data_2YYO
# 
_entry.id   2YYO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YYO         
RCSB  RCSB027300   
WWPDB D_1000027300 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001000898.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2YYO 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-30 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kishishita, S.'                                         1  
'Uchikubo-Kamo, T.'                                      2  
'Murayama, K.'                                           3  
'Terada, T.'                                             4  
'Chen, L.'                                               5  
'Fu, Z.Q.'                                               6  
'Chrzas, J.'                                             7  
'Shirouzu, M.'                                           8  
'Wang, B.C.'                                             9  
'Yokoyama, S.'                                           10 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 
# 
_citation.id                        primary 
_citation.title                     'Crystal sturcture of human SPRY domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kishishita, S.'    1  
primary 'Uchikubo-Kamo, T.' 2  
primary 'Murayama, K.'      3  
primary 'Terada, T.'        4  
primary 'Chen, L.'          5  
primary 'Fu, Z.Q.'          6  
primary 'Chrzas, J.'        7  
primary 'Shirouzu, M.'      8  
primary 'Wang, B.C.'        9  
primary 'Yokoyama, S.'      10 
# 
_cell.entry_id           2YYO 
_cell.length_a           52.107 
_cell.length_b           52.107 
_cell.length_c           108.583 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2YYO 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SPRY domain-containing protein 3' 18261.812 1  ? ? 'SPRY domain' ? 
2 water   nat water                              18.015    91 ? ? ?             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAY
HADDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTI(MSE)P(MSE)SPDGLFPAVG
(MSE)HSLGEEVRLHLNAELSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAY
HADDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRLH
LNAELSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001000898.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PHE n 
1 9   LYS n 
1 10  HIS n 
1 11  ILE n 
1 12  LEU n 
1 13  VAL n 
1 14  ASP n 
1 15  GLY n 
1 16  ASP n 
1 17  THR n 
1 18  LEU n 
1 19  SER n 
1 20  TYR n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  SER n 
1 25  GLY n 
1 26  GLU n 
1 27  VAL n 
1 28  GLY n 
1 29  CYS n 
1 30  TYR n 
1 31  VAL n 
1 32  ALA n 
1 33  SER n 
1 34  ARG n 
1 35  PRO n 
1 36  LEU n 
1 37  THR n 
1 38  LYS n 
1 39  ASP n 
1 40  SER n 
1 41  ASN n 
1 42  TYR n 
1 43  PHE n 
1 44  GLU n 
1 45  VAL n 
1 46  SER n 
1 47  ILE n 
1 48  VAL n 
1 49  ASP n 
1 50  SER n 
1 51  GLY n 
1 52  VAL n 
1 53  ARG n 
1 54  GLY n 
1 55  THR n 
1 56  ILE n 
1 57  ALA n 
1 58  VAL n 
1 59  GLY n 
1 60  LEU n 
1 61  VAL n 
1 62  PRO n 
1 63  GLN n 
1 64  TYR n 
1 65  TYR n 
1 66  SER n 
1 67  LEU n 
1 68  ASP n 
1 69  HIS n 
1 70  GLN n 
1 71  PRO n 
1 72  GLY n 
1 73  TRP n 
1 74  LEU n 
1 75  PRO n 
1 76  ASP n 
1 77  SER n 
1 78  VAL n 
1 79  ALA n 
1 80  TYR n 
1 81  HIS n 
1 82  ALA n 
1 83  ASP n 
1 84  ASP n 
1 85  GLY n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  ASN n 
1 90  GLY n 
1 91  ARG n 
1 92  ALA n 
1 93  LYS n 
1 94  GLY n 
1 95  ARG n 
1 96  GLN n 
1 97  PHE n 
1 98  GLY n 
1 99  SER n 
1 100 LYS n 
1 101 CYS n 
1 102 ASN n 
1 103 SER n 
1 104 GLY n 
1 105 ASP n 
1 106 ARG n 
1 107 ILE n 
1 108 GLY n 
1 109 CYS n 
1 110 GLY n 
1 111 ILE n 
1 112 GLU n 
1 113 PRO n 
1 114 VAL n 
1 115 SER n 
1 116 PHE n 
1 117 ASP n 
1 118 VAL n 
1 119 GLN n 
1 120 THR n 
1 121 ALA n 
1 122 GLN n 
1 123 ILE n 
1 124 PHE n 
1 125 PHE n 
1 126 THR n 
1 127 LYS n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 ARG n 
1 132 VAL n 
1 133 GLY n 
1 134 SER n 
1 135 THR n 
1 136 ILE n 
1 137 MSE n 
1 138 PRO n 
1 139 MSE n 
1 140 SER n 
1 141 PRO n 
1 142 ASP n 
1 143 GLY n 
1 144 LEU n 
1 145 PHE n 
1 146 PRO n 
1 147 ALA n 
1 148 VAL n 
1 149 GLY n 
1 150 MSE n 
1 151 HIS n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 GLU n 
1 156 GLU n 
1 157 VAL n 
1 158 ARG n 
1 159 LEU n 
1 160 HIS n 
1 161 LEU n 
1 162 ASN n 
1 163 ALA n 
1 164 GLU n 
1 165 LEU n 
1 166 SER n 
1 167 GLY n 
1 168 PRO n 
1 169 SER n 
1 170 SER n 
1 171 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SPRYD3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell-free protein synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PK050905-07 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPRY3_HUMAN 
_struct_ref.pdbx_db_accession          Q8NCJ5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKL
YNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRLHLNAEL
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2YYO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NCJ5 
_struct_ref_seq.db_align_beg                  46 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  203 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       165 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YYO GLY A 1   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 1   1  
1 2YYO SER A 2   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 2   2  
1 2YYO SER A 3   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 3   3  
1 2YYO GLY A 4   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 4   4  
1 2YYO SER A 5   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 5   5  
1 2YYO SER A 6   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 6   6  
1 2YYO GLY A 7   ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 7   7  
1 2YYO SER A 166 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 166 8  
1 2YYO GLY A 167 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 167 9  
1 2YYO PRO A 168 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 168 10 
1 2YYO SER A 169 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 169 11 
1 2YYO SER A 170 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 170 12 
1 2YYO GLY A 171 ? UNP Q8NCJ5 ? ? 'EXPRESSION TAG' 171 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2YYO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.02 
_exptl_crystal.density_percent_sol   39.02 
_exptl_crystal.description           'The file contains Friedel pairs.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '0.1M Tris, 1.6M Ammonium Sulfate, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-11-15 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si II' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9789 1.0 
2 0.9793 1.0 
3 0.971  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9789, 0.9793, 0.971' 
# 
_reflns.entry_id                     2YYO 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   18943 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.098 
_reflns.pdbx_netI_over_sigmaI        78.6 
_reflns.B_iso_Wilson_estimate        12.0 
_reflns.pdbx_redundancy              24.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.348 
_reflns_shell.meanI_over_sigI_obs    20.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2YYO 
_refine.ls_number_reflns_obs                     18943 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               213101.66 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.05 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  943 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.9 
_refine.aniso_B[1][1]                            3.24 
_refine.aniso_B[2][2]                            3.24 
_refine.aniso_B[3][3]                            -6.48 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.339151 
_refine.solvent_model_param_bsol                 40.1519 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'The file contains Friedel pairs.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2YYO 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1214 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               1305 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        26.05 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.78  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             2982 
_refine_ls_shell.R_factor_R_work                  0.225 
_refine_ls_shell.percent_reflns_obs               97.1 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            0.026 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             144 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2YYO 
_struct.title                     'Crystal sturcture of human SPRY domain' 
_struct.pdbx_descriptor           'SPRY domain-containing protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YYO 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;SPRY domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        113 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASP 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        117 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         113 
_struct_conf.end_auth_comp_id        ASP 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         117 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ILE 136 C ? ? ? 1_555 A MSE 137 N ? ? A ILE 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? A MSE 137 C ? ? ? 1_555 A PRO 138 N ? ? A MSE 137 A PRO 138 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale3 covale ? ? A PRO 138 C ? ? ? 1_555 A MSE 139 N ? ? A PRO 138 A MSE 139 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4 covale ? ? A MSE 139 C ? ? ? 1_555 A SER 140 N ? ? A MSE 139 A SER 140 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5 covale ? ? A GLY 149 C ? ? ? 1_555 A MSE 150 N ? ? A GLY 149 A MSE 150 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6 covale ? ? A MSE 150 C ? ? ? 1_555 A HIS 151 N ? ? A MSE 150 A HIS 151 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 7   ? LYS A 9   ? GLY A 7   LYS A 9   
A 2 GLY A 28  ? VAL A 31  ? GLY A 28  VAL A 31  
A 3 PHE A 145 ? MSE A 150 ? PHE A 145 MSE A 150 
A 4 ALA A 57  ? VAL A 61  ? ALA A 57  VAL A 61  
A 5 VAL A 78  ? HIS A 81  ? VAL A 78  HIS A 81  
A 6 LEU A 87  ? TYR A 88  ? LEU A 87  TYR A 88  
B 1 ILE A 11  ? ASP A 14  ? ILE A 11  ASP A 14  
B 2 THR A 17  ? TYR A 20  ? THR A 17  TYR A 20  
B 3 GLU A 155 ? HIS A 160 ? GLU A 155 HIS A 160 
B 4 TYR A 42  ? SER A 50  ? TYR A 42  SER A 50  
B 5 ARG A 106 ? ILE A 111 ? ARG A 106 ILE A 111 
B 6 ALA A 121 ? LYS A 127 ? ALA A 121 LYS A 127 
B 7 LYS A 130 ? MSE A 137 ? LYS A 130 MSE A 137 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 7   ? N GLY A 7   O VAL A 31  ? O VAL A 31  
A 2 3 N GLY A 28  ? N GLY A 28  O MSE A 150 ? O MSE A 150 
A 3 4 O PHE A 145 ? O PHE A 145 N VAL A 61  ? N VAL A 61  
A 4 5 N VAL A 58  ? N VAL A 58  O TYR A 80  ? O TYR A 80  
A 5 6 N ALA A 79  ? N ALA A 79  O TYR A 88  ? O TYR A 88  
B 1 2 N LEU A 12  ? N LEU A 12  O SER A 19  ? O SER A 19  
B 2 3 N LEU A 18  ? N LEU A 18  O VAL A 157 ? O VAL A 157 
B 3 4 O HIS A 160 ? O HIS A 160 N GLU A 44  ? N GLU A 44  
B 4 5 N VAL A 45  ? N VAL A 45  O ILE A 107 ? O ILE A 107 
B 5 6 N GLY A 110 ? N GLY A 110 O PHE A 124 ? O PHE A 124 
B 6 7 N PHE A 125 ? N PHE A 125 O VAL A 132 ? O VAL A 132 
# 
_database_PDB_matrix.entry_id          2YYO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2YYO 
_atom_sites.fract_transf_matrix[1][1]   0.019191 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019191 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009210 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 6   ? 20.280 2.674   31.169 1.00 34.58 ? 6   SER A N   1 
ATOM   2    C  CA  . SER A 1 6   ? 21.659 2.551   30.606 1.00 32.55 ? 6   SER A CA  1 
ATOM   3    C  C   . SER A 1 6   ? 22.348 3.908   30.651 1.00 30.41 ? 6   SER A C   1 
ATOM   4    O  O   . SER A 1 6   ? 23.416 4.050   31.251 1.00 30.51 ? 6   SER A O   1 
ATOM   5    C  CB  . SER A 1 6   ? 21.603 2.042   29.160 1.00 33.85 ? 6   SER A CB  1 
ATOM   6    O  OG  . SER A 1 6   ? 22.902 1.928   28.600 1.00 31.03 ? 6   SER A OG  1 
ATOM   7    N  N   . GLY A 1 7   ? 21.733 4.906   30.018 1.00 26.89 ? 7   GLY A N   1 
ATOM   8    C  CA  . GLY A 1 7   ? 22.314 6.235   30.024 1.00 22.98 ? 7   GLY A CA  1 
ATOM   9    C  C   . GLY A 1 7   ? 21.844 7.179   28.932 1.00 21.15 ? 7   GLY A C   1 
ATOM   10   O  O   . GLY A 1 7   ? 21.410 6.757   27.860 1.00 20.58 ? 7   GLY A O   1 
ATOM   11   N  N   . PHE A 1 8   ? 21.915 8.472   29.219 1.00 18.49 ? 8   PHE A N   1 
ATOM   12   C  CA  . PHE A 1 8   ? 21.540 9.489   28.252 1.00 18.96 ? 8   PHE A CA  1 
ATOM   13   C  C   . PHE A 1 8   ? 22.178 10.827  28.597 1.00 18.46 ? 8   PHE A C   1 
ATOM   14   O  O   . PHE A 1 8   ? 22.443 11.127  29.767 1.00 19.93 ? 8   PHE A O   1 
ATOM   15   C  CB  . PHE A 1 8   ? 20.006 9.637   28.145 1.00 19.79 ? 8   PHE A CB  1 
ATOM   16   C  CG  . PHE A 1 8   ? 19.291 9.740   29.471 1.00 20.41 ? 8   PHE A CG  1 
ATOM   17   C  CD1 . PHE A 1 8   ? 18.979 8.595   30.198 1.00 21.78 ? 8   PHE A CD1 1 
ATOM   18   C  CD2 . PHE A 1 8   ? 18.906 10.975  29.975 1.00 21.42 ? 8   PHE A CD2 1 
ATOM   19   C  CE1 . PHE A 1 8   ? 18.291 8.681   31.405 1.00 24.00 ? 8   PHE A CE1 1 
ATOM   20   C  CE2 . PHE A 1 8   ? 18.219 11.072  31.179 1.00 21.45 ? 8   PHE A CE2 1 
ATOM   21   C  CZ  . PHE A 1 8   ? 17.909 9.922   31.897 1.00 20.54 ? 8   PHE A CZ  1 
ATOM   22   N  N   . LYS A 1 9   ? 22.448 11.611  27.562 1.00 18.03 ? 9   LYS A N   1 
ATOM   23   C  CA  . LYS A 1 9   ? 23.043 12.933  27.707 1.00 17.69 ? 9   LYS A CA  1 
ATOM   24   C  C   . LYS A 1 9   ? 22.256 13.903  26.843 1.00 18.92 ? 9   LYS A C   1 
ATOM   25   O  O   . LYS A 1 9   ? 21.821 13.549  25.746 1.00 17.58 ? 9   LYS A O   1 
ATOM   26   C  CB  . LYS A 1 9   ? 24.502 12.929  27.227 1.00 19.11 ? 9   LYS A CB  1 
ATOM   27   C  CG  . LYS A 1 9   ? 25.486 12.248  28.152 1.00 20.48 ? 9   LYS A CG  1 
ATOM   28   C  CD  . LYS A 1 9   ? 26.911 12.299  27.589 1.00 20.12 ? 9   LYS A CD  1 
ATOM   29   C  CE  . LYS A 1 9   ? 27.436 13.723  27.463 1.00 22.77 ? 9   LYS A CE  1 
ATOM   30   N  NZ  . LYS A 1 9   ? 28.880 13.724  27.073 1.00 19.66 ? 9   LYS A NZ  1 
ATOM   31   N  N   . HIS A 1 10  ? 22.089 15.125  27.339 1.00 19.05 ? 10  HIS A N   1 
ATOM   32   C  CA  . HIS A 1 10  ? 21.379 16.171  26.618 1.00 22.41 ? 10  HIS A CA  1 
ATOM   33   C  C   . HIS A 1 10  ? 19.939 15.824  26.256 1.00 22.32 ? 10  HIS A C   1 
ATOM   34   O  O   . HIS A 1 10  ? 19.394 16.340  25.279 1.00 21.29 ? 10  HIS A O   1 
ATOM   35   C  CB  . HIS A 1 10  ? 22.159 16.556  25.361 1.00 22.50 ? 10  HIS A CB  1 
ATOM   36   C  CG  . HIS A 1 10  ? 23.512 17.121  25.654 1.00 25.82 ? 10  HIS A CG  1 
ATOM   37   N  ND1 . HIS A 1 10  ? 23.707 18.151  26.549 1.00 27.82 ? 10  HIS A ND1 1 
ATOM   38   C  CD2 . HIS A 1 10  ? 24.741 16.788  25.191 1.00 27.91 ? 10  HIS A CD2 1 
ATOM   39   C  CE1 . HIS A 1 10  ? 24.997 18.427  26.627 1.00 28.39 ? 10  HIS A CE1 1 
ATOM   40   N  NE2 . HIS A 1 10  ? 25.646 17.614  25.813 1.00 27.11 ? 10  HIS A NE2 1 
ATOM   41   N  N   . ILE A 1 11  ? 19.333 14.957  27.062 1.00 23.70 ? 11  ILE A N   1 
ATOM   42   C  CA  . ILE A 1 11  ? 17.950 14.543  26.872 1.00 23.79 ? 11  ILE A CA  1 
ATOM   43   C  C   . ILE A 1 11  ? 17.262 14.483  28.235 1.00 26.08 ? 11  ILE A C   1 
ATOM   44   O  O   . ILE A 1 11  ? 17.768 13.847  29.158 1.00 26.79 ? 11  ILE A O   1 
ATOM   45   C  CB  . ILE A 1 11  ? 17.854 13.143  26.227 1.00 22.78 ? 11  ILE A CB  1 
ATOM   46   C  CG1 . ILE A 1 11  ? 18.335 13.193  24.779 1.00 24.41 ? 11  ILE A CG1 1 
ATOM   47   C  CG2 . ILE A 1 11  ? 16.423 12.632  26.292 1.00 22.97 ? 11  ILE A CG2 1 
ATOM   48   C  CD1 . ILE A 1 11  ? 18.328 11.851  24.090 1.00 22.27 ? 11  ILE A CD1 1 
ATOM   49   N  N   . LEU A 1 12  ? 16.124 15.158  28.368 1.00 26.93 ? 12  LEU A N   1 
ATOM   50   C  CA  . LEU A 1 12  ? 15.382 15.120  29.625 1.00 27.49 ? 12  LEU A CA  1 
ATOM   51   C  C   . LEU A 1 12  ? 14.391 13.966  29.535 1.00 27.97 ? 12  LEU A C   1 
ATOM   52   O  O   . LEU A 1 12  ? 13.679 13.819  28.537 1.00 25.25 ? 12  LEU A O   1 
ATOM   53   C  CB  . LEU A 1 12  ? 14.628 16.429  29.867 1.00 30.00 ? 12  LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 12  ? 15.463 17.699  30.049 1.00 31.21 ? 12  LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 12  ? 14.544 18.853  30.419 1.00 32.70 ? 12  LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 12  ? 16.512 17.484  31.135 1.00 31.48 ? 12  LEU A CD2 1 
ATOM   57   N  N   . VAL A 1 13  ? 14.354 13.138  30.569 1.00 25.95 ? 13  VAL A N   1 
ATOM   58   C  CA  . VAL A 1 13  ? 13.448 12.006  30.564 1.00 27.31 ? 13  VAL A CA  1 
ATOM   59   C  C   . VAL A 1 13  ? 12.402 12.148  31.651 1.00 27.99 ? 13  VAL A C   1 
ATOM   60   O  O   . VAL A 1 13  ? 12.719 12.150  32.836 1.00 28.90 ? 13  VAL A O   1 
ATOM   61   C  CB  . VAL A 1 13  ? 14.208 10.674  30.762 1.00 26.24 ? 13  VAL A CB  1 
ATOM   62   C  CG1 . VAL A 1 13  ? 13.218 9.514   30.841 1.00 26.04 ? 13  VAL A CG1 1 
ATOM   63   C  CG2 . VAL A 1 13  ? 15.182 10.453  29.608 1.00 26.66 ? 13  VAL A CG2 1 
ATOM   64   N  N   . ASP A 1 14  ? 11.153 12.279  31.226 1.00 28.86 ? 14  ASP A N   1 
ATOM   65   C  CA  . ASP A 1 14  ? 10.026 12.403  32.136 1.00 30.35 ? 14  ASP A CA  1 
ATOM   66   C  C   . ASP A 1 14  ? 9.104  11.246  31.771 1.00 29.02 ? 14  ASP A C   1 
ATOM   67   O  O   . ASP A 1 14  ? 8.243  11.379  30.903 1.00 28.51 ? 14  ASP A O   1 
ATOM   68   C  CB  . ASP A 1 14  ? 9.304  13.734  31.911 1.00 33.19 ? 14  ASP A CB  1 
ATOM   69   C  CG  . ASP A 1 14  ? 8.291  14.036  32.995 1.00 36.46 ? 14  ASP A CG  1 
ATOM   70   O  OD1 . ASP A 1 14  ? 7.729  13.077  33.561 1.00 37.08 ? 14  ASP A OD1 1 
ATOM   71   O  OD2 . ASP A 1 14  ? 8.051  15.233  33.273 1.00 39.03 ? 14  ASP A OD2 1 
ATOM   72   N  N   . GLY A 1 15  ? 9.297  10.107  32.424 1.00 28.43 ? 15  GLY A N   1 
ATOM   73   C  CA  . GLY A 1 15  ? 8.478  8.951   32.114 1.00 28.91 ? 15  GLY A CA  1 
ATOM   74   C  C   . GLY A 1 15  ? 8.882  8.404   30.755 1.00 28.89 ? 15  GLY A C   1 
ATOM   75   O  O   . GLY A 1 15  ? 10.057 8.105   30.535 1.00 27.24 ? 15  GLY A O   1 
ATOM   76   N  N   . ASP A 1 16  ? 7.922  8.284   29.838 1.00 27.45 ? 16  ASP A N   1 
ATOM   77   C  CA  . ASP A 1 16  ? 8.205  7.769   28.499 1.00 26.83 ? 16  ASP A CA  1 
ATOM   78   C  C   . ASP A 1 16  ? 8.521  8.886   27.510 1.00 24.77 ? 16  ASP A C   1 
ATOM   79   O  O   . ASP A 1 16  ? 8.791  8.631   26.330 1.00 21.76 ? 16  ASP A O   1 
ATOM   80   C  CB  . ASP A 1 16  ? 7.017  6.954   27.979 1.00 30.41 ? 16  ASP A CB  1 
ATOM   81   C  CG  . ASP A 1 16  ? 6.796  5.674   28.766 1.00 35.38 ? 16  ASP A CG  1 
ATOM   82   O  OD1 . ASP A 1 16  ? 7.680  4.790   28.737 1.00 37.96 ? 16  ASP A OD1 1 
ATOM   83   O  OD2 . ASP A 1 16  ? 5.735  5.552   29.413 1.00 39.08 ? 16  ASP A OD2 1 
ATOM   84   N  N   . THR A 1 17  ? 8.488  10.121  27.997 1.00 23.11 ? 17  THR A N   1 
ATOM   85   C  CA  . THR A 1 17  ? 8.759  11.288  27.173 1.00 21.44 ? 17  THR A CA  1 
ATOM   86   C  C   . THR A 1 17  ? 10.231 11.702  27.240 1.00 20.90 ? 17  THR A C   1 
ATOM   87   O  O   . THR A 1 17  ? 10.774 11.903  28.318 1.00 20.24 ? 17  THR A O   1 
ATOM   88   C  CB  . THR A 1 17  ? 7.890  12.482  27.622 1.00 23.22 ? 17  THR A CB  1 
ATOM   89   O  OG1 . THR A 1 17  ? 6.506  12.109  27.581 1.00 24.54 ? 17  THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 17  ? 8.116  13.685  26.711 1.00 23.50 ? 17  THR A CG2 1 
ATOM   91   N  N   . LEU A 1 18  ? 10.862 11.820  26.074 1.00 19.50 ? 18  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 18  ? 12.258 12.236  25.959 1.00 18.28 ? 18  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 18  ? 12.301 13.565  25.211 1.00 18.53 ? 18  LEU A C   1 
ATOM   94   O  O   . LEU A 1 18  ? 11.785 13.672  24.098 1.00 19.26 ? 18  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 18  ? 13.065 11.204  25.173 1.00 19.79 ? 18  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 18  ? 13.550 9.910   25.832 1.00 21.92 ? 18  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 18  ? 12.459 9.249   26.646 1.00 22.90 ? 18  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 18  ? 14.045 8.986   24.733 1.00 22.37 ? 18  LEU A CD2 1 
ATOM   99   N  N   . SER A 1 19  ? 12.928 14.571  25.813 1.00 18.18 ? 19  SER A N   1 
ATOM   100  C  CA  . SER A 1 19  ? 13.015 15.891  25.195 1.00 20.35 ? 19  SER A CA  1 
ATOM   101  C  C   . SER A 1 19  ? 14.464 16.356  25.067 1.00 21.12 ? 19  SER A C   1 
ATOM   102  O  O   . SER A 1 19  ? 15.240 16.257  26.019 1.00 19.24 ? 19  SER A O   1 
ATOM   103  C  CB  . SER A 1 19  ? 12.240 16.902  26.039 1.00 21.85 ? 19  SER A CB  1 
ATOM   104  O  OG  . SER A 1 19  ? 10.965 16.397  26.396 1.00 28.33 ? 19  SER A OG  1 
ATOM   105  N  N   . TYR A 1 20  ? 14.826 16.869  23.895 1.00 21.24 ? 20  TYR A N   1 
ATOM   106  C  CA  . TYR A 1 20  ? 16.184 17.355  23.683 1.00 22.07 ? 20  TYR A CA  1 
ATOM   107  C  C   . TYR A 1 20  ? 16.429 18.469  24.685 1.00 24.31 ? 20  TYR A C   1 
ATOM   108  O  O   . TYR A 1 20  ? 15.529 19.253  24.988 1.00 20.33 ? 20  TYR A O   1 
ATOM   109  C  CB  . TYR A 1 20  ? 16.361 17.900  22.262 1.00 21.76 ? 20  TYR A CB  1 
ATOM   110  C  CG  . TYR A 1 20  ? 17.740 18.465  21.987 1.00 21.63 ? 20  TYR A CG  1 
ATOM   111  C  CD1 . TYR A 1 20  ? 18.849 17.627  21.848 1.00 20.33 ? 20  TYR A CD1 1 
ATOM   112  C  CD2 . TYR A 1 20  ? 17.940 19.845  21.880 1.00 21.23 ? 20  TYR A CD2 1 
ATOM   113  C  CE1 . TYR A 1 20  ? 20.124 18.149  21.610 1.00 22.48 ? 20  TYR A CE1 1 
ATOM   114  C  CE2 . TYR A 1 20  ? 19.205 20.378  21.645 1.00 22.75 ? 20  TYR A CE2 1 
ATOM   115  C  CZ  . TYR A 1 20  ? 20.292 19.526  21.511 1.00 22.96 ? 20  TYR A CZ  1 
ATOM   116  O  OH  . TYR A 1 20  ? 21.541 20.054  21.292 1.00 22.79 ? 20  TYR A OH  1 
ATOM   117  N  N   . HIS A 1 21  ? 17.651 18.534  25.200 1.00 27.49 ? 21  HIS A N   1 
ATOM   118  C  CA  . HIS A 1 21  ? 18.000 19.550  26.174 1.00 32.16 ? 21  HIS A CA  1 
ATOM   119  C  C   . HIS A 1 21  ? 19.492 19.828  26.083 1.00 34.30 ? 21  HIS A C   1 
ATOM   120  O  O   . HIS A 1 21  ? 20.255 19.499  26.987 1.00 36.90 ? 21  HIS A O   1 
ATOM   121  C  CB  . HIS A 1 21  ? 17.617 19.066  27.577 1.00 33.99 ? 21  HIS A CB  1 
ATOM   122  C  CG  . HIS A 1 21  ? 17.819 20.089  28.649 1.00 37.15 ? 21  HIS A CG  1 
ATOM   123  N  ND1 . HIS A 1 21  ? 19.051 20.345  29.212 1.00 38.56 ? 21  HIS A ND1 1 
ATOM   124  C  CD2 . HIS A 1 21  ? 16.949 20.935  29.248 1.00 38.26 ? 21  HIS A CD2 1 
ATOM   125  C  CE1 . HIS A 1 21  ? 18.931 21.304  30.112 1.00 40.11 ? 21  HIS A CE1 1 
ATOM   126  N  NE2 . HIS A 1 21  ? 17.665 21.681  30.153 1.00 40.28 ? 21  HIS A NE2 1 
ATOM   127  N  N   . GLY A 1 22  ? 19.900 20.425  24.970 1.00 35.28 ? 22  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 22  ? 21.300 20.735  24.766 1.00 37.76 ? 22  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 22  ? 21.485 22.123  24.194 1.00 38.14 ? 22  GLY A C   1 
ATOM   130  O  O   . GLY A 1 22  ? 20.525 22.759  23.763 1.00 36.55 ? 22  GLY A O   1 
ATOM   131  N  N   . ASN A 1 23  ? 22.725 22.597  24.193 1.00 41.09 ? 23  ASN A N   1 
ATOM   132  C  CA  . ASN A 1 23  ? 23.029 23.920  23.672 1.00 43.92 ? 23  ASN A CA  1 
ATOM   133  C  C   . ASN A 1 23  ? 23.985 23.884  22.490 1.00 44.34 ? 23  ASN A C   1 
ATOM   134  O  O   . ASN A 1 23  ? 24.943 23.109  22.463 1.00 45.63 ? 23  ASN A O   1 
ATOM   135  C  CB  . ASN A 1 23  ? 23.621 24.803  24.774 1.00 46.27 ? 23  ASN A CB  1 
ATOM   136  C  CG  . ASN A 1 23  ? 22.563 25.358  25.710 1.00 48.13 ? 23  ASN A CG  1 
ATOM   137  O  OD1 . ASN A 1 23  ? 21.673 26.101  25.290 1.00 49.94 ? 23  ASN A OD1 1 
ATOM   138  N  ND2 . ASN A 1 23  ? 22.657 25.004  26.988 1.00 48.51 ? 23  ASN A ND2 1 
ATOM   139  N  N   . SER A 1 24  ? 23.700 24.736  21.513 1.00 44.39 ? 24  SER A N   1 
ATOM   140  C  CA  . SER A 1 24  ? 24.508 24.871  20.307 1.00 43.55 ? 24  SER A CA  1 
ATOM   141  C  C   . SER A 1 24  ? 25.287 23.630  19.868 1.00 41.09 ? 24  SER A C   1 
ATOM   142  O  O   . SER A 1 24  ? 26.371 23.349  20.386 1.00 42.02 ? 24  SER A O   1 
ATOM   143  C  CB  . SER A 1 24  ? 25.481 26.046  20.477 1.00 45.77 ? 24  SER A CB  1 
ATOM   144  O  OG  . SER A 1 24  ? 26.246 26.266  19.302 1.00 47.63 ? 24  SER A OG  1 
ATOM   145  N  N   . GLY A 1 25  ? 24.715 22.893  18.918 1.00 38.14 ? 25  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 25  ? 25.365 21.717  18.359 1.00 34.52 ? 25  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 25  ? 25.584 20.469  19.192 1.00 32.09 ? 25  GLY A C   1 
ATOM   148  O  O   . GLY A 1 25  ? 26.296 19.564  18.756 1.00 31.32 ? 25  GLY A O   1 
ATOM   149  N  N   . GLU A 1 26  ? 24.989 20.393  20.374 1.00 29.26 ? 26  GLU A N   1 
ATOM   150  C  CA  . GLU A 1 26  ? 25.170 19.209  21.205 1.00 26.34 ? 26  GLU A CA  1 
ATOM   151  C  C   . GLU A 1 26  ? 24.218 18.090  20.789 1.00 24.71 ? 26  GLU A C   1 
ATOM   152  O  O   . GLU A 1 26  ? 23.020 18.315  20.613 1.00 22.35 ? 26  GLU A O   1 
ATOM   153  C  CB  . GLU A 1 26  ? 24.959 19.565  22.675 1.00 28.59 ? 26  GLU A CB  1 
ATOM   154  C  CG  . GLU A 1 26  ? 26.110 20.369  23.265 1.00 32.08 ? 26  GLU A CG  1 
ATOM   155  C  CD  . GLU A 1 26  ? 25.790 20.936  24.631 1.00 34.05 ? 26  GLU A CD  1 
ATOM   156  O  OE1 . GLU A 1 26  ? 26.724 21.420  25.304 1.00 35.00 ? 26  GLU A OE1 1 
ATOM   157  O  OE2 . GLU A 1 26  ? 24.606 20.904  25.027 1.00 34.23 ? 26  GLU A OE2 1 
ATOM   158  N  N   . VAL A 1 27  ? 24.762 16.890  20.607 1.00 23.29 ? 27  VAL A N   1 
ATOM   159  C  CA  . VAL A 1 27  ? 23.955 15.734  20.224 1.00 21.43 ? 27  VAL A CA  1 
ATOM   160  C  C   . VAL A 1 27  ? 23.445 15.045  21.486 1.00 22.13 ? 27  VAL A C   1 
ATOM   161  O  O   . VAL A 1 27  ? 24.208 14.815  22.423 1.00 21.42 ? 27  VAL A O   1 
ATOM   162  C  CB  . VAL A 1 27  ? 24.777 14.698  19.424 1.00 23.68 ? 27  VAL A CB  1 
ATOM   163  C  CG1 . VAL A 1 27  ? 23.932 13.448  19.162 1.00 21.53 ? 27  VAL A CG1 1 
ATOM   164  C  CG2 . VAL A 1 27  ? 25.258 15.305  18.110 1.00 24.31 ? 27  VAL A CG2 1 
ATOM   165  N  N   . GLY A 1 28  ? 22.154 14.731  21.511 1.00 20.65 ? 28  GLY A N   1 
ATOM   166  C  CA  . GLY A 1 28  ? 21.585 14.049  22.659 1.00 21.44 ? 28  GLY A CA  1 
ATOM   167  C  C   . GLY A 1 28  ? 21.375 12.584  22.309 1.00 20.92 ? 28  GLY A C   1 
ATOM   168  O  O   . GLY A 1 28  ? 20.913 12.266  21.215 1.00 20.08 ? 28  GLY A O   1 
ATOM   169  N  N   . CYS A 1 29  ? 21.718 11.684  23.223 1.00 21.18 ? 29  CYS A N   1 
ATOM   170  C  CA  . CYS A 1 29  ? 21.550 10.264  22.958 1.00 21.35 ? 29  CYS A CA  1 
ATOM   171  C  C   . CYS A 1 29  ? 20.987 9.545   24.179 1.00 22.11 ? 29  CYS A C   1 
ATOM   172  O  O   . CYS A 1 29  ? 21.339 9.855   25.314 1.00 21.03 ? 29  CYS A O   1 
ATOM   173  C  CB  . CYS A 1 29  ? 22.888 9.638   22.549 1.00 23.48 ? 29  CYS A CB  1 
ATOM   174  S  SG  . CYS A 1 29  ? 22.776 7.889   22.068 1.00 26.55 ? 29  CYS A SG  1 
ATOM   175  N  N   . TYR A 1 30  ? 20.103 8.586   23.927 1.00 21.40 ? 30  TYR A N   1 
ATOM   176  C  CA  . TYR A 1 30  ? 19.463 7.805   24.979 1.00 20.22 ? 30  TYR A CA  1 
ATOM   177  C  C   . TYR A 1 30  ? 19.589 6.328   24.623 1.00 21.35 ? 30  TYR A C   1 
ATOM   178  O  O   . TYR A 1 30  ? 19.296 5.934   23.493 1.00 20.92 ? 30  TYR A O   1 
ATOM   179  C  CB  . TYR A 1 30  ? 17.979 8.189   25.078 1.00 22.90 ? 30  TYR A CB  1 
ATOM   180  C  CG  . TYR A 1 30  ? 17.151 7.279   25.965 1.00 23.41 ? 30  TYR A CG  1 
ATOM   181  C  CD1 . TYR A 1 30  ? 16.903 7.601   27.296 1.00 25.44 ? 30  TYR A CD1 1 
ATOM   182  C  CD2 . TYR A 1 30  ? 16.653 6.071   25.477 1.00 25.31 ? 30  TYR A CD2 1 
ATOM   183  C  CE1 . TYR A 1 30  ? 16.178 6.731   28.127 1.00 26.99 ? 30  TYR A CE1 1 
ATOM   184  C  CE2 . TYR A 1 30  ? 15.935 5.201   26.290 1.00 26.39 ? 30  TYR A CE2 1 
ATOM   185  C  CZ  . TYR A 1 30  ? 15.702 5.533   27.611 1.00 27.80 ? 30  TYR A CZ  1 
ATOM   186  O  OH  . TYR A 1 30  ? 15.004 4.657   28.413 1.00 30.30 ? 30  TYR A OH  1 
ATOM   187  N  N   . VAL A 1 31  ? 20.043 5.513   25.572 1.00 19.46 ? 31  VAL A N   1 
ATOM   188  C  CA  . VAL A 1 31  ? 20.170 4.080   25.334 1.00 19.38 ? 31  VAL A CA  1 
ATOM   189  C  C   . VAL A 1 31  ? 19.378 3.355   26.414 1.00 21.10 ? 31  VAL A C   1 
ATOM   190  O  O   . VAL A 1 31  ? 19.563 3.602   27.609 1.00 21.68 ? 31  VAL A O   1 
ATOM   191  C  CB  . VAL A 1 31  ? 21.648 3.612   25.364 1.00 19.07 ? 31  VAL A CB  1 
ATOM   192  C  CG1 . VAL A 1 31  ? 21.734 2.112   25.080 1.00 18.94 ? 31  VAL A CG1 1 
ATOM   193  C  CG2 . VAL A 1 31  ? 22.453 4.371   24.321 1.00 19.98 ? 31  VAL A CG2 1 
ATOM   194  N  N   . ALA A 1 32  ? 18.476 2.481   25.985 1.00 20.86 ? 32  ALA A N   1 
ATOM   195  C  CA  . ALA A 1 32  ? 17.634 1.721   26.902 1.00 24.55 ? 32  ALA A CA  1 
ATOM   196  C  C   . ALA A 1 32  ? 18.445 0.766   27.770 1.00 25.28 ? 32  ALA A C   1 
ATOM   197  O  O   . ALA A 1 32  ? 19.572 0.401   27.429 1.00 25.99 ? 32  ALA A O   1 
ATOM   198  C  CB  . ALA A 1 32  ? 16.584 0.948   26.119 1.00 23.60 ? 32  ALA A CB  1 
ATOM   199  N  N   . SER A 1 33  ? 17.852 0.353   28.886 1.00 27.84 ? 33  SER A N   1 
ATOM   200  C  CA  . SER A 1 33  ? 18.502 -0.546  29.836 1.00 31.03 ? 33  SER A CA  1 
ATOM   201  C  C   . SER A 1 33  ? 18.654 -1.987  29.348 1.00 30.15 ? 33  SER A C   1 
ATOM   202  O  O   . SER A 1 33  ? 19.697 -2.608  29.543 1.00 31.33 ? 33  SER A O   1 
ATOM   203  C  CB  . SER A 1 33  ? 17.721 -0.556  31.158 1.00 31.32 ? 33  SER A CB  1 
ATOM   204  O  OG  . SER A 1 33  ? 17.513 0.757   31.649 1.00 37.66 ? 33  SER A OG  1 
ATOM   205  N  N   . ARG A 1 34  ? 17.611 -2.520  28.719 1.00 30.48 ? 34  ARG A N   1 
ATOM   206  C  CA  . ARG A 1 34  ? 17.636 -3.900  28.250 1.00 28.93 ? 34  ARG A CA  1 
ATOM   207  C  C   . ARG A 1 34  ? 17.649 -4.045  26.732 1.00 27.75 ? 34  ARG A C   1 
ATOM   208  O  O   . ARG A 1 34  ? 17.075 -3.232  26.012 1.00 26.61 ? 34  ARG A O   1 
ATOM   209  C  CB  . ARG A 1 34  ? 16.434 -4.656  28.825 1.00 32.03 ? 34  ARG A CB  1 
ATOM   210  C  CG  . ARG A 1 34  ? 16.401 -4.717  30.353 1.00 36.20 ? 34  ARG A CG  1 
ATOM   211  C  CD  . ARG A 1 34  ? 16.736 -6.114  30.862 1.00 40.24 ? 34  ARG A CD  1 
ATOM   212  N  NE  . ARG A 1 34  ? 18.011 -6.598  30.340 1.00 44.23 ? 34  ARG A NE  1 
ATOM   213  C  CZ  . ARG A 1 34  ? 18.488 -7.824  30.542 1.00 45.78 ? 34  ARG A CZ  1 
ATOM   214  N  NH1 . ARG A 1 34  ? 19.659 -8.171  30.025 1.00 45.96 ? 34  ARG A NH1 1 
ATOM   215  N  NH2 . ARG A 1 34  ? 17.797 -8.703  31.257 1.00 45.88 ? 34  ARG A NH2 1 
ATOM   216  N  N   . PRO A 1 35  ? 18.305 -5.100  26.228 1.00 26.64 ? 35  PRO A N   1 
ATOM   217  C  CA  . PRO A 1 35  ? 18.387 -5.351  24.790 1.00 26.49 ? 35  PRO A CA  1 
ATOM   218  C  C   . PRO A 1 35  ? 17.084 -5.984  24.326 1.00 25.67 ? 35  PRO A C   1 
ATOM   219  O  O   . PRO A 1 35  ? 16.292 -6.437  25.148 1.00 24.14 ? 35  PRO A O   1 
ATOM   220  C  CB  . PRO A 1 35  ? 19.556 -6.316  24.690 1.00 26.47 ? 35  PRO A CB  1 
ATOM   221  C  CG  . PRO A 1 35  ? 19.340 -7.175  25.901 1.00 27.55 ? 35  PRO A CG  1 
ATOM   222  C  CD  . PRO A 1 35  ? 18.992 -6.164  26.985 1.00 27.35 ? 35  PRO A CD  1 
ATOM   223  N  N   . LEU A 1 36  ? 16.848 -6.005  23.019 1.00 25.07 ? 36  LEU A N   1 
ATOM   224  C  CA  . LEU A 1 36  ? 15.633 -6.626  22.502 1.00 24.45 ? 36  LEU A CA  1 
ATOM   225  C  C   . LEU A 1 36  ? 15.759 -8.141  22.684 1.00 24.76 ? 36  LEU A C   1 
ATOM   226  O  O   . LEU A 1 36  ? 16.867 -8.676  22.757 1.00 20.70 ? 36  LEU A O   1 
ATOM   227  C  CB  . LEU A 1 36  ? 15.447 -6.302  21.016 1.00 23.55 ? 36  LEU A CB  1 
ATOM   228  C  CG  . LEU A 1 36  ? 15.229 -4.833  20.645 1.00 23.53 ? 36  LEU A CG  1 
ATOM   229  C  CD1 . LEU A 1 36  ? 15.080 -4.715  19.130 1.00 21.99 ? 36  LEU A CD1 1 
ATOM   230  C  CD2 . LEU A 1 36  ? 13.983 -4.295  21.338 1.00 21.65 ? 36  LEU A CD2 1 
ATOM   231  N  N   . THR A 1 37  ? 14.627 -8.829  22.759 1.00 26.41 ? 37  THR A N   1 
ATOM   232  C  CA  . THR A 1 37  ? 14.637 -10.278 22.918 1.00 30.52 ? 37  THR A CA  1 
ATOM   233  C  C   . THR A 1 37  ? 13.718 -10.902 21.878 1.00 33.27 ? 37  THR A C   1 
ATOM   234  O  O   . THR A 1 37  ? 13.062 -10.190 21.116 1.00 33.97 ? 37  THR A O   1 
ATOM   235  C  CB  . THR A 1 37  ? 14.146 -10.693 24.311 1.00 28.15 ? 37  THR A CB  1 
ATOM   236  O  OG1 . THR A 1 37  ? 12.800 -10.244 24.490 1.00 30.66 ? 37  THR A OG1 1 
ATOM   237  C  CG2 . THR A 1 37  ? 15.025 -10.087 25.388 1.00 28.04 ? 37  THR A CG2 1 
ATOM   238  N  N   . LYS A 1 38  ? 13.669 -12.230 21.845 1.00 35.40 ? 38  LYS A N   1 
ATOM   239  C  CA  . LYS A 1 38  ? 12.817 -12.916 20.886 1.00 38.24 ? 38  LYS A CA  1 
ATOM   240  C  C   . LYS A 1 38  ? 11.376 -12.479 21.113 1.00 38.46 ? 38  LYS A C   1 
ATOM   241  O  O   . LYS A 1 38  ? 10.646 -12.202 20.162 1.00 39.06 ? 38  LYS A O   1 
ATOM   242  C  CB  . LYS A 1 38  ? 12.943 -14.433 21.048 1.00 40.47 ? 38  LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 38  ? 12.238 -15.231 19.965 1.00 43.99 ? 38  LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 38  ? 12.396 -16.727 20.195 1.00 45.96 ? 38  LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 38  ? 11.731 -17.532 19.086 1.00 48.64 ? 38  LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 38  ? 10.261 -17.292 19.025 1.00 49.64 ? 38  LYS A NZ  1 
ATOM   247  N  N   . ASP A 1 39  ? 10.973 -12.403 22.379 1.00 39.36 ? 39  ASP A N   1 
ATOM   248  C  CA  . ASP A 1 39  ? 9.615  -11.986 22.712 1.00 39.66 ? 39  ASP A CA  1 
ATOM   249  C  C   . ASP A 1 39  ? 9.421  -10.486 22.497 1.00 38.21 ? 39  ASP A C   1 
ATOM   250  O  O   . ASP A 1 39  ? 8.580  -10.074 21.698 1.00 39.33 ? 39  ASP A O   1 
ATOM   251  C  CB  . ASP A 1 39  ? 9.280  -12.349 24.163 1.00 42.56 ? 39  ASP A CB  1 
ATOM   252  C  CG  . ASP A 1 39  ? 9.091  -13.844 24.364 1.00 45.38 ? 39  ASP A CG  1 
ATOM   253  O  OD1 . ASP A 1 39  ? 8.340  -14.463 23.579 1.00 47.09 ? 39  ASP A OD1 1 
ATOM   254  O  OD2 . ASP A 1 39  ? 9.683  -14.399 25.313 1.00 46.91 ? 39  ASP A OD2 1 
ATOM   255  N  N   . SER A 1 40  ? 10.197 -9.677  23.213 1.00 35.54 ? 40  SER A N   1 
ATOM   256  C  CA  . SER A 1 40  ? 10.122 -8.222  23.097 1.00 33.67 ? 40  SER A CA  1 
ATOM   257  C  C   . SER A 1 40  ? 11.181 -7.814  22.075 1.00 30.94 ? 40  SER A C   1 
ATOM   258  O  O   . SER A 1 40  ? 12.260 -7.328  22.423 1.00 28.94 ? 40  SER A O   1 
ATOM   259  C  CB  . SER A 1 40  ? 10.410 -7.577  24.455 1.00 35.13 ? 40  SER A CB  1 
ATOM   260  O  OG  . SER A 1 40  ? 10.149 -6.186  24.414 1.00 39.92 ? 40  SER A OG  1 
ATOM   261  N  N   . ASN A 1 41  ? 10.847 -8.010  20.807 1.00 27.58 ? 41  ASN A N   1 
ATOM   262  C  CA  . ASN A 1 41  ? 11.762 -7.752  19.702 1.00 26.20 ? 41  ASN A CA  1 
ATOM   263  C  C   . ASN A 1 41  ? 11.456 -6.508  18.888 1.00 24.51 ? 41  ASN A C   1 
ATOM   264  O  O   . ASN A 1 41  ? 11.990 -6.349  17.792 1.00 23.35 ? 41  ASN A O   1 
ATOM   265  C  CB  . ASN A 1 41  ? 11.715 -8.944  18.755 1.00 25.74 ? 41  ASN A CB  1 
ATOM   266  C  CG  . ASN A 1 41  ? 10.450 -8.957  17.919 1.00 27.99 ? 41  ASN A CG  1 
ATOM   267  O  OD1 . ASN A 1 41  ? 9.353  -8.717  18.426 1.00 28.63 ? 41  ASN A OD1 1 
ATOM   268  N  ND2 . ASN A 1 41  ? 10.596 -9.233  16.629 1.00 28.75 ? 41  ASN A ND2 1 
ATOM   269  N  N   . TYR A 1 42  ? 10.615 -5.627  19.409 1.00 23.75 ? 42  TYR A N   1 
ATOM   270  C  CA  . TYR A 1 42  ? 10.231 -4.445  18.649 1.00 23.48 ? 42  TYR A CA  1 
ATOM   271  C  C   . TYR A 1 42  ? 9.851  -3.272  19.547 1.00 24.07 ? 42  TYR A C   1 
ATOM   272  O  O   . TYR A 1 42  ? 9.279  -3.462  20.617 1.00 24.36 ? 42  TYR A O   1 
ATOM   273  C  CB  . TYR A 1 42  ? 9.051  -4.831  17.758 1.00 22.84 ? 42  TYR A CB  1 
ATOM   274  C  CG  . TYR A 1 42  ? 8.437  -3.724  16.936 1.00 22.29 ? 42  TYR A CG  1 
ATOM   275  C  CD1 . TYR A 1 42  ? 9.080  -3.226  15.802 1.00 22.30 ? 42  TYR A CD1 1 
ATOM   276  C  CD2 . TYR A 1 42  ? 7.181  -3.212  17.261 1.00 22.27 ? 42  TYR A CD2 1 
ATOM   277  C  CE1 . TYR A 1 42  ? 8.485  -2.257  15.009 1.00 19.91 ? 42  TYR A CE1 1 
ATOM   278  C  CE2 . TYR A 1 42  ? 6.578  -2.242  16.475 1.00 22.58 ? 42  TYR A CE2 1 
ATOM   279  C  CZ  . TYR A 1 42  ? 7.232  -1.770  15.351 1.00 21.01 ? 42  TYR A CZ  1 
ATOM   280  O  OH  . TYR A 1 42  ? 6.613  -0.833  14.556 1.00 19.93 ? 42  TYR A OH  1 
ATOM   281  N  N   . PHE A 1 43  ? 10.180 -2.059  19.113 1.00 20.52 ? 43  PHE A N   1 
ATOM   282  C  CA  . PHE A 1 43  ? 9.826  -0.873  19.879 1.00 19.67 ? 43  PHE A CA  1 
ATOM   283  C  C   . PHE A 1 43  ? 9.531  0.256   18.909 1.00 18.80 ? 43  PHE A C   1 
ATOM   284  O  O   . PHE A 1 43  ? 9.998  0.237   17.773 1.00 20.96 ? 43  PHE A O   1 
ATOM   285  C  CB  . PHE A 1 43  ? 10.957 -0.474  20.841 1.00 19.50 ? 43  PHE A CB  1 
ATOM   286  C  CG  . PHE A 1 43  ? 12.127 0.208   20.178 1.00 19.20 ? 43  PHE A CG  1 
ATOM   287  C  CD1 . PHE A 1 43  ? 12.249 1.597   20.207 1.00 19.72 ? 43  PHE A CD1 1 
ATOM   288  C  CD2 . PHE A 1 43  ? 13.115 -0.535  19.544 1.00 18.11 ? 43  PHE A CD2 1 
ATOM   289  C  CE1 . PHE A 1 43  ? 13.347 2.234   19.613 1.00 15.92 ? 43  PHE A CE1 1 
ATOM   290  C  CE2 . PHE A 1 43  ? 14.216 0.093   18.946 1.00 18.01 ? 43  PHE A CE2 1 
ATOM   291  C  CZ  . PHE A 1 43  ? 14.330 1.480   18.983 1.00 16.05 ? 43  PHE A CZ  1 
ATOM   292  N  N   . GLU A 1 44  ? 8.740  1.223   19.353 1.00 18.94 ? 44  GLU A N   1 
ATOM   293  C  CA  . GLU A 1 44  ? 8.390  2.363   18.516 1.00 19.10 ? 44  GLU A CA  1 
ATOM   294  C  C   . GLU A 1 44  ? 8.627  3.668   19.248 1.00 18.55 ? 44  GLU A C   1 
ATOM   295  O  O   . GLU A 1 44  ? 8.597  3.729   20.480 1.00 17.60 ? 44  GLU A O   1 
ATOM   296  C  CB  . GLU A 1 44  ? 6.916  2.302   18.088 1.00 20.49 ? 44  GLU A CB  1 
ATOM   297  C  CG  . GLU A 1 44  ? 6.567  1.144   17.176 1.00 24.40 ? 44  GLU A CG  1 
ATOM   298  C  CD  . GLU A 1 44  ? 5.196  1.303   16.534 1.00 25.68 ? 44  GLU A CD  1 
ATOM   299  O  OE1 . GLU A 1 44  ? 4.260  1.745   17.230 1.00 26.61 ? 44  GLU A OE1 1 
ATOM   300  O  OE2 . GLU A 1 44  ? 5.052  0.978   15.338 1.00 26.22 ? 44  GLU A OE2 1 
ATOM   301  N  N   . VAL A 1 45  ? 8.860  4.715   18.471 1.00 17.43 ? 45  VAL A N   1 
ATOM   302  C  CA  . VAL A 1 45  ? 9.083  6.038   19.019 1.00 17.26 ? 45  VAL A CA  1 
ATOM   303  C  C   . VAL A 1 45  ? 8.136  6.989   18.309 1.00 17.35 ? 45  VAL A C   1 
ATOM   304  O  O   . VAL A 1 45  ? 8.105  7.042   17.076 1.00 15.90 ? 45  VAL A O   1 
ATOM   305  C  CB  . VAL A 1 45  ? 10.539 6.493   18.796 1.00 16.67 ? 45  VAL A CB  1 
ATOM   306  C  CG1 . VAL A 1 45  ? 10.734 7.916   19.321 1.00 17.65 ? 45  VAL A CG1 1 
ATOM   307  C  CG2 . VAL A 1 45  ? 11.471 5.536   19.485 1.00 17.19 ? 45  VAL A CG2 1 
ATOM   308  N  N   . SER A 1 46  ? 7.339  7.717   19.084 1.00 15.80 ? 46  SER A N   1 
ATOM   309  C  CA  . SER A 1 46  ? 6.402  8.654   18.497 1.00 17.57 ? 46  SER A CA  1 
ATOM   310  C  C   . SER A 1 46  ? 6.964  10.056  18.572 1.00 17.17 ? 46  SER A C   1 
ATOM   311  O  O   . SER A 1 46  ? 7.382  10.506  19.634 1.00 16.95 ? 46  SER A O   1 
ATOM   312  C  CB  . SER A 1 46  ? 5.067  8.598   19.231 1.00 18.71 ? 46  SER A CB  1 
ATOM   313  O  OG  . SER A 1 46  ? 4.481  7.319   19.072 1.00 22.41 ? 46  SER A OG  1 
ATOM   314  N  N   . ILE A 1 47  ? 6.975  10.745  17.439 1.00 17.26 ? 47  ILE A N   1 
ATOM   315  C  CA  . ILE A 1 47  ? 7.481  12.106  17.397 1.00 17.08 ? 47  ILE A CA  1 
ATOM   316  C  C   . ILE A 1 47  ? 6.393  13.055  17.860 1.00 18.85 ? 47  ILE A C   1 
ATOM   317  O  O   . ILE A 1 47  ? 5.348  13.180  17.219 1.00 17.39 ? 47  ILE A O   1 
ATOM   318  C  CB  . ILE A 1 47  ? 7.911  12.510  15.971 1.00 17.43 ? 47  ILE A CB  1 
ATOM   319  C  CG1 . ILE A 1 47  ? 8.978  11.546  15.452 1.00 15.88 ? 47  ILE A CG1 1 
ATOM   320  C  CG2 . ILE A 1 47  ? 8.432  13.950  15.978 1.00 17.68 ? 47  ILE A CG2 1 
ATOM   321  C  CD1 . ILE A 1 47  ? 9.438  11.833  14.012 1.00 17.71 ? 47  ILE A CD1 1 
ATOM   322  N  N   . VAL A 1 48  ? 6.637  13.715  18.986 1.00 16.80 ? 48  VAL A N   1 
ATOM   323  C  CA  . VAL A 1 48  ? 5.688  14.668  19.524 1.00 18.56 ? 48  VAL A CA  1 
ATOM   324  C  C   . VAL A 1 48  ? 5.968  16.027  18.882 1.00 19.18 ? 48  VAL A C   1 
ATOM   325  O  O   . VAL A 1 48  ? 5.048  16.773  18.542 1.00 19.74 ? 48  VAL A O   1 
ATOM   326  C  CB  . VAL A 1 48  ? 5.825  14.777  21.067 1.00 18.94 ? 48  VAL A CB  1 
ATOM   327  C  CG1 . VAL A 1 48  ? 4.879  15.830  21.602 1.00 19.69 ? 48  VAL A CG1 1 
ATOM   328  C  CG2 . VAL A 1 48  ? 5.532  13.413  21.720 1.00 16.31 ? 48  VAL A CG2 1 
ATOM   329  N  N   . ASP A 1 49  ? 7.248  16.326  18.691 1.00 18.04 ? 49  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 49  ? 7.667  17.594  18.104 1.00 19.27 ? 49  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 49  ? 9.010  17.371  17.410 1.00 18.72 ? 49  ASP A C   1 
ATOM   332  O  O   . ASP A 1 49  ? 9.957  16.883  18.027 1.00 17.14 ? 49  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 49  ? 7.830  18.644  19.213 1.00 20.90 ? 49  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 49  ? 7.916  20.060  18.677 1.00 22.71 ? 49  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 49  ? 8.385  20.249  17.539 1.00 26.46 ? 49  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 49  ? 7.525  20.994  19.408 1.00 24.75 ? 49  ASP A OD2 1 
ATOM   337  N  N   . SER A 1 50  ? 9.095  17.728  16.134 1.00 18.44 ? 50  SER A N   1 
ATOM   338  C  CA  . SER A 1 50  ? 10.334 17.550  15.390 1.00 19.14 ? 50  SER A CA  1 
ATOM   339  C  C   . SER A 1 50  ? 11.340 18.666  15.681 1.00 19.45 ? 50  SER A C   1 
ATOM   340  O  O   . SER A 1 50  ? 12.482 18.613  15.237 1.00 17.88 ? 50  SER A O   1 
ATOM   341  C  CB  . SER A 1 50  ? 10.043 17.499  13.889 1.00 22.54 ? 50  SER A CB  1 
ATOM   342  O  OG  . SER A 1 50  ? 9.546  18.744  13.434 1.00 23.29 ? 50  SER A OG  1 
ATOM   343  N  N   . GLY A 1 51  ? 10.910 19.682  16.422 1.00 20.16 ? 51  GLY A N   1 
ATOM   344  C  CA  . GLY A 1 51  ? 11.812 20.775  16.757 1.00 20.44 ? 51  GLY A CA  1 
ATOM   345  C  C   . GLY A 1 51  ? 12.275 21.601  15.571 1.00 21.15 ? 51  GLY A C   1 
ATOM   346  O  O   . GLY A 1 51  ? 11.607 21.647  14.542 1.00 21.93 ? 51  GLY A O   1 
ATOM   347  N  N   . VAL A 1 52  ? 13.431 22.244  15.713 1.00 20.72 ? 52  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 52  ? 13.983 23.092  14.659 1.00 22.04 ? 52  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 52  ? 14.500 22.345  13.428 1.00 22.78 ? 52  VAL A C   1 
ATOM   350  O  O   . VAL A 1 52  ? 14.313 22.802  12.297 1.00 21.71 ? 52  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 52  ? 15.132 23.977  15.216 1.00 23.14 ? 52  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 52  ? 15.803 24.758  14.082 1.00 25.37 ? 52  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 52  ? 14.581 24.937  16.256 1.00 25.36 ? 52  VAL A CG2 1 
ATOM   354  N  N   . ARG A 1 53  ? 15.142 21.197  13.638 1.00 22.06 ? 53  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 53  ? 15.700 20.440  12.522 1.00 23.09 ? 53  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 53  ? 15.147 19.028  12.312 1.00 22.46 ? 53  ARG A C   1 
ATOM   357  O  O   . ARG A 1 53  ? 15.468 18.382  11.310 1.00 20.37 ? 53  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 53  ? 17.223 20.356  12.663 1.00 26.09 ? 53  ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 53  ? 17.950 21.693  12.577 1.00 29.63 ? 53  ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 53  ? 19.452 21.476  12.714 1.00 32.99 ? 53  ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 53  ? 19.952 20.549  11.699 1.00 37.35 ? 53  ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 53  ? 21.126 19.925  11.762 1.00 39.42 ? 53  ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 53  ? 21.935 20.121  12.796 1.00 41.47 ? 53  ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 53  ? 21.492 19.101  10.789 1.00 41.55 ? 53  ARG A NH2 1 
ATOM   365  N  N   . GLY A 1 54  ? 14.327 18.550  13.245 1.00 19.85 ? 54  GLY A N   1 
ATOM   366  C  CA  . GLY A 1 54  ? 13.767 17.214  13.114 1.00 19.27 ? 54  GLY A CA  1 
ATOM   367  C  C   . GLY A 1 54  ? 14.826 16.131  13.004 1.00 17.97 ? 54  GLY A C   1 
ATOM   368  O  O   . GLY A 1 54  ? 14.614 15.100  12.366 1.00 16.63 ? 54  GLY A O   1 
ATOM   369  N  N   . THR A 1 55  ? 15.969 16.365  13.641 1.00 17.71 ? 55  THR A N   1 
ATOM   370  C  CA  . THR A 1 55  ? 17.081 15.422  13.616 1.00 17.18 ? 55  THR A CA  1 
ATOM   371  C  C   . THR A 1 55  ? 16.969 14.382  14.721 1.00 17.95 ? 55  THR A C   1 
ATOM   372  O  O   . THR A 1 55  ? 17.799 14.310  15.625 1.00 17.57 ? 55  THR A O   1 
ATOM   373  C  CB  . THR A 1 55  ? 18.437 16.168  13.729 1.00 18.37 ? 55  THR A CB  1 
ATOM   374  O  OG1 . THR A 1 55  ? 18.329 17.222  14.693 1.00 18.28 ? 55  THR A OG1 1 
ATOM   375  C  CG2 . THR A 1 55  ? 18.827 16.765  12.387 1.00 19.93 ? 55  THR A CG2 1 
ATOM   376  N  N   . ILE A 1 56  ? 15.914 13.584  14.634 1.00 17.37 ? 56  ILE A N   1 
ATOM   377  C  CA  . ILE A 1 56  ? 15.647 12.516  15.584 1.00 18.27 ? 56  ILE A CA  1 
ATOM   378  C  C   . ILE A 1 56  ? 16.054 11.214  14.910 1.00 16.34 ? 56  ILE A C   1 
ATOM   379  O  O   . ILE A 1 56  ? 15.702 10.980  13.754 1.00 17.26 ? 56  ILE A O   1 
ATOM   380  C  CB  . ILE A 1 56  ? 14.146 12.468  15.924 1.00 17.20 ? 56  ILE A CB  1 
ATOM   381  C  CG1 . ILE A 1 56  ? 13.748 13.764  16.637 1.00 20.23 ? 56  ILE A CG1 1 
ATOM   382  C  CG2 . ILE A 1 56  ? 13.832 11.252  16.774 1.00 17.20 ? 56  ILE A CG2 1 
ATOM   383  C  CD1 . ILE A 1 56  ? 12.246 13.977  16.736 1.00 21.50 ? 56  ILE A CD1 1 
ATOM   384  N  N   . ALA A 1 57  ? 16.798 10.376  15.625 1.00 15.61 ? 57  ALA A N   1 
ATOM   385  C  CA  . ALA A 1 57  ? 17.254 9.096   15.085 1.00 15.18 ? 57  ALA A CA  1 
ATOM   386  C  C   . ALA A 1 57  ? 16.768 7.961   15.989 1.00 15.02 ? 57  ALA A C   1 
ATOM   387  O  O   . ALA A 1 57  ? 16.827 8.070   17.214 1.00 15.15 ? 57  ALA A O   1 
ATOM   388  C  CB  . ALA A 1 57  ? 18.775 9.080   14.995 1.00 14.13 ? 57  ALA A CB  1 
ATOM   389  N  N   . VAL A 1 58  ? 16.292 6.880   15.380 1.00 13.21 ? 58  VAL A N   1 
ATOM   390  C  CA  . VAL A 1 58  ? 15.773 5.737   16.131 1.00 14.30 ? 58  VAL A CA  1 
ATOM   391  C  C   . VAL A 1 58  ? 16.420 4.445   15.648 1.00 13.56 ? 58  VAL A C   1 
ATOM   392  O  O   . VAL A 1 58  ? 16.402 4.144   14.457 1.00 15.63 ? 58  VAL A O   1 
ATOM   393  C  CB  . VAL A 1 58  ? 14.236 5.631   15.954 1.00 12.77 ? 58  VAL A CB  1 
ATOM   394  C  CG1 . VAL A 1 58  ? 13.685 4.480   16.776 1.00 10.98 ? 58  VAL A CG1 1 
ATOM   395  C  CG2 . VAL A 1 58  ? 13.584 6.941   16.369 1.00 12.50 ? 58  VAL A CG2 1 
ATOM   396  N  N   . GLY A 1 59  ? 16.992 3.676   16.567 1.00 14.07 ? 59  GLY A N   1 
ATOM   397  C  CA  . GLY A 1 59  ? 17.629 2.438   16.151 1.00 13.81 ? 59  GLY A CA  1 
ATOM   398  C  C   . GLY A 1 59  ? 18.145 1.564   17.278 1.00 15.03 ? 59  GLY A C   1 
ATOM   399  O  O   . GLY A 1 59  ? 17.667 1.633   18.418 1.00 12.73 ? 59  GLY A O   1 
ATOM   400  N  N   . LEU A 1 60  ? 19.131 0.737   16.943 1.00 14.59 ? 60  LEU A N   1 
ATOM   401  C  CA  . LEU A 1 60  ? 19.739 -0.179  17.890 1.00 15.00 ? 60  LEU A CA  1 
ATOM   402  C  C   . LEU A 1 60  ? 21.235 0.083   17.982 1.00 16.56 ? 60  LEU A C   1 
ATOM   403  O  O   . LEU A 1 60  ? 21.888 0.367   16.982 1.00 17.55 ? 60  LEU A O   1 
ATOM   404  C  CB  . LEU A 1 60  ? 19.488 -1.624  17.442 1.00 14.13 ? 60  LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 60  ? 18.016 -2.045  17.365 1.00 15.14 ? 60  LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 60  ? 17.878 -3.372  16.589 1.00 14.46 ? 60  LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 60  ? 17.461 -2.174  18.778 1.00 15.69 ? 60  LEU A CD2 1 
ATOM   408  N  N   . VAL A 1 61  ? 21.773 -0.004  19.193 1.00 17.81 ? 61  VAL A N   1 
ATOM   409  C  CA  . VAL A 1 61  ? 23.193 0.215   19.409 1.00 17.95 ? 61  VAL A CA  1 
ATOM   410  C  C   . VAL A 1 61  ? 23.737 -0.856  20.342 1.00 19.24 ? 61  VAL A C   1 
ATOM   411  O  O   . VAL A 1 61  ? 22.985 -1.469  21.106 1.00 20.21 ? 61  VAL A O   1 
ATOM   412  C  CB  . VAL A 1 61  ? 23.464 1.592   20.054 1.00 15.88 ? 61  VAL A CB  1 
ATOM   413  C  CG1 . VAL A 1 61  ? 22.904 2.696   19.179 1.00 18.55 ? 61  VAL A CG1 1 
ATOM   414  C  CG2 . VAL A 1 61  ? 22.840 1.646   21.443 1.00 18.13 ? 61  VAL A CG2 1 
ATOM   415  N  N   . PRO A 1 62  ? 25.053 -1.100  20.291 1.00 20.69 ? 62  PRO A N   1 
ATOM   416  C  CA  . PRO A 1 62  ? 25.639 -2.114  21.170 1.00 22.12 ? 62  PRO A CA  1 
ATOM   417  C  C   . PRO A 1 62  ? 25.798 -1.496  22.550 1.00 24.03 ? 62  PRO A C   1 
ATOM   418  O  O   . PRO A 1 62  ? 25.562 -0.300  22.723 1.00 21.95 ? 62  PRO A O   1 
ATOM   419  C  CB  . PRO A 1 62  ? 26.976 -2.423  20.500 1.00 21.24 ? 62  PRO A CB  1 
ATOM   420  C  CG  . PRO A 1 62  ? 27.364 -1.086  19.899 1.00 22.24 ? 62  PRO A CG  1 
ATOM   421  C  CD  . PRO A 1 62  ? 26.044 -0.588  19.323 1.00 21.15 ? 62  PRO A CD  1 
ATOM   422  N  N   . GLN A 1 63  ? 26.174 -2.295  23.539 1.00 25.30 ? 63  GLN A N   1 
ATOM   423  C  CA  . GLN A 1 63  ? 26.355 -1.741  24.873 1.00 29.96 ? 63  GLN A CA  1 
ATOM   424  C  C   . GLN A 1 63  ? 27.572 -0.822  24.813 1.00 28.68 ? 63  GLN A C   1 
ATOM   425  O  O   . GLN A 1 63  ? 28.456 -1.012  23.978 1.00 31.49 ? 63  GLN A O   1 
ATOM   426  C  CB  . GLN A 1 63  ? 26.584 -2.858  25.897 1.00 31.84 ? 63  GLN A CB  1 
ATOM   427  C  CG  . GLN A 1 63  ? 27.991 -3.418  25.903 1.00 35.41 ? 63  GLN A CG  1 
ATOM   428  C  CD  . GLN A 1 63  ? 28.136 -4.627  26.811 1.00 37.66 ? 63  GLN A CD  1 
ATOM   429  O  OE1 . GLN A 1 63  ? 27.567 -4.671  27.905 1.00 38.12 ? 63  GLN A OE1 1 
ATOM   430  N  NE2 . GLN A 1 63  ? 28.911 -5.612  26.363 1.00 35.22 ? 63  GLN A NE2 1 
ATOM   431  N  N   . TYR A 1 64  ? 27.603 0.182   25.679 1.00 29.58 ? 64  TYR A N   1 
ATOM   432  C  CA  . TYR A 1 64  ? 28.716 1.123   25.729 1.00 30.93 ? 64  TYR A CA  1 
ATOM   433  C  C   . TYR A 1 64  ? 28.780 2.086   24.543 1.00 29.12 ? 64  TYR A C   1 
ATOM   434  O  O   . TYR A 1 64  ? 29.814 2.709   24.304 1.00 31.94 ? 64  TYR A O   1 
ATOM   435  C  CB  . TYR A 1 64  ? 30.039 0.356   25.842 1.00 32.77 ? 64  TYR A CB  1 
ATOM   436  C  CG  . TYR A 1 64  ? 30.298 -0.228  27.214 1.00 36.21 ? 64  TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1 64  ? 30.676 0.591   28.278 1.00 37.83 ? 64  TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1 64  ? 30.165 -1.597  27.450 1.00 36.90 ? 64  TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1 64  ? 30.919 0.062   29.547 1.00 39.14 ? 64  TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1 64  ? 30.405 -2.139  28.718 1.00 37.43 ? 64  TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1 64  ? 30.781 -1.303  29.761 1.00 39.58 ? 64  TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1 64  ? 31.016 -1.822  31.020 1.00 40.01 ? 64  TYR A OH  1 
ATOM   443  N  N   . TYR A 1 65  ? 27.681 2.216   23.807 1.00 26.51 ? 65  TYR A N   1 
ATOM   444  C  CA  . TYR A 1 65  ? 27.644 3.117   22.657 1.00 23.60 ? 65  TYR A CA  1 
ATOM   445  C  C   . TYR A 1 65  ? 27.844 4.553   23.139 1.00 22.42 ? 65  TYR A C   1 
ATOM   446  O  O   . TYR A 1 65  ? 27.418 4.906   24.239 1.00 22.95 ? 65  TYR A O   1 
ATOM   447  C  CB  . TYR A 1 65  ? 26.297 2.997   21.929 1.00 22.35 ? 65  TYR A CB  1 
ATOM   448  C  CG  . TYR A 1 65  ? 26.245 3.692   20.575 1.00 18.93 ? 65  TYR A CG  1 
ATOM   449  C  CD1 . TYR A 1 65  ? 26.867 3.138   19.461 1.00 19.55 ? 65  TYR A CD1 1 
ATOM   450  C  CD2 . TYR A 1 65  ? 25.568 4.900   20.414 1.00 19.95 ? 65  TYR A CD2 1 
ATOM   451  C  CE1 . TYR A 1 65  ? 26.815 3.770   18.210 1.00 17.37 ? 65  TYR A CE1 1 
ATOM   452  C  CE2 . TYR A 1 65  ? 25.512 5.541   19.172 1.00 19.50 ? 65  TYR A CE2 1 
ATOM   453  C  CZ  . TYR A 1 65  ? 26.137 4.967   18.075 1.00 18.81 ? 65  TYR A CZ  1 
ATOM   454  O  OH  . TYR A 1 65  ? 26.078 5.589   16.845 1.00 18.67 ? 65  TYR A OH  1 
ATOM   455  N  N   . SER A 1 66  ? 28.490 5.379   22.320 1.00 21.01 ? 66  SER A N   1 
ATOM   456  C  CA  . SER A 1 66  ? 28.737 6.779   22.677 1.00 21.28 ? 66  SER A CA  1 
ATOM   457  C  C   . SER A 1 66  ? 27.453 7.555   22.959 1.00 21.20 ? 66  SER A C   1 
ATOM   458  O  O   . SER A 1 66  ? 26.518 7.532   22.157 1.00 21.27 ? 66  SER A O   1 
ATOM   459  C  CB  . SER A 1 66  ? 29.502 7.482   21.556 1.00 21.76 ? 66  SER A CB  1 
ATOM   460  O  OG  . SER A 1 66  ? 29.517 8.881   21.764 1.00 21.36 ? 66  SER A OG  1 
ATOM   461  N  N   . LEU A 1 67  ? 27.416 8.257   24.089 1.00 19.76 ? 67  LEU A N   1 
ATOM   462  C  CA  . LEU A 1 67  ? 26.240 9.032   24.462 1.00 22.34 ? 67  LEU A CA  1 
ATOM   463  C  C   . LEU A 1 67  ? 26.156 10.430  23.829 1.00 24.26 ? 67  LEU A C   1 
ATOM   464  O  O   . LEU A 1 67  ? 25.246 11.198  24.144 1.00 24.93 ? 67  LEU A O   1 
ATOM   465  C  CB  . LEU A 1 67  ? 26.141 9.131   25.991 1.00 24.27 ? 67  LEU A CB  1 
ATOM   466  C  CG  . LEU A 1 67  ? 25.877 7.782   26.678 1.00 23.97 ? 67  LEU A CG  1 
ATOM   467  C  CD1 . LEU A 1 67  ? 25.870 7.934   28.199 1.00 24.11 ? 67  LEU A CD1 1 
ATOM   468  C  CD2 . LEU A 1 67  ? 24.535 7.244   26.188 1.00 23.80 ? 67  LEU A CD2 1 
ATOM   469  N  N   . ASP A 1 68  ? 27.094 10.771  22.948 1.00 24.43 ? 68  ASP A N   1 
ATOM   470  C  CA  . ASP A 1 68  ? 27.033 12.070  22.274 1.00 25.57 ? 68  ASP A CA  1 
ATOM   471  C  C   . ASP A 1 68  ? 27.118 11.945  20.761 1.00 23.52 ? 68  ASP A C   1 
ATOM   472  O  O   . ASP A 1 68  ? 27.613 12.835  20.072 1.00 21.54 ? 68  ASP A O   1 
ATOM   473  C  CB  . ASP A 1 68  ? 28.113 13.032  22.773 1.00 29.98 ? 68  ASP A CB  1 
ATOM   474  C  CG  . ASP A 1 68  ? 29.383 12.338  23.137 1.00 32.33 ? 68  ASP A CG  1 
ATOM   475  O  OD1 . ASP A 1 68  ? 29.815 11.464  22.364 1.00 33.39 ? 68  ASP A OD1 1 
ATOM   476  O  OD2 . ASP A 1 68  ? 29.949 12.677  24.199 1.00 36.37 ? 68  ASP A OD2 1 
ATOM   477  N  N   . HIS A 1 69  ? 26.654 10.812  20.252 1.00 21.52 ? 69  HIS A N   1 
ATOM   478  C  CA  . HIS A 1 69  ? 26.607 10.581  18.817 1.00 18.82 ? 69  HIS A CA  1 
ATOM   479  C  C   . HIS A 1 69  ? 25.283 9.890   18.540 1.00 17.39 ? 69  HIS A C   1 
ATOM   480  O  O   . HIS A 1 69  ? 24.794 9.114   19.364 1.00 17.68 ? 69  HIS A O   1 
ATOM   481  C  CB  . HIS A 1 69  ? 27.796 9.740   18.348 1.00 18.18 ? 69  HIS A CB  1 
ATOM   482  C  CG  . HIS A 1 69  ? 29.101 10.460  18.463 1.00 20.41 ? 69  HIS A CG  1 
ATOM   483  N  ND1 . HIS A 1 69  ? 29.895 10.382  19.587 1.00 20.99 ? 69  HIS A ND1 1 
ATOM   484  C  CD2 . HIS A 1 69  ? 29.680 11.380  17.656 1.00 20.30 ? 69  HIS A CD2 1 
ATOM   485  C  CE1 . HIS A 1 69  ? 30.903 11.228  19.470 1.00 23.21 ? 69  HIS A CE1 1 
ATOM   486  N  NE2 . HIS A 1 69  ? 30.794 11.848  18.308 1.00 23.50 ? 69  HIS A NE2 1 
ATOM   487  N  N   . GLN A 1 70  ? 24.689 10.213  17.399 1.00 16.46 ? 70  GLN A N   1 
ATOM   488  C  CA  . GLN A 1 70  ? 23.406 9.644   17.009 1.00 17.55 ? 70  GLN A CA  1 
ATOM   489  C  C   . GLN A 1 70  ? 23.564 8.160   16.749 1.00 15.40 ? 70  GLN A C   1 
ATOM   490  O  O   . GLN A 1 70  ? 24.592 7.728   16.236 1.00 15.05 ? 70  GLN A O   1 
ATOM   491  C  CB  . GLN A 1 70  ? 22.905 10.285  15.710 1.00 17.57 ? 70  GLN A CB  1 
ATOM   492  C  CG  . GLN A 1 70  ? 22.567 11.772  15.757 1.00 22.78 ? 70  GLN A CG  1 
ATOM   493  C  CD  . GLN A 1 70  ? 21.143 12.030  16.204 1.00 22.16 ? 70  GLN A CD  1 
ATOM   494  O  OE1 . GLN A 1 70  ? 20.510 12.993  15.782 1.00 22.07 ? 70  GLN A OE1 1 
ATOM   495  N  NE2 . GLN A 1 70  ? 20.637 11.170  17.074 1.00 23.32 ? 70  GLN A NE2 1 
ATOM   496  N  N   . PRO A 1 71  ? 22.561 7.353   17.122 1.00 17.41 ? 71  PRO A N   1 
ATOM   497  C  CA  . PRO A 1 71  ? 22.718 5.926   16.840 1.00 16.66 ? 71  PRO A CA  1 
ATOM   498  C  C   . PRO A 1 71  ? 22.791 5.807   15.319 1.00 16.43 ? 71  PRO A C   1 
ATOM   499  O  O   . PRO A 1 71  ? 22.153 6.583   14.600 1.00 17.02 ? 71  PRO A O   1 
ATOM   500  C  CB  . PRO A 1 71  ? 21.445 5.306   17.429 1.00 19.54 ? 71  PRO A CB  1 
ATOM   501  C  CG  . PRO A 1 71  ? 20.478 6.451   17.504 1.00 22.88 ? 71  PRO A CG  1 
ATOM   502  C  CD  . PRO A 1 71  ? 21.363 7.597   17.939 1.00 18.03 ? 71  PRO A CD  1 
ATOM   503  N  N   . GLY A 1 72  ? 23.579 4.862   14.825 1.00 15.54 ? 72  GLY A N   1 
ATOM   504  C  CA  . GLY A 1 72  ? 23.721 4.714   13.385 1.00 14.95 ? 72  GLY A CA  1 
ATOM   505  C  C   . GLY A 1 72  ? 25.012 5.345   12.871 1.00 15.45 ? 72  GLY A C   1 
ATOM   506  O  O   . GLY A 1 72  ? 25.582 4.887   11.875 1.00 13.60 ? 72  GLY A O   1 
ATOM   507  N  N   . TRP A 1 73  ? 25.475 6.398   13.542 1.00 14.20 ? 73  TRP A N   1 
ATOM   508  C  CA  . TRP A 1 73  ? 26.705 7.089   13.143 1.00 15.58 ? 73  TRP A CA  1 
ATOM   509  C  C   . TRP A 1 73  ? 27.974 6.287   13.380 1.00 16.30 ? 73  TRP A C   1 
ATOM   510  O  O   . TRP A 1 73  ? 28.928 6.384   12.607 1.00 18.01 ? 73  TRP A O   1 
ATOM   511  C  CB  . TRP A 1 73  ? 26.860 8.413   13.893 1.00 13.43 ? 73  TRP A CB  1 
ATOM   512  C  CG  . TRP A 1 73  ? 26.033 9.562   13.375 1.00 14.10 ? 73  TRP A CG  1 
ATOM   513  C  CD1 . TRP A 1 73  ? 25.228 9.577   12.260 1.00 14.31 ? 73  TRP A CD1 1 
ATOM   514  C  CD2 . TRP A 1 73  ? 25.995 10.885  13.913 1.00 11.62 ? 73  TRP A CD2 1 
ATOM   515  N  NE1 . TRP A 1 73  ? 24.700 10.832  12.078 1.00 13.64 ? 73  TRP A NE1 1 
ATOM   516  C  CE2 . TRP A 1 73  ? 25.155 11.655  13.077 1.00 15.36 ? 73  TRP A CE2 1 
ATOM   517  C  CE3 . TRP A 1 73  ? 26.595 11.498  15.023 1.00 14.12 ? 73  TRP A CE3 1 
ATOM   518  C  CZ2 . TRP A 1 73  ? 24.900 13.013  13.315 1.00 17.41 ? 73  TRP A CZ2 1 
ATOM   519  C  CZ3 . TRP A 1 73  ? 26.342 12.854  15.260 1.00 11.76 ? 73  TRP A CZ3 1 
ATOM   520  C  CH2 . TRP A 1 73  ? 25.502 13.592  14.409 1.00 17.26 ? 73  TRP A CH2 1 
ATOM   521  N  N   . LEU A 1 74  ? 27.999 5.510   14.455 1.00 17.02 ? 74  LEU A N   1 
ATOM   522  C  CA  . LEU A 1 74  ? 29.191 4.736   14.787 1.00 18.41 ? 74  LEU A CA  1 
ATOM   523  C  C   . LEU A 1 74  ? 29.012 3.237   14.544 1.00 20.84 ? 74  LEU A C   1 
ATOM   524  O  O   . LEU A 1 74  ? 27.891 2.728   14.520 1.00 21.31 ? 74  LEU A O   1 
ATOM   525  C  CB  . LEU A 1 74  ? 29.587 4.998   16.243 1.00 17.65 ? 74  LEU A CB  1 
ATOM   526  C  CG  . LEU A 1 74  ? 29.604 6.468   16.697 1.00 20.70 ? 74  LEU A CG  1 
ATOM   527  C  CD1 . LEU A 1 74  ? 30.050 6.537   18.140 1.00 19.55 ? 74  LEU A CD1 1 
ATOM   528  C  CD2 . LEU A 1 74  ? 30.524 7.299   15.821 1.00 20.35 ? 74  LEU A CD2 1 
ATOM   529  N  N   . PRO A 1 75  ? 30.128 2.512   14.371 1.00 22.21 ? 75  PRO A N   1 
ATOM   530  C  CA  . PRO A 1 75  ? 30.147 1.067   14.118 1.00 23.52 ? 75  PRO A CA  1 
ATOM   531  C  C   . PRO A 1 75  ? 29.222 0.186   14.955 1.00 22.87 ? 75  PRO A C   1 
ATOM   532  O  O   . PRO A 1 75  ? 28.978 0.451   16.132 1.00 24.15 ? 75  PRO A O   1 
ATOM   533  C  CB  . PRO A 1 75  ? 31.618 0.703   14.327 1.00 24.65 ? 75  PRO A CB  1 
ATOM   534  C  CG  . PRO A 1 75  ? 32.333 1.932   13.872 1.00 24.25 ? 75  PRO A CG  1 
ATOM   535  C  CD  . PRO A 1 75  ? 31.505 3.027   14.513 1.00 22.81 ? 75  PRO A CD  1 
ATOM   536  N  N   . ASP A 1 76  ? 28.729 -0.872  14.314 1.00 23.65 ? 76  ASP A N   1 
ATOM   537  C  CA  . ASP A 1 76  ? 27.857 -1.873  14.921 1.00 21.90 ? 76  ASP A CA  1 
ATOM   538  C  C   . ASP A 1 76  ? 26.523 -1.335  15.438 1.00 20.60 ? 76  ASP A C   1 
ATOM   539  O  O   . ASP A 1 76  ? 25.878 -1.962  16.276 1.00 17.41 ? 76  ASP A O   1 
ATOM   540  C  CB  . ASP A 1 76  ? 28.606 -2.594  16.044 1.00 25.43 ? 76  ASP A CB  1 
ATOM   541  C  CG  . ASP A 1 76  ? 30.000 -3.033  15.622 1.00 28.87 ? 76  ASP A CG  1 
ATOM   542  O  OD1 . ASP A 1 76  ? 30.135 -3.664  14.548 1.00 28.54 ? 76  ASP A OD1 1 
ATOM   543  O  OD2 . ASP A 1 76  ? 30.961 -2.741  16.366 1.00 29.62 ? 76  ASP A OD2 1 
ATOM   544  N  N   . SER A 1 77  ? 26.116 -0.174  14.934 1.00 19.17 ? 77  SER A N   1 
ATOM   545  C  CA  . SER A 1 77  ? 24.846 0.421   15.327 1.00 17.87 ? 77  SER A CA  1 
ATOM   546  C  C   . SER A 1 77  ? 24.062 0.649   14.044 1.00 17.02 ? 77  SER A C   1 
ATOM   547  O  O   . SER A 1 77  ? 24.641 0.690   12.967 1.00 16.90 ? 77  SER A O   1 
ATOM   548  C  CB  . SER A 1 77  ? 25.057 1.754   16.056 1.00 18.06 ? 77  SER A CB  1 
ATOM   549  O  OG  . SER A 1 77  ? 25.433 2.796   15.166 1.00 16.96 ? 77  SER A OG  1 
ATOM   550  N  N   . VAL A 1 78  ? 22.747 0.784   14.150 1.00 15.99 ? 78  VAL A N   1 
ATOM   551  C  CA  . VAL A 1 78  ? 21.930 0.998   12.957 1.00 17.01 ? 78  VAL A CA  1 
ATOM   552  C  C   . VAL A 1 78  ? 20.714 1.831   13.316 1.00 16.17 ? 78  VAL A C   1 
ATOM   553  O  O   . VAL A 1 78  ? 20.100 1.630   14.365 1.00 16.10 ? 78  VAL A O   1 
ATOM   554  C  CB  . VAL A 1 78  ? 21.503 -0.358  12.332 1.00 19.96 ? 78  VAL A CB  1 
ATOM   555  C  CG1 . VAL A 1 78  ? 20.672 -1.159  13.328 1.00 20.93 ? 78  VAL A CG1 1 
ATOM   556  C  CG2 . VAL A 1 78  ? 20.754 -0.118  11.035 1.00 19.47 ? 78  VAL A CG2 1 
ATOM   557  N  N   . ALA A 1 79  ? 20.365 2.779   12.455 1.00 16.50 ? 79  ALA A N   1 
ATOM   558  C  CA  . ALA A 1 79  ? 19.239 3.638   12.765 1.00 15.06 ? 79  ALA A CA  1 
ATOM   559  C  C   . ALA A 1 79  ? 18.595 4.316   11.577 1.00 16.16 ? 79  ALA A C   1 
ATOM   560  O  O   . ALA A 1 79  ? 19.204 4.491   10.517 1.00 15.31 ? 79  ALA A O   1 
ATOM   561  C  CB  . ALA A 1 79  ? 19.669 4.691   13.780 1.00 15.56 ? 79  ALA A CB  1 
ATOM   562  N  N   . TYR A 1 80  ? 17.343 4.705   11.790 1.00 15.94 ? 80  TYR A N   1 
ATOM   563  C  CA  . TYR A 1 80  ? 16.536 5.390   10.796 1.00 18.21 ? 80  TYR A CA  1 
ATOM   564  C  C   . TYR A 1 80  ? 16.470 6.839   11.268 1.00 16.15 ? 80  TYR A C   1 
ATOM   565  O  O   . TYR A 1 80  ? 16.027 7.105   12.376 1.00 19.08 ? 80  TYR A O   1 
ATOM   566  C  CB  . TYR A 1 80  ? 15.137 4.776   10.780 1.00 19.07 ? 80  TYR A CB  1 
ATOM   567  C  CG  . TYR A 1 80  ? 14.186 5.364   9.771  1.00 24.78 ? 80  TYR A CG  1 
ATOM   568  C  CD1 . TYR A 1 80  ? 14.169 4.913   8.457  1.00 27.29 ? 80  TYR A CD1 1 
ATOM   569  C  CD2 . TYR A 1 80  ? 13.259 6.332   10.144 1.00 26.92 ? 80  TYR A CD2 1 
ATOM   570  C  CE1 . TYR A 1 80  ? 13.243 5.403   7.539  1.00 30.65 ? 80  TYR A CE1 1 
ATOM   571  C  CE2 . TYR A 1 80  ? 12.329 6.830   9.233  1.00 30.59 ? 80  TYR A CE2 1 
ATOM   572  C  CZ  . TYR A 1 80  ? 12.325 6.356   7.934  1.00 29.23 ? 80  TYR A CZ  1 
ATOM   573  O  OH  . TYR A 1 80  ? 11.379 6.807   7.045  1.00 31.86 ? 80  TYR A OH  1 
ATOM   574  N  N   . HIS A 1 81  ? 16.919 7.768   10.436 1.00 16.56 ? 81  HIS A N   1 
ATOM   575  C  CA  . HIS A 1 81  ? 16.912 9.184   10.799 1.00 16.15 ? 81  HIS A CA  1 
ATOM   576  C  C   . HIS A 1 81  ? 15.706 9.884   10.182 1.00 14.93 ? 81  HIS A C   1 
ATOM   577  O  O   . HIS A 1 81  ? 15.493 9.824   8.969  1.00 16.42 ? 81  HIS A O   1 
ATOM   578  C  CB  . HIS A 1 81  ? 18.211 9.844   10.330 1.00 15.53 ? 81  HIS A CB  1 
ATOM   579  C  CG  . HIS A 1 81  ? 19.406 9.487   11.155 1.00 13.43 ? 81  HIS A CG  1 
ATOM   580  N  ND1 . HIS A 1 81  ? 19.583 8.238   11.715 1.00 16.49 ? 81  HIS A ND1 1 
ATOM   581  C  CD2 . HIS A 1 81  ? 20.499 10.210  11.499 1.00 12.38 ? 81  HIS A CD2 1 
ATOM   582  C  CE1 . HIS A 1 81  ? 20.730 8.209   12.369 1.00 12.70 ? 81  HIS A CE1 1 
ATOM   583  N  NE2 . HIS A 1 81  ? 21.304 9.394   12.254 1.00 16.27 ? 81  HIS A NE2 1 
ATOM   584  N  N   . ALA A 1 82  ? 14.926 10.547  11.028 1.00 12.94 ? 82  ALA A N   1 
ATOM   585  C  CA  . ALA A 1 82  ? 13.711 11.235  10.606 1.00 15.16 ? 82  ALA A CA  1 
ATOM   586  C  C   . ALA A 1 82  ? 13.890 12.414  9.662  1.00 15.53 ? 82  ALA A C   1 
ATOM   587  O  O   . ALA A 1 82  ? 13.060 12.635  8.781  1.00 13.26 ? 82  ALA A O   1 
ATOM   588  C  CB  . ALA A 1 82  ? 12.930 11.701  11.839 1.00 14.39 ? 82  ALA A CB  1 
ATOM   589  N  N   . ASP A 1 83  ? 14.967 13.171  9.841  1.00 16.41 ? 83  ASP A N   1 
ATOM   590  C  CA  . ASP A 1 83  ? 15.182 14.360  9.026  1.00 19.38 ? 83  ASP A CA  1 
ATOM   591  C  C   . ASP A 1 83  ? 15.453 14.098  7.557  1.00 19.78 ? 83  ASP A C   1 
ATOM   592  O  O   . ASP A 1 83  ? 15.231 14.975  6.729  1.00 20.72 ? 83  ASP A O   1 
ATOM   593  C  CB  . ASP A 1 83  ? 16.308 15.221  9.619  1.00 20.67 ? 83  ASP A CB  1 
ATOM   594  C  CG  . ASP A 1 83  ? 17.642 14.520  9.615  1.00 22.59 ? 83  ASP A CG  1 
ATOM   595  O  OD1 . ASP A 1 83  ? 17.762 13.458  10.264 1.00 27.42 ? 83  ASP A OD1 1 
ATOM   596  O  OD2 . ASP A 1 83  ? 18.573 15.035  8.963  1.00 27.58 ? 83  ASP A OD2 1 
ATOM   597  N  N   . ASP A 1 84  ? 15.922 12.898  7.223  1.00 19.42 ? 84  ASP A N   1 
ATOM   598  C  CA  . ASP A 1 84  ? 16.200 12.579  5.828  1.00 20.53 ? 84  ASP A CA  1 
ATOM   599  C  C   . ASP A 1 84  ? 15.661 11.213  5.398  1.00 19.90 ? 84  ASP A C   1 
ATOM   600  O  O   . ASP A 1 84  ? 15.762 10.845  4.227  1.00 19.60 ? 84  ASP A O   1 
ATOM   601  C  CB  . ASP A 1 84  ? 17.713 12.656  5.545  1.00 20.30 ? 84  ASP A CB  1 
ATOM   602  C  CG  . ASP A 1 84  ? 18.536 11.789  6.483  1.00 21.74 ? 84  ASP A CG  1 
ATOM   603  O  OD1 . ASP A 1 84  ? 17.975 10.849  7.080  1.00 19.95 ? 84  ASP A OD1 1 
ATOM   604  O  OD2 . ASP A 1 84  ? 19.760 12.042  6.610  1.00 23.66 ? 84  ASP A OD2 1 
ATOM   605  N  N   . GLY A 1 85  ? 15.097 10.473  6.349  1.00 18.04 ? 85  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 85  ? 14.541 9.162   6.056  1.00 18.57 ? 85  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 85  ? 15.603 8.142   5.705  1.00 18.16 ? 85  GLY A C   1 
ATOM   608  O  O   . GLY A 1 85  ? 15.303 7.030   5.276  1.00 17.32 ? 85  GLY A O   1 
ATOM   609  N  N   . LYS A 1 86  ? 16.859 8.509   5.916  1.00 17.04 ? 86  LYS A N   1 
ATOM   610  C  CA  . LYS A 1 86  ? 17.952 7.618   5.577  1.00 15.51 ? 86  LYS A CA  1 
ATOM   611  C  C   . LYS A 1 86  ? 18.330 6.609   6.649  1.00 15.14 ? 86  LYS A C   1 
ATOM   612  O  O   . LYS A 1 86  ? 18.116 6.830   7.842  1.00 14.16 ? 86  LYS A O   1 
ATOM   613  C  CB  . LYS A 1 86  ? 19.182 8.446   5.186  1.00 15.75 ? 86  LYS A CB  1 
ATOM   614  C  CG  . LYS A 1 86  ? 19.019 9.187   3.861  1.00 17.63 ? 86  LYS A CG  1 
ATOM   615  C  CD  . LYS A 1 86  ? 20.261 9.990   3.523  1.00 20.37 ? 86  LYS A CD  1 
ATOM   616  C  CE  . LYS A 1 86  ? 20.160 10.611  2.135  1.00 22.76 ? 86  LYS A CE  1 
ATOM   617  N  NZ  . LYS A 1 86  ? 21.367 11.436  1.847  1.00 24.17 ? 86  LYS A NZ  1 
ATOM   618  N  N   . LEU A 1 87  ? 18.889 5.491   6.200  1.00 14.76 ? 87  LEU A N   1 
ATOM   619  C  CA  . LEU A 1 87  ? 19.348 4.433   7.092  1.00 15.29 ? 87  LEU A CA  1 
ATOM   620  C  C   . LEU A 1 87  ? 20.842 4.640   7.324  1.00 14.99 ? 87  LEU A C   1 
ATOM   621  O  O   . LEU A 1 87  ? 21.606 4.756   6.374  1.00 14.11 ? 87  LEU A O   1 
ATOM   622  C  CB  . LEU A 1 87  ? 19.124 3.058   6.451  1.00 16.20 ? 87  LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 87  ? 19.816 1.874   7.136  1.00 18.49 ? 87  LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 87  ? 19.117 1.564   8.437  1.00 18.57 ? 87  LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 87  ? 19.796 0.652   6.210  1.00 22.07 ? 87  LEU A CD2 1 
ATOM   626  N  N   . TYR A 1 88  ? 21.246 4.704   8.587  1.00 15.06 ? 88  TYR A N   1 
ATOM   627  C  CA  . TYR A 1 88  ? 22.648 4.884   8.942  1.00 17.33 ? 88  TYR A CA  1 
ATOM   628  C  C   . TYR A 1 88  ? 23.104 3.623   9.650  1.00 18.33 ? 88  TYR A C   1 
ATOM   629  O  O   . TYR A 1 88  ? 22.413 3.126   10.539 1.00 19.01 ? 88  TYR A O   1 
ATOM   630  C  CB  . TYR A 1 88  ? 22.811 6.081   9.882  1.00 15.99 ? 88  TYR A CB  1 
ATOM   631  C  CG  . TYR A 1 88  ? 22.624 7.419   9.201  1.00 16.68 ? 88  TYR A CG  1 
ATOM   632  C  CD1 . TYR A 1 88  ? 23.718 8.232   8.909  1.00 17.27 ? 88  TYR A CD1 1 
ATOM   633  C  CD2 . TYR A 1 88  ? 21.357 7.866   8.843  1.00 13.30 ? 88  TYR A CD2 1 
ATOM   634  C  CE1 . TYR A 1 88  ? 23.551 9.469   8.276  1.00 20.09 ? 88  TYR A CE1 1 
ATOM   635  C  CE2 . TYR A 1 88  ? 21.178 9.099   8.207  1.00 17.62 ? 88  TYR A CE2 1 
ATOM   636  C  CZ  . TYR A 1 88  ? 22.276 9.892   7.929  1.00 18.10 ? 88  TYR A CZ  1 
ATOM   637  O  OH  . TYR A 1 88  ? 22.103 11.108  7.315  1.00 20.21 ? 88  TYR A OH  1 
ATOM   638  N  N   . ASN A 1 89  ? 24.248 3.080   9.258  1.00 20.24 ? 89  ASN A N   1 
ATOM   639  C  CA  . ASN A 1 89  ? 24.714 1.882   9.931  1.00 23.84 ? 89  ASN A CA  1 
ATOM   640  C  C   . ASN A 1 89  ? 26.225 1.763   10.022 1.00 23.89 ? 89  ASN A C   1 
ATOM   641  O  O   . ASN A 1 89  ? 26.829 0.843   9.471  1.00 25.14 ? 89  ASN A O   1 
ATOM   642  C  CB  . ASN A 1 89  ? 24.094 0.633   9.289  1.00 27.31 ? 89  ASN A CB  1 
ATOM   643  C  CG  . ASN A 1 89  ? 24.646 0.334   7.921  1.00 32.14 ? 89  ASN A CG  1 
ATOM   644  O  OD1 . ASN A 1 89  ? 24.888 1.236   7.117  1.00 36.38 ? 89  ASN A OD1 1 
ATOM   645  N  ND2 . ASN A 1 89  ? 24.834 -0.952  7.635  1.00 36.83 ? 89  ASN A ND2 1 
ATOM   646  N  N   . GLY A 1 90  ? 26.832 2.711   10.732 1.00 22.59 ? 90  GLY A N   1 
ATOM   647  C  CA  . GLY A 1 90  ? 28.265 2.676   10.921 1.00 22.49 ? 90  GLY A CA  1 
ATOM   648  C  C   . GLY A 1 90  ? 29.039 3.935   10.612 1.00 21.27 ? 90  GLY A C   1 
ATOM   649  O  O   . GLY A 1 90  ? 30.157 4.087   11.095 1.00 23.49 ? 90  GLY A O   1 
ATOM   650  N  N   . ARG A 1 91  ? 28.462 4.834   9.818  1.00 20.92 ? 91  ARG A N   1 
ATOM   651  C  CA  . ARG A 1 91  ? 29.132 6.081   9.435  1.00 21.62 ? 91  ARG A CA  1 
ATOM   652  C  C   . ARG A 1 91  ? 28.106 7.205   9.357  1.00 19.90 ? 91  ARG A C   1 
ATOM   653  O  O   . ARG A 1 91  ? 26.900 6.954   9.357  1.00 19.66 ? 91  ARG A O   1 
ATOM   654  C  CB  . ARG A 1 91  ? 29.791 5.935   8.053  1.00 23.14 ? 91  ARG A CB  1 
ATOM   655  C  CG  . ARG A 1 91  ? 30.132 4.513   7.661  1.00 27.48 ? 91  ARG A CG  1 
ATOM   656  C  CD  . ARG A 1 91  ? 30.455 4.406   6.172  1.00 25.39 ? 91  ARG A CD  1 
ATOM   657  N  NE  . ARG A 1 91  ? 31.586 5.251   5.794  1.00 25.71 ? 91  ARG A NE  1 
ATOM   658  C  CZ  . ARG A 1 91  ? 31.561 6.124   4.792  1.00 26.52 ? 91  ARG A CZ  1 
ATOM   659  N  NH1 . ARG A 1 91  ? 30.459 6.274   4.064  1.00 24.00 ? 91  ARG A NH1 1 
ATOM   660  N  NH2 . ARG A 1 91  ? 32.637 6.850   4.517  1.00 26.60 ? 91  ARG A NH2 1 
ATOM   661  N  N   . ALA A 1 92  ? 28.585 8.440   9.257  1.00 20.09 ? 92  ALA A N   1 
ATOM   662  C  CA  . ALA A 1 92  ? 27.695 9.594   9.194  1.00 20.65 ? 92  ALA A CA  1 
ATOM   663  C  C   . ALA A 1 92  ? 27.211 9.930   7.789  1.00 22.99 ? 92  ALA A C   1 
ATOM   664  O  O   . ALA A 1 92  ? 26.901 11.083  7.490  1.00 24.01 ? 92  ALA A O   1 
ATOM   665  C  CB  . ALA A 1 92  ? 28.359 10.809  9.817  1.00 22.93 ? 92  ALA A CB  1 
ATOM   666  N  N   . LYS A 1 93  ? 27.174 8.930   6.919  1.00 23.74 ? 93  LYS A N   1 
ATOM   667  C  CA  . LYS A 1 93  ? 26.660 9.128   5.572  1.00 25.95 ? 93  LYS A CA  1 
ATOM   668  C  C   . LYS A 1 93  ? 25.525 8.132   5.471  1.00 26.78 ? 93  LYS A C   1 
ATOM   669  O  O   . LYS A 1 93  ? 25.738 6.920   5.560  1.00 26.93 ? 93  LYS A O   1 
ATOM   670  C  CB  . LYS A 1 93  ? 27.709 8.834   4.502  1.00 28.58 ? 93  LYS A CB  1 
ATOM   671  C  CG  . LYS A 1 93  ? 27.172 9.024   3.083  1.00 32.45 ? 93  LYS A CG  1 
ATOM   672  C  CD  . LYS A 1 93  ? 28.269 8.910   2.035  1.00 33.99 ? 93  LYS A CD  1 
ATOM   673  C  CE  . LYS A 1 93  ? 27.727 9.155   0.638  1.00 36.69 ? 93  LYS A CE  1 
ATOM   674  N  NZ  . LYS A 1 93  ? 26.722 8.132   0.240  1.00 38.45 ? 93  LYS A NZ  1 
ATOM   675  N  N   . GLY A 1 94  ? 24.314 8.649   5.318  1.00 26.56 ? 94  GLY A N   1 
ATOM   676  C  CA  . GLY A 1 94  ? 23.159 7.781   5.239  1.00 28.02 ? 94  GLY A CA  1 
ATOM   677  C  C   . GLY A 1 94  ? 22.910 7.205   3.863  1.00 29.64 ? 94  GLY A C   1 
ATOM   678  O  O   . GLY A 1 94  ? 23.547 7.581   2.878  1.00 26.68 ? 94  GLY A O   1 
ATOM   679  N  N   . ARG A 1 95  ? 21.957 6.287   3.803  1.00 29.43 ? 95  ARG A N   1 
ATOM   680  C  CA  . ARG A 1 95  ? 21.601 5.642   2.558  1.00 31.40 ? 95  ARG A CA  1 
ATOM   681  C  C   . ARG A 1 95  ? 20.101 5.790   2.333  1.00 30.22 ? 95  ARG A C   1 
ATOM   682  O  O   . ARG A 1 95  ? 19.311 5.533   3.246  1.00 29.58 ? 95  ARG A O   1 
ATOM   683  C  CB  . ARG A 1 95  ? 21.976 4.170   2.641  1.00 33.90 ? 95  ARG A CB  1 
ATOM   684  C  CG  . ARG A 1 95  ? 21.795 3.426   1.356  1.00 36.22 ? 95  ARG A CG  1 
ATOM   685  C  CD  . ARG A 1 95  ? 22.102 1.973   1.560  1.00 38.15 ? 95  ARG A CD  1 
ATOM   686  N  NE  . ARG A 1 95  ? 22.057 1.243   0.303  1.00 35.49 ? 95  ARG A NE  1 
ATOM   687  C  CZ  . ARG A 1 95  ? 22.434 -0.021  0.179  1.00 34.96 ? 95  ARG A CZ  1 
ATOM   688  N  NH1 . ARG A 1 95  ? 22.882 -0.680  1.243  1.00 33.49 ? 95  ARG A NH1 1 
ATOM   689  N  NH2 . ARG A 1 95  ? 22.369 -0.617  -1.002 1.00 29.96 ? 95  ARG A NH2 1 
ATOM   690  N  N   . GLN A 1 96  ? 19.704 6.212   1.132  1.00 29.41 ? 96  GLN A N   1 
ATOM   691  C  CA  . GLN A 1 96  ? 18.281 6.376   0.830  1.00 27.94 ? 96  GLN A CA  1 
ATOM   692  C  C   . GLN A 1 96  ? 17.567 5.146   1.359  1.00 26.50 ? 96  GLN A C   1 
ATOM   693  O  O   . GLN A 1 96  ? 17.993 4.022   1.112  1.00 23.47 ? 96  GLN A O   1 
ATOM   694  C  CB  . GLN A 1 96  ? 18.058 6.533   -0.674 1.00 31.21 ? 96  GLN A CB  1 
ATOM   695  C  CG  . GLN A 1 96  ? 18.507 7.886   -1.208 1.00 36.10 ? 96  GLN A CG  1 
ATOM   696  C  CD  . GLN A 1 96  ? 17.585 9.028   -0.795 1.00 39.06 ? 96  GLN A CD  1 
ATOM   697  O  OE1 . GLN A 1 96  ? 17.343 9.258   0.395  1.00 38.84 ? 96  GLN A OE1 1 
ATOM   698  N  NE2 . GLN A 1 96  ? 17.067 9.753   -1.785 1.00 40.75 ? 96  GLN A NE2 1 
ATOM   699  N  N   . PHE A 1 97  ? 16.482 5.370   2.092  1.00 26.20 ? 97  PHE A N   1 
ATOM   700  C  CA  . PHE A 1 97  ? 15.757 4.281   2.721  1.00 25.11 ? 97  PHE A CA  1 
ATOM   701  C  C   . PHE A 1 97  ? 14.253 4.539   2.729  1.00 25.01 ? 97  PHE A C   1 
ATOM   702  O  O   . PHE A 1 97  ? 13.505 3.907   1.983  1.00 27.43 ? 97  PHE A O   1 
ATOM   703  C  CB  . PHE A 1 97  ? 16.279 4.130   4.153  1.00 25.03 ? 97  PHE A CB  1 
ATOM   704  C  CG  . PHE A 1 97  ? 15.957 2.814   4.791  1.00 23.47 ? 97  PHE A CG  1 
ATOM   705  C  CD1 . PHE A 1 97  ? 16.414 1.622   4.231  1.00 22.28 ? 97  PHE A CD1 1 
ATOM   706  C  CD2 . PHE A 1 97  ? 15.234 2.765   5.976  1.00 22.83 ? 97  PHE A CD2 1 
ATOM   707  C  CE1 . PHE A 1 97  ? 16.155 0.403   4.845  1.00 24.83 ? 97  PHE A CE1 1 
ATOM   708  C  CE2 . PHE A 1 97  ? 14.968 1.545   6.600  1.00 25.41 ? 97  PHE A CE2 1 
ATOM   709  C  CZ  . PHE A 1 97  ? 15.432 0.363   6.033  1.00 22.96 ? 97  PHE A CZ  1 
ATOM   710  N  N   . GLY A 1 98  ? 13.808 5.455   3.583  1.00 23.08 ? 98  GLY A N   1 
ATOM   711  C  CA  . GLY A 1 98  ? 12.392 5.765   3.645  1.00 20.27 ? 98  GLY A CA  1 
ATOM   712  C  C   . GLY A 1 98  ? 12.122 7.244   3.468  1.00 21.71 ? 98  GLY A C   1 
ATOM   713  O  O   . GLY A 1 98  ? 12.984 7.986   3.014  1.00 19.84 ? 98  GLY A O   1 
ATOM   714  N  N   . SER A 1 99  ? 10.919 7.675   3.829  1.00 22.30 ? 99  SER A N   1 
ATOM   715  C  CA  . SER A 1 99  ? 10.554 9.078   3.720  1.00 22.99 ? 99  SER A CA  1 
ATOM   716  C  C   . SER A 1 99  ? 10.835 9.795   5.040  1.00 22.61 ? 99  SER A C   1 
ATOM   717  O  O   . SER A 1 99  ? 10.921 9.162   6.097  1.00 19.92 ? 99  SER A O   1 
ATOM   718  C  CB  . SER A 1 99  ? 9.075  9.209   3.345  1.00 24.12 ? 99  SER A CB  1 
ATOM   719  O  OG  . SER A 1 99  ? 8.266  8.387   4.165  1.00 28.96 ? 99  SER A OG  1 
ATOM   720  N  N   . LYS A 1 100 ? 10.997 11.112  4.981  1.00 21.25 ? 100 LYS A N   1 
ATOM   721  C  CA  . LYS A 1 100 ? 11.270 11.870  6.191  1.00 23.73 ? 100 LYS A CA  1 
ATOM   722  C  C   . LYS A 1 100 ? 10.062 11.816  7.120  1.00 22.78 ? 100 LYS A C   1 
ATOM   723  O  O   . LYS A 1 100 ? 8.931  11.640  6.669  1.00 21.78 ? 100 LYS A O   1 
ATOM   724  C  CB  . LYS A 1 100 ? 11.636 13.320  5.844  1.00 26.63 ? 100 LYS A CB  1 
ATOM   725  C  CG  . LYS A 1 100 ? 10.658 14.026  4.933  1.00 33.77 ? 100 LYS A CG  1 
ATOM   726  C  CD  . LYS A 1 100 ? 11.267 15.295  4.331  1.00 38.13 ? 100 LYS A CD  1 
ATOM   727  C  CE  . LYS A 1 100 ? 11.576 16.350  5.394  1.00 41.02 ? 100 LYS A CE  1 
ATOM   728  N  NZ  . LYS A 1 100 ? 12.108 17.612  4.789  1.00 42.76 ? 100 LYS A NZ  1 
ATOM   729  N  N   . CYS A 1 101 ? 10.311 11.946  8.417  1.00 21.63 ? 101 CYS A N   1 
ATOM   730  C  CA  . CYS A 1 101 ? 9.246  11.902  9.412  1.00 20.82 ? 101 CYS A CA  1 
ATOM   731  C  C   . CYS A 1 101 ? 9.168  13.227  10.157 1.00 22.35 ? 101 CYS A C   1 
ATOM   732  O  O   . CYS A 1 101 ? 10.184 13.897  10.346 1.00 23.43 ? 101 CYS A O   1 
ATOM   733  C  CB  . CYS A 1 101 ? 9.500  10.761  10.397 1.00 18.62 ? 101 CYS A CB  1 
ATOM   734  S  SG  . CYS A 1 101 ? 9.517  9.131   9.639  1.00 20.64 ? 101 CYS A SG  1 
ATOM   735  N  N   . ASN A 1 102 ? 7.962  13.604  10.578 1.00 19.90 ? 102 ASN A N   1 
ATOM   736  C  CA  . ASN A 1 102 ? 7.766  14.864  11.284 1.00 19.07 ? 102 ASN A CA  1 
ATOM   737  C  C   . ASN A 1 102 ? 6.839  14.647  12.474 1.00 18.26 ? 102 ASN A C   1 
ATOM   738  O  O   . ASN A 1 102 ? 6.458  13.512  12.778 1.00 17.44 ? 102 ASN A O   1 
ATOM   739  C  CB  . ASN A 1 102 ? 7.152  15.903  10.336 1.00 19.55 ? 102 ASN A CB  1 
ATOM   740  C  CG  . ASN A 1 102 ? 7.618  17.316  10.626 1.00 20.82 ? 102 ASN A CG  1 
ATOM   741  O  OD1 . ASN A 1 102 ? 7.729  17.730  11.781 1.00 20.44 ? 102 ASN A OD1 1 
ATOM   742  N  ND2 . ASN A 1 102 ? 7.885  18.071  9.569  1.00 24.38 ? 102 ASN A ND2 1 
ATOM   743  N  N   . SER A 1 103 ? 6.479  15.740  13.141 1.00 17.74 ? 103 SER A N   1 
ATOM   744  C  CA  . SER A 1 103 ? 5.599  15.680  14.304 1.00 20.15 ? 103 SER A CA  1 
ATOM   745  C  C   . SER A 1 103 ? 4.339  14.889  13.962 1.00 20.90 ? 103 SER A C   1 
ATOM   746  O  O   . SER A 1 103 ? 3.661  15.199  12.981 1.00 19.57 ? 103 SER A O   1 
ATOM   747  C  CB  . SER A 1 103 ? 5.215  17.097  14.734 1.00 20.88 ? 103 SER A CB  1 
ATOM   748  O  OG  . SER A 1 103 ? 6.371  17.877  14.972 1.00 20.58 ? 103 SER A OG  1 
ATOM   749  N  N   . GLY A 1 104 ? 4.040  13.864  14.761 1.00 19.53 ? 104 GLY A N   1 
ATOM   750  C  CA  . GLY A 1 104 ? 2.858  13.056  14.511 1.00 19.16 ? 104 GLY A CA  1 
ATOM   751  C  C   . GLY A 1 104 ? 3.160  11.676  13.965 1.00 18.38 ? 104 GLY A C   1 
ATOM   752  O  O   . GLY A 1 104 ? 2.363  10.747  14.117 1.00 17.25 ? 104 GLY A O   1 
ATOM   753  N  N   . ASP A 1 105 ? 4.309  11.539  13.313 1.00 17.86 ? 105 ASP A N   1 
ATOM   754  C  CA  . ASP A 1 105 ? 4.716  10.254  12.761 1.00 18.39 ? 105 ASP A CA  1 
ATOM   755  C  C   . ASP A 1 105 ? 5.368  9.409   13.845 1.00 19.25 ? 105 ASP A C   1 
ATOM   756  O  O   . ASP A 1 105 ? 5.826  9.935   14.861 1.00 17.03 ? 105 ASP A O   1 
ATOM   757  C  CB  . ASP A 1 105 ? 5.740  10.435  11.636 1.00 18.70 ? 105 ASP A CB  1 
ATOM   758  C  CG  . ASP A 1 105 ? 5.148  11.054  10.390 1.00 20.68 ? 105 ASP A CG  1 
ATOM   759  O  OD1 . ASP A 1 105 ? 4.017  10.675  10.015 1.00 20.89 ? 105 ASP A OD1 1 
ATOM   760  O  OD2 . ASP A 1 105 ? 5.826  11.906  9.774  1.00 21.84 ? 105 ASP A OD2 1 
ATOM   761  N  N   . ARG A 1 106 ? 5.410  8.099   13.628 1.00 19.51 ? 106 ARG A N   1 
ATOM   762  C  CA  . ARG A 1 106 ? 6.074  7.218   14.576 1.00 18.20 ? 106 ARG A CA  1 
ATOM   763  C  C   . ARG A 1 106 ? 7.023  6.318   13.802 1.00 18.16 ? 106 ARG A C   1 
ATOM   764  O  O   . ARG A 1 106 ? 6.752  5.952   12.658 1.00 18.38 ? 106 ARG A O   1 
ATOM   765  C  CB  . ARG A 1 106 ? 5.069  6.397   15.393 1.00 22.63 ? 106 ARG A CB  1 
ATOM   766  C  CG  . ARG A 1 106 ? 4.357  5.262   14.683 1.00 28.01 ? 106 ARG A CG  1 
ATOM   767  C  CD  . ARG A 1 106 ? 3.543  4.482   15.724 1.00 33.11 ? 106 ARG A CD  1 
ATOM   768  N  NE  . ARG A 1 106 ? 2.893  3.289   15.190 1.00 34.20 ? 106 ARG A NE  1 
ATOM   769  C  CZ  . ARG A 1 106 ? 1.864  3.308   14.350 1.00 36.27 ? 106 ARG A CZ  1 
ATOM   770  N  NH1 . ARG A 1 106 ? 1.360  4.464   13.938 1.00 34.62 ? 106 ARG A NH1 1 
ATOM   771  N  NH2 . ARG A 1 106 ? 1.330  2.168   13.933 1.00 37.52 ? 106 ARG A NH2 1 
ATOM   772  N  N   . ILE A 1 107 ? 8.153  6.000   14.424 1.00 16.90 ? 107 ILE A N   1 
ATOM   773  C  CA  . ILE A 1 107 ? 9.182  5.166   13.820 1.00 16.98 ? 107 ILE A CA  1 
ATOM   774  C  C   . ILE A 1 107 ? 9.361  3.930   14.682 1.00 19.09 ? 107 ILE A C   1 
ATOM   775  O  O   . ILE A 1 107 ? 9.449  4.028   15.904 1.00 19.48 ? 107 ILE A O   1 
ATOM   776  C  CB  . ILE A 1 107 ? 10.535 5.933   13.741 1.00 18.53 ? 107 ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 107 ? 10.379 7.173   12.856 1.00 18.38 ? 107 ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 107 ? 11.632 5.029   13.193 1.00 19.31 ? 107 ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 107 ? 11.637 8.039   12.775 1.00 20.06 ? 107 ILE A CD1 1 
ATOM   780  N  N   . GLY A 1 108 ? 9.390  2.767   14.040 1.00 18.79 ? 108 GLY A N   1 
ATOM   781  C  CA  . GLY A 1 108 ? 9.571  1.524   14.765 1.00 17.23 ? 108 GLY A CA  1 
ATOM   782  C  C   . GLY A 1 108 ? 10.831 0.816   14.313 1.00 17.56 ? 108 GLY A C   1 
ATOM   783  O  O   . GLY A 1 108 ? 11.333 1.055   13.213 1.00 16.05 ? 108 GLY A O   1 
ATOM   784  N  N   . CYS A 1 109 ? 11.346 -0.058  15.169 1.00 17.79 ? 109 CYS A N   1 
ATOM   785  C  CA  . CYS A 1 109 ? 12.550 -0.822  14.872 1.00 18.43 ? 109 CYS A CA  1 
ATOM   786  C  C   . CYS A 1 109 ? 12.485 -2.159  15.597 1.00 19.29 ? 109 CYS A C   1 
ATOM   787  O  O   . CYS A 1 109 ? 12.185 -2.216  16.786 1.00 17.82 ? 109 CYS A O   1 
ATOM   788  C  CB  . CYS A 1 109 ? 13.798 -0.057  15.326 1.00 16.73 ? 109 CYS A CB  1 
ATOM   789  S  SG  . CYS A 1 109 ? 15.350 -0.957  15.071 1.00 22.17 ? 109 CYS A SG  1 
ATOM   790  N  N   . GLY A 1 110 ? 12.773 -3.240  14.885 1.00 20.70 ? 110 GLY A N   1 
ATOM   791  C  CA  . GLY A 1 110 ? 12.728 -4.539  15.525 1.00 22.44 ? 110 GLY A CA  1 
ATOM   792  C  C   . GLY A 1 110 ? 13.682 -5.531  14.904 1.00 24.10 ? 110 GLY A C   1 
ATOM   793  O  O   . GLY A 1 110 ? 14.338 -5.242  13.901 1.00 23.82 ? 110 GLY A O   1 
ATOM   794  N  N   . ILE A 1 111 ? 13.766 -6.705  15.514 1.00 23.46 ? 111 ILE A N   1 
ATOM   795  C  CA  . ILE A 1 111 ? 14.632 -7.759  15.019 1.00 25.97 ? 111 ILE A CA  1 
ATOM   796  C  C   . ILE A 1 111 ? 13.742 -8.947  14.665 1.00 27.73 ? 111 ILE A C   1 
ATOM   797  O  O   . ILE A 1 111 ? 12.773 -9.234  15.370 1.00 26.91 ? 111 ILE A O   1 
ATOM   798  C  CB  . ILE A 1 111 ? 15.658 -8.186  16.088 1.00 25.36 ? 111 ILE A CB  1 
ATOM   799  C  CG1 . ILE A 1 111 ? 16.609 -7.022  16.389 1.00 24.28 ? 111 ILE A CG1 1 
ATOM   800  C  CG2 . ILE A 1 111 ? 16.442 -9.406  15.607 1.00 24.04 ? 111 ILE A CG2 1 
ATOM   801  C  CD1 . ILE A 1 111 ? 17.574 -7.301  17.516 1.00 23.37 ? 111 ILE A CD1 1 
ATOM   802  N  N   . GLU A 1 112 ? 14.052 -9.622  13.565 1.00 28.46 ? 112 GLU A N   1 
ATOM   803  C  CA  . GLU A 1 112 ? 13.253 -10.770 13.170 1.00 31.70 ? 112 GLU A CA  1 
ATOM   804  C  C   . GLU A 1 112 ? 13.484 -11.872 14.199 1.00 32.65 ? 112 GLU A C   1 
ATOM   805  O  O   . GLU A 1 112 ? 14.624 -12.259 14.470 1.00 30.09 ? 112 GLU A O   1 
ATOM   806  C  CB  . GLU A 1 112 ? 13.649 -11.238 11.768 1.00 32.43 ? 112 GLU A CB  1 
ATOM   807  C  CG  . GLU A 1 112 ? 13.419 -10.181 10.689 1.00 34.45 ? 112 GLU A CG  1 
ATOM   808  C  CD  . GLU A 1 112 ? 11.949 -9.955  10.373 1.00 37.07 ? 112 GLU A CD  1 
ATOM   809  O  OE1 . GLU A 1 112 ? 11.098 -10.136 11.271 1.00 39.01 ? 112 GLU A OE1 1 
ATOM   810  O  OE2 . GLU A 1 112 ? 11.645 -9.579  9.222  1.00 37.43 ? 112 GLU A OE2 1 
ATOM   811  N  N   . PRO A 1 113 ? 12.398 -12.374 14.801 1.00 34.79 ? 113 PRO A N   1 
ATOM   812  C  CA  . PRO A 1 113 ? 12.474 -13.433 15.813 1.00 38.21 ? 113 PRO A CA  1 
ATOM   813  C  C   . PRO A 1 113 ? 13.451 -14.547 15.444 1.00 39.88 ? 113 PRO A C   1 
ATOM   814  O  O   . PRO A 1 113 ? 14.241 -14.998 16.276 1.00 40.15 ? 113 PRO A O   1 
ATOM   815  C  CB  . PRO A 1 113 ? 11.032 -13.925 15.894 1.00 37.80 ? 113 PRO A CB  1 
ATOM   816  C  CG  . PRO A 1 113 ? 10.251 -12.659 15.653 1.00 37.50 ? 113 PRO A CG  1 
ATOM   817  C  CD  . PRO A 1 113 ? 10.994 -12.054 14.480 1.00 35.76 ? 113 PRO A CD  1 
ATOM   818  N  N   . VAL A 1 114 ? 13.399 -14.966 14.184 1.00 42.42 ? 114 VAL A N   1 
ATOM   819  C  CA  . VAL A 1 114 ? 14.248 -16.039 13.671 1.00 45.04 ? 114 VAL A CA  1 
ATOM   820  C  C   . VAL A 1 114 ? 15.743 -15.789 13.825 1.00 45.84 ? 114 VAL A C   1 
ATOM   821  O  O   . VAL A 1 114 ? 16.510 -16.727 14.035 1.00 45.35 ? 114 VAL A O   1 
ATOM   822  C  CB  . VAL A 1 114 ? 13.961 -16.305 12.177 1.00 46.44 ? 114 VAL A CB  1 
ATOM   823  C  CG1 . VAL A 1 114 ? 14.849 -17.430 11.668 1.00 47.44 ? 114 VAL A CG1 1 
ATOM   824  C  CG2 . VAL A 1 114 ? 12.492 -16.658 11.985 1.00 47.48 ? 114 VAL A CG2 1 
ATOM   825  N  N   . SER A 1 115 ? 16.165 -14.533 13.719 1.00 46.59 ? 115 SER A N   1 
ATOM   826  C  CA  . SER A 1 115 ? 17.585 -14.221 13.837 1.00 47.11 ? 115 SER A CA  1 
ATOM   827  C  C   . SER A 1 115 ? 18.087 -14.365 15.266 1.00 48.17 ? 115 SER A C   1 
ATOM   828  O  O   . SER A 1 115 ? 19.294 -14.414 15.499 1.00 47.91 ? 115 SER A O   1 
ATOM   829  C  CB  . SER A 1 115 ? 17.871 -12.804 13.332 1.00 46.91 ? 115 SER A CB  1 
ATOM   830  O  OG  . SER A 1 115 ? 17.195 -11.846 14.117 1.00 46.67 ? 115 SER A OG  1 
ATOM   831  N  N   . PHE A 1 116 ? 17.172 -14.440 16.228 1.00 49.91 ? 116 PHE A N   1 
ATOM   832  C  CA  . PHE A 1 116 ? 17.589 -14.582 17.616 1.00 52.52 ? 116 PHE A CA  1 
ATOM   833  C  C   . PHE A 1 116 ? 18.311 -15.901 17.855 1.00 54.75 ? 116 PHE A C   1 
ATOM   834  O  O   . PHE A 1 116 ? 18.470 -16.342 18.993 1.00 55.17 ? 116 PHE A O   1 
ATOM   835  C  CB  . PHE A 1 116 ? 16.396 -14.432 18.562 1.00 51.15 ? 116 PHE A CB  1 
ATOM   836  C  CG  . PHE A 1 116 ? 15.989 -13.002 18.783 1.00 50.47 ? 116 PHE A CG  1 
ATOM   837  C  CD1 . PHE A 1 116 ? 14.864 -12.473 18.158 1.00 50.05 ? 116 PHE A CD1 1 
ATOM   838  C  CD2 . PHE A 1 116 ? 16.769 -12.165 19.581 1.00 50.01 ? 116 PHE A CD2 1 
ATOM   839  C  CE1 . PHE A 1 116 ? 14.523 -11.128 18.322 1.00 49.51 ? 116 PHE A CE1 1 
ATOM   840  C  CE2 . PHE A 1 116 ? 16.437 -10.825 19.750 1.00 48.40 ? 116 PHE A CE2 1 
ATOM   841  C  CZ  . PHE A 1 116 ? 15.313 -10.305 19.119 1.00 49.49 ? 116 PHE A CZ  1 
ATOM   842  N  N   . ASP A 1 117 ? 18.745 -16.518 16.760 1.00 57.17 ? 117 ASP A N   1 
ATOM   843  C  CA  . ASP A 1 117 ? 19.495 -17.763 16.799 1.00 59.41 ? 117 ASP A CA  1 
ATOM   844  C  C   . ASP A 1 117 ? 20.954 -17.394 16.526 1.00 60.08 ? 117 ASP A C   1 
ATOM   845  O  O   . ASP A 1 117 ? 21.680 -18.114 15.841 1.00 61.35 ? 117 ASP A O   1 
ATOM   846  C  CB  . ASP A 1 117 ? 18.981 -18.731 15.730 1.00 59.45 ? 117 ASP A CB  1 
ATOM   847  C  CG  . ASP A 1 117 ? 17.521 -19.102 15.932 1.00 60.10 ? 117 ASP A CG  1 
ATOM   848  O  OD1 . ASP A 1 117 ? 17.138 -19.433 17.075 1.00 59.54 ? 117 ASP A OD1 1 
ATOM   849  O  OD2 . ASP A 1 117 ? 16.757 -19.071 14.946 1.00 60.35 ? 117 ASP A OD2 1 
ATOM   850  N  N   . VAL A 1 118 ? 21.352 -16.246 17.070 1.00 60.07 ? 118 VAL A N   1 
ATOM   851  C  CA  . VAL A 1 118 ? 22.699 -15.695 16.945 1.00 60.13 ? 118 VAL A CA  1 
ATOM   852  C  C   . VAL A 1 118 ? 23.387 -15.803 15.588 1.00 59.33 ? 118 VAL A C   1 
ATOM   853  O  O   . VAL A 1 118 ? 22.880 -16.429 14.658 1.00 58.71 ? 118 VAL A O   1 
ATOM   854  C  CB  . VAL A 1 118 ? 23.656 -16.294 18.018 1.00 60.94 ? 118 VAL A CB  1 
ATOM   855  C  CG1 . VAL A 1 118 ? 23.163 -15.947 19.401 1.00 60.56 ? 118 VAL A CG1 1 
ATOM   856  C  CG2 . VAL A 1 118 ? 23.763 -17.805 17.861 1.00 61.20 ? 118 VAL A CG2 1 
ATOM   857  N  N   . GLN A 1 119 ? 24.553 -15.165 15.500 1.00 58.65 ? 119 GLN A N   1 
ATOM   858  C  CA  . GLN A 1 119 ? 25.379 -15.152 14.298 1.00 57.33 ? 119 GLN A CA  1 
ATOM   859  C  C   . GLN A 1 119 ? 24.887 -14.197 13.215 1.00 54.99 ? 119 GLN A C   1 
ATOM   860  O  O   . GLN A 1 119 ? 25.479 -14.123 12.141 1.00 55.68 ? 119 GLN A O   1 
ATOM   861  C  CB  . GLN A 1 119 ? 25.504 -16.571 13.731 1.00 58.99 ? 119 GLN A CB  1 
ATOM   862  C  CG  . GLN A 1 119 ? 25.884 -17.604 14.787 1.00 62.01 ? 119 GLN A CG  1 
ATOM   863  C  CD  . GLN A 1 119 ? 27.001 -17.119 15.701 1.00 64.05 ? 119 GLN A CD  1 
ATOM   864  O  OE1 . GLN A 1 119 ? 28.128 -16.894 15.258 1.00 65.54 ? 119 GLN A OE1 1 
ATOM   865  N  NE2 . GLN A 1 119 ? 26.688 -16.950 16.983 1.00 64.31 ? 119 GLN A NE2 1 
ATOM   866  N  N   . THR A 1 120 ? 23.812 -13.467 13.504 1.00 51.69 ? 120 THR A N   1 
ATOM   867  C  CA  . THR A 1 120 ? 23.238 -12.502 12.559 1.00 47.68 ? 120 THR A CA  1 
ATOM   868  C  C   . THR A 1 120 ? 21.938 -11.894 13.061 1.00 43.67 ? 120 THR A C   1 
ATOM   869  O  O   . THR A 1 120 ? 21.105 -12.577 13.655 1.00 43.61 ? 120 THR A O   1 
ATOM   870  C  CB  . THR A 1 120 ? 22.942 -13.136 11.190 1.00 48.58 ? 120 THR A CB  1 
ATOM   871  O  OG1 . THR A 1 120 ? 22.794 -14.552 11.346 1.00 50.93 ? 120 THR A OG1 1 
ATOM   872  C  CG2 . THR A 1 120 ? 24.052 -12.820 10.202 1.00 48.40 ? 120 THR A CG2 1 
ATOM   873  N  N   . ALA A 1 121 ? 21.762 -10.606 12.795 1.00 39.08 ? 121 ALA A N   1 
ATOM   874  C  CA  . ALA A 1 121 ? 20.568 -9.899  13.224 1.00 34.02 ? 121 ALA A CA  1 
ATOM   875  C  C   . ALA A 1 121 ? 19.846 -9.249  12.048 1.00 31.34 ? 121 ALA A C   1 
ATOM   876  O  O   . ALA A 1 121 ? 20.374 -8.335  11.416 1.00 30.26 ? 121 ALA A O   1 
ATOM   877  C  CB  . ALA A 1 121 ? 20.945 -8.845  14.255 1.00 34.99 ? 121 ALA A CB  1 
ATOM   878  N  N   . GLN A 1 122 ? 18.647 -9.735  11.747 1.00 27.39 ? 122 GLN A N   1 
ATOM   879  C  CA  . GLN A 1 122 ? 17.856 -9.170  10.662 1.00 26.77 ? 122 GLN A CA  1 
ATOM   880  C  C   . GLN A 1 122 ? 16.993 -8.062  11.264 1.00 24.34 ? 122 GLN A C   1 
ATOM   881  O  O   . GLN A 1 122 ? 15.980 -8.318  11.918 1.00 24.00 ? 122 GLN A O   1 
ATOM   882  C  CB  . GLN A 1 122 ? 16.981 -10.246 10.009 1.00 26.19 ? 122 GLN A CB  1 
ATOM   883  C  CG  . GLN A 1 122 ? 16.099 -9.716  8.888  1.00 27.44 ? 122 GLN A CG  1 
ATOM   884  C  CD  . GLN A 1 122 ? 15.634 -10.802 7.935  1.00 27.17 ? 122 GLN A CD  1 
ATOM   885  O  OE1 . GLN A 1 122 ? 14.681 -10.611 7.188  1.00 28.84 ? 122 GLN A OE1 1 
ATOM   886  N  NE2 . GLN A 1 122 ? 16.318 -11.940 7.948  1.00 28.80 ? 122 GLN A NE2 1 
ATOM   887  N  N   . ILE A 1 123 ? 17.414 -6.827  11.037 1.00 23.95 ? 123 ILE A N   1 
ATOM   888  C  CA  . ILE A 1 123 ? 16.727 -5.669  11.584 1.00 23.33 ? 123 ILE A CA  1 
ATOM   889  C  C   . ILE A 1 123 ? 15.791 -4.985  10.599 1.00 22.35 ? 123 ILE A C   1 
ATOM   890  O  O   . ILE A 1 123 ? 16.166 -4.711  9.458  1.00 21.58 ? 123 ILE A O   1 
ATOM   891  C  CB  . ILE A 1 123 ? 17.760 -4.653  12.098 1.00 25.00 ? 123 ILE A CB  1 
ATOM   892  C  CG1 . ILE A 1 123 ? 18.681 -5.345  13.109 1.00 24.19 ? 123 ILE A CG1 1 
ATOM   893  C  CG2 . ILE A 1 123 ? 17.050 -3.463  12.738 1.00 22.72 ? 123 ILE A CG2 1 
ATOM   894  C  CD1 . ILE A 1 123 ? 19.883 -4.536  13.483 1.00 28.73 ? 123 ILE A CD1 1 
ATOM   895  N  N   . PHE A 1 124 ? 14.573 -4.708  11.048 1.00 21.18 ? 124 PHE A N   1 
ATOM   896  C  CA  . PHE A 1 124 ? 13.599 -4.049  10.201 1.00 21.02 ? 124 PHE A CA  1 
ATOM   897  C  C   . PHE A 1 124 ? 13.111 -2.751  10.831 1.00 21.01 ? 124 PHE A C   1 
ATOM   898  O  O   . PHE A 1 124 ? 13.107 -2.598  12.054 1.00 19.82 ? 124 PHE A O   1 
ATOM   899  C  CB  . PHE A 1 124 ? 12.421 -4.993  9.905  1.00 23.33 ? 124 PHE A CB  1 
ATOM   900  C  CG  . PHE A 1 124 ? 11.587 -5.330  11.106 1.00 24.12 ? 124 PHE A CG  1 
ATOM   901  C  CD1 . PHE A 1 124 ? 10.551 -4.492  11.507 1.00 24.20 ? 124 PHE A CD1 1 
ATOM   902  C  CD2 . PHE A 1 124 ? 11.839 -6.485  11.842 1.00 25.92 ? 124 PHE A CD2 1 
ATOM   903  C  CE1 . PHE A 1 124 ? 9.778  -4.800  12.623 1.00 24.18 ? 124 PHE A CE1 1 
ATOM   904  C  CE2 . PHE A 1 124 ? 11.067 -6.798  12.962 1.00 24.44 ? 124 PHE A CE2 1 
ATOM   905  C  CZ  . PHE A 1 124 ? 10.037 -5.954  13.350 1.00 25.16 ? 124 PHE A CZ  1 
ATOM   906  N  N   . PHE A 1 125 ? 12.710 -1.811  9.983  1.00 19.14 ? 125 PHE A N   1 
ATOM   907  C  CA  . PHE A 1 125 ? 12.232 -0.510  10.437 1.00 18.70 ? 125 PHE A CA  1 
ATOM   908  C  C   . PHE A 1 125 ? 10.829 -0.254  9.903  1.00 19.11 ? 125 PHE A C   1 
ATOM   909  O  O   . PHE A 1 125 ? 10.456 -0.761  8.839  1.00 18.20 ? 125 PHE A O   1 
ATOM   910  C  CB  . PHE A 1 125 ? 13.187 0.588   9.956  1.00 17.12 ? 125 PHE A CB  1 
ATOM   911  C  CG  . PHE A 1 125 ? 14.509 0.597   10.672 1.00 17.53 ? 125 PHE A CG  1 
ATOM   912  C  CD1 . PHE A 1 125 ? 14.659 1.294   11.872 1.00 15.90 ? 125 PHE A CD1 1 
ATOM   913  C  CD2 . PHE A 1 125 ? 15.594 -0.119  10.171 1.00 17.94 ? 125 PHE A CD2 1 
ATOM   914  C  CE1 . PHE A 1 125 ? 15.874 1.278   12.563 1.00 16.80 ? 125 PHE A CE1 1 
ATOM   915  C  CE2 . PHE A 1 125 ? 16.810 -0.140  10.853 1.00 17.48 ? 125 PHE A CE2 1 
ATOM   916  C  CZ  . PHE A 1 125 ? 16.949 0.561   12.053 1.00 17.86 ? 125 PHE A CZ  1 
ATOM   917  N  N   . THR A 1 126 ? 10.059 0.540   10.642 1.00 18.60 ? 126 THR A N   1 
ATOM   918  C  CA  . THR A 1 126 ? 8.697  0.864   10.251 1.00 18.81 ? 126 THR A CA  1 
ATOM   919  C  C   . THR A 1 126 ? 8.415  2.352   10.406 1.00 20.46 ? 126 THR A C   1 
ATOM   920  O  O   . THR A 1 126 ? 9.044  3.035   11.210 1.00 22.81 ? 126 THR A O   1 
ATOM   921  C  CB  . THR A 1 126 ? 7.668  0.086   11.116 1.00 19.94 ? 126 THR A CB  1 
ATOM   922  O  OG1 . THR A 1 126 ? 7.802  0.471   12.487 1.00 20.03 ? 126 THR A OG1 1 
ATOM   923  C  CG2 . THR A 1 126 ? 7.905  -1.416  11.020 1.00 17.83 ? 126 THR A CG2 1 
ATOM   924  N  N   . LYS A 1 127 ? 7.482  2.855   9.610  1.00 17.99 ? 127 LYS A N   1 
ATOM   925  C  CA  . LYS A 1 127 ? 7.064  4.241   9.700  1.00 18.67 ? 127 LYS A CA  1 
ATOM   926  C  C   . LYS A 1 127 ? 5.552  4.161   9.820  1.00 20.22 ? 127 LYS A C   1 
ATOM   927  O  O   . LYS A 1 127 ? 4.877  3.646   8.926  1.00 19.29 ? 127 LYS A O   1 
ATOM   928  C  CB  . LYS A 1 127 ? 7.437  5.041   8.451  1.00 18.24 ? 127 LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 127 ? 6.935  6.470   8.544  1.00 21.68 ? 127 LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 127 ? 7.206  7.272   7.288  1.00 23.13 ? 127 LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 127 ? 6.569  8.647   7.404  1.00 24.55 ? 127 LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 127 ? 6.880  9.477   6.204  1.00 26.14 ? 127 LYS A NZ  1 
ATOM   933  N  N   . ASN A 1 128 ? 5.024  4.649   10.935 1.00 19.51 ? 128 ASN A N   1 
ATOM   934  C  CA  . ASN A 1 128 ? 3.591  4.596   11.177 1.00 20.81 ? 128 ASN A CA  1 
ATOM   935  C  C   . ASN A 1 128 ? 3.035  3.180   11.030 1.00 21.95 ? 128 ASN A C   1 
ATOM   936  O  O   . ASN A 1 128 ? 1.976  2.976   10.434 1.00 20.56 ? 128 ASN A O   1 
ATOM   937  C  CB  . ASN A 1 128 ? 2.858  5.557   10.240 1.00 21.14 ? 128 ASN A CB  1 
ATOM   938  C  CG  . ASN A 1 128 ? 3.200  7.005   10.525 1.00 22.60 ? 128 ASN A CG  1 
ATOM   939  O  OD1 . ASN A 1 128 ? 3.413  7.378   11.678 1.00 22.56 ? 128 ASN A OD1 1 
ATOM   940  N  ND2 . ASN A 1 128 ? 3.241  7.830   9.485  1.00 20.52 ? 128 ASN A ND2 1 
ATOM   941  N  N   . GLY A 1 129 ? 3.761  2.206   11.571 1.00 21.58 ? 129 GLY A N   1 
ATOM   942  C  CA  . GLY A 1 129 ? 3.316  0.821   11.522 1.00 23.50 ? 129 GLY A CA  1 
ATOM   943  C  C   . GLY A 1 129 ? 3.567  0.033   10.248 1.00 24.76 ? 129 GLY A C   1 
ATOM   944  O  O   . GLY A 1 129 ? 3.372  -1.184  10.230 1.00 25.04 ? 129 GLY A O   1 
ATOM   945  N  N   . LYS A 1 130 ? 3.992  0.713   9.186  1.00 24.24 ? 130 LYS A N   1 
ATOM   946  C  CA  . LYS A 1 130 ? 4.262  0.065   7.907  1.00 24.62 ? 130 LYS A CA  1 
ATOM   947  C  C   . LYS A 1 130 ? 5.759  -0.110  7.710  1.00 24.40 ? 130 LYS A C   1 
ATOM   948  O  O   . LYS A 1 130 ? 6.527  0.831   7.875  1.00 20.15 ? 130 LYS A O   1 
ATOM   949  C  CB  . LYS A 1 130 ? 3.693  0.901   6.760  1.00 28.41 ? 130 LYS A CB  1 
ATOM   950  C  CG  . LYS A 1 130 ? 3.860  0.266   5.384  1.00 33.71 ? 130 LYS A CG  1 
ATOM   951  C  CD  . LYS A 1 130 ? 3.233  1.131   4.293  1.00 38.65 ? 130 LYS A CD  1 
ATOM   952  C  CE  . LYS A 1 130 ? 3.334  0.462   2.925  1.00 40.54 ? 130 LYS A CE  1 
ATOM   953  N  NZ  . LYS A 1 130 ? 2.694  1.282   1.858  1.00 43.20 ? 130 LYS A NZ  1 
ATOM   954  N  N   . ARG A 1 131 ? 6.175  -1.318  7.349  1.00 25.18 ? 131 ARG A N   1 
ATOM   955  C  CA  . ARG A 1 131 ? 7.591  -1.582  7.157  1.00 26.05 ? 131 ARG A CA  1 
ATOM   956  C  C   . ARG A 1 131 ? 8.191  -0.758  6.027  1.00 26.61 ? 131 ARG A C   1 
ATOM   957  O  O   . ARG A 1 131 ? 7.587  -0.601  4.962  1.00 24.91 ? 131 ARG A O   1 
ATOM   958  C  CB  . ARG A 1 131 ? 7.832  -3.067  6.903  1.00 28.82 ? 131 ARG A CB  1 
ATOM   959  C  CG  . ARG A 1 131 ? 9.303  -3.428  6.941  1.00 35.00 ? 131 ARG A CG  1 
ATOM   960  C  CD  . ARG A 1 131 ? 9.521  -4.925  6.973  1.00 37.68 ? 131 ARG A CD  1 
ATOM   961  N  NE  . ARG A 1 131 ? 8.798  -5.565  8.064  1.00 38.95 ? 131 ARG A NE  1 
ATOM   962  C  CZ  . ARG A 1 131 ? 9.142  -6.737  8.585  1.00 40.76 ? 131 ARG A CZ  1 
ATOM   963  N  NH1 . ARG A 1 131 ? 10.201 -7.382  8.114  1.00 42.82 ? 131 ARG A NH1 1 
ATOM   964  N  NH2 . ARG A 1 131 ? 8.425  -7.270  9.564  1.00 39.96 ? 131 ARG A NH2 1 
ATOM   965  N  N   . VAL A 1 132 ? 9.383  -0.223  6.278  1.00 25.97 ? 132 VAL A N   1 
ATOM   966  C  CA  . VAL A 1 132 ? 10.097 0.593   5.303  1.00 27.34 ? 132 VAL A CA  1 
ATOM   967  C  C   . VAL A 1 132 ? 11.149 -0.262  4.614  1.00 28.23 ? 132 VAL A C   1 
ATOM   968  O  O   . VAL A 1 132 ? 11.215 -0.321  3.390  1.00 29.35 ? 132 VAL A O   1 
ATOM   969  C  CB  . VAL A 1 132 ? 10.808 1.785   5.985  1.00 27.67 ? 132 VAL A CB  1 
ATOM   970  C  CG1 . VAL A 1 132 ? 11.482 2.667   4.937  1.00 29.20 ? 132 VAL A CG1 1 
ATOM   971  C  CG2 . VAL A 1 132 ? 9.808  2.589   6.794  1.00 28.48 ? 132 VAL A CG2 1 
ATOM   972  N  N   . GLY A 1 133 ? 11.968 -0.936  5.411  1.00 27.01 ? 133 GLY A N   1 
ATOM   973  C  CA  . GLY A 1 133 ? 13.008 -1.776  4.851  1.00 25.69 ? 133 GLY A CA  1 
ATOM   974  C  C   . GLY A 1 133 ? 13.779 -2.485  5.943  1.00 23.80 ? 133 GLY A C   1 
ATOM   975  O  O   . GLY A 1 133 ? 13.521 -2.270  7.128  1.00 23.09 ? 133 GLY A O   1 
ATOM   976  N  N   . SER A 1 134 ? 14.739 -3.313  5.550  1.00 21.99 ? 134 SER A N   1 
ATOM   977  C  CA  . SER A 1 134 ? 15.525 -4.065  6.516  1.00 21.90 ? 134 SER A CA  1 
ATOM   978  C  C   . SER A 1 134 ? 16.987 -4.128  6.154  1.00 21.43 ? 134 SER A C   1 
ATOM   979  O  O   . SER A 1 134 ? 17.408 -3.688  5.084  1.00 19.91 ? 134 SER A O   1 
ATOM   980  C  CB  . SER A 1 134 ? 14.992 -5.496  6.629  1.00 22.37 ? 134 SER A CB  1 
ATOM   981  O  OG  . SER A 1 134 ? 13.592 -5.503  6.844  1.00 24.92 ? 134 SER A OG  1 
ATOM   982  N  N   . THR A 1 135 ? 17.762 -4.696  7.066  1.00 23.81 ? 135 THR A N   1 
ATOM   983  C  CA  . THR A 1 135 ? 19.186 -4.865  6.870  1.00 25.79 ? 135 THR A CA  1 
ATOM   984  C  C   . THR A 1 135 ? 19.626 -5.981  7.812  1.00 29.76 ? 135 THR A C   1 
ATOM   985  O  O   . THR A 1 135 ? 19.053 -6.153  8.890  1.00 30.67 ? 135 THR A O   1 
ATOM   986  C  CB  . THR A 1 135 ? 19.950 -3.561  7.194  1.00 27.10 ? 135 THR A CB  1 
ATOM   987  O  OG1 . THR A 1 135 ? 21.341 -3.731  6.893  1.00 27.26 ? 135 THR A OG1 1 
ATOM   988  C  CG2 . THR A 1 135 ? 19.787 -3.193  8.669  1.00 26.72 ? 135 THR A CG2 1 
ATOM   989  N  N   . ILE A 1 136 ? 20.609 -6.764  7.384  1.00 32.00 ? 136 ILE A N   1 
ATOM   990  C  CA  . ILE A 1 136 ? 21.137 -7.848  8.204  1.00 35.48 ? 136 ILE A CA  1 
ATOM   991  C  C   . ILE A 1 136 ? 22.508 -7.404  8.679  1.00 37.75 ? 136 ILE A C   1 
ATOM   992  O  O   . ILE A 1 136 ? 23.367 -7.056  7.870  1.00 36.31 ? 136 ILE A O   1 
ATOM   993  C  CB  . ILE A 1 136 ? 21.281 -9.162  7.400  1.00 36.38 ? 136 ILE A CB  1 
ATOM   994  C  CG1 . ILE A 1 136 ? 19.947 -9.905  7.360  1.00 36.34 ? 136 ILE A CG1 1 
ATOM   995  C  CG2 . ILE A 1 136 ? 22.333 -10.063 8.046  1.00 35.85 ? 136 ILE A CG2 1 
ATOM   996  C  CD1 . ILE A 1 136 ? 18.806 -9.099  6.816  1.00 40.40 ? 136 ILE A CD1 1 
HETATM 997  N  N   . MSE A 1 137 ? 22.704 -7.411  9.993  1.00 42.42 ? 137 MSE A N   1 
HETATM 998  C  CA  . MSE A 1 137 ? 23.969 -6.992  10.578 1.00 48.18 ? 137 MSE A CA  1 
HETATM 999  C  C   . MSE A 1 137 ? 24.847 -8.196  10.927 1.00 49.65 ? 137 MSE A C   1 
HETATM 1000 O  O   . MSE A 1 137 ? 24.368 -9.186  11.483 1.00 48.20 ? 137 MSE A O   1 
HETATM 1001 C  CB  . MSE A 1 137 ? 23.708 -6.164  11.838 1.00 52.56 ? 137 MSE A CB  1 
HETATM 1002 C  CG  . MSE A 1 137 ? 24.530 -4.890  11.928 1.00 60.25 ? 137 MSE A CG  1 
HETATM 1003 SE SE  . MSE A 1 137 ? 23.674 -3.365  11.094 1.00 70.89 ? 137 MSE A SE  1 
HETATM 1004 C  CE  . MSE A 1 137 ? 24.338 -3.586  9.289  1.00 67.46 ? 137 MSE A CE  1 
ATOM   1005 N  N   . PRO A 1 138 ? 26.151 -8.119  10.609 1.00 51.94 ? 138 PRO A N   1 
ATOM   1006 C  CA  . PRO A 1 138 ? 27.109 -9.196  10.882 1.00 54.12 ? 138 PRO A CA  1 
ATOM   1007 C  C   . PRO A 1 138 ? 27.257 -9.489  12.371 1.00 55.97 ? 138 PRO A C   1 
ATOM   1008 O  O   . PRO A 1 138 ? 27.876 -10.476 12.763 1.00 56.72 ? 138 PRO A O   1 
ATOM   1009 C  CB  . PRO A 1 138 ? 28.400 -8.669  10.262 1.00 53.93 ? 138 PRO A CB  1 
ATOM   1010 C  CG  . PRO A 1 138 ? 28.275 -7.190  10.448 1.00 52.91 ? 138 PRO A CG  1 
ATOM   1011 C  CD  . PRO A 1 138 ? 26.839 -6.946  10.038 1.00 52.67 ? 138 PRO A CD  1 
HETATM 1012 N  N   . MSE A 1 139 ? 26.680 -8.619  13.190 1.00 58.78 ? 139 MSE A N   1 
HETATM 1013 C  CA  . MSE A 1 139 ? 26.730 -8.755  14.638 1.00 60.73 ? 139 MSE A CA  1 
HETATM 1014 C  C   . MSE A 1 139 ? 25.625 -9.681  15.122 1.00 60.41 ? 139 MSE A C   1 
HETATM 1015 O  O   . MSE A 1 139 ? 24.686 -9.977  14.387 1.00 60.33 ? 139 MSE A O   1 
HETATM 1016 C  CB  . MSE A 1 139 ? 26.573 -7.382  15.282 1.00 64.00 ? 139 MSE A CB  1 
HETATM 1017 C  CG  . MSE A 1 139 ? 25.328 -6.649  14.819 1.00 68.31 ? 139 MSE A CG  1 
HETATM 1018 SE SE  . MSE A 1 139 ? 25.380 -4.768  15.231 1.00 75.20 ? 139 MSE A SE  1 
HETATM 1019 C  CE  . MSE A 1 139 ? 23.536 -4.309  14.839 1.00 72.05 ? 139 MSE A CE  1 
ATOM   1020 N  N   . SER A 1 140 ? 25.739 -10.134 16.364 1.00 60.15 ? 140 SER A N   1 
ATOM   1021 C  CA  . SER A 1 140 ? 24.743 -11.028 16.934 1.00 60.03 ? 140 SER A CA  1 
ATOM   1022 C  C   . SER A 1 140 ? 23.668 -10.235 17.660 1.00 59.15 ? 140 SER A C   1 
ATOM   1023 O  O   . SER A 1 140 ? 23.916 -9.124  18.129 1.00 59.96 ? 140 SER A O   1 
ATOM   1024 C  CB  . SER A 1 140 ? 25.407 -12.003 17.908 1.00 61.16 ? 140 SER A CB  1 
ATOM   1025 O  OG  . SER A 1 140 ? 24.449 -12.856 18.513 1.00 63.27 ? 140 SER A OG  1 
ATOM   1026 N  N   . PRO A 1 141 ? 22.450 -10.790 17.752 1.00 58.25 ? 141 PRO A N   1 
ATOM   1027 C  CA  . PRO A 1 141 ? 21.356 -10.099 18.439 1.00 57.37 ? 141 PRO A CA  1 
ATOM   1028 C  C   . PRO A 1 141 ? 21.499 -10.231 19.954 1.00 57.38 ? 141 PRO A C   1 
ATOM   1029 O  O   . PRO A 1 141 ? 22.562 -10.595 20.455 1.00 58.41 ? 141 PRO A O   1 
ATOM   1030 C  CB  . PRO A 1 141 ? 20.119 -10.807 17.902 1.00 57.55 ? 141 PRO A CB  1 
ATOM   1031 C  CG  . PRO A 1 141 ? 20.604 -12.213 17.736 1.00 58.09 ? 141 PRO A CG  1 
ATOM   1032 C  CD  . PRO A 1 141 ? 21.968 -12.023 17.103 1.00 57.86 ? 141 PRO A CD  1 
ATOM   1033 N  N   . ASP A 1 142 ? 20.423 -9.937  20.676 1.00 56.58 ? 142 ASP A N   1 
ATOM   1034 C  CA  . ASP A 1 142 ? 20.415 -10.005 22.136 1.00 54.20 ? 142 ASP A CA  1 
ATOM   1035 C  C   . ASP A 1 142 ? 21.492 -9.099  22.724 1.00 50.63 ? 142 ASP A C   1 
ATOM   1036 O  O   . ASP A 1 142 ? 21.664 -9.029  23.941 1.00 51.82 ? 142 ASP A O   1 
ATOM   1037 C  CB  . ASP A 1 142 ? 20.628 -11.441 22.620 1.00 57.27 ? 142 ASP A CB  1 
ATOM   1038 C  CG  . ASP A 1 142 ? 19.882 -11.730 23.911 1.00 60.36 ? 142 ASP A CG  1 
ATOM   1039 O  OD1 . ASP A 1 142 ? 18.630 -11.720 23.888 1.00 62.11 ? 142 ASP A OD1 1 
ATOM   1040 O  OD2 . ASP A 1 142 ? 20.540 -11.960 24.950 1.00 61.40 ? 142 ASP A OD2 1 
ATOM   1041 N  N   . GLY A 1 143 ? 22.219 -8.415  21.848 1.00 45.22 ? 143 GLY A N   1 
ATOM   1042 C  CA  . GLY A 1 143 ? 23.258 -7.502  22.285 1.00 38.84 ? 143 GLY A CA  1 
ATOM   1043 C  C   . GLY A 1 143 ? 22.983 -6.133  21.690 1.00 34.28 ? 143 GLY A C   1 
ATOM   1044 O  O   . GLY A 1 143 ? 23.850 -5.262  21.680 1.00 34.14 ? 143 GLY A O   1 
ATOM   1045 N  N   . LEU A 1 144 ? 21.763 -5.955  21.189 1.00 30.64 ? 144 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 144 ? 21.337 -4.700  20.571 1.00 27.35 ? 144 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 144 ? 20.313 -3.986  21.443 1.00 24.36 ? 144 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 144 ? 19.277 -4.549  21.788 1.00 24.95 ? 144 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 144 ? 20.764 -4.988  19.185 1.00 25.24 ? 144 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 144 ? 21.861 -5.446  18.225 1.00 26.01 ? 144 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 144 ? 21.264 -5.966  16.927 1.00 25.78 ? 144 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 144 ? 22.803 -4.277  17.975 1.00 25.38 ? 144 LEU A CD2 1 
ATOM   1053 N  N   . PHE A 1 145 ? 20.604 -2.735  21.780 1.00 22.94 ? 145 PHE A N   1 
ATOM   1054 C  CA  . PHE A 1 145 ? 19.745 -1.950  22.656 1.00 19.14 ? 145 PHE A CA  1 
ATOM   1055 C  C   . PHE A 1 145 ? 19.003 -0.805  21.987 1.00 17.89 ? 145 PHE A C   1 
ATOM   1056 O  O   . PHE A 1 145 ? 19.584 -0.054  21.207 1.00 16.25 ? 145 PHE A O   1 
ATOM   1057 C  CB  . PHE A 1 145 ? 20.587 -1.378  23.797 1.00 20.14 ? 145 PHE A CB  1 
ATOM   1058 C  CG  . PHE A 1 145 ? 21.282 -2.422  24.619 1.00 21.17 ? 145 PHE A CG  1 
ATOM   1059 C  CD1 . PHE A 1 145 ? 20.759 -2.820  25.846 1.00 22.09 ? 145 PHE A CD1 1 
ATOM   1060 C  CD2 . PHE A 1 145 ? 22.457 -3.018  24.164 1.00 22.02 ? 145 PHE A CD2 1 
ATOM   1061 C  CE1 . PHE A 1 145 ? 21.393 -3.798  26.612 1.00 23.35 ? 145 PHE A CE1 1 
ATOM   1062 C  CE2 . PHE A 1 145 ? 23.099 -3.998  24.922 1.00 24.25 ? 145 PHE A CE2 1 
ATOM   1063 C  CZ  . PHE A 1 145 ? 22.562 -4.386  26.152 1.00 22.47 ? 145 PHE A CZ  1 
ATOM   1064 N  N   . PRO A 1 146 ? 17.698 -0.658  22.286 1.00 16.33 ? 146 PRO A N   1 
ATOM   1065 C  CA  . PRO A 1 146 ? 16.906 0.428   21.698 1.00 16.86 ? 146 PRO A CA  1 
ATOM   1066 C  C   . PRO A 1 146 ? 17.593 1.754   22.020 1.00 17.26 ? 146 PRO A C   1 
ATOM   1067 O  O   . PRO A 1 146 ? 18.065 1.957   23.143 1.00 17.13 ? 146 PRO A O   1 
ATOM   1068 C  CB  . PRO A 1 146 ? 15.559 0.292   22.407 1.00 18.13 ? 146 PRO A CB  1 
ATOM   1069 C  CG  . PRO A 1 146 ? 15.431 -1.208  22.560 1.00 16.07 ? 146 PRO A CG  1 
ATOM   1070 C  CD  . PRO A 1 146 ? 16.837 -1.597  23.032 1.00 15.48 ? 146 PRO A CD  1 
ATOM   1071 N  N   . ALA A 1 147 ? 17.651 2.654   21.043 1.00 17.61 ? 147 ALA A N   1 
ATOM   1072 C  CA  . ALA A 1 147 ? 18.301 3.940   21.255 1.00 16.79 ? 147 ALA A CA  1 
ATOM   1073 C  C   . ALA A 1 147 ? 17.644 5.061   20.470 1.00 16.62 ? 147 ALA A C   1 
ATOM   1074 O  O   . ALA A 1 147 ? 17.087 4.844   19.399 1.00 15.79 ? 147 ALA A O   1 
ATOM   1075 C  CB  . ALA A 1 147 ? 19.784 3.839   20.881 1.00 16.92 ? 147 ALA A CB  1 
ATOM   1076 N  N   . VAL A 1 148 ? 17.711 6.266   21.018 1.00 15.18 ? 148 VAL A N   1 
ATOM   1077 C  CA  . VAL A 1 148 ? 17.127 7.433   20.372 1.00 15.35 ? 148 VAL A CA  1 
ATOM   1078 C  C   . VAL A 1 148 ? 18.135 8.566   20.408 1.00 16.07 ? 148 VAL A C   1 
ATOM   1079 O  O   . VAL A 1 148 ? 18.784 8.790   21.426 1.00 15.93 ? 148 VAL A O   1 
ATOM   1080 C  CB  . VAL A 1 148 ? 15.858 7.913   21.108 1.00 15.48 ? 148 VAL A CB  1 
ATOM   1081 C  CG1 . VAL A 1 148 ? 15.363 9.231   20.497 1.00 18.23 ? 148 VAL A CG1 1 
ATOM   1082 C  CG2 . VAL A 1 148 ? 14.782 6.849   21.034 1.00 17.39 ? 148 VAL A CG2 1 
ATOM   1083 N  N   . GLY A 1 149 ? 18.272 9.268   19.289 1.00 16.81 ? 149 GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 149 ? 19.186 10.389  19.242 1.00 15.46 ? 149 GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 149 ? 18.433 11.652  18.893 1.00 15.52 ? 149 GLY A C   1 
ATOM   1086 O  O   . GLY A 1 149 ? 17.450 11.604  18.159 1.00 14.20 ? 149 GLY A O   1 
HETATM 1087 N  N   . MSE A 1 150 ? 18.877 12.782  19.431 1.00 17.02 ? 150 MSE A N   1 
HETATM 1088 C  CA  . MSE A 1 150 ? 18.246 14.063  19.148 1.00 20.28 ? 150 MSE A CA  1 
HETATM 1089 C  C   . MSE A 1 150 ? 19.340 15.104  18.942 1.00 20.46 ? 150 MSE A C   1 
HETATM 1090 O  O   . MSE A 1 150 ? 20.475 14.909  19.378 1.00 23.03 ? 150 MSE A O   1 
HETATM 1091 C  CB  . MSE A 1 150 ? 17.273 14.439  20.274 1.00 23.03 ? 150 MSE A CB  1 
HETATM 1092 C  CG  . MSE A 1 150 ? 15.986 13.622  20.190 1.00 26.68 ? 150 MSE A CG  1 
HETATM 1093 SE SE  . MSE A 1 150 ? 14.599 13.991  21.507 1.00 38.96 ? 150 MSE A SE  1 
HETATM 1094 C  CE  . MSE A 1 150 ? 15.412 13.085  22.944 1.00 23.56 ? 150 MSE A CE  1 
ATOM   1095 N  N   . HIS A 1 151 ? 19.020 16.208  18.276 1.00 21.43 ? 151 HIS A N   1 
ATOM   1096 C  CA  . HIS A 1 151 ? 20.068 17.172  17.976 1.00 20.68 ? 151 HIS A CA  1 
ATOM   1097 C  C   . HIS A 1 151 ? 19.642 18.631  17.841 1.00 22.04 ? 151 HIS A C   1 
ATOM   1098 O  O   . HIS A 1 151 ? 20.470 19.477  17.530 1.00 22.64 ? 151 HIS A O   1 
ATOM   1099 C  CB  . HIS A 1 151 ? 20.735 16.718  16.678 1.00 20.10 ? 151 HIS A CB  1 
ATOM   1100 C  CG  . HIS A 1 151 ? 22.124 17.234  16.478 1.00 21.43 ? 151 HIS A CG  1 
ATOM   1101 N  ND1 . HIS A 1 151 ? 22.848 16.969  15.335 1.00 22.07 ? 151 HIS A ND1 1 
ATOM   1102 C  CD2 . HIS A 1 151 ? 22.936 17.962  17.280 1.00 20.34 ? 151 HIS A CD2 1 
ATOM   1103 C  CE1 . HIS A 1 151 ? 24.048 17.508  15.444 1.00 21.91 ? 151 HIS A CE1 1 
ATOM   1104 N  NE2 . HIS A 1 151 ? 24.128 18.117  16.614 1.00 24.20 ? 151 HIS A NE2 1 
ATOM   1105 N  N   . SER A 1 152 ? 18.364 18.939  18.036 1.00 21.99 ? 152 SER A N   1 
ATOM   1106 C  CA  . SER A 1 152 ? 17.935 20.329  17.909 1.00 21.09 ? 152 SER A CA  1 
ATOM   1107 C  C   . SER A 1 152 ? 16.865 20.662  18.928 1.00 21.27 ? 152 SER A C   1 
ATOM   1108 O  O   . SER A 1 152 ? 16.129 19.789  19.387 1.00 17.69 ? 152 SER A O   1 
ATOM   1109 C  CB  . SER A 1 152 ? 17.430 20.625  16.490 1.00 20.69 ? 152 SER A CB  1 
ATOM   1110 O  OG  . SER A 1 152 ? 16.113 20.147  16.286 1.00 23.18 ? 152 SER A OG  1 
ATOM   1111 N  N   . LEU A 1 153 ? 16.789 21.937  19.289 1.00 22.70 ? 153 LEU A N   1 
ATOM   1112 C  CA  . LEU A 1 153 ? 15.840 22.384  20.293 1.00 23.75 ? 153 LEU A CA  1 
ATOM   1113 C  C   . LEU A 1 153 ? 14.385 22.137  19.911 1.00 23.12 ? 153 LEU A C   1 
ATOM   1114 O  O   . LEU A 1 153 ? 13.993 22.276  18.750 1.00 23.16 ? 153 LEU A O   1 
ATOM   1115 C  CB  . LEU A 1 153 ? 16.082 23.866  20.601 1.00 29.32 ? 153 LEU A CB  1 
ATOM   1116 C  CG  . LEU A 1 153 ? 15.716 24.883  19.527 1.00 33.16 ? 153 LEU A CG  1 
ATOM   1117 C  CD1 . LEU A 1 153 ? 14.226 25.192  19.627 1.00 37.91 ? 153 LEU A CD1 1 
ATOM   1118 C  CD2 . LEU A 1 153 ? 16.527 26.162  19.723 1.00 37.58 ? 153 LEU A CD2 1 
ATOM   1119 N  N   . GLY A 1 154 ? 13.591 21.763  20.906 1.00 22.81 ? 154 GLY A N   1 
ATOM   1120 C  CA  . GLY A 1 154 ? 12.189 21.491  20.676 1.00 21.59 ? 154 GLY A CA  1 
ATOM   1121 C  C   . GLY A 1 154 ? 11.889 20.038  20.346 1.00 21.83 ? 154 GLY A C   1 
ATOM   1122 O  O   . GLY A 1 154 ? 10.736 19.621  20.402 1.00 22.73 ? 154 GLY A O   1 
ATOM   1123 N  N   . GLU A 1 155 ? 12.909 19.254  20.005 1.00 20.89 ? 155 GLU A N   1 
ATOM   1124 C  CA  . GLU A 1 155 ? 12.667 17.853  19.665 1.00 19.53 ? 155 GLU A CA  1 
ATOM   1125 C  C   . GLU A 1 155 ? 12.137 17.096  20.878 1.00 18.47 ? 155 GLU A C   1 
ATOM   1126 O  O   . GLU A 1 155 ? 12.659 17.228  21.984 1.00 17.54 ? 155 GLU A O   1 
ATOM   1127 C  CB  . GLU A 1 155 ? 13.949 17.201  19.141 1.00 18.15 ? 155 GLU A CB  1 
ATOM   1128 C  CG  . GLU A 1 155 ? 14.512 17.904  17.923 1.00 18.67 ? 155 GLU A CG  1 
ATOM   1129 C  CD  . GLU A 1 155 ? 15.735 17.215  17.350 1.00 21.27 ? 155 GLU A CD  1 
ATOM   1130 O  OE1 . GLU A 1 155 ? 16.308 16.340  18.037 1.00 20.03 ? 155 GLU A OE1 1 
ATOM   1131 O  OE2 . GLU A 1 155 ? 16.128 17.558  16.214 1.00 21.16 ? 155 GLU A OE2 1 
ATOM   1132 N  N   . GLU A 1 156 ? 11.084 16.314  20.666 1.00 19.98 ? 156 GLU A N   1 
ATOM   1133 C  CA  . GLU A 1 156 ? 10.470 15.544  21.740 1.00 17.54 ? 156 GLU A CA  1 
ATOM   1134 C  C   . GLU A 1 156 ? 9.780  14.304  21.189 1.00 17.58 ? 156 GLU A C   1 
ATOM   1135 O  O   . GLU A 1 156 ? 9.111  14.356  20.155 1.00 18.27 ? 156 GLU A O   1 
ATOM   1136 C  CB  . GLU A 1 156 ? 9.465  16.414  22.504 1.00 17.90 ? 156 GLU A CB  1 
ATOM   1137 C  CG  . GLU A 1 156 ? 8.762  15.709  23.661 1.00 19.89 ? 156 GLU A CG  1 
ATOM   1138 C  CD  . GLU A 1 156 ? 7.967  16.669  24.536 1.00 24.98 ? 156 GLU A CD  1 
ATOM   1139 O  OE1 . GLU A 1 156 ? 8.567  17.649  25.026 1.00 28.43 ? 156 GLU A OE1 1 
ATOM   1140 O  OE2 . GLU A 1 156 ? 6.752  16.448  24.739 1.00 23.12 ? 156 GLU A OE2 1 
ATOM   1141 N  N   . VAL A 1 157 ? 9.953  13.185  21.881 1.00 16.69 ? 157 VAL A N   1 
ATOM   1142 C  CA  . VAL A 1 157 ? 9.356  11.930  21.457 1.00 17.34 ? 157 VAL A CA  1 
ATOM   1143 C  C   . VAL A 1 157 ? 8.861  11.156  22.669 1.00 18.71 ? 157 VAL A C   1 
ATOM   1144 O  O   . VAL A 1 157 ? 9.131  11.525  23.813 1.00 16.73 ? 157 VAL A O   1 
ATOM   1145 C  CB  . VAL A 1 157 ? 10.386 11.031  20.717 1.00 16.92 ? 157 VAL A CB  1 
ATOM   1146 C  CG1 . VAL A 1 157 ? 11.040 11.797  19.574 1.00 14.78 ? 157 VAL A CG1 1 
ATOM   1147 C  CG2 . VAL A 1 157 ? 11.456 10.557  21.695 1.00 16.80 ? 157 VAL A CG2 1 
ATOM   1148 N  N   . ARG A 1 158 ? 8.133  10.078  22.396 1.00 21.03 ? 158 ARG A N   1 
ATOM   1149 C  CA  . ARG A 1 158 ? 7.620  9.190   23.428 1.00 22.13 ? 158 ARG A CA  1 
ATOM   1150 C  C   . ARG A 1 158 ? 8.128  7.800   23.064 1.00 21.83 ? 158 ARG A C   1 
ATOM   1151 O  O   . ARG A 1 158 ? 7.962  7.347   21.932 1.00 21.35 ? 158 ARG A O   1 
ATOM   1152 C  CB  . ARG A 1 158 ? 6.089  9.202   23.455 1.00 25.05 ? 158 ARG A CB  1 
ATOM   1153 C  CG  . ARG A 1 158 ? 5.480  10.434  24.111 1.00 30.65 ? 158 ARG A CG  1 
ATOM   1154 C  CD  . ARG A 1 158 ? 3.959  10.324  24.161 1.00 36.35 ? 158 ARG A CD  1 
ATOM   1155 N  NE  . ARG A 1 158 ? 3.511  9.121   24.865 1.00 39.56 ? 158 ARG A NE  1 
ATOM   1156 C  CZ  . ARG A 1 158 ? 2.249  8.693   24.891 1.00 42.09 ? 158 ARG A CZ  1 
ATOM   1157 N  NH1 . ARG A 1 158 ? 1.302  9.368   24.252 1.00 42.71 ? 158 ARG A NH1 1 
ATOM   1158 N  NH2 . ARG A 1 158 ? 1.928  7.587   25.552 1.00 42.43 ? 158 ARG A NH2 1 
ATOM   1159 N  N   . LEU A 1 159 ? 8.760  7.131   24.018 1.00 22.03 ? 159 LEU A N   1 
ATOM   1160 C  CA  . LEU A 1 159 ? 9.308  5.802   23.784 1.00 23.07 ? 159 LEU A CA  1 
ATOM   1161 C  C   . LEU A 1 159 ? 8.274  4.722   24.109 1.00 23.96 ? 159 LEU A C   1 
ATOM   1162 O  O   . LEU A 1 159 ? 7.690  4.722   25.193 1.00 26.33 ? 159 LEU A O   1 
ATOM   1163 C  CB  . LEU A 1 159 ? 10.561 5.621   24.644 1.00 24.03 ? 159 LEU A CB  1 
ATOM   1164 C  CG  . LEU A 1 159 ? 11.377 4.336   24.496 1.00 25.87 ? 159 LEU A CG  1 
ATOM   1165 C  CD1 . LEU A 1 159 ? 11.968 4.239   23.092 1.00 24.72 ? 159 LEU A CD1 1 
ATOM   1166 C  CD2 . LEU A 1 159 ? 12.484 4.341   25.538 1.00 28.22 ? 159 LEU A CD2 1 
ATOM   1167 N  N   . HIS A 1 160 ? 8.047  3.807   23.169 1.00 23.35 ? 160 HIS A N   1 
ATOM   1168 C  CA  . HIS A 1 160 ? 7.072  2.731   23.353 1.00 23.40 ? 160 HIS A CA  1 
ATOM   1169 C  C   . HIS A 1 160 ? 7.717  1.342   23.264 1.00 22.38 ? 160 HIS A C   1 
ATOM   1170 O  O   . HIS A 1 160 ? 7.619  0.659   22.243 1.00 23.08 ? 160 HIS A O   1 
ATOM   1171 C  CB  . HIS A 1 160 ? 5.964  2.848   22.305 1.00 24.30 ? 160 HIS A CB  1 
ATOM   1172 C  CG  . HIS A 1 160 ? 5.237  4.159   22.336 1.00 24.95 ? 160 HIS A CG  1 
ATOM   1173 N  ND1 . HIS A 1 160 ? 4.527  4.590   23.434 1.00 26.02 ? 160 HIS A ND1 1 
ATOM   1174 C  CD2 . HIS A 1 160 ? 5.117  5.135   21.404 1.00 26.73 ? 160 HIS A CD2 1 
ATOM   1175 C  CE1 . HIS A 1 160 ? 3.999  5.775   23.179 1.00 27.47 ? 160 HIS A CE1 1 
ATOM   1176 N  NE2 . HIS A 1 160 ? 4.343  6.129   21.954 1.00 27.22 ? 160 HIS A NE2 1 
ATOM   1177 N  N   . LEU A 1 161 ? 8.363  0.919   24.343 1.00 23.62 ? 161 LEU A N   1 
ATOM   1178 C  CA  . LEU A 1 161 ? 9.029  -0.380  24.366 1.00 25.66 ? 161 LEU A CA  1 
ATOM   1179 C  C   . LEU A 1 161 ? 8.071  -1.576  24.294 1.00 28.08 ? 161 LEU A C   1 
ATOM   1180 O  O   . LEU A 1 161 ? 8.503  -2.714  24.095 1.00 28.50 ? 161 LEU A O   1 
ATOM   1181 C  CB  . LEU A 1 161 ? 9.919  -0.477  25.609 1.00 25.93 ? 161 LEU A CB  1 
ATOM   1182 C  CG  . LEU A 1 161 ? 11.078 0.535   25.659 1.00 26.31 ? 161 LEU A CG  1 
ATOM   1183 C  CD1 . LEU A 1 161 ? 11.807 0.427   26.991 1.00 26.44 ? 161 LEU A CD1 1 
ATOM   1184 C  CD2 . LEU A 1 161 ? 12.047 0.277   24.518 1.00 23.08 ? 161 LEU A CD2 1 
ATOM   1185 N  N   . ASN A 1 162 ? 6.772  -1.319  24.436 1.00 31.17 ? 162 ASN A N   1 
ATOM   1186 C  CA  . ASN A 1 162 ? 5.765  -2.382  24.378 1.00 34.66 ? 162 ASN A CA  1 
ATOM   1187 C  C   . ASN A 1 162 ? 4.951  -2.355  23.085 1.00 36.31 ? 162 ASN A C   1 
ATOM   1188 O  O   . ASN A 1 162 ? 3.870  -2.943  23.011 1.00 35.32 ? 162 ASN A O   1 
ATOM   1189 C  CB  . ASN A 1 162 ? 4.806  -2.275  25.571 1.00 35.89 ? 162 ASN A CB  1 
ATOM   1190 C  CG  . ASN A 1 162 ? 5.419  -2.779  26.862 1.00 37.64 ? 162 ASN A CG  1 
ATOM   1191 O  OD1 . ASN A 1 162 ? 4.869  -2.569  27.945 1.00 39.00 ? 162 ASN A OD1 1 
ATOM   1192 N  ND2 . ASN A 1 162 ? 6.557  -3.458  26.755 1.00 37.16 ? 162 ASN A ND2 1 
ATOM   1193 N  N   . ALA A 1 163 ? 5.468  -1.676  22.068 1.00 37.53 ? 163 ALA A N   1 
ATOM   1194 C  CA  . ALA A 1 163 ? 4.771  -1.578  20.792 1.00 39.49 ? 163 ALA A CA  1 
ATOM   1195 C  C   . ALA A 1 163 ? 4.655  -2.935  20.106 1.00 40.58 ? 163 ALA A C   1 
ATOM   1196 O  O   . ALA A 1 163 ? 5.540  -3.779  20.227 1.00 40.60 ? 163 ALA A O   1 
ATOM   1197 C  CB  . ALA A 1 163 ? 5.493  -0.594  19.885 1.00 39.79 ? 163 ALA A CB  1 
ATOM   1198 N  N   . GLU A 1 164 ? 3.557  -3.141  19.386 1.00 43.97 ? 164 GLU A N   1 
ATOM   1199 C  CA  . GLU A 1 164 ? 3.331  -4.397  18.677 1.00 48.35 ? 164 GLU A CA  1 
ATOM   1200 C  C   . GLU A 1 164 ? 3.001  -4.137  17.207 1.00 49.79 ? 164 GLU A C   1 
ATOM   1201 O  O   . GLU A 1 164 ? 2.577  -3.039  16.847 1.00 49.86 ? 164 GLU A O   1 
ATOM   1202 C  CB  . GLU A 1 164 ? 2.189  -5.181  19.331 1.00 49.69 ? 164 GLU A CB  1 
ATOM   1203 C  CG  . GLU A 1 164 ? 0.789  -4.640  19.043 1.00 54.54 ? 164 GLU A CG  1 
ATOM   1204 C  CD  . GLU A 1 164 ? 0.534  -3.267  19.645 1.00 56.05 ? 164 GLU A CD  1 
ATOM   1205 O  OE1 . GLU A 1 164 ? 1.228  -2.301  19.258 1.00 58.31 ? 164 GLU A OE1 1 
ATOM   1206 O  OE2 . GLU A 1 164 ? -0.367 -3.154  20.504 1.00 56.58 ? 164 GLU A OE2 1 
ATOM   1207 N  N   . LEU A 1 165 ? 3.199  -5.158  16.373 1.00 52.18 ? 165 LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 165 ? 2.938  -5.091  14.932 1.00 53.38 ? 165 LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 165 ? 4.167  -4.592  14.181 1.00 54.28 ? 165 LEU A C   1 
ATOM   1210 O  O   . LEU A 1 165 ? 5.258  -4.601  14.783 1.00 55.47 ? 165 LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 165 ? 1.739  -4.184  14.631 1.00 54.09 ? 165 LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 165 ? 0.406  -4.571  15.281 1.00 54.48 ? 165 LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 165 ? -0.620 -3.477  15.033 1.00 54.53 ? 165 LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 165 ? -0.077 -5.902  14.723 1.00 54.24 ? 165 LEU A CD2 1 
HETATM 1215 O  O   . HOH B 2 .   ? 6.003  2.455   13.182 1.00 19.37 ? 172 HOH A O   1 
HETATM 1216 O  O   . HOH B 2 .   ? 21.710 14.841  13.194 1.00 21.25 ? 173 HOH A O   1 
HETATM 1217 O  O   . HOH B 2 .   ? 23.402 12.410  10.148 1.00 21.12 ? 174 HOH A O   1 
HETATM 1218 O  O   . HOH B 2 .   ? 16.149 14.037  32.670 1.00 24.55 ? 175 HOH A O   1 
HETATM 1219 O  O   . HOH B 2 .   ? 3.330  11.215  7.665  1.00 21.57 ? 176 HOH A O   1 
HETATM 1220 O  O   . HOH B 2 .   ? 16.862 18.885  9.159  1.00 31.72 ? 177 HOH A O   1 
HETATM 1221 O  O   . HOH B 2 .   ? 11.026 15.032  28.788 1.00 24.46 ? 178 HOH A O   1 
HETATM 1222 O  O   . HOH B 2 .   ? 4.451  1.026   25.174 1.00 44.99 ? 179 HOH A O   1 
HETATM 1223 O  O   . HOH B 2 .   ? 14.894 21.748  23.388 1.00 30.27 ? 180 HOH A O   1 
HETATM 1224 O  O   . HOH B 2 .   ? 3.047  7.185   6.855  1.00 19.44 ? 181 HOH A O   1 
HETATM 1225 O  O   . HOH B 2 .   ? 15.582 8.245   2.239  1.00 23.50 ? 182 HOH A O   1 
HETATM 1226 O  O   . HOH B 2 .   ? 16.563 -14.832 7.646  1.00 27.99 ? 183 HOH A O   1 
HETATM 1227 O  O   . HOH B 2 .   ? 25.222 -4.470  28.716 1.00 38.17 ? 184 HOH A O   1 
HETATM 1228 O  O   . HOH B 2 .   ? 30.321 4.023   20.271 1.00 25.79 ? 185 HOH A O   1 
HETATM 1229 O  O   . HOH B 2 .   ? 10.953 -3.738  23.158 1.00 24.28 ? 186 HOH A O   1 
HETATM 1230 O  O   . HOH B 2 .   ? 14.885 -1.193  28.528 1.00 28.34 ? 187 HOH A O   1 
HETATM 1231 O  O   . HOH B 2 .   ? 15.231 23.973  10.194 1.00 40.16 ? 188 HOH A O   1 
HETATM 1232 O  O   . HOH B 2 .   ? 8.874  20.487  22.329 1.00 24.86 ? 189 HOH A O   1 
HETATM 1233 O  O   . HOH B 2 .   ? 23.312 16.710  10.937 1.00 36.16 ? 190 HOH A O   1 
HETATM 1234 O  O   . HOH B 2 .   ? 3.362  11.403  17.892 1.00 24.13 ? 191 HOH A O   1 
HETATM 1235 O  O   . HOH B 2 .   ? 2.521  -0.306  15.172 1.00 32.43 ? 192 HOH A O   1 
HETATM 1236 O  O   . HOH B 2 .   ? 12.092 -13.594 24.924 1.00 44.10 ? 193 HOH A O   1 
HETATM 1237 O  O   . HOH B 2 .   ? 2.554  8.641   21.857 1.00 40.45 ? 194 HOH A O   1 
HETATM 1238 O  O   . HOH B 2 .   ? 31.980 5.692   11.853 1.00 27.27 ? 195 HOH A O   1 
HETATM 1239 O  O   . HOH B 2 .   ? 31.216 7.403   1.127  1.00 33.92 ? 196 HOH A O   1 
HETATM 1240 O  O   . HOH B 2 .   ? 14.794 -2.133  25.976 1.00 28.27 ? 197 HOH A O   1 
HETATM 1241 O  O   . HOH B 2 .   ? 31.365 15.556  24.838 1.00 49.49 ? 198 HOH A O   1 
HETATM 1242 O  O   . HOH B 2 .   ? 21.863 22.402  19.264 1.00 31.38 ? 199 HOH A O   1 
HETATM 1243 O  O   . HOH B 2 .   ? 22.702 15.792  30.316 1.00 23.33 ? 200 HOH A O   1 
HETATM 1244 O  O   . HOH B 2 .   ? 29.226 5.983   26.091 1.00 35.44 ? 201 HOH A O   1 
HETATM 1245 O  O   . HOH B 2 .   ? 28.745 17.670  26.159 1.00 42.01 ? 202 HOH A O   1 
HETATM 1246 O  O   . HOH B 2 .   ? 9.660  12.231  2.474  1.00 49.09 ? 203 HOH A O   1 
HETATM 1247 O  O   . HOH B 2 .   ? 11.691 20.303  11.920 1.00 27.07 ? 204 HOH A O   1 
HETATM 1248 O  O   . HOH B 2 .   ? 23.703 0.930   3.991  1.00 44.17 ? 205 HOH A O   1 
HETATM 1249 O  O   . HOH B 2 .   ? 13.476 -6.305  25.444 1.00 34.52 ? 206 HOH A O   1 
HETATM 1250 O  O   . HOH B 2 .   ? 19.753 13.203  12.428 1.00 28.71 ? 207 HOH A O   1 
HETATM 1251 O  O   . HOH B 2 .   ? 5.561  11.572  6.090  1.00 30.66 ? 208 HOH A O   1 
HETATM 1252 O  O   . HOH B 2 .   ? 13.685 -8.224  7.690  1.00 43.50 ? 209 HOH A O   1 
HETATM 1253 O  O   . HOH B 2 .   ? 21.795 19.071  6.974  1.00 41.49 ? 210 HOH A O   1 
HETATM 1254 O  O   . HOH B 2 .   ? 12.677 19.451  23.475 1.00 35.69 ? 211 HOH A O   1 
HETATM 1255 O  O   . HOH B 2 .   ? 10.156 20.021  24.729 1.00 29.81 ? 212 HOH A O   1 
HETATM 1256 O  O   . HOH B 2 .   ? 25.714 4.726   7.044  1.00 37.12 ? 213 HOH A O   1 
HETATM 1257 O  O   . HOH B 2 .   ? 26.270 -0.311  5.024  1.00 37.28 ? 214 HOH A O   1 
HETATM 1258 O  O   . HOH B 2 .   ? 23.590 11.229  4.780  1.00 27.75 ? 215 HOH A O   1 
HETATM 1259 O  O   . HOH B 2 .   ? 3.871  2.688   19.584 1.00 34.69 ? 216 HOH A O   1 
HETATM 1260 O  O   . HOH B 2 .   ? 8.937  5.413   4.417  1.00 30.79 ? 217 HOH A O   1 
HETATM 1261 O  O   . HOH B 2 .   ? 30.274 1.919   18.282 1.00 23.99 ? 218 HOH A O   1 
HETATM 1262 O  O   . HOH B 2 .   ? 12.719 -3.930  25.390 1.00 28.07 ? 219 HOH A O   1 
HETATM 1263 O  O   . HOH B 2 .   ? 25.224 0.493   26.281 1.00 41.98 ? 220 HOH A O   1 
HETATM 1264 O  O   . HOH B 2 .   ? 4.898  8.179   31.037 1.00 43.58 ? 221 HOH A O   1 
HETATM 1265 O  O   . HOH B 2 .   ? 9.763  4.847   1.468  1.00 44.03 ? 222 HOH A O   1 
HETATM 1266 O  O   . HOH B 2 .   ? 20.501 12.675  10.137 1.00 36.69 ? 223 HOH A O   1 
HETATM 1267 O  O   . HOH B 2 .   ? 22.114 6.035   -0.826 1.00 40.99 ? 224 HOH A O   1 
HETATM 1268 O  O   . HOH B 2 .   ? 18.899 23.615  17.878 1.00 32.74 ? 225 HOH A O   1 
HETATM 1269 O  O   . HOH B 2 .   ? 12.553 23.718  24.353 1.00 45.15 ? 226 HOH A O   1 
HETATM 1270 O  O   . HOH B 2 .   ? 7.964  2.252   26.897 1.00 30.38 ? 227 HOH A O   1 
HETATM 1271 O  O   . HOH B 2 .   ? -0.822 7.005   14.634 1.00 44.49 ? 228 HOH A O   1 
HETATM 1272 O  O   . HOH B 2 .   ? 14.233 17.494  6.971  1.00 38.14 ? 229 HOH A O   1 
HETATM 1273 O  O   . HOH B 2 .   ? 23.665 3.089   5.510  1.00 32.85 ? 230 HOH A O   1 
HETATM 1274 O  O   . HOH B 2 .   ? 7.727  -5.326  21.580 1.00 40.66 ? 231 HOH A O   1 
HETATM 1275 O  O   . HOH B 2 .   ? 19.270 -7.425  21.738 1.00 45.39 ? 232 HOH A O   1 
HETATM 1276 O  O   . HOH B 2 .   ? 0.645  8.605   20.024 1.00 42.92 ? 233 HOH A O   1 
HETATM 1277 O  O   . HOH B 2 .   ? 24.730 12.784  2.033  1.00 45.19 ? 234 HOH A O   1 
HETATM 1278 O  O   . HOH B 2 .   ? 31.386 9.099   23.639 1.00 34.35 ? 235 HOH A O   1 
HETATM 1279 O  O   . HOH B 2 .   ? 18.011 -0.461  34.347 1.00 49.76 ? 236 HOH A O   1 
HETATM 1280 O  O   . HOH B 2 .   ? 27.722 12.971  5.451  1.00 36.40 ? 237 HOH A O   1 
HETATM 1281 O  O   . HOH B 2 .   ? 24.944 12.851  8.130  1.00 37.63 ? 238 HOH A O   1 
HETATM 1282 O  O   . HOH B 2 .   ? 26.474 -4.946  22.747 1.00 25.91 ? 239 HOH A O   1 
HETATM 1283 O  O   . HOH B 2 .   ? 5.165  14.260  25.234 1.00 32.26 ? 240 HOH A O   1 
HETATM 1284 O  O   . HOH B 2 .   ? 21.157 13.310  4.569  1.00 28.26 ? 241 HOH A O   1 
HETATM 1285 O  O   . HOH B 2 .   ? 17.762 22.764  24.681 1.00 33.08 ? 242 HOH A O   1 
HETATM 1286 O  O   . HOH B 2 .   ? 23.516 9.714   1.299  1.00 33.74 ? 243 HOH A O   1 
HETATM 1287 O  O   . HOH B 2 .   ? 21.075 14.633  32.119 1.00 37.00 ? 244 HOH A O   1 
HETATM 1288 O  O   . HOH B 2 .   ? 11.711 2.052   29.701 1.00 62.36 ? 245 HOH A O   1 
HETATM 1289 O  O   . HOH B 2 .   ? 16.049 -13.830 22.797 1.00 38.15 ? 246 HOH A O   1 
HETATM 1290 O  O   . HOH B 2 .   ? 1.771  9.397   6.269  1.00 16.82 ? 247 HOH A O   1 
HETATM 1291 O  O   . HOH B 2 .   ? 26.038 14.131  24.289 1.00 37.67 ? 248 HOH A O   1 
HETATM 1292 O  O   . HOH B 2 .   ? 17.677 -9.843  27.640 1.00 33.72 ? 249 HOH A O   1 
HETATM 1293 O  O   . HOH B 2 .   ? 10.748 -10.744 27.145 0.50 39.17 ? 250 HOH A O   1 
HETATM 1294 O  O   . HOH B 2 .   ? 28.432 -8.867  24.836 1.00 35.35 ? 251 HOH A O   1 
HETATM 1295 O  O   . HOH B 2 .   ? 8.306  21.726  11.043 1.00 33.60 ? 252 HOH A O   1 
HETATM 1296 O  O   . HOH B 2 .   ? 8.471  21.822  7.399  1.00 34.16 ? 253 HOH A O   1 
HETATM 1297 O  O   . HOH B 2 .   ? 28.953 -1.205  11.722 1.00 30.01 ? 254 HOH A O   1 
HETATM 1298 O  O   . HOH B 2 .   ? 28.394 15.823  23.577 1.00 32.03 ? 255 HOH A O   1 
HETATM 1299 O  O   . HOH B 2 .   ? 18.053 15.105  2.714  1.00 54.05 ? 256 HOH A O   1 
HETATM 1300 O  O   . HOH B 2 .   ? 3.500  -4.312  5.582  1.00 38.20 ? 257 HOH A O   1 
HETATM 1301 O  O   . HOH B 2 .   ? 18.193 3.914   30.250 1.00 40.97 ? 258 HOH A O   1 
HETATM 1302 O  O   . HOH B 2 .   ? 13.826 6.415   -0.328 1.00 48.95 ? 259 HOH A O   1 
HETATM 1303 O  O   . HOH B 2 .   ? 25.773 -7.325  25.189 1.00 40.99 ? 260 HOH A O   1 
HETATM 1304 O  O   . HOH B 2 .   ? 22.813 8.794   -1.215 1.00 47.14 ? 261 HOH A O   1 
HETATM 1305 O  O   . HOH B 2 .   ? 20.451 -15.748 20.461 1.00 37.27 ? 262 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  CYS 29  29  29  CYS CYS A . n 
A 1 30  TYR 30  30  30  TYR TYR A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  TRP 73  73  73  TRP TRP A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 CYS 109 109 109 CYS CYS A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 ASN 128 128 128 ASN ASN A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 MSE 137 137 137 MSE MSE A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 MSE 139 139 139 MSE MSE A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 MSE 150 150 150 MSE MSE A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 SER 166 166 ?   ?   ?   A . n 
A 1 167 GLY 167 167 ?   ?   ?   A . n 
A 1 168 PRO 168 168 ?   ?   ?   A . n 
A 1 169 SER 169 169 ?   ?   ?   A . n 
A 1 170 SER 170 170 ?   ?   ?   A . n 
A 1 171 GLY 171 171 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  172 2   HOH TIP A . 
B 2 HOH 2  173 4   HOH TIP A . 
B 2 HOH 3  174 8   HOH TIP A . 
B 2 HOH 4  175 9   HOH TIP A . 
B 2 HOH 5  176 10  HOH TIP A . 
B 2 HOH 6  177 11  HOH TIP A . 
B 2 HOH 7  178 12  HOH TIP A . 
B 2 HOH 8  179 13  HOH TIP A . 
B 2 HOH 9  180 14  HOH TIP A . 
B 2 HOH 10 181 15  HOH TIP A . 
B 2 HOH 11 182 16  HOH TIP A . 
B 2 HOH 12 183 17  HOH TIP A . 
B 2 HOH 13 184 18  HOH TIP A . 
B 2 HOH 14 185 19  HOH TIP A . 
B 2 HOH 15 186 20  HOH TIP A . 
B 2 HOH 16 187 21  HOH TIP A . 
B 2 HOH 17 188 22  HOH TIP A . 
B 2 HOH 18 189 23  HOH TIP A . 
B 2 HOH 19 190 24  HOH TIP A . 
B 2 HOH 20 191 26  HOH TIP A . 
B 2 HOH 21 192 27  HOH TIP A . 
B 2 HOH 22 193 28  HOH TIP A . 
B 2 HOH 23 194 29  HOH TIP A . 
B 2 HOH 24 195 30  HOH TIP A . 
B 2 HOH 25 196 31  HOH TIP A . 
B 2 HOH 26 197 32  HOH TIP A . 
B 2 HOH 27 198 33  HOH TIP A . 
B 2 HOH 28 199 34  HOH TIP A . 
B 2 HOH 29 200 35  HOH TIP A . 
B 2 HOH 30 201 36  HOH TIP A . 
B 2 HOH 31 202 37  HOH TIP A . 
B 2 HOH 32 203 39  HOH TIP A . 
B 2 HOH 33 204 42  HOH TIP A . 
B 2 HOH 34 205 44  HOH TIP A . 
B 2 HOH 35 206 45  HOH TIP A . 
B 2 HOH 36 207 46  HOH TIP A . 
B 2 HOH 37 208 49  HOH TIP A . 
B 2 HOH 38 209 50  HOH TIP A . 
B 2 HOH 39 210 51  HOH TIP A . 
B 2 HOH 40 211 52  HOH TIP A . 
B 2 HOH 41 212 54  HOH TIP A . 
B 2 HOH 42 213 55  HOH TIP A . 
B 2 HOH 43 214 56  HOH TIP A . 
B 2 HOH 44 215 58  HOH TIP A . 
B 2 HOH 45 216 59  HOH TIP A . 
B 2 HOH 46 217 60  HOH TIP A . 
B 2 HOH 47 218 62  HOH TIP A . 
B 2 HOH 48 219 63  HOH TIP A . 
B 2 HOH 49 220 64  HOH TIP A . 
B 2 HOH 50 221 65  HOH TIP A . 
B 2 HOH 51 222 66  HOH TIP A . 
B 2 HOH 52 223 67  HOH TIP A . 
B 2 HOH 53 224 68  HOH TIP A . 
B 2 HOH 54 225 69  HOH TIP A . 
B 2 HOH 55 226 70  HOH TIP A . 
B 2 HOH 56 227 71  HOH TIP A . 
B 2 HOH 57 228 72  HOH TIP A . 
B 2 HOH 58 229 74  HOH TIP A . 
B 2 HOH 59 230 75  HOH TIP A . 
B 2 HOH 60 231 76  HOH TIP A . 
B 2 HOH 61 232 79  HOH TIP A . 
B 2 HOH 62 233 80  HOH TIP A . 
B 2 HOH 63 234 81  HOH TIP A . 
B 2 HOH 64 235 83  HOH TIP A . 
B 2 HOH 65 236 84  HOH TIP A . 
B 2 HOH 66 237 85  HOH TIP A . 
B 2 HOH 67 238 88  HOH TIP A . 
B 2 HOH 68 239 89  HOH TIP A . 
B 2 HOH 69 240 90  HOH TIP A . 
B 2 HOH 70 241 91  HOH TIP A . 
B 2 HOH 71 242 92  HOH TIP A . 
B 2 HOH 72 243 93  HOH TIP A . 
B 2 HOH 73 244 95  HOH TIP A . 
B 2 HOH 74 245 96  HOH TIP A . 
B 2 HOH 75 246 98  HOH TIP A . 
B 2 HOH 76 247 99  HOH TIP A . 
B 2 HOH 77 248 101 HOH TIP A . 
B 2 HOH 78 249 103 HOH TIP A . 
B 2 HOH 79 250 104 HOH TIP A . 
B 2 HOH 80 251 105 HOH TIP A . 
B 2 HOH 81 252 106 HOH TIP A . 
B 2 HOH 82 253 107 HOH TIP A . 
B 2 HOH 83 254 108 HOH TIP A . 
B 2 HOH 84 255 109 HOH TIP A . 
B 2 HOH 85 256 110 HOH TIP A . 
B 2 HOH 86 257 111 HOH TIP A . 
B 2 HOH 87 258 113 HOH TIP A . 
B 2 HOH 88 259 114 HOH TIP A . 
B 2 HOH 89 260 115 HOH TIP A . 
B 2 HOH 90 261 116 HOH TIP A . 
B 2 HOH 91 262 117 HOH TIP A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 137 A MSE 137 ? MET SELENOMETHIONINE 
2 A MSE 139 A MSE 139 ? MET SELENOMETHIONINE 
3 A MSE 150 A MSE 150 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric   2 
2 software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B 
2 1   A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z              1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 4_555 y+1/2,-x+1/2,z+1/4 0.0000000000 1.0000000000 0.0000000000 26.0535000000 -1.0000000000 
0.0000000000 0.0000000000 26.0535000000 0.0000000000 0.0000000000 1.0000000000 27.1457500000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     250 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-06 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.1 ? 1 
HKL-2000 'data reduction' .   ? 2 
HKL-2000 'data scaling'   .   ? 3 
SOLVE    phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 21  ? ? -152.96 68.32   
2  1 SER A 24  ? ? 27.64   97.66   
3  1 PHE A 97  ? ? -144.32 -73.43  
4  1 PHE A 116 ? ? -64.40  16.74   
5  1 VAL A 118 ? ? 40.70   173.50  
6  1 THR A 120 ? ? 174.28  141.66  
7  1 PRO A 141 ? ? -78.21  -164.28 
8  1 ASP A 142 ? ? 57.78   0.70    
9  1 HIS A 151 ? ? -151.76 1.69    
10 1 HIS A 160 ? ? -119.88 79.11   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A SER 166 ? A SER 166 
7  1 Y 1 A GLY 167 ? A GLY 167 
8  1 Y 1 A PRO 168 ? A PRO 168 
9  1 Y 1 A SER 169 ? A SER 169 
10 1 Y 1 A SER 170 ? A SER 170 
11 1 Y 1 A GLY 171 ? A GLY 171 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#