data_2ZH1
# 
_entry.id   2ZH1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZH1         
NDB   PR0318       
RCSB  RCSB027961   
WWPDB D_1000027961 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH2 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH5 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH7 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHA . unspecified 
PDB 2ZHB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZH1 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZH1 
_cell.length_a           57.926 
_cell.length_b           57.926 
_cell.length_c           441.183 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZH1 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'RNA (33-MER)'      10623.345 1  ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme' 51469.137 1  '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'       96.063    2  ?                    ? ? ? 
4 water       nat water               18.015    83 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAA GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAA B ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  A   n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 ? 
2 PDB 2ZH1      2ZH1   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZH1 A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 2ZH1 B 1 ? 33  ? 2ZH1   1 ? 33  ? 1 33  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ZH1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-11-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZH1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   19808 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.117 
_reflns.pdbx_netI_over_sigmaI        40.3 
_reflns.B_iso_Wilson_estimate        73.7 
_reflns.pdbx_redundancy              12.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.453 
_reflns_shell.meanI_over_sigI_obs    8.5 
_reflns_shell.pdbx_redundancy        13.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1957 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZH1 
_refine.ls_number_reflns_obs                     19684 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1538350.03 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.94 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.236 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               48.3 
_refine.aniso_B[1][1]                            -1.10 
_refine.aniso_B[2][2]                            -1.10 
_refine.aniso_B[3][3]                            2.20 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.334275 
_refine.solvent_model_param_bsol                 31.189 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2DRB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZH1 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.39 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.49 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3630 
_refine_hist.pdbx_number_atoms_nucleic_acid   705 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               4428 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        39.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.13  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.59  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.52  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             3031 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.366 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             165 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 SO4.param         ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZH1 
_struct.title                     'Complex structure of AFCCA with tRNAminiDA' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZH1 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 2   ? ILE B 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 17  ? LEU B 38  ? ASP A 17  LEU A 38  1 ? 22 
HELX_P HELX_P3  3  GLY B 46  ? ARG B 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 71  ? LEU B 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 125 ? LYS B 142 ? SER A 125 LYS A 142 1 ? 18 
HELX_P HELX_P6  6  LYS B 144 ? ASN B 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER B 171 ? GLY B 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER B 184 ? ARG B 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER B 231 ? ALA B 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER B 250 ? LYS B 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU B 263 ? GLY B 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL B 289 ? GLU B 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP B 351 ? ARG B 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR B 384 ? HIS B 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP B 397 ? LEU B 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY B 401 ? TYR B 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLY B 417 ? LYS B 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL B 425 ? MET B 433 ? VAL A 425 MET A 433 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 31 N3 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 31 O2 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 31 N4 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 30 N3 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 30 O2 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 30 N4 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? A C 3  N3 ? ? ? 1_555 A G 29 N1 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8  hydrog ? ? A C 3  N4 ? ? ? 1_555 A G 29 O6 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? A C 3  O2 ? ? ? 1_555 A G 29 N2 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? A C 4  N3 ? ? ? 1_555 A G 28 N1 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11 hydrog ? ? A C 4  N4 ? ? ? 1_555 A G 28 O6 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? A C 4  O2 ? ? ? 1_555 A G 28 N2 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 27 N1 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 27 O6 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog15 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 27 N2 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog16 hydrog ? ? A G 6  N1 ? ? ? 1_555 A U 26 O2 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog17 hydrog ? ? A G 6  O6 ? ? ? 1_555 A U 26 N3 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog18 hydrog ? ? A G 7  N1 ? ? ? 1_555 A C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? A G 7  N2 ? ? ? 1_555 A C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? A G 7  O6 ? ? ? 1_555 A C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 24 O2 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 24 N4 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog24 hydrog ? ? A G 9  N1 ? ? ? 1_555 A C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog25 hydrog ? ? A G 9  N2 ? ? ? 1_555 A C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog26 hydrog ? ? A G 9  O6 ? ? ? 1_555 A C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog27 hydrog ? ? A C 10 N3 ? ? ? 1_555 A G 22 N1 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? A C 10 N4 ? ? ? 1_555 A G 22 O6 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? A C 10 O2 ? ? ? 1_555 A G 22 N2 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? A G 11 N1 ? ? ? 1_555 A C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? A G 11 N2 ? ? ? 1_555 A C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? A G 11 O6 ? ? ? 1_555 A C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? A G 12 N1 ? ? ? 1_555 A C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? A G 12 N2 ? ? ? 1_555 A C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36 hydrog ? ? A U 13 N3 ? ? ? 1_555 A A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog37 hydrog ? ? A U 13 O2 ? ? ? 1_555 A A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 42  ? VAL B 45  ? TYR A 42  VAL A 45  
A 2 GLU B 59  ? PHE B 66  ? GLU A 59  PHE A 66  
A 3 VAL B 107 ? TYR B 115 ? VAL A 107 TYR A 115 
A 4 PRO B 98  ? VAL B 104 ? PRO A 98  VAL A 104 
A 5 SER B 89  ? TYR B 94  ? SER A 89  TYR A 94  
B 1 GLU B 207 ? LYS B 210 ? GLU A 207 LYS A 210 
B 2 THR B 199 ? ASP B 202 ? THR A 199 ASP A 202 
B 3 PHE B 215 ? ASP B 218 ? PHE A 215 ASP A 218 
B 4 ASP B 221 ? ASN B 225 ? ASP A 221 ASN A 225 
C 1 PRO B 315 ? ALA B 322 ? PRO A 315 ALA A 322 
C 2 PHE B 326 ? CYS B 333 ? PHE A 326 CYS A 333 
C 3 ALA B 277 ? ARG B 284 ? ALA A 277 ARG A 284 
C 4 GLU B 413 ? SER B 416 ? GLU A 413 SER A 416 
D 1 VAL B 341 ? GLN B 348 ? VAL A 341 GLN A 348 
D 2 ARG B 373 ? MET B 379 ? ARG A 373 MET A 379 
D 3 PHE B 368 ? GLU B 370 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 45  ? N VAL A 45  O ASP B 61  ? O ASP A 61  
A 2 3 N VAL B 62  ? N VAL A 62  O ASP B 110 ? O ASP A 110 
A 3 4 O VAL B 111 ? O VAL A 111 N VAL B 100 ? N VAL A 100 
A 4 5 O HIS B 101 ? O HIS A 101 N GLU B 91  ? N GLU A 91  
B 1 2 O ARG B 209 ? O ARG A 209 N VAL B 200 ? N VAL A 200 
B 2 3 N ILE B 201 ? N ILE A 201 O PHE B 215 ? O PHE A 215 
B 3 4 N ASP B 218 ? N ASP A 218 O ARG B 224 ? O ARG A 224 
C 1 2 N LEU B 316 ? N LEU A 316 O GLU B 332 ? O GLU A 332 
C 2 3 O LEU B 329 ? O LEU A 329 N VAL B 281 ? N VAL A 281 
C 3 4 N ALA B 280 ? N ALA A 280 O ILE B 415 ? O ILE A 415 
D 1 2 N GLY B 346 ? N GLY A 346 O TRP B 374 ? O TRP A 374 
D 2 3 O TRP B 375 ? O TRP A 375 N PHE B 368 ? N PHE A 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 438' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 439' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER B 47  ? SER A 47  . ? 1_555 ? 
2 AC1 6 TRP B 53  ? TRP A 53  . ? 1_555 ? 
3 AC1 6 LEU B 54  ? LEU A 54  . ? 1_555 ? 
4 AC1 6 SER B 57  ? SER A 57  . ? 1_555 ? 
5 AC1 6 LYS B 152 ? LYS A 152 . ? 1_555 ? 
6 AC1 6 TYR B 161 ? TYR A 161 . ? 1_555 ? 
7 AC2 3 ARG B 299 ? ARG A 299 . ? 1_555 ? 
8 AC2 3 ARG B 302 ? ARG A 302 . ? 1_555 ? 
9 AC2 3 LYS B 303 ? LYS A 303 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZH1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZH1 
_atom_sites.fract_transf_matrix[1][1]   0.017263 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002267 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . G   A 1 1   ? -14.678 35.672 36.266  1.00 58.65 ? 1   G   B P     1 
ATOM   2    O OP1   . G   A 1 1   ? -15.523 34.487 36.722  1.00 58.45 ? 1   G   B OP1   1 
ATOM   3    O OP2   . G   A 1 1   ? -15.457 36.979 36.234  1.00 59.22 ? 1   G   B OP2   1 
ATOM   4    O "O5'" . G   A 1 1   ? -14.258 35.338 34.722  1.00 56.75 ? 1   G   B "O5'" 1 
ATOM   5    C "C5'" . G   A 1 1   ? -13.176 36.047 34.095  1.00 52.92 ? 1   G   B "C5'" 1 
ATOM   6    C "C4'" . G   A 1 1   ? -12.384 35.137 33.177  1.00 50.94 ? 1   G   B "C4'" 1 
ATOM   7    O "O4'" . G   A 1 1   ? -11.989 33.914 33.860  1.00 49.84 ? 1   G   B "O4'" 1 
ATOM   8    C "C3'" . G   A 1 1   ? -13.087 34.639 31.925  1.00 49.89 ? 1   G   B "C3'" 1 
ATOM   9    O "O3'" . G   A 1 1   ? -13.059 35.642 30.922  1.00 46.61 ? 1   G   B "O3'" 1 
ATOM   10   C "C2'" . G   A 1 1   ? -12.210 33.451 31.539  1.00 48.85 ? 1   G   B "C2'" 1 
ATOM   11   O "O2'" . G   A 1 1   ? -11.012 33.851 30.902  1.00 49.52 ? 1   G   B "O2'" 1 
ATOM   12   C "C1'" . G   A 1 1   ? -11.883 32.859 32.913  1.00 48.57 ? 1   G   B "C1'" 1 
ATOM   13   N N9    . G   A 1 1   ? -12.820 31.805 33.284  1.00 47.79 ? 1   G   B N9    1 
ATOM   14   C C8    . G   A 1 1   ? -13.799 31.853 34.246  1.00 47.01 ? 1   G   B C8    1 
ATOM   15   N N7    . G   A 1 1   ? -14.496 30.751 34.326  1.00 44.67 ? 1   G   B N7    1 
ATOM   16   C C5    . G   A 1 1   ? -13.941 29.923 33.360  1.00 46.35 ? 1   G   B C5    1 
ATOM   17   C C6    . G   A 1 1   ? -14.283 28.599 32.966  1.00 46.12 ? 1   G   B C6    1 
ATOM   18   O O6    . G   A 1 1   ? -15.184 27.876 33.396  1.00 45.27 ? 1   G   B O6    1 
ATOM   19   N N1    . G   A 1 1   ? -13.452 28.137 31.949  1.00 45.87 ? 1   G   B N1    1 
ATOM   20   C C2    . G   A 1 1   ? -12.434 28.851 31.379  1.00 45.43 ? 1   G   B C2    1 
ATOM   21   N N2    . G   A 1 1   ? -11.738 28.227 30.434  1.00 46.11 ? 1   G   B N2    1 
ATOM   22   N N3    . G   A 1 1   ? -12.117 30.086 31.717  1.00 47.32 ? 1   G   B N3    1 
ATOM   23   C C4    . G   A 1 1   ? -12.903 30.558 32.711  1.00 46.87 ? 1   G   B C4    1 
ATOM   24   P P     . G   A 1 2   ? -14.300 35.799 29.917  1.00 42.94 ? 2   G   B P     1 
ATOM   25   O OP1   . G   A 1 2   ? -14.121 37.095 29.202  1.00 43.63 ? 2   G   B OP1   1 
ATOM   26   O OP2   . G   A 1 2   ? -15.563 35.541 30.664  1.00 42.73 ? 2   G   B OP2   1 
ATOM   27   O "O5'" . G   A 1 2   ? -14.084 34.614 28.874  1.00 45.04 ? 2   G   B "O5'" 1 
ATOM   28   C "C5'" . G   A 1 2   ? -12.931 34.580 28.034  1.00 43.81 ? 2   G   B "C5'" 1 
ATOM   29   C "C4'" . G   A 1 2   ? -12.836 33.250 27.324  1.00 43.41 ? 2   G   B "C4'" 1 
ATOM   30   O "O4'" . G   A 1 2   ? -12.566 32.194 28.287  1.00 43.19 ? 2   G   B "O4'" 1 
ATOM   31   C "C3'" . G   A 1 2   ? -14.091 32.769 26.611  1.00 43.09 ? 2   G   B "C3'" 1 
ATOM   32   O "O3'" . G   A 1 2   ? -14.225 33.352 25.320  1.00 43.43 ? 2   G   B "O3'" 1 
ATOM   33   C "C2'" . G   A 1 2   ? -13.807 31.284 26.485  1.00 43.29 ? 2   G   B "C2'" 1 
ATOM   34   O "O2'" . G   A 1 2   ? -12.860 31.031 25.469  1.00 44.99 ? 2   G   B "O2'" 1 
ATOM   35   C "C1'" . G   A 1 2   ? -13.174 30.990 27.845  1.00 43.85 ? 2   G   B "C1'" 1 
ATOM   36   N N9    . G   A 1 2   ? -14.159 30.565 28.838  1.00 45.05 ? 2   G   B N9    1 
ATOM   37   C C8    . G   A 1 2   ? -14.681 31.317 29.862  1.00 44.88 ? 2   G   B C8    1 
ATOM   38   N N7    . G   A 1 2   ? -15.557 30.667 30.582  1.00 45.41 ? 2   G   B N7    1 
ATOM   39   C C5    . G   A 1 2   ? -15.614 29.404 30.003  1.00 45.25 ? 2   G   B C5    1 
ATOM   40   C C6    . G   A 1 2   ? -16.383 28.261 30.359  1.00 45.59 ? 2   G   B C6    1 
ATOM   41   O O6    . G   A 1 2   ? -17.177 28.130 31.293  1.00 44.68 ? 2   G   B O6    1 
ATOM   42   N N1    . G   A 1 2   ? -16.143 27.195 29.504  1.00 45.95 ? 2   G   B N1    1 
ATOM   43   C C2    . G   A 1 2   ? -15.264 27.212 28.454  1.00 46.50 ? 2   G   B C2    1 
ATOM   44   N N2    . G   A 1 2   ? -15.167 26.074 27.754  1.00 47.56 ? 2   G   B N2    1 
ATOM   45   N N3    . G   A 1 2   ? -14.532 28.264 28.115  1.00 44.78 ? 2   G   B N3    1 
ATOM   46   C C4    . G   A 1 2   ? -14.759 29.320 28.926  1.00 44.37 ? 2   G   B C4    1 
ATOM   47   P P     . C   A 1 3   ? -15.663 33.374 24.604  1.00 42.66 ? 3   C   B P     1 
ATOM   48   O OP1   . C   A 1 3   ? -15.528 34.141 23.345  1.00 40.66 ? 3   C   B OP1   1 
ATOM   49   O OP2   . C   A 1 3   ? -16.671 33.791 25.612  1.00 43.06 ? 3   C   B OP2   1 
ATOM   50   O "O5'" . C   A 1 3   ? -15.952 31.845 24.248  1.00 41.82 ? 3   C   B "O5'" 1 
ATOM   51   C "C5'" . C   A 1 3   ? -15.372 31.247 23.094  1.00 42.27 ? 3   C   B "C5'" 1 
ATOM   52   C "C4'" . C   A 1 3   ? -15.804 29.806 22.966  1.00 43.30 ? 3   C   B "C4'" 1 
ATOM   53   O "O4'" . C   A 1 3   ? -15.455 29.089 24.185  1.00 45.30 ? 3   C   B "O4'" 1 
ATOM   54   C "C3'" . C   A 1 3   ? -17.292 29.550 22.824  1.00 42.76 ? 3   C   B "C3'" 1 
ATOM   55   O "O3'" . C   A 1 3   ? -17.735 29.726 21.489  1.00 41.93 ? 3   C   B "O3'" 1 
ATOM   56   C "C2'" . C   A 1 3   ? -17.391 28.093 23.257  1.00 43.99 ? 3   C   B "C2'" 1 
ATOM   57   O "O2'" . C   A 1 3   ? -16.973 27.194 22.255  1.00 41.60 ? 3   C   B "O2'" 1 
ATOM   58   C "C1'" . C   A 1 3   ? -16.415 28.072 24.436  1.00 44.57 ? 3   C   B "C1'" 1 
ATOM   59   N N1    . C   A 1 3   ? -17.119 28.392 25.689  1.00 45.36 ? 3   C   B N1    1 
ATOM   60   C C2    . C   A 1 3   ? -17.939 27.420 26.264  1.00 46.04 ? 3   C   B C2    1 
ATOM   61   O O2    . C   A 1 3   ? -17.967 26.291 25.760  1.00 47.96 ? 3   C   B O2    1 
ATOM   62   N N3    . C   A 1 3   ? -18.674 27.731 27.353  1.00 46.26 ? 3   C   B N3    1 
ATOM   63   C C4    . C   A 1 3   ? -18.597 28.955 27.878  1.00 44.92 ? 3   C   B C4    1 
ATOM   64   N N4    . C   A 1 3   ? -19.385 29.244 28.912  1.00 43.81 ? 3   C   B N4    1 
ATOM   65   C C5    . C   A 1 3   ? -17.720 29.947 27.350  1.00 44.13 ? 3   C   B C5    1 
ATOM   66   C C6    . C   A 1 3   ? -17.008 29.626 26.264  1.00 44.68 ? 3   C   B C6    1 
ATOM   67   P P     . C   A 1 4   ? -19.291 30.017 21.206  1.00 51.09 ? 4   C   B P     1 
ATOM   68   O OP1   . C   A 1 4   ? -19.432 30.202 19.740  1.00 51.39 ? 4   C   B OP1   1 
ATOM   69   O OP2   . C   A 1 4   ? -19.775 31.074 22.131  1.00 52.06 ? 4   C   B OP2   1 
ATOM   70   O "O5'" . C   A 1 4   ? -20.023 28.670 21.642  1.00 51.73 ? 4   C   B "O5'" 1 
ATOM   71   C "C5'" . C   A 1 4   ? -19.877 27.483 20.869  1.00 52.65 ? 4   C   B "C5'" 1 
ATOM   72   C "C4'" . C   A 1 4   ? -20.890 26.460 21.294  1.00 52.61 ? 4   C   B "C4'" 1 
ATOM   73   O "O4'" . C   A 1 4   ? -20.576 26.016 22.634  1.00 54.26 ? 4   C   B "O4'" 1 
ATOM   74   C "C3'" . C   A 1 4   ? -22.323 26.952 21.391  1.00 53.18 ? 4   C   B "C3'" 1 
ATOM   75   O "O3'" . C   A 1 4   ? -22.948 26.905 20.118  1.00 53.65 ? 4   C   B "O3'" 1 
ATOM   76   C "C2'" . C   A 1 4   ? -22.921 25.931 22.348  1.00 54.64 ? 4   C   B "C2'" 1 
ATOM   77   O "O2'" . C   A 1 4   ? -23.164 24.686 21.729  1.00 56.10 ? 4   C   B "O2'" 1 
ATOM   78   C "C1'" . C   A 1 4   ? -21.773 25.755 23.340  1.00 55.01 ? 4   C   B "C1'" 1 
ATOM   79   N N1    . C   A 1 4   ? -21.864 26.712 24.449  1.00 56.57 ? 4   C   B N1    1 
ATOM   80   C C2    . C   A 1 4   ? -22.724 26.422 25.510  1.00 57.31 ? 4   C   B C2    1 
ATOM   81   O O2    . C   A 1 4   ? -23.373 25.360 25.482  1.00 58.83 ? 4   C   B O2    1 
ATOM   82   N N3    . C   A 1 4   ? -22.828 27.299 26.535  1.00 57.37 ? 4   C   B N3    1 
ATOM   83   C C4    . C   A 1 4   ? -22.110 28.422 26.527  1.00 56.01 ? 4   C   B C4    1 
ATOM   84   N N4    . C   A 1 4   ? -22.241 29.250 27.563  1.00 54.04 ? 4   C   B N4    1 
ATOM   85   C C5    . C   A 1 4   ? -21.225 28.742 25.458  1.00 57.24 ? 4   C   B C5    1 
ATOM   86   C C6    . C   A 1 4   ? -21.131 27.867 24.448  1.00 56.87 ? 4   C   B C6    1 
ATOM   87   P P     . C   A 1 5   ? -24.123 27.946 19.758  1.00 71.69 ? 5   C   B P     1 
ATOM   88   O OP1   . C   A 1 5   ? -24.483 27.738 18.331  1.00 71.18 ? 5   C   B OP1   1 
ATOM   89   O OP2   . C   A 1 5   ? -23.707 29.293 20.219  1.00 72.60 ? 5   C   B OP2   1 
ATOM   90   O "O5'" . C   A 1 5   ? -25.354 27.469 20.651  1.00 73.64 ? 5   C   B "O5'" 1 
ATOM   91   C "C5'" . C   A 1 5   ? -25.957 26.196 20.429  1.00 74.18 ? 5   C   B "C5'" 1 
ATOM   92   C "C4'" . C   A 1 5   ? -26.953 25.874 21.523  1.00 74.37 ? 5   C   B "C4'" 1 
ATOM   93   O "O4'" . C   A 1 5   ? -26.289 25.764 22.812  1.00 74.54 ? 5   C   B "O4'" 1 
ATOM   94   C "C3'" . C   A 1 5   ? -28.035 26.901 21.787  1.00 74.68 ? 5   C   B "C3'" 1 
ATOM   95   O "O3'" . C   A 1 5   ? -29.084 26.782 20.842  1.00 74.25 ? 5   C   B "O3'" 1 
ATOM   96   C "C2'" . C   A 1 5   ? -28.525 26.480 23.166  1.00 75.42 ? 5   C   B "C2'" 1 
ATOM   97   O "O2'" . C   A 1 5   ? -29.426 25.389 23.117  1.00 76.56 ? 5   C   B "O2'" 1 
ATOM   98   C "C1'" . C   A 1 5   ? -27.222 26.053 23.843  1.00 74.68 ? 5   C   B "C1'" 1 
ATOM   99   N N1    . C   A 1 5   ? -26.700 27.135 24.684  1.00 74.41 ? 5   C   B N1    1 
ATOM   100  C C2    . C   A 1 5   ? -27.151 27.228 26.014  1.00 74.31 ? 5   C   B C2    1 
ATOM   101  O O2    . C   A 1 5   ? -27.951 26.378 26.441  1.00 74.50 ? 5   C   B O2    1 
ATOM   102  N N3    . C   A 1 5   ? -26.704 28.236 26.794  1.00 74.11 ? 5   C   B N3    1 
ATOM   103  C C4    . C   A 1 5   ? -25.838 29.126 26.301  1.00 74.69 ? 5   C   B C4    1 
ATOM   104  N N4    . C   A 1 5   ? -25.425 30.110 27.108  1.00 75.82 ? 5   C   B N4    1 
ATOM   105  C C5    . C   A 1 5   ? -25.356 29.049 24.957  1.00 74.36 ? 5   C   B C5    1 
ATOM   106  C C6    . C   A 1 5   ? -25.809 28.046 24.192  1.00 73.94 ? 5   C   B C6    1 
ATOM   107  P P     . G   A 1 6   ? -30.101 28.004 20.622  1.00 78.44 ? 6   G   B P     1 
ATOM   108  O OP1   . G   A 1 6   ? -31.190 27.467 19.778  1.00 79.48 ? 6   G   B OP1   1 
ATOM   109  O OP2   . G   A 1 6   ? -29.336 29.189 20.160  1.00 77.16 ? 6   G   B OP2   1 
ATOM   110  O "O5'" . G   A 1 6   ? -30.681 28.319 22.076  1.00 79.09 ? 6   G   B "O5'" 1 
ATOM   111  C "C5'" . G   A 1 6   ? -31.465 27.353 22.759  1.00 79.60 ? 6   G   B "C5'" 1 
ATOM   112  C "C4'" . G   A 1 6   ? -32.035 27.909 24.049  1.00 80.68 ? 6   G   B "C4'" 1 
ATOM   113  O "O4'" . G   A 1 6   ? -31.017 28.131 25.059  1.00 79.71 ? 6   G   B "O4'" 1 
ATOM   114  C "C3'" . G   A 1 6   ? -32.754 29.244 24.027  1.00 81.18 ? 6   G   B "C3'" 1 
ATOM   115  O "O3'" . G   A 1 6   ? -34.034 29.141 23.408  1.00 83.01 ? 6   G   B "O3'" 1 
ATOM   116  C "C2'" . G   A 1 6   ? -32.874 29.550 25.523  1.00 80.86 ? 6   G   B "C2'" 1 
ATOM   117  O "O2'" . G   A 1 6   ? -33.986 28.927 26.141  1.00 80.21 ? 6   G   B "O2'" 1 
ATOM   118  C "C1'" . G   A 1 6   ? -31.581 28.940 26.078  1.00 79.76 ? 6   G   B "C1'" 1 
ATOM   119  N N9    . G   A 1 6   ? -30.622 29.945 26.522  1.00 78.94 ? 6   G   B N9    1 
ATOM   120  C C8    . G   A 1 6   ? -29.508 30.414 25.869  1.00 78.42 ? 6   G   B C8    1 
ATOM   121  N N7    . G   A 1 6   ? -28.872 31.336 26.544  1.00 78.23 ? 6   G   B N7    1 
ATOM   122  C C5    . G   A 1 6   ? -29.609 31.479 27.714  1.00 78.28 ? 6   G   B C5    1 
ATOM   123  C C6    . G   A 1 6   ? -29.412 32.333 28.842  1.00 78.14 ? 6   G   B C6    1 
ATOM   124  O O6    . G   A 1 6   ? -28.511 33.157 29.046  1.00 78.43 ? 6   G   B O6    1 
ATOM   125  N N1    . G   A 1 6   ? -30.403 32.151 29.800  1.00 78.15 ? 6   G   B N1    1 
ATOM   126  C C2    . G   A 1 6   ? -31.447 31.267 29.703  1.00 78.85 ? 6   G   B C2    1 
ATOM   127  N N2    . G   A 1 6   ? -32.308 31.244 30.746  1.00 78.35 ? 6   G   B N2    1 
ATOM   128  N N3    . G   A 1 6   ? -31.640 30.465 28.665  1.00 78.77 ? 6   G   B N3    1 
ATOM   129  C C4    . G   A 1 6   ? -30.689 30.625 27.716  1.00 78.59 ? 6   G   B C4    1 
ATOM   130  P P     . G   A 1 7   ? -34.945 30.459 23.244  1.00 92.04 ? 7   G   B P     1 
ATOM   131  O OP1   . G   A 1 7   ? -36.080 30.150 22.336  1.00 91.92 ? 7   G   B OP1   1 
ATOM   132  O OP2   . G   A 1 7   ? -34.047 31.606 22.930  1.00 91.34 ? 7   G   B OP2   1 
ATOM   133  O "O5'" . G   A 1 7   ? -35.531 30.660 24.710  1.00 90.37 ? 7   G   B "O5'" 1 
ATOM   134  C "C5'" . G   A 1 7   ? -35.905 31.941 25.178  1.00 87.92 ? 7   G   B "C5'" 1 
ATOM   135  C "C4'" . G   A 1 7   ? -36.115 31.898 26.667  1.00 86.61 ? 7   G   B "C4'" 1 
ATOM   136  O "O4'" . G   A 1 7   ? -34.875 31.514 27.323  1.00 85.33 ? 7   G   B "O4'" 1 
ATOM   137  C "C3'" . G   A 1 7   ? -36.458 33.241 27.277  1.00 86.45 ? 7   G   B "C3'" 1 
ATOM   138  O "O3'" . G   A 1 7   ? -37.844 33.528 27.143  1.00 86.57 ? 7   G   B "O3'" 1 
ATOM   139  C "C2'" . G   A 1 7   ? -35.997 33.059 28.712  1.00 85.55 ? 7   G   B "C2'" 1 
ATOM   140  O "O2'" . G   A 1 7   ? -36.893 32.256 29.453  1.00 84.49 ? 7   G   B "O2'" 1 
ATOM   141  C "C1'" . G   A 1 7   ? -34.686 32.304 28.489  1.00 84.85 ? 7   G   B "C1'" 1 
ATOM   142  N N9    . G   A 1 7   ? -33.538 33.179 28.253  1.00 84.05 ? 7   G   B N9    1 
ATOM   143  C C8    . G   A 1 7   ? -32.711 33.160 27.154  1.00 82.61 ? 7   G   B C8    1 
ATOM   144  N N7    . G   A 1 7   ? -31.745 34.038 27.218  1.00 82.20 ? 7   G   B N7    1 
ATOM   145  C C5    . G   A 1 7   ? -31.945 34.686 28.431  1.00 82.65 ? 7   G   B C5    1 
ATOM   146  C C6    . G   A 1 7   ? -31.206 35.735 29.049  1.00 81.78 ? 7   G   B C6    1 
ATOM   147  O O6    . G   A 1 7   ? -30.194 36.312 28.637  1.00 80.04 ? 7   G   B O6    1 
ATOM   148  N N1    . G   A 1 7   ? -31.758 36.096 30.274  1.00 82.79 ? 7   G   B N1    1 
ATOM   149  C C2    . G   A 1 7   ? -32.868 35.521 30.843  1.00 83.90 ? 7   G   B C2    1 
ATOM   150  N N2    . G   A 1 7   ? -33.226 36.004 32.043  1.00 83.57 ? 7   G   B N2    1 
ATOM   151  N N3    . G   A 1 7   ? -33.570 34.542 30.280  1.00 83.82 ? 7   G   B N3    1 
ATOM   152  C C4    . G   A 1 7   ? -33.054 34.175 29.083  1.00 83.57 ? 7   G   B C4    1 
ATOM   153  P P     . G   A 1 8   ? -38.294 34.904 26.442  1.00 83.69 ? 8   G   B P     1 
ATOM   154  O OP1   . G   A 1 8   ? -39.770 34.902 26.307  1.00 84.39 ? 8   G   B OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? -37.455 35.066 25.225  1.00 83.19 ? 8   G   B OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? -37.878 36.006 27.517  1.00 81.75 ? 8   G   B "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? -38.452 35.983 28.819  1.00 81.41 ? 8   G   B "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? -38.090 37.234 29.584  1.00 80.83 ? 8   G   B "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? -36.786 37.103 30.209  1.00 80.36 ? 8   G   B "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? -37.992 38.508 28.765  1.00 80.69 ? 8   G   B "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? -39.272 39.070 28.489  1.00 81.68 ? 8   G   B "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? -37.132 39.391 29.662  1.00 79.98 ? 8   G   B "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? -37.850 40.042 30.689  1.00 78.62 ? 8   G   B "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? -36.143 38.370 30.235  1.00 79.17 ? 8   G   B "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? -34.952 38.290 29.397  1.00 77.50 ? 8   G   B N9    1 
ATOM   166  C C8    . G   A 1 8   ? -34.785 37.512 28.276  1.00 76.23 ? 8   G   B C8    1 
ATOM   167  N N7    . G   A 1 8   ? -33.635 37.702 27.689  1.00 76.30 ? 8   G   B N7    1 
ATOM   168  C C5    . G   A 1 8   ? -32.998 38.652 28.476  1.00 76.11 ? 8   G   B C5    1 
ATOM   169  C C6    . G   A 1 8   ? -31.725 39.266 28.328  1.00 75.91 ? 8   G   B C6    1 
ATOM   170  O O6    . G   A 1 8   ? -30.885 39.097 27.435  1.00 75.93 ? 8   G   B O6    1 
ATOM   171  N N1    . G   A 1 8   ? -31.471 40.169 29.356  1.00 76.30 ? 8   G   B N1    1 
ATOM   172  C C2    . G   A 1 8   ? -32.332 40.455 30.388  1.00 76.38 ? 8   G   B C2    1 
ATOM   173  N N2    . G   A 1 8   ? -31.899 41.358 31.282  1.00 76.31 ? 8   G   B N2    1 
ATOM   174  N N3    . G   A 1 8   ? -33.527 39.899 30.531  1.00 75.64 ? 8   G   B N3    1 
ATOM   175  C C4    . G   A 1 8   ? -33.791 39.013 29.546  1.00 76.03 ? 8   G   B C4    1 
ATOM   176  P P     . G   A 1 9   ? -39.383 40.386 27.567  1.00 80.29 ? 9   G   B P     1 
ATOM   177  O OP1   . G   A 1 9   ? -40.793 40.527 27.109  1.00 80.23 ? 9   G   B OP1   1 
ATOM   178  O OP2   . G   A 1 9   ? -38.284 40.338 26.562  1.00 79.01 ? 9   G   B OP2   1 
ATOM   179  O "O5'" . G   A 1 9   ? -39.076 41.562 28.594  1.00 79.28 ? 9   G   B "O5'" 1 
ATOM   180  C "C5'" . G   A 1 9   ? -38.354 42.714 28.199  1.00 77.59 ? 9   G   B "C5'" 1 
ATOM   181  C "C4'" . G   A 1 9   ? -37.440 43.153 29.314  1.00 76.73 ? 9   G   B "C4'" 1 
ATOM   182  O "O4'" . G   A 1 9   ? -36.392 42.168 29.502  1.00 74.64 ? 9   G   B "O4'" 1 
ATOM   183  C "C3'" . G   A 1 9   ? -36.701 44.441 29.026  1.00 77.08 ? 9   G   B "C3'" 1 
ATOM   184  O "O3'" . G   A 1 9   ? -37.504 45.550 29.400  1.00 78.66 ? 9   G   B "O3'" 1 
ATOM   185  C "C2'" . G   A 1 9   ? -35.461 44.312 29.897  1.00 76.04 ? 9   G   B "C2'" 1 
ATOM   186  O "O2'" . G   A 1 9   ? -35.711 44.657 31.247  1.00 76.57 ? 9   G   B "O2'" 1 
ATOM   187  C "C1'" . G   A 1 9   ? -35.157 42.818 29.757  1.00 74.62 ? 9   G   B "C1'" 1 
ATOM   188  N N9    . G   A 1 9   ? -34.254 42.518 28.648  1.00 72.21 ? 9   G   B N9    1 
ATOM   189  C C8    . G   A 1 9   ? -34.474 41.631 27.620  1.00 70.76 ? 9   G   B C8    1 
ATOM   190  N N7    . G   A 1 9   ? -33.487 41.579 26.768  1.00 70.24 ? 9   G   B N7    1 
ATOM   191  C C5    . G   A 1 9   ? -32.558 42.489 27.257  1.00 69.83 ? 9   G   B C5    1 
ATOM   192  C C6    . G   A 1 9   ? -31.285 42.871 26.749  1.00 69.34 ? 9   G   B C6    1 
ATOM   193  O O6    . G   A 1 9   ? -30.711 42.475 25.727  1.00 67.57 ? 9   G   B O6    1 
ATOM   194  N N1    . G   A 1 9   ? -30.674 43.818 27.566  1.00 70.37 ? 9   G   B N1    1 
ATOM   195  C C2    . G   A 1 9   ? -31.213 44.335 28.724  1.00 70.78 ? 9   G   B C2    1 
ATOM   196  N N2    . G   A 1 9   ? -30.464 45.239 29.385  1.00 71.30 ? 9   G   B N2    1 
ATOM   197  N N3    . G   A 1 9   ? -32.399 43.992 29.202  1.00 70.53 ? 9   G   B N3    1 
ATOM   198  C C4    . G   A 1 9   ? -33.012 43.072 28.423  1.00 70.66 ? 9   G   B C4    1 
ATOM   199  P P     . C   A 1 10  ? -37.932 46.612 28.283  1.00 77.08 ? 10  C   B P     1 
ATOM   200  O OP1   . C   A 1 10  ? -37.901 47.967 28.903  1.00 77.71 ? 10  C   B OP1   1 
ATOM   201  O OP2   . C   A 1 10  ? -39.183 46.120 27.638  1.00 77.89 ? 10  C   B OP2   1 
ATOM   202  O "O5'" . C   A 1 10  ? -36.758 46.479 27.216  1.00 74.25 ? 10  C   B "O5'" 1 
ATOM   203  C "C5'" . C   A 1 10  ? -36.210 47.618 26.577  1.00 69.41 ? 10  C   B "C5'" 1 
ATOM   204  C "C4'" . C   A 1 10  ? -34.957 48.063 27.291  1.00 65.06 ? 10  C   B "C4'" 1 
ATOM   205  O "O4'" . C   A 1 10  ? -34.136 46.917 27.653  1.00 61.44 ? 10  C   B "O4'" 1 
ATOM   206  C "C3'" . C   A 1 10  ? -34.046 48.904 26.425  1.00 64.23 ? 10  C   B "C3'" 1 
ATOM   207  O "O3'" . C   A 1 10  ? -34.472 50.247 26.333  1.00 63.85 ? 10  C   B "O3'" 1 
ATOM   208  C "C2'" . C   A 1 10  ? -32.695 48.700 27.088  1.00 62.75 ? 10  C   B "C2'" 1 
ATOM   209  O "O2'" . C   A 1 10  ? -32.529 49.449 28.276  1.00 61.49 ? 10  C   B "O2'" 1 
ATOM   210  C "C1'" . C   A 1 10  ? -32.768 47.203 27.389  1.00 60.54 ? 10  C   B "C1'" 1 
ATOM   211  N N1    . C   A 1 10  ? -32.355 46.396 26.222  1.00 57.58 ? 10  C   B N1    1 
ATOM   212  C C2    . C   A 1 10  ? -31.013 46.428 25.803  1.00 56.69 ? 10  C   B C2    1 
ATOM   213  O O2    . C   A 1 10  ? -30.194 47.120 26.434  1.00 58.53 ? 10  C   B O2    1 
ATOM   214  N N3    . C   A 1 10  ? -30.646 45.704 24.724  1.00 55.00 ? 10  C   B N3    1 
ATOM   215  C C4    . C   A 1 10  ? -31.549 44.965 24.075  1.00 53.91 ? 10  C   B C4    1 
ATOM   216  N N4    . C   A 1 10  ? -31.142 44.267 23.009  1.00 51.70 ? 10  C   B N4    1 
ATOM   217  C C5    . C   A 1 10  ? -32.910 44.908 24.485  1.00 53.65 ? 10  C   B C5    1 
ATOM   218  C C6    . C   A 1 10  ? -33.266 45.632 25.550  1.00 55.14 ? 10  C   B C6    1 
ATOM   219  P P     . G   A 1 11  ? -34.363 50.990 24.920  1.00 64.41 ? 11  G   B P     1 
ATOM   220  O OP1   . G   A 1 11  ? -35.016 52.326 25.022  1.00 63.28 ? 11  G   B OP1   1 
ATOM   221  O OP2   . G   A 1 11  ? -34.836 50.002 23.902  1.00 63.15 ? 11  G   B OP2   1 
ATOM   222  O "O5'" . G   A 1 11  ? -32.792 51.212 24.750  1.00 62.03 ? 11  G   B "O5'" 1 
ATOM   223  C "C5'" . G   A 1 11  ? -32.076 52.009 25.691  1.00 61.18 ? 11  G   B "C5'" 1 
ATOM   224  C "C4'" . G   A 1 11  ? -30.636 52.154 25.274  1.00 60.15 ? 11  G   B "C4'" 1 
ATOM   225  O "O4'" . G   A 1 11  ? -29.972 50.870 25.399  1.00 59.10 ? 11  G   B "O4'" 1 
ATOM   226  C "C3'" . G   A 1 11  ? -30.417 52.543 23.821  1.00 60.59 ? 11  G   B "C3'" 1 
ATOM   227  O "O3'" . G   A 1 11  ? -30.548 53.949 23.604  1.00 61.83 ? 11  G   B "O3'" 1 
ATOM   228  C "C2'" . G   A 1 11  ? -29.001 52.041 23.583  1.00 59.29 ? 11  G   B "C2'" 1 
ATOM   229  O "O2'" . G   A 1 11  ? -28.020 52.900 24.128  1.00 58.00 ? 11  G   B "O2'" 1 
ATOM   230  C "C1'" . G   A 1 11  ? -29.031 50.715 24.346  1.00 57.58 ? 11  G   B "C1'" 1 
ATOM   231  N N9    . G   A 1 11  ? -29.483 49.624 23.490  1.00 54.32 ? 11  G   B N9    1 
ATOM   232  C C8    . G   A 1 11  ? -30.719 49.022 23.487  1.00 53.81 ? 11  G   B C8    1 
ATOM   233  N N7    . G   A 1 11  ? -30.836 48.095 22.573  1.00 52.53 ? 11  G   B N7    1 
ATOM   234  C C5    . G   A 1 11  ? -29.597 48.080 21.942  1.00 51.96 ? 11  G   B C5    1 
ATOM   235  C C6    . G   A 1 11  ? -29.115 47.283 20.864  1.00 50.78 ? 11  G   B C6    1 
ATOM   236  O O6    . G   A 1 11  ? -29.709 46.407 20.229  1.00 50.06 ? 11  G   B O6    1 
ATOM   237  N N1    . G   A 1 11  ? -27.800 47.596 20.543  1.00 49.76 ? 11  G   B N1    1 
ATOM   238  C C2    . G   A 1 11  ? -27.043 48.555 21.168  1.00 51.04 ? 11  G   B C2    1 
ATOM   239  N N2    . G   A 1 11  ? -25.799 48.724 20.700  1.00 51.01 ? 11  G   B N2    1 
ATOM   240  N N3    . G   A 1 11  ? -27.475 49.300 22.175  1.00 51.82 ? 11  G   B N3    1 
ATOM   241  C C4    . G   A 1 11  ? -28.750 49.013 22.505  1.00 52.50 ? 11  G   B C4    1 
ATOM   242  P P     . G   A 1 12  ? -31.037 54.494 22.162  1.00 62.36 ? 12  G   B P     1 
ATOM   243  O OP1   . G   A 1 12  ? -31.196 55.973 22.264  1.00 61.59 ? 12  G   B OP1   1 
ATOM   244  O OP2   . G   A 1 12  ? -32.174 53.656 21.684  1.00 60.73 ? 12  G   B OP2   1 
ATOM   245  O "O5'" . G   A 1 12  ? -29.805 54.204 21.196  1.00 59.91 ? 12  G   B "O5'" 1 
ATOM   246  C "C5'" . G   A 1 12  ? -28.547 54.814 21.425  1.00 58.12 ? 12  G   B "C5'" 1 
ATOM   247  C "C4'" . G   A 1 12  ? -27.527 54.236 20.490  1.00 57.33 ? 12  G   B "C4'" 1 
ATOM   248  O "O4'" . G   A 1 12  ? -27.421 52.811 20.744  1.00 58.15 ? 12  G   B "O4'" 1 
ATOM   249  C "C3'" . G   A 1 12  ? -27.912 54.287 19.026  1.00 57.48 ? 12  G   B "C3'" 1 
ATOM   250  O "O3'" . G   A 1 12  ? -27.651 55.558 18.464  1.00 57.90 ? 12  G   B "O3'" 1 
ATOM   251  C "C2'" . G   A 1 12  ? -27.024 53.199 18.443  1.00 57.28 ? 12  G   B "C2'" 1 
ATOM   252  O "O2'" . G   A 1 12  ? -25.676 53.609 18.314  1.00 56.88 ? 12  G   B "O2'" 1 
ATOM   253  C "C1'" . G   A 1 12  ? -27.129 52.130 19.532  1.00 56.34 ? 12  G   B "C1'" 1 
ATOM   254  N N9    . G   A 1 12  ? -28.199 51.172 19.267  1.00 54.11 ? 12  G   B N9    1 
ATOM   255  C C8    . G   A 1 12  ? -29.470 51.175 19.791  1.00 53.35 ? 12  G   B C8    1 
ATOM   256  N N7    . G   A 1 12  ? -30.211 50.196 19.340  1.00 53.11 ? 12  G   B N7    1 
ATOM   257  C C5    . G   A 1 12  ? -29.377 49.504 18.470  1.00 53.68 ? 12  G   B C5    1 
ATOM   258  C C6    . G   A 1 12  ? -29.624 48.346 17.675  1.00 53.21 ? 12  G   B C6    1 
ATOM   259  O O6    . G   A 1 12  ? -30.659 47.682 17.584  1.00 54.10 ? 12  G   B O6    1 
ATOM   260  N N1    . G   A 1 12  ? -28.504 47.982 16.936  1.00 52.69 ? 12  G   B N1    1 
ATOM   261  C C2    . G   A 1 12  ? -27.299 48.638 16.958  1.00 53.45 ? 12  G   B C2    1 
ATOM   262  N N2    . G   A 1 12  ? -26.338 48.140 16.169  1.00 52.95 ? 12  G   B N2    1 
ATOM   263  N N3    . G   A 1 12  ? -27.052 49.710 17.698  1.00 54.51 ? 12  G   B N3    1 
ATOM   264  C C4    . G   A 1 12  ? -28.130 50.088 18.420  1.00 54.14 ? 12  G   B C4    1 
ATOM   265  P P     . U   A 1 13  ? -28.487 56.033 17.182  1.00 61.64 ? 13  U   B P     1 
ATOM   266  O OP1   . U   A 1 13  ? -28.034 57.388 16.792  1.00 62.30 ? 13  U   B OP1   1 
ATOM   267  O OP2   . U   A 1 13  ? -29.927 55.791 17.458  1.00 61.74 ? 13  U   B OP2   1 
ATOM   268  O "O5'" . U   A 1 13  ? -28.021 55.023 16.049  1.00 59.93 ? 13  U   B "O5'" 1 
ATOM   269  C "C5'" . U   A 1 13  ? -26.674 55.005 15.607  1.00 57.13 ? 13  U   B "C5'" 1 
ATOM   270  C "C4'" . U   A 1 13  ? -26.480 53.898 14.603  1.00 57.14 ? 13  U   B "C4'" 1 
ATOM   271  O "O4'" . U   A 1 13  ? -26.696 52.606 15.241  1.00 56.76 ? 13  U   B "O4'" 1 
ATOM   272  C "C3'" . U   A 1 13  ? -27.479 53.886 13.464  1.00 55.78 ? 13  U   B "C3'" 1 
ATOM   273  O "O3'" . U   A 1 13  ? -27.149 54.851 12.473  1.00 56.52 ? 13  U   B "O3'" 1 
ATOM   274  C "C2'" . U   A 1 13  ? -27.364 52.447 12.971  1.00 54.97 ? 13  U   B "C2'" 1 
ATOM   275  O "O2'" . U   A 1 13  ? -26.218 52.195 12.178  1.00 52.96 ? 13  U   B "O2'" 1 
ATOM   276  C "C1'" . U   A 1 13  ? -27.231 51.691 14.295  1.00 55.16 ? 13  U   B "C1'" 1 
ATOM   277  N N1    . U   A 1 13  ? -28.539 51.224 14.771  1.00 54.48 ? 13  U   B N1    1 
ATOM   278  C C2    . U   A 1 13  ? -29.023 50.049 14.236  1.00 54.54 ? 13  U   B C2    1 
ATOM   279  O O2    . U   A 1 13  ? -28.390 49.382 13.434  1.00 54.18 ? 13  U   B O2    1 
ATOM   280  N N3    . U   A 1 13  ? -30.276 49.684 14.670  1.00 54.38 ? 13  U   B N3    1 
ATOM   281  C C4    . U   A 1 13  ? -31.073 50.362 15.569  1.00 54.38 ? 13  U   B C4    1 
ATOM   282  O O4    . U   A 1 13  ? -32.199 49.929 15.832  1.00 55.54 ? 13  U   B O4    1 
ATOM   283  C C5    . U   A 1 13  ? -30.489 51.559 16.096  1.00 54.48 ? 13  U   B C5    1 
ATOM   284  C C6    . U   A 1 13  ? -29.270 51.937 15.691  1.00 54.65 ? 13  U   B C6    1 
ATOM   285  P P     . U   A 1 14  ? -28.330 55.582 11.657  1.00 55.61 ? 14  U   B P     1 
ATOM   286  O OP1   . U   A 1 14  ? -27.712 56.490 10.657  1.00 54.73 ? 14  U   B OP1   1 
ATOM   287  O OP2   . U   A 1 14  ? -29.316 56.118 12.633  1.00 53.31 ? 14  U   B OP2   1 
ATOM   288  O "O5'" . U   A 1 14  ? -29.036 54.389 10.870  1.00 54.30 ? 14  U   B "O5'" 1 
ATOM   289  C "C5'" . U   A 1 14  ? -28.320 53.652 9.881   1.00 51.65 ? 14  U   B "C5'" 1 
ATOM   290  C "C4'" . U   A 1 14  ? -29.204 52.588 9.277   1.00 50.29 ? 14  U   B "C4'" 1 
ATOM   291  O "O4'" . U   A 1 14  ? -29.459 51.545 10.254  1.00 50.27 ? 14  U   B "O4'" 1 
ATOM   292  C "C3'" . U   A 1 14  ? -30.588 53.048 8.852   1.00 48.58 ? 14  U   B "C3'" 1 
ATOM   293  O "O3'" . U   A 1 14  ? -30.539 53.658 7.567   1.00 47.75 ? 14  U   B "O3'" 1 
ATOM   294  C "C2'" . U   A 1 14  ? -31.356 51.736 8.836   1.00 47.88 ? 14  U   B "C2'" 1 
ATOM   295  O "O2'" . U   A 1 14  ? -31.119 50.988 7.665   1.00 48.61 ? 14  U   B "O2'" 1 
ATOM   296  C "C1'" . U   A 1 14  ? -30.759 51.018 10.053  1.00 48.10 ? 14  U   B "C1'" 1 
ATOM   297  N N1    . U   A 1 14  ? -31.555 51.295 11.253  1.00 49.01 ? 14  U   B N1    1 
ATOM   298  C C2    . U   A 1 14  ? -32.680 50.531 11.459  1.00 47.42 ? 14  U   B C2    1 
ATOM   299  O O2    . U   A 1 14  ? -32.975 49.589 10.749  1.00 46.62 ? 14  U   B O2    1 
ATOM   300  N N3    . U   A 1 14  ? -33.448 50.910 12.528  1.00 47.84 ? 14  U   B N3    1 
ATOM   301  C C4    . U   A 1 14  ? -33.203 51.951 13.404  1.00 48.20 ? 14  U   B C4    1 
ATOM   302  O O4    . U   A 1 14  ? -34.082 52.285 14.208  1.00 50.21 ? 14  U   B O4    1 
ATOM   303  C C5    . U   A 1 14  ? -31.983 52.654 13.161  1.00 48.75 ? 14  U   B C5    1 
ATOM   304  C C6    . U   A 1 14  ? -31.217 52.310 12.121  1.00 49.40 ? 14  U   B C6    1 
ATOM   305  P P     . C   A 1 15  ? -31.427 54.969 7.267   1.00 46.23 ? 15  C   B P     1 
ATOM   306  O OP1   . C   A 1 15  ? -30.801 55.605 6.078   1.00 48.41 ? 15  C   B OP1   1 
ATOM   307  O OP2   . C   A 1 15  ? -31.572 55.757 8.518   1.00 46.27 ? 15  C   B OP2   1 
ATOM   308  O "O5'" . C   A 1 15  ? -32.855 54.368 6.866   1.00 45.90 ? 15  C   B "O5'" 1 
ATOM   309  C "C5'" . C   A 1 15  ? -33.988 55.210 6.620   1.00 44.02 ? 15  C   B "C5'" 1 
ATOM   310  C "C4'" . C   A 1 15  ? -35.255 54.375 6.477   1.00 45.47 ? 15  C   B "C4'" 1 
ATOM   311  O "O4'" . C   A 1 15  ? -35.364 53.746 5.164   1.00 44.14 ? 15  C   B "O4'" 1 
ATOM   312  C "C3'" . C   A 1 15  ? -35.399 53.232 7.476   1.00 46.30 ? 15  C   B "C3'" 1 
ATOM   313  O "O3'" . C   A 1 15  ? -35.958 53.717 8.694   1.00 47.67 ? 15  C   B "O3'" 1 
ATOM   314  C "C2'" . C   A 1 15  ? -36.371 52.279 6.781   1.00 45.33 ? 15  C   B "C2'" 1 
ATOM   315  O "O2'" . C   A 1 15  ? -37.719 52.602 7.040   1.00 44.48 ? 15  C   B "O2'" 1 
ATOM   316  C "C1'" . C   A 1 15  ? -36.074 52.525 5.298   1.00 44.43 ? 15  C   B "C1'" 1 
ATOM   317  N N1    . C   A 1 15  ? -35.351 51.455 4.591   1.00 44.63 ? 15  C   B N1    1 
ATOM   318  C C2    . C   A 1 15  ? -33.965 51.491 4.572   1.00 45.31 ? 15  C   B C2    1 
ATOM   319  O O2    . C   A 1 15  ? -33.394 52.461 5.081   1.00 47.87 ? 15  C   B O2    1 
ATOM   320  N N3    . C   A 1 15  ? -33.275 50.479 3.987   1.00 44.79 ? 15  C   B N3    1 
ATOM   321  C C4    . C   A 1 15  ? -33.931 49.467 3.427   1.00 45.98 ? 15  C   B C4    1 
ATOM   322  N N4    . C   A 1 15  ? -33.204 48.494 2.868   1.00 46.35 ? 15  C   B N4    1 
ATOM   323  C C5    . C   A 1 15  ? -35.358 49.411 3.415   1.00 45.75 ? 15  C   B C5    1 
ATOM   324  C C6    . C   A 1 15  ? -36.022 50.421 3.997   1.00 43.98 ? 15  C   B C6    1 
ATOM   325  P P     . G   A 1 16  ? -35.564 53.022 10.084  1.00 48.86 ? 16  G   B P     1 
ATOM   326  O OP1   . G   A 1 16  ? -36.354 53.667 11.166  1.00 47.88 ? 16  G   B OP1   1 
ATOM   327  O OP2   . G   A 1 16  ? -34.082 53.026 10.160  1.00 47.22 ? 16  G   B OP2   1 
ATOM   328  O "O5'" . G   A 1 16  ? -36.067 51.520 9.915   1.00 48.14 ? 16  G   B "O5'" 1 
ATOM   329  C "C5'" . G   A 1 16  ? -37.456 51.220 9.849   1.00 47.96 ? 16  G   B "C5'" 1 
ATOM   330  C "C4'" . G   A 1 16  ? -37.656 49.779 9.436   1.00 48.61 ? 16  G   B "C4'" 1 
ATOM   331  O "O4'" . G   A 1 16  ? -37.161 49.586 8.088   1.00 49.48 ? 16  G   B "O4'" 1 
ATOM   332  C "C3'" . G   A 1 16  ? -36.888 48.765 10.264  1.00 48.34 ? 16  G   B "C3'" 1 
ATOM   333  O "O3'" . G   A 1 16  ? -37.644 48.425 11.412  1.00 49.63 ? 16  G   B "O3'" 1 
ATOM   334  C "C2'" . G   A 1 16  ? -36.774 47.577 9.317   1.00 47.98 ? 16  G   B "C2'" 1 
ATOM   335  O "O2'" . G   A 1 16  ? -37.930 46.763 9.330   1.00 46.42 ? 16  G   B "O2'" 1 
ATOM   336  C "C1'" . G   A 1 16  ? -36.628 48.277 7.961   1.00 47.96 ? 16  G   B "C1'" 1 
ATOM   337  N N9    . G   A 1 16  ? -35.248 48.381 7.496   1.00 44.99 ? 16  G   B N9    1 
ATOM   338  C C8    . G   A 1 16  ? -34.344 49.373 7.781   1.00 43.77 ? 16  G   B C8    1 
ATOM   339  N N7    . G   A 1 16  ? -33.171 49.163 7.246   1.00 45.21 ? 16  G   B N7    1 
ATOM   340  C C5    . G   A 1 16  ? -33.316 47.967 6.560   1.00 45.82 ? 16  G   B C5    1 
ATOM   341  C C6    . G   A 1 16  ? -32.378 47.225 5.791   1.00 46.41 ? 16  G   B C6    1 
ATOM   342  O O6    . G   A 1 16  ? -31.199 47.499 5.541   1.00 48.66 ? 16  G   B O6    1 
ATOM   343  N N1    . G   A 1 16  ? -32.939 46.056 5.286   1.00 45.90 ? 16  G   B N1    1 
ATOM   344  C C2    . G   A 1 16  ? -34.241 45.661 5.484   1.00 46.48 ? 16  G   B C2    1 
ATOM   345  N N2    . G   A 1 16  ? -34.599 44.493 4.932   1.00 48.13 ? 16  G   B N2    1 
ATOM   346  N N3    . G   A 1 16  ? -35.127 46.356 6.180   1.00 45.30 ? 16  G   B N3    1 
ATOM   347  C C4    . G   A 1 16  ? -34.597 47.480 6.693   1.00 44.87 ? 16  G   B C4    1 
ATOM   348  P P     . A   A 1 17  ? -36.918 48.305 12.833  1.00 53.15 ? 17  A   B P     1 
ATOM   349  O OP1   . A   A 1 17  ? -37.993 48.114 13.834  1.00 55.50 ? 17  A   B OP1   1 
ATOM   350  O OP2   . A   A 1 17  ? -35.982 49.445 12.970  1.00 50.62 ? 17  A   B OP2   1 
ATOM   351  O "O5'" . A   A 1 17  ? -36.109 46.940 12.727  1.00 52.77 ? 17  A   B "O5'" 1 
ATOM   352  C "C5'" . A   A 1 17  ? -36.810 45.704 12.688  1.00 56.19 ? 17  A   B "C5'" 1 
ATOM   353  C "C4'" . A   A 1 17  ? -35.998 44.626 13.353  1.00 58.37 ? 17  A   B "C4'" 1 
ATOM   354  O "O4'" . A   A 1 17  ? -34.767 44.466 12.602  1.00 60.27 ? 17  A   B "O4'" 1 
ATOM   355  C "C3'" . A   A 1 17  ? -35.552 44.909 14.781  1.00 60.23 ? 17  A   B "C3'" 1 
ATOM   356  O "O3'" . A   A 1 17  ? -36.581 44.648 15.754  1.00 60.54 ? 17  A   B "O3'" 1 
ATOM   357  C "C2'" . A   A 1 17  ? -34.259 44.105 14.909  1.00 61.45 ? 17  A   B "C2'" 1 
ATOM   358  O "O2'" . A   A 1 17  ? -34.422 42.739 15.223  1.00 66.54 ? 17  A   B "O2'" 1 
ATOM   359  C "C1'" . A   A 1 17  ? -33.699 44.185 13.488  1.00 59.71 ? 17  A   B "C1'" 1 
ATOM   360  N N9    . A   A 1 17  ? -32.644 45.178 13.293  1.00 56.70 ? 17  A   B N9    1 
ATOM   361  C C8    . A   A 1 17  ? -32.535 46.453 13.796  1.00 55.08 ? 17  A   B C8    1 
ATOM   362  N N7    . A   A 1 17  ? -31.444 47.074 13.421  1.00 53.87 ? 17  A   B N7    1 
ATOM   363  C C5    . A   A 1 17  ? -30.794 46.149 12.612  1.00 55.46 ? 17  A   B C5    1 
ATOM   364  C C6    . A   A 1 17  ? -29.583 46.195 11.892  1.00 54.70 ? 17  A   B C6    1 
ATOM   365  N N6    . A   A 1 17  ? -28.764 47.251 11.879  1.00 54.96 ? 17  A   B N6    1 
ATOM   366  N N1    . A   A 1 17  ? -29.233 45.098 11.179  1.00 54.43 ? 17  A   B N1    1 
ATOM   367  C C2    . A   A 1 17  ? -30.039 44.031 11.207  1.00 53.68 ? 17  A   B C2    1 
ATOM   368  N N3    . A   A 1 17  ? -31.191 43.865 11.846  1.00 54.61 ? 17  A   B N3    1 
ATOM   369  C C4    . A   A 1 17  ? -31.519 44.976 12.533  1.00 55.70 ? 17  A   B C4    1 
ATOM   370  P P     . U   A 1 18  ? -37.225 43.164 15.914  1.00 87.77 ? 18  U   B P     1 
ATOM   371  O OP1   . U   A 1 18  ? -37.588 42.636 14.567  1.00 89.45 ? 18  U   B OP1   1 
ATOM   372  O OP2   . U   A 1 18  ? -38.273 43.260 16.961  1.00 87.87 ? 18  U   B OP2   1 
ATOM   373  O "O5'" . U   A 1 18  ? -36.065 42.239 16.495  1.00 88.83 ? 18  U   B "O5'" 1 
ATOM   374  C "C5'" . U   A 1 18  ? -36.086 41.749 17.838  1.00 88.47 ? 18  U   B "C5'" 1 
ATOM   375  C "C4'" . U   A 1 18  ? -35.471 40.368 17.893  1.00 88.78 ? 18  U   B "C4'" 1 
ATOM   376  O "O4'" . U   A 1 18  ? -36.417 39.392 17.387  1.00 88.68 ? 18  U   B "O4'" 1 
ATOM   377  C "C3'" . U   A 1 18  ? -34.226 40.189 17.033  1.00 89.35 ? 18  U   B "C3'" 1 
ATOM   378  O "O3'" . U   A 1 18  ? -33.051 40.626 17.732  1.00 89.59 ? 18  U   B "O3'" 1 
ATOM   379  C "C2'" . U   A 1 18  ? -34.229 38.686 16.736  1.00 88.93 ? 18  U   B "C2'" 1 
ATOM   380  O "O2'" . U   A 1 18  ? -33.631 37.896 17.746  1.00 89.49 ? 18  U   B "O2'" 1 
ATOM   381  C "C1'" . U   A 1 18  ? -35.728 38.371 16.686  1.00 88.41 ? 18  U   B "C1'" 1 
ATOM   382  N N1    . U   A 1 18  ? -36.305 38.257 15.337  1.00 88.68 ? 18  U   B N1    1 
ATOM   383  C C2    . U   A 1 18  ? -35.944 37.160 14.556  1.00 88.29 ? 18  U   B C2    1 
ATOM   384  O O2    . U   A 1 18  ? -35.170 36.297 14.934  1.00 88.21 ? 18  U   B O2    1 
ATOM   385  N N3    . U   A 1 18  ? -36.532 37.113 13.314  1.00 87.69 ? 18  U   B N3    1 
ATOM   386  C C4    . U   A 1 18  ? -37.431 38.022 12.781  1.00 87.73 ? 18  U   B C4    1 
ATOM   387  O O4    . U   A 1 18  ? -37.888 37.830 11.654  1.00 86.72 ? 18  U   B O4    1 
ATOM   388  C C5    . U   A 1 18  ? -37.754 39.125 13.643  1.00 88.02 ? 18  U   B C5    1 
ATOM   389  C C6    . U   A 1 18  ? -37.191 39.205 14.859  1.00 88.83 ? 18  U   B C6    1 
ATOM   390  P P     . U   A 1 19  ? -31.846 41.331 16.923  1.00 70.59 ? 19  U   B P     1 
ATOM   391  O OP1   . U   A 1 19  ? -30.584 41.169 17.694  1.00 71.26 ? 19  U   B OP1   1 
ATOM   392  O OP2   . U   A 1 19  ? -32.290 42.695 16.536  1.00 69.29 ? 19  U   B OP2   1 
ATOM   393  O "O5'" . U   A 1 19  ? -31.724 40.443 15.608  1.00 71.07 ? 19  U   B "O5'" 1 
ATOM   394  C "C5'" . U   A 1 19  ? -31.007 39.207 15.612  1.00 71.98 ? 19  U   B "C5'" 1 
ATOM   395  C "C4'" . U   A 1 19  ? -30.720 38.804 14.195  1.00 73.17 ? 19  U   B "C4'" 1 
ATOM   396  O "O4'" . U   A 1 19  ? -31.963 38.443 13.548  1.00 73.00 ? 19  U   B "O4'" 1 
ATOM   397  C "C3'" . U   A 1 19  ? -30.176 39.970 13.390  1.00 74.72 ? 19  U   B "C3'" 1 
ATOM   398  O "O3'" . U   A 1 19  ? -28.762 40.108 13.597  1.00 77.39 ? 19  U   B "O3'" 1 
ATOM   399  C "C2'" . U   A 1 19  ? -30.703 39.749 11.969  1.00 74.42 ? 19  U   B "C2'" 1 
ATOM   400  O "O2'" . U   A 1 19  ? -29.853 39.046 11.085  1.00 74.32 ? 19  U   B "O2'" 1 
ATOM   401  C "C1'" . U   A 1 19  ? -31.988 38.951 12.224  1.00 74.48 ? 19  U   B "C1'" 1 
ATOM   402  N N1    . U   A 1 19  ? -33.259 39.670 12.034  1.00 75.20 ? 19  U   B N1    1 
ATOM   403  C C2    . U   A 1 19  ? -33.872 39.576 10.793  1.00 74.80 ? 19  U   B C2    1 
ATOM   404  O O2    . U   A 1 19  ? -33.376 38.976 9.856   1.00 74.13 ? 19  U   B O2    1 
ATOM   405  N N3    . U   A 1 19  ? -35.088 40.212 10.696  1.00 75.07 ? 19  U   B N3    1 
ATOM   406  C C4    . U   A 1 19  ? -35.737 40.927 11.691  1.00 75.77 ? 19  U   B C4    1 
ATOM   407  O O4    . U   A 1 19  ? -36.874 41.363 11.484  1.00 75.99 ? 19  U   B O4    1 
ATOM   408  C C5    . U   A 1 19  ? -35.021 41.009 12.931  1.00 75.02 ? 19  U   B C5    1 
ATOM   409  C C6    . U   A 1 19  ? -33.837 40.393 13.058  1.00 75.51 ? 19  U   B C6    1 
ATOM   410  P P     . C   A 1 20  ? -27.746 38.925 13.180  1.00 66.61 ? 20  C   B P     1 
ATOM   411  O OP1   . C   A 1 20  ? -28.450 37.833 12.464  1.00 70.51 ? 20  C   B OP1   1 
ATOM   412  O OP2   . C   A 1 20  ? -26.957 38.604 14.396  1.00 66.16 ? 20  C   B OP2   1 
ATOM   413  O "O5'" . C   A 1 20  ? -26.765 39.644 12.158  1.00 64.99 ? 20  C   B "O5'" 1 
ATOM   414  C "C5'" . C   A 1 20  ? -25.522 40.131 12.619  1.00 61.09 ? 20  C   B "C5'" 1 
ATOM   415  C "C4'" . C   A 1 20  ? -25.323 41.584 12.247  1.00 56.41 ? 20  C   B "C4'" 1 
ATOM   416  O "O4'" . C   A 1 20  ? -26.570 42.301 12.064  1.00 54.38 ? 20  C   B "O4'" 1 
ATOM   417  C "C3'" . C   A 1 20  ? -24.665 42.338 13.376  1.00 55.73 ? 20  C   B "C3'" 1 
ATOM   418  O "O3'" . C   A 1 20  ? -23.303 42.005 13.463  1.00 53.29 ? 20  C   B "O3'" 1 
ATOM   419  C "C2'" . C   A 1 20  ? -24.985 43.783 13.042  1.00 54.64 ? 20  C   B "C2'" 1 
ATOM   420  O "O2'" . C   A 1 20  ? -24.144 44.339 12.056  1.00 56.61 ? 20  C   B "O2'" 1 
ATOM   421  C "C1'" . C   A 1 20  ? -26.414 43.639 12.523  1.00 51.83 ? 20  C   B "C1'" 1 
ATOM   422  N N1    . C   A 1 20  ? -27.409 43.884 13.573  1.00 49.55 ? 20  C   B N1    1 
ATOM   423  C C2    . C   A 1 20  ? -27.431 45.138 14.197  1.00 49.83 ? 20  C   B C2    1 
ATOM   424  O O2    . C   A 1 20  ? -26.574 45.975 13.886  1.00 48.83 ? 20  C   B O2    1 
ATOM   425  N N3    . C   A 1 20  ? -28.381 45.403 15.125  1.00 49.42 ? 20  C   B N3    1 
ATOM   426  C C4    . C   A 1 20  ? -29.277 44.465 15.446  1.00 49.13 ? 20  C   B C4    1 
ATOM   427  N N4    . C   A 1 20  ? -30.205 44.777 16.362  1.00 48.76 ? 20  C   B N4    1 
ATOM   428  C C5    . C   A 1 20  ? -29.260 43.166 14.844  1.00 48.60 ? 20  C   B C5    1 
ATOM   429  C C6    . C   A 1 20  ? -28.315 42.922 13.925  1.00 48.44 ? 20  C   B C6    1 
ATOM   430  P P     . C   A 1 21  ? -22.751 41.392 14.831  1.00 50.65 ? 21  C   B P     1 
ATOM   431  O OP1   . C   A 1 21  ? -21.522 40.603 14.543  1.00 49.61 ? 21  C   B OP1   1 
ATOM   432  O OP2   . C   A 1 21  ? -23.897 40.734 15.520  1.00 51.77 ? 21  C   B OP2   1 
ATOM   433  O "O5'" . C   A 1 21  ? -22.366 42.712 15.632  1.00 50.65 ? 21  C   B "O5'" 1 
ATOM   434  C "C5'" . C   A 1 21  ? -21.514 43.674 15.028  1.00 48.39 ? 21  C   B "C5'" 1 
ATOM   435  C "C4'" . C   A 1 21  ? -21.472 44.919 15.855  1.00 45.74 ? 21  C   B "C4'" 1 
ATOM   436  O "O4'" . C   A 1 21  ? -22.739 45.600 15.759  1.00 47.49 ? 21  C   B "O4'" 1 
ATOM   437  C "C3'" . C   A 1 21  ? -21.287 44.676 17.333  1.00 45.21 ? 21  C   B "C3'" 1 
ATOM   438  O "O3'" . C   A 1 21  ? -19.908 44.487 17.587  1.00 44.02 ? 21  C   B "O3'" 1 
ATOM   439  C "C2'" . C   A 1 21  ? -21.862 45.956 17.930  1.00 46.77 ? 21  C   B "C2'" 1 
ATOM   440  O "O2'" . C   A 1 21  ? -20.995 47.070 17.828  1.00 44.62 ? 21  C   B "O2'" 1 
ATOM   441  C "C1'" . C   A 1 21  ? -23.057 46.193 17.006  1.00 46.21 ? 21  C   B "C1'" 1 
ATOM   442  N N1    . C   A 1 21  ? -24.331 45.619 17.467  1.00 45.73 ? 21  C   B N1    1 
ATOM   443  C C2    . C   A 1 21  ? -25.129 46.365 18.333  1.00 46.09 ? 21  C   B C2    1 
ATOM   444  O O2    . C   A 1 21  ? -24.711 47.461 18.724  1.00 47.02 ? 21  C   B O2    1 
ATOM   445  N N3    . C   A 1 21  ? -26.333 45.873 18.720  1.00 46.30 ? 21  C   B N3    1 
ATOM   446  C C4    . C   A 1 21  ? -26.736 44.679 18.273  1.00 46.36 ? 21  C   B C4    1 
ATOM   447  N N4    . C   A 1 21  ? -27.935 44.238 18.657  1.00 47.26 ? 21  C   B N4    1 
ATOM   448  C C5    . C   A 1 21  ? -25.926 43.884 17.407  1.00 45.20 ? 21  C   B C5    1 
ATOM   449  C C6    . C   A 1 21  ? -24.741 44.386 17.037  1.00 45.15 ? 21  C   B C6    1 
ATOM   450  P P     . G   A 1 22  ? -19.445 43.541 18.792  1.00 46.86 ? 22  G   B P     1 
ATOM   451  O OP1   . G   A 1 22  ? -17.962 43.417 18.692  1.00 46.87 ? 22  G   B OP1   1 
ATOM   452  O OP2   . G   A 1 22  ? -20.284 42.312 18.820  1.00 44.55 ? 22  G   B OP2   1 
ATOM   453  O "O5'" . G   A 1 22  ? -19.817 44.413 20.071  1.00 48.12 ? 22  G   B "O5'" 1 
ATOM   454  C "C5'" . G   A 1 22  ? -20.662 43.903 21.084  1.00 45.86 ? 22  G   B "C5'" 1 
ATOM   455  C "C4'" . G   A 1 22  ? -21.232 45.034 21.893  1.00 45.75 ? 22  G   B "C4'" 1 
ATOM   456  O "O4'" . G   A 1 22  ? -22.321 45.667 21.168  1.00 45.27 ? 22  G   B "O4'" 1 
ATOM   457  C "C3'" . G   A 1 22  ? -21.881 44.592 23.186  1.00 45.21 ? 22  G   B "C3'" 1 
ATOM   458  O "O3'" . G   A 1 22  ? -20.869 44.445 24.153  1.00 48.59 ? 22  G   B "O3'" 1 
ATOM   459  C "C2'" . G   A 1 22  ? -22.806 45.758 23.487  1.00 44.47 ? 22  G   B "C2'" 1 
ATOM   460  O "O2'" . G   A 1 22  ? -22.135 46.883 24.012  1.00 41.79 ? 22  G   B "O2'" 1 
ATOM   461  C "C1'" . G   A 1 22  ? -23.332 46.070 22.086  1.00 44.32 ? 22  G   B "C1'" 1 
ATOM   462  N N9    . G   A 1 22  ? -24.522 45.269 21.834  1.00 43.78 ? 22  G   B N9    1 
ATOM   463  C C8    . G   A 1 22  ? -24.647 44.209 20.968  1.00 44.09 ? 22  G   B C8    1 
ATOM   464  N N7    . G   A 1 22  ? -25.824 43.647 21.015  1.00 42.49 ? 22  G   B N7    1 
ATOM   465  C C5    . G   A 1 22  ? -26.524 44.391 21.956  1.00 42.80 ? 22  G   B C5    1 
ATOM   466  C C6    . G   A 1 22  ? -27.851 44.252 22.437  1.00 42.34 ? 22  G   B C6    1 
ATOM   467  O O6    . G   A 1 22  ? -28.702 43.413 22.122  1.00 42.54 ? 22  G   B O6    1 
ATOM   468  N N1    . G   A 1 22  ? -28.155 45.224 23.385  1.00 41.13 ? 22  G   B N1    1 
ATOM   469  C C2    . G   A 1 22  ? -27.300 46.203 23.814  1.00 39.97 ? 22  G   B C2    1 
ATOM   470  N N2    . G   A 1 22  ? -27.792 47.050 24.720  1.00 42.54 ? 22  G   B N2    1 
ATOM   471  N N3    . G   A 1 22  ? -26.058 46.342 23.381  1.00 41.45 ? 22  G   B N3    1 
ATOM   472  C C4    . G   A 1 22  ? -25.739 45.406 22.458  1.00 43.01 ? 22  G   B C4    1 
ATOM   473  P P     . C   A 1 23  ? -21.119 43.505 25.415  1.00 60.10 ? 23  C   B P     1 
ATOM   474  O OP1   . C   A 1 23  ? -19.831 43.413 26.161  1.00 57.24 ? 23  C   B OP1   1 
ATOM   475  O OP2   . C   A 1 23  ? -21.794 42.267 24.933  1.00 59.12 ? 23  C   B OP2   1 
ATOM   476  O "O5'" . C   A 1 23  ? -22.145 44.353 26.266  1.00 59.25 ? 23  C   B "O5'" 1 
ATOM   477  C "C5'" . C   A 1 23  ? -21.808 45.664 26.666  1.00 61.14 ? 23  C   B "C5'" 1 
ATOM   478  C "C4'" . C   A 1 23  ? -22.838 46.167 27.624  1.00 62.59 ? 23  C   B "C4'" 1 
ATOM   479  O "O4'" . C   A 1 23  ? -24.052 46.539 26.911  1.00 62.62 ? 23  C   B "O4'" 1 
ATOM   480  C "C3'" . C   A 1 23  ? -23.316 45.102 28.584  1.00 63.09 ? 23  C   B "C3'" 1 
ATOM   481  O "O3'" . C   A 1 23  ? -22.370 44.878 29.615  1.00 66.33 ? 23  C   B "O3'" 1 
ATOM   482  C "C2'" . C   A 1 23  ? -24.641 45.696 29.035  1.00 62.68 ? 23  C   B "C2'" 1 
ATOM   483  O "O2'" . C   A 1 23  ? -24.456 46.780 29.926  1.00 63.67 ? 23  C   B "O2'" 1 
ATOM   484  C "C1'" . C   A 1 23  ? -25.185 46.210 27.698  1.00 61.43 ? 23  C   B "C1'" 1 
ATOM   485  N N1    . C   A 1 23  ? -25.924 45.161 26.991  1.00 59.95 ? 23  C   B N1    1 
ATOM   486  C C2    . C   A 1 23  ? -27.300 45.077 27.165  1.00 59.91 ? 23  C   B C2    1 
ATOM   487  O O2    . C   A 1 23  ? -27.869 45.929 27.876  1.00 59.29 ? 23  C   B O2    1 
ATOM   488  N N3    . C   A 1 23  ? -27.978 44.077 26.553  1.00 59.75 ? 23  C   B N3    1 
ATOM   489  C C4    . C   A 1 23  ? -27.326 43.198 25.783  1.00 59.56 ? 23  C   B C4    1 
ATOM   490  N N4    . C   A 1 23  ? -28.031 42.223 25.199  1.00 60.04 ? 23  C   B N4    1 
ATOM   491  C C5    . C   A 1 23  ? -25.923 43.277 25.577  1.00 58.93 ? 23  C   B C5    1 
ATOM   492  C C6    . C   A 1 23  ? -25.269 44.265 26.191  1.00 60.20 ? 23  C   B C6    1 
ATOM   493  P P     . C   A 1 24  ? -22.726 43.862 30.798  1.00 71.64 ? 24  C   B P     1 
ATOM   494  O OP1   . C   A 1 24  ? -21.484 43.462 31.511  1.00 71.47 ? 24  C   B OP1   1 
ATOM   495  O OP2   . C   A 1 24  ? -23.623 42.813 30.251  1.00 70.57 ? 24  C   B OP2   1 
ATOM   496  O "O5'" . C   A 1 24  ? -23.573 44.796 31.763  1.00 71.47 ? 24  C   B "O5'" 1 
ATOM   497  C "C5'" . C   A 1 24  ? -24.094 44.279 32.961  1.00 71.81 ? 24  C   B "C5'" 1 
ATOM   498  C "C4'" . C   A 1 24  ? -25.504 44.754 33.180  1.00 71.13 ? 24  C   B "C4'" 1 
ATOM   499  O "O4'" . C   A 1 24  ? -26.218 44.961 31.930  1.00 69.98 ? 24  C   B "O4'" 1 
ATOM   500  C "C3'" . C   A 1 24  ? -26.302 43.679 33.871  1.00 71.60 ? 24  C   B "C3'" 1 
ATOM   501  O "O3'" . C   A 1 24  ? -25.949 43.641 35.237  1.00 73.83 ? 24  C   B "O3'" 1 
ATOM   502  C "C2'" . C   A 1 24  ? -27.734 44.058 33.521  1.00 69.94 ? 24  C   B "C2'" 1 
ATOM   503  O "O2'" . C   A 1 24  ? -28.233 45.133 34.288  1.00 69.76 ? 24  C   B "O2'" 1 
ATOM   504  C "C1'" . C   A 1 24  ? -27.558 44.498 32.065  1.00 68.79 ? 24  C   B "C1'" 1 
ATOM   505  N N1    . C   A 1 24  ? -27.763 43.412 31.092  1.00 66.15 ? 24  C   B N1    1 
ATOM   506  C C2    . C   A 1 24  ? -29.044 42.871 30.936  1.00 63.77 ? 24  C   B C2    1 
ATOM   507  O O2    . C   A 1 24  ? -29.963 43.286 31.653  1.00 60.84 ? 24  C   B O2    1 
ATOM   508  N N3    . C   A 1 24  ? -29.245 41.911 30.004  1.00 62.82 ? 24  C   B N3    1 
ATOM   509  C C4    . C   A 1 24  ? -28.227 41.489 29.250  1.00 62.95 ? 24  C   B C4    1 
ATOM   510  N N4    . C   A 1 24  ? -28.475 40.566 28.324  1.00 62.00 ? 24  C   B N4    1 
ATOM   511  C C5    . C   A 1 24  ? -26.909 42.002 29.408  1.00 64.23 ? 24  C   B C5    1 
ATOM   512  C C6    . C   A 1 24  ? -26.723 42.951 30.335  1.00 65.36 ? 24  C   B C6    1 
ATOM   513  P P     . C   A 1 25  ? -25.339 42.284 35.842  1.00 83.31 ? 25  C   B P     1 
ATOM   514  O OP1   . C   A 1 25  ? -24.275 42.628 36.824  1.00 82.77 ? 25  C   B OP1   1 
ATOM   515  O OP2   . C   A 1 25  ? -25.027 41.355 34.718  1.00 80.08 ? 25  C   B OP2   1 
ATOM   516  O "O5'" . C   A 1 25  ? -26.585 41.689 36.625  1.00 82.34 ? 25  C   B "O5'" 1 
ATOM   517  C "C5'" . C   A 1 25  ? -27.061 40.395 36.343  1.00 82.61 ? 25  C   B "C5'" 1 
ATOM   518  C "C4'" . C   A 1 25  ? -28.554 40.353 36.494  1.00 82.45 ? 25  C   B "C4'" 1 
ATOM   519  O "O4'" . C   A 1 25  ? -29.187 41.037 35.380  1.00 81.18 ? 25  C   B "O4'" 1 
ATOM   520  C "C3'" . C   A 1 25  ? -29.090 38.938 36.446  1.00 82.88 ? 25  C   B "C3'" 1 
ATOM   521  O "O3'" . C   A 1 25  ? -29.046 38.416 37.766  1.00 84.97 ? 25  C   B "O3'" 1 
ATOM   522  C "C2'" . C   A 1 25  ? -30.492 39.142 35.895  1.00 81.64 ? 25  C   B "C2'" 1 
ATOM   523  O "O2'" . C   A 1 25  ? -31.391 39.640 36.870  1.00 82.57 ? 25  C   B "O2'" 1 
ATOM   524  C "C1'" . C   A 1 25  ? -30.223 40.227 34.854  1.00 80.01 ? 25  C   B "C1'" 1 
ATOM   525  N N1    . C   A 1 25  ? -29.731 39.688 33.584  1.00 77.55 ? 25  C   B N1    1 
ATOM   526  C C2    . C   A 1 25  ? -30.595 38.943 32.776  1.00 76.11 ? 25  C   B C2    1 
ATOM   527  O O2    . C   A 1 25  ? -31.749 38.726 33.170  1.00 75.03 ? 25  C   B O2    1 
ATOM   528  N N3    . C   A 1 25  ? -30.145 38.473 31.588  1.00 75.39 ? 25  C   B N3    1 
ATOM   529  C C4    . C   A 1 25  ? -28.887 38.712 31.209  1.00 75.42 ? 25  C   B C4    1 
ATOM   530  N N4    . C   A 1 25  ? -28.488 38.228 30.031  1.00 75.39 ? 25  C   B N4    1 
ATOM   531  C C5    . C   A 1 25  ? -27.982 39.456 32.022  1.00 76.45 ? 25  C   B C5    1 
ATOM   532  C C6    . C   A 1 25  ? -28.442 39.919 33.190  1.00 77.21 ? 25  C   B C6    1 
ATOM   533  P P     . U   A 1 26  ? -28.079 37.174 38.096  1.00 87.65 ? 26  U   B P     1 
ATOM   534  O OP1   . U   A 1 26  ? -28.078 36.982 39.575  1.00 87.50 ? 26  U   B OP1   1 
ATOM   535  O OP2   . U   A 1 26  ? -26.783 37.384 37.386  1.00 86.61 ? 26  U   B OP2   1 
ATOM   536  O "O5'" . U   A 1 26  ? -28.846 35.959 37.408  1.00 86.32 ? 26  U   B "O5'" 1 
ATOM   537  C "C5'" . U   A 1 26  ? -30.251 35.830 37.553  1.00 84.94 ? 26  U   B "C5'" 1 
ATOM   538  C "C4'" . U   A 1 26  ? -30.820 35.014 36.426  1.00 84.50 ? 26  U   B "C4'" 1 
ATOM   539  O "O4'" . U   A 1 26  ? -30.747 35.759 35.184  1.00 83.79 ? 26  U   B "O4'" 1 
ATOM   540  C "C3'" . U   A 1 26  ? -30.080 33.730 36.091  1.00 84.37 ? 26  U   B "C3'" 1 
ATOM   541  O "O3'" . U   A 1 26  ? -30.370 32.680 37.007  1.00 85.95 ? 26  U   B "O3'" 1 
ATOM   542  C "C2'" . U   A 1 26  ? -30.613 33.433 34.696  1.00 83.91 ? 26  U   B "C2'" 1 
ATOM   543  O "O2'" . U   A 1 26  ? -31.900 32.844 34.707  1.00 83.33 ? 26  U   B "O2'" 1 
ATOM   544  C "C1'" . U   A 1 26  ? -30.673 34.841 34.097  1.00 83.46 ? 26  U   B "C1'" 1 
ATOM   545  N N1    . U   A 1 26  ? -29.464 35.121 33.312  1.00 82.54 ? 26  U   B N1    1 
ATOM   546  C C2    . U   A 1 26  ? -29.450 34.685 31.998  1.00 82.10 ? 26  U   B C2    1 
ATOM   547  O O2    . U   A 1 26  ? -30.395 34.115 31.484  1.00 83.32 ? 26  U   B O2    1 
ATOM   548  N N3    . U   A 1 26  ? -28.291 34.934 31.312  1.00 80.68 ? 26  U   B N3    1 
ATOM   549  C C4    . U   A 1 26  ? -27.168 35.563 31.792  1.00 80.18 ? 26  U   B C4    1 
ATOM   550  O O4    . U   A 1 26  ? -26.188 35.689 31.057  1.00 78.42 ? 26  U   B O4    1 
ATOM   551  C C5    . U   A 1 26  ? -27.261 35.999 33.158  1.00 81.02 ? 26  U   B C5    1 
ATOM   552  C C6    . U   A 1 26  ? -28.380 35.769 33.853  1.00 81.57 ? 26  U   B C6    1 
ATOM   553  P P     . G   A 1 27  ? -29.283 31.516 37.258  1.00 89.17 ? 27  G   B P     1 
ATOM   554  O OP1   . G   A 1 27  ? -29.323 31.122 38.693  1.00 87.93 ? 27  G   B OP1   1 
ATOM   555  O OP2   . G   A 1 27  ? -27.995 31.972 36.662  1.00 88.23 ? 27  G   B OP2   1 
ATOM   556  O "O5'" . G   A 1 27  ? -29.833 30.300 36.383  1.00 86.80 ? 27  G   B "O5'" 1 
ATOM   557  C "C5'" . G   A 1 27  ? -31.089 29.701 36.670  1.00 84.88 ? 27  G   B "C5'" 1 
ATOM   558  C "C4'" . G   A 1 27  ? -31.444 28.701 35.596  1.00 85.39 ? 27  G   B "C4'" 1 
ATOM   559  O "O4'" . G   A 1 27  ? -31.776 29.399 34.362  1.00 84.88 ? 27  G   B "O4'" 1 
ATOM   560  C "C3'" . G   A 1 27  ? -30.318 27.773 35.178  1.00 85.82 ? 27  G   B "C3'" 1 
ATOM   561  O "O3'" . G   A 1 27  ? -30.091 26.696 36.075  1.00 86.80 ? 27  G   B "O3'" 1 
ATOM   562  C "C2'" . G   A 1 27  ? -30.782 27.332 33.800  1.00 84.97 ? 27  G   B "C2'" 1 
ATOM   563  O "O2'" . G   A 1 27  ? -31.839 26.393 33.839  1.00 85.00 ? 27  G   B "O2'" 1 
ATOM   564  C "C1'" . G   A 1 27  ? -31.278 28.665 33.247  1.00 84.73 ? 27  G   B "C1'" 1 
ATOM   565  N N9    . G   A 1 27  ? -30.162 29.410 32.671  1.00 84.05 ? 27  G   B N9    1 
ATOM   566  C C8    . G   A 1 27  ? -29.520 30.497 33.215  1.00 83.67 ? 27  G   B C8    1 
ATOM   567  N N7    . G   A 1 27  ? -28.525 30.925 32.485  1.00 83.05 ? 27  G   B N7    1 
ATOM   568  C C5    . G   A 1 27  ? -28.515 30.075 31.387  1.00 82.83 ? 27  G   B C5    1 
ATOM   569  C C6    . G   A 1 27  ? -27.658 30.043 30.260  1.00 81.98 ? 27  G   B C6    1 
ATOM   570  O O6    . G   A 1 27  ? -26.707 30.785 29.995  1.00 80.23 ? 27  G   B O6    1 
ATOM   571  N N1    . G   A 1 27  ? -28.000 29.014 29.385  1.00 82.33 ? 27  G   B N1    1 
ATOM   572  C C2    . G   A 1 27  ? -29.035 28.130 29.568  1.00 82.51 ? 27  G   B C2    1 
ATOM   573  N N2    . G   A 1 27  ? -29.207 27.214 28.603  1.00 81.55 ? 27  G   B N2    1 
ATOM   574  N N3    . G   A 1 27  ? -29.841 28.147 30.617  1.00 82.40 ? 27  G   B N3    1 
ATOM   575  C C4    . G   A 1 27  ? -29.525 29.138 31.481  1.00 83.22 ? 27  G   B C4    1 
ATOM   576  P P     . G   A 1 28  ? -28.577 26.226 36.360  1.00 86.49 ? 28  G   B P     1 
ATOM   577  O OP1   . G   A 1 28  ? -28.509 25.591 37.704  1.00 87.57 ? 28  G   B OP1   1 
ATOM   578  O OP2   . G   A 1 28  ? -27.702 27.397 36.059  1.00 86.12 ? 28  G   B OP2   1 
ATOM   579  O "O5'" . G   A 1 28  ? -28.306 25.122 35.240  1.00 82.33 ? 28  G   B "O5'" 1 
ATOM   580  C "C5'" . G   A 1 28  ? -29.236 24.073 35.008  1.00 78.53 ? 28  G   B "C5'" 1 
ATOM   581  C "C4'" . G   A 1 28  ? -29.028 23.489 33.633  1.00 76.19 ? 28  G   B "C4'" 1 
ATOM   582  O "O4'" . G   A 1 28  ? -29.279 24.522 32.638  1.00 74.30 ? 28  G   B "O4'" 1 
ATOM   583  C "C3'" . G   A 1 28  ? -27.608 23.055 33.312  1.00 75.84 ? 28  G   B "C3'" 1 
ATOM   584  O "O3'" . G   A 1 28  ? -27.250 21.789 33.837  1.00 76.83 ? 28  G   B "O3'" 1 
ATOM   585  C "C2'" . G   A 1 28  ? -27.615 23.058 31.793  1.00 74.67 ? 28  G   B "C2'" 1 
ATOM   586  O "O2'" . G   A 1 28  ? -28.236 21.920 31.222  1.00 74.93 ? 28  G   B "O2'" 1 
ATOM   587  C "C1'" . G   A 1 28  ? -28.409 24.336 31.523  1.00 72.64 ? 28  G   B "C1'" 1 
ATOM   588  N N9    . G   A 1 28  ? -27.491 25.468 31.450  1.00 68.94 ? 28  G   B N9    1 
ATOM   589  C C8    . G   A 1 28  ? -27.266 26.431 32.404  1.00 67.60 ? 28  G   B C8    1 
ATOM   590  N N7    . G   A 1 28  ? -26.339 27.284 32.060  1.00 65.88 ? 28  G   B N7    1 
ATOM   591  C C5    . G   A 1 28  ? -25.937 26.864 30.799  1.00 66.09 ? 28  G   B C5    1 
ATOM   592  C C6    . G   A 1 28  ? -24.951 27.390 29.921  1.00 64.92 ? 28  G   B C6    1 
ATOM   593  O O6    . G   A 1 28  ? -24.215 28.365 30.088  1.00 65.04 ? 28  G   B O6    1 
ATOM   594  N N1    . G   A 1 28  ? -24.865 26.653 28.746  1.00 63.39 ? 28  G   B N1    1 
ATOM   595  C C2    . G   A 1 28  ? -25.626 25.553 28.447  1.00 64.64 ? 28  G   B C2    1 
ATOM   596  N N2    . G   A 1 28  ? -25.395 24.974 27.260  1.00 64.44 ? 28  G   B N2    1 
ATOM   597  N N3    . G   A 1 28  ? -26.549 25.053 29.253  1.00 65.87 ? 28  G   B N3    1 
ATOM   598  C C4    . G   A 1 28  ? -26.647 25.752 30.405  1.00 67.10 ? 28  G   B C4    1 
ATOM   599  P P     . G   A 1 29  ? -25.694 21.461 34.084  1.00 75.81 ? 29  G   B P     1 
ATOM   600  O OP1   . G   A 1 29  ? -25.594 20.145 34.770  1.00 76.95 ? 29  G   B OP1   1 
ATOM   601  O OP2   . G   A 1 29  ? -25.080 22.668 34.713  1.00 74.20 ? 29  G   B OP2   1 
ATOM   602  O "O5'" . G   A 1 29  ? -25.110 21.301 32.610  1.00 72.69 ? 29  G   B "O5'" 1 
ATOM   603  C "C5'" . G   A 1 29  ? -25.627 20.311 31.725  1.00 70.96 ? 29  G   B "C5'" 1 
ATOM   604  C "C4'" . G   A 1 29  ? -24.861 20.323 30.421  1.00 69.60 ? 29  G   B "C4'" 1 
ATOM   605  O "O4'" . G   A 1 29  ? -25.138 21.564 29.708  1.00 68.76 ? 29  G   B "O4'" 1 
ATOM   606  C "C3'" . G   A 1 29  ? -23.345 20.313 30.551  1.00 68.71 ? 29  G   B "C3'" 1 
ATOM   607  O "O3'" . G   A 1 29  ? -22.801 19.019 30.773  1.00 66.85 ? 29  G   B "O3'" 1 
ATOM   608  C "C2'" . G   A 1 29  ? -22.916 20.896 29.213  1.00 67.84 ? 29  G   B "C2'" 1 
ATOM   609  O "O2'" . G   A 1 29  ? -22.998 19.968 28.154  1.00 66.71 ? 29  G   B "O2'" 1 
ATOM   610  C "C1'" . G   A 1 29  ? -23.962 21.997 29.031  1.00 67.63 ? 29  G   B "C1'" 1 
ATOM   611  N N9    . G   A 1 29  ? -23.489 23.236 29.647  1.00 65.98 ? 29  G   B N9    1 
ATOM   612  C C8    . G   A 1 29  ? -23.900 23.807 30.828  1.00 65.40 ? 29  G   B C8    1 
ATOM   613  N N7    . G   A 1 29  ? -23.237 24.890 31.127  1.00 64.17 ? 29  G   B N7    1 
ATOM   614  C C5    . G   A 1 29  ? -22.344 25.045 30.078  1.00 63.94 ? 29  G   B C5    1 
ATOM   615  C C6    . G   A 1 29  ? -21.346 26.033 29.852  1.00 63.80 ? 29  G   B C6    1 
ATOM   616  O O6    . G   A 1 29  ? -21.035 26.993 30.566  1.00 63.65 ? 29  G   B O6    1 
ATOM   617  N N1    . G   A 1 29  ? -20.667 25.811 28.656  1.00 64.05 ? 29  G   B N1    1 
ATOM   618  C C2    . G   A 1 29  ? -20.905 24.765 27.792  1.00 62.67 ? 29  G   B C2    1 
ATOM   619  N N2    . G   A 1 29  ? -20.136 24.705 26.696  1.00 61.68 ? 29  G   B N2    1 
ATOM   620  N N3    . G   A 1 29  ? -21.827 23.841 27.994  1.00 63.51 ? 29  G   B N3    1 
ATOM   621  C C4    . G   A 1 29  ? -22.500 24.040 29.148  1.00 64.67 ? 29  G   B C4    1 
ATOM   622  P P     . C   A 1 30  ? -21.519 18.862 31.736  1.00 60.56 ? 30  C   B P     1 
ATOM   623  O OP1   . C   A 1 30  ? -21.393 17.425 32.118  1.00 59.66 ? 30  C   B OP1   1 
ATOM   624  O OP2   . C   A 1 30  ? -21.634 19.907 32.793  1.00 60.15 ? 30  C   B OP2   1 
ATOM   625  O "O5'" . C   A 1 30  ? -20.278 19.272 30.821  1.00 57.86 ? 30  C   B "O5'" 1 
ATOM   626  C "C5'" . C   A 1 30  ? -20.144 18.751 29.504  1.00 54.25 ? 30  C   B "C5'" 1 
ATOM   627  C "C4'" . C   A 1 30  ? -19.201 19.604 28.690  1.00 51.43 ? 30  C   B "C4'" 1 
ATOM   628  O "O4'" . C   A 1 30  ? -19.747 20.946 28.557  1.00 50.22 ? 30  C   B "O4'" 1 
ATOM   629  C "C3'" . C   A 1 30  ? -17.816 19.853 29.266  1.00 51.24 ? 30  C   B "C3'" 1 
ATOM   630  O "O3'" . C   A 1 30  ? -16.945 18.739 29.073  1.00 49.47 ? 30  C   B "O3'" 1 
ATOM   631  C "C2'" . C   A 1 30  ? -17.385 21.068 28.453  1.00 50.01 ? 30  C   B "C2'" 1 
ATOM   632  O "O2'" . C   A 1 30  ? -17.055 20.715 27.128  1.00 48.23 ? 30  C   B "O2'" 1 
ATOM   633  C "C1'" . C   A 1 30  ? -18.682 21.881 28.420  1.00 48.72 ? 30  C   B "C1'" 1 
ATOM   634  N N1    . C   A 1 30  ? -18.768 22.877 29.507  1.00 46.51 ? 30  C   B N1    1 
ATOM   635  C C2    . C   A 1 30  ? -17.956 24.020 29.444  1.00 46.43 ? 30  C   B C2    1 
ATOM   636  O O2    . C   A 1 30  ? -17.217 24.176 28.467  1.00 46.26 ? 30  C   B O2    1 
ATOM   637  N N3    . C   A 1 30  ? -18.003 24.926 30.449  1.00 47.07 ? 30  C   B N3    1 
ATOM   638  C C4    . C   A 1 30  ? -18.822 24.729 31.486  1.00 47.54 ? 30  C   B C4    1 
ATOM   639  N N4    . C   A 1 30  ? -18.824 25.639 32.466  1.00 45.62 ? 30  C   B N4    1 
ATOM   640  C C5    . C   A 1 30  ? -19.674 23.584 31.569  1.00 47.70 ? 30  C   B C5    1 
ATOM   641  C C6    . C   A 1 30  ? -19.615 22.693 30.566  1.00 46.46 ? 30  C   B C6    1 
ATOM   642  P P     . C   A 1 31  ? -15.630 18.584 29.988  1.00 40.67 ? 31  C   B P     1 
ATOM   643  O OP1   . C   A 1 31  ? -15.003 17.257 29.732  1.00 42.83 ? 31  C   B OP1   1 
ATOM   644  O OP2   . C   A 1 31  ? -15.991 18.973 31.381  1.00 42.56 ? 31  C   B OP2   1 
ATOM   645  O "O5'" . C   A 1 31  ? -14.643 19.698 29.428  1.00 41.59 ? 31  C   B "O5'" 1 
ATOM   646  C "C5'" . C   A 1 31  ? -14.291 19.724 28.054  1.00 42.87 ? 31  C   B "C5'" 1 
ATOM   647  C "C4'" . C   A 1 31  ? -13.313 20.836 27.795  1.00 43.76 ? 31  C   B "C4'" 1 
ATOM   648  O "O4'" . C   A 1 31  ? -13.970 22.124 27.952  1.00 44.08 ? 31  C   B "O4'" 1 
ATOM   649  C "C3'" . C   A 1 31  ? -12.159 20.886 28.777  1.00 43.24 ? 31  C   B "C3'" 1 
ATOM   650  O "O3'" . C   A 1 31  ? -11.140 20.000 28.365  1.00 39.70 ? 31  C   B "O3'" 1 
ATOM   651  C "C2'" . C   A 1 31  ? -11.718 22.338 28.673  1.00 43.55 ? 31  C   B "C2'" 1 
ATOM   652  O "O2'" . C   A 1 31  ? -10.963 22.552 27.494  1.00 43.74 ? 31  C   B "O2'" 1 
ATOM   653  C "C1'" . C   A 1 31  ? -13.068 23.048 28.537  1.00 44.76 ? 31  C   B "C1'" 1 
ATOM   654  N N1    . C   A 1 31  ? -13.670 23.535 29.790  1.00 46.70 ? 31  C   B N1    1 
ATOM   655  C C2    . C   A 1 31  ? -13.181 24.715 30.368  1.00 48.11 ? 31  C   B C2    1 
ATOM   656  O O2    . C   A 1 31  ? -12.187 25.264 29.867  1.00 51.01 ? 31  C   B O2    1 
ATOM   657  N N3    . C   A 1 31  ? -13.802 25.221 31.462  1.00 47.49 ? 31  C   B N3    1 
ATOM   658  C C4    . C   A 1 31  ? -14.856 24.585 31.985  1.00 47.26 ? 31  C   B C4    1 
ATOM   659  N N4    . C   A 1 31  ? -15.465 25.142 33.033  1.00 47.64 ? 31  C   B N4    1 
ATOM   660  C C5    . C   A 1 31  ? -15.339 23.357 31.449  1.00 46.61 ? 31  C   B C5    1 
ATOM   661  C C6    . C   A 1 31  ? -14.720 22.871 30.365  1.00 47.15 ? 31  C   B C6    1 
ATOM   662  P P     . A   A 1 32  ? -10.132 19.414 29.453  1.00 45.86 ? 32  A   B P     1 
ATOM   663  O OP1   . A   A 1 32  ? -9.243  18.413 28.810  1.00 44.90 ? 32  A   B OP1   1 
ATOM   664  O OP2   . A   A 1 32  ? -10.961 19.024 30.622  1.00 47.53 ? 32  A   B OP2   1 
ATOM   665  O "O5'" . A   A 1 32  ? -9.240  20.671 29.853  1.00 45.27 ? 32  A   B "O5'" 1 
ATOM   666  C "C5'" . A   A 1 32  ? -8.327  21.231 28.916  1.00 43.19 ? 32  A   B "C5'" 1 
ATOM   667  C "C4'" . A   A 1 32  ? -7.480  22.282 29.579  1.00 43.23 ? 32  A   B "C4'" 1 
ATOM   668  O "O4'" . A   A 1 32  ? -8.274  23.468 29.815  1.00 42.98 ? 32  A   B "O4'" 1 
ATOM   669  C "C3'" . A   A 1 32  ? -6.934  21.908 30.947  1.00 44.01 ? 32  A   B "C3'" 1 
ATOM   670  O "O3'" . A   A 1 32  ? -5.751  21.106 30.804  1.00 46.59 ? 32  A   B "O3'" 1 
ATOM   671  C "C2'" . A   A 1 32  ? -6.670  23.286 31.557  1.00 43.34 ? 32  A   B "C2'" 1 
ATOM   672  O "O2'" . A   A 1 32  ? -5.481  23.871 31.068  1.00 41.83 ? 32  A   B "O2'" 1 
ATOM   673  C "C1'" . A   A 1 32  ? -7.849  24.096 31.011  1.00 42.67 ? 32  A   B "C1'" 1 
ATOM   674  N N9    . A   A 1 32  ? -9.015  24.241 31.891  1.00 43.60 ? 32  A   B N9    1 
ATOM   675  C C8    . A   A 1 32  ? -9.958  23.297 32.219  1.00 42.48 ? 32  A   B C8    1 
ATOM   676  N N7    . A   A 1 32  ? -10.924 23.755 32.984  1.00 42.09 ? 32  A   B N7    1 
ATOM   677  C C5    . A   A 1 32  ? -10.591 25.087 33.183  1.00 43.23 ? 32  A   B C5    1 
ATOM   678  C C6    . A   A 1 32  ? -11.225 26.135 33.897  1.00 44.73 ? 32  A   B C6    1 
ATOM   679  N N6    . A   A 1 32  ? -12.386 26.010 34.530  1.00 44.71 ? 32  A   B N6    1 
ATOM   680  N N1    . A   A 1 32  ? -10.614 27.341 33.915  1.00 46.07 ? 32  A   B N1    1 
ATOM   681  C C2    . A   A 1 32  ? -9.463  27.487 33.234  1.00 46.44 ? 32  A   B C2    1 
ATOM   682  N N3    . A   A 1 32  ? -8.785  26.588 32.511  1.00 46.35 ? 32  A   B N3    1 
ATOM   683  C C4    . A   A 1 32  ? -9.406  25.395 32.532  1.00 44.28 ? 32  A   B C4    1 
ATOM   684  P P     . A   A 1 33  ? -5.307  20.094 31.985  1.00 59.72 ? 33  A   B P     1 
ATOM   685  O OP1   . A   A 1 33  ? -4.026  19.464 31.592  1.00 59.51 ? 33  A   B OP1   1 
ATOM   686  O OP2   . A   A 1 33  ? -6.458  19.241 32.385  1.00 58.43 ? 33  A   B OP2   1 
ATOM   687  O "O5'" . A   A 1 33  ? -4.999  21.049 33.216  1.00 61.75 ? 33  A   B "O5'" 1 
ATOM   688  C "C5'" . A   A 1 33  ? -3.782  21.782 33.299  1.00 65.17 ? 33  A   B "C5'" 1 
ATOM   689  C "C4'" . A   A 1 33  ? -3.768  22.579 34.579  1.00 68.09 ? 33  A   B "C4'" 1 
ATOM   690  O "O4'" . A   A 1 33  ? -4.925  23.466 34.574  1.00 69.18 ? 33  A   B "O4'" 1 
ATOM   691  C "C3'" . A   A 1 33  ? -3.959  21.727 35.824  1.00 68.98 ? 33  A   B "C3'" 1 
ATOM   692  O "O3'" . A   A 1 33  ? -2.774  21.020 36.268  1.00 67.35 ? 33  A   B "O3'" 1 
ATOM   693  C "C2'" . A   A 1 33  ? -4.588  22.717 36.796  1.00 69.65 ? 33  A   B "C2'" 1 
ATOM   694  O "O2'" . A   A 1 33  ? -3.627  23.577 37.378  1.00 71.12 ? 33  A   B "O2'" 1 
ATOM   695  C "C1'" . A   A 1 33  ? -5.516  23.508 35.865  1.00 68.01 ? 33  A   B "C1'" 1 
ATOM   696  N N9    . A   A 1 33  ? -6.902  23.013 35.768  1.00 65.78 ? 33  A   B N9    1 
ATOM   697  C C8    . A   A 1 33  ? -7.349  21.797 35.286  1.00 64.89 ? 33  A   B C8    1 
ATOM   698  N N7    . A   A 1 33  ? -8.656  21.646 35.349  1.00 62.32 ? 33  A   B N7    1 
ATOM   699  C C5    . A   A 1 33  ? -9.104  22.838 35.904  1.00 63.36 ? 33  A   B C5    1 
ATOM   700  C C6    . A   A 1 33  ? -10.391 23.303 36.238  1.00 63.19 ? 33  A   B C6    1 
ATOM   701  N N6    . A   A 1 33  ? -11.504 22.587 36.072  1.00 63.72 ? 33  A   B N6    1 
ATOM   702  N N1    . A   A 1 33  ? -10.495 24.544 36.764  1.00 64.12 ? 33  A   B N1    1 
ATOM   703  C C2    . A   A 1 33  ? -9.373  25.260 36.949  1.00 64.39 ? 33  A   B C2    1 
ATOM   704  N N3    . A   A 1 33  ? -8.108  24.931 36.686  1.00 64.14 ? 33  A   B N3    1 
ATOM   705  C C4    . A   A 1 33  ? -8.038  23.694 36.160  1.00 64.71 ? 33  A   B C4    1 
ATOM   706  N N     . MET B 2 1   ? 18.552  6.559  7.659   1.00 81.28 ? 1   MET A N     1 
ATOM   707  C CA    . MET B 2 1   ? 17.440  7.433  7.449   1.00 81.25 ? 1   MET A CA    1 
ATOM   708  C C     . MET B 2 1   ? 16.237  6.764  6.891   1.00 79.56 ? 1   MET A C     1 
ATOM   709  O O     . MET B 2 1   ? 15.599  7.182  5.975   1.00 78.94 ? 1   MET A O     1 
ATOM   710  C CB    . MET B 2 1   ? 17.839  8.741  6.756   1.00 83.36 ? 1   MET A CB    1 
ATOM   711  C CG    . MET B 2 1   ? 19.264  9.154  7.009   1.00 85.98 ? 1   MET A CG    1 
ATOM   712  S SD    . MET B 2 1   ? 20.119  8.343  8.308   1.00 90.24 ? 1   MET A SD    1 
ATOM   713  C CE    . MET B 2 1   ? 21.464  9.373  8.554   1.00 89.32 ? 1   MET A CE    1 
ATOM   714  N N     . LYS B 2 2   ? 15.877  5.758  7.599   1.00 77.42 ? 2   LYS A N     1 
ATOM   715  C CA    . LYS B 2 2   ? 14.514  5.283  7.437   1.00 75.39 ? 2   LYS A CA    1 
ATOM   716  C C     . LYS B 2 2   ? 13.942  5.382  8.861   1.00 74.34 ? 2   LYS A C     1 
ATOM   717  O O     . LYS B 2 2   ? 14.703  5.507  9.837   1.00 73.80 ? 2   LYS A O     1 
ATOM   718  C CB    . LYS B 2 2   ? 14.500  3.833  6.947   1.00 74.49 ? 2   LYS A CB    1 
ATOM   719  C CG    . LYS B 2 2   ? 13.102  3.275  6.696   1.00 73.07 ? 2   LYS A CG    1 
ATOM   720  C CD    . LYS B 2 2   ? 13.152  1.770  6.479   1.00 71.47 ? 2   LYS A CD    1 
ATOM   721  C CE    . LYS B 2 2   ? 13.652  1.045  7.721   1.00 70.35 ? 2   LYS A CE    1 
ATOM   722  N NZ    . LYS B 2 2   ? 15.095  1.300  8.033   1.00 68.69 ? 2   LYS A NZ    1 
ATOM   723  N N     . VAL B 2 3   ? 12.622  5.328  8.982   1.00 72.27 ? 3   VAL A N     1 
ATOM   724  C CA    . VAL B 2 3   ? 11.982  5.456  10.282  1.00 71.08 ? 3   VAL A CA    1 
ATOM   725  C C     . VAL B 2 3   ? 12.746  4.844  11.462  1.00 69.79 ? 3   VAL A C     1 
ATOM   726  O O     . VAL B 2 3   ? 13.010  5.527  12.456  1.00 68.41 ? 3   VAL A O     1 
ATOM   727  C CB    . VAL B 2 3   ? 10.566  4.850  10.269  1.00 71.65 ? 3   VAL A CB    1 
ATOM   728  C CG1   . VAL B 2 3   ? 9.712   5.561  11.310  1.00 71.88 ? 3   VAL A CG1   1 
ATOM   729  C CG2   . VAL B 2 3   ? 9.950   4.966  8.878   1.00 71.47 ? 3   VAL A CG2   1 
ATOM   730  N N     . GLU B 2 4   ? 13.085  3.561  11.345  1.00 69.28 ? 4   GLU A N     1 
ATOM   731  C CA    . GLU B 2 4   ? 13.786  2.820  12.395  1.00 69.09 ? 4   GLU A CA    1 
ATOM   732  C C     . GLU B 2 4   ? 15.134  3.452  12.719  1.00 68.73 ? 4   GLU A C     1 
ATOM   733  O O     . GLU B 2 4   ? 15.509  3.601  13.887  1.00 67.92 ? 4   GLU A O     1 
ATOM   734  C CB    . GLU B 2 4   ? 13.988  1.374  11.942  1.00 70.33 ? 4   GLU A CB    1 
ATOM   735  C CG    . GLU B 2 4   ? 12.785  0.784  11.211  1.00 72.50 ? 4   GLU A CG    1 
ATOM   736  C CD    . GLU B 2 4   ? 13.065  -0.591 10.630  1.00 73.81 ? 4   GLU A CD    1 
ATOM   737  O OE1   . GLU B 2 4   ? 13.898  -0.687 9.702   1.00 75.25 ? 4   GLU A OE1   1 
ATOM   738  O OE2   . GLU B 2 4   ? 12.455  -1.579 11.105  1.00 74.46 ? 4   GLU A OE2   1 
ATOM   739  N N     . GLU B 2 5   ? 15.865  3.813  11.670  1.00 68.88 ? 5   GLU A N     1 
ATOM   740  C CA    . GLU B 2 5   ? 17.171  4.444  11.824  1.00 68.70 ? 5   GLU A CA    1 
ATOM   741  C C     . GLU B 2 5   ? 17.011  5.683  12.701  1.00 67.05 ? 5   GLU A C     1 
ATOM   742  O O     . GLU B 2 5   ? 17.759  5.877  13.667  1.00 67.59 ? 5   GLU A O     1 
ATOM   743  C CB    . GLU B 2 5   ? 17.725  4.891  10.464  1.00 70.64 ? 5   GLU A CB    1 
ATOM   744  C CG    . GLU B 2 5   ? 17.294  4.054  9.252   1.00 73.00 ? 5   GLU A CG    1 
ATOM   745  C CD    . GLU B 2 5   ? 17.880  2.653  9.247   1.00 74.30 ? 5   GLU A CD    1 
ATOM   746  O OE1   . GLU B 2 5   ? 17.381  1.794  10.027  1.00 75.48 ? 5   GLU A OE1   1 
ATOM   747  O OE2   . GLU B 2 5   ? 18.838  2.420  8.463   1.00 73.43 ? 5   GLU A OE2   1 
ATOM   748  N N     . ILE B 2 6   ? 16.025  6.510  12.350  1.00 63.72 ? 6   ILE A N     1 
ATOM   749  C CA    . ILE B 2 6   ? 15.734  7.759  13.055  1.00 60.97 ? 6   ILE A CA    1 
ATOM   750  C C     . ILE B 2 6   ? 15.197  7.595  14.479  1.00 59.58 ? 6   ILE A C     1 
ATOM   751  O O     . ILE B 2 6   ? 15.655  8.271  15.398  1.00 59.61 ? 6   ILE A O     1 
ATOM   752  C CB    . ILE B 2 6   ? 14.718  8.626  12.258  1.00 60.85 ? 6   ILE A CB    1 
ATOM   753  C CG1   . ILE B 2 6   ? 15.160  8.754  10.797  1.00 60.47 ? 6   ILE A CG1   1 
ATOM   754  C CG2   . ILE B 2 6   ? 14.617  10.009 12.874  1.00 59.12 ? 6   ILE A CG2   1 
ATOM   755  C CD1   . ILE B 2 6   ? 16.542  9.316  10.624  1.00 59.23 ? 6   ILE A CD1   1 
ATOM   756  N N     . LEU B 2 7   ? 14.223  6.713  14.672  1.00 58.12 ? 7   LEU A N     1 
ATOM   757  C CA    . LEU B 2 7   ? 13.663  6.521  16.007  1.00 56.06 ? 7   LEU A CA    1 
ATOM   758  C C     . LEU B 2 7   ? 14.748  6.042  16.977  1.00 57.08 ? 7   LEU A C     1 
ATOM   759  O O     . LEU B 2 7   ? 14.691  6.317  18.176  1.00 56.77 ? 7   LEU A O     1 
ATOM   760  C CB    . LEU B 2 7   ? 12.480  5.533  15.966  1.00 52.42 ? 7   LEU A CB    1 
ATOM   761  C CG    . LEU B 2 7   ? 11.329  5.862  14.992  1.00 50.31 ? 7   LEU A CG    1 
ATOM   762  C CD1   . LEU B 2 7   ? 10.145  4.916  15.206  1.00 49.07 ? 7   LEU A CD1   1 
ATOM   763  C CD2   . LEU B 2 7   ? 10.877  7.294  15.198  1.00 48.12 ? 7   LEU A CD2   1 
ATOM   764  N N     . GLU B 2 8   ? 15.748  5.341  16.454  1.00 59.20 ? 8   GLU A N     1 
ATOM   765  C CA    . GLU B 2 8   ? 16.837  4.849  17.292  1.00 60.85 ? 8   GLU A CA    1 
ATOM   766  C C     . GLU B 2 8   ? 17.529  6.015  17.979  1.00 59.87 ? 8   GLU A C     1 
ATOM   767  O O     . GLU B 2 8   ? 17.872  5.950  19.156  1.00 60.51 ? 8   GLU A O     1 
ATOM   768  C CB    . GLU B 2 8   ? 17.862  4.096  16.442  1.00 64.85 ? 8   GLU A CB    1 
ATOM   769  C CG    . GLU B 2 8   ? 17.454  2.671  16.035  1.00 69.79 ? 8   GLU A CG    1 
ATOM   770  C CD    . GLU B 2 8   ? 17.730  1.634  17.131  1.00 72.62 ? 8   GLU A CD    1 
ATOM   771  O OE1   . GLU B 2 8   ? 17.509  0.419  16.878  1.00 72.90 ? 8   GLU A OE1   1 
ATOM   772  O OE2   . GLU B 2 8   ? 18.170  2.038  18.240  1.00 74.08 ? 8   GLU A OE2   1 
ATOM   773  N N     . LYS B 2 9   ? 17.719  7.091  17.232  1.00 58.89 ? 9   LYS A N     1 
ATOM   774  C CA    . LYS B 2 9   ? 18.393  8.274  17.744  1.00 57.77 ? 9   LYS A CA    1 
ATOM   775  C C     . LYS B 2 9   ? 17.449  9.169  18.524  1.00 56.24 ? 9   LYS A C     1 
ATOM   776  O O     . LYS B 2 9   ? 17.876  9.911  19.401  1.00 56.25 ? 9   LYS A O     1 
ATOM   777  C CB    . LYS B 2 9   ? 19.011  9.030  16.569  1.00 59.59 ? 9   LYS A CB    1 
ATOM   778  C CG    . LYS B 2 9   ? 19.793  8.089  15.632  1.00 61.03 ? 9   LYS A CG    1 
ATOM   779  C CD    . LYS B 2 9   ? 20.155  8.744  14.306  1.00 62.63 ? 9   LYS A CD    1 
ATOM   780  C CE    . LYS B 2 9   ? 20.869  7.766  13.387  1.00 61.74 ? 9   LYS A CE    1 
ATOM   781  N NZ    . LYS B 2 9   ? 21.096  8.369  12.045  1.00 62.44 ? 9   LYS A NZ    1 
ATOM   782  N N     . ALA B 2 10  ? 16.160  9.093  18.210  1.00 55.31 ? 10  ALA A N     1 
ATOM   783  C CA    . ALA B 2 10  ? 15.163  9.906  18.906  1.00 53.82 ? 10  ALA A CA    1 
ATOM   784  C C     . ALA B 2 10  ? 15.101  9.512  20.369  1.00 52.50 ? 10  ALA A C     1 
ATOM   785  O O     . ALA B 2 10  ? 15.106  10.371 21.240  1.00 51.89 ? 10  ALA A O     1 
ATOM   786  C CB    . ALA B 2 10  ? 13.795  9.733  18.269  1.00 53.62 ? 10  ALA A CB    1 
ATOM   787  N N     . LEU B 2 11  ? 15.041  8.211  20.637  1.00 52.37 ? 11  LEU A N     1 
ATOM   788  C CA    . LEU B 2 11  ? 14.988  7.721  22.009  1.00 52.96 ? 11  LEU A CA    1 
ATOM   789  C C     . LEU B 2 11  ? 16.007  8.448  22.878  1.00 53.89 ? 11  LEU A C     1 
ATOM   790  O O     . LEU B 2 11  ? 15.791  8.661  24.077  1.00 53.23 ? 11  LEU A O     1 
ATOM   791  C CB    . LEU B 2 11  ? 15.286  6.223  22.048  1.00 52.37 ? 11  LEU A CB    1 
ATOM   792  C CG    . LEU B 2 11  ? 14.237  5.324  21.404  1.00 52.79 ? 11  LEU A CG    1 
ATOM   793  C CD1   . LEU B 2 11  ? 14.681  3.868  21.456  1.00 49.95 ? 11  LEU A CD1   1 
ATOM   794  C CD2   . LEU B 2 11  ? 12.915  5.518  22.136  1.00 52.36 ? 11  LEU A CD2   1 
ATOM   795  N N     . GLU B 2 12  ? 17.117  8.827  22.247  1.00 55.12 ? 12  GLU A N     1 
ATOM   796  C CA    . GLU B 2 12  ? 18.220  9.508  22.916  1.00 56.21 ? 12  GLU A CA    1 
ATOM   797  C C     . GLU B 2 12  ? 17.901  10.936 23.378  1.00 56.75 ? 12  GLU A C     1 
ATOM   798  O O     . GLU B 2 12  ? 18.645  11.525 24.177  1.00 55.83 ? 12  GLU A O     1 
ATOM   799  C CB    . GLU B 2 12  ? 19.435  9.512  21.989  1.00 57.15 ? 12  GLU A CB    1 
ATOM   800  C CG    . GLU B 2 12  ? 20.729  9.830  22.690  1.00 60.09 ? 12  GLU A CG    1 
ATOM   801  C CD    . GLU B 2 12  ? 21.897  9.050  22.111  1.00 63.16 ? 12  GLU A CD    1 
ATOM   802  O OE1   . GLU B 2 12  ? 21.793  7.798  22.005  1.00 63.86 ? 12  GLU A OE1   1 
ATOM   803  O OE2   . GLU B 2 12  ? 22.920  9.689  21.771  1.00 64.88 ? 12  GLU A OE2   1 
ATOM   804  N N     . LEU B 2 13  ? 16.793  11.484 22.878  1.00 56.64 ? 13  LEU A N     1 
ATOM   805  C CA    . LEU B 2 13  ? 16.361  12.836 23.234  1.00 55.37 ? 13  LEU A CA    1 
ATOM   806  C C     . LEU B 2 13  ? 15.107  12.816 24.123  1.00 54.57 ? 13  LEU A C     1 
ATOM   807  O O     . LEU B 2 13  ? 14.843  13.758 24.872  1.00 54.82 ? 13  LEU A O     1 
ATOM   808  C CB    . LEU B 2 13  ? 16.084  13.648 21.956  1.00 54.87 ? 13  LEU A CB    1 
ATOM   809  C CG    . LEU B 2 13  ? 17.221  13.680 20.924  1.00 54.08 ? 13  LEU A CG    1 
ATOM   810  C CD1   . LEU B 2 13  ? 16.784  14.431 19.669  1.00 54.38 ? 13  LEU A CD1   1 
ATOM   811  C CD2   . LEU B 2 13  ? 18.447  14.328 21.539  1.00 54.80 ? 13  LEU A CD2   1 
ATOM   812  N N     . VAL B 2 14  ? 14.344  11.734 24.048  1.00 53.86 ? 14  VAL A N     1 
ATOM   813  C CA    . VAL B 2 14  ? 13.121  11.623 24.831  1.00 52.09 ? 14  VAL A CA    1 
ATOM   814  C C     . VAL B 2 14  ? 13.273  10.831 26.124  1.00 52.26 ? 14  VAL A C     1 
ATOM   815  O O     . VAL B 2 14  ? 12.618  11.138 27.119  1.00 52.24 ? 14  VAL A O     1 
ATOM   816  C CB    . VAL B 2 14  ? 12.004  10.990 23.989  1.00 50.35 ? 14  VAL A CB    1 
ATOM   817  C CG1   . VAL B 2 14  ? 11.647  11.914 22.831  1.00 49.27 ? 14  VAL A CG1   1 
ATOM   818  C CG2   . VAL B 2 14  ? 12.457  9.637  23.459  1.00 48.93 ? 14  VAL A CG2   1 
ATOM   819  N N     . ILE B 2 15  ? 14.134  9.816  26.115  1.00 52.77 ? 15  ILE A N     1 
ATOM   820  C CA    . ILE B 2 15  ? 14.342  8.995  27.304  1.00 52.98 ? 15  ILE A CA    1 
ATOM   821  C C     . ILE B 2 15  ? 15.370  9.604  28.269  1.00 53.37 ? 15  ILE A C     1 
ATOM   822  O O     . ILE B 2 15  ? 16.480  9.959  27.867  1.00 53.35 ? 15  ILE A O     1 
ATOM   823  C CB    . ILE B 2 15  ? 14.781  7.558  26.914  1.00 53.34 ? 15  ILE A CB    1 
ATOM   824  C CG1   . ILE B 2 15  ? 13.731  6.932  25.989  1.00 53.56 ? 15  ILE A CG1   1 
ATOM   825  C CG2   . ILE B 2 15  ? 14.927  6.684  28.169  1.00 52.04 ? 15  ILE A CG2   1 
ATOM   826  C CD1   . ILE B 2 15  ? 14.145  5.605  25.377  1.00 53.92 ? 15  ILE A CD1   1 
ATOM   827  N N     . PRO B 2 16  ? 14.995  9.747  29.557  1.00 53.41 ? 16  PRO A N     1 
ATOM   828  C CA    . PRO B 2 16  ? 15.825  10.304 30.636  1.00 53.79 ? 16  PRO A CA    1 
ATOM   829  C C     . PRO B 2 16  ? 17.033  9.420  30.920  1.00 54.73 ? 16  PRO A C     1 
ATOM   830  O O     . PRO B 2 16  ? 16.872  8.233  31.193  1.00 53.90 ? 16  PRO A O     1 
ATOM   831  C CB    . PRO B 2 16  ? 14.878  10.326 31.831  1.00 53.78 ? 16  PRO A CB    1 
ATOM   832  C CG    . PRO B 2 16  ? 13.523  10.402 31.207  1.00 54.04 ? 16  PRO A CG    1 
ATOM   833  C CD    . PRO B 2 16  ? 13.631  9.473  30.042  1.00 52.96 ? 16  PRO A CD    1 
ATOM   834  N N     . ASP B 2 17  ? 18.235  9.995  30.862  1.00 57.04 ? 17  ASP A N     1 
ATOM   835  C CA    . ASP B 2 17  ? 19.460  9.231  31.114  1.00 58.96 ? 17  ASP A CA    1 
ATOM   836  C C     . ASP B 2 17  ? 19.444  8.677  32.539  1.00 60.18 ? 17  ASP A C     1 
ATOM   837  O O     . ASP B 2 17  ? 18.531  8.987  33.314  1.00 61.02 ? 17  ASP A O     1 
ATOM   838  C CB    . ASP B 2 17  ? 20.700  10.118 30.923  1.00 58.32 ? 17  ASP A CB    1 
ATOM   839  C CG    . ASP B 2 17  ? 20.652  11.388 31.763  1.00 59.36 ? 17  ASP A CG    1 
ATOM   840  O OD1   . ASP B 2 17  ? 21.465  12.319 31.498  1.00 58.19 ? 17  ASP A OD1   1 
ATOM   841  O OD2   . ASP B 2 17  ? 19.803  11.450 32.689  1.00 58.65 ? 17  ASP A OD2   1 
ATOM   842  N N     . GLU B 2 18  ? 20.445  7.873  32.890  1.00 61.29 ? 18  GLU A N     1 
ATOM   843  C CA    . GLU B 2 18  ? 20.495  7.259  34.221  1.00 63.11 ? 18  GLU A CA    1 
ATOM   844  C C     . GLU B 2 18  ? 20.511  8.172  35.446  1.00 63.13 ? 18  GLU A C     1 
ATOM   845  O O     . GLU B 2 18  ? 19.933  7.828  36.482  1.00 62.81 ? 18  GLU A O     1 
ATOM   846  C CB    . GLU B 2 18  ? 21.683  6.304  34.297  1.00 64.76 ? 18  GLU A CB    1 
ATOM   847  C CG    . GLU B 2 18  ? 21.607  5.169  33.289  1.00 69.02 ? 18  GLU A CG    1 
ATOM   848  C CD    . GLU B 2 18  ? 22.644  4.092  33.560  1.00 71.52 ? 18  GLU A CD    1 
ATOM   849  O OE1   . GLU B 2 18  ? 23.858  4.424  33.541  1.00 72.68 ? 18  GLU A OE1   1 
ATOM   850  O OE2   . GLU B 2 18  ? 22.246  2.919  33.792  1.00 72.50 ? 18  GLU A OE2   1 
ATOM   851  N N     . GLU B 2 19  ? 21.173  9.325  35.324  1.00 63.89 ? 19  GLU A N     1 
ATOM   852  C CA    . GLU B 2 19  ? 21.290  10.294 36.421  1.00 63.51 ? 19  GLU A CA    1 
ATOM   853  C C     . GLU B 2 19  ? 20.005  11.077 36.689  1.00 60.85 ? 19  GLU A C     1 
ATOM   854  O O     . GLU B 2 19  ? 19.854  11.683 37.753  1.00 59.96 ? 19  GLU A O     1 
ATOM   855  C CB    . GLU B 2 19  ? 22.440  11.279 36.152  1.00 65.73 ? 19  GLU A CB    1 
ATOM   856  C CG    . GLU B 2 19  ? 23.339  10.912 34.961  1.00 70.40 ? 19  GLU A CG    1 
ATOM   857  C CD    . GLU B 2 19  ? 23.865  9.469  35.001  1.00 72.86 ? 19  GLU A CD    1 
ATOM   858  O OE1   . GLU B 2 19  ? 23.685  8.752  33.986  1.00 73.99 ? 19  GLU A OE1   1 
ATOM   859  O OE2   . GLU B 2 19  ? 24.458  9.057  36.032  1.00 74.08 ? 19  GLU A OE2   1 
ATOM   860  N N     . GLU B 2 20  ? 19.086  11.064 35.725  1.00 58.61 ? 20  GLU A N     1 
ATOM   861  C CA    . GLU B 2 20  ? 17.814  11.761 35.875  1.00 56.60 ? 20  GLU A CA    1 
ATOM   862  C C     . GLU B 2 20  ? 16.768  10.795 36.412  1.00 55.28 ? 20  GLU A C     1 
ATOM   863  O O     . GLU B 2 20  ? 15.877  11.180 37.168  1.00 54.34 ? 20  GLU A O     1 
ATOM   864  C CB    . GLU B 2 20  ? 17.334  12.311 34.542  1.00 56.42 ? 20  GLU A CB    1 
ATOM   865  C CG    . GLU B 2 20  ? 16.242  13.329 34.716  1.00 57.73 ? 20  GLU A CG    1 
ATOM   866  C CD    . GLU B 2 20  ? 15.574  13.707 33.417  1.00 58.96 ? 20  GLU A CD    1 
ATOM   867  O OE1   . GLU B 2 20  ? 16.285  14.033 32.440  1.00 60.30 ? 20  GLU A OE1   1 
ATOM   868  O OE2   . GLU B 2 20  ? 14.327  13.686 33.380  1.00 59.73 ? 20  GLU A OE2   1 
ATOM   869  N N     . VAL B 2 21  ? 16.878  9.538  35.996  1.00 54.94 ? 21  VAL A N     1 
ATOM   870  C CA    . VAL B 2 21  ? 15.972  8.487  36.443  1.00 54.19 ? 21  VAL A CA    1 
ATOM   871  C C     . VAL B 2 21  ? 16.299  8.199  37.907  1.00 54.47 ? 21  VAL A C     1 
ATOM   872  O O     . VAL B 2 21  ? 15.411  8.055  38.745  1.00 53.39 ? 21  VAL A O     1 
ATOM   873  C CB    . VAL B 2 21  ? 16.176  7.193  35.614  1.00 53.60 ? 21  VAL A CB    1 
ATOM   874  C CG1   . VAL B 2 21  ? 15.427  6.042  36.251  1.00 52.68 ? 21  VAL A CG1   1 
ATOM   875  C CG2   . VAL B 2 21  ? 15.697  7.402  34.186  1.00 54.27 ? 21  VAL A CG2   1 
ATOM   876  N N     . ARG B 2 22  ? 17.592  8.122  38.194  1.00 56.45 ? 22  ARG A N     1 
ATOM   877  C CA    . ARG B 2 22  ? 18.086  7.857  39.534  1.00 58.65 ? 22  ARG A CA    1 
ATOM   878  C C     . ARG B 2 22  ? 17.609  8.978  40.459  1.00 58.41 ? 22  ARG A C     1 
ATOM   879  O O     . ARG B 2 22  ? 16.815  8.745  41.373  1.00 58.58 ? 22  ARG A O     1 
ATOM   880  C CB    . ARG B 2 22  ? 19.615  7.793  39.485  1.00 61.18 ? 22  ARG A CB    1 
ATOM   881  C CG    . ARG B 2 22  ? 20.316  7.271  40.736  1.00 64.84 ? 22  ARG A CG    1 
ATOM   882  C CD    . ARG B 2 22  ? 21.848  7.319  40.534  1.00 67.61 ? 22  ARG A CD    1 
ATOM   883  N NE    . ARG B 2 22  ? 22.301  8.668  40.177  1.00 70.14 ? 22  ARG A NE    1 
ATOM   884  C CZ    . ARG B 2 22  ? 22.212  9.730  40.981  1.00 70.89 ? 22  ARG A CZ    1 
ATOM   885  N NH1   . ARG B 2 22  ? 21.696  9.604  42.199  1.00 71.18 ? 22  ARG A NH1   1 
ATOM   886  N NH2   . ARG B 2 22  ? 22.599  10.927 40.553  1.00 70.45 ? 22  ARG A NH2   1 
ATOM   887  N N     . LYS B 2 23  ? 18.102  10.189 40.219  1.00 57.99 ? 23  LYS A N     1 
ATOM   888  C CA    . LYS B 2 23  ? 17.711  11.361 40.998  1.00 57.11 ? 23  LYS A CA    1 
ATOM   889  C C     . LYS B 2 23  ? 16.214  11.400 41.310  1.00 57.05 ? 23  LYS A C     1 
ATOM   890  O O     . LYS B 2 23  ? 15.793  11.946 42.332  1.00 56.10 ? 23  LYS A O     1 
ATOM   891  C CB    . LYS B 2 23  ? 17.973  12.617 40.166  1.00 56.76 ? 23  LYS A CB    1 
ATOM   892  C CG    . LYS B 2 23  ? 17.531  13.935 40.783  1.00 57.35 ? 23  LYS A CG    1 
ATOM   893  C CD    . LYS B 2 23  ? 17.935  15.083 39.851  1.00 58.13 ? 23  LYS A CD    1 
ATOM   894  C CE    . LYS B 2 23  ? 17.499  16.447 40.373  1.00 58.31 ? 23  LYS A CE    1 
ATOM   895  N NZ    . LYS B 2 23  ? 17.881  17.541 39.431  1.00 57.74 ? 23  LYS A NZ    1 
ATOM   896  N N     . GLY B 2 24  ? 15.420  10.808 40.420  1.00 56.95 ? 24  GLY A N     1 
ATOM   897  C CA    . GLY B 2 24  ? 13.990  10.682 40.640  1.00 57.68 ? 24  GLY A CA    1 
ATOM   898  C C     . GLY B 2 24  ? 13.638  9.599  41.640  1.00 58.68 ? 24  GLY A C     1 
ATOM   899  O O     . GLY B 2 24  ? 12.796  9.797  42.527  1.00 59.03 ? 24  GLY A O     1 
ATOM   900  N N     . ARG B 2 25  ? 14.281  8.443  41.491  1.00 59.43 ? 25  ARG A N     1 
ATOM   901  C CA    . ARG B 2 25  ? 14.068  7.309  42.386  1.00 59.61 ? 25  ARG A CA    1 
ATOM   902  C C     . ARG B 2 25  ? 14.369  7.716  43.837  1.00 58.89 ? 25  ARG A C     1 
ATOM   903  O O     . ARG B 2 25  ? 13.570  7.458  44.740  1.00 57.97 ? 25  ARG A O     1 
ATOM   904  C CB    . ARG B 2 25  ? 14.973  6.142  41.965  1.00 61.65 ? 25  ARG A CB    1 
ATOM   905  C CG    . ARG B 2 25  ? 14.690  5.595  40.549  1.00 64.17 ? 25  ARG A CG    1 
ATOM   906  C CD    . ARG B 2 25  ? 13.597  4.523  40.552  1.00 65.40 ? 25  ARG A CD    1 
ATOM   907  N NE    . ARG B 2 25  ? 13.161  4.154  39.205  1.00 66.96 ? 25  ARG A NE    1 
ATOM   908  C CZ    . ARG B 2 25  ? 12.363  4.898  38.439  1.00 68.25 ? 25  ARG A CZ    1 
ATOM   909  N NH1   . ARG B 2 25  ? 11.903  6.065  38.882  1.00 68.15 ? 25  ARG A NH1   1 
ATOM   910  N NH2   . ARG B 2 25  ? 12.016  4.470  37.228  1.00 68.87 ? 25  ARG A NH2   1 
ATOM   911  N N     . GLU B 2 26  ? 15.514  8.359  44.060  1.00 57.84 ? 26  GLU A N     1 
ATOM   912  C CA    . GLU B 2 26  ? 15.891  8.797  45.407  1.00 57.82 ? 26  GLU A CA    1 
ATOM   913  C C     . GLU B 2 26  ? 14.874  9.781  45.994  1.00 56.56 ? 26  GLU A C     1 
ATOM   914  O O     . GLU B 2 26  ? 14.673  9.843  47.211  1.00 55.24 ? 26  GLU A O     1 
ATOM   915  C CB    . GLU B 2 26  ? 17.293  9.419  45.385  1.00 59.61 ? 26  GLU A CB    1 
ATOM   916  C CG    . GLU B 2 26  ? 18.421  8.396  45.555  1.00 62.72 ? 26  GLU A CG    1 
ATOM   917  C CD    . GLU B 2 26  ? 19.690  8.777  44.801  1.00 65.35 ? 26  GLU A CD    1 
ATOM   918  O OE1   . GLU B 2 26  ? 20.161  9.929  44.965  1.00 67.39 ? 26  GLU A OE1   1 
ATOM   919  O OE2   . GLU B 2 26  ? 20.215  7.923  44.045  1.00 66.57 ? 26  GLU A OE2   1 
ATOM   920  N N     . ALA B 2 27  ? 14.234  10.549 45.121  1.00 55.97 ? 27  ALA A N     1 
ATOM   921  C CA    . ALA B 2 27  ? 13.216  11.495 45.560  1.00 55.93 ? 27  ALA A CA    1 
ATOM   922  C C     . ALA B 2 27  ? 12.011  10.685 46.042  1.00 56.28 ? 27  ALA A C     1 
ATOM   923  O O     . ALA B 2 27  ? 11.603  10.790 47.196  1.00 56.84 ? 27  ALA A O     1 
ATOM   924  C CB    . ALA B 2 27  ? 12.818  12.405 44.409  1.00 54.72 ? 27  ALA A CB    1 
ATOM   925  N N     . GLU B 2 28  ? 11.453  9.869  45.148  1.00 56.73 ? 28  GLU A N     1 
ATOM   926  C CA    . GLU B 2 28  ? 10.304  9.013  45.461  1.00 56.32 ? 28  GLU A CA    1 
ATOM   927  C C     . GLU B 2 28  ? 10.557  8.209  46.739  1.00 56.58 ? 28  GLU A C     1 
ATOM   928  O O     . GLU B 2 28  ? 9.712   8.166  47.640  1.00 56.36 ? 28  GLU A O     1 
ATOM   929  C CB    . GLU B 2 28  ? 10.041  8.074  44.284  1.00 56.09 ? 28  GLU A CB    1 
ATOM   930  C CG    . GLU B 2 28  ? 9.381   6.751  44.637  1.00 57.34 ? 28  GLU A CG    1 
ATOM   931  C CD    . GLU B 2 28  ? 9.322   5.801  43.447  1.00 56.77 ? 28  GLU A CD    1 
ATOM   932  O OE1   . GLU B 2 28  ? 10.355  5.640  42.766  1.00 55.31 ? 28  GLU A OE1   1 
ATOM   933  O OE2   . GLU B 2 28  ? 8.246   5.216  43.195  1.00 56.72 ? 28  GLU A OE2   1 
ATOM   934  N N     . GLU B 2 29  ? 11.723  7.573  46.810  1.00 57.64 ? 29  GLU A N     1 
ATOM   935  C CA    . GLU B 2 29  ? 12.098  6.794  47.988  1.00 58.21 ? 29  GLU A CA    1 
ATOM   936  C C     . GLU B 2 29  ? 11.864  7.675  49.225  1.00 57.22 ? 29  GLU A C     1 
ATOM   937  O O     . GLU B 2 29  ? 10.980  7.392  50.045  1.00 56.35 ? 29  GLU A O     1 
ATOM   938  C CB    . GLU B 2 29  ? 13.575  6.380  47.892  1.00 60.54 ? 29  GLU A CB    1 
ATOM   939  C CG    . GLU B 2 29  ? 14.103  5.539  49.069  1.00 65.01 ? 29  GLU A CG    1 
ATOM   940  C CD    . GLU B 2 29  ? 13.536  4.123  49.091  1.00 68.12 ? 29  GLU A CD    1 
ATOM   941  O OE1   . GLU B 2 29  ? 13.958  3.311  49.965  1.00 68.68 ? 29  GLU A OE1   1 
ATOM   942  O OE2   . GLU B 2 29  ? 12.663  3.830  48.231  1.00 69.56 ? 29  GLU A OE2   1 
ATOM   943  N N     . GLU B 2 30  ? 12.637  8.755  49.336  1.00 55.67 ? 30  GLU A N     1 
ATOM   944  C CA    . GLU B 2 30  ? 12.510  9.682  50.460  1.00 53.94 ? 30  GLU A CA    1 
ATOM   945  C C     . GLU B 2 30  ? 11.093  10.244 50.629  1.00 53.13 ? 30  GLU A C     1 
ATOM   946  O O     . GLU B 2 30  ? 10.586  10.359 51.747  1.00 51.94 ? 30  GLU A O     1 
ATOM   947  C CB    . GLU B 2 30  ? 13.491  10.846 50.304  1.00 54.15 ? 30  GLU A CB    1 
ATOM   948  C CG    . GLU B 2 30  ? 13.336  11.914 51.386  1.00 53.64 ? 30  GLU A CG    1 
ATOM   949  C CD    . GLU B 2 30  ? 13.542  11.375 52.796  1.00 52.10 ? 30  GLU A CD    1 
ATOM   950  O OE1   . GLU B 2 30  ? 13.173  12.084 53.751  1.00 52.38 ? 30  GLU A OE1   1 
ATOM   951  O OE2   . GLU B 2 30  ? 14.075  10.254 52.950  1.00 52.33 ? 30  GLU A OE2   1 
ATOM   952  N N     . LEU B 2 31  ? 10.462  10.610 49.520  1.00 51.66 ? 31  LEU A N     1 
ATOM   953  C CA    . LEU B 2 31  ? 9.113   11.146 49.578  1.00 50.59 ? 31  LEU A CA    1 
ATOM   954  C C     . LEU B 2 31  ? 8.175   10.092 50.158  1.00 49.23 ? 31  LEU A C     1 
ATOM   955  O O     . LEU B 2 31  ? 7.242   10.409 50.899  1.00 47.70 ? 31  LEU A O     1 
ATOM   956  C CB    . LEU B 2 31  ? 8.649   11.561 48.181  1.00 51.23 ? 31  LEU A CB    1 
ATOM   957  C CG    . LEU B 2 31  ? 7.209   12.078 48.103  1.00 51.38 ? 31  LEU A CG    1 
ATOM   958  C CD1   . LEU B 2 31  ? 6.923   13.056 49.256  1.00 50.91 ? 31  LEU A CD1   1 
ATOM   959  C CD2   . LEU B 2 31  ? 7.001   12.740 46.746  1.00 50.49 ? 31  LEU A CD2   1 
ATOM   960  N N     . ARG B 2 32  ? 8.440   8.835  49.813  1.00 49.16 ? 32  ARG A N     1 
ATOM   961  C CA    . ARG B 2 32  ? 7.652   7.703  50.301  1.00 50.20 ? 32  ARG A CA    1 
ATOM   962  C C     . ARG B 2 32  ? 7.726   7.611  51.820  1.00 48.85 ? 32  ARG A C     1 
ATOM   963  O O     . ARG B 2 32  ? 6.706   7.543  52.501  1.00 47.82 ? 32  ARG A O     1 
ATOM   964  C CB    . ARG B 2 32  ? 8.178   6.395  49.698  1.00 51.92 ? 32  ARG A CB    1 
ATOM   965  C CG    . ARG B 2 32  ? 7.571   6.023  48.352  1.00 54.60 ? 32  ARG A CG    1 
ATOM   966  C CD    . ARG B 2 32  ? 6.484   4.964  48.527  1.00 56.93 ? 32  ARG A CD    1 
ATOM   967  N NE    . ARG B 2 32  ? 5.661   4.792  47.331  1.00 58.02 ? 32  ARG A NE    1 
ATOM   968  C CZ    . ARG B 2 32  ? 6.135   4.558  46.110  1.00 57.41 ? 32  ARG A CZ    1 
ATOM   969  N NH1   . ARG B 2 32  ? 7.441   4.464  45.900  1.00 55.46 ? 32  ARG A NH1   1 
ATOM   970  N NH2   . ARG B 2 32  ? 5.295   4.425  45.094  1.00 57.43 ? 32  ARG A NH2   1 
ATOM   971  N N     . ARG B 2 33  ? 8.951   7.614  52.336  1.00 47.99 ? 33  ARG A N     1 
ATOM   972  C CA    . ARG B 2 33  ? 9.198   7.512  53.768  1.00 47.10 ? 33  ARG A CA    1 
ATOM   973  C C     . ARG B 2 33  ? 8.519   8.592  54.593  1.00 47.69 ? 33  ARG A C     1 
ATOM   974  O O     . ARG B 2 33  ? 7.837   8.293  55.582  1.00 48.00 ? 33  ARG A O     1 
ATOM   975  C CB    . ARG B 2 33  ? 10.693  7.567  54.044  1.00 46.33 ? 33  ARG A CB    1 
ATOM   976  C CG    . ARG B 2 33  ? 11.519  6.603  53.231  1.00 44.75 ? 33  ARG A CG    1 
ATOM   977  C CD    . ARG B 2 33  ? 12.832  6.408  53.928  1.00 44.47 ? 33  ARG A CD    1 
ATOM   978  N NE    . ARG B 2 33  ? 13.763  5.571  53.196  1.00 44.73 ? 33  ARG A NE    1 
ATOM   979  C CZ    . ARG B 2 33  ? 14.736  6.042  52.434  1.00 45.92 ? 33  ARG A CZ    1 
ATOM   980  N NH1   . ARG B 2 33  ? 14.901  7.357  52.297  1.00 45.24 ? 33  ARG A NH1   1 
ATOM   981  N NH2   . ARG B 2 33  ? 15.562  5.191  51.835  1.00 48.53 ? 33  ARG A NH2   1 
ATOM   982  N N     . ARG B 2 34  ? 8.728   9.846  54.197  1.00 47.17 ? 34  ARG A N     1 
ATOM   983  C CA    . ARG B 2 34  ? 8.141   10.981 54.901  1.00 47.04 ? 34  ARG A CA    1 
ATOM   984  C C     . ARG B 2 34  ? 6.651   10.753 55.101  1.00 48.24 ? 34  ARG A C     1 
ATOM   985  O O     . ARG B 2 34  ? 6.100   10.971 56.192  1.00 47.55 ? 34  ARG A O     1 
ATOM   986  C CB    . ARG B 2 34  ? 8.385   12.266 54.113  1.00 45.85 ? 34  ARG A CB    1 
ATOM   987  C CG    . ARG B 2 34  ? 9.850   12.514 53.875  1.00 45.01 ? 34  ARG A CG    1 
ATOM   988  C CD    . ARG B 2 34  ? 10.118  13.866 53.275  1.00 45.62 ? 34  ARG A CD    1 
ATOM   989  N NE    . ARG B 2 34  ? 11.556  14.104 53.191  1.00 46.35 ? 34  ARG A NE    1 
ATOM   990  C CZ    . ARG B 2 34  ? 12.108  15.264 52.856  1.00 45.03 ? 34  ARG A CZ    1 
ATOM   991  N NH1   . ARG B 2 34  ? 11.339  16.307 52.570  1.00 43.80 ? 34  ARG A NH1   1 
ATOM   992  N NH2   . ARG B 2 34  ? 13.429  15.380 52.816  1.00 43.92 ? 34  ARG A NH2   1 
ATOM   993  N N     . LEU B 2 35  ? 6.010   10.294 54.035  1.00 48.62 ? 35  LEU A N     1 
ATOM   994  C CA    . LEU B 2 35  ? 4.590   10.002 54.061  1.00 49.52 ? 35  LEU A CA    1 
ATOM   995  C C     . LEU B 2 35  ? 4.262   8.846  55.005  1.00 49.71 ? 35  LEU A C     1 
ATOM   996  O O     . LEU B 2 35  ? 3.250   8.875  55.717  1.00 49.69 ? 35  LEU A O     1 
ATOM   997  C CB    . LEU B 2 35  ? 4.129   9.654  52.655  1.00 49.46 ? 35  LEU A CB    1 
ATOM   998  C CG    . LEU B 2 35  ? 4.060   10.849 51.718  1.00 49.22 ? 35  LEU A CG    1 
ATOM   999  C CD1   . LEU B 2 35  ? 4.050   10.368 50.279  1.00 50.63 ? 35  LEU A CD1   1 
ATOM   1000 C CD2   . LEU B 2 35  ? 2.808   11.649 52.041  1.00 49.02 ? 35  LEU A CD2   1 
ATOM   1001 N N     . ASP B 2 36  ? 5.116   7.826  55.003  1.00 49.45 ? 36  ASP A N     1 
ATOM   1002 C CA    . ASP B 2 36  ? 4.893   6.666  55.854  1.00 50.81 ? 36  ASP A CA    1 
ATOM   1003 C C     . ASP B 2 36  ? 5.031   7.004  57.332  1.00 51.12 ? 36  ASP A C     1 
ATOM   1004 O O     . ASP B 2 36  ? 4.286   6.477  58.160  1.00 50.39 ? 36  ASP A O     1 
ATOM   1005 C CB    . ASP B 2 36  ? 5.848   5.522  55.487  1.00 50.02 ? 36  ASP A CB    1 
ATOM   1006 C CG    . ASP B 2 36  ? 5.531   4.899  54.126  1.00 50.92 ? 36  ASP A CG    1 
ATOM   1007 O OD1   . ASP B 2 36  ? 4.350   4.940  53.690  1.00 50.01 ? 36  ASP A OD1   1 
ATOM   1008 O OD2   . ASP B 2 36  ? 6.468   4.349  53.501  1.00 50.94 ? 36  ASP A OD2   1 
ATOM   1009 N N     . GLU B 2 37  ? 5.970   7.890  57.662  1.00 52.19 ? 37  GLU A N     1 
ATOM   1010 C CA    . GLU B 2 37  ? 6.175   8.283  59.055  1.00 53.31 ? 37  GLU A CA    1 
ATOM   1011 C C     . GLU B 2 37  ? 5.027   9.169  59.528  1.00 52.30 ? 37  GLU A C     1 
ATOM   1012 O O     . GLU B 2 37  ? 4.851   9.379  60.719  1.00 53.63 ? 37  GLU A O     1 
ATOM   1013 C CB    . GLU B 2 37  ? 7.521   8.998  59.232  1.00 55.34 ? 37  GLU A CB    1 
ATOM   1014 C CG    . GLU B 2 37  ? 7.869   9.380  60.677  1.00 60.30 ? 37  GLU A CG    1 
ATOM   1015 C CD    . GLU B 2 37  ? 7.744   8.211  61.682  1.00 63.53 ? 37  GLU A CD    1 
ATOM   1016 O OE1   . GLU B 2 37  ? 8.262   7.097  61.384  1.00 64.30 ? 37  GLU A OE1   1 
ATOM   1017 O OE2   . GLU B 2 37  ? 7.141   8.420  62.775  1.00 63.47 ? 37  GLU A OE2   1 
ATOM   1018 N N     . LEU B 2 38  ? 4.243   9.693  58.599  1.00 51.64 ? 38  LEU A N     1 
ATOM   1019 C CA    . LEU B 2 38  ? 3.099   10.498 58.993  1.00 52.31 ? 38  LEU A CA    1 
ATOM   1020 C C     . LEU B 2 38  ? 1.912   9.583  58.776  1.00 52.92 ? 38  LEU A C     1 
ATOM   1021 O O     . LEU B 2 38  ? 0.763   9.951  59.023  1.00 52.91 ? 38  LEU A O     1 
ATOM   1022 C CB    . LEU B 2 38  ? 2.961   11.743 58.116  1.00 52.72 ? 38  LEU A CB    1 
ATOM   1023 C CG    . LEU B 2 38  ? 4.218   12.594 57.921  1.00 53.85 ? 38  LEU A CG    1 
ATOM   1024 C CD1   . LEU B 2 38  ? 3.812   13.897 57.268  1.00 54.36 ? 38  LEU A CD1   1 
ATOM   1025 C CD2   . LEU B 2 38  ? 4.917   12.862 59.252  1.00 55.51 ? 38  LEU A CD2   1 
ATOM   1026 N N     . GLY B 2 39  ? 2.222   8.378  58.300  1.00 54.30 ? 39  GLY A N     1 
ATOM   1027 C CA    . GLY B 2 39  ? 1.206   7.379  58.023  1.00 54.92 ? 39  GLY A CA    1 
ATOM   1028 C C     . GLY B 2 39  ? 0.079   7.984  57.222  1.00 55.65 ? 39  GLY A C     1 
ATOM   1029 O O     . GLY B 2 39  ? -1.028  8.126  57.729  1.00 56.15 ? 39  GLY A O     1 
ATOM   1030 N N     . VAL B 2 40  ? 0.358   8.353  55.976  1.00 55.60 ? 40  VAL A N     1 
ATOM   1031 C CA    . VAL B 2 40  ? -0.666  8.962  55.136  1.00 54.75 ? 40  VAL A CA    1 
ATOM   1032 C C     . VAL B 2 40  ? -1.026  8.068  53.962  1.00 53.67 ? 40  VAL A C     1 
ATOM   1033 O O     . VAL B 2 40  ? -0.159  7.420  53.380  1.00 52.76 ? 40  VAL A O     1 
ATOM   1034 C CB    . VAL B 2 40  ? -0.192  10.313 54.589  1.00 55.51 ? 40  VAL A CB    1 
ATOM   1035 C CG1   . VAL B 2 40  ? -1.364  11.045 53.941  1.00 55.53 ? 40  VAL A CG1   1 
ATOM   1036 C CG2   . VAL B 2 40  ? 0.418   11.131 55.714  1.00 55.73 ? 40  VAL A CG2   1 
ATOM   1037 N N     . GLU B 2 41  ? -2.309  8.027  53.621  1.00 53.49 ? 41  GLU A N     1 
ATOM   1038 C CA    . GLU B 2 41  ? -2.750  7.209  52.508  1.00 52.44 ? 41  GLU A CA    1 
ATOM   1039 C C     . GLU B 2 41  ? -2.605  8.003  51.213  1.00 50.82 ? 41  GLU A C     1 
ATOM   1040 O O     . GLU B 2 41  ? -3.341  8.964  50.955  1.00 49.60 ? 41  GLU A O     1 
ATOM   1041 C CB    . GLU B 2 41  ? -4.196  6.758  52.710  1.00 53.36 ? 41  GLU A CB    1 
ATOM   1042 C CG    . GLU B 2 41  ? -4.437  5.339  52.208  1.00 56.92 ? 41  GLU A CG    1 
ATOM   1043 C CD    . GLU B 2 41  ? -5.906  4.961  52.196  1.00 59.47 ? 41  GLU A CD    1 
ATOM   1044 O OE1   . GLU B 2 41  ? -6.595  5.200  53.221  1.00 62.05 ? 41  GLU A OE1   1 
ATOM   1045 O OE2   . GLU B 2 41  ? -6.371  4.421  51.165  1.00 59.36 ? 41  GLU A OE2   1 
ATOM   1046 N N     . TYR B 2 42  ? -1.641  7.572  50.407  1.00 49.48 ? 42  TYR A N     1 
ATOM   1047 C CA    . TYR B 2 42  ? -1.326  8.207  49.139  1.00 48.30 ? 42  TYR A CA    1 
ATOM   1048 C C     . TYR B 2 42  ? -1.184  7.195  48.009  1.00 47.49 ? 42  TYR A C     1 
ATOM   1049 O O     . TYR B 2 42  ? -1.254  5.982  48.218  1.00 47.71 ? 42  TYR A O     1 
ATOM   1050 C CB    . TYR B 2 42  ? -0.012  8.970  49.274  1.00 48.40 ? 42  TYR A CB    1 
ATOM   1051 C CG    . TYR B 2 42  ? 1.150   8.082  49.685  1.00 49.24 ? 42  TYR A CG    1 
ATOM   1052 C CD1   . TYR B 2 42  ? 1.885   7.357  48.736  1.00 49.18 ? 42  TYR A CD1   1 
ATOM   1053 C CD2   . TYR B 2 42  ? 1.491   7.936  51.027  1.00 48.16 ? 42  TYR A CD2   1 
ATOM   1054 C CE1   . TYR B 2 42  ? 2.936   6.506  49.129  1.00 49.12 ? 42  TYR A CE1   1 
ATOM   1055 C CE2   . TYR B 2 42  ? 2.528   7.093  51.425  1.00 49.85 ? 42  TYR A CE2   1 
ATOM   1056 C CZ    . TYR B 2 42  ? 3.245   6.383  50.479  1.00 49.95 ? 42  TYR A CZ    1 
ATOM   1057 O OH    . TYR B 2 42  ? 4.265   5.559  50.903  1.00 49.99 ? 42  TYR A OH    1 
ATOM   1058 N N     . VAL B 2 43  ? -0.980  7.724  46.807  1.00 45.65 ? 43  VAL A N     1 
ATOM   1059 C CA    . VAL B 2 43  ? -0.779  6.919  45.615  1.00 43.31 ? 43  VAL A CA    1 
ATOM   1060 C C     . VAL B 2 43  ? -0.127  7.780  44.549  1.00 42.61 ? 43  VAL A C     1 
ATOM   1061 O O     . VAL B 2 43  ? -0.641  8.845  44.199  1.00 43.33 ? 43  VAL A O     1 
ATOM   1062 C CB    . VAL B 2 43  ? -2.108  6.351  45.043  1.00 41.88 ? 43  VAL A CB    1 
ATOM   1063 C CG1   . VAL B 2 43  ? -3.036  7.472  44.619  1.00 39.73 ? 43  VAL A CG1   1 
ATOM   1064 C CG2   . VAL B 2 43  ? -1.812  5.456  43.856  1.00 39.64 ? 43  VAL A CG2   1 
ATOM   1065 N N     . PHE B 2 44  ? 1.017   7.327  44.050  1.00 41.31 ? 44  PHE A N     1 
ATOM   1066 C CA    . PHE B 2 44  ? 1.723   8.039  42.992  1.00 40.11 ? 44  PHE A CA    1 
ATOM   1067 C C     . PHE B 2 44  ? 0.978   7.818  41.672  1.00 39.24 ? 44  PHE A C     1 
ATOM   1068 O O     . PHE B 2 44  ? 0.660   6.684  41.297  1.00 37.40 ? 44  PHE A O     1 
ATOM   1069 C CB    . PHE B 2 44  ? 3.167   7.546  42.886  1.00 41.12 ? 44  PHE A CB    1 
ATOM   1070 C CG    . PHE B 2 44  ? 4.060   8.036  43.983  1.00 42.99 ? 44  PHE A CG    1 
ATOM   1071 C CD1   . PHE B 2 44  ? 3.775   7.753  45.310  1.00 43.02 ? 44  PHE A CD1   1 
ATOM   1072 C CD2   . PHE B 2 44  ? 5.191   8.781  43.685  1.00 43.67 ? 44  PHE A CD2   1 
ATOM   1073 C CE1   . PHE B 2 44  ? 4.604   8.204  46.317  1.00 43.97 ? 44  PHE A CE1   1 
ATOM   1074 C CE2   . PHE B 2 44  ? 6.023   9.233  44.689  1.00 43.02 ? 44  PHE A CE2   1 
ATOM   1075 C CZ    . PHE B 2 44  ? 5.729   8.945  46.004  1.00 44.29 ? 44  PHE A CZ    1 
ATOM   1076 N N     . VAL B 2 45  ? 0.707   8.912  40.973  1.00 39.08 ? 45  VAL A N     1 
ATOM   1077 C CA    . VAL B 2 45  ? 0.014   8.872  39.693  1.00 39.07 ? 45  VAL A CA    1 
ATOM   1078 C C     . VAL B 2 45  ? 0.823   9.698  38.693  1.00 38.84 ? 45  VAL A C     1 
ATOM   1079 O O     . VAL B 2 45  ? 1.948   10.098 38.985  1.00 39.76 ? 45  VAL A O     1 
ATOM   1080 C CB    . VAL B 2 45  ? -1.414  9.442  39.802  1.00 39.72 ? 45  VAL A CB    1 
ATOM   1081 C CG1   . VAL B 2 45  ? -2.222  8.621  40.796  1.00 38.93 ? 45  VAL A CG1   1 
ATOM   1082 C CG2   . VAL B 2 45  ? -1.365  10.898 40.244  1.00 38.05 ? 45  VAL A CG2   1 
ATOM   1083 N N     . GLY B 2 46  ? 0.265   9.956  37.518  1.00 38.58 ? 46  GLY A N     1 
ATOM   1084 C CA    . GLY B 2 46  ? 1.002   10.743 36.542  1.00 38.56 ? 46  GLY A CA    1 
ATOM   1085 C C     . GLY B 2 46  ? 2.159   9.990  35.912  1.00 37.70 ? 46  GLY A C     1 
ATOM   1086 O O     . GLY B 2 46  ? 2.514   8.895  36.349  1.00 36.75 ? 46  GLY A O     1 
ATOM   1087 N N     . SER B 2 47  ? 2.765   10.596 34.896  1.00 36.71 ? 47  SER A N     1 
ATOM   1088 C CA    . SER B 2 47  ? 3.869   9.974  34.159  1.00 37.45 ? 47  SER A CA    1 
ATOM   1089 C C     . SER B 2 47  ? 5.068   9.455  34.960  1.00 37.47 ? 47  SER A C     1 
ATOM   1090 O O     . SER B 2 47  ? 5.806   8.603  34.476  1.00 37.04 ? 47  SER A O     1 
ATOM   1091 C CB    . SER B 2 47  ? 4.377   10.927 33.079  1.00 35.43 ? 47  SER A CB    1 
ATOM   1092 O OG    . SER B 2 47  ? 4.924   12.086 33.676  1.00 39.09 ? 47  SER A OG    1 
ATOM   1093 N N     . TYR B 2 48  ? 5.290   9.958  36.165  1.00 37.17 ? 48  TYR A N     1 
ATOM   1094 C CA    . TYR B 2 48  ? 6.420   9.445  36.911  1.00 38.54 ? 48  TYR A CA    1 
ATOM   1095 C C     . TYR B 2 48  ? 6.143   8.019  37.370  1.00 40.36 ? 48  TYR A C     1 
ATOM   1096 O O     . TYR B 2 48  ? 6.990   7.132  37.236  1.00 40.94 ? 48  TYR A O     1 
ATOM   1097 C CB    . TYR B 2 48  ? 6.731   10.278 38.143  1.00 38.12 ? 48  TYR A CB    1 
ATOM   1098 C CG    . TYR B 2 48  ? 7.903   9.677  38.881  1.00 37.98 ? 48  TYR A CG    1 
ATOM   1099 C CD1   . TYR B 2 48  ? 9.196   9.803  38.379  1.00 38.19 ? 48  TYR A CD1   1 
ATOM   1100 C CD2   . TYR B 2 48  ? 7.709   8.882  40.016  1.00 38.59 ? 48  TYR A CD2   1 
ATOM   1101 C CE1   . TYR B 2 48  ? 10.265  9.152  38.976  1.00 40.13 ? 48  TYR A CE1   1 
ATOM   1102 C CE2   . TYR B 2 48  ? 8.773   8.221  40.621  1.00 39.35 ? 48  TYR A CE2   1 
ATOM   1103 C CZ    . TYR B 2 48  ? 10.051  8.359  40.093  1.00 40.93 ? 48  TYR A CZ    1 
ATOM   1104 O OH    . TYR B 2 48  ? 11.114  7.687  40.661  1.00 42.84 ? 48  TYR A OH    1 
ATOM   1105 N N     . ALA B 2 49  ? 4.954   7.808  37.924  1.00 40.35 ? 49  ALA A N     1 
ATOM   1106 C CA    . ALA B 2 49  ? 4.570   6.493  38.412  1.00 40.09 ? 49  ALA A CA    1 
ATOM   1107 C C     . ALA B 2 49  ? 4.612   5.468  37.293  1.00 39.92 ? 49  ALA A C     1 
ATOM   1108 O O     . ALA B 2 49  ? 4.984   4.319  37.516  1.00 40.74 ? 49  ALA A O     1 
ATOM   1109 C CB    . ALA B 2 49  ? 3.177   6.547  39.014  1.00 40.31 ? 49  ALA A CB    1 
ATOM   1110 N N     . ARG B 2 50  ? 4.240   5.892  36.087  1.00 40.18 ? 50  ARG A N     1 
ATOM   1111 C CA    . ARG B 2 50  ? 4.223   5.001  34.932  1.00 39.60 ? 50  ARG A CA    1 
ATOM   1112 C C     . ARG B 2 50  ? 5.442   5.127  34.025  1.00 40.43 ? 50  ARG A C     1 
ATOM   1113 O O     . ARG B 2 50  ? 5.391   4.745  32.853  1.00 41.54 ? 50  ARG A O     1 
ATOM   1114 C CB    . ARG B 2 50  ? 2.956   5.229  34.114  1.00 38.06 ? 50  ARG A CB    1 
ATOM   1115 C CG    . ARG B 2 50  ? 1.677   4.893  34.853  1.00 34.97 ? 50  ARG A CG    1 
ATOM   1116 C CD    . ARG B 2 50  ? 0.462   5.017  33.946  1.00 37.08 ? 50  ARG A CD    1 
ATOM   1117 N NE    . ARG B 2 50  ? -0.310  6.222  34.232  1.00 39.66 ? 50  ARG A NE    1 
ATOM   1118 C CZ    . ARG B 2 50  ? -0.137  7.398  33.639  1.00 39.62 ? 50  ARG A CZ    1 
ATOM   1119 N NH1   . ARG B 2 50  ? 0.786   7.557  32.704  1.00 41.37 ? 50  ARG A NH1   1 
ATOM   1120 N NH2   . ARG B 2 50  ? -0.889  8.424  33.991  1.00 42.39 ? 50  ARG A NH2   1 
ATOM   1121 N N     . ASN B 2 51  ? 6.534   5.644  34.579  1.00 41.20 ? 51  ASN A N     1 
ATOM   1122 C CA    . ASN B 2 51  ? 7.779   5.821  33.839  1.00 42.89 ? 51  ASN A CA    1 
ATOM   1123 C C     . ASN B 2 51  ? 7.553   6.306  32.407  1.00 42.68 ? 51  ASN A C     1 
ATOM   1124 O O     . ASN B 2 51  ? 8.291   5.932  31.498  1.00 44.14 ? 51  ASN A O     1 
ATOM   1125 C CB    . ASN B 2 51  ? 8.553   4.500  33.789  1.00 46.02 ? 51  ASN A CB    1 
ATOM   1126 C CG    . ASN B 2 51  ? 8.827   3.929  35.177  1.00 51.11 ? 51  ASN A CG    1 
ATOM   1127 O OD1   . ASN B 2 51  ? 9.426   4.597  36.033  1.00 52.28 ? 51  ASN A OD1   1 
ATOM   1128 N ND2   . ASN B 2 51  ? 8.391   2.684  35.407  1.00 51.15 ? 51  ASN A ND2   1 
ATOM   1129 N N     . THR B 2 52  ? 6.545   7.146  32.209  1.00 41.41 ? 52  THR A N     1 
ATOM   1130 C CA    . THR B 2 52  ? 6.234   7.665  30.883  1.00 41.79 ? 52  THR A CA    1 
ATOM   1131 C C     . THR B 2 52  ? 6.620   9.137  30.747  1.00 43.22 ? 52  THR A C     1 
ATOM   1132 O O     . THR B 2 52  ? 6.128   9.828  29.853  1.00 44.88 ? 52  THR A O     1 
ATOM   1133 C CB    . THR B 2 52  ? 4.727   7.541  30.550  1.00 42.45 ? 52  THR A CB    1 
ATOM   1134 O OG1   . THR B 2 52  ? 3.945   8.069  31.627  1.00 43.55 ? 52  THR A OG1   1 
ATOM   1135 C CG2   . THR B 2 52  ? 4.346   6.102  30.332  1.00 43.45 ? 52  THR A CG2   1 
ATOM   1136 N N     . TRP B 2 53  ? 7.499   9.625  31.616  1.00 43.49 ? 53  TRP A N     1 
ATOM   1137 C CA    . TRP B 2 53  ? 7.881   11.030 31.563  1.00 41.80 ? 53  TRP A CA    1 
ATOM   1138 C C     . TRP B 2 53  ? 9.002   11.312 30.571  1.00 41.88 ? 53  TRP A C     1 
ATOM   1139 O O     . TRP B 2 53  ? 9.958   10.544 30.433  1.00 41.04 ? 53  TRP A O     1 
ATOM   1140 C CB    . TRP B 2 53  ? 8.235   11.543 32.975  1.00 40.73 ? 53  TRP A CB    1 
ATOM   1141 C CG    . TRP B 2 53  ? 9.680   11.420 33.400  1.00 38.45 ? 53  TRP A CG    1 
ATOM   1142 C CD1   . TRP B 2 53  ? 10.683  12.319 33.174  1.00 37.41 ? 53  TRP A CD1   1 
ATOM   1143 C CD2   . TRP B 2 53  ? 10.261  10.354 34.155  1.00 37.31 ? 53  TRP A CD2   1 
ATOM   1144 N NE1   . TRP B 2 53  ? 11.850  11.882 33.742  1.00 37.71 ? 53  TRP A NE1   1 
ATOM   1145 C CE2   . TRP B 2 53  ? 11.622  10.676 34.352  1.00 39.19 ? 53  TRP A CE2   1 
ATOM   1146 C CE3   . TRP B 2 53  ? 9.764   9.157  34.686  1.00 36.86 ? 53  TRP A CE3   1 
ATOM   1147 C CZ2   . TRP B 2 53  ? 12.498  9.842  35.065  1.00 39.66 ? 53  TRP A CZ2   1 
ATOM   1148 C CZ3   . TRP B 2 53  ? 10.632  8.326  35.396  1.00 39.58 ? 53  TRP A CZ3   1 
ATOM   1149 C CH2   . TRP B 2 53  ? 11.988  8.676  35.577  1.00 39.42 ? 53  TRP A CH2   1 
ATOM   1150 N N     . LEU B 2 54  ? 8.864   12.435 29.881  1.00 42.13 ? 54  LEU A N     1 
ATOM   1151 C CA    . LEU B 2 54  ? 9.827   12.843 28.884  1.00 42.96 ? 54  LEU A CA    1 
ATOM   1152 C C     . LEU B 2 54  ? 11.125  13.340 29.506  1.00 44.37 ? 54  LEU A C     1 
ATOM   1153 O O     . LEU B 2 54  ? 11.122  14.062 30.505  1.00 43.03 ? 54  LEU A O     1 
ATOM   1154 C CB    . LEU B 2 54  ? 9.223   13.936 28.009  1.00 42.21 ? 54  LEU A CB    1 
ATOM   1155 C CG    . LEU B 2 54  ? 9.950   14.158 26.691  1.00 41.99 ? 54  LEU A CG    1 
ATOM   1156 C CD1   . LEU B 2 54  ? 10.008  12.849 25.934  1.00 39.83 ? 54  LEU A CD1   1 
ATOM   1157 C CD2   . LEU B 2 54  ? 9.236   15.232 25.887  1.00 41.85 ? 54  LEU A CD2   1 
ATOM   1158 N N     . LYS B 2 55  ? 12.237  12.945 28.896  1.00 46.76 ? 55  LYS A N     1 
ATOM   1159 C CA    . LYS B 2 55  ? 13.566  13.332 29.356  1.00 49.80 ? 55  LYS A CA    1 
ATOM   1160 C C     . LYS B 2 55  ? 13.628  14.815 29.738  1.00 50.56 ? 55  LYS A C     1 
ATOM   1161 O O     . LYS B 2 55  ? 13.523  15.684 28.877  1.00 51.97 ? 55  LYS A O     1 
ATOM   1162 C CB    . LYS B 2 55  ? 14.603  13.048 28.258  1.00 51.33 ? 55  LYS A CB    1 
ATOM   1163 C CG    . LYS B 2 55  ? 16.003  13.508 28.614  1.00 53.49 ? 55  LYS A CG    1 
ATOM   1164 C CD    . LYS B 2 55  ? 16.875  13.664 27.389  1.00 54.76 ? 55  LYS A CD    1 
ATOM   1165 C CE    . LYS B 2 55  ? 18.295  14.026 27.790  1.00 55.67 ? 55  LYS A CE    1 
ATOM   1166 N NZ    . LYS B 2 55  ? 18.317  15.124 28.801  1.00 58.56 ? 55  LYS A NZ    1 
ATOM   1167 N N     . GLY B 2 56  ? 13.787  15.105 31.026  1.00 50.70 ? 56  GLY A N     1 
ATOM   1168 C CA    . GLY B 2 56  ? 13.879  16.493 31.455  1.00 50.15 ? 56  GLY A CA    1 
ATOM   1169 C C     . GLY B 2 56  ? 12.636  17.152 32.031  1.00 49.52 ? 56  GLY A C     1 
ATOM   1170 O O     . GLY B 2 56  ? 12.669  18.338 32.355  1.00 48.19 ? 56  GLY A O     1 
ATOM   1171 N N     . SER B 2 57  ? 11.540  16.404 32.145  1.00 49.65 ? 57  SER A N     1 
ATOM   1172 C CA    . SER B 2 57  ? 10.301  16.939 32.707  1.00 49.47 ? 57  SER A CA    1 
ATOM   1173 C C     . SER B 2 57  ? 9.928   16.121 33.929  1.00 49.44 ? 57  SER A C     1 
ATOM   1174 O O     . SER B 2 57  ? 8.752   15.823 34.164  1.00 49.67 ? 57  SER A O     1 
ATOM   1175 C CB    . SER B 2 57  ? 9.162   16.880 31.685  1.00 50.26 ? 57  SER A CB    1 
ATOM   1176 O OG    . SER B 2 57  ? 9.392   17.778 30.606  1.00 51.22 ? 57  SER A OG    1 
ATOM   1177 N N     . LEU B 2 58  ? 10.947  15.765 34.708  1.00 49.13 ? 58  LEU A N     1 
ATOM   1178 C CA    . LEU B 2 58  ? 10.755  14.976 35.913  1.00 49.28 ? 58  LEU A CA    1 
ATOM   1179 C C     . LEU B 2 58  ? 9.883   15.700 36.937  1.00 50.00 ? 58  LEU A C     1 
ATOM   1180 O O     . LEU B 2 58  ? 10.277  16.719 37.510  1.00 50.28 ? 58  LEU A O     1 
ATOM   1181 C CB    . LEU B 2 58  ? 12.110  14.628 36.539  1.00 48.73 ? 58  LEU A CB    1 
ATOM   1182 C CG    . LEU B 2 58  ? 12.050  13.753 37.797  1.00 46.29 ? 58  LEU A CG    1 
ATOM   1183 C CD1   . LEU B 2 58  ? 11.308  12.467 37.478  1.00 46.69 ? 58  LEU A CD1   1 
ATOM   1184 C CD2   . LEU B 2 58  ? 13.452  13.450 38.293  1.00 46.26 ? 58  LEU A CD2   1 
ATOM   1185 N N     . GLU B 2 59  ? 8.687   15.164 37.152  1.00 50.64 ? 59  GLU A N     1 
ATOM   1186 C CA    . GLU B 2 59  ? 7.753   15.731 38.114  1.00 50.50 ? 59  GLU A CA    1 
ATOM   1187 C C     . GLU B 2 59  ? 6.899   14.600 38.697  1.00 49.40 ? 59  GLU A C     1 
ATOM   1188 O O     . GLU B 2 59  ? 6.186   13.896 37.966  1.00 47.98 ? 59  GLU A O     1 
ATOM   1189 C CB    . GLU B 2 59  ? 6.863   16.787 37.446  1.00 51.76 ? 59  GLU A CB    1 
ATOM   1190 C CG    . GLU B 2 59  ? 6.404   17.886 38.408  1.00 54.75 ? 59  GLU A CG    1 
ATOM   1191 C CD    . GLU B 2 59  ? 5.285   18.767 37.847  1.00 55.68 ? 59  GLU A CD    1 
ATOM   1192 O OE1   . GLU B 2 59  ? 4.234   18.210 37.459  1.00 55.52 ? 59  GLU A OE1   1 
ATOM   1193 O OE2   . GLU B 2 59  ? 5.452   20.012 37.806  1.00 57.09 ? 59  GLU A OE2   1 
ATOM   1194 N N     . ILE B 2 60  ? 6.995   14.432 40.016  1.00 47.49 ? 60  ILE A N     1 
ATOM   1195 C CA    . ILE B 2 60  ? 6.264   13.395 40.744  1.00 46.29 ? 60  ILE A CA    1 
ATOM   1196 C C     . ILE B 2 60  ? 4.908   13.891 41.210  1.00 45.36 ? 60  ILE A C     1 
ATOM   1197 O O     . ILE B 2 60  ? 4.819   14.948 41.813  1.00 46.56 ? 60  ILE A O     1 
ATOM   1198 C CB    . ILE B 2 60  ? 7.050   12.956 41.982  1.00 44.88 ? 60  ILE A CB    1 
ATOM   1199 C CG1   . ILE B 2 60  ? 8.367   12.308 41.554  1.00 44.11 ? 60  ILE A CG1   1 
ATOM   1200 C CG2   . ILE B 2 60  ? 6.207   12.024 42.824  1.00 44.69 ? 60  ILE A CG2   1 
ATOM   1201 C CD1   . ILE B 2 60  ? 9.331   12.060 42.685  1.00 40.56 ? 60  ILE A CD1   1 
ATOM   1202 N N     . ASP B 2 61  ? 3.859   13.123 40.945  1.00 45.80 ? 61  ASP A N     1 
ATOM   1203 C CA    . ASP B 2 61  ? 2.507   13.514 41.350  1.00 47.73 ? 61  ASP A CA    1 
ATOM   1204 C C     . ASP B 2 61  ? 1.945   12.588 42.440  1.00 47.86 ? 61  ASP A C     1 
ATOM   1205 O O     . ASP B 2 61  ? 1.647   11.425 42.183  1.00 49.22 ? 61  ASP A O     1 
ATOM   1206 C CB    . ASP B 2 61  ? 1.545   13.516 40.143  1.00 49.79 ? 61  ASP A CB    1 
ATOM   1207 C CG    . ASP B 2 61  ? 1.995   14.446 39.013  1.00 50.59 ? 61  ASP A CG    1 
ATOM   1208 O OD1   . ASP B 2 61  ? 2.673   13.958 38.085  1.00 52.55 ? 61  ASP A OD1   1 
ATOM   1209 O OD2   . ASP B 2 61  ? 1.672   15.659 39.052  1.00 50.02 ? 61  ASP A OD2   1 
ATOM   1210 N N     . VAL B 2 62  ? 1.783   13.117 43.648  1.00 47.23 ? 62  VAL A N     1 
ATOM   1211 C CA    . VAL B 2 62  ? 1.274   12.333 44.771  1.00 46.77 ? 62  VAL A CA    1 
ATOM   1212 C C     . VAL B 2 62  ? -0.139  12.710 45.200  1.00 46.69 ? 62  VAL A C     1 
ATOM   1213 O O     . VAL B 2 62  ? -0.368  13.781 45.759  1.00 47.90 ? 62  VAL A O     1 
ATOM   1214 C CB    . VAL B 2 62  ? 2.197   12.484 45.987  1.00 47.18 ? 62  VAL A CB    1 
ATOM   1215 C CG1   . VAL B 2 62  ? 1.623   11.733 47.191  1.00 45.11 ? 62  VAL A CG1   1 
ATOM   1216 C CG2   . VAL B 2 62  ? 3.588   11.983 45.622  1.00 47.38 ? 62  VAL A CG2   1 
ATOM   1217 N N     . PHE B 2 63  ? -1.083  11.813 44.951  1.00 45.44 ? 63  PHE A N     1 
ATOM   1218 C CA    . PHE B 2 63  ? -2.472  12.048 45.318  1.00 44.32 ? 63  PHE A CA    1 
ATOM   1219 C C     . PHE B 2 63  ? -2.815  11.436 46.676  1.00 44.31 ? 63  PHE A C     1 
ATOM   1220 O O     . PHE B 2 63  ? -2.537  10.258 46.939  1.00 44.13 ? 63  PHE A O     1 
ATOM   1221 C CB    . PHE B 2 63  ? -3.402  11.487 44.235  1.00 42.86 ? 63  PHE A CB    1 
ATOM   1222 C CG    . PHE B 2 63  ? -3.635  12.428 43.093  1.00 40.79 ? 63  PHE A CG    1 
ATOM   1223 C CD1   . PHE B 2 63  ? -2.572  13.097 42.494  1.00 39.24 ? 63  PHE A CD1   1 
ATOM   1224 C CD2   . PHE B 2 63  ? -4.920  12.633 42.603  1.00 41.11 ? 63  PHE A CD2   1 
ATOM   1225 C CE1   . PHE B 2 63  ? -2.787  13.955 41.423  1.00 38.66 ? 63  PHE A CE1   1 
ATOM   1226 C CE2   . PHE B 2 63  ? -5.148  13.488 41.531  1.00 40.61 ? 63  PHE A CE2   1 
ATOM   1227 C CZ    . PHE B 2 63  ? -4.078  14.150 40.940  1.00 39.41 ? 63  PHE A CZ    1 
ATOM   1228 N N     . LEU B 2 64  ? -3.416  12.250 47.537  1.00 44.36 ? 64  LEU A N     1 
ATOM   1229 C CA    . LEU B 2 64  ? -3.802  11.805 48.865  1.00 43.60 ? 64  LEU A CA    1 
ATOM   1230 C C     . LEU B 2 64  ? -5.250  11.341 48.853  1.00 44.95 ? 64  LEU A C     1 
ATOM   1231 O O     . LEU B 2 64  ? -6.161  12.122 48.562  1.00 45.18 ? 64  LEU A O     1 
ATOM   1232 C CB    . LEU B 2 64  ? -3.613  12.945 49.863  1.00 40.37 ? 64  LEU A CB    1 
ATOM   1233 C CG    . LEU B 2 64  ? -2.249  13.625 49.749  1.00 38.11 ? 64  LEU A CG    1 
ATOM   1234 C CD1   . LEU B 2 64  ? -2.106  14.637 50.878  1.00 40.15 ? 64  LEU A CD1   1 
ATOM   1235 C CD2   . LEU B 2 64  ? -1.132  12.589 49.801  1.00 34.82 ? 64  LEU A CD2   1 
ATOM   1236 N N     . LEU B 2 65  ? -5.462  10.066 49.160  1.00 46.31 ? 65  LEU A N     1 
ATOM   1237 C CA    . LEU B 2 65  ? -6.815  9.521  49.174  1.00 47.95 ? 65  LEU A CA    1 
ATOM   1238 C C     . LEU B 2 65  ? -7.569  9.869  50.460  1.00 48.97 ? 65  LEU A C     1 
ATOM   1239 O O     . LEU B 2 65  ? -7.103  9.600  51.570  1.00 49.52 ? 65  LEU A O     1 
ATOM   1240 C CB    . LEU B 2 65  ? -6.780  8.002  48.990  1.00 47.55 ? 65  LEU A CB    1 
ATOM   1241 C CG    . LEU B 2 65  ? -6.270  7.427  47.661  1.00 47.50 ? 65  LEU A CG    1 
ATOM   1242 C CD1   . LEU B 2 65  ? -6.930  8.147  46.486  1.00 47.09 ? 65  LEU A CD1   1 
ATOM   1243 C CD2   . LEU B 2 65  ? -4.769  7.559  47.596  1.00 48.01 ? 65  LEU A CD2   1 
ATOM   1244 N N     . PHE B 2 66  ? -8.743  10.468 50.302  1.00 48.62 ? 66  PHE A N     1 
ATOM   1245 C CA    . PHE B 2 66  ? -9.548  10.858 51.447  1.00 49.58 ? 66  PHE A CA    1 
ATOM   1246 C C     . PHE B 2 66  ? -10.891 10.162 51.486  1.00 49.62 ? 66  PHE A C     1 
ATOM   1247 O O     . PHE B 2 66  ? -11.461 9.823  50.454  1.00 48.70 ? 66  PHE A O     1 
ATOM   1248 C CB    . PHE B 2 66  ? -9.778  12.369 51.448  1.00 50.21 ? 66  PHE A CB    1 
ATOM   1249 C CG    . PHE B 2 66  ? -8.583  13.160 51.889  1.00 51.07 ? 66  PHE A CG    1 
ATOM   1250 C CD1   . PHE B 2 66  ? -8.139  13.090 53.207  1.00 51.47 ? 66  PHE A CD1   1 
ATOM   1251 C CD2   . PHE B 2 66  ? -7.896  13.974 50.991  1.00 50.69 ? 66  PHE A CD2   1 
ATOM   1252 C CE1   . PHE B 2 66  ? -7.028  13.819 53.627  1.00 50.03 ? 66  PHE A CE1   1 
ATOM   1253 C CE2   . PHE B 2 66  ? -6.785  14.706 51.400  1.00 49.21 ? 66  PHE A CE2   1 
ATOM   1254 C CZ    . PHE B 2 66  ? -6.352  14.628 52.719  1.00 50.43 ? 66  PHE A CZ    1 
ATOM   1255 N N     . PRO B 2 67  ? -11.409 9.926  52.696  1.00 49.59 ? 67  PRO A N     1 
ATOM   1256 C CA    . PRO B 2 67  ? -12.705 9.267  52.832  1.00 49.64 ? 67  PRO A CA    1 
ATOM   1257 C C     . PRO B 2 67  ? -13.767 10.024 52.048  1.00 50.02 ? 67  PRO A C     1 
ATOM   1258 O O     . PRO B 2 67  ? -13.775 11.251 51.987  1.00 49.72 ? 67  PRO A O     1 
ATOM   1259 C CB    . PRO B 2 67  ? -12.953 9.304  54.334  1.00 50.09 ? 67  PRO A CB    1 
ATOM   1260 C CG    . PRO B 2 67  ? -11.560 9.141  54.889  1.00 50.38 ? 67  PRO A CG    1 
ATOM   1261 C CD    . PRO B 2 67  ? -10.745 10.070 54.003  1.00 49.66 ? 67  PRO A CD    1 
ATOM   1262 N N     . GLU B 2 68  ? -14.666 9.272  51.443  1.00 50.98 ? 68  GLU A N     1 
ATOM   1263 C CA    . GLU B 2 68  ? -15.734 9.841  50.650  1.00 51.98 ? 68  GLU A CA    1 
ATOM   1264 C C     . GLU B 2 68  ? -16.553 10.902 51.402  1.00 51.34 ? 68  GLU A C     1 
ATOM   1265 O O     . GLU B 2 68  ? -16.970 11.904 50.815  1.00 51.05 ? 68  GLU A O     1 
ATOM   1266 C CB    . GLU B 2 68  ? -16.636 8.703  50.180  1.00 54.11 ? 68  GLU A CB    1 
ATOM   1267 C CG    . GLU B 2 68  ? -17.636 9.074  49.115  1.00 58.88 ? 68  GLU A CG    1 
ATOM   1268 C CD    . GLU B 2 68  ? -18.447 7.870  48.664  1.00 62.15 ? 68  GLU A CD    1 
ATOM   1269 O OE1   . GLU B 2 68  ? -17.822 6.874  48.226  1.00 64.22 ? 68  GLU A OE1   1 
ATOM   1270 O OE2   . GLU B 2 68  ? -19.699 7.915  48.749  1.00 63.44 ? 68  GLU A OE2   1 
ATOM   1271 N N     . GLU B 2 69  ? -16.765 10.689 52.700  1.00 51.21 ? 69  GLU A N     1 
ATOM   1272 C CA    . GLU B 2 69  ? -17.571 11.597 53.522  1.00 50.13 ? 69  GLU A CA    1 
ATOM   1273 C C     . GLU B 2 69  ? -16.964 12.942 53.905  1.00 49.73 ? 69  GLU A C     1 
ATOM   1274 O O     . GLU B 2 69  ? -17.677 13.825 54.384  1.00 49.92 ? 69  GLU A O     1 
ATOM   1275 C CB    . GLU B 2 69  ? -18.022 10.886 54.794  1.00 50.01 ? 69  GLU A CB    1 
ATOM   1276 C CG    . GLU B 2 69  ? -18.902 9.675  54.548  1.00 51.40 ? 69  GLU A CG    1 
ATOM   1277 C CD    . GLU B 2 69  ? -18.109 8.419  54.195  1.00 52.54 ? 69  GLU A CD    1 
ATOM   1278 O OE1   . GLU B 2 69  ? -18.751 7.368  53.956  1.00 51.68 ? 69  GLU A OE1   1 
ATOM   1279 O OE2   . GLU B 2 69  ? -16.854 8.480  54.166  1.00 51.40 ? 69  GLU A OE2   1 
ATOM   1280 N N     . PHE B 2 70  ? -15.662 13.102 53.706  1.00 50.13 ? 70  PHE A N     1 
ATOM   1281 C CA    . PHE B 2 70  ? -14.992 14.354 54.039  1.00 50.08 ? 70  PHE A CA    1 
ATOM   1282 C C     . PHE B 2 70  ? -15.477 15.531 53.187  1.00 50.90 ? 70  PHE A C     1 
ATOM   1283 O O     . PHE B 2 70  ? -15.883 15.360 52.037  1.00 50.87 ? 70  PHE A O     1 
ATOM   1284 C CB    . PHE B 2 70  ? -13.484 14.200 53.856  1.00 49.53 ? 70  PHE A CB    1 
ATOM   1285 C CG    . PHE B 2 70  ? -12.783 13.581 55.030  1.00 49.13 ? 70  PHE A CG    1 
ATOM   1286 C CD1   . PHE B 2 70  ? -13.315 12.467 55.674  1.00 48.85 ? 70  PHE A CD1   1 
ATOM   1287 C CD2   . PHE B 2 70  ? -11.575 14.102 55.478  1.00 48.50 ? 70  PHE A CD2   1 
ATOM   1288 C CE1   . PHE B 2 70  ? -12.652 11.875 56.749  1.00 48.61 ? 70  PHE A CE1   1 
ATOM   1289 C CE2   . PHE B 2 70  ? -10.902 13.518 56.555  1.00 49.22 ? 70  PHE A CE2   1 
ATOM   1290 C CZ    . PHE B 2 70  ? -11.442 12.402 57.190  1.00 48.38 ? 70  PHE A CZ    1 
ATOM   1291 N N     . SER B 2 71  ? -15.430 16.726 53.765  1.00 51.50 ? 71  SER A N     1 
ATOM   1292 C CA    . SER B 2 71  ? -15.836 17.943 53.075  1.00 51.95 ? 71  SER A CA    1 
ATOM   1293 C C     . SER B 2 71  ? -14.656 18.380 52.194  1.00 54.05 ? 71  SER A C     1 
ATOM   1294 O O     . SER B 2 71  ? -13.505 17.980 52.444  1.00 55.15 ? 71  SER A O     1 
ATOM   1295 C CB    . SER B 2 71  ? -16.134 19.032 54.100  1.00 50.71 ? 71  SER A CB    1 
ATOM   1296 O OG    . SER B 2 71  ? -14.957 19.330 54.830  1.00 49.11 ? 71  SER A OG    1 
ATOM   1297 N N     . LYS B 2 72  ? -14.923 19.184 51.165  1.00 54.15 ? 72  LYS A N     1 
ATOM   1298 C CA    . LYS B 2 72  ? -13.843 19.654 50.302  1.00 54.93 ? 72  LYS A CA    1 
ATOM   1299 C C     . LYS B 2 72  ? -12.864 20.433 51.192  1.00 53.83 ? 72  LYS A C     1 
ATOM   1300 O O     . LYS B 2 72  ? -11.648 20.286 51.085  1.00 53.95 ? 72  LYS A O     1 
ATOM   1301 C CB    . LYS B 2 72  ? -14.393 20.551 49.178  1.00 56.76 ? 72  LYS A CB    1 
ATOM   1302 C CG    . LYS B 2 72  ? -14.664 21.998 49.584  1.00 59.04 ? 72  LYS A CG    1 
ATOM   1303 C CD    . LYS B 2 72  ? -15.303 22.791 48.445  1.00 60.38 ? 72  LYS A CD    1 
ATOM   1304 C CE    . LYS B 2 72  ? -15.238 24.317 48.686  1.00 62.76 ? 72  LYS A CE    1 
ATOM   1305 N NZ    . LYS B 2 72  ? -15.998 24.812 49.893  1.00 64.01 ? 72  LYS A NZ    1 
ATOM   1306 N N     . GLU B 2 73  ? -13.423 21.243 52.085  1.00 53.43 ? 73  GLU A N     1 
ATOM   1307 C CA    . GLU B 2 73  ? -12.681 22.059 53.041  1.00 53.34 ? 73  GLU A CA    1 
ATOM   1308 C C     . GLU B 2 73  ? -11.666 21.230 53.841  1.00 53.06 ? 73  GLU A C     1 
ATOM   1309 O O     . GLU B 2 73  ? -10.496 21.616 53.976  1.00 52.26 ? 73  GLU A O     1 
ATOM   1310 C CB    . GLU B 2 73  ? -13.676 22.715 53.995  1.00 54.74 ? 73  GLU A CB    1 
ATOM   1311 C CG    . GLU B 2 73  ? -14.913 23.317 53.291  1.00 56.96 ? 73  GLU A CG    1 
ATOM   1312 C CD    . GLU B 2 73  ? -15.999 22.289 52.907  1.00 58.48 ? 73  GLU A CD    1 
ATOM   1313 O OE1   . GLU B 2 73  ? -15.679 21.218 52.348  1.00 60.79 ? 73  GLU A OE1   1 
ATOM   1314 O OE2   . GLU B 2 73  ? -17.196 22.561 53.149  1.00 58.60 ? 73  GLU A OE2   1 
ATOM   1315 N N     . GLU B 2 74  ? -12.111 20.096 54.380  1.00 52.04 ? 74  GLU A N     1 
ATOM   1316 C CA    . GLU B 2 74  ? -11.200 19.246 55.138  1.00 52.11 ? 74  GLU A CA    1 
ATOM   1317 C C     . GLU B 2 74  ? -10.090 18.781 54.221  1.00 51.32 ? 74  GLU A C     1 
ATOM   1318 O O     . GLU B 2 74  ? -8.919  18.789 54.601  1.00 51.62 ? 74  GLU A O     1 
ATOM   1319 C CB    . GLU B 2 74  ? -11.920 18.029 55.725  1.00 53.69 ? 74  GLU A CB    1 
ATOM   1320 C CG    . GLU B 2 74  ? -12.214 18.126 57.234  1.00 54.57 ? 74  GLU A CG    1 
ATOM   1321 C CD    . GLU B 2 74  ? -10.976 17.993 58.123  1.00 55.27 ? 74  GLU A CD    1 
ATOM   1322 O OE1   . GLU B 2 74  ? -10.342 16.912 58.141  1.00 54.72 ? 74  GLU A OE1   1 
ATOM   1323 O OE2   . GLU B 2 74  ? -10.646 18.977 58.820  1.00 55.68 ? 74  GLU A OE2   1 
ATOM   1324 N N     . LEU B 2 75  ? -10.455 18.387 53.006  1.00 50.79 ? 75  LEU A N     1 
ATOM   1325 C CA    . LEU B 2 75  ? -9.465  17.926 52.042  1.00 51.19 ? 75  LEU A CA    1 
ATOM   1326 C C     . LEU B 2 75  ? -8.324  18.922 51.820  1.00 51.45 ? 75  LEU A C     1 
ATOM   1327 O O     . LEU B 2 75  ? -7.157  18.530 51.816  1.00 50.81 ? 75  LEU A O     1 
ATOM   1328 C CB    . LEU B 2 75  ? -10.134 17.603 50.702  1.00 51.75 ? 75  LEU A CB    1 
ATOM   1329 C CG    . LEU B 2 75  ? -10.590 16.165 50.415  1.00 52.60 ? 75  LEU A CG    1 
ATOM   1330 C CD1   . LEU B 2 75  ? -11.606 15.672 51.446  1.00 53.12 ? 75  LEU A CD1   1 
ATOM   1331 C CD2   . LEU B 2 75  ? -11.190 16.136 49.026  1.00 52.64 ? 75  LEU A CD2   1 
ATOM   1332 N N     . ARG B 2 76  ? -8.641  20.206 51.645  1.00 53.09 ? 76  ARG A N     1 
ATOM   1333 C CA    . ARG B 2 76  ? -7.583  21.187 51.419  1.00 54.35 ? 76  ARG A CA    1 
ATOM   1334 C C     . ARG B 2 76  ? -6.759  21.462 52.672  1.00 54.65 ? 76  ARG A C     1 
ATOM   1335 O O     . ARG B 2 76  ? -5.523  21.486 52.615  1.00 54.61 ? 76  ARG A O     1 
ATOM   1336 C CB    . ARG B 2 76  ? -8.142  22.502 50.848  1.00 57.04 ? 76  ARG A CB    1 
ATOM   1337 C CG    . ARG B 2 76  ? -9.031  23.331 51.766  1.00 60.60 ? 76  ARG A CG    1 
ATOM   1338 C CD    . ARG B 2 76  ? -9.042  24.802 51.313  1.00 61.87 ? 76  ARG A CD    1 
ATOM   1339 N NE    . ARG B 2 76  ? -7.703  25.399 51.384  1.00 63.44 ? 76  ARG A NE    1 
ATOM   1340 C CZ    . ARG B 2 76  ? -7.049  25.658 52.520  1.00 64.89 ? 76  ARG A CZ    1 
ATOM   1341 N NH1   . ARG B 2 76  ? -7.606  25.385 53.696  1.00 64.77 ? 76  ARG A NH1   1 
ATOM   1342 N NH2   . ARG B 2 76  ? -5.819  26.170 52.484  1.00 65.41 ? 76  ARG A NH2   1 
ATOM   1343 N N     . GLU B 2 77  ? -7.436  21.648 53.802  1.00 54.66 ? 77  GLU A N     1 
ATOM   1344 C CA    . GLU B 2 77  ? -6.750  21.907 55.065  1.00 54.81 ? 77  GLU A CA    1 
ATOM   1345 C C     . GLU B 2 77  ? -5.775  20.793 55.456  1.00 53.67 ? 77  GLU A C     1 
ATOM   1346 O O     . GLU B 2 77  ? -4.636  21.075 55.802  1.00 53.30 ? 77  GLU A O     1 
ATOM   1347 C CB    . GLU B 2 77  ? -7.778  22.132 56.176  1.00 56.41 ? 77  GLU A CB    1 
ATOM   1348 C CG    . GLU B 2 77  ? -8.570  23.436 56.015  1.00 58.54 ? 77  GLU A CG    1 
ATOM   1349 C CD    . GLU B 2 77  ? -9.712  23.562 57.009  1.00 60.32 ? 77  GLU A CD    1 
ATOM   1350 O OE1   . GLU B 2 77  ? -10.307 24.661 57.108  1.00 60.55 ? 77  GLU A OE1   1 
ATOM   1351 O OE2   . GLU B 2 77  ? -10.021 22.554 57.688  1.00 62.16 ? 77  GLU A OE2   1 
ATOM   1352 N N     . ARG B 2 78  ? -6.211  19.534 55.394  1.00 52.24 ? 78  ARG A N     1 
ATOM   1353 C CA    . ARG B 2 78  ? -5.332  18.411 55.740  1.00 51.54 ? 78  ARG A CA    1 
ATOM   1354 C C     . ARG B 2 78  ? -4.310  18.199 54.632  1.00 50.13 ? 78  ARG A C     1 
ATOM   1355 O O     . ARG B 2 78  ? -3.197  17.735 54.884  1.00 49.32 ? 78  ARG A O     1 
ATOM   1356 C CB    . ARG B 2 78  ? -6.130  17.115 55.931  1.00 52.62 ? 78  ARG A CB    1 
ATOM   1357 C CG    . ARG B 2 78  ? -7.193  17.166 57.018  1.00 55.01 ? 78  ARG A CG    1 
ATOM   1358 C CD    . ARG B 2 78  ? -6.638  17.175 58.448  1.00 57.46 ? 78  ARG A CD    1 
ATOM   1359 N NE    . ARG B 2 78  ? -5.206  17.453 58.552  1.00 59.76 ? 78  ARG A NE    1 
ATOM   1360 C CZ    . ARG B 2 78  ? -4.247  16.562 58.309  1.00 61.02 ? 78  ARG A CZ    1 
ATOM   1361 N NH1   . ARG B 2 78  ? -4.566  15.324 57.941  1.00 60.94 ? 78  ARG A NH1   1 
ATOM   1362 N NH2   . ARG B 2 78  ? -2.968  16.902 58.448  1.00 61.11 ? 78  ARG A NH2   1 
ATOM   1363 N N     . GLY B 2 79  ? -4.707  18.530 53.405  1.00 48.79 ? 79  GLY A N     1 
ATOM   1364 C CA    . GLY B 2 79  ? -3.818  18.393 52.268  1.00 48.66 ? 79  GLY A CA    1 
ATOM   1365 C C     . GLY B 2 79  ? -2.726  19.435 52.381  1.00 48.73 ? 79  GLY A C     1 
ATOM   1366 O O     . GLY B 2 79  ? -1.557  19.173 52.084  1.00 48.60 ? 79  GLY A O     1 
ATOM   1367 N N     . LEU B 2 80  ? -3.111  20.630 52.814  1.00 47.95 ? 80  LEU A N     1 
ATOM   1368 C CA    . LEU B 2 80  ? -2.153  21.706 52.991  1.00 47.05 ? 80  LEU A CA    1 
ATOM   1369 C C     . LEU B 2 80  ? -1.208  21.354 54.133  1.00 46.12 ? 80  LEU A C     1 
ATOM   1370 O O     . LEU B 2 80  ? -0.007  21.625 54.079  1.00 44.66 ? 80  LEU A O     1 
ATOM   1371 C CB    . LEU B 2 80  ? -2.883  23.008 53.308  1.00 48.49 ? 80  LEU A CB    1 
ATOM   1372 C CG    . LEU B 2 80  ? -2.004  24.182 53.742  1.00 48.78 ? 80  LEU A CG    1 
ATOM   1373 C CD1   . LEU B 2 80  ? -0.893  24.451 52.720  1.00 47.76 ? 80  LEU A CD1   1 
ATOM   1374 C CD2   . LEU B 2 80  ? -2.900  25.396 53.919  1.00 49.54 ? 80  LEU A CD2   1 
ATOM   1375 N N     . GLU B 2 81  ? -1.768  20.746 55.169  1.00 45.81 ? 81  GLU A N     1 
ATOM   1376 C CA    . GLU B 2 81  ? -0.998  20.350 56.329  1.00 47.04 ? 81  GLU A CA    1 
ATOM   1377 C C     . GLU B 2 81  ? 0.034   19.303 55.932  1.00 46.34 ? 81  GLU A C     1 
ATOM   1378 O O     . GLU B 2 81  ? 1.218   19.420 56.261  1.00 44.88 ? 81  GLU A O     1 
ATOM   1379 C CB    . GLU B 2 81  ? -1.932  19.762 57.378  1.00 50.64 ? 81  GLU A CB    1 
ATOM   1380 C CG    . GLU B 2 81  ? -1.543  20.073 58.814  1.00 56.85 ? 81  GLU A CG    1 
ATOM   1381 C CD    . GLU B 2 81  ? -1.637  21.566 59.115  1.00 61.08 ? 81  GLU A CD    1 
ATOM   1382 O OE1   . GLU B 2 81  ? -0.656  22.297 58.817  1.00 63.09 ? 81  GLU A OE1   1 
ATOM   1383 O OE2   . GLU B 2 81  ? -2.700  22.004 59.630  1.00 62.47 ? 81  GLU A OE2   1 
ATOM   1384 N N     . ILE B 2 82  ? -0.432  18.278 55.221  1.00 45.97 ? 82  ILE A N     1 
ATOM   1385 C CA    . ILE B 2 82  ? 0.421   17.181 54.774  1.00 45.32 ? 82  ILE A CA    1 
ATOM   1386 C C     . ILE B 2 82  ? 1.494   17.631 53.795  1.00 45.78 ? 82  ILE A C     1 
ATOM   1387 O O     . ILE B 2 82  ? 2.673   17.335 53.978  1.00 44.60 ? 82  ILE A O     1 
ATOM   1388 C CB    . ILE B 2 82  ? -0.416  16.081 54.113  1.00 45.36 ? 82  ILE A CB    1 
ATOM   1389 C CG1   . ILE B 2 82  ? -1.417  15.525 55.127  1.00 45.16 ? 82  ILE A CG1   1 
ATOM   1390 C CG2   . ILE B 2 82  ? 0.489   14.989 53.578  1.00 44.17 ? 82  ILE A CG2   1 
ATOM   1391 C CD1   . ILE B 2 82  ? -2.431  14.575 54.539  1.00 44.74 ? 82  ILE A CD1   1 
ATOM   1392 N N     . GLY B 2 83  ? 1.087   18.341 52.749  1.00 46.51 ? 83  GLY A N     1 
ATOM   1393 C CA    . GLY B 2 83  ? 2.061   18.801 51.783  1.00 48.47 ? 83  GLY A CA    1 
ATOM   1394 C C     . GLY B 2 83  ? 3.134   19.615 52.481  1.00 49.66 ? 83  GLY A C     1 
ATOM   1395 O O     . GLY B 2 83  ? 4.322   19.538 52.143  1.00 50.21 ? 83  GLY A O     1 
ATOM   1396 N N     . LYS B 2 84  ? 2.705   20.381 53.480  1.00 49.81 ? 84  LYS A N     1 
ATOM   1397 C CA    . LYS B 2 84  ? 3.592   21.250 54.245  1.00 51.07 ? 84  LYS A CA    1 
ATOM   1398 C C     . LYS B 2 84  ? 4.725   20.513 54.972  1.00 50.61 ? 84  LYS A C     1 
ATOM   1399 O O     . LYS B 2 84  ? 5.909   20.794 54.748  1.00 50.17 ? 84  LYS A O     1 
ATOM   1400 C CB    . LYS B 2 84  ? 2.758   22.057 55.255  1.00 53.22 ? 84  LYS A CB    1 
ATOM   1401 C CG    . LYS B 2 84  ? 3.539   23.106 56.063  1.00 54.80 ? 84  LYS A CG    1 
ATOM   1402 C CD    . LYS B 2 84  ? 2.615   23.905 56.989  1.00 55.81 ? 84  LYS A CD    1 
ATOM   1403 C CE    . LYS B 2 84  ? 1.479   24.564 56.211  1.00 56.10 ? 84  LYS A CE    1 
ATOM   1404 N NZ    . LYS B 2 84  ? 2.011   25.389 55.083  1.00 54.62 ? 84  LYS A NZ    1 
ATOM   1405 N N     . ALA B 2 85  ? 4.355   19.570 55.835  1.00 50.56 ? 85  ALA A N     1 
ATOM   1406 C CA    . ALA B 2 85  ? 5.328   18.817 56.621  1.00 50.38 ? 85  ALA A CA    1 
ATOM   1407 C C     . ALA B 2 85  ? 6.164   17.840 55.819  1.00 50.64 ? 85  ALA A C     1 
ATOM   1408 O O     . ALA B 2 85  ? 7.166   17.325 56.316  1.00 51.31 ? 85  ALA A O     1 
ATOM   1409 C CB    . ALA B 2 85  ? 4.618   18.069 57.737  1.00 50.66 ? 85  ALA A CB    1 
ATOM   1410 N N     . VAL B 2 86  ? 5.768   17.593 54.577  1.00 50.70 ? 86  VAL A N     1 
ATOM   1411 C CA    . VAL B 2 86  ? 6.487   16.641 53.745  1.00 50.94 ? 86  VAL A CA    1 
ATOM   1412 C C     . VAL B 2 86  ? 7.346   17.255 52.639  1.00 51.28 ? 86  VAL A C     1 
ATOM   1413 O O     . VAL B 2 86  ? 8.018   16.539 51.891  1.00 50.11 ? 86  VAL A O     1 
ATOM   1414 C CB    . VAL B 2 86  ? 5.494   15.643 53.109  1.00 51.32 ? 86  VAL A CB    1 
ATOM   1415 C CG1   . VAL B 2 86  ? 4.647   16.342 52.056  1.00 51.00 ? 86  VAL A CG1   1 
ATOM   1416 C CG2   . VAL B 2 86  ? 6.241   14.471 52.524  1.00 50.90 ? 86  VAL A CG2   1 
ATOM   1417 N N     . LEU B 2 87  ? 7.359   18.578 52.543  1.00 52.29 ? 87  LEU A N     1 
ATOM   1418 C CA    . LEU B 2 87  ? 8.131   19.207 51.481  1.00 52.55 ? 87  LEU A CA    1 
ATOM   1419 C C     . LEU B 2 87  ? 9.277   20.103 51.922  1.00 53.07 ? 87  LEU A C     1 
ATOM   1420 O O     . LEU B 2 87  ? 9.094   20.989 52.758  1.00 53.51 ? 87  LEU A O     1 
ATOM   1421 C CB    . LEU B 2 87  ? 7.196   20.022 50.589  1.00 51.83 ? 87  LEU A CB    1 
ATOM   1422 C CG    . LEU B 2 87  ? 6.077   19.264 49.884  1.00 52.54 ? 87  LEU A CG    1 
ATOM   1423 C CD1   . LEU B 2 87  ? 5.105   20.265 49.299  1.00 54.30 ? 87  LEU A CD1   1 
ATOM   1424 C CD2   . LEU B 2 87  ? 6.648   18.369 48.796  1.00 53.05 ? 87  LEU A CD2   1 
ATOM   1425 N N     . ASP B 2 88  ? 10.453  19.877 51.338  1.00 52.99 ? 88  ASP A N     1 
ATOM   1426 C CA    . ASP B 2 88  ? 11.628  20.701 51.618  1.00 53.57 ? 88  ASP A CA    1 
ATOM   1427 C C     . ASP B 2 88  ? 11.196  22.171 51.482  1.00 55.77 ? 88  ASP A C     1 
ATOM   1428 O O     . ASP B 2 88  ? 11.450  22.995 52.374  1.00 56.64 ? 88  ASP A O     1 
ATOM   1429 C CB    . ASP B 2 88  ? 12.734  20.403 50.598  1.00 51.95 ? 88  ASP A CB    1 
ATOM   1430 C CG    . ASP B 2 88  ? 13.403  19.055 50.827  1.00 51.51 ? 88  ASP A CG    1 
ATOM   1431 O OD1   . ASP B 2 88  ? 12.745  18.135 51.359  1.00 51.42 ? 88  ASP A OD1   1 
ATOM   1432 O OD2   . ASP B 2 88  ? 14.590  18.913 50.455  1.00 51.67 ? 88  ASP A OD2   1 
ATOM   1433 N N     . SER B 2 89  ? 10.545  22.479 50.353  1.00 56.32 ? 89  SER A N     1 
ATOM   1434 C CA    . SER B 2 89  ? 10.037  23.821 50.040  1.00 56.17 ? 89  SER A CA    1 
ATOM   1435 C C     . SER B 2 89  ? 8.604   23.615 49.580  1.00 56.08 ? 89  SER A C     1 
ATOM   1436 O O     . SER B 2 89  ? 8.340   22.723 48.771  1.00 57.14 ? 89  SER A O     1 
ATOM   1437 C CB    . SER B 2 89  ? 10.831  24.445 48.890  1.00 56.18 ? 89  SER A CB    1 
ATOM   1438 O OG    . SER B 2 89  ? 12.216  24.145 49.006  1.00 58.56 ? 89  SER A OG    1 
ATOM   1439 N N     . TYR B 2 90  ? 7.675   24.421 50.076  1.00 55.40 ? 90  TYR A N     1 
ATOM   1440 C CA    . TYR B 2 90  ? 6.297   24.243 49.662  1.00 55.91 ? 90  TYR A CA    1 
ATOM   1441 C C     . TYR B 2 90  ? 5.702   25.543 49.149  1.00 57.10 ? 90  TYR A C     1 
ATOM   1442 O O     . TYR B 2 90  ? 6.059   26.630 49.611  1.00 59.10 ? 90  TYR A O     1 
ATOM   1443 C CB    . TYR B 2 90  ? 5.471   23.723 50.821  1.00 55.60 ? 90  TYR A CB    1 
ATOM   1444 C CG    . TYR B 2 90  ? 4.915   24.817 51.676  1.00 56.30 ? 90  TYR A CG    1 
ATOM   1445 C CD1   . TYR B 2 90  ? 3.614   25.270 51.487  1.00 56.04 ? 90  TYR A CD1   1 
ATOM   1446 C CD2   . TYR B 2 90  ? 5.689   25.407 52.671  1.00 57.24 ? 90  TYR A CD2   1 
ATOM   1447 C CE1   . TYR B 2 90  ? 3.095   26.276 52.269  1.00 58.13 ? 90  TYR A CE1   1 
ATOM   1448 C CE2   . TYR B 2 90  ? 5.186   26.417 53.458  1.00 58.07 ? 90  TYR A CE2   1 
ATOM   1449 C CZ    . TYR B 2 90  ? 3.887   26.851 53.256  1.00 59.23 ? 90  TYR A CZ    1 
ATOM   1450 O OH    . TYR B 2 90  ? 3.376   27.865 54.043  1.00 62.06 ? 90  TYR A OH    1 
ATOM   1451 N N     . GLU B 2 91  ? 4.771   25.420 48.211  1.00 56.29 ? 91  GLU A N     1 
ATOM   1452 C CA    . GLU B 2 91  ? 4.130   26.576 47.599  1.00 55.51 ? 91  GLU A CA    1 
ATOM   1453 C C     . GLU B 2 91  ? 2.685   26.208 47.257  1.00 54.37 ? 91  GLU A C     1 
ATOM   1454 O O     . GLU B 2 91  ? 2.444   25.130 46.713  1.00 56.16 ? 91  GLU A O     1 
ATOM   1455 C CB    . GLU B 2 91  ? 4.904   26.925 46.336  1.00 56.10 ? 91  GLU A CB    1 
ATOM   1456 C CG    . GLU B 2 91  ? 4.399   28.098 45.541  1.00 57.37 ? 91  GLU A CG    1 
ATOM   1457 C CD    . GLU B 2 91  ? 5.094   28.165 44.202  1.00 58.71 ? 91  GLU A CD    1 
ATOM   1458 O OE1   . GLU B 2 91  ? 6.349   28.086 44.166  1.00 59.22 ? 91  GLU A OE1   1 
ATOM   1459 O OE2   . GLU B 2 91  ? 4.383   28.288 43.186  1.00 59.97 ? 91  GLU A OE2   1 
ATOM   1460 N N     . ILE B 2 92  ? 1.729   27.084 47.564  1.00 51.73 ? 92  ILE A N     1 
ATOM   1461 C CA    . ILE B 2 92  ? 0.331   26.777 47.274  1.00 49.61 ? 92  ILE A CA    1 
ATOM   1462 C C     . ILE B 2 92  ? -0.101  27.151 45.858  1.00 49.24 ? 92  ILE A C     1 
ATOM   1463 O O     . ILE B 2 92  ? -0.159  28.330 45.496  1.00 49.20 ? 92  ILE A O     1 
ATOM   1464 C CB    . ILE B 2 92  ? -0.631  27.469 48.263  1.00 48.41 ? 92  ILE A CB    1 
ATOM   1465 C CG1   . ILE B 2 92  ? -0.475  26.869 49.658  1.00 47.04 ? 92  ILE A CG1   1 
ATOM   1466 C CG2   . ILE B 2 92  ? -2.078  27.305 47.780  1.00 47.91 ? 92  ILE A CG2   1 
ATOM   1467 C CD1   . ILE B 2 92  ? -1.481  27.400 50.658  1.00 44.54 ? 92  ILE A CD1   1 
ATOM   1468 N N     . ARG B 2 93  ? -0.425  26.135 45.066  1.00 48.57 ? 93  ARG A N     1 
ATOM   1469 C CA    . ARG B 2 93  ? -0.863  26.355 43.701  1.00 47.74 ? 93  ARG A CA    1 
ATOM   1470 C C     . ARG B 2 93  ? -2.375  26.216 43.614  1.00 47.09 ? 93  ARG A C     1 
ATOM   1471 O O     . ARG B 2 93  ? -3.036  25.910 44.602  1.00 46.13 ? 93  ARG A O     1 
ATOM   1472 C CB    . ARG B 2 93  ? -0.206  25.344 42.775  1.00 47.48 ? 93  ARG A CB    1 
ATOM   1473 C CG    . ARG B 2 93  ? 0.292   25.952 41.508  1.00 47.62 ? 93  ARG A CG    1 
ATOM   1474 C CD    . ARG B 2 93  ? 1.505   26.802 41.786  1.00 50.44 ? 93  ARG A CD    1 
ATOM   1475 N NE    . ARG B 2 93  ? 2.738   26.023 41.809  1.00 52.10 ? 93  ARG A NE    1 
ATOM   1476 C CZ    . ARG B 2 93  ? 3.204   25.347 40.761  1.00 55.53 ? 93  ARG A CZ    1 
ATOM   1477 N NH1   . ARG B 2 93  ? 2.531   25.349 39.612  1.00 57.52 ? 93  ARG A NH1   1 
ATOM   1478 N NH2   . ARG B 2 93  ? 4.360   24.700 40.839  1.00 55.35 ? 93  ARG A NH2   1 
ATOM   1479 N N     . TYR B 2 94  ? -2.924  26.445 42.429  1.00 47.98 ? 94  TYR A N     1 
ATOM   1480 C CA    . TYR B 2 94  ? -4.366  26.336 42.237  1.00 48.33 ? 94  TYR A CA    1 
ATOM   1481 C C     . TYR B 2 94  ? -4.699  25.793 40.851  1.00 48.84 ? 94  TYR A C     1 
ATOM   1482 O O     . TYR B 2 94  ? -3.895  25.881 39.916  1.00 48.98 ? 94  TYR A O     1 
ATOM   1483 C CB    . TYR B 2 94  ? -5.053  27.700 42.416  1.00 48.31 ? 94  TYR A CB    1 
ATOM   1484 C CG    . TYR B 2 94  ? -4.885  28.326 43.786  1.00 47.36 ? 94  TYR A CG    1 
ATOM   1485 C CD1   . TYR B 2 94  ? -3.702  28.962 44.141  1.00 47.44 ? 94  TYR A CD1   1 
ATOM   1486 C CD2   . TYR B 2 94  ? -5.898  28.250 44.741  1.00 47.11 ? 94  TYR A CD2   1 
ATOM   1487 C CE1   . TYR B 2 94  ? -3.524  29.505 45.417  1.00 48.26 ? 94  TYR A CE1   1 
ATOM   1488 C CE2   . TYR B 2 94  ? -5.730  28.791 46.022  1.00 47.98 ? 94  TYR A CE2   1 
ATOM   1489 C CZ    . TYR B 2 94  ? -4.537  29.415 46.350  1.00 47.77 ? 94  TYR A CZ    1 
ATOM   1490 O OH    . TYR B 2 94  ? -4.344  29.937 47.606  1.00 49.88 ? 94  TYR A OH    1 
ATOM   1491 N N     . ALA B 2 95  ? -5.897  25.229 40.745  1.00 48.48 ? 95  ALA A N     1 
ATOM   1492 C CA    . ALA B 2 95  ? -6.421  24.653 39.514  1.00 48.89 ? 95  ALA A CA    1 
ATOM   1493 C C     . ALA B 2 95  ? -7.858  24.506 40.004  1.00 49.93 ? 95  ALA A C     1 
ATOM   1494 O O     . ALA B 2 95  ? -8.369  25.368 40.720  1.00 49.93 ? 95  ALA A O     1 
ATOM   1495 C CB    . ALA B 2 95  ? -5.864  23.273 39.316  1.00 46.85 ? 95  ALA A CB    1 
ATOM   1496 N N     . GLU B 2 96  ? -8.500  23.395 39.659  1.00 50.82 ? 96  GLU A N     1 
ATOM   1497 C CA    . GLU B 2 96  ? -9.921  23.241 39.942  1.00 52.58 ? 96  GLU A CA    1 
ATOM   1498 C C     . GLU B 2 96  ? -10.124 23.498 41.434  1.00 52.07 ? 96  GLU A C     1 
ATOM   1499 O O     . GLU B 2 96  ? -11.183 23.967 41.873  1.00 50.99 ? 96  GLU A O     1 
ATOM   1500 C CB    . GLU B 2 96  ? -10.383 21.828 39.576  1.00 54.78 ? 96  GLU A CB    1 
ATOM   1501 C CG    . GLU B 2 96  ? -11.828 21.531 39.930  1.00 58.37 ? 96  GLU A CG    1 
ATOM   1502 C CD    . GLU B 2 96  ? -12.295 20.202 39.356  1.00 62.69 ? 96  GLU A CD    1 
ATOM   1503 O OE1   . GLU B 2 96  ? -11.532 19.206 39.473  1.00 64.61 ? 96  GLU A OE1   1 
ATOM   1504 O OE2   . GLU B 2 96  ? -13.424 20.154 38.798  1.00 63.37 ? 96  GLU A OE2   1 
ATOM   1505 N N     . HIS B 2 97  ? -9.078  23.180 42.194  1.00 50.53 ? 97  HIS A N     1 
ATOM   1506 C CA    . HIS B 2 97  ? -9.042  23.348 43.643  1.00 50.01 ? 97  HIS A CA    1 
ATOM   1507 C C     . HIS B 2 97  ? -7.601  23.675 43.987  1.00 47.32 ? 97  HIS A C     1 
ATOM   1508 O O     . HIS B 2 97  ? -6.708  23.561 43.143  1.00 46.81 ? 97  HIS A O     1 
ATOM   1509 C CB    . HIS B 2 97  ? -9.445  22.050 44.368  1.00 51.54 ? 97  HIS A CB    1 
ATOM   1510 C CG    . HIS B 2 97  ? -10.877 21.655 44.165  1.00 53.35 ? 97  HIS A CG    1 
ATOM   1511 N ND1   . HIS B 2 97  ? -11.930 22.385 44.674  1.00 53.52 ? 97  HIS A ND1   1 
ATOM   1512 C CD2   . HIS B 2 97  ? -11.429 20.614 43.496  1.00 53.87 ? 97  HIS A CD2   1 
ATOM   1513 C CE1   . HIS B 2 97  ? -13.070 21.810 44.328  1.00 53.66 ? 97  HIS A CE1   1 
ATOM   1514 N NE2   . HIS B 2 97  ? -12.794 20.734 43.612  1.00 54.10 ? 97  HIS A NE2   1 
ATOM   1515 N N     . PRO B 2 98  ? -7.356  24.088 45.231  1.00 44.92 ? 98  PRO A N     1 
ATOM   1516 C CA    . PRO B 2 98  ? -5.993  24.420 45.645  1.00 43.64 ? 98  PRO A CA    1 
ATOM   1517 C C     . PRO B 2 98  ? -5.217  23.183 46.089  1.00 42.32 ? 98  PRO A C     1 
ATOM   1518 O O     . PRO B 2 98  ? -5.770  22.304 46.743  1.00 42.39 ? 98  PRO A O     1 
ATOM   1519 C CB    . PRO B 2 98  ? -6.221  25.405 46.784  1.00 42.15 ? 98  PRO A CB    1 
ATOM   1520 C CG    . PRO B 2 98  ? -7.470  24.864 47.426  1.00 43.41 ? 98  PRO A CG    1 
ATOM   1521 C CD    . PRO B 2 98  ? -8.341  24.537 46.233  1.00 44.69 ? 98  PRO A CD    1 
ATOM   1522 N N     . TYR B 2 99  ? -3.938  23.129 45.734  1.00 41.71 ? 99  TYR A N     1 
ATOM   1523 C CA    . TYR B 2 99  ? -3.077  22.015 46.107  1.00 42.37 ? 99  TYR A CA    1 
ATOM   1524 C C     . TYR B 2 99  ? -1.676  22.529 46.399  1.00 42.93 ? 99  TYR A C     1 
ATOM   1525 O O     . TYR B 2 99  ? -1.363  23.670 46.091  1.00 44.53 ? 99  TYR A O     1 
ATOM   1526 C CB    . TYR B 2 99  ? -3.024  20.994 44.978  1.00 44.63 ? 99  TYR A CB    1 
ATOM   1527 C CG    . TYR B 2 99  ? -2.413  21.534 43.716  1.00 45.16 ? 99  TYR A CG    1 
ATOM   1528 C CD1   . TYR B 2 99  ? -1.047  21.426 43.478  1.00 45.41 ? 99  TYR A CD1   1 
ATOM   1529 C CD2   . TYR B 2 99  ? -3.200  22.180 42.766  1.00 45.73 ? 99  TYR A CD2   1 
ATOM   1530 C CE1   . TYR B 2 99  ? -0.481  21.950 42.322  1.00 45.72 ? 99  TYR A CE1   1 
ATOM   1531 C CE2   . TYR B 2 99  ? -2.646  22.707 41.613  1.00 46.22 ? 99  TYR A CE2   1 
ATOM   1532 C CZ    . TYR B 2 99  ? -1.288  22.590 41.396  1.00 45.66 ? 99  TYR A CZ    1 
ATOM   1533 O OH    . TYR B 2 99  ? -0.742  23.128 40.259  1.00 47.69 ? 99  TYR A OH    1 
ATOM   1534 N N     . VAL B 2 100 ? -0.826  21.696 46.986  1.00 42.35 ? 100 VAL A N     1 
ATOM   1535 C CA    . VAL B 2 100 ? 0.528   22.129 47.306  1.00 42.78 ? 100 VAL A CA    1 
ATOM   1536 C C     . VAL B 2 100 ? 1.541   21.632 46.291  1.00 43.44 ? 100 VAL A C     1 
ATOM   1537 O O     . VAL B 2 100 ? 1.441   20.511 45.814  1.00 45.41 ? 100 VAL A O     1 
ATOM   1538 C CB    . VAL B 2 100 ? 0.988   21.611 48.683  1.00 43.59 ? 100 VAL A CB    1 
ATOM   1539 C CG1   . VAL B 2 100 ? 2.364   22.182 49.010  1.00 43.57 ? 100 VAL A CG1   1 
ATOM   1540 C CG2   . VAL B 2 100 ? -0.027  21.976 49.756  1.00 42.96 ? 100 VAL A CG2   1 
ATOM   1541 N N     . HIS B 2 101 ? 2.514   22.477 45.965  1.00 43.63 ? 101 HIS A N     1 
ATOM   1542 C CA    . HIS B 2 101 ? 3.578   22.123 45.037  1.00 43.37 ? 101 HIS A CA    1 
ATOM   1543 C C     . HIS B 2 101 ? 4.882   22.362 45.782  1.00 44.41 ? 101 HIS A C     1 
ATOM   1544 O O     . HIS B 2 101 ? 5.009   23.358 46.490  1.00 45.86 ? 101 HIS A O     1 
ATOM   1545 C CB    . HIS B 2 101 ? 3.549   23.011 43.797  1.00 42.88 ? 101 HIS A CB    1 
ATOM   1546 C CG    . HIS B 2 101 ? 4.624   22.680 42.807  1.00 43.17 ? 101 HIS A CG    1 
ATOM   1547 N ND1   . HIS B 2 101 ? 4.417   21.834 41.740  1.00 41.18 ? 101 HIS A ND1   1 
ATOM   1548 C CD2   . HIS B 2 101 ? 5.930   23.036 42.757  1.00 42.07 ? 101 HIS A CD2   1 
ATOM   1549 C CE1   . HIS B 2 101 ? 5.549   21.684 41.075  1.00 41.84 ? 101 HIS A CE1   1 
ATOM   1550 N NE2   . HIS B 2 101 ? 6.481   22.403 41.672  1.00 41.45 ? 101 HIS A NE2   1 
ATOM   1551 N N     . GLY B 2 102 ? 5.853   21.469 45.624  1.00 45.17 ? 102 GLY A N     1 
ATOM   1552 C CA    . GLY B 2 102 ? 7.111   21.651 46.326  1.00 45.05 ? 102 GLY A CA    1 
ATOM   1553 C C     . GLY B 2 102 ? 8.297   20.965 45.680  1.00 45.54 ? 102 GLY A C     1 
ATOM   1554 O O     . GLY B 2 102 ? 8.308   20.725 44.474  1.00 46.40 ? 102 GLY A O     1 
ATOM   1555 N N     . VAL B 2 103 ? 9.295   20.636 46.496  1.00 46.24 ? 103 VAL A N     1 
ATOM   1556 C CA    . VAL B 2 103 ? 10.513  19.987 46.019  1.00 45.77 ? 103 VAL A CA    1 
ATOM   1557 C C     . VAL B 2 103 ? 11.068  19.041 47.076  1.00 46.47 ? 103 VAL A C     1 
ATOM   1558 O O     . VAL B 2 103 ? 11.158  19.398 48.248  1.00 47.73 ? 103 VAL A O     1 
ATOM   1559 C CB    . VAL B 2 103 ? 11.600  21.031 45.702  1.00 44.06 ? 103 VAL A CB    1 
ATOM   1560 C CG1   . VAL B 2 103 ? 12.868  20.343 45.253  1.00 44.22 ? 103 VAL A CG1   1 
ATOM   1561 C CG2   . VAL B 2 103 ? 11.107  21.985 44.637  1.00 43.43 ? 103 VAL A CG2   1 
ATOM   1562 N N     . VAL B 2 104 ? 11.439  17.834 46.658  1.00 47.65 ? 104 VAL A N     1 
ATOM   1563 C CA    . VAL B 2 104 ? 12.011  16.838 47.573  1.00 46.74 ? 104 VAL A CA    1 
ATOM   1564 C C     . VAL B 2 104 ? 13.321  16.325 46.954  1.00 47.21 ? 104 VAL A C     1 
ATOM   1565 O O     . VAL B 2 104 ? 13.352  15.973 45.778  1.00 46.47 ? 104 VAL A O     1 
ATOM   1566 C CB    . VAL B 2 104 ? 11.021  15.657 47.813  1.00 45.10 ? 104 VAL A CB    1 
ATOM   1567 C CG1   . VAL B 2 104 ? 11.661  14.616 48.711  1.00 45.45 ? 104 VAL A CG1   1 
ATOM   1568 C CG2   . VAL B 2 104 ? 9.743   16.165 48.462  1.00 44.52 ? 104 VAL A CG2   1 
ATOM   1569 N N     . LYS B 2 105 ? 14.392  16.285 47.744  1.00 47.62 ? 105 LYS A N     1 
ATOM   1570 C CA    . LYS B 2 105 ? 15.700  15.860 47.246  1.00 49.40 ? 105 LYS A CA    1 
ATOM   1571 C C     . LYS B 2 105 ? 16.065  16.365 45.865  1.00 49.60 ? 105 LYS A C     1 
ATOM   1572 O O     . LYS B 2 105 ? 16.632  15.639 45.050  1.00 50.07 ? 105 LYS A O     1 
ATOM   1573 C CB    . LYS B 2 105 ? 15.895  14.334 47.332  1.00 50.63 ? 105 LYS A CB    1 
ATOM   1574 C CG    . LYS B 2 105 ? 16.166  13.815 48.749  1.00 52.34 ? 105 LYS A CG    1 
ATOM   1575 C CD    . LYS B 2 105 ? 16.721  12.393 48.753  1.00 52.25 ? 105 LYS A CD    1 
ATOM   1576 C CE    . LYS B 2 105 ? 18.177  12.346 48.303  1.00 53.21 ? 105 LYS A CE    1 
ATOM   1577 N NZ    . LYS B 2 105 ? 18.684  10.938 48.224  1.00 53.90 ? 105 LYS A NZ    1 
ATOM   1578 N N     . GLY B 2 106 ? 15.696  17.613 45.604  1.00 49.85 ? 106 GLY A N     1 
ATOM   1579 C CA    . GLY B 2 106 ? 15.868  18.199 44.290  1.00 50.93 ? 106 GLY A CA    1 
ATOM   1580 C C     . GLY B 2 106 ? 14.946  17.846 43.130  1.00 51.85 ? 106 GLY A C     1 
ATOM   1581 O O     . GLY B 2 106 ? 15.423  17.797 41.997  1.00 52.55 ? 106 GLY A O     1 
ATOM   1582 N N     . VAL B 2 107 ? 13.657  17.593 43.368  1.00 51.12 ? 107 VAL A N     1 
ATOM   1583 C CA    . VAL B 2 107 ? 12.748  17.296 42.258  1.00 51.40 ? 107 VAL A CA    1 
ATOM   1584 C C     . VAL B 2 107 ? 11.338  17.822 42.517  1.00 51.95 ? 107 VAL A C     1 
ATOM   1585 O O     . VAL B 2 107 ? 10.883  17.901 43.666  1.00 51.84 ? 107 VAL A O     1 
ATOM   1586 C CB    . VAL B 2 107 ? 12.661  15.761 41.910  1.00 51.61 ? 107 VAL A CB    1 
ATOM   1587 C CG1   . VAL B 2 107 ? 13.966  15.049 42.264  1.00 50.37 ? 107 VAL A CG1   1 
ATOM   1588 C CG2   . VAL B 2 107 ? 11.459  15.123 42.580  1.00 50.80 ? 107 VAL A CG2   1 
ATOM   1589 N N     . GLU B 2 108 ? 10.656  18.177 41.432  1.00 52.09 ? 108 GLU A N     1 
ATOM   1590 C CA    . GLU B 2 108 ? 9.303   18.722 41.492  1.00 53.04 ? 108 GLU A CA    1 
ATOM   1591 C C     . GLU B 2 108 ? 8.268   17.744 42.017  1.00 52.19 ? 108 GLU A C     1 
ATOM   1592 O O     . GLU B 2 108 ? 8.238   16.573 41.633  1.00 52.19 ? 108 GLU A O     1 
ATOM   1593 C CB    . GLU B 2 108 ? 8.879   19.207 40.105  1.00 55.39 ? 108 GLU A CB    1 
ATOM   1594 C CG    . GLU B 2 108 ? 9.772   20.305 39.553  1.00 58.10 ? 108 GLU A CG    1 
ATOM   1595 C CD    . GLU B 2 108 ? 9.875   21.489 40.501  1.00 59.18 ? 108 GLU A CD    1 
ATOM   1596 O OE1   . GLU B 2 108 ? 8.820   22.065 40.859  1.00 59.64 ? 108 GLU A OE1   1 
ATOM   1597 O OE2   . GLU B 2 108 ? 11.015  21.840 40.888  1.00 60.52 ? 108 GLU A OE2   1 
ATOM   1598 N N     . VAL B 2 109 ? 7.398   18.240 42.885  1.00 51.08 ? 109 VAL A N     1 
ATOM   1599 C CA    . VAL B 2 109 ? 6.372   17.391 43.463  1.00 49.89 ? 109 VAL A CA    1 
ATOM   1600 C C     . VAL B 2 109 ? 5.039   18.098 43.614  1.00 48.88 ? 109 VAL A C     1 
ATOM   1601 O O     . VAL B 2 109 ? 4.983   19.252 44.055  1.00 48.25 ? 109 VAL A O     1 
ATOM   1602 C CB    . VAL B 2 109 ? 6.803   16.889 44.856  1.00 49.75 ? 109 VAL A CB    1 
ATOM   1603 C CG1   . VAL B 2 109 ? 5.645   16.172 45.541  1.00 50.98 ? 109 VAL A CG1   1 
ATOM   1604 C CG2   . VAL B 2 109 ? 8.006   15.979 44.725  1.00 50.46 ? 109 VAL A CG2   1 
ATOM   1605 N N     . ASP B 2 110 ? 3.971   17.398 43.240  1.00 47.30 ? 110 ASP A N     1 
ATOM   1606 C CA    . ASP B 2 110 ? 2.621   17.928 43.375  1.00 47.19 ? 110 ASP A CA    1 
ATOM   1607 C C     . ASP B 2 110 ? 1.936   17.061 44.423  1.00 45.65 ? 110 ASP A C     1 
ATOM   1608 O O     . ASP B 2 110 ? 2.027   15.837 44.376  1.00 45.41 ? 110 ASP A O     1 
ATOM   1609 C CB    . ASP B 2 110 ? 1.835   17.844 42.053  1.00 49.13 ? 110 ASP A CB    1 
ATOM   1610 C CG    . ASP B 2 110 ? 2.361   18.797 40.973  1.00 49.30 ? 110 ASP A CG    1 
ATOM   1611 O OD1   . ASP B 2 110 ? 2.566   19.995 41.266  1.00 49.47 ? 110 ASP A OD1   1 
ATOM   1612 O OD2   . ASP B 2 110 ? 2.550   18.350 39.820  1.00 49.76 ? 110 ASP A OD2   1 
ATOM   1613 N N     . VAL B 2 111 ? 1.275   17.695 45.383  1.00 44.54 ? 111 VAL A N     1 
ATOM   1614 C CA    . VAL B 2 111 ? 0.571   16.967 46.433  1.00 43.68 ? 111 VAL A CA    1 
ATOM   1615 C C     . VAL B 2 111 ? -0.907  17.333 46.357  1.00 45.21 ? 111 VAL A C     1 
ATOM   1616 O O     . VAL B 2 111 ? -1.362  18.279 46.999  1.00 46.19 ? 111 VAL A O     1 
ATOM   1617 C CB    . VAL B 2 111 ? 1.122   17.325 47.818  1.00 40.95 ? 111 VAL A CB    1 
ATOM   1618 C CG1   . VAL B 2 111 ? 0.374   16.559 48.890  1.00 39.67 ? 111 VAL A CG1   1 
ATOM   1619 C CG2   . VAL B 2 111 ? 2.609   17.005 47.869  1.00 39.21 ? 111 VAL A CG2   1 
ATOM   1620 N N     . VAL B 2 112 ? -1.647  16.565 45.563  1.00 45.64 ? 112 VAL A N     1 
ATOM   1621 C CA    . VAL B 2 112 ? -3.062  16.803 45.339  1.00 44.86 ? 112 VAL A CA    1 
ATOM   1622 C C     . VAL B 2 112 ? -4.024  15.993 46.194  1.00 47.04 ? 112 VAL A C     1 
ATOM   1623 O O     . VAL B 2 112 ? -3.875  14.787 46.359  1.00 49.28 ? 112 VAL A O     1 
ATOM   1624 C CB    . VAL B 2 112 ? -3.419  16.528 43.881  1.00 43.09 ? 112 VAL A CB    1 
ATOM   1625 C CG1   . VAL B 2 112 ? -4.843  16.938 43.618  1.00 41.06 ? 112 VAL A CG1   1 
ATOM   1626 C CG2   . VAL B 2 112 ? -2.458  17.256 42.969  1.00 42.25 ? 112 VAL A CG2   1 
ATOM   1627 N N     . PRO B 2 113 ? -5.016  16.664 46.779  1.00 47.31 ? 113 PRO A N     1 
ATOM   1628 C CA    . PRO B 2 113 ? -6.002  15.970 47.608  1.00 46.36 ? 113 PRO A CA    1 
ATOM   1629 C C     . PRO B 2 113 ? -7.170  15.522 46.729  1.00 46.81 ? 113 PRO A C     1 
ATOM   1630 O O     . PRO B 2 113 ? -7.582  16.249 45.823  1.00 45.43 ? 113 PRO A O     1 
ATOM   1631 C CB    . PRO B 2 113 ? -6.433  17.043 48.607  1.00 46.65 ? 113 PRO A CB    1 
ATOM   1632 C CG    . PRO B 2 113 ? -5.253  17.957 48.668  1.00 47.51 ? 113 PRO A CG    1 
ATOM   1633 C CD    . PRO B 2 113 ? -4.882  18.062 47.216  1.00 47.76 ? 113 PRO A CD    1 
ATOM   1634 N N     . CYS B 2 114 ? -7.696  14.331 47.001  1.00 47.37 ? 114 CYS A N     1 
ATOM   1635 C CA    . CYS B 2 114 ? -8.829  13.793 46.249  1.00 47.97 ? 114 CYS A CA    1 
ATOM   1636 C C     . CYS B 2 114 ? -9.520  12.748 47.103  1.00 48.41 ? 114 CYS A C     1 
ATOM   1637 O O     . CYS B 2 114 ? -8.978  12.326 48.115  1.00 49.06 ? 114 CYS A O     1 
ATOM   1638 C CB    . CYS B 2 114 ? -8.360  13.142 44.955  1.00 47.49 ? 114 CYS A CB    1 
ATOM   1639 S SG    . CYS B 2 114 ? -7.567  11.557 45.195  1.00 46.58 ? 114 CYS A SG    1 
ATOM   1640 N N     . TYR B 2 115 ? -10.710 12.325 46.699  1.00 49.15 ? 115 TYR A N     1 
ATOM   1641 C CA    . TYR B 2 115 ? -11.444 11.324 47.465  1.00 51.71 ? 115 TYR A CA    1 
ATOM   1642 C C     . TYR B 2 115 ? -11.103 9.884  47.063  1.00 52.14 ? 115 TYR A C     1 
ATOM   1643 O O     . TYR B 2 115 ? -10.948 9.580  45.884  1.00 53.21 ? 115 TYR A O     1 
ATOM   1644 C CB    . TYR B 2 115 ? -12.959 11.521 47.307  1.00 52.52 ? 115 TYR A CB    1 
ATOM   1645 C CG    . TYR B 2 115 ? -13.512 12.799 47.887  1.00 52.70 ? 115 TYR A CG    1 
ATOM   1646 C CD1   . TYR B 2 115 ? -13.657 13.937 47.101  1.00 54.66 ? 115 TYR A CD1   1 
ATOM   1647 C CD2   . TYR B 2 115 ? -13.901 12.866 49.218  1.00 52.54 ? 115 TYR A CD2   1 
ATOM   1648 C CE1   . TYR B 2 115 ? -14.178 15.122 47.627  1.00 54.95 ? 115 TYR A CE1   1 
ATOM   1649 C CE2   . TYR B 2 115 ? -14.422 14.035 49.758  1.00 54.67 ? 115 TYR A CE2   1 
ATOM   1650 C CZ    . TYR B 2 115 ? -14.561 15.165 48.961  1.00 55.07 ? 115 TYR A CZ    1 
ATOM   1651 O OH    . TYR B 2 115 ? -15.083 16.330 49.496  1.00 54.02 ? 115 TYR A OH    1 
ATOM   1652 N N     . LYS B 2 116 ? -10.979 8.995  48.042  1.00 53.25 ? 116 LYS A N     1 
ATOM   1653 C CA    . LYS B 2 116 ? -10.710 7.596  47.732  1.00 54.06 ? 116 LYS A CA    1 
ATOM   1654 C C     . LYS B 2 116 ? -12.067 7.042  47.315  1.00 54.72 ? 116 LYS A C     1 
ATOM   1655 O O     . LYS B 2 116 ? -12.990 6.974  48.126  1.00 53.92 ? 116 LYS A O     1 
ATOM   1656 C CB    . LYS B 2 116 ? -10.203 6.842  48.964  1.00 54.81 ? 116 LYS A CB    1 
ATOM   1657 C CG    . LYS B 2 116 ? -9.936  5.355  48.696  1.00 55.31 ? 116 LYS A CG    1 
ATOM   1658 C CD    . LYS B 2 116 ? -9.415  4.628  49.937  1.00 56.83 ? 116 LYS A CD    1 
ATOM   1659 C CE    . LYS B 2 116 ? -9.175  3.134  49.660  1.00 56.42 ? 116 LYS A CE    1 
ATOM   1660 N NZ    . LYS B 2 116 ? -8.837  2.385  50.914  1.00 57.30 ? 116 LYS A NZ    1 
ATOM   1661 N N     . LEU B 2 117 ? -12.192 6.653  46.051  1.00 56.80 ? 117 LEU A N     1 
ATOM   1662 C CA    . LEU B 2 117 ? -13.469 6.157  45.544  1.00 58.86 ? 117 LEU A CA    1 
ATOM   1663 C C     . LEU B 2 117 ? -13.375 4.846  44.777  1.00 61.43 ? 117 LEU A C     1 
ATOM   1664 O O     . LEU B 2 117 ? -12.284 4.361  44.467  1.00 63.43 ? 117 LEU A O     1 
ATOM   1665 C CB    . LEU B 2 117 ? -14.064 7.193  44.590  1.00 55.56 ? 117 LEU A CB    1 
ATOM   1666 C CG    . LEU B 2 117 ? -14.285 8.634  45.038  1.00 54.55 ? 117 LEU A CG    1 
ATOM   1667 C CD1   . LEU B 2 117 ? -14.503 9.508  43.812  1.00 53.68 ? 117 LEU A CD1   1 
ATOM   1668 C CD2   . LEU B 2 117 ? -15.482 8.700  45.976  1.00 53.03 ? 117 LEU A CD2   1 
ATOM   1669 N N     . LYS B 2 118 ? -14.526 4.253  44.501  1.00 63.88 ? 118 LYS A N     1 
ATOM   1670 C CA    . LYS B 2 118 ? -14.549 3.082  43.650  1.00 67.09 ? 118 LYS A CA    1 
ATOM   1671 C C     . LYS B 2 118 ? -15.730 3.334  42.728  1.00 68.96 ? 118 LYS A C     1 
ATOM   1672 O O     . LYS B 2 118 ? -16.826 3.712  43.186  1.00 69.83 ? 118 LYS A O     1 
ATOM   1673 C CB    . LYS B 2 118 ? -14.731 1.759  44.393  1.00 67.13 ? 118 LYS A CB    1 
ATOM   1674 C CG    . LYS B 2 118 ? -14.728 0.601  43.371  1.00 67.80 ? 118 LYS A CG    1 
ATOM   1675 C CD    . LYS B 2 118 ? -14.432 -0.779 43.961  1.00 67.78 ? 118 LYS A CD    1 
ATOM   1676 C CE    . LYS B 2 118 ? -14.093 -1.767 42.825  1.00 65.78 ? 118 LYS A CE    1 
ATOM   1677 N NZ    . LYS B 2 118 ? -13.619 -3.106 43.306  1.00 63.31 ? 118 LYS A NZ    1 
ATOM   1678 N N     . GLU B 2 119 ? -15.488 3.151  41.433  1.00 70.29 ? 119 GLU A N     1 
ATOM   1679 C CA    . GLU B 2 119 ? -16.489 3.370  40.394  1.00 71.52 ? 119 GLU A CA    1 
ATOM   1680 C C     . GLU B 2 119 ? -16.499 4.844  39.983  1.00 70.83 ? 119 GLU A C     1 
ATOM   1681 O O     . GLU B 2 119 ? -16.845 5.718  40.786  1.00 70.59 ? 119 GLU A O     1 
ATOM   1682 C CB    . GLU B 2 119 ? -17.889 2.929  40.862  1.00 73.17 ? 119 GLU A CB    1 
ATOM   1683 C CG    . GLU B 2 119 ? -18.107 1.407  40.822  1.00 76.22 ? 119 GLU A CG    1 
ATOM   1684 C CD    . GLU B 2 119 ? -17.754 0.796  39.457  1.00 78.29 ? 119 GLU A CD    1 
ATOM   1685 O OE1   . GLU B 2 119 ? -16.538 0.616  39.174  1.00 78.76 ? 119 GLU A OE1   1 
ATOM   1686 O OE2   . GLU B 2 119 ? -18.691 0.510  38.665  1.00 79.26 ? 119 GLU A OE2   1 
ATOM   1687 N N     . PRO B 2 120 ? -16.104 5.128  38.720  1.00 69.99 ? 120 PRO A N     1 
ATOM   1688 C CA    . PRO B 2 120 ? -16.042 6.471  38.132  1.00 68.81 ? 120 PRO A CA    1 
ATOM   1689 C C     . PRO B 2 120 ? -17.174 7.399  38.556  1.00 67.70 ? 120 PRO A C     1 
ATOM   1690 O O     . PRO B 2 120 ? -16.936 8.584  38.782  1.00 67.36 ? 120 PRO A O     1 
ATOM   1691 C CB    . PRO B 2 120 ? -16.029 6.181  36.639  1.00 68.81 ? 120 PRO A CB    1 
ATOM   1692 C CG    . PRO B 2 120 ? -15.127 4.963  36.589  1.00 69.39 ? 120 PRO A CG    1 
ATOM   1693 C CD    . PRO B 2 120 ? -15.655 4.115  37.741  1.00 69.36 ? 120 PRO A CD    1 
ATOM   1694 N N     . LYS B 2 121 ? -18.394 6.873  38.671  1.00 67.31 ? 121 LYS A N     1 
ATOM   1695 C CA    . LYS B 2 121 ? -19.524 7.701  39.116  1.00 67.79 ? 121 LYS A CA    1 
ATOM   1696 C C     . LYS B 2 121 ? -19.083 8.226  40.485  1.00 68.38 ? 121 LYS A C     1 
ATOM   1697 O O     . LYS B 2 121 ? -18.158 7.669  41.084  1.00 69.12 ? 121 LYS A O     1 
ATOM   1698 C CB    . LYS B 2 121 ? -20.794 6.861  39.311  1.00 67.83 ? 121 LYS A CB    1 
ATOM   1699 C CG    . LYS B 2 121 ? -20.984 5.685  38.354  1.00 69.03 ? 121 LYS A CG    1 
ATOM   1700 C CD    . LYS B 2 121 ? -21.416 6.112  36.947  1.00 69.42 ? 121 LYS A CD    1 
ATOM   1701 C CE    . LYS B 2 121 ? -21.630 4.875  36.052  1.00 69.46 ? 121 LYS A CE    1 
ATOM   1702 N NZ    . LYS B 2 121 ? -22.014 5.198  34.641  1.00 67.99 ? 121 LYS A NZ    1 
ATOM   1703 N N     . ASN B 2 122 ? -19.735 9.276  40.980  1.00 68.17 ? 122 ASN A N     1 
ATOM   1704 C CA    . ASN B 2 122 ? -19.403 9.861  42.289  1.00 68.62 ? 122 ASN A CA    1 
ATOM   1705 C C     . ASN B 2 122 ? -18.140 10.709 42.318  1.00 68.62 ? 122 ASN A C     1 
ATOM   1706 O O     . ASN B 2 122 ? -17.824 11.310 43.347  1.00 69.35 ? 122 ASN A O     1 
ATOM   1707 C CB    . ASN B 2 122 ? -19.007 8.783  43.319  1.00 68.45 ? 122 ASN A CB    1 
ATOM   1708 C CG    . ASN B 2 122 ? -20.132 7.798  43.604  1.00 68.79 ? 122 ASN A CG    1 
ATOM   1709 O OD1   . ASN B 2 122 ? -21.212 8.189  44.040  1.00 68.47 ? 122 ASN A OD1   1 
ATOM   1710 N ND2   . ASN B 2 122 ? -19.882 6.510  43.355  1.00 68.82 ? 122 ASN A ND2   1 
ATOM   1711 N N     . ILE B 2 123 ? -17.407 10.741 41.206  1.00 67.93 ? 123 ILE A N     1 
ATOM   1712 C CA    . ILE B 2 123 ? -16.313 11.691 41.024  1.00 66.67 ? 123 ILE A CA    1 
ATOM   1713 C C     . ILE B 2 123 ? -16.910 13.094 41.175  1.00 65.51 ? 123 ILE A C     1 
ATOM   1714 O O     . ILE B 2 123 ? -17.900 13.429 40.514  1.00 65.61 ? 123 ILE A O     1 
ATOM   1715 C CB    . ILE B 2 123 ? -15.670 11.533 39.613  1.00 67.23 ? 123 ILE A CB    1 
ATOM   1716 C CG1   . ILE B 2 123 ? -14.651 10.388 39.640  1.00 67.76 ? 123 ILE A CG1   1 
ATOM   1717 C CG2   . ILE B 2 123 ? -15.012 12.843 39.162  1.00 67.49 ? 123 ILE A CG2   1 
ATOM   1718 C CD1   . ILE B 2 123 ? -14.026 10.076 38.289  1.00 67.19 ? 123 ILE A CD1   1 
ATOM   1719 N N     . LYS B 2 124 ? -16.325 13.902 42.054  1.00 64.38 ? 124 LYS A N     1 
ATOM   1720 C CA    . LYS B 2 124 ? -16.827 15.256 42.286  1.00 63.70 ? 124 LYS A CA    1 
ATOM   1721 C C     . LYS B 2 124 ? -15.999 16.341 41.573  1.00 63.42 ? 124 LYS A C     1 
ATOM   1722 O O     . LYS B 2 124 ? -16.506 17.435 41.294  1.00 63.81 ? 124 LYS A O     1 
ATOM   1723 C CB    . LYS B 2 124 ? -16.887 15.516 43.795  1.00 63.26 ? 124 LYS A CB    1 
ATOM   1724 C CG    . LYS B 2 124 ? -17.823 14.551 44.535  1.00 61.96 ? 124 LYS A CG    1 
ATOM   1725 C CD    . LYS B 2 124 ? -17.476 14.438 46.015  1.00 61.71 ? 124 LYS A CD    1 
ATOM   1726 C CE    . LYS B 2 124 ? -18.198 13.268 46.666  1.00 60.88 ? 124 LYS A CE    1 
ATOM   1727 N NZ    . LYS B 2 124 ? -17.466 12.815 47.878  1.00 59.26 ? 124 LYS A NZ    1 
ATOM   1728 N N     . SER B 2 125 ? -14.737 16.025 41.273  1.00 62.61 ? 125 SER A N     1 
ATOM   1729 C CA    . SER B 2 125 ? -13.821 16.942 40.587  1.00 60.15 ? 125 SER A CA    1 
ATOM   1730 C C     . SER B 2 125 ? -12.906 16.131 39.671  1.00 58.46 ? 125 SER A C     1 
ATOM   1731 O O     . SER B 2 125 ? -12.609 14.968 39.956  1.00 56.78 ? 125 SER A O     1 
ATOM   1732 C CB    . SER B 2 125 ? -12.955 17.706 41.597  1.00 60.33 ? 125 SER A CB    1 
ATOM   1733 O OG    . SER B 2 125 ? -13.740 18.440 42.520  1.00 61.09 ? 125 SER A OG    1 
ATOM   1734 N N     . ALA B 2 126 ? -12.455 16.743 38.580  1.00 57.21 ? 126 ALA A N     1 
ATOM   1735 C CA    . ALA B 2 126 ? -11.576 16.049 37.650  1.00 55.57 ? 126 ALA A CA    1 
ATOM   1736 C C     . ALA B 2 126 ? -10.507 15.254 38.414  1.00 54.12 ? 126 ALA A C     1 
ATOM   1737 O O     . ALA B 2 126 ? -10.220 14.109 38.071  1.00 53.21 ? 126 ALA A O     1 
ATOM   1738 C CB    . ALA B 2 126 ? -10.917 17.050 36.703  1.00 54.97 ? 126 ALA A CB    1 
ATOM   1739 N N     . VAL B 2 127 ? -9.941  15.852 39.462  1.00 51.93 ? 127 VAL A N     1 
ATOM   1740 C CA    . VAL B 2 127 ? -8.893  15.193 40.248  1.00 50.83 ? 127 VAL A CA    1 
ATOM   1741 C C     . VAL B 2 127 ? -9.262  13.835 40.847  1.00 49.88 ? 127 VAL A C     1 
ATOM   1742 O O     . VAL B 2 127 ? -8.377  13.061 41.202  1.00 49.41 ? 127 VAL A O     1 
ATOM   1743 C CB    . VAL B 2 127 ? -8.377  16.097 41.403  1.00 50.84 ? 127 VAL A CB    1 
ATOM   1744 C CG1   . VAL B 2 127 ? -7.622  17.283 40.840  1.00 48.91 ? 127 VAL A CG1   1 
ATOM   1745 C CG2   . VAL B 2 127 ? -9.538  16.563 42.263  1.00 50.42 ? 127 VAL A CG2   1 
ATOM   1746 N N     . ASP B 2 128 ? -10.555 13.554 40.980  1.00 49.24 ? 128 ASP A N     1 
ATOM   1747 C CA    . ASP B 2 128 ? -10.995 12.272 41.527  1.00 48.09 ? 128 ASP A CA    1 
ATOM   1748 C C     . ASP B 2 128 ? -10.825 11.189 40.464  1.00 47.52 ? 128 ASP A C     1 
ATOM   1749 O O     . ASP B 2 128 ? -10.588 10.022 40.768  1.00 47.58 ? 128 ASP A O     1 
ATOM   1750 C CB    . ASP B 2 128 ? -12.471 12.327 41.945  1.00 46.89 ? 128 ASP A CB    1 
ATOM   1751 C CG    . ASP B 2 128 ? -12.696 13.155 43.186  1.00 46.44 ? 128 ASP A CG    1 
ATOM   1752 O OD1   . ASP B 2 128 ? -11.748 13.259 43.987  1.00 46.52 ? 128 ASP A OD1   1 
ATOM   1753 O OD2   . ASP B 2 128 ? -13.813 13.685 43.371  1.00 45.77 ? 128 ASP A OD2   1 
ATOM   1754 N N     . ARG B 2 129 ? -10.955 11.605 39.212  1.00 46.85 ? 129 ARG A N     1 
ATOM   1755 C CA    . ARG B 2 129 ? -10.848 10.715 38.072  1.00 45.74 ? 129 ARG A CA    1 
ATOM   1756 C C     . ARG B 2 129 ? -9.399  10.314 37.845  1.00 44.51 ? 129 ARG A C     1 
ATOM   1757 O O     . ARG B 2 129 ? -9.121  9.216  37.357  1.00 44.67 ? 129 ARG A O     1 
ATOM   1758 C CB    . ARG B 2 129 ? -11.412 11.412 36.829  1.00 45.67 ? 129 ARG A CB    1 
ATOM   1759 C CG    . ARG B 2 129 ? -11.664 10.495 35.675  1.00 47.74 ? 129 ARG A CG    1 
ATOM   1760 C CD    . ARG B 2 129 ? -12.227 11.247 34.487  1.00 50.88 ? 129 ARG A CD    1 
ATOM   1761 N NE    . ARG B 2 129 ? -13.516 11.881 34.772  1.00 54.85 ? 129 ARG A NE    1 
ATOM   1762 C CZ    . ARG B 2 129 ? -13.693 13.191 34.943  1.00 56.03 ? 129 ARG A CZ    1 
ATOM   1763 N NH1   . ARG B 2 129 ? -12.662 14.029 34.858  1.00 56.07 ? 129 ARG A NH1   1 
ATOM   1764 N NH2   . ARG B 2 129 ? -14.906 13.662 35.200  1.00 56.23 ? 129 ARG A NH2   1 
ATOM   1765 N N     . THR B 2 130 ? -8.478  11.198 38.212  1.00 42.42 ? 130 THR A N     1 
ATOM   1766 C CA    . THR B 2 130 ? -7.060  10.916 38.029  1.00 40.99 ? 130 THR A CA    1 
ATOM   1767 C C     . THR B 2 130 ? -6.679  9.532  38.546  1.00 40.89 ? 130 THR A C     1 
ATOM   1768 O O     . THR B 2 130 ? -5.948  8.803  37.887  1.00 41.31 ? 130 THR A O     1 
ATOM   1769 C CB    . THR B 2 130 ? -6.194  11.964 38.723  1.00 40.22 ? 130 THR A CB    1 
ATOM   1770 O OG1   . THR B 2 130 ? -6.670  13.262 38.370  1.00 41.17 ? 130 THR A OG1   1 
ATOM   1771 C CG2   . THR B 2 130 ? -4.743  11.842 38.281  1.00 38.38 ? 130 THR A CG2   1 
ATOM   1772 N N     . PRO B 2 131 ? -7.166  9.149  39.734  1.00 40.59 ? 131 PRO A N     1 
ATOM   1773 C CA    . PRO B 2 131 ? -6.800  7.815  40.223  1.00 40.85 ? 131 PRO A CA    1 
ATOM   1774 C C     . PRO B 2 131 ? -7.261  6.666  39.305  1.00 40.37 ? 131 PRO A C     1 
ATOM   1775 O O     . PRO B 2 131 ? -6.529  5.696  39.091  1.00 38.45 ? 131 PRO A O     1 
ATOM   1776 C CB    . PRO B 2 131 ? -7.453  7.772  41.606  1.00 40.23 ? 131 PRO A CB    1 
ATOM   1777 C CG    . PRO B 2 131 ? -7.352  9.192  42.053  1.00 39.97 ? 131 PRO A CG    1 
ATOM   1778 C CD    . PRO B 2 131 ? -7.783  9.946  40.810  1.00 40.40 ? 131 PRO A CD    1 
ATOM   1779 N N     . PHE B 2 132 ? -8.472  6.780  38.766  1.00 39.53 ? 132 PHE A N     1 
ATOM   1780 C CA    . PHE B 2 132 ? -8.987  5.751  37.877  1.00 40.40 ? 132 PHE A CA    1 
ATOM   1781 C C     . PHE B 2 132 ? -8.150  5.721  36.602  1.00 40.66 ? 132 PHE A C     1 
ATOM   1782 O O     . PHE B 2 132 ? -7.702  4.664  36.173  1.00 42.60 ? 132 PHE A O     1 
ATOM   1783 C CB    . PHE B 2 132 ? -10.461 6.010  37.541  1.00 41.34 ? 132 PHE A CB    1 
ATOM   1784 C CG    . PHE B 2 132 ? -11.396 5.835  38.713  1.00 43.44 ? 132 PHE A CG    1 
ATOM   1785 C CD1   . PHE B 2 132 ? -11.866 6.937  39.428  1.00 44.53 ? 132 PHE A CD1   1 
ATOM   1786 C CD2   . PHE B 2 132 ? -11.818 4.566  39.098  1.00 43.96 ? 132 PHE A CD2   1 
ATOM   1787 C CE1   . PHE B 2 132 ? -12.748 6.776  40.510  1.00 45.03 ? 132 PHE A CE1   1 
ATOM   1788 C CE2   . PHE B 2 132 ? -12.696 4.394  40.175  1.00 45.93 ? 132 PHE A CE2   1 
ATOM   1789 C CZ    . PHE B 2 132 ? -13.161 5.501  40.880  1.00 45.17 ? 132 PHE A CZ    1 
ATOM   1790 N N     . HIS B 2 133 ? -7.937  6.883  36.003  1.00 39.30 ? 133 HIS A N     1 
ATOM   1791 C CA    . HIS B 2 133 ? -7.142  6.968  34.791  1.00 38.41 ? 133 HIS A CA    1 
ATOM   1792 C C     . HIS B 2 133 ? -5.821  6.246  34.969  1.00 39.22 ? 133 HIS A C     1 
ATOM   1793 O O     . HIS B 2 133 ? -5.399  5.463  34.122  1.00 40.41 ? 133 HIS A O     1 
ATOM   1794 C CB    . HIS B 2 133 ? -6.836  8.422  34.449  1.00 39.49 ? 133 HIS A CB    1 
ATOM   1795 C CG    . HIS B 2 133 ? -8.009  9.186  33.933  1.00 39.82 ? 133 HIS A CG    1 
ATOM   1796 N ND1   . HIS B 2 133 ? -7.976  10.549 33.739  1.00 38.85 ? 133 HIS A ND1   1 
ATOM   1797 C CD2   . HIS B 2 133 ? -9.248  8.782  33.569  1.00 40.29 ? 133 HIS A CD2   1 
ATOM   1798 C CE1   . HIS B 2 133 ? -9.145  10.953 33.281  1.00 41.51 ? 133 HIS A CE1   1 
ATOM   1799 N NE2   . HIS B 2 133 ? -9.936  9.901  33.168  1.00 41.24 ? 133 HIS A NE2   1 
ATOM   1800 N N     . HIS B 2 134 ? -5.147  6.529  36.070  1.00 38.38 ? 134 HIS A N     1 
ATOM   1801 C CA    . HIS B 2 134 ? -3.871  5.903  36.312  1.00 38.14 ? 134 HIS A CA    1 
ATOM   1802 C C     . HIS B 2 134 ? -4.078  4.414  36.480  1.00 39.58 ? 134 HIS A C     1 
ATOM   1803 O O     . HIS B 2 134 ? -3.293  3.614  35.981  1.00 42.01 ? 134 HIS A O     1 
ATOM   1804 C CB    . HIS B 2 134 ? -3.233  6.480  37.566  1.00 36.54 ? 134 HIS A CB    1 
ATOM   1805 C CG    . HIS B 2 134 ? -1.996  5.760  37.993  1.00 34.05 ? 134 HIS A CG    1 
ATOM   1806 N ND1   . HIS B 2 134 ? -0.800  5.871  37.319  1.00 34.25 ? 134 HIS A ND1   1 
ATOM   1807 C CD2   . HIS B 2 134 ? -1.776  4.901  39.015  1.00 31.80 ? 134 HIS A CD2   1 
ATOM   1808 C CE1   . HIS B 2 134 ? 0.104   5.109  37.908  1.00 34.41 ? 134 HIS A CE1   1 
ATOM   1809 N NE2   . HIS B 2 134 ? -0.463  4.510  38.940  1.00 33.29 ? 134 HIS A NE2   1 
ATOM   1810 N N     . LYS B 2 135 ? -5.145  4.038  37.174  1.00 39.63 ? 135 LYS A N     1 
ATOM   1811 C CA    . LYS B 2 135 ? -5.422  2.631  37.401  1.00 41.02 ? 135 LYS A CA    1 
ATOM   1812 C C     . LYS B 2 135 ? -5.657  1.878  36.105  1.00 40.75 ? 135 LYS A C     1 
ATOM   1813 O O     . LYS B 2 135 ? -5.184  0.754  35.944  1.00 40.13 ? 135 LYS A O     1 
ATOM   1814 C CB    . LYS B 2 135 ? -6.632  2.476  38.313  1.00 43.84 ? 135 LYS A CB    1 
ATOM   1815 C CG    . LYS B 2 135 ? -6.278  1.941  39.682  1.00 48.63 ? 135 LYS A CG    1 
ATOM   1816 C CD    . LYS B 2 135 ? -6.072  0.430  39.662  1.00 51.41 ? 135 LYS A CD    1 
ATOM   1817 C CE    . LYS B 2 135 ? -5.334  -0.023 40.925  1.00 54.40 ? 135 LYS A CE    1 
ATOM   1818 N NZ    . LYS B 2 135 ? -5.819  0.730  42.128  1.00 56.06 ? 135 LYS A NZ    1 
ATOM   1819 N N     . TRP B 2 136 ? -6.388  2.503  35.185  1.00 39.81 ? 136 TRP A N     1 
ATOM   1820 C CA    . TRP B 2 136 ? -6.703  1.896  33.896  1.00 39.27 ? 136 TRP A CA    1 
ATOM   1821 C C     . TRP B 2 136 ? -5.467  1.830  33.012  1.00 40.93 ? 136 TRP A C     1 
ATOM   1822 O O     . TRP B 2 136 ? -5.344  0.955  32.154  1.00 43.17 ? 136 TRP A O     1 
ATOM   1823 C CB    . TRP B 2 136 ? -7.784  2.712  33.175  1.00 38.86 ? 136 TRP A CB    1 
ATOM   1824 C CG    . TRP B 2 136 ? -8.319  2.066  31.906  1.00 38.96 ? 136 TRP A CG    1 
ATOM   1825 C CD1   . TRP B 2 136 ? -9.440  1.290  31.789  1.00 39.40 ? 136 TRP A CD1   1 
ATOM   1826 C CD2   . TRP B 2 136 ? -7.717  2.094  30.604  1.00 38.66 ? 136 TRP A CD2   1 
ATOM   1827 N NE1   . TRP B 2 136 ? -9.567  0.831  30.503  1.00 40.08 ? 136 TRP A NE1   1 
ATOM   1828 C CE2   . TRP B 2 136 ? -8.526  1.309  29.754  1.00 39.44 ? 136 TRP A CE2   1 
ATOM   1829 C CE3   . TRP B 2 136 ? -6.575  2.706  30.073  1.00 38.30 ? 136 TRP A CE3   1 
ATOM   1830 C CZ2   . TRP B 2 136 ? -8.224  1.116  28.399  1.00 39.05 ? 136 TRP A CZ2   1 
ATOM   1831 C CZ3   . TRP B 2 136 ? -6.275  2.512  28.719  1.00 37.75 ? 136 TRP A CZ3   1 
ATOM   1832 C CH2   . TRP B 2 136 ? -7.099  1.724  27.902  1.00 39.36 ? 136 TRP A CH2   1 
ATOM   1833 N N     . LEU B 2 137 ? -4.540  2.747  33.244  1.00 39.91 ? 137 LEU A N     1 
ATOM   1834 C CA    . LEU B 2 137 ? -3.346  2.837  32.427  1.00 39.54 ? 137 LEU A CA    1 
ATOM   1835 C C     . LEU B 2 137 ? -2.154  1.989  32.830  1.00 39.79 ? 137 LEU A C     1 
ATOM   1836 O O     . LEU B 2 137 ? -1.474  1.442  31.964  1.00 37.94 ? 137 LEU A O     1 
ATOM   1837 C CB    . LEU B 2 137 ? -2.924  4.303  32.358  1.00 40.34 ? 137 LEU A CB    1 
ATOM   1838 C CG    . LEU B 2 137 ? -2.431  4.920  31.050  1.00 41.16 ? 137 LEU A CG    1 
ATOM   1839 C CD1   . LEU B 2 137 ? -3.194  4.365  29.867  1.00 40.89 ? 137 LEU A CD1   1 
ATOM   1840 C CD2   . LEU B 2 137 ? -2.603  6.436  31.142  1.00 41.10 ? 137 LEU A CD2   1 
ATOM   1841 N N     . GLU B 2 138 ? -1.900  1.858  34.132  1.00 40.20 ? 138 GLU A N     1 
ATOM   1842 C CA    . GLU B 2 138 ? -0.722  1.116  34.576  1.00 41.50 ? 138 GLU A CA    1 
ATOM   1843 C C     . GLU B 2 138 ? -0.485  -0.261 33.976  1.00 40.64 ? 138 GLU A C     1 
ATOM   1844 O O     . GLU B 2 138 ? 0.628   -0.555 33.557  1.00 42.04 ? 138 GLU A O     1 
ATOM   1845 C CB    . GLU B 2 138 ? -0.649  1.038  36.111  1.00 42.13 ? 138 GLU A CB    1 
ATOM   1846 C CG    . GLU B 2 138 ? -1.898  0.589  36.841  1.00 46.43 ? 138 GLU A CG    1 
ATOM   1847 C CD    . GLU B 2 138 ? -1.680  0.509  38.358  1.00 49.35 ? 138 GLU A CD    1 
ATOM   1848 O OE1   . GLU B 2 138 ? -0.945  1.367  38.905  1.00 49.47 ? 138 GLU A OE1   1 
ATOM   1849 O OE2   . GLU B 2 138 ? -2.254  -0.397 39.009  1.00 50.20 ? 138 GLU A OE2   1 
ATOM   1850 N N     . GLY B 2 139 ? -1.509  -1.097 33.909  1.00 38.33 ? 139 GLY A N     1 
ATOM   1851 C CA    . GLY B 2 139 ? -1.302  -2.418 33.357  1.00 37.80 ? 139 GLY A CA    1 
ATOM   1852 C C     . GLY B 2 139 ? -1.155  -2.470 31.849  1.00 38.78 ? 139 GLY A C     1 
ATOM   1853 O O     . GLY B 2 139 ? -0.477  -3.351 31.323  1.00 40.07 ? 139 GLY A O     1 
ATOM   1854 N N     . ARG B 2 140 ? -1.759  -1.513 31.153  1.00 38.80 ? 140 ARG A N     1 
ATOM   1855 C CA    . ARG B 2 140 ? -1.729  -1.492 29.698  1.00 38.36 ? 140 ARG A CA    1 
ATOM   1856 C C     . ARG B 2 140 ? -0.608  -0.745 28.999  1.00 40.15 ? 140 ARG A C     1 
ATOM   1857 O O     . ARG B 2 140 ? -0.358  -0.982 27.824  1.00 40.21 ? 140 ARG A O     1 
ATOM   1858 C CB    . ARG B 2 140 ? -3.063  -0.974 29.173  1.00 37.15 ? 140 ARG A CB    1 
ATOM   1859 C CG    . ARG B 2 140 ? -4.239  -1.822 29.608  1.00 36.96 ? 140 ARG A CG    1 
ATOM   1860 C CD    . ARG B 2 140 ? -5.547  -1.143 29.293  1.00 36.97 ? 140 ARG A CD    1 
ATOM   1861 N NE    . ARG B 2 140 ? -6.500  -1.326 30.379  1.00 37.98 ? 140 ARG A NE    1 
ATOM   1862 C CZ    . ARG B 2 140 ? -7.596  -2.063 30.291  1.00 38.90 ? 140 ARG A CZ    1 
ATOM   1863 N NH1   . ARG B 2 140 ? -7.883  -2.686 29.155  1.00 41.81 ? 140 ARG A NH1   1 
ATOM   1864 N NH2   . ARG B 2 140 ? -8.397  -2.186 31.339  1.00 38.90 ? 140 ARG A NH2   1 
ATOM   1865 N N     . ILE B 2 141 ? 0.077   0.152  29.695  1.00 42.13 ? 141 ILE A N     1 
ATOM   1866 C CA    . ILE B 2 141 ? 1.147   0.899  29.044  1.00 43.11 ? 141 ILE A CA    1 
ATOM   1867 C C     . ILE B 2 141 ? 2.496   0.263  29.344  1.00 44.41 ? 141 ILE A C     1 
ATOM   1868 O O     . ILE B 2 141 ? 3.522   0.630  28.773  1.00 44.34 ? 141 ILE A O     1 
ATOM   1869 C CB    . ILE B 2 141 ? 1.152   2.377  29.497  1.00 42.94 ? 141 ILE A CB    1 
ATOM   1870 C CG1   . ILE B 2 141 ? 1.961   3.217  28.509  1.00 44.13 ? 141 ILE A CG1   1 
ATOM   1871 C CG2   . ILE B 2 141 ? 1.732   2.499  30.884  1.00 42.46 ? 141 ILE A CG2   1 
ATOM   1872 C CD1   . ILE B 2 141 ? 1.420   3.207  27.082  1.00 43.55 ? 141 ILE A CD1   1 
ATOM   1873 N N     . LYS B 2 142 ? 2.482   -0.709 30.243  1.00 45.63 ? 142 LYS A N     1 
ATOM   1874 C CA    . LYS B 2 142 ? 3.701   -1.403 30.623  1.00 47.39 ? 142 LYS A CA    1 
ATOM   1875 C C     . LYS B 2 142 ? 4.364   -1.999 29.377  1.00 47.28 ? 142 LYS A C     1 
ATOM   1876 O O     . LYS B 2 142 ? 3.724   -2.702 28.600  1.00 46.63 ? 142 LYS A O     1 
ATOM   1877 C CB    . LYS B 2 142 ? 3.371   -2.517 31.626  1.00 48.67 ? 142 LYS A CB    1 
ATOM   1878 C CG    . LYS B 2 142 ? 4.567   -3.034 32.406  1.00 49.20 ? 142 LYS A CG    1 
ATOM   1879 C CD    . LYS B 2 142 ? 4.736   -2.324 33.746  1.00 49.81 ? 142 LYS A CD    1 
ATOM   1880 C CE    . LYS B 2 142 ? 6.084   -2.684 34.363  1.00 50.53 ? 142 LYS A CE    1 
ATOM   1881 N NZ    . LYS B 2 142 ? 6.333   -4.155 34.329  1.00 50.16 ? 142 LYS A NZ    1 
ATOM   1882 N N     . GLY B 2 143 ? 5.647   -1.704 29.193  1.00 48.30 ? 143 GLY A N     1 
ATOM   1883 C CA    . GLY B 2 143 ? 6.373   -2.223 28.051  1.00 48.69 ? 143 GLY A CA    1 
ATOM   1884 C C     . GLY B 2 143 ? 6.285   -1.356 26.810  1.00 48.93 ? 143 GLY A C     1 
ATOM   1885 O O     . GLY B 2 143 ? 6.722   -1.777 25.734  1.00 49.65 ? 143 GLY A O     1 
ATOM   1886 N N     . LYS B 2 144 ? 5.726   -0.154 26.945  1.00 47.59 ? 144 LYS A N     1 
ATOM   1887 C CA    . LYS B 2 144 ? 5.596   0.752  25.807  1.00 47.04 ? 144 LYS A CA    1 
ATOM   1888 C C     . LYS B 2 144 ? 5.919   2.193  26.191  1.00 47.04 ? 144 LYS A C     1 
ATOM   1889 O O     . LYS B 2 144 ? 5.714   3.127  25.411  1.00 46.25 ? 144 LYS A O     1 
ATOM   1890 C CB    . LYS B 2 144 ? 4.180   0.681  25.231  1.00 47.71 ? 144 LYS A CB    1 
ATOM   1891 C CG    . LYS B 2 144 ? 3.720   -0.720 24.847  1.00 50.64 ? 144 LYS A CG    1 
ATOM   1892 C CD    . LYS B 2 144 ? 2.966   -0.693 23.518  1.00 53.43 ? 144 LYS A CD    1 
ATOM   1893 C CE    . LYS B 2 144 ? 2.283   -2.022 23.218  1.00 53.38 ? 144 LYS A CE    1 
ATOM   1894 N NZ    . LYS B 2 144 ? 1.200   -2.330 24.212  1.00 53.98 ? 144 LYS A NZ    1 
ATOM   1895 N N     . GLU B 2 145 ? 6.428   2.366  27.403  1.00 47.41 ? 145 GLU A N     1 
ATOM   1896 C CA    . GLU B 2 145 ? 6.781   3.686  27.908  1.00 47.97 ? 145 GLU A CA    1 
ATOM   1897 C C     . GLU B 2 145 ? 7.600   4.534  26.933  1.00 48.53 ? 145 GLU A C     1 
ATOM   1898 O O     . GLU B 2 145 ? 7.371   5.733  26.802  1.00 48.89 ? 145 GLU A O     1 
ATOM   1899 C CB    . GLU B 2 145 ? 7.552   3.539  29.213  1.00 47.77 ? 145 GLU A CB    1 
ATOM   1900 C CG    . GLU B 2 145 ? 8.459   2.335  29.212  1.00 50.01 ? 145 GLU A CG    1 
ATOM   1901 C CD    . GLU B 2 145 ? 7.730   1.069  29.596  1.00 51.12 ? 145 GLU A CD    1 
ATOM   1902 O OE1   . GLU B 2 145 ? 8.216   -0.025 29.233  1.00 53.38 ? 145 GLU A OE1   1 
ATOM   1903 O OE2   . GLU B 2 145 ? 6.682   1.170  30.270  1.00 49.37 ? 145 GLU A OE2   1 
ATOM   1904 N N     . ASN B 2 146 ? 8.559   3.928  26.249  1.00 47.71 ? 146 ASN A N     1 
ATOM   1905 C CA    . ASN B 2 146 ? 9.375   4.707  25.336  1.00 47.49 ? 146 ASN A CA    1 
ATOM   1906 C C     . ASN B 2 146 ? 8.622   5.092  24.086  1.00 46.74 ? 146 ASN A C     1 
ATOM   1907 O O     . ASN B 2 146 ? 8.946   6.085  23.439  1.00 46.07 ? 146 ASN A O     1 
ATOM   1908 C CB    . ASN B 2 146 ? 10.648  3.949  25.004  1.00 48.83 ? 146 ASN A CB    1 
ATOM   1909 C CG    . ASN B 2 146 ? 11.500  3.720  26.237  1.00 51.74 ? 146 ASN A CG    1 
ATOM   1910 O OD1   . ASN B 2 146 ? 11.862  4.673  26.936  1.00 53.94 ? 146 ASN A OD1   1 
ATOM   1911 N ND2   . ASN B 2 146 ? 11.805  2.459  26.529  1.00 52.59 ? 146 ASN A ND2   1 
ATOM   1912 N N     . GLU B 2 147 ? 7.606   4.310  23.744  1.00 44.99 ? 147 GLU A N     1 
ATOM   1913 C CA    . GLU B 2 147 ? 6.800   4.639  22.585  1.00 43.56 ? 147 GLU A CA    1 
ATOM   1914 C C     . GLU B 2 147 ? 6.078   5.947  22.943  1.00 42.61 ? 147 GLU A C     1 
ATOM   1915 O O     . GLU B 2 147 ? 5.974   6.862  22.123  1.00 41.50 ? 147 GLU A O     1 
ATOM   1916 C CB    . GLU B 2 147 ? 5.805   3.513  22.286  1.00 43.41 ? 147 GLU A CB    1 
ATOM   1917 C CG    . GLU B 2 147 ? 6.446   2.222  21.749  1.00 43.95 ? 147 GLU A CG    1 
ATOM   1918 C CD    . GLU B 2 147 ? 7.399   2.475  20.580  1.00 45.30 ? 147 GLU A CD    1 
ATOM   1919 O OE1   . GLU B 2 147 ? 7.069   3.330  19.716  1.00 46.16 ? 147 GLU A OE1   1 
ATOM   1920 O OE2   . GLU B 2 147 ? 8.468   1.816  20.522  1.00 40.84 ? 147 GLU A OE2   1 
ATOM   1921 N N     . VAL B 2 148 ? 5.610   6.039  24.185  1.00 40.20 ? 148 VAL A N     1 
ATOM   1922 C CA    . VAL B 2 148 ? 4.933   7.242  24.661  1.00 37.87 ? 148 VAL A CA    1 
ATOM   1923 C C     . VAL B 2 148 ? 5.894   8.427  24.611  1.00 37.76 ? 148 VAL A C     1 
ATOM   1924 O O     . VAL B 2 148 ? 5.539   9.514  24.149  1.00 36.52 ? 148 VAL A O     1 
ATOM   1925 C CB    . VAL B 2 148 ? 4.436   7.067  26.112  1.00 36.87 ? 148 VAL A CB    1 
ATOM   1926 C CG1   . VAL B 2 148 ? 4.160   8.424  26.755  1.00 33.89 ? 148 VAL A CG1   1 
ATOM   1927 C CG2   . VAL B 2 148 ? 3.172   6.223  26.121  1.00 38.80 ? 148 VAL A CG2   1 
ATOM   1928 N N     . ARG B 2 149 ? 7.113   8.206  25.086  1.00 36.90 ? 149 ARG A N     1 
ATOM   1929 C CA    . ARG B 2 149 ? 8.120   9.250  25.094  1.00 35.99 ? 149 ARG A CA    1 
ATOM   1930 C C     . ARG B 2 149 ? 8.413   9.796  23.706  1.00 35.97 ? 149 ARG A C     1 
ATOM   1931 O O     . ARG B 2 149 ? 8.546   11.003 23.531  1.00 36.81 ? 149 ARG A O     1 
ATOM   1932 C CB    . ARG B 2 149 ? 9.386   8.726  25.761  1.00 36.74 ? 149 ARG A CB    1 
ATOM   1933 C CG    . ARG B 2 149 ? 9.263   8.748  27.266  1.00 38.50 ? 149 ARG A CG    1 
ATOM   1934 C CD    . ARG B 2 149 ? 10.307  7.914  27.964  1.00 38.96 ? 149 ARG A CD    1 
ATOM   1935 N NE    . ARG B 2 149 ? 10.211  8.131  29.401  1.00 40.03 ? 149 ARG A NE    1 
ATOM   1936 C CZ    . ARG B 2 149 ? 10.667  7.288  30.317  1.00 41.89 ? 149 ARG A CZ    1 
ATOM   1937 N NH1   . ARG B 2 149 ? 11.250  6.158  29.950  1.00 42.67 ? 149 ARG A NH1   1 
ATOM   1938 N NH2   . ARG B 2 149 ? 10.545  7.581  31.602  1.00 42.48 ? 149 ARG A NH2   1 
ATOM   1939 N N     . LEU B 2 150 ? 8.514   8.916  22.719  1.00 35.99 ? 150 LEU A N     1 
ATOM   1940 C CA    . LEU B 2 150 ? 8.771   9.359  21.360  1.00 35.01 ? 150 LEU A CA    1 
ATOM   1941 C C     . LEU B 2 150 ? 7.616   10.251 20.917  1.00 34.70 ? 150 LEU A C     1 
ATOM   1942 O O     . LEU B 2 150 ? 7.834   11.304 20.327  1.00 34.27 ? 150 LEU A O     1 
ATOM   1943 C CB    . LEU B 2 150 ? 8.887   8.160  20.420  1.00 36.57 ? 150 LEU A CB    1 
ATOM   1944 C CG    . LEU B 2 150 ? 10.138  7.288  20.548  1.00 38.62 ? 150 LEU A CG    1 
ATOM   1945 C CD1   . LEU B 2 150 ? 9.925   5.993  19.782  1.00 38.06 ? 150 LEU A CD1   1 
ATOM   1946 C CD2   . LEU B 2 150 ? 11.363  8.036  20.015  1.00 38.14 ? 150 LEU A CD2   1 
ATOM   1947 N N     . LEU B 2 151 ? 6.388   9.835  21.222  1.00 33.72 ? 151 LEU A N     1 
ATOM   1948 C CA    . LEU B 2 151 ? 5.209   10.603 20.832  1.00 33.37 ? 151 LEU A CA    1 
ATOM   1949 C C     . LEU B 2 151 ? 5.104   11.936 21.554  1.00 36.13 ? 151 LEU A C     1 
ATOM   1950 O O     . LEU B 2 151 ? 4.528   12.879 21.020  1.00 37.41 ? 151 LEU A O     1 
ATOM   1951 C CB    . LEU B 2 151 ? 3.928   9.797  21.069  1.00 28.96 ? 151 LEU A CB    1 
ATOM   1952 C CG    . LEU B 2 151 ? 2.601   10.468 20.694  1.00 23.97 ? 151 LEU A CG    1 
ATOM   1953 C CD1   . LEU B 2 151 ? 2.601   10.856 19.241  1.00 24.19 ? 151 LEU A CD1   1 
ATOM   1954 C CD2   . LEU B 2 151 ? 1.459   9.529  20.961  1.00 22.12 ? 151 LEU A CD2   1 
ATOM   1955 N N     . LYS B 2 152 ? 5.645   12.026 22.764  1.00 37.34 ? 152 LYS A N     1 
ATOM   1956 C CA    . LYS B 2 152 ? 5.584   13.283 23.498  1.00 37.05 ? 152 LYS A CA    1 
ATOM   1957 C C     . LYS B 2 152 ? 6.637   14.238 22.965  1.00 37.74 ? 152 LYS A C     1 
ATOM   1958 O O     . LYS B 2 152 ? 6.401   15.450 22.881  1.00 38.54 ? 152 LYS A O     1 
ATOM   1959 C CB    . LYS B 2 152 ? 5.802   13.060 24.999  1.00 37.81 ? 152 LYS A CB    1 
ATOM   1960 C CG    . LYS B 2 152 ? 4.628   12.419 25.698  1.00 38.17 ? 152 LYS A CG    1 
ATOM   1961 C CD    . LYS B 2 152 ? 4.843   12.313 27.191  1.00 38.47 ? 152 LYS A CD    1 
ATOM   1962 C CE    . LYS B 2 152 ? 3.615   11.722 27.870  1.00 38.72 ? 152 LYS A CE    1 
ATOM   1963 N NZ    . LYS B 2 152 ? 3.741   11.686 29.353  1.00 37.22 ? 152 LYS A NZ    1 
ATOM   1964 N N     . GLY B 2 153 ? 7.796   13.689 22.600  1.00 37.10 ? 153 GLY A N     1 
ATOM   1965 C CA    . GLY B 2 153 ? 8.870   14.515 22.078  1.00 38.48 ? 153 GLY A CA    1 
ATOM   1966 C C     . GLY B 2 153 ? 8.440   15.166 20.782  1.00 39.12 ? 153 GLY A C     1 
ATOM   1967 O O     . GLY B 2 153 ? 8.635   16.364 20.566  1.00 40.92 ? 153 GLY A O     1 
ATOM   1968 N N     . PHE B 2 154 ? 7.853   14.347 19.918  1.00 38.02 ? 154 PHE A N     1 
ATOM   1969 C CA    . PHE B 2 154 ? 7.349   14.779 18.622  1.00 38.38 ? 154 PHE A CA    1 
ATOM   1970 C C     . PHE B 2 154 ? 6.444   16.007 18.825  1.00 39.15 ? 154 PHE A C     1 
ATOM   1971 O O     . PHE B 2 154 ? 6.736   17.111 18.344  1.00 38.32 ? 154 PHE A O     1 
ATOM   1972 C CB    . PHE B 2 154 ? 6.553   13.623 18.003  1.00 36.62 ? 154 PHE A CB    1 
ATOM   1973 C CG    . PHE B 2 154 ? 6.365   13.720 16.521  1.00 35.98 ? 154 PHE A CG    1 
ATOM   1974 C CD1   . PHE B 2 154 ? 7.451   13.622 15.662  1.00 37.99 ? 154 PHE A CD1   1 
ATOM   1975 C CD2   . PHE B 2 154 ? 5.092   13.875 15.979  1.00 38.76 ? 154 PHE A CD2   1 
ATOM   1976 C CE1   . PHE B 2 154 ? 7.273   13.678 14.279  1.00 38.59 ? 154 PHE A CE1   1 
ATOM   1977 C CE2   . PHE B 2 154 ? 4.901   13.932 14.599  1.00 37.52 ? 154 PHE A CE2   1 
ATOM   1978 C CZ    . PHE B 2 154 ? 5.993   13.832 13.748  1.00 38.00 ? 154 PHE A CZ    1 
ATOM   1979 N N     . LEU B 2 155 ? 5.356   15.800 19.565  1.00 38.97 ? 155 LEU A N     1 
ATOM   1980 C CA    . LEU B 2 155 ? 4.379   16.846 19.849  1.00 38.57 ? 155 LEU A CA    1 
ATOM   1981 C C     . LEU B 2 155 ? 5.001   18.072 20.533  1.00 39.23 ? 155 LEU A C     1 
ATOM   1982 O O     . LEU B 2 155 ? 4.645   19.209 20.230  1.00 38.91 ? 155 LEU A O     1 
ATOM   1983 C CB    . LEU B 2 155 ? 3.251   16.258 20.707  1.00 35.86 ? 155 LEU A CB    1 
ATOM   1984 C CG    . LEU B 2 155 ? 2.496   15.074 20.086  1.00 34.51 ? 155 LEU A CG    1 
ATOM   1985 C CD1   . LEU B 2 155 ? 1.823   14.267 21.172  1.00 33.76 ? 155 LEU A CD1   1 
ATOM   1986 C CD2   . LEU B 2 155 ? 1.481   15.562 19.075  1.00 35.23 ? 155 LEU A CD2   1 
ATOM   1987 N N     . LYS B 2 156 ? 5.934   17.835 21.448  1.00 39.43 ? 156 LYS A N     1 
ATOM   1988 C CA    . LYS B 2 156 ? 6.602   18.920 22.157  1.00 39.59 ? 156 LYS A CA    1 
ATOM   1989 C C     . LYS B 2 156 ? 7.462   19.700 21.163  1.00 39.42 ? 156 LYS A C     1 
ATOM   1990 O O     . LYS B 2 156 ? 7.427   20.924 21.116  1.00 38.21 ? 156 LYS A O     1 
ATOM   1991 C CB    . LYS B 2 156 ? 7.482   18.342 23.265  1.00 41.46 ? 156 LYS A CB    1 
ATOM   1992 C CG    . LYS B 2 156 ? 8.138   19.359 24.178  1.00 42.27 ? 156 LYS A CG    1 
ATOM   1993 C CD    . LYS B 2 156 ? 7.295   19.616 25.415  1.00 45.18 ? 156 LYS A CD    1 
ATOM   1994 C CE    . LYS B 2 156 ? 8.000   20.554 26.404  1.00 44.92 ? 156 LYS A CE    1 
ATOM   1995 N NZ    . LYS B 2 156 ? 9.259   19.972 26.952  1.00 45.46 ? 156 LYS A NZ    1 
ATOM   1996 N N     . ALA B 2 157 ? 8.227   18.987 20.350  1.00 38.85 ? 157 ALA A N     1 
ATOM   1997 C CA    . ALA B 2 157 ? 9.091   19.641 19.383  1.00 38.71 ? 157 ALA A CA    1 
ATOM   1998 C C     . ALA B 2 157 ? 8.318   20.477 18.361  1.00 38.25 ? 157 ALA A C     1 
ATOM   1999 O O     . ALA B 2 157 ? 8.790   21.519 17.906  1.00 38.50 ? 157 ALA A O     1 
ATOM   2000 C CB    . ALA B 2 157 ? 9.941   18.603 18.678  1.00 38.33 ? 157 ALA A CB    1 
ATOM   2001 N N     . ASN B 2 158 ? 7.128   20.031 17.991  1.00 37.77 ? 158 ASN A N     1 
ATOM   2002 C CA    . ASN B 2 158 ? 6.361   20.784 17.016  1.00 36.08 ? 158 ASN A CA    1 
ATOM   2003 C C     . ASN B 2 158 ? 5.327   21.678 17.673  1.00 35.46 ? 158 ASN A C     1 
ATOM   2004 O O     . ASN B 2 158 ? 4.288   21.964 17.096  1.00 35.21 ? 158 ASN A O     1 
ATOM   2005 C CB    . ASN B 2 158 ? 5.708   19.834 16.023  1.00 36.51 ? 158 ASN A CB    1 
ATOM   2006 C CG    . ASN B 2 158 ? 6.728   19.068 15.206  1.00 37.79 ? 158 ASN A CG    1 
ATOM   2007 O OD1   . ASN B 2 158 ? 7.452   19.643 14.392  1.00 38.39 ? 158 ASN A OD1   1 
ATOM   2008 N ND2   . ASN B 2 158 ? 6.797   17.765 15.426  1.00 39.53 ? 158 ASN A ND2   1 
ATOM   2009 N N     . GLY B 2 159 ? 5.632   22.097 18.898  1.00 35.40 ? 159 GLY A N     1 
ATOM   2010 C CA    . GLY B 2 159 ? 4.782   23.000 19.663  1.00 34.50 ? 159 GLY A CA    1 
ATOM   2011 C C     . GLY B 2 159 ? 3.321   22.672 19.907  1.00 35.18 ? 159 GLY A C     1 
ATOM   2012 O O     . GLY B 2 159 ? 2.486   23.575 19.963  1.00 34.01 ? 159 GLY A O     1 
ATOM   2013 N N     . ILE B 2 160 ? 3.003   21.397 20.077  1.00 35.70 ? 160 ILE A N     1 
ATOM   2014 C CA    . ILE B 2 160 ? 1.625   21.004 20.307  1.00 34.93 ? 160 ILE A CA    1 
ATOM   2015 C C     . ILE B 2 160 ? 1.478   19.934 21.379  1.00 36.99 ? 160 ILE A C     1 
ATOM   2016 O O     . ILE B 2 160 ? 0.514   19.170 21.359  1.00 37.45 ? 160 ILE A O     1 
ATOM   2017 C CB    . ILE B 2 160 ? 0.982   20.482 19.016  1.00 32.77 ? 160 ILE A CB    1 
ATOM   2018 C CG1   . ILE B 2 160 ? 1.911   19.471 18.354  1.00 28.43 ? 160 ILE A CG1   1 
ATOM   2019 C CG2   . ILE B 2 160 ? 0.671   21.629 18.084  1.00 32.22 ? 160 ILE A CG2   1 
ATOM   2020 C CD1   . ILE B 2 160 ? 1.272   18.739 17.220  1.00 27.98 ? 160 ILE A CD1   1 
ATOM   2021 N N     . TYR B 2 161 ? 2.413   19.883 22.323  1.00 38.56 ? 161 TYR A N     1 
ATOM   2022 C CA    . TYR B 2 161 ? 2.335   18.877 23.368  1.00 39.71 ? 161 TYR A CA    1 
ATOM   2023 C C     . TYR B 2 161 ? 1.378   19.139 24.513  1.00 39.99 ? 161 TYR A C     1 
ATOM   2024 O O     . TYR B 2 161 ? 0.740   18.215 24.981  1.00 43.51 ? 161 TYR A O     1 
ATOM   2025 C CB    . TYR B 2 161 ? 3.704   18.575 23.965  1.00 41.62 ? 161 TYR A CB    1 
ATOM   2026 C CG    . TYR B 2 161 ? 3.595   17.627 25.134  1.00 42.88 ? 161 TYR A CG    1 
ATOM   2027 C CD1   . TYR B 2 161 ? 2.846   16.454 25.030  1.00 43.25 ? 161 TYR A CD1   1 
ATOM   2028 C CD2   . TYR B 2 161 ? 4.184   17.923 26.361  1.00 44.35 ? 161 TYR A CD2   1 
ATOM   2029 C CE1   . TYR B 2 161 ? 2.679   15.604 26.117  1.00 43.69 ? 161 TYR A CE1   1 
ATOM   2030 C CE2   . TYR B 2 161 ? 4.024   17.071 27.457  1.00 44.07 ? 161 TYR A CE2   1 
ATOM   2031 C CZ    . TYR B 2 161 ? 3.272   15.914 27.324  1.00 43.77 ? 161 TYR A CZ    1 
ATOM   2032 O OH    . TYR B 2 161 ? 3.139   15.047 28.385  1.00 44.58 ? 161 TYR A OH    1 
ATOM   2033 N N     . GLY B 2 162 ? 1.260   20.364 24.991  1.00 38.91 ? 162 GLY A N     1 
ATOM   2034 C CA    . GLY B 2 162 ? 0.344   20.575 26.104  1.00 39.80 ? 162 GLY A CA    1 
ATOM   2035 C C     . GLY B 2 162 ? -1.132  20.747 25.772  1.00 39.31 ? 162 GLY A C     1 
ATOM   2036 O O     . GLY B 2 162 ? -1.493  21.106 24.658  1.00 39.45 ? 162 GLY A O     1 
ATOM   2037 N N     . ALA B 2 163 ? -1.988  20.502 26.756  1.00 38.72 ? 163 ALA A N     1 
ATOM   2038 C CA    . ALA B 2 163 ? -3.429  20.657 26.579  1.00 37.92 ? 163 ALA A CA    1 
ATOM   2039 C C     . ALA B 2 163 ? -3.960  21.943 27.227  1.00 38.30 ? 163 ALA A C     1 
ATOM   2040 O O     . ALA B 2 163 ? -5.132  22.272 27.089  1.00 37.17 ? 163 ALA A O     1 
ATOM   2041 C CB    . ALA B 2 163 ? -4.150  19.464 27.148  1.00 37.81 ? 163 ALA A CB    1 
ATOM   2042 N N     . GLU B 2 164 ? -3.109  22.663 27.951  1.00 38.53 ? 164 GLU A N     1 
ATOM   2043 C CA    . GLU B 2 164 ? -3.532  23.920 28.565  1.00 39.40 ? 164 GLU A CA    1 
ATOM   2044 C C     . GLU B 2 164 ? -3.875  24.910 27.440  1.00 38.69 ? 164 GLU A C     1 
ATOM   2045 O O     . GLU B 2 164 ? -3.472  24.718 26.288  1.00 37.80 ? 164 GLU A O     1 
ATOM   2046 C CB    . GLU B 2 164 ? -2.426  24.495 29.467  1.00 38.80 ? 164 GLU A CB    1 
ATOM   2047 C CG    . GLU B 2 164 ? -1.071  24.679 28.805  1.00 39.45 ? 164 GLU A CG    1 
ATOM   2048 C CD    . GLU B 2 164 ? -0.411  23.366 28.450  1.00 41.39 ? 164 GLU A CD    1 
ATOM   2049 O OE1   . GLU B 2 164 ? 0.666   23.387 27.824  1.00 41.73 ? 164 GLU A OE1   1 
ATOM   2050 O OE2   . GLU B 2 164 ? -0.958  22.303 28.798  1.00 42.73 ? 164 GLU A OE2   1 
ATOM   2051 N N     . TYR B 2 165 ? -4.595  25.975 27.771  1.00 37.08 ? 165 TYR A N     1 
ATOM   2052 C CA    . TYR B 2 165 ? -4.999  26.925 26.752  1.00 36.47 ? 165 TYR A CA    1 
ATOM   2053 C C     . TYR B 2 165 ? -3.912  27.627 25.948  1.00 36.74 ? 165 TYR A C     1 
ATOM   2054 O O     . TYR B 2 165 ? -4.187  28.157 24.870  1.00 36.67 ? 165 TYR A O     1 
ATOM   2055 C CB    . TYR B 2 165 ? -5.965  27.945 27.345  1.00 36.90 ? 165 TYR A CB    1 
ATOM   2056 C CG    . TYR B 2 165 ? -7.376  27.424 27.385  1.00 37.40 ? 165 TYR A CG    1 
ATOM   2057 C CD1   . TYR B 2 165 ? -7.977  27.065 28.587  1.00 38.17 ? 165 TYR A CD1   1 
ATOM   2058 C CD2   . TYR B 2 165 ? -8.095  27.241 26.207  1.00 39.09 ? 165 TYR A CD2   1 
ATOM   2059 C CE1   . TYR B 2 165 ? -9.264  26.535 28.617  1.00 38.28 ? 165 TYR A CE1   1 
ATOM   2060 C CE2   . TYR B 2 165 ? -9.380  26.709 26.220  1.00 39.32 ? 165 TYR A CE2   1 
ATOM   2061 C CZ    . TYR B 2 165 ? -9.962  26.357 27.428  1.00 39.52 ? 165 TYR A CZ    1 
ATOM   2062 O OH    . TYR B 2 165 ? -11.241 25.837 27.444  1.00 37.42 ? 165 TYR A OH    1 
ATOM   2063 N N     . LYS B 2 166 ? -2.682  27.628 26.445  1.00 35.74 ? 166 LYS A N     1 
ATOM   2064 C CA    . LYS B 2 166 ? -1.601  28.265 25.710  1.00 36.53 ? 166 LYS A CA    1 
ATOM   2065 C C     . LYS B 2 166 ? -1.132  27.391 24.539  1.00 36.34 ? 166 LYS A C     1 
ATOM   2066 O O     . LYS B 2 166 ? -0.388  27.848 23.673  1.00 35.42 ? 166 LYS A O     1 
ATOM   2067 C CB    . LYS B 2 166 ? -0.418  28.551 26.637  1.00 37.80 ? 166 LYS A CB    1 
ATOM   2068 C CG    . LYS B 2 166 ? 0.809   29.074 25.884  1.00 40.83 ? 166 LYS A CG    1 
ATOM   2069 C CD    . LYS B 2 166 ? 1.922   29.538 26.811  1.00 44.98 ? 166 LYS A CD    1 
ATOM   2070 C CE    . LYS B 2 166 ? 3.037   30.212 26.012  1.00 46.13 ? 166 LYS A CE    1 
ATOM   2071 N NZ    . LYS B 2 166 ? 4.136   30.765 26.864  1.00 47.45 ? 166 LYS A NZ    1 
ATOM   2072 N N     . VAL B 2 167 ? -1.575  26.137 24.511  1.00 36.30 ? 167 VAL A N     1 
ATOM   2073 C CA    . VAL B 2 167 ? -1.168  25.209 23.460  1.00 35.47 ? 167 VAL A CA    1 
ATOM   2074 C C     . VAL B 2 167 ? -2.331  24.571 22.730  1.00 36.62 ? 167 VAL A C     1 
ATOM   2075 O O     . VAL B 2 167 ? -2.320  24.465 21.505  1.00 38.23 ? 167 VAL A O     1 
ATOM   2076 C CB    . VAL B 2 167 ? -0.318  24.056 24.022  1.00 36.09 ? 167 VAL A CB    1 
ATOM   2077 C CG1   . VAL B 2 167 ? 0.030   23.089 22.907  1.00 34.58 ? 167 VAL A CG1   1 
ATOM   2078 C CG2   . VAL B 2 167 ? 0.939   24.600 24.696  1.00 34.26 ? 167 VAL A CG2   1 
ATOM   2079 N N     . ARG B 2 168 ? -3.329  24.128 23.486  1.00 36.91 ? 168 ARG A N     1 
ATOM   2080 C CA    . ARG B 2 168 ? -4.484  23.484 22.885  1.00 36.57 ? 168 ARG A CA    1 
ATOM   2081 C C     . ARG B 2 168 ? -4.008  22.295 22.053  1.00 35.57 ? 168 ARG A C     1 
ATOM   2082 O O     . ARG B 2 168 ? -4.479  22.061 20.945  1.00 35.63 ? 168 ARG A O     1 
ATOM   2083 C CB    . ARG B 2 168 ? -5.246  24.486 22.016  1.00 37.18 ? 168 ARG A CB    1 
ATOM   2084 C CG    . ARG B 2 168 ? -6.085  25.471 22.813  1.00 37.93 ? 168 ARG A CG    1 
ATOM   2085 C CD    . ARG B 2 168 ? -6.615  26.575 21.926  1.00 40.57 ? 168 ARG A CD    1 
ATOM   2086 N NE    . ARG B 2 168 ? -7.821  27.191 22.476  1.00 43.74 ? 168 ARG A NE    1 
ATOM   2087 C CZ    . ARG B 2 168 ? -9.025  26.625 22.454  1.00 46.27 ? 168 ARG A CZ    1 
ATOM   2088 N NH1   . ARG B 2 168 ? -9.189  25.420 21.901  1.00 46.60 ? 168 ARG A NH1   1 
ATOM   2089 N NH2   . ARG B 2 168 ? -10.065 27.259 22.986  1.00 44.86 ? 168 ARG A NH2   1 
ATOM   2090 N N     . GLY B 2 169 ? -3.063  21.549 22.614  1.00 36.55 ? 169 GLY A N     1 
ATOM   2091 C CA    . GLY B 2 169 ? -2.516  20.389 21.944  1.00 36.12 ? 169 GLY A CA    1 
ATOM   2092 C C     . GLY B 2 169 ? -2.952  19.087 22.586  1.00 36.05 ? 169 GLY A C     1 
ATOM   2093 O O     . GLY B 2 169 ? -4.057  18.992 23.111  1.00 36.00 ? 169 GLY A O     1 
ATOM   2094 N N     . PHE B 2 170 ? -2.074  18.087 22.551  1.00 36.04 ? 170 PHE A N     1 
ATOM   2095 C CA    . PHE B 2 170 ? -2.355  16.756 23.094  1.00 35.40 ? 170 PHE A CA    1 
ATOM   2096 C C     . PHE B 2 170 ? -1.881  16.527 24.525  1.00 35.59 ? 170 PHE A C     1 
ATOM   2097 O O     . PHE B 2 170 ? -0.689  16.473 24.766  1.00 36.48 ? 170 PHE A O     1 
ATOM   2098 C CB    . PHE B 2 170 ? -1.630  15.677 22.268  1.00 35.58 ? 170 PHE A CB    1 
ATOM   2099 C CG    . PHE B 2 170 ? -2.001  15.649 20.806  1.00 35.83 ? 170 PHE A CG    1 
ATOM   2100 C CD1   . PHE B 2 170 ? -1.904  16.793 20.019  1.00 36.29 ? 170 PHE A CD1   1 
ATOM   2101 C CD2   . PHE B 2 170 ? -2.427  14.469 20.212  1.00 34.51 ? 170 PHE A CD2   1 
ATOM   2102 C CE1   . PHE B 2 170 ? -2.226  16.763 18.667  1.00 34.24 ? 170 PHE A CE1   1 
ATOM   2103 C CE2   . PHE B 2 170 ? -2.752  14.430 18.860  1.00 33.82 ? 170 PHE A CE2   1 
ATOM   2104 C CZ    . PHE B 2 170 ? -2.651  15.583 18.088  1.00 35.08 ? 170 PHE A CZ    1 
ATOM   2105 N N     . SER B 2 171 ? -2.800  16.353 25.467  1.00 35.71 ? 171 SER A N     1 
ATOM   2106 C CA    . SER B 2 171 ? -2.401  16.102 26.851  1.00 33.70 ? 171 SER A CA    1 
ATOM   2107 C C     . SER B 2 171 ? -1.605  14.810 26.988  1.00 33.61 ? 171 SER A C     1 
ATOM   2108 O O     . SER B 2 171 ? -1.614  13.963 26.092  1.00 33.50 ? 171 SER A O     1 
ATOM   2109 C CB    . SER B 2 171 ? -3.628  16.019 27.753  1.00 34.15 ? 171 SER A CB    1 
ATOM   2110 O OG    . SER B 2 171 ? -4.299  14.789 27.583  1.00 32.96 ? 171 SER A OG    1 
ATOM   2111 N N     . GLY B 2 172 ? -0.921  14.659 28.114  1.00 33.82 ? 172 GLY A N     1 
ATOM   2112 C CA    . GLY B 2 172 ? -0.143  13.457 28.339  1.00 35.40 ? 172 GLY A CA    1 
ATOM   2113 C C     . GLY B 2 172 ? -0.992  12.192 28.365  1.00 37.10 ? 172 GLY A C     1 
ATOM   2114 O O     . GLY B 2 172 ? -0.581  11.153 27.846  1.00 38.20 ? 172 GLY A O     1 
ATOM   2115 N N     . TYR B 2 173 ? -2.177  12.274 28.966  1.00 36.70 ? 173 TYR A N     1 
ATOM   2116 C CA    . TYR B 2 173 ? -3.081  11.132 29.060  1.00 37.07 ? 173 TYR A CA    1 
ATOM   2117 C C     . TYR B 2 173 ? -3.551  10.727 27.674  1.00 37.34 ? 173 TYR A C     1 
ATOM   2118 O O     . TYR B 2 173 ? -3.776  9.552  27.393  1.00 35.95 ? 173 TYR A O     1 
ATOM   2119 C CB    . TYR B 2 173 ? -4.277  11.498 29.943  1.00 38.24 ? 173 TYR A CB    1 
ATOM   2120 C CG    . TYR B 2 173 ? -5.359  10.440 30.065  1.00 38.93 ? 173 TYR A CG    1 
ATOM   2121 C CD1   . TYR B 2 173 ? -5.044  9.105  30.338  1.00 39.17 ? 173 TYR A CD1   1 
ATOM   2122 C CD2   . TYR B 2 173 ? -6.707  10.792 29.983  1.00 40.40 ? 173 TYR A CD2   1 
ATOM   2123 C CE1   . TYR B 2 173 ? -6.050  8.150  30.533  1.00 39.44 ? 173 TYR A CE1   1 
ATOM   2124 C CE2   . TYR B 2 173 ? -7.715  9.848  30.177  1.00 42.01 ? 173 TYR A CE2   1 
ATOM   2125 C CZ    . TYR B 2 173 ? -7.382  8.531  30.454  1.00 41.16 ? 173 TYR A CZ    1 
ATOM   2126 O OH    . TYR B 2 173 ? -8.388  7.612  30.662  1.00 40.91 ? 173 TYR A OH    1 
ATOM   2127 N N     . LEU B 2 174 ? -3.711  11.720 26.810  1.00 36.66 ? 174 LEU A N     1 
ATOM   2128 C CA    . LEU B 2 174 ? -4.136  11.469 25.450  1.00 36.36 ? 174 LEU A CA    1 
ATOM   2129 C C     . LEU B 2 174 ? -3.047  10.681 24.754  1.00 36.82 ? 174 LEU A C     1 
ATOM   2130 O O     . LEU B 2 174 ? -3.324  9.784  23.960  1.00 37.17 ? 174 LEU A O     1 
ATOM   2131 C CB    . LEU B 2 174 ? -4.359  12.788 24.706  1.00 35.51 ? 174 LEU A CB    1 
ATOM   2132 C CG    . LEU B 2 174 ? -4.710  12.643 23.225  1.00 34.43 ? 174 LEU A CG    1 
ATOM   2133 C CD1   . LEU B 2 174 ? -5.800  11.586 23.049  1.00 34.18 ? 174 LEU A CD1   1 
ATOM   2134 C CD2   . LEU B 2 174 ? -5.148  13.986 22.682  1.00 32.39 ? 174 LEU A CD2   1 
ATOM   2135 N N     . CYS B 2 175 ? -1.802  11.017 25.067  1.00 36.68 ? 175 CYS A N     1 
ATOM   2136 C CA    . CYS B 2 175 ? -0.666  10.360 24.450  1.00 37.15 ? 175 CYS A CA    1 
ATOM   2137 C C     . CYS B 2 175 ? -0.557  8.869  24.742  1.00 37.66 ? 175 CYS A C     1 
ATOM   2138 O O     . CYS B 2 175 ? -0.259  8.080  23.848  1.00 38.31 ? 175 CYS A O     1 
ATOM   2139 C CB    . CYS B 2 175 ? 0.624   11.076 24.851  1.00 37.87 ? 175 CYS A CB    1 
ATOM   2140 S SG    . CYS B 2 175 ? 0.858   12.663 23.997  1.00 37.78 ? 175 CYS A SG    1 
ATOM   2141 N N     . GLU B 2 176 ? -0.803  8.478  25.984  1.00 36.83 ? 176 GLU A N     1 
ATOM   2142 C CA    . GLU B 2 176 ? -0.707  7.079  26.347  1.00 36.14 ? 176 GLU A CA    1 
ATOM   2143 C C     . GLU B 2 176 ? -1.902  6.297  25.837  1.00 35.63 ? 176 GLU A C     1 
ATOM   2144 O O     . GLU B 2 176 ? -1.754  5.146  25.421  1.00 36.30 ? 176 GLU A O     1 
ATOM   2145 C CB    . GLU B 2 176 ? -0.549  6.961  27.852  1.00 37.09 ? 176 GLU A CB    1 
ATOM   2146 C CG    . GLU B 2 176 ? 0.720   7.646  28.307  1.00 38.96 ? 176 GLU A CG    1 
ATOM   2147 C CD    . GLU B 2 176 ? 0.965   7.539  29.789  1.00 39.31 ? 176 GLU A CD    1 
ATOM   2148 O OE1   . GLU B 2 176 ? 1.076   6.397  30.286  1.00 39.31 ? 176 GLU A OE1   1 
ATOM   2149 O OE2   . GLU B 2 176 ? 1.054   8.599  30.448  1.00 38.99 ? 176 GLU A OE2   1 
ATOM   2150 N N     . LEU B 2 177 ? -3.082  6.911  25.847  1.00 34.00 ? 177 LEU A N     1 
ATOM   2151 C CA    . LEU B 2 177 ? -4.247  6.225  25.318  1.00 32.91 ? 177 LEU A CA    1 
ATOM   2152 C C     . LEU B 2 177 ? -3.942  5.908  23.863  1.00 34.09 ? 177 LEU A C     1 
ATOM   2153 O O     . LEU B 2 177 ? -4.162  4.791  23.409  1.00 35.64 ? 177 LEU A O     1 
ATOM   2154 C CB    . LEU B 2 177 ? -5.505  7.088  25.408  1.00 31.29 ? 177 LEU A CB    1 
ATOM   2155 C CG    . LEU B 2 177 ? -6.099  7.315  26.802  1.00 31.78 ? 177 LEU A CG    1 
ATOM   2156 C CD1   . LEU B 2 177 ? -7.535  7.788  26.657  1.00 29.43 ? 177 LEU A CD1   1 
ATOM   2157 C CD2   . LEU B 2 177 ? -6.062  6.031  27.602  1.00 29.65 ? 177 LEU A CD2   1 
ATOM   2158 N N     . LEU B 2 178 ? -3.408  6.882  23.134  1.00 34.18 ? 178 LEU A N     1 
ATOM   2159 C CA    . LEU B 2 178 ? -3.071  6.656  21.727  1.00 35.39 ? 178 LEU A CA    1 
ATOM   2160 C C     . LEU B 2 178 ? -2.135  5.453  21.527  1.00 35.25 ? 178 LEU A C     1 
ATOM   2161 O O     . LEU B 2 178 ? -2.343  4.660  20.607  1.00 35.72 ? 178 LEU A O     1 
ATOM   2162 C CB    . LEU B 2 178 ? -2.453  7.920  21.108  1.00 34.07 ? 178 LEU A CB    1 
ATOM   2163 C CG    . LEU B 2 178 ? -3.421  9.085  20.857  1.00 33.71 ? 178 LEU A CG    1 
ATOM   2164 C CD1   . LEU B 2 178 ? -2.662  10.363 20.584  1.00 32.74 ? 178 LEU A CD1   1 
ATOM   2165 C CD2   . LEU B 2 178 ? -4.322  8.746  19.693  1.00 35.50 ? 178 LEU A CD2   1 
ATOM   2166 N N     . ILE B 2 179 ? -1.119  5.314  22.383  1.00 33.86 ? 179 ILE A N     1 
ATOM   2167 C CA    . ILE B 2 179 ? -0.182  4.195  22.276  1.00 33.10 ? 179 ILE A CA    1 
ATOM   2168 C C     . ILE B 2 179 ? -0.899  2.897  22.609  1.00 33.24 ? 179 ILE A C     1 
ATOM   2169 O O     . ILE B 2 179 ? -0.774  1.912  21.896  1.00 32.26 ? 179 ILE A O     1 
ATOM   2170 C CB    . ILE B 2 179 ? 1.024   4.336  23.230  1.00 31.01 ? 179 ILE A CB    1 
ATOM   2171 C CG1   . ILE B 2 179 ? 1.816   5.602  22.902  1.00 30.12 ? 179 ILE A CG1   1 
ATOM   2172 C CG2   . ILE B 2 179 ? 1.914   3.106  23.116  1.00 29.23 ? 179 ILE A CG2   1 
ATOM   2173 C CD1   . ILE B 2 179 ? 2.297   5.674  21.470  1.00 29.58 ? 179 ILE A CD1   1 
ATOM   2174 N N     . VAL B 2 180 ? -1.639  2.888  23.706  1.00 34.31 ? 180 VAL A N     1 
ATOM   2175 C CA    . VAL B 2 180 ? -2.384  1.695  24.073  1.00 35.44 ? 180 VAL A CA    1 
ATOM   2176 C C     . VAL B 2 180 ? -3.182  1.258  22.851  1.00 37.51 ? 180 VAL A C     1 
ATOM   2177 O O     . VAL B 2 180 ? -3.234  0.083  22.514  1.00 39.51 ? 180 VAL A O     1 
ATOM   2178 C CB    . VAL B 2 180 ? -3.379  1.992  25.210  1.00 34.75 ? 180 VAL A CB    1 
ATOM   2179 C CG1   . VAL B 2 180 ? -4.420  0.886  25.306  1.00 32.89 ? 180 VAL A CG1   1 
ATOM   2180 C CG2   . VAL B 2 180 ? -2.632  2.160  26.520  1.00 33.95 ? 180 VAL A CG2   1 
ATOM   2181 N N     . PHE B 2 181 ? -3.789  2.226  22.179  1.00 37.42 ? 181 PHE A N     1 
ATOM   2182 C CA    . PHE B 2 181 ? -4.612  1.945  21.017  1.00 37.52 ? 181 PHE A CA    1 
ATOM   2183 C C     . PHE B 2 181 ? -3.849  1.489  19.784  1.00 37.94 ? 181 PHE A C     1 
ATOM   2184 O O     . PHE B 2 181 ? -4.202  0.480  19.192  1.00 38.91 ? 181 PHE A O     1 
ATOM   2185 C CB    . PHE B 2 181 ? -5.430  3.175  20.658  1.00 36.24 ? 181 PHE A CB    1 
ATOM   2186 C CG    . PHE B 2 181 ? -6.543  2.906  19.694  1.00 34.10 ? 181 PHE A CG    1 
ATOM   2187 C CD1   . PHE B 2 181 ? -7.748  2.370  20.135  1.00 34.12 ? 181 PHE A CD1   1 
ATOM   2188 C CD2   . PHE B 2 181 ? -6.412  3.238  18.350  1.00 34.95 ? 181 PHE A CD2   1 
ATOM   2189 C CE1   . PHE B 2 181 ? -8.811  2.176  19.254  1.00 31.31 ? 181 PHE A CE1   1 
ATOM   2190 C CE2   . PHE B 2 181 ? -7.471  3.045  17.462  1.00 34.25 ? 181 PHE A CE2   1 
ATOM   2191 C CZ    . PHE B 2 181 ? -8.673  2.515  17.920  1.00 31.93 ? 181 PHE A CZ    1 
ATOM   2192 N N     . TYR B 2 182 ? -2.817  2.227  19.386  1.00 37.60 ? 182 TYR A N     1 
ATOM   2193 C CA    . TYR B 2 182 ? -2.058  1.873  18.194  1.00 37.73 ? 182 TYR A CA    1 
ATOM   2194 C C     . TYR B 2 182 ? -0.851  0.965  18.387  1.00 37.33 ? 182 TYR A C     1 
ATOM   2195 O O     . TYR B 2 182 ? -0.249  0.534  17.415  1.00 37.70 ? 182 TYR A O     1 
ATOM   2196 C CB    . TYR B 2 182 ? -1.638  3.143  17.466  1.00 39.14 ? 182 TYR A CB    1 
ATOM   2197 C CG    . TYR B 2 182 ? -2.798  3.831  16.797  1.00 39.65 ? 182 TYR A CG    1 
ATOM   2198 C CD1   . TYR B 2 182 ? -3.568  3.163  15.849  1.00 39.67 ? 182 TYR A CD1   1 
ATOM   2199 C CD2   . TYR B 2 182 ? -3.150  5.134  17.129  1.00 40.10 ? 182 TYR A CD2   1 
ATOM   2200 C CE1   . TYR B 2 182 ? -4.666  3.777  15.247  1.00 41.42 ? 182 TYR A CE1   1 
ATOM   2201 C CE2   . TYR B 2 182 ? -4.250  5.761  16.536  1.00 41.51 ? 182 TYR A CE2   1 
ATOM   2202 C CZ    . TYR B 2 182 ? -5.006  5.078  15.596  1.00 41.55 ? 182 TYR A CZ    1 
ATOM   2203 O OH    . TYR B 2 182 ? -6.102  5.686  15.012  1.00 42.66 ? 182 TYR A OH    1 
ATOM   2204 N N     . GLY B 2 183 ? -0.496  0.680  19.635  1.00 39.43 ? 183 GLY A N     1 
ATOM   2205 C CA    . GLY B 2 183 ? 0.630   -0.200 19.908  1.00 40.01 ? 183 GLY A CA    1 
ATOM   2206 C C     . GLY B 2 183 ? 2.019   0.406  19.933  1.00 40.45 ? 183 GLY A C     1 
ATOM   2207 O O     . GLY B 2 183 ? 2.934   -0.186 20.501  1.00 41.50 ? 183 GLY A O     1 
ATOM   2208 N N     . SER B 2 184 ? 2.191   1.571  19.316  1.00 41.47 ? 184 SER A N     1 
ATOM   2209 C CA    . SER B 2 184 ? 3.499   2.225  19.284  1.00 43.08 ? 184 SER A CA    1 
ATOM   2210 C C     . SER B 2 184 ? 3.447   3.617  18.644  1.00 43.07 ? 184 SER A C     1 
ATOM   2211 O O     . SER B 2 184 ? 2.431   4.015  18.078  1.00 42.56 ? 184 SER A O     1 
ATOM   2212 C CB    . SER B 2 184 ? 4.498   1.370  18.508  1.00 42.61 ? 184 SER A CB    1 
ATOM   2213 O OG    . SER B 2 184 ? 4.231   1.429  17.118  1.00 43.15 ? 184 SER A OG    1 
ATOM   2214 N N     . PHE B 2 185 ? 4.552   4.350  18.736  1.00 43.36 ? 185 PHE A N     1 
ATOM   2215 C CA    . PHE B 2 185 ? 4.623   5.687  18.159  1.00 43.69 ? 185 PHE A CA    1 
ATOM   2216 C C     . PHE B 2 185 ? 4.369   5.668  16.659  1.00 43.13 ? 185 PHE A C     1 
ATOM   2217 O O     . PHE B 2 185 ? 3.502   6.377  16.165  1.00 43.64 ? 185 PHE A O     1 
ATOM   2218 C CB    . PHE B 2 185 ? 5.989   6.322  18.450  1.00 45.86 ? 185 PHE A CB    1 
ATOM   2219 C CG    . PHE B 2 185 ? 6.270   7.555  17.638  1.00 46.61 ? 185 PHE A CG    1 
ATOM   2220 C CD1   . PHE B 2 185 ? 6.945   7.465  16.424  1.00 46.62 ? 185 PHE A CD1   1 
ATOM   2221 C CD2   . PHE B 2 185 ? 5.842   8.808  18.077  1.00 47.76 ? 185 PHE A CD2   1 
ATOM   2222 C CE1   . PHE B 2 185 ? 7.197   8.614  15.651  1.00 47.85 ? 185 PHE A CE1   1 
ATOM   2223 C CE2   . PHE B 2 185 ? 6.083   9.963  17.320  1.00 48.21 ? 185 PHE A CE2   1 
ATOM   2224 C CZ    . PHE B 2 185 ? 6.764   9.866  16.102  1.00 47.18 ? 185 PHE A CZ    1 
ATOM   2225 N N     . LEU B 2 186 ? 5.121   4.844  15.940  1.00 42.45 ? 186 LEU A N     1 
ATOM   2226 C CA    . LEU B 2 186 ? 4.969   4.749  14.495  1.00 40.10 ? 186 LEU A CA    1 
ATOM   2227 C C     . LEU B 2 186 ? 3.556   4.372  14.056  1.00 37.74 ? 186 LEU A C     1 
ATOM   2228 O O     . LEU B 2 186 ? 3.002   4.993  13.158  1.00 37.79 ? 186 LEU A O     1 
ATOM   2229 C CB    . LEU B 2 186 ? 5.961   3.746  13.928  1.00 40.43 ? 186 LEU A CB    1 
ATOM   2230 C CG    . LEU B 2 186 ? 6.073   3.788  12.404  1.00 41.86 ? 186 LEU A CG    1 
ATOM   2231 C CD1   . LEU B 2 186 ? 6.523   5.172  11.931  1.00 40.64 ? 186 LEU A CD1   1 
ATOM   2232 C CD2   . LEU B 2 186 ? 7.046   2.711  11.963  1.00 42.52 ? 186 LEU A CD2   1 
ATOM   2233 N N     . GLU B 2 187 ? 2.971   3.354  14.669  1.00 36.27 ? 187 GLU A N     1 
ATOM   2234 C CA    . GLU B 2 187 ? 1.613   2.965  14.300  1.00 35.32 ? 187 GLU A CA    1 
ATOM   2235 C C     . GLU B 2 187 ? 0.669   4.138  14.484  1.00 34.01 ? 187 GLU A C     1 
ATOM   2236 O O     . GLU B 2 187 ? -0.217  4.384  13.670  1.00 32.33 ? 187 GLU A O     1 
ATOM   2237 C CB    . GLU B 2 187 ? 1.144   1.777  15.141  1.00 35.77 ? 187 GLU A CB    1 
ATOM   2238 C CG    . GLU B 2 187 ? 1.662   0.465  14.621  1.00 37.88 ? 187 GLU A CG    1 
ATOM   2239 C CD    . GLU B 2 187 ? 1.330   0.278  13.150  1.00 39.46 ? 187 GLU A CD    1 
ATOM   2240 O OE1   . GLU B 2 187 ? 0.126   0.140  12.811  1.00 40.97 ? 187 GLU A OE1   1 
ATOM   2241 O OE2   . GLU B 2 187 ? 2.279   0.281  12.333  1.00 42.19 ? 187 GLU A OE2   1 
ATOM   2242 N N     . THR B 2 188 ? 0.878   4.862  15.571  1.00 33.77 ? 188 THR A N     1 
ATOM   2243 C CA    . THR B 2 188 ? 0.074   6.019  15.872  1.00 33.91 ? 188 THR A CA    1 
ATOM   2244 C C     . THR B 2 188 ? 0.261   7.010  14.730  1.00 33.40 ? 188 THR A C     1 
ATOM   2245 O O     . THR B 2 188 ? -0.708  7.513  14.169  1.00 34.28 ? 188 THR A O     1 
ATOM   2246 C CB    . THR B 2 188 ? 0.521   6.628  17.210  1.00 33.08 ? 188 THR A CB    1 
ATOM   2247 O OG1   . THR B 2 188 ? 0.422   5.627  18.226  1.00 33.91 ? 188 THR A OG1   1 
ATOM   2248 C CG2   . THR B 2 188 ? -0.348  7.814  17.597  1.00 32.34 ? 188 THR A CG2   1 
ATOM   2249 N N     . VAL B 2 189 ? 1.511   7.266  14.366  1.00 32.74 ? 189 VAL A N     1 
ATOM   2250 C CA    . VAL B 2 189 ? 1.812   8.196  13.289  1.00 33.35 ? 189 VAL A CA    1 
ATOM   2251 C C     . VAL B 2 189 ? 1.253   7.732  11.953  1.00 34.32 ? 189 VAL A C     1 
ATOM   2252 O O     . VAL B 2 189 ? 0.621   8.504  11.237  1.00 34.99 ? 189 VAL A O     1 
ATOM   2253 C CB    . VAL B 2 189 ? 3.326   8.394  13.146  1.00 32.84 ? 189 VAL A CB    1 
ATOM   2254 C CG1   . VAL B 2 189 ? 3.638   9.132  11.860  1.00 32.84 ? 189 VAL A CG1   1 
ATOM   2255 C CG2   . VAL B 2 189 ? 3.855   9.172  14.339  1.00 30.67 ? 189 VAL A CG2   1 
ATOM   2256 N N     . LYS B 2 190 ? 1.491   6.471  11.618  1.00 36.21 ? 190 LYS A N     1 
ATOM   2257 C CA    . LYS B 2 190 ? 1.014   5.921  10.362  1.00 37.76 ? 190 LYS A CA    1 
ATOM   2258 C C     . LYS B 2 190 ? -0.496  6.032  10.208  1.00 38.67 ? 190 LYS A C     1 
ATOM   2259 O O     . LYS B 2 190 ? -0.989  6.358  9.134   1.00 40.69 ? 190 LYS A O     1 
ATOM   2260 C CB    . LYS B 2 190 ? 1.440   4.457  10.229  1.00 40.63 ? 190 LYS A CB    1 
ATOM   2261 C CG    . LYS B 2 190 ? 2.931   4.248  9.931   1.00 42.75 ? 190 LYS A CG    1 
ATOM   2262 C CD    . LYS B 2 190 ? 3.247   2.766  9.713   1.00 43.81 ? 190 LYS A CD    1 
ATOM   2263 C CE    . LYS B 2 190 ? 4.729   2.538  9.424   1.00 46.44 ? 190 LYS A CE    1 
ATOM   2264 N NZ    . LYS B 2 190 ? 5.045   1.098  9.137   1.00 46.46 ? 190 LYS A NZ    1 
ATOM   2265 N N     . ASN B 2 191 ? -1.239  5.772  11.275  1.00 39.67 ? 191 ASN A N     1 
ATOM   2266 C CA    . ASN B 2 191 ? -2.695  5.838  11.203  1.00 39.60 ? 191 ASN A CA    1 
ATOM   2267 C C     . ASN B 2 191 ? -3.251  7.247  11.250  1.00 40.11 ? 191 ASN A C     1 
ATOM   2268 O O     . ASN B 2 191 ? -4.275  7.547  10.630  1.00 38.82 ? 191 ASN A O     1 
ATOM   2269 C CB    . ASN B 2 191 ? -3.290  4.992  12.316  1.00 40.86 ? 191 ASN A CB    1 
ATOM   2270 C CG    . ASN B 2 191 ? -3.175  3.513  12.023  1.00 44.09 ? 191 ASN A CG    1 
ATOM   2271 O OD1   . ASN B 2 191 ? -4.006  2.948  11.312  1.00 45.98 ? 191 ASN A OD1   1 
ATOM   2272 N ND2   . ASN B 2 191 ? -2.125  2.882  12.539  1.00 42.36 ? 191 ASN A ND2   1 
ATOM   2273 N N     . ALA B 2 192 ? -2.568  8.116  11.983  1.00 40.41 ? 192 ALA A N     1 
ATOM   2274 C CA    . ALA B 2 192 ? -2.992  9.502  12.107  1.00 40.29 ? 192 ALA A CA    1 
ATOM   2275 C C     . ALA B 2 192 ? -3.124  10.165 10.739  1.00 40.57 ? 192 ALA A C     1 
ATOM   2276 O O     . ALA B 2 192 ? -3.963  11.044 10.553  1.00 40.54 ? 192 ALA A O     1 
ATOM   2277 C CB    . ALA B 2 192 ? -2.003  10.265 12.956  1.00 39.22 ? 192 ALA A CB    1 
ATOM   2278 N N     . ARG B 2 193 ? -2.297  9.747  9.785   1.00 39.79 ? 193 ARG A N     1 
ATOM   2279 C CA    . ARG B 2 193 ? -2.343  10.319 8.452   1.00 40.64 ? 193 ARG A CA    1 
ATOM   2280 C C     . ARG B 2 193 ? -3.710  10.237 7.803   1.00 41.32 ? 193 ARG A C     1 
ATOM   2281 O O     . ARG B 2 193 ? -3.971  10.962 6.853   1.00 42.25 ? 193 ARG A O     1 
ATOM   2282 C CB    . ARG B 2 193 ? -1.345  9.631  7.539   1.00 40.91 ? 193 ARG A CB    1 
ATOM   2283 C CG    . ARG B 2 193 ? 0.092   9.979  7.792   1.00 41.11 ? 193 ARG A CG    1 
ATOM   2284 C CD    . ARG B 2 193 ? 0.962   9.336  6.726   1.00 41.82 ? 193 ARG A CD    1 
ATOM   2285 N NE    . ARG B 2 193 ? 0.954   7.882  6.847   1.00 42.18 ? 193 ARG A NE    1 
ATOM   2286 C CZ    . ARG B 2 193 ? 1.657   7.053  6.082   1.00 43.12 ? 193 ARG A CZ    1 
ATOM   2287 N NH1   . ARG B 2 193 ? 2.436   7.531  5.118   1.00 42.28 ? 193 ARG A NH1   1 
ATOM   2288 N NH2   . ARG B 2 193 ? 1.593   5.741  6.292   1.00 42.70 ? 193 ARG A NH2   1 
ATOM   2289 N N     . ARG B 2 194 ? -4.569  9.347  8.304   1.00 42.45 ? 194 ARG A N     1 
ATOM   2290 C CA    . ARG B 2 194 ? -5.921  9.155  7.761   1.00 42.79 ? 194 ARG A CA    1 
ATOM   2291 C C     . ARG B 2 194 ? -6.965  9.735  8.714   1.00 41.79 ? 194 ARG A C     1 
ATOM   2292 O O     . ARG B 2 194 ? -8.153  9.449  8.595   1.00 42.31 ? 194 ARG A O     1 
ATOM   2293 C CB    . ARG B 2 194 ? -6.230  7.664  7.558   1.00 45.76 ? 194 ARG A CB    1 
ATOM   2294 C CG    . ARG B 2 194 ? -5.033  6.790  7.180   1.00 52.23 ? 194 ARG A CG    1 
ATOM   2295 C CD    . ARG B 2 194 ? -4.769  6.677  5.665   1.00 58.94 ? 194 ARG A CD    1 
ATOM   2296 N NE    . ARG B 2 194 ? -5.608  5.687  4.968   1.00 64.30 ? 194 ARG A NE    1 
ATOM   2297 C CZ    . ARG B 2 194 ? -5.895  4.462  5.422   1.00 67.03 ? 194 ARG A CZ    1 
ATOM   2298 N NH1   . ARG B 2 194 ? -5.419  4.053  6.597   1.00 68.25 ? 194 ARG A NH1   1 
ATOM   2299 N NH2   . ARG B 2 194 ? -6.652  3.633  4.694   1.00 67.17 ? 194 ARG A NH2   1 
ATOM   2300 N N     . TRP B 2 195 ? -6.518  10.530 9.678   1.00 40.87 ? 195 TRP A N     1 
ATOM   2301 C CA    . TRP B 2 195 ? -7.436  11.158 10.617  1.00 38.76 ? 195 TRP A CA    1 
ATOM   2302 C C     . TRP B 2 195 ? -8.121  12.336 9.925   1.00 38.02 ? 195 TRP A C     1 
ATOM   2303 O O     . TRP B 2 195 ? -7.514  13.054 9.134   1.00 36.91 ? 195 TRP A O     1 
ATOM   2304 C CB    . TRP B 2 195 ? -6.687  11.692 11.847  1.00 39.64 ? 195 TRP A CB    1 
ATOM   2305 C CG    . TRP B 2 195 ? -6.314  10.671 12.890  1.00 38.30 ? 195 TRP A CG    1 
ATOM   2306 C CD1   . TRP B 2 195 ? -6.551  9.332  12.853  1.00 38.62 ? 195 TRP A CD1   1 
ATOM   2307 C CD2   . TRP B 2 195 ? -5.620  10.923 14.118  1.00 36.76 ? 195 TRP A CD2   1 
ATOM   2308 N NE1   . TRP B 2 195 ? -6.047  8.730  13.980  1.00 36.72 ? 195 TRP A NE1   1 
ATOM   2309 C CE2   . TRP B 2 195 ? -5.470  9.684  14.775  1.00 37.17 ? 195 TRP A CE2   1 
ATOM   2310 C CE3   . TRP B 2 195 ? -5.111  12.077 14.726  1.00 35.21 ? 195 TRP A CE3   1 
ATOM   2311 C CZ2   . TRP B 2 195 ? -4.825  9.562  16.012  1.00 36.05 ? 195 TRP A CZ2   1 
ATOM   2312 C CZ3   . TRP B 2 195 ? -4.470  11.957 15.951  1.00 34.76 ? 195 TRP A CZ3   1 
ATOM   2313 C CH2   . TRP B 2 195 ? -4.334  10.705 16.583  1.00 35.44 ? 195 TRP A CH2   1 
ATOM   2314 N N     . THR B 2 196 ? -9.393  12.530 10.229  1.00 37.44 ? 196 THR A N     1 
ATOM   2315 C CA    . THR B 2 196 ? -10.142 13.637 9.669   1.00 36.89 ? 196 THR A CA    1 
ATOM   2316 C C     . THR B 2 196 ? -10.660 14.415 10.874  1.00 37.85 ? 196 THR A C     1 
ATOM   2317 O O     . THR B 2 196 ? -10.400 14.029 12.018  1.00 37.16 ? 196 THR A O     1 
ATOM   2318 C CB    . THR B 2 196 ? -11.333 13.146 8.830   1.00 35.17 ? 196 THR A CB    1 
ATOM   2319 O OG1   . THR B 2 196 ? -12.330 12.598 9.694   1.00 35.67 ? 196 THR A OG1   1 
ATOM   2320 C CG2   . THR B 2 196 ? -10.891 12.075 7.863   1.00 32.96 ? 196 THR A CG2   1 
ATOM   2321 N N     . ARG B 2 197 ? -11.385 15.501 10.622  1.00 38.59 ? 197 ARG A N     1 
ATOM   2322 C CA    . ARG B 2 197 ? -11.931 16.315 11.700  1.00 39.60 ? 197 ARG A CA    1 
ATOM   2323 C C     . ARG B 2 197 ? -13.186 15.654 12.265  1.00 40.30 ? 197 ARG A C     1 
ATOM   2324 O O     . ARG B 2 197 ? -13.840 16.194 13.148  1.00 40.16 ? 197 ARG A O     1 
ATOM   2325 C CB    . ARG B 2 197 ? -12.273 17.709 11.170  1.00 39.40 ? 197 ARG A CB    1 
ATOM   2326 C CG    . ARG B 2 197 ? -13.513 17.761 10.284  1.00 39.29 ? 197 ARG A CG    1 
ATOM   2327 C CD    . ARG B 2 197 ? -13.581 19.089 9.583   1.00 37.38 ? 197 ARG A CD    1 
ATOM   2328 N NE    . ARG B 2 197 ? -12.430 19.239 8.706   1.00 39.95 ? 197 ARG A NE    1 
ATOM   2329 C CZ    . ARG B 2 197 ? -12.044 20.387 8.171   1.00 39.05 ? 197 ARG A CZ    1 
ATOM   2330 N NH1   . ARG B 2 197 ? -12.724 21.489 8.432   1.00 39.63 ? 197 ARG A NH1   1 
ATOM   2331 N NH2   . ARG B 2 197 ? -10.980 20.428 7.379   1.00 37.87 ? 197 ARG A NH2   1 
ATOM   2332 N N     . ARG B 2 198 ? -13.518 14.478 11.747  1.00 41.35 ? 198 ARG A N     1 
ATOM   2333 C CA    . ARG B 2 198 ? -14.708 13.759 12.188  1.00 42.90 ? 198 ARG A CA    1 
ATOM   2334 C C     . ARG B 2 198 ? -14.386 12.428 12.862  1.00 41.74 ? 198 ARG A C     1 
ATOM   2335 O O     . ARG B 2 198 ? -15.288 11.689 13.248  1.00 41.59 ? 198 ARG A O     1 
ATOM   2336 C CB    . ARG B 2 198 ? -15.637 13.508 10.990  1.00 45.75 ? 198 ARG A CB    1 
ATOM   2337 C CG    . ARG B 2 198 ? -16.392 14.742 10.478  1.00 50.36 ? 198 ARG A CG    1 
ATOM   2338 C CD    . ARG B 2 198 ? -17.461 15.204 11.474  1.00 53.71 ? 198 ARG A CD    1 
ATOM   2339 N NE    . ARG B 2 198 ? -18.222 16.364 10.999  1.00 56.91 ? 198 ARG A NE    1 
ATOM   2340 C CZ    . ARG B 2 198 ? -17.762 17.618 10.953  1.00 57.04 ? 198 ARG A CZ    1 
ATOM   2341 N NH1   . ARG B 2 198 ? -16.526 17.899 11.360  1.00 57.94 ? 198 ARG A NH1   1 
ATOM   2342 N NH2   . ARG B 2 198 ? -18.539 18.596 10.497  1.00 57.77 ? 198 ARG A NH2   1 
ATOM   2343 N N     . THR B 2 199 ? -13.099 12.136 13.009  1.00 39.01 ? 199 THR A N     1 
ATOM   2344 C CA    . THR B 2 199 ? -12.649 10.891 13.624  1.00 36.24 ? 199 THR A CA    1 
ATOM   2345 C C     . THR B 2 199 ? -12.907 10.763 15.137  1.00 36.51 ? 199 THR A C     1 
ATOM   2346 O O     . THR B 2 199 ? -12.693 11.701 15.909  1.00 36.97 ? 199 THR A O     1 
ATOM   2347 C CB    . THR B 2 199 ? -11.131 10.674 13.337  1.00 36.16 ? 199 THR A CB    1 
ATOM   2348 O OG1   . THR B 2 199 ? -10.940 10.445 11.932  1.00 34.76 ? 199 THR A OG1   1 
ATOM   2349 C CG2   . THR B 2 199 ? -10.583 9.497  14.131  1.00 32.34 ? 199 THR A CG2   1 
ATOM   2350 N N     . VAL B 2 200 ? -13.383 9.586  15.538  1.00 36.29 ? 200 VAL A N     1 
ATOM   2351 C CA    . VAL B 2 200 ? -13.649 9.275  16.940  1.00 36.81 ? 200 VAL A CA    1 
ATOM   2352 C C     . VAL B 2 200 ? -12.854 8.022  17.323  1.00 36.94 ? 200 VAL A C     1 
ATOM   2353 O O     . VAL B 2 200 ? -12.933 7.004  16.644  1.00 38.17 ? 200 VAL A O     1 
ATOM   2354 C CB    . VAL B 2 200 ? -15.148 8.986  17.195  1.00 37.56 ? 200 VAL A CB    1 
ATOM   2355 C CG1   . VAL B 2 200 ? -15.404 8.904  18.689  1.00 35.95 ? 200 VAL A CG1   1 
ATOM   2356 C CG2   . VAL B 2 200 ? -16.014 10.062 16.560  1.00 38.98 ? 200 VAL A CG2   1 
ATOM   2357 N N     . ILE B 2 201 ? -12.088 8.092  18.407  1.00 36.24 ? 201 ILE A N     1 
ATOM   2358 C CA    . ILE B 2 201 ? -11.295 6.948  18.843  1.00 34.60 ? 201 ILE A CA    1 
ATOM   2359 C C     . ILE B 2 201 ? -11.780 6.426  20.196  1.00 35.98 ? 201 ILE A C     1 
ATOM   2360 O O     . ILE B 2 201 ? -11.563 7.053  21.231  1.00 37.34 ? 201 ILE A O     1 
ATOM   2361 C CB    . ILE B 2 201 ? -9.784  7.317  18.902  1.00 33.61 ? 201 ILE A CB    1 
ATOM   2362 C CG1   . ILE B 2 201 ? -9.276  7.621  17.484  1.00 30.85 ? 201 ILE A CG1   1 
ATOM   2363 C CG2   . ILE B 2 201 ? -8.978  6.172  19.513  1.00 30.79 ? 201 ILE A CG2   1 
ATOM   2364 C CD1   . ILE B 2 201 ? -7.821  8.024  17.412  1.00 28.24 ? 201 ILE A CD1   1 
ATOM   2365 N N     . ASP B 2 202 ? -12.452 5.277  20.167  1.00 36.00 ? 202 ASP A N     1 
ATOM   2366 C CA    . ASP B 2 202 ? -12.995 4.651  21.369  1.00 37.01 ? 202 ASP A CA    1 
ATOM   2367 C C     . ASP B 2 202 ? -12.045 3.590  21.885  1.00 38.56 ? 202 ASP A C     1 
ATOM   2368 O O     . ASP B 2 202 ? -12.206 2.401  21.586  1.00 37.99 ? 202 ASP A O     1 
ATOM   2369 C CB    . ASP B 2 202 ? -14.360 4.002  21.086  1.00 35.67 ? 202 ASP A CB    1 
ATOM   2370 C CG    . ASP B 2 202 ? -15.142 3.712  22.359  1.00 36.10 ? 202 ASP A CG    1 
ATOM   2371 O OD1   . ASP B 2 202 ? -14.545 3.189  23.319  1.00 37.65 ? 202 ASP A OD1   1 
ATOM   2372 O OD2   . ASP B 2 202 ? -16.353 4.001  22.409  1.00 36.34 ? 202 ASP A OD2   1 
ATOM   2373 N N     . VAL B 2 203 ? -11.059 4.024  22.662  1.00 39.33 ? 203 VAL A N     1 
ATOM   2374 C CA    . VAL B 2 203 ? -10.070 3.119  23.230  1.00 40.20 ? 203 VAL A CA    1 
ATOM   2375 C C     . VAL B 2 203 ? -10.682 1.855  23.831  1.00 39.81 ? 203 VAL A C     1 
ATOM   2376 O O     . VAL B 2 203 ? -10.195 0.751  23.600  1.00 40.65 ? 203 VAL A O     1 
ATOM   2377 C CB    . VAL B 2 203 ? -9.277  3.796  24.351  1.00 40.94 ? 203 VAL A CB    1 
ATOM   2378 C CG1   . VAL B 2 203 ? -7.956  3.082  24.530  1.00 39.23 ? 203 VAL A CG1   1 
ATOM   2379 C CG2   . VAL B 2 203 ? -9.095  5.283  24.047  1.00 42.42 ? 203 VAL A CG2   1 
ATOM   2380 N N     . ALA B 2 204 ? -11.744 2.030  24.612  1.00 38.57 ? 204 ALA A N     1 
ATOM   2381 C CA    . ALA B 2 204 ? -12.402 0.912  25.275  1.00 37.39 ? 204 ALA A CA    1 
ATOM   2382 C C     . ALA B 2 204 ? -12.949 -0.139 24.318  1.00 37.15 ? 204 ALA A C     1 
ATOM   2383 O O     . ALA B 2 204 ? -12.757 -1.335 24.530  1.00 37.02 ? 204 ALA A O     1 
ATOM   2384 C CB    . ALA B 2 204 ? -13.516 1.423  26.184  1.00 36.08 ? 204 ALA A CB    1 
ATOM   2385 N N     . LYS B 2 205 ? -13.640 0.296  23.272  1.00 37.05 ? 205 LYS A N     1 
ATOM   2386 C CA    . LYS B 2 205 ? -14.193 -0.649 22.311  1.00 36.87 ? 205 LYS A CA    1 
ATOM   2387 C C     . LYS B 2 205 ? -13.158 -1.034 21.272  1.00 36.24 ? 205 LYS A C     1 
ATOM   2388 O O     . LYS B 2 205 ? -13.437 -1.826 20.396  1.00 37.72 ? 205 LYS A O     1 
ATOM   2389 C CB    . LYS B 2 205 ? -15.416 -0.055 21.614  1.00 37.18 ? 205 LYS A CB    1 
ATOM   2390 C CG    . LYS B 2 205 ? -16.606 0.158  22.522  1.00 39.27 ? 205 LYS A CG    1 
ATOM   2391 C CD    . LYS B 2 205 ? -17.732 0.872  21.786  1.00 42.09 ? 205 LYS A CD    1 
ATOM   2392 C CE    . LYS B 2 205 ? -18.939 1.089  22.696  1.00 42.56 ? 205 LYS A CE    1 
ATOM   2393 N NZ    . LYS B 2 205 ? -19.997 1.908  22.036  1.00 42.92 ? 205 LYS A NZ    1 
ATOM   2394 N N     . GLY B 2 206 ? -11.958 -0.481 21.380  1.00 36.91 ? 206 GLY A N     1 
ATOM   2395 C CA    . GLY B 2 206 ? -10.917 -0.787 20.412  1.00 38.02 ? 206 GLY A CA    1 
ATOM   2396 C C     . GLY B 2 206 ? -11.412 -0.496 19.008  1.00 38.29 ? 206 GLY A C     1 
ATOM   2397 O O     . GLY B 2 206 ? -11.048 -1.185 18.058  1.00 38.45 ? 206 GLY A O     1 
ATOM   2398 N N     . GLU B 2 207 ? -12.224 0.554  18.882  1.00 40.34 ? 207 GLU A N     1 
ATOM   2399 C CA    . GLU B 2 207 ? -12.838 0.937  17.604  1.00 42.49 ? 207 GLU A CA    1 
ATOM   2400 C C     . GLU B 2 207 ? -12.565 2.371  17.139  1.00 41.23 ? 207 GLU A C     1 
ATOM   2401 O O     . GLU B 2 207 ? -12.223 3.250  17.925  1.00 42.51 ? 207 GLU A O     1 
ATOM   2402 C CB    . GLU B 2 207 ? -14.361 0.727  17.715  1.00 44.11 ? 207 GLU A CB    1 
ATOM   2403 C CG    . GLU B 2 207 ? -15.169 0.978  16.450  1.00 47.39 ? 207 GLU A CG    1 
ATOM   2404 C CD    . GLU B 2 207 ? -16.669 0.766  16.664  1.00 49.26 ? 207 GLU A CD    1 
ATOM   2405 O OE1   . GLU B 2 207 ? -17.295 1.559  17.412  1.00 49.09 ? 207 GLU A OE1   1 
ATOM   2406 O OE2   . GLU B 2 207 ? -17.217 -0.204 16.085  1.00 50.59 ? 207 GLU A OE2   1 
ATOM   2407 N N     . VAL B 2 208 ? -12.714 2.596  15.844  1.00 40.10 ? 208 VAL A N     1 
ATOM   2408 C CA    . VAL B 2 208 ? -12.536 3.920  15.280  1.00 39.69 ? 208 VAL A CA    1 
ATOM   2409 C C     . VAL B 2 208 ? -13.748 4.153  14.404  1.00 39.11 ? 208 VAL A C     1 
ATOM   2410 O O     . VAL B 2 208 ? -14.052 3.352  13.530  1.00 38.31 ? 208 VAL A O     1 
ATOM   2411 C CB    . VAL B 2 208 ? -11.273 4.011  14.428  1.00 39.10 ? 208 VAL A CB    1 
ATOM   2412 C CG1   . VAL B 2 208 ? -11.153 5.392  13.820  1.00 37.62 ? 208 VAL A CG1   1 
ATOM   2413 C CG2   . VAL B 2 208 ? -10.073 3.712  15.278  1.00 41.19 ? 208 VAL A CG2   1 
ATOM   2414 N N     . ARG B 2 209 ? -14.454 5.242  14.648  1.00 38.80 ? 209 ARG A N     1 
ATOM   2415 C CA    . ARG B 2 209 ? -15.637 5.533  13.867  1.00 40.43 ? 209 ARG A CA    1 
ATOM   2416 C C     . ARG B 2 209 ? -15.752 7.005  13.487  1.00 42.17 ? 209 ARG A C     1 
ATOM   2417 O O     . ARG B 2 209 ? -14.835 7.795  13.723  1.00 44.01 ? 209 ARG A O     1 
ATOM   2418 C CB    . ARG B 2 209 ? -16.877 5.073  14.628  1.00 39.65 ? 209 ARG A CB    1 
ATOM   2419 C CG    . ARG B 2 209 ? -16.980 5.590  16.045  1.00 38.63 ? 209 ARG A CG    1 
ATOM   2420 C CD    . ARG B 2 209 ? -18.258 5.113  16.675  1.00 37.53 ? 209 ARG A CD    1 
ATOM   2421 N NE    . ARG B 2 209 ? -18.477 5.765  17.956  1.00 40.56 ? 209 ARG A NE    1 
ATOM   2422 C CZ    . ARG B 2 209 ? -18.077 5.288  19.129  1.00 39.42 ? 209 ARG A CZ    1 
ATOM   2423 N NH1   . ARG B 2 209 ? -17.429 4.131  19.206  1.00 38.61 ? 209 ARG A NH1   1 
ATOM   2424 N NH2   . ARG B 2 209 ? -18.323 5.983  20.227  1.00 39.20 ? 209 ARG A NH2   1 
ATOM   2425 N N     . LYS B 2 210 ? -16.882 7.367  12.893  1.00 43.67 ? 210 LYS A N     1 
ATOM   2426 C CA    . LYS B 2 210 ? -17.104 8.732  12.457  1.00 45.97 ? 210 LYS A CA    1 
ATOM   2427 C C     . LYS B 2 210 ? -18.111 9.418  13.372  1.00 46.69 ? 210 LYS A C     1 
ATOM   2428 O O     . LYS B 2 210 ? -19.208 8.907  13.586  1.00 46.55 ? 210 LYS A O     1 
ATOM   2429 C CB    . LYS B 2 210 ? -17.614 8.717  11.014  1.00 47.23 ? 210 LYS A CB    1 
ATOM   2430 C CG    . LYS B 2 210 ? -17.351 9.989  10.209  1.00 52.08 ? 210 LYS A CG    1 
ATOM   2431 C CD    . LYS B 2 210 ? -18.332 11.144 10.510  1.00 55.19 ? 210 LYS A CD    1 
ATOM   2432 C CE    . LYS B 2 210 ? -18.231 12.223 9.411   1.00 57.04 ? 210 LYS A CE    1 
ATOM   2433 N NZ    . LYS B 2 210 ? -19.247 13.316 9.501   1.00 57.96 ? 210 LYS A NZ    1 
ATOM   2434 N N     . GLY B 2 211 ? -17.723 10.568 13.923  1.00 47.20 ? 211 GLY A N     1 
ATOM   2435 C CA    . GLY B 2 211 ? -18.606 11.320 14.802  1.00 45.97 ? 211 GLY A CA    1 
ATOM   2436 C C     . GLY B 2 211 ? -18.874 12.705 14.241  1.00 47.17 ? 211 GLY A C     1 
ATOM   2437 O O     . GLY B 2 211 ? -18.784 12.930 13.029  1.00 46.97 ? 211 GLY A O     1 
ATOM   2438 N N     . GLU B 2 212 ? -19.195 13.645 15.120  1.00 48.12 ? 212 GLU A N     1 
ATOM   2439 C CA    . GLU B 2 212 ? -19.465 15.010 14.698  1.00 49.79 ? 212 GLU A CA    1 
ATOM   2440 C C     . GLU B 2 212 ? -18.275 15.931 14.961  1.00 49.95 ? 212 GLU A C     1 
ATOM   2441 O O     . GLU B 2 212 ? -18.308 17.117 14.613  1.00 50.73 ? 212 GLU A O     1 
ATOM   2442 C CB    . GLU B 2 212 ? -20.697 15.533 15.433  1.00 52.10 ? 212 GLU A CB    1 
ATOM   2443 C CG    . GLU B 2 212 ? -21.971 15.501 14.594  1.00 57.46 ? 212 GLU A CG    1 
ATOM   2444 C CD    . GLU B 2 212 ? -23.230 15.319 15.435  1.00 61.14 ? 212 GLU A CD    1 
ATOM   2445 O OE1   . GLU B 2 212 ? -23.358 15.986 16.491  1.00 63.58 ? 212 GLU A OE1   1 
ATOM   2446 O OE2   . GLU B 2 212 ? -24.096 14.505 15.033  1.00 62.95 ? 212 GLU A OE2   1 
ATOM   2447 N N     . GLU B 2 213 ? -17.225 15.368 15.558  1.00 48.77 ? 213 GLU A N     1 
ATOM   2448 C CA    . GLU B 2 213 ? -16.010 16.105 15.928  1.00 47.15 ? 213 GLU A CA    1 
ATOM   2449 C C     . GLU B 2 213 ? -14.909 15.118 16.294  1.00 44.65 ? 213 GLU A C     1 
ATOM   2450 O O     . GLU B 2 213 ? -15.185 13.940 16.528  1.00 46.89 ? 213 GLU A O     1 
ATOM   2451 C CB    . GLU B 2 213 ? -16.296 16.951 17.159  1.00 48.63 ? 213 GLU A CB    1 
ATOM   2452 C CG    . GLU B 2 213 ? -17.094 16.164 18.186  1.00 53.22 ? 213 GLU A CG    1 
ATOM   2453 C CD    . GLU B 2 213 ? -17.092 16.784 19.564  1.00 55.71 ? 213 GLU A CD    1 
ATOM   2454 O OE1   . GLU B 2 213 ? -18.083 16.562 20.300  1.00 56.77 ? 213 GLU A OE1   1 
ATOM   2455 O OE2   . GLU B 2 213 ? -16.107 17.473 19.917  1.00 56.45 ? 213 GLU A OE2   1 
ATOM   2456 N N     . PHE B 2 214 ? -13.667 15.586 16.369  1.00 40.53 ? 214 PHE A N     1 
ATOM   2457 C CA    . PHE B 2 214 ? -12.589 14.689 16.755  1.00 36.44 ? 214 PHE A CA    1 
ATOM   2458 C C     . PHE B 2 214 ? -12.893 14.334 18.204  1.00 35.22 ? 214 PHE A C     1 
ATOM   2459 O O     . PHE B 2 214 ? -12.998 15.216 19.059  1.00 35.19 ? 214 PHE A O     1 
ATOM   2460 C CB    . PHE B 2 214 ? -11.231 15.375 16.661  1.00 34.63 ? 214 PHE A CB    1 
ATOM   2461 C CG    . PHE B 2 214 ? -10.083 14.413 16.666  1.00 32.92 ? 214 PHE A CG    1 
ATOM   2462 C CD1   . PHE B 2 214 ? -9.793  13.653 15.540  1.00 31.44 ? 214 PHE A CD1   1 
ATOM   2463 C CD2   . PHE B 2 214 ? -9.333  14.218 17.813  1.00 29.07 ? 214 PHE A CD2   1 
ATOM   2464 C CE1   . PHE B 2 214 ? -8.780  12.714 15.562  1.00 31.54 ? 214 PHE A CE1   1 
ATOM   2465 C CE2   . PHE B 2 214 ? -8.318  13.278 17.839  1.00 28.27 ? 214 PHE A CE2   1 
ATOM   2466 C CZ    . PHE B 2 214 ? -8.040  12.524 16.711  1.00 28.34 ? 214 PHE A CZ    1 
ATOM   2467 N N     . PHE B 2 215 ? -13.026 13.046 18.482  1.00 33.92 ? 215 PHE A N     1 
ATOM   2468 C CA    . PHE B 2 215 ? -13.386 12.614 19.820  1.00 34.25 ? 215 PHE A CA    1 
ATOM   2469 C C     . PHE B 2 215 ? -12.632 11.359 20.258  1.00 33.99 ? 215 PHE A C     1 
ATOM   2470 O O     . PHE B 2 215 ? -12.713 10.321 19.613  1.00 34.54 ? 215 PHE A O     1 
ATOM   2471 C CB    . PHE B 2 215 ? -14.899 12.348 19.839  1.00 34.46 ? 215 PHE A CB    1 
ATOM   2472 C CG    . PHE B 2 215 ? -15.544 12.451 21.203  1.00 35.55 ? 215 PHE A CG    1 
ATOM   2473 C CD1   . PHE B 2 215 ? -16.479 13.451 21.465  1.00 34.36 ? 215 PHE A CD1   1 
ATOM   2474 C CD2   . PHE B 2 215 ? -15.275 11.519 22.196  1.00 34.95 ? 215 PHE A CD2   1 
ATOM   2475 C CE1   . PHE B 2 215 ? -17.137 13.516 22.684  1.00 33.04 ? 215 PHE A CE1   1 
ATOM   2476 C CE2   . PHE B 2 215 ? -15.932 11.578 23.425  1.00 35.78 ? 215 PHE A CE2   1 
ATOM   2477 C CZ    . PHE B 2 215 ? -16.864 12.578 23.668  1.00 34.43 ? 215 PHE A CZ    1 
ATOM   2478 N N     . VAL B 2 216 ? -11.889 11.461 21.352  1.00 32.51 ? 216 VAL A N     1 
ATOM   2479 C CA    . VAL B 2 216 ? -11.174 10.313 21.886  1.00 31.93 ? 216 VAL A CA    1 
ATOM   2480 C C     . VAL B 2 216 ? -11.878 9.997  23.192  1.00 31.81 ? 216 VAL A C     1 
ATOM   2481 O O     . VAL B 2 216 ? -11.658 10.658 24.195  1.00 31.75 ? 216 VAL A O     1 
ATOM   2482 C CB    . VAL B 2 216 ? -9.700  10.634 22.158  1.00 31.88 ? 216 VAL A CB    1 
ATOM   2483 C CG1   . VAL B 2 216 ? -9.021  9.435  22.787  1.00 31.29 ? 216 VAL A CG1   1 
ATOM   2484 C CG2   . VAL B 2 216 ? -9.010  10.998 20.861  1.00 31.93 ? 216 VAL A CG2   1 
ATOM   2485 N N     . VAL B 2 217 ? -12.745 8.994  23.172  1.00 32.64 ? 217 VAL A N     1 
ATOM   2486 C CA    . VAL B 2 217 ? -13.502 8.636  24.362  1.00 32.74 ? 217 VAL A CA    1 
ATOM   2487 C C     . VAL B 2 217 ? -12.693 7.984  25.467  1.00 32.59 ? 217 VAL A C     1 
ATOM   2488 O O     . VAL B 2 217 ? -12.034 6.964  25.272  1.00 32.50 ? 217 VAL A O     1 
ATOM   2489 C CB    . VAL B 2 217 ? -14.750 7.762  24.014  1.00 30.60 ? 217 VAL A CB    1 
ATOM   2490 C CG1   . VAL B 2 217 ? -14.427 6.801  22.936  1.00 31.14 ? 217 VAL A CG1   1 
ATOM   2491 C CG2   . VAL B 2 217 ? -15.241 7.032  25.243  1.00 27.74 ? 217 VAL A CG2   1 
ATOM   2492 N N     . ASP B 2 218 ? -12.762 8.635  26.627  1.00 33.74 ? 218 ASP A N     1 
ATOM   2493 C CA    . ASP B 2 218 ? -12.093 8.254  27.861  1.00 34.84 ? 218 ASP A CA    1 
ATOM   2494 C C     . ASP B 2 218 ? -12.509 6.835  28.218  1.00 35.52 ? 218 ASP A C     1 
ATOM   2495 O O     . ASP B 2 218 ? -13.695 6.530  28.268  1.00 36.34 ? 218 ASP A O     1 
ATOM   2496 C CB    . ASP B 2 218 ? -12.542 9.223  28.965  1.00 36.24 ? 218 ASP A CB    1 
ATOM   2497 C CG    . ASP B 2 218 ? -11.683 9.161  30.211  1.00 37.79 ? 218 ASP A CG    1 
ATOM   2498 O OD1   . ASP B 2 218 ? -11.433 8.061  30.739  1.00 37.26 ? 218 ASP A OD1   1 
ATOM   2499 O OD2   . ASP B 2 218 ? -11.271 10.239 30.677  1.00 38.20 ? 218 ASP A OD2   1 
ATOM   2500 N N     . PRO B 2 219 ? -11.542 5.944  28.462  1.00 35.51 ? 219 PRO A N     1 
ATOM   2501 C CA    . PRO B 2 219 ? -11.899 4.569  28.816  1.00 34.45 ? 219 PRO A CA    1 
ATOM   2502 C C     . PRO B 2 219 ? -12.666 4.579  30.137  1.00 34.84 ? 219 PRO A C     1 
ATOM   2503 O O     . PRO B 2 219 ? -13.544 3.758  30.374  1.00 36.15 ? 219 PRO A O     1 
ATOM   2504 C CB    . PRO B 2 219 ? -10.542 3.889  28.961  1.00 34.08 ? 219 PRO A CB    1 
ATOM   2505 C CG    . PRO B 2 219 ? -9.656  4.700  28.067  1.00 35.57 ? 219 PRO A CG    1 
ATOM   2506 C CD    . PRO B 2 219 ? -10.084 6.099  28.351  1.00 34.86 ? 219 PRO A CD    1 
ATOM   2507 N N     . VAL B 2 220 ? -12.321 5.539  30.985  1.00 35.76 ? 220 VAL A N     1 
ATOM   2508 C CA    . VAL B 2 220 ? -12.919 5.692  32.302  1.00 36.24 ? 220 VAL A CA    1 
ATOM   2509 C C     . VAL B 2 220 ? -14.261 6.416  32.306  1.00 38.48 ? 220 VAL A C     1 
ATOM   2510 O O     . VAL B 2 220 ? -14.957 6.414  33.320  1.00 40.30 ? 220 VAL A O     1 
ATOM   2511 C CB    . VAL B 2 220 ? -11.955 6.451  33.223  1.00 34.66 ? 220 VAL A CB    1 
ATOM   2512 C CG1   . VAL B 2 220 ? -12.512 6.539  34.613  1.00 32.19 ? 220 VAL A CG1   1 
ATOM   2513 C CG2   . VAL B 2 220 ? -10.614 5.762  33.232  1.00 33.66 ? 220 VAL A CG2   1 
ATOM   2514 N N     . ASP B 2 221 ? -14.628 7.034  31.187  1.00 39.29 ? 221 ASP A N     1 
ATOM   2515 C CA    . ASP B 2 221 ? -15.896 7.758  31.113  1.00 39.68 ? 221 ASP A CA    1 
ATOM   2516 C C     . ASP B 2 221 ? -16.073 7.709  29.603  1.00 40.77 ? 221 ASP A C     1 
ATOM   2517 O O     . ASP B 2 221 ? -15.227 8.199  28.848  1.00 39.69 ? 221 ASP A O     1 
ATOM   2518 C CB    . ASP B 2 221 ? -15.781 9.097  31.830  1.00 40.26 ? 221 ASP A CB    1 
ATOM   2519 C CG    . ASP B 2 221 ? -17.115 9.787  31.982  1.00 40.94 ? 221 ASP A CG    1 
ATOM   2520 O OD1   . ASP B 2 221 ? -18.038 9.501  31.187  1.00 43.19 ? 221 ASP A OD1   1 
ATOM   2521 O OD2   . ASP B 2 221 ? -17.240 10.627 32.894  1.00 42.02 ? 221 ASP A OD2   1 
ATOM   2522 N N     . GLU B 2 222 ? -17.195 7.143  29.173  1.00 43.34 ? 222 GLU A N     1 
ATOM   2523 C CA    . GLU B 2 222 ? -17.629 7.155  27.779  1.00 46.82 ? 222 GLU A CA    1 
ATOM   2524 C C     . GLU B 2 222 ? -18.144 8.509  27.273  1.00 46.56 ? 222 GLU A C     1 
ATOM   2525 O O     . GLU B 2 222 ? -18.219 8.718  26.063  1.00 45.88 ? 222 GLU A O     1 
ATOM   2526 C CB    . GLU B 2 222 ? -18.738 6.112  27.569  1.00 50.53 ? 222 GLU A CB    1 
ATOM   2527 C CG    . GLU B 2 222 ? -18.298 4.661  27.719  1.00 56.60 ? 222 GLU A CG    1 
ATOM   2528 C CD    . GLU B 2 222 ? -16.931 4.390  27.084  1.00 59.79 ? 222 GLU A CD    1 
ATOM   2529 O OE1   . GLU B 2 222 ? -15.906 4.720  27.736  1.00 60.59 ? 222 GLU A OE1   1 
ATOM   2530 O OE2   . GLU B 2 222 ? -16.885 3.858  25.937  1.00 60.97 ? 222 GLU A OE2   1 
ATOM   2531 N N     . LYS B 2 223 ? -18.496 9.421  28.174  1.00 46.86 ? 223 LYS A N     1 
ATOM   2532 C CA    . LYS B 2 223 ? -19.027 10.723 27.758  1.00 48.55 ? 223 LYS A CA    1 
ATOM   2533 C C     . LYS B 2 223 ? -17.989 11.835 27.652  1.00 48.08 ? 223 LYS A C     1 
ATOM   2534 O O     . LYS B 2 223 ? -18.243 12.887 27.064  1.00 47.52 ? 223 LYS A O     1 
ATOM   2535 C CB    . LYS B 2 223 ? -20.150 11.158 28.709  1.00 51.05 ? 223 LYS A CB    1 
ATOM   2536 C CG    . LYS B 2 223 ? -21.413 10.302 28.597  1.00 55.35 ? 223 LYS A CG    1 
ATOM   2537 C CD    . LYS B 2 223 ? -21.957 10.329 27.159  1.00 57.32 ? 223 LYS A CD    1 
ATOM   2538 C CE    . LYS B 2 223 ? -23.021 9.249  26.930  1.00 59.25 ? 223 LYS A CE    1 
ATOM   2539 N NZ    . LYS B 2 223 ? -22.487 7.862  27.183  1.00 61.37 ? 223 LYS A NZ    1 
ATOM   2540 N N     . ARG B 2 224 ? -16.809 11.578 28.199  1.00 47.49 ? 224 ARG A N     1 
ATOM   2541 C CA    . ARG B 2 224 ? -15.727 12.544 28.204  1.00 45.84 ? 224 ARG A CA    1 
ATOM   2542 C C     . ARG B 2 224 ? -14.814 12.420 26.977  1.00 43.81 ? 224 ARG A C     1 
ATOM   2543 O O     . ARG B 2 224 ? -14.498 11.319 26.541  1.00 43.62 ? 224 ARG A O     1 
ATOM   2544 C CB    . ARG B 2 224 ? -14.935 12.343 29.493  1.00 48.67 ? 224 ARG A CB    1 
ATOM   2545 C CG    . ARG B 2 224 ? -14.072 13.504 29.909  1.00 53.12 ? 224 ARG A CG    1 
ATOM   2546 C CD    . ARG B 2 224 ? -13.838 13.429 31.401  1.00 55.87 ? 224 ARG A CD    1 
ATOM   2547 N NE    . ARG B 2 224 ? -12.795 14.339 31.869  1.00 60.65 ? 224 ARG A NE    1 
ATOM   2548 C CZ    . ARG B 2 224 ? -11.540 14.347 31.419  1.00 62.97 ? 224 ARG A CZ    1 
ATOM   2549 N NH1   . ARG B 2 224 ? -11.155 13.495 30.470  1.00 64.23 ? 224 ARG A NH1   1 
ATOM   2550 N NH2   . ARG B 2 224 ? -10.658 15.194 31.938  1.00 64.42 ? 224 ARG A NH2   1 
ATOM   2551 N N     . ASN B 2 225 ? -14.402 13.549 26.411  1.00 41.11 ? 225 ASN A N     1 
ATOM   2552 C CA    . ASN B 2 225 ? -13.502 13.528 25.262  1.00 38.94 ? 225 ASN A CA    1 
ATOM   2553 C C     . ASN B 2 225 ? -12.110 13.909 25.751  1.00 38.12 ? 225 ASN A C     1 
ATOM   2554 O O     . ASN B 2 225 ? -11.904 15.025 26.222  1.00 38.37 ? 225 ASN A O     1 
ATOM   2555 C CB    . ASN B 2 225 ? -13.955 14.528 24.205  1.00 37.43 ? 225 ASN A CB    1 
ATOM   2556 C CG    . ASN B 2 225 ? -12.981 14.629 23.041  1.00 37.42 ? 225 ASN A CG    1 
ATOM   2557 O OD1   . ASN B 2 225 ? -11.860 14.122 23.104  1.00 36.58 ? 225 ASN A OD1   1 
ATOM   2558 N ND2   . ASN B 2 225 ? -13.403 15.302 21.975  1.00 36.97 ? 225 ASN A ND2   1 
ATOM   2559 N N     . VAL B 2 226 ? -11.153 12.993 25.638  1.00 37.00 ? 226 VAL A N     1 
ATOM   2560 C CA    . VAL B 2 226 ? -9.789  13.258 26.100  1.00 36.84 ? 226 VAL A CA    1 
ATOM   2561 C C     . VAL B 2 226 ? -9.072  14.347 25.317  1.00 36.94 ? 226 VAL A C     1 
ATOM   2562 O O     . VAL B 2 226 ? -8.253  15.083 25.874  1.00 36.54 ? 226 VAL A O     1 
ATOM   2563 C CB    . VAL B 2 226 ? -8.927  11.983 26.067  1.00 35.58 ? 226 VAL A CB    1 
ATOM   2564 C CG1   . VAL B 2 226 ? -7.475  12.325 26.347  1.00 35.34 ? 226 VAL A CG1   1 
ATOM   2565 C CG2   . VAL B 2 226 ? -9.433  11.003 27.101  1.00 36.54 ? 226 VAL A CG2   1 
ATOM   2566 N N     . ALA B 2 227 ? -9.392  14.451 24.031  1.00 37.11 ? 227 ALA A N     1 
ATOM   2567 C CA    . ALA B 2 227 ? -8.780  15.448 23.167  1.00 37.17 ? 227 ALA A CA    1 
ATOM   2568 C C     . ALA B 2 227 ? -9.709  16.653 22.989  1.00 37.18 ? 227 ALA A C     1 
ATOM   2569 O O     . ALA B 2 227 ? -9.587  17.409 22.034  1.00 37.17 ? 227 ALA A O     1 
ATOM   2570 C CB    . ALA B 2 227 ? -8.463  14.822 21.818  1.00 36.10 ? 227 ALA A CB    1 
ATOM   2571 N N     . ALA B 2 228 ? -10.630 16.834 23.926  1.00 37.63 ? 228 ALA A N     1 
ATOM   2572 C CA    . ALA B 2 228 ? -11.588 17.927 23.853  1.00 38.27 ? 228 ALA A CA    1 
ATOM   2573 C C     . ALA B 2 228 ? -10.973 19.295 23.553  1.00 38.60 ? 228 ALA A C     1 
ATOM   2574 O O     . ALA B 2 228 ? -11.474 20.023 22.693  1.00 39.00 ? 228 ALA A O     1 
ATOM   2575 C CB    . ALA B 2 228 ? -12.405 17.994 25.150  1.00 36.10 ? 228 ALA A CB    1 
ATOM   2576 N N     . ASN B 2 229 ? -9.896  19.654 24.244  1.00 37.81 ? 229 ASN A N     1 
ATOM   2577 C CA    . ASN B 2 229 ? -9.309  20.957 24.003  1.00 38.15 ? 229 ASN A CA    1 
ATOM   2578 C C     . ASN B 2 229 ? -8.230  20.975 22.930  1.00 39.98 ? 229 ASN A C     1 
ATOM   2579 O O     . ASN B 2 229 ? -7.420  21.894 22.879  1.00 42.87 ? 229 ASN A O     1 
ATOM   2580 C CB    . ASN B 2 229 ? -8.791  21.556 25.312  1.00 36.76 ? 229 ASN A CB    1 
ATOM   2581 C CG    . ASN B 2 229 ? -8.728  23.078 25.276  1.00 36.82 ? 229 ASN A CG    1 
ATOM   2582 O OD1   . ASN B 2 229 ? -9.559  23.738 24.660  1.00 37.31 ? 229 ASN A OD1   1 
ATOM   2583 N ND2   . ASN B 2 229 ? -7.747  23.636 25.954  1.00 37.53 ? 229 ASN A ND2   1 
ATOM   2584 N N     . LEU B 2 230 ? -8.212  19.961 22.070  1.00 39.56 ? 230 LEU A N     1 
ATOM   2585 C CA    . LEU B 2 230 ? -7.255  19.935 20.968  1.00 38.44 ? 230 LEU A CA    1 
ATOM   2586 C C     . LEU B 2 230 ? -7.913  20.789 19.886  1.00 38.24 ? 230 LEU A C     1 
ATOM   2587 O O     . LEU B 2 230 ? -8.982  20.450 19.384  1.00 38.13 ? 230 LEU A O     1 
ATOM   2588 C CB    . LEU B 2 230 ? -7.041  18.505 20.453  1.00 37.43 ? 230 LEU A CB    1 
ATOM   2589 C CG    . LEU B 2 230 ? -6.192  18.349 19.183  1.00 35.70 ? 230 LEU A CG    1 
ATOM   2590 C CD1   . LEU B 2 230 ? -4.815  18.924 19.405  1.00 35.49 ? 230 LEU A CD1   1 
ATOM   2591 C CD2   . LEU B 2 230 ? -6.097  16.891 18.806  1.00 34.40 ? 230 LEU A CD2   1 
ATOM   2592 N N     . SER B 2 231 ? -7.281  21.902 19.541  1.00 38.42 ? 231 SER A N     1 
ATOM   2593 C CA    . SER B 2 231 ? -7.851  22.795 18.543  1.00 39.68 ? 231 SER A CA    1 
ATOM   2594 C C     . SER B 2 231 ? -7.860  22.131 17.173  1.00 39.82 ? 231 SER A C     1 
ATOM   2595 O O     . SER B 2 231 ? -7.073  21.224 16.899  1.00 39.90 ? 231 SER A O     1 
ATOM   2596 C CB    . SER B 2 231 ? -7.076  24.124 18.487  1.00 39.18 ? 231 SER A CB    1 
ATOM   2597 O OG    . SER B 2 231 ? -5.934  24.051 17.650  1.00 41.05 ? 231 SER A OG    1 
ATOM   2598 N N     . LEU B 2 232 ? -8.768  22.581 16.318  1.00 39.12 ? 232 LEU A N     1 
ATOM   2599 C CA    . LEU B 2 232 ? -8.882  22.037 14.978  1.00 38.58 ? 232 LEU A CA    1 
ATOM   2600 C C     . LEU B 2 232 ? -7.588  22.179 14.160  1.00 38.93 ? 232 LEU A C     1 
ATOM   2601 O O     . LEU B 2 232 ? -7.142  21.232 13.511  1.00 38.41 ? 232 LEU A O     1 
ATOM   2602 C CB    . LEU B 2 232 ? -10.032 22.728 14.260  1.00 36.89 ? 232 LEU A CB    1 
ATOM   2603 C CG    . LEU B 2 232 ? -10.350 22.246 12.849  1.00 38.21 ? 232 LEU A CG    1 
ATOM   2604 C CD1   . LEU B 2 232 ? -10.644 20.740 12.838  1.00 37.30 ? 232 LEU A CD1   1 
ATOM   2605 C CD2   . LEU B 2 232 ? -11.544 23.044 12.347  1.00 37.44 ? 232 LEU A CD2   1 
ATOM   2606 N N     . ASP B 2 233 ? -6.984  23.360 14.182  1.00 39.77 ? 233 ASP A N     1 
ATOM   2607 C CA    . ASP B 2 233 ? -5.767  23.560 13.420  1.00 40.13 ? 233 ASP A CA    1 
ATOM   2608 C C     . ASP B 2 233 ? -4.617  22.731 13.987  1.00 40.71 ? 233 ASP A C     1 
ATOM   2609 O O     . ASP B 2 233 ? -3.792  22.212 13.238  1.00 40.62 ? 233 ASP A O     1 
ATOM   2610 C CB    . ASP B 2 233 ? -5.413  25.049 13.361  1.00 40.71 ? 233 ASP A CB    1 
ATOM   2611 C CG    . ASP B 2 233 ? -6.535  25.895 12.752  1.00 41.54 ? 233 ASP A CG    1 
ATOM   2612 O OD1   . ASP B 2 233 ? -7.225  25.399 11.840  1.00 40.54 ? 233 ASP A OD1   1 
ATOM   2613 O OD2   . ASP B 2 233 ? -6.725  27.058 13.178  1.00 42.77 ? 233 ASP A OD2   1 
ATOM   2614 N N     . ASN B 2 234 ? -4.575  22.590 15.309  1.00 41.13 ? 234 ASN A N     1 
ATOM   2615 C CA    . ASN B 2 234 ? -3.537  21.788 15.951  1.00 40.84 ? 234 ASN A CA    1 
ATOM   2616 C C     . ASN B 2 234 ? -3.674  20.329 15.536  1.00 39.68 ? 234 ASN A C     1 
ATOM   2617 O O     . ASN B 2 234 ? -2.693  19.613 15.409  1.00 40.13 ? 234 ASN A O     1 
ATOM   2618 C CB    . ASN B 2 234 ? -3.629  21.923 17.473  1.00 42.66 ? 234 ASN A CB    1 
ATOM   2619 C CG    . ASN B 2 234 ? -2.731  23.025 18.010  1.00 43.54 ? 234 ASN A CG    1 
ATOM   2620 O OD1   . ASN B 2 234 ? -2.912  23.511 19.128  1.00 43.75 ? 234 ASN A OD1   1 
ATOM   2621 N ND2   . ASN B 2 234 ? -1.746  23.417 17.212  1.00 43.54 ? 234 ASN A ND2   1 
ATOM   2622 N N     . LEU B 2 235 ? -4.904  19.884 15.333  1.00 40.12 ? 235 LEU A N     1 
ATOM   2623 C CA    . LEU B 2 235 ? -5.132  18.520 14.887  1.00 39.95 ? 235 LEU A CA    1 
ATOM   2624 C C     . LEU B 2 235 ? -4.639  18.452 13.453  1.00 40.66 ? 235 LEU A C     1 
ATOM   2625 O O     . LEU B 2 235 ? -4.060  17.457 13.037  1.00 42.50 ? 235 LEU A O     1 
ATOM   2626 C CB    . LEU B 2 235 ? -6.620  18.189 14.910  1.00 37.87 ? 235 LEU A CB    1 
ATOM   2627 C CG    . LEU B 2 235 ? -7.067  17.000 14.058  1.00 37.13 ? 235 LEU A CG    1 
ATOM   2628 C CD1   . LEU B 2 235 ? -6.674  15.702 14.737  1.00 37.00 ? 235 LEU A CD1   1 
ATOM   2629 C CD2   . LEU B 2 235 ? -8.576  17.056 13.856  1.00 37.70 ? 235 LEU A CD2   1 
ATOM   2630 N N     . ALA B 2 236 ? -4.883  19.524 12.698  1.00 39.58 ? 236 ALA A N     1 
ATOM   2631 C CA    . ALA B 2 236 ? -4.470  19.607 11.297  1.00 38.12 ? 236 ALA A CA    1 
ATOM   2632 C C     . ALA B 2 236 ? -2.958  19.523 11.159  1.00 37.82 ? 236 ALA A C     1 
ATOM   2633 O O     . ALA B 2 236 ? -2.436  18.728 10.375  1.00 38.91 ? 236 ALA A O     1 
ATOM   2634 C CB    . ALA B 2 236 ? -4.968  20.903 10.684  1.00 37.80 ? 236 ALA A CB    1 
ATOM   2635 N N     . ARG B 2 237 ? -2.251  20.346 11.920  1.00 35.90 ? 237 ARG A N     1 
ATOM   2636 C CA    . ARG B 2 237 ? -0.802  20.345 11.860  1.00 35.50 ? 237 ARG A CA    1 
ATOM   2637 C C     . ARG B 2 237 ? -0.225  18.966 12.161  1.00 35.63 ? 237 ARG A C     1 
ATOM   2638 O O     . ARG B 2 237 ? 0.766   18.547 11.563  1.00 36.78 ? 237 ARG A O     1 
ATOM   2639 C CB    . ARG B 2 237 ? -0.242  21.373 12.836  1.00 36.66 ? 237 ARG A CB    1 
ATOM   2640 C CG    . ARG B 2 237 ? -0.730  22.775 12.575  1.00 37.70 ? 237 ARG A CG    1 
ATOM   2641 C CD    . ARG B 2 237 ? -0.103  23.769 13.517  1.00 40.13 ? 237 ARG A CD    1 
ATOM   2642 N NE    . ARG B 2 237 ? -0.625  25.114 13.288  1.00 44.49 ? 237 ARG A NE    1 
ATOM   2643 C CZ    . ARG B 2 237 ? -1.654  25.659 13.942  1.00 47.19 ? 237 ARG A CZ    1 
ATOM   2644 N NH1   . ARG B 2 237 ? -2.293  24.984 14.896  1.00 49.24 ? 237 ARG A NH1   1 
ATOM   2645 N NH2   . ARG B 2 237 ? -2.069  26.883 13.622  1.00 46.99 ? 237 ARG A NH2   1 
ATOM   2646 N N     . PHE B 2 238 ? -0.852  18.254 13.084  1.00 35.44 ? 238 PHE A N     1 
ATOM   2647 C CA    . PHE B 2 238 ? -0.371  16.927 13.452  1.00 36.07 ? 238 PHE A CA    1 
ATOM   2648 C C     . PHE B 2 238 ? -0.543  15.928 12.302  1.00 34.40 ? 238 PHE A C     1 
ATOM   2649 O O     . PHE B 2 238 ? 0.412   15.268 11.903  1.00 32.15 ? 238 PHE A O     1 
ATOM   2650 C CB    . PHE B 2 238 ? -1.093  16.430 14.725  1.00 36.14 ? 238 PHE A CB    1 
ATOM   2651 C CG    . PHE B 2 238 ? -0.598  15.103 15.227  1.00 36.22 ? 238 PHE A CG    1 
ATOM   2652 C CD1   . PHE B 2 238 ? 0.745   14.912 15.528  1.00 38.11 ? 238 PHE A CD1   1 
ATOM   2653 C CD2   . PHE B 2 238 ? -1.471  14.035 15.376  1.00 36.56 ? 238 PHE A CD2   1 
ATOM   2654 C CE1   . PHE B 2 238 ? 1.212   13.675 15.969  1.00 38.52 ? 238 PHE A CE1   1 
ATOM   2655 C CE2   . PHE B 2 238 ? -1.017  12.795 15.816  1.00 36.61 ? 238 PHE A CE2   1 
ATOM   2656 C CZ    . PHE B 2 238 ? 0.325   12.614 16.111  1.00 37.50 ? 238 PHE A CZ    1 
ATOM   2657 N N     . VAL B 2 239 ? -1.756  15.828 11.768  1.00 33.54 ? 239 VAL A N     1 
ATOM   2658 C CA    . VAL B 2 239 ? -2.023  14.912 10.669  1.00 34.83 ? 239 VAL A CA    1 
ATOM   2659 C C     . VAL B 2 239 ? -1.013  15.150 9.548   1.00 35.31 ? 239 VAL A C     1 
ATOM   2660 O O     . VAL B 2 239 ? -0.420  14.213 9.009   1.00 35.30 ? 239 VAL A O     1 
ATOM   2661 C CB    . VAL B 2 239 ? -3.461  15.100 10.117  1.00 34.30 ? 239 VAL A CB    1 
ATOM   2662 C CG1   . VAL B 2 239 ? -3.703  14.164 8.937   1.00 33.65 ? 239 VAL A CG1   1 
ATOM   2663 C CG2   . VAL B 2 239 ? -4.477  14.817 11.217  1.00 33.52 ? 239 VAL A CG2   1 
ATOM   2664 N N     . HIS B 2 240 ? -0.812  16.418 9.220   1.00 36.16 ? 240 HIS A N     1 
ATOM   2665 C CA    . HIS B 2 240 ? 0.110   16.796 8.170   1.00 35.96 ? 240 HIS A CA    1 
ATOM   2666 C C     . HIS B 2 240 ? 1.546   16.497 8.568   1.00 37.26 ? 240 HIS A C     1 
ATOM   2667 O O     . HIS B 2 240 ? 2.376   16.149 7.728   1.00 36.43 ? 240 HIS A O     1 
ATOM   2668 C CB    . HIS B 2 240 ? -0.047  18.279 7.868   1.00 34.87 ? 240 HIS A CB    1 
ATOM   2669 C CG    . HIS B 2 240 ? 0.682   18.722 6.639   1.00 34.49 ? 240 HIS A CG    1 
ATOM   2670 N ND1   . HIS B 2 240 ? 2.018   19.056 6.645   1.00 31.55 ? 240 HIS A ND1   1 
ATOM   2671 C CD2   . HIS B 2 240 ? 0.267   18.854 5.356   1.00 32.80 ? 240 HIS A CD2   1 
ATOM   2672 C CE1   . HIS B 2 240 ? 2.396   19.377 5.422   1.00 32.06 ? 240 HIS A CE1   1 
ATOM   2673 N NE2   . HIS B 2 240 ? 1.351   19.263 4.622   1.00 32.92 ? 240 HIS A NE2   1 
ATOM   2674 N N     . LEU B 2 241 ? 1.837   16.636 9.855   1.00 38.81 ? 241 LEU A N     1 
ATOM   2675 C CA    . LEU B 2 241 ? 3.173   16.375 10.341  1.00 39.24 ? 241 LEU A CA    1 
ATOM   2676 C C     . LEU B 2 241 ? 3.513   14.906 10.240  1.00 40.56 ? 241 LEU A C     1 
ATOM   2677 O O     . LEU B 2 241 ? 4.662   14.547 10.000  1.00 42.19 ? 241 LEU A O     1 
ATOM   2678 C CB    . LEU B 2 241 ? 3.312   16.856 11.776  1.00 39.00 ? 241 LEU A CB    1 
ATOM   2679 C CG    . LEU B 2 241 ? 3.939   18.247 11.799  1.00 39.54 ? 241 LEU A CG    1 
ATOM   2680 C CD1   . LEU B 2 241 ? 3.713   18.903 13.131  1.00 38.77 ? 241 LEU A CD1   1 
ATOM   2681 C CD2   . LEU B 2 241 ? 5.419   18.132 11.480  1.00 39.56 ? 241 LEU A CD2   1 
ATOM   2682 N N     . CYS B 2 242 ? 2.517   14.049 10.417  1.00 40.61 ? 242 CYS A N     1 
ATOM   2683 C CA    . CYS B 2 242 ? 2.756   12.618 10.328  1.00 40.94 ? 242 CYS A CA    1 
ATOM   2684 C C     . CYS B 2 242 ? 2.963   12.278 8.873   1.00 41.63 ? 242 CYS A C     1 
ATOM   2685 O O     . CYS B 2 242 ? 3.861   11.501 8.521   1.00 42.33 ? 242 CYS A O     1 
ATOM   2686 C CB    . CYS B 2 242 ? 1.567   11.830 10.864  1.00 41.29 ? 242 CYS A CB    1 
ATOM   2687 S SG    . CYS B 2 242 ? 1.326   11.968 12.631  1.00 42.29 ? 242 CYS A SG    1 
ATOM   2688 N N     . ARG B 2 243 ? 2.122   12.865 8.027   1.00 41.11 ? 243 ARG A N     1 
ATOM   2689 C CA    . ARG B 2 243 ? 2.212   12.636 6.592   1.00 42.17 ? 243 ARG A CA    1 
ATOM   2690 C C     . ARG B 2 243 ? 3.609   12.956 6.067   1.00 42.41 ? 243 ARG A C     1 
ATOM   2691 O O     . ARG B 2 243 ? 4.138   12.236 5.223   1.00 42.70 ? 243 ARG A O     1 
ATOM   2692 C CB    . ARG B 2 243 ? 1.170   13.474 5.852   1.00 40.31 ? 243 ARG A CB    1 
ATOM   2693 C CG    . ARG B 2 243 ? -0.255  13.042 6.125   1.00 41.19 ? 243 ARG A CG    1 
ATOM   2694 C CD    . ARG B 2 243 ? -1.263  13.915 5.382   1.00 42.25 ? 243 ARG A CD    1 
ATOM   2695 N NE    . ARG B 2 243 ? -2.637  13.489 5.648   1.00 41.81 ? 243 ARG A NE    1 
ATOM   2696 C CZ    . ARG B 2 243 ? -3.719  14.058 5.125   1.00 41.21 ? 243 ARG A CZ    1 
ATOM   2697 N NH1   . ARG B 2 243 ? -3.602  15.091 4.299   1.00 40.64 ? 243 ARG A NH1   1 
ATOM   2698 N NH2   . ARG B 2 243 ? -4.920  13.584 5.426   1.00 41.33 ? 243 ARG A NH2   1 
ATOM   2699 N N     . GLU B 2 244 ? 4.213   14.027 6.569   1.00 43.27 ? 244 GLU A N     1 
ATOM   2700 C CA    . GLU B 2 244 ? 5.546   14.396 6.120   1.00 43.34 ? 244 GLU A CA    1 
ATOM   2701 C C     . GLU B 2 244 ? 6.603   13.457 6.674   1.00 43.88 ? 244 GLU A C     1 
ATOM   2702 O O     . GLU B 2 244 ? 7.424   12.927 5.927   1.00 45.24 ? 244 GLU A O     1 
ATOM   2703 C CB    . GLU B 2 244 ? 5.872   15.829 6.525   1.00 43.62 ? 244 GLU A CB    1 
ATOM   2704 C CG    . GLU B 2 244 ? 4.995   16.875 5.861   1.00 44.70 ? 244 GLU A CG    1 
ATOM   2705 C CD    . GLU B 2 244 ? 5.458   18.298 6.150   1.00 46.55 ? 244 GLU A CD    1 
ATOM   2706 O OE1   . GLU B 2 244 ? 5.542   18.670 7.344   1.00 45.44 ? 244 GLU A OE1   1 
ATOM   2707 O OE2   . GLU B 2 244 ? 5.737   19.042 5.179   1.00 48.16 ? 244 GLU A OE2   1 
ATOM   2708 N N     . PHE B 2 245 ? 6.585   13.248 7.983   1.00 44.36 ? 245 PHE A N     1 
ATOM   2709 C CA    . PHE B 2 245 ? 7.563   12.369 8.607   1.00 44.80 ? 245 PHE A CA    1 
ATOM   2710 C C     . PHE B 2 245 ? 7.627   11.063 7.848   1.00 46.17 ? 245 PHE A C     1 
ATOM   2711 O O     . PHE B 2 245 ? 8.703   10.583 7.497   1.00 46.74 ? 245 PHE A O     1 
ATOM   2712 C CB    . PHE B 2 245 ? 7.190   12.074 10.059  1.00 43.04 ? 245 PHE A CB    1 
ATOM   2713 C CG    . PHE B 2 245 ? 8.249   11.309 10.807  1.00 41.77 ? 245 PHE A CG    1 
ATOM   2714 C CD1   . PHE B 2 245 ? 9.407   11.944 11.255  1.00 41.49 ? 245 PHE A CD1   1 
ATOM   2715 C CD2   . PHE B 2 245 ? 8.109   9.952  11.027  1.00 39.85 ? 245 PHE A CD2   1 
ATOM   2716 C CE1   . PHE B 2 245 ? 10.407  11.224 11.909  1.00 40.97 ? 245 PHE A CE1   1 
ATOM   2717 C CE2   . PHE B 2 245 ? 9.097   9.226  11.675  1.00 40.09 ? 245 PHE A CE2   1 
ATOM   2718 C CZ    . PHE B 2 245 ? 10.250  9.862  12.118  1.00 39.75 ? 245 PHE A CZ    1 
ATOM   2719 N N     . MET B 2 246 ? 6.460   10.487 7.598   1.00 46.83 ? 246 MET A N     1 
ATOM   2720 C CA    . MET B 2 246 ? 6.402   9.234  6.884   1.00 48.07 ? 246 MET A CA    1 
ATOM   2721 C C     . MET B 2 246 ? 6.972   9.321  5.484   1.00 49.35 ? 246 MET A C     1 
ATOM   2722 O O     . MET B 2 246 ? 7.454   8.331  4.960   1.00 49.96 ? 246 MET A O     1 
ATOM   2723 C CB    . MET B 2 246 ? 4.967   8.731  6.821   1.00 48.69 ? 246 MET A CB    1 
ATOM   2724 C CG    . MET B 2 246 ? 4.469   8.200  8.144   1.00 49.75 ? 246 MET A CG    1 
ATOM   2725 S SD    . MET B 2 246 ? 5.604   6.954  8.778   1.00 49.92 ? 246 MET A SD    1 
ATOM   2726 C CE    . MET B 2 246 ? 6.314   7.830  10.079  1.00 49.06 ? 246 MET A CE    1 
ATOM   2727 N N     . GLU B 2 247 ? 6.933   10.497 4.874   1.00 50.87 ? 247 GLU A N     1 
ATOM   2728 C CA    . GLU B 2 247 ? 7.448   10.644 3.517   1.00 52.20 ? 247 GLU A CA    1 
ATOM   2729 C C     . GLU B 2 247 ? 8.972   10.746 3.505   1.00 51.93 ? 247 GLU A C     1 
ATOM   2730 O O     . GLU B 2 247 ? 9.629   10.310 2.558   1.00 52.01 ? 247 GLU A O     1 
ATOM   2731 C CB    . GLU B 2 247 ? 6.816   11.873 2.854   1.00 54.32 ? 247 GLU A CB    1 
ATOM   2732 C CG    . GLU B 2 247 ? 6.895   11.896 1.322   1.00 58.95 ? 247 GLU A CG    1 
ATOM   2733 C CD    . GLU B 2 247 ? 6.070   13.034 0.694   1.00 62.06 ? 247 GLU A CD    1 
ATOM   2734 O OE1   . GLU B 2 247 ? 6.059   13.144 -0.561  1.00 62.58 ? 247 GLU A OE1   1 
ATOM   2735 O OE2   . GLU B 2 247 ? 5.429   13.818 1.450   1.00 64.14 ? 247 GLU A OE2   1 
ATOM   2736 N N     . ALA B 2 248 ? 9.527   11.303 4.578   1.00 52.97 ? 248 ALA A N     1 
ATOM   2737 C CA    . ALA B 2 248 ? 10.978  11.481 4.721   1.00 53.57 ? 248 ALA A CA    1 
ATOM   2738 C C     . ALA B 2 248 ? 11.360  11.681 6.198   1.00 53.24 ? 248 ALA A C     1 
ATOM   2739 O O     . ALA B 2 248 ? 11.572  12.811 6.649   1.00 53.27 ? 248 ALA A O     1 
ATOM   2740 C CB    . ALA B 2 248 ? 11.440  12.688 3.892   1.00 53.54 ? 248 ALA A CB    1 
ATOM   2741 N N     . PRO B 2 249 ? 11.461  10.580 6.963   1.00 53.00 ? 249 PRO A N     1 
ATOM   2742 C CA    . PRO B 2 249 ? 11.812  10.588 8.388   1.00 52.91 ? 249 PRO A CA    1 
ATOM   2743 C C     . PRO B 2 249 ? 13.071  11.405 8.647   1.00 52.61 ? 249 PRO A C     1 
ATOM   2744 O O     . PRO B 2 249 ? 13.992  11.404 7.837   1.00 52.66 ? 249 PRO A O     1 
ATOM   2745 C CB    . PRO B 2 249 ? 12.023  9.111  8.697   1.00 53.47 ? 249 PRO A CB    1 
ATOM   2746 C CG    . PRO B 2 249 ? 11.114  8.431  7.740   1.00 53.21 ? 249 PRO A CG    1 
ATOM   2747 C CD    . PRO B 2 249 ? 11.352  9.200  6.467   1.00 52.69 ? 249 PRO A CD    1 
ATOM   2748 N N     . SER B 2 250 ? 13.114  12.094 9.779   1.00 52.29 ? 250 SER A N     1 
ATOM   2749 C CA    . SER B 2 250 ? 14.268  12.922 10.129  1.00 51.24 ? 250 SER A CA    1 
ATOM   2750 C C     . SER B 2 250 ? 14.330  13.127 11.630  1.00 50.04 ? 250 SER A C     1 
ATOM   2751 O O     . SER B 2 250 ? 13.294  13.191 12.294  1.00 49.75 ? 250 SER A O     1 
ATOM   2752 C CB    . SER B 2 250 ? 14.173  14.292 9.451   1.00 52.09 ? 250 SER A CB    1 
ATOM   2753 O OG    . SER B 2 250 ? 15.037  15.228 10.077  1.00 53.95 ? 250 SER A OG    1 
ATOM   2754 N N     . LEU B 2 251 ? 15.542  13.241 12.164  1.00 48.67 ? 251 LEU A N     1 
ATOM   2755 C CA    . LEU B 2 251 ? 15.691  13.445 13.593  1.00 47.45 ? 251 LEU A CA    1 
ATOM   2756 C C     . LEU B 2 251 ? 15.326  14.885 13.912  1.00 47.08 ? 251 LEU A C     1 
ATOM   2757 O O     . LEU B 2 251 ? 15.266  15.283 15.074  1.00 46.47 ? 251 LEU A O     1 
ATOM   2758 C CB    . LEU B 2 251 ? 17.124  13.144 14.038  1.00 46.23 ? 251 LEU A CB    1 
ATOM   2759 C CG    . LEU B 2 251 ? 17.319  13.014 15.554  1.00 44.85 ? 251 LEU A CG    1 
ATOM   2760 C CD1   . LEU B 2 251 ? 16.377  11.949 16.092  1.00 43.60 ? 251 LEU A CD1   1 
ATOM   2761 C CD2   . LEU B 2 251 ? 18.763  12.656 15.868  1.00 42.35 ? 251 LEU A CD2   1 
ATOM   2762 N N     . GLY B 2 252 ? 15.069  15.659 12.861  1.00 47.12 ? 252 GLY A N     1 
ATOM   2763 C CA    . GLY B 2 252 ? 14.707  17.056 13.034  1.00 46.99 ? 252 GLY A CA    1 
ATOM   2764 C C     . GLY B 2 252 ? 13.309  17.258 13.587  1.00 46.85 ? 252 GLY A C     1 
ATOM   2765 O O     . GLY B 2 252 ? 12.991  18.337 14.096  1.00 48.19 ? 252 GLY A O     1 
ATOM   2766 N N     . PHE B 2 253 ? 12.479  16.219 13.481  1.00 45.09 ? 253 PHE A N     1 
ATOM   2767 C CA    . PHE B 2 253 ? 11.105  16.253 13.970  1.00 43.03 ? 253 PHE A CA    1 
ATOM   2768 C C     . PHE B 2 253 ? 11.015  16.161 15.491  1.00 41.84 ? 253 PHE A C     1 
ATOM   2769 O O     . PHE B 2 253 ? 9.971   16.441 16.066  1.00 41.14 ? 253 PHE A O     1 
ATOM   2770 C CB    . PHE B 2 253 ? 10.298  15.109 13.359  1.00 43.61 ? 253 PHE A CB    1 
ATOM   2771 C CG    . PHE B 2 253 ? 9.977   15.295 11.903  1.00 44.11 ? 253 PHE A CG    1 
ATOM   2772 C CD1   . PHE B 2 253 ? 10.991  15.345 10.950  1.00 43.59 ? 253 PHE A CD1   1 
ATOM   2773 C CD2   . PHE B 2 253 ? 8.652   15.409 11.480  1.00 43.44 ? 253 PHE A CD2   1 
ATOM   2774 C CE1   . PHE B 2 253 ? 10.690  15.503 9.598   1.00 43.22 ? 253 PHE A CE1   1 
ATOM   2775 C CE2   . PHE B 2 253 ? 8.344   15.568 10.134  1.00 42.74 ? 253 PHE A CE2   1 
ATOM   2776 C CZ    . PHE B 2 253 ? 9.362   15.614 9.194   1.00 42.90 ? 253 PHE A CZ    1 
ATOM   2777 N N     . PHE B 2 254 ? 12.102  15.763 16.139  1.00 40.96 ? 254 PHE A N     1 
ATOM   2778 C CA    . PHE B 2 254 ? 12.105  15.650 17.590  1.00 42.46 ? 254 PHE A CA    1 
ATOM   2779 C C     . PHE B 2 254 ? 12.959  16.740 18.235  1.00 45.53 ? 254 PHE A C     1 
ATOM   2780 O O     . PHE B 2 254 ? 13.080  16.802 19.464  1.00 45.49 ? 254 PHE A O     1 
ATOM   2781 C CB    . PHE B 2 254 ? 12.604  14.264 18.030  1.00 38.53 ? 254 PHE A CB    1 
ATOM   2782 C CG    . PHE B 2 254 ? 11.798  13.122 17.474  1.00 35.53 ? 254 PHE A CG    1 
ATOM   2783 C CD1   . PHE B 2 254 ? 12.012  12.666 16.180  1.00 35.24 ? 254 PHE A CD1   1 
ATOM   2784 C CD2   . PHE B 2 254 ? 10.803  12.523 18.233  1.00 34.35 ? 254 PHE A CD2   1 
ATOM   2785 C CE1   . PHE B 2 254 ? 11.250  11.636 15.654  1.00 34.08 ? 254 PHE A CE1   1 
ATOM   2786 C CE2   . PHE B 2 254 ? 10.034  11.491 17.712  1.00 34.74 ? 254 PHE A CE2   1 
ATOM   2787 C CZ    . PHE B 2 254 ? 10.258  11.048 16.421  1.00 34.00 ? 254 PHE A CZ    1 
ATOM   2788 N N     . LYS B 2 255 ? 13.544  17.599 17.398  1.00 49.06 ? 255 LYS A N     1 
ATOM   2789 C CA    . LYS B 2 255 ? 14.378  18.705 17.863  1.00 51.36 ? 255 LYS A CA    1 
ATOM   2790 C C     . LYS B 2 255 ? 13.570  19.973 17.768  1.00 53.24 ? 255 LYS A C     1 
ATOM   2791 O O     . LYS B 2 255 ? 13.019  20.285 16.713  1.00 52.24 ? 255 LYS A O     1 
ATOM   2792 C CB    . LYS B 2 255 ? 15.621  18.860 16.989  1.00 51.69 ? 255 LYS A CB    1 
ATOM   2793 C CG    . LYS B 2 255 ? 16.545  17.664 17.007  1.00 53.15 ? 255 LYS A CG    1 
ATOM   2794 C CD    . LYS B 2 255 ? 17.799  17.914 16.164  1.00 55.01 ? 255 LYS A CD    1 
ATOM   2795 C CE    . LYS B 2 255 ? 18.765  16.727 16.272  1.00 55.61 ? 255 LYS A CE    1 
ATOM   2796 N NZ    . LYS B 2 255 ? 20.089  16.980 15.644  1.00 55.48 ? 255 LYS A NZ    1 
ATOM   2797 N N     . PRO B 2 256 ? 13.492  20.732 18.867  1.00 56.18 ? 256 PRO A N     1 
ATOM   2798 C CA    . PRO B 2 256 ? 12.728  21.982 18.863  1.00 59.15 ? 256 PRO A CA    1 
ATOM   2799 C C     . PRO B 2 256 ? 13.259  22.897 17.773  1.00 61.70 ? 256 PRO A C     1 
ATOM   2800 O O     . PRO B 2 256 ? 14.475  22.963 17.533  1.00 61.77 ? 256 PRO A O     1 
ATOM   2801 C CB    . PRO B 2 256 ? 12.983  22.549 20.252  1.00 57.49 ? 256 PRO A CB    1 
ATOM   2802 C CG    . PRO B 2 256 ? 13.219  21.317 21.081  1.00 58.34 ? 256 PRO A CG    1 
ATOM   2803 C CD    . PRO B 2 256 ? 14.118  20.510 20.178  1.00 57.34 ? 256 PRO A CD    1 
ATOM   2804 N N     . LYS B 2 257 ? 12.345  23.586 17.102  1.00 64.20 ? 257 LYS A N     1 
ATOM   2805 C CA    . LYS B 2 257 ? 12.727  24.509 16.044  1.00 66.84 ? 257 LYS A CA    1 
ATOM   2806 C C     . LYS B 2 257 ? 13.400  25.723 16.698  1.00 68.67 ? 257 LYS A C     1 
ATOM   2807 O O     . LYS B 2 257 ? 12.908  26.247 17.711  1.00 67.51 ? 257 LYS A O     1 
ATOM   2808 C CB    . LYS B 2 257 ? 11.482  24.943 15.258  1.00 67.04 ? 257 LYS A CB    1 
ATOM   2809 C CG    . LYS B 2 257 ? 10.465  23.820 15.022  1.00 67.30 ? 257 LYS A CG    1 
ATOM   2810 C CD    . LYS B 2 257 ? 11.100  22.580 14.390  1.00 67.28 ? 257 LYS A CD    1 
ATOM   2811 C CE    . LYS B 2 257 ? 10.075  21.448 14.253  1.00 67.19 ? 257 LYS A CE    1 
ATOM   2812 N NZ    . LYS B 2 257 ? 10.629  20.181 13.654  1.00 66.22 ? 257 LYS A NZ    1 
ATOM   2813 N N     . HIS B 2 258 ? 14.536  26.140 16.132  1.00 71.80 ? 258 HIS A N     1 
ATOM   2814 C CA    . HIS B 2 258 ? 15.293  27.295 16.639  1.00 75.34 ? 258 HIS A CA    1 
ATOM   2815 C C     . HIS B 2 258 ? 14.484  28.593 16.451  1.00 75.59 ? 258 HIS A C     1 
ATOM   2816 O O     . HIS B 2 258 ? 13.818  28.774 15.426  1.00 75.30 ? 258 HIS A O     1 
ATOM   2817 C CB    . HIS B 2 258 ? 16.648  27.412 15.911  1.00 77.65 ? 258 HIS A CB    1 
ATOM   2818 C CG    . HIS B 2 258 ? 17.784  26.709 16.601  1.00 80.56 ? 258 HIS A CG    1 
ATOM   2819 N ND1   . HIS B 2 258 ? 19.030  26.563 16.020  1.00 81.67 ? 258 HIS A ND1   1 
ATOM   2820 C CD2   . HIS B 2 258 ? 17.876  26.138 17.830  1.00 81.48 ? 258 HIS A CD2   1 
ATOM   2821 C CE1   . HIS B 2 258 ? 19.837  25.933 16.858  1.00 81.55 ? 258 HIS A CE1   1 
ATOM   2822 N NE2   . HIS B 2 258 ? 19.162  25.663 17.963  1.00 81.73 ? 258 HIS A NE2   1 
ATOM   2823 N N     . PRO B 2 259 ? 14.539  29.510 17.440  1.00 76.10 ? 259 PRO A N     1 
ATOM   2824 C CA    . PRO B 2 259 ? 13.799  30.780 17.364  1.00 76.70 ? 259 PRO A CA    1 
ATOM   2825 C C     . PRO B 2 259 ? 13.808  31.470 15.990  1.00 76.90 ? 259 PRO A C     1 
ATOM   2826 O O     . PRO B 2 259 ? 12.788  32.017 15.560  1.00 76.72 ? 259 PRO A O     1 
ATOM   2827 C CB    . PRO B 2 259 ? 14.463  31.627 18.454  1.00 75.48 ? 259 PRO A CB    1 
ATOM   2828 C CG    . PRO B 2 259 ? 14.766  30.605 19.495  1.00 75.03 ? 259 PRO A CG    1 
ATOM   2829 C CD    . PRO B 2 259 ? 15.363  29.468 18.666  1.00 75.73 ? 259 PRO A CD    1 
ATOM   2830 N N     . LEU B 2 260 ? 14.952  31.425 15.310  1.00 77.17 ? 260 LEU A N     1 
ATOM   2831 C CA    . LEU B 2 260 ? 15.116  32.057 13.997  1.00 77.71 ? 260 LEU A CA    1 
ATOM   2832 C C     . LEU B 2 260 ? 14.763  33.542 13.876  1.00 77.00 ? 260 LEU A C     1 
ATOM   2833 O O     . LEU B 2 260 ? 13.894  33.943 13.087  1.00 76.95 ? 260 LEU A O     1 
ATOM   2834 C CB    . LEU B 2 260 ? 14.361  31.284 12.903  1.00 78.18 ? 260 LEU A CB    1 
ATOM   2835 C CG    . LEU B 2 260 ? 14.955  31.519 11.498  1.00 79.62 ? 260 LEU A CG    1 
ATOM   2836 C CD1   . LEU B 2 260 ? 16.445  31.097 11.506  1.00 78.34 ? 260 LEU A CD1   1 
ATOM   2837 C CD2   . LEU B 2 260 ? 14.196  30.708 10.429  1.00 79.57 ? 260 LEU A CD2   1 
ATOM   2838 N N     . GLU B 2 261 ? 15.450  34.348 14.681  1.00 75.89 ? 261 GLU A N     1 
ATOM   2839 C CA    . GLU B 2 261 ? 15.167  35.766 14.817  1.00 74.72 ? 261 GLU A CA    1 
ATOM   2840 C C     . GLU B 2 261 ? 15.583  36.482 13.545  1.00 73.34 ? 261 GLU A C     1 
ATOM   2841 O O     . GLU B 2 261 ? 16.503  36.029 12.840  1.00 72.49 ? 261 GLU A O     1 
ATOM   2842 C CB    . GLU B 2 261 ? 15.908  36.307 16.032  1.00 75.84 ? 261 GLU A CB    1 
ATOM   2843 C CG    . GLU B 2 261 ? 15.367  35.703 17.325  1.00 77.18 ? 261 GLU A CG    1 
ATOM   2844 C CD    . GLU B 2 261 ? 16.304  35.861 18.498  1.00 77.37 ? 261 GLU A CD    1 
ATOM   2845 O OE1   . GLU B 2 261 ? 16.612  37.017 18.861  1.00 77.56 ? 261 GLU A OE1   1 
ATOM   2846 O OE2   . GLU B 2 261 ? 16.726  34.825 19.057  1.00 77.41 ? 261 GLU A OE2   1 
ATOM   2847 N N     . ILE B 2 262 ? 14.896  37.592 13.262  1.00 71.38 ? 262 ILE A N     1 
ATOM   2848 C CA    . ILE B 2 262 ? 15.128  38.384 12.053  1.00 68.79 ? 262 ILE A CA    1 
ATOM   2849 C C     . ILE B 2 262 ? 15.503  39.825 12.427  1.00 67.43 ? 262 ILE A C     1 
ATOM   2850 O O     . ILE B 2 262 ? 14.948  40.378 13.387  1.00 67.99 ? 262 ILE A O     1 
ATOM   2851 C CB    . ILE B 2 262 ? 13.818  38.387 11.189  1.00 68.80 ? 262 ILE A CB    1 
ATOM   2852 C CG1   . ILE B 2 262 ? 14.135  38.549 9.698   1.00 68.92 ? 262 ILE A CG1   1 
ATOM   2853 C CG2   . ILE B 2 262 ? 12.881  39.503 11.659  1.00 67.54 ? 262 ILE A CG2   1 
ATOM   2854 C CD1   . ILE B 2 262 ? 12.918  38.347 8.791   1.00 68.11 ? 262 ILE A CD1   1 
ATOM   2855 N N     . GLU B 2 263 ? 16.442  40.434 11.698  1.00 64.62 ? 263 GLU A N     1 
ATOM   2856 C CA    . GLU B 2 263 ? 16.794  41.827 12.000  1.00 62.81 ? 263 GLU A CA    1 
ATOM   2857 C C     . GLU B 2 263 ? 15.550  42.637 11.629  1.00 60.59 ? 263 GLU A C     1 
ATOM   2858 O O     . GLU B 2 263 ? 14.880  42.341 10.631  1.00 60.17 ? 263 GLU A O     1 
ATOM   2859 C CB    . GLU B 2 263 ? 18.034  42.313 11.201  1.00 63.59 ? 263 GLU A CB    1 
ATOM   2860 C CG    . GLU B 2 263 ? 17.915  42.306 9.669   1.00 64.05 ? 263 GLU A CG    1 
ATOM   2861 C CD    . GLU B 2 263 ? 18.384  40.993 9.027   1.00 64.90 ? 263 GLU A CD    1 
ATOM   2862 O OE1   . GLU B 2 263 ? 18.258  40.845 7.782   1.00 63.91 ? 263 GLU A OE1   1 
ATOM   2863 O OE2   . GLU B 2 263 ? 18.888  40.113 9.762   1.00 65.58 ? 263 GLU A OE2   1 
ATOM   2864 N N     . PRO B 2 264 ? 15.210  43.657 12.426  1.00 59.03 ? 264 PRO A N     1 
ATOM   2865 C CA    . PRO B 2 264 ? 14.015  44.423 12.076  1.00 58.45 ? 264 PRO A CA    1 
ATOM   2866 C C     . PRO B 2 264 ? 14.035  45.055 10.690  1.00 58.14 ? 264 PRO A C     1 
ATOM   2867 O O     . PRO B 2 264 ? 13.004  45.093 10.012  1.00 58.44 ? 264 PRO A O     1 
ATOM   2868 C CB    . PRO B 2 264 ? 13.898  45.436 13.222  1.00 57.39 ? 264 PRO A CB    1 
ATOM   2869 C CG    . PRO B 2 264 ? 15.291  45.601 13.680  1.00 57.33 ? 264 PRO A CG    1 
ATOM   2870 C CD    . PRO B 2 264 ? 15.838  44.191 13.643  1.00 58.22 ? 264 PRO A CD    1 
ATOM   2871 N N     . GLU B 2 265 ? 15.198  45.528 10.254  1.00 58.53 ? 265 GLU A N     1 
ATOM   2872 C CA    . GLU B 2 265 ? 15.294  46.149 8.933   1.00 58.81 ? 265 GLU A CA    1 
ATOM   2873 C C     . GLU B 2 265 ? 14.702  45.231 7.873   1.00 57.81 ? 265 GLU A C     1 
ATOM   2874 O O     . GLU B 2 265 ? 13.903  45.672 7.040   1.00 57.63 ? 265 GLU A O     1 
ATOM   2875 C CB    . GLU B 2 265 ? 16.751  46.474 8.575   1.00 60.27 ? 265 GLU A CB    1 
ATOM   2876 C CG    . GLU B 2 265 ? 16.906  47.311 7.299   1.00 63.23 ? 265 GLU A CG    1 
ATOM   2877 C CD    . GLU B 2 265 ? 16.043  48.579 7.312   1.00 65.08 ? 265 GLU A CD    1 
ATOM   2878 O OE1   . GLU B 2 265 ? 14.810  48.463 7.110   1.00 65.66 ? 265 GLU A OE1   1 
ATOM   2879 O OE2   . GLU B 2 265 ? 16.592  49.689 7.534   1.00 66.80 ? 265 GLU A OE2   1 
ATOM   2880 N N     . ARG B 2 266 ? 15.088  43.956 7.909   1.00 55.90 ? 266 ARG A N     1 
ATOM   2881 C CA    . ARG B 2 266 ? 14.570  42.993 6.944   1.00 55.49 ? 266 ARG A CA    1 
ATOM   2882 C C     . ARG B 2 266 ? 13.048  42.918 7.044   1.00 53.18 ? 266 ARG A C     1 
ATOM   2883 O O     . ARG B 2 266 ? 12.346  43.014 6.036   1.00 51.34 ? 266 ARG A O     1 
ATOM   2884 C CB    . ARG B 2 266 ? 15.177  41.605 7.182   1.00 58.27 ? 266 ARG A CB    1 
ATOM   2885 C CG    . ARG B 2 266 ? 14.668  40.518 6.211   1.00 61.44 ? 266 ARG A CG    1 
ATOM   2886 C CD    . ARG B 2 266 ? 15.315  39.153 6.501   1.00 64.40 ? 266 ARG A CD    1 
ATOM   2887 N NE    . ARG B 2 266 ? 14.616  38.047 5.840   1.00 65.81 ? 266 ARG A NE    1 
ATOM   2888 C CZ    . ARG B 2 266 ? 14.915  36.757 6.001   1.00 65.56 ? 266 ARG A CZ    1 
ATOM   2889 N NH1   . ARG B 2 266 ? 15.914  36.392 6.803   1.00 66.42 ? 266 ARG A NH1   1 
ATOM   2890 N NH2   . ARG B 2 266 ? 14.199  35.827 5.376   1.00 64.57 ? 266 ARG A NH2   1 
ATOM   2891 N N     . LEU B 2 267 ? 12.544  42.757 8.264   1.00 51.20 ? 267 LEU A N     1 
ATOM   2892 C CA    . LEU B 2 267 ? 11.108  42.680 8.487   1.00 49.72 ? 267 LEU A CA    1 
ATOM   2893 C C     . LEU B 2 267 ? 10.377  43.846 7.832   1.00 48.08 ? 267 LEU A C     1 
ATOM   2894 O O     . LEU B 2 267 ? 9.384   43.651 7.137   1.00 45.27 ? 267 LEU A O     1 
ATOM   2895 C CB    . LEU B 2 267 ? 10.808  42.674 9.978   1.00 50.84 ? 267 LEU A CB    1 
ATOM   2896 C CG    . LEU B 2 267 ? 9.317   42.657 10.329  1.00 51.65 ? 267 LEU A CG    1 
ATOM   2897 C CD1   . LEU B 2 267 ? 8.661   41.384 9.780   1.00 51.53 ? 267 LEU A CD1   1 
ATOM   2898 C CD2   . LEU B 2 267 ? 9.162   42.743 11.841  1.00 52.69 ? 267 LEU A CD2   1 
ATOM   2899 N N     . ARG B 2 268 ? 10.870  45.057 8.061   1.00 47.99 ? 268 ARG A N     1 
ATOM   2900 C CA    . ARG B 2 268 ? 10.262  46.249 7.474   1.00 48.72 ? 268 ARG A CA    1 
ATOM   2901 C C     . ARG B 2 268 ? 10.076  46.070 5.973   1.00 47.13 ? 268 ARG A C     1 
ATOM   2902 O O     . ARG B 2 268 ? 8.968   46.202 5.458   1.00 46.70 ? 268 ARG A O     1 
ATOM   2903 C CB    . ARG B 2 268 ? 11.136  47.479 7.727   1.00 50.44 ? 268 ARG A CB    1 
ATOM   2904 C CG    . ARG B 2 268 ? 10.539  48.775 7.206   1.00 54.96 ? 268 ARG A CG    1 
ATOM   2905 C CD    . ARG B 2 268 ? 11.453  49.972 7.471   1.00 58.94 ? 268 ARG A CD    1 
ATOM   2906 N NE    . ARG B 2 268 ? 12.679  49.988 6.663   1.00 62.78 ? 268 ARG A NE    1 
ATOM   2907 C CZ    . ARG B 2 268 ? 12.725  50.221 5.350   1.00 64.57 ? 268 ARG A CZ    1 
ATOM   2908 N NH1   . ARG B 2 268 ? 11.607  50.462 4.673   1.00 65.73 ? 268 ARG A NH1   1 
ATOM   2909 N NH2   . ARG B 2 268 ? 13.894  50.229 4.712   1.00 64.12 ? 268 ARG A NH2   1 
ATOM   2910 N N     . LYS B 2 269 ? 11.172  45.772 5.280   1.00 45.77 ? 269 LYS A N     1 
ATOM   2911 C CA    . LYS B 2 269 ? 11.148  45.570 3.836   1.00 45.67 ? 269 LYS A CA    1 
ATOM   2912 C C     . LYS B 2 269 ? 10.019  44.656 3.388   1.00 44.76 ? 269 LYS A C     1 
ATOM   2913 O O     . LYS B 2 269 ? 9.231   45.013 2.507   1.00 46.07 ? 269 LYS A O     1 
ATOM   2914 C CB    . LYS B 2 269 ? 12.472  44.979 3.344   1.00 46.78 ? 269 LYS A CB    1 
ATOM   2915 C CG    . LYS B 2 269 ? 13.555  45.997 3.081   1.00 48.61 ? 269 LYS A CG    1 
ATOM   2916 C CD    . LYS B 2 269 ? 14.463  45.496 1.975   1.00 49.54 ? 269 LYS A CD    1 
ATOM   2917 C CE    . LYS B 2 269 ? 15.637  46.435 1.728   1.00 50.29 ? 269 LYS A CE    1 
ATOM   2918 N NZ    . LYS B 2 269 ? 16.655  46.360 2.809   1.00 48.30 ? 269 LYS A NZ    1 
ATOM   2919 N N     . ILE B 2 270 ? 9.951   43.468 3.978   1.00 42.89 ? 270 ILE A N     1 
ATOM   2920 C CA    . ILE B 2 270 ? 8.912   42.520 3.620   1.00 40.91 ? 270 ILE A CA    1 
ATOM   2921 C C     . ILE B 2 270 ? 7.540   43.176 3.720   1.00 40.38 ? 270 ILE A C     1 
ATOM   2922 O O     . ILE B 2 270 ? 6.705   43.010 2.840   1.00 40.45 ? 270 ILE A O     1 
ATOM   2923 C CB    . ILE B 2 270 ? 8.981   41.282 4.516   1.00 40.92 ? 270 ILE A CB    1 
ATOM   2924 C CG1   . ILE B 2 270 ? 10.299  40.557 4.255   1.00 41.77 ? 270 ILE A CG1   1 
ATOM   2925 C CG2   . ILE B 2 270 ? 7.798   40.377 4.248   1.00 41.13 ? 270 ILE A CG2   1 
ATOM   2926 C CD1   . ILE B 2 270 ? 10.530  39.346 5.114   1.00 42.95 ? 270 ILE A CD1   1 
ATOM   2927 N N     . VAL B 2 271 ? 7.319   43.940 4.781   1.00 40.43 ? 271 VAL A N     1 
ATOM   2928 C CA    . VAL B 2 271 ? 6.049   44.625 4.967   1.00 40.30 ? 271 VAL A CA    1 
ATOM   2929 C C     . VAL B 2 271 ? 5.836   45.677 3.876   1.00 41.74 ? 271 VAL A C     1 
ATOM   2930 O O     . VAL B 2 271 ? 4.712   45.907 3.419   1.00 41.22 ? 271 VAL A O     1 
ATOM   2931 C CB    . VAL B 2 271 ? 5.991   45.284 6.360   1.00 38.09 ? 271 VAL A CB    1 
ATOM   2932 C CG1   . VAL B 2 271 ? 4.778   46.177 6.474   1.00 34.98 ? 271 VAL A CG1   1 
ATOM   2933 C CG2   . VAL B 2 271 ? 5.946   44.203 7.418   1.00 36.92 ? 271 VAL A CG2   1 
ATOM   2934 N N     . GLU B 2 272 ? 6.924   46.313 3.464   1.00 42.94 ? 272 GLU A N     1 
ATOM   2935 C CA    . GLU B 2 272 ? 6.880   47.327 2.416   1.00 44.29 ? 272 GLU A CA    1 
ATOM   2936 C C     . GLU B 2 272 ? 6.531   46.575 1.147   1.00 43.29 ? 272 GLU A C     1 
ATOM   2937 O O     . GLU B 2 272 ? 5.700   47.014 0.361   1.00 42.41 ? 272 GLU A O     1 
ATOM   2938 C CB    . GLU B 2 272 ? 8.256   47.973 2.285   1.00 47.75 ? 272 GLU A CB    1 
ATOM   2939 C CG    . GLU B 2 272 ? 8.305   49.339 1.632   1.00 53.42 ? 272 GLU A CG    1 
ATOM   2940 C CD    . GLU B 2 272 ? 9.481   50.167 2.158   1.00 57.70 ? 272 GLU A CD    1 
ATOM   2941 O OE1   . GLU B 2 272 ? 9.342   50.729 3.273   1.00 58.17 ? 272 GLU A OE1   1 
ATOM   2942 O OE2   . GLU B 2 272 ? 10.543  50.241 1.475   1.00 60.21 ? 272 GLU A OE2   1 
ATOM   2943 N N     . GLU B 2 273 ? 7.168   45.419 0.990   1.00 42.53 ? 273 GLU A N     1 
ATOM   2944 C CA    . GLU B 2 273 ? 6.978   44.520 -0.148  1.00 43.74 ? 273 GLU A CA    1 
ATOM   2945 C C     . GLU B 2 273 ? 5.544   43.967 -0.228  1.00 42.08 ? 273 GLU A C     1 
ATOM   2946 O O     . GLU B 2 273 ? 4.986   43.796 -1.320  1.00 41.50 ? 273 GLU A O     1 
ATOM   2947 C CB    . GLU B 2 273 ? 7.966   43.352 -0.042  1.00 46.98 ? 273 GLU A CB    1 
ATOM   2948 C CG    . GLU B 2 273 ? 9.443   43.753 -0.064  1.00 52.56 ? 273 GLU A CG    1 
ATOM   2949 C CD    . GLU B 2 273 ? 10.368  42.589 0.278   1.00 56.34 ? 273 GLU A CD    1 
ATOM   2950 O OE1   . GLU B 2 273 ? 10.175  41.492 -0.298  1.00 59.49 ? 273 GLU A OE1   1 
ATOM   2951 O OE2   . GLU B 2 273 ? 11.287  42.762 1.114   1.00 56.45 ? 273 GLU A OE2   1 
ATOM   2952 N N     . ARG B 2 274 ? 4.965   43.677 0.936   1.00 40.00 ? 274 ARG A N     1 
ATOM   2953 C CA    . ARG B 2 274 ? 3.602   43.163 1.034   1.00 37.16 ? 274 ARG A CA    1 
ATOM   2954 C C     . ARG B 2 274 ? 2.559   44.257 0.808   1.00 36.01 ? 274 ARG A C     1 
ATOM   2955 O O     . ARG B 2 274 ? 1.420   43.969 0.430   1.00 36.22 ? 274 ARG A O     1 
ATOM   2956 C CB    . ARG B 2 274 ? 3.386   42.535 2.404   1.00 37.01 ? 274 ARG A CB    1 
ATOM   2957 C CG    . ARG B 2 274 ? 4.110   41.220 2.583   1.00 36.99 ? 274 ARG A CG    1 
ATOM   2958 C CD    . ARG B 2 274 ? 3.764   40.598 3.915   1.00 35.98 ? 274 ARG A CD    1 
ATOM   2959 N NE    . ARG B 2 274 ? 3.802   39.151 3.799   1.00 35.23 ? 274 ARG A NE    1 
ATOM   2960 C CZ    . ARG B 2 274 ? 2.780   38.353 4.068   1.00 35.28 ? 274 ARG A CZ    1 
ATOM   2961 N NH1   . ARG B 2 274 ? 1.618   38.844 4.483   1.00 32.32 ? 274 ARG A NH1   1 
ATOM   2962 N NH2   . ARG B 2 274 ? 2.920   37.055 3.902   1.00 36.11 ? 274 ARG A NH2   1 
ATOM   2963 N N     . GLY B 2 275 ? 2.967   45.504 1.052   1.00 33.50 ? 275 GLY A N     1 
ATOM   2964 C CA    . GLY B 2 275 ? 2.106   46.653 0.862   1.00 31.18 ? 275 GLY A CA    1 
ATOM   2965 C C     . GLY B 2 275 ? 0.904   46.678 1.767   1.00 31.32 ? 275 GLY A C     1 
ATOM   2966 O O     . GLY B 2 275 ? -0.027  47.443 1.565   1.00 30.20 ? 275 GLY A O     1 
ATOM   2967 N N     . THR B 2 276 ? 0.926   45.839 2.786   1.00 32.65 ? 276 THR A N     1 
ATOM   2968 C CA    . THR B 2 276 ? -0.195  45.772 3.707   1.00 34.53 ? 276 THR A CA    1 
ATOM   2969 C C     . THR B 2 276 ? 0.010   46.679 4.904   1.00 33.22 ? 276 THR A C     1 
ATOM   2970 O O     . THR B 2 276 ? 1.093   47.214 5.116   1.00 33.87 ? 276 THR A O     1 
ATOM   2971 C CB    . THR B 2 276 ? -0.402  44.350 4.236   1.00 35.67 ? 276 THR A CB    1 
ATOM   2972 O OG1   . THR B 2 276 ? 0.665   44.022 5.130   1.00 36.74 ? 276 THR A OG1   1 
ATOM   2973 C CG2   . THR B 2 276 ? -0.421  43.357 3.096   1.00 36.15 ? 276 THR A CG2   1 
ATOM   2974 N N     . ALA B 2 277 ? -1.060  46.858 5.667   1.00 31.59 ? 277 ALA A N     1 
ATOM   2975 C CA    . ALA B 2 277 ? -1.019  47.670 6.864   1.00 30.88 ? 277 ALA A CA    1 
ATOM   2976 C C     . ALA B 2 277 ? -0.725  46.673 7.971   1.00 31.94 ? 277 ALA A C     1 
ATOM   2977 O O     . ALA B 2 277 ? -1.389  45.639 8.077   1.00 31.08 ? 277 ALA A O     1 
ATOM   2978 C CB    . ALA B 2 277 ? -2.366  48.348 7.094   1.00 26.45 ? 277 ALA A CB    1 
ATOM   2979 N N     . VAL B 2 278 ? 0.299   46.951 8.766   1.00 31.68 ? 278 VAL A N     1 
ATOM   2980 C CA    . VAL B 2 278 ? 0.638   46.067 9.864   1.00 28.75 ? 278 VAL A CA    1 
ATOM   2981 C C     . VAL B 2 278 ? 0.733   46.909 11.112  1.00 28.60 ? 278 VAL A C     1 
ATOM   2982 O O     . VAL B 2 278 ? 1.516   47.850 11.176  1.00 28.89 ? 278 VAL A O     1 
ATOM   2983 C CB    . VAL B 2 278 ? 1.967   45.355 9.630   1.00 27.10 ? 278 VAL A CB    1 
ATOM   2984 C CG1   . VAL B 2 278 ? 2.388   44.637 10.891  1.00 28.66 ? 278 VAL A CG1   1 
ATOM   2985 C CG2   . VAL B 2 278 ? 1.831   44.375 8.482   1.00 25.22 ? 278 VAL A CG2   1 
ATOM   2986 N N     . PHE B 2 279 ? -0.088  46.571 12.094  1.00 28.43 ? 279 PHE A N     1 
ATOM   2987 C CA    . PHE B 2 279 ? -0.113  47.292 13.350  1.00 28.85 ? 279 PHE A CA    1 
ATOM   2988 C C     . PHE B 2 279 ? -0.447  46.364 14.516  1.00 30.01 ? 279 PHE A C     1 
ATOM   2989 O O     . PHE B 2 279 ? -0.962  45.264 14.339  1.00 30.58 ? 279 PHE A O     1 
ATOM   2990 C CB    . PHE B 2 279 ? -1.130  48.426 13.269  1.00 28.06 ? 279 PHE A CB    1 
ATOM   2991 C CG    . PHE B 2 279 ? -2.527  47.963 13.023  1.00 29.86 ? 279 PHE A CG    1 
ATOM   2992 C CD1   . PHE B 2 279 ? -3.408  47.780 14.076  1.00 31.87 ? 279 PHE A CD1   1 
ATOM   2993 C CD2   . PHE B 2 279 ? -2.963  47.696 11.737  1.00 30.29 ? 279 PHE A CD2   1 
ATOM   2994 C CE1   . PHE B 2 279 ? -4.707  47.337 13.848  1.00 32.78 ? 279 PHE A CE1   1 
ATOM   2995 C CE2   . PHE B 2 279 ? -4.253  47.253 11.499  1.00 29.81 ? 279 PHE A CE2   1 
ATOM   2996 C CZ    . PHE B 2 279 ? -5.125  47.074 12.552  1.00 32.49 ? 279 PHE A CZ    1 
ATOM   2997 N N     . ALA B 2 280 ? -0.141  46.814 15.720  1.00 31.44 ? 280 ALA A N     1 
ATOM   2998 C CA    . ALA B 2 280 ? -0.412  46.016 16.897  1.00 33.30 ? 280 ALA A CA    1 
ATOM   2999 C C     . ALA B 2 280 ? -1.094  46.850 17.956  1.00 33.87 ? 280 ALA A C     1 
ATOM   3000 O O     . ALA B 2 280 ? -0.935  48.065 17.995  1.00 34.44 ? 280 ALA A O     1 
ATOM   3001 C CB    . ALA B 2 280 ? 0.884   45.439 17.448  1.00 35.07 ? 280 ALA A CB    1 
ATOM   3002 N N     . VAL B 2 281 ? -1.870  46.169 18.793  1.00 34.01 ? 281 VAL A N     1 
ATOM   3003 C CA    . VAL B 2 281 ? -2.592  46.767 19.907  1.00 33.94 ? 281 VAL A CA    1 
ATOM   3004 C C     . VAL B 2 281 ? -1.768  46.427 21.141  1.00 33.91 ? 281 VAL A C     1 
ATOM   3005 O O     . VAL B 2 281 ? -1.506  45.255 21.394  1.00 33.84 ? 281 VAL A O     1 
ATOM   3006 C CB    . VAL B 2 281 ? -3.992  46.135 20.059  1.00 34.49 ? 281 VAL A CB    1 
ATOM   3007 C CG1   . VAL B 2 281 ? -4.699  46.696 21.286  1.00 33.47 ? 281 VAL A CG1   1 
ATOM   3008 C CG2   . VAL B 2 281 ? -4.810  46.388 18.802  1.00 34.65 ? 281 VAL A CG2   1 
ATOM   3009 N N     . LYS B 2 282 ? -1.340  47.439 21.891  1.00 35.13 ? 282 LYS A N     1 
ATOM   3010 C CA    . LYS B 2 282 ? -0.545  47.203 23.090  1.00 36.74 ? 282 LYS A CA    1 
ATOM   3011 C C     . LYS B 2 282 ? -1.236  47.684 24.351  1.00 37.72 ? 282 LYS A C     1 
ATOM   3012 O O     . LYS B 2 282 ? -1.628  48.838 24.461  1.00 38.85 ? 282 LYS A O     1 
ATOM   3013 C CB    . LYS B 2 282 ? 0.816   47.880 22.974  1.00 37.46 ? 282 LYS A CB    1 
ATOM   3014 C CG    . LYS B 2 282 ? 1.692   47.707 24.210  1.00 37.33 ? 282 LYS A CG    1 
ATOM   3015 C CD    . LYS B 2 282 ? 3.088   48.264 23.981  1.00 36.97 ? 282 LYS A CD    1 
ATOM   3016 C CE    . LYS B 2 282 ? 3.933   48.158 25.234  1.00 39.17 ? 282 LYS A CE    1 
ATOM   3017 N NZ    . LYS B 2 282 ? 5.336   48.581 24.986  1.00 38.83 ? 282 LYS A NZ    1 
ATOM   3018 N N     . PHE B 2 283 ? -1.381  46.781 25.306  1.00 39.38 ? 283 PHE A N     1 
ATOM   3019 C CA    . PHE B 2 283 ? -2.016  47.090 26.576  1.00 41.12 ? 283 PHE A CA    1 
ATOM   3020 C C     . PHE B 2 283 ? -1.314  46.254 27.644  1.00 42.41 ? 283 PHE A C     1 
ATOM   3021 O O     . PHE B 2 283 ? -0.656  45.266 27.324  1.00 42.53 ? 283 PHE A O     1 
ATOM   3022 C CB    . PHE B 2 283 ? -3.505  46.748 26.506  1.00 40.59 ? 283 PHE A CB    1 
ATOM   3023 C CG    . PHE B 2 283 ? -3.779  45.315 26.180  1.00 41.37 ? 283 PHE A CG    1 
ATOM   3024 C CD1   . PHE B 2 283 ? -3.907  44.367 27.192  1.00 41.93 ? 283 PHE A CD1   1 
ATOM   3025 C CD2   . PHE B 2 283 ? -3.877  44.902 24.856  1.00 41.24 ? 283 PHE A CD2   1 
ATOM   3026 C CE1   . PHE B 2 283 ? -4.129  43.023 26.884  1.00 41.94 ? 283 PHE A CE1   1 
ATOM   3027 C CE2   . PHE B 2 283 ? -4.096  43.568 24.538  1.00 39.96 ? 283 PHE A CE2   1 
ATOM   3028 C CZ    . PHE B 2 283 ? -4.222  42.626 25.550  1.00 40.96 ? 283 PHE A CZ    1 
ATOM   3029 N N     . ARG B 2 284 ? -1.445  46.644 28.908  1.00 43.73 ? 284 ARG A N     1 
ATOM   3030 C CA    . ARG B 2 284 ? -0.793  45.907 29.986  1.00 44.43 ? 284 ARG A CA    1 
ATOM   3031 C C     . ARG B 2 284 ? -1.377  44.533 30.214  1.00 43.27 ? 284 ARG A C     1 
ATOM   3032 O O     . ARG B 2 284 ? -2.589  44.340 30.119  1.00 42.37 ? 284 ARG A O     1 
ATOM   3033 C CB    . ARG B 2 284 ? -0.843  46.707 31.288  1.00 47.28 ? 284 ARG A CB    1 
ATOM   3034 C CG    . ARG B 2 284 ? 0.152   47.848 31.289  1.00 51.32 ? 284 ARG A CG    1 
ATOM   3035 C CD    . ARG B 2 284 ? 0.076   48.720 32.531  1.00 55.42 ? 284 ARG A CD    1 
ATOM   3036 N NE    . ARG B 2 284 ? 0.912   49.904 32.342  1.00 59.57 ? 284 ARG A NE    1 
ATOM   3037 C CZ    . ARG B 2 284 ? 2.237   49.864 32.208  1.00 61.99 ? 284 ARG A CZ    1 
ATOM   3038 N NH1   . ARG B 2 284 ? 2.875   48.697 32.259  1.00 61.92 ? 284 ARG A NH1   1 
ATOM   3039 N NH2   . ARG B 2 284 ? 2.923   50.985 31.987  1.00 63.07 ? 284 ARG A NH2   1 
ATOM   3040 N N     . LYS B 2 285 ? -0.493  43.583 30.512  1.00 41.95 ? 285 LYS A N     1 
ATOM   3041 C CA    . LYS B 2 285 ? -0.887  42.205 30.769  1.00 41.06 ? 285 LYS A CA    1 
ATOM   3042 C C     . LYS B 2 285 ? -1.571  42.070 32.120  1.00 40.65 ? 285 LYS A C     1 
ATOM   3043 O O     . LYS B 2 285 ? -1.006  42.432 33.146  1.00 39.88 ? 285 LYS A O     1 
ATOM   3044 C CB    . LYS B 2 285 ? 0.334   41.282 30.750  1.00 40.78 ? 285 LYS A CB    1 
ATOM   3045 C CG    . LYS B 2 285 ? -0.001  39.875 31.155  1.00 41.76 ? 285 LYS A CG    1 
ATOM   3046 C CD    . LYS B 2 285 ? 1.207   39.121 31.645  1.00 45.31 ? 285 LYS A CD    1 
ATOM   3047 C CE    . LYS B 2 285 ? 0.782   37.813 32.310  1.00 46.53 ? 285 LYS A CE    1 
ATOM   3048 N NZ    . LYS B 2 285 ? 1.941   37.013 32.799  1.00 49.08 ? 285 LYS A NZ    1 
ATOM   3049 N N     . PRO B 2 286 ? -2.803  41.549 32.136  1.00 40.92 ? 286 PRO A N     1 
ATOM   3050 C CA    . PRO B 2 286 ? -3.523  41.380 33.398  1.00 41.55 ? 286 PRO A CA    1 
ATOM   3051 C C     . PRO B 2 286 ? -2.770  40.346 34.226  1.00 42.60 ? 286 PRO A C     1 
ATOM   3052 O O     . PRO B 2 286 ? -2.303  39.338 33.695  1.00 42.11 ? 286 PRO A O     1 
ATOM   3053 C CB    . PRO B 2 286 ? -4.893  40.862 32.952  1.00 41.02 ? 286 PRO A CB    1 
ATOM   3054 C CG    . PRO B 2 286 ? -5.045  41.401 31.577  1.00 39.66 ? 286 PRO A CG    1 
ATOM   3055 C CD    . PRO B 2 286 ? -3.665  41.198 30.998  1.00 41.00 ? 286 PRO A CD    1 
ATOM   3056 N N     . ASP B 2 287 ? -2.653  40.591 35.523  1.00 44.19 ? 287 ASP A N     1 
ATOM   3057 C CA    . ASP B 2 287 ? -1.940  39.660 36.394  1.00 45.65 ? 287 ASP A CA    1 
ATOM   3058 C C     . ASP B 2 287 ? -2.778  38.410 36.675  1.00 45.53 ? 287 ASP A C     1 
ATOM   3059 O O     . ASP B 2 287 ? -3.241  38.202 37.792  1.00 46.10 ? 287 ASP A O     1 
ATOM   3060 C CB    . ASP B 2 287 ? -1.550  40.362 37.703  1.00 46.06 ? 287 ASP A CB    1 
ATOM   3061 C CG    . ASP B 2 287 ? -0.792  39.451 38.654  1.00 47.87 ? 287 ASP A CG    1 
ATOM   3062 O OD1   . ASP B 2 287 ? 0.142   38.744 38.200  1.00 45.69 ? 287 ASP A OD1   1 
ATOM   3063 O OD2   . ASP B 2 287 ? -1.128  39.453 39.861  1.00 48.32 ? 287 ASP A OD2   1 
ATOM   3064 N N     . ILE B 2 288 ? -2.970  37.588 35.644  1.00 44.29 ? 288 ILE A N     1 
ATOM   3065 C CA    . ILE B 2 288 ? -3.751  36.359 35.758  1.00 42.25 ? 288 ILE A CA    1 
ATOM   3066 C C     . ILE B 2 288 ? -2.998  35.222 35.108  1.00 40.77 ? 288 ILE A C     1 
ATOM   3067 O O     . ILE B 2 288 ? -2.043  35.455 34.371  1.00 39.47 ? 288 ILE A O     1 
ATOM   3068 C CB    . ILE B 2 288 ? -5.124  36.476 35.062  1.00 42.74 ? 288 ILE A CB    1 
ATOM   3069 C CG1   . ILE B 2 288 ? -4.933  36.741 33.565  1.00 43.21 ? 288 ILE A CG1   1 
ATOM   3070 C CG2   . ILE B 2 288 ? -5.954  37.575 35.727  1.00 41.79 ? 288 ILE A CG2   1 
ATOM   3071 C CD1   . ILE B 2 288 ? -6.233  36.721 32.774  1.00 42.57 ? 288 ILE A CD1   1 
ATOM   3072 N N     . VAL B 2 289 ? -3.435  33.993 35.373  1.00 40.61 ? 289 VAL A N     1 
ATOM   3073 C CA    . VAL B 2 289 ? -2.775  32.817 34.809  1.00 39.82 ? 289 VAL A CA    1 
ATOM   3074 C C     . VAL B 2 289 ? -3.089  32.594 33.340  1.00 38.94 ? 289 VAL A C     1 
ATOM   3075 O O     . VAL B 2 289 ? -4.156  32.944 32.850  1.00 37.38 ? 289 VAL A O     1 
ATOM   3076 C CB    . VAL B 2 289 ? -3.129  31.521 35.586  1.00 38.89 ? 289 VAL A CB    1 
ATOM   3077 C CG1   . VAL B 2 289 ? -2.708  31.652 37.021  1.00 40.36 ? 289 VAL A CG1   1 
ATOM   3078 C CG2   . VAL B 2 289 ? -4.607  31.232 35.493  1.00 37.21 ? 289 VAL A CG2   1 
ATOM   3079 N N     . ASP B 2 290 ? -2.134  31.985 32.656  1.00 39.89 ? 290 ASP A N     1 
ATOM   3080 C CA    . ASP B 2 290 ? -2.234  31.686 31.241  1.00 40.03 ? 290 ASP A CA    1 
ATOM   3081 C C     . ASP B 2 290 ? -3.538  31.034 30.800  1.00 39.63 ? 290 ASP A C     1 
ATOM   3082 O O     . ASP B 2 290 ? -3.960  31.222 29.660  1.00 39.92 ? 290 ASP A O     1 
ATOM   3083 C CB    . ASP B 2 290 ? -1.065  30.795 30.835  1.00 39.81 ? 290 ASP A CB    1 
ATOM   3084 C CG    . ASP B 2 290 ? 0.272   31.470 31.020  1.00 39.81 ? 290 ASP A CG    1 
ATOM   3085 O OD1   . ASP B 2 290 ? 0.359   32.384 31.868  1.00 42.27 ? 290 ASP A OD1   1 
ATOM   3086 O OD2   . ASP B 2 290 ? 1.237   31.079 30.326  1.00 39.92 ? 290 ASP A OD2   1 
ATOM   3087 N N     . ASP B 2 291 ? -4.172  30.267 31.682  1.00 39.50 ? 291 ASP A N     1 
ATOM   3088 C CA    . ASP B 2 291 ? -5.420  29.591 31.330  1.00 39.46 ? 291 ASP A CA    1 
ATOM   3089 C C     . ASP B 2 291 ? -6.606  30.533 31.222  1.00 37.77 ? 291 ASP A C     1 
ATOM   3090 O O     . ASP B 2 291 ? -7.631  30.197 30.637  1.00 35.98 ? 291 ASP A O     1 
ATOM   3091 C CB    . ASP B 2 291 ? -5.732  28.486 32.332  1.00 41.95 ? 291 ASP A CB    1 
ATOM   3092 C CG    . ASP B 2 291 ? -5.079  27.175 31.967  1.00 44.73 ? 291 ASP A CG    1 
ATOM   3093 O OD1   . ASP B 2 291 ? -5.343  26.172 32.669  1.00 47.01 ? 291 ASP A OD1   1 
ATOM   3094 O OD2   . ASP B 2 291 ? -4.306  27.151 30.976  1.00 45.64 ? 291 ASP A OD2   1 
ATOM   3095 N N     . ASN B 2 292 ? -6.476  31.710 31.811  1.00 37.45 ? 292 ASN A N     1 
ATOM   3096 C CA    . ASN B 2 292 ? -7.546  32.683 31.720  1.00 38.74 ? 292 ASN A CA    1 
ATOM   3097 C C     . ASN B 2 292 ? -7.116  33.714 30.693  1.00 37.93 ? 292 ASN A C     1 
ATOM   3098 O O     . ASN B 2 292 ? -7.917  34.155 29.877  1.00 37.12 ? 292 ASN A O     1 
ATOM   3099 C CB    . ASN B 2 292 ? -7.810  33.341 33.075  1.00 38.70 ? 292 ASN A CB    1 
ATOM   3100 C CG    . ASN B 2 292 ? -8.394  32.368 34.092  1.00 39.62 ? 292 ASN A CG    1 
ATOM   3101 O OD1   . ASN B 2 292 ? -9.412  31.732 33.843  1.00 40.44 ? 292 ASN A OD1   1 
ATOM   3102 N ND2   . ASN B 2 292 ? -7.748  32.252 35.241  1.00 40.09 ? 292 ASN A ND2   1 
ATOM   3103 N N     . LEU B 2 293 ? -5.830  34.052 30.712  1.00 37.29 ? 293 LEU A N     1 
ATOM   3104 C CA    . LEU B 2 293 ? -5.271  35.045 29.805  1.00 36.06 ? 293 LEU A CA    1 
ATOM   3105 C C     . LEU B 2 293 ? -5.367  34.728 28.311  1.00 36.35 ? 293 LEU A C     1 
ATOM   3106 O O     . LEU B 2 293 ? -5.913  35.513 27.528  1.00 37.07 ? 293 LEU A O     1 
ATOM   3107 C CB    . LEU B 2 293 ? -3.809  35.301 30.151  1.00 34.02 ? 293 LEU A CB    1 
ATOM   3108 C CG    . LEU B 2 293 ? -3.159  36.282 29.172  1.00 33.72 ? 293 LEU A CG    1 
ATOM   3109 C CD1   . LEU B 2 293 ? -3.751  37.677 29.384  1.00 33.01 ? 293 LEU A CD1   1 
ATOM   3110 C CD2   . LEU B 2 293 ? -1.649  36.284 29.356  1.00 33.49 ? 293 LEU A CD2   1 
ATOM   3111 N N     . TYR B 2 294 ? -4.822  33.589 27.910  1.00 35.85 ? 294 TYR A N     1 
ATOM   3112 C CA    . TYR B 2 294 ? -4.840  33.232 26.509  1.00 36.01 ? 294 TYR A CA    1 
ATOM   3113 C C     . TYR B 2 294 ? -6.218  33.092 25.885  1.00 36.84 ? 294 TYR A C     1 
ATOM   3114 O O     . TYR B 2 294 ? -6.431  33.503 24.744  1.00 39.05 ? 294 TYR A O     1 
ATOM   3115 C CB    . TYR B 2 294 ? -4.013  31.978 26.287  1.00 33.91 ? 294 TYR A CB    1 
ATOM   3116 C CG    . TYR B 2 294 ? -2.540  32.276 26.349  1.00 33.11 ? 294 TYR A CG    1 
ATOM   3117 C CD1   . TYR B 2 294 ? -1.867  32.325 27.567  1.00 32.31 ? 294 TYR A CD1   1 
ATOM   3118 C CD2   . TYR B 2 294 ? -1.827  32.575 25.190  1.00 32.38 ? 294 TYR A CD2   1 
ATOM   3119 C CE1   . TYR B 2 294 ? -0.523  32.666 27.626  1.00 33.34 ? 294 TYR A CE1   1 
ATOM   3120 C CE2   . TYR B 2 294 ? -0.488  32.916 25.239  1.00 33.92 ? 294 TYR A CE2   1 
ATOM   3121 C CZ    . TYR B 2 294 ? 0.155   32.958 26.458  1.00 34.87 ? 294 TYR A CZ    1 
ATOM   3122 O OH    . TYR B 2 294 ? 1.483   33.285 26.504  1.00 36.93 ? 294 TYR A OH    1 
ATOM   3123 N N     . PRO B 2 295 ? -7.175  32.499 26.604  1.00 36.60 ? 295 PRO A N     1 
ATOM   3124 C CA    . PRO B 2 295 ? -8.470  32.412 25.932  1.00 36.69 ? 295 PRO A CA    1 
ATOM   3125 C C     . PRO B 2 295 ? -9.050  33.797 25.684  1.00 36.99 ? 295 PRO A C     1 
ATOM   3126 O O     . PRO B 2 295 ? -9.857  33.986 24.767  1.00 36.85 ? 295 PRO A O     1 
ATOM   3127 C CB    . PRO B 2 295 ? -9.295  31.582 26.900  1.00 36.94 ? 295 PRO A CB    1 
ATOM   3128 C CG    . PRO B 2 295 ? -8.269  30.632 27.431  1.00 35.81 ? 295 PRO A CG    1 
ATOM   3129 C CD    . PRO B 2 295 ? -7.110  31.550 27.727  1.00 36.89 ? 295 PRO A CD    1 
ATOM   3130 N N     . GLN B 2 296 ? -8.612  34.761 26.498  1.00 35.99 ? 296 GLN A N     1 
ATOM   3131 C CA    . GLN B 2 296 ? -9.065  36.147 26.388  1.00 35.65 ? 296 GLN A CA    1 
ATOM   3132 C C     . GLN B 2 296 ? -8.386  36.849 25.232  1.00 34.90 ? 296 GLN A C     1 
ATOM   3133 O O     . GLN B 2 296 ? -9.017  37.622 24.518  1.00 34.70 ? 296 GLN A O     1 
ATOM   3134 C CB    . GLN B 2 296 ? -8.792  36.908 27.681  1.00 35.03 ? 296 GLN A CB    1 
ATOM   3135 C CG    . GLN B 2 296 ? -9.713  36.508 28.817  1.00 37.46 ? 296 GLN A CG    1 
ATOM   3136 C CD    . GLN B 2 296 ? -9.556  37.382 30.037  1.00 39.09 ? 296 GLN A CD    1 
ATOM   3137 O OE1   . GLN B 2 296 ? -9.765  38.593 29.976  1.00 41.64 ? 296 GLN A OE1   1 
ATOM   3138 N NE2   . GLN B 2 296 ? -9.183  36.771 31.161  1.00 40.16 ? 296 GLN A NE2   1 
ATOM   3139 N N     . LEU B 2 297 ? -7.094  36.589 25.059  1.00 35.25 ? 297 LEU A N     1 
ATOM   3140 C CA    . LEU B 2 297 ? -6.354  37.176 23.951  1.00 36.34 ? 297 LEU A CA    1 
ATOM   3141 C C     . LEU B 2 297 ? -7.012  36.705 22.662  1.00 37.99 ? 297 LEU A C     1 
ATOM   3142 O O     . LEU B 2 297 ? -7.249  37.494 21.753  1.00 38.68 ? 297 LEU A O     1 
ATOM   3143 C CB    . LEU B 2 297 ? -4.889  36.740 23.981  1.00 33.93 ? 297 LEU A CB    1 
ATOM   3144 C CG    . LEU B 2 297 ? -4.085  37.327 25.139  1.00 32.77 ? 297 LEU A CG    1 
ATOM   3145 C CD1   . LEU B 2 297 ? -2.679  36.793 25.109  1.00 31.38 ? 297 LEU A CD1   1 
ATOM   3146 C CD2   . LEU B 2 297 ? -4.080  38.840 25.042  1.00 31.29 ? 297 LEU A CD2   1 
ATOM   3147 N N     . GLU B 2 298 ? -7.323  35.414 22.598  1.00 39.96 ? 298 GLU A N     1 
ATOM   3148 C CA    . GLU B 2 298 ? -7.974  34.847 21.424  1.00 41.21 ? 298 GLU A CA    1 
ATOM   3149 C C     . GLU B 2 298 ? -9.298  35.555 21.167  1.00 39.99 ? 298 GLU A C     1 
ATOM   3150 O O     . GLU B 2 298 ? -9.632  35.862 20.025  1.00 41.33 ? 298 GLU A O     1 
ATOM   3151 C CB    . GLU B 2 298 ? -8.182  33.333 21.604  1.00 41.99 ? 298 GLU A CB    1 
ATOM   3152 C CG    . GLU B 2 298 ? -7.005  32.511 21.052  1.00 46.57 ? 298 GLU A CG    1 
ATOM   3153 C CD    . GLU B 2 298 ? -6.994  31.033 21.477  1.00 49.06 ? 298 GLU A CD    1 
ATOM   3154 O OE1   . GLU B 2 298 ? -6.157  30.270 20.921  1.00 48.51 ? 298 GLU A OE1   1 
ATOM   3155 O OE2   . GLU B 2 298 ? -7.802  30.637 22.364  1.00 50.57 ? 298 GLU A OE2   1 
ATOM   3156 N N     . ARG B 2 299 ? -10.041 35.835 22.227  1.00 38.15 ? 299 ARG A N     1 
ATOM   3157 C CA    . ARG B 2 299 ? -11.313 36.505 22.058  1.00 36.94 ? 299 ARG A CA    1 
ATOM   3158 C C     . ARG B 2 299 ? -11.085 37.895 21.505  1.00 36.71 ? 299 ARG A C     1 
ATOM   3159 O O     . ARG B 2 299 ? -11.629 38.257 20.466  1.00 37.77 ? 299 ARG A O     1 
ATOM   3160 C CB    . ARG B 2 299 ? -12.055 36.604 23.384  1.00 36.26 ? 299 ARG A CB    1 
ATOM   3161 C CG    . ARG B 2 299 ? -13.373 37.345 23.266  1.00 35.46 ? 299 ARG A CG    1 
ATOM   3162 C CD    . ARG B 2 299 ? -14.119 37.377 24.579  1.00 36.19 ? 299 ARG A CD    1 
ATOM   3163 N NE    . ARG B 2 299 ? -15.492 36.925 24.409  1.00 40.77 ? 299 ARG A NE    1 
ATOM   3164 C CZ    . ARG B 2 299 ? -16.449 37.622 23.808  1.00 39.78 ? 299 ARG A CZ    1 
ATOM   3165 N NH1   . ARG B 2 299 ? -16.195 38.824 23.318  1.00 41.96 ? 299 ARG A NH1   1 
ATOM   3166 N NH2   . ARG B 2 299 ? -17.658 37.102 23.678  1.00 42.84 ? 299 ARG A NH2   1 
ATOM   3167 N N     . ALA B 2 300 ? -10.276 38.675 22.208  1.00 35.80 ? 300 ALA A N     1 
ATOM   3168 C CA    . ALA B 2 300 ? -9.981  40.036 21.786  1.00 36.58 ? 300 ALA A CA    1 
ATOM   3169 C C     . ALA B 2 300 ? -9.534  40.073 20.320  1.00 36.37 ? 300 ALA A C     1 
ATOM   3170 O O     . ALA B 2 300 ? -10.120 40.777 19.501  1.00 35.00 ? 300 ALA A O     1 
ATOM   3171 C CB    . ALA B 2 300 ? -8.910  40.637 22.689  1.00 37.03 ? 300 ALA A CB    1 
ATOM   3172 N N     . SER B 2 301 ? -8.501  39.310 19.993  1.00 36.04 ? 301 SER A N     1 
ATOM   3173 C CA    . SER B 2 301 ? -8.012  39.262 18.624  1.00 37.11 ? 301 SER A CA    1 
ATOM   3174 C C     . SER B 2 301 ? -9.139  39.005 17.648  1.00 36.45 ? 301 SER A C     1 
ATOM   3175 O O     . SER B 2 301 ? -9.231  39.641 16.613  1.00 35.48 ? 301 SER A O     1 
ATOM   3176 C CB    . SER B 2 301 ? -6.972  38.157 18.459  1.00 37.39 ? 301 SER A CB    1 
ATOM   3177 O OG    . SER B 2 301 ? -5.765  38.495 19.103  1.00 42.26 ? 301 SER A OG    1 
ATOM   3178 N N     . ARG B 2 302 ? -9.998  38.057 17.988  1.00 36.03 ? 302 ARG A N     1 
ATOM   3179 C CA    . ARG B 2 302 ? -11.103 37.698 17.125  1.00 34.58 ? 302 ARG A CA    1 
ATOM   3180 C C     . ARG B 2 302 ? -12.110 38.823 16.938  1.00 34.07 ? 302 ARG A C     1 
ATOM   3181 O O     . ARG B 2 302 ? -12.495 39.129 15.815  1.00 32.99 ? 302 ARG A O     1 
ATOM   3182 C CB    . ARG B 2 302 ? -11.811 36.475 17.683  1.00 34.77 ? 302 ARG A CB    1 
ATOM   3183 C CG    . ARG B 2 302 ? -12.797 35.869 16.724  1.00 38.42 ? 302 ARG A CG    1 
ATOM   3184 C CD    . ARG B 2 302 ? -13.600 34.770 17.390  1.00 42.39 ? 302 ARG A CD    1 
ATOM   3185 N NE    . ARG B 2 302 ? -14.732 35.293 18.153  1.00 45.63 ? 302 ARG A NE    1 
ATOM   3186 C CZ    . ARG B 2 302 ? -14.921 35.091 19.456  1.00 48.11 ? 302 ARG A CZ    1 
ATOM   3187 N NH1   . ARG B 2 302 ? -14.052 34.374 20.169  1.00 49.72 ? 302 ARG A NH1   1 
ATOM   3188 N NH2   . ARG B 2 302 ? -15.990 35.603 20.048  1.00 49.08 ? 302 ARG A NH2   1 
ATOM   3189 N N     . LYS B 2 303 ? -12.536 39.441 18.036  1.00 33.69 ? 303 LYS A N     1 
ATOM   3190 C CA    . LYS B 2 303 ? -13.516 40.514 17.952  1.00 33.69 ? 303 LYS A CA    1 
ATOM   3191 C C     . LYS B 2 303 ? -13.002 41.671 17.106  1.00 34.72 ? 303 LYS A C     1 
ATOM   3192 O O     . LYS B 2 303 ? -13.766 42.287 16.362  1.00 36.40 ? 303 LYS A O     1 
ATOM   3193 C CB    . LYS B 2 303 ? -13.882 41.016 19.348  1.00 33.80 ? 303 LYS A CB    1 
ATOM   3194 C CG    . LYS B 2 303 ? -14.468 39.954 20.261  1.00 36.28 ? 303 LYS A CG    1 
ATOM   3195 C CD    . LYS B 2 303 ? -15.698 39.269 19.677  1.00 35.49 ? 303 LYS A CD    1 
ATOM   3196 C CE    . LYS B 2 303 ? -16.946 40.131 19.743  1.00 34.40 ? 303 LYS A CE    1 
ATOM   3197 N NZ    . LYS B 2 303 ? -18.098 39.489 19.030  1.00 37.61 ? 303 LYS A NZ    1 
ATOM   3198 N N     . ILE B 2 304 ? -11.709 41.959 17.214  1.00 33.03 ? 304 ILE A N     1 
ATOM   3199 C CA    . ILE B 2 304 ? -11.100 43.044 16.459  1.00 30.20 ? 304 ILE A CA    1 
ATOM   3200 C C     . ILE B 2 304 ? -10.935 42.667 14.993  1.00 29.96 ? 304 ILE A C     1 
ATOM   3201 O O     . ILE B 2 304 ? -11.057 43.513 14.114  1.00 30.35 ? 304 ILE A O     1 
ATOM   3202 C CB    . ILE B 2 304 ? -9.740  43.428 17.070  1.00 31.19 ? 304 ILE A CB    1 
ATOM   3203 C CG1   . ILE B 2 304 ? -9.967  44.022 18.466  1.00 30.76 ? 304 ILE A CG1   1 
ATOM   3204 C CG2   . ILE B 2 304 ? -9.003  44.392 16.164  1.00 27.66 ? 304 ILE A CG2   1 
ATOM   3205 C CD1   . ILE B 2 304 ? -8.723  44.553 19.140  1.00 32.30 ? 304 ILE A CD1   1 
ATOM   3206 N N     . PHE B 2 305 ? -10.662 41.394 14.736  1.00 29.44 ? 305 PHE A N     1 
ATOM   3207 C CA    . PHE B 2 305 ? -10.502 40.887 13.374  1.00 28.66 ? 305 PHE A CA    1 
ATOM   3208 C C     . PHE B 2 305 ? -11.828 41.086 12.642  1.00 28.91 ? 305 PHE A C     1 
ATOM   3209 O O     . PHE B 2 305 ? -11.882 41.609 11.524  1.00 27.61 ? 305 PHE A O     1 
ATOM   3210 C CB    . PHE B 2 305 ? -10.166 39.391 13.407  1.00 26.94 ? 305 PHE A CB    1 
ATOM   3211 C CG    . PHE B 2 305 ? -9.813  38.811 12.065  1.00 28.71 ? 305 PHE A CG    1 
ATOM   3212 C CD1   . PHE B 2 305 ? -8.535  38.982 11.532  1.00 29.28 ? 305 PHE A CD1   1 
ATOM   3213 C CD2   . PHE B 2 305 ? -10.764 38.123 11.314  1.00 26.20 ? 305 PHE A CD2   1 
ATOM   3214 C CE1   . PHE B 2 305 ? -8.206  38.478 10.271  1.00 27.09 ? 305 PHE A CE1   1 
ATOM   3215 C CE2   . PHE B 2 305 ? -10.448 37.618 10.057  1.00 24.67 ? 305 PHE A CE2   1 
ATOM   3216 C CZ    . PHE B 2 305 ? -9.166  37.798 9.534   1.00 27.36 ? 305 PHE A CZ    1 
ATOM   3217 N N     . GLU B 2 306 ? -12.899 40.666 13.304  1.00 29.79 ? 306 GLU A N     1 
ATOM   3218 C CA    . GLU B 2 306 ? -14.240 40.763 12.761  1.00 30.83 ? 306 GLU A CA    1 
ATOM   3219 C C     . GLU B 2 306 ? -14.705 42.200 12.610  1.00 30.43 ? 306 GLU A C     1 
ATOM   3220 O O     . GLU B 2 306 ? -15.586 42.495 11.804  1.00 30.23 ? 306 GLU A O     1 
ATOM   3221 C CB    . GLU B 2 306 ? -15.183 39.967 13.640  1.00 31.00 ? 306 GLU A CB    1 
ATOM   3222 C CG    . GLU B 2 306 ? -14.602 38.610 13.949  1.00 37.02 ? 306 GLU A CG    1 
ATOM   3223 C CD    . GLU B 2 306 ? -15.570 37.703 14.653  1.00 39.75 ? 306 GLU A CD    1 
ATOM   3224 O OE1   . GLU B 2 306 ? -16.226 38.164 15.624  1.00 41.91 ? 306 GLU A OE1   1 
ATOM   3225 O OE2   . GLU B 2 306 ? -15.661 36.528 14.226  1.00 39.24 ? 306 GLU A OE2   1 
ATOM   3226 N N     . PHE B 2 307 ? -14.125 43.100 13.388  1.00 29.88 ? 307 PHE A N     1 
ATOM   3227 C CA    . PHE B 2 307 ? -14.478 44.504 13.252  1.00 31.07 ? 307 PHE A CA    1 
ATOM   3228 C C     . PHE B 2 307 ? -13.794 44.951 11.966  1.00 32.28 ? 307 PHE A C     1 
ATOM   3229 O O     . PHE B 2 307 ? -14.364 45.675 11.149  1.00 31.26 ? 307 PHE A O     1 
ATOM   3230 C CB    . PHE B 2 307 ? -13.936 45.324 14.416  1.00 29.01 ? 307 PHE A CB    1 
ATOM   3231 C CG    . PHE B 2 307 ? -13.872 46.791 14.130  1.00 29.60 ? 307 PHE A CG    1 
ATOM   3232 C CD1   . PHE B 2 307 ? -15.030 47.555 14.068  1.00 29.02 ? 307 PHE A CD1   1 
ATOM   3233 C CD2   . PHE B 2 307 ? -12.652 47.403 13.857  1.00 29.93 ? 307 PHE A CD2   1 
ATOM   3234 C CE1   . PHE B 2 307 ? -14.975 48.904 13.738  1.00 28.92 ? 307 PHE A CE1   1 
ATOM   3235 C CE2   . PHE B 2 307 ? -12.591 48.748 13.526  1.00 29.22 ? 307 PHE A CE2   1 
ATOM   3236 C CZ    . PHE B 2 307 ? -13.754 49.500 13.465  1.00 28.81 ? 307 PHE A CZ    1 
ATOM   3237 N N     . LEU B 2 308 ? -12.561 44.496 11.794  1.00 32.34 ? 308 LEU A N     1 
ATOM   3238 C CA    . LEU B 2 308 ? -11.799 44.839 10.621  1.00 33.25 ? 308 LEU A CA    1 
ATOM   3239 C C     . LEU B 2 308 ? -12.397 44.257 9.353   1.00 36.10 ? 308 LEU A C     1 
ATOM   3240 O O     . LEU B 2 308 ? -12.410 44.925 8.332   1.00 39.46 ? 308 LEU A O     1 
ATOM   3241 C CB    . LEU B 2 308 ? -10.359 44.368 10.775  1.00 32.49 ? 308 LEU A CB    1 
ATOM   3242 C CG    . LEU B 2 308 ? -9.484  45.112 11.785  1.00 31.96 ? 308 LEU A CG    1 
ATOM   3243 C CD1   . LEU B 2 308 ? -8.270  44.263 12.099  1.00 32.80 ? 308 LEU A CD1   1 
ATOM   3244 C CD2   . LEU B 2 308 ? -9.068  46.470 11.246  1.00 31.57 ? 308 LEU A CD2   1 
ATOM   3245 N N     . GLU B 2 309 ? -12.903 43.028 9.386   1.00 37.97 ? 309 GLU A N     1 
ATOM   3246 C CA    . GLU B 2 309 ? -13.450 42.488 8.146   1.00 39.45 ? 309 GLU A CA    1 
ATOM   3247 C C     . GLU B 2 309 ? -14.830 42.984 7.778   1.00 39.38 ? 309 GLU A C     1 
ATOM   3248 O O     . GLU B 2 309 ? -15.175 43.013 6.599   1.00 40.35 ? 309 GLU A O     1 
ATOM   3249 C CB    . GLU B 2 309 ? -13.408 40.947 8.105   1.00 40.31 ? 309 GLU A CB    1 
ATOM   3250 C CG    . GLU B 2 309 ? -14.034 40.175 9.248   1.00 44.59 ? 309 GLU A CG    1 
ATOM   3251 C CD    . GLU B 2 309 ? -13.933 38.644 9.036   1.00 49.04 ? 309 GLU A CD    1 
ATOM   3252 O OE1   . GLU B 2 309 ? -14.215 37.861 9.979   1.00 47.90 ? 309 GLU A OE1   1 
ATOM   3253 O OE2   . GLU B 2 309 ? -13.575 38.219 7.912   1.00 51.16 ? 309 GLU A OE2   1 
ATOM   3254 N N     . ARG B 2 310 ? -15.631 43.376 8.758   1.00 38.28 ? 310 ARG A N     1 
ATOM   3255 C CA    . ARG B 2 310 ? -16.942 43.876 8.403   1.00 38.78 ? 310 ARG A CA    1 
ATOM   3256 C C     . ARG B 2 310 ? -16.795 45.341 8.022   1.00 39.71 ? 310 ARG A C     1 
ATOM   3257 O O     . ARG B 2 310 ? -17.639 45.907 7.336   1.00 40.41 ? 310 ARG A O     1 
ATOM   3258 C CB    . ARG B 2 310 ? -17.940 43.725 9.554   1.00 38.54 ? 310 ARG A CB    1 
ATOM   3259 C CG    . ARG B 2 310 ? -17.698 44.587 10.771  1.00 38.32 ? 310 ARG A CG    1 
ATOM   3260 C CD    . ARG B 2 310 ? -18.974 44.650 11.618  1.00 39.25 ? 310 ARG A CD    1 
ATOM   3261 N NE    . ARG B 2 310 ? -18.679 44.906 13.023  1.00 38.65 ? 310 ARG A NE    1 
ATOM   3262 C CZ    . ARG B 2 310 ? -18.161 44.000 13.844  1.00 38.96 ? 310 ARG A CZ    1 
ATOM   3263 N NH1   . ARG B 2 310 ? -17.899 42.779 13.398  1.00 38.47 ? 310 ARG A NH1   1 
ATOM   3264 N NH2   . ARG B 2 310 ? -17.873 44.322 15.097  1.00 39.34 ? 310 ARG A NH2   1 
ATOM   3265 N N     . GLU B 2 311 ? -15.702 45.955 8.451   1.00 39.80 ? 311 GLU A N     1 
ATOM   3266 C CA    . GLU B 2 311 ? -15.483 47.355 8.147   1.00 37.63 ? 311 GLU A CA    1 
ATOM   3267 C C     . GLU B 2 311 ? -14.681 47.492 6.863   1.00 36.28 ? 311 GLU A C     1 
ATOM   3268 O O     . GLU B 2 311 ? -14.124 48.546 6.566   1.00 36.59 ? 311 GLU A O     1 
ATOM   3269 C CB    . GLU B 2 311 ? -14.786 48.043 9.323   1.00 38.48 ? 311 GLU A CB    1 
ATOM   3270 C CG    . GLU B 2 311 ? -15.338 49.428 9.607   1.00 39.72 ? 311 GLU A CG    1 
ATOM   3271 C CD    . GLU B 2 311 ? -16.831 49.422 9.891   1.00 40.20 ? 311 GLU A CD    1 
ATOM   3272 O OE1   . GLU B 2 311 ? -17.231 48.851 10.923  1.00 42.01 ? 311 GLU A OE1   1 
ATOM   3273 O OE2   . GLU B 2 311 ? -17.607 49.984 9.088   1.00 41.06 ? 311 GLU A OE2   1 
ATOM   3274 N N     . ASN B 2 312 ? -14.641 46.397 6.112   1.00 35.21 ? 312 ASN A N     1 
ATOM   3275 C CA    . ASN B 2 312 ? -13.969 46.319 4.814   1.00 34.65 ? 312 ASN A CA    1 
ATOM   3276 C C     . ASN B 2 312 ? -12.491 46.605 4.733   1.00 33.46 ? 312 ASN A C     1 
ATOM   3277 O O     . ASN B 2 312 ? -12.018 47.069 3.704   1.00 34.61 ? 312 ASN A O     1 
ATOM   3278 C CB    . ASN B 2 312 ? -14.674 47.213 3.791   1.00 35.04 ? 312 ASN A CB    1 
ATOM   3279 C CG    . ASN B 2 312 ? -16.090 46.786 3.535   1.00 34.87 ? 312 ASN A CG    1 
ATOM   3280 O OD1   . ASN B 2 312 ? -17.033 47.473 3.918   1.00 35.25 ? 312 ASN A OD1   1 
ATOM   3281 N ND2   . ASN B 2 312 ? -16.251 45.637 2.893   1.00 32.05 ? 312 ASN A ND2   1 
ATOM   3282 N N     . PHE B 2 313 ? -11.749 46.321 5.790   1.00 32.18 ? 313 PHE A N     1 
ATOM   3283 C CA    . PHE B 2 313 ? -10.319 46.564 5.740   1.00 30.53 ? 313 PHE A CA    1 
ATOM   3284 C C     . PHE B 2 313 ? -9.530  45.362 5.246   1.00 29.77 ? 313 PHE A C     1 
ATOM   3285 O O     . PHE B 2 313 ? -8.315  45.416 5.142   1.00 29.81 ? 313 PHE A O     1 
ATOM   3286 C CB    . PHE B 2 313 ? -9.809  47.027 7.100   1.00 29.73 ? 313 PHE A CB    1 
ATOM   3287 C CG    . PHE B 2 313 ? -10.180 48.441 7.415   1.00 28.80 ? 313 PHE A CG    1 
ATOM   3288 C CD1   . PHE B 2 313 ? -9.733  49.479 6.609   1.00 29.67 ? 313 PHE A CD1   1 
ATOM   3289 C CD2   . PHE B 2 313 ? -11.019 48.733 8.478   1.00 28.94 ? 313 PHE A CD2   1 
ATOM   3290 C CE1   . PHE B 2 313 ? -10.124 50.790 6.856   1.00 30.45 ? 313 PHE A CE1   1 
ATOM   3291 C CE2   . PHE B 2 313 ? -11.413 50.039 8.731   1.00 29.46 ? 313 PHE A CE2   1 
ATOM   3292 C CZ    . PHE B 2 313 ? -10.966 51.070 7.919   1.00 29.58 ? 313 PHE A CZ    1 
ATOM   3293 N N     . MET B 2 314 ? -10.240 44.286 4.930   1.00 30.05 ? 314 MET A N     1 
ATOM   3294 C CA    . MET B 2 314 ? -9.647  43.058 4.418   1.00 29.18 ? 314 MET A CA    1 
ATOM   3295 C C     . MET B 2 314 ? -8.469  42.533 5.220   1.00 29.53 ? 314 MET A C     1 
ATOM   3296 O O     . MET B 2 314 ? -7.338  42.507 4.743   1.00 32.75 ? 314 MET A O     1 
ATOM   3297 C CB    . MET B 2 314 ? -9.251  43.252 2.949   1.00 28.24 ? 314 MET A CB    1 
ATOM   3298 C CG    . MET B 2 314 ? -10.432 43.616 2.054   1.00 28.90 ? 314 MET A CG    1 
ATOM   3299 S SD    . MET B 2 314 ? -10.031 43.696 0.305   1.00 32.19 ? 314 MET A SD    1 
ATOM   3300 C CE    . MET B 2 314 ? -9.823  41.944 -0.096  1.00 26.82 ? 314 MET A CE    1 
ATOM   3301 N N     . PRO B 2 315 ? -8.727  42.097 6.458   1.00 30.05 ? 315 PRO A N     1 
ATOM   3302 C CA    . PRO B 2 315 ? -7.663  41.569 7.311   1.00 31.71 ? 315 PRO A CA    1 
ATOM   3303 C C     . PRO B 2 315 ? -7.187  40.211 6.802   1.00 33.56 ? 315 PRO A C     1 
ATOM   3304 O O     . PRO B 2 315 ? -7.964  39.443 6.231   1.00 32.70 ? 315 PRO A O     1 
ATOM   3305 C CB    . PRO B 2 315 ? -8.339  41.470 8.666   1.00 30.97 ? 315 PRO A CB    1 
ATOM   3306 C CG    . PRO B 2 315 ? -9.730  41.103 8.289   1.00 30.72 ? 315 PRO A CG    1 
ATOM   3307 C CD    . PRO B 2 315 ? -10.016 42.064 7.164   1.00 29.19 ? 315 PRO A CD    1 
ATOM   3308 N N     . LEU B 2 316 ? -5.907  39.921 7.010   1.00 34.38 ? 316 LEU A N     1 
ATOM   3309 C CA    . LEU B 2 316 ? -5.340  38.660 6.564   1.00 35.58 ? 316 LEU A CA    1 
ATOM   3310 C C     . LEU B 2 316 ? -5.062  37.580 7.583   1.00 36.57 ? 316 LEU A C     1 
ATOM   3311 O O     . LEU B 2 316 ? -5.347  36.412 7.342   1.00 38.51 ? 316 LEU A O     1 
ATOM   3312 C CB    . LEU B 2 316 ? -3.951  38.881 5.976   1.00 36.86 ? 316 LEU A CB    1 
ATOM   3313 C CG    . LEU B 2 316 ? -3.954  39.774 4.732   1.00 38.81 ? 316 LEU A CG    1 
ATOM   3314 C CD1   . LEU B 2 316 ? -2.549  39.790 4.155   1.00 38.54 ? 316 LEU A CD1   1 
ATOM   3315 C CD2   . LEU B 2 316 ? -4.964  39.261 3.692   1.00 37.85 ? 316 LEU A CD2   1 
ATOM   3316 N N     . ARG B 2 317 ? -4.495  37.965 8.716   1.00 37.02 ? 317 ARG A N     1 
ATOM   3317 C CA    . ARG B 2 317 ? -4.395  37.091 9.872   1.00 36.40 ? 317 ARG A CA    1 
ATOM   3318 C C     . ARG B 2 317 ? -4.222  37.939 11.109  1.00 37.10 ? 317 ARG A C     1 
ATOM   3319 O O     . ARG B 2 317 ? -3.918  39.128 11.027  1.00 38.35 ? 317 ARG A O     1 
ATOM   3320 C CB    . ARG B 2 317 ? -3.210  36.130 9.754   1.00 36.88 ? 317 ARG A CB    1 
ATOM   3321 C CG    . ARG B 2 317 ? -3.340  35.095 8.660   1.00 38.24 ? 317 ARG A CG    1 
ATOM   3322 C CD    . ARG B 2 317 ? -2.157  34.137 8.677   1.00 40.22 ? 317 ARG A CD    1 
ATOM   3323 N NE    . ARG B 2 317 ? -2.300  33.040 9.634   1.00 39.78 ? 317 ARG A NE    1 
ATOM   3324 C CZ    . ARG B 2 317 ? -1.303  32.231 9.993   1.00 40.06 ? 317 ARG A CZ    1 
ATOM   3325 N NH1   . ARG B 2 317 ? -0.086  32.402 9.484   1.00 38.08 ? 317 ARG A NH1   1 
ATOM   3326 N NH2   . ARG B 2 317 ? -1.521  31.235 10.843  1.00 41.36 ? 317 ARG A NH2   1 
ATOM   3327 N N     . SER B 2 318 ? -4.436  37.320 12.260  1.00 35.99 ? 318 SER A N     1 
ATOM   3328 C CA    . SER B 2 318 ? -4.274  38.011 13.519  1.00 36.25 ? 318 SER A CA    1 
ATOM   3329 C C     . SER B 2 318 ? -3.347  37.136 14.324  1.00 37.18 ? 318 SER A C     1 
ATOM   3330 O O     . SER B 2 318 ? -3.058  35.998 13.944  1.00 35.99 ? 318 SER A O     1 
ATOM   3331 C CB    . SER B 2 318 ? -5.609  38.157 14.247  1.00 34.08 ? 318 SER A CB    1 
ATOM   3332 O OG    . SER B 2 318 ? -5.999  36.941 14.852  1.00 33.62 ? 318 SER A OG    1 
ATOM   3333 N N     . ALA B 2 319 ? -2.873  37.674 15.434  1.00 37.58 ? 319 ALA A N     1 
ATOM   3334 C CA    . ALA B 2 319 ? -1.978  36.937 16.297  1.00 39.46 ? 319 ALA A CA    1 
ATOM   3335 C C     . ALA B 2 319 ? -1.865  37.689 17.605  1.00 39.64 ? 319 ALA A C     1 
ATOM   3336 O O     . ALA B 2 319 ? -2.435  38.763 17.761  1.00 42.10 ? 319 ALA A O     1 
ATOM   3337 C CB    . ALA B 2 319 ? -0.617  36.809 15.640  1.00 38.63 ? 319 ALA A CB    1 
ATOM   3338 N N     . PHE B 2 320 ? -1.136  37.121 18.552  1.00 39.13 ? 320 PHE A N     1 
ATOM   3339 C CA    . PHE B 2 320 ? -0.955  37.767 19.839  1.00 39.36 ? 320 PHE A CA    1 
ATOM   3340 C C     . PHE B 2 320 ? 0.240   37.194 20.596  1.00 38.99 ? 320 PHE A C     1 
ATOM   3341 O O     . PHE B 2 320 ? 0.564   36.015 20.478  1.00 37.13 ? 320 PHE A O     1 
ATOM   3342 C CB    . PHE B 2 320 ? -2.247  37.662 20.672  1.00 39.07 ? 320 PHE A CB    1 
ATOM   3343 C CG    . PHE B 2 320 ? -2.762  36.256 20.840  1.00 41.74 ? 320 PHE A CG    1 
ATOM   3344 C CD1   . PHE B 2 320 ? -2.075  35.333 21.625  1.00 40.84 ? 320 PHE A CD1   1 
ATOM   3345 C CD2   . PHE B 2 320 ? -3.933  35.847 20.203  1.00 42.30 ? 320 PHE A CD2   1 
ATOM   3346 C CE1   . PHE B 2 320 ? -2.543  34.034 21.772  1.00 40.85 ? 320 PHE A CE1   1 
ATOM   3347 C CE2   . PHE B 2 320 ? -4.410  34.546 20.343  1.00 41.29 ? 320 PHE A CE2   1 
ATOM   3348 C CZ    . PHE B 2 320 ? -3.711  33.640 21.129  1.00 41.27 ? 320 PHE A CZ    1 
ATOM   3349 N N     . LYS B 2 321 ? 0.912   38.059 21.347  1.00 40.91 ? 321 LYS A N     1 
ATOM   3350 C CA    . LYS B 2 321 ? 2.061   37.660 22.139  1.00 42.31 ? 321 LYS A CA    1 
ATOM   3351 C C     . LYS B 2 321 ? 1.822   38.174 23.546  1.00 42.54 ? 321 LYS A C     1 
ATOM   3352 O O     . LYS B 2 321 ? 1.105   39.146 23.745  1.00 41.05 ? 321 LYS A O     1 
ATOM   3353 C CB    . LYS B 2 321 ? 3.339   38.253 21.556  1.00 41.29 ? 321 LYS A CB    1 
ATOM   3354 C CG    . LYS B 2 321 ? 4.590   37.471 21.892  1.00 42.68 ? 321 LYS A CG    1 
ATOM   3355 C CD    . LYS B 2 321 ? 5.067   37.762 23.296  1.00 44.82 ? 321 LYS A CD    1 
ATOM   3356 C CE    . LYS B 2 321 ? 6.323   36.963 23.613  1.00 46.73 ? 321 LYS A CE    1 
ATOM   3357 N NZ    . LYS B 2 321 ? 7.338   37.065 22.517  1.00 47.66 ? 321 LYS A NZ    1 
ATOM   3358 N N     . ALA B 2 322 ? 2.400   37.501 24.529  1.00 44.96 ? 322 ALA A N     1 
ATOM   3359 C CA    . ALA B 2 322 ? 2.234   37.894 25.919  1.00 46.10 ? 322 ALA A CA    1 
ATOM   3360 C C     . ALA B 2 322 ? 3.598   37.966 26.570  1.00 48.66 ? 322 ALA A C     1 
ATOM   3361 O O     . ALA B 2 322 ? 4.443   37.105 26.328  1.00 49.67 ? 322 ALA A O     1 
ATOM   3362 C CB    . ALA B 2 322 ? 1.368   36.883 26.640  1.00 44.48 ? 322 ALA A CB    1 
ATOM   3363 N N     . SER B 2 323 ? 3.814   39.003 27.378  1.00 51.74 ? 323 SER A N     1 
ATOM   3364 C CA    . SER B 2 323 ? 5.080   39.194 28.085  1.00 53.70 ? 323 SER A CA    1 
ATOM   3365 C C     . SER B 2 323 ? 4.818   39.434 29.566  1.00 55.17 ? 323 SER A C     1 
ATOM   3366 O O     . SER B 2 323 ? 3.665   39.380 30.021  1.00 54.91 ? 323 SER A O     1 
ATOM   3367 C CB    . SER B 2 323 ? 5.828   40.394 27.515  1.00 53.32 ? 323 SER A CB    1 
ATOM   3368 O OG    . SER B 2 323 ? 5.906   40.289 26.110  1.00 55.97 ? 323 SER A OG    1 
ATOM   3369 N N     . GLU B 2 324 ? 5.887   39.680 30.322  1.00 56.82 ? 324 GLU A N     1 
ATOM   3370 C CA    . GLU B 2 324 ? 5.737   39.957 31.741  1.00 58.55 ? 324 GLU A CA    1 
ATOM   3371 C C     . GLU B 2 324 ? 5.066   41.319 31.768  1.00 58.60 ? 324 GLU A C     1 
ATOM   3372 O O     . GLU B 2 324 ? 4.083   41.556 32.475  1.00 57.86 ? 324 GLU A O     1 
ATOM   3373 C CB    . GLU B 2 324 ? 7.108   40.040 32.422  1.00 60.86 ? 324 GLU A CB    1 
ATOM   3374 C CG    . GLU B 2 324 ? 7.831   38.696 32.560  1.00 65.96 ? 324 GLU A CG    1 
ATOM   3375 C CD    . GLU B 2 324 ? 7.037   37.674 33.384  1.00 69.26 ? 324 GLU A CD    1 
ATOM   3376 O OE1   . GLU B 2 324 ? 5.881   37.365 33.001  1.00 71.36 ? 324 GLU A OE1   1 
ATOM   3377 O OE2   . GLU B 2 324 ? 7.564   37.178 34.412  1.00 70.44 ? 324 GLU A OE2   1 
ATOM   3378 N N     . GLU B 2 325 ? 5.626   42.186 30.935  1.00 58.72 ? 325 GLU A N     1 
ATOM   3379 C CA    . GLU B 2 325 ? 5.222   43.553 30.750  1.00 59.10 ? 325 GLU A CA    1 
ATOM   3380 C C     . GLU B 2 325 ? 3.869   43.933 30.097  1.00 57.15 ? 325 GLU A C     1 
ATOM   3381 O O     . GLU B 2 325 ? 3.030   44.584 30.724  1.00 56.89 ? 325 GLU A O     1 
ATOM   3382 C CB    . GLU B 2 325 ? 6.294   44.221 29.855  1.00 62.53 ? 325 GLU A CB    1 
ATOM   3383 C CG    . GLU B 2 325 ? 6.459   43.488 28.500  1.00 65.71 ? 325 GLU A CG    1 
ATOM   3384 C CD    . GLU B 2 325 ? 7.750   43.823 27.774  1.00 67.26 ? 325 GLU A CD    1 
ATOM   3385 O OE1   . GLU B 2 325 ? 7.823   43.559 26.547  1.00 66.65 ? 325 GLU A OE1   1 
ATOM   3386 O OE2   . GLU B 2 325 ? 8.686   44.334 28.433  1.00 67.36 ? 325 GLU A OE2   1 
ATOM   3387 N N     . PHE B 2 326 ? 3.667   43.502 28.853  1.00 55.26 ? 326 PHE A N     1 
ATOM   3388 C CA    . PHE B 2 326 ? 2.414   43.731 28.137  1.00 52.54 ? 326 PHE A CA    1 
ATOM   3389 C C     . PHE B 2 326 ? 1.952   42.599 27.231  1.00 50.05 ? 326 PHE A C     1 
ATOM   3390 O O     . PHE B 2 326 ? 2.553   41.531 27.190  1.00 50.39 ? 326 PHE A O     1 
ATOM   3391 C CB    . PHE B 2 326 ? 2.535   45.000 27.242  1.00 52.85 ? 326 PHE A CB    1 
ATOM   3392 C CG    . PHE B 2 326 ? 3.231   46.166 27.892  1.00 52.58 ? 326 PHE A CG    1 
ATOM   3393 C CD1   . PHE B 2 326 ? 4.616   46.211 27.963  1.00 51.62 ? 326 PHE A CD1   1 
ATOM   3394 C CD2   . PHE B 2 326 ? 2.502   47.245 28.398  1.00 53.34 ? 326 PHE A CD2   1 
ATOM   3395 C CE1   . PHE B 2 326 ? 5.270   47.314 28.522  1.00 51.28 ? 326 PHE A CE1   1 
ATOM   3396 C CE2   . PHE B 2 326 ? 3.151   48.355 28.959  1.00 50.47 ? 326 PHE A CE2   1 
ATOM   3397 C CZ    . PHE B 2 326 ? 4.536   48.384 29.018  1.00 50.15 ? 326 PHE A CZ    1 
ATOM   3398 N N     . CYS B 2 327 ? 0.862   42.848 26.513  1.00 47.78 ? 327 CYS A N     1 
ATOM   3399 C CA    . CYS B 2 327 ? 0.281   41.887 25.582  1.00 46.46 ? 327 CYS A CA    1 
ATOM   3400 C C     . CYS B 2 327 ? 0.147   42.579 24.235  1.00 44.42 ? 327 CYS A C     1 
ATOM   3401 O O     . CYS B 2 327 ? -0.185  43.759 24.168  1.00 43.75 ? 327 CYS A O     1 
ATOM   3402 C CB    . CYS B 2 327 ? -1.095  41.425 26.060  1.00 46.28 ? 327 CYS A CB    1 
ATOM   3403 S SG    . CYS B 2 327 ? -1.029  40.372 27.521  1.00 47.40 ? 327 CYS A SG    1 
ATOM   3404 N N     . TYR B 2 328 ? 0.412   41.853 23.161  1.00 41.55 ? 328 TYR A N     1 
ATOM   3405 C CA    . TYR B 2 328 ? 0.316   42.449 21.848  1.00 38.89 ? 328 TYR A CA    1 
ATOM   3406 C C     . TYR B 2 328 ? -0.678  41.742 20.973  1.00 36.44 ? 328 TYR A C     1 
ATOM   3407 O O     . TYR B 2 328 ? -0.611  40.541 20.810  1.00 35.80 ? 328 TYR A O     1 
ATOM   3408 C CB    . TYR B 2 328 ? 1.673   42.423 21.154  1.00 40.01 ? 328 TYR A CB    1 
ATOM   3409 C CG    . TYR B 2 328 ? 2.785   43.041 21.961  1.00 42.67 ? 328 TYR A CG    1 
ATOM   3410 C CD1   . TYR B 2 328 ? 3.295   42.397 23.091  1.00 42.74 ? 328 TYR A CD1   1 
ATOM   3411 C CD2   . TYR B 2 328 ? 3.362   44.252 21.575  1.00 42.48 ? 328 TYR A CD2   1 
ATOM   3412 C CE1   . TYR B 2 328 ? 4.361   42.940 23.809  1.00 42.28 ? 328 TYR A CE1   1 
ATOM   3413 C CE2   . TYR B 2 328 ? 4.425   44.800 22.288  1.00 42.50 ? 328 TYR A CE2   1 
ATOM   3414 C CZ    . TYR B 2 328 ? 4.922   44.138 23.398  1.00 42.39 ? 328 TYR A CZ    1 
ATOM   3415 O OH    . TYR B 2 328 ? 6.006   44.656 24.065  1.00 44.08 ? 328 TYR A OH    1 
ATOM   3416 N N     . LEU B 2 329 ? -1.621  42.489 20.427  1.00 35.82 ? 329 LEU A N     1 
ATOM   3417 C CA    . LEU B 2 329 ? -2.575  41.908 19.509  1.00 35.23 ? 329 LEU A CA    1 
ATOM   3418 C C     . LEU B 2 329 ? -2.038  42.370 18.164  1.00 35.05 ? 329 LEU A C     1 
ATOM   3419 O O     . LEU B 2 329 ? -1.943  43.566 17.912  1.00 34.86 ? 329 LEU A O     1 
ATOM   3420 C CB    . LEU B 2 329 ? -3.972  42.476 19.736  1.00 34.76 ? 329 LEU A CB    1 
ATOM   3421 C CG    . LEU B 2 329 ? -4.640  42.215 21.084  1.00 35.30 ? 329 LEU A CG    1 
ATOM   3422 C CD1   . LEU B 2 329 ? -6.000  42.899 21.112  1.00 33.77 ? 329 LEU A CD1   1 
ATOM   3423 C CD2   . LEU B 2 329 ? -4.792  40.726 21.306  1.00 34.01 ? 329 LEU A CD2   1 
ATOM   3424 N N     . LEU B 2 330 ? -1.653  41.440 17.303  1.00 35.18 ? 330 LEU A N     1 
ATOM   3425 C CA    . LEU B 2 330 ? -1.122  41.836 16.006  1.00 34.68 ? 330 LEU A CA    1 
ATOM   3426 C C     . LEU B 2 330 ? -2.109  41.621 14.890  1.00 33.94 ? 330 LEU A C     1 
ATOM   3427 O O     . LEU B 2 330 ? -2.971  40.748 14.965  1.00 34.94 ? 330 LEU A O     1 
ATOM   3428 C CB    . LEU B 2 330 ? 0.169   41.089 15.706  1.00 34.76 ? 330 LEU A CB    1 
ATOM   3429 C CG    . LEU B 2 330 ? 1.274   41.362 16.719  1.00 36.10 ? 330 LEU A CG    1 
ATOM   3430 C CD1   . LEU B 2 330 ? 0.960   40.659 18.019  1.00 37.95 ? 330 LEU A CD1   1 
ATOM   3431 C CD2   . LEU B 2 330 ? 2.588   40.862 16.173  1.00 39.32 ? 330 LEU A CD2   1 
ATOM   3432 N N     . PHE B 2 331 ? -1.973  42.436 13.853  1.00 33.54 ? 331 PHE A N     1 
ATOM   3433 C CA    . PHE B 2 331 ? -2.853  42.374 12.697  1.00 33.51 ? 331 PHE A CA    1 
ATOM   3434 C C     . PHE B 2 331 ? -2.138  42.766 11.412  1.00 33.73 ? 331 PHE A C     1 
ATOM   3435 O O     . PHE B 2 331 ? -1.073  43.387 11.445  1.00 34.05 ? 331 PHE A O     1 
ATOM   3436 C CB    . PHE B 2 331 ? -4.037  43.313 12.900  1.00 33.77 ? 331 PHE A CB    1 
ATOM   3437 C CG    . PHE B 2 331 ? -4.886  42.966 14.077  1.00 34.91 ? 331 PHE A CG    1 
ATOM   3438 C CD1   . PHE B 2 331 ? -5.757  41.889 14.029  1.00 33.94 ? 331 PHE A CD1   1 
ATOM   3439 C CD2   . PHE B 2 331 ? -4.814  43.715 15.240  1.00 35.73 ? 331 PHE A CD2   1 
ATOM   3440 C CE1   . PHE B 2 331 ? -6.544  41.569 15.119  1.00 33.80 ? 331 PHE A CE1   1 
ATOM   3441 C CE2   . PHE B 2 331 ? -5.599  43.402 16.338  1.00 35.17 ? 331 PHE A CE2   1 
ATOM   3442 C CZ    . PHE B 2 331 ? -6.465  42.326 16.277  1.00 35.13 ? 331 PHE A CZ    1 
ATOM   3443 N N     . GLU B 2 332 ? -2.741  42.375 10.290  1.00 32.72 ? 332 GLU A N     1 
ATOM   3444 C CA    . GLU B 2 332 ? -2.257  42.690 8.950   1.00 32.87 ? 332 GLU A CA    1 
ATOM   3445 C C     . GLU B 2 332 ? -3.494  42.790 8.075   1.00 32.94 ? 332 GLU A C     1 
ATOM   3446 O O     . GLU B 2 332 ? -4.345  41.903 8.082   1.00 33.04 ? 332 GLU A O     1 
ATOM   3447 C CB    . GLU B 2 332 ? -1.318  41.613 8.389   1.00 31.90 ? 332 GLU A CB    1 
ATOM   3448 C CG    . GLU B 2 332 ? -0.828  41.957 6.985   1.00 33.74 ? 332 GLU A CG    1 
ATOM   3449 C CD    . GLU B 2 332 ? 0.106   40.922 6.371   1.00 36.79 ? 332 GLU A CD    1 
ATOM   3450 O OE1   . GLU B 2 332 ? -0.210  39.717 6.428   1.00 39.10 ? 332 GLU A OE1   1 
ATOM   3451 O OE2   . GLU B 2 332 ? 1.152   41.316 5.810   1.00 36.20 ? 332 GLU A OE2   1 
ATOM   3452 N N     . CYS B 2 333 ? -3.598  43.891 7.341   1.00 32.61 ? 333 CYS A N     1 
ATOM   3453 C CA    . CYS B 2 333 ? -4.734  44.126 6.464   1.00 32.29 ? 333 CYS A CA    1 
ATOM   3454 C C     . CYS B 2 333 ? -4.278  44.416 5.040   1.00 33.03 ? 333 CYS A C     1 
ATOM   3455 O O     . CYS B 2 333 ? -3.111  44.734 4.804   1.00 34.16 ? 333 CYS A O     1 
ATOM   3456 C CB    . CYS B 2 333 ? -5.556  45.301 6.981   1.00 32.38 ? 333 CYS A CB    1 
ATOM   3457 S SG    . CYS B 2 333 ? -6.357  45.000 8.547   1.00 36.10 ? 333 CYS A SG    1 
ATOM   3458 N N     . GLN B 2 334 ? -5.206  44.295 4.095   1.00 30.67 ? 334 GLN A N     1 
ATOM   3459 C CA    . GLN B 2 334 ? -4.916  44.545 2.691   1.00 29.81 ? 334 GLN A CA    1 
ATOM   3460 C C     . GLN B 2 334 ? -5.225  45.994 2.341   1.00 30.55 ? 334 GLN A C     1 
ATOM   3461 O O     . GLN B 2 334 ? -4.819  46.491 1.289   1.00 30.32 ? 334 GLN A O     1 
ATOM   3462 C CB    . GLN B 2 334 ? -5.760  43.622 1.819   1.00 30.39 ? 334 GLN A CB    1 
ATOM   3463 C CG    . GLN B 2 334 ? -5.200  42.241 1.672   1.00 33.49 ? 334 GLN A CG    1 
ATOM   3464 C CD    . GLN B 2 334 ? -6.081  41.356 0.824   1.00 36.32 ? 334 GLN A CD    1 
ATOM   3465 O OE1   . GLN B 2 334 ? -6.967  40.680 1.338   1.00 39.63 ? 334 GLN A OE1   1 
ATOM   3466 N NE2   . GLN B 2 334 ? -5.855  41.370 -0.484  1.00 33.01 ? 334 GLN A NE2   1 
ATOM   3467 N N     . ILE B 2 335 ? -5.932  46.665 3.245   1.00 29.03 ? 335 ILE A N     1 
ATOM   3468 C CA    . ILE B 2 335 ? -6.343  48.043 3.043   1.00 29.27 ? 335 ILE A CA    1 
ATOM   3469 C C     . ILE B 2 335 ? -5.730  49.023 4.031   1.00 30.76 ? 335 ILE A C     1 
ATOM   3470 O O     . ILE B 2 335 ? -6.154  49.100 5.183   1.00 29.94 ? 335 ILE A O     1 
ATOM   3471 C CB    . ILE B 2 335 ? -7.876  48.170 3.160   1.00 29.72 ? 335 ILE A CB    1 
ATOM   3472 C CG1   . ILE B 2 335 ? -8.559  47.102 2.301   1.00 26.37 ? 335 ILE A CG1   1 
ATOM   3473 C CG2   . ILE B 2 335 ? -8.307  49.575 2.777   1.00 28.84 ? 335 ILE A CG2   1 
ATOM   3474 C CD1   . ILE B 2 335 ? -8.194  47.157 0.837   1.00 26.14 ? 335 ILE A CD1   1 
ATOM   3475 N N     . LYS B 2 336 ? -4.744  49.782 3.566   1.00 33.42 ? 336 LYS A N     1 
ATOM   3476 C CA    . LYS B 2 336 ? -4.088  50.789 4.396   1.00 35.01 ? 336 LYS A CA    1 
ATOM   3477 C C     . LYS B 2 336 ? -5.002  52.007 4.569   1.00 36.49 ? 336 LYS A C     1 
ATOM   3478 O O     . LYS B 2 336 ? -4.937  52.699 5.587   1.00 37.36 ? 336 LYS A O     1 
ATOM   3479 C CB    . LYS B 2 336 ? -2.788  51.261 3.751   1.00 35.35 ? 336 LYS A CB    1 
ATOM   3480 C CG    . LYS B 2 336 ? -1.681  50.240 3.640   1.00 35.29 ? 336 LYS A CG    1 
ATOM   3481 C CD    . LYS B 2 336 ? -0.534  50.834 2.835   1.00 38.64 ? 336 LYS A CD    1 
ATOM   3482 C CE    . LYS B 2 336 ? 0.698   49.938 2.857   1.00 42.60 ? 336 LYS A CE    1 
ATOM   3483 N NZ    . LYS B 2 336 ? 1.850   50.452 2.030   1.00 43.57 ? 336 LYS A NZ    1 
ATOM   3484 N N     . GLU B 2 337 ? -5.830  52.279 3.559   1.00 36.50 ? 337 GLU A N     1 
ATOM   3485 C CA    . GLU B 2 337 ? -6.756  53.408 3.598   1.00 37.67 ? 337 GLU A CA    1 
ATOM   3486 C C     . GLU B 2 337 ? -7.909  53.222 2.620   1.00 38.06 ? 337 GLU A C     1 
ATOM   3487 O O     . GLU B 2 337 ? -7.690  52.988 1.436   1.00 38.68 ? 337 GLU A O     1 
ATOM   3488 C CB    . GLU B 2 337 ? -6.029  54.724 3.272   1.00 39.37 ? 337 GLU A CB    1 
ATOM   3489 C CG    . GLU B 2 337 ? -6.963  55.923 3.040   1.00 42.08 ? 337 GLU A CG    1 
ATOM   3490 C CD    . GLU B 2 337 ? -6.245  57.278 2.983   1.00 45.20 ? 337 GLU A CD    1 
ATOM   3491 O OE1   . GLU B 2 337 ? -5.285  57.424 2.188   1.00 46.91 ? 337 GLU A OE1   1 
ATOM   3492 O OE2   . GLU B 2 337 ? -6.656  58.204 3.728   1.00 45.78 ? 337 GLU A OE2   1 
ATOM   3493 N N     . ILE B 2 338 ? -9.136  53.319 3.124   1.00 37.94 ? 338 ILE A N     1 
ATOM   3494 C CA    . ILE B 2 338 ? -10.323 53.197 2.291   1.00 37.66 ? 338 ILE A CA    1 
ATOM   3495 C C     . ILE B 2 338 ? -10.938 54.586 2.120   1.00 37.21 ? 338 ILE A C     1 
ATOM   3496 O O     . ILE B 2 338 ? -10.617 55.501 2.872   1.00 36.73 ? 338 ILE A O     1 
ATOM   3497 C CB    . ILE B 2 338 ? -11.359 52.242 2.928   1.00 39.16 ? 338 ILE A CB    1 
ATOM   3498 C CG1   . ILE B 2 338 ? -12.491 51.975 1.941   1.00 39.92 ? 338 ILE A CG1   1 
ATOM   3499 C CG2   . ILE B 2 338 ? -11.922 52.838 4.208   1.00 38.77 ? 338 ILE A CG2   1 
ATOM   3500 C CD1   . ILE B 2 338 ? -13.402 50.866 2.368   1.00 40.05 ? 338 ILE A CD1   1 
ATOM   3501 N N     . SER B 2 339 ? -11.806 54.754 1.127   1.00 37.35 ? 339 SER A N     1 
ATOM   3502 C CA    . SER B 2 339 ? -12.429 56.055 0.898   1.00 36.32 ? 339 SER A CA    1 
ATOM   3503 C C     . SER B 2 339 ? -13.371 56.420 2.041   1.00 36.37 ? 339 SER A C     1 
ATOM   3504 O O     . SER B 2 339 ? -13.729 55.576 2.863   1.00 34.61 ? 339 SER A O     1 
ATOM   3505 C CB    . SER B 2 339 ? -13.204 56.057 -0.424  1.00 36.56 ? 339 SER A CB    1 
ATOM   3506 O OG    . SER B 2 339 ? -14.290 55.145 -0.410  1.00 36.29 ? 339 SER A OG    1 
ATOM   3507 N N     . ARG B 2 340 ? -13.764 57.688 2.089   1.00 36.10 ? 340 ARG A N     1 
ATOM   3508 C CA    . ARG B 2 340 ? -14.679 58.167 3.114   1.00 36.51 ? 340 ARG A CA    1 
ATOM   3509 C C     . ARG B 2 340 ? -16.096 57.737 2.717   1.00 36.36 ? 340 ARG A C     1 
ATOM   3510 O O     . ARG B 2 340 ? -16.877 57.283 3.544   1.00 35.75 ? 340 ARG A O     1 
ATOM   3511 C CB    . ARG B 2 340 ? -14.614 59.693 3.202   1.00 36.98 ? 340 ARG A CB    1 
ATOM   3512 C CG    . ARG B 2 340 ? -14.905 60.260 4.584   1.00 37.93 ? 340 ARG A CG    1 
ATOM   3513 C CD    . ARG B 2 340 ? -13.610 60.730 5.235   1.00 40.75 ? 340 ARG A CD    1 
ATOM   3514 N NE    . ARG B 2 340 ? -13.687 60.730 6.694   1.00 41.40 ? 340 ARG A NE    1 
ATOM   3515 C CZ    . ARG B 2 340 ? -12.660 60.999 7.497   1.00 44.88 ? 340 ARG A CZ    1 
ATOM   3516 N NH1   . ARG B 2 340 ? -11.471 61.300 6.983   1.00 44.29 ? 340 ARG A NH1   1 
ATOM   3517 N NH2   . ARG B 2 340 ? -12.816 60.948 8.818   1.00 48.64 ? 340 ARG A NH2   1 
ATOM   3518 N N     . VAL B 2 341 ? -16.409 57.881 1.433   1.00 35.39 ? 341 VAL A N     1 
ATOM   3519 C CA    . VAL B 2 341 ? -17.718 57.522 0.903   1.00 34.86 ? 341 VAL A CA    1 
ATOM   3520 C C     . VAL B 2 341 ? -17.861 56.025 0.709   1.00 34.62 ? 341 VAL A C     1 
ATOM   3521 O O     . VAL B 2 341 ? -16.905 55.338 0.386   1.00 33.56 ? 341 VAL A O     1 
ATOM   3522 C CB    . VAL B 2 341 ? -17.984 58.179 -0.478  1.00 33.05 ? 341 VAL A CB    1 
ATOM   3523 C CG1   . VAL B 2 341 ? -19.402 58.651 -0.565  1.00 32.72 ? 341 VAL A CG1   1 
ATOM   3524 C CG2   . VAL B 2 341 ? -17.053 59.313 -0.705  1.00 35.13 ? 341 VAL A CG2   1 
ATOM   3525 N N     . PHE B 2 342 ? -19.075 55.538 0.917   1.00 36.40 ? 342 PHE A N     1 
ATOM   3526 C CA    . PHE B 2 342 ? -19.413 54.133 0.730   1.00 39.04 ? 342 PHE A CA    1 
ATOM   3527 C C     . PHE B 2 342 ? -20.912 54.126 0.411   1.00 41.35 ? 342 PHE A C     1 
ATOM   3528 O O     . PHE B 2 342 ? -21.585 55.136 0.638   1.00 41.93 ? 342 PHE A O     1 
ATOM   3529 C CB    . PHE B 2 342 ? -19.084 53.308 1.990   1.00 37.18 ? 342 PHE A CB    1 
ATOM   3530 C CG    . PHE B 2 342 ? -19.997 53.558 3.163   1.00 38.22 ? 342 PHE A CG    1 
ATOM   3531 C CD1   . PHE B 2 342 ? -21.115 52.760 3.379   1.00 37.11 ? 342 PHE A CD1   1 
ATOM   3532 C CD2   . PHE B 2 342 ? -19.721 54.578 4.076   1.00 38.91 ? 342 PHE A CD2   1 
ATOM   3533 C CE1   . PHE B 2 342 ? -21.945 52.969 4.486   1.00 35.24 ? 342 PHE A CE1   1 
ATOM   3534 C CE2   . PHE B 2 342 ? -20.549 54.794 5.190   1.00 36.65 ? 342 PHE A CE2   1 
ATOM   3535 C CZ    . PHE B 2 342 ? -21.661 53.985 5.389   1.00 34.91 ? 342 PHE A CZ    1 
ATOM   3536 N N     . ARG B 2 343 ? -21.429 53.025 -0.141  1.00 43.10 ? 343 ARG A N     1 
ATOM   3537 C CA    . ARG B 2 343 ? -22.851 52.954 -0.481  1.00 44.71 ? 343 ARG A CA    1 
ATOM   3538 C C     . ARG B 2 343 ? -23.718 52.120 0.469   1.00 45.55 ? 343 ARG A C     1 
ATOM   3539 O O     . ARG B 2 343 ? -23.349 51.022 0.892   1.00 44.89 ? 343 ARG A O     1 
ATOM   3540 C CB    . ARG B 2 343 ? -23.028 52.469 -1.923  1.00 44.54 ? 343 ARG A CB    1 
ATOM   3541 C CG    . ARG B 2 343 ? -22.204 51.263 -2.280  1.00 48.07 ? 343 ARG A CG    1 
ATOM   3542 C CD    . ARG B 2 343 ? -22.332 50.968 -3.755  1.00 49.50 ? 343 ARG A CD    1 
ATOM   3543 N NE    . ARG B 2 343 ? -23.640 50.424 -4.098  1.00 51.62 ? 343 ARG A NE    1 
ATOM   3544 C CZ    . ARG B 2 343 ? -24.099 50.327 -5.343  1.00 53.19 ? 343 ARG A CZ    1 
ATOM   3545 N NH1   . ARG B 2 343 ? -23.352 50.747 -6.356  1.00 53.21 ? 343 ARG A NH1   1 
ATOM   3546 N NH2   . ARG B 2 343 ? -25.296 49.802 -5.580  1.00 53.76 ? 343 ARG A NH2   1 
ATOM   3547 N N     . ARG B 2 344 ? -24.886 52.675 0.787   1.00 46.75 ? 344 ARG A N     1 
ATOM   3548 C CA    . ARG B 2 344 ? -25.868 52.073 1.691   1.00 47.29 ? 344 ARG A CA    1 
ATOM   3549 C C     . ARG B 2 344 ? -27.118 51.637 0.919   1.00 47.40 ? 344 ARG A C     1 
ATOM   3550 O O     . ARG B 2 344 ? -27.764 52.460 0.262   1.00 49.06 ? 344 ARG A O     1 
ATOM   3551 C CB    . ARG B 2 344 ? -26.233 53.104 2.769   1.00 48.41 ? 344 ARG A CB    1 
ATOM   3552 C CG    . ARG B 2 344 ? -27.413 52.764 3.667   1.00 52.21 ? 344 ARG A CG    1 
ATOM   3553 C CD    . ARG B 2 344 ? -27.342 53.580 4.957   1.00 53.28 ? 344 ARG A CD    1 
ATOM   3554 N NE    . ARG B 2 344 ? -26.143 53.228 5.720   1.00 54.88 ? 344 ARG A NE    1 
ATOM   3555 C CZ    . ARG B 2 344 ? -25.697 53.897 6.782   1.00 56.05 ? 344 ARG A CZ    1 
ATOM   3556 N NH1   . ARG B 2 344 ? -26.351 54.970 7.212   1.00 56.75 ? 344 ARG A NH1   1 
ATOM   3557 N NH2   . ARG B 2 344 ? -24.608 53.486 7.429   1.00 54.89 ? 344 ARG A NH2   1 
ATOM   3558 N N     . MET B 2 345 ? -27.456 50.351 0.994   1.00 45.24 ? 345 MET A N     1 
ATOM   3559 C CA    . MET B 2 345 ? -28.624 49.827 0.292   1.00 43.27 ? 345 MET A CA    1 
ATOM   3560 C C     . MET B 2 345 ? -29.912 50.339 0.910   1.00 42.55 ? 345 MET A C     1 
ATOM   3561 O O     . MET B 2 345 ? -30.126 50.233 2.116   1.00 42.49 ? 345 MET A O     1 
ATOM   3562 C CB    . MET B 2 345 ? -28.611 48.297 0.313   1.00 42.60 ? 345 MET A CB    1 
ATOM   3563 C CG    . MET B 2 345 ? -29.649 47.649 -0.582  1.00 42.72 ? 345 MET A CG    1 
ATOM   3564 S SD    . MET B 2 345 ? -29.469 45.853 -0.706  1.00 45.99 ? 345 MET A SD    1 
ATOM   3565 C CE    . MET B 2 345 ? -30.188 45.348 0.842   1.00 45.61 ? 345 MET A CE    1 
ATOM   3566 N N     . GLY B 2 346 ? -30.767 50.907 0.070   1.00 42.91 ? 346 GLY A N     1 
ATOM   3567 C CA    . GLY B 2 346 ? -32.037 51.425 0.535   1.00 42.23 ? 346 GLY A CA    1 
ATOM   3568 C C     . GLY B 2 346 ? -33.158 50.519 0.073   1.00 41.90 ? 346 GLY A C     1 
ATOM   3569 O O     . GLY B 2 346 ? -32.906 49.433 -0.448  1.00 40.15 ? 346 GLY A O     1 
ATOM   3570 N N     . PRO B 2 347 ? -34.417 50.932 0.259   1.00 42.21 ? 347 PRO A N     1 
ATOM   3571 C CA    . PRO B 2 347 ? -35.560 50.112 -0.166  1.00 41.52 ? 347 PRO A CA    1 
ATOM   3572 C C     . PRO B 2 347 ? -35.710 49.981 -1.688  1.00 41.95 ? 347 PRO A C     1 
ATOM   3573 O O     . PRO B 2 347 ? -35.042 50.682 -2.459  1.00 40.12 ? 347 PRO A O     1 
ATOM   3574 C CB    . PRO B 2 347 ? -36.748 50.839 0.456   1.00 41.21 ? 347 PRO A CB    1 
ATOM   3575 C CG    . PRO B 2 347 ? -36.281 52.278 0.490   1.00 41.16 ? 347 PRO A CG    1 
ATOM   3576 C CD    . PRO B 2 347 ? -34.866 52.142 0.970   1.00 39.98 ? 347 PRO A CD    1 
ATOM   3577 N N     . GLN B 2 348 ? -36.586 49.075 -2.117  1.00 42.82 ? 348 GLN A N     1 
ATOM   3578 C CA    . GLN B 2 348 ? -36.845 48.899 -3.545  1.00 43.31 ? 348 GLN A CA    1 
ATOM   3579 C C     . GLN B 2 348 ? -37.729 50.078 -3.975  1.00 42.75 ? 348 GLN A C     1 
ATOM   3580 O O     . GLN B 2 348 ? -38.491 50.600 -3.163  1.00 42.58 ? 348 GLN A O     1 
ATOM   3581 C CB    . GLN B 2 348 ? -37.526 47.547 -3.798  1.00 44.14 ? 348 GLN A CB    1 
ATOM   3582 C CG    . GLN B 2 348 ? -36.613 46.378 -3.458  1.00 46.53 ? 348 GLN A CG    1 
ATOM   3583 C CD    . GLN B 2 348 ? -37.068 45.061 -4.042  1.00 48.61 ? 348 GLN A CD    1 
ATOM   3584 O OE1   . GLN B 2 348 ? -38.190 44.620 -3.814  1.00 48.98 ? 348 GLN A OE1   1 
ATOM   3585 N NE2   . GLN B 2 348 ? -36.186 44.416 -4.800  1.00 51.17 ? 348 GLN A NE2   1 
ATOM   3586 N N     . PHE B 2 349 ? -37.638 50.502 -5.234  1.00 42.21 ? 349 PHE A N     1 
ATOM   3587 C CA    . PHE B 2 349 ? -38.402 51.669 -5.686  1.00 41.90 ? 349 PHE A CA    1 
ATOM   3588 C C     . PHE B 2 349 ? -39.902 51.718 -5.410  1.00 42.57 ? 349 PHE A C     1 
ATOM   3589 O O     . PHE B 2 349 ? -40.413 52.777 -5.070  1.00 43.92 ? 349 PHE A O     1 
ATOM   3590 C CB    . PHE B 2 349 ? -38.141 51.931 -7.176  1.00 41.01 ? 349 PHE A CB    1 
ATOM   3591 C CG    . PHE B 2 349 ? -38.942 51.067 -8.108  1.00 41.52 ? 349 PHE A CG    1 
ATOM   3592 C CD1   . PHE B 2 349 ? -40.252 51.405 -8.443  1.00 40.86 ? 349 PHE A CD1   1 
ATOM   3593 C CD2   . PHE B 2 349 ? -38.384 49.922 -8.665  1.00 40.49 ? 349 PHE A CD2   1 
ATOM   3594 C CE1   . PHE B 2 349 ? -40.990 50.621 -9.322  1.00 42.14 ? 349 PHE A CE1   1 
ATOM   3595 C CE2   . PHE B 2 349 ? -39.113 49.127 -9.546  1.00 41.20 ? 349 PHE A CE2   1 
ATOM   3596 C CZ    . PHE B 2 349 ? -40.421 49.478 -9.875  1.00 41.57 ? 349 PHE A CZ    1 
ATOM   3597 N N     . GLU B 2 350 ? -40.607 50.595 -5.529  1.00 42.24 ? 350 GLU A N     1 
ATOM   3598 C CA    . GLU B 2 350 ? -42.049 50.599 -5.307  1.00 43.40 ? 350 GLU A CA    1 
ATOM   3599 C C     . GLU B 2 350 ? -42.564 50.587 -3.861  1.00 43.55 ? 350 GLU A C     1 
ATOM   3600 O O     . GLU B 2 350 ? -43.756 50.425 -3.621  1.00 42.87 ? 350 GLU A O     1 
ATOM   3601 C CB    . GLU B 2 350 ? -42.717 49.467 -6.107  1.00 43.46 ? 350 GLU A CB    1 
ATOM   3602 C CG    . GLU B 2 350 ? -42.185 48.076 -5.889  1.00 43.00 ? 350 GLU A CG    1 
ATOM   3603 C CD    . GLU B 2 350 ? -41.090 47.704 -6.867  1.00 45.45 ? 350 GLU A CD    1 
ATOM   3604 O OE1   . GLU B 2 350 ? -39.955 48.192 -6.697  1.00 47.62 ? 350 GLU A OE1   1 
ATOM   3605 O OE2   . GLU B 2 350 ? -41.365 46.925 -7.809  1.00 44.78 ? 350 GLU A OE2   1 
ATOM   3606 N N     . ASP B 2 351 ? -41.680 50.784 -2.896  1.00 45.07 ? 351 ASP A N     1 
ATOM   3607 C CA    . ASP B 2 351 ? -42.110 50.793 -1.509  1.00 47.52 ? 351 ASP A CA    1 
ATOM   3608 C C     . ASP B 2 351 ? -41.973 52.296 -1.314  1.00 48.36 ? 351 ASP A C     1 
ATOM   3609 O O     . ASP B 2 351 ? -40.904 52.801 -0.988  1.00 47.35 ? 351 ASP A O     1 
ATOM   3610 C CB    . ASP B 2 351 ? -41.165 49.938 -0.659  1.00 49.50 ? 351 ASP A CB    1 
ATOM   3611 C CG    . ASP B 2 351 ? -41.669 49.742 0.764   1.00 51.99 ? 351 ASP A CG    1 
ATOM   3612 O OD1   . ASP B 2 351 ? -40.937 49.120 1.573   1.00 51.65 ? 351 ASP A OD1   1 
ATOM   3613 O OD2   . ASP B 2 351 ? -42.796 50.208 1.065   1.00 52.55 ? 351 ASP A OD2   1 
ATOM   3614 N N     . GLU B 2 352 ? -43.077 53.003 -1.522  1.00 49.47 ? 352 GLU A N     1 
ATOM   3615 C CA    . GLU B 2 352 ? -43.220 54.414 -1.177  1.00 51.66 ? 352 GLU A CA    1 
ATOM   3616 C C     . GLU B 2 352 ? -43.005 54.740 0.303   1.00 51.85 ? 352 GLU A C     1 
ATOM   3617 O O     . GLU B 2 352 ? -42.376 55.744 0.637   1.00 51.74 ? 352 GLU A O     1 
ATOM   3618 C CB    . GLU B 2 352 ? -44.600 54.909 -1.610  1.00 53.99 ? 352 GLU A CB    1 
ATOM   3619 C CG    . GLU B 2 352 ? -44.827 56.395 -1.392  1.00 59.58 ? 352 GLU A CG    1 
ATOM   3620 C CD    . GLU B 2 352 ? -46.248 56.831 -1.731  1.00 63.13 ? 352 GLU A CD    1 
ATOM   3621 O OE1   . GLU B 2 352 ? -46.549 57.062 -2.928  1.00 63.77 ? 352 GLU A OE1   1 
ATOM   3622 O OE2   . GLU B 2 352 ? -47.071 56.931 -0.789  1.00 65.06 ? 352 GLU A OE2   1 
ATOM   3623 N N     . ARG B 2 353 ? -43.520 53.895 1.190   1.00 52.38 ? 353 ARG A N     1 
ATOM   3624 C CA    . ARG B 2 353 ? -43.381 54.139 2.624   1.00 53.11 ? 353 ARG A CA    1 
ATOM   3625 C C     . ARG B 2 353 ? -41.924 54.288 3.054   1.00 52.55 ? 353 ARG A C     1 
ATOM   3626 O O     . ARG B 2 353 ? -41.533 55.303 3.623   1.00 52.72 ? 353 ARG A O     1 
ATOM   3627 C CB    . ARG B 2 353 ? -44.027 53.002 3.425   1.00 55.35 ? 353 ARG A CB    1 
ATOM   3628 C CG    . ARG B 2 353 ? -44.019 53.216 4.945   1.00 56.69 ? 353 ARG A CG    1 
ATOM   3629 C CD    . ARG B 2 353 ? -45.433 53.404 5.469   1.00 60.38 ? 353 ARG A CD    1 
ATOM   3630 N NE    . ARG B 2 353 ? -46.110 54.481 4.747   1.00 63.71 ? 353 ARG A NE    1 
ATOM   3631 C CZ    . ARG B 2 353 ? -47.354 54.893 4.976   1.00 64.39 ? 353 ARG A CZ    1 
ATOM   3632 N NH1   . ARG B 2 353 ? -48.091 54.315 5.922   1.00 66.27 ? 353 ARG A NH1   1 
ATOM   3633 N NH2   . ARG B 2 353 ? -47.855 55.894 4.257   1.00 64.68 ? 353 ARG A NH2   1 
ATOM   3634 N N     . ASN B 2 354 ? -41.119 53.271 2.779   1.00 51.87 ? 354 ASN A N     1 
ATOM   3635 C CA    . ASN B 2 354 ? -39.727 53.305 3.176   1.00 51.22 ? 354 ASN A CA    1 
ATOM   3636 C C     . ASN B 2 354 ? -38.855 54.231 2.347   1.00 49.65 ? 354 ASN A C     1 
ATOM   3637 O O     . ASN B 2 354 ? -37.960 54.875 2.882   1.00 49.65 ? 354 ASN A O     1 
ATOM   3638 C CB    . ASN B 2 354 ? -39.171 51.887 3.189   1.00 52.55 ? 354 ASN A CB    1 
ATOM   3639 C CG    . ASN B 2 354 ? -39.847 51.023 4.248   1.00 55.16 ? 354 ASN A CG    1 
ATOM   3640 O OD1   . ASN B 2 354 ? -39.930 51.407 5.424   1.00 53.80 ? 354 ASN A OD1   1 
ATOM   3641 N ND2   . ASN B 2 354 ? -40.340 49.854 3.838   1.00 57.21 ? 354 ASN A ND2   1 
ATOM   3642 N N     . VAL B 2 355 ? -39.111 54.306 1.048   1.00 47.74 ? 355 VAL A N     1 
ATOM   3643 C CA    . VAL B 2 355 ? -38.339 55.191 0.189   1.00 45.59 ? 355 VAL A CA    1 
ATOM   3644 C C     . VAL B 2 355 ? -38.378 56.588 0.797   1.00 44.87 ? 355 VAL A C     1 
ATOM   3645 O O     . VAL B 2 355 ? -37.360 57.263 0.908   1.00 43.18 ? 355 VAL A O     1 
ATOM   3646 C CB    . VAL B 2 355 ? -38.942 55.253 -1.234  1.00 44.40 ? 355 VAL A CB    1 
ATOM   3647 C CG1   . VAL B 2 355 ? -38.252 56.335 -2.050  1.00 40.81 ? 355 VAL A CG1   1 
ATOM   3648 C CG2   . VAL B 2 355 ? -38.817 53.902 -1.913  1.00 41.64 ? 355 VAL A CG2   1 
ATOM   3649 N N     . LYS B 2 356 ? -39.569 57.003 1.207   1.00 45.42 ? 356 LYS A N     1 
ATOM   3650 C CA    . LYS B 2 356 ? -39.756 58.320 1.783   1.00 47.19 ? 356 LYS A CA    1 
ATOM   3651 C C     . LYS B 2 356 ? -38.889 58.472 3.014   1.00 47.01 ? 356 LYS A C     1 
ATOM   3652 O O     . LYS B 2 356 ? -38.162 59.451 3.147   1.00 48.18 ? 356 LYS A O     1 
ATOM   3653 C CB    . LYS B 2 356 ? -41.233 58.550 2.134   1.00 49.22 ? 356 LYS A CB    1 
ATOM   3654 C CG    . LYS B 2 356 ? -41.628 60.024 2.347   1.00 50.81 ? 356 LYS A CG    1 
ATOM   3655 C CD    . LYS B 2 356 ? -43.145 60.178 2.513   1.00 53.42 ? 356 LYS A CD    1 
ATOM   3656 C CE    . LYS B 2 356 ? -43.527 61.598 2.937   1.00 54.41 ? 356 LYS A CE    1 
ATOM   3657 N NZ    . LYS B 2 356 ? -44.984 61.732 3.246   1.00 51.83 ? 356 LYS A NZ    1 
ATOM   3658 N N     . LYS B 2 357 ? -38.955 57.515 3.926   1.00 47.19 ? 357 LYS A N     1 
ATOM   3659 C CA    . LYS B 2 357 ? -38.122 57.623 5.109   1.00 47.88 ? 357 LYS A CA    1 
ATOM   3660 C C     . LYS B 2 357 ? -36.656 57.665 4.677   1.00 47.28 ? 357 LYS A C     1 
ATOM   3661 O O     . LYS B 2 357 ? -35.920 58.563 5.066   1.00 47.81 ? 357 LYS A O     1 
ATOM   3662 C CB    . LYS B 2 357 ? -38.391 56.454 6.057   1.00 48.15 ? 357 LYS A CB    1 
ATOM   3663 C CG    . LYS B 2 357 ? -39.825 56.438 6.569   1.00 50.09 ? 357 LYS A CG    1 
ATOM   3664 C CD    . LYS B 2 357 ? -40.066 55.326 7.588   1.00 51.61 ? 357 LYS A CD    1 
ATOM   3665 C CE    . LYS B 2 357 ? -39.230 55.549 8.849   1.00 54.01 ? 357 LYS A CE    1 
ATOM   3666 N NZ    . LYS B 2 357 ? -39.545 54.597 9.957   1.00 55.24 ? 357 LYS A NZ    1 
ATOM   3667 N N     . PHE B 2 358 ? -36.244 56.717 3.844   1.00 47.12 ? 358 PHE A N     1 
ATOM   3668 C CA    . PHE B 2 358 ? -34.863 56.656 3.360   1.00 46.96 ? 358 PHE A CA    1 
ATOM   3669 C C     . PHE B 2 358 ? -34.391 57.976 2.748   1.00 47.61 ? 358 PHE A C     1 
ATOM   3670 O O     . PHE B 2 358 ? -33.191 58.256 2.704   1.00 47.64 ? 358 PHE A O     1 
ATOM   3671 C CB    . PHE B 2 358 ? -34.719 55.545 2.317   1.00 46.16 ? 358 PHE A CB    1 
ATOM   3672 C CG    . PHE B 2 358 ? -33.300 55.274 1.910   1.00 45.48 ? 358 PHE A CG    1 
ATOM   3673 C CD1   . PHE B 2 358 ? -32.383 54.797 2.831   1.00 43.66 ? 358 PHE A CD1   1 
ATOM   3674 C CD2   . PHE B 2 358 ? -32.889 55.461 0.592   1.00 45.37 ? 358 PHE A CD2   1 
ATOM   3675 C CE1   . PHE B 2 358 ? -31.085 54.508 2.444   1.00 43.51 ? 358 PHE A CE1   1 
ATOM   3676 C CE2   . PHE B 2 358 ? -31.590 55.173 0.197   1.00 42.52 ? 358 PHE A CE2   1 
ATOM   3677 C CZ    . PHE B 2 358 ? -30.691 54.697 1.121   1.00 42.48 ? 358 PHE A CZ    1 
ATOM   3678 N N     . LEU B 2 359 ? -35.328 58.782 2.265   1.00 47.63 ? 359 LEU A N     1 
ATOM   3679 C CA    . LEU B 2 359 ? -34.955 60.051 1.667   1.00 48.93 ? 359 LEU A CA    1 
ATOM   3680 C C     . LEU B 2 359 ? -35.054 61.226 2.637   1.00 51.45 ? 359 LEU A C     1 
ATOM   3681 O O     . LEU B 2 359 ? -34.428 62.266 2.419   1.00 51.80 ? 359 LEU A O     1 
ATOM   3682 C CB    . LEU B 2 359 ? -35.809 60.335 0.431   1.00 45.31 ? 359 LEU A CB    1 
ATOM   3683 C CG    . LEU B 2 359 ? -35.615 59.402 -0.761  1.00 44.12 ? 359 LEU A CG    1 
ATOM   3684 C CD1   . LEU B 2 359 ? -36.278 60.020 -1.976  1.00 43.36 ? 359 LEU A CD1   1 
ATOM   3685 C CD2   . LEU B 2 359 ? -34.140 59.188 -1.034  1.00 42.79 ? 359 LEU A CD2   1 
ATOM   3686 N N     . SER B 2 360 ? -35.834 61.066 3.705   1.00 53.67 ? 360 SER A N     1 
ATOM   3687 C CA    . SER B 2 360 ? -35.997 62.141 4.682   1.00 55.63 ? 360 SER A CA    1 
ATOM   3688 C C     . SER B 2 360 ? -34.672 62.419 5.393   1.00 56.47 ? 360 SER A C     1 
ATOM   3689 O O     . SER B 2 360 ? -34.462 63.503 5.945   1.00 56.03 ? 360 SER A O     1 
ATOM   3690 C CB    . SER B 2 360 ? -37.092 61.787 5.705   1.00 56.26 ? 360 SER A CB    1 
ATOM   3691 O OG    . SER B 2 360 ? -36.731 60.695 6.537   1.00 59.58 ? 360 SER A OG    1 
ATOM   3692 N N     . ARG B 2 361 ? -33.785 61.427 5.364   1.00 57.50 ? 361 ARG A N     1 
ATOM   3693 C CA    . ARG B 2 361 ? -32.466 61.521 5.981   1.00 59.53 ? 361 ARG A CA    1 
ATOM   3694 C C     . ARG B 2 361 ? -31.584 62.422 5.134   1.00 59.83 ? 361 ARG A C     1 
ATOM   3695 O O     . ARG B 2 361 ? -31.083 62.002 4.093   1.00 61.08 ? 361 ARG A O     1 
ATOM   3696 C CB    . ARG B 2 361 ? -31.846 60.131 6.064   1.00 61.68 ? 361 ARG A CB    1 
ATOM   3697 C CG    . ARG B 2 361 ? -32.171 59.372 7.326   1.00 65.61 ? 361 ARG A CG    1 
ATOM   3698 C CD    . ARG B 2 361 ? -31.225 59.818 8.428   1.00 71.07 ? 361 ARG A CD    1 
ATOM   3699 N NE    . ARG B 2 361 ? -31.226 58.911 9.573   1.00 74.08 ? 361 ARG A NE    1 
ATOM   3700 C CZ    . ARG B 2 361 ? -30.239 58.839 10.463  1.00 75.65 ? 361 ARG A CZ    1 
ATOM   3701 N NH1   . ARG B 2 361 ? -29.173 59.621 10.334  1.00 77.02 ? 361 ARG A NH1   1 
ATOM   3702 N NH2   . ARG B 2 361 ? -30.315 57.989 11.482  1.00 77.59 ? 361 ARG A NH2   1 
ATOM   3703 N N     . ASN B 2 362 ? -31.385 63.662 5.562   1.00 60.50 ? 362 ASN A N     1 
ATOM   3704 C CA    . ASN B 2 362 ? -30.563 64.575 4.776   1.00 60.24 ? 362 ASN A CA    1 
ATOM   3705 C C     . ASN B 2 362 ? -29.144 64.028 4.726   1.00 58.19 ? 362 ASN A C     1 
ATOM   3706 O O     . ASN B 2 362 ? -28.565 63.666 5.746   1.00 57.57 ? 362 ASN A O     1 
ATOM   3707 C CB    . ASN B 2 362 ? -30.584 65.989 5.383   1.00 63.67 ? 362 ASN A CB    1 
ATOM   3708 C CG    . ASN B 2 362 ? -29.656 66.134 6.569   1.00 65.96 ? 362 ASN A CG    1 
ATOM   3709 O OD1   . ASN B 2 362 ? -29.616 65.273 7.451   1.00 67.89 ? 362 ASN A OD1   1 
ATOM   3710 N ND2   . ASN B 2 362 ? -28.909 67.235 6.604   1.00 66.62 ? 362 ASN A ND2   1 
ATOM   3711 N N     . ARG B 2 363 ? -28.599 63.937 3.524   1.00 56.04 ? 363 ARG A N     1 
ATOM   3712 C CA    . ARG B 2 363 ? -27.254 63.433 3.363   1.00 52.72 ? 363 ARG A CA    1 
ATOM   3713 C C     . ARG B 2 363 ? -26.471 64.441 2.551   1.00 51.39 ? 363 ARG A C     1 
ATOM   3714 O O     . ARG B 2 363 ? -27.043 65.357 1.951   1.00 52.23 ? 363 ARG A O     1 
ATOM   3715 C CB    . ARG B 2 363 ? -27.277 62.072 2.665   1.00 52.18 ? 363 ARG A CB    1 
ATOM   3716 C CG    . ARG B 2 363 ? -28.002 60.981 3.462   1.00 51.13 ? 363 ARG A CG    1 
ATOM   3717 C CD    . ARG B 2 363 ? -27.888 59.616 2.789   1.00 50.50 ? 363 ARG A CD    1 
ATOM   3718 N NE    . ARG B 2 363 ? -29.157 58.889 2.782   1.00 49.36 ? 363 ARG A NE    1 
ATOM   3719 C CZ    . ARG B 2 363 ? -29.585 58.106 3.764   1.00 50.12 ? 363 ARG A CZ    1 
ATOM   3720 N NH1   . ARG B 2 363 ? -28.845 57.926 4.857   1.00 51.88 ? 363 ARG A NH1   1 
ATOM   3721 N NH2   . ARG B 2 363 ? -30.765 57.508 3.656   1.00 49.51 ? 363 ARG A NH2   1 
ATOM   3722 N N     . ALA B 2 364 ? -25.157 64.272 2.536   1.00 49.23 ? 364 ALA A N     1 
ATOM   3723 C CA    . ALA B 2 364 ? -24.296 65.183 1.814   1.00 46.94 ? 364 ALA A CA    1 
ATOM   3724 C C     . ALA B 2 364 ? -24.292 64.908 0.323   1.00 45.86 ? 364 ALA A C     1 
ATOM   3725 O O     . ALA B 2 364 ? -23.965 65.791 -0.456  1.00 44.39 ? 364 ALA A O     1 
ATOM   3726 C CB    . ALA B 2 364 ? -22.884 65.095 2.360   1.00 46.57 ? 364 ALA A CB    1 
ATOM   3727 N N     . PHE B 2 365 ? -24.677 63.705 -0.095  1.00 45.60 ? 365 PHE A N     1 
ATOM   3728 C CA    . PHE B 2 365 ? -24.635 63.421 -1.521  1.00 44.17 ? 365 PHE A CA    1 
ATOM   3729 C C     . PHE B 2 365 ? -25.849 63.063 -2.364  1.00 46.16 ? 365 PHE A C     1 
ATOM   3730 O O     . PHE B 2 365 ? -25.682 62.835 -3.557  1.00 50.39 ? 365 PHE A O     1 
ATOM   3731 C CB    . PHE B 2 365 ? -23.549 62.394 -1.805  1.00 39.97 ? 365 PHE A CB    1 
ATOM   3732 C CG    . PHE B 2 365 ? -22.179 62.967 -1.802  1.00 36.26 ? 365 PHE A CG    1 
ATOM   3733 C CD1   . PHE B 2 365 ? -21.313 62.715 -0.759  1.00 33.93 ? 365 PHE A CD1   1 
ATOM   3734 C CD2   . PHE B 2 365 ? -21.763 63.779 -2.837  1.00 35.47 ? 365 PHE A CD2   1 
ATOM   3735 C CE1   . PHE B 2 365 ? -20.052 63.267 -0.747  1.00 35.01 ? 365 PHE A CE1   1 
ATOM   3736 C CE2   . PHE B 2 365 ? -20.501 64.338 -2.832  1.00 34.48 ? 365 PHE A CE2   1 
ATOM   3737 C CZ    . PHE B 2 365 ? -19.643 64.082 -1.786  1.00 35.13 ? 365 PHE A CZ    1 
ATOM   3738 N N     . ARG B 2 366 ? -27.056 62.994 -1.817  1.00 45.03 ? 366 ARG A N     1 
ATOM   3739 C CA    . ARG B 2 366 ? -28.192 62.696 -2.704  1.00 45.67 ? 366 ARG A CA    1 
ATOM   3740 C C     . ARG B 2 366 ? -28.330 61.346 -3.418  1.00 44.02 ? 366 ARG A C     1 
ATOM   3741 O O     . ARG B 2 366 ? -27.746 61.125 -4.480  1.00 42.52 ? 366 ARG A O     1 
ATOM   3742 C CB    . ARG B 2 366 ? -28.196 63.696 -3.883  1.00 46.89 ? 366 ARG A CB    1 
ATOM   3743 C CG    . ARG B 2 366 ? -29.241 63.453 -4.962  1.00 50.31 ? 366 ARG A CG    1 
ATOM   3744 C CD    . ARG B 2 366 ? -29.052 64.414 -6.135  1.00 53.81 ? 366 ARG A CD    1 
ATOM   3745 N NE    . ARG B 2 366 ? -29.223 65.824 -5.762  1.00 56.73 ? 366 ARG A NE    1 
ATOM   3746 C CZ    . ARG B 2 366 ? -30.400 66.432 -5.582  1.00 59.53 ? 366 ARG A CZ    1 
ATOM   3747 N NH1   . ARG B 2 366 ? -31.539 65.759 -5.740  1.00 59.60 ? 366 ARG A NH1   1 
ATOM   3748 N NH2   . ARG B 2 366 ? -30.439 67.724 -5.245  1.00 59.87 ? 366 ARG A NH2   1 
ATOM   3749 N N     . PRO B 2 367 ? -29.109 60.423 -2.838  1.00 43.35 ? 367 PRO A N     1 
ATOM   3750 C CA    . PRO B 2 367 ? -29.185 59.026 -3.283  1.00 43.26 ? 367 PRO A CA    1 
ATOM   3751 C C     . PRO B 2 367 ? -29.572 58.845 -4.747  1.00 42.34 ? 367 PRO A C     1 
ATOM   3752 O O     . PRO B 2 367 ? -30.003 59.789 -5.408  1.00 43.13 ? 367 PRO A O     1 
ATOM   3753 C CB    . PRO B 2 367 ? -30.210 58.414 -2.326  1.00 44.60 ? 367 PRO A CB    1 
ATOM   3754 C CG    . PRO B 2 367 ? -31.082 59.585 -1.966  1.00 45.70 ? 367 PRO A CG    1 
ATOM   3755 C CD    . PRO B 2 367 ? -30.078 60.687 -1.760  1.00 43.15 ? 367 PRO A CD    1 
ATOM   3756 N N     . PHE B 2 368 ? -29.418 57.622 -5.244  1.00 39.90 ? 368 PHE A N     1 
ATOM   3757 C CA    . PHE B 2 368 ? -29.741 57.319 -6.626  1.00 38.96 ? 368 PHE A CA    1 
ATOM   3758 C C     . PHE B 2 368 ? -30.365 55.934 -6.723  1.00 38.15 ? 368 PHE A C     1 
ATOM   3759 O O     . PHE B 2 368 ? -30.429 55.210 -5.731  1.00 37.72 ? 368 PHE A O     1 
ATOM   3760 C CB    . PHE B 2 368 ? -28.474 57.362 -7.482  1.00 39.58 ? 368 PHE A CB    1 
ATOM   3761 C CG    . PHE B 2 368 ? -27.410 56.399 -7.032  1.00 38.41 ? 368 PHE A CG    1 
ATOM   3762 C CD1   . PHE B 2 368 ? -26.505 56.754 -6.040  1.00 37.69 ? 368 PHE A CD1   1 
ATOM   3763 C CD2   . PHE B 2 368 ? -27.336 55.122 -7.576  1.00 37.71 ? 368 PHE A CD2   1 
ATOM   3764 C CE1   . PHE B 2 368 ? -25.545 55.855 -5.595  1.00 38.09 ? 368 PHE A CE1   1 
ATOM   3765 C CE2   . PHE B 2 368 ? -26.380 54.217 -7.133  1.00 38.68 ? 368 PHE A CE2   1 
ATOM   3766 C CZ    . PHE B 2 368 ? -25.484 54.584 -6.141  1.00 37.34 ? 368 PHE A CZ    1 
ATOM   3767 N N     . ILE B 2 369 ? -30.803 55.569 -7.929  1.00 37.00 ? 369 ILE A N     1 
ATOM   3768 C CA    . ILE B 2 369 ? -31.419 54.270 -8.176  1.00 36.99 ? 369 ILE A CA    1 
ATOM   3769 C C     . ILE B 2 369 ? -30.489 53.355 -8.977  1.00 37.71 ? 369 ILE A C     1 
ATOM   3770 O O     . ILE B 2 369 ? -29.678 53.811 -9.781  1.00 36.98 ? 369 ILE A O     1 
ATOM   3771 C CB    . ILE B 2 369 ? -32.760 54.427 -8.937  1.00 36.63 ? 369 ILE A CB    1 
ATOM   3772 C CG1   . ILE B 2 369 ? -33.738 55.245 -8.098  1.00 36.98 ? 369 ILE A CG1   1 
ATOM   3773 C CG2   . ILE B 2 369 ? -33.374 53.071 -9.216  1.00 34.81 ? 369 ILE A CG2   1 
ATOM   3774 C CD1   . ILE B 2 369 ? -35.002 55.618 -8.830  1.00 38.69 ? 369 ILE A CD1   1 
ATOM   3775 N N     . GLU B 2 370 ? -30.609 52.056 -8.741  1.00 39.03 ? 370 GLU A N     1 
ATOM   3776 C CA    . GLU B 2 370 ? -29.785 51.083 -9.428  1.00 40.75 ? 370 GLU A CA    1 
ATOM   3777 C C     . GLU B 2 370 ? -30.673 49.872 -9.255  1.00 42.26 ? 370 GLU A C     1 
ATOM   3778 O O     . GLU B 2 370 ? -31.173 49.603 -8.158  1.00 43.96 ? 370 GLU A O     1 
ATOM   3779 C CB    . GLU B 2 370 ? -28.373 51.096 -8.858  1.00 43.09 ? 370 GLU A CB    1 
ATOM   3780 C CG    . GLU B 2 370 ? -27.433 50.070 -9.486  1.00 44.16 ? 370 GLU A CG    1 
ATOM   3781 C CD    . GLU B 2 370 ? -26.063 50.055 -8.822  1.00 44.78 ? 370 GLU A CD    1 
ATOM   3782 O OE1   . GLU B 2 370 ? -25.313 51.050 -8.955  1.00 43.10 ? 370 GLU A OE1   1 
ATOM   3783 O OE2   . GLU B 2 370 ? -25.744 49.044 -8.161  1.00 45.19 ? 370 GLU A OE2   1 
ATOM   3784 N N     . ASN B 2 371 ? -30.877 49.145 -10.345 1.00 42.11 ? 371 ASN A N     1 
ATOM   3785 C CA    . ASN B 2 371 ? -31.491 47.827 -10.305 1.00 42.13 ? 371 ASN A CA    1 
ATOM   3786 C C     . ASN B 2 371 ? -32.732 47.769 -9.404  1.00 41.97 ? 371 ASN A C     1 
ATOM   3787 O O     . ASN B 2 371 ? -32.851 46.910 -8.523  1.00 43.24 ? 371 ASN A O     1 
ATOM   3788 C CB    . ASN B 2 371 ? -30.453 46.793 -9.869  1.00 42.28 ? 371 ASN A CB    1 
ATOM   3789 C CG    . ASN B 2 371 ? -29.268 46.746 -10.808 1.00 44.78 ? 371 ASN A CG    1 
ATOM   3790 O OD1   . ASN B 2 371 ? -29.408 46.382 -11.972 1.00 47.48 ? 371 ASN A OD1   1 
ATOM   3791 N ND2   . ASN B 2 371 ? -28.095 47.131 -10.314 1.00 46.54 ? 371 ASN A ND2   1 
ATOM   3792 N N     . GLY B 2 372 ? -33.649 48.706 -9.620  1.00 40.86 ? 372 GLY A N     1 
ATOM   3793 C CA    . GLY B 2 372 ? -34.891 48.705 -8.875  1.00 41.49 ? 372 GLY A CA    1 
ATOM   3794 C C     . GLY B 2 372 ? -34.899 49.194 -7.445  1.00 41.27 ? 372 GLY A C     1 
ATOM   3795 O O     . GLY B 2 372 ? -35.961 49.219 -6.815  1.00 41.86 ? 372 GLY A O     1 
ATOM   3796 N N     . ARG B 2 373 ? -33.748 49.570 -6.904  1.00 40.68 ? 373 ARG A N     1 
ATOM   3797 C CA    . ARG B 2 373 ? -33.746 50.069 -5.541  1.00 41.43 ? 373 ARG A CA    1 
ATOM   3798 C C     . ARG B 2 373 ? -32.887 51.287 -5.339  1.00 40.45 ? 373 ARG A C     1 
ATOM   3799 O O     . ARG B 2 373 ? -32.008 51.594 -6.142  1.00 40.60 ? 373 ARG A O     1 
ATOM   3800 C CB    . ARG B 2 373 ? -33.345 48.980 -4.554  1.00 41.87 ? 373 ARG A CB    1 
ATOM   3801 C CG    . ARG B 2 373 ? -31.948 48.458 -4.675  1.00 44.19 ? 373 ARG A CG    1 
ATOM   3802 C CD    . ARG B 2 373 ? -31.889 47.137 -3.918  1.00 47.79 ? 373 ARG A CD    1 
ATOM   3803 N NE    . ARG B 2 373 ? -32.529 47.253 -2.608  1.00 50.30 ? 373 ARG A NE    1 
ATOM   3804 C CZ    . ARG B 2 373 ? -33.204 46.273 -2.011  1.00 51.08 ? 373 ARG A CZ    1 
ATOM   3805 N NH1   . ARG B 2 373 ? -33.330 45.099 -2.615  1.00 51.90 ? 373 ARG A NH1   1 
ATOM   3806 N NH2   . ARG B 2 373 ? -33.753 46.469 -0.815  1.00 49.29 ? 373 ARG A NH2   1 
ATOM   3807 N N     . TRP B 2 374 ? -33.165 51.995 -4.255  1.00 38.65 ? 374 TRP A N     1 
ATOM   3808 C CA    . TRP B 2 374 ? -32.420 53.189 -3.947  1.00 38.22 ? 374 TRP A CA    1 
ATOM   3809 C C     . TRP B 2 374 ? -31.158 52.879 -3.171  1.00 38.19 ? 374 TRP A C     1 
ATOM   3810 O O     . TRP B 2 374 ? -31.085 51.895 -2.444  1.00 38.66 ? 374 TRP A O     1 
ATOM   3811 C CB    . TRP B 2 374 ? -33.286 54.160 -3.158  1.00 38.54 ? 374 TRP A CB    1 
ATOM   3812 C CG    . TRP B 2 374 ? -34.356 54.814 -3.975  1.00 40.10 ? 374 TRP A CG    1 
ATOM   3813 C CD1   . TRP B 2 374 ? -35.604 54.322 -4.257  1.00 40.38 ? 374 TRP A CD1   1 
ATOM   3814 C CD2   . TRP B 2 374 ? -34.292 56.110 -4.573  1.00 39.85 ? 374 TRP A CD2   1 
ATOM   3815 N NE1   . TRP B 2 374 ? -36.320 55.239 -4.987  1.00 39.91 ? 374 TRP A NE1   1 
ATOM   3816 C CE2   . TRP B 2 374 ? -35.537 56.344 -5.194  1.00 40.44 ? 374 TRP A CE2   1 
ATOM   3817 C CE3   . TRP B 2 374 ? -33.302 57.097 -4.644  1.00 39.61 ? 374 TRP A CE3   1 
ATOM   3818 C CZ2   . TRP B 2 374 ? -35.817 57.535 -5.869  1.00 42.01 ? 374 TRP A CZ2   1 
ATOM   3819 C CZ3   . TRP B 2 374 ? -33.578 58.277 -5.314  1.00 40.08 ? 374 TRP A CZ3   1 
ATOM   3820 C CH2   . TRP B 2 374 ? -34.824 58.487 -5.918  1.00 42.07 ? 374 TRP A CH2   1 
ATOM   3821 N N     . TRP B 2 375 ? -30.158 53.728 -3.359  1.00 37.39 ? 375 TRP A N     1 
ATOM   3822 C CA    . TRP B 2 375 ? -28.884 53.597 -2.686  1.00 37.43 ? 375 TRP A CA    1 
ATOM   3823 C C     . TRP B 2 375 ? -28.484 54.977 -2.209  1.00 38.88 ? 375 TRP A C     1 
ATOM   3824 O O     . TRP B 2 375 ? -29.011 55.978 -2.691  1.00 40.74 ? 375 TRP A O     1 
ATOM   3825 C CB    . TRP B 2 375 ? -27.832 53.065 -3.645  1.00 35.26 ? 375 TRP A CB    1 
ATOM   3826 C CG    . TRP B 2 375 ? -28.122 51.702 -4.102  1.00 34.59 ? 375 TRP A CG    1 
ATOM   3827 C CD1   . TRP B 2 375 ? -28.999 51.333 -5.070  1.00 33.15 ? 375 TRP A CD1   1 
ATOM   3828 C CD2   . TRP B 2 375 ? -27.544 50.497 -3.595  1.00 34.16 ? 375 TRP A CD2   1 
ATOM   3829 N NE1   . TRP B 2 375 ? -29.008 49.966 -5.201  1.00 34.27 ? 375 TRP A NE1   1 
ATOM   3830 C CE2   . TRP B 2 375 ? -28.127 49.428 -4.305  1.00 33.20 ? 375 TRP A CE2   1 
ATOM   3831 C CE3   . TRP B 2 375 ? -26.596 50.218 -2.604  1.00 34.07 ? 375 TRP A CE3   1 
ATOM   3832 C CZ2   . TRP B 2 375 ? -27.784 48.099 -4.062  1.00 33.72 ? 375 TRP A CZ2   1 
ATOM   3833 C CZ3   . TRP B 2 375 ? -26.256 48.899 -2.362  1.00 32.52 ? 375 TRP A CZ3   1 
ATOM   3834 C CH2   . TRP B 2 375 ? -26.851 47.855 -3.086  1.00 32.81 ? 375 TRP A CH2   1 
ATOM   3835 N N     . ALA B 2 376 ? -27.549 55.034 -1.270  1.00 38.95 ? 376 ALA A N     1 
ATOM   3836 C CA    . ALA B 2 376 ? -27.094 56.313 -0.738  1.00 38.30 ? 376 ALA A CA    1 
ATOM   3837 C C     . ALA B 2 376 ? -25.585 56.344 -0.488  1.00 37.84 ? 376 ALA A C     1 
ATOM   3838 O O     . ALA B 2 376 ? -24.976 55.336 -0.127  1.00 36.68 ? 376 ALA A O     1 
ATOM   3839 C CB    . ALA B 2 376 ? -27.836 56.629 0.559   1.00 37.79 ? 376 ALA A CB    1 
ATOM   3840 N N     . PHE B 2 377 ? -24.983 57.506 -0.697  1.00 36.47 ? 377 PHE A N     1 
ATOM   3841 C CA    . PHE B 2 377 ? -23.566 57.642 -0.458  1.00 36.92 ? 377 PHE A CA    1 
ATOM   3842 C C     . PHE B 2 377 ? -23.474 58.070 0.984   1.00 37.96 ? 377 PHE A C     1 
ATOM   3843 O O     . PHE B 2 377 ? -24.275 58.877 1.430   1.00 37.11 ? 377 PHE A O     1 
ATOM   3844 C CB    . PHE B 2 377 ? -22.970 58.697 -1.382  1.00 35.36 ? 377 PHE A CB    1 
ATOM   3845 C CG    . PHE B 2 377 ? -22.797 58.227 -2.790  1.00 36.09 ? 377 PHE A CG    1 
ATOM   3846 C CD1   . PHE B 2 377 ? -23.240 58.999 -3.855  1.00 35.39 ? 377 PHE A CD1   1 
ATOM   3847 C CD2   . PHE B 2 377 ? -22.174 57.017 -3.056  1.00 36.42 ? 377 PHE A CD2   1 
ATOM   3848 C CE1   . PHE B 2 377 ? -23.063 58.577 -5.166  1.00 33.93 ? 377 PHE A CE1   1 
ATOM   3849 C CE2   . PHE B 2 377 ? -21.994 56.585 -4.366  1.00 36.50 ? 377 PHE A CE2   1 
ATOM   3850 C CZ    . PHE B 2 377 ? -22.440 57.371 -5.424  1.00 35.48 ? 377 PHE A CZ    1 
ATOM   3851 N N     . GLU B 2 378 ? -22.515 57.519 1.716   1.00 39.24 ? 378 GLU A N     1 
ATOM   3852 C CA    . GLU B 2 378 ? -22.366 57.854 3.120   1.00 41.78 ? 378 GLU A CA    1 
ATOM   3853 C C     . GLU B 2 378 ? -20.878 58.018 3.435   1.00 42.40 ? 378 GLU A C     1 
ATOM   3854 O O     . GLU B 2 378 ? -20.032 57.430 2.760   1.00 42.67 ? 378 GLU A O     1 
ATOM   3855 C CB    . GLU B 2 378 ? -22.968 56.742 3.981   1.00 43.59 ? 378 GLU A CB    1 
ATOM   3856 C CG    . GLU B 2 378 ? -23.771 57.216 5.190   1.00 47.89 ? 378 GLU A CG    1 
ATOM   3857 C CD    . GLU B 2 378 ? -25.254 57.406 4.879   1.00 49.35 ? 378 GLU A CD    1 
ATOM   3858 O OE1   . GLU B 2 378 ? -25.588 58.298 4.071   1.00 53.10 ? 378 GLU A OE1   1 
ATOM   3859 O OE2   . GLU B 2 378 ? -26.093 56.666 5.437   1.00 49.86 ? 378 GLU A OE2   1 
ATOM   3860 N N     . MET B 2 379 ? -20.574 58.814 4.462   1.00 41.09 ? 379 MET A N     1 
ATOM   3861 C CA    . MET B 2 379 ? -19.201 59.079 4.884   1.00 39.64 ? 379 MET A CA    1 
ATOM   3862 C C     . MET B 2 379 ? -18.845 58.280 6.137   1.00 39.12 ? 379 MET A C     1 
ATOM   3863 O O     . MET B 2 379 ? -19.666 58.137 7.039   1.00 38.67 ? 379 MET A O     1 
ATOM   3864 C CB    . MET B 2 379 ? -19.032 60.567 5.169   1.00 41.04 ? 379 MET A CB    1 
ATOM   3865 C CG    . MET B 2 379 ? -19.488 61.471 4.045   1.00 40.82 ? 379 MET A CG    1 
ATOM   3866 S SD    . MET B 2 379 ? -18.622 61.112 2.505   1.00 45.19 ? 379 MET A SD    1 
ATOM   3867 C CE    . MET B 2 379 ? -17.118 62.113 2.658   1.00 42.04 ? 379 MET A CE    1 
ATOM   3868 N N     . ARG B 2 380 ? -17.614 57.774 6.191   1.00 37.68 ? 380 ARG A N     1 
ATOM   3869 C CA    . ARG B 2 380 ? -17.149 56.969 7.315   1.00 35.95 ? 380 ARG A CA    1 
ATOM   3870 C C     . ARG B 2 380 ? -16.585 57.819 8.441   1.00 36.98 ? 380 ARG A C     1 
ATOM   3871 O O     . ARG B 2 380 ? -16.230 58.971 8.228   1.00 36.11 ? 380 ARG A O     1 
ATOM   3872 C CB    . ARG B 2 380 ? -16.061 55.996 6.855   1.00 34.72 ? 380 ARG A CB    1 
ATOM   3873 C CG    . ARG B 2 380 ? -16.506 54.931 5.874   1.00 32.78 ? 380 ARG A CG    1 
ATOM   3874 C CD    . ARG B 2 380 ? -15.397 53.903 5.694   1.00 32.07 ? 380 ARG A CD    1 
ATOM   3875 N NE    . ARG B 2 380 ? -15.816 52.737 4.914   1.00 34.18 ? 380 ARG A NE    1 
ATOM   3876 C CZ    . ARG B 2 380 ? -15.998 52.725 3.595   1.00 34.70 ? 380 ARG A CZ    1 
ATOM   3877 N NH1   . ARG B 2 380 ? -15.799 53.819 2.875   1.00 37.49 ? 380 ARG A NH1   1 
ATOM   3878 N NH2   . ARG B 2 380 ? -16.385 51.613 2.995   1.00 34.16 ? 380 ARG A NH2   1 
ATOM   3879 N N     . LYS B 2 381 ? -16.500 57.248 9.643   1.00 39.83 ? 381 LYS A N     1 
ATOM   3880 C CA    . LYS B 2 381 ? -15.938 57.970 10.787  1.00 41.62 ? 381 LYS A CA    1 
ATOM   3881 C C     . LYS B 2 381 ? -14.421 57.773 10.834  1.00 39.90 ? 381 LYS A C     1 
ATOM   3882 O O     . LYS B 2 381 ? -13.718 58.520 11.503  1.00 40.73 ? 381 LYS A O     1 
ATOM   3883 C CB    . LYS B 2 381 ? -16.553 57.483 12.103  1.00 45.05 ? 381 LYS A CB    1 
ATOM   3884 C CG    . LYS B 2 381 ? -17.937 58.039 12.429  1.00 47.90 ? 381 LYS A CG    1 
ATOM   3885 C CD    . LYS B 2 381 ? -17.865 59.382 13.146  1.00 48.37 ? 381 LYS A CD    1 
ATOM   3886 C CE    . LYS B 2 381 ? -19.213 59.765 13.764  1.00 48.15 ? 381 LYS A CE    1 
ATOM   3887 N NZ    . LYS B 2 381 ? -20.272 60.104 12.756  1.00 50.05 ? 381 LYS A NZ    1 
ATOM   3888 N N     . PHE B 2 382 ? -13.932 56.754 10.130  1.00 38.37 ? 382 PHE A N     1 
ATOM   3889 C CA    . PHE B 2 382 ? -12.502 56.456 10.066  1.00 38.33 ? 382 PHE A CA    1 
ATOM   3890 C C     . PHE B 2 382 ? -12.146 55.852 8.709   1.00 37.58 ? 382 PHE A C     1 
ATOM   3891 O O     . PHE B 2 382 ? -12.951 55.134 8.114   1.00 38.83 ? 382 PHE A O     1 
ATOM   3892 C CB    . PHE B 2 382 ? -12.091 55.513 11.210  1.00 37.10 ? 382 PHE A CB    1 
ATOM   3893 C CG    . PHE B 2 382 ? -13.064 54.388 11.466  1.00 35.65 ? 382 PHE A CG    1 
ATOM   3894 C CD1   . PHE B 2 382 ? -13.123 53.281 10.618  1.00 36.07 ? 382 PHE A CD1   1 
ATOM   3895 C CD2   . PHE B 2 382 ? -13.935 54.446 12.548  1.00 34.98 ? 382 PHE A CD2   1 
ATOM   3896 C CE1   . PHE B 2 382 ? -14.045 52.249 10.848  1.00 34.05 ? 382 PHE A CE1   1 
ATOM   3897 C CE2   . PHE B 2 382 ? -14.858 53.422 12.786  1.00 35.28 ? 382 PHE A CE2   1 
ATOM   3898 C CZ    . PHE B 2 382 ? -14.912 52.323 11.934  1.00 32.99 ? 382 PHE A CZ    1 
ATOM   3899 N N     . THR B 2 383 ? -10.940 56.138 8.219   1.00 36.15 ? 383 THR A N     1 
ATOM   3900 C CA    . THR B 2 383 ? -10.524 55.634 6.913   1.00 33.67 ? 383 THR A CA    1 
ATOM   3901 C C     . THR B 2 383 ? -9.305  54.712 6.869   1.00 32.68 ? 383 THR A C     1 
ATOM   3902 O O     . THR B 2 383 ? -8.878  54.303 5.796   1.00 33.50 ? 383 THR A O     1 
ATOM   3903 C CB    . THR B 2 383 ? -10.290 56.803 5.940   1.00 34.15 ? 383 THR A CB    1 
ATOM   3904 O OG1   . THR B 2 383 ? -9.166  57.578 6.368   1.00 33.95 ? 383 THR A OG1   1 
ATOM   3905 C CG2   . THR B 2 383 ? -11.505 57.700 5.914   1.00 31.78 ? 383 THR A CG2   1 
ATOM   3906 N N     . THR B 2 384 ? -8.736  54.385 8.021   1.00 31.56 ? 384 THR A N     1 
ATOM   3907 C CA    . THR B 2 384 ? -7.591  53.481 8.060   1.00 32.83 ? 384 THR A CA    1 
ATOM   3908 C C     . THR B 2 384 ? -7.933  52.406 9.073   1.00 34.13 ? 384 THR A C     1 
ATOM   3909 O O     . THR B 2 384 ? -8.863  52.582 9.860   1.00 35.17 ? 384 THR A O     1 
ATOM   3910 C CB    . THR B 2 384 ? -6.318  54.201 8.504   1.00 33.31 ? 384 THR A CB    1 
ATOM   3911 O OG1   . THR B 2 384 ? -6.433  54.567 9.882   1.00 36.04 ? 384 THR A OG1   1 
ATOM   3912 C CG2   . THR B 2 384 ? -6.103  55.451 7.670   1.00 34.64 ? 384 THR A CG2   1 
ATOM   3913 N N     . PRO B 2 385 ? -7.207  51.273 9.065   1.00 32.96 ? 385 PRO A N     1 
ATOM   3914 C CA    . PRO B 2 385 ? -7.487  50.192 10.021  1.00 32.13 ? 385 PRO A CA    1 
ATOM   3915 C C     . PRO B 2 385 ? -7.238  50.662 11.447  1.00 32.68 ? 385 PRO A C     1 
ATOM   3916 O O     . PRO B 2 385 ? -8.106  50.579 12.303  1.00 31.52 ? 385 PRO A O     1 
ATOM   3917 C CB    . PRO B 2 385 ? -6.501  49.104 9.621   1.00 32.21 ? 385 PRO A CB    1 
ATOM   3918 C CG    . PRO B 2 385 ? -6.212  49.397 8.194   1.00 32.66 ? 385 PRO A CG    1 
ATOM   3919 C CD    . PRO B 2 385 ? -6.121  50.890 8.155   1.00 31.96 ? 385 PRO A CD    1 
ATOM   3920 N N     . GLU B 2 386 ? -6.032  51.162 11.679  1.00 34.54 ? 386 GLU A N     1 
ATOM   3921 C CA    . GLU B 2 386 ? -5.626  51.653 12.986  1.00 36.53 ? 386 GLU A CA    1 
ATOM   3922 C C     . GLU B 2 386 ? -6.629  52.661 13.520  1.00 36.79 ? 386 GLU A C     1 
ATOM   3923 O O     . GLU B 2 386 ? -7.011  52.621 14.688  1.00 37.77 ? 386 GLU A O     1 
ATOM   3924 C CB    . GLU B 2 386 ? -4.238  52.315 12.906  1.00 35.20 ? 386 GLU A CB    1 
ATOM   3925 C CG    . GLU B 2 386 ? -3.138  51.411 12.410  1.00 37.84 ? 386 GLU A CG    1 
ATOM   3926 C CD    . GLU B 2 386 ? -2.940  51.500 10.912  1.00 41.34 ? 386 GLU A CD    1 
ATOM   3927 O OE1   . GLU B 2 386 ? -3.936  51.725 10.190  1.00 42.68 ? 386 GLU A OE1   1 
ATOM   3928 O OE2   . GLU B 2 386 ? -1.782  51.334 10.457  1.00 42.75 ? 386 GLU A OE2   1 
ATOM   3929 N N     . GLU B 2 387 ? -7.038  53.574 12.654  1.00 35.85 ? 387 GLU A N     1 
ATOM   3930 C CA    . GLU B 2 387 ? -7.979  54.602 13.030  1.00 36.41 ? 387 GLU A CA    1 
ATOM   3931 C C     . GLU B 2 387 ? -9.250  53.902 13.483  1.00 36.20 ? 387 GLU A C     1 
ATOM   3932 O O     . GLU B 2 387 ? -9.878  54.272 14.467  1.00 36.16 ? 387 GLU A O     1 
ATOM   3933 C CB    . GLU B 2 387 ? -8.227  55.480 11.815  1.00 37.61 ? 387 GLU A CB    1 
ATOM   3934 C CG    . GLU B 2 387 ? -8.904  56.786 12.069  1.00 41.83 ? 387 GLU A CG    1 
ATOM   3935 C CD    . GLU B 2 387 ? -8.677  57.753 10.927  1.00 44.65 ? 387 GLU A CD    1 
ATOM   3936 O OE1   . GLU B 2 387 ? -9.437  58.733 10.813  1.00 48.53 ? 387 GLU A OE1   1 
ATOM   3937 O OE2   . GLU B 2 387 ? -7.728  57.538 10.144  1.00 44.98 ? 387 GLU A OE2   1 
ATOM   3938 N N     . GLY B 2 388 ? -9.611  52.859 12.759  1.00 35.73 ? 388 GLY A N     1 
ATOM   3939 C CA    . GLY B 2 388 ? -10.801 52.121 13.108  1.00 35.06 ? 388 GLY A CA    1 
ATOM   3940 C C     . GLY B 2 388 ? -10.662 51.388 14.424  1.00 35.12 ? 388 GLY A C     1 
ATOM   3941 O O     . GLY B 2 388 ? -11.569 51.446 15.253  1.00 36.79 ? 388 GLY A O     1 
ATOM   3942 N N     . VAL B 2 389 ? -9.538  50.699 14.622  1.00 34.40 ? 389 VAL A N     1 
ATOM   3943 C CA    . VAL B 2 389 ? -9.300  49.940 15.851  1.00 33.74 ? 389 VAL A CA    1 
ATOM   3944 C C     . VAL B 2 389 ? -9.145  50.831 17.092  1.00 36.31 ? 389 VAL A C     1 
ATOM   3945 O O     . VAL B 2 389 ? -9.328  50.368 18.217  1.00 38.14 ? 389 VAL A O     1 
ATOM   3946 C CB    . VAL B 2 389 ? -8.058  49.010 15.711  1.00 32.57 ? 389 VAL A CB    1 
ATOM   3947 C CG1   . VAL B 2 389 ? -7.861  48.172 16.980  1.00 27.67 ? 389 VAL A CG1   1 
ATOM   3948 C CG2   . VAL B 2 389 ? -8.234  48.095 14.509  1.00 30.42 ? 389 VAL A CG2   1 
ATOM   3949 N N     . ARG B 2 390 ? -8.808  52.104 16.910  1.00 36.52 ? 390 ARG A N     1 
ATOM   3950 C CA    . ARG B 2 390 ? -8.699  52.973 18.067  1.00 36.52 ? 390 ARG A CA    1 
ATOM   3951 C C     . ARG B 2 390 ? -10.113 53.301 18.508  1.00 36.83 ? 390 ARG A C     1 
ATOM   3952 O O     . ARG B 2 390 ? -10.374 53.536 19.688  1.00 36.50 ? 390 ARG A O     1 
ATOM   3953 C CB    . ARG B 2 390 ? -7.982  54.274 17.739  1.00 38.04 ? 390 ARG A CB    1 
ATOM   3954 C CG    . ARG B 2 390 ? -8.013  55.238 18.905  1.00 36.87 ? 390 ARG A CG    1 
ATOM   3955 C CD    . ARG B 2 390 ? -7.975  56.640 18.414  1.00 38.12 ? 390 ARG A CD    1 
ATOM   3956 N NE    . ARG B 2 390 ? -6.726  56.917 17.725  1.00 40.87 ? 390 ARG A NE    1 
ATOM   3957 C CZ    . ARG B 2 390 ? -6.645  57.634 16.609  1.00 42.70 ? 390 ARG A CZ    1 
ATOM   3958 N NH1   . ARG B 2 390 ? -7.747  58.138 16.061  1.00 41.96 ? 390 ARG A NH1   1 
ATOM   3959 N NH2   . ARG B 2 390 ? -5.464  57.858 16.047  1.00 42.74 ? 390 ARG A NH2   1 
ATOM   3960 N N     . SER B 2 391 ? -11.022 53.321 17.542  1.00 36.25 ? 391 SER A N     1 
ATOM   3961 C CA    . SER B 2 391 ? -12.420 53.618 17.816  1.00 37.27 ? 391 SER A CA    1 
ATOM   3962 C C     . SER B 2 391 ? -13.082 52.420 18.477  1.00 38.01 ? 391 SER A C     1 
ATOM   3963 O O     . SER B 2 391 ? -13.685 52.536 19.543  1.00 38.43 ? 391 SER A O     1 
ATOM   3964 C CB    . SER B 2 391 ? -13.155 53.954 16.519  1.00 37.10 ? 391 SER A CB    1 
ATOM   3965 O OG    . SER B 2 391 ? -14.471 54.399 16.788  1.00 36.86 ? 391 SER A OG    1 
ATOM   3966 N N     . TYR B 2 392 ? -12.958 51.265 17.831  1.00 37.47 ? 392 TYR A N     1 
ATOM   3967 C CA    . TYR B 2 392 ? -13.538 50.029 18.343  1.00 38.03 ? 392 TYR A CA    1 
ATOM   3968 C C     . TYR B 2 392 ? -13.022 49.671 19.741  1.00 37.52 ? 392 TYR A C     1 
ATOM   3969 O O     . TYR B 2 392 ? -13.801 49.329 20.628  1.00 38.84 ? 392 TYR A O     1 
ATOM   3970 C CB    . TYR B 2 392 ? -13.243 48.864 17.388  1.00 37.41 ? 392 TYR A CB    1 
ATOM   3971 C CG    . TYR B 2 392 ? -13.836 47.549 17.846  1.00 37.38 ? 392 TYR A CG    1 
ATOM   3972 C CD1   . TYR B 2 392 ? -15.223 47.370 17.911  1.00 37.20 ? 392 TYR A CD1   1 
ATOM   3973 C CD2   . TYR B 2 392 ? -13.017 46.484 18.232  1.00 38.49 ? 392 TYR A CD2   1 
ATOM   3974 C CE1   . TYR B 2 392 ? -15.777 46.166 18.346  1.00 38.10 ? 392 TYR A CE1   1 
ATOM   3975 C CE2   . TYR B 2 392 ? -13.568 45.271 18.673  1.00 38.37 ? 392 TYR A CE2   1 
ATOM   3976 C CZ    . TYR B 2 392 ? -14.949 45.124 18.727  1.00 38.31 ? 392 TYR A CZ    1 
ATOM   3977 O OH    . TYR B 2 392 ? -15.510 43.944 19.163  1.00 39.89 ? 392 TYR A OH    1 
ATOM   3978 N N     . ALA B 2 393 ? -11.708 49.750 19.922  1.00 37.34 ? 393 ALA A N     1 
ATOM   3979 C CA    . ALA B 2 393 ? -11.068 49.418 21.190  1.00 37.55 ? 393 ALA A CA    1 
ATOM   3980 C C     . ALA B 2 393 ? -11.427 50.361 22.328  1.00 37.12 ? 393 ALA A C     1 
ATOM   3981 O O     . ALA B 2 393 ? -11.514 49.943 23.480  1.00 37.87 ? 393 ALA A O     1 
ATOM   3982 C CB    . ALA B 2 393 ? -9.556  49.389 21.011  1.00 37.19 ? 393 ALA A CB    1 
ATOM   3983 N N     . SER B 2 394 ? -11.628 51.631 22.007  1.00 37.08 ? 394 SER A N     1 
ATOM   3984 C CA    . SER B 2 394 ? -11.955 52.617 23.019  1.00 36.51 ? 394 SER A CA    1 
ATOM   3985 C C     . SER B 2 394 ? -13.380 52.461 23.518  1.00 35.42 ? 394 SER A C     1 
ATOM   3986 O O     . SER B 2 394 ? -13.681 52.773 24.669  1.00 35.01 ? 394 SER A O     1 
ATOM   3987 C CB    . SER B 2 394 ? -11.745 54.025 22.458  1.00 36.32 ? 394 SER A CB    1 
ATOM   3988 O OG    . SER B 2 394 ? -10.408 54.208 22.017  1.00 38.61 ? 394 SER A OG    1 
ATOM   3989 N N     . THR B 2 395 ? -14.256 51.956 22.660  1.00 35.02 ? 395 THR A N     1 
ATOM   3990 C CA    . THR B 2 395 ? -15.653 51.802 23.035  1.00 35.13 ? 395 THR A CA    1 
ATOM   3991 C C     . THR B 2 395 ? -16.112 50.385 23.308  1.00 36.16 ? 395 THR A C     1 
ATOM   3992 O O     . THR B 2 395 ? -17.098 50.184 24.014  1.00 36.70 ? 395 THR A O     1 
ATOM   3993 C CB    . THR B 2 395 ? -16.579 52.375 21.963  1.00 32.42 ? 395 THR A CB    1 
ATOM   3994 O OG1   . THR B 2 395 ? -16.419 51.633 20.755  1.00 31.33 ? 395 THR A OG1   1 
ATOM   3995 C CG2   . THR B 2 395 ? -16.251 53.816 21.702  1.00 32.07 ? 395 THR A CG2   1 
ATOM   3996 N N     . HIS B 2 396 ? -15.414 49.399 22.761  1.00 37.59 ? 396 HIS A N     1 
ATOM   3997 C CA    . HIS B 2 396 ? -15.831 48.021 22.967  1.00 38.25 ? 396 HIS A CA    1 
ATOM   3998 C C     . HIS B 2 396 ? -14.938 47.232 23.905  1.00 38.86 ? 396 HIS A C     1 
ATOM   3999 O O     . HIS B 2 396 ? -14.967 46.000 23.899  1.00 39.93 ? 396 HIS A O     1 
ATOM   4000 C CB    . HIS B 2 396 ? -15.934 47.299 21.624  1.00 38.01 ? 396 HIS A CB    1 
ATOM   4001 C CG    . HIS B 2 396 ? -17.085 47.754 20.788  1.00 41.40 ? 396 HIS A CG    1 
ATOM   4002 N ND1   . HIS B 2 396 ? -17.223 49.056 20.354  1.00 42.25 ? 396 HIS A ND1   1 
ATOM   4003 C CD2   . HIS B 2 396 ? -18.161 47.083 20.313  1.00 42.19 ? 396 HIS A CD2   1 
ATOM   4004 C CE1   . HIS B 2 396 ? -18.334 49.166 19.648  1.00 42.61 ? 396 HIS A CE1   1 
ATOM   4005 N NE2   . HIS B 2 396 ? -18.921 47.983 19.607  1.00 43.55 ? 396 HIS A NE2   1 
ATOM   4006 N N     . TRP B 2 397 ? -14.158 47.932 24.722  1.00 38.76 ? 397 TRP A N     1 
ATOM   4007 C CA    . TRP B 2 397 ? -13.265 47.250 25.643  1.00 39.56 ? 397 TRP A CA    1 
ATOM   4008 C C     . TRP B 2 397 ? -13.974 46.111 26.374  1.00 39.88 ? 397 TRP A C     1 
ATOM   4009 O O     . TRP B 2 397 ? -13.431 45.011 26.491  1.00 39.51 ? 397 TRP A O     1 
ATOM   4010 C CB    . TRP B 2 397 ? -12.692 48.227 26.664  1.00 41.39 ? 397 TRP A CB    1 
ATOM   4011 C CG    . TRP B 2 397 ? -13.720 48.881 27.509  1.00 42.63 ? 397 TRP A CG    1 
ATOM   4012 C CD1   . TRP B 2 397 ? -14.362 50.047 27.252  1.00 42.29 ? 397 TRP A CD1   1 
ATOM   4013 C CD2   . TRP B 2 397 ? -14.239 48.399 28.757  1.00 43.31 ? 397 TRP A CD2   1 
ATOM   4014 N NE1   . TRP B 2 397 ? -15.253 50.333 28.262  1.00 42.61 ? 397 TRP A NE1   1 
ATOM   4015 C CE2   . TRP B 2 397 ? -15.199 49.335 29.198  1.00 43.24 ? 397 TRP A CE2   1 
ATOM   4016 C CE3   . TRP B 2 397 ? -13.990 47.265 29.543  1.00 45.41 ? 397 TRP A CE3   1 
ATOM   4017 C CZ2   . TRP B 2 397 ? -15.910 49.177 30.390  1.00 43.81 ? 397 TRP A CZ2   1 
ATOM   4018 C CZ3   . TRP B 2 397 ? -14.700 47.104 30.736  1.00 45.58 ? 397 TRP A CZ3   1 
ATOM   4019 C CH2   . TRP B 2 397 ? -15.650 48.058 31.144  1.00 44.72 ? 397 TRP A CH2   1 
ATOM   4020 N N     . HIS B 2 398 ? -15.194 46.363 26.839  1.00 40.31 ? 398 HIS A N     1 
ATOM   4021 C CA    . HIS B 2 398 ? -15.941 45.354 27.579  1.00 40.72 ? 398 HIS A CA    1 
ATOM   4022 C C     . HIS B 2 398 ? -16.199 44.017 26.880  1.00 39.41 ? 398 HIS A C     1 
ATOM   4023 O O     . HIS B 2 398 ? -16.527 43.038 27.537  1.00 38.74 ? 398 HIS A O     1 
ATOM   4024 C CB    . HIS B 2 398 ? -17.280 45.917 28.063  1.00 43.10 ? 398 HIS A CB    1 
ATOM   4025 C CG    . HIS B 2 398 ? -17.969 45.021 29.049  1.00 49.75 ? 398 HIS A CG    1 
ATOM   4026 N ND1   . HIS B 2 398 ? -18.536 43.813 28.693  1.00 51.62 ? 398 HIS A ND1   1 
ATOM   4027 C CD2   . HIS B 2 398 ? -18.097 45.110 30.397  1.00 50.41 ? 398 HIS A CD2   1 
ATOM   4028 C CE1   . HIS B 2 398 ? -18.980 43.197 29.776  1.00 50.23 ? 398 HIS A CE1   1 
ATOM   4029 N NE2   . HIS B 2 398 ? -18.724 43.963 30.822  1.00 51.28 ? 398 HIS A NE2   1 
ATOM   4030 N N     . THR B 2 399 ? -16.052 43.958 25.561  1.00 39.61 ? 399 THR A N     1 
ATOM   4031 C CA    . THR B 2 399 ? -16.316 42.708 24.851  1.00 38.53 ? 399 THR A CA    1 
ATOM   4032 C C     . THR B 2 399 ? -15.060 41.923 24.540  1.00 37.67 ? 399 THR A C     1 
ATOM   4033 O O     . THR B 2 399 ? -15.124 40.917 23.853  1.00 37.61 ? 399 THR A O     1 
ATOM   4034 C CB    . THR B 2 399 ? -17.064 42.944 23.515  1.00 37.85 ? 399 THR A CB    1 
ATOM   4035 O OG1   . THR B 2 399 ? -17.482 41.683 22.981  1.00 37.09 ? 399 THR A OG1   1 
ATOM   4036 C CG2   . THR B 2 399 ? -16.154 43.616 22.498  1.00 36.57 ? 399 THR A CG2   1 
ATOM   4037 N N     . LEU B 2 400 ? -13.924 42.374 25.048  1.00 36.76 ? 400 LEU A N     1 
ATOM   4038 C CA    . LEU B 2 400 ? -12.671 41.693 24.777  1.00 37.49 ? 400 LEU A CA    1 
ATOM   4039 C C     . LEU B 2 400 ? -12.188 40.818 25.941  1.00 39.34 ? 400 LEU A C     1 
ATOM   4040 O O     . LEU B 2 400 ? -10.991 40.601 26.117  1.00 40.35 ? 400 LEU A O     1 
ATOM   4041 C CB    . LEU B 2 400 ? -11.614 42.729 24.404  1.00 37.68 ? 400 LEU A CB    1 
ATOM   4042 C CG    . LEU B 2 400 ? -12.125 43.870 23.506  1.00 38.73 ? 400 LEU A CG    1 
ATOM   4043 C CD1   . LEU B 2 400 ? -10.986 44.851 23.282  1.00 35.92 ? 400 LEU A CD1   1 
ATOM   4044 C CD2   . LEU B 2 400 ? -12.678 43.340 22.184  1.00 36.10 ? 400 LEU A CD2   1 
ATOM   4045 N N     . GLY B 2 401 ? -13.128 40.302 26.724  1.00 39.85 ? 401 GLY A N     1 
ATOM   4046 C CA    . GLY B 2 401 ? -12.765 39.461 27.846  1.00 39.95 ? 401 GLY A CA    1 
ATOM   4047 C C     . GLY B 2 401 ? -12.844 40.291 29.101  1.00 41.81 ? 401 GLY A C     1 
ATOM   4048 O O     . GLY B 2 401 ? -12.606 41.500 29.042  1.00 41.00 ? 401 GLY A O     1 
ATOM   4049 N N     . LYS B 2 402 ? -13.179 39.656 30.224  1.00 40.75 ? 402 LYS A N     1 
ATOM   4050 C CA    . LYS B 2 402 ? -13.301 40.351 31.503  1.00 40.92 ? 402 LYS A CA    1 
ATOM   4051 C C     . LYS B 2 402 ? -12.008 41.064 31.859  1.00 40.47 ? 402 LYS A C     1 
ATOM   4052 O O     . LYS B 2 402 ? -12.002 42.269 32.066  1.00 38.20 ? 402 LYS A O     1 
ATOM   4053 C CB    . LYS B 2 402 ? -13.693 39.354 32.614  1.00 43.23 ? 402 LYS A CB    1 
ATOM   4054 C CG    . LYS B 2 402 ? -13.660 39.871 34.072  1.00 45.45 ? 402 LYS A CG    1 
ATOM   4055 C CD    . LYS B 2 402 ? -14.966 40.531 34.545  1.00 50.27 ? 402 LYS A CD    1 
ATOM   4056 C CE    . LYS B 2 402 ? -15.506 39.942 35.857  1.00 53.44 ? 402 LYS A CE    1 
ATOM   4057 N NZ    . LYS B 2 402 ? -16.905 40.362 36.219  1.00 55.16 ? 402 LYS A NZ    1 
ATOM   4058 N N     . ASN B 2 403 ? -10.905 40.329 31.903  1.00 40.66 ? 403 ASN A N     1 
ATOM   4059 C CA    . ASN B 2 403 ? -9.628  40.927 32.270  1.00 41.28 ? 403 ASN A CA    1 
ATOM   4060 C C     . ASN B 2 403 ? -8.962  41.733 31.172  1.00 41.29 ? 403 ASN A C     1 
ATOM   4061 O O     . ASN B 2 403 ? -8.724  42.930 31.331  1.00 40.72 ? 403 ASN A O     1 
ATOM   4062 C CB    . ASN B 2 403 ? -8.689  39.841 32.773  1.00 40.36 ? 403 ASN A CB    1 
ATOM   4063 C CG    . ASN B 2 403 ? -9.295  39.055 33.904  1.00 40.86 ? 403 ASN A CG    1 
ATOM   4064 O OD1   . ASN B 2 403 ? -9.795  39.637 34.860  1.00 40.26 ? 403 ASN A OD1   1 
ATOM   4065 N ND2   . ASN B 2 403 ? -9.269  37.727 33.802  1.00 42.57 ? 403 ASN A ND2   1 
ATOM   4066 N N     . VAL B 2 404 ? -8.652  41.078 30.061  1.00 42.64 ? 404 VAL A N     1 
ATOM   4067 C CA    . VAL B 2 404 ? -8.016  41.760 28.945  1.00 42.08 ? 404 VAL A CA    1 
ATOM   4068 C C     . VAL B 2 404 ? -8.759  43.060 28.659  1.00 41.91 ? 404 VAL A C     1 
ATOM   4069 O O     . VAL B 2 404 ? -8.143  44.101 28.425  1.00 41.51 ? 404 VAL A O     1 
ATOM   4070 C CB    . VAL B 2 404 ? -8.025  40.887 27.672  1.00 41.73 ? 404 VAL A CB    1 
ATOM   4071 C CG1   . VAL B 2 404 ? -7.617  41.725 26.470  1.00 41.11 ? 404 VAL A CG1   1 
ATOM   4072 C CG2   . VAL B 2 404 ? -7.071  39.710 27.840  1.00 41.34 ? 404 VAL A CG2   1 
ATOM   4073 N N     . GLY B 2 405 ? -10.086 42.992 28.694  1.00 42.08 ? 405 GLY A N     1 
ATOM   4074 C CA    . GLY B 2 405 ? -10.896 44.164 28.423  1.00 41.75 ? 405 GLY A CA    1 
ATOM   4075 C C     . GLY B 2 405 ? -10.745 45.263 29.452  1.00 41.04 ? 405 GLY A C     1 
ATOM   4076 O O     . GLY B 2 405 ? -10.630 46.435 29.103  1.00 43.02 ? 405 GLY A O     1 
ATOM   4077 N N     . GLU B 2 406 ? -10.756 44.887 30.725  1.00 40.44 ? 406 GLU A N     1 
ATOM   4078 C CA    . GLU B 2 406 ? -10.621 45.854 31.804  1.00 39.08 ? 406 GLU A CA    1 
ATOM   4079 C C     . GLU B 2 406 ? -9.280  46.553 31.713  1.00 37.87 ? 406 GLU A C     1 
ATOM   4080 O O     . GLU B 2 406 ? -9.172  47.723 32.070  1.00 39.52 ? 406 GLU A O     1 
ATOM   4081 C CB    . GLU B 2 406 ? -10.786 45.164 33.165  1.00 40.31 ? 406 GLU A CB    1 
ATOM   4082 C CG    . GLU B 2 406 ? -12.237 44.812 33.487  1.00 42.40 ? 406 GLU A CG    1 
ATOM   4083 C CD    . GLU B 2 406 ? -12.388 43.809 34.627  1.00 45.54 ? 406 GLU A CD    1 
ATOM   4084 O OE1   . GLU B 2 406 ? -13.552 43.457 34.948  1.00 46.51 ? 406 GLU A OE1   1 
ATOM   4085 O OE2   . GLU B 2 406 ? -11.356 43.370 35.194  1.00 45.36 ? 406 GLU A OE2   1 
ATOM   4086 N N     . SER B 2 407 ? -8.268  45.842 31.223  1.00 35.87 ? 407 SER A N     1 
ATOM   4087 C CA    . SER B 2 407 ? -6.937  46.418 31.075  1.00 35.64 ? 407 SER A CA    1 
ATOM   4088 C C     . SER B 2 407 ? -6.908  47.354 29.877  1.00 37.40 ? 407 SER A C     1 
ATOM   4089 O O     . SER B 2 407 ? -6.346  48.442 29.952  1.00 37.53 ? 407 SER A O     1 
ATOM   4090 C CB    . SER B 2 407 ? -5.894  45.328 30.880  1.00 34.13 ? 407 SER A CB    1 
ATOM   4091 O OG    . SER B 2 407 ? -4.623  45.896 30.632  1.00 35.34 ? 407 SER A OG    1 
ATOM   4092 N N     . ILE B 2 408 ? -7.513  46.934 28.768  1.00 38.78 ? 408 ILE A N     1 
ATOM   4093 C CA    . ILE B 2 408 ? -7.554  47.772 27.571  1.00 40.31 ? 408 ILE A CA    1 
ATOM   4094 C C     . ILE B 2 408 ? -8.291  49.091 27.831  1.00 39.60 ? 408 ILE A C     1 
ATOM   4095 O O     . ILE B 2 408 ? -7.838  50.153 27.409  1.00 37.48 ? 408 ILE A O     1 
ATOM   4096 C CB    . ILE B 2 408 ? -8.214  47.026 26.372  1.00 40.82 ? 408 ILE A CB    1 
ATOM   4097 C CG1   . ILE B 2 408 ? -7.228  46.002 25.803  1.00 41.43 ? 408 ILE A CG1   1 
ATOM   4098 C CG2   . ILE B 2 408 ? -8.614  48.016 25.274  1.00 38.86 ? 408 ILE A CG2   1 
ATOM   4099 C CD1   . ILE B 2 408 ? -7.718  45.296 24.565  1.00 40.84 ? 408 ILE A CD1   1 
ATOM   4100 N N     . ARG B 2 409 ? -9.425  49.013 28.520  1.00 40.86 ? 409 ARG A N     1 
ATOM   4101 C CA    . ARG B 2 409 ? -10.207 50.193 28.850  1.00 42.61 ? 409 ARG A CA    1 
ATOM   4102 C C     . ARG B 2 409 ? -9.370  51.219 29.605  1.00 43.17 ? 409 ARG A C     1 
ATOM   4103 O O     . ARG B 2 409 ? -9.492  52.416 29.368  1.00 44.34 ? 409 ARG A O     1 
ATOM   4104 C CB    . ARG B 2 409 ? -11.402 49.797 29.713  1.00 44.58 ? 409 ARG A CB    1 
ATOM   4105 C CG    . ARG B 2 409 ? -12.100 50.952 30.422  1.00 46.03 ? 409 ARG A CG    1 
ATOM   4106 C CD    . ARG B 2 409 ? -12.731 50.477 31.734  1.00 49.93 ? 409 ARG A CD    1 
ATOM   4107 N NE    . ARG B 2 409 ? -11.772 49.698 32.528  1.00 54.24 ? 409 ARG A NE    1 
ATOM   4108 C CZ    . ARG B 2 409 ? -12.060 49.049 33.657  1.00 53.61 ? 409 ARG A CZ    1 
ATOM   4109 N NH1   . ARG B 2 409 ? -13.292 49.076 34.154  1.00 53.73 ? 409 ARG A NH1   1 
ATOM   4110 N NH2   . ARG B 2 409 ? -11.115 48.358 34.286  1.00 52.46 ? 409 ARG A NH2   1 
ATOM   4111 N N     . GLU B 2 410 ? -8.515  50.761 30.512  1.00 42.92 ? 410 GLU A N     1 
ATOM   4112 C CA    . GLU B 2 410 ? -7.714  51.690 31.288  1.00 42.88 ? 410 GLU A CA    1 
ATOM   4113 C C     . GLU B 2 410 ? -6.444  52.131 30.600  1.00 42.65 ? 410 GLU A C     1 
ATOM   4114 O O     . GLU B 2 410 ? -5.818  53.094 31.028  1.00 45.90 ? 410 GLU A O     1 
ATOM   4115 C CB    . GLU B 2 410 ? -7.363  51.088 32.638  1.00 43.38 ? 410 GLU A CB    1 
ATOM   4116 C CG    . GLU B 2 410 ? -6.627  49.797 32.508  1.00 46.93 ? 410 GLU A CG    1 
ATOM   4117 C CD    . GLU B 2 410 ? -6.337  49.157 33.841  1.00 48.80 ? 410 GLU A CD    1 
ATOM   4118 O OE1   . GLU B 2 410 ? -7.255  49.123 34.695  1.00 49.50 ? 410 GLU A OE1   1 
ATOM   4119 O OE2   . GLU B 2 410 ? -5.193  48.676 34.019  1.00 49.52 ? 410 GLU A OE2   1 
ATOM   4120 N N     . TYR B 2 411 ? -6.044  51.428 29.549  1.00 40.71 ? 411 TYR A N     1 
ATOM   4121 C CA    . TYR B 2 411 ? -4.839  51.808 28.817  1.00 38.10 ? 411 TYR A CA    1 
ATOM   4122 C C     . TYR B 2 411 ? -4.821  51.013 27.529  1.00 37.99 ? 411 TYR A C     1 
ATOM   4123 O O     . TYR B 2 411 ? -5.262  49.866 27.494  1.00 37.95 ? 411 TYR A O     1 
ATOM   4124 C CB    . TYR B 2 411 ? -3.614  51.809 29.724  1.00 36.81 ? 411 TYR A CB    1 
ATOM   4125 C CG    . TYR B 2 411 ? -2.330  51.771 28.926  1.00 39.03 ? 411 TYR A CG    1 
ATOM   4126 C CD1   . TYR B 2 411 ? -1.727  50.557 28.596  1.00 39.73 ? 411 TYR A CD1   1 
ATOM   4127 C CD2   . TYR B 2 411 ? -1.762  52.940 28.429  1.00 38.16 ? 411 TYR A CD2   1 
ATOM   4128 C CE1   . TYR B 2 411 ? -0.603  50.510 27.790  1.00 39.32 ? 411 TYR A CE1   1 
ATOM   4129 C CE2   . TYR B 2 411 ? -0.640  52.902 27.624  1.00 37.84 ? 411 TYR A CE2   1 
ATOM   4130 C CZ    . TYR B 2 411 ? -0.064  51.686 27.304  1.00 39.75 ? 411 TYR A CZ    1 
ATOM   4131 O OH    . TYR B 2 411 ? 1.041   51.644 26.482  1.00 38.94 ? 411 TYR A OH    1 
ATOM   4132 N N     . PHE B 2 412 ? -4.282  51.622 26.477  1.00 38.32 ? 412 PHE A N     1 
ATOM   4133 C CA    . PHE B 2 412 ? -3.912  50.921 25.254  1.00 39.64 ? 412 PHE A CA    1 
ATOM   4134 C C     . PHE B 2 412 ? -3.349  51.922 24.252  1.00 41.23 ? 412 PHE A C     1 
ATOM   4135 O O     . PHE B 2 412 ? -3.556  53.130 24.377  1.00 41.24 ? 412 PHE A O     1 
ATOM   4136 C CB    . PHE B 2 412 ? -5.081  50.055 24.737  1.00 37.94 ? 412 PHE A CB    1 
ATOM   4137 C CG    . PHE B 2 412 ? -5.960  50.744 23.741  1.00 36.30 ? 412 PHE A CG    1 
ATOM   4138 C CD1   . PHE B 2 412 ? -5.586  50.836 22.403  1.00 36.83 ? 412 PHE A CD1   1 
ATOM   4139 C CD2   . PHE B 2 412 ? -7.142  51.337 24.146  1.00 36.31 ? 412 PHE A CD2   1 
ATOM   4140 C CE1   . PHE B 2 412 ? -6.380  51.515 21.484  1.00 36.65 ? 412 PHE A CE1   1 
ATOM   4141 C CE2   . PHE B 2 412 ? -7.947  52.019 23.242  1.00 37.69 ? 412 PHE A CE2   1 
ATOM   4142 C CZ    . PHE B 2 412 ? -7.569  52.112 21.909  1.00 39.01 ? 412 PHE A CZ    1 
ATOM   4143 N N     . GLU B 2 413 ? -2.628  51.406 23.263  1.00 42.28 ? 413 GLU A N     1 
ATOM   4144 C CA    . GLU B 2 413 ? -2.134  52.216 22.165  1.00 44.57 ? 413 GLU A CA    1 
ATOM   4145 C C     . GLU B 2 413 ? -1.966  51.359 20.925  1.00 44.54 ? 413 GLU A C     1 
ATOM   4146 O O     . GLU B 2 413 ? -1.803  50.150 21.016  1.00 45.70 ? 413 GLU A O     1 
ATOM   4147 C CB    . GLU B 2 413 ? -0.788  52.822 22.516  1.00 47.38 ? 413 GLU A CB    1 
ATOM   4148 C CG    . GLU B 2 413 ? 0.317   51.801 22.607  1.00 50.47 ? 413 GLU A CG    1 
ATOM   4149 C CD    . GLU B 2 413 ? 1.619   52.413 23.064  1.00 53.80 ? 413 GLU A CD    1 
ATOM   4150 O OE1   . GLU B 2 413 ? 2.283   53.081 22.238  1.00 54.80 ? 413 GLU A OE1   1 
ATOM   4151 O OE2   . GLU B 2 413 ? 1.970   52.232 24.257  1.00 55.08 ? 413 GLU A OE2   1 
ATOM   4152 N N     . ILE B 2 414 ? -2.002  51.991 19.762  1.00 44.76 ? 414 ILE A N     1 
ATOM   4153 C CA    . ILE B 2 414 ? -1.828  51.265 18.515  1.00 43.99 ? 414 ILE A CA    1 
ATOM   4154 C C     . ILE B 2 414 ? -0.452  51.602 17.936  1.00 44.09 ? 414 ILE A C     1 
ATOM   4155 O O     . ILE B 2 414 ? -0.141  52.764 17.683  1.00 44.73 ? 414 ILE A O     1 
ATOM   4156 C CB    . ILE B 2 414 ? -2.926  51.635 17.499  1.00 43.50 ? 414 ILE A CB    1 
ATOM   4157 C CG1   . ILE B 2 414 ? -4.299  51.427 18.135  1.00 42.45 ? 414 ILE A CG1   1 
ATOM   4158 C CG2   . ILE B 2 414 ? -2.779  50.779 16.246  1.00 43.44 ? 414 ILE A CG2   1 
ATOM   4159 C CD1   . ILE B 2 414 ? -5.459  51.949 17.313  1.00 45.39 ? 414 ILE A CD1   1 
ATOM   4160 N N     . ILE B 2 415 ? 0.368   50.580 17.739  1.00 43.45 ? 415 ILE A N     1 
ATOM   4161 C CA    . ILE B 2 415 ? 1.710   50.766 17.216  1.00 42.96 ? 415 ILE A CA    1 
ATOM   4162 C C     . ILE B 2 415 ? 1.807   50.205 15.810  1.00 44.06 ? 415 ILE A C     1 
ATOM   4163 O O     . ILE B 2 415 ? 1.188   49.201 15.503  1.00 45.39 ? 415 ILE A O     1 
ATOM   4164 C CB    . ILE B 2 415 ? 2.728   50.048 18.102  1.00 41.77 ? 415 ILE A CB    1 
ATOM   4165 C CG1   . ILE B 2 415 ? 2.550   50.494 19.548  1.00 42.60 ? 415 ILE A CG1   1 
ATOM   4166 C CG2   . ILE B 2 415 ? 4.128   50.347 17.634  1.00 42.92 ? 415 ILE A CG2   1 
ATOM   4167 C CD1   . ILE B 2 415 ? 2.703   51.979 19.743  1.00 42.89 ? 415 ILE A CD1   1 
ATOM   4168 N N     . SER B 2 416 ? 2.587   50.857 14.956  1.00 44.93 ? 416 SER A N     1 
ATOM   4169 C CA    . SER B 2 416 ? 2.762   50.409 13.581  1.00 45.54 ? 416 SER A CA    1 
ATOM   4170 C C     . SER B 2 416 ? 4.079   50.966 13.089  1.00 47.65 ? 416 SER A C     1 
ATOM   4171 O O     . SER B 2 416 ? 4.753   51.690 13.819  1.00 48.92 ? 416 SER A O     1 
ATOM   4172 C CB    . SER B 2 416 ? 1.636   50.935 12.697  1.00 43.91 ? 416 SER A CB    1 
ATOM   4173 O OG    . SER B 2 416 ? 1.763   52.331 12.519  1.00 42.45 ? 416 SER A OG    1 
ATOM   4174 N N     . GLY B 2 417 ? 4.446   50.635 11.858  1.00 49.11 ? 417 GLY A N     1 
ATOM   4175 C CA    . GLY B 2 417 ? 5.694   51.134 11.316  1.00 52.53 ? 417 GLY A CA    1 
ATOM   4176 C C     . GLY B 2 417 ? 6.915   50.642 12.072  1.00 55.64 ? 417 GLY A C     1 
ATOM   4177 O O     . GLY B 2 417 ? 6.867   49.602 12.742  1.00 55.91 ? 417 GLY A O     1 
ATOM   4178 N N     . GLU B 2 418 ? 8.010   51.397 11.964  1.00 58.27 ? 418 GLU A N     1 
ATOM   4179 C CA    . GLU B 2 418 ? 9.274   51.052 12.618  1.00 60.29 ? 418 GLU A CA    1 
ATOM   4180 C C     . GLU B 2 418 ? 9.019   50.848 14.109  1.00 60.03 ? 418 GLU A C     1 
ATOM   4181 O O     . GLU B 2 418 ? 9.346   49.794 14.670  1.00 60.55 ? 418 GLU A O     1 
ATOM   4182 C CB    . GLU B 2 418 ? 10.310  52.175 12.404  1.00 62.51 ? 418 GLU A CB    1 
ATOM   4183 C CG    . GLU B 2 418 ? 10.249  52.852 10.995  1.00 65.68 ? 418 GLU A CG    1 
ATOM   4184 C CD    . GLU B 2 418 ? 11.113  52.180 9.900   1.00 67.29 ? 418 GLU A CD    1 
ATOM   4185 O OE1   . GLU B 2 418 ? 10.705  52.237 8.708   1.00 67.42 ? 418 GLU A OE1   1 
ATOM   4186 O OE2   . GLU B 2 418 ? 12.199  51.627 10.219  1.00 67.72 ? 418 GLU A OE2   1 
ATOM   4187 N N     . LYS B 2 419 ? 8.418   51.853 14.741  1.00 59.03 ? 419 LYS A N     1 
ATOM   4188 C CA    . LYS B 2 419 ? 8.102   51.799 16.163  1.00 57.91 ? 419 LYS A CA    1 
ATOM   4189 C C     . LYS B 2 419 ? 7.524   50.441 16.554  1.00 57.06 ? 419 LYS A C     1 
ATOM   4190 O O     . LYS B 2 419 ? 7.584   50.045 17.716  1.00 58.16 ? 419 LYS A O     1 
ATOM   4191 C CB    . LYS B 2 419 ? 7.099   52.902 16.510  1.00 59.18 ? 419 LYS A CB    1 
ATOM   4192 C CG    . LYS B 2 419 ? 6.681   52.977 17.983  1.00 61.74 ? 419 LYS A CG    1 
ATOM   4193 C CD    . LYS B 2 419 ? 5.709   54.151 18.205  1.00 63.42 ? 419 LYS A CD    1 
ATOM   4194 C CE    . LYS B 2 419 ? 5.426   54.397 19.684  1.00 63.89 ? 419 LYS A CE    1 
ATOM   4195 N NZ    . LYS B 2 419 ? 4.591   55.623 19.918  1.00 64.20 ? 419 LYS A NZ    1 
ATOM   4196 N N     . LEU B 2 420 ? 6.959   49.727 15.587  1.00 55.18 ? 420 LEU A N     1 
ATOM   4197 C CA    . LEU B 2 420 ? 6.382   48.429 15.875  1.00 52.95 ? 420 LEU A CA    1 
ATOM   4198 C C     . LEU B 2 420 ? 7.424   47.346 15.808  1.00 53.11 ? 420 LEU A C     1 
ATOM   4199 O O     . LEU B 2 420 ? 7.489   46.493 16.689  1.00 51.92 ? 420 LEU A O     1 
ATOM   4200 C CB    . LEU B 2 420 ? 5.271   48.102 14.885  1.00 51.94 ? 420 LEU A CB    1 
ATOM   4201 C CG    . LEU B 2 420 ? 4.778   46.651 14.937  1.00 50.88 ? 420 LEU A CG    1 
ATOM   4202 C CD1   . LEU B 2 420 ? 4.164   46.345 16.294  1.00 49.83 ? 420 LEU A CD1   1 
ATOM   4203 C CD2   . LEU B 2 420 ? 3.763   46.431 13.838  1.00 51.16 ? 420 LEU A CD2   1 
ATOM   4204 N N     . PHE B 2 421 ? 8.236   47.396 14.755  1.00 54.20 ? 421 PHE A N     1 
ATOM   4205 C CA    . PHE B 2 421 ? 9.302   46.424 14.492  1.00 55.15 ? 421 PHE A CA    1 
ATOM   4206 C C     . PHE B 2 421 ? 10.162  46.107 15.710  1.00 56.26 ? 421 PHE A C     1 
ATOM   4207 O O     . PHE B 2 421 ? 10.750  45.026 15.789  1.00 56.62 ? 421 PHE A O     1 
ATOM   4208 C CB    . PHE B 2 421 ? 9.961   46.760 13.160  1.00 55.81 ? 421 PHE A CB    1 
ATOM   4209 C CG    . PHE B 2 421 ? 8.993   46.827 12.019  1.00 56.65 ? 421 PHE A CG    1 
ATOM   4210 C CD1   . PHE B 2 421 ? 9.030   47.884 11.117  1.00 57.07 ? 421 PHE A CD1   1 
ATOM   4211 C CD2   . PHE B 2 421 ? 8.040   45.828 11.847  1.00 56.48 ? 421 PHE A CD2   1 
ATOM   4212 C CE1   . PHE B 2 421 ? 8.131   47.945 10.058  1.00 57.14 ? 421 PHE A CE1   1 
ATOM   4213 C CE2   . PHE B 2 421 ? 7.141   45.879 10.797  1.00 56.10 ? 421 PHE A CE2   1 
ATOM   4214 C CZ    . PHE B 2 421 ? 7.187   46.942 9.898   1.00 56.62 ? 421 PHE A CZ    1 
ATOM   4215 N N     . LYS B 2 422 ? 10.241  47.038 16.654  1.00 57.02 ? 422 LYS A N     1 
ATOM   4216 C CA    . LYS B 2 422 ? 11.211  46.962 17.735  1.00 56.83 ? 422 LYS A CA    1 
ATOM   4217 C C     . LYS B 2 422 ? 10.582  46.353 18.978  1.00 56.33 ? 422 LYS A C     1 
ATOM   4218 O O     . LYS B 2 422 ? 11.283  46.003 19.937  1.00 56.60 ? 422 LYS A O     1 
ATOM   4219 C CB    . LYS B 2 422 ? 11.771  48.351 18.051  1.00 58.69 ? 422 LYS A CB    1 
ATOM   4220 C CG    . LYS B 2 422 ? 12.683  48.912 16.953  1.00 60.49 ? 422 LYS A CG    1 
ATOM   4221 C CD    . LYS B 2 422 ? 12.013  50.017 16.145  1.00 61.40 ? 422 LYS A CD    1 
ATOM   4222 C CE    . LYS B 2 422 ? 11.645  51.197 17.037  1.00 62.44 ? 422 LYS A CE    1 
ATOM   4223 N NZ    . LYS B 2 422 ? 12.797  51.664 17.867  1.00 61.92 ? 422 LYS A NZ    1 
ATOM   4224 N N     . GLU B 2 423 ? 9.257   46.236 18.971  1.00 54.13 ? 423 GLU A N     1 
ATOM   4225 C CA    . GLU B 2 423 ? 8.560   45.637 20.105  1.00 50.90 ? 423 GLU A CA    1 
ATOM   4226 C C     . GLU B 2 423 ? 8.880   44.152 20.074  1.00 48.50 ? 423 GLU A C     1 
ATOM   4227 O O     . GLU B 2 423 ? 9.351   43.628 19.063  1.00 48.92 ? 423 GLU A O     1 
ATOM   4228 C CB    . GLU B 2 423 ? 7.045   45.823 19.993  1.00 51.04 ? 423 GLU A CB    1 
ATOM   4229 C CG    . GLU B 2 423 ? 6.550   47.248 20.062  1.00 50.73 ? 423 GLU A CG    1 
ATOM   4230 C CD    . GLU B 2 423 ? 6.927   47.938 21.350  1.00 51.29 ? 423 GLU A CD    1 
ATOM   4231 O OE1   . GLU B 2 423 ? 7.185   47.230 22.350  1.00 52.73 ? 423 GLU A OE1   1 
ATOM   4232 O OE2   . GLU B 2 423 ? 6.952   49.191 21.361  1.00 53.28 ? 423 GLU A OE2   1 
ATOM   4233 N N     . PRO B 2 424 ? 8.609   43.450 21.174  1.00 47.49 ? 424 PRO A N     1 
ATOM   4234 C CA    . PRO B 2 424 ? 8.854   42.010 21.333  1.00 45.43 ? 424 PRO A CA    1 
ATOM   4235 C C     . PRO B 2 424 ? 7.912   41.116 20.523  1.00 44.18 ? 424 PRO A C     1 
ATOM   4236 O O     . PRO B 2 424 ? 7.468   40.079 21.016  1.00 43.82 ? 424 PRO A O     1 
ATOM   4237 C CB    . PRO B 2 424 ? 8.667   41.795 22.838  1.00 46.58 ? 424 PRO A CB    1 
ATOM   4238 C CG    . PRO B 2 424 ? 8.809   43.194 23.446  1.00 48.39 ? 424 PRO A CG    1 
ATOM   4239 C CD    . PRO B 2 424 ? 8.138   44.050 22.434  1.00 46.82 ? 424 PRO A CD    1 
ATOM   4240 N N     . VAL B 2 425 ? 7.619   41.488 19.282  1.00 43.55 ? 425 VAL A N     1 
ATOM   4241 C CA    . VAL B 2 425 ? 6.685   40.695 18.482  1.00 43.26 ? 425 VAL A CA    1 
ATOM   4242 C C     . VAL B 2 425 ? 7.201   40.266 17.122  1.00 44.05 ? 425 VAL A C     1 
ATOM   4243 O O     . VAL B 2 425 ? 6.463   39.680 16.332  1.00 44.80 ? 425 VAL A O     1 
ATOM   4244 C CB    . VAL B 2 425 ? 5.390   41.477 18.246  1.00 40.94 ? 425 VAL A CB    1 
ATOM   4245 C CG1   . VAL B 2 425 ? 4.707   41.766 19.569  1.00 39.36 ? 425 VAL A CG1   1 
ATOM   4246 C CG2   . VAL B 2 425 ? 5.704   42.775 17.530  1.00 39.29 ? 425 VAL A CG2   1 
ATOM   4247 N N     . THR B 2 426 ? 8.464   40.548 16.845  1.00 44.35 ? 426 THR A N     1 
ATOM   4248 C CA    . THR B 2 426 ? 9.020   40.212 15.547  1.00 44.14 ? 426 THR A CA    1 
ATOM   4249 C C     . THR B 2 426 ? 8.758   38.766 15.147  1.00 43.17 ? 426 THR A C     1 
ATOM   4250 O O     . THR B 2 426 ? 8.372   38.494 14.014  1.00 44.57 ? 426 THR A O     1 
ATOM   4251 C CB    . THR B 2 426 ? 10.542  40.474 15.499  1.00 44.33 ? 426 THR A CB    1 
ATOM   4252 O OG1   . THR B 2 426 ? 11.239  39.348 16.046  1.00 45.29 ? 426 THR A OG1   1 
ATOM   4253 C CG2   . THR B 2 426 ? 10.899  41.737 16.298  1.00 44.11 ? 426 THR A CG2   1 
ATOM   4254 N N     . ALA B 2 427 ? 8.950   37.835 16.074  1.00 42.78 ? 427 ALA A N     1 
ATOM   4255 C CA    . ALA B 2 427 ? 8.747   36.415 15.771  1.00 42.01 ? 427 ALA A CA    1 
ATOM   4256 C C     . ALA B 2 427 ? 7.305   36.073 15.381  1.00 41.76 ? 427 ALA A C     1 
ATOM   4257 O O     . ALA B 2 427 ? 7.062   35.360 14.401  1.00 40.59 ? 427 ALA A O     1 
ATOM   4258 C CB    . ALA B 2 427 ? 9.190   35.566 16.965  1.00 42.12 ? 427 ALA A CB    1 
ATOM   4259 N N     . GLU B 2 428 ? 6.359   36.583 16.162  1.00 41.72 ? 428 GLU A N     1 
ATOM   4260 C CA    . GLU B 2 428 ? 4.938   36.353 15.924  1.00 43.17 ? 428 GLU A CA    1 
ATOM   4261 C C     . GLU B 2 428 ? 4.529   36.818 14.525  1.00 42.25 ? 428 GLU A C     1 
ATOM   4262 O O     . GLU B 2 428 ? 3.787   36.124 13.825  1.00 42.34 ? 428 GLU A O     1 
ATOM   4263 C CB    . GLU B 2 428 ? 4.096   37.097 16.973  1.00 45.86 ? 428 GLU A CB    1 
ATOM   4264 C CG    . GLU B 2 428 ? 4.105   36.516 18.397  1.00 48.71 ? 428 GLU A CG    1 
ATOM   4265 C CD    . GLU B 2 428 ? 5.504   36.355 19.006  1.00 50.64 ? 428 GLU A CD    1 
ATOM   4266 O OE1   . GLU B 2 428 ? 6.352   37.269 18.868  1.00 50.21 ? 428 GLU A OE1   1 
ATOM   4267 O OE2   . GLU B 2 428 ? 5.743   35.305 19.650  1.00 52.44 ? 428 GLU A OE2   1 
ATOM   4268 N N     . LEU B 2 429 ? 5.008   37.998 14.132  1.00 40.87 ? 429 LEU A N     1 
ATOM   4269 C CA    . LEU B 2 429 ? 4.706   38.568 12.823  1.00 40.99 ? 429 LEU A CA    1 
ATOM   4270 C C     . LEU B 2 429 ? 5.258   37.711 11.690  1.00 40.52 ? 429 LEU A C     1 
ATOM   4271 O O     . LEU B 2 429 ? 4.632   37.564 10.645  1.00 39.27 ? 429 LEU A O     1 
ATOM   4272 C CB    . LEU B 2 429 ? 5.281   39.977 12.720  1.00 40.91 ? 429 LEU A CB    1 
ATOM   4273 C CG    . LEU B 2 429 ? 4.589   41.045 13.567  1.00 41.75 ? 429 LEU A CG    1 
ATOM   4274 C CD1   . LEU B 2 429 ? 5.490   42.269 13.672  1.00 41.65 ? 429 LEU A CD1   1 
ATOM   4275 C CD2   . LEU B 2 429 ? 3.231   41.398 12.952  1.00 40.99 ? 429 LEU A CD2   1 
ATOM   4276 N N     . CYS B 2 430 ? 6.439   37.149 11.890  1.00 40.51 ? 430 CYS A N     1 
ATOM   4277 C CA    . CYS B 2 430 ? 7.017   36.306 10.864  1.00 43.66 ? 430 CYS A CA    1 
ATOM   4278 C C     . CYS B 2 430 ? 6.165   35.054 10.649  1.00 44.81 ? 430 CYS A C     1 
ATOM   4279 O O     . CYS B 2 430 ? 6.055   34.541 9.532   1.00 45.03 ? 430 CYS A O     1 
ATOM   4280 C CB    . CYS B 2 430 ? 8.452   35.947 11.237  1.00 43.51 ? 430 CYS A CB    1 
ATOM   4281 S SG    . CYS B 2 430 ? 9.584   37.346 10.990  1.00 48.29 ? 430 CYS A SG    1 
ATOM   4282 N N     . GLU B 2 431 ? 5.549   34.572 11.718  1.00 45.27 ? 431 GLU A N     1 
ATOM   4283 C CA    . GLU B 2 431 ? 4.689   33.400 11.630  1.00 46.33 ? 431 GLU A CA    1 
ATOM   4284 C C     . GLU B 2 431 ? 3.350   33.808 10.999  1.00 46.34 ? 431 GLU A C     1 
ATOM   4285 O O     . GLU B 2 431 ? 2.775   33.078 10.182  1.00 46.73 ? 431 GLU A O     1 
ATOM   4286 C CB    . GLU B 2 431 ? 4.470   32.830 13.034  1.00 48.34 ? 431 GLU A CB    1 
ATOM   4287 C CG    . GLU B 2 431 ? 3.426   31.730 13.147  1.00 51.70 ? 431 GLU A CG    1 
ATOM   4288 C CD    . GLU B 2 431 ? 3.807   30.464 12.399  1.00 54.15 ? 431 GLU A CD    1 
ATOM   4289 O OE1   . GLU B 2 431 ? 4.989   30.048 12.501  1.00 53.93 ? 431 GLU A OE1   1 
ATOM   4290 O OE2   . GLU B 2 431 ? 2.916   29.876 11.728  1.00 55.84 ? 431 GLU A OE2   1 
ATOM   4291 N N     . MET B 2 432 ? 2.871   34.990 11.372  1.00 44.56 ? 432 MET A N     1 
ATOM   4292 C CA    . MET B 2 432 ? 1.606   35.512 10.868  1.00 43.01 ? 432 MET A CA    1 
ATOM   4293 C C     . MET B 2 432 ? 1.609   35.771 9.358   1.00 41.74 ? 432 MET A C     1 
ATOM   4294 O O     . MET B 2 432 ? 0.557   35.752 8.711   1.00 40.95 ? 432 MET A O     1 
ATOM   4295 C CB    . MET B 2 432 ? 1.263   36.802 11.605  1.00 42.20 ? 432 MET A CB    1 
ATOM   4296 C CG    . MET B 2 432 ? -0.140  37.279 11.376  1.00 42.70 ? 432 MET A CG    1 
ATOM   4297 S SD    . MET B 2 432 ? -0.464  38.742 12.346  1.00 43.97 ? 432 MET A SD    1 
ATOM   4298 C CE    . MET B 2 432 ? 0.353   39.996 11.365  1.00 42.69 ? 432 MET A CE    1 
ATOM   4299 N N     . MET B 2 433 ? 2.798   36.012 8.811   1.00 39.91 ? 433 MET A N     1 
ATOM   4300 C CA    . MET B 2 433 ? 2.971   36.294 7.393   1.00 39.03 ? 433 MET A CA    1 
ATOM   4301 C C     . MET B 2 433 ? 3.729   35.194 6.684   1.00 40.17 ? 433 MET A C     1 
ATOM   4302 O O     . MET B 2 433 ? 4.107   35.351 5.531   1.00 40.17 ? 433 MET A O     1 
ATOM   4303 C CB    . MET B 2 433 ? 3.750   37.585 7.196   1.00 37.95 ? 433 MET A CB    1 
ATOM   4304 C CG    . MET B 2 433 ? 3.131   38.797 7.826   1.00 40.88 ? 433 MET A CG    1 
ATOM   4305 S SD    . MET B 2 433 ? 4.205   40.220 7.638   1.00 41.55 ? 433 MET A SD    1 
ATOM   4306 C CE    . MET B 2 433 ? 5.420   39.864 8.822   1.00 41.60 ? 433 MET A CE    1 
ATOM   4307 N N     . GLY B 2 434 ? 3.978   34.090 7.371   1.00 39.78 ? 434 GLY A N     1 
ATOM   4308 C CA    . GLY B 2 434 ? 4.705   33.008 6.740   1.00 41.02 ? 434 GLY A CA    1 
ATOM   4309 C C     . GLY B 2 434 ? 6.060   33.422 6.180   1.00 43.28 ? 434 GLY A C     1 
ATOM   4310 O O     . GLY B 2 434 ? 6.487   32.926 5.140   1.00 43.44 ? 434 GLY A O     1 
ATOM   4311 N N     . VAL B 2 435 ? 6.743   34.347 6.839   1.00 44.96 ? 435 VAL A N     1 
ATOM   4312 C CA    . VAL B 2 435 ? 8.065   34.749 6.364   1.00 48.22 ? 435 VAL A CA    1 
ATOM   4313 C C     . VAL B 2 435 ? 8.910   33.476 6.362   1.00 50.96 ? 435 VAL A C     1 
ATOM   4314 O O     . VAL B 2 435 ? 9.026   32.828 7.399   1.00 52.84 ? 435 VAL A O     1 
ATOM   4315 C CB    . VAL B 2 435 ? 8.730   35.764 7.329   1.00 47.52 ? 435 VAL A CB    1 
ATOM   4316 C CG1   . VAL B 2 435 ? 10.183  35.945 6.965   1.00 46.12 ? 435 VAL A CG1   1 
ATOM   4317 C CG2   . VAL B 2 435 ? 8.007   37.093 7.283   1.00 46.13 ? 435 VAL A CG2   1 
ATOM   4318 N N     . LYS B 2 436 ? 9.497   33.099 5.230   1.00 54.49 ? 436 LYS A N     1 
ATOM   4319 C CA    . LYS B 2 436 ? 10.303  31.880 5.237   1.00 59.53 ? 436 LYS A CA    1 
ATOM   4320 C C     . LYS B 2 436 ? 11.768  32.132 4.891   1.00 63.13 ? 436 LYS A C     1 
ATOM   4321 O O     . LYS B 2 436 ? 12.150  33.262 4.568   1.00 64.03 ? 436 LYS A O     1 
ATOM   4322 C CB    . LYS B 2 436 ? 9.940   30.964 4.056   1.00 60.43 ? 436 LYS A CB    1 
ATOM   4323 C CG    . LYS B 2 436 ? 10.331  31.442 2.663   1.00 59.80 ? 436 LYS A CG    1 
ATOM   4324 C CD    . LYS B 2 436 ? 9.825   30.427 1.630   1.00 59.10 ? 436 LYS A CD    1 
ATOM   4325 C CE    . LYS B 2 436 ? 10.240  30.783 0.217   1.00 59.22 ? 436 LYS A CE    1 
ATOM   4326 N NZ    . LYS B 2 436 ? 9.603   29.851 -0.750  1.00 57.62 ? 436 LYS A NZ    1 
ATOM   4327 N N     . ASP B 2 437 ? 12.585  31.079 4.977   1.00 67.48 ? 437 ASP A N     1 
ATOM   4328 C CA    . ASP B 2 437 ? 14.052  31.149 4.997   1.00 69.91 ? 437 ASP A CA    1 
ATOM   4329 C C     . ASP B 2 437 ? 14.610  31.100 6.436   1.00 70.58 ? 437 ASP A C     1 
ATOM   4330 O O     . ASP B 2 437 ? 13.794  31.110 7.392   1.00 70.73 ? 437 ASP A O     1 
ATOM   4331 C CB    . ASP B 2 437 ? 14.524  32.428 4.289   1.00 71.52 ? 437 ASP A CB    1 
ATOM   4332 C CG    . ASP B 2 437 ? 15.976  32.766 4.591   1.00 73.63 ? 437 ASP A CG    1 
ATOM   4333 O OD1   . ASP B 2 437 ? 16.871  31.936 4.274   1.00 74.93 ? 437 ASP A OD1   1 
ATOM   4334 O OD2   . ASP B 2 437 ? 16.214  33.863 5.149   1.00 74.78 ? 437 ASP A OD2   1 
ATOM   4335 O OXT   . ASP B 2 437 ? 15.854  31.045 6.594   1.00 71.44 ? 437 ASP A OXT   1 
HETATM 4336 S S     . SO4 C 3 .   ? 5.385   14.730 31.003  1.00 52.99 ? 438 SO4 A S     1 
HETATM 4337 O O1    . SO4 C 3 .   ? 6.216   14.865 32.279  1.00 54.98 ? 438 SO4 A O1    1 
HETATM 4338 O O2    . SO4 C 3 .   ? 5.948   13.547 30.221  1.00 53.16 ? 438 SO4 A O2    1 
HETATM 4339 O O3    . SO4 C 3 .   ? 4.054   14.402 31.398  1.00 53.52 ? 438 SO4 A O3    1 
HETATM 4340 O O4    . SO4 C 3 .   ? 5.729   15.859 30.215  1.00 55.53 ? 438 SO4 A O4    1 
HETATM 4341 S S     . SO4 D 3 .   ? -19.368 37.182 20.664  1.00 80.48 ? 439 SO4 A S     1 
HETATM 4342 O O1    . SO4 D 3 .   ? -19.790 36.235 21.802  1.00 79.64 ? 439 SO4 A O1    1 
HETATM 4343 O O2    . SO4 D 3 .   ? -19.685 36.476 19.338  1.00 81.07 ? 439 SO4 A O2    1 
HETATM 4344 O O3    . SO4 D 3 .   ? -20.214 38.331 20.745  1.00 79.82 ? 439 SO4 A O3    1 
HETATM 4345 O O4    . SO4 D 3 .   ? -17.934 37.220 20.686  1.00 80.54 ? 439 SO4 A O4    1 
HETATM 4346 O O     . HOH E 4 .   ? -16.534 42.262 16.878  1.00 42.19 ? 34  HOH B O     1 
HETATM 4347 O O     . HOH E 4 .   ? -23.816 46.700 12.272  1.00 32.47 ? 35  HOH B O     1 
HETATM 4348 O O     . HOH E 4 .   ? -2.383  18.791 29.407  1.00 25.66 ? 36  HOH B O     1 
HETATM 4349 O O     . HOH E 4 .   ? -22.912 32.287 26.776  1.00 40.12 ? 37  HOH B O     1 
HETATM 4350 O O     . HOH E 4 .   ? -26.236 39.921 23.599  1.00 38.52 ? 38  HOH B O     1 
HETATM 4351 O O     . HOH E 4 .   ? -9.883  19.307 33.038  1.00 43.75 ? 39  HOH B O     1 
HETATM 4352 O O     . HOH E 4 .   ? -17.839 37.122 36.778  1.00 66.46 ? 40  HOH B O     1 
HETATM 4353 O O     . HOH E 4 .   ? -6.188  26.578 35.588  1.00 50.02 ? 41  HOH B O     1 
HETATM 4354 O O     . HOH E 4 .   ? -20.542 22.566 23.174  1.00 55.67 ? 42  HOH B O     1 
HETATM 4355 O O     . HOH E 4 .   ? -33.410 48.103 19.218  1.00 61.49 ? 43  HOH B O     1 
HETATM 4356 O O     . HOH E 4 .   ? -28.850 48.584 28.347  1.00 39.96 ? 44  HOH B O     1 
HETATM 4357 O O     . HOH E 4 .   ? -37.471 44.309 25.361  1.00 51.96 ? 45  HOH B O     1 
HETATM 4358 O O     . HOH E 4 .   ? -10.918 20.430 35.226  1.00 62.14 ? 46  HOH B O     1 
HETATM 4359 O O     . HOH E 4 .   ? -25.588 40.388 20.265  1.00 57.53 ? 47  HOH B O     1 
HETATM 4360 O O     . HOH E 4 .   ? -26.773 22.761 25.394  1.00 64.60 ? 48  HOH B O     1 
HETATM 4361 O O     . HOH E 4 .   ? -6.217  18.335 28.974  1.00 55.62 ? 49  HOH B O     1 
HETATM 4362 O O     . HOH F 4 .   ? 3.421   48.235 3.874   1.00 40.79 ? 440 HOH A O     1 
HETATM 4363 O O     . HOH F 4 .   ? -9.561  -2.625 33.948  1.00 28.95 ? 441 HOH A O     1 
HETATM 4364 O O     . HOH F 4 .   ? -5.968  -3.467 26.444  1.00 31.69 ? 442 HOH A O     1 
HETATM 4365 O O     . HOH F 4 .   ? -2.937  10.168 35.334  1.00 33.70 ? 443 HOH A O     1 
HETATM 4366 O O     . HOH F 4 .   ? 11.068  1.674  18.398  1.00 36.11 ? 444 HOH A O     1 
HETATM 4367 O O     . HOH F 4 .   ? -21.634 48.399 -2.608  1.00 50.97 ? 445 HOH A O     1 
HETATM 4368 O O     . HOH F 4 .   ? -10.941 24.337 17.650  1.00 36.65 ? 446 HOH A O     1 
HETATM 4369 O O     . HOH F 4 .   ? -13.262 43.136 4.913   1.00 29.27 ? 447 HOH A O     1 
HETATM 4370 O O     . HOH F 4 .   ? -39.563 54.996 -5.446  1.00 39.87 ? 448 HOH A O     1 
HETATM 4371 O O     . HOH F 4 .   ? -31.399 58.044 -9.480  1.00 38.03 ? 449 HOH A O     1 
HETATM 4372 O O     . HOH F 4 .   ? 12.008  17.478 28.586  1.00 50.71 ? 450 HOH A O     1 
HETATM 4373 O O     . HOH F 4 .   ? -1.656  33.490 13.702  1.00 42.61 ? 451 HOH A O     1 
HETATM 4374 O O     . HOH F 4 .   ? 0.434   30.832 34.511  1.00 36.06 ? 452 HOH A O     1 
HETATM 4375 O O     . HOH F 4 .   ? -2.518  53.284 7.445   1.00 46.46 ? 453 HOH A O     1 
HETATM 4376 O O     . HOH F 4 .   ? 19.000  34.843 14.624  1.00 37.08 ? 454 HOH A O     1 
HETATM 4377 O O     . HOH F 4 .   ? -10.147 -1.216 15.439  1.00 43.98 ? 455 HOH A O     1 
HETATM 4378 O O     . HOH F 4 .   ? -25.236 53.113 -10.470 1.00 38.33 ? 456 HOH A O     1 
HETATM 4379 O O     . HOH F 4 .   ? 11.067  39.572 18.890  1.00 34.51 ? 457 HOH A O     1 
HETATM 4380 O O     . HOH F 4 .   ? -5.101  21.797 49.316  1.00 42.35 ? 458 HOH A O     1 
HETATM 4381 O O     . HOH F 4 .   ? 3.350   9.835  4.191   1.00 32.88 ? 459 HOH A O     1 
HETATM 4382 O O     . HOH F 4 .   ? -12.463 23.947 24.034  1.00 32.81 ? 462 HOH A O     1 
HETATM 4383 O O     . HOH F 4 .   ? -2.822  29.071 33.236  1.00 41.09 ? 463 HOH A O     1 
HETATM 4384 O O     . HOH F 4 .   ? 17.774  16.169 36.475  1.00 41.61 ? 464 HOH A O     1 
HETATM 4385 O O     . HOH F 4 .   ? 5.112   1.609  32.178  1.00 49.64 ? 465 HOH A O     1 
HETATM 4386 O O     . HOH F 4 .   ? -0.746  51.510 7.447   1.00 28.95 ? 466 HOH A O     1 
HETATM 4387 O O     . HOH F 4 .   ? -0.316  16.243 30.099  1.00 42.49 ? 467 HOH A O     1 
HETATM 4388 O O     . HOH F 4 .   ? -20.145 50.154 -0.134  1.00 39.63 ? 468 HOH A O     1 
HETATM 4389 O O     . HOH F 4 .   ? -4.153  48.543 29.782  1.00 34.22 ? 469 HOH A O     1 
HETATM 4390 O O     . HOH F 4 .   ? -11.358 -0.844 29.613  1.00 32.10 ? 470 HOH A O     1 
HETATM 4391 O O     . HOH F 4 .   ? 1.819   52.599 30.066  1.00 40.14 ? 471 HOH A O     1 
HETATM 4392 O O     . HOH F 4 .   ? 24.743  10.986 38.525  1.00 56.24 ? 472 HOH A O     1 
HETATM 4393 O O     . HOH F 4 .   ? 5.789   14.047 34.480  1.00 44.19 ? 473 HOH A O     1 
HETATM 4394 O O     . HOH F 4 .   ? 3.394   29.884 8.473   1.00 51.55 ? 474 HOH A O     1 
HETATM 4395 O O     . HOH F 4 .   ? -4.344  30.329 22.812  1.00 33.23 ? 475 HOH A O     1 
HETATM 4396 O O     . HOH F 4 .   ? 7.891   25.614 45.914  1.00 35.48 ? 476 HOH A O     1 
HETATM 4397 O O     . HOH F 4 .   ? -8.616  36.120 14.764  1.00 50.11 ? 477 HOH A O     1 
HETATM 4398 O O     . HOH F 4 .   ? -12.642 16.971 44.801  1.00 47.69 ? 478 HOH A O     1 
HETATM 4399 O O     . HOH F 4 .   ? -11.038 37.783 6.217   1.00 47.15 ? 479 HOH A O     1 
HETATM 4400 O O     . HOH F 4 .   ? -4.293  45.777 34.610  1.00 51.24 ? 480 HOH A O     1 
HETATM 4401 O O     . HOH F 4 .   ? 18.788  36.087 16.894  1.00 45.39 ? 481 HOH A O     1 
HETATM 4402 O O     . HOH F 4 .   ? 3.552   48.556 9.791   1.00 43.17 ? 482 HOH A O     1 
HETATM 4403 O O     . HOH F 4 .   ? 7.268   54.647 14.975  1.00 62.61 ? 483 HOH A O     1 
HETATM 4404 O O     . HOH F 4 .   ? -3.956  57.998 14.411  1.00 28.75 ? 484 HOH A O     1 
HETATM 4405 O O     . HOH F 4 .   ? -6.093  34.191 37.499  1.00 35.65 ? 485 HOH A O     1 
HETATM 4406 O O     . HOH F 4 .   ? 1.018   33.427 13.405  1.00 44.11 ? 486 HOH A O     1 
HETATM 4407 O O     . HOH F 4 .   ? -8.795  1.782  42.561  1.00 48.31 ? 487 HOH A O     1 
HETATM 4408 O O     . HOH F 4 .   ? -5.266  29.022 13.592  1.00 38.04 ? 488 HOH A O     1 
HETATM 4409 O O     . HOH F 4 .   ? 8.267   50.189 23.463  1.00 36.32 ? 489 HOH A O     1 
HETATM 4410 O O     . HOH F 4 .   ? -7.013  14.956 28.391  1.00 39.43 ? 490 HOH A O     1 
HETATM 4411 O O     . HOH F 4 .   ? -4.505  26.886 17.517  1.00 42.88 ? 491 HOH A O     1 
HETATM 4412 O O     . HOH F 4 .   ? 3.771   33.598 20.187  1.00 30.17 ? 492 HOH A O     1 
HETATM 4413 O O     . HOH F 4 .   ? -4.893  42.598 37.264  1.00 44.76 ? 493 HOH A O     1 
HETATM 4414 O O     . HOH F 4 .   ? 3.931   10.206 39.997  1.00 49.54 ? 494 HOH A O     1 
HETATM 4415 O O     . HOH F 4 .   ? 19.669  46.622 3.879   1.00 54.59 ? 495 HOH A O     1 
HETATM 4416 O O     . HOH F 4 .   ? -3.846  56.258 10.800  1.00 35.90 ? 496 HOH A O     1 
HETATM 4417 O O     . HOH F 4 .   ? -32.766 43.802 -5.347  1.00 44.42 ? 497 HOH A O     1 
HETATM 4418 O O     . HOH F 4 .   ? -21.002 3.458  20.545  1.00 41.64 ? 498 HOH A O     1 
HETATM 4419 O O     . HOH F 4 .   ? -46.593 50.963 -2.009  1.00 45.83 ? 499 HOH A O     1 
HETATM 4420 O O     . HOH F 4 .   ? -18.803 13.115 18.280  1.00 35.24 ? 500 HOH A O     1 
HETATM 4421 O O     . HOH F 4 .   ? 5.506   49.426 6.407   1.00 61.90 ? 501 HOH A O     1 
HETATM 4422 O O     . HOH F 4 .   ? -10.647 17.907 19.624  1.00 43.45 ? 503 HOH A O     1 
HETATM 4423 O O     . HOH F 4 .   ? 1.400   33.563 21.539  1.00 42.81 ? 504 HOH A O     1 
HETATM 4424 O O     . HOH F 4 .   ? 0.266   27.800 29.976  1.00 44.78 ? 505 HOH A O     1 
HETATM 4425 O O     . HOH F 4 .   ? -5.490  -2.205 21.937  1.00 34.45 ? 506 HOH A O     1 
HETATM 4426 O O     . HOH F 4 .   ? -28.286 44.229 -14.141 1.00 34.78 ? 507 HOH A O     1 
HETATM 4427 O O     . HOH F 4 .   ? 9.682   24.359 54.268  1.00 50.80 ? 508 HOH A O     1 
HETATM 4428 O O     . HOH F 4 .   ? 3.749   21.830 27.794  1.00 45.45 ? 509 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  A   33  33  33  A   A   B . n 
B 2 1   MET 1   1   1   MET MET A . n 
B 2 2   LYS 2   2   2   LYS LYS A . n 
B 2 3   VAL 3   3   3   VAL VAL A . n 
B 2 4   GLU 4   4   4   GLU GLU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   ILE 6   6   6   ILE ILE A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  ALA 10  10  10  ALA ALA A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLU 12  12  12  GLU GLU A . n 
B 2 13  LEU 13  13  13  LEU LEU A . n 
B 2 14  VAL 14  14  14  VAL VAL A . n 
B 2 15  ILE 15  15  15  ILE ILE A . n 
B 2 16  PRO 16  16  16  PRO PRO A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  GLU 19  19  19  GLU GLU A . n 
B 2 20  GLU 20  20  20  GLU GLU A . n 
B 2 21  VAL 21  21  21  VAL VAL A . n 
B 2 22  ARG 22  22  22  ARG ARG A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  GLY 24  24  24  GLY GLY A . n 
B 2 25  ARG 25  25  25  ARG ARG A . n 
B 2 26  GLU 26  26  26  GLU GLU A . n 
B 2 27  ALA 27  27  27  ALA ALA A . n 
B 2 28  GLU 28  28  28  GLU GLU A . n 
B 2 29  GLU 29  29  29  GLU GLU A . n 
B 2 30  GLU 30  30  30  GLU GLU A . n 
B 2 31  LEU 31  31  31  LEU LEU A . n 
B 2 32  ARG 32  32  32  ARG ARG A . n 
B 2 33  ARG 33  33  33  ARG ARG A . n 
B 2 34  ARG 34  34  34  ARG ARG A . n 
B 2 35  LEU 35  35  35  LEU LEU A . n 
B 2 36  ASP 36  36  36  ASP ASP A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  LEU 38  38  38  LEU LEU A . n 
B 2 39  GLY 39  39  39  GLY GLY A . n 
B 2 40  VAL 40  40  40  VAL VAL A . n 
B 2 41  GLU 41  41  41  GLU GLU A . n 
B 2 42  TYR 42  42  42  TYR TYR A . n 
B 2 43  VAL 43  43  43  VAL VAL A . n 
B 2 44  PHE 44  44  44  PHE PHE A . n 
B 2 45  VAL 45  45  45  VAL VAL A . n 
B 2 46  GLY 46  46  46  GLY GLY A . n 
B 2 47  SER 47  47  47  SER SER A . n 
B 2 48  TYR 48  48  48  TYR TYR A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ARG 50  50  50  ARG ARG A . n 
B 2 51  ASN 51  51  51  ASN ASN A . n 
B 2 52  THR 52  52  52  THR THR A . n 
B 2 53  TRP 53  53  53  TRP TRP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LYS 55  55  55  LYS LYS A . n 
B 2 56  GLY 56  56  56  GLY GLY A . n 
B 2 57  SER 57  57  57  SER SER A . n 
B 2 58  LEU 58  58  58  LEU LEU A . n 
B 2 59  GLU 59  59  59  GLU GLU A . n 
B 2 60  ILE 60  60  60  ILE ILE A . n 
B 2 61  ASP 61  61  61  ASP ASP A . n 
B 2 62  VAL 62  62  62  VAL VAL A . n 
B 2 63  PHE 63  63  63  PHE PHE A . n 
B 2 64  LEU 64  64  64  LEU LEU A . n 
B 2 65  LEU 65  65  65  LEU LEU A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  PRO 67  67  67  PRO PRO A . n 
B 2 68  GLU 68  68  68  GLU GLU A . n 
B 2 69  GLU 69  69  69  GLU GLU A . n 
B 2 70  PHE 70  70  70  PHE PHE A . n 
B 2 71  SER 71  71  71  SER SER A . n 
B 2 72  LYS 72  72  72  LYS LYS A . n 
B 2 73  GLU 73  73  73  GLU GLU A . n 
B 2 74  GLU 74  74  74  GLU GLU A . n 
B 2 75  LEU 75  75  75  LEU LEU A . n 
B 2 76  ARG 76  76  76  ARG ARG A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  ARG 78  78  78  ARG ARG A . n 
B 2 79  GLY 79  79  79  GLY GLY A . n 
B 2 80  LEU 80  80  80  LEU LEU A . n 
B 2 81  GLU 81  81  81  GLU GLU A . n 
B 2 82  ILE 82  82  82  ILE ILE A . n 
B 2 83  GLY 83  83  83  GLY GLY A . n 
B 2 84  LYS 84  84  84  LYS LYS A . n 
B 2 85  ALA 85  85  85  ALA ALA A . n 
B 2 86  VAL 86  86  86  VAL VAL A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  ASP 88  88  88  ASP ASP A . n 
B 2 89  SER 89  89  89  SER SER A . n 
B 2 90  TYR 90  90  90  TYR TYR A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  ILE 92  92  92  ILE ILE A . n 
B 2 93  ARG 93  93  93  ARG ARG A . n 
B 2 94  TYR 94  94  94  TYR TYR A . n 
B 2 95  ALA 95  95  95  ALA ALA A . n 
B 2 96  GLU 96  96  96  GLU GLU A . n 
B 2 97  HIS 97  97  97  HIS HIS A . n 
B 2 98  PRO 98  98  98  PRO PRO A . n 
B 2 99  TYR 99  99  99  TYR TYR A . n 
B 2 100 VAL 100 100 100 VAL VAL A . n 
B 2 101 HIS 101 101 101 HIS HIS A . n 
B 2 102 GLY 102 102 102 GLY GLY A . n 
B 2 103 VAL 103 103 103 VAL VAL A . n 
B 2 104 VAL 104 104 104 VAL VAL A . n 
B 2 105 LYS 105 105 105 LYS LYS A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 VAL 107 107 107 VAL VAL A . n 
B 2 108 GLU 108 108 108 GLU GLU A . n 
B 2 109 VAL 109 109 109 VAL VAL A . n 
B 2 110 ASP 110 110 110 ASP ASP A . n 
B 2 111 VAL 111 111 111 VAL VAL A . n 
B 2 112 VAL 112 112 112 VAL VAL A . n 
B 2 113 PRO 113 113 113 PRO PRO A . n 
B 2 114 CYS 114 114 114 CYS CYS A . n 
B 2 115 TYR 115 115 115 TYR TYR A . n 
B 2 116 LYS 116 116 116 LYS LYS A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 LYS 118 118 118 LYS LYS A . n 
B 2 119 GLU 119 119 119 GLU GLU A . n 
B 2 120 PRO 120 120 120 PRO PRO A . n 
B 2 121 LYS 121 121 121 LYS LYS A . n 
B 2 122 ASN 122 122 122 ASN ASN A . n 
B 2 123 ILE 123 123 123 ILE ILE A . n 
B 2 124 LYS 124 124 124 LYS LYS A . n 
B 2 125 SER 125 125 125 SER SER A . n 
B 2 126 ALA 126 126 126 ALA ALA A . n 
B 2 127 VAL 127 127 127 VAL VAL A . n 
B 2 128 ASP 128 128 128 ASP ASP A . n 
B 2 129 ARG 129 129 129 ARG ARG A . n 
B 2 130 THR 130 130 130 THR THR A . n 
B 2 131 PRO 131 131 131 PRO PRO A . n 
B 2 132 PHE 132 132 132 PHE PHE A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 LYS 135 135 135 LYS LYS A . n 
B 2 136 TRP 136 136 136 TRP TRP A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 GLU 138 138 138 GLU GLU A . n 
B 2 139 GLY 139 139 139 GLY GLY A . n 
B 2 140 ARG 140 140 140 ARG ARG A . n 
B 2 141 ILE 141 141 141 ILE ILE A . n 
B 2 142 LYS 142 142 142 LYS LYS A . n 
B 2 143 GLY 143 143 143 GLY GLY A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 ASN 146 146 146 ASN ASN A . n 
B 2 147 GLU 147 147 147 GLU GLU A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 ARG 149 149 149 ARG ARG A . n 
B 2 150 LEU 150 150 150 LEU LEU A . n 
B 2 151 LEU 151 151 151 LEU LEU A . n 
B 2 152 LYS 152 152 152 LYS LYS A . n 
B 2 153 GLY 153 153 153 GLY GLY A . n 
B 2 154 PHE 154 154 154 PHE PHE A . n 
B 2 155 LEU 155 155 155 LEU LEU A . n 
B 2 156 LYS 156 156 156 LYS LYS A . n 
B 2 157 ALA 157 157 157 ALA ALA A . n 
B 2 158 ASN 158 158 158 ASN ASN A . n 
B 2 159 GLY 159 159 159 GLY GLY A . n 
B 2 160 ILE 160 160 160 ILE ILE A . n 
B 2 161 TYR 161 161 161 TYR TYR A . n 
B 2 162 GLY 162 162 162 GLY GLY A . n 
B 2 163 ALA 163 163 163 ALA ALA A . n 
B 2 164 GLU 164 164 164 GLU GLU A . n 
B 2 165 TYR 165 165 165 TYR TYR A . n 
B 2 166 LYS 166 166 166 LYS LYS A . n 
B 2 167 VAL 167 167 167 VAL VAL A . n 
B 2 168 ARG 168 168 168 ARG ARG A . n 
B 2 169 GLY 169 169 169 GLY GLY A . n 
B 2 170 PHE 170 170 170 PHE PHE A . n 
B 2 171 SER 171 171 171 SER SER A . n 
B 2 172 GLY 172 172 172 GLY GLY A . n 
B 2 173 TYR 173 173 173 TYR TYR A . n 
B 2 174 LEU 174 174 174 LEU LEU A . n 
B 2 175 CYS 175 175 175 CYS CYS A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 LEU 177 177 177 LEU LEU A . n 
B 2 178 LEU 178 178 178 LEU LEU A . n 
B 2 179 ILE 179 179 179 ILE ILE A . n 
B 2 180 VAL 180 180 180 VAL VAL A . n 
B 2 181 PHE 181 181 181 PHE PHE A . n 
B 2 182 TYR 182 182 182 TYR TYR A . n 
B 2 183 GLY 183 183 183 GLY GLY A . n 
B 2 184 SER 184 184 184 SER SER A . n 
B 2 185 PHE 185 185 185 PHE PHE A . n 
B 2 186 LEU 186 186 186 LEU LEU A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 THR 188 188 188 THR THR A . n 
B 2 189 VAL 189 189 189 VAL VAL A . n 
B 2 190 LYS 190 190 190 LYS LYS A . n 
B 2 191 ASN 191 191 191 ASN ASN A . n 
B 2 192 ALA 192 192 192 ALA ALA A . n 
B 2 193 ARG 193 193 193 ARG ARG A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 TRP 195 195 195 TRP TRP A . n 
B 2 196 THR 196 196 196 THR THR A . n 
B 2 197 ARG 197 197 197 ARG ARG A . n 
B 2 198 ARG 198 198 198 ARG ARG A . n 
B 2 199 THR 199 199 199 THR THR A . n 
B 2 200 VAL 200 200 200 VAL VAL A . n 
B 2 201 ILE 201 201 201 ILE ILE A . n 
B 2 202 ASP 202 202 202 ASP ASP A . n 
B 2 203 VAL 203 203 203 VAL VAL A . n 
B 2 204 ALA 204 204 204 ALA ALA A . n 
B 2 205 LYS 205 205 205 LYS LYS A . n 
B 2 206 GLY 206 206 206 GLY GLY A . n 
B 2 207 GLU 207 207 207 GLU GLU A . n 
B 2 208 VAL 208 208 208 VAL VAL A . n 
B 2 209 ARG 209 209 209 ARG ARG A . n 
B 2 210 LYS 210 210 210 LYS LYS A . n 
B 2 211 GLY 211 211 211 GLY GLY A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 GLU 213 213 213 GLU GLU A . n 
B 2 214 PHE 214 214 214 PHE PHE A . n 
B 2 215 PHE 215 215 215 PHE PHE A . n 
B 2 216 VAL 216 216 216 VAL VAL A . n 
B 2 217 VAL 217 217 217 VAL VAL A . n 
B 2 218 ASP 218 218 218 ASP ASP A . n 
B 2 219 PRO 219 219 219 PRO PRO A . n 
B 2 220 VAL 220 220 220 VAL VAL A . n 
B 2 221 ASP 221 221 221 ASP ASP A . n 
B 2 222 GLU 222 222 222 GLU GLU A . n 
B 2 223 LYS 223 223 223 LYS LYS A . n 
B 2 224 ARG 224 224 224 ARG ARG A . n 
B 2 225 ASN 225 225 225 ASN ASN A . n 
B 2 226 VAL 226 226 226 VAL VAL A . n 
B 2 227 ALA 227 227 227 ALA ALA A . n 
B 2 228 ALA 228 228 228 ALA ALA A . n 
B 2 229 ASN 229 229 229 ASN ASN A . n 
B 2 230 LEU 230 230 230 LEU LEU A . n 
B 2 231 SER 231 231 231 SER SER A . n 
B 2 232 LEU 232 232 232 LEU LEU A . n 
B 2 233 ASP 233 233 233 ASP ASP A . n 
B 2 234 ASN 234 234 234 ASN ASN A . n 
B 2 235 LEU 235 235 235 LEU LEU A . n 
B 2 236 ALA 236 236 236 ALA ALA A . n 
B 2 237 ARG 237 237 237 ARG ARG A . n 
B 2 238 PHE 238 238 238 PHE PHE A . n 
B 2 239 VAL 239 239 239 VAL VAL A . n 
B 2 240 HIS 240 240 240 HIS HIS A . n 
B 2 241 LEU 241 241 241 LEU LEU A . n 
B 2 242 CYS 242 242 242 CYS CYS A . n 
B 2 243 ARG 243 243 243 ARG ARG A . n 
B 2 244 GLU 244 244 244 GLU GLU A . n 
B 2 245 PHE 245 245 245 PHE PHE A . n 
B 2 246 MET 246 246 246 MET MET A . n 
B 2 247 GLU 247 247 247 GLU GLU A . n 
B 2 248 ALA 248 248 248 ALA ALA A . n 
B 2 249 PRO 249 249 249 PRO PRO A . n 
B 2 250 SER 250 250 250 SER SER A . n 
B 2 251 LEU 251 251 251 LEU LEU A . n 
B 2 252 GLY 252 252 252 GLY GLY A . n 
B 2 253 PHE 253 253 253 PHE PHE A . n 
B 2 254 PHE 254 254 254 PHE PHE A . n 
B 2 255 LYS 255 255 255 LYS LYS A . n 
B 2 256 PRO 256 256 256 PRO PRO A . n 
B 2 257 LYS 257 257 257 LYS LYS A . n 
B 2 258 HIS 258 258 258 HIS HIS A . n 
B 2 259 PRO 259 259 259 PRO PRO A . n 
B 2 260 LEU 260 260 260 LEU LEU A . n 
B 2 261 GLU 261 261 261 GLU GLU A . n 
B 2 262 ILE 262 262 262 ILE ILE A . n 
B 2 263 GLU 263 263 263 GLU GLU A . n 
B 2 264 PRO 264 264 264 PRO PRO A . n 
B 2 265 GLU 265 265 265 GLU GLU A . n 
B 2 266 ARG 266 266 266 ARG ARG A . n 
B 2 267 LEU 267 267 267 LEU LEU A . n 
B 2 268 ARG 268 268 268 ARG ARG A . n 
B 2 269 LYS 269 269 269 LYS LYS A . n 
B 2 270 ILE 270 270 270 ILE ILE A . n 
B 2 271 VAL 271 271 271 VAL VAL A . n 
B 2 272 GLU 272 272 272 GLU GLU A . n 
B 2 273 GLU 273 273 273 GLU GLU A . n 
B 2 274 ARG 274 274 274 ARG ARG A . n 
B 2 275 GLY 275 275 275 GLY GLY A . n 
B 2 276 THR 276 276 276 THR THR A . n 
B 2 277 ALA 277 277 277 ALA ALA A . n 
B 2 278 VAL 278 278 278 VAL VAL A . n 
B 2 279 PHE 279 279 279 PHE PHE A . n 
B 2 280 ALA 280 280 280 ALA ALA A . n 
B 2 281 VAL 281 281 281 VAL VAL A . n 
B 2 282 LYS 282 282 282 LYS LYS A . n 
B 2 283 PHE 283 283 283 PHE PHE A . n 
B 2 284 ARG 284 284 284 ARG ARG A . n 
B 2 285 LYS 285 285 285 LYS LYS A . n 
B 2 286 PRO 286 286 286 PRO PRO A . n 
B 2 287 ASP 287 287 287 ASP ASP A . n 
B 2 288 ILE 288 288 288 ILE ILE A . n 
B 2 289 VAL 289 289 289 VAL VAL A . n 
B 2 290 ASP 290 290 290 ASP ASP A . n 
B 2 291 ASP 291 291 291 ASP ASP A . n 
B 2 292 ASN 292 292 292 ASN ASN A . n 
B 2 293 LEU 293 293 293 LEU LEU A . n 
B 2 294 TYR 294 294 294 TYR TYR A . n 
B 2 295 PRO 295 295 295 PRO PRO A . n 
B 2 296 GLN 296 296 296 GLN GLN A . n 
B 2 297 LEU 297 297 297 LEU LEU A . n 
B 2 298 GLU 298 298 298 GLU GLU A . n 
B 2 299 ARG 299 299 299 ARG ARG A . n 
B 2 300 ALA 300 300 300 ALA ALA A . n 
B 2 301 SER 301 301 301 SER SER A . n 
B 2 302 ARG 302 302 302 ARG ARG A . n 
B 2 303 LYS 303 303 303 LYS LYS A . n 
B 2 304 ILE 304 304 304 ILE ILE A . n 
B 2 305 PHE 305 305 305 PHE PHE A . n 
B 2 306 GLU 306 306 306 GLU GLU A . n 
B 2 307 PHE 307 307 307 PHE PHE A . n 
B 2 308 LEU 308 308 308 LEU LEU A . n 
B 2 309 GLU 309 309 309 GLU GLU A . n 
B 2 310 ARG 310 310 310 ARG ARG A . n 
B 2 311 GLU 311 311 311 GLU GLU A . n 
B 2 312 ASN 312 312 312 ASN ASN A . n 
B 2 313 PHE 313 313 313 PHE PHE A . n 
B 2 314 MET 314 314 314 MET MET A . n 
B 2 315 PRO 315 315 315 PRO PRO A . n 
B 2 316 LEU 316 316 316 LEU LEU A . n 
B 2 317 ARG 317 317 317 ARG ARG A . n 
B 2 318 SER 318 318 318 SER SER A . n 
B 2 319 ALA 319 319 319 ALA ALA A . n 
B 2 320 PHE 320 320 320 PHE PHE A . n 
B 2 321 LYS 321 321 321 LYS LYS A . n 
B 2 322 ALA 322 322 322 ALA ALA A . n 
B 2 323 SER 323 323 323 SER SER A . n 
B 2 324 GLU 324 324 324 GLU GLU A . n 
B 2 325 GLU 325 325 325 GLU GLU A . n 
B 2 326 PHE 326 326 326 PHE PHE A . n 
B 2 327 CYS 327 327 327 CYS CYS A . n 
B 2 328 TYR 328 328 328 TYR TYR A . n 
B 2 329 LEU 329 329 329 LEU LEU A . n 
B 2 330 LEU 330 330 330 LEU LEU A . n 
B 2 331 PHE 331 331 331 PHE PHE A . n 
B 2 332 GLU 332 332 332 GLU GLU A . n 
B 2 333 CYS 333 333 333 CYS CYS A . n 
B 2 334 GLN 334 334 334 GLN GLN A . n 
B 2 335 ILE 335 335 335 ILE ILE A . n 
B 2 336 LYS 336 336 336 LYS LYS A . n 
B 2 337 GLU 337 337 337 GLU GLU A . n 
B 2 338 ILE 338 338 338 ILE ILE A . n 
B 2 339 SER 339 339 339 SER SER A . n 
B 2 340 ARG 340 340 340 ARG ARG A . n 
B 2 341 VAL 341 341 341 VAL VAL A . n 
B 2 342 PHE 342 342 342 PHE PHE A . n 
B 2 343 ARG 343 343 343 ARG ARG A . n 
B 2 344 ARG 344 344 344 ARG ARG A . n 
B 2 345 MET 345 345 345 MET MET A . n 
B 2 346 GLY 346 346 346 GLY GLY A . n 
B 2 347 PRO 347 347 347 PRO PRO A . n 
B 2 348 GLN 348 348 348 GLN GLN A . n 
B 2 349 PHE 349 349 349 PHE PHE A . n 
B 2 350 GLU 350 350 350 GLU GLU A . n 
B 2 351 ASP 351 351 351 ASP ASP A . n 
B 2 352 GLU 352 352 352 GLU GLU A . n 
B 2 353 ARG 353 353 353 ARG ARG A . n 
B 2 354 ASN 354 354 354 ASN ASN A . n 
B 2 355 VAL 355 355 355 VAL VAL A . n 
B 2 356 LYS 356 356 356 LYS LYS A . n 
B 2 357 LYS 357 357 357 LYS LYS A . n 
B 2 358 PHE 358 358 358 PHE PHE A . n 
B 2 359 LEU 359 359 359 LEU LEU A . n 
B 2 360 SER 360 360 360 SER SER A . n 
B 2 361 ARG 361 361 361 ARG ARG A . n 
B 2 362 ASN 362 362 362 ASN ASN A . n 
B 2 363 ARG 363 363 363 ARG ARG A . n 
B 2 364 ALA 364 364 364 ALA ALA A . n 
B 2 365 PHE 365 365 365 PHE PHE A . n 
B 2 366 ARG 366 366 366 ARG ARG A . n 
B 2 367 PRO 367 367 367 PRO PRO A . n 
B 2 368 PHE 368 368 368 PHE PHE A . n 
B 2 369 ILE 369 369 369 ILE ILE A . n 
B 2 370 GLU 370 370 370 GLU GLU A . n 
B 2 371 ASN 371 371 371 ASN ASN A . n 
B 2 372 GLY 372 372 372 GLY GLY A . n 
B 2 373 ARG 373 373 373 ARG ARG A . n 
B 2 374 TRP 374 374 374 TRP TRP A . n 
B 2 375 TRP 375 375 375 TRP TRP A . n 
B 2 376 ALA 376 376 376 ALA ALA A . n 
B 2 377 PHE 377 377 377 PHE PHE A . n 
B 2 378 GLU 378 378 378 GLU GLU A . n 
B 2 379 MET 379 379 379 MET MET A . n 
B 2 380 ARG 380 380 380 ARG ARG A . n 
B 2 381 LYS 381 381 381 LYS LYS A . n 
B 2 382 PHE 382 382 382 PHE PHE A . n 
B 2 383 THR 383 383 383 THR THR A . n 
B 2 384 THR 384 384 384 THR THR A . n 
B 2 385 PRO 385 385 385 PRO PRO A . n 
B 2 386 GLU 386 386 386 GLU GLU A . n 
B 2 387 GLU 387 387 387 GLU GLU A . n 
B 2 388 GLY 388 388 388 GLY GLY A . n 
B 2 389 VAL 389 389 389 VAL VAL A . n 
B 2 390 ARG 390 390 390 ARG ARG A . n 
B 2 391 SER 391 391 391 SER SER A . n 
B 2 392 TYR 392 392 392 TYR TYR A . n 
B 2 393 ALA 393 393 393 ALA ALA A . n 
B 2 394 SER 394 394 394 SER SER A . n 
B 2 395 THR 395 395 395 THR THR A . n 
B 2 396 HIS 396 396 396 HIS HIS A . n 
B 2 397 TRP 397 397 397 TRP TRP A . n 
B 2 398 HIS 398 398 398 HIS HIS A . n 
B 2 399 THR 399 399 399 THR THR A . n 
B 2 400 LEU 400 400 400 LEU LEU A . n 
B 2 401 GLY 401 401 401 GLY GLY A . n 
B 2 402 LYS 402 402 402 LYS LYS A . n 
B 2 403 ASN 403 403 403 ASN ASN A . n 
B 2 404 VAL 404 404 404 VAL VAL A . n 
B 2 405 GLY 405 405 405 GLY GLY A . n 
B 2 406 GLU 406 406 406 GLU GLU A . n 
B 2 407 SER 407 407 407 SER SER A . n 
B 2 408 ILE 408 408 408 ILE ILE A . n 
B 2 409 ARG 409 409 409 ARG ARG A . n 
B 2 410 GLU 410 410 410 GLU GLU A . n 
B 2 411 TYR 411 411 411 TYR TYR A . n 
B 2 412 PHE 412 412 412 PHE PHE A . n 
B 2 413 GLU 413 413 413 GLU GLU A . n 
B 2 414 ILE 414 414 414 ILE ILE A . n 
B 2 415 ILE 415 415 415 ILE ILE A . n 
B 2 416 SER 416 416 416 SER SER A . n 
B 2 417 GLY 417 417 417 GLY GLY A . n 
B 2 418 GLU 418 418 418 GLU GLU A . n 
B 2 419 LYS 419 419 419 LYS LYS A . n 
B 2 420 LEU 420 420 420 LEU LEU A . n 
B 2 421 PHE 421 421 421 PHE PHE A . n 
B 2 422 LYS 422 422 422 LYS LYS A . n 
B 2 423 GLU 423 423 423 GLU GLU A . n 
B 2 424 PRO 424 424 424 PRO PRO A . n 
B 2 425 VAL 425 425 425 VAL VAL A . n 
B 2 426 THR 426 426 426 THR THR A . n 
B 2 427 ALA 427 427 427 ALA ALA A . n 
B 2 428 GLU 428 428 428 GLU GLU A . n 
B 2 429 LEU 429 429 429 LEU LEU A . n 
B 2 430 CYS 430 430 430 CYS CYS A . n 
B 2 431 GLU 431 431 431 GLU GLU A . n 
B 2 432 MET 432 432 432 MET MET A . n 
B 2 433 MET 433 433 433 MET MET A . n 
B 2 434 GLY 434 434 434 GLY GLY A . n 
B 2 435 VAL 435 435 435 VAL VAL A . n 
B 2 436 LYS 436 436 436 LYS LYS A . n 
B 2 437 ASP 437 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  438 438 SO4 SO4 A . 
D 3 SO4 1  439 439 SO4 SO4 A . 
E 4 HOH 1  34  34  HOH HOH B . 
E 4 HOH 2  35  35  HOH HOH B . 
E 4 HOH 3  36  36  HOH HOH B . 
E 4 HOH 4  37  37  HOH HOH B . 
E 4 HOH 5  38  38  HOH HOH B . 
E 4 HOH 6  39  39  HOH HOH B . 
E 4 HOH 7  40  40  HOH HOH B . 
E 4 HOH 8  41  41  HOH HOH B . 
E 4 HOH 9  42  42  HOH HOH B . 
E 4 HOH 10 43  43  HOH HOH B . 
E 4 HOH 11 44  44  HOH HOH B . 
E 4 HOH 12 45  45  HOH HOH B . 
E 4 HOH 13 46  46  HOH HOH B . 
E 4 HOH 14 47  47  HOH HOH B . 
E 4 HOH 15 48  48  HOH HOH B . 
E 4 HOH 16 49  49  HOH HOH B . 
F 4 HOH 1  440 440 HOH HOH A . 
F 4 HOH 2  441 441 HOH HOH A . 
F 4 HOH 3  442 442 HOH HOH A . 
F 4 HOH 4  443 443 HOH HOH A . 
F 4 HOH 5  444 444 HOH HOH A . 
F 4 HOH 6  445 445 HOH HOH A . 
F 4 HOH 7  446 446 HOH HOH A . 
F 4 HOH 8  447 447 HOH HOH A . 
F 4 HOH 9  448 448 HOH HOH A . 
F 4 HOH 10 449 449 HOH HOH A . 
F 4 HOH 11 450 450 HOH HOH A . 
F 4 HOH 12 451 451 HOH HOH A . 
F 4 HOH 13 452 452 HOH HOH A . 
F 4 HOH 14 453 453 HOH HOH A . 
F 4 HOH 15 454 454 HOH HOH A . 
F 4 HOH 16 455 455 HOH HOH A . 
F 4 HOH 17 456 456 HOH HOH A . 
F 4 HOH 18 457 457 HOH HOH A . 
F 4 HOH 19 458 458 HOH HOH A . 
F 4 HOH 20 459 459 HOH HOH A . 
F 4 HOH 21 462 462 HOH HOH A . 
F 4 HOH 22 463 463 HOH HOH A . 
F 4 HOH 23 464 464 HOH HOH A . 
F 4 HOH 24 465 465 HOH HOH A . 
F 4 HOH 25 466 466 HOH HOH A . 
F 4 HOH 26 467 467 HOH HOH A . 
F 4 HOH 27 468 468 HOH HOH A . 
F 4 HOH 28 469 469 HOH HOH A . 
F 4 HOH 29 470 470 HOH HOH A . 
F 4 HOH 30 471 471 HOH HOH A . 
F 4 HOH 31 472 472 HOH HOH A . 
F 4 HOH 32 473 473 HOH HOH A . 
F 4 HOH 33 474 474 HOH HOH A . 
F 4 HOH 34 475 475 HOH HOH A . 
F 4 HOH 35 476 476 HOH HOH A . 
F 4 HOH 36 477 477 HOH HOH A . 
F 4 HOH 37 478 478 HOH HOH A . 
F 4 HOH 38 479 479 HOH HOH A . 
F 4 HOH 39 480 480 HOH HOH A . 
F 4 HOH 40 481 481 HOH HOH A . 
F 4 HOH 41 482 482 HOH HOH A . 
F 4 HOH 42 483 483 HOH HOH A . 
F 4 HOH 43 484 484 HOH HOH A . 
F 4 HOH 44 485 485 HOH HOH A . 
F 4 HOH 45 486 486 HOH HOH A . 
F 4 HOH 46 487 487 HOH HOH A . 
F 4 HOH 47 488 488 HOH HOH A . 
F 4 HOH 48 489 489 HOH HOH A . 
F 4 HOH 49 490 490 HOH HOH A . 
F 4 HOH 50 491 491 HOH HOH A . 
F 4 HOH 51 492 492 HOH HOH A . 
F 4 HOH 52 493 493 HOH HOH A . 
F 4 HOH 53 494 494 HOH HOH A . 
F 4 HOH 54 495 495 HOH HOH A . 
F 4 HOH 55 496 496 HOH HOH A . 
F 4 HOH 56 497 497 HOH HOH A . 
F 4 HOH 57 498 498 HOH HOH A . 
F 4 HOH 58 499 499 HOH HOH A . 
F 4 HOH 59 500 500 HOH HOH A . 
F 4 HOH 60 501 501 HOH HOH A . 
F 4 HOH 61 503 503 HOH HOH A . 
F 4 HOH 62 504 504 HOH HOH A . 
F 4 HOH 63 505 505 HOH HOH A . 
F 4 HOH 64 506 506 HOH HOH A . 
F 4 HOH 65 507 507 HOH HOH A . 
F 4 HOH 66 508 508 HOH HOH A . 
F 4 HOH 67 509 509 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2860  ? 
1 MORE         -46   ? 
1 'SSA (A^2)'  27430 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 51  ? ? 39.93   35.26   
2 1 ALA A 95  ? ? -167.94 -139.68 
3 1 GLU A 119 ? ? 85.73   114.07  
4 1 PRO A 120 ? ? -37.59  -39.05  
5 1 ASN A 122 ? ? 75.85   -5.73   
6 1 ALA A 248 ? ? -160.35 80.85   
7 1 ARG A 366 ? ? 65.69   96.52   
8 1 PHE A 412 ? ? 179.02  161.49  
9 1 PRO A 424 ? ? -71.29  41.35   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    U 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     14 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.076 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZH1 'double helix'         
2ZH1 'a-form double helix'  
2ZH1 'hairpin loop'         
2ZH1 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 -0.163 -0.193 0.909  10.622  -0.622  -5.399  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.841 -0.078 0.301  9.693   -8.254  2.269   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 -0.148 0.106  0.131  8.454   -12.761 2.942   3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 0.133  0.132  -0.052 0.026   -8.115  6.456   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 -0.200 0.078  -0.454 11.877  -6.226  6.329   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.749 -0.675 -0.688 -10.027 -13.346 9.320   6  B_G6:U26_B  B 6  ? B 26 ? 28 ? 
1 A G 7  1_555 A C 25 1_555 -0.291 0.048  -0.596 -13.638 -13.492 -4.979  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.658  -0.094 -0.188 -7.929  -11.674 1.329   8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.540 -0.260 -0.139 -14.747 -18.484 -5.655  9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 -0.644 -0.180 0.190  1.719   -13.672 -5.365  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 -0.285 -0.060 0.255  -7.791  -15.830 5.565   11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 0.163  0.179  -0.040 -8.973  -21.217 -0.589  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.277  -2.180 -0.048 -7.662  7.778   -86.928 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.498  -1.859 3.111 2.398  7.425  32.546 -4.328 -0.510 2.662 13.016 -4.204 
33.444 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.394 -1.922 3.242 -2.001 0.899  33.050 -3.521 0.359  3.208 1.579  3.513  
33.121 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.034 -2.199 3.299 1.642  7.341  33.921 -4.740 0.293  2.773 12.394 -2.772 
34.722 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 0.058  -1.892 2.997 1.993  4.780  24.749 -5.525 0.367  2.587 10.998 -4.585 
25.277 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.538  -2.338 3.848 1.611  17.388 18.659 -9.877 -3.059 1.343 43.267 -4.008 
25.503 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.107 -1.717 3.486 -4.795 2.544  37.661 -2.980 1.046  3.476 3.916  7.380  
38.037 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.076  -1.896 3.083 -0.091 12.450 37.919 -4.015 -0.121 2.369 18.558 0.136  
39.839 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.201  -1.902 3.487 -0.512 4.270  20.529 -7.047 -0.770 3.026 11.814 1.416  
20.970 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.974  -2.348 2.829 1.384  -1.551 28.832 -4.398 -1.679 2.991 -3.109 -2.774 
28.906 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.277 -2.144 3.246 -1.023 10.716 29.916 -5.660 0.341  2.364 19.962 1.905  
31.753 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.213  -1.562 3.236 2.756  7.079  37.774 -3.203 0.001  2.915 10.801 -4.205 
38.503 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.841 -1.863 3.300 1.116  -2.025 78.325 -1.418 1.489  3.318 -1.603 -0.883 
78.354 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#