00 0.00 ? 115 SER A HA   5  
ATOM 8533  H HB3  . SER A 1 115 ? -8.275  -6.064  6.827   1.00 0.00 ? 115 SER A HB3  5  
ATOM 8534  H HG   . SER A 1 115 ? -7.978  -4.524  8.423   1.00 0.00 ? 115 SER A HG   5  
ATOM 8535  N N    . VAL A 1 116 ? -5.684  -7.730  5.353   1.00 0.00 ? 116 VAL A N    5  
ATOM 8536  C CA   . VAL A 1 116 ? -5.309  -8.466  4.158   1.00 0.00 ? 116 VAL A CA   5  
ATOM 8537  C C    . VAL A 1 116 ? -6.326  -9.582  3.911   1.00 0.00 ? 116 VAL A C    5  
ATOM 8538  O O    . VAL A 1 116 ? -7.349  -9.656  4.589   1.00 0.00 ? 116 VAL A O    5  
ATOM 8539  C CB   . VAL A 1 116 ? -3.875  -8.983  4.289   1.00 0.00 ? 116 VAL A CB   5  
ATOM 8540  C CG1  . VAL A 1 116 ? -2.897  -7.832  4.539   1.00 0.00 ? 116 VAL A CG1  5  
ATOM 8541  C CG2  . VAL A 1 116 ? -3.771  -10.038 5.392   1.00 0.00 ? 116 VAL A CG2  5  
ATOM 8542  H H    . VAL A 1 116 ? -5.891  -8.297  6.151   1.00 0.00 ? 116 VAL A H    5  
ATOM 8543  H HA   . VAL A 1 116 ? -5.341  -7.770  3.320   1.00 0.00 ? 116 VAL A HA   5  
ATOM 8544  H HB   . VAL A 1 116 ? -3.601  -9.456  3.346   1.00 0.00 ? 116 VAL A HB   5  
ATOM 8545  H HG11 . VAL A 1 116 ? -2.480  -7.921  5.542   1.00 0.00 ? 116 VAL A HG11 5  
ATOM 8546  H HG12 . VAL A 1 116 ? -2.093  -7.874  3.806   1.00 0.00 ? 116 VAL A HG12 5  
ATOM 8547  H HG13 . VAL A 1 116 ? -3.424  -6.882  4.448   1.00 0.00 ? 116 VAL A HG13 5  
ATOM 8548  H HG21 . VAL A 1 116 ? -4.771  -10.370 5.673   1.00 0.00 ? 116 VAL A HG21 5  
ATOM 8549  H HG22 . VAL A 1 116 ? -3.195  -10.889 5.029   1.00 0.00 ? 116 VAL A HG22 5  
ATOM 8550  H HG23 . VAL A 1 116 ? -3.274  -9.608  6.262   1.00 0.00 ? 116 VAL A HG23 5  
ATOM 8551  N N    . MET A 1 117 ? -6.009  -10.424 2.938   1.00 0.00 ? 117 MET A N    5  
ATOM 8552  C CA   . MET A 1 117 ? -6.882  -11.533 2.595   1.00 0.00 ? 117 MET A CA   5  
ATOM 8553  C C    . MET A 1 117 ? -6.072  -12.795 2.290   1.00 0.00 ? 117 MET A C    5  
ATOM 8554  O O    . MET A 1 117 ? -5.726  -13.052 1.138   1.00 0.00 ? 117 MET A O    5  
ATOM 8555  C CB   . MET A 1 117 ? -7.724  -11.159 1.373   1.00 0.00 ? 117 MET A CB   5  
ATOM 8556  C CG   . MET A 1 117 ? -8.715  -10.043 1.708   1.00 0.00 ? 117 MET A CG   5  
ATOM 8557  S SD   . MET A 1 117 ? -10.351 -10.723 1.923   1.00 0.00 ? 117 MET A SD   5  
ATOM 8558  C CE   . MET A 1 117 ? -10.240 -11.273 3.615   1.00 0.00 ? 117 MET A CE   5  
ATOM 8559  H H    . MET A 1 117 ? -5.174  -10.358 2.391   1.00 0.00 ? 117 MET A H    5  
ATOM 8560  H HA   . MET A 1 117 ? -7.508  -11.696 3.471   1.00 0.00 ? 117 MET A HA   5  
ATOM 8561  H HB3  . MET A 1 117 ? -8.266  -12.037 1.017   1.00 0.00 ? 117 MET A HB3  5  
ATOM 8562  H HG3  . MET A 1 117 ? -8.721  -9.298  0.912   1.00 0.00 ? 117 MET A HG3  5  
ATOM 8563  H HE1  . MET A 1 117 ? -9.919  -10.444 4.247   1.00 0.00 ? 117 MET A HE1  5  
ATOM 8564  H HE2  . MET A 1 117 ? -11.216 -11.627 3.949   1.00 0.00 ? 117 MET A HE2  5  
ATOM 8565  H HE3  . MET A 1 117 ? -9.516  -12.085 3.688   1.00 0.00 ? 117 MET A HE3  5  
ATOM 8566  N N    . PRO A 1 118 ? -5.787  -13.569 3.370   1.00 0.00 ? 118 PRO A N    5  
ATOM 8567  C CA   . PRO A 1 118 ? -5.025  -14.798 3.232   1.00 0.00 ? 118 PRO A CA   5  
ATOM 8568  C C    . PRO A 1 118 ? -5.882  -15.908 2.619   1.00 0.00 ? 118 PRO A C    5  
ATOM 8569  O O    . PRO A 1 118 ? -7.109  -15.857 2.683   1.00 0.00 ? 118 PRO A O    5  
ATOM 8570  C CB   . PRO A 1 118 ? -4.545  -15.126 4.636   1.00 0.00 ? 118 PRO A CB   5  
ATOM 8571  C CG   . PRO A 1 118 ? -5.437  -14.331 5.576   1.00 0.00 ? 118 PRO A CG   5  
ATOM 8572  C CD   . PRO A 1 118 ? -6.182  -13.296 4.750   1.00 0.00 ? 118 PRO A CD   5  
ATOM 8573  H HA   . PRO A 1 118 ? -4.261  -14.663 2.600   1.00 0.00 ? 118 PRO A HA   5  
ATOM 8574  H HB3  . PRO A 1 118 ? -3.498  -14.850 4.764   1.00 0.00 ? 118 PRO A HB3  5  
ATOM 8575  H HG3  . PRO A 1 118 ? -4.840  -13.846 6.349   1.00 0.00 ? 118 PRO A HG3  5  
ATOM 8576  H HD3  . PRO A 1 118 ? -5.911  -12.283 5.046   1.00 0.00 ? 118 PRO A HD3  5  
ATOM 8577  N N    . LYS A 1 119 ? -5.200  -16.885 2.038   1.00 0.00 ? 119 LYS A N    5  
ATOM 8578  C CA   . LYS A 1 119 ? -5.885  -18.006 1.414   1.00 0.00 ? 119 LYS A CA   5  
ATOM 8579  C C    . LYS A 1 119 ? -5.364  -19.313 2.016   1.00 0.00 ? 119 LYS A C    5  
ATOM 8580  O O    . LYS A 1 119 ? -4.248  -19.364 2.530   1.00 0.00 ? 119 LYS A O    5  
ATOM 8581  C CB   . LYS A 1 119 ? -5.752  -17.933 -0.108  1.00 0.00 ? 119 LYS A CB   5  
ATOM 8582  C CG   . LYS A 1 119 ? -7.053  -17.445 -0.749  1.00 0.00 ? 119 LYS A CG   5  
ATOM 8583  C CD   . LYS A 1 119 ? -6.827  -17.032 -2.204  1.00 0.00 ? 119 LYS A CD   5  
ATOM 8584  C CE   . LYS A 1 119 ? -7.739  -17.822 -3.147  1.00 0.00 ? 119 LYS A CE   5  
ATOM 8585  N NZ   . LYS A 1 119 ? -9.152  -17.438 -2.940  1.00 0.00 ? 119 LYS A NZ   5  
ATOM 8586  H H    . LYS A 1 119 ? -4.203  -16.919 1.989   1.00 0.00 ? 119 LYS A H    5  
ATOM 8587  H HA   . LYS A 1 119 ? -6.944  -17.915 1.651   1.00 0.00 ? 119 LYS A HA   5  
ATOM 8588  H HB3  . LYS A 1 119 ? -5.497  -18.917 -0.502  1.00 0.00 ? 119 LYS A HB3  5  
ATOM 8589  H HG3  . LYS A 1 119 ? -7.445  -16.599 -0.184  1.00 0.00 ? 119 LYS A HG3  5  
ATOM 8590  H HD3  . LYS A 1 119 ? -5.785  -17.200 -2.475  1.00 0.00 ? 119 LYS A HD3  5  
ATOM 8591  H HE3  . LYS A 1 119 ? -7.614  -18.890 -2.970  1.00 0.00 ? 119 LYS A HE3  5  
ATOM 8592  H HZ1  . LYS A 1 119 ? -9.645  -18.196 -2.509  1.00 0.00 ? 119 LYS A HZ1  5  
ATOM 8593  H HZ2  . LYS A 1 119 ? -9.198  -16.633 -2.349  1.00 0.00 ? 119 LYS A HZ2  5  
ATOM 8594  H HZ3  . LYS A 1 119 ? -9.574  -17.228 -3.823  1.00 0.00 ? 119 LYS A HZ3  5  
ATOM 8595  N N    . ASP A 1 120 ? -6.197  -20.339 1.930   1.00 0.00 ? 120 ASP A N    5  
ATOM 8596  C CA   . ASP A 1 120 ? -5.835  -21.643 2.459   1.00 0.00 ? 120 ASP A CA   5  
ATOM 8597  C C    . ASP A 1 120 ? -4.787  -22.286 1.548   1.00 0.00 ? 120 ASP A C    5  
ATOM 8598  O O    . ASP A 1 120 ? -5.126  -22.872 0.521   1.00 0.00 ? 120 ASP A O    5  
ATOM 8599  C CB   . ASP A 1 120 ? -7.049  -22.574 2.510   1.00 0.00 ? 120 ASP A CB   5  
ATOM 8600  C CG   . ASP A 1 120 ? -8.133  -22.167 3.511   1.00 0.00 ? 120 ASP A CG   5  
ATOM 8601  O OD1  . ASP A 1 120 ? -7.747  -21.723 4.616   1.00 0.00 ? 120 ASP A OD1  5  
ATOM 8602  O OD2  . ASP A 1 120 ? -9.321  -22.309 3.151   1.00 0.00 ? 120 ASP A OD2  5  
ATOM 8603  H H    . ASP A 1 120 ? -7.104  -20.290 1.510   1.00 0.00 ? 120 ASP A H    5  
ATOM 8604  H HA   . ASP A 1 120 ? -5.454  -21.450 3.462   1.00 0.00 ? 120 ASP A HA   5  
ATOM 8605  H HB3  . ASP A 1 120 ? -6.708  -23.578 2.756   1.00 0.00 ? 120 ASP A HB3  5  
ATOM 8606  N N    . SER A 1 121 ? -3.534  -22.153 1.957   1.00 0.00 ? 121 SER A N    5  
ATOM 8607  C CA   . SER A 1 121 ? -2.434  -22.712 1.190   1.00 0.00 ? 121 SER A CA   5  
ATOM 8608  C C    . SER A 1 121 ? -2.247  -21.926 -0.108  1.00 0.00 ? 121 SER A C    5  
ATOM 8609  O O    . SER A 1 121 ? -3.214  -21.653 -0.818  1.00 0.00 ? 121 SER A O    5  
ATOM 8610  C CB   . SER A 1 121 ? -2.672  -24.192 0.885   1.00 0.00 ? 121 SER A CB   5  
ATOM 8611  O OG   . SER A 1 121 ? -1.479  -24.963 1.012   1.00 0.00 ? 121 SER A OG   5  
ATOM 8612  H H    . SER A 1 121 ? -3.265  -21.674 2.793   1.00 0.00 ? 121 SER A H    5  
ATOM 8613  H HA   . SER A 1 121 ? -1.555  -22.611 1.829   1.00 0.00 ? 121 SER A HA   5  
ATOM 8614  H HB3  . SER A 1 121 ? -3.063  -24.295 -0.128  1.00 0.00 ? 121 SER A HB3  5  
ATOM 8615  H HG   . SER A 1 121 ? -1.062  -24.801 1.907   1.00 0.00 ? 121 SER A HG   5  
ATOM 8616  N N    . GLY A 1 122 ? -0.996  -21.582 -0.381  1.00 0.00 ? 122 GLY A N    5  
ATOM 8617  C CA   . GLY A 1 122 ? -0.671  -20.833 -1.582  1.00 0.00 ? 122 GLY A CA   5  
ATOM 8618  C C    . GLY A 1 122 ? 0.841   -20.640 -1.714  1.00 0.00 ? 122 GLY A C    5  
ATOM 8619  O O    . GLY A 1 122 ? 1.409   -19.727 -1.118  1.00 0.00 ? 122 GLY A O    5  
ATOM 8620  H H    . GLY A 1 122 ? -0.215  -21.807 0.201   1.00 0.00 ? 122 GLY A H    5  
ATOM 8621  H HA2  . GLY A 1 122 ? -1.052  -21.357 -2.458  1.00 0.00 ? 122 GLY A HA2  5  
ATOM 8622  H HA3  . GLY A 1 122 ? -1.164  -19.861 -1.552  1.00 0.00 ? 122 GLY A HA3  5  
ATOM 8623  N N    . PRO A 1 123 ? 1.467   -21.539 -2.522  1.00 0.00 ? 123 PRO A N    5  
ATOM 8624  C CA   . PRO A 1 123 ? 2.902   -21.477 -2.741  1.00 0.00 ? 123 PRO A CA   5  
ATOM 8625  C C    . PRO A 1 123 ? 3.262   -20.326 -3.683  1.00 0.00 ? 123 PRO A C    5  
ATOM 8626  O O    . PRO A 1 123 ? 2.667   -20.181 -4.749  1.00 0.00 ? 123 PRO A O    5  
ATOM 8627  C CB   . PRO A 1 123 ? 3.274   -22.840 -3.299  1.00 0.00 ? 123 PRO A CB   5  
ATOM 8628  C CG   . PRO A 1 123 ? 1.978   -23.451 -3.806  1.00 0.00 ? 123 PRO A CG   5  
ATOM 8629  C CD   . PRO A 1 123 ? 0.826   -22.633 -3.245  1.00 0.00 ? 123 PRO A CD   5  
ATOM 8630  H HA   . PRO A 1 123 ? 3.376   -21.285 -1.881  1.00 0.00 ? 123 PRO A HA   5  
ATOM 8631  H HB3  . PRO A 1 123 ? 3.726   -23.467 -2.529  1.00 0.00 ? 123 PRO A HB3  5  
ATOM 8632  H HG3  . PRO A 1 123 ? 1.897   -24.491 -3.490  1.00 0.00 ? 123 PRO A HG3  5  
ATOM 8633  H HD3  . PRO A 1 123 ? 0.200   -23.233 -2.583  1.00 0.00 ? 123 PRO A HD3  5  
ATOM 8634  N N    . SER A 1 124 ? 4.238   -19.538 -3.256  1.00 0.00 ? 124 SER A N    5  
ATOM 8635  C CA   . SER A 1 124 ? 4.686   -18.406 -4.049  1.00 0.00 ? 124 SER A CA   5  
ATOM 8636  C C    . SER A 1 124 ? 6.093   -18.669 -4.591  1.00 0.00 ? 124 SER A C    5  
ATOM 8637  O O    . SER A 1 124 ? 6.772   -19.591 -4.141  1.00 0.00 ? 124 SER A O    5  
ATOM 8638  C CB   . SER A 1 124 ? 4.669   -17.117 -3.225  1.00 0.00 ? 124 SER A CB   5  
ATOM 8639  O OG   . SER A 1 124 ? 3.555   -16.290 -3.551  1.00 0.00 ? 124 SER A OG   5  
ATOM 8640  H H    . SER A 1 124 ? 4.719   -19.664 -2.388  1.00 0.00 ? 124 SER A H    5  
ATOM 8641  H HA   . SER A 1 124 ? 3.970   -18.324 -4.867  1.00 0.00 ? 124 SER A HA   5  
ATOM 8642  H HB3  . SER A 1 124 ? 5.592   -16.563 -3.398  1.00 0.00 ? 124 SER A HB3  5  
ATOM 8643  H HG   . SER A 1 124 ? 3.391   -15.630 -2.817  1.00 0.00 ? 124 SER A HG   5  
ATOM 8644  N N    . SER A 1 125 ? 6.487   -17.845 -5.550  1.00 0.00 ? 125 SER A N    5  
ATOM 8645  C CA   . SER A 1 125 ? 7.800   -17.977 -6.159  1.00 0.00 ? 125 SER A CA   5  
ATOM 8646  C C    . SER A 1 125 ? 8.800   -17.060 -5.452  1.00 0.00 ? 125 SER A C    5  
ATOM 8647  O O    . SER A 1 125 ? 8.819   -15.855 -5.692  1.00 0.00 ? 125 SER A O    5  
ATOM 8648  C CB   . SER A 1 125 ? 7.749   -17.657 -7.653  1.00 0.00 ? 125 SER A CB   5  
ATOM 8649  O OG   . SER A 1 125 ? 8.915   -18.109 -8.337  1.00 0.00 ? 125 SER A OG   5  
ATOM 8650  H H    . SER A 1 125 ? 5.928   -17.098 -5.909  1.00 0.00 ? 125 SER A H    5  
ATOM 8651  H HA   . SER A 1 125 ? 8.077   -19.023 -6.022  1.00 0.00 ? 125 SER A HA   5  
ATOM 8652  H HB3  . SER A 1 125 ? 7.645   -16.580 -7.789  1.00 0.00 ? 125 SER A HB3  5  
ATOM 8653  H HG   . SER A 1 125 ? 9.630   -18.342 -7.677  1.00 0.00 ? 125 SER A HG   5  
ATOM 8654  N N    . GLY A 1 126 ? 9.606   -17.667 -4.592  1.00 0.00 ? 126 GLY A N    5  
ATOM 8655  C CA   . GLY A 1 126 ? 10.607  -16.918 -3.850  1.00 0.00 ? 126 GLY A CA   5  
ATOM 8656  C C    . GLY A 1 126 ? 9.946   -15.926 -2.889  1.00 0.00 ? 126 GLY A C    5  
ATOM 8657  O O    . GLY A 1 126 ? 9.277   -16.328 -1.940  1.00 0.00 ? 126 GLY A O    5  
ATOM 8658  H H    . GLY A 1 126 ? 9.584   -18.648 -4.401  1.00 0.00 ? 126 GLY A H    5  
ATOM 8659  H HA2  . GLY A 1 126 ? 11.238  -17.608 -3.288  1.00 0.00 ? 126 GLY A HA2  5  
ATOM 8660  H HA3  . GLY A 1 126 ? 11.255  -16.384 -4.543  1.00 0.00 ? 126 GLY A HA3  5  
ATOM 8661  N N    . GLY A 1 1   ? -24.838 -14.080 26.278  1.00 0.00 ? 1   GLY A N    6  
ATOM 8662  C CA   . GLY A 1 1   ? -23.775 -15.003 25.917  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8663  C C    . GLY A 1 1   ? -22.713 -14.307 25.063  1.00 0.00 ? 1   GLY A C    6  
ATOM 8664  O O    . GLY A 1 1   ? -22.943 -13.215 24.548  1.00 0.00 ? 1   GLY A O    6  
ATOM 8665  H H1   . GLY A 1 1   ? -25.765 -14.429 26.141  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8666  H HA2  . GLY A 1 1   ? -23.315 -15.404 26.820  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8667  H HA3  . GLY A 1 1   ? -24.192 -15.847 25.369  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8668  N N    . SER A 1 2   ? -21.572 -14.970 24.941  1.00 0.00 ? 2   SER A N    6  
ATOM 8669  C CA   . SER A 1 2   ? -20.473 -14.430 24.157  1.00 0.00 ? 2   SER A CA   6  
ATOM 8670  C C    . SER A 1 2   ? -19.692 -15.567 23.497  1.00 0.00 ? 2   SER A C    6  
ATOM 8671  O O    . SER A 1 2   ? -18.880 -16.225 24.144  1.00 0.00 ? 2   SER A O    6  
ATOM 8672  C CB   . SER A 1 2   ? -19.543 -13.582 25.027  1.00 0.00 ? 2   SER A CB   6  
ATOM 8673  O OG   . SER A 1 2   ? -19.117 -12.397 24.357  1.00 0.00 ? 2   SER A OG   6  
ATOM 8674  H H    . SER A 1 2   ? -21.392 -15.858 25.362  1.00 0.00 ? 2   SER A H    6  
ATOM 8675  H HA   . SER A 1 2   ? -20.940 -13.797 23.402  1.00 0.00 ? 2   SER A HA   6  
ATOM 8676  H HB3  . SER A 1 2   ? -18.670 -14.172 25.308  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8677  H HG   . SER A 1 2   ? -18.749 -12.628 23.456  1.00 0.00 ? 2   SER A HG   6  
ATOM 8678  N N    . SER A 1 3   ? -19.966 -15.763 22.215  1.00 0.00 ? 3   SER A N    6  
ATOM 8679  C CA   . SER A 1 3   ? -19.299 -16.810 21.459  1.00 0.00 ? 3   SER A CA   6  
ATOM 8680  C C    . SER A 1 3   ? -18.123 -16.221 20.677  1.00 0.00 ? 3   SER A C    6  
ATOM 8681  O O    . SER A 1 3   ? -17.983 -15.003 20.580  1.00 0.00 ? 3   SER A O    6  
ATOM 8682  C CB   . SER A 1 3   ? -20.272 -17.509 20.508  1.00 0.00 ? 3   SER A CB   6  
ATOM 8683  O OG   . SER A 1 3   ? -20.897 -18.635 21.117  1.00 0.00 ? 3   SER A OG   6  
ATOM 8684  H H    . SER A 1 3   ? -20.627 -15.222 21.696  1.00 0.00 ? 3   SER A H    6  
ATOM 8685  H HA   . SER A 1 3   ? -18.945 -17.524 22.204  1.00 0.00 ? 3   SER A HA   6  
ATOM 8686  H HB3  . SER A 1 3   ? -19.738 -17.830 19.614  1.00 0.00 ? 3   SER A HB3  6  
ATOM 8687  H HG   . SER A 1 3   ? -20.205 -19.236 21.514  1.00 0.00 ? 3   SER A HG   6  
ATOM 8688  N N    . GLY A 1 4   ? -17.305 -17.115 20.139  1.00 0.00 ? 4   GLY A N    6  
ATOM 8689  C CA   . GLY A 1 4   ? -16.144 -16.701 19.370  1.00 0.00 ? 4   GLY A CA   6  
ATOM 8690  C C    . GLY A 1 4   ? -16.014 -17.527 18.088  1.00 0.00 ? 4   GLY A C    6  
ATOM 8691  O O    . GLY A 1 4   ? -16.568 -18.620 17.991  1.00 0.00 ? 4   GLY A O    6  
ATOM 8692  H H    . GLY A 1 4   ? -17.425 -18.105 20.223  1.00 0.00 ? 4   GLY A H    6  
ATOM 8693  H HA2  . GLY A 1 4   ? -16.230 -15.644 19.118  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8694  H HA3  . GLY A 1 4   ? -15.243 -16.812 19.972  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8695  N N    . SER A 1 5   ? -15.278 -16.970 17.137  1.00 0.00 ? 5   SER A N    6  
ATOM 8696  C CA   . SER A 1 5   ? -15.066 -17.641 15.865  1.00 0.00 ? 5   SER A CA   6  
ATOM 8697  C C    . SER A 1 5   ? -14.262 -16.741 14.925  1.00 0.00 ? 5   SER A C    6  
ATOM 8698  O O    . SER A 1 5   ? -13.909 -15.619 15.285  1.00 0.00 ? 5   SER A O    6  
ATOM 8699  C CB   . SER A 1 5   ? -16.398 -18.029 15.220  1.00 0.00 ? 5   SER A CB   6  
ATOM 8700  O OG   . SER A 1 5   ? -16.758 -19.379 15.507  1.00 0.00 ? 5   SER A OG   6  
ATOM 8701  H H    . SER A 1 5   ? -14.830 -16.080 17.224  1.00 0.00 ? 5   SER A H    6  
ATOM 8702  H HA   . SER A 1 5   ? -14.503 -18.544 16.106  1.00 0.00 ? 5   SER A HA   6  
ATOM 8703  H HB3  . SER A 1 5   ? -16.331 -17.895 14.140  1.00 0.00 ? 5   SER A HB3  6  
ATOM 8704  H HG   . SER A 1 5   ? -15.942 -19.957 15.511  1.00 0.00 ? 5   SER A HG   6  
ATOM 8705  N N    . SER A 1 6   ? -13.998 -17.267 13.737  1.00 0.00 ? 6   SER A N    6  
ATOM 8706  C CA   . SER A 1 6   ? -13.242 -16.524 12.742  1.00 0.00 ? 6   SER A CA   6  
ATOM 8707  C C    . SER A 1 6   ? -13.837 -15.123 12.573  1.00 0.00 ? 6   SER A C    6  
ATOM 8708  O O    . SER A 1 6   ? -14.969 -14.871 12.982  1.00 0.00 ? 6   SER A O    6  
ATOM 8709  C CB   . SER A 1 6   ? -13.226 -17.259 11.402  1.00 0.00 ? 6   SER A CB   6  
ATOM 8710  O OG   . SER A 1 6   ? -11.949 -17.193 10.771  1.00 0.00 ? 6   SER A OG   6  
ATOM 8711  H H    . SER A 1 6   ? -14.290 -18.179 13.453  1.00 0.00 ? 6   SER A H    6  
ATOM 8712  H HA   . SER A 1 6   ? -12.228 -16.463 13.136  1.00 0.00 ? 6   SER A HA   6  
ATOM 8713  H HB3  . SER A 1 6   ? -13.978 -16.829 10.742  1.00 0.00 ? 6   SER A HB3  6  
ATOM 8714  H HG   . SER A 1 6   ? -11.779 -16.264 10.440  1.00 0.00 ? 6   SER A HG   6  
ATOM 8715  N N    . GLY A 1 7   ? -13.047 -14.250 11.967  1.00 0.00 ? 7   GLY A N    6  
ATOM 8716  C CA   . GLY A 1 7   ? -13.480 -12.882 11.737  1.00 0.00 ? 7   GLY A CA   6  
ATOM 8717  C C    . GLY A 1 7   ? -13.411 -12.527 10.251  1.00 0.00 ? 7   GLY A C    6  
ATOM 8718  O O    . GLY A 1 7   ? -12.672 -11.627 9.857   1.00 0.00 ? 7   GLY A O    6  
ATOM 8719  H H    . GLY A 1 7   ? -12.127 -14.462 11.636  1.00 0.00 ? 7   GLY A H    6  
ATOM 8720  H HA2  . GLY A 1 7   ? -14.501 -12.755 12.099  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8721  H HA3  . GLY A 1 7   ? -12.852 -12.198 12.307  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8722  N N    . GLY A 1 8   ? -14.193 -13.254 9.466   1.00 0.00 ? 8   GLY A N    6  
ATOM 8723  C CA   . GLY A 1 8   ? -14.232 -13.027 8.031   1.00 0.00 ? 8   GLY A CA   6  
ATOM 8724  C C    . GLY A 1 8   ? -12.819 -12.884 7.461   1.00 0.00 ? 8   GLY A C    6  
ATOM 8725  O O    . GLY A 1 8   ? -12.103 -13.874 7.307   1.00 0.00 ? 8   GLY A O    6  
ATOM 8726  H H    . GLY A 1 8   ? -14.792 -13.984 9.793   1.00 0.00 ? 8   GLY A H    6  
ATOM 8727  H HA2  . GLY A 1 8   ? -14.743 -13.856 7.542   1.00 0.00 ? 8   GLY A HA2  6  
ATOM 8728  H HA3  . GLY A 1 8   ? -14.807 -12.127 7.816   1.00 0.00 ? 8   GLY A HA3  6  
ATOM 8729  N N    . PRO A 1 9   ? -12.448 -11.612 7.155   1.00 0.00 ? 9   PRO A N    6  
ATOM 8730  C CA   . PRO A 1 9   ? -11.134 -11.326 6.606   1.00 0.00 ? 9   PRO A CA   6  
ATOM 8731  C C    . PRO A 1 9   ? -10.055 -11.417 7.688   1.00 0.00 ? 9   PRO A C    6  
ATOM 8732  O O    . PRO A 1 9   ? -10.363 -11.638 8.859   1.00 0.00 ? 9   PRO A O    6  
ATOM 8733  C CB   . PRO A 1 9   ? -11.253 -9.936  6.002   1.00 0.00 ? 9   PRO A CB   6  
ATOM 8734  C CG   . PRO A 1 9   ? -12.482 -9.309  6.639   1.00 0.00 ? 9   PRO A CG   6  
ATOM 8735  C CD   . PRO A 1 9   ? -13.268 -10.415 7.324   1.00 0.00 ? 9   PRO A CD   6  
ATOM 8736  H HA   . PRO A 1 9   ? -10.889 -12.009 5.918   1.00 0.00 ? 9   PRO A HA   6  
ATOM 8737  H HB3  . PRO A 1 9   ? -11.358 -9.990  4.918   1.00 0.00 ? 9   PRO A HB3  6  
ATOM 8738  H HG3  . PRO A 1 9   ? -13.094 -8.818  5.883   1.00 0.00 ? 9   PRO A HG3  6  
ATOM 8739  H HD3  . PRO A 1 9   ? -14.251 -10.542 6.872   1.00 0.00 ? 9   PRO A HD3  6  
ATOM 8740  N N    . LYS A 1 10  ? -8.815  -11.242 7.258   1.00 0.00 ? 10  LYS A N    6  
ATOM 8741  C CA   . LYS A 1 10  ? -7.689  -11.302 8.176   1.00 0.00 ? 10  LYS A CA   6  
ATOM 8742  C C    . LYS A 1 10  ? -7.440  -9.910  8.762   1.00 0.00 ? 10  LYS A C    6  
ATOM 8743  O O    . LYS A 1 10  ? -7.670  -8.903  8.095   1.00 0.00 ? 10  LYS A O    6  
ATOM 8744  C CB   . LYS A 1 10  ? -6.465  -11.906 7.484   1.00 0.00 ? 10  LYS A CB   6  
ATOM 8745  C CG   . LYS A 1 10  ? -5.197  -11.661 8.303   1.00 0.00 ? 10  LYS A CG   6  
ATOM 8746  C CD   . LYS A 1 10  ? -5.119  -12.621 9.492   1.00 0.00 ? 10  LYS A CD   6  
ATOM 8747  C CE   . LYS A 1 10  ? -3.700  -13.168 9.664   1.00 0.00 ? 10  LYS A CE   6  
ATOM 8748  N NZ   . LYS A 1 10  ? -3.689  -14.283 10.636  1.00 0.00 ? 10  LYS A NZ   6  
ATOM 8749  H H    . LYS A 1 10  ? -8.574  -11.062 6.304   1.00 0.00 ? 10  LYS A H    6  
ATOM 8750  H HA   . LYS A 1 10  ? -7.965  -11.974 8.987   1.00 0.00 ? 10  LYS A HA   6  
ATOM 8751  H HB3  . LYS A 1 10  ? -6.351  -11.469 6.491   1.00 0.00 ? 10  LYS A HB3  6  
ATOM 8752  H HG3  . LYS A 1 10  ? -5.182  -10.632 8.660   1.00 0.00 ? 10  LYS A HG3  6  
ATOM 8753  H HD3  . LYS A 1 10  ? -5.816  -13.446 9.344   1.00 0.00 ? 10  LYS A HD3  6  
ATOM 8754  H HE3  . LYS A 1 10  ? -3.037  -12.372 10.007  1.00 0.00 ? 10  LYS A HE3  6  
ATOM 8755  H HZ1  . LYS A 1 10  ? -3.664  -15.153 10.143  1.00 0.00 ? 10  LYS A HZ1  6  
ATOM 8756  H HZ2  . LYS A 1 10  ? -2.881  -14.208 11.220  1.00 0.00 ? 10  LYS A HZ2  6  
ATOM 8757  H HZ3  . LYS A 1 10  ? -4.514  -14.243 11.200  1.00 0.00 ? 10  LYS A HZ3  6  
ATOM 8758  N N    . THR A 1 11  ? -6.974  -9.901  10.001  1.00 0.00 ? 11  THR A N    6  
ATOM 8759  C CA   . THR A 1 11  ? -6.692  -8.650  10.684  1.00 0.00 ? 11  THR A CA   6  
ATOM 8760  C C    . THR A 1 11  ? -5.293  -8.684  11.303  1.00 0.00 ? 11  THR A C    6  
ATOM 8761  O O    . THR A 1 11  ? -4.882  -9.700  11.863  1.00 0.00 ? 11  THR A O    6  
ATOM 8762  C CB   . THR A 1 11  ? -7.803  -8.408  11.710  1.00 0.00 ? 11  THR A CB   6  
ATOM 8763  O OG1  . THR A 1 11  ? -9.003  -8.664  10.984  1.00 0.00 ? 11  THR A OG1  6  
ATOM 8764  C CG2  . THR A 1 11  ? -7.917  -6.938  12.114  1.00 0.00 ? 11  THR A CG2  6  
ATOM 8765  H H    . THR A 1 11  ? -6.790  -10.725 10.536  1.00 0.00 ? 11  THR A H    6  
ATOM 8766  H HA   . THR A 1 11  ? -6.695  -7.847  9.948   1.00 0.00 ? 11  THR A HA   6  
ATOM 8767  H HB   . THR A 1 11  ? -7.669  -9.044  12.584  1.00 0.00 ? 11  THR A HB   6  
ATOM 8768  H HG1  . THR A 1 11  ? -9.144  -9.649  10.892  1.00 0.00 ? 11  THR A HG1  6  
ATOM 8769  H HG21 . THR A 1 11  ? -8.954  -6.707  12.355  1.00 0.00 ? 11  THR A HG21 6  
ATOM 8770  H HG22 . THR A 1 11  ? -7.291  -6.751  12.987  1.00 0.00 ? 11  THR A HG22 6  
ATOM 8771  H HG23 . THR A 1 11  ? -7.587  -6.308  11.288  1.00 0.00 ? 11  THR A HG23 6  
ATOM 8772  N N    . VAL A 1 12  ? -4.598  -7.562  11.180  1.00 0.00 ? 12  VAL A N    6  
ATOM 8773  C CA   . VAL A 1 12  ? -3.254  -7.451  11.719  1.00 0.00 ? 12  VAL A CA   6  
ATOM 8774  C C    . VAL A 1 12  ? -3.025  -6.022  12.216  1.00 0.00 ? 12  VAL A C    6  
ATOM 8775  O O    . VAL A 1 12  ? -3.282  -5.061  11.493  1.00 0.00 ? 12  VAL A O    6  
ATOM 8776  C CB   . VAL A 1 12  ? -2.232  -7.891  10.671  1.00 0.00 ? 12  VAL A CB   6  
ATOM 8777  C CG1  . VAL A 1 12  ? -1.903  -9.378  10.815  1.00 0.00 ? 12  VAL A CG1  6  
ATOM 8778  C CG2  . VAL A 1 12  ? -2.723  -7.571  9.257   1.00 0.00 ? 12  VAL A CG2  6  
ATOM 8779  H H    . VAL A 1 12  ? -4.940  -6.741  10.723  1.00 0.00 ? 12  VAL A H    6  
ATOM 8780  H HA   . VAL A 1 12  ? -3.182  -8.132  12.568  1.00 0.00 ? 12  VAL A HA   6  
ATOM 8781  H HB   . VAL A 1 12  ? -1.314  -7.327  10.841  1.00 0.00 ? 12  VAL A HB   6  
ATOM 8782  H HG11 . VAL A 1 12  ? -1.791  -9.625  11.870  1.00 0.00 ? 12  VAL A HG11 6  
ATOM 8783  H HG12 . VAL A 1 12  ? -2.711  -9.971  10.386  1.00 0.00 ? 12  VAL A HG12 6  
ATOM 8784  H HG13 . VAL A 1 12  ? -0.974  -9.597  10.290  1.00 0.00 ? 12  VAL A HG13 6  
ATOM 8785  H HG21 . VAL A 1 12  ? -1.871  -7.332  8.621   1.00 0.00 ? 12  VAL A HG21 6  
ATOM 8786  H HG22 . VAL A 1 12  ? -3.249  -8.435  8.852   1.00 0.00 ? 12  VAL A HG22 6  
ATOM 8787  H HG23 . VAL A 1 12  ? -3.400  -6.717  9.293   1.00 0.00 ? 12  VAL A HG23 6  
ATOM 8788  N N    . THR A 1 13  ? -2.544  -5.926  13.447  1.00 0.00 ? 13  THR A N    6  
ATOM 8789  C CA   . THR A 1 13  ? -2.278  -4.632  14.048  1.00 0.00 ? 13  THR A CA   6  
ATOM 8790  C C    . THR A 1 13  ? -0.772  -4.359  14.084  1.00 0.00 ? 13  THR A C    6  
ATOM 8791  O O    . THR A 1 13  ? 0.029   -5.290  14.158  1.00 0.00 ? 13  THR A O    6  
ATOM 8792  C CB   . THR A 1 13  ? -2.932  -4.608  15.432  1.00 0.00 ? 13  THR A CB   6  
ATOM 8793  O OG1  . THR A 1 13  ? -4.317  -4.811  15.164  1.00 0.00 ? 13  THR A OG1  6  
ATOM 8794  C CG2  . THR A 1 13  ? -2.877  -3.224  16.081  1.00 0.00 ? 13  THR A CG2  6  
ATOM 8795  H H    . THR A 1 13  ? -2.338  -6.713  14.029  1.00 0.00 ? 13  THR A H    6  
ATOM 8796  H HA   . THR A 1 13  ? -2.727  -3.862  13.421  1.00 0.00 ? 13  THR A HA   6  
ATOM 8797  H HB   . THR A 1 13  ? -2.492  -5.362  16.083  1.00 0.00 ? 13  THR A HB   6  
ATOM 8798  H HG1  . THR A 1 13  ? -4.576  -5.750  15.394  1.00 0.00 ? 13  THR A HG1  6  
ATOM 8799  H HG21 . THR A 1 13  ? -3.556  -3.197  16.935  1.00 0.00 ? 13  THR A HG21 6  
ATOM 8800  H HG22 . THR A 1 13  ? -1.861  -3.021  16.419  1.00 0.00 ? 13  THR A HG22 6  
ATOM 8801  H HG23 . THR A 1 13  ? -3.177  -2.469  15.355  1.00 0.00 ? 13  THR A HG23 6  
ATOM 8802  N N    . LEU A 1 14  ? -0.434  -3.079  14.029  1.00 0.00 ? 14  LEU A N    6  
ATOM 8803  C CA   . LEU A 1 14  ? 0.962   -2.673  14.053  1.00 0.00 ? 14  LEU A CA   6  
ATOM 8804  C C    . LEU A 1 14  ? 1.125   -1.488  15.006  1.00 0.00 ? 14  LEU A C    6  
ATOM 8805  O O    . LEU A 1 14  ? 0.189   -0.718  15.214  1.00 0.00 ? 14  LEU A O    6  
ATOM 8806  C CB   . LEU A 1 14  ? 1.463   -2.396  12.635  1.00 0.00 ? 14  LEU A CB   6  
ATOM 8807  C CG   . LEU A 1 14  ? 1.496   -3.598  11.689  1.00 0.00 ? 14  LEU A CG   6  
ATOM 8808  C CD1  . LEU A 1 14  ? 0.163   -3.752  10.953  1.00 0.00 ? 14  LEU A CD1  6  
ATOM 8809  C CD2  . LEU A 1 14  ? 2.677   -3.501  10.720  1.00 0.00 ? 14  LEU A CD2  6  
ATOM 8810  H H    . LEU A 1 14  ? -1.091  -2.329  13.968  1.00 0.00 ? 14  LEU A H    6  
ATOM 8811  H HA   . LEU A 1 14  ? 1.539   -3.511  14.442  1.00 0.00 ? 14  LEU A HA   6  
ATOM 8812  H HB3  . LEU A 1 14  ? 2.471   -1.984  12.702  1.00 0.00 ? 14  LEU A HB3  6  
ATOM 8813  H HG   . LEU A 1 14  ? 1.641   -4.499  12.285  1.00 0.00 ? 14  LEU A HG   6  
ATOM 8814  H HD11 . LEU A 1 14  ? -0.482  -4.431  11.509  1.00 0.00 ? 14  LEU A HD11 6  
ATOM 8815  H HD12 . LEU A 1 14  ? -0.321  -2.779  10.870  1.00 0.00 ? 14  LEU A HD12 6  
ATOM 8816  H HD13 . LEU A 1 14  ? 0.343   -4.154  9.956   1.00 0.00 ? 14  LEU A HD13 6  
ATOM 8817  H HD21 . LEU A 1 14  ? 2.952   -2.455  10.584  1.00 0.00 ? 14  LEU A HD21 6  
ATOM 8818  H HD22 . LEU A 1 14  ? 3.526   -4.050  11.127  1.00 0.00 ? 14  LEU A HD22 6  
ATOM 8819  H HD23 . LEU A 1 14  ? 2.395   -3.930  9.759   1.00 0.00 ? 14  LEU A HD23 6  
ATOM 8820  N N    . LYS A 1 15  ? 2.324   -1.377  15.561  1.00 0.00 ? 15  LYS A N    6  
ATOM 8821  C CA   . LYS A 1 15  ? 2.623   -0.299  16.488  1.00 0.00 ? 15  LYS A CA   6  
ATOM 8822  C C    . LYS A 1 15  ? 3.886   0.429   16.025  1.00 0.00 ? 15  LYS A C    6  
ATOM 8823  O O    . LYS A 1 15  ? 4.962   -0.166  15.958  1.00 0.00 ? 15  LYS A O    6  
ATOM 8824  C CB   . LYS A 1 15  ? 2.710   -0.832  17.920  1.00 0.00 ? 15  LYS A CB   6  
ATOM 8825  C CG   . LYS A 1 15  ? 1.426   -1.563  18.312  1.00 0.00 ? 15  LYS A CG   6  
ATOM 8826  C CD   . LYS A 1 15  ? 0.979   -1.169  19.722  1.00 0.00 ? 15  LYS A CD   6  
ATOM 8827  C CE   . LYS A 1 15  ? -0.202  -2.025  20.182  1.00 0.00 ? 15  LYS A CE   6  
ATOM 8828  N NZ   . LYS A 1 15  ? -0.349  -1.956  21.654  1.00 0.00 ? 15  LYS A NZ   6  
ATOM 8829  H H    . LYS A 1 15  ? 3.080   -2.008  15.388  1.00 0.00 ? 15  LYS A H    6  
ATOM 8830  H HA   . LYS A 1 15  ? 1.789   0.400   16.455  1.00 0.00 ? 15  LYS A HA   6  
ATOM 8831  H HB3  . LYS A 1 15  ? 2.889   -0.007  18.609  1.00 0.00 ? 15  LYS A HB3  6  
ATOM 8832  H HG3  . LYS A 1 15  ? 1.586   -2.639  18.266  1.00 0.00 ? 15  LYS A HG3  6  
ATOM 8833  H HD3  . LYS A 1 15  ? 0.698   -0.116  19.738  1.00 0.00 ? 15  LYS A HD3  6  
ATOM 8834  H HE3  . LYS A 1 15  ? -0.051  -3.060  19.876  1.00 0.00 ? 15  LYS A HE3  6  
ATOM 8835  H HZ1  . LYS A 1 15  ? -0.019  -2.806  22.063  1.00 0.00 ? 15  LYS A HZ1  6  
ATOM 8836  H HZ2  . LYS A 1 15  ? 0.183   -1.187  22.007  1.00 0.00 ? 15  LYS A HZ2  6  
ATOM 8837  H HZ3  . LYS A 1 15  ? -1.314  -1.828  21.886  1.00 0.00 ? 15  LYS A HZ3  6  
ATOM 8838  N N    . ARG A 1 16  ? 3.715   1.707   15.718  1.00 0.00 ? 16  ARG A N    6  
ATOM 8839  C CA   . ARG A 1 16  ? 4.829   2.522   15.263  1.00 0.00 ? 16  ARG A CA   6  
ATOM 8840  C C    . ARG A 1 16  ? 6.030   2.347   16.194  1.00 0.00 ? 16  ARG A C    6  
ATOM 8841  O O    . ARG A 1 16  ? 5.982   2.741   17.358  1.00 0.00 ? 16  ARG A O    6  
ATOM 8842  C CB   . ARG A 1 16  ? 4.442   4.002   15.213  1.00 0.00 ? 16  ARG A CB   6  
ATOM 8843  C CG   . ARG A 1 16  ? 5.514   4.824   14.494  1.00 0.00 ? 16  ARG A CG   6  
ATOM 8844  C CD   . ARG A 1 16  ? 4.905   5.635   13.348  1.00 0.00 ? 16  ARG A CD   6  
ATOM 8845  N NE   . ARG A 1 16  ? 5.848   6.693   12.922  1.00 0.00 ? 16  ARG A NE   6  
ATOM 8846  C CZ   . ARG A 1 16  ? 6.105   7.802   13.630  1.00 0.00 ? 16  ARG A CZ   6  
ATOM 8847  N NH1  . ARG A 1 16  ? 5.490   8.004   14.803  1.00 0.00 ? 16  ARG A NH1  6  
ATOM 8848  N NH2  . ARG A 1 16  ? 6.974   8.709   13.164  1.00 0.00 ? 16  ARG A NH2  6  
ATOM 8849  H H    . ARG A 1 16  ? 2.839   2.182   15.775  1.00 0.00 ? 16  ARG A H    6  
ATOM 8850  H HA   . ARG A 1 16  ? 5.052   2.156   14.261  1.00 0.00 ? 16  ARG A HA   6  
ATOM 8851  H HB3  . ARG A 1 16  ? 4.306   4.381   16.225  1.00 0.00 ? 16  ARG A HB3  6  
ATOM 8852  H HG3  . ARG A 1 16  ? 6.286   4.160   14.105  1.00 0.00 ? 16  ARG A HG3  6  
ATOM 8853  H HD3  . ARG A 1 16  ? 3.964   6.082   13.667  1.00 0.00 ? 16  ARG A HD3  6  
ATOM 8854  H HE   . ARG A 1 16  ? 6.324   6.574   12.050  1.00 0.00 ? 16  ARG A HE   6  
ATOM 8855  H HH11 . ARG A 1 16  ? 4.840   7.327   15.150  1.00 0.00 ? 16  ARG A HH11 6  
ATOM 8856  H HH12 . ARG A 1 16  ? 5.681   8.831   15.332  1.00 0.00 ? 16  ARG A HH12 6  
ATOM 8857  H HH21 . ARG A 1 16  ? 7.432   8.558   12.289  1.00 0.00 ? 16  ARG A HH21 6  
ATOM 8858  H HH22 . ARG A 1 16  ? 7.166   9.536   13.693  1.00 0.00 ? 16  ARG A HH22 6  
ATOM 8859  N N    . THR A 1 17  ? 7.081   1.755   15.645  1.00 0.00 ? 17  THR A N    6  
ATOM 8860  C CA   . THR A 1 17  ? 8.293   1.523   16.411  1.00 0.00 ? 17  THR A CA   6  
ATOM 8861  C C    . THR A 1 17  ? 9.327   2.612   16.118  1.00 0.00 ? 17  THR A C    6  
ATOM 8862  O O    . THR A 1 17  ? 10.457  2.312   15.732  1.00 0.00 ? 17  THR A O    6  
ATOM 8863  C CB   . THR A 1 17  ? 8.790   0.111   16.094  1.00 0.00 ? 17  THR A CB   6  
ATOM 8864  O OG1  . THR A 1 17  ? 9.383   0.233   14.804  1.00 0.00 ? 17  THR A OG1  6  
ATOM 8865  C CG2  . THR A 1 17  ? 7.644   -0.880  15.886  1.00 0.00 ? 17  THR A CG2  6  
ATOM 8866  H H    . THR A 1 17  ? 7.112   1.437   14.697  1.00 0.00 ? 17  THR A H    6  
ATOM 8867  H HA   . THR A 1 17  ? 8.048   1.593   17.472  1.00 0.00 ? 17  THR A HA   6  
ATOM 8868  H HB   . THR A 1 17  ? 9.475   -0.243  16.864  1.00 0.00 ? 17  THR A HB   6  
ATOM 8869  H HG1  . THR A 1 17  ? 8.679   0.431   14.122  1.00 0.00 ? 17  THR A HG1  6  
ATOM 8870  H HG21 . THR A 1 17  ? 8.049   -1.886  15.769  1.00 0.00 ? 17  THR A HG21 6  
ATOM 8871  H HG22 . THR A 1 17  ? 6.978   -0.854  16.747  1.00 0.00 ? 17  THR A HG22 6  
ATOM 8872  H HG23 . THR A 1 17  ? 7.088   -0.609  14.988  1.00 0.00 ? 17  THR A HG23 6  
ATOM 8873  N N    . SER A 1 18  ? 8.904   3.852   16.309  1.00 0.00 ? 18  SER A N    6  
ATOM 8874  C CA   . SER A 1 18  ? 9.779   4.987   16.068  1.00 0.00 ? 18  SER A CA   6  
ATOM 8875  C C    . SER A 1 18  ? 10.293  4.956   14.628  1.00 0.00 ? 18  SER A C    6  
ATOM 8876  O O    . SER A 1 18  ? 11.460  5.251   14.375  1.00 0.00 ? 18  SER A O    6  
ATOM 8877  C CB   . SER A 1 18  ? 10.952  4.995   17.051  1.00 0.00 ? 18  SER A CB   6  
ATOM 8878  O OG   . SER A 1 18  ? 10.714  5.858   18.159  1.00 0.00 ? 18  SER A OG   6  
ATOM 8879  H H    . SER A 1 18  ? 7.984   4.087   16.622  1.00 0.00 ? 18  SER A H    6  
ATOM 8880  H HA   . SER A 1 18  ? 9.161   5.868   16.235  1.00 0.00 ? 18  SER A HA   6  
ATOM 8881  H HB3  . SER A 1 18  ? 11.857  5.313   16.532  1.00 0.00 ? 18  SER A HB3  6  
ATOM 8882  H HG   . SER A 1 18  ? 11.325  5.619   18.915  1.00 0.00 ? 18  SER A HG   6  
ATOM 8883  N N    . GLN A 1 19  ? 9.396   4.595   13.721  1.00 0.00 ? 19  GLN A N    6  
ATOM 8884  C CA   . GLN A 1 19  ? 9.744   4.522   12.313  1.00 0.00 ? 19  GLN A CA   6  
ATOM 8885  C C    . GLN A 1 19  ? 8.514   4.158   11.480  1.00 0.00 ? 19  GLN A C    6  
ATOM 8886  O O    . GLN A 1 19  ? 7.401   4.106   12.001  1.00 0.00 ? 19  GLN A O    6  
ATOM 8887  C CB   . GLN A 1 19  ? 10.879  3.521   12.080  1.00 0.00 ? 19  GLN A CB   6  
ATOM 8888  C CG   . GLN A 1 19  ? 12.119  4.220   11.518  1.00 0.00 ? 19  GLN A CG   6  
ATOM 8889  C CD   . GLN A 1 19  ? 13.317  3.267   11.485  1.00 0.00 ? 19  GLN A CD   6  
ATOM 8890  O OE1  . GLN A 1 19  ? 13.976  3.025   12.483  1.00 0.00 ? 19  GLN A OE1  6  
ATOM 8891  N NE2  . GLN A 1 19  ? 13.559  2.742   10.288  1.00 0.00 ? 19  GLN A NE2  6  
ATOM 8892  H H    . GLN A 1 19  ? 8.450   4.356   13.936  1.00 0.00 ? 19  GLN A H    6  
ATOM 8893  H HA   . GLN A 1 19  ? 10.090  5.521   12.046  1.00 0.00 ? 19  GLN A HA   6  
ATOM 8894  H HB3  . GLN A 1 19  ? 10.548  2.746   11.388  1.00 0.00 ? 19  GLN A HB3  6  
ATOM 8895  H HG3  . GLN A 1 19  ? 12.358  5.090   12.127  1.00 0.00 ? 19  GLN A HG3  6  
ATOM 8896  H HE21 . GLN A 1 19  ? 12.978  2.983   9.510   1.00 0.00 ? 19  GLN A HE21 6  
ATOM 8897  H HE22 . GLN A 1 19  ? 14.321  2.108   10.165  1.00 0.00 ? 19  GLN A HE22 6  
ATOM 8898  N N    . GLY A 1 20  ? 8.755   3.918   10.199  1.00 0.00 ? 20  GLY A N    6  
ATOM 8899  C CA   . GLY A 1 20  ? 7.680   3.561   9.290   1.00 0.00 ? 20  GLY A CA   6  
ATOM 8900  C C    . GLY A 1 20  ? 7.346   2.071   9.391   1.00 0.00 ? 20  GLY A C    6  
ATOM 8901  O O    . GLY A 1 20  ? 7.270   1.378   8.379   1.00 0.00 ? 20  GLY A O    6  
ATOM 8902  H H    . GLY A 1 20  ? 9.664   3.962   9.783   1.00 0.00 ? 20  GLY A H    6  
ATOM 8903  H HA2  . GLY A 1 20  ? 6.794   4.153   9.518   1.00 0.00 ? 20  GLY A HA2  6  
ATOM 8904  H HA3  . GLY A 1 20  ? 7.968   3.803   8.267   1.00 0.00 ? 20  GLY A HA3  6  
ATOM 8905  N N    . PHE A 1 21  ? 7.154   1.624   10.624  1.00 0.00 ? 21  PHE A N    6  
ATOM 8906  C CA   . PHE A 1 21  ? 6.830   0.230   10.872  1.00 0.00 ? 21  PHE A CA   6  
ATOM 8907  C C    . PHE A 1 21  ? 7.877   -0.696  10.249  1.00 0.00 ? 21  PHE A C    6  
ATOM 8908  O O    . PHE A 1 21  ? 8.868   -0.230  9.688   1.00 0.00 ? 21  PHE A O    6  
ATOM 8909  C CB   . PHE A 1 21  ? 5.475   -0.039  10.215  1.00 0.00 ? 21  PHE A CB   6  
ATOM 8910  C CG   . PHE A 1 21  ? 4.309   0.704   10.870  1.00 0.00 ? 21  PHE A CG   6  
ATOM 8911  C CD1  . PHE A 1 21  ? 3.991   0.458   12.170  1.00 0.00 ? 21  PHE A CD1  6  
ATOM 8912  C CD2  . PHE A 1 21  ? 3.589   1.607   10.155  1.00 0.00 ? 21  PHE A CD2  6  
ATOM 8913  C CE1  . PHE A 1 21  ? 2.908   1.147   12.779  1.00 0.00 ? 21  PHE A CE1  6  
ATOM 8914  C CE2  . PHE A 1 21  ? 2.505   2.296   10.764  1.00 0.00 ? 21  PHE A CE2  6  
ATOM 8915  C CZ   . PHE A 1 21  ? 2.188   2.051   12.063  1.00 0.00 ? 21  PHE A CZ   6  
ATOM 8916  H H    . PHE A 1 21  ? 7.218   2.195   11.442  1.00 0.00 ? 21  PHE A H    6  
ATOM 8917  H HA   . PHE A 1 21  ? 6.820   0.088   11.953  1.00 0.00 ? 21  PHE A HA   6  
ATOM 8918  H HB3  . PHE A 1 21  ? 5.273   -1.109  10.244  1.00 0.00 ? 21  PHE A HB3  6  
ATOM 8919  H HD1  . PHE A 1 21  ? 4.569   -0.266  12.746  1.00 0.00 ? 21  PHE A HD1  6  
ATOM 8920  H HD2  . PHE A 1 21  ? 3.842   1.804   9.112   1.00 0.00 ? 21  PHE A HD2  6  
ATOM 8921  H HE1  . PHE A 1 21  ? 2.654   0.951   13.821  1.00 0.00 ? 21  PHE A HE1  6  
ATOM 8922  H HE2  . PHE A 1 21  ? 1.928   3.021   10.189  1.00 0.00 ? 21  PHE A HE2  6  
ATOM 8923  H HZ   . PHE A 1 21  ? 1.358   2.579   12.530  1.00 0.00 ? 21  PHE A HZ   6  
ATOM 8924  N N    . GLY A 1 22  ? 7.622   -1.991  10.369  1.00 0.00 ? 22  GLY A N    6  
ATOM 8925  C CA   . GLY A 1 22  ? 8.530   -2.985  9.825   1.00 0.00 ? 22  GLY A CA   6  
ATOM 8926  C C    . GLY A 1 22  ? 8.228   -3.256  8.349   1.00 0.00 ? 22  GLY A C    6  
ATOM 8927  O O    . GLY A 1 22  ? 8.991   -2.857  7.472   1.00 0.00 ? 22  GLY A O    6  
ATOM 8928  H H    . GLY A 1 22  ? 6.815   -2.361  10.827  1.00 0.00 ? 22  GLY A H    6  
ATOM 8929  H HA2  . GLY A 1 22  ? 9.559   -2.641  9.932   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 8930  H HA3  . GLY A 1 22  ? 8.444   -3.912  10.393  1.00 0.00 ? 22  GLY A HA3  6  
ATOM 8931  N N    . PHE A 1 23  ? 7.111   -3.931  8.122   1.00 0.00 ? 23  PHE A N    6  
ATOM 8932  C CA   . PHE A 1 23  ? 6.697   -4.260  6.768   1.00 0.00 ? 23  PHE A CA   6  
ATOM 8933  C C    . PHE A 1 23  ? 6.802   -3.039  5.852   1.00 0.00 ? 23  PHE A C    6  
ATOM 8934  O O    . PHE A 1 23  ? 7.002   -1.920  6.322   1.00 0.00 ? 23  PHE A O    6  
ATOM 8935  C CB   . PHE A 1 23  ? 5.235   -4.703  6.843   1.00 0.00 ? 23  PHE A CB   6  
ATOM 8936  C CG   . PHE A 1 23  ? 4.238   -3.549  6.950   1.00 0.00 ? 23  PHE A CG   6  
ATOM 8937  C CD1  . PHE A 1 23  ? 4.216   -2.772  8.067   1.00 0.00 ? 23  PHE A CD1  6  
ATOM 8938  C CD2  . PHE A 1 23  ? 3.374   -3.298  5.930   1.00 0.00 ? 23  PHE A CD2  6  
ATOM 8939  C CE1  . PHE A 1 23  ? 3.291   -1.699  8.167   1.00 0.00 ? 23  PHE A CE1  6  
ATOM 8940  C CE2  . PHE A 1 23  ? 2.450   -2.226  6.031   1.00 0.00 ? 23  PHE A CE2  6  
ATOM 8941  C CZ   . PHE A 1 23  ? 2.426   -1.449  7.146   1.00 0.00 ? 23  PHE A CZ   6  
ATOM 8942  H H    . PHE A 1 23  ? 6.495   -4.252  8.841   1.00 0.00 ? 23  PHE A H    6  
ATOM 8943  H HA   . PHE A 1 23  ? 7.366   -5.040  6.406   1.00 0.00 ? 23  PHE A HA   6  
ATOM 8944  H HB3  . PHE A 1 23  ? 5.109   -5.361  7.703   1.00 0.00 ? 23  PHE A HB3  6  
ATOM 8945  H HD1  . PHE A 1 23  ? 4.908   -2.973  8.884   1.00 0.00 ? 23  PHE A HD1  6  
ATOM 8946  H HD2  . PHE A 1 23  ? 3.391   -3.921  5.036   1.00 0.00 ? 23  PHE A HD2  6  
ATOM 8947  H HE1  . PHE A 1 23  ? 3.272   -1.077  9.061   1.00 0.00 ? 23  PHE A HE1  6  
ATOM 8948  H HE2  . PHE A 1 23  ? 1.757   -2.025  5.213   1.00 0.00 ? 23  PHE A HE2  6  
ATOM 8949  H HZ   . PHE A 1 23  ? 1.717   -0.626  7.224   1.00 0.00 ? 23  PHE A HZ   6  
ATOM 8950  N N    . THR A 1 24  ? 6.658   -3.294  4.559   1.00 0.00 ? 24  THR A N    6  
ATOM 8951  C CA   . THR A 1 24  ? 6.734   -2.231  3.574   1.00 0.00 ? 24  THR A CA   6  
ATOM 8952  C C    . THR A 1 24  ? 5.837   -2.549  2.376   1.00 0.00 ? 24  THR A C    6  
ATOM 8953  O O    . THR A 1 24  ? 5.518   -3.710  2.126   1.00 0.00 ? 24  THR A O    6  
ATOM 8954  C CB   . THR A 1 24  ? 8.204   -2.037  3.197   1.00 0.00 ? 24  THR A CB   6  
ATOM 8955  O OG1  . THR A 1 24  ? 8.162   -1.175  2.064   1.00 0.00 ? 24  THR A OG1  6  
ATOM 8956  C CG2  . THR A 1 24  ? 8.846   -3.321  2.666   1.00 0.00 ? 24  THR A CG2  6  
ATOM 8957  H H    . THR A 1 24  ? 6.495   -4.207  4.186   1.00 0.00 ? 24  THR A H    6  
ATOM 8958  H HA   . THR A 1 24  ? 6.350   -1.316  4.026   1.00 0.00 ? 24  THR A HA   6  
ATOM 8959  H HB   . THR A 1 24  ? 8.771   -1.637  4.037   1.00 0.00 ? 24  THR A HB   6  
ATOM 8960  H HG1  . THR A 1 24  ? 8.802   -0.416  2.187   1.00 0.00 ? 24  THR A HG1  6  
ATOM 8961  H HG21 . THR A 1 24  ? 8.071   -3.983  2.281   1.00 0.00 ? 24  THR A HG21 6  
ATOM 8962  H HG22 . THR A 1 24  ? 9.544   -3.073  1.865   1.00 0.00 ? 24  THR A HG22 6  
ATOM 8963  H HG23 . THR A 1 24  ? 9.381   -3.820  3.473   1.00 0.00 ? 24  THR A HG23 6  
ATOM 8964  N N    . LEU A 1 25  ? 5.455   -1.498  1.666   1.00 0.00 ? 25  LEU A N    6  
ATOM 8965  C CA   . LEU A 1 25  ? 4.602   -1.650  0.500   1.00 0.00 ? 25  LEU A CA   6  
ATOM 8966  C C    . LEU A 1 25  ? 5.417   -1.375  -0.764  1.00 0.00 ? 25  LEU A C    6  
ATOM 8967  O O    . LEU A 1 25  ? 6.467   -0.738  -0.702  1.00 0.00 ? 25  LEU A O    6  
ATOM 8968  C CB   . LEU A 1 25  ? 3.355   -0.774  0.631   1.00 0.00 ? 25  LEU A CB   6  
ATOM 8969  C CG   . LEU A 1 25  ? 2.581   -0.898  1.945   1.00 0.00 ? 25  LEU A CG   6  
ATOM 8970  C CD1  . LEU A 1 25  ? 2.279   -2.362  2.267   1.00 0.00 ? 25  LEU A CD1  6  
ATOM 8971  C CD2  . LEU A 1 25  ? 3.327   -0.203  3.088   1.00 0.00 ? 25  LEU A CD2  6  
ATOM 8972  H H    . LEU A 1 25  ? 5.719   -0.556  1.876   1.00 0.00 ? 25  LEU A H    6  
ATOM 8973  H HA   . LEU A 1 25  ? 4.266   -2.688  0.476   1.00 0.00 ? 25  LEU A HA   6  
ATOM 8974  H HB3  . LEU A 1 25  ? 2.677   -1.015  -0.189  1.00 0.00 ? 25  LEU A HB3  6  
ATOM 8975  H HG   . LEU A 1 25  ? 1.625   -0.389  1.829   1.00 0.00 ? 25  LEU A HG   6  
ATOM 8976  H HD11 . LEU A 1 25  ? 1.595   -2.765  1.521   1.00 0.00 ? 25  LEU A HD11 6  
ATOM 8977  H HD12 . LEU A 1 25  ? 3.205   -2.936  2.259   1.00 0.00 ? 25  LEU A HD12 6  
ATOM 8978  H HD13 . LEU A 1 25  ? 1.819   -2.430  3.254   1.00 0.00 ? 25  LEU A HD13 6  
ATOM 8979  H HD21 . LEU A 1 25  ? 3.797   -0.953  3.724   1.00 0.00 ? 25  LEU A HD21 6  
ATOM 8980  H HD22 . LEU A 1 25  ? 4.092   0.454   2.674   1.00 0.00 ? 25  LEU A HD22 6  
ATOM 8981  H HD23 . LEU A 1 25  ? 2.622   0.384   3.677   1.00 0.00 ? 25  LEU A HD23 6  
ATOM 8982  N N    . ARG A 1 26  ? 4.903   -1.868  -1.881  1.00 0.00 ? 26  ARG A N    6  
ATOM 8983  C CA   . ARG A 1 26  ? 5.571   -1.682  -3.158  1.00 0.00 ? 26  ARG A CA   6  
ATOM 8984  C C    . ARG A 1 26  ? 4.691   -2.200  -4.297  1.00 0.00 ? 26  ARG A C    6  
ATOM 8985  O O    . ARG A 1 26  ? 3.688   -2.869  -4.056  1.00 0.00 ? 26  ARG A O    6  
ATOM 8986  C CB   . ARG A 1 26  ? 6.915   -2.414  -3.189  1.00 0.00 ? 26  ARG A CB   6  
ATOM 8987  C CG   . ARG A 1 26  ? 7.835   -1.826  -4.259  1.00 0.00 ? 26  ARG A CG   6  
ATOM 8988  C CD   . ARG A 1 26  ? 9.305   -1.983  -3.866  1.00 0.00 ? 26  ARG A CD   6  
ATOM 8989  N NE   . ARG A 1 26  ? 10.175  -1.395  -4.909  1.00 0.00 ? 26  ARG A NE   6  
ATOM 8990  C CZ   . ARG A 1 26  ? 10.304  -0.079  -5.124  1.00 0.00 ? 26  ARG A CZ   6  
ATOM 8991  N NH1  . ARG A 1 26  ? 9.623   0.793   -4.370  1.00 0.00 ? 26  ARG A NH1  6  
ATOM 8992  N NH2  . ARG A 1 26  ? 11.116  0.365   -6.093  1.00 0.00 ? 26  ARG A NH2  6  
ATOM 8993  H H    . ARG A 1 26  ? 4.049   -2.385  -1.922  1.00 0.00 ? 26  ARG A H    6  
ATOM 8994  H HA   . ARG A 1 26  ? 5.725   -0.606  -3.239  1.00 0.00 ? 26  ARG A HA   6  
ATOM 8995  H HB3  . ARG A 1 26  ? 6.752   -3.473  -3.386  1.00 0.00 ? 26  ARG A HB3  6  
ATOM 8996  H HG3  . ARG A 1 26  ? 7.605   -0.769  -4.402  1.00 0.00 ? 26  ARG A HG3  6  
ATOM 8997  H HD3  . ARG A 1 26  ? 9.544   -3.040  -3.735  1.00 0.00 ? 26  ARG A HD3  6  
ATOM 8998  H HE   . ARG A 1 26  ? 10.698  -2.018  -5.490  1.00 0.00 ? 26  ARG A HE   6  
ATOM 8999  H HH11 . ARG A 1 26  ? 9.016   0.463   -3.646  1.00 0.00 ? 26  ARG A HH11 6  
ATOM 9000  H HH12 . ARG A 1 26  ? 9.719   1.776   -4.529  1.00 0.00 ? 26  ARG A HH12 6  
ATOM 9001  H HH21 . ARG A 1 26  ? 11.626  -0.286  -6.655  1.00 0.00 ? 26  ARG A HH21 6  
ATOM 9002  H HH22 . ARG A 1 26  ? 11.213  1.348   -6.254  1.00 0.00 ? 26  ARG A HH22 6  
ATOM 9003  N N    . HIS A 1 27  ? 5.099   -1.870  -5.515  1.00 0.00 ? 27  HIS A N    6  
ATOM 9004  C CA   . HIS A 1 27  ? 4.360   -2.293  -6.692  1.00 0.00 ? 27  HIS A CA   6  
ATOM 9005  C C    . HIS A 1 27  ? 2.944   -1.717  -6.643  1.00 0.00 ? 27  HIS A C    6  
ATOM 9006  O O    . HIS A 1 27  ? 2.412   -1.455  -5.565  1.00 0.00 ? 27  HIS A O    6  
ATOM 9007  C CB   . HIS A 1 27  ? 4.376   -3.818  -6.824  1.00 0.00 ? 27  HIS A CB   6  
ATOM 9008  C CG   . HIS A 1 27  ? 5.414   -4.340  -7.788  1.00 0.00 ? 27  HIS A CG   6  
ATOM 9009  N ND1  . HIS A 1 27  ? 5.326   -4.158  -9.157  1.00 0.00 ? 27  HIS A ND1  6  
ATOM 9010  C CD2  . HIS A 1 27  ? 6.564   -5.038  -7.566  1.00 0.00 ? 27  HIS A CD2  6  
ATOM 9011  C CE1  . HIS A 1 27  ? 6.380   -4.726  -9.723  1.00 0.00 ? 27  HIS A CE1  6  
ATOM 9012  N NE2  . HIS A 1 27  ? 7.145   -5.272  -8.735  1.00 0.00 ? 27  HIS A NE2  6  
ATOM 9013  H H    . HIS A 1 27  ? 5.916   -1.325  -5.701  1.00 0.00 ? 27  HIS A H    6  
ATOM 9014  H HA   . HIS A 1 27  ? 4.882   -1.879  -7.555  1.00 0.00 ? 27  HIS A HA   6  
ATOM 9015  H HB3  . HIS A 1 27  ? 3.390   -4.153  -7.149  1.00 0.00 ? 27  HIS A HB3  6  
ATOM 9016  H HD1  . HIS A 1 27  ? 4.591   -3.678  -9.637  1.00 0.00 ? 27  HIS A HD1  6  
ATOM 9017  H HD2  . HIS A 1 27  ? 6.941   -5.352  -6.591  1.00 0.00 ? 27  HIS A HD2  6  
ATOM 9018  H HE1  . HIS A 1 27  ? 6.597   -4.753  -10.791 1.00 0.00 ? 27  HIS A HE1  6  
ATOM 9019  N N    . PHE A 1 28  ? 2.373   -1.534  -7.825  1.00 0.00 ? 28  PHE A N    6  
ATOM 9020  C CA   . PHE A 1 28  ? 1.028   -0.993  -7.931  1.00 0.00 ? 28  PHE A CA   6  
ATOM 9021  C C    . PHE A 1 28  ? 0.483   -1.155  -9.351  1.00 0.00 ? 28  PHE A C    6  
ATOM 9022  O O    . PHE A 1 28  ? 1.214   -0.979  -10.325 1.00 0.00 ? 28  PHE A O    6  
ATOM 9023  C CB   . PHE A 1 28  ? 1.119   0.498   -7.599  1.00 0.00 ? 28  PHE A CB   6  
ATOM 9024  C CG   . PHE A 1 28  ? -0.237  1.167   -7.367  1.00 0.00 ? 28  PHE A CG   6  
ATOM 9025  C CD1  . PHE A 1 28  ? -1.172  0.556   -6.591  1.00 0.00 ? 28  PHE A CD1  6  
ATOM 9026  C CD2  . PHE A 1 28  ? -0.508  2.371   -7.936  1.00 0.00 ? 28  PHE A CD2  6  
ATOM 9027  C CE1  . PHE A 1 28  ? -2.431  1.177   -6.375  1.00 0.00 ? 28  PHE A CE1  6  
ATOM 9028  C CE2  . PHE A 1 28  ? -1.766  2.993   -7.721  1.00 0.00 ? 28  PHE A CE2  6  
ATOM 9029  C CZ   . PHE A 1 28  ? -2.702  2.382   -6.945  1.00 0.00 ? 28  PHE A CZ   6  
ATOM 9030  H H    . PHE A 1 28  ? 2.812   -1.749  -8.697  1.00 0.00 ? 28  PHE A H    6  
ATOM 9031  H HA   . PHE A 1 28  ? 0.400   -1.551  -7.237  1.00 0.00 ? 28  PHE A HA   6  
ATOM 9032  H HB3  . PHE A 1 28  ? 1.631   1.010   -8.414  1.00 0.00 ? 28  PHE A HB3  6  
ATOM 9033  H HD1  . PHE A 1 28  ? -0.955  -0.410  -6.134  1.00 0.00 ? 28  PHE A HD1  6  
ATOM 9034  H HD2  . PHE A 1 28  ? 0.242   2.861   -8.558  1.00 0.00 ? 28  PHE A HD2  6  
ATOM 9035  H HE1  . PHE A 1 28  ? -3.182  0.688   -5.752  1.00 0.00 ? 28  PHE A HE1  6  
ATOM 9036  H HE2  . PHE A 1 28  ? -1.983  3.958   -8.178  1.00 0.00 ? 28  PHE A HE2  6  
ATOM 9037  H HZ   . PHE A 1 28  ? -3.668  2.859   -6.780  1.00 0.00 ? 28  PHE A HZ   6  
ATOM 9038  N N    . ILE A 1 29  ? -0.797  -1.490  -9.425  1.00 0.00 ? 29  ILE A N    6  
ATOM 9039  C CA   . ILE A 1 29  ? -1.449  -1.677  -10.709 1.00 0.00 ? 29  ILE A CA   6  
ATOM 9040  C C    . ILE A 1 29  ? -1.571  -0.325  -11.417 1.00 0.00 ? 29  ILE A C    6  
ATOM 9041  O O    . ILE A 1 29  ? -0.696  0.056   -12.190 1.00 0.00 ? 29  ILE A O    6  
ATOM 9042  C CB   . ILE A 1 29  ? -2.784  -2.401  -10.531 1.00 0.00 ? 29  ILE A CB   6  
ATOM 9043  C CG1  . ILE A 1 29  ? -2.590  -3.746  -9.826  1.00 0.00 ? 29  ILE A CG1  6  
ATOM 9044  C CG2  . ILE A 1 29  ? -3.507  -2.557  -11.872 1.00 0.00 ? 29  ILE A CG2  6  
ATOM 9045  C CD1  . ILE A 1 29  ? -3.905  -4.523  -9.757  1.00 0.00 ? 29  ILE A CD1  6  
ATOM 9046  H H    . ILE A 1 29  ? -1.385  -1.631  -8.628  1.00 0.00 ? 29  ILE A H    6  
ATOM 9047  H HA   . ILE A 1 29  ? -0.809  -2.324  -11.309 1.00 0.00 ? 29  ILE A HA   6  
ATOM 9048  H HB   . ILE A 1 29  ? -3.422  -1.791  -9.892  1.00 0.00 ? 29  ILE A HB   6  
ATOM 9049  H HG13 . ILE A 1 29  ? -2.208  -3.579  -8.819  1.00 0.00 ? 29  ILE A HG13 6  
ATOM 9050  H HG21 . ILE A 1 29  ? -3.255  -1.718  -12.520 1.00 0.00 ? 29  ILE A HG21 6  
ATOM 9051  H HG22 . ILE A 1 29  ? -3.197  -3.488  -12.346 1.00 0.00 ? 29  ILE A HG22 6  
ATOM 9052  H HG23 . ILE A 1 29  ? -4.584  -2.575  -11.703 1.00 0.00 ? 29  ILE A HG23 6  
ATOM 9053  H HD11 . ILE A 1 29  ? -4.149  -4.732  -8.714  1.00 0.00 ? 29  ILE A HD11 6  
ATOM 9054  H HD12 . ILE A 1 29  ? -4.703  -3.930  -10.204 1.00 0.00 ? 29  ILE A HD12 6  
ATOM 9055  H HD13 . ILE A 1 29  ? -3.803  -5.462  -10.300 1.00 0.00 ? 29  ILE A HD13 6  
ATOM 9056  N N    . VAL A 1 30  ? -2.667  0.362   -11.125 1.00 0.00 ? 30  VAL A N    6  
ATOM 9057  C CA   . VAL A 1 30  ? -2.915  1.663   -11.723 1.00 0.00 ? 30  VAL A CA   6  
ATOM 9058  C C    . VAL A 1 30  ? -2.765  1.557   -13.242 1.00 0.00 ? 30  VAL A C    6  
ATOM 9059  O O    . VAL A 1 30  ? -2.404  0.503   -13.763 1.00 0.00 ? 30  VAL A O    6  
ATOM 9060  C CB   . VAL A 1 30  ? -1.988  2.710   -11.102 1.00 0.00 ? 30  VAL A CB   6  
ATOM 9061  C CG1  . VAL A 1 30  ? -0.559  2.554   -11.622 1.00 0.00 ? 30  VAL A CG1  6  
ATOM 9062  C CG2  . VAL A 1 30  ? -2.513  4.125   -11.355 1.00 0.00 ? 30  VAL A CG2  6  
ATOM 9063  H H    . VAL A 1 30  ? -3.375  0.045   -10.495 1.00 0.00 ? 30  VAL A H    6  
ATOM 9064  H HA   . VAL A 1 30  ? -3.943  1.941   -11.490 1.00 0.00 ? 30  VAL A HA   6  
ATOM 9065  H HB   . VAL A 1 30  ? -1.973  2.546   -10.025 1.00 0.00 ? 30  VAL A HB   6  
ATOM 9066  H HG11 . VAL A 1 30  ? -0.583  2.231   -12.663 1.00 0.00 ? 30  VAL A HG11 6  
ATOM 9067  H HG12 . VAL A 1 30  ? -0.039  3.510   -11.551 1.00 0.00 ? 30  VAL A HG12 6  
ATOM 9068  H HG13 . VAL A 1 30  ? -0.032  1.809   -11.023 1.00 0.00 ? 30  VAL A HG13 6  
ATOM 9069  H HG21 . VAL A 1 30  ? -2.358  4.734   -10.465 1.00 0.00 ? 30  VAL A HG21 6  
ATOM 9070  H HG22 . VAL A 1 30  ? -1.977  4.566   -12.195 1.00 0.00 ? 30  VAL A HG22 6  
ATOM 9071  H HG23 . VAL A 1 30  ? -3.577  4.081   -11.585 1.00 0.00 ? 30  VAL A HG23 6  
ATOM 9072  N N    . TYR A 1 31  ? -3.050  2.665   -13.911 1.00 0.00 ? 31  TYR A N    6  
ATOM 9073  C CA   . TYR A 1 31  ? -2.951  2.711   -15.359 1.00 0.00 ? 31  TYR A CA   6  
ATOM 9074  C C    . TYR A 1 31  ? -2.783  4.150   -15.853 1.00 0.00 ? 31  TYR A C    6  
ATOM 9075  O O    . TYR A 1 31  ? -3.767  4.860   -16.053 1.00 0.00 ? 31  TYR A O    6  
ATOM 9076  C CB   . TYR A 1 31  ? -4.273  2.155   -15.890 1.00 0.00 ? 31  TYR A CB   6  
ATOM 9077  C CG   . TYR A 1 31  ? -4.393  0.632   -15.787 1.00 0.00 ? 31  TYR A CG   6  
ATOM 9078  C CD1  . TYR A 1 31  ? -4.758  0.048   -14.591 1.00 0.00 ? 31  TYR A CD1  6  
ATOM 9079  C CD2  . TYR A 1 31  ? -4.138  -0.156  -16.890 1.00 0.00 ? 31  TYR A CD2  6  
ATOM 9080  C CE1  . TYR A 1 31  ? -4.870  -1.384  -14.494 1.00 0.00 ? 31  TYR A CE1  6  
ATOM 9081  C CE2  . TYR A 1 31  ? -4.251  -1.588  -16.794 1.00 0.00 ? 31  TYR A CE2  6  
ATOM 9082  C CZ   . TYR A 1 31  ? -4.612  -2.131  -15.601 1.00 0.00 ? 31  TYR A CZ   6  
ATOM 9083  O OH   . TYR A 1 31  ? -4.718  -3.485  -15.509 1.00 0.00 ? 31  TYR A OH   6  
ATOM 9084  H H    . TYR A 1 31  ? -3.342  3.519   -13.479 1.00 0.00 ? 31  TYR A H    6  
ATOM 9085  H HA   . TYR A 1 31  ? -2.078  2.129   -15.656 1.00 0.00 ? 31  TYR A HA   6  
ATOM 9086  H HB3  . TYR A 1 31  ? -4.386  2.447   -16.934 1.00 0.00 ? 31  TYR A HB3  6  
ATOM 9087  H HD1  . TYR A 1 31  ? -4.959  0.671   -13.720 1.00 0.00 ? 31  TYR A HD1  6  
ATOM 9088  H HD2  . TYR A 1 31  ? -3.850  0.305   -17.835 1.00 0.00 ? 31  TYR A HD2  6  
ATOM 9089  H HE1  . TYR A 1 31  ? -5.158  -1.859  -13.556 1.00 0.00 ? 31  TYR A HE1  6  
ATOM 9090  H HE2  . TYR A 1 31  ? -4.052  -2.223  -17.657 1.00 0.00 ? 31  TYR A HE2  6  
ATOM 9091  H HH   . TYR A 1 31  ? -5.678  -3.758  -15.578 1.00 0.00 ? 31  TYR A HH   6  
ATOM 9092  N N    . PRO A 1 32  ? -1.495  4.547   -16.037 1.00 0.00 ? 32  PRO A N    6  
ATOM 9093  C CA   . PRO A 1 32  ? -1.186  5.888   -16.503 1.00 0.00 ? 32  PRO A CA   6  
ATOM 9094  C C    . PRO A 1 32  ? -1.481  6.032   -17.998 1.00 0.00 ? 32  PRO A C    6  
ATOM 9095  O O    . PRO A 1 32  ? -1.666  5.036   -18.696 1.00 0.00 ? 32  PRO A O    6  
ATOM 9096  C CB   . PRO A 1 32  ? 0.283   6.092   -16.165 1.00 0.00 ? 32  PRO A CB   6  
ATOM 9097  C CG   . PRO A 1 32  ? 0.858   4.702   -15.950 1.00 0.00 ? 32  PRO A CG   6  
ATOM 9098  C CD   . PRO A 1 32  ? -0.306  3.734   -15.809 1.00 0.00 ? 32  PRO A CD   6  
ATOM 9099  H HA   . PRO A 1 32  ? -1.768  6.559   -16.044 1.00 0.00 ? 32  PRO A HA   6  
ATOM 9100  H HB3  . PRO A 1 32  ? 0.396   6.706   -15.272 1.00 0.00 ? 32  PRO A HB3  6  
ATOM 9101  H HG3  . PRO A 1 32  ? 1.481   4.682   -15.056 1.00 0.00 ? 32  PRO A HG3  6  
ATOM 9102  H HD3  . PRO A 1 32  ? -0.322  3.276   -14.821 1.00 0.00 ? 32  PRO A HD3  6  
ATOM 9103  N N    . PRO A 1 33  ? -1.519  7.312   -18.456 1.00 0.00 ? 33  PRO A N    6  
ATOM 9104  C CA   . PRO A 1 33  ? -1.789  7.599   -19.854 1.00 0.00 ? 33  PRO A CA   6  
ATOM 9105  C C    . PRO A 1 33  ? -0.570  7.286   -20.724 1.00 0.00 ? 33  PRO A C    6  
ATOM 9106  O O    . PRO A 1 33  ? -0.611  6.383   -21.557 1.00 0.00 ? 33  PRO A O    6  
ATOM 9107  C CB   . PRO A 1 33  ? -2.181  9.067   -19.886 1.00 0.00 ? 33  PRO A CB   6  
ATOM 9108  C CG   . PRO A 1 33  ? -1.669  9.663   -18.585 1.00 0.00 ? 33  PRO A CG   6  
ATOM 9109  C CD   . PRO A 1 33  ? -1.306  8.515   -17.658 1.00 0.00 ? 33  PRO A CD   6  
ATOM 9110  H HA   . PRO A 1 33  ? -2.524  7.011   -20.193 1.00 0.00 ? 33  PRO A HA   6  
ATOM 9111  H HB3  . PRO A 1 33  ? -3.262  9.181   -19.969 1.00 0.00 ? 33  PRO A HB3  6  
ATOM 9112  H HG3  . PRO A 1 33  ? -2.431  10.296  -18.130 1.00 0.00 ? 33  PRO A HG3  6  
ATOM 9113  H HD3  . PRO A 1 33  ? -1.931  8.515   -16.764 1.00 0.00 ? 33  PRO A HD3  6  
ATOM 9114  N N    . GLU A 1 34  ? 0.489   8.053   -20.500 1.00 0.00 ? 34  GLU A N    6  
ATOM 9115  C CA   . GLU A 1 34  ? 1.718   7.869   -21.252 1.00 0.00 ? 34  GLU A CA   6  
ATOM 9116  C C    . GLU A 1 34  ? 2.931   8.120   -20.355 1.00 0.00 ? 34  GLU A C    6  
ATOM 9117  O O    . GLU A 1 34  ? 3.516   7.180   -19.820 1.00 0.00 ? 34  GLU A O    6  
ATOM 9118  C CB   . GLU A 1 34  ? 1.748   8.777   -22.483 1.00 0.00 ? 34  GLU A CB   6  
ATOM 9119  C CG   . GLU A 1 34  ? 1.054   10.111  -22.197 1.00 0.00 ? 34  GLU A CG   6  
ATOM 9120  C CD   . GLU A 1 34  ? -0.231  10.246  -23.016 1.00 0.00 ? 34  GLU A CD   6  
ATOM 9121  O OE1  . GLU A 1 34  ? -0.218  9.776   -24.175 1.00 0.00 ? 34  GLU A OE1  6  
ATOM 9122  O OE2  . GLU A 1 34  ? -1.197  10.817  -22.467 1.00 0.00 ? 34  GLU A OE2  6  
ATOM 9123  H H    . GLU A 1 34  ? 0.514   8.786   -19.821 1.00 0.00 ? 34  GLU A H    6  
ATOM 9124  H HA   . GLU A 1 34  ? 1.706   6.830   -21.577 1.00 0.00 ? 34  GLU A HA   6  
ATOM 9125  H HB3  . GLU A 1 34  ? 1.258   8.279   -23.320 1.00 0.00 ? 34  GLU A HB3  6  
ATOM 9126  H HG3  . GLU A 1 34  ? 1.728   10.935  -22.433 1.00 0.00 ? 34  GLU A HG3  6  
ATOM 9127  N N    . SER A 1 35  ? 3.274   9.392   -20.219 1.00 0.00 ? 35  SER A N    6  
ATOM 9128  C CA   . SER A 1 35  ? 4.407   9.779   -19.396 1.00 0.00 ? 35  SER A CA   6  
ATOM 9129  C C    . SER A 1 35  ? 3.973   10.821  -18.364 1.00 0.00 ? 35  SER A C    6  
ATOM 9130  O O    . SER A 1 35  ? 4.744   11.715  -18.016 1.00 0.00 ? 35  SER A O    6  
ATOM 9131  C CB   . SER A 1 35  ? 5.549   10.326  -20.254 1.00 0.00 ? 35  SER A CB   6  
ATOM 9132  O OG   . SER A 1 35  ? 6.577   10.915  -19.463 1.00 0.00 ? 35  SER A OG   6  
ATOM 9133  H H    . SER A 1 35  ? 2.792   10.151  -20.658 1.00 0.00 ? 35  SER A H    6  
ATOM 9134  H HA   . SER A 1 35  ? 4.732   8.863   -18.903 1.00 0.00 ? 35  SER A HA   6  
ATOM 9135  H HB3  . SER A 1 35  ? 5.157   11.068  -20.950 1.00 0.00 ? 35  SER A HB3  6  
ATOM 9136  H HG   . SER A 1 35  ? 7.367   10.302  -19.415 1.00 0.00 ? 35  SER A HG   6  
ATOM 9137  N N    . ALA A 1 36  ? 2.741   10.672  -17.902 1.00 0.00 ? 36  ALA A N    6  
ATOM 9138  C CA   . ALA A 1 36  ? 2.195   11.589  -16.916 1.00 0.00 ? 36  ALA A CA   6  
ATOM 9139  C C    . ALA A 1 36  ? 3.032   11.516  -15.638 1.00 0.00 ? 36  ALA A C    6  
ATOM 9140  O O    . ALA A 1 36  ? 4.041   12.209  -15.513 1.00 0.00 ? 36  ALA A O    6  
ATOM 9141  C CB   . ALA A 1 36  ? 0.722   11.255  -16.667 1.00 0.00 ? 36  ALA A CB   6  
ATOM 9142  H H    . ALA A 1 36  ? 2.120   9.942   -18.190 1.00 0.00 ? 36  ALA A H    6  
ATOM 9143  H HA   . ALA A 1 36  ? 2.261   12.596  -17.327 1.00 0.00 ? 36  ALA A HA   6  
ATOM 9144  H HB1  . ALA A 1 36  ? 0.617   10.182  -16.505 1.00 0.00 ? 36  ALA A HB1  6  
ATOM 9145  H HB2  . ALA A 1 36  ? 0.371   11.793  -15.786 1.00 0.00 ? 36  ALA A HB2  6  
ATOM 9146  H HB3  . ALA A 1 36  ? 0.131   11.551  -17.533 1.00 0.00 ? 36  ALA A HB3  6  
ATOM 9147  N N    . ILE A 1 37  ? 2.586   10.669  -14.723 1.00 0.00 ? 37  ILE A N    6  
ATOM 9148  C CA   . ILE A 1 37  ? 3.282   10.497  -13.460 1.00 0.00 ? 37  ILE A CA   6  
ATOM 9149  C C    . ILE A 1 37  ? 3.239   11.809  -12.674 1.00 0.00 ? 37  ILE A C    6  
ATOM 9150  O O    . ILE A 1 37  ? 4.222   12.545  -12.634 1.00 0.00 ? 37  ILE A O    6  
ATOM 9151  C CB   . ILE A 1 37  ? 4.699   9.969   -13.696 1.00 0.00 ? 37  ILE A CB   6  
ATOM 9152  C CG1  . ILE A 1 37  ? 4.675   8.707   -14.561 1.00 0.00 ? 37  ILE A CG1  6  
ATOM 9153  C CG2  . ILE A 1 37  ? 5.428   9.742   -12.371 1.00 0.00 ? 37  ILE A CG2  6  
ATOM 9154  C CD1  . ILE A 1 37  ? 6.042   8.459   -15.205 1.00 0.00 ? 37  ILE A CD1  6  
ATOM 9155  H H    . ILE A 1 37  ? 1.764   10.109  -14.833 1.00 0.00 ? 37  ILE A H    6  
ATOM 9156  H HA   . ILE A 1 37  ? 2.746   9.736   -12.892 1.00 0.00 ? 37  ILE A HA   6  
ATOM 9157  H HB   . ILE A 1 37  ? 5.257   10.726  -14.245 1.00 0.00 ? 37  ILE A HB   6  
ATOM 9158  H HG13 . ILE A 1 37  ? 3.918   8.807   -15.337 1.00 0.00 ? 37  ILE A HG13 6  
ATOM 9159  H HG21 . ILE A 1 37  ? 5.699   8.690   -12.280 1.00 0.00 ? 37  ILE A HG21 6  
ATOM 9160  H HG22 . ILE A 1 37  ? 6.331   10.353  -12.343 1.00 0.00 ? 37  ILE A HG22 6  
ATOM 9161  H HG23 . ILE A 1 37  ? 4.775   10.022  -11.543 1.00 0.00 ? 37  ILE A HG23 6  
ATOM 9162  H HD11 . ILE A 1 37  ? 6.688   7.940   -14.496 1.00 0.00 ? 37  ILE A HD11 6  
ATOM 9163  H HD12 . ILE A 1 37  ? 5.917   7.846   -16.097 1.00 0.00 ? 37  ILE A HD12 6  
ATOM 9164  H HD13 . ILE A 1 37  ? 6.493   9.412   -15.478 1.00 0.00 ? 37  ILE A HD13 6  
ATOM 9165  N N    . GLN A 1 38  ? 2.087   12.061  -12.068 1.00 0.00 ? 38  GLN A N    6  
ATOM 9166  C CA   . GLN A 1 38  ? 1.901   13.271  -11.286 1.00 0.00 ? 38  GLN A CA   6  
ATOM 9167  C C    . GLN A 1 38  ? 1.859   12.937  -9.794  1.00 0.00 ? 38  GLN A C    6  
ATOM 9168  O O    . GLN A 1 38  ? 2.186   13.779  -8.957  1.00 0.00 ? 38  GLN A O    6  
ATOM 9169  C CB   . GLN A 1 38  ? 0.637   14.014  -11.717 1.00 0.00 ? 38  GLN A CB   6  
ATOM 9170  C CG   . GLN A 1 38  ? -0.591  13.104  -11.632 1.00 0.00 ? 38  GLN A CG   6  
ATOM 9171  C CD   . GLN A 1 38  ? -1.703  13.758  -10.810 1.00 0.00 ? 38  GLN A CD   6  
ATOM 9172  O OE1  . GLN A 1 38  ? -1.569  14.860  -10.303 1.00 0.00 ? 38  GLN A OE1  6  
ATOM 9173  N NE2  . GLN A 1 38  ? -2.805  13.021  -10.707 1.00 0.00 ? 38  GLN A NE2  6  
ATOM 9174  H H    . GLN A 1 38  ? 1.292   11.456  -12.105 1.00 0.00 ? 38  GLN A H    6  
ATOM 9175  H HA   . GLN A 1 38  ? 2.772   13.892  -11.502 1.00 0.00 ? 38  GLN A HA   6  
ATOM 9176  H HB3  . GLN A 1 38  ? 0.754   14.378  -12.738 1.00 0.00 ? 38  GLN A HB3  6  
ATOM 9177  H HG3  . GLN A 1 38  ? -0.311  12.153  -11.180 1.00 0.00 ? 38  GLN A HG3  6  
ATOM 9178  H HE21 . GLN A 1 38  ? -2.849  12.125  -11.147 1.00 0.00 ? 38  GLN A HE21 6  
ATOM 9179  H HE22 . GLN A 1 38  ? -3.590  13.363  -10.190 1.00 0.00 ? 38  GLN A HE22 6  
ATOM 9180  N N    . PHE A 1 39  ? 1.456   11.709  -9.505  1.00 0.00 ? 39  PHE A N    6  
ATOM 9181  C CA   . PHE A 1 39  ? 1.366   11.255  -8.129  1.00 0.00 ? 39  PHE A CA   6  
ATOM 9182  C C    . PHE A 1 39  ? 0.554   12.234  -7.278  1.00 0.00 ? 39  PHE A C    6  
ATOM 9183  O O    . PHE A 1 39  ? 0.163   13.298  -7.755  1.00 0.00 ? 39  PHE A O    6  
ATOM 9184  C CB   . PHE A 1 39  ? 2.797   11.189  -7.585  1.00 0.00 ? 39  PHE A CB   6  
ATOM 9185  C CG   . PHE A 1 39  ? 3.240   9.786   -7.166  1.00 0.00 ? 39  PHE A CG   6  
ATOM 9186  C CD1  . PHE A 1 39  ? 3.021   8.729   -7.993  1.00 0.00 ? 39  PHE A CD1  6  
ATOM 9187  C CD2  . PHE A 1 39  ? 3.851   9.596   -5.967  1.00 0.00 ? 39  PHE A CD2  6  
ATOM 9188  C CE1  . PHE A 1 39  ? 3.432   7.426   -7.604  1.00 0.00 ? 39  PHE A CE1  6  
ATOM 9189  C CE2  . PHE A 1 39  ? 4.263   8.294   -5.577  1.00 0.00 ? 39  PHE A CE2  6  
ATOM 9190  C CZ   . PHE A 1 39  ? 4.045   7.237   -6.405  1.00 0.00 ? 39  PHE A CZ   6  
ATOM 9191  H H    . PHE A 1 39  ? 1.192   11.032  -10.192 1.00 0.00 ? 39  PHE A H    6  
ATOM 9192  H HA   . PHE A 1 39  ? 0.867   10.285  -8.139  1.00 0.00 ? 39  PHE A HA   6  
ATOM 9193  H HB3  . PHE A 1 39  ? 2.879   11.857  -6.728  1.00 0.00 ? 39  PHE A HB3  6  
ATOM 9194  H HD1  . PHE A 1 39  ? 2.531   8.881   -8.954  1.00 0.00 ? 39  PHE A HD1  6  
ATOM 9195  H HD2  . PHE A 1 39  ? 4.026   10.445  -5.304  1.00 0.00 ? 39  PHE A HD2  6  
ATOM 9196  H HE1  . PHE A 1 39  ? 3.258   6.580   -8.267  1.00 0.00 ? 39  PHE A HE1  6  
ATOM 9197  H HE2  . PHE A 1 39  ? 4.754   8.142   -4.616  1.00 0.00 ? 39  PHE A HE2  6  
ATOM 9198  H HZ   . PHE A 1 39  ? 4.361   6.238   -6.106  1.00 0.00 ? 39  PHE A HZ   6  
ATOM 9199  N N    . SER A 1 40  ? 0.327   11.839  -6.035  1.00 0.00 ? 40  SER A N    6  
ATOM 9200  C CA   . SER A 1 40  ? -0.432  12.669  -5.114  1.00 0.00 ? 40  SER A CA   6  
ATOM 9201  C C    . SER A 1 40  ? -1.905  12.698  -5.527  1.00 0.00 ? 40  SER A C    6  
ATOM 9202  O O    . SER A 1 40  ? -2.231  12.468  -6.690  1.00 0.00 ? 40  SER A O    6  
ATOM 9203  C CB   . SER A 1 40  ? 0.133   14.090  -5.060  1.00 0.00 ? 40  SER A CB   6  
ATOM 9204  O OG   . SER A 1 40  ? 0.412   14.504  -3.725  1.00 0.00 ? 40  SER A OG   6  
ATOM 9205  H H    . SER A 1 40  ? 0.648   10.972  -5.654  1.00 0.00 ? 40  SER A H    6  
ATOM 9206  H HA   . SER A 1 40  ? -0.318  12.196  -4.137  1.00 0.00 ? 40  SER A HA   6  
ATOM 9207  H HB3  . SER A 1 40  ? -0.578  14.780  -5.513  1.00 0.00 ? 40  SER A HB3  6  
ATOM 9208  H HG   . SER A 1 40  ? 0.021   15.410  -3.560  1.00 0.00 ? 40  SER A HG   6  
ATOM 9209  N N    . TYR A 1 41  ? -2.754  12.985  -4.551  1.00 0.00 ? 41  TYR A N    6  
ATOM 9210  C CA   . TYR A 1 41  ? -4.185  13.046  -4.799  1.00 0.00 ? 41  TYR A CA   6  
ATOM 9211  C C    . TYR A 1 41  ? -4.909  13.761  -3.656  1.00 0.00 ? 41  TYR A C    6  
ATOM 9212  O O    . TYR A 1 41  ? -4.834  13.332  -2.505  1.00 0.00 ? 41  TYR A O    6  
ATOM 9213  C CB   . TYR A 1 41  ? -4.665  11.595  -4.863  1.00 0.00 ? 41  TYR A CB   6  
ATOM 9214  C CG   . TYR A 1 41  ? -5.842  11.371  -5.815  1.00 0.00 ? 41  TYR A CG   6  
ATOM 9215  C CD1  . TYR A 1 41  ? -7.035  12.035  -5.605  1.00 0.00 ? 41  TYR A CD1  6  
ATOM 9216  C CD2  . TYR A 1 41  ? -5.712  10.506  -6.881  1.00 0.00 ? 41  TYR A CD2  6  
ATOM 9217  C CE1  . TYR A 1 41  ? -8.143  11.824  -6.501  1.00 0.00 ? 41  TYR A CE1  6  
ATOM 9218  C CE2  . TYR A 1 41  ? -6.820  10.295  -7.777  1.00 0.00 ? 41  TYR A CE2  6  
ATOM 9219  C CZ   . TYR A 1 41  ? -7.981  10.965  -7.542  1.00 0.00 ? 41  TYR A CZ   6  
ATOM 9220  O OH   . TYR A 1 41  ? -9.027  10.765  -8.387  1.00 0.00 ? 41  TYR A OH   6  
ATOM 9221  H H    . TYR A 1 41  ? -2.480  13.170  -3.608  1.00 0.00 ? 41  TYR A H    6  
ATOM 9222  H HA   . TYR A 1 41  ? -4.342  13.603  -5.722  1.00 0.00 ? 41  TYR A HA   6  
ATOM 9223  H HB3  . TYR A 1 41  ? -4.954  11.275  -3.862  1.00 0.00 ? 41  TYR A HB3  6  
ATOM 9224  H HD1  . TYR A 1 41  ? -7.138  12.718  -4.763  1.00 0.00 ? 41  TYR A HD1  6  
ATOM 9225  H HD2  . TYR A 1 41  ? -4.770  9.983   -7.047  1.00 0.00 ? 41  TYR A HD2  6  
ATOM 9226  H HE1  . TYR A 1 41  ? -9.090  12.342  -6.347  1.00 0.00 ? 41  TYR A HE1  6  
ATOM 9227  H HE2  . TYR A 1 41  ? -6.731  9.614   -8.624  1.00 0.00 ? 41  TYR A HE2  6  
ATOM 9228  H HH   . TYR A 1 41  ? -9.012  9.827   -8.737  1.00 0.00 ? 41  TYR A HH   6  
ATOM 9229  N N    . LYS A 1 42  ? -5.593  14.839  -4.013  1.00 0.00 ? 42  LYS A N    6  
ATOM 9230  C CA   . LYS A 1 42  ? -6.329  15.616  -3.032  1.00 0.00 ? 42  LYS A CA   6  
ATOM 9231  C C    . LYS A 1 42  ? -7.052  14.668  -2.073  1.00 0.00 ? 42  LYS A C    6  
ATOM 9232  O O    . LYS A 1 42  ? -7.653  13.685  -2.504  1.00 0.00 ? 42  LYS A O    6  
ATOM 9233  C CB   . LYS A 1 42  ? -7.257  16.614  -3.727  1.00 0.00 ? 42  LYS A CB   6  
ATOM 9234  C CG   . LYS A 1 42  ? -7.293  17.945  -2.974  1.00 0.00 ? 42  LYS A CG   6  
ATOM 9235  C CD   . LYS A 1 42  ? -6.005  18.740  -3.201  1.00 0.00 ? 42  LYS A CD   6  
ATOM 9236  C CE   . LYS A 1 42  ? -5.210  18.880  -1.902  1.00 0.00 ? 42  LYS A CE   6  
ATOM 9237  N NZ   . LYS A 1 42  ? -4.069  19.804  -2.090  1.00 0.00 ? 42  LYS A NZ   6  
ATOM 9238  H H    . LYS A 1 42  ? -5.648  15.180  -4.951  1.00 0.00 ? 42  LYS A H    6  
ATOM 9239  H HA   . LYS A 1 42  ? -5.602  16.195  -2.462  1.00 0.00 ? 42  LYS A HA   6  
ATOM 9240  H HB3  . LYS A 1 42  ? -8.264  16.200  -3.786  1.00 0.00 ? 42  LYS A HB3  6  
ATOM 9241  H HG3  . LYS A 1 42  ? -7.427  17.762  -1.908  1.00 0.00 ? 42  LYS A HG3  6  
ATOM 9242  H HD3  . LYS A 1 42  ? -6.246  19.728  -3.595  1.00 0.00 ? 42  LYS A HD3  6  
ATOM 9243  H HE3  . LYS A 1 42  ? -4.847  17.903  -1.584  1.00 0.00 ? 42  LYS A HE3  6  
ATOM 9244  H HZ1  . LYS A 1 42  ? -4.126  20.545  -1.422  1.00 0.00 ? 42  LYS A HZ1  6  
ATOM 9245  H HZ2  . LYS A 1 42  ? -3.212  19.305  -1.962  1.00 0.00 ? 42  LYS A HZ2  6  
ATOM 9246  H HZ3  . LYS A 1 42  ? -4.097  20.184  -3.014  1.00 0.00 ? 42  LYS A HZ3  6  
ATOM 9247  N N    . ASP A 1 43  ? -6.969  14.995  -0.791  1.00 0.00 ? 43  ASP A N    6  
ATOM 9248  C CA   . ASP A 1 43  ? -7.608  14.185  0.230   1.00 0.00 ? 43  ASP A CA   6  
ATOM 9249  C C    . ASP A 1 43  ? -8.941  14.823  0.623   1.00 0.00 ? 43  ASP A C    6  
ATOM 9250  O O    . ASP A 1 43  ? -8.965  15.869  1.271   1.00 0.00 ? 43  ASP A O    6  
ATOM 9251  C CB   . ASP A 1 43  ? -6.738  14.095  1.486   1.00 0.00 ? 43  ASP A CB   6  
ATOM 9252  C CG   . ASP A 1 43  ? -5.244  13.892  1.225   1.00 0.00 ? 43  ASP A CG   6  
ATOM 9253  O OD1  . ASP A 1 43  ? -4.917  12.896  0.547   1.00 0.00 ? 43  ASP A OD1  6  
ATOM 9254  O OD2  . ASP A 1 43  ? -4.463  14.740  1.710   1.00 0.00 ? 43  ASP A OD2  6  
ATOM 9255  H H    . ASP A 1 43  ? -6.477  15.796  -0.450  1.00 0.00 ? 43  ASP A H    6  
ATOM 9256  H HA   . ASP A 1 43  ? -7.734  13.201  -0.221  1.00 0.00 ? 43  ASP A HA   6  
ATOM 9257  H HB3  . ASP A 1 43  ? -7.099  13.272  2.102   1.00 0.00 ? 43  ASP A HB3  6  
ATOM 9258  N N    . GLU A 1 44  ? -10.018 14.169  0.215   1.00 0.00 ? 44  GLU A N    6  
ATOM 9259  C CA   . GLU A 1 44  ? -11.352 14.660  0.516   1.00 0.00 ? 44  GLU A CA   6  
ATOM 9260  C C    . GLU A 1 44  ? -12.266 13.501  0.916   1.00 0.00 ? 44  GLU A C    6  
ATOM 9261  O O    . GLU A 1 44  ? -11.922 12.337  0.720   1.00 0.00 ? 44  GLU A O    6  
ATOM 9262  C CB   . GLU A 1 44  ? -11.933 15.433  -0.670  1.00 0.00 ? 44  GLU A CB   6  
ATOM 9263  C CG   . GLU A 1 44  ? -11.798 16.942  -0.460  1.00 0.00 ? 44  GLU A CG   6  
ATOM 9264  C CD   . GLU A 1 44  ? -13.004 17.500  0.299   1.00 0.00 ? 44  GLU A CD   6  
ATOM 9265  O OE1  . GLU A 1 44  ? -13.176 17.092  1.468   1.00 0.00 ? 44  GLU A OE1  6  
ATOM 9266  O OE2  . GLU A 1 44  ? -13.726 18.320  -0.308  1.00 0.00 ? 44  GLU A OE2  6  
ATOM 9267  H H    . GLU A 1 44  ? -9.989  13.318  -0.311  1.00 0.00 ? 44  GLU A H    6  
ATOM 9268  H HA   . GLU A 1 44  ? -11.226 15.341  1.359   1.00 0.00 ? 44  GLU A HA   6  
ATOM 9269  H HB3  . GLU A 1 44  ? -12.982 15.172  -0.801  1.00 0.00 ? 44  GLU A HB3  6  
ATOM 9270  H HG3  . GLU A 1 44  ? -11.710 17.440  -1.425  1.00 0.00 ? 44  GLU A HG3  6  
ATOM 9271  N N    . GLU A 1 45  ? -13.415 13.861  1.470   1.00 0.00 ? 45  GLU A N    6  
ATOM 9272  C CA   . GLU A 1 45  ? -14.383 12.865  1.900   1.00 0.00 ? 45  GLU A CA   6  
ATOM 9273  C C    . GLU A 1 45  ? -14.626 11.846  0.785   1.00 0.00 ? 45  GLU A C    6  
ATOM 9274  O O    . GLU A 1 45  ? -14.794 12.219  -0.376  1.00 0.00 ? 45  GLU A O    6  
ATOM 9275  C CB   . GLU A 1 45  ? -15.693 13.524  2.335   1.00 0.00 ? 45  GLU A CB   6  
ATOM 9276  C CG   . GLU A 1 45  ? -16.003 13.213  3.801   1.00 0.00 ? 45  GLU A CG   6  
ATOM 9277  C CD   . GLU A 1 45  ? -16.751 14.373  4.462   1.00 0.00 ? 45  GLU A CD   6  
ATOM 9278  O OE1  . GLU A 1 45  ? -17.996 14.378  4.356   1.00 0.00 ? 45  GLU A OE1  6  
ATOM 9279  O OE2  . GLU A 1 45  ? -16.060 15.229  5.056   1.00 0.00 ? 45  GLU A OE2  6  
ATOM 9280  H H    . GLU A 1 45  ? -13.689 14.810  1.627   1.00 0.00 ? 45  GLU A H    6  
ATOM 9281  H HA   . GLU A 1 45  ? -13.928 12.371  2.759   1.00 0.00 ? 45  GLU A HA   6  
ATOM 9282  H HB3  . GLU A 1 45  ? -16.509 13.173  1.705   1.00 0.00 ? 45  GLU A HB3  6  
ATOM 9283  H HG3  . GLU A 1 45  ? -15.075 13.021  4.339   1.00 0.00 ? 45  GLU A HG3  6  
ATOM 9284  N N    . ASN A 1 46  ? -14.639 10.580  1.176   1.00 0.00 ? 46  ASN A N    6  
ATOM 9285  C CA   . ASN A 1 46  ? -14.861 9.505   0.223   1.00 0.00 ? 46  ASN A CA   6  
ATOM 9286  C C    . ASN A 1 46  ? -16.249 9.659   -0.400  1.00 0.00 ? 46  ASN A C    6  
ATOM 9287  O O    . ASN A 1 46  ? -17.230 9.879   0.308   1.00 0.00 ? 46  ASN A O    6  
ATOM 9288  C CB   . ASN A 1 46  ? -14.799 8.140   0.910   1.00 0.00 ? 46  ASN A CB   6  
ATOM 9289  C CG   . ASN A 1 46  ? -15.089 7.012   -0.083  1.00 0.00 ? 46  ASN A CG   6  
ATOM 9290  O OD1  . ASN A 1 46  ? -16.179 6.466   -0.141  1.00 0.00 ? 46  ASN A OD1  6  
ATOM 9291  N ND2  . ASN A 1 46  ? -14.056 6.695   -0.858  1.00 0.00 ? 46  ASN A ND2  6  
ATOM 9292  H H    . ASN A 1 46  ? -14.502 10.285  2.121   1.00 0.00 ? 46  ASN A H    6  
ATOM 9293  H HA   . ASN A 1 46  ? -14.061 9.604   -0.510  1.00 0.00 ? 46  ASN A HA   6  
ATOM 9294  H HB3  . ASN A 1 46  ? -15.522 8.107   1.725   1.00 0.00 ? 46  ASN A HB3  6  
ATOM 9295  H HD21 . ASN A 1 46  ? -13.189 7.183   -0.760  1.00 0.00 ? 46  ASN A HD21 6  
ATOM 9296  H HD22 . ASN A 1 46  ? -14.148 5.970   -1.540  1.00 0.00 ? 46  ASN A HD22 6  
ATOM 9297  N N    . GLY A 1 47  ? -16.287 9.538   -1.719  1.00 0.00 ? 47  GLY A N    6  
ATOM 9298  C CA   . GLY A 1 47  ? -17.539 9.660   -2.446  1.00 0.00 ? 47  GLY A CA   6  
ATOM 9299  C C    . GLY A 1 47  ? -18.261 8.313   -2.527  1.00 0.00 ? 47  GLY A C    6  
ATOM 9300  O O    . GLY A 1 47  ? -18.046 7.440   -1.689  1.00 0.00 ? 47  GLY A O    6  
ATOM 9301  H H    . GLY A 1 47  ? -15.484 9.359   -2.288  1.00 0.00 ? 47  GLY A H    6  
ATOM 9302  H HA2  . GLY A 1 47  ? -18.181 10.391  -1.952  1.00 0.00 ? 47  GLY A HA2  6  
ATOM 9303  H HA3  . GLY A 1 47  ? -17.345 10.033  -3.451  1.00 0.00 ? 47  GLY A HA3  6  
ATOM 9304  N N    . ASN A 1 48  ? -19.102 8.188   -3.543  1.00 0.00 ? 48  ASN A N    6  
ATOM 9305  C CA   . ASN A 1 48  ? -19.856 6.963   -3.744  1.00 0.00 ? 48  ASN A CA   6  
ATOM 9306  C C    . ASN A 1 48  ? -19.426 6.315   -5.062  1.00 0.00 ? 48  ASN A C    6  
ATOM 9307  O O    . ASN A 1 48  ? -19.315 6.992   -6.083  1.00 0.00 ? 48  ASN A O    6  
ATOM 9308  C CB   . ASN A 1 48  ? -21.357 7.247   -3.824  1.00 0.00 ? 48  ASN A CB   6  
ATOM 9309  C CG   . ASN A 1 48  ? -22.168 5.963   -3.641  1.00 0.00 ? 48  ASN A CG   6  
ATOM 9310  O OD1  . ASN A 1 48  ? -21.874 4.924   -4.208  1.00 0.00 ? 48  ASN A OD1  6  
ATOM 9311  N ND2  . ASN A 1 48  ? -23.205 6.091   -2.818  1.00 0.00 ? 48  ASN A ND2  6  
ATOM 9312  H H    . ASN A 1 48  ? -19.271 8.905   -4.220  1.00 0.00 ? 48  ASN A H    6  
ATOM 9313  H HA   . ASN A 1 48  ? -19.627 6.340   -2.879  1.00 0.00 ? 48  ASN A HA   6  
ATOM 9314  H HB3  . ASN A 1 48  ? -21.595 7.697   -4.788  1.00 0.00 ? 48  ASN A HB3  6  
ATOM 9315  H HD21 . ASN A 1 48  ? -23.393 6.972   -2.384  1.00 0.00 ? 48  ASN A HD21 6  
ATOM 9316  H HD22 . ASN A 1 48  ? -23.797 5.306   -2.634  1.00 0.00 ? 48  ASN A HD22 6  
ATOM 9317  N N    . ARG A 1 49  ? -19.196 5.013   -4.996  1.00 0.00 ? 49  ARG A N    6  
ATOM 9318  C CA   . ARG A 1 49  ? -18.781 4.266   -6.171  1.00 0.00 ? 49  ARG A CA   6  
ATOM 9319  C C    . ARG A 1 49  ? -19.101 2.779   -5.997  1.00 0.00 ? 49  ARG A C    6  
ATOM 9320  O O    . ARG A 1 49  ? -19.419 2.334   -4.895  1.00 0.00 ? 49  ARG A O    6  
ATOM 9321  C CB   . ARG A 1 49  ? -17.281 4.430   -6.428  1.00 0.00 ? 49  ARG A CB   6  
ATOM 9322  C CG   . ARG A 1 49  ? -17.020 5.513   -7.477  1.00 0.00 ? 49  ARG A CG   6  
ATOM 9323  C CD   . ARG A 1 49  ? -16.225 6.675   -6.879  1.00 0.00 ? 49  ARG A CD   6  
ATOM 9324  N NE   . ARG A 1 49  ? -16.954 7.947   -7.088  1.00 0.00 ? 49  ARG A NE   6  
ATOM 9325  C CZ   . ARG A 1 49  ? -16.486 9.148   -6.723  1.00 0.00 ? 49  ARG A CZ   6  
ATOM 9326  N NH1  . ARG A 1 49  ? -15.289 9.249   -6.128  1.00 0.00 ? 49  ARG A NH1  6  
ATOM 9327  N NH2  . ARG A 1 49  ? -17.215 10.249  -6.951  1.00 0.00 ? 49  ARG A NH2  6  
ATOM 9328  H H    . ARG A 1 49  ? -19.288 4.469   -4.161  1.00 0.00 ? 49  ARG A H    6  
ATOM 9329  H HA   . ARG A 1 49  ? -19.355 4.697   -6.992  1.00 0.00 ? 49  ARG A HA   6  
ATOM 9330  H HB3  . ARG A 1 49  ? -16.860 3.484   -6.765  1.00 0.00 ? 49  ARG A HB3  6  
ATOM 9331  H HG3  . ARG A 1 49  ? -17.969 5.880   -7.869  1.00 0.00 ? 49  ARG A HG3  6  
ATOM 9332  H HD3  . ARG A 1 49  ? -15.240 6.730   -7.344  1.00 0.00 ? 49  ARG A HD3  6  
ATOM 9333  H HE   . ARG A 1 49  ? -17.850 7.906   -7.529  1.00 0.00 ? 49  ARG A HE   6  
ATOM 9334  H HH11 . ARG A 1 49  ? -14.744 8.429   -5.957  1.00 0.00 ? 49  ARG A HH11 6  
ATOM 9335  H HH12 . ARG A 1 49  ? -14.940 10.146  -5.856  1.00 0.00 ? 49  ARG A HH12 6  
ATOM 9336  H HH21 . ARG A 1 49  ? -18.109 10.173  -7.395  1.00 0.00 ? 49  ARG A HH21 6  
ATOM 9337  H HH22 . ARG A 1 49  ? -16.867 11.145  -6.678  1.00 0.00 ? 49  ARG A HH22 6  
ATOM 9338  N N    . GLY A 1 50  ? -19.007 2.052   -7.101  1.00 0.00 ? 50  GLY A N    6  
ATOM 9339  C CA   . GLY A 1 50  ? -19.282 0.626   -7.083  1.00 0.00 ? 50  GLY A CA   6  
ATOM 9340  C C    . GLY A 1 50  ? -18.343 -0.126  -8.028  1.00 0.00 ? 50  GLY A C    6  
ATOM 9341  O O    . GLY A 1 50  ? -17.412 0.460   -8.580  1.00 0.00 ? 50  GLY A O    6  
ATOM 9342  H H    . GLY A 1 50  ? -18.748 2.422   -7.992  1.00 0.00 ? 50  GLY A H    6  
ATOM 9343  H HA2  . GLY A 1 50  ? -19.168 0.242   -6.070  1.00 0.00 ? 50  GLY A HA2  6  
ATOM 9344  H HA3  . GLY A 1 50  ? -20.318 0.448   -7.377  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 9345  N N    . GLY A 1 51  ? -18.619 -1.412  -8.187  1.00 0.00 ? 51  GLY A N    6  
ATOM 9346  C CA   . GLY A 1 51  ? -17.810 -2.249  -9.055  1.00 0.00 ? 51  GLY A CA   6  
ATOM 9347  C C    . GLY A 1 51  ? -17.361 -3.520  -8.330  1.00 0.00 ? 51  GLY A C    6  
ATOM 9348  O O    . GLY A 1 51  ? -16.510 -3.467  -7.444  1.00 0.00 ? 51  GLY A O    6  
ATOM 9349  H H    . GLY A 1 51  ? -19.377 -1.880  -7.734  1.00 0.00 ? 51  GLY A H    6  
ATOM 9350  H HA2  . GLY A 1 51  ? -18.380 -2.517  -9.944  1.00 0.00 ? 51  GLY A HA2  6  
ATOM 9351  H HA3  . GLY A 1 51  ? -16.935 -1.692  -9.393  1.00 0.00 ? 51  GLY A HA3  6  
ATOM 9352  N N    . LYS A 1 52  ? -17.956 -4.634  -8.734  1.00 0.00 ? 52  LYS A N    6  
ATOM 9353  C CA   . LYS A 1 52  ? -17.630 -5.916  -8.133  1.00 0.00 ? 52  LYS A CA   6  
ATOM 9354  C C    . LYS A 1 52  ? -16.161 -6.242  -8.405  1.00 0.00 ? 52  LYS A C    6  
ATOM 9355  O O    . LYS A 1 52  ? -15.345 -6.269  -7.483  1.00 0.00 ? 52  LYS A O    6  
ATOM 9356  C CB   . LYS A 1 52  ? -18.599 -6.996  -8.617  1.00 0.00 ? 52  LYS A CB   6  
ATOM 9357  C CG   . LYS A 1 52  ? -19.597 -7.370  -7.519  1.00 0.00 ? 52  LYS A CG   6  
ATOM 9358  C CD   . LYS A 1 52  ? -20.905 -6.593  -7.679  1.00 0.00 ? 52  LYS A CD   6  
ATOM 9359  C CE   . LYS A 1 52  ? -22.066 -7.536  -8.004  1.00 0.00 ? 52  LYS A CE   6  
ATOM 9360  N NZ   . LYS A 1 52  ? -22.313 -7.568  -9.463  1.00 0.00 ? 52  LYS A NZ   6  
ATOM 9361  H H    . LYS A 1 52  ? -18.649 -4.668  -9.455  1.00 0.00 ? 52  LYS A H    6  
ATOM 9362  H HA   . LYS A 1 52  ? -17.769 -5.817  -7.057  1.00 0.00 ? 52  LYS A HA   6  
ATOM 9363  H HB3  . LYS A 1 52  ? -18.042 -7.881  -8.922  1.00 0.00 ? 52  LYS A HB3  6  
ATOM 9364  H HG3  . LYS A 1 52  ? -19.162 -7.160  -6.541  1.00 0.00 ? 52  LYS A HG3  6  
ATOM 9365  H HD3  . LYS A 1 52  ? -20.799 -5.855  -8.473  1.00 0.00 ? 52  LYS A HD3  6  
ATOM 9366  H HE3  . LYS A 1 52  ? -22.966 -7.209  -7.484  1.00 0.00 ? 52  LYS A HE3  6  
ATOM 9367  H HZ1  . LYS A 1 52  ? -21.771 -6.856  -9.909  1.00 0.00 ? 52  LYS A HZ1  6  
ATOM 9368  H HZ2  . LYS A 1 52  ? -22.052 -8.462  -9.826  1.00 0.00 ? 52  LYS A HZ2  6  
ATOM 9369  H HZ3  . LYS A 1 52  ? -23.285 -7.408  -9.639  1.00 0.00 ? 52  LYS A HZ3  6  
ATOM 9370  N N    . GLN A 1 53  ? -15.865 -6.482  -9.674  1.00 0.00 ? 53  GLN A N    6  
ATOM 9371  C CA   . GLN A 1 53  ? -14.508 -6.805  -10.078 1.00 0.00 ? 53  GLN A CA   6  
ATOM 9372  C C    . GLN A 1 53  ? -14.071 -5.907  -11.238 1.00 0.00 ? 53  GLN A C    6  
ATOM 9373  O O    . GLN A 1 53  ? -14.111 -6.317  -12.396 1.00 0.00 ? 53  GLN A O    6  
ATOM 9374  C CB   . GLN A 1 53  ? -14.386 -8.284  -10.457 1.00 0.00 ? 53  GLN A CB   6  
ATOM 9375  C CG   . GLN A 1 53  ? -13.246 -8.954  -9.685  1.00 0.00 ? 53  GLN A CG   6  
ATOM 9376  C CD   . GLN A 1 53  ? -12.869 -10.293 -10.320 1.00 0.00 ? 53  GLN A CD   6  
ATOM 9377  O OE1  . GLN A 1 53  ? -13.553 -10.815 -11.184 1.00 0.00 ? 53  GLN A OE1  6  
ATOM 9378  N NE2  . GLN A 1 53  ? -11.741 -10.817 -9.848  1.00 0.00 ? 53  GLN A NE2  6  
ATOM 9379  H H    . GLN A 1 53  ? -16.533 -6.459  -10.417 1.00 0.00 ? 53  GLN A H    6  
ATOM 9380  H HA   . GLN A 1 53  ? -13.891 -6.608  -9.203  1.00 0.00 ? 53  GLN A HA   6  
ATOM 9381  H HB3  . GLN A 1 53  ? -14.207 -8.376  -11.528 1.00 0.00 ? 53  GLN A HB3  6  
ATOM 9382  H HG3  . GLN A 1 53  ? -13.549 -9.111  -8.649  1.00 0.00 ? 53  GLN A HG3  6  
ATOM 9383  H HE21 . GLN A 1 53  ? -11.225 -10.335 -9.138  1.00 0.00 ? 53  GLN A HE21 6  
ATOM 9384  H HE22 . GLN A 1 53  ? -11.409 -11.691 -10.201 1.00 0.00 ? 53  GLN A HE22 6  
ATOM 9385  N N    . ARG A 1 54  ? -13.664 -4.696  -10.885 1.00 0.00 ? 54  ARG A N    6  
ATOM 9386  C CA   . ARG A 1 54  ? -13.221 -3.735  -11.880 1.00 0.00 ? 54  ARG A CA   6  
ATOM 9387  C C    . ARG A 1 54  ? -12.938 -2.382  -11.222 1.00 0.00 ? 54  ARG A C    6  
ATOM 9388  O O    . ARG A 1 54  ? -11.872 -1.802  -11.423 1.00 0.00 ? 54  ARG A O    6  
ATOM 9389  C CB   . ARG A 1 54  ? -14.272 -3.552  -12.975 1.00 0.00 ? 54  ARG A CB   6  
ATOM 9390  C CG   . ARG A 1 54  ? -13.759 -4.073  -14.320 1.00 0.00 ? 54  ARG A CG   6  
ATOM 9391  C CD   . ARG A 1 54  ? -14.597 -3.524  -15.475 1.00 0.00 ? 54  ARG A CD   6  
ATOM 9392  N NE   . ARG A 1 54  ? -15.004 -4.627  -16.374 1.00 0.00 ? 54  ARG A NE   6  
ATOM 9393  C CZ   . ARG A 1 54  ? -15.944 -4.517  -17.322 1.00 0.00 ? 54  ARG A CZ   6  
ATOM 9394  N NH1  . ARG A 1 54  ? -16.582 -3.352  -17.501 1.00 0.00 ? 54  ARG A NH1  6  
ATOM 9395  N NH2  . ARG A 1 54  ? -16.247 -5.571  -18.092 1.00 0.00 ? 54  ARG A NH2  6  
ATOM 9396  H H    . ARG A 1 54  ? -13.635 -4.371  -9.939  1.00 0.00 ? 54  ARG A H    6  
ATOM 9397  H HA   . ARG A 1 54  ? -12.310 -4.167  -12.296 1.00 0.00 ? 54  ARG A HA   6  
ATOM 9398  H HB3  . ARG A 1 54  ? -14.530 -2.497  -13.064 1.00 0.00 ? 54  ARG A HB3  6  
ATOM 9399  H HG3  . ARG A 1 54  ? -13.792 -5.163  -14.328 1.00 0.00 ? 54  ARG A HG3  6  
ATOM 9400  H HD3  . ARG A 1 54  ? -14.023 -2.783  -16.032 1.00 0.00 ? 54  ARG A HD3  6  
ATOM 9401  H HE   . ARG A 1 54  ? -14.547 -5.511  -16.267 1.00 0.00 ? 54  ARG A HE   6  
ATOM 9402  H HH11 . ARG A 1 54  ? -16.355 -2.565  -16.927 1.00 0.00 ? 54  ARG A HH11 6  
ATOM 9403  H HH12 . ARG A 1 54  ? -17.283 -3.269  -18.209 1.00 0.00 ? 54  ARG A HH12 6  
ATOM 9404  H HH21 . ARG A 1 54  ? -15.772 -6.442  -17.959 1.00 0.00 ? 54  ARG A HH21 6  
ATOM 9405  H HH22 . ARG A 1 54  ? -16.950 -5.489  -18.799 1.00 0.00 ? 54  ARG A HH22 6  
ATOM 9406  N N    . ASN A 1 55  ? -13.910 -1.921  -10.450 1.00 0.00 ? 55  ASN A N    6  
ATOM 9407  C CA   . ASN A 1 55  ? -13.780 -0.647  -9.762  1.00 0.00 ? 55  ASN A CA   6  
ATOM 9408  C C    . ASN A 1 55  ? -13.670 0.476   -10.796 1.00 0.00 ? 55  ASN A C    6  
ATOM 9409  O O    . ASN A 1 55  ? -12.570 0.897   -11.146 1.00 0.00 ? 55  ASN A O    6  
ATOM 9410  C CB   . ASN A 1 55  ? -12.520 -0.617  -8.896  1.00 0.00 ? 55  ASN A CB   6  
ATOM 9411  C CG   . ASN A 1 55  ? -12.875 -0.690  -7.410  1.00 0.00 ? 55  ASN A CG   6  
ATOM 9412  O OD1  . ASN A 1 55  ? -13.463 0.215   -6.839  1.00 0.00 ? 55  ASN A OD1  6  
ATOM 9413  N ND2  . ASN A 1 55  ? -12.484 -1.813  -6.815  1.00 0.00 ? 55  ASN A ND2  6  
ATOM 9414  H H    . ASN A 1 55  ? -14.774 -2.400  -10.293 1.00 0.00 ? 55  ASN A H    6  
ATOM 9415  H HA   . ASN A 1 55  ? -14.674 -0.561  -9.146  1.00 0.00 ? 55  ASN A HA   6  
ATOM 9416  H HB3  . ASN A 1 55  ? -11.959 0.297   -9.095  1.00 0.00 ? 55  ASN A HB3  6  
ATOM 9417  H HD21 . ASN A 1 55  ? -12.004 -2.516  -7.339  1.00 0.00 ? 55  ASN A HD21 6  
ATOM 9418  H HD22 . ASN A 1 55  ? -12.671 -1.956  -5.843  1.00 0.00 ? 55  ASN A HD22 6  
ATOM 9419  N N    . ARG A 1 56  ? -14.828 0.930   -11.254 1.00 0.00 ? 56  ARG A N    6  
ATOM 9420  C CA   . ARG A 1 56  ? -14.877 1.996   -12.239 1.00 0.00 ? 56  ARG A CA   6  
ATOM 9421  C C    . ARG A 1 56  ? -13.889 3.106   -11.870 1.00 0.00 ? 56  ARG A C    6  
ATOM 9422  O O    . ARG A 1 56  ? -13.639 3.351   -10.692 1.00 0.00 ? 56  ARG A O    6  
ATOM 9423  C CB   . ARG A 1 56  ? -16.284 2.589   -12.342 1.00 0.00 ? 56  ARG A CB   6  
ATOM 9424  C CG   . ARG A 1 56  ? -16.513 3.226   -13.714 1.00 0.00 ? 56  ARG A CG   6  
ATOM 9425  C CD   . ARG A 1 56  ? -16.649 2.155   -14.799 1.00 0.00 ? 56  ARG A CD   6  
ATOM 9426  N NE   . ARG A 1 56  ? -15.312 1.780   -15.310 1.00 0.00 ? 56  ARG A NE   6  
ATOM 9427  C CZ   . ARG A 1 56  ? -14.554 2.571   -16.081 1.00 0.00 ? 56  ARG A CZ   6  
ATOM 9428  N NH1  . ARG A 1 56  ? -14.997 3.785   -16.436 1.00 0.00 ? 56  ARG A NH1  6  
ATOM 9429  N NH2  . ARG A 1 56  ? -13.355 2.147   -16.500 1.00 0.00 ? 56  ARG A NH2  6  
ATOM 9430  H H    . ARG A 1 56  ? -15.721 0.582   -10.964 1.00 0.00 ? 56  ARG A H    6  
ATOM 9431  H HA   . ARG A 1 56  ? -14.599 1.520   -13.180 1.00 0.00 ? 56  ARG A HA   6  
ATOM 9432  H HB3  . ARG A 1 56  ? -16.425 3.337   -11.561 1.00 0.00 ? 56  ARG A HB3  6  
ATOM 9433  H HG3  . ARG A 1 56  ? -15.682 3.888   -13.955 1.00 0.00 ? 56  ARG A HG3  6  
ATOM 9434  H HD3  . ARG A 1 56  ? -17.268 2.529   -15.614 1.00 0.00 ? 56  ARG A HD3  6  
ATOM 9435  H HE   . ARG A 1 56  ? -14.952 0.880   -15.065 1.00 0.00 ? 56  ARG A HE   6  
ATOM 9436  H HH11 . ARG A 1 56  ? -15.892 4.101   -16.125 1.00 0.00 ? 56  ARG A HH11 6  
ATOM 9437  H HH12 . ARG A 1 56  ? -14.431 4.375   -17.012 1.00 0.00 ? 56  ARG A HH12 6  
ATOM 9438  H HH21 . ARG A 1 56  ? -13.024 1.240   -16.236 1.00 0.00 ? 56  ARG A HH21 6  
ATOM 9439  H HH22 . ARG A 1 56  ? -12.788 2.737   -17.075 1.00 0.00 ? 56  ARG A HH22 6  
ATOM 9440  N N    . LEU A 1 57  ? -13.355 3.746   -12.900 1.00 0.00 ? 57  LEU A N    6  
ATOM 9441  C CA   . LEU A 1 57  ? -12.401 4.822   -12.700 1.00 0.00 ? 57  LEU A CA   6  
ATOM 9442  C C    . LEU A 1 57  ? -11.129 4.259   -12.063 1.00 0.00 ? 57  LEU A C    6  
ATOM 9443  O O    . LEU A 1 57  ? -10.893 4.445   -10.871 1.00 0.00 ? 57  LEU A O    6  
ATOM 9444  C CB   . LEU A 1 57  ? -13.038 5.959   -11.897 1.00 0.00 ? 57  LEU A CB   6  
ATOM 9445  C CG   . LEU A 1 57  ? -13.888 6.950   -12.696 1.00 0.00 ? 57  LEU A CG   6  
ATOM 9446  C CD1  . LEU A 1 57  ? -14.109 6.454   -14.127 1.00 0.00 ? 57  LEU A CD1  6  
ATOM 9447  C CD2  . LEU A 1 57  ? -15.208 7.242   -11.980 1.00 0.00 ? 57  LEU A CD2  6  
ATOM 9448  H H    . LEU A 1 57  ? -13.565 3.539   -13.856 1.00 0.00 ? 57  LEU A H    6  
ATOM 9449  H HA   . LEU A 1 57  ? -12.149 5.223   -13.681 1.00 0.00 ? 57  LEU A HA   6  
ATOM 9450  H HB3  . LEU A 1 57  ? -12.244 6.514   -11.397 1.00 0.00 ? 57  LEU A HB3  6  
ATOM 9451  H HG   . LEU A 1 57  ? -13.343 7.891   -12.762 1.00 0.00 ? 57  LEU A HG   6  
ATOM 9452  H HD11 . LEU A 1 57  ? -13.197 6.598   -14.706 1.00 0.00 ? 57  LEU A HD11 6  
ATOM 9453  H HD12 . LEU A 1 57  ? -14.365 5.393   -14.107 1.00 0.00 ? 57  LEU A HD12 6  
ATOM 9454  H HD13 . LEU A 1 57  ? -14.923 7.015   -14.584 1.00 0.00 ? 57  LEU A HD13 6  
ATOM 9455  H HD21 . LEU A 1 57  ? -15.877 7.775   -12.655 1.00 0.00 ? 57  LEU A HD21 6  
ATOM 9456  H HD22 . LEU A 1 57  ? -15.671 6.303   -11.674 1.00 0.00 ? 57  LEU A HD22 6  
ATOM 9457  H HD23 . LEU A 1 57  ? -15.016 7.855   -11.100 1.00 0.00 ? 57  LEU A HD23 6  
ATOM 9458  N N    . GLU A 1 58  ? -10.345 3.580   -12.887 1.00 0.00 ? 58  GLU A N    6  
ATOM 9459  C CA   . GLU A 1 58  ? -9.103  2.988   -12.420 1.00 0.00 ? 58  GLU A CA   6  
ATOM 9460  C C    . GLU A 1 58  ? -9.379  2.014   -11.273 1.00 0.00 ? 58  GLU A C    6  
ATOM 9461  O O    . GLU A 1 58  ? -10.400 2.119   -10.596 1.00 0.00 ? 58  GLU A O    6  
ATOM 9462  C CB   . GLU A 1 58  ? -8.106  4.068   -11.995 1.00 0.00 ? 58  GLU A CB   6  
ATOM 9463  C CG   . GLU A 1 58  ? -7.963  5.138   -13.079 1.00 0.00 ? 58  GLU A CG   6  
ATOM 9464  C CD   . GLU A 1 58  ? -7.384  6.431   -12.499 1.00 0.00 ? 58  GLU A CD   6  
ATOM 9465  O OE1  . GLU A 1 58  ? -6.138  6.523   -12.452 1.00 0.00 ? 58  GLU A OE1  6  
ATOM 9466  O OE2  . GLU A 1 58  ? -8.199  7.297   -12.117 1.00 0.00 ? 58  GLU A OE2  6  
ATOM 9467  H H    . GLU A 1 58  ? -10.545 3.432   -13.856 1.00 0.00 ? 58  GLU A H    6  
ATOM 9468  H HA   . GLU A 1 58  ? -8.699  2.447   -13.276 1.00 0.00 ? 58  GLU A HA   6  
ATOM 9469  H HB3  . GLU A 1 58  ? -7.135  3.614   -11.798 1.00 0.00 ? 58  GLU A HB3  6  
ATOM 9470  H HG3  . GLU A 1 58  ? -8.937  5.340   -13.526 1.00 0.00 ? 58  GLU A HG3  6  
ATOM 9471  N N    . PRO A 1 59  ? -8.423  1.063   -11.083 1.00 0.00 ? 59  PRO A N    6  
ATOM 9472  C CA   . PRO A 1 59  ? -8.552  0.072   -10.028 1.00 0.00 ? 59  PRO A CA   6  
ATOM 9473  C C    . PRO A 1 59  ? -8.261  0.686   -8.659  1.00 0.00 ? 59  PRO A C    6  
ATOM 9474  O O    . PRO A 1 59  ? -9.126  0.700   -7.784  1.00 0.00 ? 59  PRO A O    6  
ATOM 9475  C CB   . PRO A 1 59  ? -7.577  -1.031  -10.405 1.00 0.00 ? 59  PRO A CB   6  
ATOM 9476  C CG   . PRO A 1 59  ? -6.606  -0.408  -11.397 1.00 0.00 ? 59  PRO A CG   6  
ATOM 9477  C CD   . PRO A 1 59  ? -7.201  0.910   -11.865 1.00 0.00 ? 59  PRO A CD   6  
ATOM 9478  H HA   . PRO A 1 59  ? -9.492  -0.264  -9.983  1.00 0.00 ? 59  PRO A HA   6  
ATOM 9479  H HB3  . PRO A 1 59  ? -8.098  -1.879  -10.848 1.00 0.00 ? 59  PRO A HB3  6  
ATOM 9480  H HG3  . PRO A 1 59  ? -6.445  -1.078  -12.242 1.00 0.00 ? 59  PRO A HG3  6  
ATOM 9481  H HD3  . PRO A 1 59  ? -7.413  0.890   -12.934 1.00 0.00 ? 59  PRO A HD3  6  
ATOM 9482  N N    . MET A 1 60  ? -7.040  1.181   -8.515  1.00 0.00 ? 60  MET A N    6  
ATOM 9483  C CA   . MET A 1 60  ? -6.624  1.796   -7.266  1.00 0.00 ? 60  MET A CA   6  
ATOM 9484  C C    . MET A 1 60  ? -7.240  1.073   -6.067  1.00 0.00 ? 60  MET A C    6  
ATOM 9485  O O    . MET A 1 60  ? -8.269  1.497   -5.543  1.00 0.00 ? 60  MET A O    6  
ATOM 9486  C CB   . MET A 1 60  ? -7.053  3.265   -7.252  1.00 0.00 ? 60  MET A CB   6  
ATOM 9487  C CG   . MET A 1 60  ? -8.399  3.450   -7.954  1.00 0.00 ? 60  MET A CG   6  
ATOM 9488  S SD   . MET A 1 60  ? -8.852  5.177   -7.964  1.00 0.00 ? 60  MET A SD   6  
ATOM 9489  C CE   . MET A 1 60  ? -10.630 5.031   -7.939  1.00 0.00 ? 60  MET A CE   6  
ATOM 9490  H H    . MET A 1 60  ? -6.343  1.167   -9.232  1.00 0.00 ? 60  MET A H    6  
ATOM 9491  H HA   . MET A 1 60  ? -5.539  1.699   -7.241  1.00 0.00 ? 60  MET A HA   6  
ATOM 9492  H HB3  . MET A 1 60  ? -6.295  3.873   -7.746  1.00 0.00 ? 60  MET A HB3  6  
ATOM 9493  H HG3  . MET A 1 60  ? -9.168  2.868   -7.446  1.00 0.00 ? 60  MET A HG3  6  
ATOM 9494  H HE1  . MET A 1 60  ? -10.941 4.241   -8.622  1.00 0.00 ? 60  MET A HE1  6  
ATOM 9495  H HE2  . MET A 1 60  ? -10.962 4.788   -6.929  1.00 0.00 ? 60  MET A HE2  6  
ATOM 9496  H HE3  . MET A 1 60  ? -11.077 5.976   -8.250  1.00 0.00 ? 60  MET A HE3  6  
ATOM 9497  N N    . ASP A 1 61  ? -6.584  -0.007  -5.667  1.00 0.00 ? 61  ASP A N    6  
ATOM 9498  C CA   . ASP A 1 61  ? -7.055  -0.793  -4.540  1.00 0.00 ? 61  ASP A CA   6  
ATOM 9499  C C    . ASP A 1 61  ? -6.345  -2.149  -4.537  1.00 0.00 ? 61  ASP A C    6  
ATOM 9500  O O    . ASP A 1 61  ? -6.903  -3.146  -4.993  1.00 0.00 ? 61  ASP A O    6  
ATOM 9501  C CB   . ASP A 1 61  ? -8.561  -1.048  -4.636  1.00 0.00 ? 61  ASP A CB   6  
ATOM 9502  C CG   . ASP A 1 61  ? -9.069  -2.235  -3.815  1.00 0.00 ? 61  ASP A CG   6  
ATOM 9503  O OD1  . ASP A 1 61  ? -8.385  -2.577  -2.827  1.00 0.00 ? 61  ASP A OD1  6  
ATOM 9504  O OD2  . ASP A 1 61  ? -10.131 -2.775  -4.195  1.00 0.00 ? 61  ASP A OD2  6  
ATOM 9505  H H    . ASP A 1 61  ? -5.749  -0.345  -6.099  1.00 0.00 ? 61  ASP A H    6  
ATOM 9506  H HA   . ASP A 1 61  ? -6.821  -0.198  -3.657  1.00 0.00 ? 61  ASP A HA   6  
ATOM 9507  H HB3  . ASP A 1 61  ? -8.821  -1.211  -5.682  1.00 0.00 ? 61  ASP A HB3  6  
ATOM 9508  N N    . THR A 1 62  ? -5.127  -2.141  -4.018  1.00 0.00 ? 62  THR A N    6  
ATOM 9509  C CA   . THR A 1 62  ? -4.334  -3.358  -3.950  1.00 0.00 ? 62  THR A CA   6  
ATOM 9510  C C    . THR A 1 62  ? -3.260  -3.236  -2.868  1.00 0.00 ? 62  THR A C    6  
ATOM 9511  O O    . THR A 1 62  ? -3.523  -3.495  -1.695  1.00 0.00 ? 62  THR A O    6  
ATOM 9512  C CB   . THR A 1 62  ? -3.765  -3.630  -5.345  1.00 0.00 ? 62  THR A CB   6  
ATOM 9513  O OG1  . THR A 1 62  ? -4.914  -3.891  -6.144  1.00 0.00 ? 62  THR A OG1  6  
ATOM 9514  C CG2  . THR A 1 62  ? -2.963  -4.932  -5.405  1.00 0.00 ? 62  THR A CG2  6  
ATOM 9515  H H    . THR A 1 62  ? -4.680  -1.325  -3.649  1.00 0.00 ? 62  THR A H    6  
ATOM 9516  H HA   . THR A 1 62  ? -4.989  -4.179  -3.659  1.00 0.00 ? 62  THR A HA   6  
ATOM 9517  H HB   . THR A 1 62  ? -3.167  -2.787  -5.691  1.00 0.00 ? 62  THR A HB   6  
ATOM 9518  H HG1  . THR A 1 62  ? -4.739  -3.629  -7.092  1.00 0.00 ? 62  THR A HG1  6  
ATOM 9519  H HG21 . THR A 1 62  ? -2.090  -4.852  -4.757  1.00 0.00 ? 62  THR A HG21 6  
ATOM 9520  H HG22 . THR A 1 62  ? -3.589  -5.759  -5.071  1.00 0.00 ? 62  THR A HG22 6  
ATOM 9521  H HG23 . THR A 1 62  ? -2.640  -5.111  -6.430  1.00 0.00 ? 62  THR A HG23 6  
ATOM 9522  N N    . ILE A 1 63  ? -2.071  -2.839  -3.301  1.00 0.00 ? 63  ILE A N    6  
ATOM 9523  C CA   . ILE A 1 63  ? -0.957  -2.678  -2.383  1.00 0.00 ? 63  ILE A CA   6  
ATOM 9524  C C    . ILE A 1 63  ? -0.557  -4.047  -1.829  1.00 0.00 ? 63  ILE A C    6  
ATOM 9525  O O    . ILE A 1 63  ? -1.343  -4.694  -1.138  1.00 0.00 ? 63  ILE A O    6  
ATOM 9526  C CB   . ILE A 1 63  ? -1.297  -1.651  -1.300  1.00 0.00 ? 63  ILE A CB   6  
ATOM 9527  C CG1  . ILE A 1 63  ? -1.400  -0.245  -1.893  1.00 0.00 ? 63  ILE A CG1  6  
ATOM 9528  C CG2  . ILE A 1 63  ? -0.292  -1.716  -0.149  1.00 0.00 ? 63  ILE A CG2  6  
ATOM 9529  C CD1  . ILE A 1 63  ? -2.823  0.304   -1.760  1.00 0.00 ? 63  ILE A CD1  6  
ATOM 9530  H H    . ILE A 1 63  ? -1.867  -2.629  -4.256  1.00 0.00 ? 63  ILE A H    6  
ATOM 9531  H HA   . ILE A 1 63  ? -0.119  -2.279  -2.954  1.00 0.00 ? 63  ILE A HA   6  
ATOM 9532  H HB   . ILE A 1 63  ? -2.275  -1.900  -0.889  1.00 0.00 ? 63  ILE A HB   6  
ATOM 9533  H HG13 . ILE A 1 63  ? -1.112  -0.266  -2.945  1.00 0.00 ? 63  ILE A HG13 6  
ATOM 9534  H HG21 . ILE A 1 63  ? -0.620  -2.458  0.579   1.00 0.00 ? 63  ILE A HG21 6  
ATOM 9535  H HG22 . ILE A 1 63  ? 0.687   -1.997  -0.537  1.00 0.00 ? 63  ILE A HG22 6  
ATOM 9536  H HG23 . ILE A 1 63  ? -0.227  -0.740  0.332   1.00 0.00 ? 63  ILE A HG23 6  
ATOM 9537  H HD11 . ILE A 1 63  ? -3.478  -0.216  -2.458  1.00 0.00 ? 63  ILE A HD11 6  
ATOM 9538  H HD12 . ILE A 1 63  ? -3.178  0.148   -0.742  1.00 0.00 ? 63  ILE A HD12 6  
ATOM 9539  H HD13 . ILE A 1 63  ? -2.823  1.370   -1.986  1.00 0.00 ? 63  ILE A HD13 6  
ATOM 9540  N N    . PHE A 1 64  ? 0.663   -4.448  -2.152  1.00 0.00 ? 64  PHE A N    6  
ATOM 9541  C CA   . PHE A 1 64  ? 1.178   -5.728  -1.693  1.00 0.00 ? 64  PHE A CA   6  
ATOM 9542  C C    . PHE A 1 64  ? 2.328   -5.535  -0.704  1.00 0.00 ? 64  PHE A C    6  
ATOM 9543  O O    . PHE A 1 64  ? 2.871   -4.437  -0.583  1.00 0.00 ? 64  PHE A O    6  
ATOM 9544  C CB   . PHE A 1 64  ? 1.699   -6.467  -2.927  1.00 0.00 ? 64  PHE A CB   6  
ATOM 9545  C CG   . PHE A 1 64  ? 0.638   -6.707  -4.004  1.00 0.00 ? 64  PHE A CG   6  
ATOM 9546  C CD1  . PHE A 1 64  ? -0.142  -7.820  -3.953  1.00 0.00 ? 64  PHE A CD1  6  
ATOM 9547  C CD2  . PHE A 1 64  ? 0.476   -5.807  -5.010  1.00 0.00 ? 64  PHE A CD2  6  
ATOM 9548  C CE1  . PHE A 1 64  ? -1.127  -8.042  -4.953  1.00 0.00 ? 64  PHE A CE1  6  
ATOM 9549  C CE2  . PHE A 1 64  ? -0.508  -6.030  -6.009  1.00 0.00 ? 64  PHE A CE2  6  
ATOM 9550  C CZ   . PHE A 1 64  ? -1.289  -7.142  -5.959  1.00 0.00 ? 64  PHE A CZ   6  
ATOM 9551  H H    . PHE A 1 64  ? 1.297   -3.914  -2.712  1.00 0.00 ? 64  PHE A H    6  
ATOM 9552  H HA   . PHE A 1 64  ? 0.356   -6.246  -1.197  1.00 0.00 ? 64  PHE A HA   6  
ATOM 9553  H HB3  . PHE A 1 64  ? 2.109   -7.428  -2.616  1.00 0.00 ? 64  PHE A HB3  6  
ATOM 9554  H HD1  . PHE A 1 64  ? -0.012  -8.541  -3.147  1.00 0.00 ? 64  PHE A HD1  6  
ATOM 9555  H HD2  . PHE A 1 64  ? 1.101   -4.914  -5.051  1.00 0.00 ? 64  PHE A HD2  6  
ATOM 9556  H HE1  . PHE A 1 64  ? -1.751  -8.934  -4.913  1.00 0.00 ? 64  PHE A HE1  6  
ATOM 9557  H HE2  . PHE A 1 64  ? -0.639  -5.309  -6.817  1.00 0.00 ? 64  PHE A HE2  6  
ATOM 9558  H HZ   . PHE A 1 64  ? -2.044  -7.313  -6.727  1.00 0.00 ? 64  PHE A HZ   6  
ATOM 9559  N N    . VAL A 1 65  ? 2.668   -6.618  -0.022  1.00 0.00 ? 65  VAL A N    6  
ATOM 9560  C CA   . VAL A 1 65  ? 3.745   -6.583  0.953   1.00 0.00 ? 65  VAL A CA   6  
ATOM 9561  C C    . VAL A 1 65  ? 5.041   -7.052  0.290   1.00 0.00 ? 65  VAL A C    6  
ATOM 9562  O O    . VAL A 1 65  ? 5.145   -8.200  -0.136  1.00 0.00 ? 65  VAL A O    6  
ATOM 9563  C CB   . VAL A 1 65  ? 3.366   -7.413  2.182   1.00 0.00 ? 65  VAL A CB   6  
ATOM 9564  C CG1  . VAL A 1 65  ? 4.574   -7.616  3.098   1.00 0.00 ? 65  VAL A CG1  6  
ATOM 9565  C CG2  . VAL A 1 65  ? 2.203   -6.770  2.940   1.00 0.00 ? 65  VAL A CG2  6  
ATOM 9566  H H    . VAL A 1 65  ? 2.221   -7.507  -0.126  1.00 0.00 ? 65  VAL A H    6  
ATOM 9567  H HA   . VAL A 1 65  ? 3.866   -5.547  1.269   1.00 0.00 ? 65  VAL A HA   6  
ATOM 9568  H HB   . VAL A 1 65  ? 3.039   -8.393  1.835   1.00 0.00 ? 65  VAL A HB   6  
ATOM 9569  H HG11 . VAL A 1 65  ? 5.233   -8.370  2.668   1.00 0.00 ? 65  VAL A HG11 6  
ATOM 9570  H HG12 . VAL A 1 65  ? 5.115   -6.675  3.202   1.00 0.00 ? 65  VAL A HG12 6  
ATOM 9571  H HG13 . VAL A 1 65  ? 4.234   -7.950  4.078   1.00 0.00 ? 65  VAL A HG13 6  
ATOM 9572  H HG21 . VAL A 1 65  ? 1.628   -7.545  3.448   1.00 0.00 ? 65  VAL A HG21 6  
ATOM 9573  H HG22 . VAL A 1 65  ? 2.594   -6.068  3.676   1.00 0.00 ? 65  VAL A HG22 6  
ATOM 9574  H HG23 . VAL A 1 65  ? 1.559   -6.242  2.238   1.00 0.00 ? 65  VAL A HG23 6  
ATOM 9575  N N    . LYS A 1 66  ? 6.000   -6.138  0.226   1.00 0.00 ? 66  LYS A N    6  
ATOM 9576  C CA   . LYS A 1 66  ? 7.286   -6.443  -0.377  1.00 0.00 ? 66  LYS A CA   6  
ATOM 9577  C C    . LYS A 1 66  ? 8.091   -7.331  0.574   1.00 0.00 ? 66  LYS A C    6  
ATOM 9578  O O    . LYS A 1 66  ? 8.545   -8.408  0.188   1.00 0.00 ? 66  LYS A O    6  
ATOM 9579  C CB   . LYS A 1 66  ? 8.008   -5.156  -0.777  1.00 0.00 ? 66  LYS A CB   6  
ATOM 9580  C CG   . LYS A 1 66  ? 9.039   -5.426  -1.876  1.00 0.00 ? 66  LYS A CG   6  
ATOM 9581  C CD   . LYS A 1 66  ? 10.459  -5.440  -1.304  1.00 0.00 ? 66  LYS A CD   6  
ATOM 9582  C CE   . LYS A 1 66  ? 11.362  -4.462  -2.057  1.00 0.00 ? 66  LYS A CE   6  
ATOM 9583  N NZ   . LYS A 1 66  ? 12.776  -4.895  -1.975  1.00 0.00 ? 66  LYS A NZ   6  
ATOM 9584  H H    . LYS A 1 66  ? 5.907   -5.206  0.577   1.00 0.00 ? 66  LYS A H    6  
ATOM 9585  H HA   . LYS A 1 66  ? 7.092   -7.003  -1.292  1.00 0.00 ? 66  LYS A HA   6  
ATOM 9586  H HB3  . LYS A 1 66  ? 8.504   -4.727  0.094   1.00 0.00 ? 66  LYS A HB3  6  
ATOM 9587  H HG3  . LYS A 1 66  ? 8.962   -4.660  -2.647  1.00 0.00 ? 66  LYS A HG3  6  
ATOM 9588  H HD3  . LYS A 1 66  ? 10.871  -6.447  -1.371  1.00 0.00 ? 66  LYS A HD3  6  
ATOM 9589  H HE3  . LYS A 1 66  ? 11.258  -3.463  -1.635  1.00 0.00 ? 66  LYS A HE3  6  
ATOM 9590  H HZ1  . LYS A 1 66  ? 13.374  -4.111  -2.139  1.00 0.00 ? 66  LYS A HZ1  6  
ATOM 9591  H HZ2  . LYS A 1 66  ? 12.958  -5.270  -1.067  1.00 0.00 ? 66  LYS A HZ2  6  
ATOM 9592  H HZ3  . LYS A 1 66  ? 12.950  -5.597  -2.666  1.00 0.00 ? 66  LYS A HZ3  6  
ATOM 9593  N N    . GLN A 1 67  ? 8.245   -6.847  1.798   1.00 0.00 ? 67  GLN A N    6  
ATOM 9594  C CA   . GLN A 1 67  ? 8.987   -7.583  2.806   1.00 0.00 ? 67  GLN A CA   6  
ATOM 9595  C C    . GLN A 1 67  ? 8.422   -7.295  4.198   1.00 0.00 ? 67  GLN A C    6  
ATOM 9596  O O    . GLN A 1 67  ? 7.580   -6.414  4.360   1.00 0.00 ? 67  GLN A O    6  
ATOM 9597  C CB   . GLN A 1 67  ? 10.478  -7.249  2.741   1.00 0.00 ? 67  GLN A CB   6  
ATOM 9598  C CG   . GLN A 1 67  ? 11.116  -7.829  1.477   1.00 0.00 ? 67  GLN A CG   6  
ATOM 9599  C CD   . GLN A 1 67  ? 12.643  -7.767  1.555   1.00 0.00 ? 67  GLN A CD   6  
ATOM 9600  O OE1  . GLN A 1 67  ? 13.225  -6.877  2.153   1.00 0.00 ? 67  GLN A OE1  6  
ATOM 9601  N NE2  . GLN A 1 67  ? 13.258  -8.760  0.917   1.00 0.00 ? 67  GLN A NE2  6  
ATOM 9602  H H    . GLN A 1 67  ? 7.872   -5.970  2.103   1.00 0.00 ? 67  GLN A H    6  
ATOM 9603  H HA   . GLN A 1 67  ? 8.847   -8.635  2.559   1.00 0.00 ? 67  GLN A HA   6  
ATOM 9604  H HB3  . GLN A 1 67  ? 10.984  -7.647  3.622   1.00 0.00 ? 67  GLN A HB3  6  
ATOM 9605  H HG3  . GLN A 1 67  ? 10.771  -7.276  0.604   1.00 0.00 ? 67  GLN A HG3  6  
ATOM 9606  H HE21 . GLN A 1 67  ? 12.721  -9.459  0.444   1.00 0.00 ? 67  GLN A HE21 6  
ATOM 9607  H HE22 . GLN A 1 67  ? 14.256  -8.808  0.910   1.00 0.00 ? 67  GLN A HE22 6  
ATOM 9608  N N    . VAL A 1 68  ? 8.908   -8.055  5.169   1.00 0.00 ? 68  VAL A N    6  
ATOM 9609  C CA   . VAL A 1 68  ? 8.461   -7.893  6.541   1.00 0.00 ? 68  VAL A CA   6  
ATOM 9610  C C    . VAL A 1 68  ? 9.678   -7.809  7.463   1.00 0.00 ? 68  VAL A C    6  
ATOM 9611  O O    . VAL A 1 68  ? 10.386  -8.797  7.654   1.00 0.00 ? 68  VAL A O    6  
ATOM 9612  C CB   . VAL A 1 68  ? 7.503   -9.027  6.917   1.00 0.00 ? 68  VAL A CB   6  
ATOM 9613  C CG1  . VAL A 1 68  ? 7.339   -9.124  8.436   1.00 0.00 ? 68  VAL A CG1  6  
ATOM 9614  C CG2  . VAL A 1 68  ? 6.148   -8.850  6.230   1.00 0.00 ? 68  VAL A CG2  6  
ATOM 9615  H H    . VAL A 1 68  ? 9.592   -8.771  5.029   1.00 0.00 ? 68  VAL A H    6  
ATOM 9616  H HA   . VAL A 1 68  ? 7.911   -6.954  6.600   1.00 0.00 ? 68  VAL A HA   6  
ATOM 9617  H HB   . VAL A 1 68  ? 7.937   -9.963  6.566   1.00 0.00 ? 68  VAL A HB   6  
ATOM 9618  H HG11 . VAL A 1 68  ? 7.757   -8.233  8.905   1.00 0.00 ? 68  VAL A HG11 6  
ATOM 9619  H HG12 . VAL A 1 68  ? 6.281   -9.202  8.683   1.00 0.00 ? 68  VAL A HG12 6  
ATOM 9620  H HG13 . VAL A 1 68  ? 7.864   -10.006 8.802   1.00 0.00 ? 68  VAL A HG13 6  
ATOM 9621  H HG21 . VAL A 1 68  ? 5.894   -9.761  5.687   1.00 0.00 ? 68  VAL A HG21 6  
ATOM 9622  H HG22 . VAL A 1 68  ? 5.383   -8.650  6.981   1.00 0.00 ? 68  VAL A HG22 6  
ATOM 9623  H HG23 . VAL A 1 68  ? 6.200   -8.014  5.533   1.00 0.00 ? 68  VAL A HG23 6  
ATOM 9624  N N    . LYS A 1 69  ? 9.885   -6.620  8.010   1.00 0.00 ? 69  LYS A N    6  
ATOM 9625  C CA   . LYS A 1 69  ? 11.006  -6.394  8.906   1.00 0.00 ? 69  LYS A CA   6  
ATOM 9626  C C    . LYS A 1 69  ? 11.115  -7.566  9.885   1.00 0.00 ? 69  LYS A C    6  
ATOM 9627  O O    . LYS A 1 69  ? 10.139  -7.920  10.544  1.00 0.00 ? 69  LYS A O    6  
ATOM 9628  C CB   . LYS A 1 69  ? 10.878  -5.031  9.590   1.00 0.00 ? 69  LYS A CB   6  
ATOM 9629  C CG   . LYS A 1 69  ? 12.256  -4.422  9.861   1.00 0.00 ? 69  LYS A CG   6  
ATOM 9630  C CD   . LYS A 1 69  ? 12.152  -2.914  10.101  1.00 0.00 ? 69  LYS A CD   6  
ATOM 9631  C CE   . LYS A 1 69  ? 13.477  -2.348  10.612  1.00 0.00 ? 69  LYS A CE   6  
ATOM 9632  N NZ   . LYS A 1 69  ? 14.058  -1.416  9.620   1.00 0.00 ? 69  LYS A NZ   6  
ATOM 9633  H H    . LYS A 1 69  ? 9.305   -5.822  7.848   1.00 0.00 ? 69  LYS A H    6  
ATOM 9634  H HA   . LYS A 1 69  ? 11.911  -6.366  8.299   1.00 0.00 ? 69  LYS A HA   6  
ATOM 9635  H HB3  . LYS A 1 69  ? 10.334  -5.140  10.528  1.00 0.00 ? 69  LYS A HB3  6  
ATOM 9636  H HG3  . LYS A 1 69  ? 12.914  -4.614  9.014   1.00 0.00 ? 69  LYS A HG3  6  
ATOM 9637  H HD3  . LYS A 1 69  ? 11.362  -2.712  10.826  1.00 0.00 ? 69  LYS A HD3  6  
ATOM 9638  H HE3  . LYS A 1 69  ? 14.176  -3.162  10.807  1.00 0.00 ? 69  LYS A HE3  6  
ATOM 9639  H HZ1  . LYS A 1 69  ? 13.362  -0.758  9.333   1.00 0.00 ? 69  LYS A HZ1  6  
ATOM 9640  H HZ2  . LYS A 1 69  ? 14.828  -0.928  10.031  1.00 0.00 ? 69  LYS A HZ2  6  
ATOM 9641  H HZ3  . LYS A 1 69  ? 14.377  -1.932  8.824   1.00 0.00 ? 69  LYS A HZ3  6  
ATOM 9642  N N    . GLU A 1 70  ? 12.311  -8.133  9.949   1.00 0.00 ? 70  GLU A N    6  
ATOM 9643  C CA   . GLU A 1 70  ? 12.560  -9.256  10.837  1.00 0.00 ? 70  GLU A CA   6  
ATOM 9644  C C    . GLU A 1 70  ? 12.793  -8.762  12.265  1.00 0.00 ? 70  GLU A C    6  
ATOM 9645  O O    . GLU A 1 70  ? 13.925  -8.476  12.650  1.00 0.00 ? 70  GLU A O    6  
ATOM 9646  C CB   . GLU A 1 70  ? 13.743  -10.090 10.344  1.00 0.00 ? 70  GLU A CB   6  
ATOM 9647  C CG   . GLU A 1 70  ? 13.434  -11.586 10.431  1.00 0.00 ? 70  GLU A CG   6  
ATOM 9648  C CD   . GLU A 1 70  ? 13.106  -12.160 9.051   1.00 0.00 ? 70  GLU A CD   6  
ATOM 9649  O OE1  . GLU A 1 70  ? 13.859  -11.837 8.109   1.00 0.00 ? 70  GLU A OE1  6  
ATOM 9650  O OE2  . GLU A 1 70  ? 12.109  -12.910 8.971   1.00 0.00 ? 70  GLU A OE2  6  
ATOM 9651  H H    . GLU A 1 70  ? 13.099  -7.837  9.410   1.00 0.00 ? 70  GLU A H    6  
ATOM 9652  H HA   . GLU A 1 70  ? 11.655  -9.862  10.797  1.00 0.00 ? 70  GLU A HA   6  
ATOM 9653  H HB3  . GLU A 1 70  ? 14.626  -9.863  10.940  1.00 0.00 ? 70  GLU A HB3  6  
ATOM 9654  H HG3  . GLU A 1 70  ? 12.593  -11.748 11.106  1.00 0.00 ? 70  GLU A HG3  6  
ATOM 9655  N N    . GLY A 1 71  ? 11.703  -8.677  13.014  1.00 0.00 ? 71  GLY A N    6  
ATOM 9656  C CA   . GLY A 1 71  ? 11.775  -8.223  14.392  1.00 0.00 ? 71  GLY A CA   6  
ATOM 9657  C C    . GLY A 1 71  ? 11.094  -6.863  14.557  1.00 0.00 ? 71  GLY A C    6  
ATOM 9658  O O    . GLY A 1 71  ? 11.589  -6.001  15.283  1.00 0.00 ? 71  GLY A O    6  
ATOM 9659  H H    . GLY A 1 71  ? 10.785  -8.911  12.692  1.00 0.00 ? 71  GLY A H    6  
ATOM 9660  H HA2  . GLY A 1 71  ? 11.297  -8.954  15.045  1.00 0.00 ? 71  GLY A HA2  6  
ATOM 9661  H HA3  . GLY A 1 71  ? 12.817  -8.152  14.701  1.00 0.00 ? 71  GLY A HA3  6  
ATOM 9662  N N    . GLY A 1 72  ? 9.969   -6.713  13.872  1.00 0.00 ? 72  GLY A N    6  
ATOM 9663  C CA   . GLY A 1 72  ? 9.217   -5.471  13.934  1.00 0.00 ? 72  GLY A CA   6  
ATOM 9664  C C    . GLY A 1 72  ? 7.779   -5.724  14.392  1.00 0.00 ? 72  GLY A C    6  
ATOM 9665  O O    . GLY A 1 72  ? 7.500   -6.728  15.046  1.00 0.00 ? 72  GLY A O    6  
ATOM 9666  H H    . GLY A 1 72  ? 9.574   -7.418  13.285  1.00 0.00 ? 72  GLY A H    6  
ATOM 9667  H HA2  . GLY A 1 72  ? 9.704   -4.779  14.621  1.00 0.00 ? 72  GLY A HA2  6  
ATOM 9668  H HA3  . GLY A 1 72  ? 9.211   -4.996  12.953  1.00 0.00 ? 72  GLY A HA3  6  
ATOM 9669  N N    . PRO A 1 73  ? 6.881   -4.772  14.020  1.00 0.00 ? 73  PRO A N    6  
ATOM 9670  C CA   . PRO A 1 73  ? 5.479   -4.884  14.385  1.00 0.00 ? 73  PRO A CA   6  
ATOM 9671  C C    . PRO A 1 73  ? 4.771   -5.936  13.531  1.00 0.00 ? 73  PRO A C    6  
ATOM 9672  O O    . PRO A 1 73  ? 4.200   -6.888  14.058  1.00 0.00 ? 73  PRO A O    6  
ATOM 9673  C CB   . PRO A 1 73  ? 4.912   -3.485  14.200  1.00 0.00 ? 73  PRO A CB   6  
ATOM 9674  C CG   . PRO A 1 73  ? 5.895   -2.755  13.298  1.00 0.00 ? 73  PRO A CG   6  
ATOM 9675  C CD   . PRO A 1 73  ? 7.176   -3.571  13.246  1.00 0.00 ? 73  PRO A CD   6  
ATOM 9676  H HA   . PRO A 1 73  ? 5.390   -5.195  15.332  1.00 0.00 ? 73  PRO A HA   6  
ATOM 9677  H HB3  . PRO A 1 73  ? 4.808   -2.975  15.157  1.00 0.00 ? 73  PRO A HB3  6  
ATOM 9678  H HG3  . PRO A 1 73  ? 6.095   -1.755  13.683  1.00 0.00 ? 73  PRO A HG3  6  
ATOM 9679  H HD3  . PRO A 1 73  ? 8.014   -3.020  13.673  1.00 0.00 ? 73  PRO A HD3  6  
ATOM 9680  N N    . ALA A 1 74  ? 4.829   -5.725  12.223  1.00 0.00 ? 74  ALA A N    6  
ATOM 9681  C CA   . ALA A 1 74  ? 4.200   -6.643  11.289  1.00 0.00 ? 74  ALA A CA   6  
ATOM 9682  C C    . ALA A 1 74  ? 4.618   -8.075  11.627  1.00 0.00 ? 74  ALA A C    6  
ATOM 9683  O O    . ALA A 1 74  ? 3.776   -8.914  11.942  1.00 0.00 ? 74  ALA A O    6  
ATOM 9684  C CB   . ALA A 1 74  ? 4.572   -6.250  9.858   1.00 0.00 ? 74  ALA A CB   6  
ATOM 9685  H H    . ALA A 1 74  ? 5.294   -4.947  11.803  1.00 0.00 ? 74  ALA A H    6  
ATOM 9686  H HA   . ALA A 1 74  ? 3.121   -6.550  11.409  1.00 0.00 ? 74  ALA A HA   6  
ATOM 9687  H HB1  . ALA A 1 74  ? 4.339   -5.198  9.698   1.00 0.00 ? 74  ALA A HB1  6  
ATOM 9688  H HB2  . ALA A 1 74  ? 5.639   -6.414  9.702   1.00 0.00 ? 74  ALA A HB2  6  
ATOM 9689  H HB3  . ALA A 1 74  ? 4.005   -6.859  9.154   1.00 0.00 ? 74  ALA A HB3  6  
ATOM 9690  N N    . PHE A 1 75  ? 5.920   -8.311  11.553  1.00 0.00 ? 75  PHE A N    6  
ATOM 9691  C CA   . PHE A 1 75  ? 6.461   -9.628  11.848  1.00 0.00 ? 75  PHE A CA   6  
ATOM 9692  C C    . PHE A 1 75  ? 5.727   -10.269 13.027  1.00 0.00 ? 75  PHE A C    6  
ATOM 9693  O O    . PHE A 1 75  ? 5.540   -11.484 13.059  1.00 0.00 ? 75  PHE A O    6  
ATOM 9694  C CB   . PHE A 1 75  ? 7.932   -9.433  12.222  1.00 0.00 ? 75  PHE A CB   6  
ATOM 9695  C CG   . PHE A 1 75  ? 8.521   -10.582 13.043  1.00 0.00 ? 75  PHE A CG   6  
ATOM 9696  C CD1  . PHE A 1 75  ? 8.736   -11.792 12.462  1.00 0.00 ? 75  PHE A CD1  6  
ATOM 9697  C CD2  . PHE A 1 75  ? 8.830   -10.391 14.354  1.00 0.00 ? 75  PHE A CD2  6  
ATOM 9698  C CE1  . PHE A 1 75  ? 9.283   -12.858 13.225  1.00 0.00 ? 75  PHE A CE1  6  
ATOM 9699  C CE2  . PHE A 1 75  ? 9.378   -11.458 15.117  1.00 0.00 ? 75  PHE A CE2  6  
ATOM 9700  C CZ   . PHE A 1 75  ? 9.592   -12.669 14.535  1.00 0.00 ? 75  PHE A CZ   6  
ATOM 9701  H H    . PHE A 1 75  ? 6.599   -7.623  11.297  1.00 0.00 ? 75  PHE A H    6  
ATOM 9702  H HA   . PHE A 1 75  ? 6.322   -10.241 10.958  1.00 0.00 ? 75  PHE A HA   6  
ATOM 9703  H HB3  . PHE A 1 75  ? 8.033   -8.506  12.788  1.00 0.00 ? 75  PHE A HB3  6  
ATOM 9704  H HD1  . PHE A 1 75  ? 8.489   -11.945 11.412  1.00 0.00 ? 75  PHE A HD1  6  
ATOM 9705  H HD2  . PHE A 1 75  ? 8.658   -9.422  14.819  1.00 0.00 ? 75  PHE A HD2  6  
ATOM 9706  H HE1  . PHE A 1 75  ? 9.456   -13.828 12.759  1.00 0.00 ? 75  PHE A HE1  6  
ATOM 9707  H HE2  . PHE A 1 75  ? 9.625   -11.305 16.167  1.00 0.00 ? 75  PHE A HE2  6  
ATOM 9708  H HZ   . PHE A 1 75  ? 10.013  -13.487 15.120  1.00 0.00 ? 75  PHE A HZ   6  
ATOM 9709  N N    . GLU A 1 76  ? 5.331   -9.425  13.967  1.00 0.00 ? 76  GLU A N    6  
ATOM 9710  C CA   . GLU A 1 76  ? 4.622   -9.895  15.145  1.00 0.00 ? 76  GLU A CA   6  
ATOM 9711  C C    . GLU A 1 76  ? 3.156   -10.171 14.808  1.00 0.00 ? 76  GLU A C    6  
ATOM 9712  O O    . GLU A 1 76  ? 2.686   -11.299 14.946  1.00 0.00 ? 76  GLU A O    6  
ATOM 9713  C CB   . GLU A 1 76  ? 4.740   -8.890  16.293  1.00 0.00 ? 76  GLU A CB   6  
ATOM 9714  C CG   . GLU A 1 76  ? 6.206   -8.649  16.664  1.00 0.00 ? 76  GLU A CG   6  
ATOM 9715  C CD   . GLU A 1 76  ? 6.563   -9.353  17.975  1.00 0.00 ? 76  GLU A CD   6  
ATOM 9716  O OE1  . GLU A 1 76  ? 6.026   -8.919  19.015  1.00 0.00 ? 76  GLU A OE1  6  
ATOM 9717  O OE2  . GLU A 1 76  ? 7.364   -10.309 17.905  1.00 0.00 ? 76  GLU A OE2  6  
ATOM 9718  H H    . GLU A 1 76  ? 5.488   -8.438  13.935  1.00 0.00 ? 76  GLU A H    6  
ATOM 9719  H HA   . GLU A 1 76  ? 5.118   -10.822 15.431  1.00 0.00 ? 76  GLU A HA   6  
ATOM 9720  H HB3  . GLU A 1 76  ? 4.198   -9.261  17.163  1.00 0.00 ? 76  GLU A HB3  6  
ATOM 9721  H HG3  . GLU A 1 76  ? 6.389   -7.580  16.760  1.00 0.00 ? 76  GLU A HG3  6  
ATOM 9722  N N    . ALA A 1 77  ? 2.475   -9.122  14.371  1.00 0.00 ? 77  ALA A N    6  
ATOM 9723  C CA   . ALA A 1 77  ? 1.072   -9.239  14.011  1.00 0.00 ? 77  ALA A CA   6  
ATOM 9724  C C    . ALA A 1 77  ? 0.847   -10.558 13.270  1.00 0.00 ? 77  ALA A C    6  
ATOM 9725  O O    . ALA A 1 77  ? -0.216  -11.165 13.386  1.00 0.00 ? 77  ALA A O    6  
ATOM 9726  C CB   . ALA A 1 77  ? 0.655   -8.023  13.179  1.00 0.00 ? 77  ALA A CB   6  
ATOM 9727  H H    . ALA A 1 77  ? 2.865   -8.208  14.260  1.00 0.00 ? 77  ALA A H    6  
ATOM 9728  H HA   . ALA A 1 77  ? 0.492   -9.247  14.935  1.00 0.00 ? 77  ALA A HA   6  
ATOM 9729  H HB1  . ALA A 1 77  ? 0.789   -8.246  12.120  1.00 0.00 ? 77  ALA A HB1  6  
ATOM 9730  H HB2  . ALA A 1 77  ? -0.393  -7.792  13.373  1.00 0.00 ? 77  ALA A HB2  6  
ATOM 9731  H HB3  . ALA A 1 77  ? 1.273   -7.168  13.451  1.00 0.00 ? 77  ALA A HB3  6  
ATOM 9732  N N    . GLY A 1 78  ? 1.865   -10.961 12.524  1.00 0.00 ? 78  GLY A N    6  
ATOM 9733  C CA   . GLY A 1 78  ? 1.791   -12.198 11.765  1.00 0.00 ? 78  GLY A CA   6  
ATOM 9734  C C    . GLY A 1 78  ? 1.920   -11.927 10.264  1.00 0.00 ? 78  GLY A C    6  
ATOM 9735  O O    . GLY A 1 78  ? 1.799   -12.843 9.452   1.00 0.00 ? 78  GLY A O    6  
ATOM 9736  H H    . GLY A 1 78  ? 2.726   -10.461 12.435  1.00 0.00 ? 78  GLY A H    6  
ATOM 9737  H HA2  . GLY A 1 78  ? 2.584   -12.873 12.085  1.00 0.00 ? 78  GLY A HA2  6  
ATOM 9738  H HA3  . GLY A 1 78  ? 0.845   -12.699 11.968  1.00 0.00 ? 78  GLY A HA3  6  
ATOM 9739  N N    . LEU A 1 79  ? 2.162   -10.665 9.941   1.00 0.00 ? 79  LEU A N    6  
ATOM 9740  C CA   . LEU A 1 79  ? 2.308   -10.263 8.553   1.00 0.00 ? 79  LEU A CA   6  
ATOM 9741  C C    . LEU A 1 79  ? 3.398   -11.108 7.893   1.00 0.00 ? 79  LEU A C    6  
ATOM 9742  O O    . LEU A 1 79  ? 4.380   -11.474 8.536   1.00 0.00 ? 79  LEU A O    6  
ATOM 9743  C CB   . LEU A 1 79  ? 2.555   -8.755  8.456   1.00 0.00 ? 79  LEU A CB   6  
ATOM 9744  C CG   . LEU A 1 79  ? 1.737   -8.009  7.400   1.00 0.00 ? 79  LEU A CG   6  
ATOM 9745  C CD1  . LEU A 1 79  ? 0.247   -8.026  7.747   1.00 0.00 ? 79  LEU A CD1  6  
ATOM 9746  C CD2  . LEU A 1 79  ? 2.263   -6.586  7.203   1.00 0.00 ? 79  LEU A CD2  6  
ATOM 9747  H H    . LEU A 1 79  ? 2.258   -9.926  10.607  1.00 0.00 ? 79  LEU A H    6  
ATOM 9748  H HA   . LEU A 1 79  ? 1.361   -10.466 8.052   1.00 0.00 ? 79  LEU A HA   6  
ATOM 9749  H HB3  . LEU A 1 79  ? 3.612   -8.595  8.248   1.00 0.00 ? 79  LEU A HB3  6  
ATOM 9750  H HG   . LEU A 1 79  ? 1.851   -8.529  6.448   1.00 0.00 ? 79  LEU A HG   6  
ATOM 9751  H HD11 . LEU A 1 79  ? 0.122   -8.299  8.795   1.00 0.00 ? 79  LEU A HD11 6  
ATOM 9752  H HD12 . LEU A 1 79  ? -0.178  -7.036  7.576   1.00 0.00 ? 79  LEU A HD12 6  
ATOM 9753  H HD13 . LEU A 1 79  ? -0.265  -8.754  7.119   1.00 0.00 ? 79  LEU A HD13 6  
ATOM 9754  H HD21 . LEU A 1 79  ? 1.658   -6.074  6.456   1.00 0.00 ? 79  LEU A HD21 6  
ATOM 9755  H HD22 . LEU A 1 79  ? 2.209   -6.045  8.148   1.00 0.00 ? 79  LEU A HD22 6  
ATOM 9756  H HD23 . LEU A 1 79  ? 3.300   -6.625  6.866   1.00 0.00 ? 79  LEU A HD23 6  
ATOM 9757  N N    . CYS A 1 80  ? 3.188   -11.395 6.617   1.00 0.00 ? 80  CYS A N    6  
ATOM 9758  C CA   . CYS A 1 80  ? 4.141   -12.192 5.862   1.00 0.00 ? 80  CYS A CA   6  
ATOM 9759  C C    . CYS A 1 80  ? 4.434   -11.470 4.544   1.00 0.00 ? 80  CYS A C    6  
ATOM 9760  O O    . CYS A 1 80  ? 4.073   -10.305 4.377   1.00 0.00 ? 80  CYS A O    6  
ATOM 9761  C CB   . CYS A 1 80  ? 3.631   -13.615 5.631   1.00 0.00 ? 80  CYS A CB   6  
ATOM 9762  S SG   . CYS A 1 80  ? 4.908   -14.826 6.130   1.00 0.00 ? 80  CYS A SG   6  
ATOM 9763  H H    . CYS A 1 80  ? 2.387   -11.093 6.100   1.00 0.00 ? 80  CYS A H    6  
ATOM 9764  H HA   . CYS A 1 80  ? 5.041   -12.264 6.471   1.00 0.00 ? 80  CYS A HA   6  
ATOM 9765  H HB3  . CYS A 1 80  ? 3.377   -13.753 4.580   1.00 0.00 ? 80  CYS A HB3  6  
ATOM 9766  H HG   . CYS A 1 80  ? 4.128   -15.521 6.953   1.00 0.00 ? 80  CYS A HG   6  
ATOM 9767  N N    . THR A 1 81  ? 5.086   -12.191 3.644   1.00 0.00 ? 81  THR A N    6  
ATOM 9768  C CA   . THR A 1 81  ? 5.431   -11.633 2.347   1.00 0.00 ? 81  THR A CA   6  
ATOM 9769  C C    . THR A 1 81  ? 4.488   -12.169 1.268   1.00 0.00 ? 81  THR A C    6  
ATOM 9770  O O    . THR A 1 81  ? 4.234   -13.370 1.201   1.00 0.00 ? 81  THR A O    6  
ATOM 9771  C CB   . THR A 1 81  ? 6.905   -11.945 2.075   1.00 0.00 ? 81  THR A CB   6  
ATOM 9772  O OG1  . THR A 1 81  ? 7.034   -13.325 2.410   1.00 0.00 ? 81  THR A OG1  6  
ATOM 9773  C CG2  . THR A 1 81  ? 7.843   -11.236 3.055   1.00 0.00 ? 81  THR A CG2  6  
ATOM 9774  H H    . THR A 1 81  ? 5.375   -13.137 3.788   1.00 0.00 ? 81  THR A H    6  
ATOM 9775  H HA   . THR A 1 81  ? 5.290   -10.552 2.389   1.00 0.00 ? 81  THR A HA   6  
ATOM 9776  H HB   . THR A 1 81  ? 7.168   -11.711 1.045   1.00 0.00 ? 81  THR A HB   6  
ATOM 9777  H HG1  . THR A 1 81  ? 6.408   -13.871 1.853   1.00 0.00 ? 81  THR A HG1  6  
ATOM 9778  H HG21 . THR A 1 81  ? 8.535   -10.601 2.499   1.00 0.00 ? 81  THR A HG21 6  
ATOM 9779  H HG22 . THR A 1 81  ? 7.257   -10.623 3.740   1.00 0.00 ? 81  THR A HG22 6  
ATOM 9780  H HG23 . THR A 1 81  ? 8.405   -11.978 3.621   1.00 0.00 ? 81  THR A HG23 6  
ATOM 9781  N N    . GLY A 1 82  ? 3.995   -11.251 0.450   1.00 0.00 ? 82  GLY A N    6  
ATOM 9782  C CA   . GLY A 1 82  ? 3.086   -11.615 -0.622  1.00 0.00 ? 82  GLY A CA   6  
ATOM 9783  C C    . GLY A 1 82  ? 1.663   -11.139 -0.321  1.00 0.00 ? 82  GLY A C    6  
ATOM 9784  O O    . GLY A 1 82  ? 0.862   -10.950 -1.234  1.00 0.00 ? 82  GLY A O    6  
ATOM 9785  H H    . GLY A 1 82  ? 4.207   -10.275 0.512   1.00 0.00 ? 82  GLY A H    6  
ATOM 9786  H HA2  . GLY A 1 82  ? 3.429   -11.177 -1.560  1.00 0.00 ? 82  GLY A HA2  6  
ATOM 9787  H HA3  . GLY A 1 82  ? 3.090   -12.696 -0.756  1.00 0.00 ? 82  GLY A HA3  6  
ATOM 9788  N N    . ASP A 1 83  ? 1.394   -10.958 0.963   1.00 0.00 ? 83  ASP A N    6  
ATOM 9789  C CA   . ASP A 1 83  ? 0.081   -10.507 1.396   1.00 0.00 ? 83  ASP A CA   6  
ATOM 9790  C C    . ASP A 1 83  ? -0.187  -9.112  0.828   1.00 0.00 ? 83  ASP A C    6  
ATOM 9791  O O    . ASP A 1 83  ? 0.742   -8.409  0.433   1.00 0.00 ? 83  ASP A O    6  
ATOM 9792  C CB   . ASP A 1 83  ? 0.006   -10.418 2.922   1.00 0.00 ? 83  ASP A CB   6  
ATOM 9793  C CG   . ASP A 1 83  ? -0.483  -11.690 3.619   1.00 0.00 ? 83  ASP A CG   6  
ATOM 9794  O OD1  . ASP A 1 83  ? -1.499  -12.241 3.145   1.00 0.00 ? 83  ASP A OD1  6  
ATOM 9795  O OD2  . ASP A 1 83  ? 0.170   -12.079 4.612   1.00 0.00 ? 83  ASP A OD2  6  
ATOM 9796  H H    . ASP A 1 83  ? 2.051   -11.114 1.700   1.00 0.00 ? 83  ASP A H    6  
ATOM 9797  H HA   . ASP A 1 83  ? -0.617  -11.254 1.019   1.00 0.00 ? 83  ASP A HA   6  
ATOM 9798  H HB3  . ASP A 1 83  ? -0.656  -9.596  3.191   1.00 0.00 ? 83  ASP A HB3  6  
ATOM 9799  N N    . ARG A 1 84  ? -1.462  -8.753  0.805   1.00 0.00 ? 84  ARG A N    6  
ATOM 9800  C CA   . ARG A 1 84  ? -1.865  -7.455  0.292   1.00 0.00 ? 84  ARG A CA   6  
ATOM 9801  C C    . ARG A 1 84  ? -2.858  -6.791  1.248   1.00 0.00 ? 84  ARG A C    6  
ATOM 9802  O O    . ARG A 1 84  ? -3.715  -7.460  1.820   1.00 0.00 ? 84  ARG A O    6  
ATOM 9803  C CB   . ARG A 1 84  ? -2.507  -7.584  -1.091  1.00 0.00 ? 84  ARG A CB   6  
ATOM 9804  C CG   . ARG A 1 84  ? -3.878  -8.257  -0.998  1.00 0.00 ? 84  ARG A CG   6  
ATOM 9805  C CD   . ARG A 1 84  ? -4.424  -8.583  -2.390  1.00 0.00 ? 84  ARG A CD   6  
ATOM 9806  N NE   . ARG A 1 84  ? -4.995  -9.949  -2.403  1.00 0.00 ? 84  ARG A NE   6  
ATOM 9807  C CZ   . ARG A 1 84  ? -5.200  -10.666 -3.516  1.00 0.00 ? 84  ARG A CZ   6  
ATOM 9808  N NH1  . ARG A 1 84  ? -4.884  -10.151 -4.712  1.00 0.00 ? 84  ARG A NH1  6  
ATOM 9809  N NH2  . ARG A 1 84  ? -5.723  -11.897 -3.432  1.00 0.00 ? 84  ARG A NH2  6  
ATOM 9810  H H    . ARG A 1 84  ? -2.211  -9.331  1.129   1.00 0.00 ? 84  ARG A H    6  
ATOM 9811  H HA   . ARG A 1 84  ? -0.939  -6.881  0.226   1.00 0.00 ? 84  ARG A HA   6  
ATOM 9812  H HB3  . ARG A 1 84  ? -1.857  -8.165  -1.745  1.00 0.00 ? 84  ARG A HB3  6  
ATOM 9813  H HG3  . ARG A 1 84  ? -4.573  -7.602  -0.473  1.00 0.00 ? 84  ARG A HG3  6  
ATOM 9814  H HD3  . ARG A 1 84  ? -3.628  -8.505  -3.130  1.00 0.00 ? 84  ARG A HD3  6  
ATOM 9815  H HE   . ARG A 1 84  ? -5.242  -10.362 -1.527  1.00 0.00 ? 84  ARG A HE   6  
ATOM 9816  H HH11 . ARG A 1 84  ? -4.495  -9.233  -4.775  1.00 0.00 ? 84  ARG A HH11 6  
ATOM 9817  H HH12 . ARG A 1 84  ? -5.038  -10.687 -5.542  1.00 0.00 ? 84  ARG A HH12 6  
ATOM 9818  H HH21 . ARG A 1 84  ? -5.958  -12.281 -2.539  1.00 0.00 ? 84  ARG A HH21 6  
ATOM 9819  H HH22 . ARG A 1 84  ? -5.875  -12.432 -4.263  1.00 0.00 ? 84  ARG A HH22 6  
ATOM 9820  N N    . ILE A 1 85  ? -2.709  -5.482  1.389   1.00 0.00 ? 85  ILE A N    6  
ATOM 9821  C CA   . ILE A 1 85  ? -3.582  -4.719  2.266   1.00 0.00 ? 85  ILE A CA   6  
ATOM 9822  C C    . ILE A 1 85  ? -4.888  -4.408  1.532   1.00 0.00 ? 85  ILE A C    6  
ATOM 9823  O O    . ILE A 1 85  ? -4.878  -3.761  0.487   1.00 0.00 ? 85  ILE A O    6  
ATOM 9824  C CB   . ILE A 1 85  ? -2.860  -3.477  2.792   1.00 0.00 ? 85  ILE A CB   6  
ATOM 9825  C CG1  . ILE A 1 85  ? -1.943  -3.831  3.964   1.00 0.00 ? 85  ILE A CG1  6  
ATOM 9826  C CG2  . ILE A 1 85  ? -3.859  -2.377  3.157   1.00 0.00 ? 85  ILE A CG2  6  
ATOM 9827  C CD1  . ILE A 1 85  ? -1.245  -5.170  3.728   1.00 0.00 ? 85  ILE A CD1  6  
ATOM 9828  H H    . ILE A 1 85  ? -2.009  -4.945  0.919   1.00 0.00 ? 85  ILE A H    6  
ATOM 9829  H HA   . ILE A 1 85  ? -3.809  -5.348  3.126   1.00 0.00 ? 85  ILE A HA   6  
ATOM 9830  H HB   . ILE A 1 85  ? -2.228  -3.086  1.995   1.00 0.00 ? 85  ILE A HB   6  
ATOM 9831  H HG13 . ILE A 1 85  ? -2.525  -3.876  4.885   1.00 0.00 ? 85  ILE A HG13 6  
ATOM 9832  H HG21 . ILE A 1 85  ? -4.189  -1.870  2.250   1.00 0.00 ? 85  ILE A HG21 6  
ATOM 9833  H HG22 . ILE A 1 85  ? -4.719  -2.820  3.659   1.00 0.00 ? 85  ILE A HG22 6  
ATOM 9834  H HG23 . ILE A 1 85  ? -3.381  -1.658  3.821   1.00 0.00 ? 85  ILE A HG23 6  
ATOM 9835  H HD11 . ILE A 1 85  ? -1.991  -5.963  3.657   1.00 0.00 ? 85  ILE A HD11 6  
ATOM 9836  H HD12 . ILE A 1 85  ? -0.673  -5.126  2.802   1.00 0.00 ? 85  ILE A HD12 6  
ATOM 9837  H HD13 . ILE A 1 85  ? -0.571  -5.381  4.561   1.00 0.00 ? 85  ILE A HD13 6  
ATOM 9838  N N    . ILE A 1 86  ? -5.981  -4.884  2.110   1.00 0.00 ? 86  ILE A N    6  
ATOM 9839  C CA   . ILE A 1 86  ? -7.293  -4.665  1.523   1.00 0.00 ? 86  ILE A CA   6  
ATOM 9840  C C    . ILE A 1 86  ? -8.005  -3.546  2.286   1.00 0.00 ? 86  ILE A C    6  
ATOM 9841  O O    . ILE A 1 86  ? -8.838  -2.838  1.720   1.00 0.00 ? 86  ILE A O    6  
ATOM 9842  C CB   . ILE A 1 86  ? -8.082  -5.974  1.473   1.00 0.00 ? 86  ILE A CB   6  
ATOM 9843  C CG1  . ILE A 1 86  ? -8.268  -6.558  2.874   1.00 0.00 ? 86  ILE A CG1  6  
ATOM 9844  C CG2  . ILE A 1 86  ? -7.427  -6.974  0.518   1.00 0.00 ? 86  ILE A CG2  6  
ATOM 9845  C CD1  . ILE A 1 86  ? -9.394  -7.594  2.894   1.00 0.00 ? 86  ILE A CD1  6  
ATOM 9846  H H    . ILE A 1 86  ? -5.980  -5.410  2.960   1.00 0.00 ? 86  ILE A H    6  
ATOM 9847  H HA   . ILE A 1 86  ? -7.140  -4.341  0.495   1.00 0.00 ? 86  ILE A HA   6  
ATOM 9848  H HB   . ILE A 1 86  ? -9.076  -5.758  1.080   1.00 0.00 ? 86  ILE A HB   6  
ATOM 9849  H HG13 . ILE A 1 86  ? -8.493  -5.758  3.579   1.00 0.00 ? 86  ILE A HG13 6  
ATOM 9850  H HG21 . ILE A 1 86  ? -7.283  -7.924  1.028   1.00 0.00 ? 86  ILE A HG21 6  
ATOM 9851  H HG22 . ILE A 1 86  ? -8.068  -7.120  -0.351  1.00 0.00 ? 86  ILE A HG22 6  
ATOM 9852  H HG23 . ILE A 1 86  ? -6.460  -6.585  0.194   1.00 0.00 ? 86  ILE A HG23 6  
ATOM 9853  H HD11 . ILE A 1 86  ? -10.113 -7.334  3.671   1.00 0.00 ? 86  ILE A HD11 6  
ATOM 9854  H HD12 . ILE A 1 86  ? -9.894  -7.602  1.925   1.00 0.00 ? 86  ILE A HD12 6  
ATOM 9855  H HD13 . ILE A 1 86  ? -8.978  -8.580  3.097   1.00 0.00 ? 86  ILE A HD13 6  
ATOM 9856  N N    . LYS A 1 87  ? -7.655  -3.423  3.557   1.00 0.00 ? 87  LYS A N    6  
ATOM 9857  C CA   . LYS A 1 87  ? -8.251  -2.401  4.403   1.00 0.00 ? 87  LYS A CA   6  
ATOM 9858  C C    . LYS A 1 87  ? -7.154  -1.721  5.225   1.00 0.00 ? 87  LYS A C    6  
ATOM 9859  O O    . LYS A 1 87  ? -6.079  -2.286  5.421   1.00 0.00 ? 87  LYS A O    6  
ATOM 9860  C CB   . LYS A 1 87  ? -9.375  -2.999  5.251   1.00 0.00 ? 87  LYS A CB   6  
ATOM 9861  C CG   . LYS A 1 87  ? -10.563 -3.410  4.379   1.00 0.00 ? 87  LYS A CG   6  
ATOM 9862  C CD   . LYS A 1 87  ? -11.093 -4.786  4.788   1.00 0.00 ? 87  LYS A CD   6  
ATOM 9863  C CE   . LYS A 1 87  ? -11.698 -5.519  3.589   1.00 0.00 ? 87  LYS A CE   6  
ATOM 9864  N NZ   . LYS A 1 87  ? -12.319 -6.792  4.020   1.00 0.00 ? 87  LYS A NZ   6  
ATOM 9865  H H    . LYS A 1 87  ? -6.978  -4.002  4.010   1.00 0.00 ? 87  LYS A H    6  
ATOM 9866  H HA   . LYS A 1 87  ? -8.702  -1.658  3.747   1.00 0.00 ? 87  LYS A HA   6  
ATOM 9867  H HB3  . LYS A 1 87  ? -9.701  -2.271  5.995   1.00 0.00 ? 87  LYS A HB3  6  
ATOM 9868  H HG3  . LYS A 1 87  ? -10.259 -3.431  3.331   1.00 0.00 ? 87  LYS A HG3  6  
ATOM 9869  H HD3  . LYS A 1 87  ? -11.848 -4.671  5.566   1.00 0.00 ? 87  LYS A HD3  6  
ATOM 9870  H HE3  . LYS A 1 87  ? -10.923 -5.718  2.848   1.00 0.00 ? 87  LYS A HE3  6  
ATOM 9871  H HZ1  . LYS A 1 87  ? -12.014 -7.014  4.946   1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 9872  H HZ2  . LYS A 1 87  ? -13.314 -6.698  4.009   1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 9873  H HZ3  . LYS A 1 87  ? -12.047 -7.523  3.394   1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 9874  N N    . VAL A 1 88  ? -7.464  -0.519  5.684   1.00 0.00 ? 88  VAL A N    6  
ATOM 9875  C CA   . VAL A 1 88  ? -6.519  0.245   6.481   1.00 0.00 ? 88  VAL A CA   6  
ATOM 9876  C C    . VAL A 1 88  ? -7.277  1.026   7.556   1.00 0.00 ? 88  VAL A C    6  
ATOM 9877  O O    . VAL A 1 88  ? -7.927  2.027   7.259   1.00 0.00 ? 88  VAL A O    6  
ATOM 9878  C CB   . VAL A 1 88  ? -5.675  1.142   5.572   1.00 0.00 ? 88  VAL A CB   6  
ATOM 9879  C CG1  . VAL A 1 88  ? -4.830  2.116   6.398   1.00 0.00 ? 88  VAL A CG1  6  
ATOM 9880  C CG2  . VAL A 1 88  ? -4.795  0.308   4.641   1.00 0.00 ? 88  VAL A CG2  6  
ATOM 9881  H H    . VAL A 1 88  ? -8.341  -0.065  5.521   1.00 0.00 ? 88  VAL A H    6  
ATOM 9882  H HA   . VAL A 1 88  ? -5.850  -0.465  6.968   1.00 0.00 ? 88  VAL A HA   6  
ATOM 9883  H HB   . VAL A 1 88  ? -6.355  1.729   4.956   1.00 0.00 ? 88  VAL A HB   6  
ATOM 9884  H HG11 . VAL A 1 88  ? -3.907  1.626   6.706   1.00 0.00 ? 88  VAL A HG11 6  
ATOM 9885  H HG12 . VAL A 1 88  ? -4.591  2.992   5.793   1.00 0.00 ? 88  VAL A HG12 6  
ATOM 9886  H HG13 . VAL A 1 88  ? -5.391  2.425   7.280   1.00 0.00 ? 88  VAL A HG13 6  
ATOM 9887  H HG21 . VAL A 1 88  ? -4.002  -0.168  5.219   1.00 0.00 ? 88  VAL A HG21 6  
ATOM 9888  H HG22 . VAL A 1 88  ? -5.401  -0.459  4.158   1.00 0.00 ? 88  VAL A HG22 6  
ATOM 9889  H HG23 . VAL A 1 88  ? -4.355  0.954   3.882   1.00 0.00 ? 88  VAL A HG23 6  
ATOM 9890  N N    . ASN A 1 89  ? -7.169  0.539   8.783   1.00 0.00 ? 89  ASN A N    6  
ATOM 9891  C CA   . ASN A 1 89  ? -7.836  1.177   9.904   1.00 0.00 ? 89  ASN A CA   6  
ATOM 9892  C C    . ASN A 1 89  ? -9.338  1.253   9.623   1.00 0.00 ? 89  ASN A C    6  
ATOM 9893  O O    . ASN A 1 89  ? -10.011 2.181   10.068  1.00 0.00 ? 89  ASN A O    6  
ATOM 9894  C CB   . ASN A 1 89  ? -7.321  2.604   10.111  1.00 0.00 ? 89  ASN A CB   6  
ATOM 9895  C CG   . ASN A 1 89  ? -6.052  2.609   10.965  1.00 0.00 ? 89  ASN A CG   6  
ATOM 9896  O OD1  . ASN A 1 89  ? -5.745  1.664   11.673  1.00 0.00 ? 89  ASN A OD1  6  
ATOM 9897  N ND2  . ASN A 1 89  ? -5.334  3.724   10.859  1.00 0.00 ? 89  ASN A ND2  6  
ATOM 9898  H H    . ASN A 1 89  ? -6.638  -0.278  9.016   1.00 0.00 ? 89  ASN A H    6  
ATOM 9899  H HA   . ASN A 1 89  ? -7.605  0.554   10.768  1.00 0.00 ? 89  ASN A HA   6  
ATOM 9900  H HB3  . ASN A 1 89  ? -8.091  3.205   10.593  1.00 0.00 ? 89  ASN A HB3  6  
ATOM 9901  H HD21 . ASN A 1 89  ? -5.643  4.462   10.258  1.00 0.00 ? 89  ASN A HD21 6  
ATOM 9902  H HD22 . ASN A 1 89  ? -4.486  3.823   11.378  1.00 0.00 ? 89  ASN A HD22 6  
ATOM 9903  N N    . GLY A 1 90  ? -9.820  0.264   8.883   1.00 0.00 ? 90  GLY A N    6  
ATOM 9904  C CA   . GLY A 1 90  ? -11.230 0.207   8.537   1.00 0.00 ? 90  GLY A CA   6  
ATOM 9905  C C    . GLY A 1 90  ? -11.676 1.495   7.844   1.00 0.00 ? 90  GLY A C    6  
ATOM 9906  O O    . GLY A 1 90  ? -12.839 1.885   7.938   1.00 0.00 ? 90  GLY A O    6  
ATOM 9907  H H    . GLY A 1 90  ? -9.266  -0.487  8.525   1.00 0.00 ? 90  GLY A H    6  
ATOM 9908  H HA2  . GLY A 1 90  ? -11.412 -0.644  7.882   1.00 0.00 ? 90  GLY A HA2  6  
ATOM 9909  H HA3  . GLY A 1 90  ? -11.823 0.049   9.438   1.00 0.00 ? 90  GLY A HA3  6  
ATOM 9910  N N    . GLU A 1 91  ? -10.728 2.124   7.163   1.00 0.00 ? 91  GLU A N    6  
ATOM 9911  C CA   . GLU A 1 91  ? -11.009 3.360   6.455   1.00 0.00 ? 91  GLU A CA   6  
ATOM 9912  C C    . GLU A 1 91  ? -11.473 3.061   5.028   1.00 0.00 ? 91  GLU A C    6  
ATOM 9913  O O    . GLU A 1 91  ? -11.843 3.971   4.288   1.00 0.00 ? 91  GLU A O    6  
ATOM 9914  C CB   . GLU A 1 91  ? -9.787  4.280   6.452   1.00 0.00 ? 91  GLU A CB   6  
ATOM 9915  C CG   . GLU A 1 91  ? -10.185 5.723   6.776   1.00 0.00 ? 91  GLU A CG   6  
ATOM 9916  C CD   . GLU A 1 91  ? -11.460 6.120   6.029   1.00 0.00 ? 91  GLU A CD   6  
ATOM 9917  O OE1  . GLU A 1 91  ? -11.321 6.579   4.875   1.00 0.00 ? 91  GLU A OE1  6  
ATOM 9918  O OE2  . GLU A 1 91  ? -12.544 5.957   6.628   1.00 0.00 ? 91  GLU A OE2  6  
ATOM 9919  H H    . GLU A 1 91  ? -9.785  1.800   7.091   1.00 0.00 ? 91  GLU A H    6  
ATOM 9920  H HA   . GLU A 1 91  ? -11.814 3.837   7.014   1.00 0.00 ? 91  GLU A HA   6  
ATOM 9921  H HB3  . GLU A 1 91  ? -9.303  4.244   5.477   1.00 0.00 ? 91  GLU A HB3  6  
ATOM 9922  H HG3  . GLU A 1 91  ? -9.375  6.397   6.505   1.00 0.00 ? 91  GLU A HG3  6  
ATOM 9923  N N    . SER A 1 92  ? -11.439 1.781   4.685   1.00 0.00 ? 92  SER A N    6  
ATOM 9924  C CA   . SER A 1 92  ? -11.851 1.351   3.360   1.00 0.00 ? 92  SER A CA   6  
ATOM 9925  C C    . SER A 1 92  ? -10.999 2.045   2.295   1.00 0.00 ? 92  SER A C    6  
ATOM 9926  O O    . SER A 1 92  ? -11.234 3.208   1.968   1.00 0.00 ? 92  SER A O    6  
ATOM 9927  C CB   . SER A 1 92  ? -13.335 1.640   3.124   1.00 0.00 ? 92  SER A CB   6  
ATOM 9928  O OG   . SER A 1 92  ? -14.153 1.121   4.168   1.00 0.00 ? 92  SER A OG   6  
ATOM 9929  H H    . SER A 1 92  ? -11.136 1.048   5.293   1.00 0.00 ? 92  SER A H    6  
ATOM 9930  H HA   . SER A 1 92  ? -11.684 0.275   3.341   1.00 0.00 ? 92  SER A HA   6  
ATOM 9931  H HB3  . SER A 1 92  ? -13.643 1.204   2.173   1.00 0.00 ? 92  SER A HB3  6  
ATOM 9932  H HG   . SER A 1 92  ? -13.646 1.116   5.030   1.00 0.00 ? 92  SER A HG   6  
ATOM 9933  N N    . VAL A 1 93  ? -10.029 1.302   1.784   1.00 0.00 ? 93  VAL A N    6  
ATOM 9934  C CA   . VAL A 1 93  ? -9.141  1.832   0.762   1.00 0.00 ? 93  VAL A CA   6  
ATOM 9935  C C    . VAL A 1 93  ? -9.608  1.351   -0.613  1.00 0.00 ? 93  VAL A C    6  
ATOM 9936  O O    . VAL A 1 93  ? -8.812  0.832   -1.396  1.00 0.00 ? 93  VAL A O    6  
ATOM 9937  C CB   . VAL A 1 93  ? -7.695  1.443   1.073   1.00 0.00 ? 93  VAL A CB   6  
ATOM 9938  C CG1  . VAL A 1 93  ? -7.274  1.951   2.453   1.00 0.00 ? 93  VAL A CG1  6  
ATOM 9939  C CG2  . VAL A 1 93  ? -7.498  -0.071  0.964   1.00 0.00 ? 93  VAL A CG2  6  
ATOM 9940  H H    . VAL A 1 93  ? -9.845  0.358   2.054   1.00 0.00 ? 93  VAL A H    6  
ATOM 9941  H HA   . VAL A 1 93  ? -9.212  2.919   0.796   1.00 0.00 ? 93  VAL A HA   6  
ATOM 9942  H HB   . VAL A 1 93  ? -7.053  1.918   0.331   1.00 0.00 ? 93  VAL A HB   6  
ATOM 9943  H HG11 . VAL A 1 93  ? -6.233  1.685   2.637   1.00 0.00 ? 93  VAL A HG11 6  
ATOM 9944  H HG12 . VAL A 1 93  ? -7.383  3.036   2.489   1.00 0.00 ? 93  VAL A HG12 6  
ATOM 9945  H HG13 . VAL A 1 93  ? -7.906  1.497   3.216   1.00 0.00 ? 93  VAL A HG13 6  
ATOM 9946  H HG21 . VAL A 1 93  ? -6.540  -0.280  0.489   1.00 0.00 ? 93  VAL A HG21 6  
ATOM 9947  H HG22 . VAL A 1 93  ? -7.516  -0.512  1.960   1.00 0.00 ? 93  VAL A HG22 6  
ATOM 9948  H HG23 . VAL A 1 93  ? -8.302  -0.499  0.363   1.00 0.00 ? 93  VAL A HG23 6  
ATOM 9949  N N    . ILE A 1 94  ? -10.895 1.539   -0.865  1.00 0.00 ? 94  ILE A N    6  
ATOM 9950  C CA   . ILE A 1 94  ? -11.476 1.130   -2.133  1.00 0.00 ? 94  ILE A CA   6  
ATOM 9951  C C    . ILE A 1 94  ? -11.192 2.201   -3.189  1.00 0.00 ? 94  ILE A C    6  
ATOM 9952  O O    . ILE A 1 94  ? -10.535 1.928   -4.191  1.00 0.00 ? 94  ILE A O    6  
ATOM 9953  C CB   . ILE A 1 94  ? -12.964 0.814   -1.962  1.00 0.00 ? 94  ILE A CB   6  
ATOM 9954  C CG1  . ILE A 1 94  ? -13.168 -0.359  -1.001  1.00 0.00 ? 94  ILE A CG1  6  
ATOM 9955  C CG2  . ILE A 1 94  ? -13.631 0.568   -3.317  1.00 0.00 ? 94  ILE A CG2  6  
ATOM 9956  C CD1  . ILE A 1 94  ? -12.885 -1.694  -1.695  1.00 0.00 ? 94  ILE A CD1  6  
ATOM 9957  H H    . ILE A 1 94  ? -11.534 1.961   -0.224  1.00 0.00 ? 94  ILE A H    6  
ATOM 9958  H HA   . ILE A 1 94  ? -10.983 0.206   -2.436  1.00 0.00 ? 94  ILE A HA   6  
ATOM 9959  H HB   . ILE A 1 94  ? -13.449 1.683   -1.517  1.00 0.00 ? 94  ILE A HB   6  
ATOM 9960  H HG13 . ILE A 1 94  ? -14.192 -0.351  -0.625  1.00 0.00 ? 94  ILE A HG13 6  
ATOM 9961  H HG21 . ILE A 1 94  ? -14.355 1.359   -3.514  1.00 0.00 ? 94  ILE A HG21 6  
ATOM 9962  H HG22 . ILE A 1 94  ? -12.873 0.566   -4.100  1.00 0.00 ? 94  ILE A HG22 6  
ATOM 9963  H HG23 . ILE A 1 94  ? -14.140 -0.395  -3.301  1.00 0.00 ? 94  ILE A HG23 6  
ATOM 9964  H HD11 . ILE A 1 94  ? -13.791 -2.296  -1.707  1.00 0.00 ? 94  ILE A HD11 6  
ATOM 9965  H HD12 . ILE A 1 94  ? -12.559 -1.508  -2.719  1.00 0.00 ? 94  ILE A HD12 6  
ATOM 9966  H HD13 . ILE A 1 94  ? -12.101 -2.224  -1.155  1.00 0.00 ? 94  ILE A HD13 6  
ATOM 9967  N N    . GLY A 1 95  ? -11.702 3.395   -2.925  1.00 0.00 ? 95  GLY A N    6  
ATOM 9968  C CA   . GLY A 1 95  ? -11.510 4.507   -3.840  1.00 0.00 ? 95  GLY A CA   6  
ATOM 9969  C C    . GLY A 1 95  ? -10.341 5.388   -3.396  1.00 0.00 ? 95  GLY A C    6  
ATOM 9970  O O    . GLY A 1 95  ? -10.418 6.613   -3.474  1.00 0.00 ? 95  GLY A O    6  
ATOM 9971  H H    . GLY A 1 95  ? -12.235 3.607   -2.107  1.00 0.00 ? 95  GLY A H    6  
ATOM 9972  H HA2  . GLY A 1 95  ? -11.323 4.128   -4.846  1.00 0.00 ? 95  GLY A HA2  6  
ATOM 9973  H HA3  . GLY A 1 95  ? -12.421 5.103   -3.889  1.00 0.00 ? 95  GLY A HA3  6  
ATOM 9974  N N    . LYS A 1 96  ? -9.286  4.729   -2.941  1.00 0.00 ? 96  LYS A N    6  
ATOM 9975  C CA   . LYS A 1 96  ? -8.102  5.437   -2.483  1.00 0.00 ? 96  LYS A CA   6  
ATOM 9976  C C    . LYS A 1 96  ? -6.884  4.945   -3.267  1.00 0.00 ? 96  LYS A C    6  
ATOM 9977  O O    . LYS A 1 96  ? -6.922  3.875   -3.874  1.00 0.00 ? 96  LYS A O    6  
ATOM 9978  C CB   . LYS A 1 96  ? -7.951  5.306   -0.967  1.00 0.00 ? 96  LYS A CB   6  
ATOM 9979  C CG   . LYS A 1 96  ? -9.018  6.124   -0.236  1.00 0.00 ? 96  LYS A CG   6  
ATOM 9980  C CD   . LYS A 1 96  ? -8.957  5.883   1.273   1.00 0.00 ? 96  LYS A CD   6  
ATOM 9981  C CE   . LYS A 1 96  ? -10.090 6.617   1.993   1.00 0.00 ? 96  LYS A CE   6  
ATOM 9982  N NZ   . LYS A 1 96  ? -11.383 5.944   1.743   1.00 0.00 ? 96  LYS A NZ   6  
ATOM 9983  H H    . LYS A 1 96  ? -9.231  3.732   -2.881  1.00 0.00 ? 96  LYS A H    6  
ATOM 9984  H HA   . LYS A 1 96  ? -8.250  6.496   -2.703  1.00 0.00 ? 96  LYS A HA   6  
ATOM 9985  H HB3  . LYS A 1 96  ? -6.960  5.644   -0.666  1.00 0.00 ? 96  LYS A HB3  6  
ATOM 9986  H HG3  . LYS A 1 96  ? -10.006 5.855   -0.611  1.00 0.00 ? 96  LYS A HG3  6  
ATOM 9987  H HD3  . LYS A 1 96  ? -7.995  6.221   1.660   1.00 0.00 ? 96  LYS A HD3  6  
ATOM 9988  H HE3  . LYS A 1 96  ? -10.138 7.649   1.648   1.00 0.00 ? 96  LYS A HE3  6  
ATOM 9989  H HZ1  . LYS A 1 96  ? -11.788 6.300   0.900   1.00 0.00 ? 96  LYS A HZ1  6  
ATOM 9990  H HZ2  . LYS A 1 96  ? -11.235 4.960   1.652   1.00 0.00 ? 96  LYS A HZ2  6  
ATOM 9991  H HZ3  . LYS A 1 96  ? -12.003 6.118   2.509   1.00 0.00 ? 96  LYS A HZ3  6  
ATOM 9992  N N    . THR A 1 97  ? -5.832  5.750   -3.231  1.00 0.00 ? 97  THR A N    6  
ATOM 9993  C CA   . THR A 1 97  ? -4.605  5.409   -3.932  1.00 0.00 ? 97  THR A CA   6  
ATOM 9994  C C    . THR A 1 97  ? -3.495  5.075   -2.932  1.00 0.00 ? 97  THR A C    6  
ATOM 9995  O O    . THR A 1 97  ? -3.677  5.225   -1.724  1.00 0.00 ? 97  THR A O    6  
ATOM 9996  C CB   . THR A 1 97  ? -4.254  6.570   -4.863  1.00 0.00 ? 97  THR A CB   6  
ATOM 9997  O OG1  . THR A 1 97  ? -2.905  6.314   -5.244  1.00 0.00 ? 97  THR A OG1  6  
ATOM 9998  C CG2  . THR A 1 97  ? -4.185  7.910   -4.127  1.00 0.00 ? 97  THR A CG2  6  
ATOM 9999  H H    . THR A 1 97  ? -5.810  6.619   -2.736  1.00 0.00 ? 97  THR A H    6  
ATOM 10000 H HA   . THR A 1 97  ? -4.785  4.510   -4.522  1.00 0.00 ? 97  THR A HA   6  
ATOM 10001 H HB   . THR A 1 97  ? -4.949  6.622   -5.701  1.00 0.00 ? 97  THR A HB   6  
ATOM 10002 H HG1  . THR A 1 97  ? -2.668  6.857   -6.050  1.00 0.00 ? 97  THR A HG1  6  
ATOM 10003 H HG21 . THR A 1 97  ? -3.289  8.449   -4.435  1.00 0.00 ? 97  THR A HG21 6  
ATOM 10004 H HG22 . THR A 1 97  ? -5.067  8.504   -4.369  1.00 0.00 ? 97  THR A HG22 6  
ATOM 10005 H HG23 . THR A 1 97  ? -4.151  7.735   -3.052  1.00 0.00 ? 97  THR A HG23 6  
ATOM 10006 N N    . TYR A 1 98  ? -2.372  4.628   -3.471  1.00 0.00 ? 98  TYR A N    6  
ATOM 10007 C CA   . TYR A 1 98  ? -1.234  4.272   -2.642  1.00 0.00 ? 98  TYR A CA   6  
ATOM 10008 C C    . TYR A 1 98  ? -0.906  5.389   -1.650  1.00 0.00 ? 98  TYR A C    6  
ATOM 10009 O O    . TYR A 1 98  ? -0.857  5.158   -0.443  1.00 0.00 ? 98  TYR A O    6  
ATOM 10010 C CB   . TYR A 1 98  ? -0.052  4.094   -3.599  1.00 0.00 ? 98  TYR A CB   6  
ATOM 10011 C CG   . TYR A 1 98  ? 1.256   3.708   -2.908  1.00 0.00 ? 98  TYR A CG   6  
ATOM 10012 C CD1  . TYR A 1 98  ? 1.288   2.634   -2.041  1.00 0.00 ? 98  TYR A CD1  6  
ATOM 10013 C CD2  . TYR A 1 98  ? 2.405   4.434   -3.151  1.00 0.00 ? 98  TYR A CD2  6  
ATOM 10014 C CE1  . TYR A 1 98  ? 2.521   2.272   -1.391  1.00 0.00 ? 98  TYR A CE1  6  
ATOM 10015 C CE2  . TYR A 1 98  ? 3.637   4.071   -2.500  1.00 0.00 ? 98  TYR A CE2  6  
ATOM 10016 C CZ   . TYR A 1 98  ? 3.634   3.008   -1.653  1.00 0.00 ? 98  TYR A CZ   6  
ATOM 10017 O OH   . TYR A 1 98  ? 4.798   2.664   -1.038  1.00 0.00 ? 98  TYR A OH   6  
ATOM 10018 H H    . TYR A 1 98  ? -2.232  4.508   -4.454  1.00 0.00 ? 98  TYR A H    6  
ATOM 10019 H HA   . TYR A 1 98  ? -1.490  3.369   -2.089  1.00 0.00 ? 98  TYR A HA   6  
ATOM 10020 H HB3  . TYR A 1 98  ? 0.099   5.022   -4.148  1.00 0.00 ? 98  TYR A HB3  6  
ATOM 10021 H HD1  . TYR A 1 98  ? 0.382   2.061   -1.849  1.00 0.00 ? 98  TYR A HD1  6  
ATOM 10022 H HD2  . TYR A 1 98  ? 2.379   5.283   -3.834  1.00 0.00 ? 98  TYR A HD2  6  
ATOM 10023 H HE1  . TYR A 1 98  ? 2.561   1.426   -0.703  1.00 0.00 ? 98  TYR A HE1  6  
ATOM 10024 H HE2  . TYR A 1 98  ? 4.551   4.635   -2.683  1.00 0.00 ? 98  TYR A HE2  6  
ATOM 10025 H HH   . TYR A 1 98  ? 5.248   1.929   -1.544  1.00 0.00 ? 98  TYR A HH   6  
ATOM 10026 N N    . SER A 1 99  ? -0.692  6.578   -2.196  1.00 0.00 ? 99  SER A N    6  
ATOM 10027 C CA   . SER A 1 99  ? -0.371  7.732   -1.373  1.00 0.00 ? 99  SER A CA   6  
ATOM 10028 C C    . SER A 1 99  ? -1.366  7.844   -0.218  1.00 0.00 ? 99  SER A C    6  
ATOM 10029 O O    . SER A 1 99  ? -0.970  8.014   0.934   1.00 0.00 ? 99  SER A O    6  
ATOM 10030 C CB   . SER A 1 99  ? -0.375  9.017   -2.203  1.00 0.00 ? 99  SER A CB   6  
ATOM 10031 O OG   . SER A 1 99  ? -0.801  8.786   -3.544  1.00 0.00 ? 99  SER A OG   6  
ATOM 10032 H H    . SER A 1 99  ? -0.735  6.757   -3.178  1.00 0.00 ? 99  SER A H    6  
ATOM 10033 H HA   . SER A 1 99  ? 0.634   7.547   -0.995  1.00 0.00 ? 99  SER A HA   6  
ATOM 10034 H HB3  . SER A 1 99  ? 0.626   9.446   -2.210  1.00 0.00 ? 99  SER A HB3  6  
ATOM 10035 H HG   . SER A 1 99  ? -0.675  9.614   -4.089  1.00 0.00 ? 99  SER A HG   6  
ATOM 10036 N N    . GLN A 1 100 ? -2.641  7.743   -0.565  1.00 0.00 ? 100 GLN A N    6  
ATOM 10037 C CA   . GLN A 1 100 ? -3.697  7.831   0.429   1.00 0.00 ? 100 GLN A CA   6  
ATOM 10038 C C    . GLN A 1 100 ? -3.445  6.834   1.563   1.00 0.00 ? 100 GLN A C    6  
ATOM 10039 O O    . GLN A 1 100 ? -3.132  7.230   2.685   1.00 0.00 ? 100 GLN A O    6  
ATOM 10040 C CB   . GLN A 1 100 ? -5.070  7.601   -0.206  1.00 0.00 ? 100 GLN A CB   6  
ATOM 10041 C CG   . GLN A 1 100 ? -5.580  8.875   -0.883  1.00 0.00 ? 100 GLN A CG   6  
ATOM 10042 C CD   . GLN A 1 100 ? -7.022  9.178   -0.469  1.00 0.00 ? 100 GLN A CD   6  
ATOM 10043 O OE1  . GLN A 1 100 ? -7.952  9.093   -1.253  1.00 0.00 ? 100 GLN A OE1  6  
ATOM 10044 N NE2  . GLN A 1 100 ? -7.154  9.532   0.807   1.00 0.00 ? 100 GLN A NE2  6  
ATOM 10045 H H    . GLN A 1 100 ? -2.956  7.604   -1.503  1.00 0.00 ? 100 GLN A H    6  
ATOM 10046 H HA   . GLN A 1 100 ? -3.649  8.850   0.815   1.00 0.00 ? 100 GLN A HA   6  
ATOM 10047 H HB3  . GLN A 1 100 ? -5.779  7.282   0.558   1.00 0.00 ? 100 GLN A HB3  6  
ATOM 10048 H HG3  . GLN A 1 100 ? -5.526  8.762   -1.966  1.00 0.00 ? 100 GLN A HG3  6  
ATOM 10049 H HE21 . GLN A 1 100 ? -6.350  9.581   1.399   1.00 0.00 ? 100 GLN A HE21 6  
ATOM 10050 H HE22 . GLN A 1 100 ? -8.058  9.749   1.174   1.00 0.00 ? 100 GLN A HE22 6  
ATOM 10051 N N    . VAL A 1 101 ? -3.588  5.560   1.229   1.00 0.00 ? 101 VAL A N    6  
ATOM 10052 C CA   . VAL A 1 101 ? -3.378  4.503   2.204   1.00 0.00 ? 101 VAL A CA   6  
ATOM 10053 C C    . VAL A 1 101 ? -2.025  4.707   2.889   1.00 0.00 ? 101 VAL A C    6  
ATOM 10054 O O    . VAL A 1 101 ? -1.888  4.464   4.087   1.00 0.00 ? 101 VAL A O    6  
ATOM 10055 C CB   . VAL A 1 101 ? -3.508  3.135   1.530   1.00 0.00 ? 101 VAL A CB   6  
ATOM 10056 C CG1  . VAL A 1 101 ? -4.916  2.934   0.965   1.00 0.00 ? 101 VAL A CG1  6  
ATOM 10057 C CG2  . VAL A 1 101 ? -2.449  2.960   0.441   1.00 0.00 ? 101 VAL A CG2  6  
ATOM 10058 H H    . VAL A 1 101 ? -3.842  5.246   0.315   1.00 0.00 ? 101 VAL A H    6  
ATOM 10059 H HA   . VAL A 1 101 ? -4.166  4.587   2.954   1.00 0.00 ? 101 VAL A HA   6  
ATOM 10060 H HB   . VAL A 1 101 ? -3.338  2.371   2.289   1.00 0.00 ? 101 VAL A HB   6  
ATOM 10061 H HG11 . VAL A 1 101 ? -4.955  3.315   -0.055  1.00 0.00 ? 101 VAL A HG11 6  
ATOM 10062 H HG12 . VAL A 1 101 ? -5.158  1.871   0.967   1.00 0.00 ? 101 VAL A HG12 6  
ATOM 10063 H HG13 . VAL A 1 101 ? -5.635  3.472   1.582   1.00 0.00 ? 101 VAL A HG13 6  
ATOM 10064 H HG21 . VAL A 1 101 ? -1.456  2.999   0.888   1.00 0.00 ? 101 VAL A HG21 6  
ATOM 10065 H HG22 . VAL A 1 101 ? -2.588  1.997   -0.049  1.00 0.00 ? 101 VAL A HG22 6  
ATOM 10066 H HG23 . VAL A 1 101 ? -2.547  3.758   -0.293  1.00 0.00 ? 101 VAL A HG23 6  
ATOM 10067 N N    . ILE A 1 102 ? -1.059  5.151   2.097   1.00 0.00 ? 102 ILE A N    6  
ATOM 10068 C CA   . ILE A 1 102 ? 0.279   5.390   2.612   1.00 0.00 ? 102 ILE A CA   6  
ATOM 10069 C C    . ILE A 1 102 ? 0.204   6.385   3.771   1.00 0.00 ? 102 ILE A C    6  
ATOM 10070 O O    . ILE A 1 102 ? 0.592   6.067   4.894   1.00 0.00 ? 102 ILE A O    6  
ATOM 10071 C CB   . ILE A 1 102 ? 1.216   5.828   1.484   1.00 0.00 ? 102 ILE A CB   6  
ATOM 10072 C CG1  . ILE A 1 102 ? 1.642   4.632   0.630   1.00 0.00 ? 102 ILE A CG1  6  
ATOM 10073 C CG2  . ILE A 1 102 ? 2.418   6.596   2.038   1.00 0.00 ? 102 ILE A CG2  6  
ATOM 10074 C CD1  . ILE A 1 102 ? 2.768   3.849   1.307   1.00 0.00 ? 102 ILE A CD1  6  
ATOM 10075 H H    . ILE A 1 102 ? -1.179  5.346   1.124   1.00 0.00 ? 102 ILE A H    6  
ATOM 10076 H HA   . ILE A 1 102 ? 0.656   4.442   2.995   1.00 0.00 ? 102 ILE A HA   6  
ATOM 10077 H HB   . ILE A 1 102 ? 0.670   6.511   0.833   1.00 0.00 ? 102 ILE A HB   6  
ATOM 10078 H HG13 . ILE A 1 102 ? 1.974   4.979   -0.348  1.00 0.00 ? 102 ILE A HG13 6  
ATOM 10079 H HG21 . ILE A 1 102 ? 3.262   6.489   1.357   1.00 0.00 ? 102 ILE A HG21 6  
ATOM 10080 H HG22 . ILE A 1 102 ? 2.161   7.651   2.136   1.00 0.00 ? 102 ILE A HG22 6  
ATOM 10081 H HG23 . ILE A 1 102 ? 2.687   6.195   3.015   1.00 0.00 ? 102 ILE A HG23 6  
ATOM 10082 H HD11 . ILE A 1 102 ? 3.719   4.098   0.836   1.00 0.00 ? 102 ILE A HD11 6  
ATOM 10083 H HD12 . ILE A 1 102 ? 2.808   4.111   2.365   1.00 0.00 ? 102 ILE A HD12 6  
ATOM 10084 H HD13 . ILE A 1 102 ? 2.580   2.780   1.206   1.00 0.00 ? 102 ILE A HD13 6  
ATOM 10085 N N    . ALA A 1 103 ? -0.297  7.572   3.459   1.00 0.00 ? 103 ALA A N    6  
ATOM 10086 C CA   . ALA A 1 103 ? -0.428  8.616   4.462   1.00 0.00 ? 103 ALA A CA   6  
ATOM 10087 C C    . ALA A 1 103 ? -1.234  8.082   5.647   1.00 0.00 ? 103 ALA A C    6  
ATOM 10088 O O    . ALA A 1 103 ? -0.958  8.423   6.796   1.00 0.00 ? 103 ALA A O    6  
ATOM 10089 C CB   . ALA A 1 103 ? -1.068  9.852   3.830   1.00 0.00 ? 103 ALA A CB   6  
ATOM 10090 H H    . ALA A 1 103 ? -0.611  7.823   2.544   1.00 0.00 ? 103 ALA A H    6  
ATOM 10091 H HA   . ALA A 1 103 ? 0.575   8.876   4.803   1.00 0.00 ? 103 ALA A HA   6  
ATOM 10092 H HB1  . ALA A 1 103 ? -0.927  9.824   2.750   1.00 0.00 ? 103 ALA A HB1  6  
ATOM 10093 H HB2  . ALA A 1 103 ? -2.135  9.866   4.056   1.00 0.00 ? 103 ALA A HB2  6  
ATOM 10094 H HB3  . ALA A 1 103 ? -0.600  10.751  4.233   1.00 0.00 ? 103 ALA A HB3  6  
ATOM 10095 N N    . LEU A 1 104 ? -2.216  7.252   5.327   1.00 0.00 ? 104 LEU A N    6  
ATOM 10096 C CA   . LEU A 1 104 ? -3.064  6.666   6.350   1.00 0.00 ? 104 LEU A CA   6  
ATOM 10097 C C    . LEU A 1 104 ? -2.202  5.864   7.326   1.00 0.00 ? 104 LEU A C    6  
ATOM 10098 O O    . LEU A 1 104 ? -2.458  5.860   8.529   1.00 0.00 ? 104 LEU A O    6  
ATOM 10099 C CB   . LEU A 1 104 ? -4.191  5.852   5.712   1.00 0.00 ? 104 LEU A CB   6  
ATOM 10100 C CG   . LEU A 1 104 ? -5.276  6.654   4.992   1.00 0.00 ? 104 LEU A CG   6  
ATOM 10101 C CD1  . LEU A 1 104 ? -6.382  5.736   4.466   1.00 0.00 ? 104 LEU A CD1  6  
ATOM 10102 C CD2  . LEU A 1 104 ? -5.829  7.760   5.894   1.00 0.00 ? 104 LEU A CD2  6  
ATOM 10103 H H    . LEU A 1 104 ? -2.434  6.978   4.390   1.00 0.00 ? 104 LEU A H    6  
ATOM 10104 H HA   . LEU A 1 104 ? -3.531  7.487   6.897   1.00 0.00 ? 104 LEU A HA   6  
ATOM 10105 H HB3  . LEU A 1 104 ? -4.666  5.252   6.490   1.00 0.00 ? 104 LEU A HB3  6  
ATOM 10106 H HG   . LEU A 1 104 ? -4.824  7.141   4.127   1.00 0.00 ? 104 LEU A HG   6  
ATOM 10107 H HD11 . LEU A 1 104 ? -7.172  5.658   5.213   1.00 0.00 ? 104 LEU A HD11 6  
ATOM 10108 H HD12 . LEU A 1 104 ? -6.790  6.150   3.545   1.00 0.00 ? 104 LEU A HD12 6  
ATOM 10109 H HD13 . LEU A 1 104 ? -5.968  4.747   4.270   1.00 0.00 ? 104 LEU A HD13 6  
ATOM 10110 H HD21 . LEU A 1 104 ? -6.917  7.772   5.830   1.00 0.00 ? 104 LEU A HD21 6  
ATOM 10111 H HD22 . LEU A 1 104 ? -5.528  7.572   6.925   1.00 0.00 ? 104 LEU A HD22 6  
ATOM 10112 H HD23 . LEU A 1 104 ? -5.436  8.724   5.570   1.00 0.00 ? 104 LEU A HD23 6  
ATOM 10113 N N    . ILE A 1 105 ? -1.196  5.204   6.770   1.00 0.00 ? 105 ILE A N    6  
ATOM 10114 C CA   . ILE A 1 105 ? -0.294  4.398   7.576   1.00 0.00 ? 105 ILE A CA   6  
ATOM 10115 C C    . ILE A 1 105 ? 0.648   5.321   8.354   1.00 0.00 ? 105 ILE A C    6  
ATOM 10116 O O    . ILE A 1 105 ? 0.909   5.092   9.534   1.00 0.00 ? 105 ILE A O    6  
ATOM 10117 C CB   . ILE A 1 105 ? 0.434   3.374   6.703   1.00 0.00 ? 105 ILE A CB   6  
ATOM 10118 C CG1  . ILE A 1 105 ? -0.531  2.296   6.204   1.00 0.00 ? 105 ILE A CG1  6  
ATOM 10119 C CG2  . ILE A 1 105 ? 1.630   2.772   7.444   1.00 0.00 ? 105 ILE A CG2  6  
ATOM 10120 C CD1  . ILE A 1 105 ? -0.085  1.746   4.848   1.00 0.00 ? 105 ILE A CD1  6  
ATOM 10121 H H    . ILE A 1 105 ? -0.995  5.212   5.791   1.00 0.00 ? 105 ILE A H    6  
ATOM 10122 H HA   . ILE A 1 105 ? -0.901  3.842   8.290   1.00 0.00 ? 105 ILE A HA   6  
ATOM 10123 H HB   . ILE A 1 105 ? 0.824   3.887   5.826   1.00 0.00 ? 105 ILE A HB   6  
ATOM 10124 H HG13 . ILE A 1 105 ? -1.535  2.713   6.119   1.00 0.00 ? 105 ILE A HG13 6  
ATOM 10125 H HG21 . ILE A 1 105 ? 1.273   2.137   8.255   1.00 0.00 ? 105 ILE A HG21 6  
ATOM 10126 H HG22 . ILE A 1 105 ? 2.224   2.177   6.752   1.00 0.00 ? 105 ILE A HG22 6  
ATOM 10127 H HG23 . ILE A 1 105 ? 2.243   3.574   7.853   1.00 0.00 ? 105 ILE A HG23 6  
ATOM 10128 H HD11 . ILE A 1 105 ? -0.962  1.521   4.241   1.00 0.00 ? 105 ILE A HD11 6  
ATOM 10129 H HD12 . ILE A 1 105 ? 0.527   2.490   4.339   1.00 0.00 ? 105 ILE A HD12 6  
ATOM 10130 H HD13 . ILE A 1 105 ? 0.495   0.837   4.998   1.00 0.00 ? 105 ILE A HD13 6  
ATOM 10131 N N    . GLN A 1 106 ? 1.130   6.342   7.662   1.00 0.00 ? 106 GLN A N    6  
ATOM 10132 C CA   . GLN A 1 106 ? 2.036   7.299   8.274   1.00 0.00 ? 106 GLN A CA   6  
ATOM 10133 C C    . GLN A 1 106 ? 1.290   8.155   9.301   1.00 0.00 ? 106 GLN A C    6  
ATOM 10134 O O    . GLN A 1 106 ? 1.894   8.669   10.241  1.00 0.00 ? 106 GLN A O    6  
ATOM 10135 C CB   . GLN A 1 106 ? 2.707   8.175   7.214   1.00 0.00 ? 106 GLN A CB   6  
ATOM 10136 C CG   . GLN A 1 106 ? 3.524   7.327   6.239   1.00 0.00 ? 106 GLN A CG   6  
ATOM 10137 C CD   . GLN A 1 106 ? 4.908   7.936   6.011   1.00 0.00 ? 106 GLN A CD   6  
ATOM 10138 O OE1  . GLN A 1 106 ? 5.279   8.940   6.598   1.00 0.00 ? 106 GLN A OE1  6  
ATOM 10139 N NE2  . GLN A 1 106 ? 5.652   7.276   5.126   1.00 0.00 ? 106 GLN A NE2  6  
ATOM 10140 H H    . GLN A 1 106 ? 0.912   6.520   6.703   1.00 0.00 ? 106 GLN A H    6  
ATOM 10141 H HA   . GLN A 1 106 ? 2.796   6.699   8.775   1.00 0.00 ? 106 GLN A HA   6  
ATOM 10142 H HB3  . GLN A 1 106 ? 3.353   8.906   7.697   1.00 0.00 ? 106 GLN A HB3  6  
ATOM 10143 H HG3  . GLN A 1 106 ? 2.996   7.247   5.289   1.00 0.00 ? 106 GLN A HG3  6  
ATOM 10144 H HE21 . GLN A 1 106 ? 5.288   6.459   4.678   1.00 0.00 ? 106 GLN A HE21 6  
ATOM 10145 H HE22 . GLN A 1 106 ? 6.573   7.597   4.908   1.00 0.00 ? 106 GLN A HE22 6  
ATOM 10146 N N    . ASN A 1 107 ? -0.011  8.280   9.085   1.00 0.00 ? 107 ASN A N    6  
ATOM 10147 C CA   . ASN A 1 107 ? -0.845  9.065   9.981   1.00 0.00 ? 107 ASN A CA   6  
ATOM 10148 C C    . ASN A 1 107 ? -1.880  8.149   10.637  1.00 0.00 ? 107 ASN A C    6  
ATOM 10149 O O    . ASN A 1 107 ? -2.932  8.611   11.078  1.00 0.00 ? 107 ASN A O    6  
ATOM 10150 C CB   . ASN A 1 107 ? -1.597  10.156  9.217   1.00 0.00 ? 107 ASN A CB   6  
ATOM 10151 C CG   . ASN A 1 107 ? -0.726  11.404  9.047   1.00 0.00 ? 107 ASN A CG   6  
ATOM 10152 O OD1  . ASN A 1 107 ? -0.436  12.122  9.989   1.00 0.00 ? 107 ASN A OD1  6  
ATOM 10153 N ND2  . ASN A 1 107 ? -0.329  11.620  7.796   1.00 0.00 ? 107 ASN A ND2  6  
ATOM 10154 H H    . ASN A 1 107 ? -0.495  7.858   8.319   1.00 0.00 ? 107 ASN A H    6  
ATOM 10155 H HA   . ASN A 1 107 ? -0.157  9.502   10.703  1.00 0.00 ? 107 ASN A HA   6  
ATOM 10156 H HB3  . ASN A 1 107 ? -2.511  10.417  9.751   1.00 0.00 ? 107 ASN A HB3  6  
ATOM 10157 H HD21 . ASN A 1 107 ? -0.604  10.992  7.069   1.00 0.00 ? 107 ASN A HD21 6  
ATOM 10158 H HD22 . ASN A 1 107 ? 0.244   12.412  7.584   1.00 0.00 ? 107 ASN A HD22 6  
ATOM 10159 N N    . SER A 1 108 ? -1.546  6.868   10.683  1.00 0.00 ? 108 SER A N    6  
ATOM 10160 C CA   . SER A 1 108 ? -2.435  5.884   11.280  1.00 0.00 ? 108 SER A CA   6  
ATOM 10161 C C    . SER A 1 108 ? -2.351  5.961   12.805  1.00 0.00 ? 108 SER A C    6  
ATOM 10162 O O    . SER A 1 108 ? -3.024  5.206   13.507  1.00 0.00 ? 108 SER A O    6  
ATOM 10163 C CB   . SER A 1 108 ? -2.095  4.472   10.798  1.00 0.00 ? 108 SER A CB   6  
ATOM 10164 O OG   . SER A 1 108 ? -3.058  3.976   9.873   1.00 0.00 ? 108 SER A OG   6  
ATOM 10165 H H    . SER A 1 108 ? -0.690  6.500   10.323  1.00 0.00 ? 108 SER A H    6  
ATOM 10166 H HA   . SER A 1 108 ? -3.434  6.153   10.937  1.00 0.00 ? 108 SER A HA   6  
ATOM 10167 H HB3  . SER A 1 108 ? -2.036  3.801   11.656  1.00 0.00 ? 108 SER A HB3  6  
ATOM 10168 H HG   . SER A 1 108 ? -2.761  4.160   8.937   1.00 0.00 ? 108 SER A HG   6  
ATOM 10169 N N    . ASP A 1 109 ? -1.517  6.876   13.276  1.00 0.00 ? 109 ASP A N    6  
ATOM 10170 C CA   . ASP A 1 109 ? -1.336  7.061   14.705  1.00 0.00 ? 109 ASP A CA   6  
ATOM 10171 C C    . ASP A 1 109 ? -0.328  6.034   15.223  1.00 0.00 ? 109 ASP A C    6  
ATOM 10172 O O    . ASP A 1 109 ? 0.169   5.206   14.460  1.00 0.00 ? 109 ASP A O    6  
ATOM 10173 C CB   . ASP A 1 109 ? -2.652  6.853   15.459  1.00 0.00 ? 109 ASP A CB   6  
ATOM 10174 C CG   . ASP A 1 109 ? -2.734  7.546   16.819  1.00 0.00 ? 109 ASP A CG   6  
ATOM 10175 O OD1  . ASP A 1 109 ? -2.396  8.749   16.865  1.00 0.00 ? 109 ASP A OD1  6  
ATOM 10176 O OD2  . ASP A 1 109 ? -3.135  6.859   17.784  1.00 0.00 ? 109 ASP A OD2  6  
ATOM 10177 H H    . ASP A 1 109 ? -0.973  7.486   12.699  1.00 0.00 ? 109 ASP A H    6  
ATOM 10178 H HA   . ASP A 1 109 ? -0.984  8.086   14.819  1.00 0.00 ? 109 ASP A HA   6  
ATOM 10179 H HB3  . ASP A 1 109 ? -2.806  5.784   15.602  1.00 0.00 ? 109 ASP A HB3  6  
ATOM 10180 N N    . THR A 1 110 ? -0.053  6.122   16.517  1.00 0.00 ? 110 THR A N    6  
ATOM 10181 C CA   . THR A 1 110 ? 0.887   5.211   17.146  1.00 0.00 ? 110 THR A CA   6  
ATOM 10182 C C    . THR A 1 110 ? 0.753   3.809   16.549  1.00 0.00 ? 110 THR A C    6  
ATOM 10183 O O    . THR A 1 110 ? 1.748   3.192   16.173  1.00 0.00 ? 110 THR A O    6  
ATOM 10184 C CB   . THR A 1 110 ? 0.649   5.254   18.657  1.00 0.00 ? 110 THR A CB   6  
ATOM 10185 O OG1  . THR A 1 110 ? 1.169   6.519   19.055  1.00 0.00 ? 110 THR A OG1  6  
ATOM 10186 C CG2  . THR A 1 110 ? 1.510   4.242   19.414  1.00 0.00 ? 110 THR A CG2  6  
ATOM 10187 H H    . THR A 1 110 ? -0.461  6.798   17.130  1.00 0.00 ? 110 THR A H    6  
ATOM 10188 H HA   . THR A 1 110 ? 1.898   5.556   16.928  1.00 0.00 ? 110 THR A HA   6  
ATOM 10189 H HB   . THR A 1 110 ? -0.407  5.117   18.888  1.00 0.00 ? 110 THR A HB   6  
ATOM 10190 H HG1  . THR A 1 110 ? 0.561   7.251   18.750  1.00 0.00 ? 110 THR A HG1  6  
ATOM 10191 H HG21 . THR A 1 110 ? 1.680   4.597   20.430  1.00 0.00 ? 110 THR A HG21 6  
ATOM 10192 H HG22 . THR A 1 110 ? 0.997   3.280   19.447  1.00 0.00 ? 110 THR A HG22 6  
ATOM 10193 H HG23 . THR A 1 110 ? 2.467   4.124   18.905  1.00 0.00 ? 110 THR A HG23 6  
ATOM 10194 N N    . THR A 1 111 ? -0.487  3.347   16.480  1.00 0.00 ? 111 THR A N    6  
ATOM 10195 C CA   . THR A 1 111 ? -0.765  2.029   15.935  1.00 0.00 ? 111 THR A CA   6  
ATOM 10196 C C    . THR A 1 111 ? -1.235  2.140   14.483  1.00 0.00 ? 111 THR A C    6  
ATOM 10197 O O    . THR A 1 111 ? -1.464  3.241   13.984  1.00 0.00 ? 111 THR A O    6  
ATOM 10198 C CB   . THR A 1 111 ? -1.781  1.343   16.851  1.00 0.00 ? 111 THR A CB   6  
ATOM 10199 O OG1  . THR A 1 111 ? -2.498  2.423   17.443  1.00 0.00 ? 111 THR A OG1  6  
ATOM 10200 C CG2  . THR A 1 111 ? -1.119  0.642   18.038  1.00 0.00 ? 111 THR A CG2  6  
ATOM 10201 H H    . THR A 1 111 ? -1.292  3.856   16.788  1.00 0.00 ? 111 THR A H    6  
ATOM 10202 H HA   . THR A 1 111 ? 0.162   1.458   15.928  1.00 0.00 ? 111 THR A HA   6  
ATOM 10203 H HB   . THR A 1 111 ? -2.407  0.650   16.289  1.00 0.00 ? 111 THR A HB   6  
ATOM 10204 H HG1  . THR A 1 111 ? -3.332  2.081   17.877  1.00 0.00 ? 111 THR A HG1  6  
ATOM 10205 H HG21 . THR A 1 111 ? -0.034  0.676   17.923  1.00 0.00 ? 111 THR A HG21 6  
ATOM 10206 H HG22 . THR A 1 111 ? -1.402  1.144   18.962  1.00 0.00 ? 111 THR A HG22 6  
ATOM 10207 H HG23 . THR A 1 111 ? -1.445  -0.398  18.075  1.00 0.00 ? 111 THR A HG23 6  
ATOM 10208 N N    . LEU A 1 112 ? -1.365  0.986   13.847  1.00 0.00 ? 112 LEU A N    6  
ATOM 10209 C CA   . LEU A 1 112 ? -1.803  0.940   12.461  1.00 0.00 ? 112 LEU A CA   6  
ATOM 10210 C C    . LEU A 1 112 ? -2.367  -0.449  12.156  1.00 0.00 ? 112 LEU A C    6  
ATOM 10211 O O    . LEU A 1 112 ? -1.618  -1.421  12.064  1.00 0.00 ? 112 LEU A O    6  
ATOM 10212 C CB   . LEU A 1 112 ? -0.668  1.364   11.526  1.00 0.00 ? 112 LEU A CB   6  
ATOM 10213 C CG   . LEU A 1 112 ? -0.926  1.169   10.030  1.00 0.00 ? 112 LEU A CG   6  
ATOM 10214 C CD1  . LEU A 1 112 ? -0.263  -0.114  9.523   1.00 0.00 ? 112 LEU A CD1  6  
ATOM 10215 C CD2  . LEU A 1 112 ? -2.424  1.201   9.723   1.00 0.00 ? 112 LEU A CD2  6  
ATOM 10216 H H    . LEU A 1 112 ? -1.177  0.095   14.260  1.00 0.00 ? 112 LEU A H    6  
ATOM 10217 H HA   . LEU A 1 112 ? -2.604  1.671   12.348  1.00 0.00 ? 112 LEU A HA   6  
ATOM 10218 H HB3  . LEU A 1 112 ? 0.227   0.803   11.797  1.00 0.00 ? 112 LEU A HB3  6  
ATOM 10219 H HG   . LEU A 1 112 ? -0.469  2.001   9.494   1.00 0.00 ? 112 LEU A HG   6  
ATOM 10220 H HD11 . LEU A 1 112 ? -0.243  -0.853  10.322  1.00 0.00 ? 112 LEU A HD11 6  
ATOM 10221 H HD12 . LEU A 1 112 ? -0.830  -0.505  8.678   1.00 0.00 ? 112 LEU A HD12 6  
ATOM 10222 H HD13 . LEU A 1 112 ? 0.757   0.106   9.204   1.00 0.00 ? 112 LEU A HD13 6  
ATOM 10223 H HD21 . LEU A 1 112 ? -2.838  0.199   9.833   1.00 0.00 ? 112 LEU A HD21 6  
ATOM 10224 H HD22 . LEU A 1 112 ? -2.923  1.878   10.415  1.00 0.00 ? 112 LEU A HD22 6  
ATOM 10225 H HD23 . LEU A 1 112 ? -2.576  1.547   8.700   1.00 0.00 ? 112 LEU A HD23 6  
ATOM 10226 N N    . GLU A 1 113 ? -3.683  -0.499  12.006  1.00 0.00 ? 113 GLU A N    6  
ATOM 10227 C CA   . GLU A 1 113 ? -4.356  -1.753  11.713  1.00 0.00 ? 113 GLU A CA   6  
ATOM 10228 C C    . GLU A 1 113 ? -4.437  -1.970  10.200  1.00 0.00 ? 113 GLU A C    6  
ATOM 10229 O O    . GLU A 1 113 ? -4.694  -1.032  9.448   1.00 0.00 ? 113 GLU A O    6  
ATOM 10230 C CB   . GLU A 1 113 ? -5.748  -1.789  12.348  1.00 0.00 ? 113 GLU A CB   6  
ATOM 10231 C CG   . GLU A 1 113 ? -6.391  -3.168  12.177  1.00 0.00 ? 113 GLU A CG   6  
ATOM 10232 C CD   . GLU A 1 113 ? -7.780  -3.206  12.819  1.00 0.00 ? 113 GLU A CD   6  
ATOM 10233 O OE1  . GLU A 1 113 ? -7.828  -3.319  14.063  1.00 0.00 ? 113 GLU A OE1  6  
ATOM 10234 O OE2  . GLU A 1 113 ? -8.762  -3.124  12.049  1.00 0.00 ? 113 GLU A OE2  6  
ATOM 10235 H H    . GLU A 1 113 ? -4.284  0.297   12.083  1.00 0.00 ? 113 GLU A H    6  
ATOM 10236 H HA   . GLU A 1 113 ? -3.736  -2.526  12.166  1.00 0.00 ? 113 GLU A HA   6  
ATOM 10237 H HB3  . GLU A 1 113 ? -6.380  -1.029  11.889  1.00 0.00 ? 113 GLU A HB3  6  
ATOM 10238 H HG3  . GLU A 1 113 ? -5.756  -3.928  12.631  1.00 0.00 ? 113 GLU A HG3  6  
ATOM 10239 N N    . LEU A 1 114 ? -4.211  -3.213  9.802   1.00 0.00 ? 114 LEU A N    6  
ATOM 10240 C CA   . LEU A 1 114 ? -4.256  -3.565  8.392   1.00 0.00 ? 114 LEU A CA   6  
ATOM 10241 C C    . LEU A 1 114 ? -5.170  -4.777  8.202   1.00 0.00 ? 114 LEU A C    6  
ATOM 10242 O O    . LEU A 1 114 ? -5.698  -5.319  9.172   1.00 0.00 ? 114 LEU A O    6  
ATOM 10243 C CB   . LEU A 1 114 ? -2.841  -3.772  7.846   1.00 0.00 ? 114 LEU A CB   6  
ATOM 10244 C CG   . LEU A 1 114 ? -1.913  -2.557  7.912   1.00 0.00 ? 114 LEU A CG   6  
ATOM 10245 C CD1  . LEU A 1 114 ? -0.446  -2.988  7.930   1.00 0.00 ? 114 LEU A CD1  6  
ATOM 10246 C CD2  . LEU A 1 114 ? -2.209  -1.579  6.775   1.00 0.00 ? 114 LEU A CD2  6  
ATOM 10247 H H    . LEU A 1 114 ? -4.003  -3.970  10.419  1.00 0.00 ? 114 LEU A H    6  
ATOM 10248 H HA   . LEU A 1 114 ? -4.687  -2.720  7.857   1.00 0.00 ? 114 LEU A HA   6  
ATOM 10249 H HB3  . LEU A 1 114 ? -2.917  -4.090  6.807   1.00 0.00 ? 114 LEU A HB3  6  
ATOM 10250 H HG   . LEU A 1 114 ? -2.105  -2.031  8.849   1.00 0.00 ? 114 LEU A HG   6  
ATOM 10251 H HD11 . LEU A 1 114 ? 0.038   -2.669  7.007   1.00 0.00 ? 114 LEU A HD11 6  
ATOM 10252 H HD12 . LEU A 1 114 ? 0.058   -2.531  8.782   1.00 0.00 ? 114 LEU A HD12 6  
ATOM 10253 H HD13 . LEU A 1 114 ? -0.386  -4.074  8.014   1.00 0.00 ? 114 LEU A HD13 6  
ATOM 10254 H HD21 . LEU A 1 114 ? -1.340  -0.942  6.609   1.00 0.00 ? 114 LEU A HD21 6  
ATOM 10255 H HD22 . LEU A 1 114 ? -2.430  -2.136  5.865   1.00 0.00 ? 114 LEU A HD22 6  
ATOM 10256 H HD23 . LEU A 1 114 ? -3.067  -0.961  7.041   1.00 0.00 ? 114 LEU A HD23 6  
ATOM 10257 N N    . SER A 1 115 ? -5.330  -5.168  6.947   1.00 0.00 ? 115 SER A N    6  
ATOM 10258 C CA   . SER A 1 115 ? -6.172  -6.304  6.617   1.00 0.00 ? 115 SER A CA   6  
ATOM 10259 C C    . SER A 1 115 ? -5.694  -6.949  5.313   1.00 0.00 ? 115 SER A C    6  
ATOM 10260 O O    . SER A 1 115 ? -5.580  -6.276  4.291   1.00 0.00 ? 115 SER A O    6  
ATOM 10261 C CB   . SER A 1 115 ? -7.640  -5.887  6.497   1.00 0.00 ? 115 SER A CB   6  
ATOM 10262 O OG   . SER A 1 115 ? -7.988  -4.884  7.447   1.00 0.00 ? 115 SER A OG   6  
ATOM 10263 H H    . SER A 1 115 ? -4.897  -4.721  6.163   1.00 0.00 ? 115 SER A H    6  
ATOM 10264 H HA   . SER A 1 115 ? -6.059  -6.998  7.450   1.00 0.00 ? 115 SER A HA   6  
ATOM 10265 H HB3  . SER A 1 115 ? -8.277  -6.760  6.639   1.00 0.00 ? 115 SER A HB3  6  
ATOM 10266 H HG   . SER A 1 115 ? -8.823  -5.148  7.930   1.00 0.00 ? 115 SER A HG   6  
ATOM 10267 N N    . VAL A 1 116 ? -5.430  -8.244  5.394   1.00 0.00 ? 116 VAL A N    6  
ATOM 10268 C CA   . VAL A 1 116 ? -4.969  -8.986  4.233   1.00 0.00 ? 116 VAL A CA   6  
ATOM 10269 C C    . VAL A 1 116 ? -5.928  -10.147 3.961   1.00 0.00 ? 116 VAL A C    6  
ATOM 10270 O O    . VAL A 1 116 ? -6.899  -10.338 4.690   1.00 0.00 ? 116 VAL A O    6  
ATOM 10271 C CB   . VAL A 1 116 ? -3.523  -9.443  4.445   1.00 0.00 ? 116 VAL A CB   6  
ATOM 10272 C CG1  . VAL A 1 116 ? -2.605  -8.248  4.709   1.00 0.00 ? 116 VAL A CG1  6  
ATOM 10273 C CG2  . VAL A 1 116 ? -3.432  -10.467 5.578   1.00 0.00 ? 116 VAL A CG2  6  
ATOM 10274 H H    . VAL A 1 116 ? -5.527  -8.784  6.230   1.00 0.00 ? 116 VAL A H    6  
ATOM 10275 H HA   . VAL A 1 116 ? -4.988  -8.308  3.380   1.00 0.00 ? 116 VAL A HA   6  
ATOM 10276 H HB   . VAL A 1 116 ? -3.187  -9.927  3.528   1.00 0.00 ? 116 VAL A HB   6  
ATOM 10277 H HG11 . VAL A 1 116 ? -3.200  -7.335  4.758   1.00 0.00 ? 116 VAL A HG11 6  
ATOM 10278 H HG12 . VAL A 1 116 ? -2.084  -8.392  5.656   1.00 0.00 ? 116 VAL A HG12 6  
ATOM 10279 H HG13 . VAL A 1 116 ? -1.877  -8.163  3.903   1.00 0.00 ? 116 VAL A HG13 6  
ATOM 10280 H HG21 . VAL A 1 116 ? -2.452  -10.945 5.557   1.00 0.00 ? 116 VAL A HG21 6  
ATOM 10281 H HG22 . VAL A 1 116 ? -3.571  -9.964  6.534   1.00 0.00 ? 116 VAL A HG22 6  
ATOM 10282 H HG23 . VAL A 1 116 ? -4.207  -11.221 5.448   1.00 0.00 ? 116 VAL A HG23 6  
ATOM 10283 N N    . MET A 1 117 ? -5.622  -10.892 2.908   1.00 0.00 ? 117 MET A N    6  
ATOM 10284 C CA   . MET A 1 117 ? -6.445  -12.028 2.530   1.00 0.00 ? 117 MET A CA   6  
ATOM 10285 C C    . MET A 1 117 ? -5.582  -13.261 2.252   1.00 0.00 ? 117 MET A C    6  
ATOM 10286 O O    . MET A 1 117 ? -5.080  -13.434 1.142   1.00 0.00 ? 117 MET A O    6  
ATOM 10287 C CB   . MET A 1 117 ? -7.255  -11.679 1.280   1.00 0.00 ? 117 MET A CB   6  
ATOM 10288 C CG   . MET A 1 117 ? -8.071  -10.402 1.495   1.00 0.00 ? 117 MET A CG   6  
ATOM 10289 S SD   . MET A 1 117 ? -9.776  -10.816 1.821   1.00 0.00 ? 117 MET A SD   6  
ATOM 10290 C CE   . MET A 1 117 ? -9.600  -11.637 3.396   1.00 0.00 ? 117 MET A CE   6  
ATOM 10291 H H    . MET A 1 117 ? -4.830  -10.729 2.320   1.00 0.00 ? 117 MET A H    6  
ATOM 10292 H HA   . MET A 1 117 ? -7.094  -12.216 3.385   1.00 0.00 ? 117 MET A HA   6  
ATOM 10293 H HB3  . MET A 1 117 ? -7.923  -12.504 1.033   1.00 0.00 ? 117 MET A HB3  6  
ATOM 10294 H HG3  . MET A 1 117 ? -8.005  -9.766  0.612   1.00 0.00 ? 117 MET A HG3  6  
ATOM 10295 H HE1  . MET A 1 117 ? -9.393  -12.695 3.233   1.00 0.00 ? 117 MET A HE1  6  
ATOM 10296 H HE2  . MET A 1 117 ? -8.778  -11.188 3.950   1.00 0.00 ? 117 MET A HE2  6  
ATOM 10297 H HE3  . MET A 1 117 ? -10.524 -11.532 3.965   1.00 0.00 ? 117 MET A HE3  6  
ATOM 10298 N N    . PRO A 1 118 ? -5.432  -14.107 3.305   1.00 0.00 ? 118 PRO A N    6  
ATOM 10299 C CA   . PRO A 1 118 ? -4.640  -15.319 3.186   1.00 0.00 ? 118 PRO A CA   6  
ATOM 10300 C C    . PRO A 1 118 ? -5.389  -16.388 2.388   1.00 0.00 ? 118 PRO A C    6  
ATOM 10301 O O    . PRO A 1 118 ? -6.505  -16.155 1.928   1.00 0.00 ? 118 PRO A O    6  
ATOM 10302 C CB   . PRO A 1 118 ? -4.347  -15.741 4.616   1.00 0.00 ? 118 PRO A CB   6  
ATOM 10303 C CG   . PRO A 1 118 ? -5.368  -15.020 5.480   1.00 0.00 ? 118 PRO A CG   6  
ATOM 10304 C CD   . PRO A 1 118 ? -6.013  -13.935 4.634   1.00 0.00 ? 118 PRO A CD   6  
ATOM 10305 H HA   . PRO A 1 118 ? -3.800  -15.136 2.674   1.00 0.00 ? 118 PRO A HA   6  
ATOM 10306 H HB3  . PRO A 1 118 ? -3.331  -15.469 4.903   1.00 0.00 ? 118 PRO A HB3  6  
ATOM 10307 H HG3  . PRO A 1 118 ? -4.889  -14.587 6.357   1.00 0.00 ? 118 PRO A HG3  6  
ATOM 10308 H HD3  . PRO A 1 118 ? -5.799  -12.942 5.034   1.00 0.00 ? 118 PRO A HD3  6  
ATOM 10309 N N    . LYS A 1 119 ? -4.746  -17.537 2.249   1.00 0.00 ? 119 LYS A N    6  
ATOM 10310 C CA   . LYS A 1 119 ? -5.337  -18.643 1.516   1.00 0.00 ? 119 LYS A CA   6  
ATOM 10311 C C    . LYS A 1 119 ? -4.816  -19.964 2.086   1.00 0.00 ? 119 LYS A C    6  
ATOM 10312 O O    . LYS A 1 119 ? -5.538  -20.668 2.791   1.00 0.00 ? 119 LYS A O    6  
ATOM 10313 C CB   . LYS A 1 119 ? -5.093  -18.482 0.015   1.00 0.00 ? 119 LYS A CB   6  
ATOM 10314 C CG   . LYS A 1 119 ? -5.240  -19.821 -0.711  1.00 0.00 ? 119 LYS A CG   6  
ATOM 10315 C CD   . LYS A 1 119 ? -4.999  -19.660 -2.214  1.00 0.00 ? 119 LYS A CD   6  
ATOM 10316 C CE   . LYS A 1 119 ? -4.945  -21.021 -2.910  1.00 0.00 ? 119 LYS A CE   6  
ATOM 10317 N NZ   . LYS A 1 119 ? -4.205  -20.921 -4.188  1.00 0.00 ? 119 LYS A NZ   6  
ATOM 10318 H H    . LYS A 1 119 ? -3.836  -17.719 2.627   1.00 0.00 ? 119 LYS A H    6  
ATOM 10319 H HA   . LYS A 1 119 ? -6.415  -18.600 1.674   1.00 0.00 ? 119 LYS A HA   6  
ATOM 10320 H HB3  . LYS A 1 119 ? -4.093  -18.081 -0.154  1.00 0.00 ? 119 LYS A HB3  6  
ATOM 10321 H HG3  . LYS A 1 119 ? -6.238  -20.224 -0.541  1.00 0.00 ? 119 LYS A HG3  6  
ATOM 10322 H HD3  . LYS A 1 119 ? -4.063  -19.124 -2.380  1.00 0.00 ? 119 LYS A HD3  6  
ATOM 10323 H HE3  . LYS A 1 119 ? -5.958  -21.380 -3.096  1.00 0.00 ? 119 LYS A HE3  6  
ATOM 10324 H HZ1  . LYS A 1 119 ? -3.288  -20.564 -4.013  1.00 0.00 ? 119 LYS A HZ1  6  
ATOM 10325 H HZ2  . LYS A 1 119 ? -4.136  -21.828 -4.605  1.00 0.00 ? 119 LYS A HZ2  6  
ATOM 10326 H HZ3  . LYS A 1 119 ? -4.691  -20.304 -4.807  1.00 0.00 ? 119 LYS A HZ3  6  
ATOM 10327 N N    . ASP A 1 120 ? -3.567  -20.261 1.760   1.00 0.00 ? 120 ASP A N    6  
ATOM 10328 C CA   . ASP A 1 120 ? -2.942  -21.485 2.231   1.00 0.00 ? 120 ASP A CA   6  
ATOM 10329 C C    . ASP A 1 120 ? -1.568  -21.157 2.819   1.00 0.00 ? 120 ASP A C    6  
ATOM 10330 O O    . ASP A 1 120 ? -0.597  -20.988 2.082   1.00 0.00 ? 120 ASP A O    6  
ATOM 10331 C CB   . ASP A 1 120 ? -2.739  -22.477 1.083   1.00 0.00 ? 120 ASP A CB   6  
ATOM 10332 C CG   . ASP A 1 120 ? -1.866  -23.687 1.420   1.00 0.00 ? 120 ASP A CG   6  
ATOM 10333 O OD1  . ASP A 1 120 ? -2.408  -24.622 2.047   1.00 0.00 ? 120 ASP A OD1  6  
ATOM 10334 O OD2  . ASP A 1 120 ? -0.674  -23.649 1.042   1.00 0.00 ? 120 ASP A OD2  6  
ATOM 10335 H H    . ASP A 1 120 ? -2.987  -19.683 1.188   1.00 0.00 ? 120 ASP A H    6  
ATOM 10336 H HA   . ASP A 1 120 ? -3.628  -21.890 2.973   1.00 0.00 ? 120 ASP A HA   6  
ATOM 10337 H HB3  . ASP A 1 120 ? -2.293  -21.948 0.241   1.00 0.00 ? 120 ASP A HB3  6  
ATOM 10338 N N    . SER A 1 121 ? -1.529  -21.076 4.140   1.00 0.00 ? 121 SER A N    6  
ATOM 10339 C CA   . SER A 1 121 ? -0.291  -20.772 4.837   1.00 0.00 ? 121 SER A CA   6  
ATOM 10340 C C    . SER A 1 121 ? -0.185  -21.615 6.109   1.00 0.00 ? 121 SER A C    6  
ATOM 10341 O O    . SER A 1 121 ? -1.196  -22.054 6.654   1.00 0.00 ? 121 SER A O    6  
ATOM 10342 C CB   . SER A 1 121 ? -0.203  -19.283 5.179   1.00 0.00 ? 121 SER A CB   6  
ATOM 10343 O OG   . SER A 1 121 ? 0.697   -18.590 4.317   1.00 0.00 ? 121 SER A OG   6  
ATOM 10344 H H    . SER A 1 121 ? -2.324  -21.216 4.733   1.00 0.00 ? 121 SER A H    6  
ATOM 10345 H HA   . SER A 1 121 ? 0.505   -21.032 4.139   1.00 0.00 ? 121 SER A HA   6  
ATOM 10346 H HB3  . SER A 1 121 ? 0.121   -19.166 6.211   1.00 0.00 ? 121 SER A HB3  6  
ATOM 10347 H HG   . SER A 1 121 ? 0.223   -18.302 3.486   1.00 0.00 ? 121 SER A HG   6  
ATOM 10348 N N    . GLY A 1 122 ? 1.050   -21.816 6.546   1.00 0.00 ? 122 GLY A N    6  
ATOM 10349 C CA   . GLY A 1 122 ? 1.302   -22.599 7.744   1.00 0.00 ? 122 GLY A CA   6  
ATOM 10350 C C    . GLY A 1 122 ? 2.438   -21.990 8.568   1.00 0.00 ? 122 GLY A C    6  
ATOM 10351 O O    . GLY A 1 122 ? 3.583   -21.950 8.121   1.00 0.00 ? 122 GLY A O    6  
ATOM 10352 H H    . GLY A 1 122 ? 1.867   -21.456 6.097   1.00 0.00 ? 122 GLY A H    6  
ATOM 10353 H HA2  . GLY A 1 122 ? 0.396   -22.648 8.347   1.00 0.00 ? 122 GLY A HA2  6  
ATOM 10354 H HA3  . GLY A 1 122 ? 1.557   -23.622 7.467   1.00 0.00 ? 122 GLY A HA3  6  
ATOM 10355 N N    . PRO A 1 123 ? 2.072   -21.517 9.790   1.00 0.00 ? 123 PRO A N    6  
ATOM 10356 C CA   . PRO A 1 123 ? 3.046   -20.911 10.681  1.00 0.00 ? 123 PRO A CA   6  
ATOM 10357 C C    . PRO A 1 123 ? 3.938   -21.975 11.322  1.00 0.00 ? 123 PRO A C    6  
ATOM 10358 O O    . PRO A 1 123 ? 3.521   -23.119 11.492  1.00 0.00 ? 123 PRO A O    6  
ATOM 10359 C CB   . PRO A 1 123 ? 2.223   -20.136 11.696  1.00 0.00 ? 123 PRO A CB   6  
ATOM 10360 C CG   . PRO A 1 123 ? 0.817   -20.710 11.619  1.00 0.00 ? 123 PRO A CG   6  
ATOM 10361 C CD   . PRO A 1 123 ? 0.725   -21.547 10.353  1.00 0.00 ? 123 PRO A CD   6  
ATOM 10362 H HA   . PRO A 1 123 ? 3.661   -20.311 10.167  1.00 0.00 ? 123 PRO A HA   6  
ATOM 10363 H HB3  . PRO A 1 123 ? 2.222   -19.070 11.467  1.00 0.00 ? 123 PRO A HB3  6  
ATOM 10364 H HG3  . PRO A 1 123 ? 0.078   -19.909 11.603  1.00 0.00 ? 123 PRO A HG3  6  
ATOM 10365 H HD3  . PRO A 1 123 ? -0.005  -21.132 9.655   1.00 0.00 ? 123 PRO A HD3  6  
ATOM 10366 N N    . SER A 1 124 ? 5.151   -21.560 11.661  1.00 0.00 ? 124 SER A N    6  
ATOM 10367 C CA   . SER A 1 124 ? 6.105   -22.463 12.279  1.00 0.00 ? 124 SER A CA   6  
ATOM 10368 C C    . SER A 1 124 ? 7.399   -21.714 12.606  1.00 0.00 ? 124 SER A C    6  
ATOM 10369 O O    . SER A 1 124 ? 7.831   -21.687 13.757  1.00 0.00 ? 124 SER A O    6  
ATOM 10370 C CB   . SER A 1 124 ? 6.399   -23.660 11.372  1.00 0.00 ? 124 SER A CB   6  
ATOM 10371 O OG   . SER A 1 124 ? 6.959   -24.752 12.094  1.00 0.00 ? 124 SER A OG   6  
ATOM 10372 H H    . SER A 1 124 ? 5.482   -20.627 11.519  1.00 0.00 ? 124 SER A H    6  
ATOM 10373 H HA   . SER A 1 124 ? 5.623   -22.811 13.193  1.00 0.00 ? 124 SER A HA   6  
ATOM 10374 H HB3  . SER A 1 124 ? 7.088   -23.356 10.584  1.00 0.00 ? 124 SER A HB3  6  
ATOM 10375 H HG   . SER A 1 124 ? 6.972   -25.571 11.520  1.00 0.00 ? 124 SER A HG   6  
ATOM 10376 N N    . SER A 1 125 ? 7.981   -21.124 11.572  1.00 0.00 ? 125 SER A N    6  
ATOM 10377 C CA   . SER A 1 125 ? 9.215   -20.377 11.734  1.00 0.00 ? 125 SER A CA   6  
ATOM 10378 C C    . SER A 1 125 ? 10.293  -21.273 12.348  1.00 0.00 ? 125 SER A C    6  
ATOM 10379 O O    . SER A 1 125 ? 10.259  -21.559 13.544  1.00 0.00 ? 125 SER A O    6  
ATOM 10380 C CB   . SER A 1 125 ? 8.999   -19.136 12.602  1.00 0.00 ? 125 SER A CB   6  
ATOM 10381 O OG   . SER A 1 125 ? 9.276   -17.932 11.893  1.00 0.00 ? 125 SER A OG   6  
ATOM 10382 H H    . SER A 1 125 ? 7.622   -21.151 10.638  1.00 0.00 ? 125 SER A H    6  
ATOM 10383 H HA   . SER A 1 125 ? 9.502   -20.069 10.728  1.00 0.00 ? 125 SER A HA   6  
ATOM 10384 H HB3  . SER A 1 125 ? 9.638   -19.194 13.483  1.00 0.00 ? 125 SER A HB3  6  
ATOM 10385 H HG   . SER A 1 125 ? 8.819   -17.160 12.336  1.00 0.00 ? 125 SER A HG   6  
ATOM 10386 N N    . GLY A 1 126 ? 11.223  -21.691 11.502  1.00 0.00 ? 126 GLY A N    6  
ATOM 10387 C CA   . GLY A 1 126 ? 12.308  -22.549 11.947  1.00 0.00 ? 126 GLY A CA   6  
ATOM 10388 C C    . GLY A 1 126 ? 13.208  -22.946 10.774  1.00 0.00 ? 126 GLY A C    6  
ATOM 10389 O O    . GLY A 1 126 ? 12.723  -23.419 9.747   1.00 0.00 ? 126 GLY A O    6  
ATOM 10390 H H    . GLY A 1 126 ? 11.244  -21.452 10.531  1.00 0.00 ? 126 GLY A H    6  
ATOM 10391 H HA2  . GLY A 1 126 ? 12.898  -22.031 12.703  1.00 0.00 ? 126 GLY A HA2  6  
ATOM 10392 H HA3  . GLY A 1 126 ? 11.900  -23.443 12.416  1.00 0.00 ? 126 GLY A HA3  6  
ATOM 10393 N N    . GLY A 1 1   ? -0.851  -8.221  24.350  1.00 0.00 ? 1   GLY A N    7  
ATOM 10394 C CA   . GLY A 1 1   ? -1.279  -7.742  23.045  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10395 C C    . GLY A 1 1   ? -2.494  -8.525  22.546  1.00 0.00 ? 1   GLY A C    7  
ATOM 10396 O O    . GLY A 1 1   ? -3.633  -8.113  22.760  1.00 0.00 ? 1   GLY A O    7  
ATOM 10397 H H1   . GLY A 1 1   ? -1.571  -8.638  24.903  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10398 H HA2  . GLY A 1 1   ? -1.525  -6.682  23.106  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10399 H HA3  . GLY A 1 1   ? -0.460  -7.838  22.332  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10400 N N    . SER A 1 2   ? -2.210  -9.639  21.888  1.00 0.00 ? 2   SER A N    7  
ATOM 10401 C CA   . SER A 1 2   ? -3.267  -10.483 21.356  1.00 0.00 ? 2   SER A CA   7  
ATOM 10402 C C    . SER A 1 2   ? -4.010  -9.750  20.237  1.00 0.00 ? 2   SER A C    7  
ATOM 10403 O O    . SER A 1 2   ? -3.800  -8.557  20.027  1.00 0.00 ? 2   SER A O    7  
ATOM 10404 C CB   . SER A 1 2   ? -4.243  -10.904 22.456  1.00 0.00 ? 2   SER A CB   7  
ATOM 10405 O OG   . SER A 1 2   ? -4.559  -12.292 22.387  1.00 0.00 ? 2   SER A OG   7  
ATOM 10406 H H    . SER A 1 2   ? -1.281  -9.967  21.718  1.00 0.00 ? 2   SER A H    7  
ATOM 10407 H HA   . SER A 1 2   ? -2.760  -11.366 20.964  1.00 0.00 ? 2   SER A HA   7  
ATOM 10408 H HB3  . SER A 1 2   ? -5.159  -10.318 22.370  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10409 H HG   . SER A 1 2   ? -3.853  -12.778 21.873  1.00 0.00 ? 2   SER A HG   7  
ATOM 10410 N N    . SER A 1 3   ? -4.863  -10.495 19.550  1.00 0.00 ? 3   SER A N    7  
ATOM 10411 C CA   . SER A 1 3   ? -5.639  -9.930  18.459  1.00 0.00 ? 3   SER A CA   7  
ATOM 10412 C C    . SER A 1 3   ? -6.462  -11.025 17.780  1.00 0.00 ? 3   SER A C    7  
ATOM 10413 O O    . SER A 1 3   ? -5.984  -12.145 17.600  1.00 0.00 ? 3   SER A O    7  
ATOM 10414 C CB   . SER A 1 3   ? -4.732  -9.239  17.439  1.00 0.00 ? 3   SER A CB   7  
ATOM 10415 O OG   . SER A 1 3   ? -5.230  -7.956  17.065  1.00 0.00 ? 3   SER A OG   7  
ATOM 10416 H H    . SER A 1 3   ? -5.027  -11.464 19.728  1.00 0.00 ? 3   SER A H    7  
ATOM 10417 H HA   . SER A 1 3   ? -6.292  -9.191  18.923  1.00 0.00 ? 3   SER A HA   7  
ATOM 10418 H HB3  . SER A 1 3   ? -4.641  -9.865  16.552  1.00 0.00 ? 3   SER A HB3  7  
ATOM 10419 H HG   . SER A 1 3   ? -4.727  -7.240  17.549  1.00 0.00 ? 3   SER A HG   7  
ATOM 10420 N N    . GLY A 1 4   ? -7.687  -10.666 17.423  1.00 0.00 ? 4   GLY A N    7  
ATOM 10421 C CA   . GLY A 1 4   ? -8.580  -11.604 16.768  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10422 C C    . GLY A 1 4   ? -9.990  -11.022 16.640  1.00 0.00 ? 4   GLY A C    7  
ATOM 10423 O O    . GLY A 1 4   ? -10.175 -9.959  16.053  1.00 0.00 ? 4   GLY A O    7  
ATOM 10424 H H    . GLY A 1 4   ? -8.068  -9.754  17.574  1.00 0.00 ? 4   GLY A H    7  
ATOM 10425 H HA2  . GLY A 1 4   ? -8.196  -11.851 15.778  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10426 H HA3  . GLY A 1 4   ? -8.618  -12.533 17.336  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10427 N N    . SER A 1 5   ? -10.948 -11.745 17.204  1.00 0.00 ? 5   SER A N    7  
ATOM 10428 C CA   . SER A 1 5   ? -12.335 -11.313 17.162  1.00 0.00 ? 5   SER A CA   7  
ATOM 10429 C C    . SER A 1 5   ? -12.825 -11.270 15.713  1.00 0.00 ? 5   SER A C    7  
ATOM 10430 O O    . SER A 1 5   ? -12.020 -11.236 14.783  1.00 0.00 ? 5   SER A O    7  
ATOM 10431 C CB   . SER A 1 5   ? -12.505 -9.943  17.821  1.00 0.00 ? 5   SER A CB   7  
ATOM 10432 O OG   . SER A 1 5   ? -12.348 -10.008 19.236  1.00 0.00 ? 5   SER A OG   7  
ATOM 10433 H H    . SER A 1 5   ? -10.788 -12.609 17.682  1.00 0.00 ? 5   SER A H    7  
ATOM 10434 H HA   . SER A 1 5   ? -12.887 -12.061 17.730  1.00 0.00 ? 5   SER A HA   7  
ATOM 10435 H HB3  . SER A 1 5   ? -13.492 -9.547  17.583  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10436 H HG   . SER A 1 5   ? -12.053 -9.120  19.588  1.00 0.00 ? 5   SER A HG   7  
ATOM 10437 N N    . SER A 1 6   ? -14.141 -11.271 15.566  1.00 0.00 ? 6   SER A N    7  
ATOM 10438 C CA   . SER A 1 6   ? -14.749 -11.232 14.246  1.00 0.00 ? 6   SER A CA   7  
ATOM 10439 C C    . SER A 1 6   ? -14.331 -12.465 13.442  1.00 0.00 ? 6   SER A C    7  
ATOM 10440 O O    . SER A 1 6   ? -13.267 -13.034 13.679  1.00 0.00 ? 6   SER A O    7  
ATOM 10441 C CB   . SER A 1 6   ? -14.360 -9.955  13.500  1.00 0.00 ? 6   SER A CB   7  
ATOM 10442 O OG   . SER A 1 6   ? -15.311 -8.912  13.694  1.00 0.00 ? 6   SER A OG   7  
ATOM 10443 H H    . SER A 1 6   ? -14.789 -11.297 16.329  1.00 0.00 ? 6   SER A H    7  
ATOM 10444 H HA   . SER A 1 6   ? -15.824 -11.235 14.424  1.00 0.00 ? 6   SER A HA   7  
ATOM 10445 H HB3  . SER A 1 6   ? -14.270 -10.171 12.434  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10446 H HG   . SER A 1 6   ? -14.858 -8.097  14.053  1.00 0.00 ? 6   SER A HG   7  
ATOM 10447 N N    . GLY A 1 7   ? -15.192 -12.842 12.509  1.00 0.00 ? 7   GLY A N    7  
ATOM 10448 C CA   . GLY A 1 7   ? -14.928 -13.998 11.669  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10449 C C    . GLY A 1 7   ? -15.208 -13.682 10.199  1.00 0.00 ? 7   GLY A C    7  
ATOM 10450 O O    . GLY A 1 7   ? -16.349 -13.419 9.823   1.00 0.00 ? 7   GLY A O    7  
ATOM 10451 H H    . GLY A 1 7   ? -16.057 -12.373 12.324  1.00 0.00 ? 7   GLY A H    7  
ATOM 10452 H HA2  . GLY A 1 7   ? -13.889 -14.307 11.787  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10453 H HA3  . GLY A 1 7   ? -15.548 -14.835 11.989  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10454 N N    . GLY A 1 8   ? -14.146 -13.718 9.406   1.00 0.00 ? 8   GLY A N    7  
ATOM 10455 C CA   . GLY A 1 8   ? -14.263 -13.439 7.985   1.00 0.00 ? 8   GLY A CA   7  
ATOM 10456 C C    . GLY A 1 8   ? -12.914 -13.026 7.394   1.00 0.00 ? 8   GLY A C    7  
ATOM 10457 O O    . GLY A 1 8   ? -12.096 -13.878 7.050   1.00 0.00 ? 8   GLY A O    7  
ATOM 10458 H H    . GLY A 1 8   ? -13.222 -13.932 9.720   1.00 0.00 ? 8   GLY A H    7  
ATOM 10459 H HA2  . GLY A 1 8   ? -14.637 -14.322 7.467   1.00 0.00 ? 8   GLY A HA2  7  
ATOM 10460 H HA3  . GLY A 1 8   ? -14.992 -12.644 7.825   1.00 0.00 ? 8   GLY A HA3  7  
ATOM 10461 N N    . PRO A 1 9   ? -12.717 -11.684 7.294   1.00 0.00 ? 9   PRO A N    7  
ATOM 10462 C CA   . PRO A 1 9   ? -11.480 -11.149 6.750   1.00 0.00 ? 9   PRO A CA   7  
ATOM 10463 C C    . PRO A 1 9   ? -10.338 -11.276 7.761   1.00 0.00 ? 9   PRO A C    7  
ATOM 10464 O O    . PRO A 1 9   ? -10.563 -11.622 8.919   1.00 0.00 ? 9   PRO A O    7  
ATOM 10465 C CB   . PRO A 1 9   ? -11.800 -9.706  6.394   1.00 0.00 ? 9   PRO A CB   7  
ATOM 10466 C CG   . PRO A 1 9   ? -13.055 -9.352  7.174   1.00 0.00 ? 9   PRO A CG   7  
ATOM 10467 C CD   . PRO A 1 9   ? -13.662 -10.645 7.693   1.00 0.00 ? 9   PRO A CD   7  
ATOM 10468 H HA   . PRO A 1 9   ? -11.196 -11.674 5.950   1.00 0.00 ? 9   PRO A HA   7  
ATOM 10469 H HB3  . PRO A 1 9   ? -11.962 -9.595  5.322   1.00 0.00 ? 9   PRO A HB3  7  
ATOM 10470 H HG3  . PRO A 1 9   ? -13.766 -8.826  6.535   1.00 0.00 ? 9   PRO A HG3  7  
ATOM 10471 H HD3  . PRO A 1 9   ? -14.648 -10.822 7.263   1.00 0.00 ? 9   PRO A HD3  7  
ATOM 10472 N N    . LYS A 1 10  ? -9.134  -10.988 7.285   1.00 0.00 ? 10  LYS A N    7  
ATOM 10473 C CA   . LYS A 1 10  ? -7.957  -11.066 8.132   1.00 0.00 ? 10  LYS A CA   7  
ATOM 10474 C C    . LYS A 1 10  ? -7.683  -9.691  8.744   1.00 0.00 ? 10  LYS A C    7  
ATOM 10475 O O    . LYS A 1 10  ? -7.981  -8.665  8.135   1.00 0.00 ? 10  LYS A O    7  
ATOM 10476 C CB   . LYS A 1 10  ? -6.773  -11.637 7.349   1.00 0.00 ? 10  LYS A CB   7  
ATOM 10477 C CG   . LYS A 1 10  ? -5.465  -11.460 8.126   1.00 0.00 ? 10  LYS A CG   7  
ATOM 10478 C CD   . LYS A 1 10  ? -5.345  -12.504 9.239   1.00 0.00 ? 10  LYS A CD   7  
ATOM 10479 C CE   . LYS A 1 10  ? -3.920  -13.057 9.318   1.00 0.00 ? 10  LYS A CE   7  
ATOM 10480 N NZ   . LYS A 1 10  ? -3.897  -14.318 10.092  1.00 0.00 ? 10  LYS A NZ   7  
ATOM 10481 H H    . LYS A 1 10  ? -8.960  -10.706 6.341   1.00 0.00 ? 10  LYS A H    7  
ATOM 10482 H HA   . LYS A 1 10  ? -8.178  -11.766 8.936   1.00 0.00 ? 10  LYS A HA   7  
ATOM 10483 H HB3  . LYS A 1 10  ? -6.695  -11.138 6.383   1.00 0.00 ? 10  LYS A HB3  7  
ATOM 10484 H HG3  . LYS A 1 10  ? -5.426  -10.460 8.556   1.00 0.00 ? 10  LYS A HG3  7  
ATOM 10485 H HD3  . LYS A 1 10  ? -6.045  -13.317 9.057   1.00 0.00 ? 10  LYS A HD3  7  
ATOM 10486 H HE3  . LYS A 1 10  ? -3.264  -12.322 9.786   1.00 0.00 ? 10  LYS A HE3  7  
ATOM 10487 H HZ1  . LYS A 1 10  ? -3.764  -15.089 9.470   1.00 0.00 ? 10  LYS A HZ1  7  
ATOM 10488 H HZ2  . LYS A 1 10  ? -3.146  -14.290 10.752  1.00 0.00 ? 10  LYS A HZ2  7  
ATOM 10489 H HZ3  . LYS A 1 10  ? -4.764  -14.427 10.578  1.00 0.00 ? 10  LYS A HZ3  7  
ATOM 10490 N N    . THR A 1 11  ? -7.118  -9.715  9.943   1.00 0.00 ? 11  THR A N    7  
ATOM 10491 C CA   . THR A 1 11  ? -6.801  -8.483  10.645  1.00 0.00 ? 11  THR A CA   7  
ATOM 10492 C C    . THR A 1 11  ? -5.398  -8.559  11.249  1.00 0.00 ? 11  THR A C    7  
ATOM 10493 O O    . THR A 1 11  ? -5.021  -9.576  11.828  1.00 0.00 ? 11  THR A O    7  
ATOM 10494 C CB   . THR A 1 11  ? -7.896  -8.237  11.684  1.00 0.00 ? 11  THR A CB   7  
ATOM 10495 O OG1  . THR A 1 11  ? -9.111  -8.437  10.966  1.00 0.00 ? 11  THR A OG1  7  
ATOM 10496 C CG2  . THR A 1 11  ? -7.964  -6.774  12.128  1.00 0.00 ? 11  THR A CG2  7  
ATOM 10497 H H    . THR A 1 11  ? -6.880  -10.554 10.433  1.00 0.00 ? 11  THR A H    7  
ATOM 10498 H HA   . THR A 1 11  ? -6.796  -7.667  9.923   1.00 0.00 ? 11  THR A HA   7  
ATOM 10499 H HB   . THR A 1 11  ? -7.775  -8.898  12.542  1.00 0.00 ? 11  THR A HB   7  
ATOM 10500 H HG1  . THR A 1 11  ? -9.892  -8.354  11.583  1.00 0.00 ? 11  THR A HG1  7  
ATOM 10501 H HG21 . THR A 1 11  ? -7.558  -6.136  11.344  1.00 0.00 ? 11  THR A HG21 7  
ATOM 10502 H HG22 . THR A 1 11  ? -9.001  -6.498  12.318  1.00 0.00 ? 11  THR A HG22 7  
ATOM 10503 H HG23 . THR A 1 11  ? -7.382  -6.643  13.040  1.00 0.00 ? 11  THR A HG23 7  
ATOM 10504 N N    . VAL A 1 12  ? -4.661  -7.469  11.091  1.00 0.00 ? 12  VAL A N    7  
ATOM 10505 C CA   . VAL A 1 12  ? -3.306  -7.399  11.612  1.00 0.00 ? 12  VAL A CA   7  
ATOM 10506 C C    . VAL A 1 12  ? -3.035  -5.986  12.129  1.00 0.00 ? 12  VAL A C    7  
ATOM 10507 O O    . VAL A 1 12  ? -3.191  -5.012  11.394  1.00 0.00 ? 12  VAL A O    7  
ATOM 10508 C CB   . VAL A 1 12  ? -2.310  -7.846  10.540  1.00 0.00 ? 12  VAL A CB   7  
ATOM 10509 C CG1  . VAL A 1 12  ? -2.012  -9.341  10.657  1.00 0.00 ? 12  VAL A CG1  7  
ATOM 10510 C CG2  . VAL A 1 12  ? -2.816  -7.495  9.139   1.00 0.00 ? 12  VAL A CG2  7  
ATOM 10511 H H    . VAL A 1 12  ? -4.975  -6.646  10.618  1.00 0.00 ? 12  VAL A H    7  
ATOM 10512 H HA   . VAL A 1 12  ? -3.239  -8.097  12.447  1.00 0.00 ? 12  VAL A HA   7  
ATOM 10513 H HB   . VAL A 1 12  ? -1.377  -7.305  10.704  1.00 0.00 ? 12  VAL A HB   7  
ATOM 10514 H HG11 . VAL A 1 12  ? -2.807  -9.909  10.174  1.00 0.00 ? 12  VAL A HG11 7  
ATOM 10515 H HG12 . VAL A 1 12  ? -1.061  -9.563  10.172  1.00 0.00 ? 12  VAL A HG12 7  
ATOM 10516 H HG13 . VAL A 1 12  ? -1.955  -9.619  11.710  1.00 0.00 ? 12  VAL A HG13 7  
ATOM 10517 H HG21 . VAL A 1 12  ? -3.567  -6.707  9.212   1.00 0.00 ? 12  VAL A HG21 7  
ATOM 10518 H HG22 . VAL A 1 12  ? -1.984  -7.148  8.529   1.00 0.00 ? 12  VAL A HG22 7  
ATOM 10519 H HG23 . VAL A 1 12  ? -3.261  -8.379  8.683   1.00 0.00 ? 12  VAL A HG23 7  
ATOM 10520 N N    . THR A 1 13  ? -2.634  -5.917  13.390  1.00 0.00 ? 13  THR A N    7  
ATOM 10521 C CA   . THR A 1 13  ? -2.341  -4.638  14.014  1.00 0.00 ? 13  THR A CA   7  
ATOM 10522 C C    . THR A 1 13  ? -0.829  -4.430  14.117  1.00 0.00 ? 13  THR A C    7  
ATOM 10523 O O    . THR A 1 13  ? -0.067  -5.395  14.161  1.00 0.00 ? 13  THR A O    7  
ATOM 10524 C CB   . THR A 1 13  ? -3.053  -4.598  15.368  1.00 0.00 ? 13  THR A CB   7  
ATOM 10525 O OG1  . THR A 1 13  ? -4.429  -4.778  15.042  1.00 0.00 ? 13  THR A OG1  7  
ATOM 10526 C CG2  . THR A 1 13  ? -3.002  -3.213  16.015  1.00 0.00 ? 13  THR A CG2  7  
ATOM 10527 H H    . THR A 1 13  ? -2.510  -6.714  13.981  1.00 0.00 ? 13  THR A H    7  
ATOM 10528 H HA   . THR A 1 13  ? -2.729  -3.846  13.375  1.00 0.00 ? 13  THR A HA   7  
ATOM 10529 H HB   . THR A 1 13  ? -2.654  -5.357  16.040  1.00 0.00 ? 13  THR A HB   7  
ATOM 10530 H HG1  . THR A 1 13  ? -4.870  -5.355  15.728  1.00 0.00 ? 13  THR A HG1  7  
ATOM 10531 H HG21 . THR A 1 13  ? -3.678  -3.185  16.869  1.00 0.00 ? 13  THR A HG21 7  
ATOM 10532 H HG22 . THR A 1 13  ? -1.985  -3.004  16.350  1.00 0.00 ? 13  THR A HG22 7  
ATOM 10533 H HG23 . THR A 1 13  ? -3.305  -2.460  15.288  1.00 0.00 ? 13  THR A HG23 7  
ATOM 10534 N N    . LEU A 1 14  ? -0.439  -3.163  14.152  1.00 0.00 ? 14  LEU A N    7  
ATOM 10535 C CA   . LEU A 1 14  ? 0.969   -2.817  14.248  1.00 0.00 ? 14  LEU A CA   7  
ATOM 10536 C C    . LEU A 1 14  ? 1.144   -1.695  15.275  1.00 0.00 ? 14  LEU A C    7  
ATOM 10537 O O    . LEU A 1 14  ? 0.163   -1.116  15.738  1.00 0.00 ? 14  LEU A O    7  
ATOM 10538 C CB   . LEU A 1 14  ? 1.533   -2.480  12.866  1.00 0.00 ? 14  LEU A CB   7  
ATOM 10539 C CG   . LEU A 1 14  ? 1.355   -3.552  11.790  1.00 0.00 ? 14  LEU A CG   7  
ATOM 10540 C CD1  . LEU A 1 14  ? -0.012  -3.429  11.113  1.00 0.00 ? 14  LEU A CD1  7  
ATOM 10541 C CD2  . LEU A 1 14  ? 2.502   -3.507  10.777  1.00 0.00 ? 14  LEU A CD2  7  
ATOM 10542 H H    . LEU A 1 14  ? -1.065  -2.384  14.116  1.00 0.00 ? 14  LEU A H    7  
ATOM 10543 H HA   . LEU A 1 14  ? 1.499   -3.699  14.607  1.00 0.00 ? 14  LEU A HA   7  
ATOM 10544 H HB3  . LEU A 1 14  ? 2.599   -2.272  12.972  1.00 0.00 ? 14  LEU A HB3  7  
ATOM 10545 H HG   . LEU A 1 14  ? 1.389   -4.529  12.271  1.00 0.00 ? 14  LEU A HG   7  
ATOM 10546 H HD11 . LEU A 1 14  ? -0.158  -4.268  10.434  1.00 0.00 ? 14  LEU A HD11 7  
ATOM 10547 H HD12 . LEU A 1 14  ? -0.794  -3.434  11.872  1.00 0.00 ? 14  LEU A HD12 7  
ATOM 10548 H HD13 . LEU A 1 14  ? -0.056  -2.494  10.552  1.00 0.00 ? 14  LEU A HD13 7  
ATOM 10549 H HD21 . LEU A 1 14  ? 2.537   -2.523  10.311  1.00 0.00 ? 14  LEU A HD21 7  
ATOM 10550 H HD22 . LEU A 1 14  ? 3.445   -3.703  11.288  1.00 0.00 ? 14  LEU A HD22 7  
ATOM 10551 H HD23 . LEU A 1 14  ? 2.340   -4.266  10.012  1.00 0.00 ? 14  LEU A HD23 7  
ATOM 10552 N N    . LYS A 1 15  ? 2.400   -1.423  15.597  1.00 0.00 ? 15  LYS A N    7  
ATOM 10553 C CA   . LYS A 1 15  ? 2.715   -0.383  16.560  1.00 0.00 ? 15  LYS A CA   7  
ATOM 10554 C C    . LYS A 1 15  ? 3.922   0.417   16.063  1.00 0.00 ? 15  LYS A C    7  
ATOM 10555 O O    . LYS A 1 15  ? 5.013   -0.131  15.911  1.00 0.00 ? 15  LYS A O    7  
ATOM 10556 C CB   . LYS A 1 15  ? 2.907   -0.981  17.955  1.00 0.00 ? 15  LYS A CB   7  
ATOM 10557 C CG   . LYS A 1 15  ? 1.741   -1.902  18.322  1.00 0.00 ? 15  LYS A CG   7  
ATOM 10558 C CD   . LYS A 1 15  ? 1.551   -1.970  19.837  1.00 0.00 ? 15  LYS A CD   7  
ATOM 10559 C CE   . LYS A 1 15  ? 0.940   -3.308  20.254  1.00 0.00 ? 15  LYS A CE   7  
ATOM 10560 N NZ   . LYS A 1 15  ? 1.085   -3.513  21.712  1.00 0.00 ? 15  LYS A NZ   7  
ATOM 10561 H H    . LYS A 1 15  ? 3.192   -1.899  15.215  1.00 0.00 ? 15  LYS A H    7  
ATOM 10562 H HA   . LYS A 1 15  ? 1.856   0.287   16.611  1.00 0.00 ? 15  LYS A HA   7  
ATOM 10563 H HB3  . LYS A 1 15  ? 2.987   -0.181  18.691  1.00 0.00 ? 15  LYS A HB3  7  
ATOM 10564 H HG3  . LYS A 1 15  ? 1.927   -2.903  17.929  1.00 0.00 ? 15  LYS A HG3  7  
ATOM 10565 H HD3  . LYS A 1 15  ? 0.906   -1.154  20.163  1.00 0.00 ? 15  LYS A HD3  7  
ATOM 10566 H HE3  . LYS A 1 15  ? 1.428   -4.121  19.716  1.00 0.00 ? 15  LYS A HE3  7  
ATOM 10567 H HZ1  . LYS A 1 15  ? 1.399   -2.665  22.139  1.00 0.00 ? 15  LYS A HZ1  7  
ATOM 10568 H HZ2  . LYS A 1 15  ? 0.202   -3.775  22.101  1.00 0.00 ? 15  LYS A HZ2  7  
ATOM 10569 H HZ3  . LYS A 1 15  ? 1.751   -4.238  21.884  1.00 0.00 ? 15  LYS A HZ3  7  
ATOM 10570 N N    . ARG A 1 16  ? 3.686   1.698   15.823  1.00 0.00 ? 16  ARG A N    7  
ATOM 10571 C CA   . ARG A 1 16  ? 4.738   2.578   15.345  1.00 0.00 ? 16  ARG A CA   7  
ATOM 10572 C C    . ARG A 1 16  ? 6.033   2.325   16.123  1.00 0.00 ? 16  ARG A C    7  
ATOM 10573 O O    . ARG A 1 16  ? 6.113   2.622   17.314  1.00 0.00 ? 16  ARG A O    7  
ATOM 10574 C CB   . ARG A 1 16  ? 4.339   4.048   15.496  1.00 0.00 ? 16  ARG A CB   7  
ATOM 10575 C CG   . ARG A 1 16  ? 5.415   4.970   14.916  1.00 0.00 ? 16  ARG A CG   7  
ATOM 10576 C CD   . ARG A 1 16  ? 4.795   6.024   13.997  1.00 0.00 ? 16  ARG A CD   7  
ATOM 10577 N NE   . ARG A 1 16  ? 5.574   7.280   14.071  1.00 0.00 ? 16  ARG A NE   7  
ATOM 10578 C CZ   . ARG A 1 16  ? 5.258   8.400   13.407  1.00 0.00 ? 16  ARG A CZ   7  
ATOM 10579 N NH1  . ARG A 1 16  ? 4.178   8.427   12.615  1.00 0.00 ? 16  ARG A NH1  7  
ATOM 10580 N NH2  . ARG A 1 16  ? 6.023   9.492   13.534  1.00 0.00 ? 16  ARG A NH2  7  
ATOM 10581 H H    . ARG A 1 16  ? 2.795   2.136   15.948  1.00 0.00 ? 16  ARG A H    7  
ATOM 10582 H HA   . ARG A 1 16  ? 4.859   2.324   14.292  1.00 0.00 ? 16  ARG A HA   7  
ATOM 10583 H HB3  . ARG A 1 16  ? 4.185   4.280   16.550  1.00 0.00 ? 16  ARG A HB3  7  
ATOM 10584 H HG3  . ARG A 1 16  ? 6.143   4.379   14.361  1.00 0.00 ? 16  ARG A HG3  7  
ATOM 10585 H HD3  . ARG A 1 16  ? 3.761   6.209   14.287  1.00 0.00 ? 16  ARG A HD3  7  
ATOM 10586 H HE   . ARG A 1 16  ? 6.388   7.294   14.653  1.00 0.00 ? 16  ARG A HE   7  
ATOM 10587 H HH11 . ARG A 1 16  ? 3.606   7.612   12.521  1.00 0.00 ? 16  ARG A HH11 7  
ATOM 10588 H HH12 . ARG A 1 16  ? 3.941   9.263   12.120  1.00 0.00 ? 16  ARG A HH12 7  
ATOM 10589 H HH21 . ARG A 1 16  ? 6.829   9.472   14.124  1.00 0.00 ? 16  ARG A HH21 7  
ATOM 10590 H HH22 . ARG A 1 16  ? 5.788   10.328  13.038  1.00 0.00 ? 16  ARG A HH22 7  
ATOM 10591 N N    . THR A 1 17  ? 7.013   1.783   15.417  1.00 0.00 ? 17  THR A N    7  
ATOM 10592 C CA   . THR A 1 17  ? 8.299   1.487   16.025  1.00 0.00 ? 17  THR A CA   7  
ATOM 10593 C C    . THR A 1 17  ? 9.430   2.117   15.212  1.00 0.00 ? 17  THR A C    7  
ATOM 10594 O O    . THR A 1 17  ? 10.336  2.731   15.773  1.00 0.00 ? 17  THR A O    7  
ATOM 10595 C CB   . THR A 1 17  ? 8.421   -0.032  16.161  1.00 0.00 ? 17  THR A CB   7  
ATOM 10596 O OG1  . THR A 1 17  ? 9.703   -0.226  16.752  1.00 0.00 ? 17  THR A OG1  7  
ATOM 10597 C CG2  . THR A 1 17  ? 8.523   -0.734  14.806  1.00 0.00 ? 17  THR A CG2  7  
ATOM 10598 H H    . THR A 1 17  ? 6.939   1.544   14.449  1.00 0.00 ? 17  THR A H    7  
ATOM 10599 H HA   . THR A 1 17  ? 8.324   1.943   17.015  1.00 0.00 ? 17  THR A HA   7  
ATOM 10600 H HB   . THR A 1 17  ? 7.596   -0.438  16.748  1.00 0.00 ? 17  THR A HB   7  
ATOM 10601 H HG1  . THR A 1 17  ? 9.644   -0.108  17.743  1.00 0.00 ? 17  THR A HG1  7  
ATOM 10602 H HG21 . THR A 1 17  ? 9.398   -0.363  14.270  1.00 0.00 ? 17  THR A HG21 7  
ATOM 10603 H HG22 . THR A 1 17  ? 8.622   -1.809  14.960  1.00 0.00 ? 17  THR A HG22 7  
ATOM 10604 H HG23 . THR A 1 17  ? 7.627   -0.531  14.221  1.00 0.00 ? 17  THR A HG23 7  
ATOM 10605 N N    . SER A 1 18  ? 9.342   1.943   13.901  1.00 0.00 ? 18  SER A N    7  
ATOM 10606 C CA   . SER A 1 18  ? 10.348  2.486   13.005  1.00 0.00 ? 18  SER A CA   7  
ATOM 10607 C C    . SER A 1 18  ? 9.674   3.253   11.865  1.00 0.00 ? 18  SER A C    7  
ATOM 10608 O O    . SER A 1 18  ? 8.447   3.291   11.777  1.00 0.00 ? 18  SER A O    7  
ATOM 10609 C CB   . SER A 1 18  ? 11.242  1.380   12.443  1.00 0.00 ? 18  SER A CB   7  
ATOM 10610 O OG   . SER A 1 18  ? 12.578  1.831   12.228  1.00 0.00 ? 18  SER A OG   7  
ATOM 10611 H H    . SER A 1 18  ? 8.603   1.443   13.453  1.00 0.00 ? 18  SER A H    7  
ATOM 10612 H HA   . SER A 1 18  ? 10.947  3.161   13.618  1.00 0.00 ? 18  SER A HA   7  
ATOM 10613 H HB3  . SER A 1 18  ? 10.826  1.017   11.503  1.00 0.00 ? 18  SER A HB3  7  
ATOM 10614 H HG   . SER A 1 18  ? 12.659  2.240   11.320  1.00 0.00 ? 18  SER A HG   7  
ATOM 10615 N N    . GLN A 1 19  ? 10.505  3.846   11.021  1.00 0.00 ? 19  GLN A N    7  
ATOM 10616 C CA   . GLN A 1 19  ? 10.004  4.609   9.889   1.00 0.00 ? 19  GLN A CA   7  
ATOM 10617 C C    . GLN A 1 19  ? 9.268   3.691   8.914   1.00 0.00 ? 19  GLN A C    7  
ATOM 10618 O O    . GLN A 1 19  ? 9.759   2.612   8.579   1.00 0.00 ? 19  GLN A O    7  
ATOM 10619 C CB   . GLN A 1 19  ? 11.139  5.359   9.188   1.00 0.00 ? 19  GLN A CB   7  
ATOM 10620 C CG   . GLN A 1 19  ? 11.098  6.851   9.522   1.00 0.00 ? 19  GLN A CG   7  
ATOM 10621 C CD   . GLN A 1 19  ? 10.571  7.663   8.338   1.00 0.00 ? 19  GLN A CD   7  
ATOM 10622 O OE1  . GLN A 1 19  ? 11.142  7.681   7.261   1.00 0.00 ? 19  GLN A OE1  7  
ATOM 10623 N NE2  . GLN A 1 19  ? 9.453   8.335   8.598   1.00 0.00 ? 19  GLN A NE2  7  
ATOM 10624 H H    . GLN A 1 19  ? 11.501  3.812   11.099  1.00 0.00 ? 19  GLN A H    7  
ATOM 10625 H HA   . GLN A 1 19  ? 9.307   5.333   10.314  1.00 0.00 ? 19  GLN A HA   7  
ATOM 10626 H HB3  . GLN A 1 19  ? 11.057  5.222   8.110   1.00 0.00 ? 19  GLN A HB3  7  
ATOM 10627 H HG3  . GLN A 1 19  ? 12.098  7.195   9.787   1.00 0.00 ? 19  GLN A HG3  7  
ATOM 10628 H HE21 . GLN A 1 19  ? 9.034   8.279   9.505   1.00 0.00 ? 19  GLN A HE21 7  
ATOM 10629 H HE22 . GLN A 1 19  ? 9.029   8.896   7.887   1.00 0.00 ? 19  GLN A HE22 7  
ATOM 10630 N N    . GLY A 1 20  ? 8.102   4.150   8.482   1.00 0.00 ? 20  GLY A N    7  
ATOM 10631 C CA   . GLY A 1 20  ? 7.294   3.382   7.550   1.00 0.00 ? 20  GLY A CA   7  
ATOM 10632 C C    . GLY A 1 20  ? 6.994   1.988   8.103   1.00 0.00 ? 20  GLY A C    7  
ATOM 10633 O O    . GLY A 1 20  ? 6.779   1.046   7.342   1.00 0.00 ? 20  GLY A O    7  
ATOM 10634 H H    . GLY A 1 20  ? 7.710   5.027   8.757   1.00 0.00 ? 20  GLY A H    7  
ATOM 10635 H HA2  . GLY A 1 20  ? 6.358   3.909   7.355   1.00 0.00 ? 20  GLY A HA2  7  
ATOM 10636 H HA3  . GLY A 1 20  ? 7.816   3.295   6.596   1.00 0.00 ? 20  GLY A HA3  7  
ATOM 10637 N N    . PHE A 1 21  ? 6.992   1.899   9.425   1.00 0.00 ? 21  PHE A N    7  
ATOM 10638 C CA   . PHE A 1 21  ? 6.723   0.634   10.089  1.00 0.00 ? 21  PHE A CA   7  
ATOM 10639 C C    . PHE A 1 21  ? 7.632   -0.472  9.552   1.00 0.00 ? 21  PHE A C    7  
ATOM 10640 O O    . PHE A 1 21  ? 8.378   -0.258  8.597   1.00 0.00 ? 21  PHE A O    7  
ATOM 10641 C CB   . PHE A 1 21  ? 5.267   0.272   9.789   1.00 0.00 ? 21  PHE A CB   7  
ATOM 10642 C CG   . PHE A 1 21  ? 4.258   0.901   10.750  1.00 0.00 ? 21  PHE A CG   7  
ATOM 10643 C CD1  . PHE A 1 21  ? 4.058   0.354   11.980  1.00 0.00 ? 21  PHE A CD1  7  
ATOM 10644 C CD2  . PHE A 1 21  ? 3.559   2.007   10.378  1.00 0.00 ? 21  PHE A CD2  7  
ATOM 10645 C CE1  . PHE A 1 21  ? 3.122   0.937   12.874  1.00 0.00 ? 21  PHE A CE1  7  
ATOM 10646 C CE2  . PHE A 1 21  ? 2.622   2.590   11.271  1.00 0.00 ? 21  PHE A CE2  7  
ATOM 10647 C CZ   . PHE A 1 21  ? 2.422   2.043   12.500  1.00 0.00 ? 21  PHE A CZ   7  
ATOM 10648 H H    . PHE A 1 21  ? 7.168   2.668   10.038  1.00 0.00 ? 21  PHE A H    7  
ATOM 10649 H HA   . PHE A 1 21  ? 6.918   0.780   11.152  1.00 0.00 ? 21  PHE A HA   7  
ATOM 10650 H HB3  . PHE A 1 21  ? 5.159   -0.811  9.822   1.00 0.00 ? 21  PHE A HB3  7  
ATOM 10651 H HD1  . PHE A 1 21  ? 4.618   -0.532  12.279  1.00 0.00 ? 21  PHE A HD1  7  
ATOM 10652 H HD2  . PHE A 1 21  ? 3.719   2.445   9.392   1.00 0.00 ? 21  PHE A HD2  7  
ATOM 10653 H HE1  . PHE A 1 21  ? 2.962   0.500   13.859  1.00 0.00 ? 21  PHE A HE1  7  
ATOM 10654 H HE2  . PHE A 1 21  ? 2.062   3.475   10.972  1.00 0.00 ? 21  PHE A HE2  7  
ATOM 10655 H HZ   . PHE A 1 21  ? 1.704   2.491   13.186  1.00 0.00 ? 21  PHE A HZ   7  
ATOM 10656 N N    . GLY A 1 22  ? 7.543   -1.630  10.189  1.00 0.00 ? 22  GLY A N    7  
ATOM 10657 C CA   . GLY A 1 22  ? 8.349   -2.770  9.787   1.00 0.00 ? 22  GLY A CA   7  
ATOM 10658 C C    . GLY A 1 22  ? 8.141   -3.093  8.307   1.00 0.00 ? 22  GLY A C    7  
ATOM 10659 O O    . GLY A 1 22  ? 8.971   -2.745  7.469   1.00 0.00 ? 22  GLY A O    7  
ATOM 10660 H H    . GLY A 1 22  ? 6.934   -1.796  10.966  1.00 0.00 ? 22  GLY A H    7  
ATOM 10661 H HA2  . GLY A 1 22  ? 9.401   -2.558  9.973   1.00 0.00 ? 22  GLY A HA2  7  
ATOM 10662 H HA3  . GLY A 1 22  ? 8.086   -3.638  10.393  1.00 0.00 ? 22  GLY A HA3  7  
ATOM 10663 N N    . PHE A 1 23  ? 7.027   -3.757  8.030   1.00 0.00 ? 23  PHE A N    7  
ATOM 10664 C CA   . PHE A 1 23  ? 6.700   -4.132  6.664   1.00 0.00 ? 23  PHE A CA   7  
ATOM 10665 C C    . PHE A 1 23  ? 6.734   -2.914  5.739   1.00 0.00 ? 23  PHE A C    7  
ATOM 10666 O O    . PHE A 1 23  ? 6.974   -1.795  6.188   1.00 0.00 ? 23  PHE A O    7  
ATOM 10667 C CB   . PHE A 1 23  ? 5.280   -4.703  6.686   1.00 0.00 ? 23  PHE A CB   7  
ATOM 10668 C CG   . PHE A 1 23  ? 4.182   -3.638  6.665   1.00 0.00 ? 23  PHE A CG   7  
ATOM 10669 C CD1  . PHE A 1 23  ? 4.129   -2.696  7.644   1.00 0.00 ? 23  PHE A CD1  7  
ATOM 10670 C CD2  . PHE A 1 23  ? 3.259   -3.634  5.667   1.00 0.00 ? 23  PHE A CD2  7  
ATOM 10671 C CE1  . PHE A 1 23  ? 3.109   -1.708  7.625   1.00 0.00 ? 23  PHE A CE1  7  
ATOM 10672 C CE2  . PHE A 1 23  ? 2.238   -2.646  5.647   1.00 0.00 ? 23  PHE A CE2  7  
ATOM 10673 C CZ   . PHE A 1 23  ? 2.185   -1.703  6.626   1.00 0.00 ? 23  PHE A CZ   7  
ATOM 10674 H H    . PHE A 1 23  ? 6.357   -4.037  8.717   1.00 0.00 ? 23  PHE A H    7  
ATOM 10675 H HA   . PHE A 1 23  ? 7.449   -4.854  6.340   1.00 0.00 ? 23  PHE A HA   7  
ATOM 10676 H HB3  . PHE A 1 23  ? 5.160   -5.316  7.578   1.00 0.00 ? 23  PHE A HB3  7  
ATOM 10677 H HD1  . PHE A 1 23  ? 4.869   -2.699  8.443   1.00 0.00 ? 23  PHE A HD1  7  
ATOM 10678 H HD2  . PHE A 1 23  ? 3.300   -4.389  4.882   1.00 0.00 ? 23  PHE A HD2  7  
ATOM 10679 H HE1  . PHE A 1 23  ? 3.067   -0.953  8.410   1.00 0.00 ? 23  PHE A HE1  7  
ATOM 10680 H HE2  . PHE A 1 23  ? 1.498   -2.642  4.846   1.00 0.00 ? 23  PHE A HE2  7  
ATOM 10681 H HZ   . PHE A 1 23  ? 1.403   -0.945  6.611   1.00 0.00 ? 23  PHE A HZ   7  
ATOM 10682 N N    . THR A 1 24  ? 6.488   -3.175  4.462   1.00 0.00 ? 24  THR A N    7  
ATOM 10683 C CA   . THR A 1 24  ? 6.489   -2.114  3.470   1.00 0.00 ? 24  THR A CA   7  
ATOM 10684 C C    . THR A 1 24  ? 5.672   -2.530  2.245   1.00 0.00 ? 24  THR A C    7  
ATOM 10685 O O    . THR A 1 24  ? 5.506   -3.720  1.981   1.00 0.00 ? 24  THR A O    7  
ATOM 10686 C CB   . THR A 1 24  ? 7.943   -1.773  3.142   1.00 0.00 ? 24  THR A CB   7  
ATOM 10687 O OG1  . THR A 1 24  ? 7.846   -0.751  2.152   1.00 0.00 ? 24  THR A OG1  7  
ATOM 10688 C CG2  . THR A 1 24  ? 8.667   -2.916  2.429   1.00 0.00 ? 24  THR A CG2  7  
ATOM 10689 H H    . THR A 1 24  ? 6.294   -4.088  4.105   1.00 0.00 ? 24  THR A H    7  
ATOM 10690 H HA   . THR A 1 24  ? 5.997   -1.240  3.899   1.00 0.00 ? 24  THR A HA   7  
ATOM 10691 H HB   . THR A 1 24  ? 8.483   -1.468  4.038   1.00 0.00 ? 24  THR A HB   7  
ATOM 10692 H HG1  . THR A 1 24  ? 7.514   -1.140  1.292   1.00 0.00 ? 24  THR A HG1  7  
ATOM 10693 H HG21 . THR A 1 24  ? 8.472   -3.852  2.952   1.00 0.00 ? 24  THR A HG21 7  
ATOM 10694 H HG22 . THR A 1 24  ? 8.307   -2.991  1.404   1.00 0.00 ? 24  THR A HG22 7  
ATOM 10695 H HG23 . THR A 1 24  ? 9.739   -2.720  2.425   1.00 0.00 ? 24  THR A HG23 7  
ATOM 10696 N N    . LEU A 1 25  ? 5.183   -1.527  1.530   1.00 0.00 ? 25  LEU A N    7  
ATOM 10697 C CA   . LEU A 1 25  ? 4.387   -1.775  0.340   1.00 0.00 ? 25  LEU A CA   7  
ATOM 10698 C C    . LEU A 1 25  ? 5.155   -1.288  -0.892  1.00 0.00 ? 25  LEU A C    7  
ATOM 10699 O O    . LEU A 1 25  ? 6.176   -0.613  -0.765  1.00 0.00 ? 25  LEU A O    7  
ATOM 10700 C CB   . LEU A 1 25  ? 2.998   -1.152  0.484   1.00 0.00 ? 25  LEU A CB   7  
ATOM 10701 C CG   . LEU A 1 25  ? 2.294   -1.386  1.823   1.00 0.00 ? 25  LEU A CG   7  
ATOM 10702 C CD1  . LEU A 1 25  ? 2.513   -2.819  2.313   1.00 0.00 ? 25  LEU A CD1  7  
ATOM 10703 C CD2  . LEU A 1 25  ? 2.733   -0.351  2.861   1.00 0.00 ? 25  LEU A CD2  7  
ATOM 10704 H H    . LEU A 1 25  ? 5.323   -0.562  1.752   1.00 0.00 ? 25  LEU A H    7  
ATOM 10705 H HA   . LEU A 1 25  ? 4.250   -2.852  0.256   1.00 0.00 ? 25  LEU A HA   7  
ATOM 10706 H HB3  . LEU A 1 25  ? 2.362   -1.541  -0.312  1.00 0.00 ? 25  LEU A HB3  7  
ATOM 10707 H HG   . LEU A 1 25  ? 1.222   -1.257  1.672   1.00 0.00 ? 25  LEU A HG   7  
ATOM 10708 H HD11 . LEU A 1 25  ? 2.721   -3.466  1.463   1.00 0.00 ? 25  LEU A HD11 7  
ATOM 10709 H HD12 . LEU A 1 25  ? 3.357   -2.842  3.003   1.00 0.00 ? 25  LEU A HD12 7  
ATOM 10710 H HD13 . LEU A 1 25  ? 1.616   -3.168  2.825   1.00 0.00 ? 25  LEU A HD13 7  
ATOM 10711 H HD21 . LEU A 1 25  ? 2.635   0.650   2.440   1.00 0.00 ? 25  LEU A HD21 7  
ATOM 10712 H HD22 . LEU A 1 25  ? 2.103   -0.435  3.747   1.00 0.00 ? 25  LEU A HD22 7  
ATOM 10713 H HD23 . LEU A 1 25  ? 3.772   -0.530  3.136   1.00 0.00 ? 25  LEU A HD23 7  
ATOM 10714 N N    . ARG A 1 26  ? 4.634   -1.647  -2.056  1.00 0.00 ? 26  ARG A N    7  
ATOM 10715 C CA   . ARG A 1 26  ? 5.257   -1.255  -3.308  1.00 0.00 ? 26  ARG A CA   7  
ATOM 10716 C C    . ARG A 1 26  ? 4.193   -1.043  -4.387  1.00 0.00 ? 26  ARG A C    7  
ATOM 10717 O O    . ARG A 1 26  ? 3.474   -1.973  -4.746  1.00 0.00 ? 26  ARG A O    7  
ATOM 10718 C CB   . ARG A 1 26  ? 6.250   -2.317  -3.785  1.00 0.00 ? 26  ARG A CB   7  
ATOM 10719 C CG   . ARG A 1 26  ? 6.911   -1.898  -5.099  1.00 0.00 ? 26  ARG A CG   7  
ATOM 10720 C CD   . ARG A 1 26  ? 8.201   -2.686  -5.341  1.00 0.00 ? 26  ARG A CD   7  
ATOM 10721 N NE   . ARG A 1 26  ? 9.356   -1.762  -5.389  1.00 0.00 ? 26  ARG A NE   7  
ATOM 10722 C CZ   . ARG A 1 26  ? 10.596  -2.130  -5.739  1.00 0.00 ? 26  ARG A CZ   7  
ATOM 10723 N NH1  . ARG A 1 26  ? 10.850  -3.402  -6.074  1.00 0.00 ? 26  ARG A NH1  7  
ATOM 10724 N NH2  . ARG A 1 26  ? 11.584  -1.224  -5.753  1.00 0.00 ? 26  ARG A NH2  7  
ATOM 10725 H H    . ARG A 1 26  ? 3.803   -2.196  -2.150  1.00 0.00 ? 26  ARG A H    7  
ATOM 10726 H HA   . ARG A 1 26  ? 5.777   -0.325  -3.081  1.00 0.00 ? 26  ARG A HA   7  
ATOM 10727 H HB3  . ARG A 1 26  ? 5.736   -3.268  -3.920  1.00 0.00 ? 26  ARG A HB3  7  
ATOM 10728 H HG3  . ARG A 1 26  ? 7.132   -0.831  -5.077  1.00 0.00 ? 26  ARG A HG3  7  
ATOM 10729 H HD3  . ARG A 1 26  ? 8.128   -3.240  -6.277  1.00 0.00 ? 26  ARG A HD3  7  
ATOM 10730 H HE   . ARG A 1 26  ? 9.201   -0.806  -5.144  1.00 0.00 ? 26  ARG A HE   7  
ATOM 10731 H HH11 . ARG A 1 26  ? 10.112  -4.078  -6.064  1.00 0.00 ? 26  ARG A HH11 7  
ATOM 10732 H HH12 . ARG A 1 26  ? 11.775  -3.675  -6.336  1.00 0.00 ? 26  ARG A HH12 7  
ATOM 10733 H HH21 . ARG A 1 26  ? 11.395  -0.275  -5.502  1.00 0.00 ? 26  ARG A HH21 7  
ATOM 10734 H HH22 . ARG A 1 26  ? 12.510  -1.497  -6.015  1.00 0.00 ? 26  ARG A HH22 7  
ATOM 10735 N N    . HIS A 1 27  ? 4.126   0.189   -4.871  1.00 0.00 ? 27  HIS A N    7  
ATOM 10736 C CA   . HIS A 1 27  ? 3.161   0.537   -5.900  1.00 0.00 ? 27  HIS A CA   7  
ATOM 10737 C C    . HIS A 1 27  ? 3.321   2.010   -6.278  1.00 0.00 ? 27  HIS A C    7  
ATOM 10738 O O    . HIS A 1 27  ? 2.409   2.810   -6.078  1.00 0.00 ? 27  HIS A O    7  
ATOM 10739 C CB   . HIS A 1 27  ? 1.739   0.191   -5.453  1.00 0.00 ? 27  HIS A CB   7  
ATOM 10740 C CG   . HIS A 1 27  ? 0.664   0.670   -6.397  1.00 0.00 ? 27  HIS A CG   7  
ATOM 10741 N ND1  . HIS A 1 27  ? 0.944   1.207   -7.642  1.00 0.00 ? 27  HIS A ND1  7  
ATOM 10742 C CD2  . HIS A 1 27  ? -0.693  0.688   -6.267  1.00 0.00 ? 27  HIS A CD2  7  
ATOM 10743 C CE1  . HIS A 1 27  ? -0.201  1.531   -8.225  1.00 0.00 ? 27  HIS A CE1  7  
ATOM 10744 N NE2  . HIS A 1 27  ? -1.215  1.208   -7.372  1.00 0.00 ? 27  HIS A NE2  7  
ATOM 10745 H H    . HIS A 1 27  ? 4.714   0.940   -4.572  1.00 0.00 ? 27  HIS A H    7  
ATOM 10746 H HA   . HIS A 1 27  ? 3.395   -0.080  -6.768  1.00 0.00 ? 27  HIS A HA   7  
ATOM 10747 H HB3  . HIS A 1 27  ? 1.564   0.624   -4.468  1.00 0.00 ? 27  HIS A HB3  7  
ATOM 10748 H HD1  . HIS A 1 27  ? 1.856   1.332   -8.034  1.00 0.00 ? 27  HIS A HD1  7  
ATOM 10749 H HD2  . HIS A 1 27  ? -1.255  0.334   -5.403  1.00 0.00 ? 27  HIS A HD2  7  
ATOM 10750 H HE1  . HIS A 1 27  ? -0.313  1.977   -9.214  1.00 0.00 ? 27  HIS A HE1  7  
ATOM 10751 N N    . PHE A 1 28  ? 4.490   2.326   -6.819  1.00 0.00 ? 28  PHE A N    7  
ATOM 10752 C CA   . PHE A 1 28  ? 4.782   3.688   -7.227  1.00 0.00 ? 28  PHE A CA   7  
ATOM 10753 C C    . PHE A 1 28  ? 4.517   3.882   -8.722  1.00 0.00 ? 28  PHE A C    7  
ATOM 10754 O O    . PHE A 1 28  ? 4.628   4.995   -9.236  1.00 0.00 ? 28  PHE A O    7  
ATOM 10755 C CB   . PHE A 1 28  ? 6.267   3.930   -6.948  1.00 0.00 ? 28  PHE A CB   7  
ATOM 10756 C CG   . PHE A 1 28  ? 6.759   5.319   -7.361  1.00 0.00 ? 28  PHE A CG   7  
ATOM 10757 C CD1  . PHE A 1 28  ? 5.882   6.353   -7.451  1.00 0.00 ? 28  PHE A CD1  7  
ATOM 10758 C CD2  . PHE A 1 28  ? 8.076   5.518   -7.638  1.00 0.00 ? 28  PHE A CD2  7  
ATOM 10759 C CE1  . PHE A 1 28  ? 6.339   7.642   -7.835  1.00 0.00 ? 28  PHE A CE1  7  
ATOM 10760 C CE2  . PHE A 1 28  ? 8.535   6.807   -8.021  1.00 0.00 ? 28  PHE A CE2  7  
ATOM 10761 C CZ   . PHE A 1 28  ? 7.656   7.841   -8.112  1.00 0.00 ? 28  PHE A CZ   7  
ATOM 10762 H H    . PHE A 1 28  ? 5.227   1.669   -6.979  1.00 0.00 ? 28  PHE A H    7  
ATOM 10763 H HA   . PHE A 1 28  ? 4.126   4.346   -6.655  1.00 0.00 ? 28  PHE A HA   7  
ATOM 10764 H HB3  . PHE A 1 28  ? 6.852   3.177   -7.475  1.00 0.00 ? 28  PHE A HB3  7  
ATOM 10765 H HD1  . PHE A 1 28  ? 4.826   6.192   -7.230  1.00 0.00 ? 28  PHE A HD1  7  
ATOM 10766 H HD2  . PHE A 1 28  ? 8.781   4.689   -7.565  1.00 0.00 ? 28  PHE A HD2  7  
ATOM 10767 H HE1  . PHE A 1 28  ? 5.635   8.471   -7.909  1.00 0.00 ? 28  PHE A HE1  7  
ATOM 10768 H HE2  . PHE A 1 28  ? 9.589   6.966   -8.244  1.00 0.00 ? 28  PHE A HE2  7  
ATOM 10769 H HZ   . PHE A 1 28  ? 8.007   8.831   -8.407  1.00 0.00 ? 28  PHE A HZ   7  
ATOM 10770 N N    . ILE A 1 29  ? 4.173   2.784   -9.376  1.00 0.00 ? 29  ILE A N    7  
ATOM 10771 C CA   . ILE A 1 29  ? 3.893   2.819   -10.801 1.00 0.00 ? 29  ILE A CA   7  
ATOM 10772 C C    . ILE A 1 29  ? 2.995   4.019   -11.111 1.00 0.00 ? 29  ILE A C    7  
ATOM 10773 O O    . ILE A 1 29  ? 3.471   5.050   -11.581 1.00 0.00 ? 29  ILE A O    7  
ATOM 10774 C CB   . ILE A 1 29  ? 3.313   1.482   -11.267 1.00 0.00 ? 29  ILE A CB   7  
ATOM 10775 C CG1  . ILE A 1 29  ? 4.316   0.345   -11.053 1.00 0.00 ? 29  ILE A CG1  7  
ATOM 10776 C CG2  . ILE A 1 29  ? 2.842   1.564   -12.719 1.00 0.00 ? 29  ILE A CG2  7  
ATOM 10777 C CD1  . ILE A 1 29  ? 3.765   -0.979  -11.586 1.00 0.00 ? 29  ILE A CD1  7  
ATOM 10778 H H    . ILE A 1 29  ? 4.086   1.884   -8.950  1.00 0.00 ? 29  ILE A H    7  
ATOM 10779 H HA   . ILE A 1 29  ? 4.843   2.956   -11.319 1.00 0.00 ? 29  ILE A HA   7  
ATOM 10780 H HB   . ILE A 1 29  ? 2.439   1.258   -10.656 1.00 0.00 ? 29  ILE A HB   7  
ATOM 10781 H HG13 . ILE A 1 29  ? 4.540   0.250   -9.989  1.00 0.00 ? 29  ILE A HG13 7  
ATOM 10782 H HG21 . ILE A 1 29  ? 1.977   2.224   -12.784 1.00 0.00 ? 29  ILE A HG21 7  
ATOM 10783 H HG22 . ILE A 1 29  ? 3.647   1.958   -13.341 1.00 0.00 ? 29  ILE A HG22 7  
ATOM 10784 H HG23 . ILE A 1 29  ? 2.566   0.569   -13.069 1.00 0.00 ? 29  ILE A HG23 7  
ATOM 10785 H HD11 . ILE A 1 29  ? 2.708   -1.062  -11.331 1.00 0.00 ? 29  ILE A HD11 7  
ATOM 10786 H HD12 . ILE A 1 29  ? 3.882   -1.011  -12.668 1.00 0.00 ? 29  ILE A HD12 7  
ATOM 10787 H HD13 . ILE A 1 29  ? 4.313   -1.806  -11.135 1.00 0.00 ? 29  ILE A HD13 7  
ATOM 10788 N N    . VAL A 1 30  ? 1.711   3.844   -10.833 1.00 0.00 ? 30  VAL A N    7  
ATOM 10789 C CA   . VAL A 1 30  ? 0.743   4.899   -11.075 1.00 0.00 ? 30  VAL A CA   7  
ATOM 10790 C C    . VAL A 1 30  ? 0.900   5.412   -12.507 1.00 0.00 ? 30  VAL A C    7  
ATOM 10791 O O    . VAL A 1 30  ? 1.780   4.959   -13.239 1.00 0.00 ? 30  VAL A O    7  
ATOM 10792 C CB   . VAL A 1 30  ? 0.898   6.003   -10.025 1.00 0.00 ? 30  VAL A CB   7  
ATOM 10793 C CG1  . VAL A 1 30  ? 2.141   6.850   -10.300 1.00 0.00 ? 30  VAL A CG1  7  
ATOM 10794 C CG2  . VAL A 1 30  ? -0.358  6.876   -9.959  1.00 0.00 ? 30  VAL A CG2  7  
ATOM 10795 H H    . VAL A 1 30  ? 1.331   3.003   -10.449 1.00 0.00 ? 30  VAL A H    7  
ATOM 10796 H HA   . VAL A 1 30  ? -0.251  4.466   -10.964 1.00 0.00 ? 30  VAL A HA   7  
ATOM 10797 H HB   . VAL A 1 30  ? 1.024   5.525   -9.054  1.00 0.00 ? 30  VAL A HB   7  
ATOM 10798 H HG11 . VAL A 1 30  ? 2.273   6.964   -11.376 1.00 0.00 ? 30  VAL A HG11 7  
ATOM 10799 H HG12 . VAL A 1 30  ? 2.021   7.832   -9.844  1.00 0.00 ? 30  VAL A HG12 7  
ATOM 10800 H HG13 . VAL A 1 30  ? 3.018   6.358   -9.878  1.00 0.00 ? 30  VAL A HG13 7  
ATOM 10801 H HG21 . VAL A 1 30  ? -0.200  7.783   -10.543 1.00 0.00 ? 30  VAL A HG21 7  
ATOM 10802 H HG22 . VAL A 1 30  ? -1.205  6.326   -10.365 1.00 0.00 ? 30  VAL A HG22 7  
ATOM 10803 H HG23 . VAL A 1 30  ? -0.559  7.143   -8.921  1.00 0.00 ? 30  VAL A HG23 7  
ATOM 10804 N N    . TYR A 1 31  ? 0.034   6.348   -12.866 1.00 0.00 ? 31  TYR A N    7  
ATOM 10805 C CA   . TYR A 1 31  ? 0.066   6.926   -14.200 1.00 0.00 ? 31  TYR A CA   7  
ATOM 10806 C C    . TYR A 1 31  ? -0.608  8.299   -14.218 1.00 0.00 ? 31  TYR A C    7  
ATOM 10807 O O    . TYR A 1 31  ? -1.778  8.416   -14.581 1.00 0.00 ? 31  TYR A O    7  
ATOM 10808 C CB   . TYR A 1 31  ? -0.727  5.970   -15.093 1.00 0.00 ? 31  TYR A CB   7  
ATOM 10809 C CG   . TYR A 1 31  ? 0.022   4.684   -15.447 1.00 0.00 ? 31  TYR A CG   7  
ATOM 10810 C CD1  . TYR A 1 31  ? 0.024   3.621   -14.567 1.00 0.00 ? 31  TYR A CD1  7  
ATOM 10811 C CD2  . TYR A 1 31  ? 0.699   4.587   -16.647 1.00 0.00 ? 31  TYR A CD2  7  
ATOM 10812 C CE1  . TYR A 1 31  ? 0.730   2.410   -14.900 1.00 0.00 ? 31  TYR A CE1  7  
ATOM 10813 C CE2  . TYR A 1 31  ? 1.403   3.376   -16.980 1.00 0.00 ? 31  TYR A CE2  7  
ATOM 10814 C CZ   . TYR A 1 31  ? 1.383   2.349   -16.090 1.00 0.00 ? 31  TYR A CZ   7  
ATOM 10815 O OH   . TYR A 1 31  ? 2.050   1.205   -16.407 1.00 0.00 ? 31  TYR A OH   7  
ATOM 10816 H H    . TYR A 1 31  ? -0.679  6.710   -12.266 1.00 0.00 ? 31  TYR A H    7  
ATOM 10817 H HA   . TYR A 1 31  ? 1.110   7.038   -14.493 1.00 0.00 ? 31  TYR A HA   7  
ATOM 10818 H HB3  . TYR A 1 31  ? -0.996  6.487   -16.014 1.00 0.00 ? 31  TYR A HB3  7  
ATOM 10819 H HD1  . TYR A 1 31  ? -0.509  3.697   -13.619 1.00 0.00 ? 31  TYR A HD1  7  
ATOM 10820 H HD2  . TYR A 1 31  ? 0.696   5.427   -17.342 1.00 0.00 ? 31  TYR A HD2  7  
ATOM 10821 H HE1  . TYR A 1 31  ? 0.738   1.563   -14.215 1.00 0.00 ? 31  TYR A HE1  7  
ATOM 10822 H HE2  . TYR A 1 31  ? 1.941   3.287   -17.925 1.00 0.00 ? 31  TYR A HE2  7  
ATOM 10823 H HH   . TYR A 1 31  ? 3.004   1.413   -16.618 1.00 0.00 ? 31  TYR A HH   7  
ATOM 10824 N N    . PRO A 1 32  ? 0.178   9.331   -13.810 1.00 0.00 ? 32  PRO A N    7  
ATOM 10825 C CA   . PRO A 1 32  ? -0.330  10.691  -13.776 1.00 0.00 ? 32  PRO A CA   7  
ATOM 10826 C C    . PRO A 1 32  ? -0.427  11.277  -15.187 1.00 0.00 ? 32  PRO A C    7  
ATOM 10827 O O    . PRO A 1 32  ? 0.149   10.733  -16.128 1.00 0.00 ? 32  PRO A O    7  
ATOM 10828 C CB   . PRO A 1 32  ? 0.637   11.450  -12.884 1.00 0.00 ? 32  PRO A CB   7  
ATOM 10829 C CG   . PRO A 1 32  ? 1.902   10.610  -12.827 1.00 0.00 ? 32  PRO A CG   7  
ATOM 10830 C CD   . PRO A 1 32  ? 1.568   9.231   -13.373 1.00 0.00 ? 32  PRO A CD   7  
ATOM 10831 H HA   . PRO A 1 32  ? -1.262  10.706  -13.411 1.00 0.00 ? 32  PRO A HA   7  
ATOM 10832 H HB3  . PRO A 1 32  ? 0.218   11.595  -11.888 1.00 0.00 ? 32  PRO A HB3  7  
ATOM 10833 H HG3  . PRO A 1 32  ? 2.266   10.536  -11.803 1.00 0.00 ? 32  PRO A HG3  7  
ATOM 10834 H HD3  . PRO A 1 32  ? 1.687   8.462   -12.609 1.00 0.00 ? 32  PRO A HD3  7  
ATOM 10835 N N    . PRO A 1 33  ? -1.178  12.405  -15.291 1.00 0.00 ? 33  PRO A N    7  
ATOM 10836 C CA   . PRO A 1 33  ? -1.356  13.070  -16.571 1.00 0.00 ? 33  PRO A CA   7  
ATOM 10837 C C    . PRO A 1 33  ? -0.092  13.831  -16.975 1.00 0.00 ? 33  PRO A C    7  
ATOM 10838 O O    . PRO A 1 33  ? 0.974   13.624  -16.396 1.00 0.00 ? 33  PRO A O    7  
ATOM 10839 C CB   . PRO A 1 33  ? -2.561  13.977  -16.379 1.00 0.00 ? 33  PRO A CB   7  
ATOM 10840 C CG   . PRO A 1 33  ? -2.725  14.137  -14.876 1.00 0.00 ? 33  PRO A CG   7  
ATOM 10841 C CD   . PRO A 1 33  ? -1.874  13.077  -14.198 1.00 0.00 ? 33  PRO A CD   7  
ATOM 10842 H HA   . PRO A 1 33  ? -1.511  12.395  -17.293 1.00 0.00 ? 33  PRO A HA   7  
ATOM 10843 H HB3  . PRO A 1 33  ? -3.454  13.540  -16.825 1.00 0.00 ? 33  PRO A HB3  7  
ATOM 10844 H HG3  . PRO A 1 33  ? -3.773  14.025  -14.592 1.00 0.00 ? 33  PRO A HG3  7  
ATOM 10845 H HD3  . PRO A 1 33  ? -2.488  12.378  -13.630 1.00 0.00 ? 33  PRO A HD3  7  
ATOM 10846 N N    . GLU A 1 34  ? -0.254  14.698  -17.965 1.00 0.00 ? 34  GLU A N    7  
ATOM 10847 C CA   . GLU A 1 34  ? 0.862   15.492  -18.452 1.00 0.00 ? 34  GLU A CA   7  
ATOM 10848 C C    . GLU A 1 34  ? 1.332   16.467  -17.371 1.00 0.00 ? 34  GLU A C    7  
ATOM 10849 O O    . GLU A 1 34  ? 2.335   16.222  -16.701 1.00 0.00 ? 34  GLU A O    7  
ATOM 10850 C CB   . GLU A 1 34  ? 0.485   16.237  -19.735 1.00 0.00 ? 34  GLU A CB   7  
ATOM 10851 C CG   . GLU A 1 34  ? 1.474   15.924  -20.859 1.00 0.00 ? 34  GLU A CG   7  
ATOM 10852 C CD   . GLU A 1 34  ? 0.760   15.846  -22.211 1.00 0.00 ? 34  GLU A CD   7  
ATOM 10853 O OE1  . GLU A 1 34  ? 0.141   16.866  -22.586 1.00 0.00 ? 34  GLU A OE1  7  
ATOM 10854 O OE2  . GLU A 1 34  ? 0.849   14.768  -22.839 1.00 0.00 ? 34  GLU A OE2  7  
ATOM 10855 H H    . GLU A 1 34  ? -1.123  14.861  -18.429 1.00 0.00 ? 34  GLU A H    7  
ATOM 10856 H HA   . GLU A 1 34  ? 1.653   14.776  -18.674 1.00 0.00 ? 34  GLU A HA   7  
ATOM 10857 H HB3  . GLU A 1 34  ? 0.472   17.309  -19.546 1.00 0.00 ? 34  GLU A HB3  7  
ATOM 10858 H HG3  . GLU A 1 34  ? 1.976   14.979  -20.656 1.00 0.00 ? 34  GLU A HG3  7  
ATOM 10859 N N    . SER A 1 35  ? 0.587   17.553  -17.232 1.00 0.00 ? 35  SER A N    7  
ATOM 10860 C CA   . SER A 1 35  ? 0.915   18.566  -16.243 1.00 0.00 ? 35  SER A CA   7  
ATOM 10861 C C    . SER A 1 35  ? -0.212  18.677  -15.215 1.00 0.00 ? 35  SER A C    7  
ATOM 10862 O O    . SER A 1 35  ? 0.020   18.525  -14.016 1.00 0.00 ? 35  SER A O    7  
ATOM 10863 C CB   . SER A 1 35  ? 1.164   19.922  -16.906 1.00 0.00 ? 35  SER A CB   7  
ATOM 10864 O OG   . SER A 1 35  ? 1.647   20.888  -15.978 1.00 0.00 ? 35  SER A OG   7  
ATOM 10865 H H    . SER A 1 35  ? -0.227  17.746  -17.780 1.00 0.00 ? 35  SER A H    7  
ATOM 10866 H HA   . SER A 1 35  ? 1.833   18.219  -15.770 1.00 0.00 ? 35  SER A HA   7  
ATOM 10867 H HB3  . SER A 1 35  ? 0.239   20.281  -17.356 1.00 0.00 ? 35  SER A HB3  7  
ATOM 10868 H HG   . SER A 1 35  ? 1.226   20.745  -15.083 1.00 0.00 ? 35  SER A HG   7  
ATOM 10869 N N    . ALA A 1 36  ? -1.409  18.941  -15.719 1.00 0.00 ? 36  ALA A N    7  
ATOM 10870 C CA   . ALA A 1 36  ? -2.571  19.074  -14.860 1.00 0.00 ? 36  ALA A CA   7  
ATOM 10871 C C    . ALA A 1 36  ? -2.352  20.238  -13.890 1.00 0.00 ? 36  ALA A C    7  
ATOM 10872 O O    . ALA A 1 36  ? -1.238  20.743  -13.763 1.00 0.00 ? 36  ALA A O    7  
ATOM 10873 C CB   . ALA A 1 36  ? -2.825  17.752  -14.134 1.00 0.00 ? 36  ALA A CB   7  
ATOM 10874 H H    . ALA A 1 36  ? -1.588  19.064  -16.696 1.00 0.00 ? 36  ALA A H    7  
ATOM 10875 H HA   . ALA A 1 36  ? -3.428  19.297  -15.494 1.00 0.00 ? 36  ALA A HA   7  
ATOM 10876 H HB1  . ALA A 1 36  ? -3.628  17.211  -14.635 1.00 0.00 ? 36  ALA A HB1  7  
ATOM 10877 H HB2  . ALA A 1 36  ? -1.916  17.149  -14.150 1.00 0.00 ? 36  ALA A HB2  7  
ATOM 10878 H HB3  . ALA A 1 36  ? -3.108  17.952  -13.102 1.00 0.00 ? 36  ALA A HB3  7  
ATOM 10879 N N    . ILE A 1 37  ? -3.433  20.629  -13.231 1.00 0.00 ? 37  ILE A N    7  
ATOM 10880 C CA   . ILE A 1 37  ? -3.373  21.723  -12.277 1.00 0.00 ? 37  ILE A CA   7  
ATOM 10881 C C    . ILE A 1 37  ? -3.646  21.184  -10.872 1.00 0.00 ? 37  ILE A C    7  
ATOM 10882 O O    . ILE A 1 37  ? -4.626  20.474  -10.655 1.00 0.00 ? 37  ILE A O    7  
ATOM 10883 C CB   . ILE A 1 37  ? -4.318  22.851  -12.697 1.00 0.00 ? 37  ILE A CB   7  
ATOM 10884 C CG1  . ILE A 1 37  ? -4.007  23.326  -14.118 1.00 0.00 ? 37  ILE A CG1  7  
ATOM 10885 C CG2  . ILE A 1 37  ? -4.281  24.001  -11.687 1.00 0.00 ? 37  ILE A CG2  7  
ATOM 10886 C CD1  . ILE A 1 37  ? -5.097  24.270  -14.631 1.00 0.00 ? 37  ILE A CD1  7  
ATOM 10887 H H    . ILE A 1 37  ? -4.336  20.212  -13.340 1.00 0.00 ? 37  ILE A H    7  
ATOM 10888 H HA   . ILE A 1 37  ? -2.361  22.125  -12.304 1.00 0.00 ? 37  ILE A HA   7  
ATOM 10889 H HB   . ILE A 1 37  ? -5.335  22.461  -12.703 1.00 0.00 ? 37  ILE A HB   7  
ATOM 10890 H HG13 . ILE A 1 37  ? -3.924  22.467  -14.782 1.00 0.00 ? 37  ILE A HG13 7  
ATOM 10891 H HG21 . ILE A 1 37  ? -3.268  24.401  -11.630 1.00 0.00 ? 37  ILE A HG21 7  
ATOM 10892 H HG22 . ILE A 1 37  ? -4.964  24.788  -12.008 1.00 0.00 ? 37  ILE A HG22 7  
ATOM 10893 H HG23 . ILE A 1 37  ? -4.582  23.634  -10.707 1.00 0.00 ? 37  ILE A HG23 7  
ATOM 10894 H HD11 . ILE A 1 37  ? -5.338  24.019  -15.664 1.00 0.00 ? 37  ILE A HD11 7  
ATOM 10895 H HD12 . ILE A 1 37  ? -5.989  24.164  -14.014 1.00 0.00 ? 37  ILE A HD12 7  
ATOM 10896 H HD13 . ILE A 1 37  ? -4.740  25.298  -14.581 1.00 0.00 ? 37  ILE A HD13 7  
ATOM 10897 N N    . GLN A 1 38  ? -2.761  21.543  -9.954  1.00 0.00 ? 38  GLN A N    7  
ATOM 10898 C CA   . GLN A 1 38  ? -2.893  21.104  -8.574  1.00 0.00 ? 38  GLN A CA   7  
ATOM 10899 C C    . GLN A 1 38  ? -3.891  21.992  -7.828  1.00 0.00 ? 38  GLN A C    7  
ATOM 10900 O O    . GLN A 1 38  ? -4.132  23.131  -8.225  1.00 0.00 ? 38  GLN A O    7  
ATOM 10901 C CB   . GLN A 1 38  ? -1.536  21.092  -7.870  1.00 0.00 ? 38  GLN A CB   7  
ATOM 10902 C CG   . GLN A 1 38  ? -1.430  19.913  -6.902  1.00 0.00 ? 38  GLN A CG   7  
ATOM 10903 C CD   . GLN A 1 38  ? -0.730  18.723  -7.560  1.00 0.00 ? 38  GLN A CD   7  
ATOM 10904 O OE1  . GLN A 1 38  ? -1.343  17.737  -7.932  1.00 0.00 ? 38  GLN A OE1  7  
ATOM 10905 N NE2  . GLN A 1 38  ? 0.587   18.871  -7.683  1.00 0.00 ? 38  GLN A NE2  7  
ATOM 10906 H H    . GLN A 1 38  ? -1.967  22.121  -10.139 1.00 0.00 ? 38  GLN A H    7  
ATOM 10907 H HA   . GLN A 1 38  ? -3.275  20.084  -8.630  1.00 0.00 ? 38  GLN A HA   7  
ATOM 10908 H HB3  . GLN A 1 38  ? -1.395  22.027  -7.327  1.00 0.00 ? 38  GLN A HB3  7  
ATOM 10909 H HG3  . GLN A 1 38  ? -2.427  19.616  -6.573  1.00 0.00 ? 38  GLN A HG3  7  
ATOM 10910 H HE21 . GLN A 1 38  ? 1.030   19.705  -7.356  1.00 0.00 ? 38  GLN A HE21 7  
ATOM 10911 H HE22 . GLN A 1 38  ? 1.134   18.146  -8.102  1.00 0.00 ? 38  GLN A HE22 7  
ATOM 10912 N N    . PHE A 1 39  ? -4.443  21.438  -6.759  1.00 0.00 ? 39  PHE A N    7  
ATOM 10913 C CA   . PHE A 1 39  ? -5.409  22.166  -5.954  1.00 0.00 ? 39  PHE A CA   7  
ATOM 10914 C C    . PHE A 1 39  ? -5.475  21.601  -4.533  1.00 0.00 ? 39  PHE A C    7  
ATOM 10915 O O    . PHE A 1 39  ? -5.307  22.335  -3.560  1.00 0.00 ? 39  PHE A O    7  
ATOM 10916 C CB   . PHE A 1 39  ? -6.773  21.991  -6.624  1.00 0.00 ? 39  PHE A CB   7  
ATOM 10917 C CG   . PHE A 1 39  ? -6.978  22.871  -7.859  1.00 0.00 ? 39  PHE A CG   7  
ATOM 10918 C CD1  . PHE A 1 39  ? -7.086  24.219  -7.723  1.00 0.00 ? 39  PHE A CD1  7  
ATOM 10919 C CD2  . PHE A 1 39  ? -7.051  22.304  -9.093  1.00 0.00 ? 39  PHE A CD2  7  
ATOM 10920 C CE1  . PHE A 1 39  ? -7.276  25.036  -8.868  1.00 0.00 ? 39  PHE A CE1  7  
ATOM 10921 C CE2  . PHE A 1 39  ? -7.240  23.121  -10.239 1.00 0.00 ? 39  PHE A CE2  7  
ATOM 10922 C CZ   . PHE A 1 39  ? -7.348  24.470  -10.102 1.00 0.00 ? 39  PHE A CZ   7  
ATOM 10923 H H    . PHE A 1 39  ? -4.242  20.512  -6.443  1.00 0.00 ? 39  PHE A H    7  
ATOM 10924 H HA   . PHE A 1 39  ? -5.081  23.205  -5.915  1.00 0.00 ? 39  PHE A HA   7  
ATOM 10925 H HB3  . PHE A 1 39  ? -7.555  22.214  -5.898  1.00 0.00 ? 39  PHE A HB3  7  
ATOM 10926 H HD1  . PHE A 1 39  ? -7.027  24.674  -6.733  1.00 0.00 ? 39  PHE A HD1  7  
ATOM 10927 H HD2  . PHE A 1 39  ? -6.964  21.223  -9.202  1.00 0.00 ? 39  PHE A HD2  7  
ATOM 10928 H HE1  . PHE A 1 39  ? -7.363  26.118  -8.759  1.00 0.00 ? 39  PHE A HE1  7  
ATOM 10929 H HE2  . PHE A 1 39  ? -7.300  22.667  -11.228 1.00 0.00 ? 39  PHE A HE2  7  
ATOM 10930 H HZ   . PHE A 1 39  ? -7.494  25.097  -10.982 1.00 0.00 ? 39  PHE A HZ   7  
ATOM 10931 N N    . SER A 1 40  ? -5.722  20.301  -4.459  1.00 0.00 ? 40  SER A N    7  
ATOM 10932 C CA   . SER A 1 40  ? -5.813  19.629  -3.174  1.00 0.00 ? 40  SER A CA   7  
ATOM 10933 C C    . SER A 1 40  ? -4.548  19.894  -2.355  1.00 0.00 ? 40  SER A C    7  
ATOM 10934 O O    . SER A 1 40  ? -3.482  20.147  -2.915  1.00 0.00 ? 40  SER A O    7  
ATOM 10935 C CB   . SER A 1 40  ? -6.024  18.124  -3.353  1.00 0.00 ? 40  SER A CB   7  
ATOM 10936 O OG   . SER A 1 40  ? -5.891  17.417  -2.124  1.00 0.00 ? 40  SER A OG   7  
ATOM 10937 H H    . SER A 1 40  ? -5.857  19.711  -5.256  1.00 0.00 ? 40  SER A H    7  
ATOM 10938 H HA   . SER A 1 40  ? -6.685  20.062  -2.683  1.00 0.00 ? 40  SER A HA   7  
ATOM 10939 H HB3  . SER A 1 40  ? -5.302  17.740  -4.074  1.00 0.00 ? 40  SER A HB3  7  
ATOM 10940 H HG   . SER A 1 40  ? -6.700  16.854  -1.964  1.00 0.00 ? 40  SER A HG   7  
ATOM 10941 N N    . TYR A 1 41  ? -4.706  19.825  -1.041  1.00 0.00 ? 41  TYR A N    7  
ATOM 10942 C CA   . TYR A 1 41  ? -3.591  20.053  -0.139  1.00 0.00 ? 41  TYR A CA   7  
ATOM 10943 C C    . TYR A 1 41  ? -3.991  19.771  1.310   1.00 0.00 ? 41  TYR A C    7  
ATOM 10944 O O    . TYR A 1 41  ? -3.330  18.998  2.002   1.00 0.00 ? 41  TYR A O    7  
ATOM 10945 C CB   . TYR A 1 41  ? -3.233  21.534  -0.278  1.00 0.00 ? 41  TYR A CB   7  
ATOM 10946 C CG   . TYR A 1 41  ? -2.313  22.059  0.827   1.00 0.00 ? 41  TYR A CG   7  
ATOM 10947 C CD1  . TYR A 1 41  ? -1.033  21.561  0.952   1.00 0.00 ? 41  TYR A CD1  7  
ATOM 10948 C CD2  . TYR A 1 41  ? -2.764  23.029  1.697   1.00 0.00 ? 41  TYR A CD2  7  
ATOM 10949 C CE1  . TYR A 1 41  ? -0.166  22.054  1.992   1.00 0.00 ? 41  TYR A CE1  7  
ATOM 10950 C CE2  . TYR A 1 41  ? -1.899  23.524  2.737   1.00 0.00 ? 41  TYR A CE2  7  
ATOM 10951 C CZ   . TYR A 1 41  ? -0.643  23.011  2.833   1.00 0.00 ? 41  TYR A CZ   7  
ATOM 10952 O OH   . TYR A 1 41  ? 0.174   23.477  3.814   1.00 0.00 ? 41  TYR A OH   7  
ATOM 10953 H H    . TYR A 1 41  ? -5.576  19.617  -0.593  1.00 0.00 ? 41  TYR A H    7  
ATOM 10954 H HA   . TYR A 1 41  ? -2.784  19.377  -0.423  1.00 0.00 ? 41  TYR A HA   7  
ATOM 10955 H HB3  . TYR A 1 41  ? -4.152  22.121  -0.281  1.00 0.00 ? 41  TYR A HB3  7  
ATOM 10956 H HD1  . TYR A 1 41  ? -0.676  20.794  0.265   1.00 0.00 ? 41  TYR A HD1  7  
ATOM 10957 H HD2  . TYR A 1 41  ? -3.776  23.423  1.597   1.00 0.00 ? 41  TYR A HD2  7  
ATOM 10958 H HE1  . TYR A 1 41  ? 0.847   21.669  2.102   1.00 0.00 ? 41  TYR A HE1  7  
ATOM 10959 H HE2  . TYR A 1 41  ? -2.243  24.290  3.430   1.00 0.00 ? 41  TYR A HE2  7  
ATOM 10960 H HH   . TYR A 1 41  ? 1.069   23.032  3.755   1.00 0.00 ? 41  TYR A HH   7  
ATOM 10961 N N    . LYS A 1 42  ? -5.071  20.414  1.729   1.00 0.00 ? 42  LYS A N    7  
ATOM 10962 C CA   . LYS A 1 42  ? -5.566  20.244  3.083   1.00 0.00 ? 42  LYS A CA   7  
ATOM 10963 C C    . LYS A 1 42  ? -6.160  18.842  3.231   1.00 0.00 ? 42  LYS A C    7  
ATOM 10964 O O    . LYS A 1 42  ? -6.376  18.147  2.238   1.00 0.00 ? 42  LYS A O    7  
ATOM 10965 C CB   . LYS A 1 42  ? -6.544  21.365  3.442   1.00 0.00 ? 42  LYS A CB   7  
ATOM 10966 C CG   . LYS A 1 42  ? -6.367  21.800  4.900   1.00 0.00 ? 42  LYS A CG   7  
ATOM 10967 C CD   . LYS A 1 42  ? -6.275  23.324  5.008   1.00 0.00 ? 42  LYS A CD   7  
ATOM 10968 C CE   . LYS A 1 42  ? -6.890  23.818  6.320   1.00 0.00 ? 42  LYS A CE   7  
ATOM 10969 N NZ   . LYS A 1 42  ? -8.002  24.757  6.051   1.00 0.00 ? 42  LYS A NZ   7  
ATOM 10970 H H    . LYS A 1 42  ? -5.603  21.044  1.161   1.00 0.00 ? 42  LYS A H    7  
ATOM 10971 H HA   . LYS A 1 42  ? -4.713  20.330  3.757   1.00 0.00 ? 42  LYS A HA   7  
ATOM 10972 H HB3  . LYS A 1 42  ? -7.567  21.027  3.282   1.00 0.00 ? 42  LYS A HB3  7  
ATOM 10973 H HG3  . LYS A 1 42  ? -5.464  21.349  5.310   1.00 0.00 ? 42  LYS A HG3  7  
ATOM 10974 H HD3  . LYS A 1 42  ? -6.791  23.785  4.166   1.00 0.00 ? 42  LYS A HD3  7  
ATOM 10975 H HE3  . LYS A 1 42  ? -6.128  24.310  6.923   1.00 0.00 ? 42  LYS A HE3  7  
ATOM 10976 H HZ1  . LYS A 1 42  ? -8.185  25.299  6.871   1.00 0.00 ? 42  LYS A HZ1  7  
ATOM 10977 H HZ2  . LYS A 1 42  ? -7.749  25.366  5.299   1.00 0.00 ? 42  LYS A HZ2  7  
ATOM 10978 H HZ3  . LYS A 1 42  ? -8.821  24.241  5.801   1.00 0.00 ? 42  LYS A HZ3  7  
ATOM 10979 N N    . ASP A 1 43  ? -6.408  18.466  4.477   1.00 0.00 ? 43  ASP A N    7  
ATOM 10980 C CA   . ASP A 1 43  ? -6.972  17.158  4.768   1.00 0.00 ? 43  ASP A CA   7  
ATOM 10981 C C    . ASP A 1 43  ? -8.439  17.321  5.171   1.00 0.00 ? 43  ASP A C    7  
ATOM 10982 O O    . ASP A 1 43  ? -8.738  17.818  6.255   1.00 0.00 ? 43  ASP A O    7  
ATOM 10983 C CB   . ASP A 1 43  ? -6.234  16.485  5.926   1.00 0.00 ? 43  ASP A CB   7  
ATOM 10984 C CG   . ASP A 1 43  ? -6.944  15.271  6.525   1.00 0.00 ? 43  ASP A CG   7  
ATOM 10985 O OD1  . ASP A 1 43  ? -7.241  14.342  5.742   1.00 0.00 ? 43  ASP A OD1  7  
ATOM 10986 O OD2  . ASP A 1 43  ? -7.175  15.296  7.753   1.00 0.00 ? 43  ASP A OD2  7  
ATOM 10987 H H    . ASP A 1 43  ? -6.229  19.037  5.279   1.00 0.00 ? 43  ASP A H    7  
ATOM 10988 H HA   . ASP A 1 43  ? -6.853  16.585  3.849   1.00 0.00 ? 43  ASP A HA   7  
ATOM 10989 H HB3  . ASP A 1 43  ? -6.078  17.222  6.715   1.00 0.00 ? 43  ASP A HB3  7  
ATOM 10990 N N    . GLU A 1 44  ? -9.316  16.889  4.276   1.00 0.00 ? 44  GLU A N    7  
ATOM 10991 C CA   . GLU A 1 44  ? -10.745 16.979  4.525   1.00 0.00 ? 44  GLU A CA   7  
ATOM 10992 C C    . GLU A 1 44  ? -11.345 15.580  4.681   1.00 0.00 ? 44  GLU A C    7  
ATOM 10993 O O    . GLU A 1 44  ? -10.879 14.628  4.059   1.00 0.00 ? 44  GLU A O    7  
ATOM 10994 C CB   . GLU A 1 44  ? -11.448 17.757  3.411   1.00 0.00 ? 44  GLU A CB   7  
ATOM 10995 C CG   . GLU A 1 44  ? -12.963 17.557  3.474   1.00 0.00 ? 44  GLU A CG   7  
ATOM 10996 C CD   . GLU A 1 44  ? -13.555 18.236  4.712   1.00 0.00 ? 44  GLU A CD   7  
ATOM 10997 O OE1  . GLU A 1 44  ? -13.068 19.339  5.041   1.00 0.00 ? 44  GLU A OE1  7  
ATOM 10998 O OE2  . GLU A 1 44  ? -14.481 17.636  5.301   1.00 0.00 ? 44  GLU A OE2  7  
ATOM 10999 H H    . GLU A 1 44  ? -9.065  16.485  3.396   1.00 0.00 ? 44  GLU A H    7  
ATOM 11000 H HA   . GLU A 1 44  ? -10.841 17.530  5.461   1.00 0.00 ? 44  GLU A HA   7  
ATOM 11001 H HB3  . GLU A 1 44  ? -11.074 17.428  2.441   1.00 0.00 ? 44  GLU A HB3  7  
ATOM 11002 H HG3  . GLU A 1 44  ? -13.193 16.491  3.496   1.00 0.00 ? 44  GLU A HG3  7  
ATOM 11003 N N    . GLU A 1 45  ? -12.372 15.502  5.514   1.00 0.00 ? 45  GLU A N    7  
ATOM 11004 C CA   . GLU A 1 45  ? -13.042 14.236  5.760   1.00 0.00 ? 45  GLU A CA   7  
ATOM 11005 C C    . GLU A 1 45  ? -14.559 14.414  5.684   1.00 0.00 ? 45  GLU A C    7  
ATOM 11006 O O    . GLU A 1 45  ? -15.197 14.769  6.674   1.00 0.00 ? 45  GLU A O    7  
ATOM 11007 C CB   . GLU A 1 45  ? -12.626 13.648  7.110   1.00 0.00 ? 45  GLU A CB   7  
ATOM 11008 C CG   . GLU A 1 45  ? -12.168 12.197  6.959   1.00 0.00 ? 45  GLU A CG   7  
ATOM 11009 C CD   . GLU A 1 45  ? -13.299 11.225  7.302   1.00 0.00 ? 45  GLU A CD   7  
ATOM 11010 O OE1  . GLU A 1 45  ? -14.307 11.241  6.561   1.00 0.00 ? 45  GLU A OE1  7  
ATOM 11011 O OE2  . GLU A 1 45  ? -13.133 10.490  8.298   1.00 0.00 ? 45  GLU A OE2  7  
ATOM 11012 H H    . GLU A 1 45  ? -12.746 16.281  6.016   1.00 0.00 ? 45  GLU A H    7  
ATOM 11013 H HA   . GLU A 1 45  ? -12.707 13.571  4.963   1.00 0.00 ? 45  GLU A HA   7  
ATOM 11014 H HB3  . GLU A 1 45  ? -13.464 13.699  7.806   1.00 0.00 ? 45  GLU A HB3  7  
ATOM 11015 H HG3  . GLU A 1 45  ? -11.314 12.010  7.609   1.00 0.00 ? 45  GLU A HG3  7  
ATOM 11016 N N    . ASN A 1 46  ? -15.093 14.162  4.498   1.00 0.00 ? 46  ASN A N    7  
ATOM 11017 C CA   . ASN A 1 46  ? -16.525 14.289  4.279   1.00 0.00 ? 46  ASN A CA   7  
ATOM 11018 C C    . ASN A 1 46  ? -16.947 13.367  3.134   1.00 0.00 ? 46  ASN A C    7  
ATOM 11019 O O    . ASN A 1 46  ? -16.110 12.927  2.347   1.00 0.00 ? 46  ASN A O    7  
ATOM 11020 C CB   . ASN A 1 46  ? -16.897 15.722  3.893   1.00 0.00 ? 46  ASN A CB   7  
ATOM 11021 C CG   . ASN A 1 46  ? -18.298 16.079  4.393   1.00 0.00 ? 46  ASN A CG   7  
ATOM 11022 O OD1  . ASN A 1 46  ? -18.562 16.154  5.581   1.00 0.00 ? 46  ASN A OD1  7  
ATOM 11023 N ND2  . ASN A 1 46  ? -19.180 16.294  3.421   1.00 0.00 ? 46  ASN A ND2  7  
ATOM 11024 H H    . ASN A 1 46  ? -14.569 13.874  3.697   1.00 0.00 ? 46  ASN A H    7  
ATOM 11025 H HA   . ASN A 1 46  ? -16.985 14.014  5.229   1.00 0.00 ? 46  ASN A HA   7  
ATOM 11026 H HB3  . ASN A 1 46  ? -16.854 15.833  2.809   1.00 0.00 ? 46  ASN A HB3  7  
ATOM 11027 H HD21 . ASN A 1 46  ? -18.900 16.215  2.465   1.00 0.00 ? 46  ASN A HD21 7  
ATOM 11028 H HD22 . ASN A 1 46  ? -20.125 16.532  3.647   1.00 0.00 ? 46  ASN A HD22 7  
ATOM 11029 N N    . GLY A 1 47  ? -18.243 13.099  3.079   1.00 0.00 ? 47  GLY A N    7  
ATOM 11030 C CA   . GLY A 1 47  ? -18.786 12.237  2.043   1.00 0.00 ? 47  GLY A CA   7  
ATOM 11031 C C    . GLY A 1 47  ? -18.799 12.947  0.688   1.00 0.00 ? 47  GLY A C    7  
ATOM 11032 O O    . GLY A 1 47  ? -19.824 13.487  0.276   1.00 0.00 ? 47  GLY A O    7  
ATOM 11033 H H    . GLY A 1 47  ? -18.917 13.461  3.723   1.00 0.00 ? 47  GLY A H    7  
ATOM 11034 H HA2  . GLY A 1 47  ? -18.190 11.326  1.975   1.00 0.00 ? 47  GLY A HA2  7  
ATOM 11035 H HA3  . GLY A 1 47  ? -19.799 11.935  2.310   1.00 0.00 ? 47  GLY A HA3  7  
ATOM 11036 N N    . ASN A 1 48  ? -17.648 12.924  0.034   1.00 0.00 ? 48  ASN A N    7  
ATOM 11037 C CA   . ASN A 1 48  ? -17.514 13.561  -1.267  1.00 0.00 ? 48  ASN A CA   7  
ATOM 11038 C C    . ASN A 1 48  ? -17.731 12.517  -2.365  1.00 0.00 ? 48  ASN A C    7  
ATOM 11039 O O    . ASN A 1 48  ? -18.587 12.691  -3.231  1.00 0.00 ? 48  ASN A O    7  
ATOM 11040 C CB   . ASN A 1 48  ? -16.115 14.154  -1.449  1.00 0.00 ? 48  ASN A CB   7  
ATOM 11041 C CG   . ASN A 1 48  ? -15.904 15.353  -0.522  1.00 0.00 ? 48  ASN A CG   7  
ATOM 11042 O OD1  . ASN A 1 48  ? -15.598 15.218  0.651   1.00 0.00 ? 48  ASN A OD1  7  
ATOM 11043 N ND2  . ASN A 1 48  ? -16.085 16.531  -1.113  1.00 0.00 ? 48  ASN A ND2  7  
ATOM 11044 H H    . ASN A 1 48  ? -16.818 12.484  0.374   1.00 0.00 ? 48  ASN A H    7  
ATOM 11045 H HA   . ASN A 1 48  ? -18.271 14.345  -1.281  1.00 0.00 ? 48  ASN A HA   7  
ATOM 11046 H HB3  . ASN A 1 48  ? -15.979 14.461  -2.485  1.00 0.00 ? 48  ASN A HB3  7  
ATOM 11047 H HD21 . ASN A 1 48  ? -16.336 16.572  -2.080  1.00 0.00 ? 48  ASN A HD21 7  
ATOM 11048 H HD22 . ASN A 1 48  ? -15.970 17.376  -0.590  1.00 0.00 ? 48  ASN A HD22 7  
ATOM 11049 N N    . ARG A 1 49  ? -16.941 11.457  -2.294  1.00 0.00 ? 49  ARG A N    7  
ATOM 11050 C CA   . ARG A 1 49  ? -17.035 10.385  -3.271  1.00 0.00 ? 49  ARG A CA   7  
ATOM 11051 C C    . ARG A 1 49  ? -16.735 10.918  -4.673  1.00 0.00 ? 49  ARG A C    7  
ATOM 11052 O O    . ARG A 1 49  ? -17.047 12.067  -4.985  1.00 0.00 ? 49  ARG A O    7  
ATOM 11053 C CB   . ARG A 1 49  ? -18.428 9.751   -3.260  1.00 0.00 ? 49  ARG A CB   7  
ATOM 11054 C CG   . ARG A 1 49  ? -18.382 8.339   -2.674  1.00 0.00 ? 49  ARG A CG   7  
ATOM 11055 C CD   . ARG A 1 49  ? -19.689 7.590   -2.948  1.00 0.00 ? 49  ARG A CD   7  
ATOM 11056 N NE   . ARG A 1 49  ? -20.156 6.919   -1.714  1.00 0.00 ? 49  ARG A NE   7  
ATOM 11057 C CZ   . ARG A 1 49  ? -20.588 7.567   -0.624  1.00 0.00 ? 49  ARG A CZ   7  
ATOM 11058 N NH1  . ARG A 1 49  ? -20.616 8.907   -0.608  1.00 0.00 ? 49  ARG A NH1  7  
ATOM 11059 N NH2  . ARG A 1 49  ? -20.993 6.876   0.450   1.00 0.00 ? 49  ARG A NH2  7  
ATOM 11060 H H    . ARG A 1 49  ? -16.245 11.323  -1.587  1.00 0.00 ? 49  ARG A H    7  
ATOM 11061 H HA   . ARG A 1 49  ? -16.286 9.656   -2.959  1.00 0.00 ? 49  ARG A HA   7  
ATOM 11062 H HB3  . ARG A 1 49  ? -18.823 9.715   -4.275  1.00 0.00 ? 49  ARG A HB3  7  
ATOM 11063 H HG3  . ARG A 1 49  ? -18.210 8.392   -1.599  1.00 0.00 ? 49  ARG A HG3  7  
ATOM 11064 H HD3  . ARG A 1 49  ? -19.536 6.853   -3.737  1.00 0.00 ? 49  ARG A HD3  7  
ATOM 11065 H HE   . ARG A 1 49  ? -20.149 5.919   -1.694  1.00 0.00 ? 49  ARG A HE   7  
ATOM 11066 H HH11 . ARG A 1 49  ? -20.313 9.423   -1.410  1.00 0.00 ? 49  ARG A HH11 7  
ATOM 11067 H HH12 . ARG A 1 49  ? -20.938 9.390   0.205   1.00 0.00 ? 49  ARG A HH12 7  
ATOM 11068 H HH21 . ARG A 1 49  ? -20.973 5.877   0.437   1.00 0.00 ? 49  ARG A HH21 7  
ATOM 11069 H HH22 . ARG A 1 49  ? -21.316 7.360   1.264   1.00 0.00 ? 49  ARG A HH22 7  
ATOM 11070 N N    . GLY A 1 50  ? -16.134 10.059  -5.482  1.00 0.00 ? 50  GLY A N    7  
ATOM 11071 C CA   . GLY A 1 50  ? -15.788 10.429  -6.844  1.00 0.00 ? 50  GLY A CA   7  
ATOM 11072 C C    . GLY A 1 50  ? -17.034 10.474  -7.732  1.00 0.00 ? 50  GLY A C    7  
ATOM 11073 O O    . GLY A 1 50  ? -18.114 10.059  -7.315  1.00 0.00 ? 50  GLY A O    7  
ATOM 11074 H H    . GLY A 1 50  ? -15.885 9.126   -5.221  1.00 0.00 ? 50  GLY A H    7  
ATOM 11075 H HA2  . GLY A 1 50  ? -15.299 11.402  -6.847  1.00 0.00 ? 50  GLY A HA2  7  
ATOM 11076 H HA3  . GLY A 1 50  ? -15.075 9.711   -7.249  1.00 0.00 ? 50  GLY A HA3  7  
ATOM 11077 N N    . GLY A 1 51  ? -16.842 10.983  -8.940  1.00 0.00 ? 51  GLY A N    7  
ATOM 11078 C CA   . GLY A 1 51  ? -17.936 11.091  -9.890  1.00 0.00 ? 51  GLY A CA   7  
ATOM 11079 C C    . GLY A 1 51  ? -17.785 10.067  -11.016 1.00 0.00 ? 51  GLY A C    7  
ATOM 11080 O O    . GLY A 1 51  ? -17.213 8.996   -10.815 1.00 0.00 ? 51  GLY A O    7  
ATOM 11081 H H    . GLY A 1 51  ? -15.960 11.321  -9.270  1.00 0.00 ? 51  GLY A H    7  
ATOM 11082 H HA2  . GLY A 1 51  ? -18.885 10.934  -9.377  1.00 0.00 ? 51  GLY A HA2  7  
ATOM 11083 H HA3  . GLY A 1 51  ? -17.961 12.097  -10.309 1.00 0.00 ? 51  GLY A HA3  7  
ATOM 11084 N N    . LYS A 1 52  ? -18.307 10.432  -12.178 1.00 0.00 ? 52  LYS A N    7  
ATOM 11085 C CA   . LYS A 1 52  ? -18.238 9.558   -13.338 1.00 0.00 ? 52  LYS A CA   7  
ATOM 11086 C C    . LYS A 1 52  ? -16.822 8.990   -13.458 1.00 0.00 ? 52  LYS A C    7  
ATOM 11087 O O    . LYS A 1 52  ? -16.645 7.787   -13.641 1.00 0.00 ? 52  LYS A O    7  
ATOM 11088 C CB   . LYS A 1 52  ? -18.715 10.292  -14.591 1.00 0.00 ? 52  LYS A CB   7  
ATOM 11089 C CG   . LYS A 1 52  ? -19.411 9.333   -15.558 1.00 0.00 ? 52  LYS A CG   7  
ATOM 11090 C CD   . LYS A 1 52  ? -19.603 9.980   -16.931 1.00 0.00 ? 52  LYS A CD   7  
ATOM 11091 C CE   . LYS A 1 52  ? -19.017 9.102   -18.039 1.00 0.00 ? 52  LYS A CE   7  
ATOM 11092 N NZ   . LYS A 1 52  ? -18.618 9.930   -19.199 1.00 0.00 ? 52  LYS A NZ   7  
ATOM 11093 H H    . LYS A 1 52  ? -18.769 11.304  -12.334 1.00 0.00 ? 52  LYS A H    7  
ATOM 11094 H HA   . LYS A 1 52  ? -18.926 8.732   -13.166 1.00 0.00 ? 52  LYS A HA   7  
ATOM 11095 H HB3  . LYS A 1 52  ? -17.865 10.762  -15.088 1.00 0.00 ? 52  LYS A HB3  7  
ATOM 11096 H HG3  . LYS A 1 52  ? -20.378 9.039   -15.150 1.00 0.00 ? 52  LYS A HG3  7  
ATOM 11097 H HD3  . LYS A 1 52  ? -19.125 10.959  -16.946 1.00 0.00 ? 52  LYS A HD3  7  
ATOM 11098 H HE3  . LYS A 1 52  ? -19.752 8.360   -18.349 1.00 0.00 ? 52  LYS A HE3  7  
ATOM 11099 H HZ1  . LYS A 1 52  ? -18.656 9.377   -20.031 1.00 0.00 ? 52  LYS A HZ1  7  
ATOM 11100 H HZ2  . LYS A 1 52  ? -19.243 10.706  -19.286 1.00 0.00 ? 52  LYS A HZ2  7  
ATOM 11101 H HZ3  . LYS A 1 52  ? -17.686 10.266  -19.064 1.00 0.00 ? 52  LYS A HZ3  7  
ATOM 11102 N N    . GLN A 1 53  ? -15.850 9.883   -13.351 1.00 0.00 ? 53  GLN A N    7  
ATOM 11103 C CA   . GLN A 1 53  ? -14.454 9.487   -13.446 1.00 0.00 ? 53  GLN A CA   7  
ATOM 11104 C C    . GLN A 1 53  ? -14.207 8.725   -14.749 1.00 0.00 ? 53  GLN A C    7  
ATOM 11105 O O    . GLN A 1 53  ? -15.150 8.381   -15.461 1.00 0.00 ? 53  GLN A O    7  
ATOM 11106 C CB   . GLN A 1 53  ? -14.038 8.652   -12.235 1.00 0.00 ? 53  GLN A CB   7  
ATOM 11107 C CG   . GLN A 1 53  ? -13.584 9.546   -11.081 1.00 0.00 ? 53  GLN A CG   7  
ATOM 11108 C CD   . GLN A 1 53  ? -12.190 9.145   -10.591 1.00 0.00 ? 53  GLN A CD   7  
ATOM 11109 O OE1  . GLN A 1 53  ? -11.219 9.155   -11.327 1.00 0.00 ? 53  GLN A OE1  7  
ATOM 11110 N NE2  . GLN A 1 53  ? -12.149 8.793   -9.308  1.00 0.00 ? 53  GLN A NE2  7  
ATOM 11111 H H    . GLN A 1 53  ? -16.001 10.861  -13.202 1.00 0.00 ? 53  GLN A H    7  
ATOM 11112 H HA   . GLN A 1 53  ? -13.888 10.418  -13.449 1.00 0.00 ? 53  GLN A HA   7  
ATOM 11113 H HB3  . GLN A 1 53  ? -13.230 7.975   -12.515 1.00 0.00 ? 53  GLN A HB3  7  
ATOM 11114 H HG3  . GLN A 1 53  ? -14.297 9.476   -10.259 1.00 0.00 ? 53  GLN A HG3  7  
ATOM 11115 H HE21 . GLN A 1 53  ? -12.984 8.808   -8.758  1.00 0.00 ? 53  GLN A HE21 7  
ATOM 11116 H HE22 . GLN A 1 53  ? -11.282 8.515   -8.895  1.00 0.00 ? 53  GLN A HE22 7  
ATOM 11117 N N    . ARG A 1 54  ? -12.934 8.482   -15.024 1.00 0.00 ? 54  ARG A N    7  
ATOM 11118 C CA   . ARG A 1 54  ? -12.552 7.766   -16.228 1.00 0.00 ? 54  ARG A CA   7  
ATOM 11119 C C    . ARG A 1 54  ? -11.921 6.419   -15.869 1.00 0.00 ? 54  ARG A C    7  
ATOM 11120 O O    . ARG A 1 54  ? -12.468 5.366   -16.195 1.00 0.00 ? 54  ARG A O    7  
ATOM 11121 C CB   . ARG A 1 54  ? -11.557 8.579   -17.061 1.00 0.00 ? 54  ARG A CB   7  
ATOM 11122 C CG   . ARG A 1 54  ? -12.039 8.722   -18.505 1.00 0.00 ? 54  ARG A CG   7  
ATOM 11123 C CD   . ARG A 1 54  ? -11.067 9.574   -19.325 1.00 0.00 ? 54  ARG A CD   7  
ATOM 11124 N NE   . ARG A 1 54  ? -11.700 9.975   -20.602 1.00 0.00 ? 54  ARG A NE   7  
ATOM 11125 C CZ   . ARG A 1 54  ? -12.509 11.035  -20.737 1.00 0.00 ? 54  ARG A CZ   7  
ATOM 11126 N NH1  . ARG A 1 54  ? -12.788 11.806  -19.678 1.00 0.00 ? 54  ARG A NH1  7  
ATOM 11127 N NH2  . ARG A 1 54  ? -13.038 11.324  -21.936 1.00 0.00 ? 54  ARG A NH2  7  
ATOM 11128 H H    . ARG A 1 54  ? -12.173 8.764   -14.439 1.00 0.00 ? 54  ARG A H    7  
ATOM 11129 H HA   . ARG A 1 54  ? -13.481 7.629   -16.779 1.00 0.00 ? 54  ARG A HA   7  
ATOM 11130 H HB3  . ARG A 1 54  ? -10.581 8.094   -17.044 1.00 0.00 ? 54  ARG A HB3  7  
ATOM 11131 H HG3  . ARG A 1 54  ? -13.029 9.179   -18.519 1.00 0.00 ? 54  ARG A HG3  7  
ATOM 11132 H HD3  . ARG A 1 54  ? -10.156 9.010   -19.524 1.00 0.00 ? 54  ARG A HD3  7  
ATOM 11133 H HE   . ARG A 1 54  ? -11.513 9.421   -21.413 1.00 0.00 ? 54  ARG A HE   7  
ATOM 11134 H HH11 . ARG A 1 54  ? -12.392 11.590  -18.786 1.00 0.00 ? 54  ARG A HH11 7  
ATOM 11135 H HH12 . ARG A 1 54  ? -13.392 12.596  -19.781 1.00 0.00 ? 54  ARG A HH12 7  
ATOM 11136 H HH21 . ARG A 1 54  ? -12.830 10.748  -22.725 1.00 0.00 ? 54  ARG A HH21 7  
ATOM 11137 H HH22 . ARG A 1 54  ? -13.641 12.115  -22.037 1.00 0.00 ? 54  ARG A HH22 7  
ATOM 11138 N N    . ASN A 1 55  ? -10.779 6.495   -15.199 1.00 0.00 ? 55  ASN A N    7  
ATOM 11139 C CA   . ASN A 1 55  ? -10.069 5.295   -14.791 1.00 0.00 ? 55  ASN A CA   7  
ATOM 11140 C C    . ASN A 1 55  ? -9.572  4.555   -16.034 1.00 0.00 ? 55  ASN A C    7  
ATOM 11141 O O    . ASN A 1 55  ? -10.364 4.176   -16.895 1.00 0.00 ? 55  ASN A O    7  
ATOM 11142 C CB   . ASN A 1 55  ? -10.988 4.349   -14.015 1.00 0.00 ? 55  ASN A CB   7  
ATOM 11143 C CG   . ASN A 1 55  ? -10.211 3.597   -12.933 1.00 0.00 ? 55  ASN A CG   7  
ATOM 11144 O OD1  . ASN A 1 55  ? -9.001  3.698   -12.817 1.00 0.00 ? 55  ASN A OD1  7  
ATOM 11145 N ND2  . ASN A 1 55  ? -10.973 2.841   -12.148 1.00 0.00 ? 55  ASN A ND2  7  
ATOM 11146 H H    . ASN A 1 55  ? -10.341 7.355   -14.937 1.00 0.00 ? 55  ASN A H    7  
ATOM 11147 H HA   . ASN A 1 55  ? -9.254  5.646   -14.160 1.00 0.00 ? 55  ASN A HA   7  
ATOM 11148 H HB3  . ASN A 1 55  ? -11.445 3.636   -14.701 1.00 0.00 ? 55  ASN A HB3  7  
ATOM 11149 H HD21 . ASN A 1 55  ? -11.960 2.802   -12.295 1.00 0.00 ? 55  ASN A HD21 7  
ATOM 11150 H HD22 . ASN A 1 55  ? -10.557 2.310   -11.408 1.00 0.00 ? 55  ASN A HD22 7  
ATOM 11151 N N    . ARG A 1 56  ? -8.260  4.372   -16.088 1.00 0.00 ? 56  ARG A N    7  
ATOM 11152 C CA   . ARG A 1 56  ? -7.646  3.683   -17.212 1.00 0.00 ? 56  ARG A CA   7  
ATOM 11153 C C    . ARG A 1 56  ? -7.231  2.268   -16.806 1.00 0.00 ? 56  ARG A C    7  
ATOM 11154 O O    . ARG A 1 56  ? -7.728  1.731   -15.815 1.00 0.00 ? 56  ARG A O    7  
ATOM 11155 C CB   . ARG A 1 56  ? -6.419  4.442   -17.718 1.00 0.00 ? 56  ARG A CB   7  
ATOM 11156 C CG   . ARG A 1 56  ? -6.456  4.595   -19.239 1.00 0.00 ? 56  ARG A CG   7  
ATOM 11157 C CD   . ARG A 1 56  ? -5.085  5.000   -19.784 1.00 0.00 ? 56  ARG A CD   7  
ATOM 11158 N NE   . ARG A 1 56  ? -5.221  6.173   -20.677 1.00 0.00 ? 56  ARG A NE   7  
ATOM 11159 C CZ   . ARG A 1 56  ? -4.201  6.735   -21.339 1.00 0.00 ? 56  ARG A CZ   7  
ATOM 11160 N NH1  . ARG A 1 56  ? -2.964  6.236   -21.211 1.00 0.00 ? 56  ARG A NH1  7  
ATOM 11161 N NH2  . ARG A 1 56  ? -4.418  7.796   -22.127 1.00 0.00 ? 56  ARG A NH2  7  
ATOM 11162 H H    . ARG A 1 56  ? -7.623  4.682   -15.384 1.00 0.00 ? 56  ARG A H    7  
ATOM 11163 H HA   . ARG A 1 56  ? -8.419  3.660   -17.980 1.00 0.00 ? 56  ARG A HA   7  
ATOM 11164 H HB3  . ARG A 1 56  ? -5.513  3.911   -17.424 1.00 0.00 ? 56  ARG A HB3  7  
ATOM 11165 H HG3  . ARG A 1 56  ? -7.197  5.347   -19.515 1.00 0.00 ? 56  ARG A HG3  7  
ATOM 11166 H HD3  . ARG A 1 56  ? -4.641  4.166   -20.330 1.00 0.00 ? 56  ARG A HD3  7  
ATOM 11167 H HE   . ARG A 1 56  ? -6.131  6.570   -20.793 1.00 0.00 ? 56  ARG A HE   7  
ATOM 11168 H HH11 . ARG A 1 56  ? -2.801  5.444   -20.624 1.00 0.00 ? 56  ARG A HH11 7  
ATOM 11169 H HH12 . ARG A 1 56  ? -2.202  6.657   -21.707 1.00 0.00 ? 56  ARG A HH12 7  
ATOM 11170 H HH21 . ARG A 1 56  ? -5.341  8.169   -22.221 1.00 0.00 ? 56  ARG A HH21 7  
ATOM 11171 H HH22 . ARG A 1 56  ? -3.655  8.217   -22.621 1.00 0.00 ? 56  ARG A HH22 7  
ATOM 11172 N N    . LEU A 1 57  ? -6.326  1.703   -17.590 1.00 0.00 ? 57  LEU A N    7  
ATOM 11173 C CA   . LEU A 1 57  ? -5.838  0.360   -17.324 1.00 0.00 ? 57  LEU A CA   7  
ATOM 11174 C C    . LEU A 1 57  ? -4.769  0.417   -16.231 1.00 0.00 ? 57  LEU A C    7  
ATOM 11175 O O    . LEU A 1 57  ? -3.579  0.300   -16.517 1.00 0.00 ? 57  LEU A O    7  
ATOM 11176 C CB   . LEU A 1 57  ? -5.362  -0.302  -18.617 1.00 0.00 ? 57  LEU A CB   7  
ATOM 11177 C CG   . LEU A 1 57  ? -6.450  -0.932  -19.489 1.00 0.00 ? 57  LEU A CG   7  
ATOM 11178 C CD1  . LEU A 1 57  ? -7.479  0.113   -19.923 1.00 0.00 ? 57  LEU A CD1  7  
ATOM 11179 C CD2  . LEU A 1 57  ? -5.839  -1.667  -20.684 1.00 0.00 ? 57  LEU A CD2  7  
ATOM 11180 H H    . LEU A 1 57  ? -5.927  2.146   -18.392 1.00 0.00 ? 57  LEU A H    7  
ATOM 11181 H HA   . LEU A 1 57  ? -6.679  -0.225  -16.952 1.00 0.00 ? 57  LEU A HA   7  
ATOM 11182 H HB3  . LEU A 1 57  ? -4.637  -1.076  -18.360 1.00 0.00 ? 57  LEU A HB3  7  
ATOM 11183 H HG   . LEU A 1 57  ? -6.979  -1.676  -18.891 1.00 0.00 ? 57  LEU A HG   7  
ATOM 11184 H HD11 . LEU A 1 57  ? -7.005  0.836   -20.586 1.00 0.00 ? 57  LEU A HD11 7  
ATOM 11185 H HD12 . LEU A 1 57  ? -8.298  -0.380  -20.448 1.00 0.00 ? 57  LEU A HD12 7  
ATOM 11186 H HD13 . LEU A 1 57  ? -7.868  0.627   -19.043 1.00 0.00 ? 57  LEU A HD13 7  
ATOM 11187 H HD21 . LEU A 1 57  ? -5.492  -0.939  -21.418 1.00 0.00 ? 57  LEU A HD21 7  
ATOM 11188 H HD22 . LEU A 1 57  ? -4.998  -2.273  -20.347 1.00 0.00 ? 57  LEU A HD22 7  
ATOM 11189 H HD23 . LEU A 1 57  ? -6.593  -2.311  -21.139 1.00 0.00 ? 57  LEU A HD23 7  
ATOM 11190 N N    . GLU A 1 58  ? -5.231  0.599   -15.003 1.00 0.00 ? 58  GLU A N    7  
ATOM 11191 C CA   . GLU A 1 58  ? -4.328  0.673   -13.867 1.00 0.00 ? 58  GLU A CA   7  
ATOM 11192 C C    . GLU A 1 58  ? -3.313  -0.470  -13.920 1.00 0.00 ? 58  GLU A C    7  
ATOM 11193 O O    . GLU A 1 58  ? -3.541  -1.476  -14.591 1.00 0.00 ? 58  GLU A O    7  
ATOM 11194 C CB   . GLU A 1 58  ? -5.105  0.656   -12.548 1.00 0.00 ? 58  GLU A CB   7  
ATOM 11195 C CG   . GLU A 1 58  ? -6.213  1.711   -12.551 1.00 0.00 ? 58  GLU A CG   7  
ATOM 11196 C CD   . GLU A 1 58  ? -6.710  1.989   -11.130 1.00 0.00 ? 58  GLU A CD   7  
ATOM 11197 O OE1  . GLU A 1 58  ? -7.301  1.055   -10.545 1.00 0.00 ? 58  GLU A OE1  7  
ATOM 11198 O OE2  . GLU A 1 58  ? -6.489  3.126   -10.663 1.00 0.00 ? 58  GLU A OE2  7  
ATOM 11199 H H    . GLU A 1 58  ? -6.201  0.694   -14.779 1.00 0.00 ? 58  GLU A H    7  
ATOM 11200 H HA   . GLU A 1 58  ? -3.814  1.630   -13.967 1.00 0.00 ? 58  GLU A HA   7  
ATOM 11201 H HB3  . GLU A 1 58  ? -4.423  0.842   -11.718 1.00 0.00 ? 58  GLU A HB3  7  
ATOM 11202 H HG3  . GLU A 1 58  ? -7.042  1.371   -13.171 1.00 0.00 ? 58  GLU A HG3  7  
ATOM 11203 N N    . PRO A 1 59  ? -2.187  -0.273  -13.185 1.00 0.00 ? 59  PRO A N    7  
ATOM 11204 C CA   . PRO A 1 59  ? -1.136  -1.276  -13.141 1.00 0.00 ? 59  PRO A CA   7  
ATOM 11205 C C    . PRO A 1 59  ? -1.543  -2.459  -12.261 1.00 0.00 ? 59  PRO A C    7  
ATOM 11206 O O    . PRO A 1 59  ? -1.890  -3.525  -12.770 1.00 0.00 ? 59  PRO A O    7  
ATOM 11207 C CB   . PRO A 1 59  ? 0.088   -0.541  -12.619 1.00 0.00 ? 59  PRO A CB   7  
ATOM 11208 C CG   . PRO A 1 59  ? -0.437  0.720   -11.952 1.00 0.00 ? 59  PRO A CG   7  
ATOM 11209 C CD   . PRO A 1 59  ? -1.884  0.906   -12.378 1.00 0.00 ? 59  PRO A CD   7  
ATOM 11210 H HA   . PRO A 1 59  ? -0.979  -1.654  -14.053 1.00 0.00 ? 59  PRO A HA   7  
ATOM 11211 H HB3  . PRO A 1 59  ? 0.773   -0.297  -13.430 1.00 0.00 ? 59  PRO A HB3  7  
ATOM 11212 H HG3  . PRO A 1 59  ? 0.161   1.584   -12.244 1.00 0.00 ? 59  PRO A HG3  7  
ATOM 11213 H HD3  . PRO A 1 59  ? -2.013  1.823   -12.953 1.00 0.00 ? 59  PRO A HD3  7  
ATOM 11214 N N    . MET A 1 60  ? -1.488  -2.232  -10.958 1.00 0.00 ? 60  MET A N    7  
ATOM 11215 C CA   . MET A 1 60  ? -1.847  -3.268  -10.003 1.00 0.00 ? 60  MET A CA   7  
ATOM 11216 C C    . MET A 1 60  ? -3.118  -2.892  -9.239  1.00 0.00 ? 60  MET A C    7  
ATOM 11217 O O    . MET A 1 60  ? -4.173  -3.488  -9.449  1.00 0.00 ? 60  MET A O    7  
ATOM 11218 C CB   . MET A 1 60  ? -0.697  -3.470  -9.014  1.00 0.00 ? 60  MET A CB   7  
ATOM 11219 C CG   . MET A 1 60  ? 0.437   -4.278  -9.648  1.00 0.00 ? 60  MET A CG   7  
ATOM 11220 S SD   . MET A 1 60  ? 0.548   -5.884  -8.880  1.00 0.00 ? 60  MET A SD   7  
ATOM 11221 C CE   . MET A 1 60  ? 1.004   -6.873  -10.296 1.00 0.00 ? 60  MET A CE   7  
ATOM 11222 H H    . MET A 1 60  ? -1.205  -1.363  -10.552 1.00 0.00 ? 60  MET A H    7  
ATOM 11223 H HA   . MET A 1 60  ? -2.022  -4.166  -10.597 1.00 0.00 ? 60  MET A HA   7  
ATOM 11224 H HB3  . MET A 1 60  ? -1.063  -3.988  -8.127  1.00 0.00 ? 60  MET A HB3  7  
ATOM 11225 H HG3  . MET A 1 60  ? 1.381   -3.745  -9.535  1.00 0.00 ? 60  MET A HG3  7  
ATOM 11226 H HE1  . MET A 1 60  ? 0.751   -7.917  -10.106 1.00 0.00 ? 60  MET A HE1  7  
ATOM 11227 H HE2  . MET A 1 60  ? 0.462   -6.523  -11.173 1.00 0.00 ? 60  MET A HE2  7  
ATOM 11228 H HE3  . MET A 1 60  ? 2.075   -6.785  -10.471 1.00 0.00 ? 60  MET A HE3  7  
ATOM 11229 N N    . ASP A 1 61  ? -2.975  -1.904  -8.367  1.00 0.00 ? 61  ASP A N    7  
ATOM 11230 C CA   . ASP A 1 61  ? -4.100  -1.442  -7.571  1.00 0.00 ? 61  ASP A CA   7  
ATOM 11231 C C    . ASP A 1 61  ? -4.562  -2.568  -6.645  1.00 0.00 ? 61  ASP A C    7  
ATOM 11232 O O    . ASP A 1 61  ? -5.334  -3.435  -7.053  1.00 0.00 ? 61  ASP A O    7  
ATOM 11233 C CB   . ASP A 1 61  ? -5.279  -1.047  -8.461  1.00 0.00 ? 61  ASP A CB   7  
ATOM 11234 C CG   . ASP A 1 61  ? -6.202  0.024   -7.875  1.00 0.00 ? 61  ASP A CG   7  
ATOM 11235 O OD1  . ASP A 1 61  ? -5.741  1.183   -7.785  1.00 0.00 ? 61  ASP A OD1  7  
ATOM 11236 O OD2  . ASP A 1 61  ? -7.347  -0.339  -7.527  1.00 0.00 ? 61  ASP A OD2  7  
ATOM 11237 H H    . ASP A 1 61  ? -2.115  -1.423  -8.201  1.00 0.00 ? 61  ASP A H    7  
ATOM 11238 H HA   . ASP A 1 61  ? -3.725  -0.579  -7.021  1.00 0.00 ? 61  ASP A HA   7  
ATOM 11239 H HB3  . ASP A 1 61  ? -5.871  -1.938  -8.671  1.00 0.00 ? 61  ASP A HB3  7  
ATOM 11240 N N    . THR A 1 62  ? -4.070  -2.521  -5.416  1.00 0.00 ? 62  THR A N    7  
ATOM 11241 C CA   . THR A 1 62  ? -4.422  -3.528  -4.429  1.00 0.00 ? 62  THR A CA   7  
ATOM 11242 C C    . THR A 1 62  ? -3.464  -3.467  -3.238  1.00 0.00 ? 62  THR A C    7  
ATOM 11243 O O    . THR A 1 62  ? -3.829  -3.834  -2.123  1.00 0.00 ? 62  THR A O    7  
ATOM 11244 C CB   . THR A 1 62  ? -4.438  -4.889  -5.127  1.00 0.00 ? 62  THR A CB   7  
ATOM 11245 O OG1  . THR A 1 62  ? -5.816  -5.123  -5.402  1.00 0.00 ? 62  THR A OG1  7  
ATOM 11246 C CG2  . THR A 1 62  ? -4.046  -6.033  -4.189  1.00 0.00 ? 62  THR A CG2  7  
ATOM 11247 H H    . THR A 1 62  ? -3.441  -1.814  -5.092  1.00 0.00 ? 62  THR A H    7  
ATOM 11248 H HA   . THR A 1 62  ? -5.418  -3.302  -4.050  1.00 0.00 ? 62  THR A HA   7  
ATOM 11249 H HB   . THR A 1 62  ? -3.805  -4.879  -6.014  1.00 0.00 ? 62  THR A HB   7  
ATOM 11250 H HG1  . THR A 1 62  ? -6.113  -4.558  -6.173  1.00 0.00 ? 62  THR A HG1  7  
ATOM 11251 H HG21 . THR A 1 62  ? -4.761  -6.091  -3.368  1.00 0.00 ? 62  THR A HG21 7  
ATOM 11252 H HG22 . THR A 1 62  ? -4.049  -6.973  -4.741  1.00 0.00 ? 62  THR A HG22 7  
ATOM 11253 H HG23 . THR A 1 62  ? -3.049  -5.850  -3.789  1.00 0.00 ? 62  THR A HG23 7  
ATOM 11254 N N    . ILE A 1 63  ? -2.256  -2.999  -3.516  1.00 0.00 ? 63  ILE A N    7  
ATOM 11255 C CA   . ILE A 1 63  ? -1.241  -2.885  -2.481  1.00 0.00 ? 63  ILE A CA   7  
ATOM 11256 C C    . ILE A 1 63  ? -0.840  -4.284  -2.010  1.00 0.00 ? 63  ILE A C    7  
ATOM 11257 O O    . ILE A 1 63  ? -1.663  -5.020  -1.467  1.00 0.00 ? 63  ILE A O    7  
ATOM 11258 C CB   . ILE A 1 63  ? -1.727  -1.973  -1.354  1.00 0.00 ? 63  ILE A CB   7  
ATOM 11259 C CG1  . ILE A 1 63  ? -1.490  -0.500  -1.699  1.00 0.00 ? 63  ILE A CG1  7  
ATOM 11260 C CG2  . ILE A 1 63  ? -1.085  -2.359  -0.020  1.00 0.00 ? 63  ILE A CG2  7  
ATOM 11261 C CD1  . ILE A 1 63  ? -2.808  0.275   -1.724  1.00 0.00 ? 63  ILE A CD1  7  
ATOM 11262 H H    . ILE A 1 63  ? -1.966  -2.702  -4.426  1.00 0.00 ? 63  ILE A H    7  
ATOM 11263 H HA   . ILE A 1 63  ? -0.370  -2.408  -2.929  1.00 0.00 ? 63  ILE A HA   7  
ATOM 11264 H HB   . ILE A 1 63  ? -2.803  -2.108  -1.244  1.00 0.00 ? 63  ILE A HB   7  
ATOM 11265 H HG13 . ILE A 1 63  ? -1.000  -0.426  -2.670  1.00 0.00 ? 63  ILE A HG13 7  
ATOM 11266 H HG21 . ILE A 1 63  ? -0.012  -2.174  -0.066  1.00 0.00 ? 63  ILE A HG21 7  
ATOM 11267 H HG22 . ILE A 1 63  ? -1.522  -1.764  0.781   1.00 0.00 ? 63  ILE A HG22 7  
ATOM 11268 H HG23 . ILE A 1 63  ? -1.263  -3.416  0.175   1.00 0.00 ? 63  ILE A HG23 7  
ATOM 11269 H HD11 . ILE A 1 63  ? -2.996  0.704   -0.740  1.00 0.00 ? 63  ILE A HD11 7  
ATOM 11270 H HD12 . ILE A 1 63  ? -2.744  1.076   -2.462  1.00 0.00 ? 63  ILE A HD12 7  
ATOM 11271 H HD13 . ILE A 1 63  ? -3.621  -0.399  -1.989  1.00 0.00 ? 63  ILE A HD13 7  
ATOM 11272 N N    . PHE A 1 64  ? 0.424   -4.610  -2.236  1.00 0.00 ? 64  PHE A N    7  
ATOM 11273 C CA   . PHE A 1 64  ? 0.946   -5.908  -1.841  1.00 0.00 ? 64  PHE A CA   7  
ATOM 11274 C C    . PHE A 1 64  ? 2.172   -5.755  -0.940  1.00 0.00 ? 64  PHE A C    7  
ATOM 11275 O O    . PHE A 1 64  ? 2.949   -4.815  -1.097  1.00 0.00 ? 64  PHE A O    7  
ATOM 11276 C CB   . PHE A 1 64  ? 1.356   -6.634  -3.124  1.00 0.00 ? 64  PHE A CB   7  
ATOM 11277 C CG   . PHE A 1 64  ? 0.181   -7.035  -4.017  1.00 0.00 ? 64  PHE A CG   7  
ATOM 11278 C CD1  . PHE A 1 64  ? -0.359  -6.131  -4.877  1.00 0.00 ? 64  PHE A CD1  7  
ATOM 11279 C CD2  . PHE A 1 64  ? -0.324  -8.296  -3.950  1.00 0.00 ? 64  PHE A CD2  7  
ATOM 11280 C CE1  . PHE A 1 64  ? -1.450  -6.502  -5.706  1.00 0.00 ? 64  PHE A CE1  7  
ATOM 11281 C CE2  . PHE A 1 64  ? -1.416  -8.668  -4.779  1.00 0.00 ? 64  PHE A CE2  7  
ATOM 11282 C CZ   . PHE A 1 64  ? -1.955  -7.763  -5.640  1.00 0.00 ? 64  PHE A CZ   7  
ATOM 11283 H H    . PHE A 1 64  ? 1.087   -4.006  -2.679  1.00 0.00 ? 64  PHE A H    7  
ATOM 11284 H HA   . PHE A 1 64  ? 0.155   -6.420  -1.294  1.00 0.00 ? 64  PHE A HA   7  
ATOM 11285 H HB3  . PHE A 1 64  ? 1.920   -7.528  -2.858  1.00 0.00 ? 64  PHE A HB3  7  
ATOM 11286 H HD1  . PHE A 1 64  ? 0.045   -5.121  -4.931  1.00 0.00 ? 64  PHE A HD1  7  
ATOM 11287 H HD2  . PHE A 1 64  ? 0.109   -9.020  -3.260  1.00 0.00 ? 64  PHE A HD2  7  
ATOM 11288 H HE1  . PHE A 1 64  ? -1.883  -5.778  -6.396  1.00 0.00 ? 64  PHE A HE1  7  
ATOM 11289 H HE2  . PHE A 1 64  ? -1.821  -9.679  -4.724  1.00 0.00 ? 64  PHE A HE2  7  
ATOM 11290 H HZ   . PHE A 1 64  ? -2.793  -8.050  -6.275  1.00 0.00 ? 64  PHE A HZ   7  
ATOM 11291 N N    . VAL A 1 65  ? 2.307   -6.695  -0.015  1.00 0.00 ? 65  VAL A N    7  
ATOM 11292 C CA   . VAL A 1 65  ? 3.425   -6.677  0.911   1.00 0.00 ? 65  VAL A CA   7  
ATOM 11293 C C    . VAL A 1 65  ? 4.708   -7.052  0.165   1.00 0.00 ? 65  VAL A C    7  
ATOM 11294 O O    . VAL A 1 65  ? 4.725   -8.019  -0.596  1.00 0.00 ? 65  VAL A O    7  
ATOM 11295 C CB   . VAL A 1 65  ? 3.135   -7.595  2.100   1.00 0.00 ? 65  VAL A CB   7  
ATOM 11296 C CG1  . VAL A 1 65  ? 4.337   -7.665  3.045   1.00 0.00 ? 65  VAL A CG1  7  
ATOM 11297 C CG2  . VAL A 1 65  ? 1.877   -7.147  2.845   1.00 0.00 ? 65  VAL A CG2  7  
ATOM 11298 H H    . VAL A 1 65  ? 1.671   -7.457  0.105   1.00 0.00 ? 65  VAL A H    7  
ATOM 11299 H HA   . VAL A 1 65  ? 3.525   -5.658  1.288   1.00 0.00 ? 65  VAL A HA   7  
ATOM 11300 H HB   . VAL A 1 65  ? 2.956   -8.598  1.712   1.00 0.00 ? 65  VAL A HB   7  
ATOM 11301 H HG11 . VAL A 1 65  ? 3.994   -7.904  4.052   1.00 0.00 ? 65  VAL A HG11 7  
ATOM 11302 H HG12 . VAL A 1 65  ? 5.024   -8.440  2.703   1.00 0.00 ? 65  VAL A HG12 7  
ATOM 11303 H HG13 . VAL A 1 65  ? 4.848   -6.703  3.054   1.00 0.00 ? 65  VAL A HG13 7  
ATOM 11304 H HG21 . VAL A 1 65  ? 1.435   -8.000  3.359   1.00 0.00 ? 65  VAL A HG21 7  
ATOM 11305 H HG22 . VAL A 1 65  ? 2.140   -6.380  3.574   1.00 0.00 ? 65  VAL A HG22 7  
ATOM 11306 H HG23 . VAL A 1 65  ? 1.160   -6.739  2.133   1.00 0.00 ? 65  VAL A HG23 7  
ATOM 11307 N N    . LYS A 1 66  ? 5.748   -6.269  0.408   1.00 0.00 ? 66  LYS A N    7  
ATOM 11308 C CA   . LYS A 1 66  ? 7.030   -6.508  -0.232  1.00 0.00 ? 66  LYS A CA   7  
ATOM 11309 C C    . LYS A 1 66  ? 7.939   -7.278  0.729   1.00 0.00 ? 66  LYS A C    7  
ATOM 11310 O O    . LYS A 1 66  ? 8.367   -8.390  0.426   1.00 0.00 ? 66  LYS A O    7  
ATOM 11311 C CB   . LYS A 1 66  ? 7.634   -5.192  -0.728  1.00 0.00 ? 66  LYS A CB   7  
ATOM 11312 C CG   . LYS A 1 66  ? 8.826   -5.450  -1.654  1.00 0.00 ? 66  LYS A CG   7  
ATOM 11313 C CD   . LYS A 1 66  ? 9.842   -4.310  -1.568  1.00 0.00 ? 66  LYS A CD   7  
ATOM 11314 C CE   . LYS A 1 66  ? 11.075  -4.734  -0.766  1.00 0.00 ? 66  LYS A CE   7  
ATOM 11315 N NZ   . LYS A 1 66  ? 12.225  -4.970  -1.669  1.00 0.00 ? 66  LYS A NZ   7  
ATOM 11316 H H    . LYS A 1 66  ? 5.724   -5.485  1.028   1.00 0.00 ? 66  LYS A H    7  
ATOM 11317 H HA   . LYS A 1 66  ? 6.847   -7.130  -1.108  1.00 0.00 ? 66  LYS A HA   7  
ATOM 11318 H HB3  . LYS A 1 66  ? 7.953   -4.590  0.123   1.00 0.00 ? 66  LYS A HB3  7  
ATOM 11319 H HG3  . LYS A 1 66  ? 8.476   -5.555  -2.681  1.00 0.00 ? 66  LYS A HG3  7  
ATOM 11320 H HD3  . LYS A 1 66  ? 9.382   -3.440  -1.100  1.00 0.00 ? 66  LYS A HD3  7  
ATOM 11321 H HE3  . LYS A 1 66  ? 10.855  -5.642  -0.204  1.00 0.00 ? 66  LYS A HE3  7  
ATOM 11322 H HZ1  . LYS A 1 66  ? 12.017  -5.733  -2.280  1.00 0.00 ? 66  LYS A HZ1  7  
ATOM 11323 H HZ2  . LYS A 1 66  ? 12.397  -4.146  -2.210  1.00 0.00 ? 66  LYS A HZ2  7  
ATOM 11324 H HZ3  . LYS A 1 66  ? 13.035  -5.187  -1.125  1.00 0.00 ? 66  LYS A HZ3  7  
ATOM 11325 N N    . GLN A 1 67  ? 8.208   -6.654  1.865   1.00 0.00 ? 67  GLN A N    7  
ATOM 11326 C CA   . GLN A 1 67  ? 9.057   -7.267  2.873   1.00 0.00 ? 67  GLN A CA   7  
ATOM 11327 C C    . GLN A 1 67  ? 8.428   -7.121  4.260   1.00 0.00 ? 67  GLN A C    7  
ATOM 11328 O O    . GLN A 1 67  ? 7.493   -6.343  4.442   1.00 0.00 ? 67  GLN A O    7  
ATOM 11329 C CB   . GLN A 1 67  ? 10.464  -6.667  2.843   1.00 0.00 ? 67  GLN A CB   7  
ATOM 11330 C CG   . GLN A 1 67  ? 11.391  -7.484  1.941   1.00 0.00 ? 67  GLN A CG   7  
ATOM 11331 C CD   . GLN A 1 67  ? 12.597  -8.007  2.725   1.00 0.00 ? 67  GLN A CD   7  
ATOM 11332 O OE1  . GLN A 1 67  ? 12.573  -9.077  3.309   1.00 0.00 ? 67  GLN A OE1  7  
ATOM 11333 N NE2  . GLN A 1 67  ? 13.649  -7.193  2.704   1.00 0.00 ? 67  GLN A NE2  7  
ATOM 11334 H H    . GLN A 1 67  ? 7.855   -5.749  2.105   1.00 0.00 ? 67  GLN A H    7  
ATOM 11335 H HA   . GLN A 1 67  ? 9.114   -8.321  2.601   1.00 0.00 ? 67  GLN A HA   7  
ATOM 11336 H HB3  . GLN A 1 67  ? 10.871  -6.632  3.854   1.00 0.00 ? 67  GLN A HB3  7  
ATOM 11337 H HG3  . GLN A 1 67  ? 11.733  -6.867  1.110   1.00 0.00 ? 67  GLN A HG3  7  
ATOM 11338 H HE21 . GLN A 1 67  ? 13.602  -6.329  2.206   1.00 0.00 ? 67  GLN A HE21 7  
ATOM 11339 H HE22 . GLN A 1 67  ? 14.487  -7.447  3.189   1.00 0.00 ? 67  GLN A HE22 7  
ATOM 11340 N N    . VAL A 1 68  ? 8.967   -7.881  5.202   1.00 0.00 ? 68  VAL A N    7  
ATOM 11341 C CA   . VAL A 1 68  ? 8.470   -7.846  6.566   1.00 0.00 ? 68  VAL A CA   7  
ATOM 11342 C C    . VAL A 1 68  ? 9.654   -7.820  7.536   1.00 0.00 ? 68  VAL A C    7  
ATOM 11343 O O    . VAL A 1 68  ? 10.423  -8.777  7.608   1.00 0.00 ? 68  VAL A O    7  
ATOM 11344 C CB   . VAL A 1 68  ? 7.525   -9.025  6.810   1.00 0.00 ? 68  VAL A CB   7  
ATOM 11345 C CG1  . VAL A 1 68  ? 7.240   -9.200  8.303   1.00 0.00 ? 68  VAL A CG1  7  
ATOM 11346 C CG2  . VAL A 1 68  ? 6.226   -8.857  6.020   1.00 0.00 ? 68  VAL A CG2  7  
ATOM 11347 H H    . VAL A 1 68  ? 9.728   -8.511  5.045   1.00 0.00 ? 68  VAL A H    7  
ATOM 11348 H HA   . VAL A 1 68  ? 7.899   -6.925  6.686   1.00 0.00 ? 68  VAL A HA   7  
ATOM 11349 H HB   . VAL A 1 68  ? 8.019   -9.929  6.453   1.00 0.00 ? 68  VAL A HB   7  
ATOM 11350 H HG11 . VAL A 1 68  ? 7.486   -8.279  8.830   1.00 0.00 ? 68  VAL A HG11 7  
ATOM 11351 H HG12 . VAL A 1 68  ? 6.185   -9.430  8.447   1.00 0.00 ? 68  VAL A HG12 7  
ATOM 11352 H HG13 . VAL A 1 68  ? 7.847   -10.017 8.695   1.00 0.00 ? 68  VAL A HG13 7  
ATOM 11353 H HG21 . VAL A 1 68  ? 6.297   -7.973  5.384   1.00 0.00 ? 68  VAL A HG21 7  
ATOM 11354 H HG22 . VAL A 1 68  ? 6.061   -9.738  5.400   1.00 0.00 ? 68  VAL A HG22 7  
ATOM 11355 H HG23 . VAL A 1 68  ? 5.392   -8.739  6.714   1.00 0.00 ? 68  VAL A HG23 7  
ATOM 11356 N N    . LYS A 1 69  ? 9.764   -6.713  8.255   1.00 0.00 ? 69  LYS A N    7  
ATOM 11357 C CA   . LYS A 1 69  ? 10.841  -6.549  9.216   1.00 0.00 ? 69  LYS A CA   7  
ATOM 11358 C C    . LYS A 1 69  ? 11.067  -7.871  9.953   1.00 0.00 ? 69  LYS A C    7  
ATOM 11359 O O    . LYS A 1 69  ? 10.128  -8.639  10.161  1.00 0.00 ? 69  LYS A O    7  
ATOM 11360 C CB   . LYS A 1 69  ? 10.555  -5.369  10.147  1.00 0.00 ? 69  LYS A CB   7  
ATOM 11361 C CG   . LYS A 1 69  ? 11.855  -4.708  10.609  1.00 0.00 ? 69  LYS A CG   7  
ATOM 11362 C CD   . LYS A 1 69  ? 12.561  -5.563  11.664  1.00 0.00 ? 69  LYS A CD   7  
ATOM 11363 C CE   . LYS A 1 69  ? 12.797  -4.766  12.947  1.00 0.00 ? 69  LYS A CE   7  
ATOM 11364 N NZ   . LYS A 1 69  ? 13.709  -5.502  13.853  1.00 0.00 ? 69  LYS A NZ   7  
ATOM 11365 H H    . LYS A 1 69  ? 9.134   -5.939  8.190   1.00 0.00 ? 69  LYS A H    7  
ATOM 11366 H HA   . LYS A 1 69  ? 11.744  -6.307  8.656   1.00 0.00 ? 69  LYS A HA   7  
ATOM 11367 H HB3  . LYS A 1 69  ? 9.990   -5.712  11.013  1.00 0.00 ? 69  LYS A HB3  7  
ATOM 11368 H HG3  . LYS A 1 69  ? 11.639  -3.722  11.021  1.00 0.00 ? 69  LYS A HG3  7  
ATOM 11369 H HD3  . LYS A 1 69  ? 13.514  -5.918  11.271  1.00 0.00 ? 69  LYS A HD3  7  
ATOM 11370 H HE3  . LYS A 1 69  ? 11.847  -4.582  13.450  1.00 0.00 ? 69  LYS A HE3  7  
ATOM 11371 H HZ1  . LYS A 1 69  ? 14.648  -5.416  13.520  1.00 0.00 ? 69  LYS A HZ1  7  
ATOM 11372 H HZ2  . LYS A 1 69  ? 13.646  -5.116  14.773  1.00 0.00 ? 69  LYS A HZ2  7  
ATOM 11373 H HZ3  . LYS A 1 69  ? 13.449  -6.465  13.876  1.00 0.00 ? 69  LYS A HZ3  7  
ATOM 11374 N N    . GLU A 1 70  ? 12.318  -8.098  10.327  1.00 0.00 ? 70  GLU A N    7  
ATOM 11375 C CA   . GLU A 1 70  ? 12.679  -9.313  11.037  1.00 0.00 ? 70  GLU A CA   7  
ATOM 11376 C C    . GLU A 1 70  ? 12.615  -9.085  12.548  1.00 0.00 ? 70  GLU A C    7  
ATOM 11377 O O    . GLU A 1 70  ? 13.637  -8.833  13.185  1.00 0.00 ? 70  GLU A O    7  
ATOM 11378 C CB   . GLU A 1 70  ? 14.065  -9.803  10.613  1.00 0.00 ? 70  GLU A CB   7  
ATOM 11379 C CG   . GLU A 1 70  ? 14.249  -11.285 10.947  1.00 0.00 ? 70  GLU A CG   7  
ATOM 11380 C CD   . GLU A 1 70  ? 15.136  -11.465 12.180  1.00 0.00 ? 70  GLU A CD   7  
ATOM 11381 O OE1  . GLU A 1 70  ? 16.154  -10.744 12.258  1.00 0.00 ? 70  GLU A OE1  7  
ATOM 11382 O OE2  . GLU A 1 70  ? 14.776  -12.319 13.019  1.00 0.00 ? 70  GLU A OE2  7  
ATOM 11383 H H    . GLU A 1 70  ? 13.076  -7.468  10.154  1.00 0.00 ? 70  GLU A H    7  
ATOM 11384 H HA   . GLU A 1 70  ? 11.933  -10.053 10.741  1.00 0.00 ? 70  GLU A HA   7  
ATOM 11385 H HB3  . GLU A 1 70  ? 14.832  -9.216  11.119  1.00 0.00 ? 70  GLU A HB3  7  
ATOM 11386 H HG3  . GLU A 1 70  ? 14.694  -11.800 10.095  1.00 0.00 ? 70  GLU A HG3  7  
ATOM 11387 N N    . GLY A 1 71  ? 11.405  -9.185  13.078  1.00 0.00 ? 71  GLY A N    7  
ATOM 11388 C CA   . GLY A 1 71  ? 11.194  -8.992  14.502  1.00 0.00 ? 71  GLY A CA   7  
ATOM 11389 C C    . GLY A 1 71  ? 10.560  -7.629  14.784  1.00 0.00 ? 71  GLY A C    7  
ATOM 11390 O O    . GLY A 1 71  ? 10.763  -7.054  15.854  1.00 0.00 ? 71  GLY A O    7  
ATOM 11391 H H    . GLY A 1 71  ? 10.579  -9.390  12.553  1.00 0.00 ? 71  GLY A H    7  
ATOM 11392 H HA2  . GLY A 1 71  ? 10.551  -9.783  14.888  1.00 0.00 ? 71  GLY A HA2  7  
ATOM 11393 H HA3  . GLY A 1 71  ? 12.146  -9.070  15.029  1.00 0.00 ? 71  GLY A HA3  7  
ATOM 11394 N N    . GLY A 1 72  ? 9.805   -7.150  13.806  1.00 0.00 ? 72  GLY A N    7  
ATOM 11395 C CA   . GLY A 1 72  ? 9.140   -5.864  13.936  1.00 0.00 ? 72  GLY A CA   7  
ATOM 11396 C C    . GLY A 1 72  ? 7.679   -6.042  14.356  1.00 0.00 ? 72  GLY A C    7  
ATOM 11397 O O    . GLY A 1 72  ? 7.322   -7.052  14.957  1.00 0.00 ? 72  GLY A O    7  
ATOM 11398 H H    . GLY A 1 72  ? 9.646   -7.623  12.941  1.00 0.00 ? 72  GLY A H    7  
ATOM 11399 H HA2  . GLY A 1 72  ? 9.661   -5.253  14.672  1.00 0.00 ? 72  GLY A HA2  7  
ATOM 11400 H HA3  . GLY A 1 72  ? 9.186   -5.329  12.988  1.00 0.00 ? 72  GLY A HA3  7  
ATOM 11401 N N    . PRO A 1 73  ? 6.854   -5.016  14.013  1.00 0.00 ? 73  PRO A N    7  
ATOM 11402 C CA   . PRO A 1 73  ? 5.440   -5.051  14.347  1.00 0.00 ? 73  PRO A CA   7  
ATOM 11403 C C    . PRO A 1 73  ? 4.682   -6.013  13.431  1.00 0.00 ? 73  PRO A C    7  
ATOM 11404 O O    . PRO A 1 73  ? 4.209   -7.057  13.877  1.00 0.00 ? 73  PRO A O    7  
ATOM 11405 C CB   . PRO A 1 73  ? 4.971   -3.611  14.216  1.00 0.00 ? 73  PRO A CB   7  
ATOM 11406 C CG   . PRO A 1 73  ? 6.017   -2.908  13.366  1.00 0.00 ? 73  PRO A CG   7  
ATOM 11407 C CD   . PRO A 1 73  ? 7.243   -3.804  13.300  1.00 0.00 ? 73  PRO A CD   7  
ATOM 11408 H HA   . PRO A 1 73  ? 5.312   -5.398  15.277  1.00 0.00 ? 73  PRO A HA   7  
ATOM 11409 H HB3  . PRO A 1 73  ? 4.879   -3.139  15.193  1.00 0.00 ? 73  PRO A HB3  7  
ATOM 11410 H HG3  . PRO A 1 73  ? 6.274   -1.941  13.801  1.00 0.00 ? 73  PRO A HG3  7  
ATOM 11411 H HD3  . PRO A 1 73  ? 8.106   -3.330  13.767  1.00 0.00 ? 73  PRO A HD3  7  
ATOM 11412 N N    . ALA A 1 74  ? 4.592   -5.629  12.166  1.00 0.00 ? 74  ALA A N    7  
ATOM 11413 C CA   . ALA A 1 74  ? 3.899   -6.444  11.184  1.00 0.00 ? 74  ALA A CA   7  
ATOM 11414 C C    . ALA A 1 74  ? 4.348   -7.899  11.330  1.00 0.00 ? 74  ALA A C    7  
ATOM 11415 O O    . ALA A 1 74  ? 3.528   -8.815  11.265  1.00 0.00 ? 74  ALA A O    7  
ATOM 11416 C CB   . ALA A 1 74  ? 4.163   -5.890  9.783   1.00 0.00 ? 74  ALA A CB   7  
ATOM 11417 H H    . ALA A 1 74  ? 4.980   -4.778  11.813  1.00 0.00 ? 74  ALA A H    7  
ATOM 11418 H HA   . ALA A 1 74  ? 2.832   -6.379  11.391  1.00 0.00 ? 74  ALA A HA   7  
ATOM 11419 H HB1  . ALA A 1 74  ? 3.235   -5.885  9.213   1.00 0.00 ? 74  ALA A HB1  7  
ATOM 11420 H HB2  . ALA A 1 74  ? 4.548   -4.873  9.860   1.00 0.00 ? 74  ALA A HB2  7  
ATOM 11421 H HB3  . ALA A 1 74  ? 4.897   -6.518  9.276   1.00 0.00 ? 74  ALA A HB3  7  
ATOM 11422 N N    . PHE A 1 75  ? 5.648   -8.069  11.522  1.00 0.00 ? 75  PHE A N    7  
ATOM 11423 C CA   . PHE A 1 75  ? 6.214   -9.398  11.677  1.00 0.00 ? 75  PHE A CA   7  
ATOM 11424 C C    . PHE A 1 75  ? 5.516   -10.164 12.801  1.00 0.00 ? 75  PHE A C    7  
ATOM 11425 O O    . PHE A 1 75  ? 5.396   -11.388 12.741  1.00 0.00 ? 75  PHE A O    7  
ATOM 11426 C CB   . PHE A 1 75  ? 7.689   -9.215  12.041  1.00 0.00 ? 75  PHE A CB   7  
ATOM 11427 C CG   . PHE A 1 75  ? 8.413   -10.519 12.383  1.00 0.00 ? 75  PHE A CG   7  
ATOM 11428 C CD1  . PHE A 1 75  ? 8.663   -11.435 11.410  1.00 0.00 ? 75  PHE A CD1  7  
ATOM 11429 C CD2  . PHE A 1 75  ? 8.804   -10.763 13.663  1.00 0.00 ? 75  PHE A CD2  7  
ATOM 11430 C CE1  . PHE A 1 75  ? 9.333   -12.645 11.728  1.00 0.00 ? 75  PHE A CE1  7  
ATOM 11431 C CE2  . PHE A 1 75  ? 9.474   -11.974 13.981  1.00 0.00 ? 75  PHE A CE2  7  
ATOM 11432 C CZ   . PHE A 1 75  ? 9.725   -12.889 13.008  1.00 0.00 ? 75  PHE A CZ   7  
ATOM 11433 H H    . PHE A 1 75  ? 6.308   -7.320  11.572  1.00 0.00 ? 75  PHE A H    7  
ATOM 11434 H HA   . PHE A 1 75  ? 6.068   -9.924  10.733  1.00 0.00 ? 75  PHE A HA   7  
ATOM 11435 H HB3  . PHE A 1 75  ? 7.763   -8.537  12.890  1.00 0.00 ? 75  PHE A HB3  7  
ATOM 11436 H HD1  . PHE A 1 75  ? 8.349   -11.239 10.384  1.00 0.00 ? 75  PHE A HD1  7  
ATOM 11437 H HD2  . PHE A 1 75  ? 8.602   -10.029 14.444  1.00 0.00 ? 75  PHE A HD2  7  
ATOM 11438 H HE1  . PHE A 1 75  ? 9.534   -13.379 10.947  1.00 0.00 ? 75  PHE A HE1  7  
ATOM 11439 H HE2  . PHE A 1 75  ? 9.789   -12.169 15.007  1.00 0.00 ? 75  PHE A HE2  7  
ATOM 11440 H HZ   . PHE A 1 75  ? 10.240  -13.818 13.252  1.00 0.00 ? 75  PHE A HZ   7  
ATOM 11441 N N    . GLU A 1 76  ? 5.072   -9.414  13.799  1.00 0.00 ? 76  GLU A N    7  
ATOM 11442 C CA   . GLU A 1 76  ? 4.388   -10.009 14.935  1.00 0.00 ? 76  GLU A CA   7  
ATOM 11443 C C    . GLU A 1 76  ? 2.904   -10.206 14.616  1.00 0.00 ? 76  GLU A C    7  
ATOM 11444 O O    . GLU A 1 76  ? 2.375   -11.305 14.770  1.00 0.00 ? 76  GLU A O    7  
ATOM 11445 C CB   . GLU A 1 76  ? 4.571   -9.156  16.192  1.00 0.00 ? 76  GLU A CB   7  
ATOM 11446 C CG   . GLU A 1 76  ? 6.053   -8.892  16.464  1.00 0.00 ? 76  GLU A CG   7  
ATOM 11447 C CD   . GLU A 1 76  ? 6.551   -9.732  17.642  1.00 0.00 ? 76  GLU A CD   7  
ATOM 11448 O OE1  . GLU A 1 76  ? 6.286   -10.954 17.621  1.00 0.00 ? 76  GLU A OE1  7  
ATOM 11449 O OE2  . GLU A 1 76  ? 7.185   -9.133  18.538  1.00 0.00 ? 76  GLU A OE2  7  
ATOM 11450 H H    . GLU A 1 76  ? 5.173   -8.421  13.839  1.00 0.00 ? 76  GLU A H    7  
ATOM 11451 H HA   . GLU A 1 76  ? 4.865   -10.977 15.087  1.00 0.00 ? 76  GLU A HA   7  
ATOM 11452 H HB3  . GLU A 1 76  ? 4.124   -9.663  17.047  1.00 0.00 ? 76  GLU A HB3  7  
ATOM 11453 H HG3  . GLU A 1 76  ? 6.204   -7.834  16.678  1.00 0.00 ? 76  GLU A HG3  7  
ATOM 11454 N N    . ALA A 1 77  ? 2.277   -9.124  14.180  1.00 0.00 ? 77  ALA A N    7  
ATOM 11455 C CA   . ALA A 1 77  ? 0.864   -9.165  13.840  1.00 0.00 ? 77  ALA A CA   7  
ATOM 11456 C C    . ALA A 1 77  ? 0.551   -10.487 13.138  1.00 0.00 ? 77  ALA A C    7  
ATOM 11457 O O    . ALA A 1 77  ? -0.556  -11.010 13.256  1.00 0.00 ? 77  ALA A O    7  
ATOM 11458 C CB   . ALA A 1 77  ? 0.512   -7.950  12.978  1.00 0.00 ? 77  ALA A CB   7  
ATOM 11459 H H    . ALA A 1 77  ? 2.715   -8.235  14.059  1.00 0.00 ? 77  ALA A H    7  
ATOM 11460 H HA   . ALA A 1 77  ? 0.298   -9.112  14.768  1.00 0.00 ? 77  ALA A HA   7  
ATOM 11461 H HB1  . ALA A 1 77  ? 1.104   -7.093  13.298  1.00 0.00 ? 77  ALA A HB1  7  
ATOM 11462 H HB2  . ALA A 1 77  ? 0.727   -8.172  11.933  1.00 0.00 ? 77  ALA A HB2  7  
ATOM 11463 H HB3  . ALA A 1 77  ? -0.548  -7.721  13.089  1.00 0.00 ? 77  ALA A HB3  7  
ATOM 11464 N N    . GLY A 1 78  ? 1.547   -10.992 12.424  1.00 0.00 ? 78  GLY A N    7  
ATOM 11465 C CA   . GLY A 1 78  ? 1.391   -12.244 11.703  1.00 0.00 ? 78  GLY A CA   7  
ATOM 11466 C C    . GLY A 1 78  ? 1.503   -12.025 10.192  1.00 0.00 ? 78  GLY A C    7  
ATOM 11467 O O    . GLY A 1 78  ? 1.286   -12.949 9.410   1.00 0.00 ? 78  GLY A O    7  
ATOM 11468 H H    . GLY A 1 78  ? 2.445   -10.561 12.333  1.00 0.00 ? 78  GLY A H    7  
ATOM 11469 H HA2  . GLY A 1 78  ? 2.153   -12.953 12.028  1.00 0.00 ? 78  GLY A HA2  7  
ATOM 11470 H HA3  . GLY A 1 78  ? 0.422   -12.687 11.939  1.00 0.00 ? 78  GLY A HA3  7  
ATOM 11471 N N    . LEU A 1 79  ? 1.841   -10.797 9.829   1.00 0.00 ? 79  LEU A N    7  
ATOM 11472 C CA   . LEU A 1 79  ? 1.985   -10.445 8.426   1.00 0.00 ? 79  LEU A CA   7  
ATOM 11473 C C    . LEU A 1 79  ? 3.041   -11.348 7.784   1.00 0.00 ? 79  LEU A C    7  
ATOM 11474 O O    . LEU A 1 79  ? 3.589   -12.232 8.440   1.00 0.00 ? 79  LEU A O    7  
ATOM 11475 C CB   . LEU A 1 79  ? 2.279   -8.952  8.275   1.00 0.00 ? 79  LEU A CB   7  
ATOM 11476 C CG   . LEU A 1 79  ? 1.508   -8.225  7.173   1.00 0.00 ? 79  LEU A CG   7  
ATOM 11477 C CD1  . LEU A 1 79  ? 0.050   -8.002  7.580   1.00 0.00 ? 79  LEU A CD1  7  
ATOM 11478 C CD2  . LEU A 1 79  ? 2.201   -6.915  6.791   1.00 0.00 ? 79  LEU A CD2  7  
ATOM 11479 H H    . LEU A 1 79  ? 2.017   -10.052 10.471  1.00 0.00 ? 79  LEU A H    7  
ATOM 11480 H HA   . LEU A 1 79  ? 1.027   -10.636 7.942   1.00 0.00 ? 79  LEU A HA   7  
ATOM 11481 H HB3  . LEU A 1 79  ? 3.346   -8.830  8.087   1.00 0.00 ? 79  LEU A HB3  7  
ATOM 11482 H HG   . LEU A 1 79  ? 1.501   -8.856  6.286   1.00 0.00 ? 79  LEU A HG   7  
ATOM 11483 H HD11 . LEU A 1 79  ? -0.517  -7.644  6.720   1.00 0.00 ? 79  LEU A HD11 7  
ATOM 11484 H HD12 . LEU A 1 79  ? -0.377  -8.942  7.930   1.00 0.00 ? 79  LEU A HD12 7  
ATOM 11485 H HD13 . LEU A 1 79  ? 0.004   -7.263  8.379   1.00 0.00 ? 79  LEU A HD13 7  
ATOM 11486 H HD21 . LEU A 1 79  ? 1.533   -6.077  6.989   1.00 0.00 ? 79  LEU A HD21 7  
ATOM 11487 H HD22 . LEU A 1 79  ? 3.111   -6.801  7.380   1.00 0.00 ? 79  LEU A HD22 7  
ATOM 11488 H HD23 . LEU A 1 79  ? 2.456   -6.934  5.731   1.00 0.00 ? 79  LEU A HD23 7  
ATOM 11489 N N    . CYS A 1 80  ? 3.293   -11.094 6.508   1.00 0.00 ? 80  CYS A N    7  
ATOM 11490 C CA   . CYS A 1 80  ? 4.272   -11.873 5.769   1.00 0.00 ? 80  CYS A CA   7  
ATOM 11491 C C    . CYS A 1 80  ? 4.413   -11.266 4.371   1.00 0.00 ? 80  CYS A C    7  
ATOM 11492 O O    . CYS A 1 80  ? 3.964   -10.148 4.128   1.00 0.00 ? 80  CYS A O    7  
ATOM 11493 C CB   . CYS A 1 80  ? 3.892   -13.355 5.713   1.00 0.00 ? 80  CYS A CB   7  
ATOM 11494 S SG   . CYS A 1 80  ? 5.191   -14.365 6.513   1.00 0.00 ? 80  CYS A SG   7  
ATOM 11495 H H    . CYS A 1 80  ? 2.842   -10.374 5.981   1.00 0.00 ? 80  CYS A H    7  
ATOM 11496 H HA   . CYS A 1 80  ? 5.210   -11.800 6.320   1.00 0.00 ? 80  CYS A HA   7  
ATOM 11497 H HB3  . CYS A 1 80  ? 3.764   -13.666 4.677   1.00 0.00 ? 80  CYS A HB3  7  
ATOM 11498 H HG   . CYS A 1 80  ? 5.241   -13.659 7.640   1.00 0.00 ? 80  CYS A HG   7  
ATOM 11499 N N    . THR A 1 81  ? 5.039   -12.033 3.490   1.00 0.00 ? 81  THR A N    7  
ATOM 11500 C CA   . THR A 1 81  ? 5.246   -11.583 2.123   1.00 0.00 ? 81  THR A CA   7  
ATOM 11501 C C    . THR A 1 81  ? 4.265   -12.283 1.180   1.00 0.00 ? 81  THR A C    7  
ATOM 11502 O O    . THR A 1 81  ? 4.087   -13.497 1.252   1.00 0.00 ? 81  THR A O    7  
ATOM 11503 C CB   . THR A 1 81  ? 6.713   -11.825 1.763   1.00 0.00 ? 81  THR A CB   7  
ATOM 11504 O OG1  . THR A 1 81  ? 6.881   -13.232 1.916   1.00 0.00 ? 81  THR A OG1  7  
ATOM 11505 C CG2  . THR A 1 81  ? 7.675   -11.221 2.788   1.00 0.00 ? 81  THR A CG2  7  
ATOM 11506 H H    . THR A 1 81  ? 5.403   -12.941 3.696   1.00 0.00 ? 81  THR A H    7  
ATOM 11507 H HA   . THR A 1 81  ? 5.031   -10.517 2.075   1.00 0.00 ? 81  THR A HA   7  
ATOM 11508 H HB   . THR A 1 81  ? 6.933   -11.460 0.760   1.00 0.00 ? 81  THR A HB   7  
ATOM 11509 H HG1  . THR A 1 81  ? 7.049   -13.453 2.877   1.00 0.00 ? 81  THR A HG1  7  
ATOM 11510 H HG21 . THR A 1 81  ? 8.044   -10.263 2.419   1.00 0.00 ? 81  THR A HG21 7  
ATOM 11511 H HG22 . THR A 1 81  ? 7.152   -11.070 3.731   1.00 0.00 ? 81  THR A HG22 7  
ATOM 11512 H HG23 . THR A 1 81  ? 8.515   -11.899 2.942   1.00 0.00 ? 81  THR A HG23 7  
ATOM 11513 N N    . GLY A 1 82  ? 3.654   -11.485 0.316   1.00 0.00 ? 82  GLY A N    7  
ATOM 11514 C CA   . GLY A 1 82  ? 2.697   -12.011 -0.642  1.00 0.00 ? 82  GLY A CA   7  
ATOM 11515 C C    . GLY A 1 82  ? 1.267   -11.627 -0.255  1.00 0.00 ? 82  GLY A C    7  
ATOM 11516 O O    . GLY A 1 82  ? 0.339   -11.801 -1.042  1.00 0.00 ? 82  GLY A O    7  
ATOM 11517 H H    . GLY A 1 82  ? 3.805   -10.497 0.263   1.00 0.00 ? 82  GLY A H    7  
ATOM 11518 H HA2  . GLY A 1 82  ? 2.923   -11.628 -1.637  1.00 0.00 ? 82  GLY A HA2  7  
ATOM 11519 H HA3  . GLY A 1 82  ? 2.785   -13.097 -0.691  1.00 0.00 ? 82  GLY A HA3  7  
ATOM 11520 N N    . ASP A 1 83  ? 1.135   -11.113 0.959   1.00 0.00 ? 83  ASP A N    7  
ATOM 11521 C CA   . ASP A 1 83  ? -0.166  -10.703 1.461   1.00 0.00 ? 83  ASP A CA   7  
ATOM 11522 C C    . ASP A 1 83  ? -0.504  -9.316  0.916   1.00 0.00 ? 83  ASP A C    7  
ATOM 11523 O O    . ASP A 1 83  ? 0.352   -8.432  0.883   1.00 0.00 ? 83  ASP A O    7  
ATOM 11524 C CB   . ASP A 1 83  ? -0.166  -10.625 2.989   1.00 0.00 ? 83  ASP A CB   7  
ATOM 11525 C CG   . ASP A 1 83  ? 0.105   -11.949 3.705   1.00 0.00 ? 83  ASP A CG   7  
ATOM 11526 O OD1  . ASP A 1 83  ? -0.742  -12.856 3.561   1.00 0.00 ? 83  ASP A OD1  7  
ATOM 11527 O OD2  . ASP A 1 83  ? 1.155   -12.023 4.380   1.00 0.00 ? 83  ASP A OD2  7  
ATOM 11528 H H    . ASP A 1 83  ? 1.895   -10.975 1.595   1.00 0.00 ? 83  ASP A H    7  
ATOM 11529 H HA   . ASP A 1 83  ? -0.861  -11.469 1.114   1.00 0.00 ? 83  ASP A HA   7  
ATOM 11530 H HB3  . ASP A 1 83  ? -1.134  -10.243 3.317   1.00 0.00 ? 83  ASP A HB3  7  
ATOM 11531 N N    . ARG A 1 84  ? -1.754  -9.164  0.500   1.00 0.00 ? 84  ARG A N    7  
ATOM 11532 C CA   . ARG A 1 84  ? -2.214  -7.898  -0.042  1.00 0.00 ? 84  ARG A CA   7  
ATOM 11533 C C    . ARG A 1 84  ? -3.078  -7.164  0.986   1.00 0.00 ? 84  ARG A C    7  
ATOM 11534 O O    . ARG A 1 84  ? -3.814  -7.791  1.745   1.00 0.00 ? 84  ARG A O    7  
ATOM 11535 C CB   . ARG A 1 84  ? -3.027  -8.111  -1.321  1.00 0.00 ? 84  ARG A CB   7  
ATOM 11536 C CG   . ARG A 1 84  ? -4.281  -8.941  -1.043  1.00 0.00 ? 84  ARG A CG   7  
ATOM 11537 C CD   . ARG A 1 84  ? -5.226  -8.926  -2.246  1.00 0.00 ? 84  ARG A CD   7  
ATOM 11538 N NE   . ARG A 1 84  ? -6.631  -8.998  -1.787  1.00 0.00 ? 84  ARG A NE   7  
ATOM 11539 C CZ   . ARG A 1 84  ? -7.660  -9.346  -2.571  1.00 0.00 ? 84  ARG A CZ   7  
ATOM 11540 N NH1  . ARG A 1 84  ? -7.449  -9.656  -3.857  1.00 0.00 ? 84  ARG A NH1  7  
ATOM 11541 N NH2  . ARG A 1 84  ? -8.903  -9.384  -2.068  1.00 0.00 ? 84  ARG A NH2  7  
ATOM 11542 H H    . ARG A 1 84  ? -2.442  -9.888  0.531   1.00 0.00 ? 84  ARG A H    7  
ATOM 11543 H HA   . ARG A 1 84  ? -1.304  -7.340  -0.260  1.00 0.00 ? 84  ARG A HA   7  
ATOM 11544 H HB3  . ARG A 1 84  ? -2.411  -8.613  -2.067  1.00 0.00 ? 84  ARG A HB3  7  
ATOM 11545 H HG3  . ARG A 1 84  ? -4.796  -8.548  -0.167  1.00 0.00 ? 84  ARG A HG3  7  
ATOM 11546 H HD3  . ARG A 1 84  ? -5.006  -9.769  -2.902  1.00 0.00 ? 84  ARG A HD3  7  
ATOM 11547 H HE   . ARG A 1 84  ? -6.824  -8.773  -0.831  1.00 0.00 ? 84  ARG A HE   7  
ATOM 11548 H HH11 . ARG A 1 84  ? -6.523  -9.627  -4.231  1.00 0.00 ? 84  ARG A HH11 7  
ATOM 11549 H HH12 . ARG A 1 84  ? -8.218  -9.916  -4.442  1.00 0.00 ? 84  ARG A HH12 7  
ATOM 11550 H HH21 . ARG A 1 84  ? -9.0