data_2ZH2
# 
_entry.id   2ZH2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZH2         
NDB   PR0319       
RCSB  RCSB027962   
WWPDB D_1000027962 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH1 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH5 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH7 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHA . unspecified 
PDB 2ZHB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZH2 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZH2 
_cell.length_a           57.983 
_cell.length_b           57.983 
_cell.length_c           440.748 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZH2 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (34-MER)'     10928.526 1   ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme' 51469.137 1   '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'       96.063    2   ?                    ? ? ? 
4 water       nat water               18.015    129 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAAC GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAAC B ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  A   n 
1 34  C   n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 ? 
2 PDB 2ZH2      2ZH2   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAAC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZH2 A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 2ZH2 B 1 ? 34  ? 2ZH2   1 ? 34  ? 1 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ZH2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.97 
_exptl_crystal.density_percent_sol   58.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-10-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZH2 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.66 
_reflns.number_obs                   23187 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.150 
_reflns.pdbx_netI_over_sigmaI        50.5 
_reflns.B_iso_Wilson_estimate        43.6 
_reflns.pdbx_redundancy              13.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.66 
_reflns_shell.d_res_low              2.76 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.268 
_reflns_shell.meanI_over_sigI_obs    11.3 
_reflns_shell.pdbx_redundancy        12.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2258 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZH2 
_refine.ls_number_reflns_obs                     23047 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2763048.31 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.94 
_refine.ls_d_res_high                            2.66 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.224 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.224 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1115 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.6 
_refine.aniso_B[1][1]                            -0.52 
_refine.aniso_B[2][2]                            -0.52 
_refine.aniso_B[3][3]                            1.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.34772 
_refine.solvent_model_param_bsol                 29.6244 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2DRB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZH2 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3630 
_refine_hist.pdbx_number_atoms_nucleic_acid   725 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             129 
_refine_hist.number_atoms_total               4494 
_refine_hist.d_res_high                       2.66 
_refine_hist.d_res_low                        39.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.01  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.07  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.87  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.51  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.42  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.66 
_refine_ls_shell.d_res_low                        2.83 
_refine_ls_shell.number_reflns_R_work             3538 
_refine_ls_shell.R_factor_R_work                  0.29 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            0.026 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             186 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 SO4.param         ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZH2 
_struct.title                     'Complex structure of AFCCA with tRNAminiDAC' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZH2 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 2   ? ILE B 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 17  ? GLU B 37  ? ASP A 17  GLU A 37  1 ? 21 
HELX_P HELX_P3  3  GLY B 46  ? ARG B 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 71  ? LEU B 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 125 ? LYS B 142 ? SER A 125 LYS A 142 1 ? 18 
HELX_P HELX_P6  6  LYS B 144 ? ASN B 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER B 171 ? GLY B 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER B 184 ? ARG B 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER B 231 ? ALA B 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER B 250 ? LYS B 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU B 263 ? GLY B 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL B 289 ? GLU B 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP B 351 ? ARG B 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR B 384 ? HIS B 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP B 397 ? LEU B 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY B 401 ? TYR B 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLU B 418 ? LEU B 420 ? GLU A 418 LEU A 420 5 ? 3  
HELX_P HELX_P18 18 VAL B 425 ? GLY B 434 ? VAL A 425 GLY A 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 31 N3 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 31 O2 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 31 N4 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 30 N3 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 30 O2 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 30 N4 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? A C 3  N3 ? ? ? 1_555 A G 29 N1 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8  hydrog ? ? A C 3  N4 ? ? ? 1_555 A G 29 O6 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? A C 3  O2 ? ? ? 1_555 A G 29 N2 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? A C 4  N3 ? ? ? 1_555 A G 28 N1 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11 hydrog ? ? A C 4  N4 ? ? ? 1_555 A G 28 O6 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? A C 4  O2 ? ? ? 1_555 A G 28 N2 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 27 N1 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 27 O6 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog15 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 27 N2 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog16 hydrog ? ? A G 6  N1 ? ? ? 1_555 A U 26 O2 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog17 hydrog ? ? A G 6  O6 ? ? ? 1_555 A U 26 N3 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog18 hydrog ? ? A G 7  N1 ? ? ? 1_555 A C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? A G 7  N2 ? ? ? 1_555 A C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? A G 7  O6 ? ? ? 1_555 A C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 24 O2 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 24 N4 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog24 hydrog ? ? A G 9  N1 ? ? ? 1_555 A C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog25 hydrog ? ? A G 9  N2 ? ? ? 1_555 A C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog26 hydrog ? ? A G 9  O6 ? ? ? 1_555 A C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog27 hydrog ? ? A C 10 N3 ? ? ? 1_555 A G 22 N1 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? A C 10 N4 ? ? ? 1_555 A G 22 O6 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? A C 10 O2 ? ? ? 1_555 A G 22 N2 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? A G 11 N1 ? ? ? 1_555 A C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? A G 11 N2 ? ? ? 1_555 A C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? A G 11 O6 ? ? ? 1_555 A C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? A G 12 N1 ? ? ? 1_555 A C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? A G 12 N2 ? ? ? 1_555 A C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36 hydrog ? ? A U 13 N3 ? ? ? 1_555 A A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog37 hydrog ? ? A U 13 O2 ? ? ? 1_555 A A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 42  ? VAL B 45  ? TYR A 42  VAL A 45  
A 2 GLU B 59  ? PHE B 66  ? GLU A 59  PHE A 66  
A 3 VAL B 107 ? TYR B 115 ? VAL A 107 TYR A 115 
A 4 PRO B 98  ? VAL B 104 ? PRO A 98  VAL A 104 
A 5 SER B 89  ? TYR B 94  ? SER A 89  TYR A 94  
B 1 GLU B 207 ? LYS B 210 ? GLU A 207 LYS A 210 
B 2 THR B 199 ? ASP B 202 ? THR A 199 ASP A 202 
B 3 PHE B 215 ? ASP B 218 ? PHE A 215 ASP A 218 
B 4 ASP B 221 ? ASN B 225 ? ASP A 221 ASN A 225 
C 1 PRO B 315 ? ALA B 322 ? PRO A 315 ALA A 322 
C 2 PHE B 326 ? CYS B 333 ? PHE A 326 CYS A 333 
C 3 ALA B 277 ? ARG B 284 ? ALA A 277 ARG A 284 
C 4 GLU B 413 ? SER B 416 ? GLU A 413 SER A 416 
D 1 VAL B 341 ? GLN B 348 ? VAL A 341 GLN A 348 
D 2 ARG B 373 ? MET B 379 ? ARG A 373 MET A 379 
D 3 PHE B 368 ? GLU B 370 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 43  ? N VAL A 43  O PHE B 63  ? O PHE A 63  
A 2 3 N VAL B 62  ? N VAL A 62  O ASP B 110 ? O ASP A 110 
A 3 4 O VAL B 111 ? O VAL A 111 N VAL B 100 ? N VAL A 100 
A 4 5 O HIS B 101 ? O HIS A 101 N GLU B 91  ? N GLU A 91  
B 1 2 O GLU B 207 ? O GLU A 207 N ASP B 202 ? N ASP A 202 
B 2 3 N THR B 199 ? N THR A 199 O PHE B 215 ? O PHE A 215 
B 3 4 N ASP B 218 ? N ASP A 218 O ARG B 224 ? O ARG A 224 
C 1 2 N LEU B 316 ? N LEU A 316 O GLU B 332 ? O GLU A 332 
C 2 3 O LEU B 329 ? O LEU A 329 N VAL B 281 ? N VAL A 281 
C 3 4 N LYS B 282 ? N LYS A 282 O GLU B 413 ? O GLU A 413 
D 1 2 N PHE B 342 ? N PHE A 342 O GLU B 378 ? O GLU A 378 
D 2 3 O TRP B 375 ? O TRP A 375 N PHE B 368 ? N PHE A 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 438' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 439' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER B 47  ? SER A 47  . ? 1_555 ? 
2 AC1 6 TRP B 53  ? TRP A 53  . ? 1_555 ? 
3 AC1 6 LEU B 54  ? LEU A 54  . ? 1_555 ? 
4 AC1 6 SER B 57  ? SER A 57  . ? 1_555 ? 
5 AC1 6 LYS B 152 ? LYS A 152 . ? 1_555 ? 
6 AC1 6 TYR B 161 ? TYR A 161 . ? 1_555 ? 
7 AC2 3 ARG B 299 ? ARG A 299 . ? 1_555 ? 
8 AC2 3 ARG B 302 ? ARG A 302 . ? 1_555 ? 
9 AC2 3 LYS B 303 ? LYS A 303 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZH2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZH2 
_atom_sites.fract_transf_matrix[1][1]   0.017246 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017246 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002269 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . G   A 1 1   ? 14.431  6.818   36.230  1.00 56.57 ? 1   G   B P     1 
ATOM   2    O OP1   . G   A 1 1   ? 13.275  5.834   36.412  1.00 56.40 ? 1   G   B OP1   1 
ATOM   3    O OP2   . G   A 1 1   ? 13.969  8.267   36.329  1.00 56.20 ? 1   G   B OP2   1 
ATOM   4    O "O5'" . G   A 1 1   ? 14.946  6.570   34.698  1.00 53.79 ? 1   G   B "O5'" 1 
ATOM   5    C "C5'" . G   A 1 1   ? 16.132  7.216   34.207  1.00 48.27 ? 1   G   B "C5'" 1 
ATOM   6    C "C4'" . G   A 1 1   ? 16.841  6.344   33.194  1.00 45.54 ? 1   G   B "C4'" 1 
ATOM   7    O "O4'" . G   A 1 1   ? 17.238  5.087   33.799  1.00 43.67 ? 1   G   B "O4'" 1 
ATOM   8    C "C3'" . G   A 1 1   ? 16.067  5.929   31.955  1.00 44.58 ? 1   G   B "C3'" 1 
ATOM   9    O "O3'" . G   A 1 1   ? 16.111  6.958   30.972  1.00 44.85 ? 1   G   B "O3'" 1 
ATOM   10   C "C2'" . G   A 1 1   ? 16.878  4.731   31.481  1.00 44.51 ? 1   G   B "C2'" 1 
ATOM   11   O "O2'" . G   A 1 1   ? 18.042  5.147   30.797  1.00 44.01 ? 1   G   B "O2'" 1 
ATOM   12   C "C1'" . G   A 1 1   ? 17.267  4.074   32.810  1.00 43.12 ? 1   G   B "C1'" 1 
ATOM   13   N N9    . G   A 1 1   ? 16.345  3.014   33.210  1.00 42.78 ? 1   G   B N9    1 
ATOM   14   C C8    . G   A 1 1   ? 15.361  3.095   34.168  1.00 42.72 ? 1   G   B C8    1 
ATOM   15   N N7    . G   A 1 1   ? 14.674  1.992   34.294  1.00 42.43 ? 1   G   B N7    1 
ATOM   16   C C5    . G   A 1 1   ? 15.243  1.124   33.367  1.00 42.69 ? 1   G   B C5    1 
ATOM   17   C C6    . G   A 1 1   ? 14.914  -0.223  33.039  1.00 41.54 ? 1   G   B C6    1 
ATOM   18   O O6    . G   A 1 1   ? 14.019  -0.933  33.503  1.00 39.67 ? 1   G   B O6    1 
ATOM   19   N N1    . G   A 1 1   ? 15.752  -0.729  32.051  1.00 41.51 ? 1   G   B N1    1 
ATOM   20   C C2    . G   A 1 1   ? 16.771  -0.036  31.449  1.00 42.10 ? 1   G   B C2    1 
ATOM   21   N N2    . G   A 1 1   ? 17.487  -0.718  30.545  1.00 42.27 ? 1   G   B N2    1 
ATOM   22   N N3    . G   A 1 1   ? 17.073  1.225   31.724  1.00 42.88 ? 1   G   B N3    1 
ATOM   23   C C4    . G   A 1 1   ? 16.278  1.738   32.692  1.00 42.88 ? 1   G   B C4    1 
ATOM   24   P P     . G   A 1 2   ? 14.946  7.061   29.865  1.00 37.13 ? 2   G   B P     1 
ATOM   25   O OP1   . G   A 1 2   ? 15.150  8.311   29.077  1.00 36.40 ? 2   G   B OP1   1 
ATOM   26   O OP2   . G   A 1 2   ? 13.651  6.834   30.556  1.00 38.13 ? 2   G   B OP2   1 
ATOM   27   O "O5'" . G   A 1 2   ? 15.224  5.816   28.912  1.00 38.88 ? 2   G   B "O5'" 1 
ATOM   28   C "C5'" . G   A 1 2   ? 16.392  5.765   28.099  1.00 38.62 ? 2   G   B "C5'" 1 
ATOM   29   C "C4'" . G   A 1 2   ? 16.454  4.459   27.344  1.00 38.77 ? 2   G   B "C4'" 1 
ATOM   30   O "O4'" . G   A 1 2   ? 16.711  3.367   28.268  1.00 38.90 ? 2   G   B "O4'" 1 
ATOM   31   C "C3'" . G   A 1 2   ? 15.185  4.021   26.629  1.00 38.79 ? 2   G   B "C3'" 1 
ATOM   32   O "O3'" . G   A 1 2   ? 15.011  4.652   25.366  1.00 36.95 ? 2   G   B "O3'" 1 
ATOM   33   C "C2'" . G   A 1 2   ? 15.448  2.536   26.449  1.00 38.81 ? 2   G   B "C2'" 1 
ATOM   34   O "O2'" . G   A 1 2   ? 16.393  2.302   25.424  1.00 39.42 ? 2   G   B "O2'" 1 
ATOM   35   C "C1'" . G   A 1 2   ? 16.074  2.190   27.798  1.00 39.68 ? 2   G   B "C1'" 1 
ATOM   36   N N9    . G   A 1 2   ? 15.081  1.761   28.781  1.00 41.03 ? 2   G   B N9    1 
ATOM   37   C C8    . G   A 1 2   ? 14.490  2.520   29.765  1.00 41.50 ? 2   G   B C8    1 
ATOM   38   N N7    . G   A 1 2   ? 13.626  1.848   30.480  1.00 41.12 ? 2   G   B N7    1 
ATOM   39   C C5    . G   A 1 2   ? 13.652  0.567   29.940  1.00 40.78 ? 2   G   B C5    1 
ATOM   40   C C6    . G   A 1 2   ? 12.927  -0.601  30.299  1.00 40.48 ? 2   G   B C6    1 
ATOM   41   O O6    . G   A 1 2   ? 12.092  -0.746  31.199  1.00 40.50 ? 2   G   B O6    1 
ATOM   42   N N1    . G   A 1 2   ? 13.257  -1.676  29.484  1.00 39.24 ? 2   G   B N1    1 
ATOM   43   C C2    . G   A 1 2   ? 14.163  -1.637  28.459  1.00 40.44 ? 2   G   B C2    1 
ATOM   44   N N2    . G   A 1 2   ? 14.338  -2.777  27.779  1.00 41.72 ? 2   G   B N2    1 
ATOM   45   N N3    . G   A 1 2   ? 14.849  -0.562  28.119  1.00 40.63 ? 2   G   B N3    1 
ATOM   46   C C4    . G   A 1 2   ? 14.545  0.496   28.894  1.00 40.68 ? 2   G   B C4    1 
ATOM   47   P P     . C   A 1 3   ? 13.571  4.616   24.665  1.00 33.62 ? 3   C   B P     1 
ATOM   48   O OP1   . C   A 1 3   ? 13.652  5.330   23.367  1.00 35.63 ? 3   C   B OP1   1 
ATOM   49   O OP2   . C   A 1 3   ? 12.570  5.041   25.676  1.00 37.53 ? 3   C   B OP2   1 
ATOM   50   O "O5'" . C   A 1 3   ? 13.302  3.073   24.376  1.00 36.32 ? 3   C   B "O5'" 1 
ATOM   51   C "C5'" . C   A 1 3   ? 13.939  2.417   23.284  1.00 35.66 ? 3   C   B "C5'" 1 
ATOM   52   C "C4'" . C   A 1 3   ? 13.416  1.012   23.135  1.00 36.31 ? 3   C   B "C4'" 1 
ATOM   53   O "O4'" . C   A 1 3   ? 13.698  0.264   24.352  1.00 36.41 ? 3   C   B "O4'" 1 
ATOM   54   C "C3'" . C   A 1 3   ? 11.913  0.855   22.967  1.00 36.92 ? 3   C   B "C3'" 1 
ATOM   55   O "O3'" . C   A 1 3   ? 11.486  1.060   21.625  1.00 37.50 ? 3   C   B "O3'" 1 
ATOM   56   C "C2'" . C   A 1 3   ? 11.717  -0.594  23.380  1.00 36.53 ? 3   C   B "C2'" 1 
ATOM   57   O "O2'" . C   A 1 3   ? 12.122  -1.472  22.350  1.00 34.55 ? 3   C   B "O2'" 1 
ATOM   58   C "C1'" . C   A 1 3   ? 12.674  -0.692  24.571  1.00 35.78 ? 3   C   B "C1'" 1 
ATOM   59   N N1    . C   A 1 3   ? 11.984  -0.353  25.822  1.00 35.83 ? 3   C   B N1    1 
ATOM   60   C C2    . C   A 1 3   ? 11.229  -1.335  26.443  1.00 35.03 ? 3   C   B C2    1 
ATOM   61   O O2    . C   A 1 3   ? 11.222  -2.469  25.957  1.00 37.25 ? 3   C   B O2    1 
ATOM   62   N N3    . C   A 1 3   ? 10.529  -1.033  27.551  1.00 34.45 ? 3   C   B N3    1 
ATOM   63   C C4    . C   A 1 3   ? 10.573  0.201   28.047  1.00 34.69 ? 3   C   B C4    1 
ATOM   64   N N4    . C   A 1 3   ? 9.834   0.463   29.123  1.00 33.68 ? 3   C   B N4    1 
ATOM   65   C C5    . C   A 1 3   ? 11.369  1.222   27.456  1.00 34.31 ? 3   C   B C5    1 
ATOM   66   C C6    . C   A 1 3   ? 12.054  0.904   26.354  1.00 35.35 ? 3   C   B C6    1 
ATOM   67   P P     . C   A 1 4   ? 9.921   1.290   21.322  1.00 45.37 ? 4   C   B P     1 
ATOM   68   O OP1   . C   A 1 4   ? 9.753   1.414   19.852  1.00 44.43 ? 4   C   B OP1   1 
ATOM   69   O OP2   . C   A 1 4   ? 9.419   2.366   22.214  1.00 45.37 ? 4   C   B OP2   1 
ATOM   70   O "O5'" . C   A 1 4   ? 9.231   -0.061  21.810  1.00 45.79 ? 4   C   B "O5'" 1 
ATOM   71   C "C5'" . C   A 1 4   ? 9.302   -1.240  21.015  1.00 44.93 ? 4   C   B "C5'" 1 
ATOM   72   C "C4'" . C   A 1 4   ? 8.272   -2.235  21.473  1.00 44.79 ? 4   C   B "C4'" 1 
ATOM   73   O "O4'" . C   A 1 4   ? 8.586   -2.635  22.828  1.00 45.32 ? 4   C   B "O4'" 1 
ATOM   74   C "C3'" . C   A 1 4   ? 6.847   -1.720  21.571  1.00 45.05 ? 4   C   B "C3'" 1 
ATOM   75   O "O3'" . C   A 1 4   ? 6.205   -1.769  20.300  1.00 44.82 ? 4   C   B "O3'" 1 
ATOM   76   C "C2'" . C   A 1 4   ? 6.236   -2.707  22.556  1.00 45.73 ? 4   C   B "C2'" 1 
ATOM   77   O "O2'" . C   A 1 4   ? 5.963   -3.956  21.961  1.00 46.21 ? 4   C   B "O2'" 1 
ATOM   78   C "C1'" . C   A 1 4   ? 7.390   -2.895  23.538  1.00 45.79 ? 4   C   B "C1'" 1 
ATOM   79   N N1    . C   A 1 4   ? 7.328   -1.988  24.692  1.00 46.56 ? 4   C   B N1    1 
ATOM   80   C C2    . C   A 1 4   ? 6.495   -2.325  25.755  1.00 46.46 ? 4   C   B C2    1 
ATOM   81   O O2    . C   A 1 4   ? 5.822   -3.369  25.676  1.00 46.52 ? 4   C   B O2    1 
ATOM   82   N N3    . C   A 1 4   ? 6.440   -1.511  26.837  1.00 45.92 ? 4   C   B N3    1 
ATOM   83   C C4    . C   A 1 4   ? 7.174   -0.397  26.873  1.00 45.58 ? 4   C   B C4    1 
ATOM   84   N N4    . C   A 1 4   ? 7.095   0.370   27.964  1.00 43.89 ? 4   C   B N4    1 
ATOM   85   C C5    . C   A 1 4   ? 8.023   -0.021  25.796  1.00 45.45 ? 4   C   B C5    1 
ATOM   86   C C6    . C   A 1 4   ? 8.072   -0.839  24.734  1.00 46.87 ? 4   C   B C6    1 
ATOM   87   P P     . C   A 1 5   ? 4.936   -0.817  20.001  1.00 61.03 ? 5   C   B P     1 
ATOM   88   O OP1   . C   A 1 5   ? 4.503   -1.101  18.606  1.00 61.22 ? 5   C   B OP1   1 
ATOM   89   O OP2   . C   A 1 5   ? 5.270   0.579   20.396  1.00 60.28 ? 5   C   B OP2   1 
ATOM   90   O "O5'" . C   A 1 5   ? 3.800   -1.365  20.980  1.00 61.07 ? 5   C   B "O5'" 1 
ATOM   91   C "C5'" . C   A 1 5   ? 3.129   -2.590  20.688  1.00 60.83 ? 5   C   B "C5'" 1 
ATOM   92   C "C4'" . C   A 1 5   ? 2.146   -2.948  21.783  1.00 60.88 ? 5   C   B "C4'" 1 
ATOM   93   O "O4'" . C   A 1 5   ? 2.836   -3.089  23.057  1.00 60.03 ? 5   C   B "O4'" 1 
ATOM   94   C "C3'" . C   A 1 5   ? 1.049   -1.946  22.102  1.00 60.76 ? 5   C   B "C3'" 1 
ATOM   95   O "O3'" . C   A 1 5   ? -0.018  -2.002  21.159  1.00 62.11 ? 5   C   B "O3'" 1 
ATOM   96   C "C2'" . C   A 1 5   ? 0.590   -2.441  23.468  1.00 60.35 ? 5   C   B "C2'" 1 
ATOM   97   O "O2'" . C   A 1 5   ? -0.234  -3.587  23.371  1.00 60.32 ? 5   C   B "O2'" 1 
ATOM   98   C "C1'" . C   A 1 5   ? 1.922   -2.827  24.113  1.00 59.71 ? 5   C   B "C1'" 1 
ATOM   99   N N1    . C   A 1 5   ? 2.441   -1.731  24.939  1.00 58.94 ? 5   C   B N1    1 
ATOM   100  C C2    . C   A 1 5   ? 1.942   -1.587  26.236  1.00 58.98 ? 5   C   B C2    1 
ATOM   101  O O2    . C   A 1 5   ? 1.108   -2.403  26.648  1.00 58.89 ? 5   C   B O2    1 
ATOM   102  N N3    . C   A 1 5   ? 2.381   -0.569  27.009  1.00 58.39 ? 5   C   B N3    1 
ATOM   103  C C4    . C   A 1 5   ? 3.294   0.279   26.532  1.00 58.70 ? 5   C   B C4    1 
ATOM   104  N N4    . C   A 1 5   ? 3.706   1.267   27.332  1.00 59.16 ? 5   C   B N4    1 
ATOM   105  C C5    . C   A 1 5   ? 3.827   0.151   25.212  1.00 58.16 ? 5   C   B C5    1 
ATOM   106  C C6    . C   A 1 5   ? 3.376   -0.859  24.458  1.00 58.38 ? 5   C   B C6    1 
ATOM   107  P P     . G   A 1 6   ? -0.997  -0.729  20.980  1.00 76.32 ? 6   G   B P     1 
ATOM   108  O OP1   . G   A 1 6   ? -2.125  -1.183  20.129  1.00 75.79 ? 6   G   B OP1   1 
ATOM   109  O OP2   . G   A 1 6   ? -0.183  0.439   20.549  1.00 75.08 ? 6   G   B OP2   1 
ATOM   110  O "O5'" . G   A 1 6   ? -1.555  -0.444  22.451  1.00 74.83 ? 6   G   B "O5'" 1 
ATOM   111  C "C5'" . G   A 1 6   ? -2.406  -1.392  23.086  1.00 75.37 ? 6   G   B "C5'" 1 
ATOM   112  C "C4'" . G   A 1 6   ? -2.994  -0.841  24.370  1.00 75.59 ? 6   G   B "C4'" 1 
ATOM   113  O "O4'" . G   A 1 6   ? -2.005  -0.737  25.427  1.00 75.07 ? 6   G   B "O4'" 1 
ATOM   114  C "C3'" . G   A 1 6   ? -3.598  0.551   24.372  1.00 75.72 ? 6   G   B "C3'" 1 
ATOM   115  O "O3'" . G   A 1 6   ? -4.857  0.593   23.708  1.00 76.79 ? 6   G   B "O3'" 1 
ATOM   116  C "C2'" . G   A 1 6   ? -3.757  0.812   25.872  1.00 74.88 ? 6   G   B "C2'" 1 
ATOM   117  O "O2'" . G   A 1 6   ? -4.923  0.242   26.431  1.00 74.61 ? 6   G   B "O2'" 1 
ATOM   118  C "C1'" . G   A 1 6   ? -2.529  0.101   26.448  1.00 73.83 ? 6   G   B "C1'" 1 
ATOM   119  N N9    . G   A 1 6   ? -1.522  1.064   26.876  1.00 72.57 ? 6   G   B N9    1 
ATOM   120  C C8    . G   A 1 6   ? -0.423  1.513   26.183  1.00 71.90 ? 6   G   B C8    1 
ATOM   121  N N7    . G   A 1 6   ? 0.252   2.424   26.834  1.00 71.11 ? 6   G   B N7    1 
ATOM   122  C C5    . G   A 1 6   ? -0.438  2.575   28.032  1.00 70.78 ? 6   G   B C5    1 
ATOM   123  C C6    . G   A 1 6   ? -0.189  3.430   29.146  1.00 70.46 ? 6   G   B C6    1 
ATOM   124  O O6    . G   A 1 6   ? 0.719   4.257   29.303  1.00 70.79 ? 6   G   B O6    1 
ATOM   125  N N1    . G   A 1 6   ? -1.139  3.254   30.146  1.00 70.41 ? 6   G   B N1    1 
ATOM   126  C C2    . G   A 1 6   ? -2.196  2.378   30.091  1.00 70.50 ? 6   G   B C2    1 
ATOM   127  N N2    . G   A 1 6   ? -3.011  2.360   31.162  1.00 69.56 ? 6   G   B N2    1 
ATOM   128  N N3    . G   A 1 6   ? -2.439  1.580   29.063  1.00 70.90 ? 6   G   B N3    1 
ATOM   129  C C4    . G   A 1 6   ? -1.527  1.732   28.077  1.00 71.38 ? 6   G   B C4    1 
ATOM   130  P P     . G   A 1 7   ? -5.657  1.985   23.615  1.00 85.61 ? 7   G   B P     1 
ATOM   131  O OP1   . G   A 1 7   ? -6.651  1.896   22.512  1.00 85.34 ? 7   G   B OP1   1 
ATOM   132  O OP2   . G   A 1 7   ? -4.665  3.091   23.624  1.00 85.27 ? 7   G   B OP2   1 
ATOM   133  O "O5'" . G   A 1 7   ? -6.437  2.042   24.999  1.00 83.11 ? 7   G   B "O5'" 1 
ATOM   134  C "C5'" . G   A 1 7   ? -6.764  3.281   25.593  1.00 81.45 ? 7   G   B "C5'" 1 
ATOM   135  C "C4'" . G   A 1 7   ? -6.851  3.130   27.086  1.00 81.08 ? 7   G   B "C4'" 1 
ATOM   136  O "O4'" . G   A 1 7   ? -5.552  2.741   27.609  1.00 80.58 ? 7   G   B "O4'" 1 
ATOM   137  C "C3'" . G   A 1 7   ? -7.166  4.426   27.802  1.00 81.43 ? 7   G   B "C3'" 1 
ATOM   138  O "O3'" . G   A 1 7   ? -8.560  4.683   27.769  1.00 81.37 ? 7   G   B "O3'" 1 
ATOM   139  C "C2'" . G   A 1 7   ? -6.585  4.177   29.185  1.00 80.80 ? 7   G   B "C2'" 1 
ATOM   140  O "O2'" . G   A 1 7   ? -7.395  3.347   29.990  1.00 80.64 ? 7   G   B "O2'" 1 
ATOM   141  C "C1'" . G   A 1 7   ? -5.295  3.442   28.818  1.00 80.42 ? 7   G   B "C1'" 1 
ATOM   142  N N9    . G   A 1 7   ? -4.178  4.353   28.577  1.00 79.88 ? 7   G   B N9    1 
ATOM   143  C C8    . G   A 1 7   ? -3.345  4.361   27.484  1.00 79.19 ? 7   G   B C8    1 
ATOM   144  N N7    . G   A 1 7   ? -2.420  5.280   27.550  1.00 78.81 ? 7   G   B N7    1 
ATOM   145  C C5    . G   A 1 7   ? -2.658  5.923   28.758  1.00 78.89 ? 7   G   B C5    1 
ATOM   146  C C6    . G   A 1 7   ? -1.971  7.001   29.376  1.00 78.69 ? 7   G   B C6    1 
ATOM   147  O O6    . G   A 1 7   ? -0.976  7.610   28.975  1.00 78.24 ? 7   G   B O6    1 
ATOM   148  N N1    . G   A 1 7   ? -2.552  7.349   30.590  1.00 78.86 ? 7   G   B N1    1 
ATOM   149  C C2    . G   A 1 7   ? -3.645  6.733   31.147  1.00 79.41 ? 7   G   B C2    1 
ATOM   150  N N2    . G   A 1 7   ? -4.055  7.219   32.330  1.00 79.43 ? 7   G   B N2    1 
ATOM   151  N N3    . G   A 1 7   ? -4.289  5.718   30.588  1.00 79.23 ? 7   G   B N3    1 
ATOM   152  C C4    . G   A 1 7   ? -3.745  5.368   29.402  1.00 79.29 ? 7   G   B C4    1 
ATOM   153  P P     . G   A 1 8   ? -9.086  6.022   27.062  1.00 76.48 ? 8   G   B P     1 
ATOM   154  O OP1   . G   A 1 8   ? -10.564 5.959   27.005  1.00 77.26 ? 8   G   B OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? -8.311  6.201   25.804  1.00 76.32 ? 8   G   B OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? -8.659  7.149   28.102  1.00 74.75 ? 8   G   B "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? -9.155  7.108   29.439  1.00 73.78 ? 8   G   B "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? -8.745  8.347   30.195  1.00 72.69 ? 8   G   B "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? -7.392  8.212   30.703  1.00 71.76 ? 8   G   B "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? -8.696  9.619   29.373  1.00 72.45 ? 8   G   B "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? -9.982  10.179  29.144  1.00 72.93 ? 8   G   B "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? -7.790  10.507  30.219  1.00 71.57 ? 8   G   B "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? -8.437  11.135  31.306  1.00 71.90 ? 8   G   B "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? -6.766  9.489   30.722  1.00 70.28 ? 8   G   B "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? -5.604  9.446   29.841  1.00 68.22 ? 8   G   B N9    1 
ATOM   166  C C8    . G   A 1 8   ? -5.433  8.655   28.730  1.00 67.13 ? 8   G   B C8    1 
ATOM   167  N N7    . G   A 1 8   ? -4.298  8.868   28.122  1.00 66.13 ? 8   G   B N7    1 
ATOM   168  C C5    . G   A 1 8   ? -3.681  9.852   28.881  1.00 65.42 ? 8   G   B C5    1 
ATOM   169  C C6    . G   A 1 8   ? -2.432  10.493  28.707  1.00 65.05 ? 8   G   B C6    1 
ATOM   170  O O6    . G   A 1 8   ? -1.592  10.316  27.817  1.00 65.52 ? 8   G   B O6    1 
ATOM   171  N N1    . G   A 1 8   ? -2.198  11.433  29.703  1.00 64.18 ? 8   G   B N1    1 
ATOM   172  C C2    . G   A 1 8   ? -3.056  11.724  30.732  1.00 63.76 ? 8   G   B C2    1 
ATOM   173  N N2    . G   A 1 8   ? -2.650  12.671  31.587  1.00 62.31 ? 8   G   B N2    1 
ATOM   174  N N3    . G   A 1 8   ? -4.224  11.133  30.907  1.00 64.60 ? 8   G   B N3    1 
ATOM   175  C C4    . G   A 1 8   ? -4.470  10.215  29.950  1.00 66.10 ? 8   G   B C4    1 
ATOM   176  P P     . G   A 1 9   ? -10.112 11.504  28.250  1.00 69.65 ? 9   G   B P     1 
ATOM   177  O OP1   . G   A 1 9   ? -11.551 11.773  27.988  1.00 70.35 ? 9   G   B OP1   1 
ATOM   178  O OP2   . G   A 1 9   ? -9.168  11.373  27.109  1.00 68.71 ? 9   G   B OP2   1 
ATOM   179  O "O5'" . G   A 1 9   ? -9.568  12.624  29.239  1.00 68.16 ? 9   G   B "O5'" 1 
ATOM   180  C "C5'" . G   A 1 9   ? -9.039  13.842  28.753  1.00 66.96 ? 9   G   B "C5'" 1 
ATOM   181  C "C4'" . G   A 1 9   ? -8.089  14.418  29.768  1.00 66.30 ? 9   G   B "C4'" 1 
ATOM   182  O "O4'" . G   A 1 9   ? -7.009  13.475  29.993  1.00 65.35 ? 9   G   B "O4'" 1 
ATOM   183  C "C3'" . G   A 1 9   ? -7.405  15.696  29.322  1.00 66.36 ? 9   G   B "C3'" 1 
ATOM   184  O "O3'" . G   A 1 9   ? -8.218  16.824  29.626  1.00 67.93 ? 9   G   B "O3'" 1 
ATOM   185  C "C2'" . G   A 1 9   ? -6.115  15.666  30.128  1.00 64.81 ? 9   G   B "C2'" 1 
ATOM   186  O "O2'" . G   A 1 9   ? -6.314  16.084  31.465  1.00 63.95 ? 9   G   B "O2'" 1 
ATOM   187  C "C1'" . G   A 1 9   ? -5.778  14.173  30.083  1.00 63.67 ? 9   G   B "C1'" 1 
ATOM   188  N N9    . G   A 1 9   ? -4.966  13.810  28.923  1.00 61.34 ? 9   G   B N9    1 
ATOM   189  C C8    . G   A 1 9   ? -5.279  12.908  27.930  1.00 60.32 ? 9   G   B C8    1 
ATOM   190  N N7    . G   A 1 9   ? -4.351  12.807  27.017  1.00 59.13 ? 9   G   B N7    1 
ATOM   191  C C5    . G   A 1 9   ? -3.367  13.698  27.429  1.00 59.15 ? 9   G   B C5    1 
ATOM   192  C C6    . G   A 1 9   ? -2.113  14.031  26.839  1.00 58.88 ? 9   G   B C6    1 
ATOM   193  O O6    . G   A 1 9   ? -1.605  13.593  25.797  1.00 57.67 ? 9   G   B O6    1 
ATOM   194  N N1    . G   A 1 9   ? -1.432  14.978  27.595  1.00 58.83 ? 9   G   B N1    1 
ATOM   195  C C2    . G   A 1 9   ? -1.886  15.537  28.766  1.00 59.49 ? 9   G   B C2    1 
ATOM   196  N N2    . G   A 1 9   ? -1.081  16.440  29.347  1.00 59.70 ? 9   G   B N2    1 
ATOM   197  N N3    . G   A 1 9   ? -3.044  15.235  29.326  1.00 59.80 ? 9   G   B N3    1 
ATOM   198  C C4    . G   A 1 9   ? -3.729  14.318  28.608  1.00 59.84 ? 9   G   B C4    1 
ATOM   199  P P     . C   A 1 10  ? -8.674  17.802  28.440  1.00 61.35 ? 10  C   B P     1 
ATOM   200  O OP1   . C   A 1 10  ? -8.874  19.168  29.004  1.00 60.35 ? 10  C   B OP1   1 
ATOM   201  O OP2   . C   A 1 10  ? -9.784  17.128  27.706  1.00 60.79 ? 10  C   B OP2   1 
ATOM   202  O "O5'" . C   A 1 10  ? -7.401  17.797  27.483  1.00 59.08 ? 10  C   B "O5'" 1 
ATOM   203  C "C5'" . C   A 1 10  ? -6.974  18.971  26.810  1.00 56.47 ? 10  C   B "C5'" 1 
ATOM   204  C "C4'" . C   A 1 10  ? -5.674  19.462  27.402  1.00 53.41 ? 10  C   B "C4'" 1 
ATOM   205  O "O4'" . C   A 1 10  ? -4.826  18.338  27.766  1.00 51.18 ? 10  C   B "O4'" 1 
ATOM   206  C "C3'" . C   A 1 10  ? -4.838  20.281  26.441  1.00 52.70 ? 10  C   B "C3'" 1 
ATOM   207  O "O3'" . C   A 1 10  ? -5.257  21.633  26.410  1.00 53.90 ? 10  C   B "O3'" 1 
ATOM   208  C "C2'" . C   A 1 10  ? -3.434  20.087  26.990  1.00 51.48 ? 10  C   B "C2'" 1 
ATOM   209  O "O2'" . C   A 1 10  ? -3.145  20.897  28.112  1.00 49.54 ? 10  C   B "O2'" 1 
ATOM   210  C "C1'" . C   A 1 10  ? -3.486  18.611  27.388  1.00 50.24 ? 10  C   B "C1'" 1 
ATOM   211  N N1    . C   A 1 10  ? -3.144  17.716  26.267  1.00 48.50 ? 10  C   B N1    1 
ATOM   212  C C2    . C   A 1 10  ? -1.832  17.717  25.768  1.00 47.88 ? 10  C   B C2    1 
ATOM   213  O O2    . C   A 1 10  ? -0.989  18.476  26.281  1.00 48.23 ? 10  C   B O2    1 
ATOM   214  N N3    . C   A 1 10  ? -1.516  16.897  24.742  1.00 47.71 ? 10  C   B N3    1 
ATOM   215  C C4    . C   A 1 10  ? -2.445  16.100  24.213  1.00 48.29 ? 10  C   B C4    1 
ATOM   216  N N4    . C   A 1 10  ? -2.082  15.306  23.200  1.00 47.35 ? 10  C   B N4    1 
ATOM   217  C C5    . C   A 1 10  ? -3.788  16.081  24.698  1.00 48.26 ? 10  C   B C5    1 
ATOM   218  C C6    . C   A 1 10  ? -4.090  16.896  25.717  1.00 48.10 ? 10  C   B C6    1 
ATOM   219  P P     . G   A 1 11  ? -5.240  22.426  25.017  1.00 53.68 ? 11  G   B P     1 
ATOM   220  O OP1   . G   A 1 11  ? -5.900  23.739  25.242  1.00 53.59 ? 11  G   B OP1   1 
ATOM   221  O OP2   . G   A 1 11  ? -5.765  21.503  23.971  1.00 53.34 ? 11  G   B OP2   1 
ATOM   222  O "O5'" . G   A 1 11  ? -3.688  22.680  24.768  1.00 51.88 ? 11  G   B "O5'" 1 
ATOM   223  C "C5'" . G   A 1 11  ? -2.940  23.472  25.685  1.00 49.58 ? 11  G   B "C5'" 1 
ATOM   224  C "C4'" . G   A 1 11  ? -1.499  23.555  25.256  1.00 46.93 ? 11  G   B "C4'" 1 
ATOM   225  O "O4'" . G   A 1 11  ? -0.883  22.248  25.385  1.00 44.82 ? 11  G   B "O4'" 1 
ATOM   226  C "C3'" . G   A 1 11  ? -1.264  23.913  23.800  1.00 47.18 ? 11  G   B "C3'" 1 
ATOM   227  O "O3'" . G   A 1 11  ? -1.385  25.311  23.552  1.00 48.64 ? 11  G   B "O3'" 1 
ATOM   228  C "C2'" . G   A 1 11  ? 0.152   23.396  23.591  1.00 45.15 ? 11  G   B "C2'" 1 
ATOM   229  O "O2'" . G   A 1 11  ? 1.119   24.244  24.175  1.00 45.93 ? 11  G   B "O2'" 1 
ATOM   230  C "C1'" . G   A 1 11  ? 0.096   22.083  24.371  1.00 43.00 ? 11  G   B "C1'" 1 
ATOM   231  N N9    . G   A 1 11  ? -0.301  20.959  23.532  1.00 38.62 ? 11  G   B N9    1 
ATOM   232  C C8    . G   A 1 11  ? -1.510  20.305  23.529  1.00 38.12 ? 11  G   B C8    1 
ATOM   233  N N7    . G   A 1 11  ? -1.570  19.346  22.641  1.00 37.34 ? 11  G   B N7    1 
ATOM   234  C C5    . G   A 1 11  ? -0.325  19.371  22.029  1.00 35.71 ? 11  G   B C5    1 
ATOM   235  C C6    . G   A 1 11  ? 0.200   18.573  20.984  1.00 34.43 ? 11  G   B C6    1 
ATOM   236  O O6    . G   A 1 11  ? -0.342  17.640  20.379  1.00 35.66 ? 11  G   B O6    1 
ATOM   237  N N1    . G   A 1 11  ? 1.499   18.948  20.658  1.00 33.68 ? 11  G   B N1    1 
ATOM   238  C C2    . G   A 1 11  ? 2.207   19.951  21.270  1.00 34.78 ? 11  G   B C2    1 
ATOM   239  N N2    . G   A 1 11  ? 3.449   20.162  20.817  1.00 34.35 ? 11  G   B N2    1 
ATOM   240  N N3    . G   A 1 11  ? 1.731   20.695  22.256  1.00 35.61 ? 11  G   B N3    1 
ATOM   241  C C4    . G   A 1 11  ? 0.470   20.358  22.575  1.00 36.37 ? 11  G   B C4    1 
ATOM   242  P P     . G   A 1 12  ? -1.826  25.820  22.088  1.00 53.64 ? 12  G   B P     1 
ATOM   243  O OP1   . G   A 1 12  ? -1.977  27.300  22.132  1.00 53.70 ? 12  G   B OP1   1 
ATOM   244  O OP2   . G   A 1 12  ? -2.966  24.971  21.643  1.00 52.98 ? 12  G   B OP2   1 
ATOM   245  O "O5'" . G   A 1 12  ? -0.581  25.459  21.164  1.00 49.85 ? 12  G   B "O5'" 1 
ATOM   246  C "C5'" . G   A 1 12  ? 0.714   25.954  21.466  1.00 46.68 ? 12  G   B "C5'" 1 
ATOM   247  C "C4'" . G   A 1 12  ? 1.725   25.360  20.520  1.00 45.49 ? 12  G   B "C4'" 1 
ATOM   248  O "O4'" . G   A 1 12  ? 1.808   23.927  20.736  1.00 44.72 ? 12  G   B "O4'" 1 
ATOM   249  C "C3'" . G   A 1 12  ? 1.363   25.454  19.052  1.00 45.69 ? 12  G   B "C3'" 1 
ATOM   250  O "O3'" . G   A 1 12  ? 1.663   26.726  18.516  1.00 46.66 ? 12  G   B "O3'" 1 
ATOM   251  C "C2'" . G   A 1 12  ? 2.244   24.374  18.451  1.00 45.27 ? 12  G   B "C2'" 1 
ATOM   252  O "O2'" . G   A 1 12  ? 3.586   24.793  18.330  1.00 45.45 ? 12  G   B "O2'" 1 
ATOM   253  C "C1'" . G   A 1 12  ? 2.122   23.281  19.512  1.00 44.12 ? 12  G   B "C1'" 1 
ATOM   254  N N9    . G   A 1 12  ? 1.058   22.331  19.200  1.00 42.08 ? 12  G   B N9    1 
ATOM   255  C C8    . G   A 1 12  ? -0.224  22.313  19.697  1.00 40.52 ? 12  G   B C8    1 
ATOM   256  N N7    . G   A 1 12  ? -0.945  21.335  19.216  1.00 39.84 ? 12  G   B N7    1 
ATOM   257  C C5    . G   A 1 12  ? -0.086  20.667  18.353  1.00 40.27 ? 12  G   B C5    1 
ATOM   258  C C6    . G   A 1 12  ? -0.303  19.525  17.545  1.00 40.78 ? 12  G   B C6    1 
ATOM   259  O O6    . G   A 1 12  ? -1.325  18.834  17.444  1.00 41.86 ? 12  G   B O6    1 
ATOM   260  N N1    . G   A 1 12  ? 0.829   19.199  16.807  1.00 40.64 ? 12  G   B N1    1 
ATOM   261  C C2    . G   A 1 12  ? 2.021   19.877  16.851  1.00 40.78 ? 12  G   B C2    1 
ATOM   262  N N2    . G   A 1 12  ? 2.995   19.418  16.050  1.00 41.51 ? 12  G   B N2    1 
ATOM   263  N N3    . G   A 1 12  ? 2.242   20.928  17.616  1.00 40.15 ? 12  G   B N3    1 
ATOM   264  C C4    . G   A 1 12  ? 1.151   21.270  18.330  1.00 40.64 ? 12  G   B C4    1 
ATOM   265  P P     . U   A 1 13  ? 0.890   27.231  17.208  1.00 40.19 ? 13  U   B P     1 
ATOM   266  O OP1   . U   A 1 13  ? 1.449   28.564  16.869  1.00 41.81 ? 13  U   B OP1   1 
ATOM   267  O OP2   . U   A 1 13  ? -0.567  27.073  17.445  1.00 39.23 ? 13  U   B OP2   1 
ATOM   268  O "O5'" . U   A 1 13  ? 1.323   26.199  16.073  1.00 39.59 ? 13  U   B "O5'" 1 
ATOM   269  C "C5'" . U   A 1 13  ? 2.663   26.156  15.604  1.00 38.89 ? 13  U   B "C5'" 1 
ATOM   270  C "C4'" . U   A 1 13  ? 2.818   25.058  14.580  1.00 39.62 ? 13  U   B "C4'" 1 
ATOM   271  O "O4'" . U   A 1 13  ? 2.588   23.766  15.206  1.00 39.30 ? 13  U   B "O4'" 1 
ATOM   272  C "C3'" . U   A 1 13  ? 1.815   25.087  13.444  1.00 39.46 ? 13  U   B "C3'" 1 
ATOM   273  O "O3'" . U   A 1 13  ? 2.193   26.019  12.441  1.00 40.67 ? 13  U   B "O3'" 1 
ATOM   274  C "C2'" . U   A 1 13  ? 1.854   23.645  12.949  1.00 39.47 ? 13  U   B "C2'" 1 
ATOM   275  O "O2'" . U   A 1 13  ? 2.948   23.356  12.101  1.00 38.13 ? 13  U   B "O2'" 1 
ATOM   276  C "C1'" . U   A 1 13  ? 1.992   22.882  14.268  1.00 38.23 ? 13  U   B "C1'" 1 
ATOM   277  N N1    . U   A 1 13  ? 0.673   22.484  14.775  1.00 37.61 ? 13  U   B N1    1 
ATOM   278  C C2    . U   A 1 13  ? 0.182   21.266  14.357  1.00 37.37 ? 13  U   B C2    1 
ATOM   279  O O2    . U   A 1 13  ? 0.824   20.512  13.645  1.00 37.59 ? 13  U   B O2    1 
ATOM   280  N N3    . U   A 1 13  ? -1.084  20.964  14.804  1.00 37.05 ? 13  U   B N3    1 
ATOM   281  C C4    . U   A 1 13  ? -1.885  21.742  15.624  1.00 36.44 ? 13  U   B C4    1 
ATOM   282  O O4    . U   A 1 13  ? -3.021  21.353  15.912  1.00 37.04 ? 13  U   B O4    1 
ATOM   283  C C5    . U   A 1 13  ? -1.289  22.978  16.041  1.00 36.30 ? 13  U   B C5    1 
ATOM   284  C C6    . U   A 1 13  ? -0.059  23.299  15.613  1.00 36.62 ? 13  U   B C6    1 
ATOM   285  P P     . U   A 1 14  ? 1.055   26.800  11.618  1.00 42.80 ? 14  U   B P     1 
ATOM   286  O OP1   . U   A 1 14  ? 1.724   27.649  10.592  1.00 41.28 ? 14  U   B OP1   1 
ATOM   287  O OP2   . U   A 1 14  ? 0.130   27.420  12.608  1.00 40.30 ? 14  U   B OP2   1 
ATOM   288  O "O5'" . U   A 1 14  ? 0.263   25.638  10.864  1.00 42.21 ? 14  U   B "O5'" 1 
ATOM   289  C "C5'" . U   A 1 14  ? 0.916   24.818  9.902   1.00 41.54 ? 14  U   B "C5'" 1 
ATOM   290  C "C4'" . U   A 1 14  ? -0.040  23.782  9.345   1.00 41.13 ? 14  U   B "C4'" 1 
ATOM   291  O "O4'" . U   A 1 14  ? -0.345  22.781  10.353  1.00 40.73 ? 14  U   B "O4'" 1 
ATOM   292  C "C3'" . U   A 1 14  ? -1.406  24.277  8.900   1.00 40.53 ? 14  U   B "C3'" 1 
ATOM   293  O "O3'" . U   A 1 14  ? -1.351  24.879  7.607   1.00 41.02 ? 14  U   B "O3'" 1 
ATOM   294  C "C2'" . U   A 1 14  ? -2.202  22.979  8.891   1.00 40.04 ? 14  U   B "C2'" 1 
ATOM   295  O "O2'" . U   A 1 14  ? -1.904  22.186  7.765   1.00 40.05 ? 14  U   B "O2'" 1 
ATOM   296  C "C1'" . U   A 1 14  ? -1.659  22.284  10.142  1.00 40.52 ? 14  U   B "C1'" 1 
ATOM   297  N N1    . U   A 1 14  ? -2.473  22.576  11.332  1.00 39.91 ? 14  U   B N1    1 
ATOM   298  C C2    . U   A 1 14  ? -3.566  21.761  11.582  1.00 40.14 ? 14  U   B C2    1 
ATOM   299  O O2    . U   A 1 14  ? -3.839  20.780  10.898  1.00 41.00 ? 14  U   B O2    1 
ATOM   300  N N3    . U   A 1 14  ? -4.329  22.133  12.660  1.00 39.46 ? 14  U   B N3    1 
ATOM   301  C C4    . U   A 1 14  ? -4.113  23.209  13.499  1.00 39.42 ? 14  U   B C4    1 
ATOM   302  O O4    . U   A 1 14  ? -4.947  23.478  14.376  1.00 39.34 ? 14  U   B O4    1 
ATOM   303  C C5    . U   A 1 14  ? -2.941  23.973  13.193  1.00 39.06 ? 14  U   B C5    1 
ATOM   304  C C6    . U   A 1 14  ? -2.182  23.636  12.150  1.00 39.33 ? 14  U   B C6    1 
ATOM   305  P P     . C   A 1 15  ? -2.228  26.197  7.297   1.00 37.16 ? 15  C   B P     1 
ATOM   306  O OP1   . C   A 1 15  ? -1.653  26.818  6.073   1.00 40.41 ? 15  C   B OP1   1 
ATOM   307  O OP2   . C   A 1 15  ? -2.327  27.004  8.543   1.00 37.05 ? 15  C   B OP2   1 
ATOM   308  O "O5'" . C   A 1 15  ? -3.671  25.609  6.940   1.00 37.43 ? 15  C   B "O5'" 1 
ATOM   309  C "C5'" . C   A 1 15  ? -4.799  26.460  6.726   1.00 35.05 ? 15  C   B "C5'" 1 
ATOM   310  C "C4'" . C   A 1 15  ? -6.062  25.632  6.547   1.00 35.62 ? 15  C   B "C4'" 1 
ATOM   311  O "O4'" . C   A 1 15  ? -6.115  24.995  5.236   1.00 34.14 ? 15  C   B "O4'" 1 
ATOM   312  C "C3'" . C   A 1 15  ? -6.250  24.493  7.539   1.00 35.50 ? 15  C   B "C3'" 1 
ATOM   313  O "O3'" . C   A 1 15  ? -6.811  24.982  8.760   1.00 38.00 ? 15  C   B "O3'" 1 
ATOM   314  C "C2'" . C   A 1 15  ? -7.218  23.566  6.808   1.00 34.63 ? 15  C   B "C2'" 1 
ATOM   315  O "O2'" . C   A 1 15  ? -8.563  23.964  6.969   1.00 35.27 ? 15  C   B "O2'" 1 
ATOM   316  C "C1'" . C   A 1 15  ? -6.824  23.773  5.343   1.00 32.94 ? 15  C   B "C1'" 1 
ATOM   317  N N1    . C   A 1 15  ? -6.047  22.702  4.691   1.00 31.93 ? 15  C   B N1    1 
ATOM   318  C C2    . C   A 1 15  ? -4.656  22.748  4.759   1.00 31.30 ? 15  C   B C2    1 
ATOM   319  O O2    . C   A 1 15  ? -4.123  23.692  5.343   1.00 33.52 ? 15  C   B O2    1 
ATOM   320  N N3    . C   A 1 15  ? -3.925  21.768  4.182   1.00 30.30 ? 15  C   B N3    1 
ATOM   321  C C4    . C   A 1 15  ? -4.535  20.764  3.559   1.00 30.24 ? 15  C   B C4    1 
ATOM   322  N N4    . C   A 1 15  ? -3.763  19.827  3.003   1.00 28.75 ? 15  C   B N4    1 
ATOM   323  C C5    . C   A 1 15  ? -5.959  20.682  3.476   1.00 29.89 ? 15  C   B C5    1 
ATOM   324  C C6    . C   A 1 15  ? -6.670  21.669  4.047   1.00 30.09 ? 15  C   B C6    1 
ATOM   325  P P     . G   A 1 16  ? -6.426  24.278  10.158  1.00 38.77 ? 16  G   B P     1 
ATOM   326  O OP1   . G   A 1 16  ? -7.295  24.887  11.202  1.00 39.61 ? 16  G   B OP1   1 
ATOM   327  O OP2   . G   A 1 16  ? -4.950  24.331  10.313  1.00 38.04 ? 16  G   B OP2   1 
ATOM   328  O "O5'" . G   A 1 16  ? -6.897  22.771  9.945   1.00 38.95 ? 16  G   B "O5'" 1 
ATOM   329  C "C5'" . G   A 1 16  ? -8.285  22.471  9.791   1.00 40.56 ? 16  G   B "C5'" 1 
ATOM   330  C "C4'" . G   A 1 16  ? -8.477  21.024  9.410   1.00 41.03 ? 16  G   B "C4'" 1 
ATOM   331  O "O4'" . G   A 1 16  ? -7.974  20.797  8.072   1.00 42.03 ? 16  G   B "O4'" 1 
ATOM   332  C "C3'" . G   A 1 16  ? -7.729  20.022  10.269  1.00 41.22 ? 16  G   B "C3'" 1 
ATOM   333  O "O3'" . G   A 1 16  ? -8.484  19.730  11.435  1.00 42.33 ? 16  G   B "O3'" 1 
ATOM   334  C "C2'" . G   A 1 16  ? -7.630  18.814  9.346   1.00 41.07 ? 16  G   B "C2'" 1 
ATOM   335  O "O2'" . G   A 1 16  ? -8.807  18.031  9.342   1.00 38.97 ? 16  G   B "O2'" 1 
ATOM   336  C "C1'" . G   A 1 16  ? -7.438  19.486  7.983   1.00 42.01 ? 16  G   B "C1'" 1 
ATOM   337  N N9    . G   A 1 16  ? -6.040  19.592  7.574   1.00 41.67 ? 16  G   B N9    1 
ATOM   338  C C8    . G   A 1 16  ? -5.149  20.585  7.903   1.00 41.21 ? 16  G   B C8    1 
ATOM   339  N N7    . G   A 1 16  ? -3.959  20.389  7.401   1.00 40.61 ? 16  G   B N7    1 
ATOM   340  C C5    . G   A 1 16  ? -4.076  19.198  6.697   1.00 41.44 ? 16  G   B C5    1 
ATOM   341  C C6    . G   A 1 16  ? -3.112  18.473  5.944   1.00 42.21 ? 16  G   B C6    1 
ATOM   342  O O6    . G   A 1 16  ? -1.919  18.752  5.742   1.00 43.20 ? 16  G   B O6    1 
ATOM   343  N N1    . G   A 1 16  ? -3.657  17.313  5.395   1.00 41.92 ? 16  G   B N1    1 
ATOM   344  C C2    . G   A 1 16  ? -4.963  16.909  5.541   1.00 41.35 ? 16  G   B C2    1 
ATOM   345  N N2    . G   A 1 16  ? -5.302  15.762  4.930   1.00 41.05 ? 16  G   B N2    1 
ATOM   346  N N3    . G   A 1 16  ? -5.869  17.579  6.235   1.00 40.82 ? 16  G   B N3    1 
ATOM   347  C C4    . G   A 1 16  ? -5.359  18.699  6.786   1.00 41.00 ? 16  G   B C4    1 
ATOM   348  P P     . A   A 1 17  ? -7.762  19.708  12.868  1.00 47.04 ? 17  A   B P     1 
ATOM   349  O OP1   . A   A 1 17  ? -8.826  19.714  13.899  1.00 47.71 ? 17  A   B OP1   1 
ATOM   350  O OP2   . A   A 1 17  ? -6.730  20.776  12.879  1.00 47.06 ? 17  A   B OP2   1 
ATOM   351  O "O5'" . A   A 1 17  ? -7.036  18.293  12.919  1.00 46.82 ? 17  A   B "O5'" 1 
ATOM   352  C "C5'" . A   A 1 17  ? -7.792  17.093  12.998  1.00 49.04 ? 17  A   B "C5'" 1 
ATOM   353  C "C4'" . A   A 1 17  ? -6.938  15.986  13.554  1.00 50.65 ? 17  A   B "C4'" 1 
ATOM   354  O "O4'" . A   A 1 17  ? -5.748  15.892  12.730  1.00 51.04 ? 17  A   B "O4'" 1 
ATOM   355  C "C3'" . A   A 1 17  ? -6.399  16.201  14.962  1.00 51.67 ? 17  A   B "C3'" 1 
ATOM   356  O "O3'" . A   A 1 17  ? -7.353  15.898  16.000  1.00 53.72 ? 17  A   B "O3'" 1 
ATOM   357  C "C2'" . A   A 1 17  ? -5.118  15.378  14.975  1.00 52.02 ? 17  A   B "C2'" 1 
ATOM   358  O "O2'" . A   A 1 17  ? -5.310  14.009  15.266  1.00 55.54 ? 17  A   B "O2'" 1 
ATOM   359  C "C1'" . A   A 1 17  ? -4.637  15.524  13.529  1.00 50.74 ? 17  A   B "C1'" 1 
ATOM   360  N N9    . A   A 1 17  ? -3.557  16.495  13.330  1.00 48.01 ? 17  A   B N9    1 
ATOM   361  C C8    . A   A 1 17  ? -3.412  17.756  13.858  1.00 46.28 ? 17  A   B C8    1 
ATOM   362  N N7    . A   A 1 17  ? -2.299  18.354  13.497  1.00 44.41 ? 17  A   B N7    1 
ATOM   363  C C5    . A   A 1 17  ? -1.676  17.430  12.670  1.00 44.76 ? 17  A   B C5    1 
ATOM   364  C C6    . A   A 1 17  ? -0.456  17.456  11.958  1.00 44.81 ? 17  A   B C6    1 
ATOM   365  N N6    . A   A 1 17  ? 0.396   18.489  11.971  1.00 44.15 ? 17  A   B N6    1 
ATOM   366  N N1    . A   A 1 17  ? -0.133  16.366  11.223  1.00 44.68 ? 17  A   B N1    1 
ATOM   367  C C2    . A   A 1 17  ? -0.976  15.328  11.213  1.00 44.63 ? 17  A   B C2    1 
ATOM   368  N N3    . A   A 1 17  ? -2.145  15.183  11.839  1.00 45.87 ? 17  A   B N3    1 
ATOM   369  C C4    . A   A 1 17  ? -2.440  16.282  12.556  1.00 45.90 ? 17  A   B C4    1 
ATOM   370  P P     . U   A 1 18  ? -8.132  14.473  16.039  1.00 68.52 ? 18  U   B P     1 
ATOM   371  O OP1   . U   A 1 18  ? -8.634  14.123  14.680  1.00 68.12 ? 18  U   B OP1   1 
ATOM   372  O OP2   . U   A 1 18  ? -9.090  14.575  17.164  1.00 67.99 ? 18  U   B OP2   1 
ATOM   373  O "O5'" . U   A 1 18  ? -7.055  13.385  16.473  1.00 69.38 ? 18  U   B "O5'" 1 
ATOM   374  C "C5'" . U   A 1 18  ? -6.966  12.925  17.822  1.00 71.21 ? 18  U   B "C5'" 1 
ATOM   375  C "C4'" . U   A 1 18  ? -6.314  11.564  17.860  1.00 72.36 ? 18  U   B "C4'" 1 
ATOM   376  O "O4'" . U   A 1 18  ? -7.233  10.561  17.360  1.00 73.28 ? 18  U   B "O4'" 1 
ATOM   377  C "C3'" . U   A 1 18  ? -5.083  11.446  16.979  1.00 73.03 ? 18  U   B "C3'" 1 
ATOM   378  O "O3'" . U   A 1 18  ? -3.941  11.886  17.709  1.00 74.34 ? 18  U   B "O3'" 1 
ATOM   379  C "C2'" . U   A 1 18  ? -5.030  9.950   16.662  1.00 73.38 ? 18  U   B "C2'" 1 
ATOM   380  O "O2'" . U   A 1 18  ? -4.356  9.191   17.648  1.00 72.69 ? 18  U   B "O2'" 1 
ATOM   381  C "C1'" . U   A 1 18  ? -6.515  9.569   16.644  1.00 73.76 ? 18  U   B "C1'" 1 
ATOM   382  N N1    . U   A 1 18  ? -7.119  9.429   15.309  1.00 74.93 ? 18  U   B N1    1 
ATOM   383  C C2    . U   A 1 18  ? -6.686  8.380   14.505  1.00 75.63 ? 18  U   B C2    1 
ATOM   384  O O2    . U   A 1 18  ? -5.822  7.588   14.853  1.00 76.48 ? 18  U   B O2    1 
ATOM   385  N N3    . U   A 1 18  ? -7.306  8.294   13.279  1.00 76.00 ? 18  U   B N3    1 
ATOM   386  C C4    . U   A 1 18  ? -8.294  9.126   12.783  1.00 75.53 ? 18  U   B C4    1 
ATOM   387  O O4    . U   A 1 18  ? -8.776  8.894   11.673  1.00 75.16 ? 18  U   B O4    1 
ATOM   388  C C5    . U   A 1 18  ? -8.682  10.188  13.666  1.00 75.09 ? 18  U   B C5    1 
ATOM   389  C C6    . U   A 1 18  ? -8.095  10.302  14.867  1.00 74.99 ? 18  U   B C6    1 
ATOM   390  P P     . U   A 1 19  ? -2.827  12.797  16.991  1.00 65.27 ? 19  U   B P     1 
ATOM   391  O OP1   . U   A 1 19  ? -1.602  12.772  17.834  1.00 65.33 ? 19  U   B OP1   1 
ATOM   392  O OP2   . U   A 1 19  ? -3.452  14.097  16.667  1.00 64.35 ? 19  U   B OP2   1 
ATOM   393  O "O5'" . U   A 1 19  ? -2.527  12.006  15.645  1.00 65.18 ? 19  U   B "O5'" 1 
ATOM   394  C "C5'" . U   A 1 19  ? -1.836  10.758  15.666  1.00 66.58 ? 19  U   B "C5'" 1 
ATOM   395  C "C4'" . U   A 1 19  ? -1.585  10.307  14.257  1.00 67.40 ? 19  U   B "C4'" 1 
ATOM   396  O "O4'" . U   A 1 19  ? -2.842  9.923   13.657  1.00 67.48 ? 19  U   B "O4'" 1 
ATOM   397  C "C3'" . U   A 1 19  ? -1.048  11.436  13.397  1.00 68.55 ? 19  U   B "C3'" 1 
ATOM   398  O "O3'" . U   A 1 19  ? 0.377   11.533  13.528  1.00 69.82 ? 19  U   B "O3'" 1 
ATOM   399  C "C2'" . U   A 1 19  ? -1.639  11.197  12.005  1.00 68.36 ? 19  U   B "C2'" 1 
ATOM   400  O "O2'" . U   A 1 19  ? -0.821  10.516  11.077  1.00 69.53 ? 19  U   B "O2'" 1 
ATOM   401  C "C1'" . U   A 1 19  ? -2.902  10.383  12.321  1.00 68.45 ? 19  U   B "C1'" 1 
ATOM   402  N N1    . U   A 1 19  ? -4.182  11.081  12.135  1.00 68.72 ? 19  U   B N1    1 
ATOM   403  C C2    . U   A 1 19  ? -4.712  11.125  10.854  1.00 68.91 ? 19  U   B C2    1 
ATOM   404  O O2    . U   A 1 19  ? -4.148  10.641  9.884   1.00 68.44 ? 19  U   B O2    1 
ATOM   405  N N3    . U   A 1 19  ? -5.928  11.756  10.752  1.00 69.34 ? 19  U   B N3    1 
ATOM   406  C C4    . U   A 1 19  ? -6.653  12.338  11.775  1.00 69.07 ? 19  U   B C4    1 
ATOM   407  O O4    . U   A 1 19  ? -7.756  12.833  11.532  1.00 69.18 ? 19  U   B O4    1 
ATOM   408  C C5    . U   A 1 19  ? -6.030  12.266  13.063  1.00 68.49 ? 19  U   B C5    1 
ATOM   409  C C6    . U   A 1 19  ? -4.844  11.657  13.196  1.00 68.52 ? 19  U   B C6    1 
ATOM   410  P P     . C   A 1 20  ? 1.332   10.311  13.068  1.00 54.37 ? 20  C   B P     1 
ATOM   411  O OP1   . C   A 1 20  ? 0.592   9.329   12.245  1.00 56.83 ? 20  C   B OP1   1 
ATOM   412  O OP2   . C   A 1 20  ? 2.038   9.843   14.286  1.00 53.84 ? 20  C   B OP2   1 
ATOM   413  O "O5'" . C   A 1 20  ? 2.409   11.033  12.146  1.00 53.47 ? 20  C   B "O5'" 1 
ATOM   414  C "C5'" . C   A 1 20  ? 3.575   11.568  12.735  1.00 52.52 ? 20  C   B "C5'" 1 
ATOM   415  C "C4'" . C   A 1 20  ? 3.807   13.000  12.314  1.00 51.35 ? 20  C   B "C4'" 1 
ATOM   416  O "O4'" . C   A 1 20  ? 2.579   13.745  12.095  1.00 50.35 ? 20  C   B "O4'" 1 
ATOM   417  C "C3'" . C   A 1 20  ? 4.481   13.754  13.434  1.00 50.97 ? 20  C   B "C3'" 1 
ATOM   418  O "O3'" . C   A 1 20  ? 5.837   13.394  13.505  1.00 50.83 ? 20  C   B "O3'" 1 
ATOM   419  C "C2'" . C   A 1 20  ? 4.167   15.203  13.114  1.00 50.59 ? 20  C   B "C2'" 1 
ATOM   420  O "O2'" . C   A 1 20  ? 5.032   15.767  12.153  1.00 49.95 ? 20  C   B "O2'" 1 
ATOM   421  C "C1'" . C   A 1 20  ? 2.737   15.076  12.583  1.00 50.18 ? 20  C   B "C1'" 1 
ATOM   422  N N1    . C   A 1 20  ? 1.720   15.301  13.623  1.00 50.03 ? 20  C   B N1    1 
ATOM   423  C C2    . C   A 1 20  ? 1.663   16.546  14.270  1.00 50.64 ? 20  C   B C2    1 
ATOM   424  O O2    . C   A 1 20  ? 2.495   17.417  13.976  1.00 50.67 ? 20  C   B O2    1 
ATOM   425  N N3    . C   A 1 20  ? 0.702   16.764  15.201  1.00 50.57 ? 20  C   B N3    1 
ATOM   426  C C4    . C   A 1 20  ? -0.173  15.796  15.497  1.00 50.15 ? 20  C   B C4    1 
ATOM   427  N N4    . C   A 1 20  ? -1.115  16.057  16.414  1.00 49.10 ? 20  C   B N4    1 
ATOM   428  C C5    . C   A 1 20  ? -0.122  14.515  14.867  1.00 49.60 ? 20  C   B C5    1 
ATOM   429  C C6    . C   A 1 20  ? 0.831   14.315  13.948  1.00 49.47 ? 20  C   B C6    1 
ATOM   430  P P     . C   A 1 21  ? 6.379   12.745  14.860  1.00 41.43 ? 21  C   B P     1 
ATOM   431  O OP1   . C   A 1 21  ? 7.584   11.919  14.574  1.00 38.50 ? 21  C   B OP1   1 
ATOM   432  O OP2   . C   A 1 21  ? 5.195   12.124  15.516  1.00 39.82 ? 21  C   B OP2   1 
ATOM   433  O "O5'" . C   A 1 21  ? 6.803   14.037  15.679  1.00 39.64 ? 21  C   B "O5'" 1 
ATOM   434  C "C5'" . C   A 1 21  ? 7.572   15.039  15.035  1.00 37.54 ? 21  C   B "C5'" 1 
ATOM   435  C "C4'" . C   A 1 21  ? 7.621   16.265  15.881  1.00 36.94 ? 21  C   B "C4'" 1 
ATOM   436  O "O4'" . C   A 1 21  ? 6.345   16.939  15.842  1.00 37.18 ? 21  C   B "O4'" 1 
ATOM   437  C "C3'" . C   A 1 21  ? 7.843   15.974  17.345  1.00 36.63 ? 21  C   B "C3'" 1 
ATOM   438  O "O3'" . C   A 1 21  ? 9.227   15.749  17.563  1.00 36.69 ? 21  C   B "O3'" 1 
ATOM   439  C "C2'" . C   A 1 21  ? 7.293   17.239  17.996  1.00 36.38 ? 21  C   B "C2'" 1 
ATOM   440  O "O2'" . C   A 1 21  ? 8.185   18.338  17.906  1.00 35.96 ? 21  C   B "O2'" 1 
ATOM   441  C "C1'" . C   A 1 21  ? 6.078   17.517  17.107  1.00 35.20 ? 21  C   B "C1'" 1 
ATOM   442  N N1    . C   A 1 21  ? 4.805   16.960  17.583  1.00 33.89 ? 21  C   B N1    1 
ATOM   443  C C2    . C   A 1 21  ? 3.999   17.739  18.406  1.00 32.82 ? 21  C   B C2    1 
ATOM   444  O O2    . C   A 1 21  ? 4.416   18.843  18.773  1.00 33.61 ? 21  C   B O2    1 
ATOM   445  N N3    . C   A 1 21  ? 2.789   17.270  18.782  1.00 32.67 ? 21  C   B N3    1 
ATOM   446  C C4    . C   A 1 21  ? 2.385   16.068  18.369  1.00 33.13 ? 21  C   B C4    1 
ATOM   447  N N4    . C   A 1 21  ? 1.160   15.662  18.726  1.00 34.33 ? 21  C   B N4    1 
ATOM   448  C C5    . C   A 1 21  ? 3.209   15.232  17.564  1.00 31.53 ? 21  C   B C5    1 
ATOM   449  C C6    . C   A 1 21  ? 4.401   15.712  17.200  1.00 32.77 ? 21  C   B C6    1 
ATOM   450  P P     . G   A 1 22  ? 9.697   14.791  18.758  1.00 35.28 ? 22  G   B P     1 
ATOM   451  O OP1   . G   A 1 22  ? 11.172  14.654  18.615  1.00 33.86 ? 22  G   B OP1   1 
ATOM   452  O OP2   . G   A 1 22  ? 8.846   13.574  18.768  1.00 33.11 ? 22  G   B OP2   1 
ATOM   453  O "O5'" . G   A 1 22  ? 9.367   15.665  20.055  1.00 34.46 ? 22  G   B "O5'" 1 
ATOM   454  C "C5'" . G   A 1 22  ? 8.608   15.149  21.147  1.00 33.63 ? 22  G   B "C5'" 1 
ATOM   455  C "C4'" . G   A 1 22  ? 8.041   16.289  21.971  1.00 33.42 ? 22  G   B "C4'" 1 
ATOM   456  O "O4'" . G   A 1 22  ? 6.935   16.896  21.248  1.00 34.63 ? 22  G   B "O4'" 1 
ATOM   457  C "C3'" . G   A 1 22  ? 7.421   15.896  23.302  1.00 33.28 ? 22  G   B "C3'" 1 
ATOM   458  O "O3'" . G   A 1 22  ? 8.424   15.784  24.302  1.00 36.28 ? 22  G   B "O3'" 1 
ATOM   459  C "C2'" . G   A 1 22  ? 6.460   17.049  23.567  1.00 33.34 ? 22  G   B "C2'" 1 
ATOM   460  O "O2'" . G   A 1 22  ? 7.055   18.230  24.054  1.00 31.22 ? 22  G   B "O2'" 1 
ATOM   461  C "C1'" . G   A 1 22  ? 5.932   17.312  22.161  1.00 34.00 ? 22  G   B "C1'" 1 
ATOM   462  N N9    . G   A 1 22  ? 4.724   16.528  21.929  1.00 34.47 ? 22  G   B N9    1 
ATOM   463  C C8    . G   A 1 22  ? 4.553   15.459  21.079  1.00 33.05 ? 22  G   B C8    1 
ATOM   464  N N7    . G   A 1 22  ? 3.354   14.944  21.142  1.00 33.63 ? 22  G   B N7    1 
ATOM   465  C C5    . G   A 1 22  ? 2.690   15.728  22.082  1.00 33.93 ? 22  G   B C5    1 
ATOM   466  C C6    . G   A 1 22  ? 1.357   15.654  22.580  1.00 33.61 ? 22  G   B C6    1 
ATOM   467  O O6    . G   A 1 22  ? 0.460   14.848  22.292  1.00 35.60 ? 22  G   B O6    1 
ATOM   468  N N1    . G   A 1 22  ? 1.106   16.648  23.514  1.00 32.45 ? 22  G   B N1    1 
ATOM   469  C C2    . G   A 1 22  ? 2.008   17.586  23.926  1.00 33.57 ? 22  G   B C2    1 
ATOM   470  N N2    . G   A 1 22  ? 1.562   18.458  24.841  1.00 35.77 ? 22  G   B N2    1 
ATOM   471  N N3    . G   A 1 22  ? 3.249   17.667  23.482  1.00 33.53 ? 22  G   B N3    1 
ATOM   472  C C4    . G   A 1 22  ? 3.519   16.714  22.566  1.00 34.26 ? 22  G   B C4    1 
ATOM   473  P P     . C   A 1 23  ? 8.148   14.892  25.610  1.00 43.37 ? 23  C   B P     1 
ATOM   474  O OP1   . C   A 1 23  ? 9.424   14.774  26.367  1.00 44.56 ? 23  C   B OP1   1 
ATOM   475  O OP2   . C   A 1 23  ? 7.411   13.666  25.211  1.00 43.95 ? 23  C   B OP2   1 
ATOM   476  O "O5'" . C   A 1 23  ? 7.146   15.791  26.446  1.00 44.26 ? 23  C   B "O5'" 1 
ATOM   477  C "C5'" . C   A 1 23  ? 7.485   17.126  26.766  1.00 43.66 ? 23  C   B "C5'" 1 
ATOM   478  C "C4'" . C   A 1 23  ? 6.442   17.695  27.670  1.00 44.31 ? 23  C   B "C4'" 1 
ATOM   479  O "O4'" . C   A 1 23  ? 5.223   17.948  26.922  1.00 46.14 ? 23  C   B "O4'" 1 
ATOM   480  C "C3'" . C   A 1 23  ? 6.003   16.721  28.738  1.00 44.59 ? 23  C   B "C3'" 1 
ATOM   481  O "O3'" . C   A 1 23  ? 6.958   16.688  29.787  1.00 46.34 ? 23  C   B "O3'" 1 
ATOM   482  C "C2'" . C   A 1 23  ? 4.635   17.278  29.114  1.00 44.44 ? 23  C   B "C2'" 1 
ATOM   483  O "O2'" . C   A 1 23  ? 4.721   18.445  29.915  1.00 44.75 ? 23  C   B "O2'" 1 
ATOM   484  C "C1'" . C   A 1 23  ? 4.094   17.665  27.734  1.00 43.92 ? 23  C   B "C1'" 1 
ATOM   485  N N1    . C   A 1 23  ? 3.320   16.604  27.071  1.00 42.31 ? 23  C   B N1    1 
ATOM   486  C C2    . C   A 1 23  ? 1.963   16.472  27.368  1.00 42.09 ? 23  C   B C2    1 
ATOM   487  O O2    . C   A 1 23  ? 1.450   17.249  28.195  1.00 42.87 ? 23  C   B O2    1 
ATOM   488  N N3    . C   A 1 23  ? 1.242   15.503  26.752  1.00 41.19 ? 23  C   B N3    1 
ATOM   489  C C4    . C   A 1 23  ? 1.833   14.684  25.877  1.00 40.89 ? 23  C   B C4    1 
ATOM   490  N N4    . C   A 1 23  ? 1.085   13.740  25.289  1.00 39.04 ? 23  C   B N4    1 
ATOM   491  C C5    . C   A 1 23  ? 3.218   14.795  25.561  1.00 40.43 ? 23  C   B C5    1 
ATOM   492  C C6    . C   A 1 23  ? 3.916   15.761  26.174  1.00 41.36 ? 23  C   B C6    1 
ATOM   493  P P     . C   A 1 24  ? 6.829   15.583  30.941  1.00 60.65 ? 24  C   B P     1 
ATOM   494  O OP1   . C   A 1 24  ? 8.052   15.627  31.773  1.00 61.53 ? 24  C   B OP1   1 
ATOM   495  O OP2   . C   A 1 24  ? 6.387   14.291  30.355  1.00 59.86 ? 24  C   B OP2   1 
ATOM   496  O "O5'" . C   A 1 24  ? 5.645   16.158  31.818  1.00 61.35 ? 24  C   B "O5'" 1 
ATOM   497  C "C5'" . C   A 1 24  ? 5.080   15.372  32.827  1.00 63.12 ? 24  C   B "C5'" 1 
ATOM   498  C "C4'" . C   A 1 24  ? 3.734   15.904  33.201  1.00 63.70 ? 24  C   B "C4'" 1 
ATOM   499  O "O4'" . C   A 1 24  ? 2.949   16.152  32.013  1.00 62.84 ? 24  C   B "O4'" 1 
ATOM   500  C "C3'" . C   A 1 24  ? 2.959   14.871  33.981  1.00 64.70 ? 24  C   B "C3'" 1 
ATOM   501  O "O3'" . C   A 1 24  ? 3.316   14.992  35.343  1.00 66.80 ? 24  C   B "O3'" 1 
ATOM   502  C "C2'" . C   A 1 24  ? 1.514   15.221  33.669  1.00 64.04 ? 24  C   B "C2'" 1 
ATOM   503  O "O2'" . C   A 1 24  ? 1.029   16.269  34.484  1.00 64.52 ? 24  C   B "O2'" 1 
ATOM   504  C "C1'" . C   A 1 24  ? 1.630   15.675  32.209  1.00 62.64 ? 24  C   B "C1'" 1 
ATOM   505  N N1    . C   A 1 24  ? 1.392   14.626  31.207  1.00 60.67 ? 24  C   B N1    1 
ATOM   506  C C2    . C   A 1 24  ? 0.106   14.108  31.058  1.00 59.77 ? 24  C   B C2    1 
ATOM   507  O O2    . C   A 1 24  ? -0.793  14.513  31.810  1.00 59.34 ? 24  C   B O2    1 
ATOM   508  N N3    . C   A 1 24  ? -0.127  13.181  30.098  1.00 59.01 ? 24  C   B N3    1 
ATOM   509  C C4    . C   A 1 24  ? 0.871   12.773  29.310  1.00 58.66 ? 24  C   B C4    1 
ATOM   510  N N4    . C   A 1 24  ? 0.594   11.880  28.359  1.00 57.80 ? 24  C   B N4    1 
ATOM   511  C C5    . C   A 1 24  ? 2.197   13.268  29.458  1.00 59.35 ? 24  C   B C5    1 
ATOM   512  C C6    . C   A 1 24  ? 2.412   14.181  30.414  1.00 60.24 ? 24  C   B C6    1 
ATOM   513  P P     . C   A 1 25  ? 3.767   13.687  36.153  1.00 76.64 ? 25  C   B P     1 
ATOM   514  O OP1   . C   A 1 25  ? 4.665   14.120  37.258  1.00 76.03 ? 25  C   B OP1   1 
ATOM   515  O OP2   . C   A 1 25  ? 4.237   12.662  35.174  1.00 74.42 ? 25  C   B OP2   1 
ATOM   516  O "O5'" . C   A 1 25  ? 2.388   13.179  36.761  1.00 73.81 ? 25  C   B "O5'" 1 
ATOM   517  C "C5'" . C   A 1 25  ? 1.975   11.846  36.564  1.00 72.56 ? 25  C   B "C5'" 1 
ATOM   518  C "C4'" . C   A 1 25  ? 0.479   11.746  36.644  1.00 71.18 ? 25  C   B "C4'" 1 
ATOM   519  O "O4'" . C   A 1 25  ? -0.121  12.331  35.457  1.00 70.07 ? 25  C   B "O4'" 1 
ATOM   520  C "C3'" . C   A 1 25  ? 0.023   10.302  36.632  1.00 71.30 ? 25  C   B "C3'" 1 
ATOM   521  O "O3'" . C   A 1 25  ? 0.096   9.770   37.951  1.00 71.62 ? 25  C   B "O3'" 1 
ATOM   522  C "C2'" . C   A 1 25  ? -1.372  10.408  36.035  1.00 70.54 ? 25  C   B "C2'" 1 
ATOM   523  O "O2'" . C   A 1 25  ? -2.346  10.871  36.953  1.00 71.43 ? 25  C   B "O2'" 1 
ATOM   524  C "C1'" . C   A 1 25  ? -1.130  11.464  34.956  1.00 68.95 ? 25  C   B "C1'" 1 
ATOM   525  N N1    . C   A 1 25  ? -0.630  10.877  33.703  1.00 67.36 ? 25  C   B N1    1 
ATOM   526  C C2    . C   A 1 25  ? -1.482  10.068  32.937  1.00 66.93 ? 25  C   B C2    1 
ATOM   527  O O2    . C   A 1 25  ? -2.629  9.840   33.349  1.00 67.13 ? 25  C   B O2    1 
ATOM   528  N N3    . C   A 1 25  ? -1.033  9.551   31.771  1.00 66.13 ? 25  C   B N3    1 
ATOM   529  C C4    . C   A 1 25  ? 0.215   9.801   31.369  1.00 66.34 ? 25  C   B C4    1 
ATOM   530  N N4    . C   A 1 25  ? 0.618   9.269   30.215  1.00 66.04 ? 25  C   B N4    1 
ATOM   531  C C5    . C   A 1 25  ? 1.109   10.608  32.136  1.00 66.42 ? 25  C   B C5    1 
ATOM   532  C C6    . C   A 1 25  ? 0.649   11.120  33.284  1.00 66.62 ? 25  C   B C6    1 
ATOM   533  P P     . U   A 1 26  ? 1.061   8.518   38.240  1.00 76.81 ? 26  U   B P     1 
ATOM   534  O OP1   . U   A 1 26  ? 1.042   8.242   39.700  1.00 77.43 ? 26  U   B OP1   1 
ATOM   535  O OP2   . U   A 1 26  ? 2.359   8.791   37.563  1.00 75.77 ? 26  U   B OP2   1 
ATOM   536  O "O5'" . U   A 1 26  ? 0.309   7.334   37.486  1.00 75.46 ? 26  U   B "O5'" 1 
ATOM   537  C "C5'" . U   A 1 26  ? -1.089  7.151   37.684  1.00 75.29 ? 26  U   B "C5'" 1 
ATOM   538  C "C4'" . U   A 1 26  ? -1.679  6.314   36.581  1.00 75.71 ? 26  U   B "C4'" 1 
ATOM   539  O "O4'" . U   A 1 26  ? -1.613  7.032   35.319  1.00 75.50 ? 26  U   B "O4'" 1 
ATOM   540  C "C3'" . U   A 1 26  ? -0.949  5.021   36.265  1.00 75.86 ? 26  U   B "C3'" 1 
ATOM   541  O "O3'" . U   A 1 26  ? -1.210  3.986   37.204  1.00 76.58 ? 26  U   B "O3'" 1 
ATOM   542  C "C2'" . U   A 1 26  ? -1.501  4.694   34.885  1.00 75.74 ? 26  U   B "C2'" 1 
ATOM   543  O "O2'" . U   A 1 26  ? -2.791  4.109   34.926  1.00 75.42 ? 26  U   B "O2'" 1 
ATOM   544  C "C1'" . U   A 1 26  ? -1.555  6.089   34.254  1.00 75.30 ? 26  U   B "C1'" 1 
ATOM   545  N N1    . U   A 1 26  ? -0.352  6.340   33.447  1.00 74.22 ? 26  U   B N1    1 
ATOM   546  C C2    . U   A 1 26  ? -0.330  5.799   32.167  1.00 73.61 ? 26  U   B C2    1 
ATOM   547  O O2    . U   A 1 26  ? -1.261  5.161   31.704  1.00 73.58 ? 26  U   B O2    1 
ATOM   548  N N3    . U   A 1 26  ? 0.819   6.031   31.454  1.00 73.06 ? 26  U   B N3    1 
ATOM   549  C C4    . U   A 1 26  ? 1.926   6.736   31.874  1.00 73.15 ? 26  U   B C4    1 
ATOM   550  O O4    . U   A 1 26  ? 2.882   6.866   31.105  1.00 72.65 ? 26  U   B O4    1 
ATOM   551  C C5    . U   A 1 26  ? 1.829   7.272   33.209  1.00 72.89 ? 26  U   B C5    1 
ATOM   552  C C6    . U   A 1 26  ? 0.719   7.062   33.930  1.00 73.30 ? 26  U   B C6    1 
ATOM   553  P P     . G   A 1 27  ? -0.072  2.886   37.502  1.00 78.63 ? 27  G   B P     1 
ATOM   554  O OP1   . G   A 1 27  ? -0.080  2.570   38.957  1.00 78.11 ? 27  G   B OP1   1 
ATOM   555  O OP2   . G   A 1 27  ? 1.183   3.373   36.862  1.00 78.11 ? 27  G   B OP2   1 
ATOM   556  O "O5'" . G   A 1 27  ? -0.567  1.607   36.690  1.00 76.19 ? 27  G   B "O5'" 1 
ATOM   557  C "C5'" . G   A 1 27  ? -1.875  1.080   36.885  1.00 74.40 ? 27  G   B "C5'" 1 
ATOM   558  C "C4'" . G   A 1 27  ? -2.196  0.073   35.810  1.00 74.29 ? 27  G   B "C4'" 1 
ATOM   559  O "O4'" . G   A 1 27  ? -2.394  0.750   34.536  1.00 73.57 ? 27  G   B "O4'" 1 
ATOM   560  C "C3'" . G   A 1 27  ? -1.084  -0.918  35.512  1.00 74.34 ? 27  G   B "C3'" 1 
ATOM   561  O "O3'" . G   A 1 27  ? -1.002  -1.963  36.470  1.00 74.73 ? 27  G   B "O3'" 1 
ATOM   562  C "C2'" . G   A 1 27  ? -1.462  -1.389  34.115  1.00 73.85 ? 27  G   B "C2'" 1 
ATOM   563  O "O2'" . G   A 1 27  ? -2.543  -2.307  34.101  1.00 73.70 ? 27  G   B "O2'" 1 
ATOM   564  C "C1'" . G   A 1 27  ? -1.879  -0.059  33.482  1.00 72.84 ? 27  G   B "C1'" 1 
ATOM   565  N N9    . G   A 1 27  ? -0.722  0.621   32.905  1.00 71.28 ? 27  G   B N9    1 
ATOM   566  C C8    . G   A 1 27  ? 0.000   1.657   33.456  1.00 70.59 ? 27  G   B C8    1 
ATOM   567  N N7    . G   A 1 27  ? 0.999   2.040   32.707  1.00 69.41 ? 27  G   B N7    1 
ATOM   568  C C5    . G   A 1 27  ? 0.930   1.214   31.595  1.00 69.12 ? 27  G   B C5    1 
ATOM   569  C C6    . G   A 1 27  ? 1.752   1.158   30.443  1.00 68.67 ? 27  G   B C6    1 
ATOM   570  O O6    . G   A 1 27  ? 2.736   1.859   30.162  1.00 67.91 ? 27  G   B O6    1 
ATOM   571  N N1    . G   A 1 27  ? 1.330   0.163   29.563  1.00 68.27 ? 27  G   B N1    1 
ATOM   572  C C2    . G   A 1 27  ? 0.252   -0.667  29.764  1.00 68.46 ? 27  G   B C2    1 
ATOM   573  N N2    . G   A 1 27  ? 0.000   -1.559  28.802  1.00 67.59 ? 27  G   B N2    1 
ATOM   574  N N3    . G   A 1 27  ? -0.522  -0.624  30.832  1.00 68.69 ? 27  G   B N3    1 
ATOM   575  C C4    . G   A 1 27  ? -0.128  0.333   31.701  1.00 69.66 ? 27  G   B C4    1 
ATOM   576  P P     . G   A 1 28  ? 0.444   -2.521  36.897  1.00 84.11 ? 28  G   B P     1 
ATOM   577  O OP1   . G   A 1 28  ? 0.272   -3.374  38.101  1.00 84.82 ? 28  G   B OP1   1 
ATOM   578  O OP2   . G   A 1 28  ? 1.383   -1.365  36.939  1.00 84.04 ? 28  G   B OP2   1 
ATOM   579  O "O5'" . G   A 1 28  ? 0.845   -3.463  35.675  1.00 81.77 ? 28  G   B "O5'" 1 
ATOM   580  C "C5'" . G   A 1 28  ? 0.067   -4.620  35.391  1.00 78.91 ? 28  G   B "C5'" 1 
ATOM   581  C "C4'" . G   A 1 28  ? 0.391   -5.165  34.023  1.00 76.98 ? 28  G   B "C4'" 1 
ATOM   582  O "O4'" . G   A 1 28  ? 0.178   -4.128  33.026  1.00 75.85 ? 28  G   B "O4'" 1 
ATOM   583  C "C3'" . G   A 1 28  ? 1.829   -5.580  33.765  1.00 76.32 ? 28  G   B "C3'" 1 
ATOM   584  O "O3'" . G   A 1 28  ? 2.156   -6.856  34.294  1.00 76.96 ? 28  G   B "O3'" 1 
ATOM   585  C "C2'" . G   A 1 28  ? 1.850   -5.611  32.247  1.00 75.28 ? 28  G   B "C2'" 1 
ATOM   586  O "O2'" . G   A 1 28  ? 1.179   -6.744  31.722  1.00 74.80 ? 28  G   B "O2'" 1 
ATOM   587  C "C1'" . G   A 1 28  ? 1.065   -4.339  31.933  1.00 73.78 ? 28  G   B "C1'" 1 
ATOM   588  N N9    . G   A 1 28  ? 1.972   -3.200  31.837  1.00 70.72 ? 28  G   B N9    1 
ATOM   589  C C8    . G   A 1 28  ? 2.196   -2.217  32.773  1.00 69.33 ? 28  G   B C8    1 
ATOM   590  N N7    . G   A 1 28  ? 3.098   -1.351  32.397  1.00 67.53 ? 28  G   B N7    1 
ATOM   591  C C5    . G   A 1 28  ? 3.487   -1.785  31.135  1.00 67.46 ? 28  G   B C5    1 
ATOM   592  C C6    . G   A 1 28  ? 4.445   -1.252  30.226  1.00 66.73 ? 28  G   B C6    1 
ATOM   593  O O6    . G   A 1 28  ? 5.158   -0.248  30.355  1.00 66.42 ? 28  G   B O6    1 
ATOM   594  N N1    . G   A 1 28  ? 4.529   -2.015  29.067  1.00 64.85 ? 28  G   B N1    1 
ATOM   595  C C2    . G   A 1 28  ? 3.792   -3.138  28.807  1.00 65.19 ? 28  G   B C2    1 
ATOM   596  N N2    . G   A 1 28  ? 4.029   -3.738  27.640  1.00 64.43 ? 28  G   B N2    1 
ATOM   597  N N3    . G   A 1 28  ? 2.891   -3.641  29.635  1.00 66.67 ? 28  G   B N3    1 
ATOM   598  C C4    . G   A 1 28  ? 2.795   -2.921  30.774  1.00 68.49 ? 28  G   B C4    1 
ATOM   599  P P     . G   A 1 29  ? 3.702   -7.268  34.441  1.00 71.30 ? 29  G   B P     1 
ATOM   600  O OP1   . G   A 1 29  ? 3.761   -8.631  35.031  1.00 71.32 ? 29  G   B OP1   1 
ATOM   601  O OP2   . G   A 1 29  ? 4.402   -6.138  35.122  1.00 69.30 ? 29  G   B OP2   1 
ATOM   602  O "O5'" . G   A 1 29  ? 4.203   -7.362  32.930  1.00 68.49 ? 29  G   B "O5'" 1 
ATOM   603  C "C5'" . G   A 1 29  ? 3.720   -8.395  32.075  1.00 67.99 ? 29  G   B "C5'" 1 
ATOM   604  C "C4'" . G   A 1 29  ? 4.469   -8.396  30.760  1.00 67.84 ? 29  G   B "C4'" 1 
ATOM   605  O "O4'" . G   A 1 29  ? 4.188   -7.165  30.040  1.00 67.68 ? 29  G   B "O4'" 1 
ATOM   606  C "C3'" . G   A 1 29  ? 5.989   -8.428  30.836  1.00 66.96 ? 29  G   B "C3'" 1 
ATOM   607  O "O3'" . G   A 1 29  ? 6.493   -9.744  31.037  1.00 66.48 ? 29  G   B "O3'" 1 
ATOM   608  C "C2'" . G   A 1 29  ? 6.370   -7.888  29.465  1.00 66.47 ? 29  G   B "C2'" 1 
ATOM   609  O "O2'" . G   A 1 29  ? 6.228   -8.839  28.430  1.00 65.54 ? 29  G   B "O2'" 1 
ATOM   610  C "C1'" . G   A 1 29  ? 5.333   -6.778  29.295  1.00 66.60 ? 29  G   B "C1'" 1 
ATOM   611  N N9    . G   A 1 29  ? 5.850   -5.532  29.850  1.00 65.49 ? 29  G   B N9    1 
ATOM   612  C C8    . G   A 1 29  ? 5.515   -4.937  31.042  1.00 65.20 ? 29  G   B C8    1 
ATOM   613  N N7    . G   A 1 29  ? 6.207   -3.855  31.284  1.00 64.20 ? 29  G   B N7    1 
ATOM   614  C C5    . G   A 1 29  ? 7.038   -3.727  30.180  1.00 63.96 ? 29  G   B C5    1 
ATOM   615  C C6    . G   A 1 29  ? 8.032   -2.754  29.881  1.00 63.23 ? 29  G   B C6    1 
ATOM   616  O O6    . G   A 1 29  ? 8.396   -1.789  30.566  1.00 62.43 ? 29  G   B O6    1 
ATOM   617  N N1    . G   A 1 29  ? 8.634   -3.000  28.646  1.00 62.65 ? 29  G   B N1    1 
ATOM   618  C C2    . G   A 1 29  ? 8.332   -4.058  27.813  1.00 63.03 ? 29  G   B C2    1 
ATOM   619  N N2    . G   A 1 29  ? 9.026   -4.141  26.667  1.00 61.76 ? 29  G   B N2    1 
ATOM   620  N N3    . G   A 1 29  ? 7.415   -4.972  28.086  1.00 64.01 ? 29  G   B N3    1 
ATOM   621  C C4    . G   A 1 29  ? 6.814   -4.746  29.277  1.00 64.68 ? 29  G   B C4    1 
ATOM   622  P P     . C   A 1 30  ? 7.832   -9.955  31.903  1.00 53.25 ? 30  C   B P     1 
ATOM   623  O OP1   . C   A 1 30  ? 7.995   -11.416 32.133  1.00 52.32 ? 30  C   B OP1   1 
ATOM   624  O OP2   . C   A 1 30  ? 7.752   -9.028  33.066  1.00 52.06 ? 30  C   B OP2   1 
ATOM   625  O "O5'" . C   A 1 30  ? 9.002   -9.457  30.939  1.00 48.65 ? 30  C   B "O5'" 1 
ATOM   626  C "C5'" . C   A 1 30  ? 9.115   -9.968  29.618  1.00 43.96 ? 30  C   B "C5'" 1 
ATOM   627  C "C4'" . C   A 1 30  ? 10.075  -9.134  28.805  1.00 42.17 ? 30  C   B "C4'" 1 
ATOM   628  O "O4'" . C   A 1 30  ? 9.573   -7.775  28.700  1.00 42.15 ? 30  C   B "O4'" 1 
ATOM   629  C "C3'" . C   A 1 30  ? 11.468  -8.946  29.377  1.00 41.24 ? 30  C   B "C3'" 1 
ATOM   630  O "O3'" . C   A 1 30  ? 12.301  -10.073 29.113  1.00 39.70 ? 30  C   B "O3'" 1 
ATOM   631  C "C2'" . C   A 1 30  ? 11.940  -7.715  28.617  1.00 40.06 ? 30  C   B "C2'" 1 
ATOM   632  O "O2'" . C   A 1 30  ? 12.316  -8.022  27.296  1.00 39.48 ? 30  C   B "O2'" 1 
ATOM   633  C "C1'" . C   A 1 30  ? 10.663  -6.877  28.573  1.00 39.86 ? 30  C   B "C1'" 1 
ATOM   634  N N1    . C   A 1 30  ? 10.597  -5.888  29.660  1.00 38.66 ? 30  C   B N1    1 
ATOM   635  C C2    . C   A 1 30  ? 11.405  -4.747  29.581  1.00 37.32 ? 30  C   B C2    1 
ATOM   636  O O2    . C   A 1 30  ? 12.117  -4.582  28.581  1.00 36.04 ? 30  C   B O2    1 
ATOM   637  N N3    . C   A 1 30  ? 11.381  -3.852  30.588  1.00 37.63 ? 30  C   B N3    1 
ATOM   638  C C4    . C   A 1 30  ? 10.583  -4.049  31.637  1.00 37.90 ? 30  C   B C4    1 
ATOM   639  N N4    . C   A 1 30  ? 10.604  -3.141  32.609  1.00 37.79 ? 30  C   B N4    1 
ATOM   640  C C5    . C   A 1 30  ? 9.732   -5.187  31.736  1.00 38.11 ? 30  C   B C5    1 
ATOM   641  C C6    . C   A 1 30  ? 9.772   -6.076  30.734  1.00 38.95 ? 30  C   B C6    1 
ATOM   642  P P     . C   A 1 31  ? 13.642  -10.292 29.979  1.00 33.70 ? 31  C   B P     1 
ATOM   643  O OP1   . C   A 1 31  ? 14.228  -11.600 29.611  1.00 33.27 ? 31  C   B OP1   1 
ATOM   644  O OP2   . C   A 1 31  ? 13.313  -10.002 31.401  1.00 35.19 ? 31  C   B OP2   1 
ATOM   645  O "O5'" . C   A 1 31  ? 14.629  -9.144  29.484  1.00 33.46 ? 31  C   B "O5'" 1 
ATOM   646  C "C5'" . C   A 1 31  ? 14.995  -9.046  28.116  1.00 32.59 ? 31  C   B "C5'" 1 
ATOM   647  C "C4'" . C   A 1 31  ? 15.930  -7.888  27.910  1.00 32.16 ? 31  C   B "C4'" 1 
ATOM   648  O "O4'" . C   A 1 31  ? 15.235  -6.630  28.122  1.00 32.27 ? 31  C   B "O4'" 1 
ATOM   649  C "C3'" . C   A 1 31  ? 17.100  -7.822  28.867  1.00 30.56 ? 31  C   B "C3'" 1 
ATOM   650  O "O3'" . C   A 1 31  ? 18.129  -8.680  28.414  1.00 29.49 ? 31  C   B "O3'" 1 
ATOM   651  C "C2'" . C   A 1 31  ? 17.502  -6.363  28.741  1.00 31.16 ? 31  C   B "C2'" 1 
ATOM   652  O "O2'" . C   A 1 31  ? 18.187  -6.152  27.524  1.00 33.24 ? 31  C   B "O2'" 1 
ATOM   653  C "C1'" . C   A 1 31  ? 16.134  -5.678  28.657  1.00 31.11 ? 31  C   B "C1'" 1 
ATOM   654  N N1    . C   A 1 31  ? 15.595  -5.233  29.948  1.00 31.00 ? 31  C   B N1    1 
ATOM   655  C C2    . C   A 1 31  ? 16.030  -4.015  30.489  1.00 31.37 ? 31  C   B C2    1 
ATOM   656  O O2    . C   A 1 31  ? 16.891  -3.358  29.886  1.00 30.91 ? 31  C   B O2    1 
ATOM   657  N N3    . C   A 1 31  ? 15.500  -3.589  31.657  1.00 31.89 ? 31  C   B N3    1 
ATOM   658  C C4    . C   A 1 31  ? 14.576  -4.329  32.283  1.00 32.06 ? 31  C   B C4    1 
ATOM   659  N N4    . C   A 1 31  ? 14.059  -3.855  33.423  1.00 32.21 ? 31  C   B N4    1 
ATOM   660  C C5    . C   A 1 31  ? 14.135  -5.581  31.765  1.00 30.97 ? 31  C   B C5    1 
ATOM   661  C C6    . C   A 1 31  ? 14.667  -5.991  30.609  1.00 31.06 ? 31  C   B C6    1 
ATOM   662  P P     . A   A 1 32  ? 19.100  -9.384  29.478  1.00 32.96 ? 32  A   B P     1 
ATOM   663  O OP1   . A   A 1 32  ? 19.868  -10.430 28.762  1.00 33.66 ? 32  A   B OP1   1 
ATOM   664  O OP2   . A   A 1 32  ? 18.276  -9.758  30.655  1.00 34.04 ? 32  A   B OP2   1 
ATOM   665  O "O5'" . A   A 1 32  ? 20.110  -8.230  29.922  1.00 30.59 ? 32  A   B "O5'" 1 
ATOM   666  C "C5'" . A   A 1 32  ? 21.028  -7.665  28.993  1.00 30.13 ? 32  A   B "C5'" 1 
ATOM   667  C "C4'" . A   A 1 32  ? 21.759  -6.499  29.616  1.00 31.60 ? 32  A   B "C4'" 1 
ATOM   668  O "O4'" . A   A 1 32  ? 20.853  -5.385  29.824  1.00 31.44 ? 32  A   B "O4'" 1 
ATOM   669  C "C3'" . A   A 1 32  ? 22.358  -6.747  30.990  1.00 31.78 ? 32  A   B "C3'" 1 
ATOM   670  O "O3'" . A   A 1 32  ? 23.621  -7.394  30.850  1.00 34.90 ? 32  A   B "O3'" 1 
ATOM   671  C "C2'" . A   A 1 32  ? 22.516  -5.327  31.525  1.00 30.88 ? 32  A   B "C2'" 1 
ATOM   672  O "O2'" . A   A 1 32  ? 23.673  -4.711  31.004  1.00 30.66 ? 32  A   B "O2'" 1 
ATOM   673  C "C1'" . A   A 1 32  ? 21.278  -4.634  30.948  1.00 31.12 ? 32  A   B "C1'" 1 
ATOM   674  N N9    . A   A 1 32  ? 20.147  -4.499  31.870  1.00 32.35 ? 32  A   B N9    1 
ATOM   675  C C8    . A   A 1 32  ? 19.254  -5.459  32.280  1.00 31.65 ? 32  A   B C8    1 
ATOM   676  N N7    . A   A 1 32  ? 18.329  -5.007  33.093  1.00 30.79 ? 32  A   B N7    1 
ATOM   677  C C5    . A   A 1 32  ? 18.634  -3.662  33.232  1.00 31.32 ? 32  A   B C5    1 
ATOM   678  C C6    . A   A 1 32  ? 18.022  -2.614  33.958  1.00 31.20 ? 32  A   B C6    1 
ATOM   679  N N6    . A   A 1 32  ? 16.913  -2.755  34.684  1.00 28.78 ? 32  A   B N6    1 
ATOM   680  N N1    . A   A 1 32  ? 18.593  -1.393  33.897  1.00 33.01 ? 32  A   B N1    1 
ATOM   681  C C2    . A   A 1 32  ? 19.687  -1.231  33.139  1.00 32.78 ? 32  A   B C2    1 
ATOM   682  N N3    . A   A 1 32  ? 20.340  -2.127  32.400  1.00 34.03 ? 32  A   B N3    1 
ATOM   683  C C4    . A   A 1 32  ? 19.758  -3.337  32.493  1.00 32.45 ? 32  A   B C4    1 
ATOM   684  P P     . A   A 1 33  ? 23.996  -8.646  31.790  1.00 44.67 ? 33  A   B P     1 
ATOM   685  O OP1   . A   A 1 33  ? 25.270  -9.219  31.287  1.00 43.36 ? 33  A   B OP1   1 
ATOM   686  O OP2   . A   A 1 33  ? 22.810  -9.521  31.953  1.00 43.60 ? 33  A   B OP2   1 
ATOM   687  O "O5'" . A   A 1 33  ? 24.268  -7.982  33.202  1.00 49.06 ? 33  A   B "O5'" 1 
ATOM   688  C "C5'" . A   A 1 33  ? 25.209  -6.935  33.349  1.00 53.91 ? 33  A   B "C5'" 1 
ATOM   689  C "C4'" . A   A 1 33  ? 25.147  -6.416  34.757  1.00 58.42 ? 33  A   B "C4'" 1 
ATOM   690  O "O4'" . A   A 1 33  ? 24.002  -5.540  34.924  1.00 59.14 ? 33  A   B "O4'" 1 
ATOM   691  C "C3'" . A   A 1 33  ? 24.917  -7.520  35.775  1.00 60.59 ? 33  A   B "C3'" 1 
ATOM   692  O "O3'" . A   A 1 33  ? 26.122  -8.238  36.028  1.00 64.48 ? 33  A   B "O3'" 1 
ATOM   693  C "C2'" . A   A 1 33  ? 24.272  -6.795  36.949  1.00 60.22 ? 33  A   B "C2'" 1 
ATOM   694  O "O2'" . A   A 1 33  ? 25.192  -6.224  37.864  1.00 60.17 ? 33  A   B "O2'" 1 
ATOM   695  C "C1'" . A   A 1 33  ? 23.454  -5.715  36.225  1.00 59.27 ? 33  A   B "C1'" 1 
ATOM   696  N N9    . A   A 1 33  ? 22.022  -6.005  36.093  1.00 57.95 ? 33  A   B N9    1 
ATOM   697  C C8    . A   A 1 33  ? 21.392  -7.122  35.586  1.00 57.31 ? 33  A   B C8    1 
ATOM   698  N N7    . A   A 1 33  ? 20.078  -7.055  35.628  1.00 55.68 ? 33  A   B N7    1 
ATOM   699  C C5    . A   A 1 33  ? 19.827  -5.813  36.199  1.00 55.59 ? 33  A   B C5    1 
ATOM   700  C C6    . A   A 1 33  ? 18.632  -5.132  36.516  1.00 54.64 ? 33  A   B C6    1 
ATOM   701  N N6    . A   A 1 33  ? 17.409  -5.623  36.294  1.00 52.39 ? 33  A   B N6    1 
ATOM   702  N N1    . A   A 1 33  ? 18.739  -3.905  37.075  1.00 54.76 ? 33  A   B N1    1 
ATOM   703  C C2    . A   A 1 33  ? 19.962  -3.398  37.290  1.00 55.72 ? 33  A   B C2    1 
ATOM   704  N N3    . A   A 1 33  ? 21.154  -3.934  37.036  1.00 56.82 ? 33  A   B N3    1 
ATOM   705  C C4    . A   A 1 33  ? 21.016  -5.154  36.488  1.00 56.99 ? 33  A   B C4    1 
ATOM   706  P P     . C   A 1 34  ? 27.393  -7.491  36.671  1.00 82.03 ? 34  C   B P     1 
ATOM   707  O OP1   . C   A 1 34  ? 27.145  -6.022  36.715  1.00 80.97 ? 34  C   B OP1   1 
ATOM   708  O OP2   . C   A 1 34  ? 28.582  -8.014  35.926  1.00 79.52 ? 34  C   B OP2   1 
ATOM   709  O "O5'" . C   A 1 34  ? 27.442  -8.059  38.163  1.00 81.85 ? 34  C   B "O5'" 1 
ATOM   710  C "C5'" . C   A 1 34  ? 26.356  -8.818  38.705  1.00 81.27 ? 34  C   B "C5'" 1 
ATOM   711  C "C4'" . C   A 1 34  ? 26.748  -10.275 38.853  1.00 80.83 ? 34  C   B "C4'" 1 
ATOM   712  O "O4'" . C   A 1 34  ? 25.840  -11.091 38.071  1.00 80.74 ? 34  C   B "O4'" 1 
ATOM   713  C "C3'" . C   A 1 34  ? 28.121  -10.661 38.321  1.00 80.92 ? 34  C   B "C3'" 1 
ATOM   714  O "O3'" . C   A 1 34  ? 29.184  -10.405 39.241  1.00 80.47 ? 34  C   B "O3'" 1 
ATOM   715  C "C2'" . C   A 1 34  ? 27.976  -12.157 38.079  1.00 81.16 ? 34  C   B "C2'" 1 
ATOM   716  O "O2'" . C   A 1 34  ? 28.172  -12.906 39.262  1.00 82.35 ? 34  C   B "O2'" 1 
ATOM   717  C "C1'" . C   A 1 34  ? 26.512  -12.264 37.641  1.00 81.35 ? 34  C   B "C1'" 1 
ATOM   718  N N1    . C   A 1 34  ? 26.323  -12.431 36.187  1.00 82.06 ? 34  C   B N1    1 
ATOM   719  C C2    . C   A 1 34  ? 26.468  -13.717 35.641  1.00 82.43 ? 34  C   B C2    1 
ATOM   720  O O2    . C   A 1 34  ? 26.762  -14.660 36.395  1.00 82.56 ? 34  C   B O2    1 
ATOM   721  N N3    . C   A 1 34  ? 26.286  -13.899 34.310  1.00 82.52 ? 34  C   B N3    1 
ATOM   722  C C4    . C   A 1 34  ? 25.976  -12.863 33.529  1.00 82.38 ? 34  C   B C4    1 
ATOM   723  N N4    . C   A 1 34  ? 25.803  -13.099 32.223  1.00 81.71 ? 34  C   B N4    1 
ATOM   724  C C5    . C   A 1 34  ? 25.830  -11.539 34.053  1.00 82.30 ? 34  C   B C5    1 
ATOM   725  C C6    . C   A 1 34  ? 26.011  -11.371 35.377  1.00 82.27 ? 34  C   B C6    1 
ATOM   726  N N     . MET B 2 1   ? 47.970  -23.259 7.180   1.00 78.64 ? 1   MET A N     1 
ATOM   727  C CA    . MET B 2 1   ? 47.289  -21.934 7.096   1.00 78.71 ? 1   MET A CA    1 
ATOM   728  C C     . MET B 2 1   ? 45.792  -22.103 6.878   1.00 77.35 ? 1   MET A C     1 
ATOM   729  O O     . MET B 2 1   ? 45.118  -21.229 6.322   1.00 76.84 ? 1   MET A O     1 
ATOM   730  C CB    . MET B 2 1   ? 47.904  -21.090 5.975   1.00 80.78 ? 1   MET A CB    1 
ATOM   731  C CG    . MET B 2 1   ? 49.338  -20.665 6.264   1.00 82.85 ? 1   MET A CG    1 
ATOM   732  S SD    . MET B 2 1   ? 49.461  -19.712 7.804   1.00 85.86 ? 1   MET A SD    1 
ATOM   733  C CE    . MET B 2 1   ? 49.613  -21.036 9.043   1.00 84.54 ? 1   MET A CE    1 
ATOM   734  N N     . LYS B 2 2   ? 45.290  -23.249 7.326   1.00 75.46 ? 2   LYS A N     1 
ATOM   735  C CA    . LYS B 2 2   ? 43.876  -23.579 7.239   1.00 73.46 ? 2   LYS A CA    1 
ATOM   736  C C     . LYS B 2 2   ? 43.312  -23.449 8.658   1.00 72.12 ? 2   LYS A C     1 
ATOM   737  O O     . LYS B 2 2   ? 44.072  -23.401 9.630   1.00 71.55 ? 2   LYS A O     1 
ATOM   738  C CB    . LYS B 2 2   ? 43.709  -25.005 6.722   1.00 73.26 ? 2   LYS A CB    1 
ATOM   739  C CG    . LYS B 2 2   ? 42.272  -25.479 6.615   1.00 73.31 ? 2   LYS A CG    1 
ATOM   740  C CD    . LYS B 2 2   ? 42.207  -26.932 6.159   1.00 73.61 ? 2   LYS A CD    1 
ATOM   741  C CE    . LYS B 2 2   ? 42.866  -27.875 7.165   1.00 73.49 ? 2   LYS A CE    1 
ATOM   742  N NZ    . LYS B 2 2   ? 44.325  -27.620 7.369   1.00 72.71 ? 2   LYS A NZ    1 
ATOM   743  N N     . VAL B 2 3   ? 41.988  -23.392 8.772   1.00 70.20 ? 3   VAL A N     1 
ATOM   744  C CA    . VAL B 2 3   ? 41.324  -23.241 10.065  1.00 68.13 ? 3   VAL A CA    1 
ATOM   745  C C     . VAL B 2 3   ? 42.023  -23.968 11.213  1.00 67.84 ? 3   VAL A C     1 
ATOM   746  O O     . VAL B 2 3   ? 42.385  -23.347 12.212  1.00 67.40 ? 3   VAL A O     1 
ATOM   747  C CB    . VAL B 2 3   ? 39.862  -23.723 10.000  1.00 66.81 ? 3   VAL A CB    1 
ATOM   748  C CG1   . VAL B 2 3   ? 39.123  -23.297 11.256  1.00 66.04 ? 3   VAL A CG1   1 
ATOM   749  C CG2   . VAL B 2 3   ? 39.183  -23.160 8.773   1.00 65.62 ? 3   VAL A CG2   1 
ATOM   750  N N     . GLU B 2 4   ? 42.215  -25.276 11.061  1.00 67.94 ? 4   GLU A N     1 
ATOM   751  C CA    . GLU B 2 4   ? 42.861  -26.103 12.086  1.00 68.13 ? 4   GLU A CA    1 
ATOM   752  C C     . GLU B 2 4   ? 44.161  -25.485 12.595  1.00 67.14 ? 4   GLU A C     1 
ATOM   753  O O     . GLU B 2 4   ? 44.430  -25.478 13.796  1.00 66.75 ? 4   GLU A O     1 
ATOM   754  C CB    . GLU B 2 4   ? 43.190  -27.496 11.533  1.00 69.61 ? 4   GLU A CB    1 
ATOM   755  C CG    . GLU B 2 4   ? 42.115  -28.149 10.673  1.00 72.10 ? 4   GLU A CG    1 
ATOM   756  C CD    . GLU B 2 4   ? 42.583  -29.474 10.074  1.00 74.34 ? 4   GLU A CD    1 
ATOM   757  O OE1   . GLU B 2 4   ? 43.694  -29.505 9.492   1.00 74.68 ? 4   GLU A OE1   1 
ATOM   758  O OE2   . GLU B 2 4   ? 41.844  -30.482 10.180  1.00 74.92 ? 4   GLU A OE2   1 
ATOM   759  N N     . GLU B 2 5   ? 44.965  -24.978 11.666  1.00 66.58 ? 5   GLU A N     1 
ATOM   760  C CA    . GLU B 2 5   ? 46.255  -24.378 11.994  1.00 66.09 ? 5   GLU A CA    1 
ATOM   761  C C     . GLU B 2 5   ? 46.089  -23.102 12.807  1.00 64.28 ? 5   GLU A C     1 
ATOM   762  O O     . GLU B 2 5   ? 46.770  -22.900 13.815  1.00 64.20 ? 5   GLU A O     1 
ATOM   763  C CB    . GLU B 2 5   ? 47.032  -24.048 10.712  1.00 68.22 ? 5   GLU A CB    1 
ATOM   764  C CG    . GLU B 2 5   ? 46.648  -24.874 9.468   1.00 71.56 ? 5   GLU A CG    1 
ATOM   765  C CD    . GLU B 2 5   ? 47.158  -26.313 9.489   1.00 72.76 ? 5   GLU A CD    1 
ATOM   766  O OE1   . GLU B 2 5   ? 46.767  -27.081 10.398  1.00 73.54 ? 5   GLU A OE1   1 
ATOM   767  O OE2   . GLU B 2 5   ? 47.948  -26.675 8.586   1.00 73.05 ? 5   GLU A OE2   1 
ATOM   768  N N     . ILE B 2 6   ? 45.178  -22.246 12.356  1.00 62.12 ? 6   ILE A N     1 
ATOM   769  C CA    . ILE B 2 6   ? 44.915  -20.964 13.005  1.00 59.80 ? 6   ILE A CA    1 
ATOM   770  C C     . ILE B 2 6   ? 44.347  -21.089 14.417  1.00 58.32 ? 6   ILE A C     1 
ATOM   771  O O     . ILE B 2 6   ? 44.713  -20.326 15.308  1.00 58.12 ? 6   ILE A O     1 
ATOM   772  C CB    . ILE B 2 6   ? 43.930  -20.117 12.169  1.00 59.83 ? 6   ILE A CB    1 
ATOM   773  C CG1   . ILE B 2 6   ? 44.366  -20.103 10.698  1.00 60.53 ? 6   ILE A CG1   1 
ATOM   774  C CG2   . ILE B 2 6   ? 43.858  -18.703 12.726  1.00 58.88 ? 6   ILE A CG2   1 
ATOM   775  C CD1   . ILE B 2 6   ? 45.762  -19.569 10.457  1.00 60.98 ? 6   ILE A CD1   1 
ATOM   776  N N     . LEU B 2 7   ? 43.456  -22.052 14.621  1.00 56.29 ? 7   LEU A N     1 
ATOM   777  C CA    . LEU B 2 7   ? 42.843  -22.237 15.923  1.00 54.54 ? 7   LEU A CA    1 
ATOM   778  C C     . LEU B 2 7   ? 43.836  -22.719 16.976  1.00 54.74 ? 7   LEU A C     1 
ATOM   779  O O     . LEU B 2 7   ? 43.683  -22.417 18.156  1.00 54.77 ? 7   LEU A O     1 
ATOM   780  C CB    . LEU B 2 7   ? 41.657  -23.197 15.805  1.00 52.87 ? 7   LEU A CB    1 
ATOM   781  C CG    . LEU B 2 7   ? 40.562  -22.745 14.828  1.00 50.94 ? 7   LEU A CG    1 
ATOM   782  C CD1   . LEU B 2 7   ? 39.429  -23.753 14.817  1.00 49.88 ? 7   LEU A CD1   1 
ATOM   783  C CD2   . LEU B 2 7   ? 40.034  -21.377 15.226  1.00 50.43 ? 7   LEU A CD2   1 
ATOM   784  N N     . GLU B 2 8   ? 44.852  -23.463 16.553  1.00 55.39 ? 8   GLU A N     1 
ATOM   785  C CA    . GLU B 2 8   ? 45.871  -23.950 17.483  1.00 56.19 ? 8   GLU A CA    1 
ATOM   786  C C     . GLU B 2 8   ? 46.632  -22.753 18.034  1.00 55.12 ? 8   GLU A C     1 
ATOM   787  O O     . GLU B 2 8   ? 46.998  -22.708 19.209  1.00 54.37 ? 8   GLU A O     1 
ATOM   788  C CB    . GLU B 2 8   ? 46.865  -24.872 16.770  1.00 59.08 ? 8   GLU A CB    1 
ATOM   789  C CG    . GLU B 2 8   ? 46.380  -26.293 16.525  1.00 63.48 ? 8   GLU A CG    1 
ATOM   790  C CD    . GLU B 2 8   ? 46.270  -27.105 17.803  1.00 65.59 ? 8   GLU A CD    1 
ATOM   791  O OE1   . GLU B 2 8   ? 46.005  -28.323 17.705  1.00 67.58 ? 8   GLU A OE1   1 
ATOM   792  O OE2   . GLU B 2 8   ? 46.444  -26.531 18.903  1.00 66.52 ? 8   GLU A OE2   1 
ATOM   793  N N     . LYS B 2 9   ? 46.867  -21.780 17.163  1.00 54.24 ? 9   LYS A N     1 
ATOM   794  C CA    . LYS B 2 9   ? 47.592  -20.577 17.536  1.00 53.58 ? 9   LYS A CA    1 
ATOM   795  C C     . LYS B 2 9   ? 46.703  -19.620 18.316  1.00 51.87 ? 9   LYS A C     1 
ATOM   796  O O     . LYS B 2 9   ? 47.190  -18.856 19.142  1.00 51.27 ? 9   LYS A O     1 
ATOM   797  C CB    . LYS B 2 9   ? 48.117  -19.879 16.283  1.00 55.02 ? 9   LYS A CB    1 
ATOM   798  C CG    . LYS B 2 9   ? 48.824  -20.805 15.309  1.00 57.18 ? 9   LYS A CG    1 
ATOM   799  C CD    . LYS B 2 9   ? 49.282  -20.046 14.070  1.00 59.21 ? 9   LYS A CD    1 
ATOM   800  C CE    . LYS B 2 9   ? 49.859  -20.983 13.019  1.00 59.77 ? 9   LYS A CE    1 
ATOM   801  N NZ    . LYS B 2 9   ? 50.223  -20.241 11.778  1.00 60.54 ? 9   LYS A NZ    1 
ATOM   802  N N     . ALA B 2 10  ? 45.400  -19.666 18.043  1.00 50.35 ? 10  ALA A N     1 
ATOM   803  C CA    . ALA B 2 10  ? 44.434  -18.797 18.715  1.00 49.32 ? 10  ALA A CA    1 
ATOM   804  C C     . ALA B 2 10  ? 44.282  -19.170 20.178  1.00 48.58 ? 10  ALA A C     1 
ATOM   805  O O     . ALA B 2 10  ? 44.259  -18.303 21.047  1.00 47.74 ? 10  ALA A O     1 
ATOM   806  C CB    . ALA B 2 10  ? 43.079  -18.875 18.018  1.00 48.52 ? 10  ALA A CB    1 
ATOM   807  N N     . LEU B 2 11  ? 44.169  -20.468 20.439  1.00 49.11 ? 11  LEU A N     1 
ATOM   808  C CA    . LEU B 2 11  ? 44.023  -20.976 21.795  1.00 50.02 ? 11  LEU A CA    1 
ATOM   809  C C     . LEU B 2 11  ? 45.059  -20.336 22.702  1.00 50.62 ? 11  LEU A C     1 
ATOM   810  O O     . LEU B 2 11  ? 44.835  -20.154 23.898  1.00 51.46 ? 11  LEU A O     1 
ATOM   811  C CB    . LEU B 2 11  ? 44.202  -22.495 21.812  1.00 50.11 ? 11  LEU A CB    1 
ATOM   812  C CG    . LEU B 2 11  ? 43.040  -23.328 21.267  1.00 50.77 ? 11  LEU A CG    1 
ATOM   813  C CD1   . LEU B 2 11  ? 43.431  -24.801 21.196  1.00 50.25 ? 11  LEU A CD1   1 
ATOM   814  C CD2   . LEU B 2 11  ? 41.823  -23.137 22.167  1.00 51.11 ? 11  LEU A CD2   1 
ATOM   815  N N     . GLU B 2 12  ? 46.194  -19.982 22.117  1.00 50.64 ? 12  GLU A N     1 
ATOM   816  C CA    . GLU B 2 12  ? 47.280  -19.376 22.864  1.00 50.91 ? 12  GLU A CA    1 
ATOM   817  C C     . GLU B 2 12  ? 46.957  -17.961 23.345  1.00 50.11 ? 12  GLU A C     1 
ATOM   818  O O     . GLU B 2 12  ? 47.556  -17.472 24.309  1.00 50.67 ? 12  GLU A O     1 
ATOM   819  C CB    . GLU B 2 12  ? 48.526  -19.372 21.990  1.00 52.48 ? 12  GLU A CB    1 
ATOM   820  C CG    . GLU B 2 12  ? 49.774  -18.888 22.668  1.00 55.74 ? 12  GLU A CG    1 
ATOM   821  C CD    . GLU B 2 12  ? 50.997  -19.167 21.830  1.00 58.37 ? 12  GLU A CD    1 
ATOM   822  O OE1   . GLU B 2 12  ? 51.338  -20.362 21.661  1.00 59.48 ? 12  GLU A OE1   1 
ATOM   823  O OE2   . GLU B 2 12  ? 51.608  -18.195 21.332  1.00 60.06 ? 12  GLU A OE2   1 
ATOM   824  N N     . LEU B 2 13  ? 46.003  -17.314 22.679  1.00 48.71 ? 13  LEU A N     1 
ATOM   825  C CA    . LEU B 2 13  ? 45.602  -15.952 23.028  1.00 47.09 ? 13  LEU A CA    1 
ATOM   826  C C     . LEU B 2 13  ? 44.370  -15.931 23.927  1.00 46.58 ? 13  LEU A C     1 
ATOM   827  O O     . LEU B 2 13  ? 44.064  -14.913 24.545  1.00 46.11 ? 13  LEU A O     1 
ATOM   828  C CB    . LEU B 2 13  ? 45.291  -15.156 21.763  1.00 46.07 ? 13  LEU A CB    1 
ATOM   829  C CG    . LEU B 2 13  ? 46.364  -15.075 20.682  1.00 45.40 ? 13  LEU A CG    1 
ATOM   830  C CD1   . LEU B 2 13  ? 45.774  -14.482 19.406  1.00 44.50 ? 13  LEU A CD1   1 
ATOM   831  C CD2   . LEU B 2 13  ? 47.524  -14.241 21.198  1.00 45.05 ? 13  LEU A CD2   1 
ATOM   832  N N     . VAL B 2 14  ? 43.663  -17.053 23.996  1.00 45.80 ? 14  VAL A N     1 
ATOM   833  C CA    . VAL B 2 14  ? 42.455  -17.122 24.804  1.00 45.07 ? 14  VAL A CA    1 
ATOM   834  C C     . VAL B 2 14  ? 42.586  -17.963 26.076  1.00 45.86 ? 14  VAL A C     1 
ATOM   835  O O     . VAL B 2 14  ? 41.930  -17.684 27.079  1.00 45.81 ? 14  VAL A O     1 
ATOM   836  C CB    . VAL B 2 14  ? 41.273  -17.650 23.953  1.00 43.89 ? 14  VAL A CB    1 
ATOM   837  C CG1   . VAL B 2 14  ? 41.086  -16.763 22.732  1.00 42.79 ? 14  VAL A CG1   1 
ATOM   838  C CG2   . VAL B 2 14  ? 41.521  -19.085 23.524  1.00 42.46 ? 14  VAL A CG2   1 
ATOM   839  N N     . ILE B 2 15  ? 43.436  -18.984 26.042  1.00 46.40 ? 15  ILE A N     1 
ATOM   840  C CA    . ILE B 2 15  ? 43.614  -19.850 27.203  1.00 46.23 ? 15  ILE A CA    1 
ATOM   841  C C     . ILE B 2 15  ? 44.640  -19.280 28.178  1.00 46.05 ? 15  ILE A C     1 
ATOM   842  O O     . ILE B 2 15  ? 45.752  -18.942 27.786  1.00 46.38 ? 15  ILE A O     1 
ATOM   843  C CB    . ILE B 2 15  ? 44.064  -21.270 26.783  1.00 46.00 ? 15  ILE A CB    1 
ATOM   844  C CG1   . ILE B 2 15  ? 43.057  -21.877 25.804  1.00 45.65 ? 15  ILE A CG1   1 
ATOM   845  C CG2   . ILE B 2 15  ? 44.171  -22.166 28.008  1.00 46.70 ? 15  ILE A CG2   1 
ATOM   846  C CD1   . ILE B 2 15  ? 43.410  -23.295 25.368  1.00 45.84 ? 15  ILE A CD1   1 
ATOM   847  N N     . PRO B 2 16  ? 44.266  -19.155 29.464  1.00 45.86 ? 16  PRO A N     1 
ATOM   848  C CA    . PRO B 2 16  ? 45.136  -18.628 30.525  1.00 45.96 ? 16  PRO A CA    1 
ATOM   849  C C     . PRO B 2 16  ? 46.381  -19.487 30.714  1.00 46.53 ? 16  PRO A C     1 
ATOM   850  O O     . PRO B 2 16  ? 46.316  -20.708 30.604  1.00 45.59 ? 16  PRO A O     1 
ATOM   851  C CB    . PRO B 2 16  ? 44.241  -18.668 31.759  1.00 45.51 ? 16  PRO A CB    1 
ATOM   852  C CG    . PRO B 2 16  ? 42.870  -18.492 31.187  1.00 46.60 ? 16  PRO A CG    1 
ATOM   853  C CD    . PRO B 2 16  ? 42.898  -19.369 29.968  1.00 45.42 ? 16  PRO A CD    1 
ATOM   854  N N     . ASP B 2 17  ? 47.509  -18.844 31.006  1.00 48.11 ? 17  ASP A N     1 
ATOM   855  C CA    . ASP B 2 17  ? 48.773  -19.554 31.225  1.00 49.78 ? 17  ASP A CA    1 
ATOM   856  C C     . ASP B 2 17  ? 48.874  -20.023 32.676  1.00 50.49 ? 17  ASP A C     1 
ATOM   857  O O     . ASP B 2 17  ? 48.299  -19.403 33.564  1.00 50.63 ? 17  ASP A O     1 
ATOM   858  C CB    . ASP B 2 17  ? 49.943  -18.635 30.882  1.00 50.39 ? 17  ASP A CB    1 
ATOM   859  C CG    . ASP B 2 17  ? 49.891  -17.321 31.637  1.00 51.64 ? 17  ASP A CG    1 
ATOM   860  O OD1   . ASP B 2 17  ? 50.503  -16.338 31.163  1.00 51.50 ? 17  ASP A OD1   1 
ATOM   861  O OD2   . ASP B 2 17  ? 49.248  -17.269 32.708  1.00 52.17 ? 17  ASP A OD2   1 
ATOM   862  N N     . GLU B 2 18  ? 49.605  -21.111 32.912  1.00 52.10 ? 18  GLU A N     1 
ATOM   863  C CA    . GLU B 2 18  ? 49.755  -21.678 34.258  1.00 54.13 ? 18  GLU A CA    1 
ATOM   864  C C     . GLU B 2 18  ? 49.827  -20.671 35.412  1.00 54.48 ? 18  GLU A C     1 
ATOM   865  O O     . GLU B 2 18  ? 49.244  -20.900 36.474  1.00 54.65 ? 18  GLU A O     1 
ATOM   866  C CB    . GLU B 2 18  ? 50.986  -22.597 34.324  1.00 55.84 ? 18  GLU A CB    1 
ATOM   867  C CG    . GLU B 2 18  ? 50.864  -23.893 33.518  1.00 59.74 ? 18  GLU A CG    1 
ATOM   868  C CD    . GLU B 2 18  ? 52.014  -24.876 33.775  1.00 61.95 ? 18  GLU A CD    1 
ATOM   869  O OE1   . GLU B 2 18  ? 53.188  -24.526 33.506  1.00 63.34 ? 18  GLU A OE1   1 
ATOM   870  O OE2   . GLU B 2 18  ? 51.742  -26.004 34.247  1.00 61.96 ? 18  GLU A OE2   1 
ATOM   871  N N     . GLU B 2 19  ? 50.533  -19.560 35.211  1.00 54.87 ? 19  GLU A N     1 
ATOM   872  C CA    . GLU B 2 19  ? 50.674  -18.555 36.262  1.00 54.75 ? 19  GLU A CA    1 
ATOM   873  C C     . GLU B 2 19  ? 49.368  -17.806 36.551  1.00 53.38 ? 19  GLU A C     1 
ATOM   874  O O     . GLU B 2 19  ? 49.207  -17.219 37.623  1.00 53.94 ? 19  GLU A O     1 
ATOM   875  C CB    . GLU B 2 19  ? 51.782  -17.547 35.911  1.00 56.07 ? 19  GLU A CB    1 
ATOM   876  C CG    . GLU B 2 19  ? 52.650  -17.882 34.679  1.00 60.37 ? 19  GLU A CG    1 
ATOM   877  C CD    . GLU B 2 19  ? 53.238  -19.299 34.686  1.00 62.37 ? 19  GLU A CD    1 
ATOM   878  O OE1   . GLU B 2 19  ? 52.668  -20.183 34.003  1.00 63.07 ? 19  GLU A OE1   1 
ATOM   879  O OE2   . GLU B 2 19  ? 54.266  -19.532 35.366  1.00 61.92 ? 19  GLU A OE2   1 
ATOM   880  N N     . GLU B 2 20  ? 48.440  -17.826 35.599  1.00 51.50 ? 20  GLU A N     1 
ATOM   881  C CA    . GLU B 2 20  ? 47.158  -17.151 35.774  1.00 49.49 ? 20  GLU A CA    1 
ATOM   882  C C     . GLU B 2 20  ? 46.159  -18.138 36.366  1.00 48.17 ? 20  GLU A C     1 
ATOM   883  O O     . GLU B 2 20  ? 45.290  -17.767 37.151  1.00 47.82 ? 20  GLU A O     1 
ATOM   884  C CB    . GLU B 2 20  ? 46.642  -16.626 34.436  1.00 49.04 ? 20  GLU A CB    1 
ATOM   885  C CG    . GLU B 2 20  ? 45.613  -15.519 34.573  1.00 49.40 ? 20  GLU A CG    1 
ATOM   886  C CD    . GLU B 2 20  ? 44.924  -15.192 33.258  1.00 50.07 ? 20  GLU A CD    1 
ATOM   887  O OE1   . GLU B 2 20  ? 45.633  -15.018 32.241  1.00 51.34 ? 20  GLU A OE1   1 
ATOM   888  O OE2   . GLU B 2 20  ? 43.676  -15.103 33.246  1.00 48.58 ? 20  GLU A OE2   1 
ATOM   889  N N     . VAL B 2 21  ? 46.287  -19.400 35.979  1.00 46.93 ? 21  VAL A N     1 
ATOM   890  C CA    . VAL B 2 21  ? 45.417  -20.444 36.499  1.00 46.30 ? 21  VAL A CA    1 
ATOM   891  C C     . VAL B 2 21  ? 45.775  -20.653 37.964  1.00 46.50 ? 21  VAL A C     1 
ATOM   892  O O     . VAL B 2 21  ? 44.909  -20.661 38.839  1.00 46.57 ? 21  VAL A O     1 
ATOM   893  C CB    . VAL B 2 21  ? 45.626  -21.771 35.746  1.00 45.69 ? 21  VAL A CB    1 
ATOM   894  C CG1   . VAL B 2 21  ? 44.957  -22.911 36.498  1.00 44.52 ? 21  VAL A CG1   1 
ATOM   895  C CG2   . VAL B 2 21  ? 45.056  -21.658 34.341  1.00 45.58 ? 21  VAL A CG2   1 
ATOM   896  N N     . ARG B 2 22  ? 47.067  -20.821 38.216  1.00 46.25 ? 22  ARG A N     1 
ATOM   897  C CA    . ARG B 2 22  ? 47.561  -21.024 39.561  1.00 47.09 ? 22  ARG A CA    1 
ATOM   898  C C     . ARG B 2 22  ? 47.121  -19.874 40.469  1.00 46.21 ? 22  ARG A C     1 
ATOM   899  O O     . ARG B 2 22  ? 46.651  -20.094 41.585  1.00 45.99 ? 22  ARG A O     1 
ATOM   900  C CB    . ARG B 2 22  ? 49.087  -21.122 39.542  1.00 49.64 ? 22  ARG A CB    1 
ATOM   901  C CG    . ARG B 2 22  ? 49.692  -21.556 40.869  1.00 54.27 ? 22  ARG A CG    1 
ATOM   902  C CD    . ARG B 2 22  ? 51.214  -21.558 40.821  1.00 58.12 ? 22  ARG A CD    1 
ATOM   903  N NE    . ARG B 2 22  ? 51.757  -20.212 40.643  1.00 61.39 ? 22  ARG A NE    1 
ATOM   904  C CZ    . ARG B 2 22  ? 51.541  -19.202 41.482  1.00 62.93 ? 22  ARG A CZ    1 
ATOM   905  N NH1   . ARG B 2 22  ? 50.792  -19.383 42.561  1.00 63.44 ? 22  ARG A NH1   1 
ATOM   906  N NH2   . ARG B 2 22  ? 52.072  -18.010 41.244  1.00 63.75 ? 22  ARG A NH2   1 
ATOM   907  N N     . LYS B 2 23  ? 47.277  -18.646 39.991  1.00 45.50 ? 23  LYS A N     1 
ATOM   908  C CA    . LYS B 2 23  ? 46.889  -17.481 40.775  1.00 45.16 ? 23  LYS A CA    1 
ATOM   909  C C     . LYS B 2 23  ? 45.425  -17.609 41.208  1.00 45.02 ? 23  LYS A C     1 
ATOM   910  O O     . LYS B 2 23  ? 45.060  -17.237 42.324  1.00 44.78 ? 23  LYS A O     1 
ATOM   911  C CB    . LYS B 2 23  ? 47.087  -16.205 39.946  1.00 45.24 ? 23  LYS A CB    1 
ATOM   912  C CG    . LYS B 2 23  ? 46.953  -14.917 40.739  1.00 45.57 ? 23  LYS A CG    1 
ATOM   913  C CD    . LYS B 2 23  ? 47.183  -13.681 39.873  1.00 45.67 ? 23  LYS A CD    1 
ATOM   914  C CE    . LYS B 2 23  ? 47.027  -12.404 40.701  1.00 46.92 ? 23  LYS A CE    1 
ATOM   915  N NZ    . LYS B 2 23  ? 46.975  -11.159 39.880  1.00 46.31 ? 23  LYS A NZ    1 
ATOM   916  N N     . GLY B 2 24  ? 44.597  -18.151 40.317  1.00 44.80 ? 24  GLY A N     1 
ATOM   917  C CA    . GLY B 2 24  ? 43.185  -18.321 40.607  1.00 44.37 ? 24  GLY A CA    1 
ATOM   918  C C     . GLY B 2 24  ? 42.883  -19.468 41.552  1.00 44.73 ? 24  GLY A C     1 
ATOM   919  O O     . GLY B 2 24  ? 42.015  -19.357 42.419  1.00 44.42 ? 24  GLY A O     1 
ATOM   920  N N     . ARG B 2 25  ? 43.588  -20.579 41.381  1.00 45.45 ? 25  ARG A N     1 
ATOM   921  C CA    . ARG B 2 25  ? 43.391  -21.741 42.238  1.00 46.02 ? 25  ARG A CA    1 
ATOM   922  C C     . ARG B 2 25  ? 43.702  -21.354 43.677  1.00 45.17 ? 25  ARG A C     1 
ATOM   923  O O     . ARG B 2 25  ? 43.017  -21.778 44.608  1.00 45.05 ? 25  ARG A O     1 
ATOM   924  C CB    . ARG B 2 25  ? 44.315  -22.887 41.806  1.00 48.89 ? 25  ARG A CB    1 
ATOM   925  C CG    . ARG B 2 25  ? 44.032  -23.443 40.411  1.00 52.91 ? 25  ARG A CG    1 
ATOM   926  C CD    . ARG B 2 25  ? 42.770  -24.300 40.399  1.00 56.29 ? 25  ARG A CD    1 
ATOM   927  N NE    . ARG B 2 25  ? 42.289  -24.594 39.050  1.00 58.81 ? 25  ARG A NE    1 
ATOM   928  C CZ    . ARG B 2 25  ? 41.859  -23.670 38.192  1.00 61.26 ? 25  ARG A CZ    1 
ATOM   929  N NH1   . ARG B 2 25  ? 41.856  -22.387 38.538  1.00 62.09 ? 25  ARG A NH1   1 
ATOM   930  N NH2   . ARG B 2 25  ? 41.412  -24.027 36.994  1.00 61.75 ? 25  ARG A NH2   1 
ATOM   931  N N     . GLU B 2 26  ? 44.738  -20.537 43.845  1.00 44.58 ? 26  GLU A N     1 
ATOM   932  C CA    . GLU B 2 26  ? 45.167  -20.088 45.162  1.00 44.12 ? 26  GLU A CA    1 
ATOM   933  C C     . GLU B 2 26  ? 44.199  -19.121 45.829  1.00 43.29 ? 26  GLU A C     1 
ATOM   934  O O     . GLU B 2 26  ? 44.091  -19.092 47.059  1.00 42.85 ? 26  GLU A O     1 
ATOM   935  C CB    . GLU B 2 26  ? 46.570  -19.486 45.067  1.00 44.58 ? 26  GLU A CB    1 
ATOM   936  C CG    . GLU B 2 26  ? 47.659  -20.512 45.370  1.00 47.19 ? 26  GLU A CG    1 
ATOM   937  C CD    . GLU B 2 26  ? 48.997  -20.168 44.750  1.00 48.31 ? 26  GLU A CD    1 
ATOM   938  O OE1   . GLU B 2 26  ? 49.376  -18.977 44.782  1.00 49.44 ? 26  GLU A OE1   1 
ATOM   939  O OE2   . GLU B 2 26  ? 49.670  -21.092 44.240  1.00 47.91 ? 26  GLU A OE2   1 
ATOM   940  N N     . ALA B 2 27  ? 43.493  -18.337 45.021  1.00 42.26 ? 27  ALA A N     1 
ATOM   941  C CA    . ALA B 2 27  ? 42.509  -17.404 45.551  1.00 41.88 ? 27  ALA A CA    1 
ATOM   942  C C     . ALA B 2 27  ? 41.288  -18.222 45.959  1.00 41.89 ? 27  ALA A C     1 
ATOM   943  O O     . ALA B 2 27  ? 40.753  -18.060 47.060  1.00 41.86 ? 27  ALA A O     1 
ATOM   944  C CB    . ALA B 2 27  ? 42.128  -16.384 44.496  1.00 41.68 ? 27  ALA A CB    1 
ATOM   945  N N     . GLU B 2 28  ? 40.855  -19.107 45.064  1.00 41.43 ? 28  GLU A N     1 
ATOM   946  C CA    . GLU B 2 28  ? 39.706  -19.967 45.328  1.00 41.15 ? 28  GLU A CA    1 
ATOM   947  C C     . GLU B 2 28  ? 39.952  -20.784 46.590  1.00 41.85 ? 28  GLU A C     1 
ATOM   948  O O     . GLU B 2 28  ? 39.096  -20.872 47.469  1.00 40.95 ? 28  GLU A O     1 
ATOM   949  C CB    . GLU B 2 28  ? 39.466  -20.909 44.146  1.00 40.36 ? 28  GLU A CB    1 
ATOM   950  C CG    . GLU B 2 28  ? 38.686  -22.163 44.511  1.00 39.75 ? 28  GLU A CG    1 
ATOM   951  C CD    . GLU B 2 28  ? 38.452  -23.084 43.331  1.00 39.33 ? 28  GLU A CD    1 
ATOM   952  O OE1   . GLU B 2 28  ? 39.260  -23.050 42.377  1.00 39.18 ? 28  GLU A OE1   1 
ATOM   953  O OE2   . GLU B 2 28  ? 37.468  -23.857 43.367  1.00 38.13 ? 28  GLU A OE2   1 
ATOM   954  N N     . GLU B 2 29  ? 41.132  -21.387 46.670  1.00 43.38 ? 29  GLU A N     1 
ATOM   955  C CA    . GLU B 2 29  ? 41.490  -22.196 47.822  1.00 44.39 ? 29  GLU A CA    1 
ATOM   956  C C     . GLU B 2 29  ? 41.348  -21.345 49.085  1.00 43.67 ? 29  GLU A C     1 
ATOM   957  O O     . GLU B 2 29  ? 40.580  -21.681 49.986  1.00 43.52 ? 29  GLU A O     1 
ATOM   958  C CB    . GLU B 2 29  ? 42.926  -22.705 47.670  1.00 47.36 ? 29  GLU A CB    1 
ATOM   959  C CG    . GLU B 2 29  ? 43.389  -23.626 48.789  1.00 53.39 ? 29  GLU A CG    1 
ATOM   960  C CD    . GLU B 2 29  ? 42.769  -25.014 48.713  1.00 57.64 ? 29  GLU A CD    1 
ATOM   961  O OE1   . GLU B 2 29  ? 42.976  -25.812 49.664  1.00 58.63 ? 29  GLU A OE1   1 
ATOM   962  O OE2   . GLU B 2 29  ? 42.085  -25.309 47.703  1.00 58.95 ? 29  GLU A OE2   1 
ATOM   963  N N     . GLU B 2 30  ? 42.073  -20.231 49.134  1.00 42.71 ? 30  GLU A N     1 
ATOM   964  C CA    . GLU B 2 30  ? 42.025  -19.331 50.282  1.00 41.59 ? 30  GLU A CA    1 
ATOM   965  C C     . GLU B 2 30  ? 40.625  -18.788 50.573  1.00 41.16 ? 30  GLU A C     1 
ATOM   966  O O     . GLU B 2 30  ? 40.231  -18.656 51.730  1.00 41.70 ? 30  GLU A O     1 
ATOM   967  C CB    . GLU B 2 30  ? 42.994  -18.161 50.078  1.00 41.38 ? 30  GLU A CB    1 
ATOM   968  C CG    . GLU B 2 30  ? 42.907  -17.096 51.171  1.00 42.16 ? 30  GLU A CG    1 
ATOM   969  C CD    . GLU B 2 30  ? 43.083  -17.657 52.580  1.00 40.83 ? 30  GLU A CD    1 
ATOM   970  O OE1   . GLU B 2 30  ? 42.723  -16.960 53.541  1.00 39.18 ? 30  GLU A OE1   1 
ATOM   971  O OE2   . GLU B 2 30  ? 43.585  -18.788 52.731  1.00 42.26 ? 30  GLU A OE2   1 
ATOM   972  N N     . LEU B 2 31  ? 39.875  -18.466 49.526  1.00 40.53 ? 31  LEU A N     1 
ATOM   973  C CA    . LEU B 2 31  ? 38.524  -17.946 49.703  1.00 39.39 ? 31  LEU A CA    1 
ATOM   974  C C     . LEU B 2 31  ? 37.604  -19.007 50.317  1.00 38.91 ? 31  LEU A C     1 
ATOM   975  O O     . LEU B 2 31  ? 36.721  -18.690 51.115  1.00 39.72 ? 31  LEU A O     1 
ATOM   976  C CB    . LEU B 2 31  ? 37.976  -17.461 48.359  1.00 38.49 ? 31  LEU A CB    1 
ATOM   977  C CG    . LEU B 2 31  ? 36.577  -16.843 48.297  1.00 37.99 ? 31  LEU A CG    1 
ATOM   978  C CD1   . LEU B 2 31  ? 36.435  -15.727 49.320  1.00 36.62 ? 31  LEU A CD1   1 
ATOM   979  C CD2   . LEU B 2 31  ? 36.346  -16.310 46.888  1.00 37.01 ? 31  LEU A CD2   1 
ATOM   980  N N     . ARG B 2 32  ? 37.820  -20.268 49.957  1.00 38.18 ? 32  ARG A N     1 
ATOM   981  C CA    . ARG B 2 32  ? 37.012  -21.356 50.499  1.00 38.09 ? 32  ARG A CA    1 
ATOM   982  C C     . ARG B 2 32  ? 37.209  -21.528 52.004  1.00 36.51 ? 32  ARG A C     1 
ATOM   983  O O     . ARG B 2 32  ? 36.254  -21.765 52.731  1.00 36.16 ? 32  ARG A O     1 
ATOM   984  C CB    . ARG B 2 32  ? 37.339  -22.678 49.796  1.00 40.31 ? 32  ARG A CB    1 
ATOM   985  C CG    . ARG B 2 32  ? 36.670  -22.866 48.440  1.00 42.78 ? 32  ARG A CG    1 
ATOM   986  C CD    . ARG B 2 32  ? 35.846  -24.144 48.444  1.00 45.20 ? 32  ARG A CD    1 
ATOM   987  N NE    . ARG B 2 32  ? 35.002  -24.288 47.263  1.00 45.46 ? 32  ARG A NE    1 
ATOM   988  C CZ    . ARG B 2 32  ? 35.470  -24.422 46.031  1.00 45.68 ? 32  ARG A CZ    1 
ATOM   989  N NH1   . ARG B 2 32  ? 36.779  -24.427 45.817  1.00 45.42 ? 32  ARG A NH1   1 
ATOM   990  N NH2   . ARG B 2 32  ? 34.629  -24.565 45.016  1.00 45.86 ? 32  ARG A NH2   1 
ATOM   991  N N     . ARG B 2 33  ? 38.445  -21.416 52.474  1.00 35.52 ? 33  ARG A N     1 
ATOM   992  C CA    . ARG B 2 33  ? 38.716  -21.573 53.900  1.00 34.97 ? 33  ARG A CA    1 
ATOM   993  C C     . ARG B 2 33  ? 38.051  -20.466 54.711  1.00 34.33 ? 33  ARG A C     1 
ATOM   994  O O     . ARG B 2 33  ? 37.429  -20.727 55.745  1.00 33.80 ? 33  ARG A O     1 
ATOM   995  C CB    . ARG B 2 33  ? 40.215  -21.548 54.171  1.00 35.19 ? 33  ARG A CB    1 
ATOM   996  C CG    . ARG B 2 33  ? 41.026  -22.513 53.348  1.00 35.14 ? 33  ARG A CG    1 
ATOM   997  C CD    . ARG B 2 33  ? 42.466  -22.457 53.800  1.00 36.74 ? 33  ARG A CD    1 
ATOM   998  N NE    . ARG B 2 33  ? 43.372  -23.064 52.839  1.00 39.52 ? 33  ARG A NE    1 
ATOM   999  C CZ    . ARG B 2 33  ? 44.131  -22.375 51.996  1.00 42.49 ? 33  ARG A CZ    1 
ATOM   1000 N NH1   . ARG B 2 33  ? 44.100  -21.046 51.999  1.00 42.96 ? 33  ARG A NH1   1 
ATOM   1001 N NH2   . ARG B 2 33  ? 44.915  -23.015 51.137  1.00 44.31 ? 33  ARG A NH2   1 
ATOM   1002 N N     . ARG B 2 34  ? 38.193  -19.229 54.239  1.00 32.44 ? 34  ARG A N     1 
ATOM   1003 C CA    . ARG B 2 34  ? 37.599  -18.092 54.916  1.00 31.56 ? 34  ARG A CA    1 
ATOM   1004 C C     . ARG B 2 34  ? 36.089  -18.264 55.044  1.00 31.82 ? 34  ARG A C     1 
ATOM   1005 O O     . ARG B 2 34  ? 35.484  -17.875 56.046  1.00 31.79 ? 34  ARG A O     1 
ATOM   1006 C CB    . ARG B 2 34  ? 37.918  -16.805 54.160  1.00 30.39 ? 34  ARG A CB    1 
ATOM   1007 C CG    . ARG B 2 34  ? 39.392  -16.478 54.129  1.00 31.49 ? 34  ARG A CG    1 
ATOM   1008 C CD    . ARG B 2 34  ? 39.656  -15.124 53.488  1.00 33.20 ? 34  ARG A CD    1 
ATOM   1009 N NE    . ARG B 2 34  ? 41.086  -14.908 53.270  1.00 33.50 ? 34  ARG A NE    1 
ATOM   1010 C CZ    . ARG B 2 34  ? 41.614  -13.826 52.700  1.00 33.87 ? 34  ARG A CZ    1 
ATOM   1011 N NH1   . ARG B 2 34  ? 40.833  -12.836 52.278  1.00 33.43 ? 34  ARG A NH1   1 
ATOM   1012 N NH2   . ARG B 2 34  ? 42.930  -13.736 52.554  1.00 33.10 ? 34  ARG A NH2   1 
ATOM   1013 N N     . LEU B 2 35  ? 35.489  -18.861 54.022  1.00 32.74 ? 35  LEU A N     1 
ATOM   1014 C CA    . LEU B 2 35  ? 34.053  -19.088 53.993  1.00 32.45 ? 35  LEU A CA    1 
ATOM   1015 C C     . LEU B 2 35  ? 33.632  -20.259 54.856  1.00 33.19 ? 35  LEU A C     1 
ATOM   1016 O O     . LEU B 2 35  ? 32.602  -20.203 55.525  1.00 33.07 ? 35  LEU A O     1 
ATOM   1017 C CB    . LEU B 2 35  ? 33.595  -19.336 52.559  1.00 32.15 ? 35  LEU A CB    1 
ATOM   1018 C CG    . LEU B 2 35  ? 33.454  -18.109 51.664  1.00 31.14 ? 35  LEU A CG    1 
ATOM   1019 C CD1   . LEU B 2 35  ? 33.281  -18.556 50.214  1.00 32.82 ? 35  LEU A CD1   1 
ATOM   1020 C CD2   . LEU B 2 35  ? 32.265  -17.288 52.124  1.00 30.97 ? 35  LEU A CD2   1 
ATOM   1021 N N     . ASP B 2 36  ? 34.421  -21.326 54.832  1.00 34.82 ? 36  ASP A N     1 
ATOM   1022 C CA    . ASP B 2 36  ? 34.101  -22.508 55.620  1.00 36.57 ? 36  ASP A CA    1 
ATOM   1023 C C     . ASP B 2 36  ? 34.281  -22.241 57.111  1.00 37.85 ? 36  ASP A C     1 
ATOM   1024 O O     . ASP B 2 36  ? 33.569  -22.809 57.943  1.00 37.73 ? 36  ASP A O     1 
ATOM   1025 C CB    . ASP B 2 36  ? 34.962  -23.695 55.181  1.00 35.44 ? 36  ASP A CB    1 
ATOM   1026 C CG    . ASP B 2 36  ? 34.761  -24.053 53.712  1.00 35.83 ? 36  ASP A CG    1 
ATOM   1027 O OD1   . ASP B 2 36  ? 33.669  -23.779 53.168  1.00 33.39 ? 36  ASP A OD1   1 
ATOM   1028 O OD2   . ASP B 2 36  ? 35.693  -24.621 53.103  1.00 37.42 ? 36  ASP A OD2   1 
ATOM   1029 N N     . GLU B 2 37  ? 35.226  -21.366 57.447  1.00 38.80 ? 37  GLU A N     1 
ATOM   1030 C CA    . GLU B 2 37  ? 35.469  -21.030 58.842  1.00 39.66 ? 37  GLU A CA    1 
ATOM   1031 C C     . GLU B 2 37  ? 34.237  -20.317 59.403  1.00 39.45 ? 37  GLU A C     1 
ATOM   1032 O O     . GLU B 2 37  ? 34.003  -20.321 60.610  1.00 40.10 ? 37  GLU A O     1 
ATOM   1033 C CB    . GLU B 2 37  ? 36.718  -20.151 58.967  1.00 40.74 ? 37  GLU A CB    1 
ATOM   1034 C CG    . GLU B 2 37  ? 37.036  -19.661 60.379  1.00 44.01 ? 37  GLU A CG    1 
ATOM   1035 C CD    . GLU B 2 37  ? 37.160  -20.785 61.408  1.00 47.00 ? 37  GLU A CD    1 
ATOM   1036 O OE1   . GLU B 2 37  ? 37.726  -21.852 61.068  1.00 48.92 ? 37  GLU A OE1   1 
ATOM   1037 O OE2   . GLU B 2 37  ? 36.707  -20.594 62.565  1.00 46.26 ? 37  GLU A OE2   1 
ATOM   1038 N N     . LEU B 2 38  ? 33.440  -19.718 58.526  1.00 37.59 ? 38  LEU A N     1 
ATOM   1039 C CA    . LEU B 2 38  ? 32.233  -19.033 58.967  1.00 36.44 ? 38  LEU A CA    1 
ATOM   1040 C C     . LEU B 2 38  ? 31.027  -19.942 58.742  1.00 35.98 ? 38  LEU A C     1 
ATOM   1041 O O     . LEU B 2 38  ? 29.898  -19.591 59.069  1.00 35.52 ? 38  LEU A O     1 
ATOM   1042 C CB    . LEU B 2 38  ? 32.053  -17.719 58.198  1.00 36.62 ? 38  LEU A CB    1 
ATOM   1043 C CG    . LEU B 2 38  ? 33.280  -16.802 58.155  1.00 36.80 ? 38  LEU A CG    1 
ATOM   1044 C CD1   . LEU B 2 38  ? 32.933  -15.509 57.434  1.00 36.31 ? 38  LEU A CD1   1 
ATOM   1045 C CD2   . LEU B 2 38  ? 33.758  -16.510 59.575  1.00 37.01 ? 38  LEU A CD2   1 
ATOM   1046 N N     . GLY B 2 39  ? 31.275  -21.120 58.182  1.00 36.00 ? 39  GLY A N     1 
ATOM   1047 C CA    . GLY B 2 39  ? 30.190  -22.046 57.928  1.00 35.99 ? 39  GLY A CA    1 
ATOM   1048 C C     . GLY B 2 39  ? 29.126  -21.414 57.050  1.00 37.20 ? 39  GLY A C     1 
ATOM   1049 O O     . GLY B 2 39  ? 27.933  -21.476 57.355  1.00 37.81 ? 39  GLY A O     1 
ATOM   1050 N N     . VAL B 2 40  ? 29.558  -20.794 55.958  1.00 36.70 ? 40  VAL A N     1 
ATOM   1051 C CA    . VAL B 2 40  ? 28.635  -20.155 55.032  1.00 36.27 ? 40  VAL A CA    1 
ATOM   1052 C C     . VAL B 2 40  ? 28.264  -21.114 53.898  1.00 36.10 ? 40  VAL A C     1 
ATOM   1053 O O     . VAL B 2 40  ? 29.104  -21.857 53.395  1.00 36.80 ? 40  VAL A O     1 
ATOM   1054 C CB    . VAL B 2 40  ? 29.257  -18.856 54.440  1.00 36.34 ? 40  VAL A CB    1 
ATOM   1055 C CG1   . VAL B 2 40  ? 28.383  -18.306 53.326  1.00 36.06 ? 40  VAL A CG1   1 
ATOM   1056 C CG2   . VAL B 2 40  ? 29.413  -17.811 55.540  1.00 36.18 ? 40  VAL A CG2   1 
ATOM   1057 N N     . GLU B 2 41  ? 26.995  -21.106 53.513  1.00 35.17 ? 41  GLU A N     1 
ATOM   1058 C CA    . GLU B 2 41  ? 26.532  -21.965 52.439  1.00 35.20 ? 41  GLU A CA    1 
ATOM   1059 C C     . GLU B 2 41  ? 26.653  -21.172 51.141  1.00 34.65 ? 41  GLU A C     1 
ATOM   1060 O O     . GLU B 2 41  ? 25.915  -20.211 50.910  1.00 34.71 ? 41  GLU A O     1 
ATOM   1061 C CB    . GLU B 2 41  ? 25.080  -22.376 52.669  1.00 35.38 ? 41  GLU A CB    1 
ATOM   1062 C CG    . GLU B 2 41  ? 24.678  -23.618 51.903  1.00 37.22 ? 41  GLU A CG    1 
ATOM   1063 C CD    . GLU B 2 41  ? 23.182  -23.843 51.918  1.00 40.44 ? 41  GLU A CD    1 
ATOM   1064 O OE1   . GLU B 2 41  ? 22.550  -23.582 52.973  1.00 41.92 ? 41  GLU A OE1   1 
ATOM   1065 O OE2   . GLU B 2 41  ? 22.642  -24.289 50.880  1.00 39.89 ? 41  GLU A OE2   1 
ATOM   1066 N N     . TYR B 2 42  ? 27.584  -21.591 50.294  1.00 33.28 ? 42  TYR A N     1 
ATOM   1067 C CA    . TYR B 2 42  ? 27.837  -20.903 49.040  1.00 31.74 ? 42  TYR A CA    1 
ATOM   1068 C C     . TYR B 2 42  ? 28.058  -21.866 47.884  1.00 30.73 ? 42  TYR A C     1 
ATOM   1069 O O     . TYR B 2 42  ? 28.105  -23.087 48.052  1.00 31.80 ? 42  TYR A O     1 
ATOM   1070 C CB    . TYR B 2 42  ? 29.082  -20.035 49.204  1.00 31.45 ? 42  TYR A CB    1 
ATOM   1071 C CG    . TYR B 2 42  ? 30.316  -20.843 49.545  1.00 31.72 ? 42  TYR A CG    1 
ATOM   1072 C CD1   . TYR B 2 42  ? 31.042  -21.505 48.550  1.00 31.67 ? 42  TYR A CD1   1 
ATOM   1073 C CD2   . TYR B 2 42  ? 30.730  -20.990 50.869  1.00 31.88 ? 42  TYR A CD2   1 
ATOM   1074 C CE1   . TYR B 2 42  ? 32.144  -22.292 48.867  1.00 33.16 ? 42  TYR A CE1   1 
ATOM   1075 C CE2   . TYR B 2 42  ? 31.828  -21.777 51.199  1.00 32.59 ? 42  TYR A CE2   1 
ATOM   1076 C CZ    . TYR B 2 42  ? 32.531  -22.426 50.197  1.00 33.99 ? 42  TYR A CZ    1 
ATOM   1077 O OH    . TYR B 2 42  ? 33.615  -23.212 50.528  1.00 35.26 ? 42  TYR A OH    1 
ATOM   1078 N N     . VAL B 2 43  ? 28.209  -21.298 46.700  1.00 29.28 ? 43  VAL A N     1 
ATOM   1079 C CA    . VAL B 2 43  ? 28.475  -22.085 45.505  1.00 28.17 ? 43  VAL A CA    1 
ATOM   1080 C C     . VAL B 2 43  ? 29.233  -21.213 44.519  1.00 27.05 ? 43  VAL A C     1 
ATOM   1081 O O     . VAL B 2 43  ? 28.863  -20.062 44.297  1.00 25.90 ? 43  VAL A O     1 
ATOM   1082 C CB    . VAL B 2 43  ? 27.176  -22.577 44.825  1.00 26.96 ? 43  VAL A CB    1 
ATOM   1083 C CG1   . VAL B 2 43  ? 26.299  -21.400 44.436  1.00 27.30 ? 43  VAL A CG1   1 
ATOM   1084 C CG2   . VAL B 2 43  ? 27.530  -23.393 43.596  1.00 25.18 ? 43  VAL A CG2   1 
ATOM   1085 N N     . PHE B 2 44  ? 30.310  -21.750 43.956  1.00 27.41 ? 44  PHE A N     1 
ATOM   1086 C CA    . PHE B 2 44  ? 31.080  -21.005 42.963  1.00 27.99 ? 44  PHE A CA    1 
ATOM   1087 C C     . PHE B 2 44  ? 30.386  -21.142 41.608  1.00 28.23 ? 44  PHE A C     1 
ATOM   1088 O O     . PHE B 2 44  ? 30.080  -22.252 41.155  1.00 27.95 ? 44  PHE A O     1 
ATOM   1089 C CB    . PHE B 2 44  ? 32.518  -21.533 42.859  1.00 27.19 ? 44  PHE A CB    1 
ATOM   1090 C CG    . PHE B 2 44  ? 33.445  -20.996 43.916  1.00 28.13 ? 44  PHE A CG    1 
ATOM   1091 C CD1   . PHE B 2 44  ? 33.167  -21.171 45.261  1.00 27.79 ? 44  PHE A CD1   1 
ATOM   1092 C CD2   . PHE B 2 44  ? 34.616  -20.340 43.563  1.00 28.76 ? 44  PHE A CD2   1 
ATOM   1093 C CE1   . PHE B 2 44  ? 34.045  -20.705 46.241  1.00 28.71 ? 44  PHE A CE1   1 
ATOM   1094 C CE2   . PHE B 2 44  ? 35.500  -19.870 44.537  1.00 28.80 ? 44  PHE A CE2   1 
ATOM   1095 C CZ    . PHE B 2 44  ? 35.215  -20.054 45.875  1.00 27.76 ? 44  PHE A CZ    1 
ATOM   1096 N N     . VAL B 2 45  ? 30.111  -20.011 40.975  1.00 27.27 ? 45  VAL A N     1 
ATOM   1097 C CA    . VAL B 2 45  ? 29.474  -20.032 39.676  1.00 27.56 ? 45  VAL A CA    1 
ATOM   1098 C C     . VAL B 2 45  ? 30.339  -19.218 38.713  1.00 29.04 ? 45  VAL A C     1 
ATOM   1099 O O     . VAL B 2 45  ? 31.470  -18.857 39.042  1.00 30.14 ? 45  VAL A O     1 
ATOM   1100 C CB    . VAL B 2 45  ? 28.051  -19.454 39.774  1.00 27.75 ? 45  VAL A CB    1 
ATOM   1101 C CG1   . VAL B 2 45  ? 27.282  -20.170 40.887  1.00 26.98 ? 45  VAL A CG1   1 
ATOM   1102 C CG2   . VAL B 2 45  ? 28.105  -17.967 40.058  1.00 27.63 ? 45  VAL A CG2   1 
ATOM   1103 N N     . GLY B 2 46  ? 29.824  -18.946 37.521  1.00 30.32 ? 46  GLY A N     1 
ATOM   1104 C CA    . GLY B 2 46  ? 30.585  -18.170 36.560  1.00 30.06 ? 46  GLY A CA    1 
ATOM   1105 C C     . GLY B 2 46  ? 31.582  -18.988 35.764  1.00 30.21 ? 46  GLY A C     1 
ATOM   1106 O O     . GLY B 2 46  ? 31.722  -20.190 35.963  1.00 30.14 ? 46  GLY A O     1 
ATOM   1107 N N     . SER B 2 47  ? 32.291  -18.319 34.865  1.00 30.66 ? 47  SER A N     1 
ATOM   1108 C CA    . SER B 2 47  ? 33.269  -18.972 34.015  1.00 31.06 ? 47  SER A CA    1 
ATOM   1109 C C     . SER B 2 47  ? 34.500  -19.475 34.772  1.00 31.37 ? 47  SER A C     1 
ATOM   1110 O O     . SER B 2 47  ? 35.214  -20.353 34.283  1.00 31.50 ? 47  SER A O     1 
ATOM   1111 C CB    . SER B 2 47  ? 33.694  -18.024 32.889  1.00 30.45 ? 47  SER A CB    1 
ATOM   1112 O OG    . SER B 2 47  ? 34.125  -16.786 33.414  1.00 31.17 ? 47  SER A OG    1 
ATOM   1113 N N     . TYR B 2 48  ? 34.764  -18.926 35.953  1.00 30.68 ? 48  TYR A N     1 
ATOM   1114 C CA    . TYR B 2 48  ? 35.915  -19.398 36.703  1.00 31.06 ? 48  TYR A CA    1 
ATOM   1115 C C     . TYR B 2 48  ? 35.627  -20.783 37.244  1.00 31.24 ? 48  TYR A C     1 
ATOM   1116 O O     . TYR B 2 48  ? 36.505  -21.647 37.266  1.00 31.77 ? 48  TYR A O     1 
ATOM   1117 C CB    . TYR B 2 48  ? 36.253  -18.502 37.890  1.00 31.26 ? 48  TYR A CB    1 
ATOM   1118 C CG    . TYR B 2 48  ? 37.361  -19.123 38.708  1.00 32.03 ? 48  TYR A CG    1 
ATOM   1119 C CD1   . TYR B 2 48  ? 38.680  -19.105 38.248  1.00 30.85 ? 48  TYR A CD1   1 
ATOM   1120 C CD2   . TYR B 2 48  ? 37.074  -19.855 39.865  1.00 32.24 ? 48  TYR A CD2   1 
ATOM   1121 C CE1   . TYR B 2 48  ? 39.685  -19.808 38.906  1.00 31.41 ? 48  TYR A CE1   1 
ATOM   1122 C CE2   . TYR B 2 48  ? 38.073  -20.568 40.531  1.00 32.44 ? 48  TYR A CE2   1 
ATOM   1123 C CZ    . TYR B 2 48  ? 39.379  -20.545 40.040  1.00 32.07 ? 48  TYR A CZ    1 
ATOM   1124 O OH    . TYR B 2 48  ? 40.361  -21.307 40.645  1.00 32.70 ? 48  TYR A OH    1 
ATOM   1125 N N     . ALA B 2 49  ? 34.391  -20.974 37.696  1.00 31.34 ? 49  ALA A N     1 
ATOM   1126 C CA    . ALA B 2 49  ? 33.948  -22.241 38.262  1.00 31.12 ? 49  ALA A CA    1 
ATOM   1127 C C     . ALA B 2 49  ? 33.930  -23.337 37.214  1.00 31.73 ? 49  ALA A C     1 
ATOM   1128 O O     . ALA B 2 49  ? 34.089  -24.513 37.538  1.00 32.03 ? 49  ALA A O     1 
ATOM   1129 C CB    . ALA B 2 49  ? 32.561  -22.080 38.873  1.00 30.12 ? 49  ALA A CB    1 
ATOM   1130 N N     . ARG B 2 50  ? 33.738  -22.944 35.959  1.00 32.23 ? 50  ARG A N     1 
ATOM   1131 C CA    . ARG B 2 50  ? 33.692  -23.892 34.852  1.00 32.18 ? 50  ARG A CA    1 
ATOM   1132 C C     . ARG B 2 50  ? 34.912  -23.802 33.934  1.00 32.62 ? 50  ARG A C     1 
ATOM   1133 O O     . ARG B 2 50  ? 34.885  -24.298 32.809  1.00 33.05 ? 50  ARG A O     1 
ATOM   1134 C CB    . ARG B 2 50  ? 32.406  -23.688 34.044  1.00 31.64 ? 50  ARG A CB    1 
ATOM   1135 C CG    . ARG B 2 50  ? 31.148  -24.010 34.835  1.00 32.94 ? 50  ARG A CG    1 
ATOM   1136 C CD    . ARG B 2 50  ? 29.879  -23.873 34.010  1.00 34.07 ? 50  ARG A CD    1 
ATOM   1137 N NE    . ARG B 2 50  ? 29.161  -22.621 34.261  1.00 37.77 ? 50  ARG A NE    1 
ATOM   1138 C CZ    . ARG B 2 50  ? 29.400  -21.467 33.643  1.00 37.65 ? 50  ARG A CZ    1 
ATOM   1139 N NH1   . ARG B 2 50  ? 30.347  -21.383 32.726  1.00 38.46 ? 50  ARG A NH1   1 
ATOM   1140 N NH2   . ARG B 2 50  ? 28.680  -20.397 33.934  1.00 38.41 ? 50  ARG A NH2   1 
ATOM   1141 N N     . ASN B 2 51  ? 35.977  -23.175 34.427  1.00 32.75 ? 51  ASN A N     1 
ATOM   1142 C CA    . ASN B 2 51  ? 37.221  -23.018 33.673  1.00 32.67 ? 51  ASN A CA    1 
ATOM   1143 C C     . ASN B 2 51  ? 36.975  -22.647 32.210  1.00 31.53 ? 51  ASN A C     1 
ATOM   1144 O O     . ASN B 2 51  ? 37.491  -23.287 31.295  1.00 31.73 ? 51  ASN A O     1 
ATOM   1145 C CB    . ASN B 2 51  ? 38.045  -24.310 33.764  1.00 35.22 ? 51  ASN A CB    1 
ATOM   1146 C CG    . ASN B 2 51  ? 38.295  -24.749 35.211  1.00 39.49 ? 51  ASN A CG    1 
ATOM   1147 O OD1   . ASN B 2 51  ? 38.997  -24.071 35.978  1.00 42.10 ? 51  ASN A OD1   1 
ATOM   1148 N ND2   . ASN B 2 51  ? 37.712  -25.884 35.594  1.00 40.30 ? 51  ASN A ND2   1 
ATOM   1149 N N     . THR B 2 52  ? 36.180  -21.608 31.994  1.00 29.95 ? 52  THR A N     1 
ATOM   1150 C CA    . THR B 2 52  ? 35.880  -21.155 30.649  1.00 30.07 ? 52  THR A CA    1 
ATOM   1151 C C     . THR B 2 52  ? 36.141  -19.663 30.538  1.00 32.09 ? 52  THR A C     1 
ATOM   1152 O O     . THR B 2 52  ? 35.729  -19.025 29.571  1.00 32.73 ? 52  THR A O     1 
ATOM   1153 C CB    . THR B 2 52  ? 34.404  -21.430 30.270  1.00 29.43 ? 52  THR A CB    1 
ATOM   1154 O OG1   . THR B 2 52  ? 33.530  -20.769 31.190  1.00 27.59 ? 52  THR A OG1   1 
ATOM   1155 C CG2   . THR B 2 52  ? 34.116  -22.917 30.299  1.00 29.71 ? 52  THR A CG2   1 
ATOM   1156 N N     . TRP B 2 53  ? 36.835  -19.110 31.529  1.00 33.72 ? 53  TRP A N     1 
ATOM   1157 C CA    . TRP B 2 53  ? 37.138  -17.683 31.553  1.00 34.02 ? 53  TRP A CA    1 
ATOM   1158 C C     . TRP B 2 53  ? 38.265  -17.341 30.588  1.00 34.93 ? 53  TRP A C     1 
ATOM   1159 O O     . TRP B 2 53  ? 39.291  -18.021 30.529  1.00 35.68 ? 53  TRP A O     1 
ATOM   1160 C CB    . TRP B 2 53  ? 37.498  -17.240 32.979  1.00 34.51 ? 53  TRP A CB    1 
ATOM   1161 C CG    . TRP B 2 53  ? 38.944  -17.432 33.370  1.00 35.66 ? 53  TRP A CG    1 
ATOM   1162 C CD1   . TRP B 2 53  ? 39.984  -16.572 33.129  1.00 35.86 ? 53  TRP A CD1   1 
ATOM   1163 C CD2   . TRP B 2 53  ? 39.499  -18.536 34.090  1.00 34.82 ? 53  TRP A CD2   1 
ATOM   1164 N NE1   . TRP B 2 53  ? 41.147  -17.072 33.659  1.00 35.02 ? 53  TRP A NE1   1 
ATOM   1165 C CE2   . TRP B 2 53  ? 40.879  -18.277 34.254  1.00 36.08 ? 53  TRP A CE2   1 
ATOM   1166 C CE3   . TRP B 2 53  ? 38.966  -19.718 34.615  1.00 35.70 ? 53  TRP A CE3   1 
ATOM   1167 C CZ2   . TRP B 2 53  ? 41.731  -19.157 34.924  1.00 37.31 ? 53  TRP A CZ2   1 
ATOM   1168 C CZ3   . TRP B 2 53  ? 39.814  -20.595 35.284  1.00 37.38 ? 53  TRP A CZ3   1 
ATOM   1169 C CH2   . TRP B 2 53  ? 41.182  -20.307 35.432  1.00 37.88 ? 53  TRP A CH2   1 
ATOM   1170 N N     . LEU B 2 54  ? 38.057  -16.273 29.831  1.00 35.73 ? 54  LEU A N     1 
ATOM   1171 C CA    . LEU B 2 54  ? 39.017  -15.825 28.838  1.00 36.13 ? 54  LEU A CA    1 
ATOM   1172 C C     . LEU B 2 54  ? 40.293  -15.284 29.461  1.00 37.52 ? 54  LEU A C     1 
ATOM   1173 O O     . LEU B 2 54  ? 40.248  -14.548 30.447  1.00 38.12 ? 54  LEU A O     1 
ATOM   1174 C CB    . LEU B 2 54  ? 38.379  -14.743 27.975  1.00 34.89 ? 54  LEU A CB    1 
ATOM   1175 C CG    . LEU B 2 54  ? 39.084  -14.512 26.649  1.00 34.40 ? 54  LEU A CG    1 
ATOM   1176 C CD1   . LEU B 2 54  ? 39.049  -15.812 25.840  1.00 32.75 ? 54  LEU A CD1   1 
ATOM   1177 C CD2   . LEU B 2 54  ? 38.401  -13.364 25.904  1.00 33.49 ? 54  LEU A CD2   1 
ATOM   1178 N N     . LYS B 2 55  ? 41.428  -15.644 28.871  1.00 39.07 ? 55  LYS A N     1 
ATOM   1179 C CA    . LYS B 2 55  ? 42.736  -15.192 29.349  1.00 40.68 ? 55  LYS A CA    1 
ATOM   1180 C C     . LYS B 2 55  ? 42.698  -13.712 29.729  1.00 40.87 ? 55  LYS A C     1 
ATOM   1181 O O     . LYS B 2 55  ? 42.157  -12.889 28.989  1.00 41.94 ? 55  LYS A O     1 
ATOM   1182 C CB    . LYS B 2 55  ? 43.796  -15.402 28.260  1.00 41.71 ? 55  LYS A CB    1 
ATOM   1183 C CG    . LYS B 2 55  ? 45.213  -15.013 28.669  1.00 43.66 ? 55  LYS A CG    1 
ATOM   1184 C CD    . LYS B 2 55  ? 46.183  -15.110 27.490  1.00 45.92 ? 55  LYS A CD    1 
ATOM   1185 C CE    . LYS B 2 55  ? 47.641  -15.185 27.950  1.00 46.59 ? 55  LYS A CE    1 
ATOM   1186 N NZ    . LYS B 2 55  ? 48.014  -14.044 28.832  1.00 48.32 ? 55  LYS A NZ    1 
ATOM   1187 N N     . GLY B 2 56  ? 43.262  -13.379 30.886  1.00 40.44 ? 56  GLY A N     1 
ATOM   1188 C CA    . GLY B 2 56  ? 43.289  -11.997 31.318  1.00 40.59 ? 56  GLY A CA    1 
ATOM   1189 C C     . GLY B 2 56  ? 42.006  -11.470 31.936  1.00 41.07 ? 56  GLY A C     1 
ATOM   1190 O O     . GLY B 2 56  ? 41.936  -10.293 32.310  1.00 41.20 ? 56  GLY A O     1 
ATOM   1191 N N     . SER B 2 57  ? 40.985  -12.319 32.039  1.00 40.63 ? 57  SER A N     1 
ATOM   1192 C CA    . SER B 2 57  ? 39.715  -11.907 32.641  1.00 39.97 ? 57  SER A CA    1 
ATOM   1193 C C     . SER B 2 57  ? 39.369  -12.774 33.843  1.00 39.50 ? 57  SER A C     1 
ATOM   1194 O O     . SER B 2 57  ? 38.223  -13.194 34.005  1.00 39.99 ? 57  SER A O     1 
ATOM   1195 C CB    . SER B 2 57  ? 38.576  -11.986 31.624  1.00 40.20 ? 57  SER A CB    1 
ATOM   1196 O OG    . SER B 2 57  ? 38.707  -10.991 30.631  1.00 41.29 ? 57  SER A OG    1 
ATOM   1197 N N     . LEU B 2 58  ? 40.356  -13.037 34.691  1.00 39.31 ? 58  LEU A N     1 
ATOM   1198 C CA    . LEU B 2 58  ? 40.117  -13.860 35.861  1.00 39.01 ? 58  LEU A CA    1 
ATOM   1199 C C     . LEU B 2 58  ? 39.322  -13.111 36.916  1.00 39.38 ? 58  LEU A C     1 
ATOM   1200 O O     . LEU B 2 58  ? 39.726  -12.043 37.380  1.00 40.53 ? 58  LEU A O     1 
ATOM   1201 C CB    . LEU B 2 58  ? 41.435  -14.333 36.466  1.00 39.00 ? 58  LEU A CB    1 
ATOM   1202 C CG    . LEU B 2 58  ? 41.312  -15.237 37.699  1.00 37.91 ? 58  LEU A CG    1 
ATOM   1203 C CD1   . LEU B 2 58  ? 40.614  -16.526 37.324  1.00 36.36 ? 58  LEU A CD1   1 
ATOM   1204 C CD2   . LEU B 2 58  ? 42.693  -15.524 38.264  1.00 38.16 ? 58  LEU A CD2   1 
ATOM   1205 N N     . GLU B 2 59  ? 38.178  -13.674 37.280  1.00 38.73 ? 59  GLU A N     1 
ATOM   1206 C CA    . GLU B 2 59  ? 37.320  -13.098 38.303  1.00 38.30 ? 59  GLU A CA    1 
ATOM   1207 C C     . GLU B 2 59  ? 36.453  -14.231 38.853  1.00 35.56 ? 59  GLU A C     1 
ATOM   1208 O O     . GLU B 2 59  ? 35.786  -14.941 38.098  1.00 33.86 ? 59  GLU A O     1 
ATOM   1209 C CB    . GLU B 2 59  ? 36.446  -11.971 37.728  1.00 40.82 ? 59  GLU A CB    1 
ATOM   1210 C CG    . GLU B 2 59  ? 35.752  -11.143 38.819  1.00 46.21 ? 59  GLU A CG    1 
ATOM   1211 C CD    . GLU B 2 59  ? 34.926  -9.978  38.282  1.00 48.74 ? 59  GLU A CD    1 
ATOM   1212 O OE1   . GLU B 2 59  ? 33.757  -10.193 37.875  1.00 50.07 ? 59  GLU A OE1   1 
ATOM   1213 O OE2   . GLU B 2 59  ? 35.454  -8.842  38.267  1.00 50.06 ? 59  GLU A OE2   1 
ATOM   1214 N N     . ILE B 2 60  ? 36.490  -14.395 40.173  1.00 33.71 ? 60  ILE A N     1 
ATOM   1215 C CA    . ILE B 2 60  ? 35.746  -15.442 40.868  1.00 32.13 ? 60  ILE A CA    1 
ATOM   1216 C C     . ILE B 2 60  ? 34.367  -14.981 41.329  1.00 32.03 ? 60  ILE A C     1 
ATOM   1217 O O     . ILE B 2 60  ? 34.232  -13.937 41.972  1.00 32.55 ? 60  ILE A O     1 
ATOM   1218 C CB    . ILE B 2 60  ? 36.544  -15.935 42.104  1.00 31.10 ? 60  ILE A CB    1 
ATOM   1219 C CG1   . ILE B 2 60  ? 37.847  -16.601 41.649  1.00 30.13 ? 60  ILE A CG1   1 
ATOM   1220 C CG2   . ILE B 2 60  ? 35.698  -16.878 42.938  1.00 30.35 ? 60  ILE A CG2   1 
ATOM   1221 C CD1   . ILE B 2 60  ? 38.785  -16.940 42.773  1.00 28.59 ? 60  ILE A CD1   1 
ATOM   1222 N N     . ASP B 2 61  ? 33.344  -15.758 40.997  1.00 31.42 ? 61  ASP A N     1 
ATOM   1223 C CA    . ASP B 2 61  ? 31.982  -15.429 41.400  1.00 31.36 ? 61  ASP A CA    1 
ATOM   1224 C C     . ASP B 2 61  ? 31.514  -16.365 42.510  1.00 30.85 ? 61  ASP A C     1 
ATOM   1225 O O     . ASP B 2 61  ? 31.400  -17.572 42.302  1.00 32.50 ? 61  ASP A O     1 
ATOM   1226 C CB    . ASP B 2 61  ? 31.027  -15.533 40.206  1.00 31.79 ? 61  ASP A CB    1 
ATOM   1227 C CG    . ASP B 2 61  ? 31.161  -14.366 39.238  1.00 31.93 ? 61  ASP A CG    1 
ATOM   1228 O OD1   . ASP B 2 61  ? 31.340  -14.606 38.028  1.00 34.44 ? 61  ASP A OD1   1 
ATOM   1229 O OD2   . ASP B 2 61  ? 31.073  -13.204 39.682  1.00 33.10 ? 61  ASP A OD2   1 
ATOM   1230 N N     . VAL B 2 62  ? 31.251  -15.802 43.688  1.00 30.44 ? 62  VAL A N     1 
ATOM   1231 C CA    . VAL B 2 62  ? 30.789  -16.572 44.842  1.00 29.26 ? 62  VAL A CA    1 
ATOM   1232 C C     . VAL B 2 62  ? 29.384  -16.133 45.185  1.00 28.97 ? 62  VAL A C     1 
ATOM   1233 O O     . VAL B 2 62  ? 29.183  -15.018 45.656  1.00 28.05 ? 62  VAL A O     1 
ATOM   1234 C CB    . VAL B 2 62  ? 31.669  -16.327 46.098  1.00 31.10 ? 62  VAL A CB    1 
ATOM   1235 C CG1   . VAL B 2 62  ? 31.103  -17.089 47.296  1.00 28.52 ? 62  VAL A CG1   1 
ATOM   1236 C CG2   . VAL B 2 62  ? 33.102  -16.752 45.825  1.00 30.95 ? 62  VAL A CG2   1 
ATOM   1237 N N     . PHE B 2 63  ? 28.418  -17.014 44.943  1.00 29.75 ? 63  PHE A N     1 
ATOM   1238 C CA    . PHE B 2 63  ? 27.010  -16.739 45.230  1.00 29.59 ? 63  PHE A CA    1 
ATOM   1239 C C     . PHE B 2 63  ? 26.610  -17.392 46.555  1.00 30.27 ? 63  PHE A C     1 
ATOM   1240 O O     . PHE B 2 63  ? 26.763  -18.603 46.739  1.00 31.73 ? 63  PHE A O     1 
ATOM   1241 C CB    . PHE B 2 63  ? 26.125  -17.265 44.088  1.00 29.09 ? 63  PHE A CB    1 
ATOM   1242 C CG    . PHE B 2 63  ? 25.925  -16.278 42.960  1.00 28.46 ? 63  PHE A CG    1 
ATOM   1243 C CD1   . PHE B 2 63  ? 27.006  -15.628 42.377  1.00 27.89 ? 63  PHE A CD1   1 
ATOM   1244 C CD2   . PHE B 2 63  ? 24.649  -16.006 42.477  1.00 28.14 ? 63  PHE A CD2   1 
ATOM   1245 C CE1   . PHE B 2 63  ? 26.816  -14.718 41.328  1.00 26.96 ? 63  PHE A CE1   1 
ATOM   1246 C CE2   . PHE B 2 63  ? 24.452  -15.097 41.429  1.00 27.16 ? 63  PHE A CE2   1 
ATOM   1247 C CZ    . PHE B 2 63  ? 25.539  -14.455 40.858  1.00 26.28 ? 63  PHE A CZ    1 
ATOM   1248 N N     . LEU B 2 64  ? 26.097  -16.588 47.479  1.00 29.22 ? 64  LEU A N     1 
ATOM   1249 C CA    . LEU B 2 64  ? 25.701  -17.099 48.780  1.00 28.41 ? 64  LEU A CA    1 
ATOM   1250 C C     . LEU B 2 64  ? 24.252  -17.593 48.762  1.00 28.81 ? 64  LEU A C     1 
ATOM   1251 O O     . LEU B 2 64  ? 23.331  -16.826 48.476  1.00 28.41 ? 64  LEU A O     1 
ATOM   1252 C CB    . LEU B 2 64  ? 25.887  -16.001 49.831  1.00 26.67 ? 64  LEU A CB    1 
ATOM   1253 C CG    . LEU B 2 64  ? 27.227  -15.252 49.747  1.00 25.37 ? 64  LEU A CG    1 
ATOM   1254 C CD1   . LEU B 2 64  ? 27.278  -14.177 50.820  1.00 25.47 ? 64  LEU A CD1   1 
ATOM   1255 C CD2   . LEU B 2 64  ? 28.391  -16.213 49.900  1.00 24.44 ? 64  LEU A CD2   1 
ATOM   1256 N N     . LEU B 2 65  ? 24.052  -18.877 49.057  1.00 29.40 ? 65  LEU A N     1 
ATOM   1257 C CA    . LEU B 2 65  ? 22.702  -19.439 49.060  1.00 31.13 ? 65  LEU A CA    1 
ATOM   1258 C C     . LEU B 2 65  ? 21.955  -19.100 50.334  1.00 31.84 ? 65  LEU A C     1 
ATOM   1259 O O     . LEU B 2 65  ? 22.324  -19.543 51.422  1.00 32.76 ? 65  LEU A O     1 
ATOM   1260 C CB    . LEU B 2 65  ? 22.720  -20.965 48.891  1.00 30.95 ? 65  LEU A CB    1 
ATOM   1261 C CG    . LEU B 2 65  ? 23.082  -21.591 47.543  1.00 29.43 ? 65  LEU A CG    1 
ATOM   1262 C CD1   . LEU B 2 65  ? 22.685  -20.653 46.414  1.00 27.61 ? 65  LEU A CD1   1 
ATOM   1263 C CD2   . LEU B 2 65  ? 24.562  -21.882 47.509  1.00 30.74 ? 65  LEU A CD2   1 
ATOM   1264 N N     . PHE B 2 66  ? 20.891  -18.320 50.184  1.00 32.50 ? 66  PHE A N     1 
ATOM   1265 C CA    . PHE B 2 66  ? 20.078  -17.904 51.312  1.00 33.80 ? 66  PHE A CA    1 
ATOM   1266 C C     . PHE B 2 66  ? 18.720  -18.595 51.323  1.00 34.25 ? 66  PHE A C     1 
ATOM   1267 O O     . PHE B 2 66  ? 18.116  -18.821 50.274  1.00 34.45 ? 66  PHE A O     1 
ATOM   1268 C CB    . PHE B 2 66  ? 19.887  -16.390 51.277  1.00 34.46 ? 66  PHE A CB    1 
ATOM   1269 C CG    . PHE B 2 66  ? 20.987  -15.626 51.947  1.00 34.74 ? 66  PHE A CG    1 
ATOM   1270 C CD1   . PHE B 2 66  ? 21.056  -15.561 53.339  1.00 34.64 ? 66  PHE A CD1   1 
ATOM   1271 C CD2   . PHE B 2 66  ? 21.966  -14.979 51.192  1.00 35.26 ? 66  PHE A CD2   1 
ATOM   1272 C CE1   . PHE B 2 66  ? 22.084  -14.862 53.975  1.00 33.46 ? 66  PHE A CE1   1 
ATOM   1273 C CE2   . PHE B 2 66  ? 23.004  -14.275 51.817  1.00 35.42 ? 66  PHE A CE2   1 
ATOM   1274 C CZ    . PHE B 2 66  ? 23.061  -14.219 53.214  1.00 34.75 ? 66  PHE A CZ    1 
ATOM   1275 N N     . PRO B 2 67  ? 18.230  -18.951 52.518  1.00 34.56 ? 67  PRO A N     1 
ATOM   1276 C CA    . PRO B 2 67  ? 16.936  -19.617 52.669  1.00 35.29 ? 67  PRO A CA    1 
ATOM   1277 C C     . PRO B 2 67  ? 15.864  -18.836 51.926  1.00 38.08 ? 67  PRO A C     1 
ATOM   1278 O O     . PRO B 2 67  ? 15.829  -17.606 51.974  1.00 38.08 ? 67  PRO A O     1 
ATOM   1279 C CB    . PRO B 2 67  ? 16.719  -19.609 54.172  1.00 34.25 ? 67  PRO A CB    1 
ATOM   1280 C CG    . PRO B 2 67  ? 18.119  -19.732 54.698  1.00 33.76 ? 67  PRO A CG    1 
ATOM   1281 C CD    . PRO B 2 67  ? 18.890  -18.776 53.822  1.00 33.71 ? 67  PRO A CD    1 
ATOM   1282 N N     . GLU B 2 68  ? 14.989  -19.563 51.243  1.00 40.55 ? 68  GLU A N     1 
ATOM   1283 C CA    . GLU B 2 68  ? 13.923  -18.963 50.458  1.00 42.77 ? 68  GLU A CA    1 
ATOM   1284 C C     . GLU B 2 68  ? 13.084  -17.905 51.171  1.00 42.54 ? 68  GLU A C     1 
ATOM   1285 O O     . GLU B 2 68  ? 12.762  -16.876 50.587  1.00 43.90 ? 68  GLU A O     1 
ATOM   1286 C CB    . GLU B 2 68  ? 13.007  -20.063 49.934  1.00 45.11 ? 68  GLU A CB    1 
ATOM   1287 C CG    . GLU B 2 68  ? 12.048  -19.604 48.864  1.00 50.08 ? 68  GLU A CG    1 
ATOM   1288 C CD    . GLU B 2 68  ? 11.300  -20.761 48.230  1.00 54.50 ? 68  GLU A CD    1 
ATOM   1289 O OE1   . GLU B 2 68  ? 11.941  -21.811 47.960  1.00 56.05 ? 68  GLU A OE1   1 
ATOM   1290 O OE2   . GLU B 2 68  ? 10.078  -20.616 47.993  1.00 56.37 ? 68  GLU A OE2   1 
ATOM   1291 N N     . GLU B 2 69  ? 12.742  -18.156 52.429  1.00 42.07 ? 69  GLU A N     1 
ATOM   1292 C CA    . GLU B 2 69  ? 11.909  -17.243 53.209  1.00 41.56 ? 69  GLU A CA    1 
ATOM   1293 C C     . GLU B 2 69  ? 12.479  -15.874 53.579  1.00 41.29 ? 69  GLU A C     1 
ATOM   1294 O O     . GLU B 2 69  ? 11.716  -14.937 53.814  1.00 41.78 ? 69  GLU A O     1 
ATOM   1295 C CB    . GLU B 2 69  ? 11.447  -17.931 54.494  1.00 42.48 ? 69  GLU A CB    1 
ATOM   1296 C CG    . GLU B 2 69  ? 10.617  -19.182 54.265  1.00 43.70 ? 69  GLU A CG    1 
ATOM   1297 C CD    . GLU B 2 69  ? 11.460  -20.417 53.969  1.00 43.59 ? 69  GLU A CD    1 
ATOM   1298 O OE1   . GLU B 2 69  ? 10.865  -21.463 53.626  1.00 41.97 ? 69  GLU A OE1   1 
ATOM   1299 O OE2   . GLU B 2 69  ? 12.707  -20.345 54.088  1.00 43.73 ? 69  GLU A OE2   1 
ATOM   1300 N N     . PHE B 2 70  ? 13.802  -15.756 53.655  1.00 40.25 ? 70  PHE A N     1 
ATOM   1301 C CA    . PHE B 2 70  ? 14.426  -14.482 54.018  1.00 38.83 ? 70  PHE A CA    1 
ATOM   1302 C C     . PHE B 2 70  ? 13.907  -13.305 53.203  1.00 39.53 ? 70  PHE A C     1 
ATOM   1303 O O     . PHE B 2 70  ? 13.412  -13.468 52.085  1.00 40.36 ? 70  PHE A O     1 
ATOM   1304 C CB    . PHE B 2 70  ? 15.945  -14.558 53.851  1.00 36.33 ? 70  PHE A CB    1 
ATOM   1305 C CG    . PHE B 2 70  ? 16.634  -15.355 54.912  1.00 33.38 ? 70  PHE A CG    1 
ATOM   1306 C CD1   . PHE B 2 70  ? 15.990  -16.421 55.534  1.00 32.92 ? 70  PHE A CD1   1 
ATOM   1307 C CD2   . PHE B 2 70  ? 17.934  -15.052 55.283  1.00 32.69 ? 70  PHE A CD2   1 
ATOM   1308 C CE1   . PHE B 2 70  ? 16.641  -17.181 56.505  1.00 32.29 ? 70  PHE A CE1   1 
ATOM   1309 C CE2   . PHE B 2 70  ? 18.597  -15.809 56.256  1.00 32.90 ? 70  PHE A CE2   1 
ATOM   1310 C CZ    . PHE B 2 70  ? 17.949  -16.870 56.869  1.00 31.13 ? 70  PHE A CZ    1 
ATOM   1311 N N     . SER B 2 71  ? 14.025  -12.119 53.785  1.00 39.47 ? 71  SER A N     1 
ATOM   1312 C CA    . SER B 2 71  ? 13.601  -10.891 53.142  1.00 39.32 ? 71  SER A CA    1 
ATOM   1313 C C     . SER B 2 71  ? 14.803  -10.415 52.324  1.00 40.25 ? 71  SER A C     1 
ATOM   1314 O O     . SER B 2 71  ? 15.948  -10.763 52.641  1.00 40.40 ? 71  SER A O     1 
ATOM   1315 C CB    . SER B 2 71  ? 13.250  -9.854  54.203  1.00 38.47 ? 71  SER A CB    1 
ATOM   1316 O OG    . SER B 2 71  ? 14.390  -9.553  54.992  1.00 38.44 ? 71  SER A OG    1 
ATOM   1317 N N     . LYS B 2 72  ? 14.557  -9.623  51.283  1.00 40.13 ? 72  LYS A N     1 
ATOM   1318 C CA    . LYS B 2 72  ? 15.656  -9.135  50.453  1.00 39.99 ? 72  LYS A CA    1 
ATOM   1319 C C     . LYS B 2 72  ? 16.632  -8.342  51.321  1.00 38.52 ? 72  LYS A C     1 
ATOM   1320 O O     . LYS B 2 72  ? 17.836  -8.352  51.088  1.00 37.82 ? 72  LYS A O     1 
ATOM   1321 C CB    . LYS B 2 72  ? 15.122  -8.264  49.303  1.00 41.58 ? 72  LYS A CB    1 
ATOM   1322 C CG    . LYS B 2 72  ? 14.900  -6.794  49.659  1.00 45.39 ? 72  LYS A CG    1 
ATOM   1323 C CD    . LYS B 2 72  ? 14.301  -6.012  48.493  1.00 46.98 ? 72  LYS A CD    1 
ATOM   1324 C CE    . LYS B 2 72  ? 14.370  -4.504  48.734  1.00 48.32 ? 72  LYS A CE    1 
ATOM   1325 N NZ    . LYS B 2 72  ? 13.647  -4.071  49.970  1.00 49.55 ? 72  LYS A NZ    1 
ATOM   1326 N N     . GLU B 2 73  ? 16.100  -7.667  52.333  1.00 38.75 ? 73  GLU A N     1 
ATOM   1327 C CA    . GLU B 2 73  ? 16.904  -6.876  53.261  1.00 39.17 ? 73  GLU A CA    1 
ATOM   1328 C C     . GLU B 2 73  ? 17.948  -7.741  53.989  1.00 37.89 ? 73  GLU A C     1 
ATOM   1329 O O     . GLU B 2 73  ? 19.089  -7.323  54.174  1.00 36.92 ? 73  GLU A O     1 
ATOM   1330 C CB    . GLU B 2 73  ? 15.992  -6.200  54.290  1.00 42.13 ? 73  GLU A CB    1 
ATOM   1331 C CG    . GLU B 2 73  ? 14.875  -5.301  53.713  1.00 47.73 ? 73  GLU A CG    1 
ATOM   1332 C CD    . GLU B 2 73  ? 13.814  -6.045  52.869  1.00 51.38 ? 73  GLU A CD    1 
ATOM   1333 O OE1   . GLU B 2 73  ? 13.725  -7.293  52.928  1.00 51.76 ? 73  GLU A OE1   1 
ATOM   1334 O OE2   . GLU B 2 73  ? 13.049  -5.363  52.149  1.00 53.49 ? 73  GLU A OE2   1 
ATOM   1335 N N     . GLU B 2 74  ? 17.557  -8.941  54.411  1.00 36.44 ? 74  GLU A N     1 
ATOM   1336 C CA    . GLU B 2 74  ? 18.491  -9.835  55.096  1.00 36.83 ? 74  GLU A CA    1 
ATOM   1337 C C     . GLU B 2 74  ? 19.618  -10.262 54.169  1.00 36.90 ? 74  GLU A C     1 
ATOM   1338 O O     . GLU B 2 74  ? 20.795  -10.234 54.545  1.00 35.85 ? 74  GLU A O     1 
ATOM   1339 C CB    . GLU B 2 74  ? 17.780  -11.091 55.602  1.00 37.85 ? 74  GLU A CB    1 
ATOM   1340 C CG    . GLU B 2 74  ? 17.257  -11.001 57.015  1.00 39.14 ? 74  GLU A CG    1 
ATOM   1341 C CD    . GLU B 2 74  ? 18.352  -11.059 58.062  1.00 39.62 ? 74  GLU A CD    1 
ATOM   1342 O OE1   . GLU B 2 74  ? 19.060  -12.086 58.136  1.00 39.04 ? 74  GLU A OE1   1 
ATOM   1343 O OE2   . GLU B 2 74  ? 18.496  -10.076 58.820  1.00 41.35 ? 74  GLU A OE2   1 
ATOM   1344 N N     . LEU B 2 75  ? 19.250  -10.679 52.960  1.00 37.18 ? 75  LEU A N     1 
ATOM   1345 C CA    . LEU B 2 75  ? 20.241  -11.107 51.986  1.00 37.38 ? 75  LEU A CA    1 
ATOM   1346 C C     . LEU B 2 75  ? 21.314  -10.036 51.812  1.00 38.26 ? 75  LEU A C     1 
ATOM   1347 O O     . LEU B 2 75  ? 22.509  -10.343 51.818  1.00 38.81 ? 75  LEU A O     1 
ATOM   1348 C CB    . LEU B 2 75  ? 19.584  -11.410 50.635  1.00 36.95 ? 75  LEU A CB    1 
ATOM   1349 C CG    . LEU B 2 75  ? 18.992  -12.807 50.403  1.00 37.76 ? 75  LEU A CG    1 
ATOM   1350 C CD1   . LEU B 2 75  ? 17.863  -13.096 51.382  1.00 37.49 ? 75  LEU A CD1   1 
ATOM   1351 C CD2   . LEU B 2 75  ? 18.480  -12.890 48.971  1.00 36.72 ? 75  LEU A CD2   1 
ATOM   1352 N N     . ARG B 2 76  ? 20.905  -8.777  51.684  1.00 38.24 ? 76  ARG A N     1 
ATOM   1353 C CA    . ARG B 2 76  ? 21.896  -7.734  51.498  1.00 40.04 ? 76  ARG A CA    1 
ATOM   1354 C C     . ARG B 2 76  ? 22.725  -7.469  52.746  1.00 40.59 ? 76  ARG A C     1 
ATOM   1355 O O     . ARG B 2 76  ? 23.947  -7.335  52.662  1.00 40.40 ? 76  ARG A O     1 
ATOM   1356 C CB    . ARG B 2 76  ? 21.250  -6.432  51.007  1.00 41.95 ? 76  ARG A CB    1 
ATOM   1357 C CG    . ARG B 2 76  ? 20.534  -5.595  52.052  1.00 46.06 ? 76  ARG A CG    1 
ATOM   1358 C CD    . ARG B 2 76  ? 20.644  -4.119  51.672  1.00 45.89 ? 76  ARG A CD    1 
ATOM   1359 N NE    . ARG B 2 76  ? 22.043  -3.711  51.666  1.00 46.73 ? 76  ARG A NE    1 
ATOM   1360 C CZ    . ARG B 2 76  ? 22.733  -3.400  52.761  1.00 48.29 ? 76  ARG A CZ    1 
ATOM   1361 N NH1   . ARG B 2 76  ? 22.151  -3.439  53.958  1.00 45.51 ? 76  ARG A NH1   1 
ATOM   1362 N NH2   . ARG B 2 76  ? 24.017  -3.068  52.663  1.00 49.43 ? 76  ARG A NH2   1 
ATOM   1363 N N     . GLU B 2 77  ? 22.072  -7.405  53.904  1.00 41.48 ? 77  GLU A N     1 
ATOM   1364 C CA    . GLU B 2 77  ? 22.780  -7.153  55.155  1.00 42.29 ? 77  GLU A CA    1 
ATOM   1365 C C     . GLU B 2 77  ? 23.731  -8.294  55.540  1.00 41.32 ? 77  GLU A C     1 
ATOM   1366 O O     . GLU B 2 77  ? 24.915  -8.058  55.783  1.00 40.86 ? 77  GLU A O     1 
ATOM   1367 C CB    . GLU B 2 77  ? 21.773  -6.881  56.279  1.00 44.25 ? 77  GLU A CB    1 
ATOM   1368 C CG    . GLU B 2 77  ? 20.959  -5.609  56.049  1.00 49.23 ? 77  GLU A CG    1 
ATOM   1369 C CD    . GLU B 2 77  ? 19.682  -5.524  56.891  1.00 52.55 ? 77  GLU A CD    1 
ATOM   1370 O OE1   . GLU B 2 77  ? 18.924  -4.541  56.696  1.00 53.73 ? 77  GLU A OE1   1 
ATOM   1371 O OE2   . GLU B 2 77  ? 19.433  -6.426  57.732  1.00 52.35 ? 77  GLU A OE2   1 
ATOM   1372 N N     . ARG B 2 78  ? 23.235  -9.526  55.594  1.00 40.92 ? 78  ARG A N     1 
ATOM   1373 C CA    . ARG B 2 78  ? 24.109  -10.642 55.953  1.00 40.83 ? 78  ARG A CA    1 
ATOM   1374 C C     . ARG B 2 78  ? 25.146  -10.861 54.853  1.00 40.31 ? 78  ARG A C     1 
ATOM   1375 O O     . ARG B 2 78  ? 26.270  -11.291 55.122  1.00 40.48 ? 78  ARG A O     1 
ATOM   1376 C CB    . ARG B 2 78  ? 23.299  -11.922 56.188  1.00 41.31 ? 78  ARG A CB    1 
ATOM   1377 C CG    . ARG B 2 78  ? 22.324  -11.846 57.367  1.00 43.27 ? 78  ARG A CG    1 
ATOM   1378 C CD    . ARG B 2 78  ? 23.008  -11.725 58.736  1.00 45.88 ? 78  ARG A CD    1 
ATOM   1379 N NE    . ARG B 2 78  ? 24.468  -11.606 58.664  1.00 50.41 ? 78  ARG A NE    1 
ATOM   1380 C CZ    . ARG B 2 78  ? 25.312  -12.614 58.421  1.00 51.99 ? 78  ARG A CZ    1 
ATOM   1381 N NH1   . ARG B 2 78  ? 24.857  -13.850 58.223  1.00 51.68 ? 78  ARG A NH1   1 
ATOM   1382 N NH2   . ARG B 2 78  ? 26.621  -12.383 58.371  1.00 51.00 ? 78  ARG A NH2   1 
ATOM   1383 N N     . GLY B 2 79  ? 24.761  -10.557 53.615  1.00 39.08 ? 79  GLY A N     1 
ATOM   1384 C CA    . GLY B 2 79  ? 25.676  -10.701 52.499  1.00 37.01 ? 79  GLY A CA    1 
ATOM   1385 C C     . GLY B 2 79  ? 26.782  -9.661  52.592  1.00 36.10 ? 79  GLY A C     1 
ATOM   1386 O O     . GLY B 2 79  ? 27.943  -9.940  52.287  1.00 35.65 ? 79  GLY A O     1 
ATOM   1387 N N     . LEU B 2 80  ? 26.422  -8.454  53.017  1.00 34.46 ? 80  LEU A N     1 
ATOM   1388 C CA    . LEU B 2 80  ? 27.395  -7.382  53.153  1.00 33.81 ? 80  LEU A CA    1 
ATOM   1389 C C     . LEU B 2 80  ? 28.317  -7.668  54.318  1.00 34.32 ? 80  LEU A C     1 
ATOM   1390 O O     . LEU B 2 80  ? 29.454  -7.209  54.348  1.00 35.15 ? 80  LEU A O     1 
ATOM   1391 C CB    . LEU B 2 80  ? 26.697  -6.041  53.382  1.00 32.78 ? 80  LEU A CB    1 
ATOM   1392 C CG    . LEU B 2 80  ? 27.583  -4.882  53.861  1.00 31.73 ? 80  LEU A CG    1 
ATOM   1393 C CD1   . LEU B 2 80  ? 28.705  -4.607  52.868  1.00 29.38 ? 80  LEU A CD1   1 
ATOM   1394 C CD2   . LEU B 2 80  ? 26.717  -3.654  54.047  1.00 31.55 ? 80  LEU A CD2   1 
ATOM   1395 N N     . GLU B 2 81  ? 27.822  -8.425  55.286  1.00 35.14 ? 81  GLU A N     1 
ATOM   1396 C CA    . GLU B 2 81  ? 28.626  -8.750  56.449  1.00 36.23 ? 81  GLU A CA    1 
ATOM   1397 C C     . GLU B 2 81  ? 29.648  -9.809  56.071  1.00 35.02 ? 81  GLU A C     1 
ATOM   1398 O O     . GLU B 2 81  ? 30.820  -9.697  56.421  1.00 35.25 ? 81  GLU A O     1 
ATOM   1399 C CB    . GLU B 2 81  ? 27.727  -9.241  57.588  1.00 39.81 ? 81  GLU A CB    1 
ATOM   1400 C CG    . GLU B 2 81  ? 27.808  -8.406  58.857  1.00 45.15 ? 81  GLU A CG    1 
ATOM   1401 C CD    . GLU B 2 81  ? 27.803  -6.903  58.581  1.00 49.16 ? 81  GLU A CD    1 
ATOM   1402 O OE1   . GLU B 2 81  ? 28.865  -6.357  58.201  1.00 50.89 ? 81  GLU A OE1   1 
ATOM   1403 O OE2   . GLU B 2 81  ? 26.736  -6.268  58.739  1.00 51.64 ? 81  GLU A OE2   1 
ATOM   1404 N N     . ILE B 2 82  ? 29.197  -10.824 55.336  1.00 33.63 ? 82  ILE A N     1 
ATOM   1405 C CA    . ILE B 2 82  ? 30.060  -11.919 54.900  1.00 31.69 ? 82  ILE A CA    1 
ATOM   1406 C C     . ILE B 2 82  ? 31.162  -11.478 53.926  1.00 32.37 ? 82  ILE A C     1 
ATOM   1407 O O     . ILE B 2 82  ? 32.339  -11.795 54.119  1.00 31.25 ? 82  ILE A O     1 
ATOM   1408 C CB    . ILE B 2 82  ? 29.230  -13.038 54.236  1.00 29.64 ? 82  ILE A CB    1 
ATOM   1409 C CG1   . ILE B 2 82  ? 28.256  -13.643 55.252  1.00 28.80 ? 82  ILE A CG1   1 
ATOM   1410 C CG2   . ILE B 2 82  ? 30.148  -14.113 53.701  1.00 29.08 ? 82  ILE A CG2   1 
ATOM   1411 C CD1   . ILE B 2 82  ? 27.231  -14.609 54.658  1.00 24.16 ? 82  ILE A CD1   1 
ATOM   1412 N N     . GLY B 2 83  ? 30.783  -10.749 52.881  1.00 32.66 ? 83  GLY A N     1 
ATOM   1413 C CA    . GLY B 2 83  ? 31.771  -10.312 51.916  1.00 33.64 ? 83  GLY A CA    1 
ATOM   1414 C C     . GLY B 2 83  ? 32.826  -9.458  52.585  1.00 34.58 ? 83  GLY A C     1 
ATOM   1415 O O     . GLY B 2 83  ? 34.017  -9.526  52.259  1.00 33.86 ? 83  GLY A O     1 
ATOM   1416 N N     . LYS B 2 84  ? 32.368  -8.656  53.538  1.00 34.92 ? 84  LYS A N     1 
ATOM   1417 C CA    . LYS B 2 84  ? 33.228  -7.753  54.288  1.00 36.37 ? 84  LYS A CA    1 
ATOM   1418 C C     . LYS B 2 84  ? 34.288  -8.534  55.074  1.00 35.70 ? 84  LYS A C     1 
ATOM   1419 O O     . LYS B 2 84  ? 35.462  -8.156  55.113  1.00 36.63 ? 84  LYS A O     1 
ATOM   1420 C CB    . LYS B 2 84  ? 32.360  -6.937  55.251  1.00 38.55 ? 84  LYS A CB    1 
ATOM   1421 C CG    . LYS B 2 84  ? 32.950  -5.622  55.701  1.00 42.22 ? 84  LYS A CG    1 
ATOM   1422 C CD    . LYS B 2 84  ? 32.121  -5.011  56.835  1.00 46.31 ? 84  LYS A CD    1 
ATOM   1423 C CE    . LYS B 2 84  ? 30.731  -4.575  56.381  1.00 47.92 ? 84  LYS A CE    1 
ATOM   1424 N NZ    . LYS B 2 84  ? 30.788  -3.409  55.455  1.00 49.78 ? 84  LYS A NZ    1 
ATOM   1425 N N     . ALA B 2 85  ? 33.864  -9.637  55.679  1.00 34.30 ? 85  ALA A N     1 
ATOM   1426 C CA    . ALA B 2 85  ? 34.738  -10.464 56.493  1.00 33.54 ? 85  ALA A CA    1 
ATOM   1427 C C     . ALA B 2 85  ? 35.672  -11.397 55.724  1.00 34.93 ? 85  ALA A C     1 
ATOM   1428 O O     . ALA B 2 85  ? 36.732  -11.779 56.228  1.00 34.84 ? 85  ALA A O     1 
ATOM   1429 C CB    . ALA B 2 85  ? 33.893  -11.274 57.449  1.00 32.82 ? 85  ALA A CB    1 
ATOM   1430 N N     . VAL B 2 86  ? 35.297  -11.752 54.503  1.00 35.68 ? 86  VAL A N     1 
ATOM   1431 C CA    . VAL B 2 86  ? 36.095  -12.683 53.717  1.00 36.16 ? 86  VAL A CA    1 
ATOM   1432 C C     . VAL B 2 86  ? 37.017  -12.087 52.648  1.00 35.86 ? 86  VAL A C     1 
ATOM   1433 O O     . VAL B 2 86  ? 37.851  -12.790 52.076  1.00 36.13 ? 86  VAL A O     1 
ATOM   1434 C CB    . VAL B 2 86  ? 35.166  -13.718 53.049  1.00 37.12 ? 86  VAL A CB    1 
ATOM   1435 C CG1   . VAL B 2 86  ? 34.326  -13.048 51.973  1.00 37.60 ? 86  VAL A CG1   1 
ATOM   1436 C CG2   . VAL B 2 86  ? 35.978  -14.840 52.466  1.00 39.25 ? 86  VAL A CG2   1 
ATOM   1437 N N     . LEU B 2 87  ? 36.888  -10.794 52.389  1.00 35.72 ? 87  LEU A N     1 
ATOM   1438 C CA    . LEU B 2 87  ? 37.701  -10.154 51.363  1.00 34.51 ? 87  LEU A CA    1 
ATOM   1439 C C     . LEU B 2 87  ? 38.886  -9.379  51.917  1.00 34.39 ? 87  LEU A C     1 
ATOM   1440 O O     . LEU B 2 87  ? 38.860  -8.941  53.056  1.00 34.56 ? 87  LEU A O     1 
ATOM   1441 C CB    . LEU B 2 87  ? 36.818  -9.213  50.543  1.00 34.01 ? 87  LEU A CB    1 
ATOM   1442 C CG    . LEU B 2 87  ? 35.654  -9.880  49.810  1.00 33.14 ? 87  LEU A CG    1 
ATOM   1443 C CD1   . LEU B 2 87  ? 34.636  -8.839  49.381  1.00 32.50 ? 87  LEU A CD1   1 
ATOM   1444 C CD2   . LEU B 2 87  ? 36.189  -10.650 48.612  1.00 32.71 ? 87  LEU A CD2   1 
ATOM   1445 N N     . ASP B 2 88  ? 39.927  -9.216  51.105  1.00 34.63 ? 88  ASP A N     1 
ATOM   1446 C CA    . ASP B 2 88  ? 41.095  -8.448  51.517  1.00 35.73 ? 88  ASP A CA    1 
ATOM   1447 C C     . ASP B 2 88  ? 40.722  -6.960  51.471  1.00 37.53 ? 88  ASP A C     1 
ATOM   1448 O O     . ASP B 2 88  ? 41.134  -6.185  52.331  1.00 38.56 ? 88  ASP A O     1 
ATOM   1449 C CB    . ASP B 2 88  ? 42.283  -8.714  50.585  1.00 34.64 ? 88  ASP A CB    1 
ATOM   1450 C CG    . ASP B 2 88  ? 42.935  -10.070 50.826  1.00 35.05 ? 88  ASP A CG    1 
ATOM   1451 O OD1   . ASP B 2 88  ? 42.643  -10.697 51.866  1.00 33.76 ? 88  ASP A OD1   1 
ATOM   1452 O OD2   . ASP B 2 88  ? 43.754  -10.504 49.979  1.00 34.20 ? 88  ASP A OD2   1 
ATOM   1453 N N     . SER B 2 89  ? 39.937  -6.583  50.458  1.00 38.54 ? 89  SER A N     1 
ATOM   1454 C CA    . SER B 2 89  ? 39.453  -5.212  50.251  1.00 39.10 ? 89  SER A CA    1 
ATOM   1455 C C     . SER B 2 89  ? 38.055  -5.360  49.674  1.00 39.42 ? 89  SER A C     1 
ATOM   1456 O O     . SER B 2 89  ? 37.825  -6.234  48.849  1.00 39.61 ? 89  SER A O     1 
ATOM   1457 C CB    . SER B 2 89  ? 40.314  -4.480  49.231  1.00 39.66 ? 89  SER A CB    1 
ATOM   1458 O OG    . SER B 2 89  ? 41.683  -4.704  49.485  1.00 42.89 ? 89  SER A OG    1 
ATOM   1459 N N     . TYR B 2 90  ? 37.121  -4.515  50.089  1.00 40.22 ? 90  TYR A N     1 
ATOM   1460 C CA    . TYR B 2 90  ? 35.764  -4.631  49.575  1.00 40.92 ? 90  TYR A CA    1 
ATOM   1461 C C     . TYR B 2 90  ? 35.194  -3.318  49.080  1.00 41.67 ? 90  TYR A C     1 
ATOM   1462 O O     . TYR B 2 90  ? 35.689  -2.239  49.398  1.00 42.82 ? 90  TYR A O     1 
ATOM   1463 C CB    . TYR B 2 90  ? 34.840  -5.214  50.637  1.00 41.01 ? 90  TYR A CB    1 
ATOM   1464 C CG    . TYR B 2 90  ? 34.351  -4.207  51.637  1.00 40.52 ? 90  TYR A CG    1 
ATOM   1465 C CD1   . TYR B 2 90  ? 33.110  -3.605  51.486  1.00 40.29 ? 90  TYR A CD1   1 
ATOM   1466 C CD2   . TYR B 2 90  ? 35.124  -3.868  52.749  1.00 41.06 ? 90  TYR A CD2   1 
ATOM   1467 C CE1   . TYR B 2 90  ? 32.641  -2.693  52.416  1.00 42.05 ? 90  TYR A CE1   1 
ATOM   1468 C CE2   . TYR B 2 90  ? 34.668  -2.952  53.689  1.00 41.45 ? 90  TYR A CE2   1 
ATOM   1469 C CZ    . TYR B 2 90  ? 33.423  -2.369  53.518  1.00 42.41 ? 90  TYR A CZ    1 
ATOM   1470 O OH    . TYR B 2 90  ? 32.950  -1.471  54.448  1.00 43.02 ? 90  TYR A OH    1 
ATOM   1471 N N     . GLU B 2 91  ? 34.114  -3.435  48.322  1.00 41.99 ? 91  GLU A N     1 
ATOM   1472 C CA    . GLU B 2 91  ? 33.460  -2.296  47.707  1.00 40.93 ? 91  GLU A CA    1 
ATOM   1473 C C     . GLU B 2 91  ? 32.051  -2.739  47.356  1.00 39.74 ? 91  GLU A C     1 
ATOM   1474 O O     . GLU B 2 91  ? 31.865  -3.805  46.776  1.00 40.82 ? 91  GLU A O     1 
ATOM   1475 C CB    . GLU B 2 91  ? 34.247  -1.937  46.447  1.00 41.73 ? 91  GLU A CB    1 
ATOM   1476 C CG    . GLU B 2 91  ? 33.493  -1.221  45.349  1.00 43.99 ? 91  GLU A CG    1 
ATOM   1477 C CD    . GLU B 2 91  ? 34.228  -1.325  44.021  1.00 45.30 ? 91  GLU A CD    1 
ATOM   1478 O OE1   . GLU B 2 91  ? 35.470  -1.175  44.021  1.00 47.03 ? 91  GLU A OE1   1 
ATOM   1479 O OE2   . GLU B 2 91  ? 33.574  -1.554  42.981  1.00 45.23 ? 91  GLU A OE2   1 
ATOM   1480 N N     . ILE B 2 92  ? 31.058  -1.935  47.712  1.00 38.29 ? 92  ILE A N     1 
ATOM   1481 C CA    . ILE B 2 92  ? 29.681  -2.287  47.407  1.00 36.32 ? 92  ILE A CA    1 
ATOM   1482 C C     . ILE B 2 92  ? 29.350  -1.990  45.952  1.00 36.01 ? 92  ILE A C     1 
ATOM   1483 O O     . ILE B 2 92  ? 29.702  -0.945  45.418  1.00 35.76 ? 92  ILE A O     1 
ATOM   1484 C CB    . ILE B 2 92  ? 28.686  -1.538  48.321  1.00 36.53 ? 92  ILE A CB    1 
ATOM   1485 C CG1   . ILE B 2 92  ? 28.898  -1.967  49.777  1.00 35.66 ? 92  ILE A CG1   1 
ATOM   1486 C CG2   . ILE B 2 92  ? 27.253  -1.832  47.886  1.00 35.36 ? 92  ILE A CG2   1 
ATOM   1487 C CD1   . ILE B 2 92  ? 27.948  -1.315  50.761  1.00 37.23 ? 92  ILE A CD1   1 
ATOM   1488 N N     . ARG B 2 93  ? 28.682  -2.942  45.317  1.00 35.95 ? 93  ARG A N     1 
ATOM   1489 C CA    . ARG B 2 93  ? 28.279  -2.836  43.927  1.00 35.14 ? 93  ARG A CA    1 
ATOM   1490 C C     . ARG B 2 93  ? 26.769  -2.870  43.935  1.00 35.01 ? 93  ARG A C     1 
ATOM   1491 O O     . ARG B 2 93  ? 26.165  -3.311  44.904  1.00 34.54 ? 93  ARG A O     1 
ATOM   1492 C CB    . ARG B 2 93  ? 28.798  -4.036  43.135  1.00 35.49 ? 93  ARG A CB    1 
ATOM   1493 C CG    . ARG B 2 93  ? 29.794  -3.718  42.030  1.00 35.89 ? 93  ARG A CG    1 
ATOM   1494 C CD    . ARG B 2 93  ? 31.055  -3.085  42.567  1.00 36.48 ? 93  ARG A CD    1 
ATOM   1495 N NE    . ARG B 2 93  ? 32.267  -3.753  42.096  1.00 39.48 ? 93  ARG A NE    1 
ATOM   1496 C CZ    . ARG B 2 93  ? 32.558  -3.993  40.820  1.00 41.19 ? 93  ARG A CZ    1 
ATOM   1497 N NH1   . ARG B 2 93  ? 31.721  -3.627  39.859  1.00 45.20 ? 93  ARG A NH1   1 
ATOM   1498 N NH2   . ARG B 2 93  ? 33.702  -4.581  40.496  1.00 40.30 ? 93  ARG A NH2   1 
ATOM   1499 N N     . TYR B 2 94  ? 26.154  -2.415  42.853  1.00 36.17 ? 94  TYR A N     1 
ATOM   1500 C CA    . TYR B 2 94  ? 24.704  -2.419  42.767  1.00 36.33 ? 94  TYR A CA    1 
ATOM   1501 C C     . TYR B 2 94  ? 24.240  -2.983  41.442  1.00 36.35 ? 94  TYR A C     1 
ATOM   1502 O O     . TYR B 2 94  ? 24.663  -2.534  40.384  1.00 36.98 ? 94  TYR A O     1 
ATOM   1503 C CB    . TYR B 2 94  ? 24.148  -1.002  42.926  1.00 36.50 ? 94  TYR A CB    1 
ATOM   1504 C CG    . TYR B 2 94  ? 24.547  -0.316  44.213  1.00 36.93 ? 94  TYR A CG    1 
ATOM   1505 C CD1   . TYR B 2 94  ? 25.803  0.271   44.353  1.00 37.79 ? 94  TYR A CD1   1 
ATOM   1506 C CD2   . TYR B 2 94  ? 23.680  -0.279  45.300  1.00 37.27 ? 94  TYR A CD2   1 
ATOM   1507 C CE1   . TYR B 2 94  ? 26.186  0.875   45.544  1.00 39.41 ? 94  TYR A CE1   1 
ATOM   1508 C CE2   . TYR B 2 94  ? 24.049  0.322   46.499  1.00 38.40 ? 94  TYR A CE2   1 
ATOM   1509 C CZ    . TYR B 2 94  ? 25.303  0.897   46.618  1.00 39.80 ? 94  TYR A CZ    1 
ATOM   1510 O OH    . TYR B 2 94  ? 25.681  1.484   47.810  1.00 40.75 ? 94  TYR A OH    1 
ATOM   1511 N N     . ALA B 2 95  ? 23.384  -3.988  41.503  1.00 37.49 ? 95  ALA A N     1 
ATOM   1512 C CA    . ALA B 2 95  ? 22.820  -4.576  40.301  1.00 40.23 ? 95  ALA A CA    1 
ATOM   1513 C C     . ALA B 2 95  ? 21.320  -4.392  40.514  1.00 42.07 ? 95  ALA A C     1 
ATOM   1514 O O     . ALA B 2 95  ? 20.853  -3.283  40.774  1.00 41.65 ? 95  ALA A O     1 
ATOM   1515 C CB    . ALA B 2 95  ? 23.181  -6.054  40.215  1.00 39.26 ? 95  ALA A CB    1 
ATOM   1516 N N     . GLU B 2 96  ? 20.570  -5.482  40.421  1.00 44.61 ? 96  GLU A N     1 
ATOM   1517 C CA    . GLU B 2 96  ? 19.131  -5.448  40.644  1.00 45.67 ? 96  GLU A CA    1 
ATOM   1518 C C     . GLU B 2 96  ? 19.018  -5.082  42.124  1.00 44.63 ? 96  GLU A C     1 
ATOM   1519 O O     . GLU B 2 96  ? 18.093  -4.391  42.540  1.00 44.79 ? 96  GLU A O     1 
ATOM   1520 C CB    . GLU B 2 96  ? 18.576  -6.843  40.385  1.00 50.26 ? 96  GLU A CB    1 
ATOM   1521 C CG    . GLU B 2 96  ? 17.143  -6.940  39.925  1.00 54.82 ? 96  GLU A CG    1 
ATOM   1522 C CD    . GLU B 2 96  ? 16.929  -8.203  39.096  1.00 58.68 ? 96  GLU A CD    1 
ATOM   1523 O OE1   . GLU B 2 96  ? 17.650  -9.197  39.341  1.00 60.00 ? 96  GLU A OE1   1 
ATOM   1524 O OE2   . GLU B 2 96  ? 16.049  -8.209  38.207  1.00 60.80 ? 96  GLU A OE2   1 
ATOM   1525 N N     . HIS B 2 97  ? 20.002  -5.556  42.893  1.00 42.61 ? 97  HIS A N     1 
ATOM   1526 C CA    . HIS B 2 97  ? 20.129  -5.334  44.336  1.00 40.12 ? 97  HIS A CA    1 
ATOM   1527 C C     . HIS B 2 97  ? 21.628  -5.244  44.593  1.00 38.12 ? 97  HIS A C     1 
ATOM   1528 O O     . HIS B 2 97  ? 22.416  -5.715  43.780  1.00 39.28 ? 97  HIS A O     1 
ATOM   1529 C CB    . HIS B 2 97  ? 19.549  -6.514  45.115  1.00 39.74 ? 97  HIS A CB    1 
ATOM   1530 C CG    . HIS B 2 97  ? 18.097  -6.751  44.850  1.00 40.17 ? 97  HIS A CG    1 
ATOM   1531 N ND1   . HIS B 2 97  ? 17.110  -5.898  45.297  1.00 40.12 ? 97  HIS A ND1   1 
ATOM   1532 C CD2   . HIS B 2 97  ? 17.466  -7.720  44.145  1.00 40.41 ? 97  HIS A CD2   1 
ATOM   1533 C CE1   . HIS B 2 97  ? 15.935  -6.331  44.877  1.00 39.42 ? 97  HIS A CE1   1 
ATOM   1534 N NE2   . HIS B 2 97  ? 16.124  -7.434  44.175  1.00 40.01 ? 97  HIS A NE2   1 
ATOM   1535 N N     . PRO B 2 98  ? 22.046  -4.651  45.723  1.00 36.05 ? 98  PRO A N     1 
ATOM   1536 C CA    . PRO B 2 98  ? 23.483  -4.545  45.993  1.00 34.57 ? 98  PRO A CA    1 
ATOM   1537 C C     . PRO B 2 98  ? 24.167  -5.846  46.405  1.00 34.11 ? 98  PRO A C     1 
ATOM   1538 O O     . PRO B 2 98  ? 23.530  -6.754  46.929  1.00 35.07 ? 98  PRO A O     1 
ATOM   1539 C CB    . PRO B 2 98  ? 23.549  -3.487  47.100  1.00 33.23 ? 98  PRO A CB    1 
ATOM   1540 C CG    . PRO B 2 98  ? 22.308  -3.735  47.864  1.00 33.78 ? 98  PRO A CG    1 
ATOM   1541 C CD    . PRO B 2 98  ? 21.265  -3.968  46.773  1.00 35.24 ? 98  PRO A CD    1 
ATOM   1542 N N     . TYR B 2 99  ? 25.470  -5.920  46.149  1.00 32.70 ? 99  TYR A N     1 
ATOM   1543 C CA    . TYR B 2 99  ? 26.284  -7.067  46.518  1.00 32.43 ? 99  TYR A CA    1 
ATOM   1544 C C     . TYR B 2 99  ? 27.671  -6.544  46.848  1.00 32.21 ? 99  TYR A C     1 
ATOM   1545 O O     . TYR B 2 99  ? 27.860  -5.337  46.961  1.00 33.65 ? 99  TYR A O     1 
ATOM   1546 C CB    . TYR B 2 99  ? 26.347  -8.095  45.384  1.00 33.15 ? 99  TYR A CB    1 
ATOM   1547 C CG    . TYR B 2 99  ? 26.816  -7.565  44.057  1.00 31.99 ? 99  TYR A CG    1 
ATOM   1548 C CD1   . TYR B 2 99  ? 28.130  -7.759  43.628  1.00 31.54 ? 99  TYR A CD1   1 
ATOM   1549 C CD2   . TYR B 2 99  ? 25.931  -6.906  43.203  1.00 31.72 ? 99  TYR A CD2   1 
ATOM   1550 C CE1   . TYR B 2 99  ? 28.552  -7.313  42.370  1.00 32.14 ? 99  TYR A CE1   1 
ATOM   1551 C CE2   . TYR B 2 99  ? 26.340  -6.455  41.948  1.00 33.30 ? 99  TYR A CE2   1 
ATOM   1552 C CZ    . TYR B 2 99  ? 27.650  -6.663  41.538  1.00 32.93 ? 99  TYR A CZ    1 
ATOM   1553 O OH    . TYR B 2 99  ? 28.040  -6.210  40.300  1.00 33.06 ? 99  TYR A OH    1 
ATOM   1554 N N     . VAL B 2 100 ? 28.645  -7.428  47.002  1.00 30.72 ? 100 VAL A N     1 
ATOM   1555 C CA    . VAL B 2 100 ? 29.979  -6.963  47.343  1.00 30.38 ? 100 VAL A CA    1 
ATOM   1556 C C     . VAL B 2 100 ? 31.041  -7.395  46.341  1.00 30.16 ? 100 VAL A C     1 
ATOM   1557 O O     . VAL B 2 100 ? 31.002  -8.507  45.811  1.00 29.15 ? 100 VAL A O     1 
ATOM   1558 C CB    . VAL B 2 100 ? 30.409  -7.472  48.746  1.00 31.12 ? 100 VAL A CB    1 
ATOM   1559 C CG1   . VAL B 2 100 ? 31.786  -6.921  49.097  1.00 29.60 ? 100 VAL A CG1   1 
ATOM   1560 C CG2   . VAL B 2 100 ? 29.379  -7.071  49.793  1.00 30.16 ? 100 VAL A CG2   1 
ATOM   1561 N N     . HIS B 2 101 ? 31.990  -6.504  46.085  1.00 29.91 ? 101 HIS A N     1 
ATOM   1562 C CA    . HIS B 2 101 ? 33.080  -6.811  45.181  1.00 30.74 ? 101 HIS A CA    1 
ATOM   1563 C C     . HIS B 2 101 ? 34.357  -6.584  45.964  1.00 31.82 ? 101 HIS A C     1 
ATOM   1564 O O     . HIS B 2 101 ? 34.408  -5.730  46.846  1.00 32.85 ? 101 HIS A O     1 
ATOM   1565 C CB    . HIS B 2 101 ? 33.060  -5.905  43.952  1.00 30.44 ? 101 HIS A CB    1 
ATOM   1566 C CG    . HIS B 2 101 ? 34.131  -6.226  42.957  1.00 29.96 ? 101 HIS A CG    1 
ATOM   1567 N ND1   . HIS B 2 101 ? 33.997  -7.222  42.013  1.00 29.66 ? 101 HIS A ND1   1 
ATOM   1568 C CD2   . HIS B 2 101 ? 35.379  -5.726  42.797  1.00 28.61 ? 101 HIS A CD2   1 
ATOM   1569 C CE1   . HIS B 2 101 ? 35.114  -7.321  41.317  1.00 28.56 ? 101 HIS A CE1   1 
ATOM   1570 N NE2   . HIS B 2 101 ? 35.970  -6.423  41.774  1.00 28.35 ? 101 HIS A NE2   1 
ATOM   1571 N N     . GLY B 2 102 ? 35.390  -7.355  45.655  1.00 32.44 ? 102 GLY A N     1 
ATOM   1572 C CA    . GLY B 2 102 ? 36.636  -7.197  46.376  1.00 31.94 ? 102 GLY A CA    1 
ATOM   1573 C C     . GLY B 2 102 ? 37.772  -7.971  45.758  1.00 32.02 ? 102 GLY A C     1 
ATOM   1574 O O     . GLY B 2 102 ? 37.706  -8.360  44.591  1.00 32.14 ? 102 GLY A O     1 
ATOM   1575 N N     . VAL B 2 103 ? 38.815  -8.191  46.553  1.00 32.91 ? 103 VAL A N     1 
ATOM   1576 C CA    . VAL B 2 103 ? 40.003  -8.913  46.115  1.00 33.21 ? 103 VAL A CA    1 
ATOM   1577 C C     . VAL B 2 103 ? 40.425  -9.933  47.167  1.00 34.51 ? 103 VAL A C     1 
ATOM   1578 O O     . VAL B 2 103 ? 40.174  -9.759  48.362  1.00 34.87 ? 103 VAL A O     1 
ATOM   1579 C CB    . VAL B 2 103 ? 41.184  -7.942  45.881  1.00 33.44 ? 103 VAL A CB    1 
ATOM   1580 C CG1   . VAL B 2 103 ? 42.354  -8.681  45.244  1.00 33.71 ? 103 VAL A CG1   1 
ATOM   1581 C CG2   . VAL B 2 103 ? 40.742  -6.780  45.002  1.00 32.95 ? 103 VAL A CG2   1 
ATOM   1582 N N     . VAL B 2 104 ? 41.065  -11.004 46.707  1.00 35.78 ? 104 VAL A N     1 
ATOM   1583 C CA    . VAL B 2 104 ? 41.559  -12.071 47.574  1.00 35.43 ? 104 VAL A CA    1 
ATOM   1584 C C     . VAL B 2 104 ? 42.835  -12.604 46.920  1.00 36.06 ? 104 VAL A C     1 
ATOM   1585 O O     . VAL B 2 104 ? 42.804  -13.111 45.800  1.00 36.82 ? 104 VAL A O     1 
ATOM   1586 C CB    . VAL B 2 104 ? 40.516  -13.210 47.716  1.00 34.76 ? 104 VAL A CB    1 
ATOM   1587 C CG1   . VAL B 2 104 ? 41.111  -14.367 48.481  1.00 36.18 ? 104 VAL A CG1   1 
ATOM   1588 C CG2   . VAL B 2 104 ? 39.275  -12.700 48.441  1.00 34.22 ? 104 VAL A CG2   1 
ATOM   1589 N N     . LYS B 2 105 ? 43.957  -12.478 47.616  1.00 36.76 ? 105 LYS A N     1 
ATOM   1590 C CA    . LYS B 2 105 ? 45.238  -12.924 47.083  1.00 37.16 ? 105 LYS A CA    1 
ATOM   1591 C C     . LYS B 2 105 ? 45.400  -12.485 45.636  1.00 36.68 ? 105 LYS A C     1 
ATOM   1592 O O     . LYS B 2 105 ? 45.670  -13.297 44.748  1.00 37.01 ? 105 LYS A O     1 
ATOM   1593 C CB    . LYS B 2 105 ? 45.380  -14.449 47.195  1.00 38.68 ? 105 LYS A CB    1 
ATOM   1594 C CG    . LYS B 2 105 ? 45.564  -14.935 48.630  1.00 41.24 ? 105 LYS A CG    1 
ATOM   1595 C CD    . LYS B 2 105 ? 45.992  -16.396 48.708  1.00 42.08 ? 105 LYS A CD    1 
ATOM   1596 C CE    . LYS B 2 105 ? 47.435  -16.592 48.280  1.00 42.80 ? 105 LYS A CE    1 
ATOM   1597 N NZ    . LYS B 2 105 ? 47.873  -18.008 48.470  1.00 44.47 ? 105 LYS A NZ    1 
ATOM   1598 N N     . GLY B 2 106 ? 45.205  -11.193 45.403  1.00 36.31 ? 106 GLY A N     1 
ATOM   1599 C CA    . GLY B 2 106 ? 45.355  -10.639 44.069  1.00 35.07 ? 106 GLY A CA    1 
ATOM   1600 C C     . GLY B 2 106 ? 44.291  -10.847 42.998  1.00 34.74 ? 106 GLY A C     1 
ATOM   1601 O O     . GLY B 2 106 ? 44.507  -10.415 41.863  1.00 34.98 ? 106 GLY A O     1 
ATOM   1602 N N     . VAL B 2 107 ? 43.159  -11.481 43.304  1.00 33.32 ? 107 VAL A N     1 
ATOM   1603 C CA    . VAL B 2 107 ? 42.156  -11.668 42.262  1.00 33.38 ? 107 VAL A CA    1 
ATOM   1604 C C     . VAL B 2 107 ? 40.743  -11.159 42.575  1.00 34.11 ? 107 VAL A C     1 
ATOM   1605 O O     . VAL B 2 107 ? 40.224  -11.296 43.686  1.00 34.25 ? 107 VAL A O     1 
ATOM   1606 C CB    . VAL B 2 107 ? 42.085  -13.157 41.783  1.00 32.58 ? 107 VAL A CB    1 
ATOM   1607 C CG1   . VAL B 2 107 ? 43.399  -13.858 42.060  1.00 31.20 ? 107 VAL A CG1   1 
ATOM   1608 C CG2   . VAL B 2 107 ? 40.927  -13.869 42.410  1.00 32.36 ? 107 VAL A CG2   1 
ATOM   1609 N N     . GLU B 2 108 ? 40.140  -10.562 41.555  1.00 34.03 ? 108 GLU A N     1 
ATOM   1610 C CA    . GLU B 2 108 ? 38.805  -9.994  41.632  1.00 35.05 ? 108 GLU A CA    1 
ATOM   1611 C C     . GLU B 2 108 ? 37.760  -11.012 42.065  1.00 34.61 ? 108 GLU A C     1 
ATOM   1612 O O     . GLU B 2 108 ? 37.682  -12.109 41.506  1.00 34.82 ? 108 GLU A O     1 
ATOM   1613 C CB    . GLU B 2 108 ? 38.419  -9.428  40.265  1.00 36.56 ? 108 GLU A CB    1 
ATOM   1614 C CG    . GLU B 2 108 ? 39.474  -8.527  39.658  1.00 37.51 ? 108 GLU A CG    1 
ATOM   1615 C CD    . GLU B 2 108 ? 39.707  -7.289  40.487  1.00 39.45 ? 108 GLU A CD    1 
ATOM   1616 O OE1   . GLU B 2 108 ? 38.732  -6.534  40.703  1.00 39.54 ? 108 GLU A OE1   1 
ATOM   1617 O OE2   . GLU B 2 108 ? 40.863  -7.072  40.923  1.00 40.88 ? 108 GLU A OE2   1 
ATOM   1618 N N     . VAL B 2 109 ? 36.944  -10.636 43.045  1.00 33.30 ? 109 VAL A N     1 
ATOM   1619 C CA    . VAL B 2 109 ? 35.895  -11.520 43.534  1.00 32.48 ? 109 VAL A CA    1 
ATOM   1620 C C     . VAL B 2 109 ? 34.561  -10.807 43.742  1.00 32.49 ? 109 VAL A C     1 
ATOM   1621 O O     . VAL B 2 109 ? 34.516  -9.651  44.178  1.00 32.59 ? 109 VAL A O     1 
ATOM   1622 C CB    . VAL B 2 109 ? 36.290  -12.171 44.880  1.00 32.01 ? 109 VAL A CB    1 
ATOM   1623 C CG1   . VAL B 2 109 ? 35.128  -12.994 45.418  1.00 31.01 ? 109 VAL A CG1   1 
ATOM   1624 C CG2   . VAL B 2 109 ? 37.527  -13.046 44.699  1.00 31.87 ? 109 VAL A CG2   1 
ATOM   1625 N N     . ASP B 2 110 ? 33.476  -11.505 43.417  1.00 31.49 ? 110 ASP A N     1 
ATOM   1626 C CA    . ASP B 2 110 ? 32.136  -10.974 43.622  1.00 29.66 ? 110 ASP A CA    1 
ATOM   1627 C C     . ASP B 2 110 ? 31.474  -11.868 44.659  1.00 28.58 ? 110 ASP A C     1 
ATOM   1628 O O     . ASP B 2 110 ? 31.503  -13.090 44.523  1.00 28.74 ? 110 ASP A O     1 
ATOM   1629 C CB    . ASP B 2 110 ? 31.293  -11.019 42.341  1.00 30.18 ? 110 ASP A CB    1 
ATOM   1630 C CG    . ASP B 2 110 ? 31.674  -9.946  41.335  1.00 30.15 ? 110 ASP A CG    1 
ATOM   1631 O OD1   . ASP B 2 110 ? 32.060  -8.835  41.751  1.00 30.69 ? 110 ASP A OD1   1 
ATOM   1632 O OD2   . ASP B 2 110 ? 31.565  -10.216 40.119  1.00 30.67 ? 110 ASP A OD2   1 
ATOM   1633 N N     . VAL B 2 111 ? 30.903  -11.272 45.703  1.00 26.32 ? 111 VAL A N     1 
ATOM   1634 C CA    . VAL B 2 111 ? 30.198  -12.045 46.723  1.00 24.62 ? 111 VAL A CA    1 
ATOM   1635 C C     . VAL B 2 111 ? 28.765  -11.567 46.590  1.00 25.67 ? 111 VAL A C     1 
ATOM   1636 O O     . VAL B 2 111 ? 28.409  -10.489 47.067  1.00 26.27 ? 111 VAL A O     1 
ATOM   1637 C CB    . VAL B 2 111 ? 30.732  -11.772 48.131  1.00 22.26 ? 111 VAL A CB    1 
ATOM   1638 C CG1   . VAL B 2 111 ? 30.010  -12.647 49.124  1.00 20.09 ? 111 VAL A CG1   1 
ATOM   1639 C CG2   . VAL B 2 111 ? 32.226  -12.050 48.188  1.00 21.02 ? 111 VAL A CG2   1 
ATOM   1640 N N     . VAL B 2 112 ? 27.961  -12.387 45.917  1.00 26.37 ? 112 VAL A N     1 
ATOM   1641 C CA    . VAL B 2 112 ? 26.567  -12.091 45.593  1.00 26.29 ? 112 VAL A CA    1 
ATOM   1642 C C     . VAL B 2 112 ? 25.513  -12.865 46.367  1.00 28.82 ? 112 VAL A C     1 
ATOM   1643 O O     . VAL B 2 112 ? 25.469  -14.093 46.311  1.00 30.39 ? 112 VAL A O     1 
ATOM   1644 C CB    . VAL B 2 112 ? 26.311  -12.365 44.093  1.00 24.22 ? 112 VAL A CB    1 
ATOM   1645 C CG1   . VAL B 2 112 ? 24.906  -11.928 43.708  1.00 22.84 ? 112 VAL A CG1   1 
ATOM   1646 C CG2   . VAL B 2 112 ? 27.382  -11.677 43.250  1.00 20.76 ? 112 VAL A CG2   1 
ATOM   1647 N N     . PRO B 2 113 ? 24.634  -12.155 47.089  1.00 30.27 ? 113 PRO A N     1 
ATOM   1648 C CA    . PRO B 2 113 ? 23.585  -12.831 47.851  1.00 31.11 ? 113 PRO A CA    1 
ATOM   1649 C C     . PRO B 2 113 ? 22.478  -13.237 46.879  1.00 32.41 ? 113 PRO A C     1 
ATOM   1650 O O     . PRO B 2 113 ? 22.118  -12.467 45.985  1.00 33.98 ? 113 PRO A O     1 
ATOM   1651 C CB    . PRO B 2 113 ? 23.097  -11.753 48.815  1.00 30.83 ? 113 PRO A CB    1 
ATOM   1652 C CG    . PRO B 2 113 ? 24.207  -10.760 48.858  1.00 31.28 ? 113 PRO A CG    1 
ATOM   1653 C CD    . PRO B 2 113 ? 24.676  -10.728 47.435  1.00 31.31 ? 113 PRO A CD    1 
ATOM   1654 N N     . CYS B 2 114 ? 21.950  -14.442 47.044  1.00 32.45 ? 114 CYS A N     1 
ATOM   1655 C CA    . CYS B 2 114 ? 20.873  -14.920 46.192  1.00 34.35 ? 114 CYS A CA    1 
ATOM   1656 C C     . CYS B 2 114 ? 20.098  -15.962 46.986  1.00 35.50 ? 114 CYS A C     1 
ATOM   1657 O O     . CYS B 2 114 ? 20.557  -16.411 48.036  1.00 35.68 ? 114 CYS A O     1 
ATOM   1658 C CB    . CYS B 2 114 ? 21.429  -15.557 44.917  1.00 35.36 ? 114 CYS A CB    1 
ATOM   1659 S SG    . CYS B 2 114 ? 21.944  -17.281 45.118  1.00 35.26 ? 114 CYS A SG    1 
ATOM   1660 N N     . TYR B 2 115 ? 18.929  -16.341 46.484  1.00 36.04 ? 115 TYR A N     1 
ATOM   1661 C CA    . TYR B 2 115 ? 18.100  -17.332 47.150  1.00 37.49 ? 115 TYR A CA    1 
ATOM   1662 C C     . TYR B 2 115 ? 18.413  -18.752 46.683  1.00 38.51 ? 115 TYR A C     1 
ATOM   1663 O O     . TYR B 2 115 ? 18.693  -18.986 45.508  1.00 38.09 ? 115 TYR A O     1 
ATOM   1664 C CB    . TYR B 2 115 ? 16.616  -17.048 46.894  1.00 37.73 ? 115 TYR A CB    1 
ATOM   1665 C CG    . TYR B 2 115 ? 16.091  -15.803 47.563  1.00 38.87 ? 115 TYR A CG    1 
ATOM   1666 C CD1   . TYR B 2 115 ? 15.889  -14.633 46.840  1.00 38.84 ? 115 TYR A CD1   1 
ATOM   1667 C CD2   . TYR B 2 115 ? 15.796  -15.795 48.925  1.00 39.58 ? 115 TYR A CD2   1 
ATOM   1668 C CE1   . TYR B 2 115 ? 15.403  -13.481 47.458  1.00 39.64 ? 115 TYR A CE1   1 
ATOM   1669 C CE2   . TYR B 2 115 ? 15.311  -14.649 49.552  1.00 40.49 ? 115 TYR A CE2   1 
ATOM   1670 C CZ    . TYR B 2 115 ? 15.117  -13.497 48.812  1.00 40.18 ? 115 TYR A CZ    1 
ATOM   1671 O OH    . TYR B 2 115 ? 14.634  -12.363 49.426  1.00 41.26 ? 115 TYR A OH    1 
ATOM   1672 N N     . LYS B 2 116 ? 18.364  -19.697 47.613  1.00 39.82 ? 116 LYS A N     1 
ATOM   1673 C CA    . LYS B 2 116 ? 18.605  -21.098 47.293  1.00 41.99 ? 116 LYS A CA    1 
ATOM   1674 C C     . LYS B 2 116 ? 17.230  -21.690 46.997  1.00 43.62 ? 116 LYS A C     1 
ATOM   1675 O O     . LYS B 2 116 ? 16.393  -21.810 47.890  1.00 44.28 ? 116 LYS A O     1 
ATOM   1676 C CB    . LYS B 2 116 ? 19.233  -21.813 48.487  1.00 40.96 ? 116 LYS A CB    1 
ATOM   1677 C CG    . LYS B 2 116 ? 19.558  -23.267 48.240  1.00 41.70 ? 116 LYS A CG    1 
ATOM   1678 C CD    . LYS B 2 116 ? 19.941  -23.951 49.544  1.00 42.11 ? 116 LYS A CD    1 
ATOM   1679 C CE    . LYS B 2 116 ? 20.196  -25.440 49.360  1.00 40.30 ? 116 LYS A CE    1 
ATOM   1680 N NZ    . LYS B 2 116 ? 20.398  -26.088 50.683  1.00 40.58 ? 116 LYS A NZ    1 
ATOM   1681 N N     . LEU B 2 117 ? 16.993  -22.055 45.744  1.00 45.73 ? 117 LEU A N     1 
ATOM   1682 C CA    . LEU B 2 117 ? 15.696  -22.598 45.358  1.00 47.65 ? 117 LEU A CA    1 
ATOM   1683 C C     . LEU B 2 117 ? 15.806  -23.819 44.472  1.00 50.26 ? 117 LEU A C     1 
ATOM   1684 O O     . LEU B 2 117 ? 16.840  -24.056 43.843  1.00 50.53 ? 117 LEU A O     1 
ATOM   1685 C CB    . LEU B 2 117 ? 14.912  -21.562 44.561  1.00 44.96 ? 117 LEU A CB    1 
ATOM   1686 C CG    . LEU B 2 117 ? 15.004  -20.093 44.929  1.00 43.73 ? 117 LEU A CG    1 
ATOM   1687 C CD1   . LEU B 2 117 ? 14.751  -19.254 43.687  1.00 43.12 ? 117 LEU A CD1   1 
ATOM   1688 C CD2   . LEU B 2 117 ? 14.008  -19.781 46.023  1.00 42.64 ? 117 LEU A CD2   1 
ATOM   1689 N N     . LYS B 2 118 ? 14.730  -24.598 44.430  1.00 53.48 ? 118 LYS A N     1 
ATOM   1690 C CA    . LYS B 2 118 ? 14.682  -25.726 43.517  1.00 57.06 ? 118 LYS A CA    1 
ATOM   1691 C C     . LYS B 2 118 ? 13.522  -25.371 42.595  1.00 58.34 ? 118 LYS A C     1 
ATOM   1692 O O     . LYS B 2 118 ? 12.441  -25.001 43.060  1.00 58.77 ? 118 LYS A O     1 
ATOM   1693 C CB    . LYS B 2 118 ? 14.427  -27.061 44.218  1.00 58.20 ? 118 LYS A CB    1 
ATOM   1694 C CG    . LYS B 2 118 ? 14.568  -28.225 43.224  1.00 59.81 ? 118 LYS A CG    1 
ATOM   1695 C CD    . LYS B 2 118 ? 14.852  -29.571 43.872  1.00 59.96 ? 118 LYS A CD    1 
ATOM   1696 C CE    . LYS B 2 118 ? 15.243  -30.590 42.801  1.00 60.56 ? 118 LYS A CE    1 
ATOM   1697 N NZ    . LYS B 2 118 ? 15.675  -31.906 43.359  1.00 60.08 ? 118 LYS A NZ    1 
ATOM   1698 N N     . GLU B 2 119 ? 13.771  -25.456 41.292  1.00 59.64 ? 119 GLU A N     1 
ATOM   1699 C CA    . GLU B 2 119 ? 12.790  -25.117 40.264  1.00 60.83 ? 119 GLU A CA    1 
ATOM   1700 C C     . GLU B 2 119 ? 12.835  -23.615 39.985  1.00 60.32 ? 119 GLU A C     1 
ATOM   1701 O O     . GLU B 2 119 ? 12.593  -22.799 40.879  1.00 59.26 ? 119 GLU A O     1 
ATOM   1702 C CB    . GLU B 2 119 ? 11.368  -25.535 40.677  1.00 62.98 ? 119 GLU A CB    1 
ATOM   1703 C CG    . GLU B 2 119 ? 11.136  -27.046 40.715  1.00 64.95 ? 119 GLU A CG    1 
ATOM   1704 C CD    . GLU B 2 119 ? 11.474  -27.727 39.393  1.00 66.81 ? 119 GLU A CD    1 
ATOM   1705 O OE1   . GLU B 2 119 ? 12.671  -27.762 39.025  1.00 66.84 ? 119 GLU A OE1   1 
ATOM   1706 O OE2   . GLU B 2 119 ? 10.544  -28.227 38.719  1.00 67.54 ? 119 GLU A OE2   1 
ATOM   1707 N N     . PRO B 2 120 ? 13.167  -23.239 38.735  1.00 60.18 ? 120 PRO A N     1 
ATOM   1708 C CA    . PRO B 2 120 ? 13.276  -21.866 38.233  1.00 59.96 ? 120 PRO A CA    1 
ATOM   1709 C C     . PRO B 2 120 ? 12.130  -20.953 38.637  1.00 59.88 ? 120 PRO A C     1 
ATOM   1710 O O     . PRO B 2 120 ? 12.327  -19.753 38.809  1.00 60.00 ? 120 PRO A O     1 
ATOM   1711 C CB    . PRO B 2 120 ? 13.361  -22.066 36.728  1.00 59.87 ? 120 PRO A CB    1 
ATOM   1712 C CG    . PRO B 2 120 ? 14.178  -23.306 36.637  1.00 59.82 ? 120 PRO A CG    1 
ATOM   1713 C CD    . PRO B 2 120 ? 13.543  -24.199 37.680  1.00 59.87 ? 120 PRO A CD    1 
ATOM   1714 N N     . LYS B 2 121 ? 10.931  -21.513 38.767  1.00 60.01 ? 121 LYS A N     1 
ATOM   1715 C CA    . LYS B 2 121 ? 9.780   -20.719 39.184  1.00 60.30 ? 121 LYS A CA    1 
ATOM   1716 C C     . LYS B 2 121 ? 10.183  -20.183 40.560  1.00 59.77 ? 121 LYS A C     1 
ATOM   1717 O O     . LYS B 2 121 ? 10.907  -20.862 41.290  1.00 60.66 ? 121 LYS A O     1 
ATOM   1718 C CB    . LYS B 2 121 ? 8.534   -21.603 39.336  1.00 61.91 ? 121 LYS A CB    1 
ATOM   1719 C CG    . LYS B 2 121 ? 8.476   -22.840 38.432  1.00 63.84 ? 121 LYS A CG    1 
ATOM   1720 C CD    . LYS B 2 121 ? 8.266   -22.494 36.961  1.00 64.87 ? 121 LYS A CD    1 
ATOM   1721 C CE    . LYS B 2 121 ? 8.156   -23.757 36.109  1.00 65.51 ? 121 LYS A CE    1 
ATOM   1722 N NZ    . LYS B 2 121 ? 8.026   -23.466 34.649  1.00 65.03 ? 121 LYS A NZ    1 
ATOM   1723 N N     . ASN B 2 122 ? 9.735   -18.980 40.908  1.00 58.04 ? 122 ASN A N     1 
ATOM   1724 C CA    . ASN B 2 122 ? 10.054  -18.370 42.204  1.00 57.06 ? 122 ASN A CA    1 
ATOM   1725 C C     . ASN B 2 122 ? 11.370  -17.592 42.228  1.00 55.66 ? 122 ASN A C     1 
ATOM   1726 O O     . ASN B 2 122 ? 11.830  -17.186 43.298  1.00 55.91 ? 122 ASN A O     1 
ATOM   1727 C CB    . ASN B 2 122 ? 10.273  -19.442 43.280  1.00 57.25 ? 122 ASN A CB    1 
ATOM   1728 C CG    . ASN B 2 122 ? 8.998   -20.169 43.642  1.00 58.05 ? 122 ASN A CG    1 
ATOM   1729 O OD1   . ASN B 2 122 ? 8.061   -19.568 44.165  1.00 58.76 ? 122 ASN A OD1   1 
ATOM   1730 N ND2   . ASN B 2 122 ? 8.951   -21.470 43.363  1.00 57.84 ? 122 ASN A ND2   1 
ATOM   1731 N N     . ILE B 2 123 ? 11.979  -17.398 41.062  1.00 53.66 ? 123 ILE A N     1 
ATOM   1732 C CA    . ILE B 2 123 ? 13.135  -16.520 40.928  1.00 51.37 ? 123 ILE A CA    1 
ATOM   1733 C C     . ILE B 2 123 ? 12.658  -15.097 41.207  1.00 50.06 ? 123 ILE A C     1 
ATOM   1734 O O     . ILE B 2 123 ? 11.687  -14.633 40.611  1.00 50.12 ? 123 ILE A O     1 
ATOM   1735 C CB    . ILE B 2 123 ? 13.745  -16.626 39.503  1.00 51.15 ? 123 ILE A CB    1 
ATOM   1736 C CG1   . ILE B 2 123 ? 14.602  -17.893 39.410  1.00 50.37 ? 123 ILE A CG1   1 
ATOM   1737 C CG2   . ILE B 2 123 ? 14.573  -15.393 39.180  1.00 50.56 ? 123 ILE A CG2   1 
ATOM   1738 C CD1   . ILE B 2 123 ? 15.206  -18.143 38.050  1.00 49.77 ? 123 ILE A CD1   1 
ATOM   1739 N N     . LYS B 2 124 ? 13.333  -14.409 42.120  1.00 48.57 ? 124 LYS A N     1 
ATOM   1740 C CA    . LYS B 2 124 ? 12.934  -13.053 42.481  1.00 48.24 ? 124 LYS A CA    1 
ATOM   1741 C C     . LYS B 2 124 ? 13.818  -11.975 41.848  1.00 47.81 ? 124 LYS A C     1 
ATOM   1742 O O     . LYS B 2 124 ? 13.430  -10.808 41.770  1.00 47.05 ? 124 LYS A O     1 
ATOM   1743 C CB    . LYS B 2 124 ? 12.920  -12.931 44.006  1.00 48.63 ? 124 LYS A CB    1 
ATOM   1744 C CG    . LYS B 2 124 ? 12.036  -13.991 44.671  1.00 49.23 ? 124 LYS A CG    1 
ATOM   1745 C CD    . LYS B 2 124 ? 12.478  -14.276 46.098  1.00 50.34 ? 124 LYS A CD    1 
ATOM   1746 C CE    . LYS B 2 124 ? 11.862  -15.560 46.658  1.00 49.33 ? 124 LYS A CE    1 
ATOM   1747 N NZ    . LYS B 2 124 ? 12.519  -15.951 47.944  1.00 45.93 ? 124 LYS A NZ    1 
ATOM   1748 N N     . SER B 2 125 ? 14.997  -12.384 41.385  1.00 47.15 ? 125 SER A N     1 
ATOM   1749 C CA    . SER B 2 125 ? 15.955  -11.490 40.734  1.00 45.77 ? 125 SER A CA    1 
ATOM   1750 C C     . SER B 2 125 ? 16.746  -12.331 39.742  1.00 44.58 ? 125 SER A C     1 
ATOM   1751 O O     . SER B 2 125 ? 16.727  -13.557 39.813  1.00 44.05 ? 125 SER A O     1 
ATOM   1752 C CB    . SER B 2 125 ? 16.925  -10.883 41.753  1.00 47.30 ? 125 SER A CB    1 
ATOM   1753 O OG    . SER B 2 125 ? 16.245  -10.144 42.751  1.00 49.88 ? 125 SER A OG    1 
ATOM   1754 N N     . ALA B 2 126 ? 17.447  -11.673 38.825  1.00 42.83 ? 126 ALA A N     1 
ATOM   1755 C CA    . ALA B 2 126 ? 18.241  -12.380 37.832  1.00 40.54 ? 126 ALA A CA    1 
ATOM   1756 C C     . ALA B 2 126 ? 19.325  -13.211 38.515  1.00 39.47 ? 126 ALA A C     1 
ATOM   1757 O O     . ALA B 2 126 ? 19.640  -14.318 38.082  1.00 39.04 ? 126 ALA A O     1 
ATOM   1758 C CB    . ALA B 2 126 ? 18.869  -11.386 36.869  1.00 39.44 ? 126 ALA A CB    1 
ATOM   1759 N N     . VAL B 2 127 ? 19.890  -12.685 39.593  1.00 37.99 ? 127 VAL A N     1 
ATOM   1760 C CA    . VAL B 2 127 ? 20.939  -13.411 40.297  1.00 37.18 ? 127 VAL A CA    1 
ATOM   1761 C C     . VAL B 2 127 ? 20.479  -14.778 40.806  1.00 37.01 ? 127 VAL A C     1 
ATOM   1762 O O     . VAL B 2 127 ? 21.304  -15.655 41.063  1.00 37.55 ? 127 VAL A O     1 
ATOM   1763 C CB    . VAL B 2 127 ? 21.485  -12.600 41.492  1.00 35.93 ? 127 VAL A CB    1 
ATOM   1764 C CG1   . VAL B 2 127 ? 22.075  -11.282 41.002  1.00 33.37 ? 127 VAL A CG1   1 
ATOM   1765 C CG2   . VAL B 2 127 ? 20.380  -12.366 42.507  1.00 34.44 ? 127 VAL A CG2   1 
ATOM   1766 N N     . ASP B 2 128 ? 19.171  -14.966 40.952  1.00 35.67 ? 128 ASP A N     1 
ATOM   1767 C CA    . ASP B 2 128 ? 18.661  -16.243 41.439  1.00 35.05 ? 128 ASP A CA    1 
ATOM   1768 C C     . ASP B 2 128 ? 18.690  -17.288 40.346  1.00 35.14 ? 128 ASP A C     1 
ATOM   1769 O O     . ASP B 2 128 ? 18.804  -18.481 40.617  1.00 34.27 ? 128 ASP A O     1 
ATOM   1770 C CB    . ASP B 2 128 ? 17.220  -16.117 41.951  1.00 34.89 ? 128 ASP A CB    1 
ATOM   1771 C CG    . ASP B 2 128 ? 17.111  -15.267 43.193  1.00 34.13 ? 128 ASP A CG    1 
ATOM   1772 O OD1   . ASP B 2 128 ? 18.059  -15.275 44.009  1.00 33.45 ? 128 ASP A OD1   1 
ATOM   1773 O OD2   . ASP B 2 128 ? 16.063  -14.602 43.357  1.00 34.86 ? 128 ASP A OD2   1 
ATOM   1774 N N     . ARG B 2 129 ? 18.576  -16.833 39.105  1.00 36.18 ? 129 ARG A N     1 
ATOM   1775 C CA    . ARG B 2 129 ? 18.573  -17.746 37.973  1.00 36.72 ? 129 ARG A CA    1 
ATOM   1776 C C     . ARG B 2 129 ? 19.972  -18.283 37.709  1.00 36.10 ? 129 ARG A C     1 
ATOM   1777 O O     . ARG B 2 129 ? 20.131  -19.387 37.195  1.00 36.92 ? 129 ARG A O     1 
ATOM   1778 C CB    . ARG B 2 129 ? 18.032  -17.044 36.720  1.00 37.92 ? 129 ARG A CB    1 
ATOM   1779 C CG    . ARG B 2 129 ? 17.740  -18.010 35.579  1.00 40.23 ? 129 ARG A CG    1 
ATOM   1780 C CD    . ARG B 2 129 ? 17.224  -17.321 34.336  1.00 40.86 ? 129 ARG A CD    1 
ATOM   1781 N NE    . ARG B 2 129 ? 15.985  -16.591 34.579  1.00 43.31 ? 129 ARG A NE    1 
ATOM   1782 C CZ    . ARG B 2 129 ? 15.915  -15.285 34.815  1.00 43.61 ? 129 ARG A CZ    1 
ATOM   1783 N NH1   . ARG B 2 129 ? 17.018  -14.547 34.840  1.00 43.80 ? 129 ARG A NH1   1 
ATOM   1784 N NH2   . ARG B 2 129 ? 14.735  -14.715 35.015  1.00 43.95 ? 129 ARG A NH2   1 
ATOM   1785 N N     . THR B 2 130 ? 20.979  -17.503 38.083  1.00 34.92 ? 130 THR A N     1 
ATOM   1786 C CA    . THR B 2 130 ? 22.367  -17.887 37.877  1.00 34.81 ? 130 THR A CA    1 
ATOM   1787 C C     . THR B 2 130 ? 22.716  -19.291 38.368  1.00 34.55 ? 130 THR A C     1 
ATOM   1788 O O     . THR B 2 130 ? 23.326  -20.066 37.637  1.00 34.86 ? 130 THR A O     1 
ATOM   1789 C CB    . THR B 2 130 ? 23.325  -16.858 38.526  1.00 35.54 ? 130 THR A CB    1 
ATOM   1790 O OG1   . THR B 2 130 ? 23.090  -15.571 37.945  1.00 36.89 ? 130 THR A OG1   1 
ATOM   1791 C CG2   . THR B 2 130 ? 24.784  -17.238 38.289  1.00 33.86 ? 130 THR A CG2   1 
ATOM   1792 N N     . PRO B 2 131 ? 22.347  -19.639 39.612  1.00 34.95 ? 131 PRO A N     1 
ATOM   1793 C CA    . PRO B 2 131 ? 22.676  -20.985 40.095  1.00 33.82 ? 131 PRO A CA    1 
ATOM   1794 C C     . PRO B 2 131 ? 22.176  -22.082 39.147  1.00 32.71 ? 131 PRO A C     1 
ATOM   1795 O O     . PRO B 2 131 ? 22.889  -23.052 38.874  1.00 31.87 ? 131 PRO A O     1 
ATOM   1796 C CB    . PRO B 2 131 ? 21.997  -21.033 41.467  1.00 34.93 ? 131 PRO A CB    1 
ATOM   1797 C CG    . PRO B 2 131 ? 22.108  -19.620 41.935  1.00 35.90 ? 131 PRO A CG    1 
ATOM   1798 C CD    . PRO B 2 131 ? 21.725  -18.838 40.684  1.00 35.83 ? 131 PRO A CD    1 
ATOM   1799 N N     . PHE B 2 132 ? 20.949  -21.926 38.658  1.00 31.57 ? 132 PHE A N     1 
ATOM   1800 C CA    . PHE B 2 132 ? 20.375  -22.895 37.736  1.00 31.72 ? 132 PHE A CA    1 
ATOM   1801 C C     . PHE B 2 132 ? 21.186  -22.925 36.446  1.00 31.27 ? 132 PHE A C     1 
ATOM   1802 O O     . PHE B 2 132 ? 21.445  -23.991 35.884  1.00 31.91 ? 132 PHE A O     1 
ATOM   1803 C CB    . PHE B 2 132 ? 18.919  -22.541 37.418  1.00 31.90 ? 132 PHE A CB    1 
ATOM   1804 C CG    . PHE B 2 132 ? 17.989  -22.716 38.577  1.00 32.82 ? 132 PHE A CG    1 
ATOM   1805 C CD1   . PHE B 2 132 ? 17.531  -21.615 39.294  1.00 33.07 ? 132 PHE A CD1   1 
ATOM   1806 C CD2   . PHE B 2 132 ? 17.572  -23.991 38.958  1.00 32.40 ? 132 PHE A CD2   1 
ATOM   1807 C CE1   . PHE B 2 132 ? 16.665  -21.776 40.376  1.00 33.48 ? 132 PHE A CE1   1 
ATOM   1808 C CE2   . PHE B 2 132 ? 16.708  -24.167 40.036  1.00 33.05 ? 132 PHE A CE2   1 
ATOM   1809 C CZ    . PHE B 2 132 ? 16.250  -23.059 40.749  1.00 33.25 ? 132 PHE A CZ    1 
ATOM   1810 N N     . HIS B 2 133 ? 21.572  -21.744 35.978  1.00 29.35 ? 133 HIS A N     1 
ATOM   1811 C CA    . HIS B 2 133 ? 22.363  -21.636 34.771  1.00 29.54 ? 133 HIS A CA    1 
ATOM   1812 C C     . HIS B 2 133 ? 23.656  -22.415 34.955  1.00 29.29 ? 133 HIS A C     1 
ATOM   1813 O O     . HIS B 2 133 ? 24.084  -23.136 34.057  1.00 30.75 ? 133 HIS A O     1 
ATOM   1814 C CB    . HIS B 2 133 ? 22.683  -20.165 34.463  1.00 30.30 ? 133 HIS A CB    1 
ATOM   1815 C CG    . HIS B 2 133 ? 21.561  -19.421 33.807  1.00 29.78 ? 133 HIS A CG    1 
ATOM   1816 N ND1   . HIS B 2 133 ? 21.606  -18.065 33.568  1.00 29.80 ? 133 HIS A ND1   1 
ATOM   1817 C CD2   . HIS B 2 133 ? 20.371  -19.846 33.316  1.00 30.80 ? 133 HIS A CD2   1 
ATOM   1818 C CE1   . HIS B 2 133 ? 20.497  -17.687 32.958  1.00 30.25 ? 133 HIS A CE1   1 
ATOM   1819 N NE2   . HIS B 2 133 ? 19.731  -18.751 32.794  1.00 30.60 ? 133 HIS A NE2   1 
ATOM   1820 N N     . HIS B 2 134 ? 24.279  -22.274 36.120  1.00 28.52 ? 134 HIS A N     1 
ATOM   1821 C CA    . HIS B 2 134 ? 25.528  -22.974 36.389  1.00 27.05 ? 134 HIS A CA    1 
ATOM   1822 C C     . HIS B 2 134 ? 25.323  -24.486 36.407  1.00 28.19 ? 134 HIS A C     1 
ATOM   1823 O O     . HIS B 2 134 ? 26.097  -25.231 35.797  1.00 28.35 ? 134 HIS A O     1 
ATOM   1824 C CB    . HIS B 2 134 ? 26.122  -22.523 37.723  1.00 24.92 ? 134 HIS A CB    1 
ATOM   1825 C CG    . HIS B 2 134 ? 27.383  -23.246 38.087  1.00 22.73 ? 134 HIS A CG    1 
ATOM   1826 N ND1   . HIS B 2 134 ? 28.559  -23.088 37.385  1.00 21.35 ? 134 HIS A ND1   1 
ATOM   1827 C CD2   . HIS B 2 134 ? 27.633  -24.179 39.037  1.00 20.17 ? 134 HIS A CD2   1 
ATOM   1828 C CE1   . HIS B 2 134 ? 29.479  -23.896 37.883  1.00 20.07 ? 134 HIS A CE1   1 
ATOM   1829 N NE2   . HIS B 2 134 ? 28.943  -24.568 38.885  1.00 20.55 ? 134 HIS A NE2   1 
ATOM   1830 N N     . LYS B 2 135 ? 24.284  -24.933 37.110  1.00 29.12 ? 135 LYS A N     1 
ATOM   1831 C CA    . LYS B 2 135 ? 23.971  -26.360 37.205  1.00 30.65 ? 135 LYS A CA    1 
ATOM   1832 C C     . LYS B 2 135 ? 23.781  -26.998 35.832  1.00 30.12 ? 135 LYS A C     1 
ATOM   1833 O O     . LYS B 2 135 ? 24.331  -28.064 35.557  1.00 30.87 ? 135 LYS A O     1 
ATOM   1834 C CB    . LYS B 2 135 ? 22.708  -26.573 38.033  1.00 33.20 ? 135 LYS A CB    1 
ATOM   1835 C CG    . LYS B 2 135 ? 22.962  -26.861 39.491  1.00 38.59 ? 135 LYS A CG    1 
ATOM   1836 C CD    . LYS B 2 135 ? 23.257  -28.344 39.725  1.00 42.19 ? 135 LYS A CD    1 
ATOM   1837 C CE    . LYS B 2 135 ? 23.561  -28.632 41.202  1.00 44.75 ? 135 LYS A CE    1 
ATOM   1838 N NZ    . LYS B 2 135 ? 22.476  -28.143 42.126  1.00 45.53 ? 135 LYS A NZ    1 
ATOM   1839 N N     . TRP B 2 136 ? 23.017  -26.339 34.967  1.00 28.63 ? 136 TRP A N     1 
ATOM   1840 C CA    . TRP B 2 136 ? 22.764  -26.867 33.635  1.00 28.00 ? 136 TRP A CA    1 
ATOM   1841 C C     . TRP B 2 136 ? 24.039  -26.940 32.813  1.00 29.87 ? 136 TRP A C     1 
ATOM   1842 O O     . TRP B 2 136 ? 24.204  -27.831 31.983  1.00 30.59 ? 136 TRP A O     1 
ATOM   1843 C CB    . TRP B 2 136 ? 21.758  -25.984 32.894  1.00 26.11 ? 136 TRP A CB    1 
ATOM   1844 C CG    . TRP B 2 136 ? 21.164  -26.639 31.674  1.00 24.09 ? 136 TRP A CG    1 
ATOM   1845 C CD1   . TRP B 2 136 ? 20.023  -27.396 31.620  1.00 22.88 ? 136 TRP A CD1   1 
ATOM   1846 C CD2   . TRP B 2 136 ? 21.697  -26.623 30.340  1.00 22.58 ? 136 TRP A CD2   1 
ATOM   1847 N NE1   . TRP B 2 136 ? 19.813  -27.847 30.337  1.00 22.19 ? 136 TRP A NE1   1 
ATOM   1848 C CE2   . TRP B 2 136 ? 20.821  -27.389 29.533  1.00 21.25 ? 136 TRP A CE2   1 
ATOM   1849 C CE3   . TRP B 2 136 ? 22.824  -26.034 29.750  1.00 22.64 ? 136 TRP A CE3   1 
ATOM   1850 C CZ2   . TRP B 2 136 ? 21.046  -27.588 28.162  1.00 20.55 ? 136 TRP A CZ2   1 
ATOM   1851 C CZ3   . TRP B 2 136 ? 23.048  -26.234 28.378  1.00 23.29 ? 136 TRP A CZ3   1 
ATOM   1852 C CH2   . TRP B 2 136 ? 22.156  -27.003 27.603  1.00 21.83 ? 136 TRP A CH2   1 
ATOM   1853 N N     . LEU B 2 137 ? 24.949  -26.008 33.062  1.00 31.49 ? 137 LEU A N     1 
ATOM   1854 C CA    . LEU B 2 137 ? 26.195  -25.918 32.307  1.00 32.93 ? 137 LEU A CA    1 
ATOM   1855 C C     . LEU B 2 137 ? 27.373  -26.797 32.719  1.00 34.41 ? 137 LEU A C     1 
ATOM   1856 O O     . LEU B 2 137 ? 28.064  -27.337 31.852  1.00 34.71 ? 137 LEU A O     1 
ATOM   1857 C CB    . LEU B 2 137 ? 26.651  -24.450 32.277  1.00 32.22 ? 137 LEU A CB    1 
ATOM   1858 C CG    . LEU B 2 137 ? 26.625  -23.653 30.962  1.00 33.01 ? 137 LEU A CG    1 
ATOM   1859 C CD1   . LEU B 2 137 ? 25.661  -24.254 29.972  1.00 31.39 ? 137 LEU A CD1   1 
ATOM   1860 C CD2   . LEU B 2 137 ? 26.254  -22.209 31.259  1.00 31.42 ? 137 LEU A CD2   1 
ATOM   1861 N N     . GLU B 2 138 ? 27.607  -26.952 34.021  1.00 35.70 ? 138 GLU A N     1 
ATOM   1862 C CA    . GLU B 2 138 ? 28.766  -27.726 34.476  1.00 36.65 ? 138 GLU A CA    1 
ATOM   1863 C C     . GLU B 2 138 ? 28.888  -29.146 33.950  1.00 36.31 ? 138 GLU A C     1 
ATOM   1864 O O     . GLU B 2 138 ? 29.978  -29.574 33.551  1.00 36.12 ? 138 GLU A O     1 
ATOM   1865 C CB    . GLU B 2 138 ? 28.869  -27.731 36.013  1.00 37.09 ? 138 GLU A CB    1 
ATOM   1866 C CG    . GLU B 2 138 ? 27.603  -28.029 36.768  1.00 39.08 ? 138 GLU A CG    1 
ATOM   1867 C CD    . GLU B 2 138 ? 27.869  -28.217 38.256  1.00 42.00 ? 138 GLU A CD    1 
ATOM   1868 O OE1   . GLU B 2 138 ? 28.806  -27.568 38.777  1.00 42.84 ? 138 GLU A OE1   1 
ATOM   1869 O OE2   . GLU B 2 138 ? 27.141  -29.002 38.911  1.00 42.36 ? 138 GLU A OE2   1 
ATOM   1870 N N     . GLY B 2 139 ? 27.785  -29.880 33.937  1.00 35.08 ? 139 GLY A N     1 
ATOM   1871 C CA    . GLY B 2 139 ? 27.861  -31.235 33.447  1.00 35.12 ? 139 GLY A CA    1 
ATOM   1872 C C     . GLY B 2 139 ? 27.944  -31.353 31.937  1.00 34.83 ? 139 GLY A C     1 
ATOM   1873 O O     . GLY B 2 139 ? 28.445  -32.350 31.429  1.00 36.60 ? 139 GLY A O     1 
ATOM   1874 N N     . ARG B 2 140 ? 27.481  -30.340 31.212  1.00 34.24 ? 140 ARG A N     1 
ATOM   1875 C CA    . ARG B 2 140 ? 27.476  -30.409 29.753  1.00 33.96 ? 140 ARG A CA    1 
ATOM   1876 C C     . ARG B 2 140 ? 28.605  -29.703 29.018  1.00 33.99 ? 140 ARG A C     1 
ATOM   1877 O O     . ARG B 2 140 ? 28.942  -30.085 27.901  1.00 34.55 ? 140 ARG A O     1 
ATOM   1878 C CB    . ARG B 2 140 ? 26.150  -29.871 29.212  1.00 32.40 ? 140 ARG A CB    1 
ATOM   1879 C CG    . ARG B 2 140 ? 24.911  -30.534 29.777  1.00 30.58 ? 140 ARG A CG    1 
ATOM   1880 C CD    . ARG B 2 140 ? 23.682  -29.746 29.372  1.00 30.49 ? 140 ARG A CD    1 
ATOM   1881 N NE    . ARG B 2 140 ? 22.543  -30.028 30.236  1.00 31.43 ? 140 ARG A NE    1 
ATOM   1882 C CZ    . ARG B 2 140 ? 21.722  -31.053 30.070  1.00 31.51 ? 140 ARG A CZ    1 
ATOM   1883 N NH1   . ARG B 2 140 ? 21.914  -31.893 29.061  1.00 34.57 ? 140 ARG A NH1   1 
ATOM   1884 N NH2   . ARG B 2 140 ? 20.715  -31.239 30.909  1.00 30.78 ? 140 ARG A NH2   1 
ATOM   1885 N N     . ILE B 2 141 ? 29.185  -28.674 29.621  1.00 34.23 ? 141 ILE A N     1 
ATOM   1886 C CA    . ILE B 2 141 ? 30.241  -27.931 28.943  1.00 34.67 ? 141 ILE A CA    1 
ATOM   1887 C C     . ILE B 2 141 ? 31.605  -28.574 29.166  1.00 35.43 ? 141 ILE A C     1 
ATOM   1888 O O     . ILE B 2 141 ? 32.552  -28.341 28.407  1.00 34.97 ? 141 ILE A O     1 
ATOM   1889 C CB    . ILE B 2 141 ? 30.259  -26.446 29.412  1.00 34.74 ? 141 ILE A CB    1 
ATOM   1890 C CG1   . ILE B 2 141 ? 31.084  -25.596 28.438  1.00 34.12 ? 141 ILE A CG1   1 
ATOM   1891 C CG2   . ILE B 2 141 ? 30.819  -26.347 30.828  1.00 32.32 ? 141 ILE A CG2   1 
ATOM   1892 C CD1   . ILE B 2 141 ? 30.557  -25.591 27.021  1.00 32.99 ? 141 ILE A CD1   1 
ATOM   1893 N N     . LYS B 2 142 ? 31.686  -29.396 30.208  1.00 36.13 ? 142 LYS A N     1 
ATOM   1894 C CA    . LYS B 2 142 ? 32.909  -30.104 30.559  1.00 37.34 ? 142 LYS A CA    1 
ATOM   1895 C C     . LYS B 2 142 ? 33.565  -30.692 29.296  1.00 36.53 ? 142 LYS A C     1 
ATOM   1896 O O     . LYS B 2 142 ? 32.902  -31.339 28.480  1.00 35.52 ? 142 LYS A O     1 
ATOM   1897 C CB    . LYS B 2 142 ? 32.573  -31.229 31.551  1.00 39.78 ? 142 LYS A CB    1 
ATOM   1898 C CG    . LYS B 2 142 ? 33.749  -31.756 32.354  1.00 42.31 ? 142 LYS A CG    1 
ATOM   1899 C CD    . LYS B 2 142 ? 33.738  -31.227 33.789  1.00 44.91 ? 142 LYS A CD    1 
ATOM   1900 C CE    . LYS B 2 142 ? 35.097  -31.454 34.467  1.00 47.35 ? 142 LYS A CE    1 
ATOM   1901 N NZ    . LYS B 2 142 ? 35.573  -32.876 34.352  1.00 46.85 ? 142 LYS A NZ    1 
ATOM   1902 N N     . GLY B 2 143 ? 34.862  -30.453 29.129  1.00 35.90 ? 143 GLY A N     1 
ATOM   1903 C CA    . GLY B 2 143 ? 35.559  -30.979 27.967  1.00 35.71 ? 143 GLY A CA    1 
ATOM   1904 C C     . GLY B 2 143 ? 35.645  -30.027 26.786  1.00 35.49 ? 143 GLY A C     1 
ATOM   1905 O O     . GLY B 2 143 ? 36.506  -30.188 25.922  1.00 34.35 ? 143 GLY A O     1 
ATOM   1906 N N     . LYS B 2 144 ? 34.771  -29.022 26.753  1.00 36.09 ? 144 LYS A N     1 
ATOM   1907 C CA    . LYS B 2 144 ? 34.758  -28.065 25.649  1.00 36.07 ? 144 LYS A CA    1 
ATOM   1908 C C     . LYS B 2 144 ? 35.143  -26.647 26.058  1.00 35.40 ? 144 LYS A C     1 
ATOM   1909 O O     . LYS B 2 144 ? 34.968  -25.701 25.290  1.00 33.96 ? 144 LYS A O     1 
ATOM   1910 C CB    . LYS B 2 144 ? 33.372  -28.040 25.011  1.00 36.14 ? 144 LYS A CB    1 
ATOM   1911 C CG    . LYS B 2 144 ? 32.791  -29.419 24.713  1.00 38.43 ? 144 LYS A CG    1 
ATOM   1912 C CD    . LYS B 2 144 ? 32.075  -29.407 23.370  1.00 39.72 ? 144 LYS A CD    1 
ATOM   1913 C CE    . LYS B 2 144 ? 31.298  -30.677 23.107  1.00 40.48 ? 144 LYS A CE    1 
ATOM   1914 N NZ    . LYS B 2 144 ? 29.998  -30.689 23.830  1.00 42.11 ? 144 LYS A NZ    1 
ATOM   1915 N N     . GLU B 2 145 ? 35.692  -26.505 27.259  1.00 35.80 ? 145 GLU A N     1 
ATOM   1916 C CA    . GLU B 2 145 ? 36.062  -25.193 27.767  1.00 36.33 ? 145 GLU A CA    1 
ATOM   1917 C C     . GLU B 2 145 ? 36.935  -24.308 26.859  1.00 36.32 ? 145 GLU A C     1 
ATOM   1918 O O     . GLU B 2 145 ? 36.785  -23.076 26.866  1.00 36.75 ? 145 GLU A O     1 
ATOM   1919 C CB    . GLU B 2 145 ? 36.692  -25.328 29.164  1.00 36.44 ? 145 GLU A CB    1 
ATOM   1920 C CG    . GLU B 2 145 ? 37.596  -26.540 29.376  1.00 38.96 ? 145 GLU A CG    1 
ATOM   1921 C CD    . GLU B 2 145 ? 36.835  -27.836 29.624  1.00 39.53 ? 145 GLU A CD    1 
ATOM   1922 O OE1   . GLU B 2 145 ? 36.942  -28.727 28.764  1.00 40.77 ? 145 GLU A OE1   1 
ATOM   1923 O OE2   . GLU B 2 145 ? 36.145  -27.970 30.663  1.00 38.07 ? 145 GLU A OE2   1 
ATOM   1924 N N     . ASN B 2 146 ? 37.836  -24.899 26.077  1.00 35.28 ? 146 ASN A N     1 
ATOM   1925 C CA    . ASN B 2 146 ? 38.666  -24.079 25.200  1.00 34.92 ? 146 ASN A CA    1 
ATOM   1926 C C     . ASN B 2 146 ? 37.902  -23.662 23.951  1.00 34.35 ? 146 ASN A C     1 
ATOM   1927 O O     . ASN B 2 146 ? 38.271  -22.685 23.291  1.00 34.51 ? 146 ASN A O     1 
ATOM   1928 C CB    . ASN B 2 146 ? 39.951  -24.807 24.809  1.00 36.60 ? 146 ASN A CB    1 
ATOM   1929 C CG    . ASN B 2 146 ? 40.866  -25.043 25.998  1.00 38.44 ? 146 ASN A CG    1 
ATOM   1930 O OD1   . ASN B 2 146 ? 40.962  -24.210 26.905  1.00 38.42 ? 146 ASN A OD1   1 
ATOM   1931 N ND2   . ASN B 2 146 ? 41.551  -26.178 25.995  1.00 39.40 ? 146 ASN A ND2   1 
ATOM   1932 N N     . GLU B 2 147 ? 36.844  -24.403 23.623  1.00 32.67 ? 147 GLU A N     1 
ATOM   1933 C CA    . GLU B 2 147 ? 36.020  -24.057 22.474  1.00 31.37 ? 147 GLU A CA    1 
ATOM   1934 C C     . GLU B 2 147 ? 35.235  -22.779 22.850  1.00 31.01 ? 147 GLU A C     1 
ATOM   1935 O O     . GLU B 2 147 ? 34.956  -21.923 22.000  1.00 30.11 ? 147 GLU A O     1 
ATOM   1936 C CB    . GLU B 2 147 ? 35.054  -25.197 22.142  1.00 31.48 ? 147 GLU A CB    1 
ATOM   1937 C CG    . GLU B 2 147 ? 35.710  -26.512 21.701  1.00 31.58 ? 147 GLU A CG    1 
ATOM   1938 C CD    . GLU B 2 147 ? 36.565  -26.391 20.431  1.00 32.26 ? 147 GLU A CD    1 
ATOM   1939 O OE1   . GLU B 2 147 ? 36.208  -25.603 19.521  1.00 30.28 ? 147 GLU A OE1   1 
ATOM   1940 O OE2   . GLU B 2 147 ? 37.591  -27.106 20.336  1.00 31.14 ? 147 GLU A OE2   1 
ATOM   1941 N N     . VAL B 2 148 ? 34.889  -22.664 24.133  1.00 29.00 ? 148 VAL A N     1 
ATOM   1942 C CA    . VAL B 2 148 ? 34.173  -21.503 24.643  1.00 27.46 ? 148 VAL A CA    1 
ATOM   1943 C C     . VAL B 2 148 ? 35.100  -20.293 24.601  1.00 27.03 ? 148 VAL A C     1 
ATOM   1944 O O     . VAL B 2 148 ? 34.705  -19.204 24.195  1.00 26.68 ? 148 VAL A O     1 
ATOM   1945 C CB    . VAL B 2 148 ? 33.718  -21.723 26.100  1.00 26.95 ? 148 VAL A CB    1 
ATOM   1946 C CG1   . VAL B 2 148 ? 33.229  -20.424 26.705  1.00 25.60 ? 148 VAL A CG1   1 
ATOM   1947 C CG2   . VAL B 2 148 ? 32.620  -22.753 26.145  1.00 28.49 ? 148 VAL A CG2   1 
ATOM   1948 N N     . ARG B 2 149 ? 36.341  -20.493 25.023  1.00 27.52 ? 149 ARG A N     1 
ATOM   1949 C CA    . ARG B 2 149 ? 37.326  -19.417 25.029  1.00 27.93 ? 149 ARG A CA    1 
ATOM   1950 C C     . ARG B 2 149 ? 37.627  -18.902 23.623  1.00 27.70 ? 149 ARG A C     1 
ATOM   1951 O O     . ARG B 2 149 ? 37.767  -17.696 23.418  1.00 28.93 ? 149 ARG A O     1 
ATOM   1952 C CB    . ARG B 2 149 ? 38.598  -19.895 25.722  1.00 27.55 ? 149 ARG A CB    1 
ATOM   1953 C CG    . ARG B 2 149 ? 38.465  -19.919 27.228  1.00 29.08 ? 149 ARG A CG    1 
ATOM   1954 C CD    . ARG B 2 149 ? 39.431  -20.875 27.883  1.00 29.78 ? 149 ARG A CD    1 
ATOM   1955 N NE    . ARG B 2 149 ? 39.465  -20.670 29.328  1.00 31.46 ? 149 ARG A NE    1 
ATOM   1956 C CZ    . ARG B 2 149 ? 39.974  -21.538 30.194  1.00 33.54 ? 149 ARG A CZ    1 
ATOM   1957 N NH1   . ARG B 2 149 ? 40.492  -22.678 29.764  1.00 34.38 ? 149 ARG A NH1   1 
ATOM   1958 N NH2   . ARG B 2 149 ? 39.969  -21.265 31.492  1.00 35.59 ? 149 ARG A NH2   1 
ATOM   1959 N N     . LEU B 2 150 ? 37.721  -19.809 22.655  1.00 26.14 ? 150 LEU A N     1 
ATOM   1960 C CA    . LEU B 2 150 ? 37.973  -19.410 21.279  1.00 24.68 ? 150 LEU A CA    1 
ATOM   1961 C C     . LEU B 2 150 ? 36.832  -18.515 20.804  1.00 24.64 ? 150 LEU A C     1 
ATOM   1962 O O     . LEU B 2 150 ? 37.055  -17.508 20.123  1.00 25.64 ? 150 LEU A O     1 
ATOM   1963 C CB    . LEU B 2 150 ? 38.075  -20.642 20.375  1.00 24.76 ? 150 LEU A CB    1 
ATOM   1964 C CG    . LEU B 2 150 ? 39.417  -21.383 20.330  1.00 23.77 ? 150 LEU A CG    1 
ATOM   1965 C CD1   . LEU B 2 150 ? 39.264  -22.675 19.542  1.00 23.84 ? 150 LEU A CD1   1 
ATOM   1966 C CD2   . LEU B 2 150 ? 40.481  -20.490 19.694  1.00 23.47 ? 150 LEU A CD2   1 
ATOM   1967 N N     . LEU B 2 151 ? 35.607  -18.876 21.171  1.00 23.75 ? 151 LEU A N     1 
ATOM   1968 C CA    . LEU B 2 151 ? 34.440  -18.088 20.776  1.00 24.33 ? 151 LEU A CA    1 
ATOM   1969 C C     . LEU B 2 151 ? 34.419  -16.741 21.497  1.00 25.11 ? 151 LEU A C     1 
ATOM   1970 O O     . LEU B 2 151 ? 34.029  -15.731 20.922  1.00 25.48 ? 151 LEU A O     1 
ATOM   1971 C CB    . LEU B 2 151 ? 33.152  -18.866 21.071  1.00 22.80 ? 151 LEU A CB    1 
ATOM   1972 C CG    . LEU B 2 151 ? 31.767  -18.273 20.796  1.00 20.69 ? 151 LEU A CG    1 
ATOM   1973 C CD1   . LEU B 2 151 ? 31.633  -17.756 19.374  1.00 19.14 ? 151 LEU A CD1   1 
ATOM   1974 C CD2   . LEU B 2 151 ? 30.750  -19.374 21.029  1.00 20.76 ? 151 LEU A CD2   1 
ATOM   1975 N N     . LYS B 2 152 ? 34.851  -16.724 22.752  1.00 25.49 ? 152 LYS A N     1 
ATOM   1976 C CA    . LYS B 2 152 ? 34.866  -15.489 23.512  1.00 26.15 ? 152 LYS A CA    1 
ATOM   1977 C C     . LYS B 2 152 ? 35.902  -14.538 22.941  1.00 27.65 ? 152 LYS A C     1 
ATOM   1978 O O     . LYS B 2 152 ? 35.634  -13.342 22.758  1.00 26.65 ? 152 LYS A O     1 
ATOM   1979 C CB    . LYS B 2 152 ? 35.174  -15.771 24.984  1.00 25.80 ? 152 LYS A CB    1 
ATOM   1980 C CG    . LYS B 2 152 ? 34.051  -16.474 25.709  1.00 25.29 ? 152 LYS A CG    1 
ATOM   1981 C CD    . LYS B 2 152 ? 34.315  -16.566 27.191  1.00 26.01 ? 152 LYS A CD    1 
ATOM   1982 C CE    . LYS B 2 152 ? 33.052  -16.990 27.923  1.00 27.84 ? 152 LYS A CE    1 
ATOM   1983 N NZ    . LYS B 2 152 ? 33.272  -17.119 29.389  1.00 30.72 ? 152 LYS A NZ    1 
ATOM   1984 N N     . GLY B 2 153 ? 37.083  -15.077 22.650  1.00 27.82 ? 153 GLY A N     1 
ATOM   1985 C CA    . GLY B 2 153 ? 38.152  -14.258 22.105  1.00 29.35 ? 153 GLY A CA    1 
ATOM   1986 C C     . GLY B 2 153 ? 37.797  -13.677 20.750  1.00 29.68 ? 153 GLY A C     1 
ATOM   1987 O O     . GLY B 2 153 ? 38.128  -12.524 20.451  1.00 29.32 ? 153 GLY A O     1 
ATOM   1988 N N     . PHE B 2 154 ? 37.123  -14.483 19.933  1.00 29.40 ? 154 PHE A N     1 
ATOM   1989 C CA    . PHE B 2 154 ? 36.696  -14.070 18.598  1.00 29.72 ? 154 PHE A CA    1 
ATOM   1990 C C     . PHE B 2 154 ? 35.781  -12.843 18.714  1.00 30.84 ? 154 PHE A C     1 
ATOM   1991 O O     . PHE B 2 154 ? 36.048  -11.784 18.128  1.00 31.62 ? 154 PHE A O     1 
ATOM   1992 C CB    . PHE B 2 154 ? 35.948  -15.225 17.935  1.00 28.36 ? 154 PHE A CB    1 
ATOM   1993 C CG    . PHE B 2 154 ? 35.714  -15.047 16.464  1.00 27.55 ? 154 PHE A CG    1 
ATOM   1994 C CD1   . PHE B 2 154 ? 36.754  -15.198 15.556  1.00 27.38 ? 154 PHE A CD1   1 
ATOM   1995 C CD2   . PHE B 2 154 ? 34.439  -14.774 15.979  1.00 27.61 ? 154 PHE A CD2   1 
ATOM   1996 C CE1   . PHE B 2 154 ? 36.523  -15.085 14.181  1.00 26.30 ? 154 PHE A CE1   1 
ATOM   1997 C CE2   . PHE B 2 154 ? 34.201  -14.661 14.610  1.00 26.55 ? 154 PHE A CE2   1 
ATOM   1998 C CZ    . PHE B 2 154 ? 35.243  -14.818 13.711  1.00 25.26 ? 154 PHE A CZ    1 
ATOM   1999 N N     . LEU B 2 155 ? 34.712  -12.996 19.493  1.00 30.35 ? 155 LEU A N     1 
ATOM   2000 C CA    . LEU B 2 155 ? 33.733  -11.932 19.718  1.00 29.42 ? 155 LEU A CA    1 
ATOM   2001 C C     . LEU B 2 155 ? 34.348  -10.693 20.373  1.00 29.03 ? 155 LEU A C     1 
ATOM   2002 O O     . LEU B 2 155 ? 34.005  -9.562  20.037  1.00 28.59 ? 155 LEU A O     1 
ATOM   2003 C CB    . LEU B 2 155 ? 32.582  -12.468 20.587  1.00 27.56 ? 155 LEU A CB    1 
ATOM   2004 C CG    . LEU B 2 155 ? 31.727  -13.556 19.923  1.00 26.28 ? 155 LEU A CG    1 
ATOM   2005 C CD1   . LEU B 2 155 ? 30.929  -14.332 20.954  1.00 24.26 ? 155 LEU A CD1   1 
ATOM   2006 C CD2   . LEU B 2 155 ? 30.824  -12.908 18.903  1.00 26.14 ? 155 LEU A CD2   1 
ATOM   2007 N N     . LYS B 2 156 ? 35.248  -10.912 21.320  1.00 29.74 ? 156 LYS A N     1 
ATOM   2008 C CA    . LYS B 2 156 ? 35.906  -9.814  22.010  1.00 29.94 ? 156 LYS A CA    1 
ATOM   2009 C C     . LYS B 2 156 ? 36.740  -9.016  21.006  1.00 29.81 ? 156 LYS A C     1 
ATOM   2010 O O     . LYS B 2 156 ? 36.567  -7.809  20.853  1.00 29.43 ? 156 LYS A O     1 
ATOM   2011 C CB    . LYS B 2 156 ? 36.799  -10.377 23.108  1.00 31.61 ? 156 LYS A CB    1 
ATOM   2012 C CG    . LYS B 2 156 ? 37.574  -9.363  23.924  1.00 35.24 ? 156 LYS A CG    1 
ATOM   2013 C CD    . LYS B 2 156 ? 36.723  -8.742  25.022  1.00 38.96 ? 156 LYS A CD    1 
ATOM   2014 C CE    . LYS B 2 156 ? 37.590  -7.984  26.032  1.00 38.73 ? 156 LYS A CE    1 
ATOM   2015 N NZ    . LYS B 2 156 ? 38.501  -8.897  26.779  1.00 38.01 ? 156 LYS A NZ    1 
ATOM   2016 N N     . ALA B 2 157 ? 37.639  -9.698  20.309  1.00 30.76 ? 157 ALA A N     1 
ATOM   2017 C CA    . ALA B 2 157 ? 38.497  -9.029  19.341  1.00 31.05 ? 157 ALA A CA    1 
ATOM   2018 C C     . ALA B 2 157 ? 37.689  -8.201  18.345  1.00 31.71 ? 157 ALA A C     1 
ATOM   2019 O O     . ALA B 2 157 ? 38.179  -7.193  17.831  1.00 32.74 ? 157 ALA A O     1 
ATOM   2020 C CB    . ALA B 2 157 ? 39.347  -10.056 18.603  1.00 30.35 ? 157 ALA A CB    1 
ATOM   2021 N N     . ASN B 2 158 ? 36.452  -8.621  18.085  1.00 31.64 ? 158 ASN A N     1 
ATOM   2022 C CA    . ASN B 2 158 ? 35.578  -7.931  17.134  1.00 30.82 ? 158 ASN A CA    1 
ATOM   2023 C C     . ASN B 2 158 ? 34.508  -7.052  17.777  1.00 30.38 ? 158 ASN A C     1 
ATOM   2024 O O     . ASN B 2 158 ? 33.448  -6.838  17.193  1.00 30.28 ? 158 ASN A O     1 
ATOM   2025 C CB    . ASN B 2 158 ? 34.912  -8.948  16.204  1.00 31.01 ? 158 ASN A CB    1 
ATOM   2026 C CG    . ASN B 2 158 ? 35.901  -9.627  15.281  1.00 31.55 ? 158 ASN A CG    1 
ATOM   2027 O OD1   . ASN B 2 158 ? 36.263  -9.090  14.235  1.00 31.94 ? 158 ASN A OD1   1 
ATOM   2028 N ND2   . ASN B 2 158 ? 36.357  -10.810 15.671  1.00 30.83 ? 158 ASN A ND2   1 
ATOM   2029 N N     . GLY B 2 159 ? 34.794  -6.561  18.981  1.00 29.58 ? 159 GLY A N     1 
ATOM   2030 C CA    . GLY B 2 159 ? 33.889  -5.671  19.694  1.00 27.68 ? 159 GLY A CA    1 
ATOM   2031 C C     . GLY B 2 159 ? 32.433  -6.031  19.918  1.00 28.47 ? 159 GLY A C     1 
ATOM   2032 O O     . GLY B 2 159 ? 31.574  -5.147  19.954  1.00 27.89 ? 159 GLY A O     1 
ATOM   2033 N N     . ILE B 2 160 ? 32.137  -7.314  20.093  1.00 29.02 ? 160 ILE A N     1 
ATOM   2034 C CA    . ILE B 2 160 ? 30.757  -7.729  20.311  1.00 28.63 ? 160 ILE A CA    1 
ATOM   2035 C C     . ILE B 2 160 ? 30.487  -8.664  21.479  1.00 29.63 ? 160 ILE A C     1 
ATOM   2036 O O     . ILE B 2 160 ? 29.389  -9.207  21.596  1.00 31.00 ? 160 ILE A O     1 
ATOM   2037 C CB    . ILE B 2 160 ? 30.103  -8.207  19.000  1.00 27.96 ? 160 ILE A CB    1 
ATOM   2038 C CG1   . ILE B 2 160 ? 30.978  -9.275  18.344  1.00 26.11 ? 160 ILE A CG1   1 
ATOM   2039 C CG2   . ILE B 2 160 ? 29.882  -7.028  18.070  1.00 27.71 ? 160 ILE A CG2   1 
ATOM   2040 C CD1   . ILE B 2 160 ? 30.407  -9.825  17.064  1.00 24.83 ? 160 ILE A CD1   1 
ATOM   2041 N N     . TYR B 2 161 ? 31.468  -8.832  22.360  1.00 30.34 ? 161 TYR A N     1 
ATOM   2042 C CA    . TYR B 2 161 ? 31.403  -9.869  23.372  1.00 30.47 ? 161 TYR A CA    1 
ATOM   2043 C C     . TYR B 2 161 ? 30.500  -9.688  24.588  1.00 31.80 ? 161 TYR A C     1 
ATOM   2044 O O     . TYR B 2 161 ? 29.802  -10.611 24.965  1.00 35.14 ? 161 TYR A O     1 
ATOM   2045 C CB    . TYR B 2 161 ? 32.789  -10.156 23.943  1.00 29.65 ? 161 TYR A CB    1 
ATOM   2046 C CG    . TYR B 2 161 ? 32.742  -11.150 25.079  1.00 28.60 ? 161 TYR A CG    1 
ATOM   2047 C CD1   . TYR B 2 161 ? 32.037  -12.351 24.948  1.00 28.22 ? 161 TYR A CD1   1 
ATOM   2048 C CD2   . TYR B 2 161 ? 33.347  -10.868 26.304  1.00 28.35 ? 161 TYR A CD2   1 
ATOM   2049 C CE1   . TYR B 2 161 ? 31.928  -13.242 26.010  1.00 29.08 ? 161 TYR A CE1   1 
ATOM   2050 C CE2   . TYR B 2 161 ? 33.246  -11.752 27.378  1.00 28.93 ? 161 TYR A CE2   1 
ATOM   2051 C CZ    . TYR B 2 161 ? 32.536  -12.935 27.226  1.00 29.80 ? 161 TYR A CZ    1 
ATOM   2052 O OH    . TYR B 2 161 ? 32.438  -13.809 28.284  1.00 31.42 ? 161 TYR A OH    1 
ATOM   2053 N N     . GLY B 2 162 ? 30.487  -8.533  25.228  1.00 30.50 ? 162 GLY A N     1 
ATOM   2054 C CA    . GLY B 2 162 ? 29.523  -8.369  26.310  1.00 30.23 ? 162 GLY A CA    1 
ATOM   2055 C C     . GLY B 2 162 ? 28.056  -8.222  25.904  1.00 30.18 ? 162 GLY A C     1 
ATOM   2056 O O     . GLY B 2 162 ? 27.741  -7.862  24.770  1.00 30.41 ? 162 GLY A O     1 
ATOM   2057 N N     . ALA B 2 163 ? 27.140  -8.495  26.829  1.00 29.28 ? 163 ALA A N     1 
ATOM   2058 C CA    . ALA B 2 163 ? 25.715  -8.344  26.532  1.00 29.07 ? 163 ALA A CA    1 
ATOM   2059 C C     . ALA B 2 163 ? 25.155  -7.056  27.137  1.00 28.98 ? 163 ALA A C     1 
ATOM   2060 O O     . ALA B 2 163 ? 23.956  -6.793  27.051  1.00 28.37 ? 163 ALA A O     1 
ATOM   2061 C CB    . ALA B 2 163 ? 24.928  -9.540  27.057  1.00 28.51 ? 163 ALA A CB    1 
ATOM   2062 N N     . GLU B 2 164 ? 26.016  -6.258  27.763  1.00 29.13 ? 164 GLU A N     1 
ATOM   2063 C CA    . GLU B 2 164 ? 25.556  -5.007  28.353  1.00 28.94 ? 164 GLU A CA    1 
ATOM   2064 C C     . GLU B 2 164 ? 25.292  -3.969  27.257  1.00 28.26 ? 164 GLU A C     1 
ATOM   2065 O O     . GLU B 2 164 ? 25.734  -4.124  26.111  1.00 27.82 ? 164 GLU A O     1 
ATOM   2066 C CB    . GLU B 2 164 ? 26.564  -4.468  29.374  1.00 28.30 ? 164 GLU A CB    1 
ATOM   2067 C CG    . GLU B 2 164 ? 27.896  -4.019  28.808  1.00 29.26 ? 164 GLU A CG    1 
ATOM   2068 C CD    . GLU B 2 164 ? 28.823  -5.165  28.464  1.00 30.33 ? 164 GLU A CD    1 
ATOM   2069 O OE1   . GLU B 2 164 ? 30.026  -4.898  28.243  1.00 31.70 ? 164 GLU A OE1   1 
ATOM   2070 O OE2   . GLU B 2 164 ? 28.361  -6.324  28.411  1.00 29.27 ? 164 GLU A OE2   1 
ATOM   2071 N N     . TYR B 2 165 ? 24.577  -2.910  27.614  1.00 26.75 ? 165 TYR A N     1 
ATOM   2072 C CA    . TYR B 2 165 ? 24.216  -1.899  26.644  1.00 25.78 ? 165 TYR A CA    1 
ATOM   2073 C C     . TYR B 2 165 ? 25.325  -1.192  25.880  1.00 26.68 ? 165 TYR A C     1 
ATOM   2074 O O     . TYR B 2 165 ? 25.100  -0.739  24.753  1.00 26.17 ? 165 TYR A O     1 
ATOM   2075 C CB    . TYR B 2 165 ? 23.264  -0.901  27.283  1.00 23.89 ? 165 TYR A CB    1 
ATOM   2076 C CG    . TYR B 2 165 ? 21.859  -1.457  27.367  1.00 21.47 ? 165 TYR A CG    1 
ATOM   2077 C CD1   . TYR B 2 165 ? 21.274  -1.755  28.597  1.00 21.23 ? 165 TYR A CD1   1 
ATOM   2078 C CD2   . TYR B 2 165 ? 21.127  -1.712  26.207  1.00 20.15 ? 165 TYR A CD2   1 
ATOM   2079 C CE1   . TYR B 2 165 ? 19.989  -2.292  28.671  1.00 20.69 ? 165 TYR A CE1   1 
ATOM   2080 C CE2   . TYR B 2 165 ? 19.848  -2.253  26.262  1.00 20.18 ? 165 TYR A CE2   1 
ATOM   2081 C CZ    . TYR B 2 165 ? 19.278  -2.544  27.498  1.00 20.21 ? 165 TYR A CZ    1 
ATOM   2082 O OH    . TYR B 2 165 ? 18.005  -3.079  27.561  1.00 17.48 ? 165 TYR A OH    1 
ATOM   2083 N N     . LYS B 2 166 ? 26.523  -1.103  26.443  1.00 27.45 ? 166 LYS A N     1 
ATOM   2084 C CA    . LYS B 2 166 ? 27.585  -0.457  25.688  1.00 28.66 ? 166 LYS A CA    1 
ATOM   2085 C C     . LYS B 2 166 ? 28.024  -1.364  24.520  1.00 28.04 ? 166 LYS A C     1 
ATOM   2086 O O     . LYS B 2 166 ? 28.698  -0.918  23.590  1.00 28.83 ? 166 LYS A O     1 
ATOM   2087 C CB    . LYS B 2 166 ? 28.782  -0.132  26.591  1.00 29.76 ? 166 LYS A CB    1 
ATOM   2088 C CG    . LYS B 2 166 ? 29.947  0.488   25.822  1.00 32.64 ? 166 LYS A CG    1 
ATOM   2089 C CD    . LYS B 2 166 ? 31.127  0.865   26.712  1.00 35.89 ? 166 LYS A CD    1 
ATOM   2090 C CE    . LYS B 2 166 ? 32.272  1.424   25.863  1.00 38.07 ? 166 LYS A CE    1 
ATOM   2091 N NZ    . LYS B 2 166 ? 33.372  2.052   26.654  1.00 40.64 ? 166 LYS A NZ    1 
ATOM   2092 N N     . VAL B 2 167 ? 27.625  -2.632  24.554  1.00 27.26 ? 167 VAL A N     1 
ATOM   2093 C CA    . VAL B 2 167 ? 28.013  -3.561  23.499  1.00 26.23 ? 167 VAL A CA    1 
ATOM   2094 C C     . VAL B 2 167 ? 26.867  -4.231  22.761  1.00 26.35 ? 167 VAL A C     1 
ATOM   2095 O O     . VAL B 2 167 ? 26.952  -4.439  21.552  1.00 26.52 ? 167 VAL A O     1 
ATOM   2096 C CB    . VAL B 2 167 ? 28.931  -4.684  24.047  1.00 26.42 ? 167 VAL A CB    1 
ATOM   2097 C CG1   . VAL B 2 167 ? 29.354  -5.600  22.920  1.00 23.93 ? 167 VAL A CG1   1 
ATOM   2098 C CG2   . VAL B 2 167 ? 30.152  -4.079  24.724  1.00 24.06 ? 167 VAL A CG2   1 
ATOM   2099 N N     . ARG B 2 168 ? 25.803  -4.578  23.479  1.00 26.55 ? 168 ARG A N     1 
ATOM   2100 C CA    . ARG B 2 168 ? 24.666  -5.257  22.856  1.00 26.95 ? 168 ARG A CA    1 
ATOM   2101 C C     . ARG B 2 168 ? 25.124  -6.488  22.061  1.00 26.41 ? 168 ARG A C     1 
ATOM   2102 O O     . ARG B 2 168 ? 24.669  -6.726  20.944  1.00 26.47 ? 168 ARG A O     1 
ATOM   2103 C CB    . ARG B 2 168 ? 23.920  -4.290  21.938  1.00 26.72 ? 168 ARG A CB    1 
ATOM   2104 C CG    . ARG B 2 168 ? 23.032  -3.308  22.677  1.00 27.01 ? 168 ARG A CG    1 
ATOM   2105 C CD    . ARG B 2 168 ? 22.607  -2.196  21.756  1.00 28.40 ? 168 ARG A CD    1 
ATOM   2106 N NE    . ARG B 2 168 ? 21.653  -1.278  22.368  1.00 30.80 ? 168 ARG A NE    1 
ATOM   2107 C CZ    . ARG B 2 168 ? 20.415  -1.606  22.719  1.00 32.92 ? 168 ARG A CZ    1 
ATOM   2108 N NH1   . ARG B 2 168 ? 19.969  -2.846  22.528  1.00 34.96 ? 168 ARG A NH1   1 
ATOM   2109 N NH2   . ARG B 2 168 ? 19.612  -0.684  23.235  1.00 32.76 ? 168 ARG A NH2   1 
ATOM   2110 N N     . GLY B 2 169 ? 26.034  -7.261  22.648  1.00 26.24 ? 169 GLY A N     1 
ATOM   2111 C CA    . GLY B 2 169 ? 26.552  -8.448  21.989  1.00 25.48 ? 169 GLY A CA    1 
ATOM   2112 C C     . GLY B 2 169 ? 26.166  -9.769  22.636  1.00 24.73 ? 169 GLY A C     1 
ATOM   2113 O O     . GLY B 2 169 ? 25.086  -9.894  23.217  1.00 23.42 ? 169 GLY A O     1 
ATOM   2114 N N     . PHE B 2 170 ? 27.063  -10.749 22.532  1.00 24.54 ? 170 PHE A N     1 
ATOM   2115 C CA    . PHE B 2 170 ? 26.851  -12.101 23.061  1.00 23.81 ? 170 PHE A CA    1 
ATOM   2116 C C     . PHE B 2 170 ? 27.365  -12.409 24.459  1.00 23.18 ? 170 PHE A C     1 
ATOM   2117 O O     . PHE B 2 170 ? 28.562  -12.595 24.633  1.00 23.95 ? 170 PHE A O     1 
ATOM   2118 C CB    . PHE B 2 170 ? 27.583  -13.142 22.196  1.00 24.72 ? 170 PHE A CB    1 
ATOM   2119 C CG    . PHE B 2 170 ? 27.193  -13.142 20.741  1.00 25.37 ? 170 PHE A CG    1 
ATOM   2120 C CD1   . PHE B 2 170 ? 27.474  -12.058 19.926  1.00 26.08 ? 170 PHE A CD1   1 
ATOM   2121 C CD2   . PHE B 2 170 ? 26.573  -14.251 20.182  1.00 25.22 ? 170 PHE A CD2   1 
ATOM   2122 C CE1   . PHE B 2 170 ? 27.144  -12.079 18.569  1.00 25.74 ? 170 PHE A CE1   1 
ATOM   2123 C CE2   . PHE B 2 170 ? 26.240  -14.281 18.835  1.00 24.35 ? 170 PHE A CE2   1 
ATOM   2124 C CZ    . PHE B 2 170 ? 26.525  -13.193 18.028  1.00 25.15 ? 170 PHE A CZ    1 
ATOM   2125 N N     . SER B 2 171 ? 26.481  -12.521 25.447  1.00 22.91 ? 171 SER A N     1 
ATOM   2126 C CA    . SER B 2 171 ? 26.933  -12.735 26.828  1.00 21.87 ? 171 SER A CA    1 
ATOM   2127 C C     . SER B 2 171 ? 27.743  -14.024 26.945  1.00 22.69 ? 171 SER A C     1 
ATOM   2128 O O     . SER B 2 171 ? 27.719  -14.869 26.049  1.00 21.17 ? 171 SER A O     1 
ATOM   2129 C CB    . SER B 2 171 ? 25.745  -12.829 27.779  1.00 22.60 ? 171 SER A CB    1 
ATOM   2130 O OG    . SER B 2 171 ? 25.007  -14.012 27.551  1.00 21.67 ? 171 SER A OG    1 
ATOM   2131 N N     . GLY B 2 172 ? 28.467  -14.170 28.051  1.00 23.18 ? 172 GLY A N     1 
ATOM   2132 C CA    . GLY B 2 172 ? 29.246  -15.377 28.259  1.00 23.70 ? 172 GLY A CA    1 
ATOM   2133 C C     . GLY B 2 172 ? 28.328  -16.587 28.195  1.00 25.56 ? 172 GLY A C     1 
ATOM   2134 O O     . GLY B 2 172 ? 28.554  -17.511 27.406  1.00 26.92 ? 172 GLY A O     1 
ATOM   2135 N N     . TYR B 2 173 ? 27.277  -16.570 29.015  1.00 25.32 ? 173 TYR A N     1 
ATOM   2136 C CA    . TYR B 2 173 ? 26.299  -17.649 29.065  1.00 26.10 ? 173 TYR A CA    1 
ATOM   2137 C C     . TYR B 2 173 ? 25.818  -18.043 27.667  1.00 26.53 ? 173 TYR A C     1 
ATOM   2138 O O     . TYR B 2 173 ? 25.661  -19.225 27.369  1.00 26.60 ? 173 TYR A O     1 
ATOM   2139 C CB    . TYR B 2 173 ? 25.101  -17.234 29.927  1.00 26.17 ? 173 TYR A CB    1 
ATOM   2140 C CG    . TYR B 2 173 ? 24.026  -18.295 30.040  1.00 28.78 ? 173 TYR A CG    1 
ATOM   2141 C CD1   . TYR B 2 173 ? 24.354  -19.623 30.329  1.00 30.01 ? 173 TYR A CD1   1 
ATOM   2142 C CD2   . TYR B 2 173 ? 22.675  -17.969 29.892  1.00 29.25 ? 173 TYR A CD2   1 
ATOM   2143 C CE1   . TYR B 2 173 ? 23.356  -20.602 30.472  1.00 31.43 ? 173 TYR A CE1   1 
ATOM   2144 C CE2   . TYR B 2 173 ? 21.672  -18.937 30.028  1.00 30.49 ? 173 TYR A CE2   1 
ATOM   2145 C CZ    . TYR B 2 173 ? 22.019  -20.253 30.320  1.00 31.84 ? 173 TYR A CZ    1 
ATOM   2146 O OH    . TYR B 2 173 ? 21.032  -21.211 30.466  1.00 31.71 ? 173 TYR A OH    1 
ATOM   2147 N N     . LEU B 2 174 ? 25.580  -17.052 26.814  1.00 26.00 ? 174 LEU A N     1 
ATOM   2148 C CA    . LEU B 2 174 ? 25.132  -17.334 25.461  1.00 26.03 ? 174 LEU A CA    1 
ATOM   2149 C C     . LEU B 2 174 ? 26.202  -18.112 24.722  1.00 26.03 ? 174 LEU A C     1 
ATOM   2150 O O     . LEU B 2 174 ? 25.894  -19.013 23.945  1.00 27.67 ? 174 LEU A O     1 
ATOM   2151 C CB    . LEU B 2 174 ? 24.835  -16.038 24.695  1.00 23.89 ? 174 LEU A CB    1 
ATOM   2152 C CG    . LEU B 2 174 ? 24.509  -16.254 23.208  1.00 23.47 ? 174 LEU A CG    1 
ATOM   2153 C CD1   . LEU B 2 174 ? 23.423  -17.335 23.067  1.00 21.91 ? 174 LEU A CD1   1 
ATOM   2154 C CD2   . LEU B 2 174 ? 24.073  -14.936 22.566  1.00 21.56 ? 174 LEU A CD2   1 
ATOM   2155 N N     . CYS B 2 175 ? 27.459  -17.760 24.958  1.00 25.53 ? 175 CYS A N     1 
ATOM   2156 C CA    . CYS B 2 175 ? 28.569  -18.432 24.299  1.00 26.67 ? 175 CYS A CA    1 
ATOM   2157 C C     . CYS B 2 175 ? 28.618  -19.913 24.673  1.00 27.01 ? 175 CYS A C     1 
ATOM   2158 O O     . CYS B 2 175 ? 28.823  -20.774 23.820  1.00 26.87 ? 175 CYS A O     1 
ATOM   2159 C CB    . CYS B 2 175 ? 29.896  -17.762 24.675  1.00 27.44 ? 175 CYS A CB    1 
ATOM   2160 S SG    . CYS B 2 175 ? 30.108  -16.091 24.027  1.00 28.86 ? 175 CYS A SG    1 
ATOM   2161 N N     . GLU B 2 176 ? 28.424  -20.205 25.953  1.00 26.73 ? 176 GLU A N     1 
ATOM   2162 C CA    . GLU B 2 176 ? 28.455  -21.577 26.410  1.00 26.23 ? 176 GLU A CA    1 
ATOM   2163 C C     . GLU B 2 176 ? 27.285  -22.400 25.918  1.00 25.49 ? 176 GLU A C     1 
ATOM   2164 O O     . GLU B 2 176 ? 27.458  -23.577 25.616  1.00 25.41 ? 176 GLU A O     1 
ATOM   2165 C CB    . GLU B 2 176 ? 28.571  -21.614 27.927  1.00 25.63 ? 176 GLU A CB    1 
ATOM   2166 C CG    . GLU B 2 176 ? 29.942  -21.123 28.338  1.00 27.24 ? 176 GLU A CG    1 
ATOM   2167 C CD    . GLU B 2 176 ? 30.249  -21.348 29.787  1.00 27.22 ? 176 GLU A CD    1 
ATOM   2168 O OE1   . GLU B 2 176 ? 30.205  -22.514 30.234  1.00 26.58 ? 176 GLU A OE1   1 
ATOM   2169 O OE2   . GLU B 2 176 ? 30.546  -20.350 30.471  1.00 28.63 ? 176 GLU A OE2   1 
ATOM   2170 N N     . LEU B 2 177 ? 26.101  -21.801 25.821  1.00 25.32 ? 177 LEU A N     1 
ATOM   2171 C CA    . LEU B 2 177 ? 24.962  -22.545 25.303  1.00 25.40 ? 177 LEU A CA    1 
ATOM   2172 C C     . LEU B 2 177 ? 25.254  -22.836 23.825  1.00 27.37 ? 177 LEU A C     1 
ATOM   2173 O O     . LEU B 2 177 ? 24.875  -23.877 23.299  1.00 28.06 ? 177 LEU A O     1 
ATOM   2174 C CB    . LEU B 2 177 ? 23.662  -21.747 25.427  1.00 22.18 ? 177 LEU A CB    1 
ATOM   2175 C CG    . LEU B 2 177 ? 23.139  -21.433 26.835  1.00 22.32 ? 177 LEU A CG    1 
ATOM   2176 C CD1   . LEU B 2 177 ? 21.853  -20.644 26.696  1.00 20.84 ? 177 LEU A CD1   1 
ATOM   2177 C CD2   . LEU B 2 177 ? 22.899  -22.699 27.646  1.00 20.43 ? 177 LEU A CD2   1 
ATOM   2178 N N     . LEU B 2 178 ? 25.950  -21.920 23.159  1.00 28.91 ? 178 LEU A N     1 
ATOM   2179 C CA    . LEU B 2 178 ? 26.274  -22.117 21.748  1.00 29.65 ? 178 LEU A CA    1 
ATOM   2180 C C     . LEU B 2 178 ? 27.224  -23.296 21.519  1.00 29.80 ? 178 LEU A C     1 
ATOM   2181 O O     . LEU B 2 178 ? 27.084  -24.035 20.540  1.00 29.91 ? 178 LEU A O     1 
ATOM   2182 C CB    . LEU B 2 178 ? 26.860  -20.832 21.154  1.00 29.08 ? 178 LEU A CB    1 
ATOM   2183 C CG    . LEU B 2 178 ? 25.826  -19.731 20.887  1.00 29.57 ? 178 LEU A CG    1 
ATOM   2184 C CD1   . LEU B 2 178 ? 26.507  -18.479 20.356  1.00 29.76 ? 178 LEU A CD1   1 
ATOM   2185 C CD2   . LEU B 2 178 ? 24.802  -20.238 19.879  1.00 29.74 ? 178 LEU A CD2   1 
ATOM   2186 N N     . ILE B 2 179 ? 28.186  -23.477 22.418  1.00 29.28 ? 179 ILE A N     1 
ATOM   2187 C CA    . ILE B 2 179 ? 29.125  -24.585 22.288  1.00 29.12 ? 179 ILE A CA    1 
ATOM   2188 C C     . ILE B 2 179 ? 28.434  -25.900 22.638  1.00 29.22 ? 179 ILE A C     1 
ATOM   2189 O O     . ILE B 2 179 ? 28.659  -26.926 21.998  1.00 29.82 ? 179 ILE A O     1 
ATOM   2190 C CB    . ILE B 2 179 ? 30.359  -24.398 23.198  1.00 28.95 ? 179 ILE A CB    1 
ATOM   2191 C CG1   . ILE B 2 179 ? 31.150  -23.175 22.737  1.00 28.64 ? 179 ILE A CG1   1 
ATOM   2192 C CG2   . ILE B 2 179 ? 31.239  -25.649 23.160  1.00 28.62 ? 179 ILE A CG2   1 
ATOM   2193 C CD1   . ILE B 2 179 ? 31.529  -23.220 21.275  1.00 28.47 ? 179 ILE A CD1   1 
ATOM   2194 N N     . VAL B 2 180 ? 27.587  -25.873 23.655  1.00 28.38 ? 180 VAL A N     1 
ATOM   2195 C CA    . VAL B 2 180 ? 26.878  -27.078 24.033  1.00 27.50 ? 180 VAL A CA    1 
ATOM   2196 C C     . VAL B 2 180 ? 26.043  -27.533 22.847  1.00 27.78 ? 180 VAL A C     1 
ATOM   2197 O O     . VAL B 2 180 ? 25.876  -28.737 22.615  1.00 28.40 ? 180 VAL A O     1 
ATOM   2198 C CB    . VAL B 2 180 ? 25.952  -26.831 25.239  1.00 26.82 ? 180 VAL A CB    1 
ATOM   2199 C CG1   . VAL B 2 180 ? 24.959  -27.981 25.386  1.00 25.22 ? 180 VAL A CG1   1 
ATOM   2200 C CG2   . VAL B 2 180 ? 26.794  -26.680 26.511  1.00 25.35 ? 180 VAL A CG2   1 
ATOM   2201 N N     . PHE B 2 181 ? 25.539  -26.563 22.090  1.00 26.64 ? 181 PHE A N     1 
ATOM   2202 C CA    . PHE B 2 181 ? 24.697  -26.850 20.934  1.00 26.02 ? 181 PHE A CA    1 
ATOM   2203 C C     . PHE B 2 181 ? 25.462  -27.317 19.693  1.00 25.37 ? 181 PHE A C     1 
ATOM   2204 O O     . PHE B 2 181 ? 25.171  -28.369 19.129  1.00 25.30 ? 181 PHE A O     1 
ATOM   2205 C CB    . PHE B 2 181 ? 23.874  -25.616 20.562  1.00 24.80 ? 181 PHE A CB    1 
ATOM   2206 C CG    . PHE B 2 181 ? 22.689  -25.917 19.678  1.00 25.02 ? 181 PHE A CG    1 
ATOM   2207 C CD1   . PHE B 2 181 ? 21.478  -26.339 20.232  1.00 24.28 ? 181 PHE A CD1   1 
ATOM   2208 C CD2   . PHE B 2 181 ? 22.771  -25.751 18.299  1.00 24.08 ? 181 PHE A CD2   1 
ATOM   2209 C CE1   . PHE B 2 181 ? 20.363  -26.585 19.428  1.00 22.99 ? 181 PHE A CE1   1 
ATOM   2210 C CE2   . PHE B 2 181 ? 21.661  -25.996 17.482  1.00 23.14 ? 181 PHE A CE2   1 
ATOM   2211 C CZ    . PHE B 2 181 ? 20.454  -26.411 18.052  1.00 23.72 ? 181 PHE A CZ    1 
ATOM   2212 N N     . TYR B 2 182 ? 26.432  -26.530 19.259  1.00 25.42 ? 182 TYR A N     1 
ATOM   2213 C CA    . TYR B 2 182 ? 27.175  -26.886 18.072  1.00 25.80 ? 182 TYR A CA    1 
ATOM   2214 C C     . TYR B 2 182 ? 28.329  -27.838 18.318  1.00 26.84 ? 182 TYR A C     1 
ATOM   2215 O O     . TYR B 2 182 ? 28.790  -28.502 17.393  1.00 28.73 ? 182 TYR A O     1 
ATOM   2216 C CB    . TYR B 2 182 ? 27.639  -25.614 17.372  1.00 25.33 ? 182 TYR A CB    1 
ATOM   2217 C CG    . TYR B 2 182 ? 26.480  -24.855 16.771  1.00 24.41 ? 182 TYR A CG    1 
ATOM   2218 C CD1   . TYR B 2 182 ? 25.757  -25.393 15.698  1.00 24.25 ? 182 TYR A CD1   1 
ATOM   2219 C CD2   . TYR B 2 182 ? 26.074  -23.625 17.291  1.00 22.80 ? 182 TYR A CD2   1 
ATOM   2220 C CE1   . TYR B 2 182 ? 24.662  -24.726 15.161  1.00 24.10 ? 182 TYR A CE1   1 
ATOM   2221 C CE2   . TYR B 2 182 ? 24.971  -22.948 16.762  1.00 22.40 ? 182 TYR A CE2   1 
ATOM   2222 C CZ    . TYR B 2 182 ? 24.273  -23.508 15.698  1.00 23.69 ? 182 TYR A CZ    1 
ATOM   2223 O OH    . TYR B 2 182 ? 23.184  -22.866 15.170  1.00 24.85 ? 182 TYR A OH    1 
ATOM   2224 N N     . GLY B 2 183 ? 28.793  -27.914 19.561  1.00 27.74 ? 183 GLY A N     1 
ATOM   2225 C CA    . GLY B 2 183 ? 29.875  -28.827 19.887  1.00 28.05 ? 183 GLY A CA    1 
ATOM   2226 C C     . GLY B 2 183 ? 31.259  -28.215 19.931  1.00 29.35 ? 183 GLY A C     1 
ATOM   2227 O O     . GLY B 2 183 ? 32.132  -28.725 20.625  1.00 30.82 ? 183 GLY A O     1 
ATOM   2228 N N     . SER B 2 184 ? 31.471  -27.133 19.189  1.00 29.03 ? 184 SER A N     1 
ATOM   2229 C CA    . SER B 2 184 ? 32.777  -26.482 19.166  1.00 28.79 ? 184 SER A CA    1 
ATOM   2230 C C     . SER B 2 184 ? 32.697  -25.121 18.488  1.00 29.42 ? 184 SER A C     1 
ATOM   2231 O O     . SER B 2 184 ? 31.666  -24.757 17.921  1.00 29.90 ? 184 SER A O     1 
ATOM   2232 C CB    . SER B 2 184 ? 33.791  -27.347 18.417  1.00 28.18 ? 184 SER A CB    1 
ATOM   2233 O OG    . SER B 2 184 ? 33.616  -27.237 17.011  1.00 26.16 ? 184 SER A OG    1 
ATOM   2234 N N     . PHE B 2 185 ? 33.797  -24.380 18.552  1.00 29.58 ? 185 PHE A N     1 
ATOM   2235 C CA    . PHE B 2 185 ? 33.878  -23.059 17.942  1.00 31.33 ? 185 PHE A CA    1 
ATOM   2236 C C     . PHE B 2 185 ? 33.709  -23.126 16.432  1.00 32.57 ? 185 PHE A C     1 
ATOM   2237 O O     . PHE B 2 185 ? 32.962  -22.338 15.851  1.00 34.24 ? 185 PHE A O     1 
ATOM   2238 C CB    . PHE B 2 185 ? 35.223  -22.403 18.281  1.00 31.81 ? 185 PHE A CB    1 
ATOM   2239 C CG    . PHE B 2 185 ? 35.512  -21.154 17.495  1.00 32.20 ? 185 PHE A CG    1 
ATOM   2240 C CD1   . PHE B 2 185 ? 36.210  -21.217 16.296  1.00 33.39 ? 185 PHE A CD1   1 
ATOM   2241 C CD2   . PHE B 2 185 ? 35.087  -19.911 17.957  1.00 32.51 ? 185 PHE A CD2   1 
ATOM   2242 C CE1   . PHE B 2 185 ? 36.484  -20.047 15.563  1.00 33.94 ? 185 PHE A CE1   1 
ATOM   2243 C CE2   . PHE B 2 185 ? 35.354  -18.745 17.237  1.00 32.55 ? 185 PHE A CE2   1 
ATOM   2244 C CZ    . PHE B 2 185 ? 36.053  -18.812 16.040  1.00 32.87 ? 185 PHE A CZ    1 
ATOM   2245 N N     . LEU B 2 186 ? 34.396  -24.069 15.797  1.00 32.76 ? 186 LEU A N     1 
ATOM   2246 C CA    . LEU B 2 186 ? 34.306  -24.199 14.354  1.00 32.73 ? 186 LEU A CA    1 
ATOM   2247 C C     . LEU B 2 186 ? 32.879  -24.485 13.904  1.00 32.20 ? 186 LEU A C     1 
ATOM   2248 O O     . LEU B 2 186 ? 32.391  -23.863 12.967  1.00 33.03 ? 186 LEU A O     1 
ATOM   2249 C CB    . LEU B 2 186 ? 35.257  -25.291 13.854  1.00 33.21 ? 186 LEU A CB    1 
ATOM   2250 C CG    . LEU B 2 186 ? 35.468  -25.366 12.333  1.00 34.22 ? 186 LEU A CG    1 
ATOM   2251 C CD1   . LEU B 2 186 ? 35.803  -23.985 11.786  1.00 32.71 ? 186 LEU A CD1   1 
ATOM   2252 C CD2   . LEU B 2 186 ? 36.592  -26.340 12.010  1.00 33.19 ? 186 LEU A CD2   1 
ATOM   2253 N N     . GLU B 2 187 ? 32.201  -25.413 14.569  1.00 31.81 ? 187 GLU A N     1 
ATOM   2254 C CA    . GLU B 2 187 ? 30.829  -25.735 14.192  1.00 31.81 ? 187 GLU A CA    1 
ATOM   2255 C C     . GLU B 2 187 ? 29.868  -24.574 14.429  1.00 31.96 ? 187 GLU A C     1 
ATOM   2256 O O     . GLU B 2 187 ? 28.910  -24.401 13.673  1.00 31.08 ? 187 GLU A O     1 
ATOM   2257 C CB    . GLU B 2 187 ? 30.341  -26.976 14.941  1.00 32.55 ? 187 GLU A CB    1 
ATOM   2258 C CG    . GLU B 2 187 ? 30.976  -28.258 14.444  1.00 36.11 ? 187 GLU A CG    1 
ATOM   2259 C CD    . GLU B 2 187 ? 30.769  -28.473 12.948  1.00 37.99 ? 187 GLU A CD    1 
ATOM   2260 O OE1   . GLU B 2 187 ? 29.597  -28.619 12.521  1.00 38.32 ? 187 GLU A OE1   1 
ATOM   2261 O OE2   . GLU B 2 187 ? 31.782  -28.489 12.204  1.00 37.54 ? 187 GLU A OE2   1 
ATOM   2262 N N     . THR B 2 188 ? 30.113  -23.786 15.478  1.00 31.17 ? 188 THR A N     1 
ATOM   2263 C CA    . THR B 2 188 ? 29.256  -22.641 15.765  1.00 30.33 ? 188 THR A CA    1 
ATOM   2264 C C     . THR B 2 188 ? 29.425  -21.653 14.617  1.00 30.47 ? 188 THR A C     1 
ATOM   2265 O O     . THR B 2 188 ? 28.447  -21.156 14.053  1.00 31.54 ? 188 THR A O     1 
ATOM   2266 C CB    . THR B 2 188 ? 29.644  -21.943 17.096  1.00 30.27 ? 188 THR A CB    1 
ATOM   2267 O OG1   . THR B 2 188 ? 29.501  -22.864 18.183  1.00 29.49 ? 188 THR A OG1   1 
ATOM   2268 C CG2   . THR B 2 188 ? 28.737  -20.740 17.355  1.00 29.26 ? 188 THR A CG2   1 
ATOM   2269 N N     . VAL B 2 189 ? 30.675  -21.385 14.265  1.00 29.74 ? 189 VAL A N     1 
ATOM   2270 C CA    . VAL B 2 189 ? 30.990  -20.474 13.180  1.00 30.07 ? 189 VAL A CA    1 
ATOM   2271 C C     . VAL B 2 189 ? 30.404  -20.944 11.846  1.00 31.24 ? 189 VAL A C     1 
ATOM   2272 O O     . VAL B 2 189 ? 29.701  -20.191 11.166  1.00 31.93 ? 189 VAL A O     1 
ATOM   2273 C CB    . VAL B 2 189 ? 32.518  -20.310 13.042  1.00 29.86 ? 189 VAL A CB    1 
ATOM   2274 C CG1   . VAL B 2 189 ? 32.845  -19.470 11.819  1.00 30.03 ? 189 VAL A CG1   1 
ATOM   2275 C CG2   . VAL B 2 189 ? 33.083  -19.651 14.300  1.00 28.36 ? 189 VAL A CG2   1 
ATOM   2276 N N     . LYS B 2 190 ? 30.686  -22.186 11.467  1.00 32.80 ? 190 LYS A N     1 
ATOM   2277 C CA    . LYS B 2 190 ? 30.168  -22.715 10.210  1.00 33.40 ? 190 LYS A CA    1 
ATOM   2278 C C     . LYS B 2 190 ? 28.662  -22.507 10.090  1.00 33.10 ? 190 LYS A C     1 
ATOM   2279 O O     . LYS B 2 190 ? 28.179  -21.943 9.108   1.00 33.88 ? 190 LYS A O     1 
ATOM   2280 C CB    . LYS B 2 190 ? 30.462  -24.206 10.087  1.00 35.18 ? 190 LYS A CB    1 
ATOM   2281 C CG    . LYS B 2 190 ? 31.911  -24.570 9.790   1.00 38.00 ? 190 LYS A CG    1 
ATOM   2282 C CD    . LYS B 2 190 ? 32.025  -26.088 9.672   1.00 40.47 ? 190 LYS A CD    1 
ATOM   2283 C CE    . LYS B 2 190 ? 33.453  -26.574 9.490   1.00 42.43 ? 190 LYS A CE    1 
ATOM   2284 N NZ    . LYS B 2 190 ? 33.532  -28.074 9.607   1.00 42.56 ? 190 LYS A NZ    1 
ATOM   2285 N N     . ASN B 2 191 ? 27.926  -22.964 11.095  1.00 31.62 ? 191 ASN A N     1 
ATOM   2286 C CA    . ASN B 2 191 ? 26.476  -22.855 11.093  1.00 31.50 ? 191 ASN A CA    1 
ATOM   2287 C C     . ASN B 2 191 ? 25.974  -21.425 11.233  1.00 32.00 ? 191 ASN A C     1 
ATOM   2288 O O     . ASN B 2 191 ? 24.946  -21.052 10.640  1.00 30.07 ? 191 ASN A O     1 
ATOM   2289 C CB    . ASN B 2 191 ? 25.898  -23.735 12.203  1.00 32.39 ? 191 ASN A CB    1 
ATOM   2290 C CG    . ASN B 2 191 ? 26.051  -25.223 11.906  1.00 31.98 ? 191 ASN A CG    1 
ATOM   2291 O OD1   . ASN B 2 191 ? 25.232  -25.809 11.210  1.00 32.78 ? 191 ASN A OD1   1 
ATOM   2292 N ND2   . ASN B 2 191 ? 27.109  -25.833 12.429  1.00 32.78 ? 191 ASN A ND2   1 
ATOM   2293 N N     . ALA B 2 192 ? 26.694  -20.621 12.014  1.00 32.75 ? 192 ALA A N     1 
ATOM   2294 C CA    . ALA B 2 192 ? 26.309  -19.220 12.213  1.00 32.29 ? 192 ALA A CA    1 
ATOM   2295 C C     . ALA B 2 192 ? 26.136  -18.510 10.867  1.00 31.98 ? 192 ALA A C     1 
ATOM   2296 O O     . ALA B 2 192 ? 25.277  -17.640 10.729  1.00 32.26 ? 192 ALA A O     1 
ATOM   2297 C CB    . ALA B 2 192 ? 27.348  -18.504 13.053  1.00 31.22 ? 192 ALA A CB    1 
ATOM   2298 N N     . ARG B 2 193 ? 26.947  -18.899 9.881   1.00 31.49 ? 193 ARG A N     1 
ATOM   2299 C CA    . ARG B 2 193 ? 26.895  -18.310 8.541   1.00 31.32 ? 193 ARG A CA    1 
ATOM   2300 C C     . ARG B 2 193 ? 25.526  -18.455 7.882   1.00 31.80 ? 193 ARG A C     1 
ATOM   2301 O O     . ARG B 2 193 ? 25.237  -17.783 6.887   1.00 30.50 ? 193 ARG A O     1 
ATOM   2302 C CB    . ARG B 2 193 ? 27.936  -18.958 7.630   1.00 30.05 ? 193 ARG A CB    1 
ATOM   2303 C CG    . ARG B 2 193 ? 29.369  -18.726 8.033   1.00 29.92 ? 193 ARG A CG    1 
ATOM   2304 C CD    . ARG B 2 193 ? 30.320  -19.456 7.093   1.00 30.73 ? 193 ARG A CD    1 
ATOM   2305 N NE    . ARG B 2 193 ? 30.076  -20.897 7.083   1.00 29.59 ? 193 ARG A NE    1 
ATOM   2306 C CZ    . ARG B 2 193 ? 30.685  -21.761 6.275   1.00 29.23 ? 193 ARG A CZ    1 
ATOM   2307 N NH1   . ARG B 2 193 ? 31.585  -21.338 5.398   1.00 27.66 ? 193 ARG A NH1   1 
ATOM   2308 N NH2   . ARG B 2 193 ? 30.394  -23.054 6.343   1.00 28.23 ? 193 ARG A NH2   1 
ATOM   2309 N N     . ARG B 2 194 ? 24.691  -19.326 8.449   1.00 33.37 ? 194 ARG A N     1 
ATOM   2310 C CA    . ARG B 2 194 ? 23.360  -19.602 7.912   1.00 33.66 ? 194 ARG A CA    1 
ATOM   2311 C C     . ARG B 2 194 ? 22.273  -18.930 8.727   1.00 32.36 ? 194 ARG A C     1 
ATOM   2312 O O     . ARG B 2 194 ? 21.100  -18.995 8.371   1.00 32.62 ? 194 ARG A O     1 
ATOM   2313 C CB    . ARG B 2 194 ? 23.110  -21.107 7.904   1.00 37.58 ? 194 ARG A CB    1 
ATOM   2314 C CG    . ARG B 2 194 ? 24.306  -21.932 7.472   1.00 43.91 ? 194 ARG A CG    1 
ATOM   2315 C CD    . ARG B 2 194 ? 24.509  -21.879 5.968   1.00 49.57 ? 194 ARG A CD    1 
ATOM   2316 N NE    . ARG B 2 194 ? 23.430  -22.554 5.248   1.00 54.90 ? 194 ARG A NE    1 
ATOM   2317 C CZ    . ARG B 2 194 ? 23.070  -23.821 5.447   1.00 57.07 ? 194 ARG A CZ    1 
ATOM   2318 N NH1   . ARG B 2 194 ? 23.701  -24.562 6.352   1.00 57.97 ? 194 ARG A NH1   1 
ATOM   2319 N NH2   . ARG B 2 194 ? 22.081  -24.353 4.737   1.00 58.25 ? 194 ARG A NH2   1 
ATOM   2320 N N     . TRP B 2 195 ? 22.666  -18.298 9.829   1.00 31.01 ? 195 TRP A N     1 
ATOM   2321 C CA    . TRP B 2 195 ? 21.723  -17.611 10.700  1.00 30.37 ? 195 TRP A CA    1 
ATOM   2322 C C     . TRP B 2 195 ? 21.001  -16.443 10.018  1.00 31.34 ? 195 TRP A C     1 
ATOM   2323 O O     . TRP B 2 195 ? 21.568  -15.733 9.184   1.00 31.16 ? 195 TRP A O     1 
ATOM   2324 C CB    . TRP B 2 195 ? 22.443  -17.096 11.952  1.00 31.14 ? 195 TRP A CB    1 
ATOM   2325 C CG    . TRP B 2 195 ? 22.858  -18.178 12.926  1.00 30.40 ? 195 TRP A CG    1 
ATOM   2326 C CD1   . TRP B 2 195 ? 22.622  -19.520 12.815  1.00 30.28 ? 195 TRP A CD1   1 
ATOM   2327 C CD2   . TRP B 2 195 ? 23.580  -17.999 14.152  1.00 28.93 ? 195 TRP A CD2   1 
ATOM   2328 N NE1   . TRP B 2 195 ? 23.152  -20.188 13.896  1.00 29.03 ? 195 TRP A NE1   1 
ATOM   2329 C CE2   . TRP B 2 195 ? 23.745  -19.281 14.729  1.00 29.61 ? 195 TRP A CE2   1 
ATOM   2330 C CE3   . TRP B 2 195 ? 24.100  -16.885 14.818  1.00 27.92 ? 195 TRP A CE3   1 
ATOM   2331 C CZ2   . TRP B 2 195 ? 24.417  -19.475 15.945  1.00 28.68 ? 195 TRP A CZ2   1 
ATOM   2332 C CZ3   . TRP B 2 195 ? 24.765  -17.076 16.024  1.00 27.28 ? 195 TRP A CZ3   1 
ATOM   2333 C CH2   . TRP B 2 195 ? 24.916  -18.364 16.575  1.00 28.66 ? 195 TRP A CH2   1 
ATOM   2334 N N     . THR B 2 196 ? 19.737  -16.254 10.379  1.00 31.43 ? 196 THR A N     1 
ATOM   2335 C CA    . THR B 2 196 ? 18.935  -15.168 9.829   1.00 30.96 ? 196 THR A CA    1 
ATOM   2336 C C     . THR B 2 196 ? 18.380  -14.396 11.007  1.00 30.73 ? 196 THR A C     1 
ATOM   2337 O O     . THR B 2 196 ? 18.484  -14.837 12.147  1.00 31.56 ? 196 THR A O     1 
ATOM   2338 C CB    . THR B 2 196 ? 17.734  -15.689 9.023   1.00 30.93 ? 196 THR A CB    1 
ATOM   2339 O OG1   . THR B 2 196 ? 16.763  -16.233 9.925   1.00 32.57 ? 196 THR A OG1   1 
ATOM   2340 C CG2   . THR B 2 196 ? 18.163  -16.762 8.053   1.00 29.99 ? 196 THR A CG2   1 
ATOM   2341 N N     . ARG B 2 197 ? 17.776  -13.249 10.732  1.00 31.48 ? 197 ARG A N     1 
ATOM   2342 C CA    . ARG B 2 197 ? 17.189  -12.436 11.793  1.00 31.66 ? 197 ARG A CA    1 
ATOM   2343 C C     . ARG B 2 197 ? 15.931  -13.137 12.333  1.00 31.53 ? 197 ARG A C     1 
ATOM   2344 O O     . ARG B 2 197 ? 15.226  -12.610 13.194  1.00 31.10 ? 197 ARG A O     1 
ATOM   2345 C CB    . ARG B 2 197 ? 16.831  -11.048 11.246  1.00 31.57 ? 197 ARG A CB    1 
ATOM   2346 C CG    . ARG B 2 197 ? 15.630  -11.021 10.296  1.00 30.76 ? 197 ARG A CG    1 
ATOM   2347 C CD    . ARG B 2 197 ? 15.547  -9.679  9.591   1.00 30.58 ? 197 ARG A CD    1 
ATOM   2348 N NE    . ARG B 2 197 ? 16.650  -9.518  8.650   1.00 31.51 ? 197 ARG A NE    1 
ATOM   2349 C CZ    . ARG B 2 197 ? 17.055  -8.353  8.158   1.00 31.53 ? 197 ARG A CZ    1 
ATOM   2350 N NH1   . ARG B 2 197 ? 16.447  -7.233  8.525   1.00 31.74 ? 197 ARG A NH1   1 
ATOM   2351 N NH2   . ARG B 2 197 ? 18.060  -8.312  7.289   1.00 29.27 ? 197 ARG A NH2   1 
ATOM   2352 N N     . ARG B 2 198 ? 15.655  -14.334 11.826  1.00 31.16 ? 198 ARG A N     1 
ATOM   2353 C CA    . ARG B 2 198 ? 14.484  -15.071 12.271  1.00 32.66 ? 198 ARG A CA    1 
ATOM   2354 C C     . ARG B 2 198 ? 14.838  -16.376 12.977  1.00 31.40 ? 198 ARG A C     1 
ATOM   2355 O O     . ARG B 2 198 ? 13.958  -17.100 13.434  1.00 31.53 ? 198 ARG A O     1 
ATOM   2356 C CB    . ARG B 2 198 ? 13.574  -15.359 11.075  1.00 35.16 ? 198 ARG A CB    1 
ATOM   2357 C CG    . ARG B 2 198 ? 12.896  -14.123 10.504  1.00 40.56 ? 198 ARG A CG    1 
ATOM   2358 C CD    . ARG B 2 198 ? 11.922  -13.496 11.506  1.00 44.85 ? 198 ARG A CD    1 
ATOM   2359 N NE    . ARG B 2 198 ? 11.229  -12.328 10.953  1.00 49.56 ? 198 ARG A NE    1 
ATOM   2360 C CZ    . ARG B 2 198 ? 11.685  -11.075 10.993  1.00 50.21 ? 198 ARG A CZ    1 
ATOM   2361 N NH1   . ARG B 2 198 ? 12.850  -10.798 11.571  1.00 51.38 ? 198 ARG A NH1   1 
ATOM   2362 N NH2   . ARG B 2 198 ? 10.975  -10.095 10.446  1.00 50.57 ? 198 ARG A NH2   1 
ATOM   2363 N N     . THR B 2 199 ? 16.129  -16.662 13.080  1.00 29.01 ? 199 THR A N     1 
ATOM   2364 C CA    . THR B 2 199 ? 16.594  -17.891 13.694  1.00 28.23 ? 199 THR A CA    1 
ATOM   2365 C C     . THR B 2 199 ? 16.227  -18.059 15.168  1.00 29.44 ? 199 THR A C     1 
ATOM   2366 O O     . THR B 2 199 ? 16.167  -17.094 15.933  1.00 31.35 ? 199 THR A O     1 
ATOM   2367 C CB    . THR B 2 199 ? 18.128  -18.023 13.528  1.00 27.87 ? 199 THR A CB    1 
ATOM   2368 O OG1   . THR B 2 199 ? 18.451  -18.087 12.129  1.00 27.71 ? 199 THR A OG1   1 
ATOM   2369 C CG2   . THR B 2 199 ? 18.646  -19.273 14.221  1.00 24.20 ? 199 THR A CG2   1 
ATOM   2370 N N     . VAL B 2 200 ? 15.967  -19.304 15.548  1.00 28.07 ? 200 VAL A N     1 
ATOM   2371 C CA    . VAL B 2 200 ? 15.633  -19.649 16.917  1.00 27.61 ? 200 VAL A CA    1 
ATOM   2372 C C     . VAL B 2 200 ? 16.410  -20.920 17.263  1.00 28.11 ? 200 VAL A C     1 
ATOM   2373 O O     . VAL B 2 200 ? 16.298  -21.938 16.587  1.00 28.19 ? 200 VAL A O     1 
ATOM   2374 C CB    . VAL B 2 200 ? 14.125  -19.903 17.082  1.00 28.09 ? 200 VAL A CB    1 
ATOM   2375 C CG1   . VAL B 2 200 ? 13.814  -20.278 18.524  1.00 26.08 ? 200 VAL A CG1   1 
ATOM   2376 C CG2   . VAL B 2 200 ? 13.348  -18.660 16.669  1.00 27.44 ? 200 VAL A CG2   1 
ATOM   2377 N N     . ILE B 2 201 ? 17.226  -20.843 18.304  1.00 27.95 ? 201 ILE A N     1 
ATOM   2378 C CA    . ILE B 2 201 ? 18.020  -21.978 18.721  1.00 28.78 ? 201 ILE A CA    1 
ATOM   2379 C C     . ILE B 2 201 ? 17.523  -22.436 20.082  1.00 30.13 ? 201 ILE A C     1 
ATOM   2380 O O     . ILE B 2 201 ? 17.755  -21.772 21.092  1.00 31.85 ? 201 ILE A O     1 
ATOM   2381 C CB    . ILE B 2 201 ? 19.515  -21.593 18.795  1.00 28.21 ? 201 ILE A CB    1 
ATOM   2382 C CG1   . ILE B 2 201 ? 19.994  -21.125 17.412  1.00 25.88 ? 201 ILE A CG1   1 
ATOM   2383 C CG2   . ILE B 2 201 ? 20.346  -22.785 19.270  1.00 27.70 ? 201 ILE A CG2   1 
ATOM   2384 C CD1   . ILE B 2 201 ? 21.401  -20.547 17.403  1.00 24.49 ? 201 ILE A CD1   1 
ATOM   2385 N N     . ASP B 2 202 ? 16.825  -23.568 20.103  1.00 30.37 ? 202 ASP A N     1 
ATOM   2386 C CA    . ASP B 2 202 ? 16.281  -24.108 21.345  1.00 31.17 ? 202 ASP A CA    1 
ATOM   2387 C C     . ASP B 2 202 ? 17.207  -25.220 21.824  1.00 31.32 ? 202 ASP A C     1 
ATOM   2388 O O     . ASP B 2 202 ? 17.103  -26.353 21.370  1.00 32.69 ? 202 ASP A O     1 
ATOM   2389 C CB    . ASP B 2 202 ? 14.874  -24.660 21.098  1.00 31.23 ? 202 ASP A CB    1 
ATOM   2390 C CG    . ASP B 2 202 ? 14.121  -24.944 22.377  1.00 31.88 ? 202 ASP A CG    1 
ATOM   2391 O OD1   . ASP B 2 202 ? 14.753  -25.351 23.372  1.00 34.50 ? 202 ASP A OD1   1 
ATOM   2392 O OD2   . ASP B 2 202 ? 12.887  -24.778 22.387  1.00 32.87 ? 202 ASP A OD2   1 
ATOM   2393 N N     . VAL B 2 203 ? 18.110  -24.889 22.740  1.00 31.26 ? 203 VAL A N     1 
ATOM   2394 C CA    . VAL B 2 203 ? 19.082  -25.851 23.270  1.00 32.06 ? 203 VAL A CA    1 
ATOM   2395 C C     . VAL B 2 203 ? 18.465  -27.109 23.869  1.00 30.86 ? 203 VAL A C     1 
ATOM   2396 O O     . VAL B 2 203 ? 18.873  -28.223 23.552  1.00 30.82 ? 203 VAL A O     1 
ATOM   2397 C CB    . VAL B 2 203 ? 19.950  -25.220 24.377  1.00 33.56 ? 203 VAL A CB    1 
ATOM   2398 C CG1   . VAL B 2 203 ? 21.309  -25.902 24.403  1.00 34.19 ? 203 VAL A CG1   1 
ATOM   2399 C CG2   . VAL B 2 203 ? 20.078  -23.708 24.156  1.00 35.83 ? 203 VAL A CG2   1 
ATOM   2400 N N     . ALA B 2 204 ? 17.496  -26.916 24.755  1.00 30.27 ? 204 ALA A N     1 
ATOM   2401 C CA    . ALA B 2 204 ? 16.819  -28.018 25.429  1.00 29.47 ? 204 ALA A CA    1 
ATOM   2402 C C     . ALA B 2 204 ? 16.233  -29.039 24.448  1.00 29.15 ? 204 ALA A C     1 
ATOM   2403 O O     . ALA B 2 204 ? 16.362  -30.247 24.649  1.00 27.14 ? 204 ALA A O     1 
ATOM   2404 C CB    . ALA B 2 204 ? 15.719  -27.468 26.350  1.00 27.82 ? 204 ALA A CB    1 
ATOM   2405 N N     . LYS B 2 205 ? 15.581  -28.559 23.394  1.00 28.69 ? 205 LYS A N     1 
ATOM   2406 C CA    . LYS B 2 205 ? 15.003  -29.474 22.417  1.00 29.37 ? 205 LYS A CA    1 
ATOM   2407 C C     . LYS B 2 205 ? 16.003  -29.829 21.319  1.00 28.67 ? 205 LYS A C     1 
ATOM   2408 O O     . LYS B 2 205 ? 15.674  -30.575 20.405  1.00 29.47 ? 205 LYS A O     1 
ATOM   2409 C CB    . LYS B 2 205 ? 13.758  -28.862 21.784  1.00 29.76 ? 205 LYS A CB    1 
ATOM   2410 C CG    . LYS B 2 205 ? 12.575  -28.721 22.710  1.00 31.06 ? 205 LYS A CG    1 
ATOM   2411 C CD    . LYS B 2 205 ? 11.418  -28.056 21.973  1.00 34.07 ? 205 LYS A CD    1 
ATOM   2412 C CE    . LYS B 2 205 ? 10.210  -27.825 22.875  1.00 36.11 ? 205 LYS A CE    1 
ATOM   2413 N NZ    . LYS B 2 205 ? 9.177   -26.983 22.181  1.00 38.20 ? 205 LYS A NZ    1 
ATOM   2414 N N     . GLY B 2 206 ? 17.221  -29.304 21.422  1.00 28.59 ? 206 GLY A N     1 
ATOM   2415 C CA    . GLY B 2 206 ? 18.239  -29.564 20.414  1.00 30.38 ? 206 GLY A CA    1 
ATOM   2416 C C     . GLY B 2 206 ? 17.681  -29.278 19.032  1.00 31.16 ? 206 GLY A C     1 
ATOM   2417 O O     . GLY B 2 206 ? 17.865  -30.060 18.100  1.00 30.16 ? 206 GLY A O     1 
ATOM   2418 N N     . GLU B 2 207 ? 17.024  -28.129 18.901  1.00 32.34 ? 207 GLU A N     1 
ATOM   2419 C CA    . GLU B 2 207 ? 16.373  -27.746 17.655  1.00 32.70 ? 207 GLU A CA    1 
ATOM   2420 C C     . GLU B 2 207 ? 16.660  -26.320 17.169  1.00 32.39 ? 207 GLU A C     1 
ATOM   2421 O O     . GLU B 2 207 ? 17.072  -25.454 17.937  1.00 33.97 ? 207 GLU A O     1 
ATOM   2422 C CB    . GLU B 2 207 ? 14.866  -27.928 17.853  1.00 34.46 ? 207 GLU A CB    1 
ATOM   2423 C CG    . GLU B 2 207 ? 13.987  -27.522 16.700  1.00 38.76 ? 207 GLU A CG    1 
ATOM   2424 C CD    . GLU B 2 207 ? 12.521  -27.753 17.007  1.00 41.69 ? 207 GLU A CD    1 
ATOM   2425 O OE1   . GLU B 2 207 ? 11.985  -27.063 17.903  1.00 41.23 ? 207 GLU A OE1   1 
ATOM   2426 O OE2   . GLU B 2 207 ? 11.912  -28.632 16.355  1.00 43.86 ? 207 GLU A OE2   1 
ATOM   2427 N N     . VAL B 2 208 ? 16.444  -26.096 15.877  1.00 31.85 ? 208 VAL A N     1 
ATOM   2428 C CA    . VAL B 2 208 ? 16.609  -24.782 15.261  1.00 31.16 ? 208 VAL A CA    1 
ATOM   2429 C C     . VAL B 2 208 ? 15.348  -24.567 14.429  1.00 30.93 ? 208 VAL A C     1 
ATOM   2430 O O     . VAL B 2 208 ? 14.964  -25.433 13.655  1.00 30.96 ? 208 VAL A O     1 
ATOM   2431 C CB    . VAL B 2 208 ? 17.814  -24.720 14.304  1.00 31.32 ? 208 VAL A CB    1 
ATOM   2432 C CG1   . VAL B 2 208 ? 17.963  -23.313 13.756  1.00 29.52 ? 208 VAL A CG1   1 
ATOM   2433 C CG2   . VAL B 2 208 ? 19.074  -25.134 15.025  1.00 33.23 ? 208 VAL A CG2   1 
ATOM   2434 N N     . ARG B 2 209 ? 14.697  -23.426 14.600  1.00 31.15 ? 209 ARG A N     1 
ATOM   2435 C CA    . ARG B 2 209 ? 13.491  -23.139 13.849  1.00 32.55 ? 209 ARG A CA    1 
ATOM   2436 C C     . ARG B 2 209 ? 13.384  -21.674 13.448  1.00 34.51 ? 209 ARG A C     1 
ATOM   2437 O O     . ARG B 2 209 ? 14.257  -20.865 13.769  1.00 35.62 ? 209 ARG A O     1 
ATOM   2438 C CB    . ARG B 2 209 ? 12.261  -23.563 14.652  1.00 32.49 ? 209 ARG A CB    1 
ATOM   2439 C CG    . ARG B 2 209 ? 12.270  -23.129 16.097  1.00 32.47 ? 209 ARG A CG    1 
ATOM   2440 C CD    . ARG B 2 209 ? 10.911  -23.378 16.719  1.00 32.45 ? 209 ARG A CD    1 
ATOM   2441 N NE    . ARG B 2 209 ? 10.841  -22.873 18.085  1.00 34.70 ? 209 ARG A NE    1 
ATOM   2442 C CZ    . ARG B 2 209 ? 11.347  -23.500 19.141  1.00 34.73 ? 209 ARG A CZ    1 
ATOM   2443 N NH1   . ARG B 2 209 ? 11.961  -24.666 18.995  1.00 34.97 ? 209 ARG A NH1   1 
ATOM   2444 N NH2   . ARG B 2 209 ? 11.245  -22.958 20.343  1.00 34.61 ? 209 ARG A NH2   1 
ATOM   2445 N N     . LYS B 2 210 ? 12.319  -21.341 12.728  1.00 36.07 ? 210 LYS A N     1 
ATOM   2446 C CA    . LYS B 2 210 ? 12.103  -19.976 12.271  1.00 38.26 ? 210 LYS A CA    1 
ATOM   2447 C C     . LYS B 2 210 ? 11.151  -19.300 13.245  1.00 38.83 ? 210 LYS A C     1 
ATOM   2448 O O     . LYS B 2 210 ? 10.062  -19.803 13.500  1.00 40.03 ? 210 LYS A O     1 
ATOM   2449 C CB    . LYS B 2 210 ? 11.500  -19.994 10.865  1.00 39.15 ? 210 LYS A CB    1 
ATOM   2450 C CG    . LYS B 2 210 ? 11.625  -18.698 10.060  1.00 43.15 ? 210 LYS A CG    1 
ATOM   2451 C CD    . LYS B 2 210 ? 10.652  -17.571 10.478  1.00 44.94 ? 210 LYS A CD    1 
ATOM   2452 C CE    . LYS B 2 210 ? 10.673  -16.434 9.421   1.00 46.62 ? 210 LYS A CE    1 
ATOM   2453 N NZ    . LYS B 2 210 ? 9.975   -15.155 9.789   1.00 45.52 ? 210 LYS A NZ    1 
ATOM   2454 N N     . GLY B 2 211 ? 11.575  -18.178 13.812  1.00 39.02 ? 211 GLY A N     1 
ATOM   2455 C CA    . GLY B 2 211 ? 10.728  -17.456 14.742  1.00 39.53 ? 211 GLY A CA    1 
ATOM   2456 C C     . GLY B 2 211 ? 10.449  -16.066 14.202  1.00 41.05 ? 211 GLY A C     1 
ATOM   2457 O O     . GLY B 2 211 ? 10.542  -15.833 12.993  1.00 40.64 ? 211 GLY A O     1 
ATOM   2458 N N     . GLU B 2 212 ? 10.111  -15.137 15.091  1.00 41.50 ? 212 GLU A N     1 
ATOM   2459 C CA    . GLU B 2 212 ? 9.826   -13.770 14.679  1.00 41.96 ? 212 GLU A CA    1 
ATOM   2460 C C     . GLU B 2 212 ? 11.004  -12.854 14.987  1.00 40.98 ? 212 GLU A C     1 
ATOM   2461 O O     . GLU B 2 212 ? 11.005  -11.674 14.627  1.00 41.21 ? 212 GLU A O     1 
ATOM   2462 C CB    . GLU B 2 212 ? 8.553   -13.274 15.371  1.00 43.89 ? 212 GLU A CB    1 
ATOM   2463 C CG    . GLU B 2 212 ? 7.284   -13.500 14.546  1.00 48.68 ? 212 GLU A CG    1 
ATOM   2464 C CD    . GLU B 2 212 ? 6.028   -13.658 15.403  1.00 52.90 ? 212 GLU A CD    1 
ATOM   2465 O OE1   . GLU B 2 212 ? 5.819   -12.839 16.333  1.00 54.78 ? 212 GLU A OE1   1 
ATOM   2466 O OE2   . GLU B 2 212 ? 5.243   -14.603 15.139  1.00 53.84 ? 212 GLU A OE2   1 
ATOM   2467 N N     . GLU B 2 213 ? 12.015  -13.420 15.639  1.00 39.27 ? 213 GLU A N     1 
ATOM   2468 C CA    . GLU B 2 213 ? 13.218  -12.685 16.014  1.00 37.78 ? 213 GLU A CA    1 
ATOM   2469 C C     . GLU B 2 213 ? 14.322  -13.677 16.364  1.00 35.23 ? 213 GLU A C     1 
ATOM   2470 O O     . GLU B 2 213 ? 14.048  -14.865 16.539  1.00 36.22 ? 213 GLU A O     1 
ATOM   2471 C CB    . GLU B 2 213 ? 12.921  -11.792 17.217  1.00 39.23 ? 213 GLU A CB    1 
ATOM   2472 C CG    . GLU B 2 213 ? 12.052  -12.466 18.254  1.00 43.92 ? 213 GLU A CG    1 
ATOM   2473 C CD    . GLU B 2 213 ? 11.993  -11.707 19.564  1.00 46.99 ? 213 GLU A CD    1 
ATOM   2474 O OE1   . GLU B 2 213 ? 11.242  -12.144 20.469  1.00 48.35 ? 213 GLU A OE1   1 
ATOM   2475 O OE2   . GLU B 2 213 ? 12.701  -10.681 19.693  1.00 48.38 ? 213 GLU A OE2   1 
ATOM   2476 N N     . PHE B 2 214 ? 15.566  -13.209 16.443  1.00 32.30 ? 214 PHE A N     1 
ATOM   2477 C CA    . PHE B 2 214 ? 16.662  -14.103 16.797  1.00 29.53 ? 214 PHE A CA    1 
ATOM   2478 C C     . PHE B 2 214 ? 16.374  -14.464 18.239  1.00 28.94 ? 214 PHE A C     1 
ATOM   2479 O O     . PHE B 2 214 ? 16.284  -13.584 19.096  1.00 28.64 ? 214 PHE A O     1 
ATOM   2480 C CB    . PHE B 2 214 ? 18.012  -13.407 16.707  1.00 27.65 ? 214 PHE A CB    1 
ATOM   2481 C CG    . PHE B 2 214 ? 19.180  -14.356 16.785  1.00 26.83 ? 214 PHE A CG    1 
ATOM   2482 C CD1   . PHE B 2 214 ? 19.395  -15.291 15.780  1.00 26.37 ? 214 PHE A CD1   1 
ATOM   2483 C CD2   . PHE B 2 214 ? 20.050  -14.325 17.862  1.00 25.26 ? 214 PHE A CD2   1 
ATOM   2484 C CE1   . PHE B 2 214 ? 20.454  -16.181 15.851  1.00 26.47 ? 214 PHE A CE1   1 
ATOM   2485 C CE2   . PHE B 2 214 ? 21.115  -15.216 17.941  1.00 25.82 ? 214 PHE A CE2   1 
ATOM   2486 C CZ    . PHE B 2 214 ? 21.318  -16.144 16.935  1.00 25.66 ? 214 PHE A CZ    1 
ATOM   2487 N N     . PHE B 2 215 ? 16.239  -15.754 18.513  1.00 27.08 ? 215 PHE A N     1 
ATOM   2488 C CA    . PHE B 2 215 ? 15.884  -16.177 19.855  1.00 26.70 ? 215 PHE A CA    1 
ATOM   2489 C C     . PHE B 2 215 ? 16.569  -17.471 20.290  1.00 26.97 ? 215 PHE A C     1 
ATOM   2490 O O     . PHE B 2 215 ? 16.324  -18.543 19.730  1.00 27.19 ? 215 PHE A O     1 
ATOM   2491 C CB    . PHE B 2 215 ? 14.357  -16.326 19.897  1.00 24.56 ? 215 PHE A CB    1 
ATOM   2492 C CG    . PHE B 2 215 ? 13.758  -16.344 21.281  1.00 23.32 ? 215 PHE A CG    1 
ATOM   2493 C CD1   . PHE B 2 215 ? 12.695  -15.495 21.588  1.00 22.51 ? 215 PHE A CD1   1 
ATOM   2494 C CD2   . PHE B 2 215 ? 14.168  -17.274 22.233  1.00 24.52 ? 215 PHE A CD2   1 
ATOM   2495 C CE1   . PHE B 2 215 ? 12.043  -15.574 22.808  1.00 23.81 ? 215 PHE A CE1   1 
ATOM   2496 C CE2   . PHE B 2 215 ? 13.518  -17.367 23.469  1.00 24.64 ? 215 PHE A CE2   1 
ATOM   2497 C CZ    . PHE B 2 215 ? 12.452  -16.512 23.754  1.00 26.04 ? 215 PHE A CZ    1 
ATOM   2498 N N     . VAL B 2 216 ? 17.448  -17.353 21.280  1.00 26.33 ? 216 VAL A N     1 
ATOM   2499 C CA    . VAL B 2 216 ? 18.146  -18.502 21.841  1.00 25.75 ? 216 VAL A CA    1 
ATOM   2500 C C     . VAL B 2 216 ? 17.421  -18.774 23.153  1.00 26.06 ? 216 VAL A C     1 
ATOM   2501 O O     . VAL B 2 216 ? 17.614  -18.061 24.141  1.00 26.31 ? 216 VAL A O     1 
ATOM   2502 C CB    . VAL B 2 216 ? 19.615  -18.179 22.121  1.00 24.30 ? 216 VAL A CB    1 
ATOM   2503 C CG1   . VAL B 2 216 ? 20.302  -19.383 22.733  1.00 24.81 ? 216 VAL A CG1   1 
ATOM   2504 C CG2   . VAL B 2 216 ? 20.299  -17.763 20.833  1.00 22.73 ? 216 VAL A CG2   1 
ATOM   2505 N N     . VAL B 2 217 ? 16.565  -19.790 23.158  1.00 26.14 ? 217 VAL A N     1 
ATOM   2506 C CA    . VAL B 2 217 ? 15.796  -20.087 24.355  1.00 26.74 ? 217 VAL A CA    1 
ATOM   2507 C C     . VAL B 2 217 ? 16.600  -20.682 25.497  1.00 26.41 ? 217 VAL A C     1 
ATOM   2508 O O     . VAL B 2 217 ? 17.364  -21.624 25.320  1.00 26.86 ? 217 VAL A O     1 
ATOM   2509 C CB    . VAL B 2 217 ? 14.543  -20.974 24.022  1.00 27.09 ? 217 VAL A CB    1 
ATOM   2510 C CG1   . VAL B 2 217 ? 14.697  -21.598 22.644  1.00 26.96 ? 217 VAL A CG1   1 
ATOM   2511 C CG2   . VAL B 2 217 ? 14.323  -22.031 25.109  1.00 25.19 ? 217 VAL A CG2   1 
ATOM   2512 N N     . ASP B 2 218 ? 16.422  -20.086 26.671  1.00 26.77 ? 218 ASP A N     1 
ATOM   2513 C CA    . ASP B 2 218 ? 17.102  -20.496 27.888  1.00 27.46 ? 218 ASP A CA    1 
ATOM   2514 C C     . ASP B 2 218 ? 16.675  -21.911 28.276  1.00 28.22 ? 218 ASP A C     1 
ATOM   2515 O O     . ASP B 2 218 ? 15.482  -22.207 28.363  1.00 30.17 ? 218 ASP A O     1 
ATOM   2516 C CB    . ASP B 2 218 ? 16.738  -19.528 29.018  1.00 28.43 ? 218 ASP A CB    1 
ATOM   2517 C CG    . ASP B 2 218 ? 17.663  -19.639 30.212  1.00 29.31 ? 218 ASP A CG    1 
ATOM   2518 O OD1   . ASP B 2 218 ? 18.144  -20.748 30.522  1.00 30.51 ? 218 ASP A OD1   1 
ATOM   2519 O OD2   . ASP B 2 218 ? 17.901  -18.603 30.855  1.00 29.96 ? 218 ASP A OD2   1 
ATOM   2520 N N     . PRO B 2 219 ? 17.643  -22.809 28.503  1.00 28.04 ? 219 PRO A N     1 
ATOM   2521 C CA    . PRO B 2 219 ? 17.339  -24.193 28.890  1.00 26.92 ? 219 PRO A CA    1 
ATOM   2522 C C     . PRO B 2 219 ? 16.593  -24.241 30.232  1.00 27.26 ? 219 PRO A C     1 
ATOM   2523 O O     . PRO B 2 219 ? 15.756  -25.108 30.472  1.00 26.47 ? 219 PRO A O     1 
ATOM   2524 C CB    . PRO B 2 219 ? 18.720  -24.828 28.997  1.00 24.84 ? 219 PRO A CB    1 
ATOM   2525 C CG    . PRO B 2 219 ? 19.517  -24.061 28.018  1.00 27.48 ? 219 PRO A CG    1 
ATOM   2526 C CD    . PRO B 2 219 ? 19.080  -22.640 28.232  1.00 27.34 ? 219 PRO A CD    1 
ATOM   2527 N N     . VAL B 2 220 ? 16.913  -23.290 31.099  1.00 27.94 ? 220 VAL A N     1 
ATOM   2528 C CA    . VAL B 2 220 ? 16.322  -23.193 32.430  1.00 29.49 ? 220 VAL A CA    1 
ATOM   2529 C C     . VAL B 2 220 ? 14.977  -22.456 32.437  1.00 31.07 ? 220 VAL A C     1 
ATOM   2530 O O     . VAL B 2 220 ? 14.299  -22.383 33.465  1.00 31.31 ? 220 VAL A O     1 
ATOM   2531 C CB    . VAL B 2 220 ? 17.299  -22.462 33.383  1.00 28.53 ? 220 VAL A CB    1 
ATOM   2532 C CG1   . VAL B 2 220 ? 16.759  -22.451 34.783  1.00 29.75 ? 220 VAL A CG1   1 
ATOM   2533 C CG2   . VAL B 2 220 ? 18.662  -23.139 33.347  1.00 28.62 ? 220 VAL A CG2   1 
ATOM   2534 N N     . ASP B 2 221 ? 14.585  -21.911 31.291  1.00 32.20 ? 221 ASP A N     1 
ATOM   2535 C CA    . ASP B 2 221 ? 13.336  -21.173 31.215  1.00 33.06 ? 221 ASP A CA    1 
ATOM   2536 C C     . ASP B 2 221 ? 13.010  -20.876 29.757  1.00 34.16 ? 221 ASP A C     1 
ATOM   2537 O O     . ASP B 2 221 ? 13.530  -19.926 29.173  1.00 32.51 ? 221 ASP A O     1 
ATOM   2538 C CB    . ASP B 2 221 ? 13.470  -19.873 32.005  1.00 34.34 ? 221 ASP A CB    1 
ATOM   2539 C CG    . ASP B 2 221 ? 12.160  -19.146 32.148  1.00 35.85 ? 221 ASP A CG    1 
ATOM   2540 O OD1   . ASP B 2 221 ? 11.203  -19.511 31.431  1.00 38.54 ? 221 ASP A OD1   1 
ATOM   2541 O OD2   . ASP B 2 221 ? 12.089  -18.208 32.968  1.00 35.76 ? 221 ASP A OD2   1 
ATOM   2542 N N     . GLU B 2 222 ? 12.130  -21.691 29.182  1.00 36.96 ? 222 GLU A N     1 
ATOM   2543 C CA    . GLU B 2 222 ? 11.750  -21.555 27.782  1.00 39.94 ? 222 GLU A CA    1 
ATOM   2544 C C     . GLU B 2 222 ? 11.243  -20.184 27.344  1.00 40.20 ? 222 GLU A C     1 
ATOM   2545 O O     . GLU B 2 222 ? 11.400  -19.818 26.184  1.00 41.80 ? 222 GLU A O     1 
ATOM   2546 C CB    . GLU B 2 222 ? 10.713  -22.616 27.405  1.00 42.40 ? 222 GLU A CB    1 
ATOM   2547 C CG    . GLU B 2 222 ? 11.212  -24.073 27.472  1.00 48.46 ? 222 GLU A CG    1 
ATOM   2548 C CD    . GLU B 2 222 ? 12.668  -24.264 27.004  1.00 51.32 ? 222 GLU A CD    1 
ATOM   2549 O OE1   . GLU B 2 222 ? 13.585  -24.025 27.829  1.00 51.52 ? 222 GLU A OE1   1 
ATOM   2550 O OE2   . GLU B 2 222 ? 12.895  -24.651 25.823  1.00 52.19 ? 222 GLU A OE2   1 
ATOM   2551 N N     . LYS B 2 223 ? 10.652  -19.422 28.258  1.00 39.49 ? 223 LYS A N     1 
ATOM   2552 C CA    . LYS B 2 223 ? 10.115  -18.103 27.917  1.00 39.49 ? 223 LYS A CA    1 
ATOM   2553 C C     . LYS B 2 223 ? 11.163  -16.989 27.823  1.00 38.38 ? 223 LYS A C     1 
ATOM   2554 O O     . LYS B 2 223 ? 10.865  -15.866 27.414  1.00 37.24 ? 223 LYS A O     1 
ATOM   2555 C CB    . LYS B 2 223 ? 9.040   -17.712 28.938  1.00 41.45 ? 223 LYS A CB    1 
ATOM   2556 C CG    . LYS B 2 223 ? 7.824   -18.634 28.911  1.00 44.68 ? 223 LYS A CG    1 
ATOM   2557 C CD    . LYS B 2 223 ? 7.157   -18.620 27.530  1.00 48.27 ? 223 LYS A CD    1 
ATOM   2558 C CE    . LYS B 2 223 ? 6.189   -19.783 27.349  1.00 49.98 ? 223 LYS A CE    1 
ATOM   2559 N NZ    . LYS B 2 223 ? 6.889   -21.110 27.402  1.00 50.88 ? 223 LYS A NZ    1 
ATOM   2560 N N     . ARG B 2 224 ? 12.399  -17.313 28.178  1.00 37.85 ? 224 ARG A N     1 
ATOM   2561 C CA    . ARG B 2 224 ? 13.472  -16.338 28.171  1.00 36.11 ? 224 ARG A CA    1 
ATOM   2562 C C     . ARG B 2 224 ? 14.439  -16.473 26.974  1.00 33.62 ? 224 ARG A C     1 
ATOM   2563 O O     . ARG B 2 224 ? 14.811  -17.574 26.571  1.00 35.20 ? 224 ARG A O     1 
ATOM   2564 C CB    . ARG B 2 224 ? 14.205  -16.448 29.507  1.00 38.39 ? 224 ARG A CB    1 
ATOM   2565 C CG    . ARG B 2 224 ? 15.005  -15.228 29.874  1.00 44.42 ? 224 ARG A CG    1 
ATOM   2566 C CD    . ARG B 2 224 ? 15.236  -15.134 31.368  1.00 46.95 ? 224 ARG A CD    1 
ATOM   2567 N NE    . ARG B 2 224 ? 16.195  -14.076 31.673  1.00 51.21 ? 224 ARG A NE    1 
ATOM   2568 C CZ    . ARG B 2 224 ? 17.485  -14.130 31.354  1.00 53.49 ? 224 ARG A CZ    1 
ATOM   2569 N NH1   . ARG B 2 224 ? 17.969  -15.196 30.722  1.00 54.44 ? 224 ARG A NH1   1 
ATOM   2570 N NH2   . ARG B 2 224 ? 18.292  -13.119 31.657  1.00 53.33 ? 224 ARG A NH2   1 
ATOM   2571 N N     . ASN B 2 225 ? 14.815  -15.338 26.392  1.00 30.35 ? 225 ASN A N     1 
ATOM   2572 C CA    . ASN B 2 225 ? 15.730  -15.304 25.256  1.00 26.96 ? 225 ASN A CA    1 
ATOM   2573 C C     . ASN B 2 225 ? 17.102  -14.854 25.738  1.00 25.95 ? 225 ASN A C     1 
ATOM   2574 O O     . ASN B 2 225 ? 17.286  -13.701 26.130  1.00 24.83 ? 225 ASN A O     1 
ATOM   2575 C CB    . ASN B 2 225 ? 15.220  -14.337 24.187  1.00 25.62 ? 225 ASN A CB    1 
ATOM   2576 C CG    . ASN B 2 225 ? 16.222  -14.128 23.056  1.00 26.85 ? 225 ASN A CG    1 
ATOM   2577 O OD1   . ASN B 2 225 ? 17.309  -14.716 23.050  1.00 25.76 ? 225 ASN A OD1   1 
ATOM   2578 N ND2   . ASN B 2 225 ? 15.861  -13.281 22.094  1.00 25.04 ? 225 ASN A ND2   1 
ATOM   2579 N N     . VAL B 2 226 ? 18.064  -15.771 25.707  1.00 24.37 ? 226 VAL A N     1 
ATOM   2580 C CA    . VAL B 2 226 ? 19.415  -15.474 26.168  1.00 24.03 ? 226 VAL A CA    1 
ATOM   2581 C C     . VAL B 2 226 ? 20.092  -14.362 25.365  1.00 24.44 ? 226 VAL A C     1 
ATOM   2582 O O     . VAL B 2 226 ? 20.849  -13.567 25.918  1.00 23.69 ? 226 VAL A O     1 
ATOM   2583 C CB    . VAL B 2 226 ? 20.281  -16.763 26.153  1.00 22.57 ? 226 VAL A CB    1 
ATOM   2584 C CG1   . VAL B 2 226 ? 21.726  -16.450 26.472  1.00 19.31 ? 226 VAL A CG1   1 
ATOM   2585 C CG2   . VAL B 2 226 ? 19.724  -17.750 27.169  1.00 20.99 ? 226 VAL A CG2   1 
ATOM   2586 N N     . ALA B 2 227 ? 19.793  -14.308 24.068  1.00 25.20 ? 227 ALA A N     1 
ATOM   2587 C CA    . ALA B 2 227 ? 20.349  -13.310 23.155  1.00 24.66 ? 227 ALA A CA    1 
ATOM   2588 C C     . ALA B 2 227 ? 19.434  -12.089 23.033  1.00 25.12 ? 227 ALA A C     1 
ATOM   2589 O O     . ALA B 2 227 ? 19.537  -11.319 22.076  1.00 24.17 ? 227 ALA A O     1 
ATOM   2590 C CB    . ALA B 2 227 ? 20.546  -13.931 21.784  1.00 22.98 ? 227 ALA A CB    1 
ATOM   2591 N N     . ALA B 2 228 ? 18.549  -11.909 24.008  1.00 24.36 ? 228 ALA A N     1 
ATOM   2592 C CA    . ALA B 2 228 ? 17.604  -10.805 23.989  1.00 24.83 ? 228 ALA A CA    1 
ATOM   2593 C C     . ALA B 2 228 ? 18.223  -9.468  23.627  1.00 25.84 ? 228 ALA A C     1 
ATOM   2594 O O     . ALA B 2 228 ? 17.672  -8.723  22.814  1.00 26.37 ? 228 ALA A O     1 
ATOM   2595 C CB    . ALA B 2 228 ? 16.909  -10.696 25.332  1.00 25.13 ? 228 ALA A CB    1 
ATOM   2596 N N     . ASN B 2 229 ? 19.370  -9.167  24.229  1.00 26.63 ? 229 ASN A N     1 
ATOM   2597 C CA    . ASN B 2 229 ? 20.041  -7.900  23.990  1.00 27.20 ? 229 ASN A CA    1 
ATOM   2598 C C     . ASN B 2 229 ? 21.118  -7.935  22.912  1.00 28.29 ? 229 ASN A C     1 
ATOM   2599 O O     . ASN B 2 229 ? 22.004  -7.081  22.887  1.00 31.09 ? 229 ASN A O     1 
ATOM   2600 C CB    . ASN B 2 229 ? 20.626  -7.357  25.301  1.00 26.98 ? 229 ASN A CB    1 
ATOM   2601 C CG    . ASN B 2 229 ? 20.567  -5.837  25.380  1.00 27.55 ? 229 ASN A CG    1 
ATOM   2602 O OD1   . ASN B 2 229 ? 19.549  -5.233  25.051  1.00 26.80 ? 229 ASN A OD1   1 
ATOM   2603 N ND2   . ASN B 2 229 ? 21.651  -5.218  25.825  1.00 27.49 ? 229 ASN A ND2   1 
ATOM   2604 N N     . LEU B 2 230 ? 21.060  -8.919  22.025  1.00 27.40 ? 230 LEU A N     1 
ATOM   2605 C CA    . LEU B 2 230 ? 22.025  -8.971  20.930  1.00 26.54 ? 230 LEU A CA    1 
ATOM   2606 C C     . LEU B 2 230 ? 21.384  -8.141  19.823  1.00 26.72 ? 230 LEU A C     1 
ATOM   2607 O O     . LEU B 2 230 ? 20.370  -8.547  19.249  1.00 25.60 ? 230 LEU A O     1 
ATOM   2608 C CB    . LEU B 2 230 ? 22.239  -10.406 20.439  1.00 25.97 ? 230 LEU A CB    1 
ATOM   2609 C CG    . LEU B 2 230 ? 23.076  -10.537 19.163  1.00 25.11 ? 230 LEU A CG    1 
ATOM   2610 C CD1   . LEU B 2 230 ? 24.508  -10.065 19.445  1.00 24.60 ? 230 LEU A CD1   1 
ATOM   2611 C CD2   . LEU B 2 230 ? 23.050  -11.987 18.666  1.00 23.95 ? 230 LEU A CD2   1 
ATOM   2612 N N     . SER B 2 231 ? 21.965  -6.986  19.520  1.00 27.04 ? 231 SER A N     1 
ATOM   2613 C CA    . SER B 2 231 ? 21.386  -6.116  18.502  1.00 28.58 ? 231 SER A CA    1 
ATOM   2614 C C     . SER B 2 231 ? 21.381  -6.750  17.116  1.00 29.47 ? 231 SER A C     1 
ATOM   2615 O O     . SER B 2 231 ? 22.222  -7.591  16.792  1.00 28.99 ? 231 SER A O     1 
ATOM   2616 C CB    . SER B 2 231 ? 22.114  -4.758  18.455  1.00 27.40 ? 231 SER A CB    1 
ATOM   2617 O OG    . SER B 2 231 ? 23.235  -4.785  17.589  1.00 27.25 ? 231 SER A OG    1 
ATOM   2618 N N     . LEU B 2 232 ? 20.409  -6.337  16.308  1.00 29.97 ? 232 LEU A N     1 
ATOM   2619 C CA    . LEU B 2 232 ? 20.269  -6.830  14.948  1.00 29.42 ? 232 LEU A CA    1 
ATOM   2620 C C     . LEU B 2 232 ? 21.556  -6.608  14.156  1.00 28.55 ? 232 LEU A C     1 
ATOM   2621 O O     . LEU B 2 232 ? 22.019  -7.500  13.448  1.00 28.66 ? 232 LEU A O     1 
ATOM   2622 C CB    . LEU B 2 232 ? 19.096  -6.121  14.256  1.00 28.43 ? 232 LEU A CB    1 
ATOM   2623 C CG    . LEU B 2 232 ? 18.992  -6.281  12.736  1.00 28.59 ? 232 LEU A CG    1 
ATOM   2624 C CD1   . LEU B 2 232 ? 18.849  -7.752  12.374  1.00 29.97 ? 232 LEU A CD1   1 
ATOM   2625 C CD2   . LEU B 2 232 ? 17.816  -5.487  12.216  1.00 27.17 ? 232 LEU A CD2   1 
ATOM   2626 N N     . ASP B 2 233 ? 22.144  -5.423  14.277  1.00 28.57 ? 233 ASP A N     1 
ATOM   2627 C CA    . ASP B 2 233 ? 23.372  -5.150  13.537  1.00 28.63 ? 233 ASP A CA    1 
ATOM   2628 C C     . ASP B 2 233 ? 24.578  -5.934  14.053  1.00 28.51 ? 233 ASP A C     1 
ATOM   2629 O O     . ASP B 2 233 ? 25.471  -6.263  13.277  1.00 28.95 ? 233 ASP A O     1 
ATOM   2630 C CB    . ASP B 2 233 ? 23.676  -3.649  13.514  1.00 27.89 ? 233 ASP A CB    1 
ATOM   2631 C CG    . ASP B 2 233 ? 22.731  -2.878  12.606  1.00 28.70 ? 233 ASP A CG    1 
ATOM   2632 O OD1   . ASP B 2 233 ? 22.165  -3.499  11.682  1.00 27.18 ? 233 ASP A OD1   1 
ATOM   2633 O OD2   . ASP B 2 233 ? 22.566  -1.651  12.801  1.00 29.16 ? 233 ASP A OD2   1 
ATOM   2634 N N     . ASN B 2 234 ? 24.618  -6.238  15.349  1.00 28.12 ? 234 ASN A N     1 
ATOM   2635 C CA    . ASN B 2 234 ? 25.742  -7.008  15.871  1.00 28.76 ? 234 ASN A CA    1 
ATOM   2636 C C     . ASN B 2 234 ? 25.582  -8.453  15.435  1.00 28.26 ? 234 ASN A C     1 
ATOM   2637 O O     . ASN B 2 234 ? 26.567  -9.151  15.193  1.00 28.86 ? 234 ASN A O     1 
ATOM   2638 C CB    . ASN B 2 234 ? 25.816  -6.921  17.395  1.00 29.80 ? 234 ASN A CB    1 
ATOM   2639 C CG    . ASN B 2 234 ? 26.589  -5.707  17.868  1.00 29.62 ? 234 ASN A CG    1 
ATOM   2640 O OD1   . ASN B 2 234 ? 26.386  -5.221  18.986  1.00 30.02 ? 234 ASN A OD1   1 
ATOM   2641 N ND2   . ASN B 2 234 ? 27.488  -5.212  17.019  1.00 27.93 ? 234 ASN A ND2   1 
ATOM   2642 N N     . LEU B 2 235 ? 24.336  -8.896  15.331  1.00 27.50 ? 235 LEU A N     1 
ATOM   2643 C CA    . LEU B 2 235 ? 24.052  -10.255 14.888  1.00 27.43 ? 235 LEU A CA    1 
ATOM   2644 C C     . LEU B 2 235 ? 24.564  -10.337 13.461  1.00 28.32 ? 235 LEU A C     1 
ATOM   2645 O O     . LEU B 2 235 ? 25.257  -11.295 13.086  1.00 29.37 ? 235 LEU A O     1 
ATOM   2646 C CB    . LEU B 2 235 ? 22.539  -10.530 14.907  1.00 24.77 ? 235 LEU A CB    1 
ATOM   2647 C CG    . LEU B 2 235 ? 22.063  -11.815 14.215  1.00 22.67 ? 235 LEU A CG    1 
ATOM   2648 C CD1   . LEU B 2 235 ? 22.604  -13.034 14.942  1.00 22.18 ? 235 LEU A CD1   1 
ATOM   2649 C CD2   . LEU B 2 235 ? 20.550  -11.850 14.173  1.00 21.28 ? 235 LEU A CD2   1 
ATOM   2650 N N     . ALA B 2 236 ? 24.223  -9.317  12.677  1.00 27.92 ? 236 ALA A N     1 
ATOM   2651 C CA    . ALA B 2 236 ? 24.629  -9.240  11.281  1.00 28.18 ? 236 ALA A CA    1 
ATOM   2652 C C     . ALA B 2 236 ? 26.146  -9.222  11.135  1.00 28.29 ? 236 ALA A C     1 
ATOM   2653 O O     . ALA B 2 236 ? 26.695  -9.922  10.292  1.00 28.79 ? 236 ALA A O     1 
ATOM   2654 C CB    . ALA B 2 236 ? 24.028  -8.001  10.629  1.00 28.39 ? 236 ALA A CB    1 
ATOM   2655 N N     . ARG B 2 237 ? 26.833  -8.430  11.945  1.00 28.29 ? 237 ARG A N     1 
ATOM   2656 C CA    . ARG B 2 237 ? 28.288  -8.386  11.834  1.00 29.98 ? 237 ARG A CA    1 
ATOM   2657 C C     . ARG B 2 237 ? 28.871  -9.753  12.136  1.00 29.83 ? 237 ARG A C     1 
ATOM   2658 O O     . ARG B 2 237 ? 29.753  -10.220 11.429  1.00 31.60 ? 237 ARG A O     1 
ATOM   2659 C CB    . ARG B 2 237 ? 28.880  -7.345  12.783  1.00 31.23 ? 237 ARG A CB    1 
ATOM   2660 C CG    . ARG B 2 237 ? 28.249  -5.988  12.608  1.00 32.31 ? 237 ARG A CG    1 
ATOM   2661 C CD    . ARG B 2 237 ? 28.982  -4.876  13.317  1.00 31.77 ? 237 ARG A CD    1 
ATOM   2662 N NE    . ARG B 2 237 ? 28.348  -3.606  12.967  1.00 33.34 ? 237 ARG A NE    1 
ATOM   2663 C CZ    . ARG B 2 237 ? 27.394  -3.007  13.676  1.00 31.69 ? 237 ARG A CZ    1 
ATOM   2664 N NH1   . ARG B 2 237 ? 26.954  -3.546  14.808  1.00 30.38 ? 237 ARG A NH1   1 
ATOM   2665 N NH2   . ARG B 2 237 ? 26.856  -1.880  13.226  1.00 31.38 ? 237 ARG A NH2   1 
ATOM   2666 N N     . PHE B 2 238 ? 28.369  -10.405 13.178  1.00 30.44 ? 238 PHE A N     1 
ATOM   2667 C CA    . PHE B 2 238 ? 28.868  -11.728 13.534  1.00 30.37 ? 238 PHE A CA    1 
ATOM   2668 C C     . PHE B 2 238 ? 28.738  -12.698 12.364  1.00 30.75 ? 238 PHE A C     1 
ATOM   2669 O O     . PHE B 2 238 ? 29.713  -13.331 11.952  1.00 30.67 ? 238 PHE A O     1 
ATOM   2670 C CB    . PHE B 2 238 ? 28.100  -12.286 14.724  1.00 30.10 ? 238 PHE A CB    1 
ATOM   2671 C CG    . PHE B 2 238 ? 28.604  -13.616 15.190  1.00 29.65 ? 238 PHE A CG    1 
ATOM   2672 C CD1   . PHE B 2 238 ? 29.910  -13.754 15.646  1.00 29.85 ? 238 PHE A CD1   1 
ATOM   2673 C CD2   . PHE B 2 238 ? 27.782  -14.733 15.171  1.00 29.97 ? 238 PHE A CD2   1 
ATOM   2674 C CE1   . PHE B 2 238 ? 30.394  -14.990 16.076  1.00 29.66 ? 238 PHE A CE1   1 
ATOM   2675 C CE2   . PHE B 2 238 ? 28.255  -15.973 15.599  1.00 31.00 ? 238 PHE A CE2   1 
ATOM   2676 C CZ    . PHE B 2 238 ? 29.565  -16.098 16.053  1.00 30.10 ? 238 PHE A CZ    1 
ATOM   2677 N N     . VAL B 2 239 ? 27.521  -12.810 11.836  1.00 30.76 ? 239 VAL A N     1 
ATOM   2678 C CA    . VAL B 2 239 ? 27.261  -13.705 10.725  1.00 30.21 ? 239 VAL A CA    1 
ATOM   2679 C C     . VAL B 2 239 ? 28.236  -13.439 9.592   1.00 30.11 ? 239 VAL A C     1 
ATOM   2680 O O     . VAL B 2 239 ? 28.854  -14.367 9.056   1.00 30.35 ? 239 VAL A O     1 
ATOM   2681 C CB    . VAL B 2 239 ? 25.814  -13.547 10.217  1.00 30.78 ? 239 VAL A CB    1 
ATOM   2682 C CG1   . VAL B 2 239 ? 25.627  -14.308 8.909   1.00 29.89 ? 239 VAL A CG1   1 
ATOM   2683 C CG2   . VAL B 2 239 ? 24.845  -14.081 11.264  1.00 30.52 ? 239 VAL A CG2   1 
ATOM   2684 N N     . HIS B 2 240 ? 28.378  -12.170 9.230   1.00 29.40 ? 240 HIS A N     1 
ATOM   2685 C CA    . HIS B 2 240 ? 29.285  -11.794 8.159   1.00 28.48 ? 240 HIS A CA    1 
ATOM   2686 C C     . HIS B 2 240 ? 30.713  -12.210 8.495   1.00 28.70 ? 240 HIS A C     1 
ATOM   2687 O O     . HIS B 2 240 ? 31.448  -12.688 7.631   1.00 27.78 ? 240 HIS A O     1 
ATOM   2688 C CB    . HIS B 2 240 ? 29.229  -10.283 7.923   1.00 28.12 ? 240 HIS A CB    1 
ATOM   2689 C CG    . HIS B 2 240 ? 30.018  -9.832  6.731   1.00 28.37 ? 240 HIS A CG    1 
ATOM   2690 N ND1   . HIS B 2 240 ? 31.235  -9.196  6.840   1.00 28.19 ? 240 HIS A ND1   1 
ATOM   2691 C CD2   . HIS B 2 240 ? 29.773  -9.953  5.405   1.00 27.93 ? 240 HIS A CD2   1 
ATOM   2692 C CE1   . HIS B 2 240 ? 31.707  -8.943  5.633   1.00 29.71 ? 240 HIS A CE1   1 
ATOM   2693 N NE2   . HIS B 2 240 ? 30.839  -9.392  4.744   1.00 29.44 ? 240 HIS A NE2   1 
ATOM   2694 N N     . LEU B 2 241 ? 31.097  -12.024 9.755   1.00 29.16 ? 241 LEU A N     1 
ATOM   2695 C CA    . LEU B 2 241 ? 32.434  -12.372 10.209  1.00 30.55 ? 241 LEU A CA    1 
ATOM   2696 C C     . LEU B 2 241 ? 32.724  -13.858 10.089  1.00 31.07 ? 241 LEU A C     1 
ATOM   2697 O O     . LEU B 2 241 ? 33.867  -14.257 9.849   1.00 31.82 ? 241 LEU A O     1 
ATOM   2698 C CB    . LEU B 2 241 ? 32.633  -11.942 11.662  1.00 30.99 ? 241 LEU A CB    1 
ATOM   2699 C CG    . LEU B 2 241 ? 33.043  -10.503 11.964  1.00 30.84 ? 241 LEU A CG    1 
ATOM   2700 C CD1   . LEU B 2 241 ? 33.126  -10.335 13.468  1.00 32.42 ? 241 LEU A CD1   1 
ATOM   2701 C CD2   . LEU B 2 241 ? 34.388  -10.194 11.326  1.00 31.41 ? 241 LEU A CD2   1 
ATOM   2702 N N     . CYS B 2 242 ? 31.695  -14.679 10.269  1.00 31.48 ? 242 CYS A N     1 
ATOM   2703 C CA    . CYS B 2 242 ? 31.874  -16.117 10.184  1.00 31.74 ? 242 CYS A CA    1 
ATOM   2704 C C     . CYS B 2 242 ? 32.107  -16.524 8.743   1.00 32.21 ? 242 CYS A C     1 
ATOM   2705 O O     . CYS B 2 242 ? 32.909  -17.414 8.462   1.00 33.56 ? 242 CYS A O     1 
ATOM   2706 C CB    . CYS B 2 242 ? 30.663  -16.842 10.770  1.00 31.72 ? 242 CYS A CB    1 
ATOM   2707 S SG    . CYS B 2 242 ? 30.569  -16.736 12.590  1.00 32.66 ? 242 CYS A SG    1 
ATOM   2708 N N     . ARG B 2 243 ? 31.425  -15.859 7.821   1.00 32.42 ? 243 ARG A N     1 
ATOM   2709 C CA    . ARG B 2 243 ? 31.602  -16.176 6.410   1.00 33.05 ? 243 ARG A CA    1 
ATOM   2710 C C     . ARG B 2 243 ? 33.041  -15.856 6.004   1.00 34.04 ? 243 ARG A C     1 
ATOM   2711 O O     . ARG B 2 243 ? 33.713  -16.657 5.342   1.00 33.92 ? 243 ARG A O     1 
ATOM   2712 C CB    . ARG B 2 243 ? 30.604  -15.379 5.562   1.00 30.56 ? 243 ARG A CB    1 
ATOM   2713 C CG    . ARG B 2 243 ? 29.171  -15.815 5.801   1.00 28.81 ? 243 ARG A CG    1 
ATOM   2714 C CD    . ARG B 2 243 ? 28.150  -14.886 5.171   1.00 28.04 ? 243 ARG A CD    1 
ATOM   2715 N NE    . ARG B 2 243 ? 26.799  -15.378 5.439   1.00 28.04 ? 243 ARG A NE    1 
ATOM   2716 C CZ    . ARG B 2 243 ? 25.677  -14.722 5.162   1.00 26.42 ? 243 ARG A CZ    1 
ATOM   2717 N NH1   . ARG B 2 243 ? 25.709  -13.524 4.601   1.00 26.68 ? 243 ARG A NH1   1 
ATOM   2718 N NH2   . ARG B 2 243 ? 24.515  -15.279 5.447   1.00 28.04 ? 243 ARG A NH2   1 
ATOM   2719 N N     . GLU B 2 244 ? 33.515  -14.691 6.431   1.00 34.63 ? 244 GLU A N     1 
ATOM   2720 C CA    . GLU B 2 244 ? 34.865  -14.255 6.120   1.00 36.12 ? 244 GLU A CA    1 
ATOM   2721 C C     . GLU B 2 244 ? 35.940  -15.152 6.714   1.00 36.85 ? 244 GLU A C     1 
ATOM   2722 O O     . GLU B 2 244 ? 36.885  -15.538 6.026   1.00 37.43 ? 244 GLU A O     1 
ATOM   2723 C CB    . GLU B 2 244 ? 35.077  -12.834 6.607   1.00 36.24 ? 244 GLU A CB    1 
ATOM   2724 C CG    . GLU B 2 244 ? 34.317  -11.817 5.815   1.00 38.59 ? 244 GLU A CG    1 
ATOM   2725 C CD    . GLU B 2 244 ? 34.649  -10.421 6.257   1.00 41.61 ? 244 GLU A CD    1 
ATOM   2726 O OE1   . GLU B 2 244 ? 34.540  -10.158 7.481   1.00 43.12 ? 244 GLU A OE1   1 
ATOM   2727 O OE2   . GLU B 2 244 ? 35.015  -9.596  5.388   1.00 41.18 ? 244 GLU A OE2   1 
ATOM   2728 N N     . PHE B 2 245 ? 35.804  -15.476 7.992   1.00 37.12 ? 245 PHE A N     1 
ATOM   2729 C CA    . PHE B 2 245 ? 36.785  -16.328 8.641   1.00 37.27 ? 245 PHE A CA    1 
ATOM   2730 C C     . PHE B 2 245 ? 36.879  -17.673 7.921   1.00 37.62 ? 245 PHE A C     1 
ATOM   2731 O O     . PHE B 2 245 ? 37.969  -18.186 7.683   1.00 37.27 ? 245 PHE A O     1 
ATOM   2732 C CB    . PHE B 2 245 ? 36.407  -16.556 10.105  1.00 37.13 ? 245 PHE A CB    1 
ATOM   2733 C CG    . PHE B 2 245 ? 37.349  -17.475 10.832  1.00 36.82 ? 245 PHE A CG    1 
ATOM   2734 C CD1   . PHE B 2 245 ? 38.591  -17.021 11.272  1.00 35.88 ? 245 PHE A CD1   1 
ATOM   2735 C CD2   . PHE B 2 245 ? 37.011  -18.806 11.041  1.00 34.45 ? 245 PHE A CD2   1 
ATOM   2736 C CE1   . PHE B 2 245 ? 39.479  -17.886 11.910  1.00 34.98 ? 245 PHE A CE1   1 
ATOM   2737 C CE2   . PHE B 2 245 ? 37.893  -19.676 11.675  1.00 34.34 ? 245 PHE A CE2   1 
ATOM   2738 C CZ    . PHE B 2 245 ? 39.127  -19.215 12.109  1.00 33.68 ? 245 PHE A CZ    1 
ATOM   2739 N N     . MET B 2 246 ? 35.729  -18.243 7.579   1.00 38.13 ? 246 MET A N     1 
ATOM   2740 C CA    . MET B 2 246 ? 35.707  -19.523 6.893   1.00 39.40 ? 246 MET A CA    1 
ATOM   2741 C C     . MET B 2 246 ? 36.237  -19.422 5.473   1.00 41.32 ? 246 MET A C     1 
ATOM   2742 O O     . MET B 2 246 ? 36.757  -20.391 4.933   1.00 42.74 ? 246 MET A O     1 
ATOM   2743 C CB    . MET B 2 246 ? 34.287  -20.087 6.854   1.00 39.49 ? 246 MET A CB    1 
ATOM   2744 C CG    . MET B 2 246 ? 33.797  -20.649 8.175   1.00 38.99 ? 246 MET A CG    1 
ATOM   2745 S SD    . MET B 2 246 ? 34.882  -21.936 8.787   1.00 36.83 ? 246 MET A SD    1 
ATOM   2746 C CE    . MET B 2 246 ? 35.382  -21.229 10.216  1.00 39.72 ? 246 MET A CE    1 
ATOM   2747 N N     . GLU B 2 247 ? 36.100  -18.254 4.861   1.00 43.14 ? 247 GLU A N     1 
ATOM   2748 C CA    . GLU B 2 247 ? 36.569  -18.072 3.496   1.00 44.56 ? 247 GLU A CA    1 
ATOM   2749 C C     . GLU B 2 247 ? 38.086  -17.875 3.464   1.00 45.49 ? 247 GLU A C     1 
ATOM   2750 O O     . GLU B 2 247 ? 38.752  -18.258 2.498   1.00 46.14 ? 247 GLU A O     1 
ATOM   2751 C CB    . GLU B 2 247 ? 35.862  -16.870 2.865   1.00 45.21 ? 247 GLU A CB    1 
ATOM   2752 C CG    . GLU B 2 247 ? 35.947  -16.819 1.347   1.00 48.22 ? 247 GLU A CG    1 
ATOM   2753 C CD    . GLU B 2 247 ? 35.119  -15.691 0.754   1.00 51.04 ? 247 GLU A CD    1 
ATOM   2754 O OE1   . GLU B 2 247 ? 35.076  -15.568 -0.493  1.00 51.87 ? 247 GLU A OE1   1 
ATOM   2755 O OE2   . GLU B 2 247 ? 34.512  -14.924 1.537   1.00 52.99 ? 247 GLU A OE2   1 
ATOM   2756 N N     . ALA B 2 248 ? 38.626  -17.288 4.531   1.00 45.16 ? 248 ALA A N     1 
ATOM   2757 C CA    . ALA B 2 248 ? 40.057  -17.027 4.635   1.00 43.46 ? 248 ALA A CA    1 
ATOM   2758 C C     . ALA B 2 248 ? 40.463  -16.896 6.101   1.00 42.96 ? 248 ALA A C     1 
ATOM   2759 O O     . ALA B 2 248 ? 40.680  -15.789 6.599   1.00 41.39 ? 248 ALA A O     1 
ATOM   2760 C CB    . ALA B 2 248 ? 40.403  -15.750 3.883   1.00 42.74 ? 248 ALA A CB    1 
ATOM   2761 N N     . PRO B 2 249 ? 40.577  -18.031 6.811   1.00 43.35 ? 249 PRO A N     1 
ATOM   2762 C CA    . PRO B 2 249 ? 40.957  -18.029 8.229   1.00 43.52 ? 249 PRO A CA    1 
ATOM   2763 C C     . PRO B 2 249 ? 42.231  -17.229 8.475   1.00 43.37 ? 249 PRO A C     1 
ATOM   2764 O O     . PRO B 2 249 ? 43.144  -17.235 7.651   1.00 44.17 ? 249 PRO A O     1 
ATOM   2765 C CB    . PRO B 2 249 ? 41.143  -19.514 8.541   1.00 43.29 ? 249 PRO A CB    1 
ATOM   2766 C CG    . PRO B 2 249 ? 40.204  -20.176 7.601   1.00 43.28 ? 249 PRO A CG    1 
ATOM   2767 C CD    . PRO B 2 249 ? 40.412  -19.409 6.319   1.00 43.08 ? 249 PRO A CD    1 
ATOM   2768 N N     . SER B 2 250 ? 42.286  -16.548 9.612   1.00 42.98 ? 250 SER A N     1 
ATOM   2769 C CA    . SER B 2 250 ? 43.448  -15.745 9.970   1.00 42.73 ? 250 SER A CA    1 
ATOM   2770 C C     . SER B 2 250 ? 43.494  -15.561 11.480  1.00 42.82 ? 250 SER A C     1 
ATOM   2771 O O     . SER B 2 250 ? 42.456  -15.518 12.135  1.00 43.76 ? 250 SER A O     1 
ATOM   2772 C CB    . SER B 2 250 ? 43.375  -14.379 9.285   1.00 42.02 ? 250 SER A CB    1 
ATOM   2773 O OG    . SER B 2 250 ? 44.407  -13.524 9.740   1.00 43.08 ? 250 SER A OG    1 
ATOM   2774 N N     . LEU B 2 251 ? 44.697  -15.455 12.034  1.00 42.22 ? 251 LEU A N     1 
ATOM   2775 C CA    . LEU B 2 251 ? 44.840  -15.277 13.472  1.00 40.80 ? 251 LEU A CA    1 
ATOM   2776 C C     . LEU B 2 251 ? 44.452  -13.855 13.840  1.00 40.03 ? 251 LEU A C     1 
ATOM   2777 O O     . LEU B 2 251 ? 44.345  -13.514 15.018  1.00 40.29 ? 251 LEU A O     1 
ATOM   2778 C CB    . LEU B 2 251 ? 46.282  -15.552 13.904  1.00 40.52 ? 251 LEU A CB    1 
ATOM   2779 C CG    . LEU B 2 251 ? 46.558  -15.572 15.411  1.00 40.39 ? 251 LEU A CG    1 
ATOM   2780 C CD1   . LEU B 2 251 ? 45.592  -16.530 16.101  1.00 39.83 ? 251 LEU A CD1   1 
ATOM   2781 C CD2   . LEU B 2 251 ? 48.002  -15.991 15.658  1.00 38.84 ? 251 LEU A CD2   1 
ATOM   2782 N N     . GLY B 2 252 ? 44.230  -13.034 12.819  1.00 39.35 ? 252 GLY A N     1 
ATOM   2783 C CA    . GLY B 2 252 ? 43.862  -11.650 13.045  1.00 38.39 ? 252 GLY A CA    1 
ATOM   2784 C C     . GLY B 2 252 ? 42.465  -11.500 13.611  1.00 38.76 ? 252 GLY A C     1 
ATOM   2785 O O     . GLY B 2 252 ? 42.151  -10.479 14.226  1.00 39.62 ? 252 GLY A O     1 
ATOM   2786 N N     . PHE B 2 253 ? 41.627  -12.516 13.401  1.00 38.30 ? 253 PHE A N     1 
ATOM   2787 C CA    . PHE B 2 253 ? 40.251  -12.508 13.889  1.00 36.34 ? 253 PHE A CA    1 
ATOM   2788 C C     . PHE B 2 253 ? 40.180  -12.624 15.406  1.00 36.90 ? 253 PHE A C     1 
ATOM   2789 O O     . PHE B 2 253 ? 39.116  -12.461 16.000  1.00 35.40 ? 253 PHE A O     1 
ATOM   2790 C CB    . PHE B 2 253 ? 39.453  -13.658 13.272  1.00 35.44 ? 253 PHE A CB    1 
ATOM   2791 C CG    . PHE B 2 253 ? 39.128  -13.467 11.820  1.00 34.31 ? 253 PHE A CG    1 
ATOM   2792 C CD1   . PHE B 2 253 ? 40.086  -13.705 10.838  1.00 33.31 ? 253 PHE A CD1   1 
ATOM   2793 C CD2   . PHE B 2 253 ? 37.862  -13.040 11.434  1.00 32.96 ? 253 PHE A CD2   1 
ATOM   2794 C CE1   . PHE B 2 253 ? 39.786  -13.520 9.492   1.00 32.36 ? 253 PHE A CE1   1 
ATOM   2795 C CE2   . PHE B 2 253 ? 37.550  -12.851 10.092  1.00 32.92 ? 253 PHE A CE2   1 
ATOM   2796 C CZ    . PHE B 2 253 ? 38.516  -13.092 9.116   1.00 32.71 ? 253 PHE A CZ    1 
ATOM   2797 N N     . PHE B 2 254 ? 41.310  -12.921 16.035  1.00 38.47 ? 254 PHE A N     1 
ATOM   2798 C CA    . PHE B 2 254 ? 41.332  -13.054 17.482  1.00 39.88 ? 254 PHE A CA    1 
ATOM   2799 C C     . PHE B 2 254 ? 42.173  -11.972 18.150  1.00 42.36 ? 254 PHE A C     1 
ATOM   2800 O O     . PHE B 2 254 ? 42.309  -11.964 19.372  1.00 42.52 ? 254 PHE A O     1 
ATOM   2801 C CB    . PHE B 2 254 ? 41.850  -14.436 17.880  1.00 37.42 ? 254 PHE A CB    1 
ATOM   2802 C CG    . PHE B 2 254 ? 41.060  -15.573 17.291  1.00 35.67 ? 254 PHE A CG    1 
ATOM   2803 C CD1   . PHE B 2 254 ? 41.259  -15.967 15.970  1.00 34.61 ? 254 PHE A CD1   1 
ATOM   2804 C CD2   . PHE B 2 254 ? 40.111  -16.249 18.056  1.00 34.35 ? 254 PHE A CD2   1 
ATOM   2805 C CE1   . PHE B 2 254 ? 40.527  -17.016 15.421  1.00 33.57 ? 254 PHE A CE1   1 
ATOM   2806 C CE2   . PHE B 2 254 ? 39.373  -17.298 17.515  1.00 33.99 ? 254 PHE A CE2   1 
ATOM   2807 C CZ    . PHE B 2 254 ? 39.582  -17.682 16.196  1.00 33.69 ? 254 PHE A CZ    1 
ATOM   2808 N N     . LYS B 2 255 ? 42.734  -11.065 17.349  1.00 44.95 ? 255 LYS A N     1 
ATOM   2809 C CA    . LYS B 2 255 ? 43.552  -9.969  17.874  1.00 47.42 ? 255 LYS A CA    1 
ATOM   2810 C C     . LYS B 2 255 ? 42.782  -8.659  17.800  1.00 48.92 ? 255 LYS A C     1 
ATOM   2811 O O     . LYS B 2 255 ? 42.272  -8.298  16.742  1.00 47.99 ? 255 LYS A O     1 
ATOM   2812 C CB    . LYS B 2 255 ? 44.842  -9.823  17.069  1.00 48.15 ? 255 LYS A CB    1 
ATOM   2813 C CG    . LYS B 2 255 ? 45.775  -11.009 17.163  1.00 50.12 ? 255 LYS A CG    1 
ATOM   2814 C CD    . LYS B 2 255 ? 47.011  -10.798 16.299  1.00 51.69 ? 255 LYS A CD    1 
ATOM   2815 C CE    . LYS B 2 255 ? 48.013  -11.936 16.478  1.00 53.28 ? 255 LYS A CE    1 
ATOM   2816 N NZ    . LYS B 2 255 ? 49.210  -11.775 15.608  1.00 55.30 ? 255 LYS A NZ    1 
ATOM   2817 N N     . PRO B 2 256 ? 42.677  -7.934  18.927  1.00 51.25 ? 256 PRO A N     1 
ATOM   2818 C CA    . PRO B 2 256 ? 41.952  -6.659  18.934  1.00 53.80 ? 256 PRO A CA    1 
ATOM   2819 C C     . PRO B 2 256 ? 42.544  -5.742  17.876  1.00 56.31 ? 256 PRO A C     1 
ATOM   2820 O O     . PRO B 2 256 ? 43.765  -5.641  17.745  1.00 56.00 ? 256 PRO A O     1 
ATOM   2821 C CB    . PRO B 2 256 ? 42.185  -6.136  20.346  1.00 53.25 ? 256 PRO A CB    1 
ATOM   2822 C CG    . PRO B 2 256 ? 42.295  -7.395  21.152  1.00 53.33 ? 256 PRO A CG    1 
ATOM   2823 C CD    . PRO B 2 256 ? 43.176  -8.256  20.274  1.00 52.47 ? 256 PRO A CD    1 
ATOM   2824 N N     . LYS B 2 257 ? 41.678  -5.083  17.117  1.00 59.34 ? 257 LYS A N     1 
ATOM   2825 C CA    . LYS B 2 257 ? 42.130  -4.192  16.060  1.00 63.62 ? 257 LYS A CA    1 
ATOM   2826 C C     . LYS B 2 257 ? 42.706  -2.907  16.654  1.00 66.26 ? 257 LYS A C     1 
ATOM   2827 O O     . LYS B 2 257 ? 42.177  -2.372  17.631  1.00 66.02 ? 257 LYS A O     1 
ATOM   2828 C CB    . LYS B 2 257 ? 40.960  -3.868  15.130  1.00 63.65 ? 257 LYS A CB    1 
ATOM   2829 C CG    . LYS B 2 257 ? 39.913  -4.984  15.045  1.00 63.57 ? 257 LYS A CG    1 
ATOM   2830 C CD    . LYS B 2 257 ? 40.497  -6.297  14.537  1.00 63.36 ? 257 LYS A CD    1 
ATOM   2831 C CE    . LYS B 2 257 ? 39.417  -7.369  14.439  1.00 64.30 ? 257 LYS A CE    1 
ATOM   2832 N NZ    . LYS B 2 257 ? 39.878  -8.626  13.773  1.00 63.65 ? 257 LYS A NZ    1 
ATOM   2833 N N     . HIS B 2 258 ? 43.796  -2.423  16.065  1.00 69.93 ? 258 HIS A N     1 
ATOM   2834 C CA    . HIS B 2 258 ? 44.449  -1.200  16.535  1.00 73.61 ? 258 HIS A CA    1 
ATOM   2835 C C     . HIS B 2 258 ? 43.589  0.047   16.317  1.00 74.40 ? 258 HIS A C     1 
ATOM   2836 O O     . HIS B 2 258 ? 42.942  0.199   15.275  1.00 74.36 ? 258 HIS A O     1 
ATOM   2837 C CB    . HIS B 2 258 ? 45.804  -1.025  15.839  1.00 75.63 ? 258 HIS A CB    1 
ATOM   2838 C CG    . HIS B 2 258 ? 46.898  -1.862  16.428  1.00 78.56 ? 258 HIS A CG    1 
ATOM   2839 N ND1   . HIS B 2 258 ? 48.098  -2.081  15.783  1.00 79.57 ? 258 HIS A ND1   1 
ATOM   2840 C CD2   . HIS B 2 258 ? 46.983  -2.514  17.613  1.00 79.19 ? 258 HIS A CD2   1 
ATOM   2841 C CE1   . HIS B 2 258 ? 48.874  -2.833  16.545  1.00 80.17 ? 258 HIS A CE1   1 
ATOM   2842 N NE2   . HIS B 2 258 ? 48.221  -3.109  17.660  1.00 80.27 ? 258 HIS A NE2   1 
ATOM   2843 N N     . PRO B 2 259 ? 43.578  0.959   17.304  1.00 74.83 ? 259 PRO A N     1 
ATOM   2844 C CA    . PRO B 2 259 ? 42.804  2.204   17.249  1.00 75.29 ? 259 PRO A CA    1 
ATOM   2845 C C     . PRO B 2 259 ? 42.949  2.953   15.925  1.00 75.60 ? 259 PRO A C     1 
ATOM   2846 O O     . PRO B 2 259 ? 42.102  3.774   15.570  1.00 75.69 ? 259 PRO A O     1 
ATOM   2847 C CB    . PRO B 2 259 ? 43.355  2.997   18.431  1.00 74.83 ? 259 PRO A CB    1 
ATOM   2848 C CG    . PRO B 2 259 ? 43.650  1.918   19.424  1.00 74.70 ? 259 PRO A CG    1 
ATOM   2849 C CD    . PRO B 2 259 ? 44.340  0.878   18.564  1.00 74.93 ? 259 PRO A CD    1 
ATOM   2850 N N     . LEU B 2 260 ? 44.021  2.650   15.199  1.00 76.03 ? 260 LEU A N     1 
ATOM   2851 C CA    . LEU B 2 260 ? 44.307  3.287   13.917  1.00 76.63 ? 260 LEU A CA    1 
ATOM   2852 C C     . LEU B 2 260 ? 44.116  4.789   13.718  1.00 76.36 ? 260 LEU A C     1 
ATOM   2853 O O     . LEU B 2 260 ? 43.550  5.234   12.716  1.00 76.29 ? 260 LEU A O     1 
ATOM   2854 C CB    . LEU B 2 260 ? 43.617  2.537   12.773  1.00 77.55 ? 260 LEU A CB    1 
ATOM   2855 C CG    . LEU B 2 260 ? 44.151  2.886   11.377  1.00 78.50 ? 260 LEU A CG    1 
ATOM   2856 C CD1   . LEU B 2 260 ? 45.646  2.568   11.309  1.00 78.73 ? 260 LEU A CD1   1 
ATOM   2857 C CD2   . LEU B 2 260 ? 43.391  2.103   10.315  1.00 78.34 ? 260 LEU A CD2   1 
ATOM   2858 N N     . GLU B 2 261 ? 44.582  5.557   14.696  1.00 75.85 ? 261 GLU A N     1 
ATOM   2859 C CA    . GLU B 2 261 ? 44.288  6.975   14.811  1.00 75.05 ? 261 GLU A CA    1 
ATOM   2860 C C     . GLU B 2 261 ? 44.733  7.705   13.550  1.00 73.61 ? 261 GLU A C     1 
ATOM   2861 O O     . GLU B 2 261 ? 45.727  7.335   12.917  1.00 73.32 ? 261 GLU A O     1 
ATOM   2862 C CB    . GLU B 2 261 ? 44.980  7.553   16.052  1.00 76.14 ? 261 GLU A CB    1 
ATOM   2863 C CG    . GLU B 2 261 ? 44.410  7.022   17.367  1.00 77.12 ? 261 GLU A CG    1 
ATOM   2864 C CD    . GLU B 2 261 ? 45.230  7.425   18.581  1.00 77.93 ? 261 GLU A CD    1 
ATOM   2865 O OE1   . GLU B 2 261 ? 45.392  8.639   18.828  1.00 78.13 ? 261 GLU A OE1   1 
ATOM   2866 O OE2   . GLU B 2 261 ? 45.712  6.519   19.294  1.00 78.42 ? 261 GLU A OE2   1 
ATOM   2867 N N     . ILE B 2 262 ? 43.983  8.743   13.196  1.00 71.68 ? 262 ILE A N     1 
ATOM   2868 C CA    . ILE B 2 262 ? 44.252  9.531   11.999  1.00 69.21 ? 262 ILE A CA    1 
ATOM   2869 C C     . ILE B 2 262 ? 44.584  10.971  12.369  1.00 67.06 ? 262 ILE A C     1 
ATOM   2870 O O     . ILE B 2 262 ? 44.082  11.490  13.366  1.00 67.33 ? 262 ILE A O     1 
ATOM   2871 C CB    . ILE B 2 262 ? 43.011  9.533   11.075  1.00 69.32 ? 262 ILE A CB    1 
ATOM   2872 C CG1   . ILE B 2 262 ? 43.350  10.160  9.722   1.00 69.29 ? 262 ILE A CG1   1 
ATOM   2873 C CG2   . ILE B 2 262 ? 41.869  10.299  11.746  1.00 67.80 ? 262 ILE A CG2   1 
ATOM   2874 C CD1   . ILE B 2 262 ? 42.208  10.089  8.725   1.00 69.53 ? 262 ILE A CD1   1 
ATOM   2875 N N     . GLU B 2 263 ? 45.431  11.618  11.578  1.00 63.98 ? 263 GLU A N     1 
ATOM   2876 C CA    . GLU B 2 263 ? 45.763  13.004  11.861  1.00 61.58 ? 263 GLU A CA    1 
ATOM   2877 C C     . GLU B 2 263 ? 44.549  13.840  11.470  1.00 59.32 ? 263 GLU A C     1 
ATOM   2878 O O     . GLU B 2 263 ? 43.957  13.632  10.409  1.00 59.02 ? 263 GLU A O     1 
ATOM   2879 C CB    . GLU B 2 263 ? 47.007  13.453  11.078  1.00 62.14 ? 263 GLU A CB    1 
ATOM   2880 C CG    . GLU B 2 263 ? 46.995  13.152  9.583   1.00 63.62 ? 263 GLU A CG    1 
ATOM   2881 C CD    . GLU B 2 263 ? 47.273  11.687  9.257   1.00 64.54 ? 263 GLU A CD    1 
ATOM   2882 O OE1   . GLU B 2 263 ? 47.436  11.372  8.057   1.00 63.97 ? 263 GLU A OE1   1 
ATOM   2883 O OE2   . GLU B 2 263 ? 47.331  10.852  10.189  1.00 64.46 ? 263 GLU A OE2   1 
ATOM   2884 N N     . PRO B 2 264 ? 44.147  14.786  12.333  1.00 57.08 ? 264 PRO A N     1 
ATOM   2885 C CA    . PRO B 2 264 ? 42.988  15.619  12.019  1.00 55.77 ? 264 PRO A CA    1 
ATOM   2886 C C     . PRO B 2 264 ? 43.079  16.344  10.680  1.00 55.20 ? 264 PRO A C     1 
ATOM   2887 O O     . PRO B 2 264 ? 42.062  16.771  10.134  1.00 55.65 ? 264 PRO A O     1 
ATOM   2888 C CB    . PRO B 2 264 ? 42.918  16.575  13.211  1.00 55.03 ? 264 PRO A CB    1 
ATOM   2889 C CG    . PRO B 2 264 ? 44.321  16.662  13.666  1.00 54.85 ? 264 PRO A CG    1 
ATOM   2890 C CD    . PRO B 2 264 ? 44.775  15.229  13.586  1.00 55.94 ? 264 PRO A CD    1 
ATOM   2891 N N     . GLU B 2 265 ? 44.282  16.482  10.138  1.00 53.98 ? 265 GLU A N     1 
ATOM   2892 C CA    . GLU B 2 265 ? 44.413  17.164  8.861   1.00 53.18 ? 265 GLU A CA    1 
ATOM   2893 C C     . GLU B 2 265 ? 43.767  16.311  7.781   1.00 52.23 ? 265 GLU A C     1 
ATOM   2894 O O     . GLU B 2 265 ? 42.961  16.801  6.993   1.00 51.82 ? 265 GLU A O     1 
ATOM   2895 C CB    . GLU B 2 265 ? 45.884  17.421  8.532   1.00 54.09 ? 265 GLU A CB    1 
ATOM   2896 C CG    . GLU B 2 265 ? 46.108  18.390  7.366   1.00 55.22 ? 265 GLU A CG    1 
ATOM   2897 C CD    . GLU B 2 265 ? 45.165  19.590  7.395   1.00 56.33 ? 265 GLU A CD    1 
ATOM   2898 O OE1   . GLU B 2 265 ? 44.084  19.507  6.773   1.00 56.73 ? 265 GLU A OE1   1 
ATOM   2899 O OE2   . GLU B 2 265 ? 45.493  20.611  8.043   1.00 57.55 ? 265 GLU A OE2   1 
ATOM   2900 N N     . ARG B 2 266 ? 44.114  15.029  7.758   1.00 51.92 ? 266 ARG A N     1 
ATOM   2901 C CA    . ARG B 2 266 ? 43.560  14.102  6.778   1.00 51.94 ? 266 ARG A CA    1 
ATOM   2902 C C     . ARG B 2 266 ? 42.042  13.989  6.943   1.00 50.81 ? 266 ARG A C     1 
ATOM   2903 O O     . ARG B 2 266 ? 41.318  13.812  5.967   1.00 49.96 ? 266 ARG A O     1 
ATOM   2904 C CB    . ARG B 2 266 ? 44.208  12.720  6.930   1.00 53.36 ? 266 ARG A CB    1 
ATOM   2905 C CG    . ARG B 2 266 ? 43.763  11.693  5.888   1.00 55.39 ? 266 ARG A CG    1 
ATOM   2906 C CD    . ARG B 2 266 ? 44.271  10.300  6.239   1.00 57.28 ? 266 ARG A CD    1 
ATOM   2907 N NE    . ARG B 2 266 ? 43.571  9.245   5.507   1.00 59.19 ? 266 ARG A NE    1 
ATOM   2908 C CZ    . ARG B 2 266 ? 43.552  7.964   5.870   1.00 59.76 ? 266 ARG A CZ    1 
ATOM   2909 N NH1   . ARG B 2 266 ? 44.195  7.564   6.963   1.00 59.33 ? 266 ARG A NH1   1 
ATOM   2910 N NH2   . ARG B 2 266 ? 42.884  7.078   5.139   1.00 59.84 ? 266 ARG A NH2   1 
ATOM   2911 N N     . LEU B 2 267 ? 41.564  14.092  8.179   1.00 49.68 ? 267 LEU A N     1 
ATOM   2912 C CA    . LEU B 2 267 ? 40.134  14.013  8.436   1.00 48.99 ? 267 LEU A CA    1 
ATOM   2913 C C     . LEU B 2 267 ? 39.462  15.222  7.777   1.00 48.71 ? 267 LEU A C     1 
ATOM   2914 O O     . LEU B 2 267 ? 38.463  15.084  7.069   1.00 48.39 ? 267 LEU A O     1 
ATOM   2915 C CB    . LEU B 2 267 ? 39.870  13.996  9.945   1.00 48.86 ? 267 LEU A CB    1 
ATOM   2916 C CG    . LEU B 2 267 ? 38.434  13.716  10.409  1.00 49.04 ? 267 LEU A CG    1 
ATOM   2917 C CD1   . LEU B 2 267 ? 37.946  12.411  9.807   1.00 48.78 ? 267 LEU A CD1   1 
ATOM   2918 C CD2   . LEU B 2 267 ? 38.383  13.649  11.927  1.00 48.77 ? 267 LEU A CD2   1 
ATOM   2919 N N     . ARG B 2 268 ? 40.033  16.404  7.999   1.00 48.42 ? 268 ARG A N     1 
ATOM   2920 C CA    . ARG B 2 268 ? 39.519  17.645  7.419   1.00 47.95 ? 268 ARG A CA    1 
ATOM   2921 C C     . ARG B 2 268 ? 39.380  17.512  5.905   1.00 46.88 ? 268 ARG A C     1 
ATOM   2922 O O     . ARG B 2 268 ? 38.354  17.884  5.335   1.00 46.84 ? 268 ARG A O     1 
ATOM   2923 C CB    . ARG B 2 268 ? 40.466  18.813  7.728   1.00 50.13 ? 268 ARG A CB    1 
ATOM   2924 C CG    . ARG B 2 268 ? 39.981  20.181  7.235   1.00 52.42 ? 268 ARG A CG    1 
ATOM   2925 C CD    . ARG B 2 268 ? 41.063  21.259  7.375   1.00 54.66 ? 268 ARG A CD    1 
ATOM   2926 N NE    . ARG B 2 268 ? 42.138  21.129  6.388   1.00 56.97 ? 268 ARG A NE    1 
ATOM   2927 C CZ    . ARG B 2 268 ? 42.007  21.389  5.088   1.00 57.42 ? 268 ARG A CZ    1 
ATOM   2928 N NH1   . ARG B 2 268 ? 40.842  21.802  4.602   1.00 57.52 ? 268 ARG A NH1   1 
ATOM   2929 N NH2   . ARG B 2 268 ? 43.040  21.230  4.268   1.00 57.28 ? 268 ARG A NH2   1 
ATOM   2930 N N     . LYS B 2 269 ? 40.419  16.983  5.261   1.00 44.86 ? 269 LYS A N     1 
ATOM   2931 C CA    . LYS B 2 269 ? 40.426  16.799  3.810   1.00 42.82 ? 269 LYS A CA    1 
ATOM   2932 C C     . LYS B 2 269 ? 39.323  15.872  3.330   1.00 41.10 ? 269 LYS A C     1 
ATOM   2933 O O     . LYS B 2 269 ? 38.670  16.139  2.320   1.00 40.94 ? 269 LYS A O     1 
ATOM   2934 C CB    . LYS B 2 269 ? 41.768  16.232  3.336   1.00 43.80 ? 269 LYS A CB    1 
ATOM   2935 C CG    . LYS B 2 269 ? 42.866  17.254  3.180   1.00 46.61 ? 269 LYS A CG    1 
ATOM   2936 C CD    . LYS B 2 269 ? 43.931  16.748  2.212   1.00 48.63 ? 269 LYS A CD    1 
ATOM   2937 C CE    . LYS B 2 269 ? 45.094  17.736  2.083   1.00 49.50 ? 269 LYS A CE    1 
ATOM   2938 N NZ    . LYS B 2 269 ? 45.923  17.816  3.328   1.00 49.62 ? 269 LYS A NZ    1 
ATOM   2939 N N     . ILE B 2 270 ? 39.136  14.773  4.052   1.00 38.46 ? 270 ILE A N     1 
ATOM   2940 C CA    . ILE B 2 270 ? 38.123  13.787  3.709   1.00 34.66 ? 270 ILE A CA    1 
ATOM   2941 C C     . ILE B 2 270 ? 36.723  14.371  3.812   1.00 32.75 ? 270 ILE A C     1 
ATOM   2942 O O     . ILE B 2 270 ? 35.883  14.109  2.963   1.00 32.08 ? 270 ILE A O     1 
ATOM   2943 C CB    . ILE B 2 270 ? 38.259  12.546  4.614   1.00 34.18 ? 270 ILE A CB    1 
ATOM   2944 C CG1   . ILE B 2 270 ? 39.528  11.779  4.227   1.00 33.80 ? 270 ILE A CG1   1 
ATOM   2945 C CG2   . ILE B 2 270 ? 37.036  11.663  4.498   1.00 33.67 ? 270 ILE A CG2   1 
ATOM   2946 C CD1   . ILE B 2 270 ? 39.909  10.690  5.203   1.00 35.88 ? 270 ILE A CD1   1 
ATOM   2947 N N     . VAL B 2 271 ? 36.479  15.169  4.846   1.00 31.42 ? 271 VAL A N     1 
ATOM   2948 C CA    . VAL B 2 271 ? 35.168  15.789  5.033   1.00 30.41 ? 271 VAL A CA    1 
ATOM   2949 C C     . VAL B 2 271 ? 34.931  16.803  3.914   1.00 31.73 ? 271 VAL A C     1 
ATOM   2950 O O     . VAL B 2 271 ? 33.800  17.055  3.495   1.00 31.46 ? 271 VAL A O     1 
ATOM   2951 C CB    . VAL B 2 271 ? 35.075  16.498  6.415   1.00 26.54 ? 271 VAL A CB    1 
ATOM   2952 C CG1   . VAL B 2 271 ? 33.785  17.287  6.530   1.00 23.75 ? 271 VAL A CG1   1 
ATOM   2953 C CG2   . VAL B 2 271 ? 35.135  15.475  7.506   1.00 24.29 ? 271 VAL A CG2   1 
ATOM   2954 N N     . GLU B 2 272 ? 36.021  17.376  3.433   1.00 33.40 ? 272 GLU A N     1 
ATOM   2955 C CA    . GLU B 2 272 ? 35.970  18.357  2.365   1.00 35.87 ? 272 GLU A CA    1 
ATOM   2956 C C     . GLU B 2 272 ? 35.566  17.655  1.076   1.00 35.86 ? 272 GLU A C     1 
ATOM   2957 O O     . GLU B 2 272 ? 34.658  18.098  0.380   1.00 36.12 ? 272 GLU A O     1 
ATOM   2958 C CB    . GLU B 2 272 ? 37.347  18.995  2.223   1.00 38.69 ? 272 GLU A CB    1 
ATOM   2959 C CG    . GLU B 2 272 ? 37.409  20.209  1.347   1.00 43.78 ? 272 GLU A CG    1 
ATOM   2960 C CD    . GLU B 2 272 ? 38.652  21.020  1.636   1.00 47.67 ? 272 GLU A CD    1 
ATOM   2961 O OE1   . GLU B 2 272 ? 38.772  21.508  2.785   1.00 48.26 ? 272 GLU A OE1   1 
ATOM   2962 O OE2   . GLU B 2 272 ? 39.509  21.158  0.727   1.00 49.64 ? 272 GLU A OE2   1 
ATOM   2963 N N     . GLU B 2 273 ? 36.254  16.558  0.776   1.00 35.83 ? 273 GLU A N     1 
ATOM   2964 C CA    . GLU B 2 273 ? 35.987  15.747  -0.404  1.00 36.75 ? 273 GLU A CA    1 
ATOM   2965 C C     . GLU B 2 273 ? 34.526  15.287  -0.400  1.00 35.52 ? 273 GLU A C     1 
ATOM   2966 O O     . GLU B 2 273 ? 33.875  15.220  -1.444  1.00 36.14 ? 273 GLU A O     1 
ATOM   2967 C CB    . GLU B 2 273 ? 36.887  14.507  -0.405  1.00 40.80 ? 273 GLU A CB    1 
ATOM   2968 C CG    . GLU B 2 273 ? 38.387  14.772  -0.456  1.00 47.55 ? 273 GLU A CG    1 
ATOM   2969 C CD    . GLU B 2 273 ? 39.204  13.509  -0.173  1.00 51.84 ? 273 GLU A CD    1 
ATOM   2970 O OE1   . GLU B 2 273 ? 38.810  12.429  -0.678  1.00 54.55 ? 273 GLU A OE1   1 
ATOM   2971 O OE2   . GLU B 2 273 ? 40.235  13.592  0.545   1.00 52.88 ? 273 GLU A OE2   1 
ATOM   2972 N N     . ARG B 2 274 ? 34.022  14.951  0.782   1.00 32.70 ? 274 ARG A N     1 
ATOM   2973 C CA    . ARG B 2 274 ? 32.647  14.497  0.932   1.00 30.05 ? 274 ARG A CA    1 
ATOM   2974 C C     . ARG B 2 274 ? 31.636  15.621  0.737   1.00 30.65 ? 274 ARG A C     1 
ATOM   2975 O O     . ARG B 2 274 ? 30.501  15.376  0.315   1.00 31.58 ? 274 ARG A O     1 
ATOM   2976 C CB    . ARG B 2 274 ? 32.452  13.890  2.311   1.00 28.57 ? 274 ARG A CB    1 
ATOM   2977 C CG    . ARG B 2 274 ? 33.266  12.651  2.551   1.00 26.60 ? 274 ARG A CG    1 
ATOM   2978 C CD    . ARG B 2 274 ? 32.829  11.968  3.837   1.00 23.72 ? 274 ARG A CD    1 
ATOM   2979 N NE    . ARG B 2 274 ? 32.864  10.534  3.632   1.00 23.05 ? 274 ARG A NE    1 
ATOM   2980 C CZ    . ARG B 2 274 ? 31.910  9.699   4.010   1.00 23.28 ? 274 ARG A CZ    1 
ATOM   2981 N NH1   . ARG B 2 274 ? 30.826  10.137  4.634   1.00 21.88 ? 274 ARG A NH1   1 
ATOM   2982 N NH2   . ARG B 2 274 ? 32.039  8.419   3.734   1.00 25.50 ? 274 ARG A NH2   1 
ATOM   2983 N N     . GLY B 2 275 ? 32.049  16.844  1.063   1.00 28.43 ? 275 GLY A N     1 
ATOM   2984 C CA    . GLY B 2 275 ? 31.181  17.993  0.913   1.00 27.45 ? 275 GLY A CA    1 
ATOM   2985 C C     . GLY B 2 275 ? 29.978  17.999  1.836   1.00 27.71 ? 275 GLY A C     1 
ATOM   2986 O O     . GLY B 2 275 ? 29.044  18.776  1.641   1.00 29.10 ? 275 GLY A O     1 
ATOM   2987 N N     . THR B 2 276 ? 29.998  17.150  2.854   1.00 27.83 ? 276 THR A N     1 
ATOM   2988 C CA    . THR B 2 276 ? 28.877  17.076  3.783   1.00 27.44 ? 276 THR A CA    1 
ATOM   2989 C C     . THR B 2 276 ? 29.071  17.981  4.987   1.00 26.62 ? 276 THR A C     1 
ATOM   2990 O O     . THR B 2 276 ? 30.121  18.591  5.153   1.00 25.60 ? 276 THR A O     1 
ATOM   2991 C CB    . THR B 2 276 ? 28.684  15.653  4.328   1.00 27.48 ? 276 THR A CB    1 
ATOM   2992 O OG1   . THR B 2 276 ? 29.808  15.312  5.147   1.00 29.54 ? 276 THR A OG1   1 
ATOM   2993 C CG2   . THR B 2 276 ? 28.554  14.646  3.197   1.00 26.45 ? 276 THR A CG2   1 
ATOM   2994 N N     . ALA B 2 277 ? 28.034  18.062  5.817   1.00 26.01 ? 277 ALA A N     1 
ATOM   2995 C CA    . ALA B 2 277 ? 28.076  18.843  7.039   1.00 24.50 ? 277 ALA A CA    1 
ATOM   2996 C C     . ALA B 2 277 ? 28.383  17.829  8.134   1.00 25.54 ? 277 ALA A C     1 
ATOM   2997 O O     . ALA B 2 277 ? 27.660  16.845  8.310   1.00 25.22 ? 277 ALA A O     1 
ATOM   2998 C CB    . ALA B 2 277 ? 26.745  19.487  7.296   1.00 23.30 ? 277 ALA A CB    1 
ATOM   2999 N N     . VAL B 2 278 ? 29.479  18.045  8.848   1.00 25.89 ? 278 VAL A N     1 
ATOM   3000 C CA    . VAL B 2 278 ? 29.856  17.138  9.915   1.00 25.93 ? 278 VAL A CA    1 
ATOM   3001 C C     . VAL B 2 278 ? 29.908  17.964  11.165  1.00 26.26 ? 278 VAL A C     1 
ATOM   3002 O O     . VAL B 2 278 ? 30.657  18.933  11.242  1.00 28.96 ? 278 VAL A O     1 
ATOM   3003 C CB    . VAL B 2 278 ? 31.237  16.494  9.671   1.00 25.39 ? 278 VAL A CB    1 
ATOM   3004 C CG1   . VAL B 2 278 ? 31.674  15.731  10.912  1.00 25.63 ? 278 VAL A CG1   1 
ATOM   3005 C CG2   . VAL B 2 278 ? 31.167  15.550  8.482   1.00 24.08 ? 278 VAL A CG2   1 
ATOM   3006 N N     . PHE B 2 279 ? 29.094  17.596  12.142  1.00 25.12 ? 279 PHE A N     1 
ATOM   3007 C CA    . PHE B 2 279 ? 29.071  18.338  13.383  1.00 25.07 ? 279 PHE A CA    1 
ATOM   3008 C C     . PHE B 2 279 ? 28.714  17.433  14.550  1.00 26.16 ? 279 PHE A C     1 
ATOM   3009 O O     . PHE B 2 279 ? 28.263  16.303  14.366  1.00 27.54 ? 279 PHE A O     1 
ATOM   3010 C CB    . PHE B 2 279 ? 28.081  19.497  13.272  1.00 24.46 ? 279 PHE A CB    1 
ATOM   3011 C CG    . PHE B 2 279 ? 26.663  19.068  13.036  1.00 23.95 ? 279 PHE A CG    1 
ATOM   3012 C CD1   . PHE B 2 279 ? 25.793  18.878  14.106  1.00 25.21 ? 279 PHE A CD1   1 
ATOM   3013 C CD2   . PHE B 2 279 ? 26.188  18.875  11.747  1.00 22.62 ? 279 PHE A CD2   1 
ATOM   3014 C CE1   . PHE B 2 279 ? 24.464  18.506  13.895  1.00 23.71 ? 279 PHE A CE1   1 
ATOM   3015 C CE2   . PHE B 2 279 ? 24.864  18.502  11.520  1.00 22.41 ? 279 PHE A CE2   1 
ATOM   3016 C CZ    . PHE B 2 279 ? 24.000  18.319  12.598  1.00 22.90 ? 279 PHE A CZ    1 
ATOM   3017 N N     . ALA B 2 280 ? 28.938  17.928  15.756  1.00 26.69 ? 280 ALA A N     1 
ATOM   3018 C CA    . ALA B 2 280 ? 28.632  17.154  16.934  1.00 26.80 ? 280 ALA A CA    1 
ATOM   3019 C C     . ALA B 2 280 ? 27.990  18.021  17.987  1.00 26.37 ? 280 ALA A C     1 
ATOM   3020 O O     . ALA B 2 280 ? 28.188  19.233  18.014  1.00 27.20 ? 280 ALA A O     1 
ATOM   3021 C CB    . ALA B 2 280 ? 29.896  16.521  17.487  1.00 28.10 ? 280 ALA A CB    1 
ATOM   3022 N N     . VAL B 2 281 ? 27.195  17.380  18.833  1.00 26.27 ? 281 VAL A N     1 
ATOM   3023 C CA    . VAL B 2 281 ? 26.530  18.041  19.937  1.00 25.77 ? 281 VAL A CA    1 
ATOM   3024 C C     . VAL B 2 281 ? 27.324  17.609  21.163  1.00 26.39 ? 281 VAL A C     1 
ATOM   3025 O O     . VAL B 2 281 ? 27.480  16.410  21.416  1.00 25.92 ? 281 VAL A O     1 
ATOM   3026 C CB    . VAL B 2 281 ? 25.069  17.581  20.069  1.00 25.56 ? 281 VAL A CB    1 
ATOM   3027 C CG1   . VAL B 2 281 ? 24.431  18.200  21.307  1.00 23.77 ? 281 VAL A CG1   1 
ATOM   3028 C CG2   . VAL B 2 281 ? 24.304  17.971  18.821  1.00 26.05 ? 281 VAL A CG2   1 
ATOM   3029 N N     . LYS B 2 282 ? 27.856  18.586  21.893  1.00 26.79 ? 282 LYS A N     1 
ATOM   3030 C CA    . LYS B 2 282 ? 28.650  18.319  23.082  1.00 26.30 ? 282 LYS A CA    1 
ATOM   3031 C C     . LYS B 2 282 ? 27.970  18.837  24.336  1.00 26.99 ? 282 LYS A C     1 
ATOM   3032 O O     . LYS B 2 282 ? 27.430  19.940  24.360  1.00 26.98 ? 282 LYS A O     1 
ATOM   3033 C CB    . LYS B 2 282 ? 30.029  18.963  22.946  1.00 26.11 ? 282 LYS A CB    1 
ATOM   3034 C CG    . LYS B 2 282 ? 30.852  18.959  24.231  1.00 25.54 ? 282 LYS A CG    1 
ATOM   3035 C CD    . LYS B 2 282 ? 32.260  19.491  23.988  1.00 25.95 ? 282 LYS A CD    1 
ATOM   3036 C CE    . LYS B 2 282 ? 33.029  19.624  25.299  1.00 27.34 ? 282 LYS A CE    1 
ATOM   3037 N NZ    . LYS B 2 282 ? 34.466  19.960  25.094  1.00 28.10 ? 282 LYS A NZ    1 
ATOM   3038 N N     . PHE B 2 283 ? 27.992  18.022  25.378  1.00 27.55 ? 283 PHE A N     1 
ATOM   3039 C CA    . PHE B 2 283 ? 27.398  18.394  26.648  1.00 29.10 ? 283 PHE A CA    1 
ATOM   3040 C C     . PHE B 2 283 ? 28.122  17.594  27.718  1.00 30.34 ? 283 PHE A C     1 
ATOM   3041 O O     . PHE B 2 283 ? 29.001  16.804  27.396  1.00 30.70 ? 283 PHE A O     1 
ATOM   3042 C CB    . PHE B 2 283 ? 25.884  18.107  26.637  1.00 28.61 ? 283 PHE A CB    1 
ATOM   3043 C CG    . PHE B 2 283 ? 25.522  16.689  26.298  1.00 27.43 ? 283 PHE A CG    1 
ATOM   3044 C CD1   . PHE B 2 283 ? 25.354  15.740  27.300  1.00 28.44 ? 283 PHE A CD1   1 
ATOM   3045 C CD2   . PHE B 2 283 ? 25.340  16.303  24.976  1.00 27.94 ? 283 PHE A CD2   1 
ATOM   3046 C CE1   . PHE B 2 283 ? 25.007  14.425  26.986  1.00 28.43 ? 283 PHE A CE1   1 
ATOM   3047 C CE2   . PHE B 2 283 ? 24.993  14.992  24.652  1.00 27.02 ? 283 PHE A CE2   1 
ATOM   3048 C CZ    . PHE B 2 283 ? 24.827  14.054  25.656  1.00 27.77 ? 283 PHE A CZ    1 
ATOM   3049 N N     . ARG B 2 284 ? 27.785  17.795  28.984  1.00 32.57 ? 284 ARG A N     1 
ATOM   3050 C CA    . ARG B 2 284 ? 28.469  17.045  30.029  1.00 35.07 ? 284 ARG A CA    1 
ATOM   3051 C C     . ARG B 2 284 ? 27.818  15.695  30.309  1.00 34.75 ? 284 ARG A C     1 
ATOM   3052 O O     . ARG B 2 284 ? 26.600  15.588  30.427  1.00 33.19 ? 284 ARG A O     1 
ATOM   3053 C CB    . ARG B 2 284 ? 28.552  17.874  31.316  1.00 37.95 ? 284 ARG A CB    1 
ATOM   3054 C CG    . ARG B 2 284 ? 29.501  19.055  31.199  1.00 42.21 ? 284 ARG A CG    1 
ATOM   3055 C CD    . ARG B 2 284 ? 29.465  19.958  32.423  1.00 45.84 ? 284 ARG A CD    1 
ATOM   3056 N NE    . ARG B 2 284 ? 30.131  21.228  32.139  1.00 50.44 ? 284 ARG A NE    1 
ATOM   3057 C CZ    . ARG B 2 284 ? 31.449  21.376  32.029  1.00 52.72 ? 284 ARG A CZ    1 
ATOM   3058 N NH1   . ARG B 2 284 ? 32.255  20.329  32.193  1.00 53.19 ? 284 ARG A NH1   1 
ATOM   3059 N NH2   . ARG B 2 284 ? 31.961  22.566  31.723  1.00 52.17 ? 284 ARG A NH2   1 
ATOM   3060 N N     . LYS B 2 285 ? 28.655  14.665  30.389  1.00 35.18 ? 285 LYS A N     1 
ATOM   3061 C CA    . LYS B 2 285 ? 28.198  13.315  30.665  1.00 35.49 ? 285 LYS A CA    1 
ATOM   3062 C C     . LYS B 2 285 ? 27.539  13.251  32.030  1.00 35.37 ? 285 LYS A C     1 
ATOM   3063 O O     . LYS B 2 285 ? 28.135  13.627  33.029  1.00 34.62 ? 285 LYS A O     1 
ATOM   3064 C CB    . LYS B 2 285 ? 29.379  12.349  30.634  1.00 36.58 ? 285 LYS A CB    1 
ATOM   3065 C CG    . LYS B 2 285 ? 29.112  11.023  31.312  1.00 38.85 ? 285 LYS A CG    1 
ATOM   3066 C CD    . LYS B 2 285 ? 30.377  10.191  31.371  1.00 42.70 ? 285 LYS A CD    1 
ATOM   3067 C CE    . LYS B 2 285 ? 30.196  8.974   32.276  1.00 45.91 ? 285 LYS A CE    1 
ATOM   3068 N NZ    . LYS B 2 285 ? 31.420  8.108   32.311  1.00 48.65 ? 285 LYS A NZ    1 
ATOM   3069 N N     . PRO B 2 286 ? 26.290  12.779  32.090  1.00 35.97 ? 286 PRO A N     1 
ATOM   3070 C CA    . PRO B 2 286 ? 25.637  12.701  33.396  1.00 36.83 ? 286 PRO A CA    1 
ATOM   3071 C C     . PRO B 2 286 ? 26.404  11.667  34.222  1.00 38.33 ? 286 PRO A C     1 
ATOM   3072 O O     . PRO B 2 286 ? 27.033  10.758  33.671  1.00 38.66 ? 286 PRO A O     1 
ATOM   3073 C CB    . PRO B 2 286 ? 24.225  12.230  33.050  1.00 36.67 ? 286 PRO A CB    1 
ATOM   3074 C CG    . PRO B 2 286 ? 24.045  12.676  31.624  1.00 36.52 ? 286 PRO A CG    1 
ATOM   3075 C CD    . PRO B 2 286 ? 25.375  12.351  31.020  1.00 35.19 ? 286 PRO A CD    1 
ATOM   3076 N N     . ASP B 2 287 ? 26.359  11.805  35.538  1.00 39.26 ? 287 ASP A N     1 
ATOM   3077 C CA    . ASP B 2 287 ? 27.066  10.875  36.408  1.00 39.96 ? 287 ASP A CA    1 
ATOM   3078 C C     . ASP B 2 287 ? 26.203  9.649   36.688  1.00 39.13 ? 287 ASP A C     1 
ATOM   3079 O O     . ASP B 2 287 ? 25.652  9.500   37.778  1.00 39.09 ? 287 ASP A O     1 
ATOM   3080 C CB    . ASP B 2 287 ? 27.438  11.575  37.713  1.00 41.28 ? 287 ASP A CB    1 
ATOM   3081 C CG    . ASP B 2 287 ? 28.270  10.709  38.621  1.00 42.18 ? 287 ASP A CG    1 
ATOM   3082 O OD1   . ASP B 2 287 ? 29.220  10.065  38.118  1.00 43.46 ? 287 ASP A OD1   1 
ATOM   3083 O OD2   . ASP B 2 287 ? 27.980  10.690  39.837  1.00 42.80 ? 287 ASP A OD2   1 
ATOM   3084 N N     . ILE B 2 288 ? 26.080  8.785   35.685  1.00 37.20 ? 288 ILE A N     1 
ATOM   3085 C CA    . ILE B 2 288 ? 25.289  7.567   35.808  1.00 35.19 ? 288 ILE A CA    1 
ATOM   3086 C C     . ILE B 2 288 ? 26.086  6.415   35.221  1.00 34.86 ? 288 ILE A C     1 
ATOM   3087 O O     . ILE B 2 288 ? 27.097  6.634   34.554  1.00 34.28 ? 288 ILE A O     1 
ATOM   3088 C CB    . ILE B 2 288 ? 23.941  7.682   35.050  1.00 34.32 ? 288 ILE A CB    1 
ATOM   3089 C CG1   . ILE B 2 288 ? 24.199  8.030   33.584  1.00 32.74 ? 288 ILE A CG1   1 
ATOM   3090 C CG2   . ILE B 2 288 ? 23.051  8.731   35.710  1.00 32.52 ? 288 ILE A CG2   1 
ATOM   3091 C CD1   . ILE B 2 288 ? 22.948  8.110   32.753  1.00 31.78 ? 288 ILE A CD1   1 
ATOM   3092 N N     . VAL B 2 289 ? 25.636  5.190   35.466  1.00 34.66 ? 289 VAL A N     1 
ATOM   3093 C CA    . VAL B 2 289 ? 26.343  4.021   34.948  1.00 34.55 ? 289 VAL A CA    1 
ATOM   3094 C C     . VAL B 2 289 ? 26.110  3.818   33.461  1.00 34.53 ? 289 VAL A C     1 
ATOM   3095 O O     . VAL B 2 289 ? 25.045  4.154   32.926  1.00 34.34 ? 289 VAL A O     1 
ATOM   3096 C CB    . VAL B 2 289 ? 25.945  2.709   35.691  1.00 33.54 ? 289 VAL A CB    1 
ATOM   3097 C CG1   . VAL B 2 289 ? 26.320  2.815   37.155  1.00 32.69 ? 289 VAL A CG1   1 
ATOM   3098 C CG2   . VAL B 2 289 ? 24.457  2.440   35.543  1.00 32.34 ? 289 VAL A CG2   1 
ATOM   3099 N N     . ASP B 2 290 ? 27.129  3.276   32.803  1.00 33.84 ? 290 ASP A N     1 
ATOM   3100 C CA    . ASP B 2 290 ? 27.076  2.992   31.382  1.00 33.02 ? 290 ASP A CA    1 
ATOM   3101 C C     . ASP B 2 290 ? 25.742  2.359   30.978  1.00 33.08 ? 290 ASP A C     1 
ATOM   3102 O O     . ASP B 2 290 ? 25.173  2.721   29.952  1.00 34.18 ? 290 ASP A O     1 
ATOM   3103 C CB    . ASP B 2 290 ? 28.226  2.054   31.000  1.00 32.82 ? 290 ASP A CB    1 
ATOM   3104 C CG    . ASP B 2 290 ? 29.567  2.768   30.909  1.00 33.86 ? 290 ASP A CG    1 
ATOM   3105 O OD1   . ASP B 2 290 ? 29.647  3.961   31.279  1.00 35.11 ? 290 ASP A OD1   1 
ATOM   3106 O OD2   . ASP B 2 290 ? 30.547  2.131   30.463  1.00 32.47 ? 290 ASP A OD2   1 
ATOM   3107 N N     . ASP B 2 291 ? 25.234  1.429   31.783  1.00 32.92 ? 291 ASP A N     1 
ATOM   3108 C CA    . ASP B 2 291 ? 23.979  0.773   31.444  1.00 32.96 ? 291 ASP A CA    1 
ATOM   3109 C C     . ASP B 2 291 ? 22.771  1.698   31.327  1.00 32.22 ? 291 ASP A C     1 
ATOM   3110 O O     . ASP B 2 291 ? 21.791  1.354   30.668  1.00 31.38 ? 291 ASP A O     1 
ATOM   3111 C CB    . ASP B 2 291 ? 23.688  -0.365  32.425  1.00 34.16 ? 291 ASP A CB    1 
ATOM   3112 C CG    . ASP B 2 291 ? 24.355  -1.677  32.010  1.00 35.83 ? 291 ASP A CG    1 
ATOM   3113 O OD1   . ASP B 2 291 ? 24.333  -2.643  32.805  1.00 36.66 ? 291 ASP A OD1   1 
ATOM   3114 O OD2   . ASP B 2 291 ? 24.897  -1.744  30.885  1.00 35.43 ? 291 ASP A OD2   1 
ATOM   3115 N N     . ASN B 2 292 ? 22.836  2.865   31.962  1.00 31.68 ? 292 ASN A N     1 
ATOM   3116 C CA    . ASN B 2 292 ? 21.744  3.831   31.880  1.00 31.01 ? 292 ASN A CA    1 
ATOM   3117 C C     . ASN B 2 292 ? 22.099  4.932   30.887  1.00 30.01 ? 292 ASN A C     1 
ATOM   3118 O O     . ASN B 2 292 ? 21.219  5.510   30.249  1.00 30.01 ? 292 ASN A O     1 
ATOM   3119 C CB    . ASN B 2 292 ? 21.460  4.467   33.243  1.00 32.63 ? 292 ASN A CB    1 
ATOM   3120 C CG    . ASN B 2 292 ? 20.812  3.499   34.218  1.00 33.38 ? 292 ASN A CG    1 
ATOM   3121 O OD1   . ASN B 2 292 ? 19.818  2.839   33.892  1.00 32.35 ? 292 ASN A OD1   1 
ATOM   3122 N ND2   . ASN B 2 292 ? 21.365  3.419   35.429  1.00 32.89 ? 292 ASN A ND2   1 
ATOM   3123 N N     . LEU B 2 293 ? 23.397  5.205   30.761  1.00 27.51 ? 293 LEU A N     1 
ATOM   3124 C CA    . LEU B 2 293 ? 23.891  6.239   29.864  1.00 25.28 ? 293 LEU A CA    1 
ATOM   3125 C C     . LEU B 2 293 ? 23.798  5.918   28.376  1.00 26.32 ? 293 LEU A C     1 
ATOM   3126 O O     . LEU B 2 293 ? 23.253  6.707   27.591  1.00 25.78 ? 293 LEU A O     1 
ATOM   3127 C CB    . LEU B 2 293 ? 25.351  6.562   30.178  1.00 22.60 ? 293 LEU A CB    1 
ATOM   3128 C CG    . LEU B 2 293 ? 25.991  7.542   29.184  1.00 20.80 ? 293 LEU A CG    1 
ATOM   3129 C CD1   . LEU B 2 293 ? 25.424  8.941   29.408  1.00 17.19 ? 293 LEU A CD1   1 
ATOM   3130 C CD2   . LEU B 2 293 ? 27.486  7.544   29.339  1.00 18.45 ? 293 LEU A CD2   1 
ATOM   3131 N N     . TYR B 2 294 ? 24.339  4.770   27.980  1.00 26.04 ? 294 TYR A N     1 
ATOM   3132 C CA    . TYR B 2 294 ? 24.355  4.423   26.569  1.00 25.24 ? 294 TYR A CA    1 
ATOM   3133 C C     . TYR B 2 294 ? 23.008  4.329   25.887  1.00 24.92 ? 294 TYR A C     1 
ATOM   3134 O O     . TYR B 2 294 ? 22.872  4.716   24.725  1.00 25.85 ? 294 TYR A O     1 
ATOM   3135 C CB    . TYR B 2 294 ? 25.205  3.174   26.340  1.00 24.63 ? 294 TYR A CB    1 
ATOM   3136 C CG    . TYR B 2 294 ? 26.683  3.504   26.420  1.00 24.24 ? 294 TYR A CG    1 
ATOM   3137 C CD1   . TYR B 2 294 ? 27.344  3.567   27.649  1.00 24.50 ? 294 TYR A CD1   1 
ATOM   3138 C CD2   . TYR B 2 294 ? 27.401  3.826   25.273  1.00 24.22 ? 294 TYR A CD2   1 
ATOM   3139 C CE1   . TYR B 2 294 ? 28.685  3.947   27.732  1.00 24.58 ? 294 TYR A CE1   1 
ATOM   3140 C CE2   . TYR B 2 294 ? 28.740  4.207   25.338  1.00 24.60 ? 294 TYR A CE2   1 
ATOM   3141 C CZ    . TYR B 2 294 ? 29.378  4.267   26.567  1.00 26.64 ? 294 TYR A CZ    1 
ATOM   3142 O OH    . TYR B 2 294 ? 30.704  4.644   26.624  1.00 27.27 ? 294 TYR A OH    1 
ATOM   3143 N N     . PRO B 2 295 ? 21.986  3.826   26.584  1.00 24.59 ? 295 PRO A N     1 
ATOM   3144 C CA    . PRO B 2 295 ? 20.701  3.771   25.886  1.00 25.24 ? 295 PRO A CA    1 
ATOM   3145 C C     . PRO B 2 295 ? 20.179  5.208   25.693  1.00 25.38 ? 295 PRO A C     1 
ATOM   3146 O O     . PRO B 2 295 ? 19.481  5.513   24.723  1.00 23.99 ? 295 PRO A O     1 
ATOM   3147 C CB    . PRO B 2 295 ? 19.831  2.947   26.839  1.00 25.30 ? 295 PRO A CB    1 
ATOM   3148 C CG    . PRO B 2 295 ? 20.821  2.018   27.456  1.00 24.57 ? 295 PRO A CG    1 
ATOM   3149 C CD    . PRO B 2 295 ? 21.957  2.977   27.783  1.00 25.91 ? 295 PRO A CD    1 
ATOM   3150 N N     . GLN B 2 296 ? 20.529  6.090   26.625  1.00 25.00 ? 296 GLN A N     1 
ATOM   3151 C CA    . GLN B 2 296 ? 20.090  7.470   26.532  1.00 25.31 ? 296 GLN A CA    1 
ATOM   3152 C C     . GLN B 2 296 ? 20.808  8.136   25.373  1.00 24.87 ? 296 GLN A C     1 
ATOM   3153 O O     . GLN B 2 296 ? 20.213  8.923   24.638  1.00 25.25 ? 296 GLN A O     1 
ATOM   3154 C CB    . GLN B 2 296 ? 20.358  8.215   27.843  1.00 24.75 ? 296 GLN A CB    1 
ATOM   3155 C CG    . GLN B 2 296 ? 19.391  7.846   28.956  1.00 25.14 ? 296 GLN A CG    1 
ATOM   3156 C CD    . GLN B 2 296 ? 19.630  8.646   30.229  1.00 27.82 ? 296 GLN A CD    1 
ATOM   3157 O OE1   . GLN B 2 296 ? 19.680  9.879   30.201  1.00 30.33 ? 296 GLN A OE1   1 
ATOM   3158 N NE2   . GLN B 2 296 ? 19.767  7.950   31.353  1.00 27.09 ? 296 GLN A NE2   1 
ATOM   3159 N N     . LEU B 2 297 ? 22.089  7.812   25.209  1.00 25.35 ? 297 LEU A N     1 
ATOM   3160 C CA    . LEU B 2 297 ? 22.864  8.367   24.112  1.00 25.36 ? 297 LEU A CA    1 
ATOM   3161 C C     . LEU B 2 297 ? 22.250  7.898   22.798  1.00 27.37 ? 297 LEU A C     1 
ATOM   3162 O O     . LEU B 2 297 ? 22.109  8.684   21.858  1.00 27.38 ? 297 LEU A O     1 
ATOM   3163 C CB    . LEU B 2 297 ? 24.331  7.931   24.200  1.00 23.93 ? 297 LEU A CB    1 
ATOM   3164 C CG    . LEU B 2 297 ? 25.163  8.648   25.269  1.00 23.04 ? 297 LEU A CG    1 
ATOM   3165 C CD1   . LEU B 2 297 ? 26.603  8.186   25.220  1.00 21.52 ? 297 LEU A CD1   1 
ATOM   3166 C CD2   . LEU B 2 297 ? 25.092  10.138  25.038  1.00 21.62 ? 297 LEU A CD2   1 
ATOM   3167 N N     . GLU B 2 298 ? 21.869  6.621   22.745  1.00 27.99 ? 298 GLU A N     1 
ATOM   3168 C CA    . GLU B 2 298 ? 21.246  6.059   21.550  1.00 28.34 ? 298 GLU A CA    1 
ATOM   3169 C C     . GLU B 2 298 ? 19.928  6.766   21.254  1.00 27.18 ? 298 GLU A C     1 
ATOM   3170 O O     . GLU B 2 298 ? 19.642  7.099   20.102  1.00 27.62 ? 298 GLU A O     1 
ATOM   3171 C CB    . GLU B 2 298 ? 21.021  4.549   21.715  1.00 29.96 ? 298 GLU A CB    1 
ATOM   3172 C CG    . GLU B 2 298 ? 22.309  3.740   21.572  1.00 33.44 ? 298 GLU A CG    1 
ATOM   3173 C CD    . GLU B 2 298 ? 22.147  2.234   21.799  1.00 36.58 ? 298 GLU A CD    1 
ATOM   3174 O OE1   . GLU B 2 298 ? 23.059  1.480   21.373  1.00 38.70 ? 298 GLU A OE1   1 
ATOM   3175 O OE2   . GLU B 2 298 ? 21.135  1.802   22.403  1.00 35.88 ? 298 GLU A OE2   1 
ATOM   3176 N N     . ARG B 2 299 ? 19.137  7.023   22.290  1.00 26.73 ? 299 ARG A N     1 
ATOM   3177 C CA    . ARG B 2 299 ? 17.860  7.696   22.095  1.00 26.14 ? 299 ARG A CA    1 
ATOM   3178 C C     . ARG B 2 299 ? 18.077  9.124   21.620  1.00 26.39 ? 299 ARG A C     1 
ATOM   3179 O O     . ARG B 2 299 ? 17.376  9.601   20.728  1.00 26.14 ? 299 ARG A O     1 
ATOM   3180 C CB    . ARG B 2 299 ? 17.030  7.711   23.387  1.00 25.12 ? 299 ARG A CB    1 
ATOM   3181 C CG    . ARG B 2 299 ? 15.814  8.639   23.290  1.00 25.80 ? 299 ARG A CG    1 
ATOM   3182 C CD    . ARG B 2 299 ? 14.928  8.600   24.509  1.00 25.74 ? 299 ARG A CD    1 
ATOM   3183 N NE    . ARG B 2 299 ? 13.614  8.087   24.151  1.00 30.30 ? 299 ARG A NE    1 
ATOM   3184 C CZ    . ARG B 2 299 ? 12.585  8.822   23.735  1.00 30.81 ? 299 ARG A CZ    1 
ATOM   3185 N NH1   . ARG B 2 299 ? 12.687  10.137  23.626  1.00 31.24 ? 299 ARG A NH1   1 
ATOM   3186 N NH2   . ARG B 2 299 ? 11.449  8.227   23.399  1.00 32.76 ? 299 ARG A NH2   1 
ATOM   3187 N N     . ALA B 2 300 ? 19.045  9.799   22.231  1.00 26.62 ? 300 ALA A N     1 
ATOM   3188 C CA    . ALA B 2 300 ? 19.378  11.180  21.897  1.00 26.49 ? 300 ALA A CA    1 
ATOM   3189 C C     . ALA B 2 300 ? 19.753  11.328  20.424  1.00 26.71 ? 300 ALA A C     1 
ATOM   3190 O O     . ALA B 2 300 ? 19.190  12.160  19.713  1.00 27.26 ? 300 ALA A O     1 
ATOM   3191 C CB    . ALA B 2 300 ? 20.519  11.654  22.773  1.00 27.34 ? 300 ALA A CB    1 
ATOM   3192 N N     . SER B 2 301 ? 20.705  10.523  19.966  1.00 26.19 ? 301 SER A N     1 
ATOM   3193 C CA    . SER B 2 301 ? 21.128  10.568  18.572  1.00 27.44 ? 301 SER A CA    1 
ATOM   3194 C C     . SER B 2 301 ? 19.946  10.340  17.640  1.00 27.90 ? 301 SER A C     1 
ATOM   3195 O O     . SER B 2 301 ? 19.747  11.075  16.679  1.00 28.71 ? 301 SER A O     1 
ATOM   3196 C CB    . SER B 2 301 ? 22.170  9.487   18.296  1.00 27.88 ? 301 SER A CB    1 
ATOM   3197 O OG    . SER B 2 301 ? 23.291  9.635   19.142  1.00 30.81 ? 301 SER A OG    1 
ATOM   3198 N N     . ARG B 2 302 ? 19.165  9.310   17.938  1.00 28.00 ? 302 ARG A N     1 
ATOM   3199 C CA    . ARG B 2 302 ? 18.014  8.952   17.128  1.00 27.20 ? 302 ARG A CA    1 
ATOM   3200 C C     . ARG B 2 302 ? 17.014  10.089  16.972  1.00 27.00 ? 302 ARG A C     1 
ATOM   3201 O O     . ARG B 2 302 ? 16.601  10.407  15.858  1.00 27.10 ? 302 ARG A O     1 
ATOM   3202 C CB    . ARG B 2 302 ? 17.315  7.732   17.738  1.00 27.47 ? 302 ARG A CB    1 
ATOM   3203 C CG    . ARG B 2 302 ? 16.307  7.061   16.829  1.00 28.53 ? 302 ARG A CG    1 
ATOM   3204 C CD    . ARG B 2 302 ? 15.628  5.893   17.533  1.00 30.89 ? 302 ARG A CD    1 
ATOM   3205 N NE    . ARG B 2 302 ? 14.536  6.327   18.403  1.00 34.22 ? 302 ARG A NE    1 
ATOM   3206 C CZ    . ARG B 2 302 ? 14.402  5.964   19.678  1.00 37.50 ? 302 ARG A CZ    1 
ATOM   3207 N NH1   . ARG B 2 302 ? 15.297  5.153   20.257  1.00 37.74 ? 302 ARG A NH1   1 
ATOM   3208 N NH2   . ARG B 2 302 ? 13.369  6.412   20.381  1.00 37.09 ? 302 ARG A NH2   1 
ATOM   3209 N N     . LYS B 2 303 ? 16.620  10.705  18.081  1.00 27.11 ? 303 LYS A N     1 
ATOM   3210 C CA    . LYS B 2 303 ? 15.630  11.778  18.015  1.00 27.81 ? 303 LYS A CA    1 
ATOM   3211 C C     . LYS B 2 303 ? 16.132  12.961  17.195  1.00 28.39 ? 303 LYS A C     1 
ATOM   3212 O O     . LYS B 2 303 ? 15.365  13.582  16.450  1.00 27.97 ? 303 LYS A O     1 
ATOM   3213 C CB    . LYS B 2 303 ? 15.243  12.245  19.422  1.00 28.63 ? 303 LYS A CB    1 
ATOM   3214 C CG    . LYS B 2 303 ? 14.601  11.167  20.285  1.00 31.02 ? 303 LYS A CG    1 
ATOM   3215 C CD    . LYS B 2 303 ? 13.295  10.649  19.693  1.00 32.71 ? 303 LYS A CD    1 
ATOM   3216 C CE    . LYS B 2 303 ? 12.203  11.714  19.707  1.00 35.67 ? 303 LYS A CE    1 
ATOM   3217 N NZ    . LYS B 2 303 ? 10.936  11.247  19.059  1.00 37.58 ? 303 LYS A NZ    1 
ATOM   3218 N N     . ILE B 2 304 ? 17.418  13.272  17.337  1.00 27.26 ? 304 ILE A N     1 
ATOM   3219 C CA    . ILE B 2 304 ? 18.005  14.375  16.597  1.00 26.36 ? 304 ILE A CA    1 
ATOM   3220 C C     . ILE B 2 304 ? 18.146  13.960  15.138  1.00 25.98 ? 304 ILE A C     1 
ATOM   3221 O O     . ILE B 2 304 ? 17.910  14.759  14.236  1.00 25.41 ? 304 ILE A O     1 
ATOM   3222 C CB    . ILE B 2 304 ? 19.380  14.770  17.202  1.00 27.42 ? 304 ILE A CB    1 
ATOM   3223 C CG1   . ILE B 2 304 ? 19.160  15.458  18.557  1.00 28.41 ? 304 ILE A CG1   1 
ATOM   3224 C CG2   . ILE B 2 304 ? 20.148  15.682  16.255  1.00 24.22 ? 304 ILE A CG2   1 
ATOM   3225 C CD1   . ILE B 2 304 ? 20.420  15.587  19.397  1.00 27.96 ? 304 ILE A CD1   1 
ATOM   3226 N N     . PHE B 2 305 ? 18.509  12.700  14.910  1.00 24.91 ? 305 PHE A N     1 
ATOM   3227 C CA    . PHE B 2 305 ? 18.663  12.187  13.550  1.00 25.09 ? 305 PHE A CA    1 
ATOM   3228 C C     . PHE B 2 305 ? 17.328  12.284  12.814  1.00 25.23 ? 305 PHE A C     1 
ATOM   3229 O O     . PHE B 2 305 ? 17.265  12.734  11.670  1.00 25.04 ? 305 PHE A O     1 
ATOM   3230 C CB    . PHE B 2 305 ? 19.117  10.731  13.575  1.00 24.56 ? 305 PHE A CB    1 
ATOM   3231 C CG    . PHE B 2 305 ? 19.489  10.187  12.225  1.00 24.52 ? 305 PHE A CG    1 
ATOM   3232 C CD1   . PHE B 2 305 ? 20.780  10.358  11.720  1.00 24.19 ? 305 PHE A CD1   1 
ATOM   3233 C CD2   . PHE B 2 305 ? 18.542  9.513   11.444  1.00 24.61 ? 305 PHE A CD2   1 
ATOM   3234 C CE1   . PHE B 2 305 ? 21.127  9.866   10.456  1.00 21.82 ? 305 PHE A CE1   1 
ATOM   3235 C CE2   . PHE B 2 305 ? 18.879  9.019   10.182  1.00 22.38 ? 305 PHE A CE2   1 
ATOM   3236 C CZ    . PHE B 2 305 ? 20.173  9.198   9.689   1.00 22.49 ? 305 PHE A CZ    1 
ATOM   3237 N N     . GLU B 2 306 ? 16.265  11.859  13.488  1.00 26.09 ? 306 GLU A N     1 
ATOM   3238 C CA    . GLU B 2 306 ? 14.915  11.896  12.930  1.00 25.91 ? 306 GLU A CA    1 
ATOM   3239 C C     . GLU B 2 306 ? 14.467  13.331  12.673  1.00 24.65 ? 306 GLU A C     1 
ATOM   3240 O O     . GLU B 2 306 ? 13.686  13.596  11.755  1.00 25.31 ? 306 GLU A O     1 
ATOM   3241 C CB    . GLU B 2 306 ? 13.944  11.202  13.883  1.00 27.75 ? 306 GLU A CB    1 
ATOM   3242 C CG    . GLU B 2 306 ? 13.956  9.683   13.769  1.00 30.94 ? 306 GLU A CG    1 
ATOM   3243 C CD    . GLU B 2 306 ? 13.345  8.990   14.981  1.00 35.33 ? 306 GLU A CD    1 
ATOM   3244 O OE1   . GLU B 2 306 ? 12.594  9.644   15.752  1.00 36.15 ? 306 GLU A OE1   1 
ATOM   3245 O OE2   . GLU B 2 306 ? 13.620  7.780   15.156  1.00 36.99 ? 306 GLU A OE2   1 
ATOM   3246 N N     . PHE B 2 307 ? 14.952  14.258  13.491  1.00 22.79 ? 307 PHE A N     1 
ATOM   3247 C CA    . PHE B 2 307 ? 14.620  15.665  13.303  1.00 21.11 ? 307 PHE A CA    1 
ATOM   3248 C C     . PHE B 2 307 ? 15.308  16.104  12.012  1.00 21.57 ? 307 PHE A C     1 
ATOM   3249 O O     . PHE B 2 307 ? 14.733  16.824  11.199  1.00 21.37 ? 307 PHE A O     1 
ATOM   3250 C CB    . PHE B 2 307 ? 15.137  16.501  14.476  1.00 18.27 ? 307 PHE A CB    1 
ATOM   3251 C CG    . PHE B 2 307 ? 15.196  17.974  14.192  1.00 16.63 ? 307 PHE A CG    1 
ATOM   3252 C CD1   . PHE B 2 307 ? 14.036  18.743  14.168  1.00 16.07 ? 307 PHE A CD1   1 
ATOM   3253 C CD2   . PHE B 2 307 ? 16.421  18.597  13.939  1.00 16.79 ? 307 PHE A CD2   1 
ATOM   3254 C CE1   . PHE B 2 307 ? 14.091  20.117  13.894  1.00 15.90 ? 307 PHE A CE1   1 
ATOM   3255 C CE2   . PHE B 2 307 ? 16.489  19.961  13.666  1.00 15.67 ? 307 PHE A CE2   1 
ATOM   3256 C CZ    . PHE B 2 307 ? 15.319  20.727  13.643  1.00 15.52 ? 307 PHE A CZ    1 
ATOM   3257 N N     . LEU B 2 308 ? 16.539  15.642  11.824  1.00 21.85 ? 308 LEU A N     1 
ATOM   3258 C CA    . LEU B 2 308 ? 17.294  15.984  10.639  1.00 23.33 ? 308 LEU A CA    1 
ATOM   3259 C C     . LEU B 2 308 ? 16.670  15.456  9.356   1.00 25.99 ? 308 LEU A C     1 
ATOM   3260 O O     . LEU B 2 308 ? 16.702  16.140  8.337   1.00 26.51 ? 308 LEU A O     1 
ATOM   3261 C CB    . LEU B 2 308 ? 18.735  15.482  10.755  1.00 21.49 ? 308 LEU A CB    1 
ATOM   3262 C CG    . LEU B 2 308 ? 19.640  16.186  11.774  1.00 20.40 ? 308 LEU A CG    1 
ATOM   3263 C CD1   . LEU B 2 308 ? 20.946  15.431  11.896  1.00 19.47 ? 308 LEU A CD1   1 
ATOM   3264 C CD2   . LEU B 2 308 ? 19.894  17.635  11.349  1.00 19.46 ? 308 LEU A CD2   1 
ATOM   3265 N N     . GLU B 2 309 ? 16.087  14.261  9.375   1.00 28.68 ? 309 GLU A N     1 
ATOM   3266 C CA    . GLU B 2 309 ? 15.513  13.771  8.131   1.00 30.09 ? 309 GLU A CA    1 
ATOM   3267 C C     . GLU B 2 309 ? 14.166  14.361  7.757   1.00 29.71 ? 309 GLU A C     1 
ATOM   3268 O O     . GLU B 2 309 ? 13.915  14.602  6.576   1.00 29.71 ? 309 GLU A O     1 
ATOM   3269 C CB    . GLU B 2 309 ? 15.469  12.231  8.079   1.00 31.09 ? 309 GLU A CB    1 
ATOM   3270 C CG    . GLU B 2 309 ? 14.984  11.495  9.306   1.00 36.83 ? 309 GLU A CG    1 
ATOM   3271 C CD    . GLU B 2 309 ? 15.093  9.960   9.146   1.00 40.42 ? 309 GLU A CD    1 
ATOM   3272 O OE1   . GLU B 2 309 ? 14.745  9.222   10.098  1.00 41.43 ? 309 GLU A OE1   1 
ATOM   3273 O OE2   . GLU B 2 309 ? 15.527  9.486   8.067   1.00 40.87 ? 309 GLU A OE2   1 
ATOM   3274 N N     . ARG B 2 310 ? 13.298  14.625  8.725   1.00 28.97 ? 310 ARG A N     1 
ATOM   3275 C CA    . ARG B 2 310 ? 12.009  15.195  8.353   1.00 29.33 ? 310 ARG A CA    1 
ATOM   3276 C C     . ARG B 2 310 ? 12.151  16.668  8.038   1.00 29.41 ? 310 ARG A C     1 
ATOM   3277 O O     . ARG B 2 310 ? 11.245  17.279  7.477   1.00 31.05 ? 310 ARG A O     1 
ATOM   3278 C CB    . ARG B 2 310 ? 10.956  14.997  9.447   1.00 28.99 ? 310 ARG A CB    1 
ATOM   3279 C CG    . ARG B 2 310 ? 11.244  15.672  10.754  1.00 29.56 ? 310 ARG A CG    1 
ATOM   3280 C CD    . ARG B 2 310 ? 10.018  15.637  11.645  1.00 29.15 ? 310 ARG A CD    1 
ATOM   3281 N NE    . ARG B 2 310 ? 10.332  16.068  13.002  1.00 30.72 ? 310 ARG A NE    1 
ATOM   3282 C CZ    . ARG B 2 310 ? 11.027  15.342  13.873  1.00 30.64 ? 310 ARG A CZ    1 
ATOM   3283 N NH1   . ARG B 2 310 ? 11.477  14.144  13.529  1.00 32.11 ? 310 ARG A NH1   1 
ATOM   3284 N NH2   . ARG B 2 310 ? 11.282  15.819  15.083  1.00 30.69 ? 310 ARG A NH2   1 
ATOM   3285 N N     . GLU B 2 311 ? 13.301  17.230  8.385   1.00 28.72 ? 311 GLU A N     1 
ATOM   3286 C CA    . GLU B 2 311 ? 13.577  18.634  8.135   1.00 28.07 ? 311 GLU A CA    1 
ATOM   3287 C C     . GLU B 2 311 ? 14.372  18.781  6.828   1.00 27.84 ? 311 GLU A C     1 
ATOM   3288 O O     . GLU B 2 311 ? 14.869  19.860  6.500   1.00 28.04 ? 311 GLU A O     1 
ATOM   3289 C CB    . GLU B 2 311 ? 14.358  19.212  9.310   1.00 28.39 ? 311 GLU A CB    1 
ATOM   3290 C CG    . GLU B 2 311 ? 13.940  20.602  9.698   1.00 30.68 ? 311 GLU A CG    1 
ATOM   3291 C CD    . GLU B 2 311 ? 12.491  20.689  10.147  1.00 30.42 ? 311 GLU A CD    1 
ATOM   3292 O OE1   . GLU B 2 311 ? 12.120  20.028  11.141  1.00 31.59 ? 311 GLU A OE1   1 
ATOM   3293 O OE2   . GLU B 2 311 ? 11.721  21.427  9.503   1.00 30.32 ? 311 GLU A OE2   1 
ATOM   3294 N N     . ASN B 2 312 ? 14.495  17.671  6.103   1.00 26.69 ? 312 ASN A N     1 
ATOM   3295 C CA    . ASN B 2 312 ? 15.176  17.607  4.806   1.00 26.92 ? 312 ASN A CA    1 
ATOM   3296 C C     . ASN B 2 312 ? 16.672  17.854  4.737   1.00 26.23 ? 312 ASN A C     1 
ATOM   3297 O O     . ASN B 2 312 ? 17.182  18.238  3.686   1.00 27.86 ? 312 ASN A O     1 
ATOM   3298 C CB    . ASN B 2 312 ? 14.490  18.544  3.802   1.00 26.93 ? 312 ASN A CB    1 
ATOM   3299 C CG    . ASN B 2 312 ? 13.044  18.175  3.564   1.00 27.73 ? 312 ASN A CG    1 
ATOM   3300 O OD1   . ASN B 2 312 ? 12.139  18.969  3.832   1.00 29.20 ? 312 ASN A OD1   1 
ATOM   3301 N ND2   . ASN B 2 312 ? 12.814  16.965  3.069   1.00 24.22 ? 312 ASN A ND2   1 
ATOM   3302 N N     . PHE B 2 313 ? 17.392  17.627  5.825   1.00 24.97 ? 313 PHE A N     1 
ATOM   3303 C CA    . PHE B 2 313 ? 18.832  17.848  5.782   1.00 23.17 ? 313 PHE A CA    1 
ATOM   3304 C C     . PHE B 2 313 ? 19.607  16.632  5.311   1.00 21.54 ? 313 PHE A C     1 
ATOM   3305 O O     . PHE B 2 313 ? 20.827  16.660  5.232   1.00 21.16 ? 313 PHE A O     1 
ATOM   3306 C CB    . PHE B 2 313 ? 19.336  18.345  7.139   1.00 22.72 ? 313 PHE A CB    1 
ATOM   3307 C CG    . PHE B 2 313 ? 18.957  19.767  7.418   1.00 21.90 ? 313 PHE A CG    1 
ATOM   3308 C CD1   . PHE B 2 313 ? 19.389  20.784  6.573   1.00 22.29 ? 313 PHE A CD1   1 
ATOM   3309 C CD2   . PHE B 2 313 ? 18.137  20.089  8.493   1.00 22.64 ? 313 PHE A CD2   1 
ATOM   3310 C CE1   . PHE B 2 313 ? 19.008  22.105  6.794   1.00 23.57 ? 313 PHE A CE1   1 
ATOM   3311 C CE2   . PHE B 2 313 ? 17.748  21.399  8.725   1.00 22.67 ? 313 PHE A CE2   1 
ATOM   3312 C CZ    . PHE B 2 313 ? 18.184  22.414  7.875   1.00 23.49 ? 313 PHE A CZ    1 
ATOM   3313 N N     . MET B 2 314 ? 18.876  15.572  4.984   1.00 21.54 ? 314 MET A N     1 
ATOM   3314 C CA    . MET B 2 314 ? 19.461  14.340  4.473   1.00 21.74 ? 314 MET A CA    1 
ATOM   3315 C C     . MET B 2 314 ? 20.627  13.786  5.290   1.00 22.08 ? 314 MET A C     1 
ATOM   3316 O O     . MET B 2 314 ? 21.742  13.655  4.793   1.00 21.89 ? 314 MET A O     1 
ATOM   3317 C CB    . MET B 2 314 ? 19.897  14.566  3.024   1.00 22.37 ? 314 MET A CB    1 
ATOM   3318 C CG    . MET B 2 314 ? 18.749  14.976  2.109   1.00 22.96 ? 314 MET A CG    1 
ATOM   3319 S SD    . MET B 2 314 ? 19.229  15.141  0.375   1.00 26.96 ? 314 MET A SD    1 
ATOM   3320 C CE    . MET B 2 314 ? 19.264  13.389  -0.117  1.00 22.84 ? 314 MET A CE    1 
ATOM   3321 N N     . PRO B 2 315 ? 20.382  13.441  6.557   1.00 22.22 ? 315 PRO A N     1 
ATOM   3322 C CA    . PRO B 2 315 ? 21.473  12.907  7.369   1.00 22.94 ? 315 PRO A CA    1 
ATOM   3323 C C     . PRO B 2 315 ? 21.885  11.511  6.874   1.00 24.38 ? 315 PRO A C     1 
ATOM   3324 O O     . PRO B 2 315 ? 21.031  10.710  6.469   1.00 24.16 ? 315 PRO A O     1 
ATOM   3325 C CB    . PRO B 2 315 ? 20.869  12.895  8.768   1.00 23.05 ? 315 PRO A CB    1 
ATOM   3326 C CG    . PRO B 2 315 ? 19.427  12.552  8.496   1.00 22.08 ? 315 PRO A CG    1 
ATOM   3327 C CD    . PRO B 2 315 ? 19.103  13.416  7.296   1.00 22.60 ? 315 PRO A CD    1 
ATOM   3328 N N     . LEU B 2 316 ? 23.189  11.234  6.893   1.00 24.57 ? 316 LEU A N     1 
ATOM   3329 C CA    . LEU B 2 316 ? 23.716  9.939   6.448   1.00 25.25 ? 316 LEU A CA    1 
ATOM   3330 C C     . LEU B 2 316 ? 23.786  8.919   7.576   1.00 25.70 ? 316 LEU A C     1 
ATOM   3331 O O     . LEU B 2 316 ? 23.292  7.802   7.446   1.00 26.87 ? 316 LEU A O     1 
ATOM   3332 C CB    . LEU B 2 316 ? 25.108  10.104  5.850   1.00 25.08 ? 316 LEU A CB    1 
ATOM   3333 C CG    . LEU B 2 316 ? 25.198  10.848  4.526   1.00 24.65 ? 316 LEU A CG    1 
ATOM   3334 C CD1   . LEU B 2 316 ? 26.668  11.121  4.229   1.00 24.13 ? 316 LEU A CD1   1 
ATOM   3335 C CD2   . LEU B 2 316 ? 24.551  10.017  3.414   1.00 23.86 ? 316 LEU A CD2   1 
ATOM   3336 N N     . ARG B 2 317 ? 24.428  9.300   8.672   1.00 25.53 ? 317 ARG A N     1 
ATOM   3337 C CA    . ARG B 2 317 ? 24.542  8.428   9.834   1.00 25.94 ? 317 ARG A CA    1 
ATOM   3338 C C     . ARG B 2 317 ? 24.775  9.297   11.051  1.00 26.38 ? 317 ARG A C     1 
ATOM   3339 O O     . ARG B 2 317 ? 24.986  10.503  10.931  1.00 26.13 ? 317 ARG A O     1 
ATOM   3340 C CB    . ARG B 2 317 ? 25.716  7.456   9.690   1.00 24.91 ? 317 ARG A CB    1 
ATOM   3341 C CG    . ARG B 2 317 ? 25.633  6.519   8.506   1.00 25.96 ? 317 ARG A CG    1 
ATOM   3342 C CD    . ARG B 2 317 ? 26.812  5.553   8.503   1.00 27.18 ? 317 ARG A CD    1 
ATOM   3343 N NE    . ARG B 2 317 ? 26.621  4.435   9.423   1.00 28.42 ? 317 ARG A NE    1 
ATOM   3344 C CZ    . ARG B 2 317 ? 27.593  3.623   9.836   1.00 28.97 ? 317 ARG A CZ    1 
ATOM   3345 N NH1   . ARG B 2 317 ? 28.847  3.803   9.425   1.00 28.77 ? 317 ARG A NH1   1 
ATOM   3346 N NH2   . ARG B 2 317 ? 27.303  2.607   10.640  1.00 27.20 ? 317 ARG A NH2   1 
ATOM   3347 N N     . SER B 2 318 ? 24.716  8.685   12.226  1.00 26.45 ? 318 SER A N     1 
ATOM   3348 C CA    . SER B 2 318 ? 24.963  9.405   13.460  1.00 27.04 ? 318 SER A CA    1 
ATOM   3349 C C     . SER B 2 318 ? 25.869  8.508   14.267  1.00 28.09 ? 318 SER A C     1 
ATOM   3350 O O     . SER B 2 318 ? 26.049  7.331   13.941  1.00 28.83 ? 318 SER A O     1 
ATOM   3351 C CB    . SER B 2 318 ? 23.672  9.659   14.235  1.00 27.20 ? 318 SER A CB    1 
ATOM   3352 O OG    . SER B 2 318 ? 23.197  8.473   14.847  1.00 30.02 ? 318 SER A OG    1 
ATOM   3353 N N     . ALA B 2 319 ? 26.451  9.069   15.314  1.00 27.82 ? 319 ALA A N     1 
ATOM   3354 C CA    . ALA B 2 319 ? 27.339  8.319   16.173  1.00 27.04 ? 319 ALA A CA    1 
ATOM   3355 C C     . ALA B 2 319 ? 27.314  9.021   17.507  1.00 27.47 ? 319 ALA A C     1 
ATOM   3356 O O     . ALA B 2 319 ? 26.579  9.985   17.687  1.00 28.36 ? 319 ALA A O     1 
ATOM   3357 C CB    . ALA B 2 319 ? 28.745  8.316   15.597  1.00 26.22 ? 319 ALA A CB    1 
ATOM   3358 N N     . PHE B 2 320 ? 28.101  8.534   18.450  1.00 28.17 ? 320 PHE A N     1 
ATOM   3359 C CA    . PHE B 2 320 ? 28.151  9.155   19.756  1.00 29.83 ? 320 PHE A CA    1 
ATOM   3360 C C     . PHE B 2 320 ? 29.326  8.605   20.549  1.00 30.16 ? 320 PHE A C     1 
ATOM   3361 O O     . PHE B 2 320 ? 29.818  7.516   20.272  1.00 29.92 ? 320 PHE A O     1 
ATOM   3362 C CB    . PHE B 2 320 ? 26.825  8.943   20.506  1.00 29.28 ? 320 PHE A CB    1 
ATOM   3363 C CG    . PHE B 2 320 ? 26.499  7.499   20.793  1.00 30.66 ? 320 PHE A CG    1 
ATOM   3364 C CD1   . PHE B 2 320 ? 27.281  6.746   21.674  1.00 30.45 ? 320 PHE A CD1   1 
ATOM   3365 C CD2   . PHE B 2 320 ? 25.401  6.892   20.190  1.00 30.37 ? 320 PHE A CD2   1 
ATOM   3366 C CE1   . PHE B 2 320 ? 26.969  5.409   21.946  1.00 29.64 ? 320 PHE A CE1   1 
ATOM   3367 C CE2   . PHE B 2 320 ? 25.080  5.557   20.457  1.00 30.08 ? 320 PHE A CE2   1 
ATOM   3368 C CZ    . PHE B 2 320 ? 25.867  4.815   21.336  1.00 29.38 ? 320 PHE A CZ    1 
ATOM   3369 N N     . LYS B 2 321 ? 29.795  9.382   21.513  1.00 30.57 ? 321 LYS A N     1 
ATOM   3370 C CA    . LYS B 2 321 ? 30.898  8.939   22.339  1.00 31.91 ? 321 LYS A CA    1 
ATOM   3371 C C     . LYS B 2 321 ? 30.849  9.596   23.699  1.00 32.70 ? 321 LYS A C     1 
ATOM   3372 O O     . LYS B 2 321 ? 30.489  10.760  23.828  1.00 31.51 ? 321 LYS A O     1 
ATOM   3373 C CB    . LYS B 2 321 ? 32.242  9.250   21.687  1.00 30.60 ? 321 LYS A CB    1 
ATOM   3374 C CG    . LYS B 2 321 ? 33.386  8.533   22.366  1.00 30.20 ? 321 LYS A CG    1 
ATOM   3375 C CD    . LYS B 2 321 ? 34.478  9.476   22.829  1.00 32.72 ? 321 LYS A CD    1 
ATOM   3376 C CE    . LYS B 2 321 ? 35.595  8.689   23.514  1.00 33.46 ? 321 LYS A CE    1 
ATOM   3377 N NZ    . LYS B 2 321 ? 36.067  7.538   22.665  1.00 33.46 ? 321 LYS A NZ    1 
ATOM   3378 N N     . ALA B 2 322 ? 31.208  8.828   24.716  1.00 34.84 ? 322 ALA A N     1 
ATOM   3379 C CA    . ALA B 2 322 ? 31.234  9.338   26.070  1.00 36.95 ? 322 ALA A CA    1 
ATOM   3380 C C     . ALA B 2 322 ? 32.674  9.305   26.558  1.00 39.11 ? 322 ALA A C     1 
ATOM   3381 O O     . ALA B 2 322 ? 33.435  8.401   26.221  1.00 39.21 ? 322 ALA A O     1 
ATOM   3382 C CB    . ALA B 2 322 ? 30.356  8.493   26.970  1.00 34.97 ? 322 ALA A CB    1 
ATOM   3383 N N     . SER B 2 323 ? 33.039  10.322  27.327  1.00 42.31 ? 323 SER A N     1 
ATOM   3384 C CA    . SER B 2 323 ? 34.362  10.437  27.915  1.00 45.24 ? 323 SER A CA    1 
ATOM   3385 C C     . SER B 2 323 ? 34.087  10.600  29.394  1.00 47.25 ? 323 SER A C     1 
ATOM   3386 O O     . SER B 2 323 ? 32.924  10.625  29.815  1.00 47.99 ? 323 SER A O     1 
ATOM   3387 C CB    . SER B 2 323 ? 35.076  11.683  27.405  1.00 46.13 ? 323 SER A CB    1 
ATOM   3388 O OG    . SER B 2 323 ? 35.116  11.699  25.994  1.00 49.56 ? 323 SER A OG    1 
ATOM   3389 N N     . GLU B 2 324 ? 35.140  10.704  30.192  1.00 48.84 ? 324 GLU A N     1 
ATOM   3390 C CA    . GLU B 2 324 ? 34.937  10.885  31.617  1.00 50.19 ? 324 GLU A CA    1 
ATOM   3391 C C     . GLU B 2 324 ? 34.284  12.247  31.695  1.00 49.29 ? 324 GLU A C     1 
ATOM   3392 O O     . GLU B 2 324 ? 33.312  12.470  32.410  1.00 48.07 ? 324 GLU A O     1 
ATOM   3393 C CB    . GLU B 2 324 ? 36.284  10.904  32.343  1.00 53.57 ? 324 GLU A CB    1 
ATOM   3394 C CG    . GLU B 2 324 ? 37.008  9.556   32.374  1.00 56.52 ? 324 GLU A CG    1 
ATOM   3395 C CD    . GLU B 2 324 ? 36.289  8.517   33.230  1.00 59.09 ? 324 GLU A CD    1 
ATOM   3396 O OE1   . GLU B 2 324 ? 35.129  8.168   32.907  1.00 60.45 ? 324 GLU A OE1   1 
ATOM   3397 O OE2   . GLU B 2 324 ? 36.885  8.052   34.229  1.00 59.11 ? 324 GLU A OE2   1 
ATOM   3398 N N     . GLU B 2 325 ? 34.828  13.137  30.882  1.00 49.16 ? 325 GLU A N     1 
ATOM   3399 C CA    . GLU B 2 325 ? 34.409  14.519  30.790  1.00 49.00 ? 325 GLU A CA    1 
ATOM   3400 C C     . GLU B 2 325 ? 33.082  14.906  30.130  1.00 47.26 ? 325 GLU A C     1 
ATOM   3401 O O     . GLU B 2 325 ? 32.184  15.439  30.788  1.00 46.59 ? 325 GLU A O     1 
ATOM   3402 C CB    . GLU B 2 325 ? 35.497  15.280  30.025  1.00 52.72 ? 325 GLU A CB    1 
ATOM   3403 C CG    . GLU B 2 325 ? 35.901  14.584  28.706  1.00 55.43 ? 325 GLU A CG    1 
ATOM   3404 C CD    . GLU B 2 325 ? 37.102  15.225  28.022  1.00 57.29 ? 325 GLU A CD    1 
ATOM   3405 O OE1   . GLU B 2 325 ? 37.303  14.968  26.806  1.00 56.79 ? 325 GLU A OE1   1 
ATOM   3406 O OE2   . GLU B 2 325 ? 37.844  15.975  28.700  1.00 57.07 ? 325 GLU A OE2   1 
ATOM   3407 N N     . PHE B 2 326 ? 32.965  14.634  28.829  1.00 44.93 ? 326 PHE A N     1 
ATOM   3408 C CA    . PHE B 2 326 ? 31.745  14.921  28.079  1.00 40.95 ? 326 PHE A CA    1 
ATOM   3409 C C     . PHE B 2 326 ? 31.185  13.797  27.221  1.00 39.35 ? 326 PHE A C     1 
ATOM   3410 O O     . PHE B 2 326 ? 31.714  12.688  27.169  1.00 38.76 ? 326 PHE A O     1 
ATOM   3411 C CB    . PHE B 2 326 ? 31.978  16.115  27.148  1.00 40.22 ? 326 PHE A CB    1 
ATOM   3412 C CG    . PHE B 2 326 ? 32.650  17.289  27.804  1.00 39.28 ? 326 PHE A CG    1 
ATOM   3413 C CD1   . PHE B 2 326 ? 34.027  17.302  27.991  1.00 38.02 ? 326 PHE A CD1   1 
ATOM   3414 C CD2   . PHE B 2 326 ? 31.904  18.397  28.213  1.00 38.61 ? 326 PHE A CD2   1 
ATOM   3415 C CE1   . PHE B 2 326 ? 34.653  18.398  28.568  1.00 38.41 ? 326 PHE A CE1   1 
ATOM   3416 C CE2   . PHE B 2 326 ? 32.521  19.498  28.792  1.00 37.15 ? 326 PHE A CE2   1 
ATOM   3417 C CZ    . PHE B 2 326 ? 33.898  19.500  28.969  1.00 36.73 ? 326 PHE A CZ    1 
ATOM   3418 N N     . CYS B 2 327 ? 30.097  14.125  26.536  1.00 37.24 ? 327 CYS A N     1 
ATOM   3419 C CA    . CYS B 2 327 ? 29.420  13.209  25.632  1.00 35.70 ? 327 CYS A CA    1 
ATOM   3420 C C     . CYS B 2 327 ? 29.283  13.933  24.302  1.00 34.44 ? 327 CYS A C     1 
ATOM   3421 O O     . CYS B 2 327 ? 29.125  15.159  24.263  1.00 33.85 ? 327 CYS A O     1 
ATOM   3422 C CB    . CYS B 2 327 ? 28.031  12.834  26.160  1.00 34.15 ? 327 CYS A CB    1 
ATOM   3423 S SG    . CYS B 2 327 ? 28.047  11.660  27.526  1.00 32.84 ? 327 CYS A SG    1 
ATOM   3424 N N     . TYR B 2 328 ? 29.354  13.176  23.215  1.00 32.81 ? 328 TYR A N     1 
ATOM   3425 C CA    . TYR B 2 328 ? 29.241  13.760  21.891  1.00 30.59 ? 328 TYR A CA    1 
ATOM   3426 C C     . TYR B 2 328 ? 28.265  12.978  21.052  1.00 28.97 ? 328 TYR A C     1 
ATOM   3427 O O     . TYR B 2 328 ? 28.245  11.755  21.081  1.00 29.36 ? 328 TYR A O     1 
ATOM   3428 C CB    . TYR B 2 328 ? 30.587  13.754  21.163  1.00 30.95 ? 328 TYR A CB    1 
ATOM   3429 C CG    . TYR B 2 328 ? 31.726  14.394  21.912  1.00 32.75 ? 328 TYR A CG    1 
ATOM   3430 C CD1   . TYR B 2 328 ? 32.372  13.719  22.951  1.00 32.17 ? 328 TYR A CD1   1 
ATOM   3431 C CD2   . TYR B 2 328 ? 32.185  15.672  21.563  1.00 33.38 ? 328 TYR A CD2   1 
ATOM   3432 C CE1   . TYR B 2 328 ? 33.454  14.296  23.624  1.00 32.71 ? 328 TYR A CE1   1 
ATOM   3433 C CE2   . TYR B 2 328 ? 33.266  16.258  22.232  1.00 33.34 ? 328 TYR A CE2   1 
ATOM   3434 C CZ    . TYR B 2 328 ? 33.894  15.562  23.258  1.00 32.73 ? 328 TYR A CZ    1 
ATOM   3435 O OH    . TYR B 2 328 ? 34.968  16.126  23.905  1.00 34.41 ? 328 TYR A OH    1 
ATOM   3436 N N     . LEU B 2 329 ? 27.440  13.701  20.313  1.00 28.20 ? 329 LEU A N     1 
ATOM   3437 C CA    . LEU B 2 329 ? 26.489  13.089  19.405  1.00 26.54 ? 329 LEU A CA    1 
ATOM   3438 C C     . LEU B 2 329 ? 27.017  13.586  18.065  1.00 26.80 ? 329 LEU A C     1 
ATOM   3439 O O     . LEU B 2 329 ? 27.115  14.788  17.842  1.00 26.75 ? 329 LEU A O     1 
ATOM   3440 C CB    . LEU B 2 329 ? 25.077  13.611  19.673  1.00 25.05 ? 329 LEU A CB    1 
ATOM   3441 C CG    . LEU B 2 329 ? 24.594  13.439  21.114  1.00 22.90 ? 329 LEU A CG    1 
ATOM   3442 C CD1   . LEU B 2 329 ? 23.178  13.977  21.263  1.00 20.04 ? 329 LEU A CD1   1 
ATOM   3443 C CD2   . LEU B 2 329 ? 24.656  11.966  21.489  1.00 23.28 ? 329 LEU A CD2   1 
ATOM   3444 N N     . LEU B 2 330 ? 27.391  12.664  17.189  1.00 27.03 ? 330 LEU A N     1 
ATOM   3445 C CA    . LEU B 2 330 ? 27.940  13.037  15.897  1.00 27.14 ? 330 LEU A CA    1 
ATOM   3446 C C     . LEU B 2 330 ? 26.934  12.901  14.770  1.00 26.17 ? 330 LEU A C     1 
ATOM   3447 O O     . LEU B 2 330 ? 26.049  12.060  14.822  1.00 26.30 ? 330 LEU A O     1 
ATOM   3448 C CB    . LEU B 2 330 ? 29.169  12.183  15.605  1.00 28.23 ? 330 LEU A CB    1 
ATOM   3449 C CG    . LEU B 2 330 ? 30.403  12.459  16.465  1.00 30.35 ? 330 LEU A CG    1 
ATOM   3450 C CD1   . LEU B 2 330 ? 30.036  12.600  17.930  1.00 31.23 ? 330 LEU A CD1   1 
ATOM   3451 C CD2   . LEU B 2 330 ? 31.382  11.315  16.273  1.00 32.74 ? 330 LEU A CD2   1 
ATOM   3452 N N     . PHE B 2 331 ? 27.091  13.731  13.744  1.00 26.33 ? 331 PHE A N     1 
ATOM   3453 C CA    . PHE B 2 331 ? 26.197  13.715  12.595  1.00 24.84 ? 331 PHE A CA    1 
ATOM   3454 C C     . PHE B 2 331 ? 26.896  14.137  11.312  1.00 25.46 ? 331 PHE A C     1 
ATOM   3455 O O     . PHE B 2 331 ? 27.834  14.939  11.332  1.00 25.84 ? 331 PHE A O     1 
ATOM   3456 C CB    . PHE B 2 331 ? 25.018  14.657  12.839  1.00 23.66 ? 331 PHE A CB    1 
ATOM   3457 C CG    . PHE B 2 331 ? 24.211  14.307  14.053  1.00 23.12 ? 331 PHE A CG    1 
ATOM   3458 C CD1   . PHE B 2 331 ? 23.342  13.225  14.036  1.00 21.05 ? 331 PHE A CD1   1 
ATOM   3459 C CD2   . PHE B 2 331 ? 24.364  15.027  15.234  1.00 21.74 ? 331 PHE A CD2   1 
ATOM   3460 C CE1   . PHE B 2 331 ? 22.640  12.865  15.179  1.00 21.14 ? 331 PHE A CE1   1 
ATOM   3461 C CE2   . PHE B 2 331 ? 23.665  14.674  16.383  1.00 21.51 ? 331 PHE A CE2   1 
ATOM   3462 C CZ    . PHE B 2 331 ? 22.803  13.592  16.356  1.00 21.05 ? 331 PHE A CZ    1 
ATOM   3463 N N     . GLU B 2 332 ? 26.442  13.565  10.202  1.00 25.18 ? 332 GLU A N     1 
ATOM   3464 C CA    . GLU B 2 332 ? 26.945  13.908  8.884   1.00 25.06 ? 332 GLU A CA    1 
ATOM   3465 C C     . GLU B 2 332 ? 25.698  14.008  8.012   1.00 26.02 ? 332 GLU A C     1 
ATOM   3466 O O     . GLU B 2 332 ? 24.891  13.076  7.956   1.00 26.30 ? 332 GLU A O     1 
ATOM   3467 C CB    . GLU B 2 332 ? 27.907  12.852  8.322   1.00 24.28 ? 332 GLU A CB    1 
ATOM   3468 C CG    . GLU B 2 332 ? 28.471  13.277  6.958   1.00 25.00 ? 332 GLU A CG    1 
ATOM   3469 C CD    . GLU B 2 332 ? 29.363  12.242  6.298   1.00 27.02 ? 332 GLU A CD    1 
ATOM   3470 O OE1   . GLU B 2 332 ? 29.082  11.029  6.431   1.00 30.32 ? 332 GLU A OE1   1 
ATOM   3471 O OE2   . GLU B 2 332 ? 30.338  12.640  5.621   1.00 24.90 ? 332 GLU A OE2   1 
ATOM   3472 N N     . CYS B 2 333 ? 25.531  15.156  7.363   1.00 25.17 ? 333 CYS A N     1 
ATOM   3473 C CA    . CYS B 2 333 ? 24.381  15.399  6.510   1.00 25.40 ? 333 CYS A CA    1 
ATOM   3474 C C     . CYS B 2 333 ? 24.817  15.716  5.092   1.00 26.05 ? 333 CYS A C     1 
ATOM   3475 O O     . CYS B 2 333 ? 25.943  16.164  4.866   1.00 27.92 ? 333 CYS A O     1 
ATOM   3476 C CB    . CYS B 2 333 ? 23.556  16.560  7.066   1.00 25.15 ? 333 CYS A CB    1 
ATOM   3477 S SG    . CYS B 2 333 ? 22.741  16.185  8.630   1.00 28.95 ? 333 CYS A SG    1 
ATOM   3478 N N     . GLN B 2 334 ? 23.923  15.489  4.137   1.00 25.34 ? 334 GLN A N     1 
ATOM   3479 C CA    . GLN B 2 334 ? 24.224  15.752  2.736   1.00 25.57 ? 334 GLN A CA    1 
ATOM   3480 C C     . GLN B 2 334 ? 23.993  17.210  2.390   1.00 25.64 ? 334 GLN A C     1 
ATOM   3481 O O     . GLN B 2 334 ? 24.601  17.736  1.460   1.00 25.88 ? 334 GLN A O     1 
ATOM   3482 C CB    . GLN B 2 334 ? 23.355  14.877  1.827   1.00 26.60 ? 334 GLN A CB    1 
ATOM   3483 C CG    . GLN B 2 334 ? 23.892  13.483  1.595   1.00 27.66 ? 334 GLN A CG    1 
ATOM   3484 C CD    . GLN B 2 334 ? 23.037  12.699  0.614   1.00 29.47 ? 334 GLN A CD    1 
ATOM   3485 O OE1   . GLN B 2 334 ? 22.030  12.095  0.997   1.00 30.97 ? 334 GLN A OE1   1 
ATOM   3486 N NE2   . GLN B 2 334 ? 23.426  12.719  -0.665  1.00 26.50 ? 334 GLN A NE2   1 
ATOM   3487 N N     . ILE B 2 335 ? 23.116  17.856  3.154   1.00 24.43 ? 335 ILE A N     1 
ATOM   3488 C CA    . ILE B 2 335 ? 22.779  19.255  2.927   1.00 24.89 ? 335 ILE A CA    1 
ATOM   3489 C C     . ILE B 2 335 ? 23.406  20.224  3.927   1.00 24.37 ? 335 ILE A C     1 
ATOM   3490 O O     . ILE B 2 335 ? 22.963  20.296  5.063   1.00 24.36 ? 335 ILE A O     1 
ATOM   3491 C CB    . ILE B 2 335 ? 21.248  19.453  2.988   1.00 25.28 ? 335 ILE A CB    1 
ATOM   3492 C CG1   . ILE B 2 335 ? 20.555  18.417  2.095   1.00 26.62 ? 335 ILE A CG1   1 
ATOM   3493 C CG2   . ILE B 2 335 ? 20.881  20.878  2.574   1.00 25.17 ? 335 ILE A CG2   1 
ATOM   3494 C CD1   . ILE B 2 335 ? 20.968  18.458  0.634   1.00 24.24 ? 335 ILE A CD1   1 
ATOM   3495 N N     . LYS B 2 336 ? 24.422  20.973  3.504   1.00 25.04 ? 336 LYS A N     1 
ATOM   3496 C CA    . LYS B 2 336 ? 25.062  21.971  4.375   1.00 26.51 ? 336 LYS A CA    1 
ATOM   3497 C C     . LYS B 2 336 ? 24.142  23.192  4.555   1.00 27.01 ? 336 LYS A C     1 
ATOM   3498 O O     . LYS B 2 336 ? 24.133  23.839  5.607   1.00 25.94 ? 336 LYS A O     1 
ATOM   3499 C CB    . LYS B 2 336 ? 26.379  22.460  3.775   1.00 25.92 ? 336 LYS A CB    1 
ATOM   3500 C CG    . LYS B 2 336 ? 27.467  21.433  3.687   1.00 28.39 ? 336 LYS A CG    1 
ATOM   3501 C CD    . LYS B 2 336 ? 28.748  22.079  3.170   1.00 30.56 ? 336 LYS A CD    1 
ATOM   3502 C CE    . LYS B 2 336 ? 29.921  21.120  3.258   1.00 33.63 ? 336 LYS A CE    1 
ATOM   3503 N NZ    . LYS B 2 336 ? 31.182  21.690  2.692   1.00 36.33 ? 336 LYS A NZ    1 
ATOM   3504 N N     . GLU B 2 337 ? 23.386  23.512  3.511   1.00 28.98 ? 337 GLU A N     1 
ATOM   3505 C CA    . GLU B 2 337 ? 22.466  24.644  3.543   1.00 30.42 ? 337 GLU A CA    1 
ATOM   3506 C C     . GLU B 2 337 ? 21.288  24.424  2.601   1.00 29.89 ? 337 GLU A C     1 
ATOM   3507 O O     . GLU B 2 337 ? 21.460  23.992  1.462   1.00 30.43 ? 337 GLU A O     1 
ATOM   3508 C CB    . GLU B 2 337 ? 23.197  25.941  3.162   1.00 31.32 ? 337 GLU A CB    1 
ATOM   3509 C CG    . GLU B 2 337 ? 22.282  27.158  3.106   1.00 36.50 ? 337 GLU A CG    1 
ATOM   3510 C CD    . GLU B 2 337 ? 23.028  28.475  3.252   1.00 38.57 ? 337 GLU A CD    1 
ATOM   3511 O OE1   . GLU B 2 337 ? 24.010  28.702  2.510   1.00 40.43 ? 337 GLU A OE1   1 
ATOM   3512 O OE2   . GLU B 2 337 ? 22.625  29.290  4.113   1.00 40.45 ? 337 GLU A OE2   1 
ATOM   3513 N N     . ILE B 2 338 ? 20.089  24.714  3.085   1.00 29.28 ? 338 ILE A N     1 
ATOM   3514 C CA    . ILE B 2 338 ? 18.889  24.563  2.274   1.00 28.56 ? 338 ILE A CA    1 
ATOM   3515 C C     . ILE B 2 338 ? 18.241  25.936  2.127   1.00 28.48 ? 338 ILE A C     1 
ATOM   3516 O O     . ILE B 2 338 ? 18.523  26.840  2.917   1.00 29.50 ? 338 ILE A O     1 
ATOM   3517 C CB    . ILE B 2 338 ? 17.902  23.578  2.934   1.00 28.06 ? 338 ILE A CB    1 
ATOM   3518 C CG1   . ILE B 2 338 ? 16.798  23.209  1.953   1.00 28.45 ? 338 ILE A CG1   1 
ATOM   3519 C CG2   . ILE B 2 338 ? 17.306  24.189  4.177   1.00 27.56 ? 338 ILE A CG2   1 
ATOM   3520 C CD1   . ILE B 2 338 ? 16.050  21.962  2.354   1.00 28.16 ? 338 ILE A CD1   1 
ATOM   3521 N N     . SER B 2 339 ? 17.392  26.109  1.118   1.00 27.57 ? 339 SER A N     1 
ATOM   3522 C CA    . SER B 2 339 ? 16.745  27.402  0.930   1.00 26.09 ? 339 SER A CA    1 
ATOM   3523 C C     . SER B 2 339 ? 15.835  27.738  2.107   1.00 26.85 ? 339 SER A C     1 
ATOM   3524 O O     . SER B 2 339 ? 15.558  26.898  2.975   1.00 25.06 ? 339 SER A O     1 
ATOM   3525 C CB    . SER B 2 339 ? 15.933  27.421  -0.364  1.00 25.31 ? 339 SER A CB    1 
ATOM   3526 O OG    . SER B 2 339 ? 14.894  26.453  -0.338  1.00 25.07 ? 339 SER A OG    1 
ATOM   3527 N N     . ARG B 2 340 ? 15.381  28.986  2.132   1.00 28.33 ? 340 ARG A N     1 
ATOM   3528 C CA    . ARG B 2 340 ? 14.496  29.458  3.178   1.00 29.08 ? 340 ARG A CA    1 
ATOM   3529 C C     . ARG B 2 340 ? 13.071  29.080  2.765   1.00 28.78 ? 340 ARG A C     1 
ATOM   3530 O O     . ARG B 2 340 ? 12.237  28.767  3.617   1.00 29.06 ? 340 ARG A O     1 
ATOM   3531 C CB    . ARG B 2 340 ? 14.641  30.976  3.325   1.00 31.89 ? 340 ARG A CB    1 
ATOM   3532 C CG    . ARG B 2 340 ? 14.127  31.554  4.630   1.00 34.37 ? 340 ARG A CG    1 
ATOM   3533 C CD    . ARG B 2 340 ? 15.233  32.323  5.337   1.00 37.53 ? 340 ARG A CD    1 
ATOM   3534 N NE    . ARG B 2 340 ? 15.418  31.859  6.713   1.00 41.23 ? 340 ARG A NE    1 
ATOM   3535 C CZ    . ARG B 2 340 ? 16.496  32.110  7.451   1.00 42.86 ? 340 ARG A CZ    1 
ATOM   3536 N NH1   . ARG B 2 340 ? 17.495  32.828  6.953   1.00 42.84 ? 340 ARG A NH1   1 
ATOM   3537 N NH2   . ARG B 2 340 ? 16.586  31.625  8.684   1.00 44.25 ? 340 ARG A NH2   1 
ATOM   3538 N N     . VAL B 2 341 ? 12.801  29.102  1.457   1.00 27.76 ? 341 VAL A N     1 
ATOM   3539 C CA    . VAL B 2 341 ? 11.472  28.750  0.927   1.00 27.81 ? 341 VAL A CA    1 
ATOM   3540 C C     . VAL B 2 341 ? 11.296  27.258  0.734   1.00 27.20 ? 341 VAL A C     1 
ATOM   3541 O O     . VAL B 2 341 ? 12.239  26.555  0.382   1.00 25.79 ? 341 VAL A O     1 
ATOM   3542 C CB    . VAL B 2 341 ? 11.183  29.338  -0.490  1.00 27.98 ? 341 VAL A CB    1 
ATOM   3543 C CG1   . VAL B 2 341 ? 9.950   30.194  -0.460  1.00 27.77 ? 341 VAL A CG1   1 
ATOM   3544 C CG2   . VAL B 2 341 ? 12.373  30.084  -1.007  1.00 29.37 ? 341 VAL A CG2   1 
ATOM   3545 N N     . PHE B 2 342 ? 10.071  26.797  0.940   1.00 27.16 ? 342 PHE A N     1 
ATOM   3546 C CA    . PHE B 2 342 ? 9.719   25.401  0.731   1.00 29.67 ? 342 PHE A CA    1 
ATOM   3547 C C     . PHE B 2 342 ? 8.222   25.384  0.437   1.00 31.21 ? 342 PHE A C     1 
ATOM   3548 O O     . PHE B 2 342 ? 7.494   26.287  0.847   1.00 31.29 ? 342 PHE A O     1 
ATOM   3549 C CB    . PHE B 2 342 ? 10.069  24.542  1.960   1.00 28.43 ? 342 PHE A CB    1 
ATOM   3550 C CG    . PHE B 2 342 ? 9.174   24.761  3.142   1.00 28.54 ? 342 PHE A CG    1 
ATOM   3551 C CD1   . PHE B 2 342 ? 8.060   23.949  3.350   1.00 28.31 ? 342 PHE A CD1   1 
ATOM   3552 C CD2   . PHE B 2 342 ? 9.445   25.774  4.057   1.00 28.90 ? 342 PHE A CD2   1 
ATOM   3553 C CE1   . PHE B 2 342 ? 7.227   24.140  4.458   1.00 28.50 ? 342 PHE A CE1   1 
ATOM   3554 C CE2   . PHE B 2 342 ? 8.621   25.975  5.168   1.00 28.79 ? 342 PHE A CE2   1 
ATOM   3555 C CZ    . PHE B 2 342 ? 7.507   25.151  5.368   1.00 28.45 ? 342 PHE A CZ    1 
ATOM   3556 N N     . ARG B 2 343 ? 7.766   24.375  -0.296  1.00 33.88 ? 343 ARG A N     1 
ATOM   3557 C CA    . ARG B 2 343 ? 6.355   24.286  -0.642  1.00 35.10 ? 343 ARG A CA    1 
ATOM   3558 C C     . ARG B 2 343 ? 5.546   23.462  0.348   1.00 36.27 ? 343 ARG A C     1 
ATOM   3559 O O     . ARG B 2 343 ? 5.970   22.396  0.801   1.00 36.48 ? 343 ARG A O     1 
ATOM   3560 C CB    . ARG B 2 343 ? 6.188   23.722  -2.057  1.00 34.84 ? 343 ARG A CB    1 
ATOM   3561 C CG    . ARG B 2 343 ? 6.970   22.452  -2.327  1.00 38.55 ? 343 ARG A CG    1 
ATOM   3562 C CD    . ARG B 2 343 ? 6.867   22.044  -3.794  1.00 40.21 ? 343 ARG A CD    1 
ATOM   3563 N NE    . ARG B 2 343 ? 5.571   21.463  -4.123  1.00 41.58 ? 343 ARG A NE    1 
ATOM   3564 C CZ    . ARG B 2 343 ? 5.060   21.437  -5.348  1.00 42.53 ? 343 ARG A CZ    1 
ATOM   3565 N NH1   . ARG B 2 343 ? 5.731   21.966  -6.360  1.00 41.56 ? 343 ARG A NH1   1 
ATOM   3566 N NH2   . ARG B 2 343 ? 3.878   20.881  -5.561  1.00 43.80 ? 343 ARG A NH2   1 
ATOM   3567 N N     . ARG B 2 344 ? 4.379   23.992  0.696   1.00 37.11 ? 344 ARG A N     1 
ATOM   3568 C CA    . ARG B 2 344 ? 3.467   23.328  1.607   1.00 37.21 ? 344 ARG A CA    1 
ATOM   3569 C C     . ARG B 2 344 ? 2.254   22.905  0.806   1.00 36.21 ? 344 ARG A C     1 
ATOM   3570 O O     . ARG B 2 344 ? 1.678   23.718  0.083   1.00 35.87 ? 344 ARG A O     1 
ATOM   3571 C CB    . ARG B 2 344 ? 3.032   24.279  2.720   1.00 39.14 ? 344 ARG A CB    1 
ATOM   3572 C CG    . ARG B 2 344 ? 1.827   23.797  3.519   1.00 41.70 ? 344 ARG A CG    1 
ATOM   3573 C CD    . ARG B 2 344 ? 1.704   24.578  4.819   1.00 44.53 ? 344 ARG A CD    1 
ATOM   3574 N NE    . ARG B 2 344 ? 2.884   24.378  5.660   1.00 46.34 ? 344 ARG A NE    1 
ATOM   3575 C CZ    . ARG B 2 344 ? 3.236   25.185  6.656   1.00 46.94 ? 344 ARG A CZ    1 
ATOM   3576 N NH1   . ARG B 2 344 ? 2.495   26.252  6.937   1.00 47.58 ? 344 ARG A NH1   1 
ATOM   3577 N NH2   . ARG B 2 344 ? 4.330   24.933  7.366   1.00 45.51 ? 344 ARG A NH2   1 
ATOM   3578 N N     . MET B 2 345 ? 1.879   21.634  0.930   1.00 35.66 ? 345 MET A N     1 
ATOM   3579 C CA    . MET B 2 345 ? 0.715   21.104  0.222   1.00 33.59 ? 345 MET A CA    1 
ATOM   3580 C C     . MET B 2 345 ? -0.556  21.595  0.888   1.00 32.22 ? 345 MET A C     1 
ATOM   3581 O O     . MET B 2 345 ? -0.672  21.579  2.108   1.00 31.27 ? 345 MET A O     1 
ATOM   3582 C CB    . MET B 2 345 ? 0.727   19.577  0.230   1.00 33.02 ? 345 MET A CB    1 
ATOM   3583 C CG    . MET B 2 345 ? -0.414  18.958  -0.561  1.00 34.04 ? 345 MET A CG    1 
ATOM   3584 S SD    . MET B 2 345 ? -0.332  17.154  -0.640  1.00 36.12 ? 345 MET A SD    1 
ATOM   3585 C CE    . MET B 2 345 ? -1.158  16.711  0.860   1.00 34.68 ? 345 MET A CE    1 
ATOM   3586 N N     . GLY B 2 346 ? -1.503  22.039  0.073   1.00 32.12 ? 346 GLY A N     1 
ATOM   3587 C CA    . GLY B 2 346 ? -2.770  22.523  0.594   1.00 31.65 ? 346 GLY A CA    1 
ATOM   3588 C C     . GLY B 2 346 ? -3.932  21.665  0.125   1.00 30.88 ? 346 GLY A C     1 
ATOM   3589 O O     . GLY B 2 346 ? -3.719  20.553  -0.374  1.00 31.13 ? 346 GLY A O     1 
ATOM   3590 N N     . PRO B 2 347 ? -5.178  22.149  0.271   1.00 30.29 ? 347 PRO A N     1 
ATOM   3591 C CA    . PRO B 2 347 ? -6.385  21.419  -0.141  1.00 30.19 ? 347 PRO A CA    1 
ATOM   3592 C C     . PRO B 2 347 ? -6.591  21.291  -1.658  1.00 31.64 ? 347 PRO A C     1 
ATOM   3593 O O     . PRO B 2 347 ? -5.992  22.031  -2.446  1.00 30.72 ? 347 PRO A O     1 
ATOM   3594 C CB    . PRO B 2 347 ? -7.503  22.224  0.508   1.00 29.00 ? 347 PRO A CB    1 
ATOM   3595 C CG    . PRO B 2 347 ? -6.956  23.629  0.459   1.00 28.07 ? 347 PRO A CG    1 
ATOM   3596 C CD    . PRO B 2 347 ? -5.534  23.428  0.914   1.00 28.60 ? 347 PRO A CD    1 
ATOM   3597 N N     . GLN B 2 348 ? -7.442  20.341  -2.058  1.00 33.29 ? 348 GLN A N     1 
ATOM   3598 C CA    . GLN B 2 348 ? -7.763  20.155  -3.473  1.00 34.27 ? 348 GLN A CA    1 
ATOM   3599 C C     . GLN B 2 348 ? -8.684  21.307  -3.872  1.00 33.31 ? 348 GLN A C     1 
ATOM   3600 O O     . GLN B 2 348 ? -9.451  21.801  -3.041  1.00 33.29 ? 348 GLN A O     1 
ATOM   3601 C CB    . GLN B 2 348 ? -8.441  18.808  -3.698  1.00 35.21 ? 348 GLN A CB    1 
ATOM   3602 C CG    . GLN B 2 348 ? -7.509  17.643  -3.456  1.00 38.16 ? 348 GLN A CG    1 
ATOM   3603 C CD    . GLN B 2 348 ? -8.014  16.356  -4.078  1.00 40.38 ? 348 GLN A CD    1 
ATOM   3604 O OE1   . GLN B 2 348 ? -9.170  15.968  -3.888  1.00 41.32 ? 348 GLN A OE1   1 
ATOM   3605 N NE2   . GLN B 2 348 ? -7.144  15.681  -4.821  1.00 41.52 ? 348 GLN A NE2   1 
ATOM   3606 N N     . PHE B 2 349 ? -8.618  21.734  -5.130  1.00 32.05 ? 349 PHE A N     1 
ATOM   3607 C CA    . PHE B 2 349 ? -9.408  22.880  -5.565  1.00 31.82 ? 349 PHE A CA    1 
ATOM   3608 C C     . PHE B 2 349 ? -10.915 22.842  -5.340  1.00 32.85 ? 349 PHE A C     1 
ATOM   3609 O O     . PHE B 2 349 ? -11.521 23.887  -5.080  1.00 32.97 ? 349 PHE A O     1 
ATOM   3610 C CB    . PHE B 2 349 ? -9.105  23.207  -7.031  1.00 30.09 ? 349 PHE A CB    1 
ATOM   3611 C CG    . PHE B 2 349 ? -9.866  22.375  -8.022  1.00 27.83 ? 349 PHE A CG    1 
ATOM   3612 C CD1   . PHE B 2 349 ? -11.173 22.709  -8.371  1.00 27.37 ? 349 PHE A CD1   1 
ATOM   3613 C CD2   . PHE B 2 349 ? -9.264  21.276  -8.631  1.00 25.51 ? 349 PHE A CD2   1 
ATOM   3614 C CE1   . PHE B 2 349 ? -11.866 21.958  -9.318  1.00 27.53 ? 349 PHE A CE1   1 
ATOM   3615 C CE2   . PHE B 2 349 ? -9.942  20.521  -9.573  1.00 24.39 ? 349 PHE A CE2   1 
ATOM   3616 C CZ    . PHE B 2 349 ? -11.245 20.858  -9.923  1.00 26.38 ? 349 PHE A CZ    1 
ATOM   3617 N N     . GLU B 2 350 ? -11.538 21.672  -5.424  1.00 33.02 ? 350 GLU A N     1 
ATOM   3618 C CA    . GLU B 2 350 ? -12.981 21.643  -5.218  1.00 35.10 ? 350 GLU A CA    1 
ATOM   3619 C C     . GLU B 2 350 ? -13.404 21.779  -3.755  1.00 35.73 ? 350 GLU A C     1 
ATOM   3620 O O     . GLU B 2 350 ? -14.596 21.791  -3.445  1.00 36.42 ? 350 GLU A O     1 
ATOM   3621 C CB    . GLU B 2 350 ? -13.618 20.390  -5.849  1.00 35.37 ? 350 GLU A CB    1 
ATOM   3622 C CG    . GLU B 2 350 ? -12.848 19.089  -5.742  1.00 36.24 ? 350 GLU A CG    1 
ATOM   3623 C CD    . GLU B 2 350 ? -11.805 18.923  -6.840  1.00 36.00 ? 350 GLU A CD    1 
ATOM   3624 O OE1   . GLU B 2 350 ? -10.669 19.407  -6.660  1.00 36.28 ? 350 GLU A OE1   1 
ATOM   3625 O OE2   . GLU B 2 350 ? -12.127 18.311  -7.884  1.00 34.84 ? 350 GLU A OE2   1 
ATOM   3626 N N     . ASP B 2 351 ? -12.430 21.918  -2.861  1.00 36.27 ? 351 ASP A N     1 
ATOM   3627 C CA    . ASP B 2 351 ? -12.724 22.050  -1.440  1.00 36.91 ? 351 ASP A CA    1 
ATOM   3628 C C     . ASP B 2 351 ? -12.763 23.520  -1.028  1.00 37.69 ? 351 ASP A C     1 
ATOM   3629 O O     . ASP B 2 351 ? -11.846 24.021  -0.378  1.00 37.00 ? 351 ASP A O     1 
ATOM   3630 C CB    . ASP B 2 351 ? -11.678 21.295  -0.623  1.00 37.36 ? 351 ASP A CB    1 
ATOM   3631 C CG    . ASP B 2 351 ? -12.090 21.110  0.822   1.00 39.41 ? 351 ASP A CG    1 
ATOM   3632 O OD1   . ASP B 2 351 ? -11.318 20.490  1.583   1.00 39.56 ? 351 ASP A OD1   1 
ATOM   3633 O OD2   . ASP B 2 351 ? -13.186 21.579  1.202   1.00 41.39 ? 351 ASP A OD2   1 
ATOM   3634 N N     . GLU B 2 352 ? -13.844 24.196  -1.407  1.00 38.80 ? 352 GLU A N     1 
ATOM   3635 C CA    . GLU B 2 352 ? -14.036 25.613  -1.112  1.00 40.63 ? 352 GLU A CA    1 
ATOM   3636 C C     . GLU B 2 352 ? -13.824 26.023  0.346   1.00 41.38 ? 352 GLU A C     1 
ATOM   3637 O O     . GLU B 2 352 ? -13.267 27.080  0.623   1.00 40.99 ? 352 GLU A O     1 
ATOM   3638 C CB    . GLU B 2 352 ? -15.433 26.035  -1.562  1.00 42.11 ? 352 GLU A CB    1 
ATOM   3639 C CG    . GLU B 2 352 ? -15.791 27.481  -1.266  1.00 45.34 ? 352 GLU A CG    1 
ATOM   3640 C CD    . GLU B 2 352 ? -17.178 27.837  -1.767  1.00 47.44 ? 352 GLU A CD    1 
ATOM   3641 O OE1   . GLU B 2 352 ? -17.345 28.075  -2.979  1.00 47.05 ? 352 GLU A OE1   1 
ATOM   3642 O OE2   . GLU B 2 352 ? -18.116 27.859  -0.944  1.00 50.40 ? 352 GLU A OE2   1 
ATOM   3643 N N     . ARG B 2 353 ? -14.263 25.192  1.280   1.00 42.59 ? 353 ARG A N     1 
ATOM   3644 C CA    . ARG B 2 353 ? -14.114 25.519  2.692   1.00 43.73 ? 353 ARG A CA    1 
ATOM   3645 C C     . ARG B 2 353 ? -12.646 25.670  3.088   1.00 43.51 ? 353 ARG A C     1 
ATOM   3646 O O     . ARG B 2 353 ? -12.201 26.758  3.464   1.00 42.56 ? 353 ARG A O     1 
ATOM   3647 C CB    . ARG B 2 353 ? -14.776 24.437  3.552   1.00 46.09 ? 353 ARG A CB    1 
ATOM   3648 C CG    . ARG B 2 353 ? -14.865 24.768  5.036   1.00 48.21 ? 353 ARG A CG    1 
ATOM   3649 C CD    . ARG B 2 353 ? -16.311 24.729  5.509   1.00 51.51 ? 353 ARG A CD    1 
ATOM   3650 N NE    . ARG B 2 353 ? -17.141 25.687  4.778   1.00 54.40 ? 353 ARG A NE    1 
ATOM   3651 C CZ    . ARG B 2 353 ? -18.416 25.951  5.054   1.00 55.55 ? 353 ARG A CZ    1 
ATOM   3652 N NH1   . ARG B 2 353 ? -19.034 25.328  6.055   1.00 56.95 ? 353 ARG A NH1   1 
ATOM   3653 N NH2   . ARG B 2 353 ? -19.074 26.848  4.331   1.00 55.52 ? 353 ARG A NH2   1 
ATOM   3654 N N     . ASN B 2 354 ? -11.899 24.573  2.995   1.00 42.98 ? 354 ASN A N     1 
ATOM   3655 C CA    . ASN B 2 354 ? -10.489 24.577  3.363   1.00 42.88 ? 354 ASN A CA    1 
ATOM   3656 C C     . ASN B 2 354 ? -9.619  25.449  2.470   1.00 41.67 ? 354 ASN A C     1 
ATOM   3657 O O     . ASN B 2 354 ? -8.659  26.045  2.942   1.00 42.73 ? 354 ASN A O     1 
ATOM   3658 C CB    . ASN B 2 354 ? -9.951  23.142  3.400   1.00 44.40 ? 354 ASN A CB    1 
ATOM   3659 C CG    . ASN B 2 354 ? -10.605 22.307  4.500   1.00 45.28 ? 354 ASN A CG    1 
ATOM   3660 O OD1   . ASN B 2 354 ? -10.519 22.647  5.682   1.00 45.21 ? 354 ASN A OD1   1 
ATOM   3661 N ND2   . ASN B 2 354 ? -11.268 21.219  4.112   1.00 44.81 ? 354 ASN A ND2   1 
ATOM   3662 N N     . VAL B 2 355 ? -9.943  25.533  1.186   1.00 40.52 ? 355 VAL A N     1 
ATOM   3663 C CA    . VAL B 2 355 ? -9.158  26.376  0.293   1.00 38.69 ? 355 VAL A CA    1 
ATOM   3664 C C     . VAL B 2 355 ? -9.191  27.793  0.846   1.00 38.58 ? 355 VAL A C     1 
ATOM   3665 O O     . VAL B 2 355 ? -8.163  28.466  0.926   1.00 38.38 ? 355 VAL A O     1 
ATOM   3666 C CB    . VAL B 2 355 ? -9.729  26.401  -1.144  1.00 37.41 ? 355 VAL A CB    1 
ATOM   3667 C CG1   . VAL B 2 355 ? -9.046  27.495  -1.956  1.00 35.14 ? 355 VAL A CG1   1 
ATOM   3668 C CG2   . VAL B 2 355 ? -9.515  25.061  -1.808  1.00 36.45 ? 355 VAL A CG2   1 
ATOM   3669 N N     . LYS B 2 356 ? -10.380 28.231  1.242   1.00 38.99 ? 356 LYS A N     1 
ATOM   3670 C CA    . LYS B 2 356 ? -10.552 29.571  1.776   1.00 40.46 ? 356 LYS A CA    1 
ATOM   3671 C C     . LYS B 2 356 ? -9.704  29.775  3.018   1.00 40.22 ? 356 LYS A C     1 
ATOM   3672 O O     . LYS B 2 356 ? -9.088  30.825  3.185   1.00 40.67 ? 356 LYS A O     1 
ATOM   3673 C CB    . LYS B 2 356 ? -12.024 29.836  2.098   1.00 42.36 ? 356 LYS A CB    1 
ATOM   3674 C CG    . LYS B 2 356 ? -12.330 31.308  2.359   1.00 46.59 ? 356 LYS A CG    1 
ATOM   3675 C CD    . LYS B 2 356 ? -13.835 31.573  2.451   1.00 49.17 ? 356 LYS A CD    1 
ATOM   3676 C CE    . LYS B 2 356 ? -14.116 33.041  2.761   1.00 50.06 ? 356 LYS A CE    1 
ATOM   3677 N NZ    . LYS B 2 356 ? -15.568 33.284  2.999   1.00 50.80 ? 356 LYS A NZ    1 
ATOM   3678 N N     . LYS B 2 357 ? -9.667  28.779  3.894   1.00 40.01 ? 357 LYS A N     1 
ATOM   3679 C CA    . LYS B 2 357 ? -8.865  28.907  5.100   1.00 40.48 ? 357 LYS A CA    1 
ATOM   3680 C C     . LYS B 2 357 ? -7.376  28.901  4.735   1.00 40.64 ? 357 LYS A C     1 
ATOM   3681 O O     . LYS B 2 357 ? -6.595  29.695  5.261   1.00 41.25 ? 357 LYS A O     1 
ATOM   3682 C CB    . LYS B 2 357 ? -9.199  27.776  6.081   1.00 40.13 ? 357 LYS A CB    1 
ATOM   3683 C CG    . LYS B 2 357 ? -10.592 27.910  6.692   1.00 40.16 ? 357 LYS A CG    1 
ATOM   3684 C CD    . LYS B 2 357 ? -10.998 26.702  7.530   1.00 40.23 ? 357 LYS A CD    1 
ATOM   3685 C CE    . LYS B 2 357 ? -10.222 26.619  8.836   1.00 40.80 ? 357 LYS A CE    1 
ATOM   3686 N NZ    . LYS B 2 357 ? -10.659 25.453  9.662   1.00 39.62 ? 357 LYS A NZ    1 
ATOM   3687 N N     . PHE B 2 358 ? -6.998  28.024  3.812   1.00 40.09 ? 358 PHE A N     1 
ATOM   3688 C CA    . PHE B 2 358 ? -5.614  27.915  3.371   1.00 39.74 ? 358 PHE A CA    1 
ATOM   3689 C C     . PHE B 2 358 ? -5.085  29.207  2.749   1.00 40.29 ? 358 PHE A C     1 
ATOM   3690 O O     . PHE B 2 358 ? -3.896  29.508  2.848   1.00 40.50 ? 358 PHE A O     1 
ATOM   3691 C CB    . PHE B 2 358 ? -5.482  26.787  2.356   1.00 38.72 ? 358 PHE A CB    1 
ATOM   3692 C CG    . PHE B 2 358 ? -4.063  26.460  1.996   1.00 37.69 ? 358 PHE A CG    1 
ATOM   3693 C CD1   . PHE B 2 358 ? -3.200  25.917  2.942   1.00 36.43 ? 358 PHE A CD1   1 
ATOM   3694 C CD2   . PHE B 2 358 ? -3.594  26.676  0.702   1.00 36.07 ? 358 PHE A CD2   1 
ATOM   3695 C CE1   . PHE B 2 358 ? -1.895  25.589  2.603   1.00 35.72 ? 358 PHE A CE1   1 
ATOM   3696 C CE2   . PHE B 2 358 ? -2.295  26.354  0.353   1.00 35.15 ? 358 PHE A CE2   1 
ATOM   3697 C CZ    . PHE B 2 358 ? -1.443  25.808  1.303   1.00 36.71 ? 358 PHE A CZ    1 
ATOM   3698 N N     . LEU B 2 359 ? -5.960  29.964  2.097   1.00 40.52 ? 359 LEU A N     1 
ATOM   3699 C CA    . LEU B 2 359 ? -5.540  31.218  1.479   1.00 41.38 ? 359 LEU A CA    1 
ATOM   3700 C C     . LEU B 2 359 ? -5.701  32.397  2.440   1.00 42.54 ? 359 LEU A C     1 
ATOM   3701 O O     . LEU B 2 359 ? -5.138  33.467  2.208   1.00 43.18 ? 359 LEU A O     1 
ATOM   3702 C CB    . LEU B 2 359 ? -6.341  31.505  0.197   1.00 38.99 ? 359 LEU A CB    1 
ATOM   3703 C CG    . LEU B 2 359 ? -6.341  30.518  -0.978  1.00 38.50 ? 359 LEU A CG    1 
ATOM   3704 C CD1   . LEU B 2 359 ? -6.911  31.216  -2.205  1.00 37.85 ? 359 LEU A CD1   1 
ATOM   3705 C CD2   . LEU B 2 359 ? -4.942  30.023  -1.282  1.00 36.47 ? 359 LEU A CD2   1 
ATOM   3706 N N     . SER B 2 360 ? -6.461  32.203  3.516   1.00 43.47 ? 360 SER A N     1 
ATOM   3707 C CA    . SER B 2 360 ? -6.689  33.281  4.474   1.00 44.95 ? 360 SER A CA    1 
ATOM   3708 C C     . SER B 2 360 ? -5.400  33.653  5.186   1.00 46.42 ? 360 SER A C     1 
ATOM   3709 O O     . SER B 2 360 ? -5.241  34.784  5.635   1.00 46.57 ? 360 SER A O     1 
ATOM   3710 C CB    . SER B 2 360 ? -7.730  32.878  5.511   1.00 43.83 ? 360 SER A CB    1 
ATOM   3711 O OG    . SER B 2 360 ? -7.151  32.037  6.484   1.00 44.50 ? 360 SER A OG    1 
ATOM   3712 N N     . ARG B 2 361 ? -4.494  32.686  5.306   1.00 48.15 ? 361 ARG A N     1 
ATOM   3713 C CA    . ARG B 2 361 ? -3.200  32.912  5.946   1.00 50.10 ? 361 ARG A CA    1 
ATOM   3714 C C     . ARG B 2 361 ? -2.372  33.875  5.096   1.00 50.26 ? 361 ARG A C     1 
ATOM   3715 O O     . ARG B 2 361 ? -2.234  33.694  3.886   1.00 50.27 ? 361 ARG A O     1 
ATOM   3716 C CB    . ARG B 2 361 ? -2.449  31.590  6.086   1.00 52.80 ? 361 ARG A CB    1 
ATOM   3717 C CG    . ARG B 2 361 ? -2.626  30.891  7.416   1.00 57.79 ? 361 ARG A CG    1 
ATOM   3718 C CD    . ARG B 2 361 ? -1.416  31.151  8.307   1.00 61.58 ? 361 ARG A CD    1 
ATOM   3719 N NE    . ARG B 2 361 ? -1.469  30.408  9.566   1.00 64.62 ? 361 ARG A NE    1 
ATOM   3720 C CZ    . ARG B 2 361 ? -0.503  30.427  10.481  1.00 66.61 ? 361 ARG A CZ    1 
ATOM   3721 N NH1   . ARG B 2 361 ? 0.593   31.148  10.279  1.00 67.53 ? 361 ARG A NH1   1 
ATOM   3722 N NH2   . ARG B 2 361 ? -0.630  29.730  11.603  1.00 68.07 ? 361 ARG A NH2   1 
ATOM   3723 N N     . ASN B 2 362 ? -1.818  34.904  5.717   1.00 50.46 ? 362 ASN A N     1 
ATOM   3724 C CA    . ASN B 2 362 ? -1.027  35.840  4.948   1.00 51.58 ? 362 ASN A CA    1 
ATOM   3725 C C     . ASN B 2 362 ? 0.402   35.333  4.889   1.00 50.60 ? 362 ASN A C     1 
ATOM   3726 O O     . ASN B 2 362 ? 1.029   35.076  5.916   1.00 49.58 ? 362 ASN A O     1 
ATOM   3727 C CB    . ASN B 2 362 ? -1.082  37.238  5.567   1.00 54.88 ? 362 ASN A CB    1 
ATOM   3728 C CG    . ASN B 2 362 ? -0.296  37.338  6.846   1.00 57.87 ? 362 ASN A CG    1 
ATOM   3729 O OD1   . ASN B 2 362 ? -0.387  36.466  7.713   1.00 61.20 ? 362 ASN A OD1   1 
ATOM   3730 N ND2   . ASN B 2 362 ? 0.479   38.409  6.982   1.00 59.39 ? 362 ASN A ND2   1 
ATOM   3731 N N     . ARG B 2 363 ? 0.896   35.158  3.670   1.00 49.46 ? 363 ARG A N     1 
ATOM   3732 C CA    . ARG B 2 363 ? 2.253   34.688  3.461   1.00 47.73 ? 363 ARG A CA    1 
ATOM   3733 C C     . ARG B 2 363 ? 2.962   35.722  2.605   1.00 46.76 ? 363 ARG A C     1 
ATOM   3734 O O     . ARG B 2 363 ? 2.329   36.615  2.037   1.00 46.84 ? 363 ARG A O     1 
ATOM   3735 C CB    . ARG B 2 363 ? 2.252   33.333  2.752   1.00 47.75 ? 363 ARG A CB    1 
ATOM   3736 C CG    . ARG B 2 363 ? 1.320   32.303  3.371   1.00 48.68 ? 363 ARG A CG    1 
ATOM   3737 C CD    . ARG B 2 363 ? 1.391   30.995  2.604   1.00 49.85 ? 363 ARG A CD    1 
ATOM   3738 N NE    . ARG B 2 363 ? 0.137   30.248  2.647   1.00 50.73 ? 363 ARG A NE    1 
ATOM   3739 C CZ    . ARG B 2 363 ? -0.338  29.642  3.727   1.00 52.61 ? 363 ARG A CZ    1 
ATOM   3740 N NH1   . ARG B 2 363 ? 0.344   29.695  4.866   1.00 55.09 ? 363 ARG A NH1   1 
ATOM   3741 N NH2   . ARG B 2 363 ? -1.489  28.980  3.670   1.00 51.23 ? 363 ARG A NH2   1 
ATOM   3742 N N     . ALA B 2 364 ? 4.277   35.607  2.513   1.00 44.88 ? 364 ALA A N     1 
ATOM   3743 C CA    . ALA B 2 364 ? 5.041   36.556  1.730   1.00 42.83 ? 364 ALA A CA    1 
ATOM   3744 C C     . ALA B 2 364 ? 4.943   36.302  0.229   1.00 41.77 ? 364 ALA A C     1 
ATOM   3745 O O     . ALA B 2 364 ? 5.148   37.224  -0.559  1.00 40.42 ? 364 ALA A O     1 
ATOM   3746 C CB    . ALA B 2 364 ? 6.503   36.525  2.168   1.00 42.32 ? 364 ALA A CB    1 
ATOM   3747 N N     . PHE B 2 365 ? 4.599   35.077  -0.177  1.00 41.00 ? 365 PHE A N     1 
ATOM   3748 C CA    . PHE B 2 365 ? 4.558   34.790  -1.608  1.00 40.30 ? 365 PHE A CA    1 
ATOM   3749 C C     . PHE B 2 365 ? 3.320   34.438  -2.419  1.00 41.22 ? 365 PHE A C     1 
ATOM   3750 O O     . PHE B 2 365 ? 3.430   34.344  -3.639  1.00 44.70 ? 365 PHE A O     1 
ATOM   3751 C CB    . PHE B 2 365 ? 5.643   33.773  -1.948  1.00 36.86 ? 365 PHE A CB    1 
ATOM   3752 C CG    . PHE B 2 365 ? 7.023   34.317  -1.819  1.00 33.22 ? 365 PHE A CG    1 
ATOM   3753 C CD1   . PHE B 2 365 ? 7.780   34.056  -0.690  1.00 31.87 ? 365 PHE A CD1   1 
ATOM   3754 C CD2   . PHE B 2 365 ? 7.521   35.178  -2.775  1.00 31.65 ? 365 PHE A CD2   1 
ATOM   3755 C CE1   . PHE B 2 365 ? 9.027   34.627  -0.525  1.00 31.66 ? 365 PHE A CE1   1 
ATOM   3756 C CE2   . PHE B 2 365 ? 8.771   35.757  -2.620  1.00 32.47 ? 365 PHE A CE2   1 
ATOM   3757 C CZ    . PHE B 2 365 ? 9.520   35.492  -1.485  1.00 31.42 ? 365 PHE A CZ    1 
ATOM   3758 N N     . ARG B 2 366 ? 2.154   34.232  -1.828  1.00 40.96 ? 366 ARG A N     1 
ATOM   3759 C CA    . ARG B 2 366 ? 1.004   33.933  -2.698  1.00 41.11 ? 366 ARG A CA    1 
ATOM   3760 C C     . ARG B 2 366 ? 1.029   32.496  -3.224  1.00 38.88 ? 366 ARG A C     1 
ATOM   3761 O O     . ARG B 2 366 ? 1.911   32.111  -3.990  1.00 36.82 ? 366 ARG A O     1 
ATOM   3762 C CB    . ARG B 2 366 ? 0.987   34.909  -3.889  1.00 43.17 ? 366 ARG A CB    1 
ATOM   3763 C CG    . ARG B 2 366 ? -0.173  34.752  -4.849  1.00 48.89 ? 366 ARG A CG    1 
ATOM   3764 C CD    . ARG B 2 366 ? 0.011   35.640  -6.075  1.00 52.68 ? 366 ARG A CD    1 
ATOM   3765 N NE    . ARG B 2 366 ? 0.081   37.071  -5.766  1.00 57.22 ? 366 ARG A NE    1 
ATOM   3766 C CZ    . ARG B 2 366 ? -0.968  37.840  -5.465  1.00 59.64 ? 366 ARG A CZ    1 
ATOM   3767 N NH1   . ARG B 2 366 ? -2.194  37.319  -5.425  1.00 59.64 ? 366 ARG A NH1   1 
ATOM   3768 N NH2   . ARG B 2 366 ? -0.796  39.141  -5.223  1.00 59.35 ? 366 ARG A NH2   1 
ATOM   3769 N N     . PRO B 2 367 ? 0.051   31.683  -2.809  1.00 37.87 ? 367 PRO A N     1 
ATOM   3770 C CA    . PRO B 2 367 ? -0.040  30.284  -3.233  1.00 37.15 ? 367 PRO A CA    1 
ATOM   3771 C C     . PRO B 2 367 ? -0.462  30.064  -4.685  1.00 36.21 ? 367 PRO A C     1 
ATOM   3772 O O     . PRO B 2 367 ? -1.007  30.958  -5.327  1.00 36.90 ? 367 PRO A O     1 
ATOM   3773 C CB    . PRO B 2 367 ? -1.023  29.686  -2.223  1.00 37.57 ? 367 PRO A CB    1 
ATOM   3774 C CG    . PRO B 2 367 ? -1.888  30.842  -1.875  1.00 38.11 ? 367 PRO A CG    1 
ATOM   3775 C CD    . PRO B 2 367 ? -0.912  31.969  -1.731  1.00 36.99 ? 367 PRO A CD    1 
ATOM   3776 N N     . PHE B 2 368 ? -0.203  28.860  -5.186  1.00 34.59 ? 368 PHE A N     1 
ATOM   3777 C CA    . PHE B 2 368 ? -0.517  28.496  -6.559  1.00 32.43 ? 368 PHE A CA    1 
ATOM   3778 C C     . PHE B 2 368 ? -1.214  27.148  -6.639  1.00 32.31 ? 368 PHE A C     1 
ATOM   3779 O O     . PHE B 2 368 ? -1.337  26.444  -5.641  1.00 32.26 ? 368 PHE A O     1 
ATOM   3780 C CB    . PHE B 2 368 ? 0.768   28.426  -7.394  1.00 30.87 ? 368 PHE A CB    1 
ATOM   3781 C CG    . PHE B 2 368 ? 1.797   27.485  -6.841  1.00 29.66 ? 368 PHE A CG    1 
ATOM   3782 C CD1   . PHE B 2 368 ? 2.639   27.885  -5.802  1.00 30.46 ? 368 PHE A CD1   1 
ATOM   3783 C CD2   . PHE B 2 368 ? 1.907   26.188  -7.329  1.00 31.08 ? 368 PHE A CD2   1 
ATOM   3784 C CE1   . PHE B 2 368 ? 3.575   27.009  -5.256  1.00 30.26 ? 368 PHE A CE1   1 
ATOM   3785 C CE2   . PHE B 2 368 ? 2.841   25.295  -6.790  1.00 30.83 ? 368 PHE A CE2   1 
ATOM   3786 C CZ    . PHE B 2 368 ? 3.678   25.706  -5.751  1.00 30.66 ? 368 PHE A CZ    1 
ATOM   3787 N N     . ILE B 2 369 ? -1.653  26.797  -7.846  1.00 32.35 ? 369 ILE A N     1 
ATOM   3788 C CA    . ILE B 2 369 ? -2.320  25.526  -8.103  1.00 32.46 ? 369 ILE A CA    1 
ATOM   3789 C C     . ILE B 2 369 ? -1.396  24.641  -8.941  1.00 32.15 ? 369 ILE A C     1 
ATOM   3790 O O     . ILE B 2 369 ? -0.632  25.136  -9.760  1.00 32.90 ? 369 ILE A O     1 
ATOM   3791 C CB    . ILE B 2 369 ? -3.655  25.747  -8.855  1.00 32.28 ? 369 ILE A CB    1 
ATOM   3792 C CG1   . ILE B 2 369 ? -4.600  26.556  -7.965  1.00 32.06 ? 369 ILE A CG1   1 
ATOM   3793 C CG2   . ILE B 2 369 ? -4.275  24.407  -9.253  1.00 30.27 ? 369 ILE A CG2   1 
ATOM   3794 C CD1   . ILE B 2 369 ? -5.925  26.877  -8.598  1.00 33.78 ? 369 ILE A CD1   1 
ATOM   3795 N N     . GLU B 2 370 ? -1.460  23.336  -8.710  1.00 31.86 ? 370 GLU A N     1 
ATOM   3796 C CA    . GLU B 2 370 ? -0.639  22.373  -9.436  1.00 31.23 ? 370 GLU A CA    1 
ATOM   3797 C C     . GLU B 2 370 ? -1.347  21.043  -9.261  1.00 31.38 ? 370 GLU A C     1 
ATOM   3798 O O     . GLU B 2 370 ? -1.594  20.611  -8.133  1.00 31.67 ? 370 GLU A O     1 
ATOM   3799 C CB    . GLU B 2 370 ? 0.781   22.347  -8.873  1.00 31.87 ? 370 GLU A CB    1 
ATOM   3800 C CG    . GLU B 2 370 ? 1.675   21.309  -9.511  1.00 31.82 ? 370 GLU A CG    1 
ATOM   3801 C CD    . GLU B 2 370 ? 2.992   21.138  -8.784  1.00 33.20 ? 370 GLU A CD    1 
ATOM   3802 O OE1   . GLU B 2 370 ? 3.812   22.084  -8.778  1.00 32.10 ? 370 GLU A OE1   1 
ATOM   3803 O OE2   . GLU B 2 370 ? 3.207   20.046  -8.218  1.00 34.83 ? 370 GLU A OE2   1 
ATOM   3804 N N     . ASN B 2 371 ? -1.678  20.407  -10.380 1.00 31.03 ? 371 ASN A N     1 
ATOM   3805 C CA    . ASN B 2 371 ? -2.347  19.111  -10.385 1.00 31.64 ? 371 ASN A CA    1 
ATOM   3806 C C     . ASN B 2 371 ? -3.561  19.057  -9.462  1.00 31.74 ? 371 ASN A C     1 
ATOM   3807 O O     . ASN B 2 371 ? -3.668  18.183  -8.606  1.00 31.86 ? 371 ASN A O     1 
ATOM   3808 C CB    . ASN B 2 371 ? -1.375  17.991  -10.023 1.00 33.30 ? 371 ASN A CB    1 
ATOM   3809 C CG    . ASN B 2 371 ? -0.103  18.056  -10.827 1.00 37.65 ? 371 ASN A CG    1 
ATOM   3810 O OD1   . ASN B 2 371 ? -0.133  18.043  -12.056 1.00 40.02 ? 371 ASN A OD1   1 
ATOM   3811 N ND2   . ASN B 2 371 ? 1.033   18.134  -10.137 1.00 39.64 ? 371 ASN A ND2   1 
ATOM   3812 N N     . GLY B 2 372 ? -4.466  20.013  -9.622  1.00 32.12 ? 372 GLY A N     1 
ATOM   3813 C CA    . GLY B 2 372 ? -5.689  20.006  -8.839  1.00 32.92 ? 372 GLY A CA    1 
ATOM   3814 C C     . GLY B 2 372 ? -5.687  20.436  -7.386  1.00 33.59 ? 372 GLY A C     1 
ATOM   3815 O O     . GLY B 2 372 ? -6.705  20.300  -6.698  1.00 34.15 ? 372 GLY A O     1 
ATOM   3816 N N     . ARG B 2 373 ? -4.570  20.941  -6.885  1.00 33.72 ? 373 ARG A N     1 
ATOM   3817 C CA    . ARG B 2 373 ? -4.581  21.373  -5.503  1.00 33.72 ? 373 ARG A CA    1 
ATOM   3818 C C     . ARG B 2 373 ? -3.694  22.560  -5.255  1.00 33.82 ? 373 ARG A C     1 
ATOM   3819 O O     . ARG B 2 373 ? -2.767  22.836  -6.018  1.00 35.12 ? 373 ARG A O     1 
ATOM   3820 C CB    . ARG B 2 373 ? -4.223  20.221  -4.557  1.00 33.61 ? 373 ARG A CB    1 
ATOM   3821 C CG    . ARG B 2 373 ? -2.828  19.667  -4.650  1.00 33.18 ? 373 ARG A CG    1 
ATOM   3822 C CD    . ARG B 2 373 ? -2.781  18.346  -3.872  1.00 34.59 ? 373 ARG A CD    1 
ATOM   3823 N NE    . ARG B 2 373 ? -3.293  18.507  -2.512  1.00 34.37 ? 373 ARG A NE    1 
ATOM   3824 C CZ    . ARG B 2 373 ? -4.037  17.606  -1.873  1.00 33.85 ? 373 ARG A CZ    1 
ATOM   3825 N NH1   . ARG B 2 373 ? -4.363  16.469  -2.467  1.00 31.26 ? 373 ARG A NH1   1 
ATOM   3826 N NH2   . ARG B 2 373 ? -4.467  17.852  -0.639  1.00 31.93 ? 373 ARG A NH2   1 
ATOM   3827 N N     . TRP B 2 374 ? -4.006  23.278  -4.185  1.00 33.76 ? 374 TRP A N     1 
ATOM   3828 C CA    . TRP B 2 374 ? -3.256  24.459  -3.831  1.00 33.12 ? 374 TRP A CA    1 
ATOM   3829 C C     . TRP B 2 374 ? -1.991  24.131  -3.077  1.00 33.56 ? 374 TRP A C     1 
ATOM   3830 O O     . TRP B 2 374 ? -1.937  23.162  -2.330  1.00 33.85 ? 374 TRP A O     1 
ATOM   3831 C CB    . TRP B 2 374 ? -4.118  25.395  -2.995  1.00 33.06 ? 374 TRP A CB    1 
ATOM   3832 C CG    . TRP B 2 374 ? -5.221  26.047  -3.767  1.00 32.28 ? 374 TRP A CG    1 
ATOM   3833 C CD1   . TRP B 2 374 ? -6.469  25.545  -4.016  1.00 31.91 ? 374 TRP A CD1   1 
ATOM   3834 C CD2   . TRP B 2 374 ? -5.175  27.340  -4.382  1.00 31.74 ? 374 TRP A CD2   1 
ATOM   3835 N NE1   . TRP B 2 374 ? -7.205  26.455  -4.744  1.00 30.98 ? 374 TRP A NE1   1 
ATOM   3836 C CE2   . TRP B 2 374 ? -6.438  27.555  -4.980  1.00 31.31 ? 374 TRP A CE2   1 
ATOM   3837 C CE3   . TRP B 2 374 ? -4.192  28.329  -4.481  1.00 31.71 ? 374 TRP A CE3   1 
ATOM   3838 C CZ2   . TRP B 2 374 ? -6.734  28.736  -5.669  1.00 33.00 ? 374 TRP A CZ2   1 
ATOM   3839 C CZ3   . TRP B 2 374 ? -4.492  29.500  -5.166  1.00 30.81 ? 374 TRP A CZ3   1 
ATOM   3840 C CH2   . TRP B 2 374 ? -5.754  29.693  -5.751  1.00 31.89 ? 374 TRP A CH2   1 
ATOM   3841 N N     . TRP B 2 375 ? -0.969  24.948  -3.304  1.00 34.08 ? 375 TRP A N     1 
ATOM   3842 C CA    . TRP B 2 375 ? 0.315   24.808  -2.638  1.00 33.16 ? 375 TRP A CA    1 
ATOM   3843 C C     . TRP B 2 375 ? 0.733   26.201  -2.187  1.00 33.71 ? 375 TRP A C     1 
ATOM   3844 O O     . TRP B 2 375 ? 0.465   27.191  -2.869  1.00 33.67 ? 375 TRP A O     1 
ATOM   3845 C CB    . TRP B 2 375 ? 1.378   24.249  -3.585  1.00 31.25 ? 375 TRP A CB    1 
ATOM   3846 C CG    . TRP B 2 375 ? 1.125   22.854  -4.025  1.00 31.61 ? 375 TRP A CG    1 
ATOM   3847 C CD1   . TRP B 2 375 ? 0.252   22.441  -4.987  1.00 30.80 ? 375 TRP A CD1   1 
ATOM   3848 C CD2   . TRP B 2 375 ? 1.733   21.674  -3.504  1.00 30.86 ? 375 TRP A CD2   1 
ATOM   3849 N NE1   . TRP B 2 375 ? 0.277   21.074  -5.093  1.00 31.70 ? 375 TRP A NE1   1 
ATOM   3850 C CE2   . TRP B 2 375 ? 1.178   20.574  -4.180  1.00 30.61 ? 375 TRP A CE2   1 
ATOM   3851 C CE3   . TRP B 2 375 ? 2.689   21.433  -2.507  1.00 31.85 ? 375 TRP A CE3   1 
ATOM   3852 C CZ2   . TRP B 2 375 ? 1.550   19.256  -3.918  1.00 32.54 ? 375 TRP A CZ2   1 
ATOM   3853 C CZ3   . TRP B 2 375 ? 3.063   20.121  -2.239  1.00 32.47 ? 375 TRP A CZ3   1 
ATOM   3854 C CH2   . TRP B 2 375 ? 2.490   19.048  -2.936  1.00 31.45 ? 375 TRP A CH2   1 
ATOM   3855 N N     . ALA B 2 376 ? 1.378   26.280  -1.033  1.00 33.20 ? 376 ALA A N     1 
ATOM   3856 C CA    . ALA B 2 376 ? 1.834   27.560  -0.525  1.00 33.29 ? 376 ALA A CA    1 
ATOM   3857 C C     . ALA B 2 376 ? 3.352   27.552  -0.372  1.00 33.52 ? 376 ALA A C     1 
ATOM   3858 O O     . ALA B 2 376 ? 3.965   26.504  -0.141  1.00 32.98 ? 376 ALA A O     1 
ATOM   3859 C CB    . ALA B 2 376 ? 1.179   27.850  0.818   1.00 33.01 ? 376 ALA A CB    1 
ATOM   3860 N N     . PHE B 2 377 ? 3.960   28.720  -0.532  1.00 32.99 ? 377 PHE A N     1 
ATOM   3861 C CA    . PHE B 2 377 ? 5.397   28.845  -0.360  1.00 32.28 ? 377 PHE A CA    1 
ATOM   3862 C C     . PHE B 2 377 ? 5.581   29.294  1.080   1.00 33.10 ? 377 PHE A C     1 
ATOM   3863 O O     . PHE B 2 377 ? 4.957   30.260  1.519   1.00 32.85 ? 377 PHE A O     1 
ATOM   3864 C CB    . PHE B 2 377 ? 5.956   29.894  -1.312  1.00 30.95 ? 377 PHE A CB    1 
ATOM   3865 C CG    . PHE B 2 377 ? 6.193   29.387  -2.702  1.00 29.40 ? 377 PHE A CG    1 
ATOM   3866 C CD1   . PHE B 2 377 ? 5.710   30.086  -3.800  1.00 28.12 ? 377 PHE A CD1   1 
ATOM   3867 C CD2   . PHE B 2 377 ? 6.951   28.240  -2.917  1.00 29.38 ? 377 PHE A CD2   1 
ATOM   3868 C CE1   . PHE B 2 377 ? 5.980   29.661  -5.091  1.00 27.31 ? 377 PHE A CE1   1 
ATOM   3869 C CE2   . PHE B 2 377 ? 7.228   27.805  -4.208  1.00 29.41 ? 377 PHE A CE2   1 
ATOM   3870 C CZ    . PHE B 2 377 ? 6.742   28.520  -5.299  1.00 29.18 ? 377 PHE A CZ    1 
ATOM   3871 N N     . GLU B 2 378 ? 6.425   28.593  1.821   1.00 33.79 ? 378 GLU A N     1 
ATOM   3872 C CA    . GLU B 2 378 ? 6.641   28.942  3.211   1.00 34.80 ? 378 GLU A CA    1 
ATOM   3873 C C     . GLU B 2 378 ? 8.116   29.264  3.458   1.00 35.01 ? 378 GLU A C     1 
ATOM   3874 O O     . GLU B 2 378 ? 8.965   29.004  2.596   1.00 36.15 ? 378 GLU A O     1 
ATOM   3875 C CB    . GLU B 2 378 ? 6.185   27.783  4.095   1.00 37.05 ? 378 GLU A CB    1 
ATOM   3876 C CG    . GLU B 2 378 ? 5.245   28.169  5.231   1.00 40.13 ? 378 GLU A CG    1 
ATOM   3877 C CD    . GLU B 2 378 ? 3.870   28.590  4.746   1.00 41.84 ? 378 GLU A CD    1 
ATOM   3878 O OE1   . GLU B 2 378 ? 3.785   29.588  3.999   1.00 44.49 ? 378 GLU A OE1   1 
ATOM   3879 O OE2   . GLU B 2 378 ? 2.873   27.925  5.111   1.00 42.58 ? 378 GLU A OE2   1 
ATOM   3880 N N     . MET B 2 379 ? 8.410   29.838  4.625   1.00 33.84 ? 379 MET A N     1 
ATOM   3881 C CA    . MET B 2 379 ? 9.777   30.202  4.991   1.00 33.08 ? 379 MET A CA    1 
ATOM   3882 C C     . MET B 2 379 ? 10.221  29.441  6.241   1.00 32.19 ? 379 MET A C     1 
ATOM   3883 O O     . MET B 2 379 ? 9.463   29.309  7.197   1.00 31.14 ? 379 MET A O     1 
ATOM   3884 C CB    . MET B 2 379 ? 9.872   31.712  5.251   1.00 32.99 ? 379 MET A CB    1 
ATOM   3885 C CG    . MET B 2 379 ? 9.541   32.579  4.057   1.00 33.36 ? 379 MET A CG    1 
ATOM   3886 S SD    . MET B 2 379 ? 10.603  32.241  2.626   1.00 37.37 ? 379 MET A SD    1 
ATOM   3887 C CE    . MET B 2 379 ? 11.910  33.428  2.864   1.00 36.49 ? 379 MET A CE    1 
ATOM   3888 N N     . ARG B 2 380 ? 11.458  28.955  6.234   1.00 31.89 ? 380 ARG A N     1 
ATOM   3889 C CA    . ARG B 2 380 ? 11.997  28.207  7.368   1.00 31.68 ? 380 ARG A CA    1 
ATOM   3890 C C     . ARG B 2 380 ? 12.629  29.114  8.426   1.00 32.47 ? 380 ARG A C     1 
ATOM   3891 O O     . ARG B 2 380 ? 13.127  30.198  8.123   1.00 32.88 ? 380 ARG A O     1 
ATOM   3892 C CB    . ARG B 2 380 ? 13.076  27.222  6.898   1.00 29.66 ? 380 ARG A CB    1 
ATOM   3893 C CG    . ARG B 2 380 ? 12.644  26.150  5.913   1.00 28.45 ? 380 ARG A CG    1 
ATOM   3894 C CD    . ARG B 2 380 ? 13.845  25.259  5.573   1.00 28.64 ? 380 ARG A CD    1 
ATOM   3895 N NE    . ARG B 2 380 ? 13.445  24.017  4.915   1.00 30.51 ? 380 ARG A NE    1 
ATOM   3896 C CZ    . ARG B 2 380 ? 13.137  23.897  3.624   1.00 31.17 ? 380 ARG A CZ    1 
ATOM   3897 N NH1   . ARG B 2 380 ? 13.191  24.945  2.812   1.00 32.17 ? 380 ARG A NH1   1 
ATOM   3898 N NH2   . ARG B 2 380 ? 12.737  22.726  3.153   1.00 29.94 ? 380 ARG A NH2   1 
ATOM   3899 N N     . LYS B 2 381 ? 12.624  28.657  9.670   1.00 33.79 ? 381 LYS A N     1 
ATOM   3900 C CA    . LYS B 2 381 ? 13.251  29.417  10.743  1.00 34.92 ? 381 LYS A CA    1 
ATOM   3901 C C     . LYS B 2 381 ? 14.763  29.150  10.730  1.00 33.22 ? 381 LYS A C     1 
ATOM   3902 O O     . LYS B 2 381 ? 15.530  29.878  11.350  1.00 34.09 ? 381 LYS A O     1 
ATOM   3903 C CB    . LYS B 2 381 ? 12.661  29.024  12.105  1.00 38.26 ? 381 LYS A CB    1 
ATOM   3904 C CG    . LYS B 2 381 ? 11.250  29.574  12.381  1.00 41.25 ? 381 LYS A CG    1 
ATOM   3905 C CD    . LYS B 2 381 ? 11.262  30.543  13.561  1.00 44.76 ? 381 LYS A CD    1 
ATOM   3906 C CE    . LYS B 2 381 ? 9.859   31.001  13.962  1.00 47.11 ? 381 LYS A CE    1 
ATOM   3907 N NZ    . LYS B 2 381 ? 9.208   31.902  12.957  1.00 48.59 ? 381 LYS A NZ    1 
ATOM   3908 N N     . PHE B 2 382 ? 15.192  28.109  10.022  1.00 31.24 ? 382 PHE A N     1 
ATOM   3909 C CA    . PHE B 2 382 ? 16.616  27.787  9.949   1.00 29.64 ? 382 PHE A CA    1 
ATOM   3910 C C     . PHE B 2 382 ? 17.003  27.201  8.597   1.00 27.32 ? 382 PHE A C     1 
ATOM   3911 O O     . PHE B 2 382 ? 16.194  26.550  7.954   1.00 27.73 ? 382 PHE A O     1 
ATOM   3912 C CB    . PHE B 2 382 ? 17.008  26.831  11.092  1.00 30.19 ? 382 PHE A CB    1 
ATOM   3913 C CG    . PHE B 2 382 ? 16.101  25.642  11.240  1.00 28.94 ? 382 PHE A CG    1 
ATOM   3914 C CD1   . PHE B 2 382 ? 16.127  24.604  10.309  1.00 29.01 ? 382 PHE A CD1   1 
ATOM   3915 C CD2   . PHE B 2 382 ? 15.216  25.564  12.306  1.00 28.24 ? 382 PHE A CD2   1 
ATOM   3916 C CE1   . PHE B 2 382 ? 15.278  23.500  10.438  1.00 27.65 ? 382 PHE A CE1   1 
ATOM   3917 C CE2   . PHE B 2 382 ? 14.361  24.465  12.446  1.00 28.69 ? 382 PHE A CE2   1 
ATOM   3918 C CZ    . PHE B 2 382 ? 14.395  23.430  11.506  1.00 27.68 ? 382 PHE A CZ    1 
ATOM   3919 N N     . THR B 2 383 ? 18.244  27.431  8.176   1.00 25.77 ? 383 THR A N     1 
ATOM   3920 C CA    . THR B 2 383 ? 18.710  26.955  6.880   1.00 23.61 ? 383 THR A CA    1 
ATOM   3921 C C     . THR B 2 383 ? 19.960  26.066  6.883   1.00 24.17 ? 383 THR A C     1 
ATOM   3922 O O     . THR B 2 383 ? 20.529  25.780  5.822   1.00 25.07 ? 383 THR A O     1 
ATOM   3923 C CB    . THR B 2 383 ? 18.955  28.146  5.929   1.00 23.17 ? 383 THR A CB    1 
ATOM   3924 O OG1   . THR B 2 383 ? 20.045  28.942  6.407   1.00 21.47 ? 383 THR A OG1   1 
ATOM   3925 C CG2   . THR B 2 383 ? 17.722  29.010  5.852   1.00 22.64 ? 383 THR A CG2   1 
ATOM   3926 N N     . THR B 2 384 ? 20.405  25.643  8.060   1.00 24.13 ? 384 THR A N     1 
ATOM   3927 C CA    . THR B 2 384 ? 21.560  24.756  8.147   1.00 24.79 ? 384 THR A CA    1 
ATOM   3928 C C     . THR B 2 384 ? 21.270  23.710  9.203   1.00 26.42 ? 384 THR A C     1 
ATOM   3929 O O     . THR B 2 384 ? 20.511  23.963  10.137  1.00 28.44 ? 384 THR A O     1 
ATOM   3930 C CB    . THR B 2 384 ? 22.861  25.492  8.556   1.00 25.68 ? 384 THR A CB    1 
ATOM   3931 O OG1   . THR B 2 384 ? 22.809  25.838  9.945   1.00 25.49 ? 384 THR A OG1   1 
ATOM   3932 C CG2   . THR B 2 384 ? 23.056  26.751  7.726   1.00 24.60 ? 384 THR A CG2   1 
ATOM   3933 N N     . PRO B 2 385 ? 21.855  22.510  9.062   1.00 27.33 ? 385 PRO A N     1 
ATOM   3934 C CA    . PRO B 2 385 ? 21.663  21.412  10.018  1.00 27.01 ? 385 PRO A CA    1 
ATOM   3935 C C     . PRO B 2 385 ? 22.006  21.850  11.450  1.00 27.30 ? 385 PRO A C     1 
ATOM   3936 O O     . PRO B 2 385 ? 21.248  21.602  12.382  1.00 27.61 ? 385 PRO A O     1 
ATOM   3937 C CB    . PRO B 2 385 ? 22.631  20.349  9.512   1.00 28.03 ? 385 PRO A CB    1 
ATOM   3938 C CG    . PRO B 2 385 ? 22.679  20.610  8.049   1.00 28.12 ? 385 PRO A CG    1 
ATOM   3939 C CD    . PRO B 2 385 ? 22.742  22.095  7.962   1.00 27.21 ? 385 PRO A CD    1 
ATOM   3940 N N     . GLU B 2 386 ? 23.159  22.495  11.609  1.00 26.47 ? 386 GLU A N     1 
ATOM   3941 C CA    . GLU B 2 386 ? 23.613  22.965  12.913  1.00 26.90 ? 386 GLU A CA    1 
ATOM   3942 C C     . GLU B 2 386 ? 22.618  23.949  13.503  1.00 27.03 ? 386 GLU A C     1 
ATOM   3943 O O     . GLU B 2 386 ? 22.356  23.956  14.700  1.00 26.96 ? 386 GLU A O     1 
ATOM   3944 C CB    . GLU B 2 386 ? 24.985  23.642  12.799  1.00 26.49 ? 386 GLU A CB    1 
ATOM   3945 C CG    . GLU B 2 386 ? 26.093  22.754  12.257  1.00 27.49 ? 386 GLU A CG    1 
ATOM   3946 C CD    . GLU B 2 386 ? 26.240  22.824  10.738  1.00 29.82 ? 386 GLU A CD    1 
ATOM   3947 O OE1   . GLU B 2 386 ? 25.272  23.208  10.037  1.00 29.21 ? 386 GLU A OE1   1 
ATOM   3948 O OE2   . GLU B 2 386 ? 27.335  22.474  10.241  1.00 30.89 ? 386 GLU A OE2   1 
ATOM   3949 N N     . GLU B 2 387 ? 22.067  24.784  12.640  1.00 27.89 ? 387 GLU A N     1 
ATOM   3950 C CA    . GLU B 2 387 ? 21.108  25.791  13.045  1.00 29.07 ? 387 GLU A CA    1 
ATOM   3951 C C     . GLU B 2 387 ? 19.810  25.110  13.481  1.00 28.76 ? 387 GLU A C     1 
ATOM   3952 O O     . GLU B 2 387 ? 19.111  25.588  14.376  1.00 28.96 ? 387 GLU A O     1 
ATOM   3953 C CB    . GLU B 2 387 ? 20.890  26.732  11.863  1.00 31.05 ? 387 GLU A CB    1 
ATOM   3954 C CG    . GLU B 2 387 ? 19.950  27.896  12.080  1.00 36.14 ? 387 GLU A CG    1 
ATOM   3955 C CD    . GLU B 2 387 ? 20.035  28.911  10.936  1.00 38.43 ? 387 GLU A CD    1 
ATOM   3956 O OE1   . GLU B 2 387 ? 19.041  29.641  10.711  1.00 40.77 ? 387 GLU A OE1   1 
ATOM   3957 O OE2   . GLU B 2 387 ? 21.100  28.986  10.270  1.00 37.49 ? 387 GLU A OE2   1 
ATOM   3958 N N     . GLY B 2 388 ? 19.509  23.975  12.855  1.00 28.52 ? 388 GLY A N     1 
ATOM   3959 C CA    . GLY B 2 388 ? 18.301  23.238  13.177  1.00 27.22 ? 388 GLY A CA    1 
ATOM   3960 C C     . GLY B 2 388 ? 18.397  22.533  14.515  1.00 27.06 ? 388 GLY A C     1 
ATOM   3961 O O     . GLY B 2 388 ? 17.486  22.643  15.346  1.00 26.62 ? 388 GLY A O     1 
ATOM   3962 N N     . VAL B 2 389 ? 19.499  21.813  14.725  1.00 25.78 ? 389 VAL A N     1 
ATOM   3963 C CA    . VAL B 2 389 ? 19.719  21.089  15.976  1.00 25.54 ? 389 VAL A CA    1 
ATOM   3964 C C     . VAL B 2 389 ? 19.855  22.030  17.188  1.00 26.51 ? 389 VAL A C     1 
ATOM   3965 O O     . VAL B 2 389 ? 19.402  21.698  18.285  1.00 26.62 ? 389 VAL A O     1 
ATOM   3966 C CB    . VAL B 2 389 ? 20.969  20.182  15.884  1.00 24.28 ? 389 VAL A CB    1 
ATOM   3967 C CG1   . VAL B 2 389 ? 21.174  19.432  17.193  1.00 20.45 ? 389 VAL A CG1   1 
ATOM   3968 C CG2   . VAL B 2 389 ? 20.809  19.210  14.725  1.00 22.70 ? 389 VAL A CG2   1 
ATOM   3969 N N     . ARG B 2 390 ? 20.476  23.196  17.005  1.00 26.17 ? 390 ARG A N     1 
ATOM   3970 C CA    . ARG B 2 390 ? 20.595  24.125  18.120  1.00 26.47 ? 390 ARG A CA    1 
ATOM   3971 C C     . ARG B 2 390 ? 19.194  24.530  18.537  1.00 25.68 ? 390 ARG A C     1 
ATOM   3972 O O     . ARG B 2 390 ? 18.958  24.889  19.689  1.00 26.33 ? 390 ARG A O     1 
ATOM   3973 C CB    . ARG B 2 390 ? 21.372  25.386  17.749  1.00 28.01 ? 390 ARG A CB    1 
ATOM   3974 C CG    . ARG B 2 390 ? 21.285  26.463  18.841  1.00 27.86 ? 390 ARG A CG    1 
ATOM   3975 C CD    . ARG B 2 390 ? 21.157  27.845  18.236  1.00 29.91 ? 390 ARG A CD    1 
ATOM   3976 N NE    . ARG B 2 390 ? 22.423  28.306  17.684  1.00 32.67 ? 390 ARG A NE    1 
ATOM   3977 C CZ    . ARG B 2 390 ? 22.551  28.939  16.524  1.00 33.62 ? 390 ARG A CZ    1 
ATOM   3978 N NH1   . ARG B 2 390 ? 21.483  29.190  15.778  1.00 32.32 ? 390 ARG A NH1   1 
ATOM   3979 N NH2   . ARG B 2 390 ? 23.754  29.325  16.114  1.00 34.51 ? 390 ARG A NH2   1 
ATOM   3980 N N     . SER B 2 391 ? 18.264  24.480  17.594  1.00 25.04 ? 391 SER A N     1 
ATOM   3981 C CA    . SER B 2 391 ? 16.884  24.825  17.902  1.00 25.30 ? 391 SER A CA    1 
ATOM   3982 C C     . SER B 2 391 ? 16.189  23.641  18.567  1.00 25.71 ? 391 SER A C     1 
ATOM   3983 O O     . SER B 2 391 ? 15.592  23.774  19.642  1.00 26.49 ? 391 SER A O     1 
ATOM   3984 C CB    . SER B 2 391 ? 16.122  25.214  16.634  1.00 24.72 ? 391 SER A CB    1 
ATOM   3985 O OG    . SER B 2 391 ? 14.848  25.729  16.976  1.00 22.90 ? 391 SER A OG    1 
ATOM   3986 N N     . TYR B 2 392 ? 16.278  22.483  17.922  1.00 25.18 ? 392 TYR A N     1 
ATOM   3987 C CA    . TYR B 2 392 ? 15.663  21.260  18.432  1.00 25.54 ? 392 TYR A CA    1 
ATOM   3988 C C     . TYR B 2 392 ? 16.155  20.911  19.840  1.00 25.95 ? 392 TYR A C     1 
ATOM   3989 O O     . TYR B 2 392 ? 15.360  20.757  20.769  1.00 26.06 ? 392 TYR A O     1 
ATOM   3990 C CB    . TYR B 2 392 ? 15.968  20.094  17.488  1.00 24.94 ? 392 TYR A CB    1 
ATOM   3991 C CG    . TYR B 2 392 ? 15.349  18.796  17.924  1.00 25.22 ? 392 TYR A CG    1 
ATOM   3992 C CD1   . TYR B 2 392 ? 13.962  18.626  17.920  1.00 25.16 ? 392 TYR A CD1   1 
ATOM   3993 C CD2   . TYR B 2 392 ? 16.143  17.734  18.352  1.00 24.79 ? 392 TYR A CD2   1 
ATOM   3994 C CE1   . TYR B 2 392 ? 13.387  17.426  18.328  1.00 24.28 ? 392 TYR A CE1   1 
ATOM   3995 C CE2   . TYR B 2 392 ? 15.574  16.534  18.768  1.00 24.11 ? 392 TYR A CE2   1 
ATOM   3996 C CZ    . TYR B 2 392 ? 14.200  16.386  18.751  1.00 24.49 ? 392 TYR A CZ    1 
ATOM   3997 O OH    . TYR B 2 392 ? 13.637  15.193  19.154  1.00 27.06 ? 392 TYR A OH    1 
ATOM   3998 N N     . ALA B 2 393 ? 17.470  20.784  19.981  1.00 25.78 ? 393 ALA A N     1 
ATOM   3999 C CA    . ALA B 2 393 ? 18.088  20.451  21.258  1.00 26.62 ? 393 ALA A CA    1 
ATOM   4000 C C     . ALA B 2 393 ? 17.761  21.451  22.369  1.00 26.57 ? 393 ALA A C     1 
ATOM   4001 O O     . ALA B 2 393 ? 17.772  21.089  23.538  1.00 28.50 ? 393 ALA A O     1 
ATOM   4002 C CB    . ALA B 2 393 ? 19.605  20.335  21.088  1.00 25.87 ? 393 ALA A CB    1 
ATOM   4003 N N     . SER B 2 394 ? 17.473  22.699  22.009  1.00 25.95 ? 394 SER A N     1 
ATOM   4004 C CA    . SER B 2 394 ? 17.152  23.727  23.000  1.00 24.44 ? 394 SER A CA    1 
ATOM   4005 C C     . SER B 2 394 ? 15.729  23.621  23.517  1.00 24.84 ? 394 SER A C     1 
ATOM   4006 O O     . SER B 2 394 ? 15.457  23.953  24.668  1.00 24.61 ? 394 SER A O     1 
ATOM   4007 C CB    . SER B 2 394 ? 17.348  25.130  22.416  1.00 23.00 ? 394 SER A CB    1 
ATOM   4008 O OG    . SER B 2 394 ? 18.711  25.451  22.240  1.00 24.00 ? 394 SER A OG    1 
ATOM   4009 N N     . THR B 2 395 ? 14.818  23.158  22.669  1.00 26.34 ? 395 THR A N     1 
ATOM   4010 C CA    . THR B 2 395 ? 13.414  23.051  23.059  1.00 28.66 ? 395 THR A CA    1 
ATOM   4011 C C     . THR B 2 395 ? 12.931  21.627  23.307  1.00 30.35 ? 395 THR A C     1 
ATOM   4012 O O     . THR B 2 395 ? 11.914  21.426  23.976  1.00 31.40 ? 395 THR A O     1 
ATOM   4013 C CB    . THR B 2 395 ? 12.497  23.671  21.996  1.00 27.53 ? 395 THR A CB    1 
ATOM   4014 O OG1   . THR B 2 395 ? 12.614  22.925  20.784  1.00 30.40 ? 395 THR A OG1   1 
ATOM   4015 C CG2   . THR B 2 395 ? 12.895  25.102  21.718  1.00 28.70 ? 395 THR A CG2   1 
ATOM   4016 N N     . HIS B 2 396 ? 13.646  20.640  22.775  1.00 31.05 ? 396 HIS A N     1 
ATOM   4017 C CA    . HIS B 2 396 ? 13.237  19.258  22.964  1.00 31.76 ? 396 HIS A CA    1 
ATOM   4018 C C     . HIS B 2 396 ? 14.197  18.457  23.830  1.00 32.87 ? 396 HIS A C     1 
ATOM   4019 O O     . HIS B 2 396 ? 14.244  17.229  23.737  1.00 34.56 ? 396 HIS A O     1 
ATOM   4020 C CB    . HIS B 2 396 ? 13.055  18.572  21.611  1.00 30.72 ? 396 HIS A CB    1 
ATOM   4021 C CG    . HIS B 2 396 ? 11.857  19.054  20.850  1.00 31.19 ? 396 HIS A CG    1 
ATOM   4022 N ND1   . HIS B 2 396 ? 11.679  20.375  20.493  1.00 30.86 ? 396 HIS A ND1   1 
ATOM   4023 C CD2   . HIS B 2 396 ? 10.777  18.388  20.373  1.00 30.61 ? 396 HIS A CD2   1 
ATOM   4024 C CE1   . HIS B 2 396 ? 10.543  20.503  19.830  1.00 30.31 ? 396 HIS A CE1   1 
ATOM   4025 N NE2   . HIS B 2 396 ? 9.977   19.312  19.742  1.00 31.43 ? 396 HIS A NE2   1 
ATOM   4026 N N     . TRP B 2 397 ? 14.945  19.147  24.688  1.00 32.01 ? 397 TRP A N     1 
ATOM   4027 C CA    . TRP B 2 397 ? 15.894  18.475  25.564  1.00 31.38 ? 397 TRP A CA    1 
ATOM   4028 C C     . TRP B 2 397 ? 15.246  17.342  26.355  1.00 31.54 ? 397 TRP A C     1 
ATOM   4029 O O     . TRP B 2 397 ? 15.851  16.294  26.555  1.00 31.62 ? 397 TRP A O     1 
ATOM   4030 C CB    . TRP B 2 397 ? 16.514  19.468  26.550  1.00 31.76 ? 397 TRP A CB    1 
ATOM   4031 C CG    . TRP B 2 397 ? 15.498  20.150  27.419  1.00 31.86 ? 397 TRP A CG    1 
ATOM   4032 C CD1   . TRP B 2 397 ? 14.809  21.291  27.127  1.00 32.29 ? 397 TRP A CD1   1 
ATOM   4033 C CD2   . TRP B 2 397 ? 14.983  19.682  28.677  1.00 31.68 ? 397 TRP A CD2   1 
ATOM   4034 N NE1   . TRP B 2 397 ? 13.894  21.560  28.118  1.00 32.33 ? 397 TRP A NE1   1 
ATOM   4035 C CE2   . TRP B 2 397 ? 13.978  20.593  29.078  1.00 31.91 ? 397 TRP A CE2   1 
ATOM   4036 C CE3   . TRP B 2 397 ? 15.272  18.584  29.498  1.00 32.40 ? 397 TRP A CE3   1 
ATOM   4037 C CZ2   . TRP B 2 397 ? 13.255  20.434  30.271  1.00 31.09 ? 397 TRP A CZ2   1 
ATOM   4038 C CZ3   . TRP B 2 397 ? 14.552  18.427  30.688  1.00 31.74 ? 397 TRP A CZ3   1 
ATOM   4039 C CH2   . TRP B 2 397 ? 13.556  19.350  31.060  1.00 31.69 ? 397 TRP A CH2   1 
ATOM   4040 N N     . HIS B 2 398 ? 14.012  17.542  26.799  1.00 31.72 ? 398 HIS A N     1 
ATOM   4041 C CA    . HIS B 2 398 ? 13.346  16.526  27.606  1.00 31.98 ? 398 HIS A CA    1 
ATOM   4042 C C     . HIS B 2 398 ? 13.095  15.195  26.920  1.00 31.11 ? 398 HIS A C     1 
ATOM   4043 O O     . HIS B 2 398 ? 12.724  14.232  27.573  1.00 31.26 ? 398 HIS A O     1 
ATOM   4044 C CB    . HIS B 2 398 ? 12.101  17.117  28.279  1.00 32.96 ? 398 HIS A CB    1 
ATOM   4045 C CG    . HIS B 2 398 ? 11.424  16.178  29.231  1.00 36.53 ? 398 HIS A CG    1 
ATOM   4046 N ND1   . HIS B 2 398 ? 10.358  15.384  28.864  1.00 37.70 ? 398 HIS A ND1   1 
ATOM   4047 C CD2   . HIS B 2 398 ? 11.683  15.879  30.529  1.00 36.55 ? 398 HIS A CD2   1 
ATOM   4048 C CE1   . HIS B 2 398 ? 9.987   14.640  29.891  1.00 36.11 ? 398 HIS A CE1   1 
ATOM   4049 N NE2   . HIS B 2 398 ? 10.776  14.921  30.914  1.00 34.90 ? 398 HIS A NE2   1 
ATOM   4050 N N     . THR B 2 399 ? 13.306  15.121  25.613  1.00 30.59 ? 399 THR A N     1 
ATOM   4051 C CA    . THR B 2 399 ? 12.973  13.899  24.887  1.00 29.80 ? 399 THR A CA    1 
ATOM   4052 C C     . THR B 2 399 ? 14.242  13.150  24.514  1.00 29.08 ? 399 THR A C     1 
ATOM   4053 O O     . THR B 2 399 ? 14.199  12.155  23.800  1.00 29.11 ? 399 THR A O     1 
ATOM   4054 C CB    . THR B 2 399 ? 12.148  14.207  23.599  1.00 30.16 ? 399 THR A CB    1 
ATOM   4055 O OG1   . THR B 2 399 ? 11.449  13.028  23.195  1.00 31.82 ? 399 THR A OG1   1 
ATOM   4056 C CG2   . THR B 2 399 ? 13.053  14.650  22.445  1.00 29.66 ? 399 THR A CG2   1 
ATOM   4057 N N     . LEU B 2 400 ? 15.370  13.628  25.024  1.00 28.71 ? 400 LEU A N     1 
ATOM   4058 C CA    . LEU B 2 400 ? 16.668  13.035  24.728  1.00 29.00 ? 400 LEU A CA    1 
ATOM   4059 C C     . LEU B 2 400 ? 17.184  12.147  25.857  1.00 30.98 ? 400 LEU A C     1 
ATOM   4060 O O     . LEU B 2 400 ? 18.390  12.015  26.072  1.00 32.58 ? 400 LEU A O     1 
ATOM   4061 C CB    . LEU B 2 400 ? 17.658  14.158  24.427  1.00 27.28 ? 400 LEU A CB    1 
ATOM   4062 C CG    . LEU B 2 400 ? 17.091  15.165  23.403  1.00 26.99 ? 400 LEU A CG    1 
ATOM   4063 C CD1   . LEU B 2 400 ? 18.041  16.340  23.228  1.00 24.61 ? 400 LEU A CD1   1 
ATOM   4064 C CD2   . LEU B 2 400 ? 16.839  14.460  22.065  1.00 24.35 ? 400 LEU A CD2   1 
ATOM   4065 N N     . GLY B 2 401 ? 16.261  11.514  26.569  1.00 31.78 ? 401 GLY A N     1 
ATOM   4066 C CA    . GLY B 2 401 ? 16.662  10.669  27.671  1.00 32.68 ? 401 GLY A CA    1 
ATOM   4067 C C     . GLY B 2 401 ? 16.637  11.495  28.941  1.00 34.24 ? 401 GLY A C     1 
ATOM   4068 O O     . GLY B 2 401 ? 17.091  12.644  28.956  1.00 34.17 ? 401 GLY A O     1 
ATOM   4069 N N     . LYS B 2 402 ? 16.100  10.912  30.007  1.00 33.95 ? 402 LYS A N     1 
ATOM   4070 C CA    . LYS B 2 402 ? 15.996  11.594  31.286  1.00 33.29 ? 402 LYS A CA    1 
ATOM   4071 C C     . LYS B 2 402 ? 17.247  12.364  31.684  1.00 32.53 ? 402 LYS A C     1 
ATOM   4072 O O     . LYS B 2 402 ? 17.216  13.582  31.819  1.00 32.68 ? 402 LYS A O     1 
ATOM   4073 C CB    . LYS B 2 402 ? 15.654  10.585  32.379  1.00 34.35 ? 402 LYS A CB    1 
ATOM   4074 C CG    . LYS B 2 402 ? 14.253  10.746  32.948  1.00 37.00 ? 402 LYS A CG    1 
ATOM   4075 C CD    . LYS B 2 402 ? 14.206  11.819  34.021  1.00 38.29 ? 402 LYS A CD    1 
ATOM   4076 C CE    . LYS B 2 402 ? 15.034  11.408  35.231  1.00 38.62 ? 402 LYS A CE    1 
ATOM   4077 N NZ    . LYS B 2 402 ? 15.134  12.504  36.224  1.00 40.13 ? 402 LYS A NZ    1 
ATOM   4078 N N     . ASN B 2 403 ? 18.351  11.651  31.860  1.00 31.66 ? 403 ASN A N     1 
ATOM   4079 C CA    . ASN B 2 403 ? 19.595  12.278  32.280  1.00 31.27 ? 403 ASN A CA    1 
ATOM   4080 C C     . ASN B 2 403 ? 20.298  13.081  31.189  1.00 31.86 ? 403 ASN A C     1 
ATOM   4081 O O     . ASN B 2 403 ? 20.583  14.263  31.375  1.00 31.76 ? 403 ASN A O     1 
ATOM   4082 C CB    . ASN B 2 403 ? 20.513  11.209  32.873  1.00 29.82 ? 403 ASN A CB    1 
ATOM   4083 C CG    . ASN B 2 403 ? 19.823  10.411  33.974  1.00 28.79 ? 403 ASN A CG    1 
ATOM   4084 O OD1   . ASN B 2 403 ? 19.235  10.984  34.890  1.00 28.25 ? 403 ASN A OD1   1 
ATOM   4085 N ND2   . ASN B 2 403 ? 19.885  9.092   33.883  1.00 27.84 ? 403 ASN A ND2   1 
ATOM   4086 N N     . VAL B 2 404 ? 20.582  12.453  30.055  1.00 31.89 ? 404 VAL A N     1 
ATOM   4087 C CA    . VAL B 2 404 ? 21.225  13.174  28.967  1.00 31.37 ? 404 VAL A CA    1 
ATOM   4088 C C     . VAL B 2 404 ? 20.402  14.426  28.639  1.00 31.90 ? 404 VAL A C     1 
ATOM   4089 O O     . VAL B 2 404 ? 20.952  15.508  28.405  1.00 32.27 ? 404 VAL A O     1 
ATOM   4090 C CB    . VAL B 2 404 ? 21.340  12.292  27.706  1.00 30.64 ? 404 VAL A CB    1 
ATOM   4091 C CG1   . VAL B 2 404 ? 21.696  13.150  26.502  1.00 28.61 ? 404 VAL A CG1   1 
ATOM   4092 C CG2   . VAL B 2 404 ? 22.401  11.214  27.920  1.00 28.38 ? 404 VAL A CG2   1 
ATOM   4093 N N     . GLY B 2 405 ? 19.082  14.273  28.629  1.00 31.43 ? 405 GLY A N     1 
ATOM   4094 C CA    . GLY B 2 405 ? 18.218  15.399  28.330  1.00 32.40 ? 405 GLY A CA    1 
ATOM   4095 C C     . GLY B 2 405 ? 18.388  16.546  29.309  1.00 33.17 ? 405 GLY A C     1 
ATOM   4096 O O     . GLY B 2 405 ? 18.481  17.701  28.902  1.00 33.19 ? 405 GLY A O     1 
ATOM   4097 N N     . GLU B 2 406 ? 18.432  16.220  30.600  1.00 33.76 ? 406 GLU A N     1 
ATOM   4098 C CA    . GLU B 2 406 ? 18.596  17.211  31.659  1.00 33.91 ? 406 GLU A CA    1 
ATOM   4099 C C     . GLU B 2 406 ? 19.965  17.885  31.607  1.00 33.27 ? 406 GLU A C     1 
ATOM   4100 O O     . GLU B 2 406 ? 20.105  19.055  31.980  1.00 34.49 ? 406 GLU A O     1 
ATOM   4101 C CB    . GLU B 2 406 ? 18.363  16.556  33.030  1.00 34.61 ? 406 GLU A CB    1 
ATOM   4102 C CG    . GLU B 2 406 ? 16.880  16.321  33.327  1.00 37.40 ? 406 GLU A CG    1 
ATOM   4103 C CD    . GLU B 2 406 ? 16.610  15.247  34.381  1.00 40.27 ? 406 GLU A CD    1 
ATOM   4104 O OE1   . GLU B 2 406 ? 15.417  14.933  34.601  1.00 42.27 ? 406 GLU A OE1   1 
ATOM   4105 O OE2   . GLU B 2 406 ? 17.571  14.712  34.985  1.00 40.40 ? 406 GLU A OE2   1 
ATOM   4106 N N     . SER B 2 407 ? 20.967  17.156  31.134  1.00 30.95 ? 407 SER A N     1 
ATOM   4107 C CA    . SER B 2 407 ? 22.311  17.697  31.021  1.00 30.41 ? 407 SER A CA    1 
ATOM   4108 C C     . SER B 2 407 ? 22.396  18.686  29.859  1.00 31.81 ? 407 SER A C     1 
ATOM   4109 O O     . SER B 2 407 ? 23.050  19.726  29.956  1.00 32.09 ? 407 SER A O     1 
ATOM   4110 C CB    . SER B 2 407 ? 23.309  16.567  30.797  1.00 29.83 ? 407 SER A CB    1 
ATOM   4111 O OG    . SER B 2 407 ? 24.610  17.073  30.581  1.00 28.95 ? 407 SER A OG    1 
ATOM   4112 N N     . ILE B 2 408 ? 21.740  18.346  28.752  1.00 32.39 ? 408 ILE A N     1 
ATOM   4113 C CA    . ILE B 2 408 ? 21.732  19.201  27.571  1.00 31.65 ? 408 ILE A CA    1 
ATOM   4114 C C     . ILE B 2 408 ? 20.899  20.448  27.826  1.00 31.76 ? 408 ILE A C     1 
ATOM   4115 O O     . ILE B 2 408 ? 21.155  21.500  27.244  1.00 31.57 ? 408 ILE A O     1 
ATOM   4116 C CB    . ILE B 2 408 ? 21.173  18.449  26.340  1.00 31.21 ? 408 ILE A CB    1 
ATOM   4117 C CG1   . ILE B 2 408 ? 22.162  17.365  25.910  1.00 29.14 ? 408 ILE A CG1   1 
ATOM   4118 C CG2   . ILE B 2 408 ? 20.906  19.426  25.193  1.00 31.80 ? 408 ILE A CG2   1 
ATOM   4119 C CD1   . ILE B 2 408 ? 21.677  16.508  24.768  1.00 26.74 ? 408 ILE A CD1   1 
ATOM   4120 N N     . ARG B 2 409 ? 19.905  20.326  28.698  1.00 32.72 ? 409 ARG A N     1 
ATOM   4121 C CA    . ARG B 2 409 ? 19.051  21.455  29.037  1.00 34.48 ? 409 ARG A CA    1 
ATOM   4122 C C     . ARG B 2 409 ? 19.851  22.479  29.835  1.00 35.31 ? 409 ARG A C     1 
ATOM   4123 O O     . ARG B 2 409 ? 19.567  23.675  29.774  1.00 35.57 ? 409 ARG A O     1 
ATOM   4124 C CB    . ARG B 2 409 ? 17.847  20.981  29.857  1.00 35.97 ? 409 ARG A CB    1 
ATOM   4125 C CG    . ARG B 2 409 ? 16.974  22.092  30.461  1.00 39.42 ? 409 ARG A CG    1 
ATOM   4126 C CD    . ARG B 2 409 ? 16.242  21.564  31.696  1.00 42.43 ? 409 ARG A CD    1 
ATOM   4127 N NE    . ARG B 2 409 ? 17.171  20.751  32.490  1.00 48.23 ? 409 ARG A NE    1 
ATOM   4128 C CZ    . ARG B 2 409 ? 16.889  20.136  33.638  1.00 48.17 ? 409 ARG A CZ    1 
ATOM   4129 N NH1   . ARG B 2 409 ? 15.674  20.223  34.175  1.00 49.51 ? 409 ARG A NH1   1 
ATOM   4130 N NH2   . ARG B 2 409 ? 17.836  19.430  34.251  1.00 47.49 ? 409 ARG A NH2   1 
ATOM   4131 N N     . GLU B 2 410 ? 20.857  22.017  30.578  1.00 35.88 ? 410 GLU A N     1 
ATOM   4132 C CA    . GLU B 2 410 ? 21.674  22.934  31.377  1.00 36.57 ? 410 GLU A CA    1 
ATOM   4133 C C     . GLU B 2 410 ? 22.932  23.413  30.658  1.00 34.35 ? 410 GLU A C     1 
ATOM   4134 O O     . GLU B 2 410 ? 23.589  24.349  31.107  1.00 34.12 ? 410 GLU A O     1 
ATOM   4135 C CB    . GLU B 2 410 ? 22.041  22.305  32.734  1.00 38.36 ? 410 GLU A CB    1 
ATOM   4136 C CG    . GLU B 2 410 ? 22.687  20.939  32.653  1.00 43.94 ? 410 GLU A CG    1 
ATOM   4137 C CD    . GLU B 2 410 ? 23.040  20.369  34.023  1.00 46.71 ? 410 GLU A CD    1 
ATOM   4138 O OE1   . GLU B 2 410 ? 22.169  20.401  34.928  1.00 47.94 ? 410 GLU A OE1   1 
ATOM   4139 O OE2   . GLU B 2 410 ? 24.185  19.881  34.189  1.00 47.01 ? 410 GLU A OE2   1 
ATOM   4140 N N     . TYR B 2 411 ? 23.258  22.771  29.539  1.00 33.36 ? 411 TYR A N     1 
ATOM   4141 C CA    . TYR B 2 411 ? 24.423  23.141  28.730  1.00 30.74 ? 411 TYR A CA    1 
ATOM   4142 C C     . TYR B 2 411 ? 24.646  22.244  27.521  1.00 29.49 ? 411 TYR A C     1 
ATOM   4143 O O     . TYR B 2 411 ? 24.490  21.026  27.607  1.00 28.83 ? 411 TYR A O     1 
ATOM   4144 C CB    . TYR B 2 411 ? 25.710  23.127  29.560  1.00 29.07 ? 411 TYR A CB    1 
ATOM   4145 C CG    . TYR B 2 411 ? 26.958  22.993  28.699  1.00 29.97 ? 411 TYR A CG    1 
ATOM   4146 C CD1   . TYR B 2 411 ? 27.659  21.780  28.626  1.00 29.36 ? 411 TYR A CD1   1 
ATOM   4147 C CD2   . TYR B 2 411 ? 27.401  24.057  27.902  1.00 29.49 ? 411 TYR A CD2   1 
ATOM   4148 C CE1   . TYR B 2 411 ? 28.766  21.629  27.779  1.00 28.21 ? 411 TYR A CE1   1 
ATOM   4149 C CE2   . TYR B 2 411 ? 28.504  23.918  27.050  1.00 28.69 ? 411 TYR A CE2   1 
ATOM   4150 C CZ    . TYR B 2 411 ? 29.183  22.702  26.993  1.00 29.64 ? 411 TYR A CZ    1 
ATOM   4151 O OH    . TYR B 2 411 ? 30.271  22.561  26.149  1.00 27.35 ? 411 TYR A OH    1 
ATOM   4152 N N     . PHE B 2 412 ? 25.019  22.860  26.401  1.00 28.74 ? 412 PHE A N     1 
ATOM   4153 C CA    . PHE B 2 412 ? 25.335  22.134  25.173  1.00 28.78 ? 412 PHE A CA    1 
ATOM   4154 C C     . PHE B 2 412 ? 25.814  23.079  24.080  1.00 30.31 ? 412 PHE A C     1 
ATOM   4155 O O     . PHE B 2 412 ? 25.463  24.252  24.054  1.00 30.74 ? 412 PHE A O     1 
ATOM   4156 C CB    . PHE B 2 412 ? 24.130  21.306  24.677  1.00 25.76 ? 412 PHE A CB    1 
ATOM   4157 C CG    . PHE B 2 412 ? 23.194  22.043  23.748  1.00 22.68 ? 412 PHE A CG    1 
ATOM   4158 C CD1   . PHE B 2 412 ? 23.508  22.204  22.398  1.00 22.17 ? 412 PHE A CD1   1 
ATOM   4159 C CD2   . PHE B 2 412 ? 21.976  22.536  24.214  1.00 22.11 ? 412 PHE A CD2   1 
ATOM   4160 C CE1   . PHE B 2 412 ? 22.620  22.842  21.525  1.00 21.00 ? 412 PHE A CE1   1 
ATOM   4161 C CE2   . PHE B 2 412 ? 21.076  23.178  23.352  1.00 21.11 ? 412 PHE A CE2   1 
ATOM   4162 C CZ    . PHE B 2 412 ? 21.398  23.332  22.004  1.00 20.46 ? 412 PHE A CZ    1 
ATOM   4163 N N     . GLU B 2 413 ? 26.640  22.564  23.183  1.00 31.90 ? 413 GLU A N     1 
ATOM   4164 C CA    . GLU B 2 413 ? 27.127  23.367  22.083  1.00 33.74 ? 413 GLU A CA    1 
ATOM   4165 C C     . GLU B 2 413 ? 27.298  22.485  20.863  1.00 34.60 ? 413 GLU A C     1 
ATOM   4166 O O     . GLU B 2 413 ? 27.439  21.266  20.978  1.00 34.66 ? 413 GLU A O     1 
ATOM   4167 C CB    . GLU B 2 413 ? 28.457  24.012  22.439  1.00 35.07 ? 413 GLU A CB    1 
ATOM   4168 C CG    . GLU B 2 413 ? 29.556  23.031  22.716  1.00 38.86 ? 413 GLU A CG    1 
ATOM   4169 C CD    . GLU B 2 413 ? 30.851  23.721  23.071  1.00 41.65 ? 413 GLU A CD    1 
ATOM   4170 O OE1   . GLU B 2 413 ? 31.336  24.523  22.240  1.00 43.11 ? 413 GLU A OE1   1 
ATOM   4171 O OE2   . GLU B 2 413 ? 31.381  23.462  24.177  1.00 42.17 ? 413 GLU A OE2   1 
ATOM   4172 N N     . ILE B 2 414 ? 27.265  23.099  19.688  1.00 34.98 ? 414 ILE A N     1 
ATOM   4173 C CA    . ILE B 2 414 ? 27.442  22.347  18.462  1.00 34.76 ? 414 ILE A CA    1 
ATOM   4174 C C     . ILE B 2 414 ? 28.798  22.704  17.878  1.00 36.19 ? 414 ILE A C     1 
ATOM   4175 O O     . ILE B 2 414 ? 29.068  23.859  17.551  1.00 35.07 ? 414 ILE A O     1 
ATOM   4176 C CB    . ILE B 2 414 ? 26.326  22.658  17.472  1.00 33.42 ? 414 ILE A CB    1 
ATOM   4177 C CG1   . ILE B 2 414 ? 24.987  22.299  18.112  1.00 31.06 ? 414 ILE A CG1   1 
ATOM   4178 C CG2   . ILE B 2 414 ? 26.537  21.866  16.182  1.00 32.68 ? 414 ILE A CG2   1 
ATOM   4179 C CD1   . ILE B 2 414 ? 23.793  22.824  17.367  1.00 33.89 ? 414 ILE A CD1   1 
ATOM   4180 N N     . ILE B 2 415 ? 29.656  21.694  17.779  1.00 38.15 ? 415 ILE A N     1 
ATOM   4181 C CA    . ILE B 2 415 ? 31.003  21.859  17.259  1.00 39.53 ? 415 ILE A CA    1 
ATOM   4182 C C     . ILE B 2 415 ? 31.098  21.350  15.828  1.00 40.71 ? 415 ILE A C     1 
ATOM   4183 O O     . ILE B 2 415 ? 30.506  20.337  15.490  1.00 40.74 ? 415 ILE A O     1 
ATOM   4184 C CB    . ILE B 2 415 ? 32.015  21.075  18.102  1.00 39.44 ? 415 ILE A CB    1 
ATOM   4185 C CG1   . ILE B 2 415 ? 31.774  21.335  19.584  1.00 38.47 ? 415 ILE A CG1   1 
ATOM   4186 C CG2   . ILE B 2 415 ? 33.418  21.474  17.712  1.00 39.16 ? 415 ILE A CG2   1 
ATOM   4187 C CD1   . ILE B 2 415 ? 31.844  22.778  19.954  1.00 40.51 ? 415 ILE A CD1   1 
ATOM   4188 N N     . SER B 2 416 ? 31.857  22.056  14.999  1.00 42.79 ? 416 SER A N     1 
ATOM   4189 C CA    . SER B 2 416 ? 32.040  21.679  13.607  1.00 45.85 ? 416 SER A CA    1 
ATOM   4190 C C     . SER B 2 416 ? 33.339  22.266  13.082  1.00 48.85 ? 416 SER A C     1 
ATOM   4191 O O     . SER B 2 416 ? 33.891  23.198  13.667  1.00 50.71 ? 416 SER A O     1 
ATOM   4192 C CB    . SER B 2 416 ? 30.877  22.192  12.765  1.00 46.62 ? 416 SER A CB    1 
ATOM   4193 O OG    . SER B 2 416 ? 30.737  23.592  12.907  1.00 45.38 ? 416 SER A OG    1 
ATOM   4194 N N     . GLY B 2 417 ? 33.829  21.720  11.976  1.00 51.40 ? 417 GLY A N     1 
ATOM   4195 C CA    . GLY B 2 417 ? 35.066  22.218  11.404  1.00 53.07 ? 417 GLY A CA    1 
ATOM   4196 C C     . GLY B 2 417 ? 36.305  21.774  12.161  1.00 55.20 ? 417 GLY A C     1 
ATOM   4197 O O     . GLY B 2 417 ? 36.311  20.736  12.832  1.00 54.21 ? 417 GLY A O     1 
ATOM   4198 N N     . GLU B 2 418 ? 37.361  22.575  12.055  1.00 57.18 ? 418 GLU A N     1 
ATOM   4199 C CA    . GLU B 2 418 ? 38.625  22.271  12.714  1.00 59.07 ? 418 GLU A CA    1 
ATOM   4200 C C     . GLU B 2 418 ? 38.435  22.113  14.218  1.00 59.22 ? 418 GLU A C     1 
ATOM   4201 O O     . GLU B 2 418 ? 39.171  21.370  14.867  1.00 60.45 ? 418 GLU A O     1 
ATOM   4202 C CB    . GLU B 2 418 ? 39.649  23.384  12.442  1.00 60.93 ? 418 GLU A CB    1 
ATOM   4203 C CG    . GLU B 2 418 ? 39.608  23.963  11.018  1.00 62.77 ? 418 GLU A CG    1 
ATOM   4204 C CD    . GLU B 2 418 ? 39.959  22.949  9.925   1.00 63.81 ? 418 GLU A CD    1 
ATOM   4205 O OE1   . GLU B 2 418 ? 39.742  23.264  8.729   1.00 63.71 ? 418 GLU A OE1   1 
ATOM   4206 O OE2   . GLU B 2 418 ? 40.456  21.846  10.256  1.00 64.48 ? 418 GLU A OE2   1 
ATOM   4207 N N     . LYS B 2 419 ? 37.448  22.814  14.770  1.00 58.69 ? 419 LYS A N     1 
ATOM   4208 C CA    . LYS B 2 419 ? 37.185  22.753  16.202  1.00 58.17 ? 419 LYS A CA    1 
ATOM   4209 C C     . LYS B 2 419 ? 36.665  21.380  16.623  1.00 56.92 ? 419 LYS A C     1 
ATOM   4210 O O     . LYS B 2 419 ? 36.818  20.978  17.779  1.00 57.49 ? 419 LYS A O     1 
ATOM   4211 C CB    . LYS B 2 419 ? 36.181  23.845  16.595  1.00 60.27 ? 419 LYS A CB    1 
ATOM   4212 C CG    . LYS B 2 419 ? 35.941  23.987  18.102  1.00 62.57 ? 419 LYS A CG    1 
ATOM   4213 C CD    . LYS B 2 419 ? 35.124  25.247  18.417  1.00 64.41 ? 419 LYS A CD    1 
ATOM   4214 C CE    . LYS B 2 419 ? 35.008  25.495  19.920  1.00 65.27 ? 419 LYS A CE    1 
ATOM   4215 N NZ    . LYS B 2 419 ? 34.391  26.823  20.235  1.00 65.38 ? 419 LYS A NZ    1 
ATOM   4216 N N     . LEU B 2 420 ? 36.055  20.661  15.686  1.00 54.75 ? 420 LEU A N     1 
ATOM   4217 C CA    . LEU B 2 420 ? 35.518  19.334  15.972  1.00 53.23 ? 420 LEU A CA    1 
ATOM   4218 C C     . LEU B 2 420 ? 36.594  18.261  15.854  1.00 53.17 ? 420 LEU A C     1 
ATOM   4219 O O     . LEU B 2 420 ? 36.652  17.333  16.662  1.00 52.11 ? 420 LEU A O     1 
ATOM   4220 C CB    . LEU B 2 420 ? 34.377  19.003  15.010  1.00 51.48 ? 420 LEU A CB    1 
ATOM   4221 C CG    . LEU B 2 420 ? 33.794  17.592  15.129  1.00 49.52 ? 420 LEU A CG    1 
ATOM   4222 C CD1   . LEU B 2 420 ? 33.049  17.441  16.447  1.00 48.51 ? 420 LEU A CD1   1 
ATOM   4223 C CD2   . LEU B 2 420 ? 32.863  17.332  13.961  1.00 49.67 ? 420 LEU A CD2   1 
ATOM   4224 N N     . PHE B 2 421 ? 37.446  18.401  14.843  1.00 53.67 ? 421 PHE A N     1 
ATOM   4225 C CA    . PHE B 2 421 ? 38.522  17.453  14.590  1.00 53.76 ? 421 PHE A CA    1 
ATOM   4226 C C     . PHE B 2 421 ? 39.471  17.348  15.777  1.00 54.55 ? 421 PHE A C     1 
ATOM   4227 O O     . PHE B 2 421 ? 40.322  16.456  15.823  1.00 55.18 ? 421 PHE A O     1 
ATOM   4228 C CB    . PHE B 2 421 ? 39.192  17.793  13.259  1.00 53.76 ? 421 PHE A CB    1 
ATOM   4229 C CG    . PHE B 2 421 ? 38.232  17.818  12.099  1.00 54.38 ? 421 PHE A CG    1 
ATOM   4230 C CD1   . PHE B 2 421 ? 38.329  18.798  11.113  1.00 54.34 ? 421 PHE A CD1   1 
ATOM   4231 C CD2   . PHE B 2 421 ? 37.218  16.868  12.002  1.00 53.73 ? 421 PHE A CD2   1 
ATOM   4232 C CE1   . PHE B 2 421 ? 37.422  18.841  10.052  1.00 53.74 ? 421 PHE A CE1   1 
ATOM   4233 C CE2   . PHE B 2 421 ? 36.309  16.901  10.950  1.00 54.43 ? 421 PHE A CE2   1 
ATOM   4234 C CZ    . PHE B 2 421 ? 36.413  17.889  9.969   1.00 53.92 ? 421 PHE A CZ    1 
ATOM   4235 N N     . LYS B 2 422 ? 39.307  18.255  16.740  1.00 54.61 ? 422 LYS A N     1 
ATOM   4236 C CA    . LYS B 2 422 ? 40.192  18.346  17.896  1.00 53.67 ? 422 LYS A CA    1 
ATOM   4237 C C     . LYS B 2 422 ? 39.586  17.706  19.136  1.00 51.93 ? 422 LYS A C     1 
ATOM   4238 O O     . LYS B 2 422 ? 40.203  17.695  20.204  1.00 51.99 ? 422 LYS A O     1 
ATOM   4239 C CB    . LYS B 2 422 ? 40.536  19.808  18.188  1.00 55.79 ? 422 LYS A CB    1 
ATOM   4240 C CG    . LYS B 2 422 ? 41.843  20.268  17.545  1.00 58.67 ? 422 LYS A CG    1 
ATOM   4241 C CD    . LYS B 2 422 ? 41.671  21.537  16.711  1.00 61.18 ? 422 LYS A CD    1 
ATOM   4242 C CE    . LYS B 2 422 ? 41.066  22.681  17.521  1.00 62.64 ? 422 LYS A CE    1 
ATOM   4243 N NZ    . LYS B 2 422 ? 41.852  22.992  18.747  1.00 64.49 ? 422 LYS A NZ    1 
ATOM   4244 N N     . GLU B 2 423 ? 38.375  17.177  18.997  1.00 49.73 ? 423 GLU A N     1 
ATOM   4245 C CA    . GLU B 2 423 ? 37.698  16.520  20.111  1.00 47.14 ? 423 GLU A CA    1 
ATOM   4246 C C     . GLU B 2 423 ? 38.034  15.027  20.072  1.00 45.46 ? 423 GLU A C     1 
ATOM   4247 O O     . GLU B 2 423 ? 38.467  14.509  19.043  1.00 45.75 ? 423 GLU A O     1 
ATOM   4248 C CB    . GLU B 2 423 ? 36.185  16.712  19.996  1.00 46.92 ? 423 GLU A CB    1 
ATOM   4249 C CG    . GLU B 2 423 ? 35.701  18.160  20.032  1.00 46.86 ? 423 GLU A CG    1 
ATOM   4250 C CD    . GLU B 2 423 ? 35.945  18.840  21.369  1.00 46.92 ? 423 GLU A CD    1 
ATOM   4251 O OE1   . GLU B 2 423 ? 35.939  18.147  22.404  1.00 46.81 ? 423 GLU A OE1   1 
ATOM   4252 O OE2   . GLU B 2 423 ? 36.125  20.075  21.389  1.00 48.01 ? 423 GLU A OE2   1 
ATOM   4253 N N     . PRO B 2 424 ? 37.840  14.316  21.195  1.00 44.01 ? 424 PRO A N     1 
ATOM   4254 C CA    . PRO B 2 424 ? 38.124  12.877  21.291  1.00 42.98 ? 424 PRO A CA    1 
ATOM   4255 C C     . PRO B 2 424 ? 36.969  12.197  20.562  1.00 41.59 ? 424 PRO A C     1 
ATOM   4256 O O     . PRO B 2 424 ? 36.212  11.426  21.154  1.00 40.82 ? 424 PRO A O     1 
ATOM   4257 C CB    . PRO B 2 424 ? 38.027  12.599  22.793  1.00 43.44 ? 424 PRO A CB    1 
ATOM   4258 C CG    . PRO B 2 424 ? 38.180  13.955  23.432  1.00 44.32 ? 424 PRO A CG    1 
ATOM   4259 C CD    . PRO B 2 424 ? 37.428  14.848  22.501  1.00 43.95 ? 424 PRO A CD    1 
ATOM   4260 N N     . VAL B 2 425 ? 36.847  12.478  19.273  1.00 41.31 ? 425 VAL A N     1 
ATOM   4261 C CA    . VAL B 2 425 ? 35.859  11.814  18.438  1.00 40.30 ? 425 VAL A CA    1 
ATOM   4262 C C     . VAL B 2 425 ? 36.365  11.399  17.060  1.00 40.79 ? 425 VAL A C     1 
ATOM   4263 O O     . VAL B 2 425 ? 35.605  10.849  16.263  1.00 41.35 ? 425 VAL A O     1 
ATOM   4264 C CB    . VAL B 2 425 ? 34.624  12.729  18.243  1.00 39.04 ? 425 VAL A CB    1 
ATOM   4265 C CG1   . VAL B 2 425 ? 33.917  12.952  19.572  1.00 37.18 ? 425 VAL A CG1   1 
ATOM   4266 C CG2   . VAL B 2 425 ? 35.067  14.063  17.649  1.00 36.42 ? 425 VAL A CG2   1 
ATOM   4267 N N     . THR B 2 426 ? 37.639  11.641  16.774  1.00 40.56 ? 426 THR A N     1 
ATOM   4268 C CA    . THR B 2 426 ? 38.160  11.299  15.456  1.00 40.50 ? 426 THR A CA    1 
ATOM   4269 C C     . THR B 2 426 ? 37.961  9.822   15.116  1.00 39.33 ? 426 THR A C     1 
ATOM   4270 O O     . THR B 2 426 ? 37.775  9.469   13.953  1.00 39.70 ? 426 THR A O     1 
ATOM   4271 C CB    . THR B 2 426 ? 39.667  11.671  15.313  1.00 41.40 ? 426 THR A CB    1 
ATOM   4272 O OG1   . THR B 2 426 ? 40.486  10.561  15.700  1.00 42.55 ? 426 THR A OG1   1 
ATOM   4273 C CG2   . THR B 2 426 ? 40.003  12.875  16.187  1.00 42.23 ? 426 THR A CG2   1 
ATOM   4274 N N     . ALA B 2 427 ? 37.986  8.957   16.123  1.00 38.30 ? 427 ALA A N     1 
ATOM   4275 C CA    . ALA B 2 427 ? 37.807  7.530   15.873  1.00 37.14 ? 427 ALA A CA    1 
ATOM   4276 C C     . ALA B 2 427 ? 36.370  7.240   15.464  1.00 36.25 ? 427 ALA A C     1 
ATOM   4277 O O     . ALA B 2 427 ? 36.126  6.580   14.455  1.00 35.56 ? 427 ALA A O     1 
ATOM   4278 C CB    . ALA B 2 427 ? 38.178  6.722   17.113  1.00 36.97 ? 427 ALA A CB    1 
ATOM   4279 N N     . GLU B 2 428 ? 35.425  7.736   16.255  1.00 35.79 ? 428 GLU A N     1 
ATOM   4280 C CA    . GLU B 2 428 ? 34.006  7.545   15.982  1.00 35.98 ? 428 GLU A CA    1 
ATOM   4281 C C     . GLU B 2 428 ? 33.636  8.079   14.588  1.00 35.77 ? 428 GLU A C     1 
ATOM   4282 O O     . GLU B 2 428 ? 32.849  7.460   13.865  1.00 35.91 ? 428 GLU A O     1 
ATOM   4283 C CB    . GLU B 2 428 ? 33.171  8.251   17.056  1.00 37.30 ? 428 GLU A CB    1 
ATOM   4284 C CG    . GLU B 2 428 ? 33.293  7.665   18.472  1.00 39.22 ? 428 GLU A CG    1 
ATOM   4285 C CD    . GLU B 2 428 ? 34.739  7.544   18.977  1.00 41.21 ? 428 GLU A CD    1 
ATOM   4286 O OE1   . GLU B 2 428 ? 35.513  8.523   18.874  1.00 38.27 ? 428 GLU A OE1   1 
ATOM   4287 O OE2   . GLU B 2 428 ? 35.097  6.459   19.495  1.00 42.98 ? 428 GLU A OE2   1 
ATOM   4288 N N     . LEU B 2 429 ? 34.213  9.219   14.213  1.00 34.60 ? 429 LEU A N     1 
ATOM   4289 C CA    . LEU B 2 429 ? 33.961  9.827   12.910  1.00 34.12 ? 429 LEU A CA    1 
ATOM   4290 C C     . LEU B 2 429 ? 34.453  8.968   11.741  1.00 35.10 ? 429 LEU A C     1 
ATOM   4291 O O     . LEU B 2 429 ? 33.751  8.802   10.738  1.00 36.10 ? 429 LEU A O     1 
ATOM   4292 C CB    . LEU B 2 429 ? 34.616  11.212  12.837  1.00 33.41 ? 429 LEU A CB    1 
ATOM   4293 C CG    . LEU B 2 429 ? 33.985  12.303  13.707  1.00 32.41 ? 429 LEU A CG    1 
ATOM   4294 C CD1   . LEU B 2 429 ? 34.854  13.546  13.679  1.00 31.00 ? 429 LEU A CD1   1 
ATOM   4295 C CD2   . LEU B 2 429 ? 32.578  12.605  13.214  1.00 30.36 ? 429 LEU A CD2   1 
ATOM   4296 N N     . CYS B 2 430 ? 35.661  8.430   11.852  1.00 34.77 ? 430 CYS A N     1 
ATOM   4297 C CA    . CYS B 2 430 ? 36.180  7.594   10.783  1.00 36.09 ? 430 CYS A CA    1 
ATOM   4298 C C     . CYS B 2 430 ? 35.287  6.372   10.580  1.00 37.53 ? 430 CYS A C     1 
ATOM   4299 O O     . CYS B 2 430 ? 34.996  5.982   9.448   1.00 38.25 ? 430 CYS A O     1 
ATOM   4300 C CB    . CYS B 2 430 ? 37.612  7.156   11.096  1.00 34.88 ? 430 CYS A CB    1 
ATOM   4301 S SG    . CYS B 2 430 ? 38.814  8.493   10.981  1.00 34.12 ? 430 CYS A SG    1 
ATOM   4302 N N     . GLU B 2 431 ? 34.850  5.771   11.680  1.00 38.67 ? 431 GLU A N     1 
ATOM   4303 C CA    . GLU B 2 431 ? 33.987  4.596   11.619  1.00 40.16 ? 431 GLU A CA    1 
ATOM   4304 C C     . GLU B 2 431 ? 32.620  4.980   11.065  1.00 40.36 ? 431 GLU A C     1 
ATOM   4305 O O     . GLU B 2 431 ? 31.937  4.164   10.441  1.00 40.93 ? 431 GLU A O     1 
ATOM   4306 C CB    . GLU B 2 431 ? 33.830  3.994   13.021  1.00 41.77 ? 431 GLU A CB    1 
ATOM   4307 C CG    . GLU B 2 431 ? 32.688  2.983   13.191  1.00 44.39 ? 431 GLU A CG    1 
ATOM   4308 C CD    . GLU B 2 431 ? 32.924  1.668   12.458  1.00 46.33 ? 431 GLU A CD    1 
ATOM   4309 O OE1   . GLU B 2 431 ? 34.067  1.157   12.496  1.00 47.21 ? 431 GLU A OE1   1 
ATOM   4310 O OE2   . GLU B 2 431 ? 31.961  1.135   11.857  1.00 47.15 ? 431 GLU A OE2   1 
ATOM   4311 N N     . MET B 2 432 ? 32.226  6.228   11.295  1.00 39.60 ? 432 MET A N     1 
ATOM   4312 C CA    . MET B 2 432 ? 30.933  6.717   10.834  1.00 38.92 ? 432 MET A CA    1 
ATOM   4313 C C     . MET B 2 432 ? 30.935  6.981   9.326   1.00 37.78 ? 432 MET A C     1 
ATOM   4314 O O     . MET B 2 432 ? 29.947  6.718   8.643   1.00 36.86 ? 432 MET A O     1 
ATOM   4315 C CB    . MET B 2 432 ? 30.565  7.992   11.602  1.00 38.98 ? 432 MET A CB    1 
ATOM   4316 C CG    . MET B 2 432 ? 29.200  8.560   11.272  1.00 40.09 ? 432 MET A CG    1 
ATOM   4317 S SD    . MET B 2 432 ? 28.797  10.048  12.229  1.00 42.04 ? 432 MET A SD    1 
ATOM   4318 C CE    . MET B 2 432 ? 29.722  11.277  11.352  1.00 41.44 ? 432 MET A CE    1 
ATOM   4319 N N     . MET B 2 433 ? 32.061  7.478   8.818   1.00 36.86 ? 433 MET A N     1 
ATOM   4320 C CA    . MET B 2 433 ? 32.206  7.808   7.398   1.00 35.91 ? 433 MET A CA    1 
ATOM   4321 C C     . MET B 2 433 ? 32.883  6.727   6.571   1.00 35.88 ? 433 MET A C     1 
ATOM   4322 O O     . MET B 2 433 ? 33.177  6.941   5.395   1.00 35.80 ? 433 MET A O     1 
ATOM   4323 C CB    . MET B 2 433 ? 32.997  9.110   7.239   1.00 34.58 ? 433 MET A CB    1 
ATOM   4324 C CG    . MET B 2 433 ? 32.409  10.268  8.016   1.00 33.43 ? 433 MET A CG    1 
ATOM   4325 S SD    . MET B 2 433 ? 33.267  11.805  7.758   1.00 32.04 ? 433 MET A SD    1 
ATOM   4326 C CE    . MET B 2 433 ? 34.819  11.451  8.520   1.00 30.32 ? 433 MET A CE    1 
ATOM   4327 N N     . GLY B 2 434 ? 33.134  5.573   7.179   1.00 35.73 ? 434 GLY A N     1 
ATOM   4328 C CA    . GLY B 2 434 ? 33.786  4.503   6.453   1.00 35.79 ? 434 GLY A CA    1 
ATOM   4329 C C     . GLY B 2 434 ? 35.254  4.741   6.154   1.00 36.83 ? 434 GLY A C     1 
ATOM   4330 O O     . GLY B 2 434 ? 35.841  4.060   5.324   1.00 35.38 ? 434 GLY A O     1 
ATOM   4331 N N     . VAL B 2 435 ? 35.863  5.715   6.820   1.00 39.25 ? 435 VAL A N     1 
ATOM   4332 C CA    . VAL B 2 435 ? 37.225  6.106   6.476   1.00 42.36 ? 435 VAL A CA    1 
ATOM   4333 C C     . VAL B 2 435 ? 38.092  4.862   6.505   1.00 45.37 ? 435 VAL A C     1 
ATOM   4334 O O     . VAL B 2 435 ? 38.329  4.299   7.571   1.00 45.78 ? 435 VAL A O     1 
ATOM   4335 C CB    . VAL B 2 435 ? 37.809  7.123   7.478   1.00 41.75 ? 435 VAL A CB    1 
ATOM   4336 C CG1   . VAL B 2 435 ? 39.285  7.335   7.196   1.00 41.07 ? 435 VAL A CG1   1 
ATOM   4337 C CG2   . VAL B 2 435 ? 37.063  8.436   7.380   1.00 41.06 ? 435 VAL A CG2   1 
ATOM   4338 N N     . LYS B 2 436 ? 38.556  4.416   5.344   1.00 49.04 ? 436 LYS A N     1 
ATOM   4339 C CA    . LYS B 2 436 ? 39.396  3.232   5.329   1.00 53.35 ? 436 LYS A CA    1 
ATOM   4340 C C     . LYS B 2 436 ? 40.870  3.587   5.287   1.00 55.78 ? 436 LYS A C     1 
ATOM   4341 O O     . LYS B 2 436 ? 41.229  4.764   5.388   1.00 55.30 ? 436 LYS A O     1 
ATOM   4342 C CB    . LYS B 2 436 ? 39.027  2.304   4.165   1.00 53.88 ? 436 LYS A CB    1 
ATOM   4343 C CG    . LYS B 2 436 ? 39.119  2.885   2.777   1.00 54.54 ? 436 LYS A CG    1 
ATOM   4344 C CD    . LYS B 2 436 ? 38.694  1.820   1.781   1.00 55.20 ? 436 LYS A CD    1 
ATOM   4345 C CE    . LYS B 2 436 ? 38.670  2.339   0.366   1.00 56.89 ? 436 LYS A CE    1 
ATOM   4346 N NZ    . LYS B 2 436 ? 38.368  1.231   -0.578  1.00 57.66 ? 436 LYS A NZ    1 
ATOM   4347 N N     . ASP B 2 437 ? 41.710  2.558   5.159   1.00 59.46 ? 437 ASP A N     1 
ATOM   4348 C CA    . ASP B 2 437 ? 43.174  2.691   5.116   1.00 62.53 ? 437 ASP A CA    1 
ATOM   4349 C C     . ASP B 2 437 ? 43.776  2.356   6.484   1.00 62.68 ? 437 ASP A C     1 
ATOM   4350 O O     . ASP B 2 437 ? 43.045  1.777   7.321   1.00 62.55 ? 437 ASP A O     1 
ATOM   4351 C CB    . ASP B 2 437 ? 43.588  4.108   4.687   1.00 64.55 ? 437 ASP A CB    1 
ATOM   4352 C CG    . ASP B 2 437 ? 45.090  4.288   4.625   1.00 66.91 ? 437 ASP A CG    1 
ATOM   4353 O OD1   . ASP B 2 437 ? 45.757  3.495   3.923   1.00 68.25 ? 437 ASP A OD1   1 
ATOM   4354 O OD2   . ASP B 2 437 ? 45.604  5.228   5.277   1.00 67.74 ? 437 ASP A OD2   1 
ATOM   4355 O OXT   . ASP B 2 437 ? 44.970  2.656   6.700   1.00 62.59 ? 437 ASP A OXT   1 
HETATM 4356 S S     . SO4 C 3 .   ? 34.687  -14.104 31.119  1.00 53.04 ? 438 SO4 A S     1 
HETATM 4357 O O1    . SO4 C 3 .   ? 35.515  -14.276 32.386  1.00 53.50 ? 438 SO4 A O1    1 
HETATM 4358 O O2    . SO4 C 3 .   ? 35.120  -15.198 30.144  1.00 52.30 ? 438 SO4 A O2    1 
HETATM 4359 O O3    . SO4 C 3 .   ? 33.335  -14.355 31.467  1.00 52.51 ? 438 SO4 A O3    1 
HETATM 4360 O O4    . SO4 C 3 .   ? 35.154  -12.893 30.546  1.00 53.76 ? 438 SO4 A O4    1 
HETATM 4361 S S     . SO4 D 3 .   ? 9.497   8.422   20.637  1.00 85.52 ? 439 SO4 A S     1 
HETATM 4362 O O1    . SO4 D 3 .   ? 9.464   7.292   21.662  1.00 84.82 ? 439 SO4 A O1    1 
HETATM 4363 O O2    . SO4 D 3 .   ? 8.448   8.098   19.575  1.00 84.98 ? 439 SO4 A O2    1 
HETATM 4364 O O3    . SO4 D 3 .   ? 9.070   9.595   21.305  1.00 84.65 ? 439 SO4 A O3    1 
HETATM 4365 O O4    . SO4 D 3 .   ? 10.746  8.286   19.966  1.00 84.77 ? 439 SO4 A O4    1 
HETATM 4366 O O     . HOH E 4 .   ? 12.650  13.800  16.780  1.00 23.66 ? 36  HOH B O     1 
HETATM 4367 O O     . HOH E 4 .   ? 26.879  -10.031 29.425  1.00 23.38 ? 37  HOH B O     1 
HETATM 4368 O O     . HOH E 4 .   ? 11.074  6.487   38.249  1.00 43.06 ? 38  HOH B O     1 
HETATM 4369 O O     . HOH E 4 .   ? 14.656  4.096   37.729  1.00 40.02 ? 39  HOH B O     1 
HETATM 4370 O O     . HOH E 4 .   ? -3.736  18.476  21.917  1.00 55.99 ? 40  HOH B O     1 
HETATM 4371 O O     . HOH E 4 .   ? -3.692  18.548  18.791  1.00 51.27 ? 41  HOH B O     1 
HETATM 4372 O O     . HOH E 4 .   ? 9.127   0.579   32.443  1.00 45.85 ? 42  HOH B O     1 
HETATM 4373 O O     . HOH E 4 .   ? -8.262  15.304  26.427  1.00 57.16 ? 43  HOH B O     1 
HETATM 4374 O O     . HOH E 4 .   ? 12.848  -5.344  25.793  1.00 32.52 ? 44  HOH B O     1 
HETATM 4375 O O     . HOH E 4 .   ? 3.434   20.862  26.207  1.00 44.81 ? 45  HOH B O     1 
HETATM 4376 O O     . HOH E 4 .   ? 6.980   -3.182  33.804  1.00 37.69 ? 46  HOH B O     1 
HETATM 4377 O O     . HOH E 4 .   ? 4.996   22.420  17.947  1.00 43.44 ? 48  HOH B O     1 
HETATM 4378 O O     . HOH E 4 .   ? -4.084  22.021  20.480  1.00 46.58 ? 49  HOH B O     1 
HETATM 4379 O O     . HOH E 4 .   ? 5.369   18.493  12.836  1.00 37.54 ? 50  HOH B O     1 
HETATM 4380 O O     . HOH E 4 .   ? 11.914  8.951   35.835  1.00 44.23 ? 556 HOH B O     1 
HETATM 4381 O O     . HOH F 4 .   ? 22.839  -32.422 26.661  1.00 23.51 ? 440 HOH A O     1 
HETATM 4382 O O     . HOH F 4 .   ? 17.116  -12.111 44.602  1.00 25.62 ? 441 HOH A O     1 
HETATM 4383 O O     . HOH F 4 .   ? 7.010   19.360  -2.597  1.00 39.73 ? 442 HOH A O     1 
HETATM 4384 O O     . HOH F 4 .   ? 29.287  -24.529 51.014  1.00 33.01 ? 443 HOH A O     1 
HETATM 4385 O O     . HOH F 4 .   ? 18.152  -4.266  17.486  1.00 22.27 ? 444 HOH A O     1 
HETATM 4386 O O     . HOH F 4 .   ? 15.925  14.391  4.989   1.00 26.20 ? 445 HOH A O     1 
HETATM 4387 O O     . HOH F 4 .   ? 24.404  -9.714  60.274  1.00 44.23 ? 446 HOH A O     1 
HETATM 4388 O O     . HOH F 4 .   ? 29.583  2.301   34.638  1.00 27.99 ? 447 HOH A O     1 
HETATM 4389 O O     . HOH F 4 .   ? 20.709  7.553   15.305  1.00 27.43 ? 448 HOH A O     1 
HETATM 4390 O O     . HOH F 4 .   ? 19.361  2.425   30.726  1.00 33.08 ? 449 HOH A O     1 
HETATM 4391 O O     . HOH F 4 .   ? 26.893  4.528   13.826  1.00 38.79 ? 451 HOH A O     1 
HETATM 4392 O O     . HOH F 4 .   ? 18.567  32.400  10.134  1.00 35.80 ? 452 HOH A O     1 
HETATM 4393 O O     . HOH F 4 .   ? 40.767  -12.128 22.434  1.00 34.85 ? 453 HOH A O     1 
HETATM 4394 O O     . HOH F 4 .   ? 25.604  19.519  29.794  1.00 33.67 ? 454 HOH A O     1 
HETATM 4395 O O     . HOH F 4 .   ? 18.106  8.328   6.424   1.00 36.66 ? 455 HOH A O     1 
HETATM 4396 O O     . HOH F 4 .   ? 16.802  -5.143  23.806  1.00 28.75 ? 456 HOH A O     1 
HETATM 4397 O O     . HOH F 4 .   ? -9.791  26.006  -5.569  1.00 21.99 ? 457 HOH A O     1 
HETATM 4398 O O     . HOH F 4 .   ? 24.586  -1.971  17.439  1.00 35.39 ? 458 HOH A O     1 
HETATM 4399 O O     . HOH F 4 .   ? 32.295  -18.933 4.701   1.00 32.35 ? 459 HOH A O     1 
HETATM 4400 O O     . HOH F 4 .   ? 11.028  -15.631 18.071  1.00 30.59 ? 460 HOH A O     1 
HETATM 4401 O O     . HOH F 4 .   ? 35.190  -15.045 35.020  1.00 30.13 ? 461 HOH A O     1 
HETATM 4402 O O     . HOH F 4 .   ? 26.262  -18.541 34.507  1.00 29.44 ? 462 HOH A O     1 
HETATM 4403 O O     . HOH F 4 .   ? 26.366  23.545  7.542   1.00 30.86 ? 463 HOH A O     1 
HETATM 4404 O O     . HOH F 4 .   ? 17.292  -29.538 29.497  1.00 27.93 ? 464 HOH A O     1 
HETATM 4405 O O     . HOH F 4 .   ? 26.954  -0.636  29.313  1.00 27.28 ? 465 HOH A O     1 
HETATM 4406 O O     . HOH F 4 .   ? 11.244  -8.998  50.996  1.00 32.76 ? 466 HOH A O     1 
HETATM 4407 O O     . HOH F 4 .   ? 39.886  -26.873 18.495  1.00 34.67 ? 467 HOH A O     1 
HETATM 4408 O O     . HOH F 4 .   ? 18.813  -22.448 43.892  1.00 27.91 ? 468 HOH A O     1 
HETATM 4409 O O     . HOH F 4 .   ? 33.325  17.706  -3.475  1.00 31.70 ? 469 HOH A O     1 
HETATM 4410 O O     . HOH F 4 .   ? 41.609  -10.862 39.132  1.00 26.34 ? 470 HOH A O     1 
HETATM 4411 O O     . HOH F 4 .   ? 10.508  18.829  15.500  1.00 41.03 ? 471 HOH A O     1 
HETATM 4412 O O     . HOH F 4 .   ? 11.581  19.335  26.504  1.00 32.09 ? 472 HOH A O     1 
HETATM 4413 O O     . HOH F 4 .   ? 22.298  -23.915 12.906  1.00 27.88 ? 473 HOH A O     1 
HETATM 4414 O O     . HOH F 4 .   ? -1.370  34.703  10.136  1.00 32.32 ? 474 HOH A O     1 
HETATM 4415 O O     . HOH F 4 .   ? 3.931   24.164  -10.327 1.00 29.03 ? 475 HOH A O     1 
HETATM 4416 O O     . HOH F 4 .   ? 40.541  -10.703 28.770  1.00 36.62 ? 476 HOH A O     1 
HETATM 4417 O O     . HOH F 4 .   ? 32.607  -27.285 36.113  1.00 37.25 ? 477 HOH A O     1 
HETATM 4418 O O     . HOH F 4 .   ? 20.921  -2.875  15.270  1.00 30.96 ? 478 HOH A O     1 
HETATM 4419 O O     . HOH F 4 .   ? 9.019   21.259  -0.118  1.00 41.70 ? 479 HOH A O     1 
HETATM 4420 O O     . HOH F 4 .   ? 23.567  -11.990 24.915  1.00 30.63 ? 480 HOH A O     1 
HETATM 4421 O O     . HOH F 4 .   ? 29.878  21.441  9.146   1.00 50.14 ? 481 HOH A O     1 
HETATM 4422 O O     . HOH F 4 .   ? 23.093  5.568   37.500  1.00 29.51 ? 482 HOH A O     1 
HETATM 4423 O O     . HOH F 4 .   ? 32.066  -13.356 2.650   1.00 37.27 ? 483 HOH A O     1 
HETATM 4424 O O     . HOH F 4 .   ? 19.867  6.714   35.528  1.00 46.58 ? 484 HOH A O     1 
HETATM 4425 O O     . HOH F 4 .   ? 40.108  15.141  25.634  1.00 36.67 ? 485 HOH A O     1 
HETATM 4426 O O     . HOH F 4 .   ? 29.750  -12.807 59.193  1.00 34.18 ? 486 HOH A O     1 
HETATM 4427 O O     . HOH F 4 .   ? 29.143  -12.494 29.934  1.00 36.54 ? 487 HOH A O     1 
HETATM 4428 O O     . HOH F 4 .   ? 30.594  -24.811 45.098  1.00 41.18 ? 488 HOH A O     1 
HETATM 4429 O O     . HOH F 4 .   ? 32.224  19.168  3.744   1.00 36.75 ? 489 HOH A O     1 
HETATM 4430 O O     . HOH F 4 .   ? -5.082  17.247  -6.675  1.00 44.32 ? 490 HOH A O     1 
HETATM 4431 O O     . HOH F 4 .   ? 1.693   18.202  -7.638  1.00 35.28 ? 491 HOH A O     1 
HETATM 4432 O O     . HOH F 4 .   ? 21.240  10.249  3.295   1.00 48.25 ? 492 HOH A O     1 
HETATM 4433 O O     . HOH F 4 .   ? 25.133  -7.341  49.710  1.00 36.59 ? 493 HOH A O     1 
HETATM 4434 O O     . HOH F 4 .   ? 2.858   -12.297 16.056  1.00 37.38 ? 494 HOH A O     1 
HETATM 4435 O O     . HOH F 4 .   ? 9.427   -13.474 19.181  1.00 42.02 ? 495 HOH A O     1 
HETATM 4436 O O     . HOH F 4 .   ? 9.862   22.996  8.116   1.00 40.00 ? 496 HOH A O     1 
HETATM 4437 O O     . HOH F 4 .   ? 31.404  -30.151 16.943  1.00 38.58 ? 497 HOH A O     1 
HETATM 4438 O O     . HOH F 4 .   ? 30.116  -0.688  54.112  1.00 46.92 ? 498 HOH A O     1 
HETATM 4439 O O     . HOH F 4 .   ? 40.730  22.135  -1.953  1.00 31.92 ? 499 HOH A O     1 
HETATM 4440 O O     . HOH F 4 .   ? 30.385  -3.656  16.873  1.00 40.30 ? 500 HOH A O     1 
HETATM 4441 O O     . HOH F 4 .   ? 35.154  -26.001 50.508  1.00 38.53 ? 501 HOH A O     1 
HETATM 4442 O O     . HOH F 4 .   ? 5.596   32.784  1.551   1.00 39.16 ? 502 HOH A O     1 
HETATM 4443 O O     . HOH F 4 .   ? 24.804  29.458  13.698  1.00 41.17 ? 503 HOH A O     1 
HETATM 4444 O O     . HOH F 4 .   ? 38.810  -7.980  31.807  1.00 38.44 ? 504 HOH A O     1 
HETATM 4445 O O     . HOH F 4 .   ? 33.778  -18.707 40.167  1.00 43.70 ? 505 HOH A O     1 
HETATM 4446 O O     . HOH F 4 .   ? 49.623  -14.801 33.399  1.00 40.73 ? 506 HOH A O     1 
HETATM 4447 O O     . HOH F 4 .   ? 43.436  -26.789 17.590  1.00 59.58 ? 507 HOH A O     1 
HETATM 4448 O O     . HOH F 4 .   ? 16.773  -24.439 25.412  1.00 44.14 ? 508 HOH A O     1 
HETATM 4449 O O     . HOH F 4 .   ? 14.140  10.531  5.473   1.00 37.71 ? 509 HOH A O     1 
HETATM 4450 O O     . HOH F 4 .   ? 15.993  -20.509 10.762  1.00 38.07 ? 510 HOH A O     1 
HETATM 4451 O O     . HOH F 4 .   ? 34.471  -6.496  12.980  1.00 46.02 ? 511 HOH A O     1 
HETATM 4452 O O     . HOH F 4 .   ? 33.716  -6.354  23.076  1.00 55.29 ? 512 HOH A O     1 
HETATM 4453 O O     . HOH F 4 .   ? 18.527  -6.779  20.597  1.00 47.02 ? 513 HOH A O     1 
HETATM 4454 O O     . HOH F 4 .   ? 24.160  0.121   13.880  1.00 42.05 ? 514 HOH A O     1 
HETATM 4455 O O     . HOH F 4 .   ? 16.759  -10.044 15.624  1.00 39.16 ? 515 HOH A O     1 
HETATM 4456 O O     . HOH F 4 .   ? -4.630  17.508  1.909   1.00 43.09 ? 516 HOH A O     1 
HETATM 4457 O O     . HOH F 4 .   ? 9.542   20.554  5.447   1.00 48.01 ? 517 HOH A O     1 
HETATM 4458 O O     . HOH F 4 .   ? 30.562  7.427   35.056  1.00 47.54 ? 518 HOH A O     1 
HETATM 4459 O O     . HOH F 4 .   ? 13.948  22.296  6.953   1.00 32.16 ? 519 HOH A O     1 
HETATM 4460 O O     . HOH F 4 .   ? 20.330  -14.322 59.079  1.00 50.10 ? 520 HOH A O     1 
HETATM 4461 O O     . HOH F 4 .   ? 36.737  -25.497 16.912  1.00 39.98 ? 521 HOH A O     1 
HETATM 4462 O O     . HOH F 4 .   ? 43.820  -17.143 4.398   1.00 50.76 ? 522 HOH A O     1 
HETATM 4463 O O     . HOH F 4 .   ? 14.669  14.937  1.892   1.00 39.03 ? 523 HOH A O     1 
HETATM 4464 O O     . HOH F 4 .   ? 47.825  2.153   3.031   1.00 47.82 ? 524 HOH A O     1 
HETATM 4465 O O     . HOH F 4 .   ? 19.054  -19.804 6.423   1.00 32.10 ? 525 HOH A O     1 
HETATM 4466 O O     . HOH F 4 .   ? 28.190  8.850   8.085   1.00 39.62 ? 526 HOH A O     1 
HETATM 4467 O O     . HOH F 4 .   ? 24.375  6.252   16.775  1.00 42.57 ? 527 HOH A O     1 
HETATM 4468 O O     . HOH F 4 .   ? 18.902  -19.548 42.988  1.00 32.75 ? 528 HOH A O     1 
HETATM 4469 O O     . HOH F 4 .   ? 18.777  28.156  15.585  1.00 42.41 ? 529 HOH A O     1 
HETATM 4470 O O     . HOH F 4 .   ? 46.878  -23.188 30.874  1.00 37.88 ? 530 HOH A O     1 
HETATM 4471 O O     . HOH F 4 .   ? 16.997  -0.555  24.347  1.00 35.40 ? 531 HOH A O     1 
HETATM 4472 O O     . HOH F 4 .   ? 17.435  6.926   37.566  1.00 53.42 ? 532 HOH A O     1 
HETATM 4473 O O     . HOH F 4 .   ? 19.337  -26.350 36.172  1.00 38.23 ? 533 HOH A O     1 
HETATM 4474 O O     . HOH F 4 .   ? 25.610  20.524  0.864   1.00 39.76 ? 534 HOH A O     1 
HETATM 4475 O O     . HOH F 4 .   ? 10.607  -23.963 55.562  1.00 30.15 ? 535 HOH A O     1 
HETATM 4476 O O     . HOH F 4 .   ? 20.156  -8.554  42.159  1.00 51.07 ? 536 HOH A O     1 
HETATM 4477 O O     . HOH F 4 .   ? 37.553  -6.699  53.437  1.00 40.11 ? 537 HOH A O     1 
HETATM 4478 O O     . HOH F 4 .   ? 23.833  -16.290 34.446  1.00 44.38 ? 538 HOH A O     1 
HETATM 4479 O O     . HOH F 4 .   ? 30.702  7.509   37.939  1.00 51.41 ? 539 HOH A O     1 
HETATM 4480 O O     . HOH F 4 .   ? 36.791  2.432   11.748  1.00 55.56 ? 540 HOH A O     1 
HETATM 4481 O O     . HOH F 4 .   ? 50.023  -13.504 30.350  1.00 48.03 ? 541 HOH A O     1 
HETATM 4482 O O     . HOH F 4 .   ? 6.166   38.574  -2.956  1.00 39.38 ? 542 HOH A O     1 
HETATM 4483 O O     . HOH F 4 .   ? 35.932  -28.287 8.632   1.00 36.90 ? 543 HOH A O     1 
HETATM 4484 O O     . HOH F 4 .   ? 32.516  -6.753  27.196  1.00 42.15 ? 544 HOH A O     1 
HETATM 4485 O O     . HOH F 4 .   ? 18.517  -10.900 19.311  1.00 39.24 ? 545 HOH A O     1 
HETATM 4486 O O     . HOH F 4 .   ? 28.736  25.277  13.986  1.00 50.41 ? 546 HOH A O     1 
HETATM 4487 O O     . HOH F 4 .   ? 3.165   17.977  -11.735 1.00 51.08 ? 547 HOH A O     1 
HETATM 4488 O O     . HOH F 4 .   ? 48.206  7.730   17.115  1.00 40.25 ? 548 HOH A O     1 
HETATM 4489 O O     . HOH F 4 .   ? 41.709  22.711  1.311   1.00 41.54 ? 549 HOH A O     1 
HETATM 4490 O O     . HOH F 4 .   ? 33.741  -16.602 37.825  1.00 38.69 ? 550 HOH A O     1 
HETATM 4491 O O     . HOH F 4 .   ? 8.934   -15.435 25.496  1.00 39.21 ? 551 HOH A O     1 
HETATM 4492 O O     . HOH F 4 .   ? 31.544  16.759  32.741  1.00 50.57 ? 552 HOH A O     1 
HETATM 4493 O O     . HOH F 4 .   ? 44.835  -24.558 45.976  1.00 44.35 ? 554 HOH A O     1 
HETATM 4494 O O     . HOH F 4 .   ? 33.045  2.509   29.297  1.00 66.10 ? 555 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  A   33  33  33  A   A   B . n 
A 1 34  C   34  34  34  C   C   B . n 
B 2 1   MET 1   1   1   MET MET A . n 
B 2 2   LYS 2   2   2   LYS LYS A . n 
B 2 3   VAL 3   3   3   VAL VAL A . n 
B 2 4   GLU 4   4   4   GLU GLU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   ILE 6   6   6   ILE ILE A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  ALA 10  10  10  ALA ALA A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLU 12  12  12  GLU GLU A . n 
B 2 13  LEU 13  13  13  LEU LEU A . n 
B 2 14  VAL 14  14  14  VAL VAL A . n 
B 2 15  ILE 15  15  15  ILE ILE A . n 
B 2 16  PRO 16  16  16  PRO PRO A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  GLU 19  19  19  GLU GLU A . n 
B 2 20  GLU 20  20  20  GLU GLU A . n 
B 2 21  VAL 21  21  21  VAL VAL A . n 
B 2 22  ARG 22  22  22  ARG ARG A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  GLY 24  24  24  GLY GLY A . n 
B 2 25  ARG 25  25  25  ARG ARG A . n 
B 2 26  GLU 26  26  26  GLU GLU A . n 
B 2 27  ALA 27  27  27  ALA ALA A . n 
B 2 28  GLU 28  28  28  GLU GLU A . n 
B 2 29  GLU 29  29  29  GLU GLU A . n 
B 2 30  GLU 30  30  30  GLU GLU A . n 
B 2 31  LEU 31  31  31  LEU LEU A . n 
B 2 32  ARG 32  32  32  ARG ARG A . n 
B 2 33  ARG 33  33  33  ARG ARG A . n 
B 2 34  ARG 34  34  34  ARG ARG A . n 
B 2 35  LEU 35  35  35  LEU LEU A . n 
B 2 36  ASP 36  36  36  ASP ASP A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  LEU 38  38  38  LEU LEU A . n 
B 2 39  GLY 39  39  39  GLY GLY A . n 
B 2 40  VAL 40  40  40  VAL VAL A . n 
B 2 41  GLU 41  41  41  GLU GLU A . n 
B 2 42  TYR 42  42  42  TYR TYR A . n 
B 2 43  VAL 43  43  43  VAL VAL A . n 
B 2 44  PHE 44  44  44  PHE PHE A . n 
B 2 45  VAL 45  45  45  VAL VAL A . n 
B 2 46  GLY 46  46  46  GLY GLY A . n 
B 2 47  SER 47  47  47  SER SER A . n 
B 2 48  TYR 48  48  48  TYR TYR A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ARG 50  50  50  ARG ARG A . n 
B 2 51  ASN 51  51  51  ASN ASN A . n 
B 2 52  THR 52  52  52  THR THR A . n 
B 2 53  TRP 53  53  53  TRP TRP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LYS 55  55  55  LYS LYS A . n 
B 2 56  GLY 56  56  56  GLY GLY A . n 
B 2 57  SER 57  57  57  SER SER A . n 
B 2 58  LEU 58  58  58  LEU LEU A . n 
B 2 59  GLU 59  59  59  GLU GLU A . n 
B 2 60  ILE 60  60  60  ILE ILE A . n 
B 2 61  ASP 61  61  61  ASP ASP A . n 
B 2 62  VAL 62  62  62  VAL VAL A . n 
B 2 63  PHE 63  63  63  PHE PHE A . n 
B 2 64  LEU 64  64  64  LEU LEU A . n 
B 2 65  LEU 65  65  65  LEU LEU A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  PRO 67  67  67  PRO PRO A . n 
B 2 68  GLU 68  68  68  GLU GLU A . n 
B 2 69  GLU 69  69  69  GLU GLU A . n 
B 2 70  PHE 70  70  70  PHE PHE A . n 
B 2 71  SER 71  71  71  SER SER A . n 
B 2 72  LYS 72  72  72  LYS LYS A . n 
B 2 73  GLU 73  73  73  GLU GLU A . n 
B 2 74  GLU 74  74  74  GLU GLU A . n 
B 2 75  LEU 75  75  75  LEU LEU A . n 
B 2 76  ARG 76  76  76  ARG ARG A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  ARG 78  78  78  ARG ARG A . n 
B 2 79  GLY 79  79  79  GLY GLY A . n 
B 2 80  LEU 80  80  80  LEU LEU A . n 
B 2 81  GLU 81  81  81  GLU GLU A . n 
B 2 82  ILE 82  82  82  ILE ILE A . n 
B 2 83  GLY 83  83  83  GLY GLY A . n 
B 2 84  LYS 84  84  84  LYS LYS A . n 
B 2 85  ALA 85  85  85  ALA ALA A . n 
B 2 86  VAL 86  86  86  VAL VAL A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  ASP 88  88  88  ASP ASP A . n 
B 2 89  SER 89  89  89  SER SER A . n 
B 2 90  TYR 90  90  90  TYR TYR A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  ILE 92  92  92  ILE ILE A . n 
B 2 93  ARG 93  93  93  ARG ARG A . n 
B 2 94  TYR 94  94  94  TYR TYR A . n 
B 2 95  ALA 95  95  95  ALA ALA A . n 
B 2 96  GLU 96  96  96  GLU GLU A . n 
B 2 97  HIS 97  97  97  HIS HIS A . n 
B 2 98  PRO 98  98  98  PRO PRO A . n 
B 2 99  TYR 99  99  99  TYR TYR A . n 
B 2 100 VAL 100 100 100 VAL VAL A . n 
B 2 101 HIS 101 101 101 HIS HIS A . n 
B 2 102 GLY 102 102 102 GLY GLY A . n 
B 2 103 VAL 103 103 103 VAL VAL A . n 
B 2 104 VAL 104 104 104 VAL VAL A . n 
B 2 105 LYS 105 105 105 LYS LYS A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 VAL 107 107 107 VAL VAL A . n 
B 2 108 GLU 108 108 108 GLU GLU A . n 
B 2 109 VAL 109 109 109 VAL VAL A . n 
B 2 110 ASP 110 110 110 ASP ASP A . n 
B 2 111 VAL 111 111 111 VAL VAL A . n 
B 2 112 VAL 112 112 112 VAL VAL A . n 
B 2 113 PRO 113 113 113 PRO PRO A . n 
B 2 114 CYS 114 114 114 CYS CYS A . n 
B 2 115 TYR 115 115 115 TYR TYR A . n 
B 2 116 LYS 116 116 116 LYS LYS A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 LYS 118 118 118 LYS LYS A . n 
B 2 119 GLU 119 119 119 GLU GLU A . n 
B 2 120 PRO 120 120 120 PRO PRO A . n 
B 2 121 LYS 121 121 121 LYS LYS A . n 
B 2 122 ASN 122 122 122 ASN ASN A . n 
B 2 123 ILE 123 123 123 ILE ILE A . n 
B 2 124 LYS 124 124 124 LYS LYS A . n 
B 2 125 SER 125 125 125 SER SER A . n 
B 2 126 ALA 126 126 126 ALA ALA A . n 
B 2 127 VAL 127 127 127 VAL VAL A . n 
B 2 128 ASP 128 128 128 ASP ASP A . n 
B 2 129 ARG 129 129 129 ARG ARG A . n 
B 2 130 THR 130 130 130 THR THR A . n 
B 2 131 PRO 131 131 131 PRO PRO A . n 
B 2 132 PHE 132 132 132 PHE PHE A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 LYS 135 135 135 LYS LYS A . n 
B 2 136 TRP 136 136 136 TRP TRP A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 GLU 138 138 138 GLU GLU A . n 
B 2 139 GLY 139 139 139 GLY GLY A . n 
B 2 140 ARG 140 140 140 ARG ARG A . n 
B 2 141 ILE 141 141 141 ILE ILE A . n 
B 2 142 LYS 142 142 142 LYS LYS A . n 
B 2 143 GLY 143 143 143 GLY GLY A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 ASN 146 146 146 ASN ASN A . n 
B 2 147 GLU 147 147 147 GLU GLU A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 ARG 149 149 149 ARG ARG A . n 
B 2 150 LEU 150 150 150 LEU LEU A . n 
B 2 151 LEU 151 151 151 LEU LEU A . n 
B 2 152 LYS 152 152 152 LYS LYS A . n 
B 2 153 GLY 153 153 153 GLY GLY A . n 
B 2 154 PHE 154 154 154 PHE PHE A . n 
B 2 155 LEU 155 155 155 LEU LEU A . n 
B 2 156 LYS 156 156 156 LYS LYS A . n 
B 2 157 ALA 157 157 157 ALA ALA A . n 
B 2 158 ASN 158 158 158 ASN ASN A . n 
B 2 159 GLY 159 159 159 GLY GLY A . n 
B 2 160 ILE 160 160 160 ILE ILE A . n 
B 2 161 TYR 161 161 161 TYR TYR A . n 
B 2 162 GLY 162 162 162 GLY GLY A . n 
B 2 163 ALA 163 163 163 ALA ALA A . n 
B 2 164 GLU 164 164 164 GLU GLU A . n 
B 2 165 TYR 165 165 165 TYR TYR A . n 
B 2 166 LYS 166 166 166 LYS LYS A . n 
B 2 167 VAL 167 167 167 VAL VAL A . n 
B 2 168 ARG 168 168 168 ARG ARG A . n 
B 2 169 GLY 169 169 169 GLY GLY A . n 
B 2 170 PHE 170 170 170 PHE PHE A . n 
B 2 171 SER 171 171 171 SER SER A . n 
B 2 172 GLY 172 172 172 GLY GLY A . n 
B 2 173 TYR 173 173 173 TYR TYR A . n 
B 2 174 LEU 174 174 174 LEU LEU A . n 
B 2 175 CYS 175 175 175 CYS CYS A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 LEU 177 177 177 LEU LEU A . n 
B 2 178 LEU 178 178 178 LEU LEU A . n 
B 2 179 ILE 179 179 179 ILE ILE A . n 
B 2 180 VAL 180 180 180 VAL VAL A . n 
B 2 181 PHE 181 181 181 PHE PHE A . n 
B 2 182 TYR 182 182 182 TYR TYR A . n 
B 2 183 GLY 183 183 183 GLY GLY A . n 
B 2 184 SER 184 184 184 SER SER A . n 
B 2 185 PHE 185 185 185 PHE PHE A . n 
B 2 186 LEU 186 186 186 LEU LEU A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 THR 188 188 188 THR THR A . n 
B 2 189 VAL 189 189 189 VAL VAL A . n 
B 2 190 LYS 190 190 190 LYS LYS A . n 
B 2 191 ASN 191 191 191 ASN ASN A . n 
B 2 192 ALA 192 192 192 ALA ALA A . n 
B 2 193 ARG 193 193 193 ARG ARG A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 TRP 195 195 195 TRP TRP A . n 
B 2 196 THR 196 196 196 THR THR A . n 
B 2 197 ARG 197 197 197 ARG ARG A . n 
B 2 198 ARG 198 198 198 ARG ARG A . n 
B 2 199 THR 199 199 199 THR THR A . n 
B 2 200 VAL 200 200 200 VAL VAL A . n 
B 2 201 ILE 201 201 201 ILE ILE A . n 
B 2 202 ASP 202 202 202 ASP ASP A . n 
B 2 203 VAL 203 203 203 VAL VAL A . n 
B 2 204 ALA 204 204 204 ALA ALA A . n 
B 2 205 LYS 205 205 205 LYS LYS A . n 
B 2 206 GLY 206 206 206 GLY GLY A . n 
B 2 207 GLU 207 207 207 GLU GLU A . n 
B 2 208 VAL 208 208 208 VAL VAL A . n 
B 2 209 ARG 209 209 209 ARG ARG A . n 
B 2 210 LYS 210 210 210 LYS LYS A . n 
B 2 211 GLY 211 211 211 GLY GLY A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 GLU 213 213 213 GLU GLU A . n 
B 2 214 PHE 214 214 214 PHE PHE A . n 
B 2 215 PHE 215 215 215 PHE PHE A . n 
B 2 216 VAL 216 216 216 VAL VAL A . n 
B 2 217 VAL 217 217 217 VAL VAL A . n 
B 2 218 ASP 218 218 218 ASP ASP A . n 
B 2 219 PRO 219 219 219 PRO PRO A . n 
B 2 220 VAL 220 220 220 VAL VAL A . n 
B 2 221 ASP 221 221 221 ASP ASP A . n 
B 2 222 GLU 222 222 222 GLU GLU A . n 
B 2 223 LYS 223 223 223 LYS LYS A . n 
B 2 224 ARG 224 224 224 ARG ARG A . n 
B 2 225 ASN 225 225 225 ASN ASN A . n 
B 2 226 VAL 226 226 226 VAL VAL A . n 
B 2 227 ALA 227 227 227 ALA ALA A . n 
B 2 228 ALA 228 228 228 ALA ALA A . n 
B 2 229 ASN 229 229 229 ASN ASN A . n 
B 2 230 LEU 230 230 230 LEU LEU A . n 
B 2 231 SER 231 231 231 SER SER A . n 
B 2 232 LEU 232 232 232 LEU LEU A . n 
B 2 233 ASP 233 233 233 ASP ASP A . n 
B 2 234 ASN 234 234 234 ASN ASN A . n 
B 2 235 LEU 235 235 235 LEU LEU A . n 
B 2 236 ALA 236 236 236 ALA ALA A . n 
B 2 237 ARG 237 237 237 ARG ARG A . n 
B 2 238 PHE 238 238 238 PHE PHE A . n 
B 2 239 VAL 239 239 239 VAL VAL A . n 
B 2 240 HIS 240 240 240 HIS HIS A . n 
B 2 241 LEU 241 241 241 LEU LEU A . n 
B 2 242 CYS 242 242 242 CYS CYS A . n 
B 2 243 ARG 243 243 243 ARG ARG A . n 
B 2 244 GLU 244 244 244 GLU GLU A . n 
B 2 245 PHE 245 245 245 PHE PHE A . n 
B 2 246 MET 246 246 246 MET MET A . n 
B 2 247 GLU 247 247 247 GLU GLU A . n 
B 2 248 ALA 248 248 248 ALA ALA A . n 
B 2 249 PRO 249 249 249 PRO PRO A . n 
B 2 250 SER 250 250 250 SER SER A . n 
B 2 251 LEU 251 251 251 LEU LEU A . n 
B 2 252 GLY 252 252 252 GLY GLY A . n 
B 2 253 PHE 253 253 253 PHE PHE A . n 
B 2 254 PHE 254 254 254 PHE PHE A . n 
B 2 255 LYS 255 255 255 LYS LYS A . n 
B 2 256 PRO 256 256 256 PRO PRO A . n 
B 2 257 LYS 257 257 257 LYS LYS A . n 
B 2 258 HIS 258 258 258 HIS HIS A . n 
B 2 259 PRO 259 259 259 PRO PRO A . n 
B 2 260 LEU 260 260 260 LEU LEU A . n 
B 2 261 GLU 261 261 261 GLU GLU A . n 
B 2 262 ILE 262 262 262 ILE ILE A . n 
B 2 263 GLU 263 263 263 GLU GLU A . n 
B 2 264 PRO 264 264 264 PRO PRO A . n 
B 2 265 GLU 265 265 265 GLU GLU A . n 
B 2 266 ARG 266 266 266 ARG ARG A . n 
B 2 267 LEU 267 267 267 LEU LEU A . n 
B 2 268 ARG 268 268 268 ARG ARG A . n 
B 2 269 LYS 269 269 269 LYS LYS A . n 
B 2 270 ILE 270 270 270 ILE ILE A . n 
B 2 271 VAL 271 271 271 VAL VAL A . n 
B 2 272 GLU 272 272 272 GLU GLU A . n 
B 2 273 GLU 273 273 273 GLU GLU A . n 
B 2 274 ARG 274 274 274 ARG ARG A . n 
B 2 275 GLY 275 275 275 GLY GLY A . n 
B 2 276 THR 276 276 276 THR THR A . n 
B 2 277 ALA 277 277 277 ALA ALA A . n 
B 2 278 VAL 278 278 278 VAL VAL A . n 
B 2 279 PHE 279 279 279 PHE PHE A . n 
B 2 280 ALA 280 280 280 ALA ALA A . n 
B 2 281 VAL 281 281 281 VAL VAL A . n 
B 2 282 LYS 282 282 282 LYS LYS A . n 
B 2 283 PHE 283 283 283 PHE PHE A . n 
B 2 284 ARG 284 284 284 ARG ARG A . n 
B 2 285 LYS 285 285 285 LYS LYS A . n 
B 2 286 PRO 286 286 286 PRO PRO A . n 
B 2 287 ASP 287 287 287 ASP ASP A . n 
B 2 288 ILE 288 288 288 ILE ILE A . n 
B 2 289 VAL 289 289 289 VAL VAL A . n 
B 2 290 ASP 290 290 290 ASP ASP A . n 
B 2 291 ASP 291 291 291 ASP ASP A . n 
B 2 292 ASN 292 292 292 ASN ASN A . n 
B 2 293 LEU 293 293 293 LEU LEU A . n 
B 2 294 TYR 294 294 294 TYR TYR A . n 
B 2 295 PRO 295 295 295 PRO PRO A . n 
B 2 296 GLN 296 296 296 GLN GLN A . n 
B 2 297 LEU 297 297 297 LEU LEU A . n 
B 2 298 GLU 298 298 298 GLU GLU A . n 
B 2 299 ARG 299 299 299 ARG ARG A . n 
B 2 300 ALA 300 300 300 ALA ALA A . n 
B 2 301 SER 301 301 301 SER SER A . n 
B 2 302 ARG 302 302 302 ARG ARG A . n 
B 2 303 LYS 303 303 303 LYS LYS A . n 
B 2 304 ILE 304 304 304 ILE ILE A . n 
B 2 305 PHE 305 305 305 PHE PHE A . n 
B 2 306 GLU 306 306 306 GLU GLU A . n 
B 2 307 PHE 307 307 307 PHE PHE A . n 
B 2 308 LEU 308 308 308 LEU LEU A . n 
B 2 309 GLU 309 309 309 GLU GLU A . n 
B 2 310 ARG 310 310 310 ARG ARG A . n 
B 2 311 GLU 311 311 311 GLU GLU A . n 
B 2 312 ASN 312 312 312 ASN ASN A . n 
B 2 313 PHE 313 313 313 PHE PHE A . n 
B 2 314 MET 314 314 314 MET MET A . n 
B 2 315 PRO 315 315 315 PRO PRO A . n 
B 2 316 LEU 316 316 316 LEU LEU A . n 
B 2 317 ARG 317 317 317 ARG ARG A . n 
B 2 318 SER 318 318 318 SER SER A . n 
B 2 319 ALA 319 319 319 ALA ALA A . n 
B 2 320 PHE 320 320 320 PHE PHE A . n 
B 2 321 LYS 321 321 321 LYS LYS A . n 
B 2 322 ALA 322 322 322 ALA ALA A . n 
B 2 323 SER 323 323 323 SER SER A . n 
B 2 324 GLU 324 324 324 GLU GLU A . n 
B 2 325 GLU 325 325 325 GLU GLU A . n 
B 2 326 PHE 326 326 326 PHE PHE A . n 
B 2 327 CYS 327 327 327 CYS CYS A . n 
B 2 328 TYR 328 328 328 TYR TYR A . n 
B 2 329 LEU 329 329 329 LEU LEU A . n 
B 2 330 LEU 330 330 330 LEU LEU A . n 
B 2 331 PHE 331 331 331 PHE PHE A . n 
B 2 332 GLU 332 332 332 GLU GLU A . n 
B 2 333 CYS 333 333 333 CYS CYS A . n 
B 2 334 GLN 334 334 334 GLN GLN A . n 
B 2 335 ILE 335 335 335 ILE ILE A . n 
B 2 336 LYS 336 336 336 LYS LYS A . n 
B 2 337 GLU 337 337 337 GLU GLU A . n 
B 2 338 ILE 338 338 338 ILE ILE A . n 
B 2 339 SER 339 339 339 SER SER A . n 
B 2 340 ARG 340 340 340 ARG ARG A . n 
B 2 341 VAL 341 341 341 VAL VAL A . n 
B 2 342 PHE 342 342 342 PHE PHE A . n 
B 2 343 ARG 343 343 343 ARG ARG A . n 
B 2 344 ARG 344 344 344 ARG ARG A . n 
B 2 345 MET 345 345 345 MET MET A . n 
B 2 346 GLY 346 346 346 GLY GLY A . n 
B 2 347 PRO 347 347 347 PRO PRO A . n 
B 2 348 GLN 348 348 348 GLN GLN A . n 
B 2 349 PHE 349 349 349 PHE PHE A . n 
B 2 350 GLU 350 350 350 GLU GLU A . n 
B 2 351 ASP 351 351 351 ASP ASP A . n 
B 2 352 GLU 352 352 352 GLU GLU A . n 
B 2 353 ARG 353 353 353 ARG ARG A . n 
B 2 354 ASN 354 354 354 ASN ASN A . n 
B 2 355 VAL 355 355 355 VAL VAL A . n 
B 2 356 LYS 356 356 356 LYS LYS A . n 
B 2 357 LYS 357 357 357 LYS LYS A . n 
B 2 358 PHE 358 358 358 PHE PHE A . n 
B 2 359 LEU 359 359 359 LEU LEU A . n 
B 2 360 SER 360 360 360 SER SER A . n 
B 2 361 ARG 361 361 361 ARG ARG A . n 
B 2 362 ASN 362 362 362 ASN ASN A . n 
B 2 363 ARG 363 363 363 ARG ARG A . n 
B 2 364 ALA 364 364 364 ALA ALA A . n 
B 2 365 PHE 365 365 365 PHE PHE A . n 
B 2 366 ARG 366 366 366 ARG ARG A . n 
B 2 367 PRO 367 367 367 PRO PRO A . n 
B 2 368 PHE 368 368 368 PHE PHE A . n 
B 2 369 ILE 369 369 369 ILE ILE A . n 
B 2 370 GLU 370 370 370 GLU GLU A . n 
B 2 371 ASN 371 371 371 ASN ASN A . n 
B 2 372 GLY 372 372 372 GLY GLY A . n 
B 2 373 ARG 373 373 373 ARG ARG A . n 
B 2 374 TRP 374 374 374 TRP TRP A . n 
B 2 375 TRP 375 375 375 TRP TRP A . n 
B 2 376 ALA 376 376 376 ALA ALA A . n 
B 2 377 PHE 377 377 377 PHE PHE A . n 
B 2 378 GLU 378 378 378 GLU GLU A . n 
B 2 379 MET 379 379 379 MET MET A . n 
B 2 380 ARG 380 380 380 ARG ARG A . n 
B 2 381 LYS 381 381 381 LYS LYS A . n 
B 2 382 PHE 382 382 382 PHE PHE A . n 
B 2 383 THR 383 383 383 THR THR A . n 
B 2 384 THR 384 384 384 THR THR A . n 
B 2 385 PRO 385 385 385 PRO PRO A . n 
B 2 386 GLU 386 386 386 GLU GLU A . n 
B 2 387 GLU 387 387 387 GLU GLU A . n 
B 2 388 GLY 388 388 388 GLY GLY A . n 
B 2 389 VAL 389 389 389 VAL VAL A . n 
B 2 390 ARG 390 390 390 ARG ARG A . n 
B 2 391 SER 391 391 391 SER SER A . n 
B 2 392 TYR 392 392 392 TYR TYR A . n 
B 2 393 ALA 393 393 393 ALA ALA A . n 
B 2 394 SER 394 394 394 SER SER A . n 
B 2 395 THR 395 395 395 THR THR A . n 
B 2 396 HIS 396 396 396 HIS HIS A . n 
B 2 397 TRP 397 397 397 TRP TRP A . n 
B 2 398 HIS 398 398 398 HIS HIS A . n 
B 2 399 THR 399 399 399 THR THR A . n 
B 2 400 LEU 400 400 400 LEU LEU A . n 
B 2 401 GLY 401 401 401 GLY GLY A . n 
B 2 402 LYS 402 402 402 LYS LYS A . n 
B 2 403 ASN 403 403 403 ASN ASN A . n 
B 2 404 VAL 404 404 404 VAL VAL A . n 
B 2 405 GLY 405 405 405 GLY GLY A . n 
B 2 406 GLU 406 406 406 GLU GLU A . n 
B 2 407 SER 407 407 407 SER SER A . n 
B 2 408 ILE 408 408 408 ILE ILE A . n 
B 2 409 ARG 409 409 409 ARG ARG A . n 
B 2 410 GLU 410 410 410 GLU GLU A . n 
B 2 411 TYR 411 411 411 TYR TYR A . n 
B 2 412 PHE 412 412 412 PHE PHE A . n 
B 2 413 GLU 413 413 413 GLU GLU A . n 
B 2 414 ILE 414 414 414 ILE ILE A . n 
B 2 415 ILE 415 415 415 ILE ILE A . n 
B 2 416 SER 416 416 416 SER SER A . n 
B 2 417 GLY 417 417 417 GLY GLY A . n 
B 2 418 GLU 418 418 418 GLU GLU A . n 
B 2 419 LYS 419 419 419 LYS LYS A . n 
B 2 420 LEU 420 420 420 LEU LEU A . n 
B 2 421 PHE 421 421 421 PHE PHE A . n 
B 2 422 LYS 422 422 422 LYS LYS A . n 
B 2 423 GLU 423 423 423 GLU GLU A . n 
B 2 424 PRO 424 424 424 PRO PRO A . n 
B 2 425 VAL 425 425 425 VAL VAL A . n 
B 2 426 THR 426 426 426 THR THR A . n 
B 2 427 ALA 427 427 427 ALA ALA A . n 
B 2 428 GLU 428 428 428 GLU GLU A . n 
B 2 429 LEU 429 429 429 LEU LEU A . n 
B 2 430 CYS 430 430 430 CYS CYS A . n 
B 2 431 GLU 431 431 431 GLU GLU A . n 
B 2 432 MET 432 432 432 MET MET A . n 
B 2 433 MET 433 433 433 MET MET A . n 
B 2 434 GLY 434 434 434 GLY GLY A . n 
B 2 435 VAL 435 435 435 VAL VAL A . n 
B 2 436 LYS 436 436 436 LYS LYS A . n 
B 2 437 ASP 437 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   438 438 SO4 SO4 A . 
D 3 SO4 1   439 439 SO4 SO4 A . 
E 4 HOH 1   36  36  HOH HOH B . 
E 4 HOH 2   37  37  HOH HOH B . 
E 4 HOH 3   38  38  HOH HOH B . 
E 4 HOH 4   39  39  HOH HOH B . 
E 4 HOH 5   40  40  HOH HOH B . 
E 4 HOH 6   41  41  HOH HOH B . 
E 4 HOH 7   42  42  HOH HOH B . 
E 4 HOH 8   43  43  HOH HOH B . 
E 4 HOH 9   44  44  HOH HOH B . 
E 4 HOH 10  45  45  HOH HOH B . 
E 4 HOH 11  46  46  HOH HOH B . 
E 4 HOH 12  48  48  HOH HOH B . 
E 4 HOH 13  49  49  HOH HOH B . 
E 4 HOH 14  50  50  HOH HOH B . 
E 4 HOH 15  556 556 HOH HOH B . 
F 4 HOH 1   440 440 HOH HOH A . 
F 4 HOH 2   441 441 HOH HOH A . 
F 4 HOH 3   442 442 HOH HOH A . 
F 4 HOH 4   443 443 HOH HOH A . 
F 4 HOH 5   444 444 HOH HOH A . 
F 4 HOH 6   445 445 HOH HOH A . 
F 4 HOH 7   446 446 HOH HOH A . 
F 4 HOH 8   447 447 HOH HOH A . 
F 4 HOH 9   448 448 HOH HOH A . 
F 4 HOH 10  449 449 HOH HOH A . 
F 4 HOH 11  451 451 HOH HOH A . 
F 4 HOH 12  452 452 HOH HOH A . 
F 4 HOH 13  453 453 HOH HOH A . 
F 4 HOH 14  454 454 HOH HOH A . 
F 4 HOH 15  455 455 HOH HOH A . 
F 4 HOH 16  456 456 HOH HOH A . 
F 4 HOH 17  457 457 HOH HOH A . 
F 4 HOH 18  458 458 HOH HOH A . 
F 4 HOH 19  459 459 HOH HOH A . 
F 4 HOH 20  460 460 HOH HOH A . 
F 4 HOH 21  461 461 HOH HOH A . 
F 4 HOH 22  462 462 HOH HOH A . 
F 4 HOH 23  463 463 HOH HOH A . 
F 4 HOH 24  464 464 HOH HOH A . 
F 4 HOH 25  465 465 HOH HOH A . 
F 4 HOH 26  466 466 HOH HOH A . 
F 4 HOH 27  467 467 HOH HOH A . 
F 4 HOH 28  468 468 HOH HOH A . 
F 4 HOH 29  469 469 HOH HOH A . 
F 4 HOH 30  470 470 HOH HOH A . 
F 4 HOH 31  471 471 HOH HOH A . 
F 4 HOH 32  472 472 HOH HOH A . 
F 4 HOH 33  473 473 HOH HOH A . 
F 4 HOH 34  474 474 HOH HOH A . 
F 4 HOH 35  475 475 HOH HOH A . 
F 4 HOH 36  476 476 HOH HOH A . 
F 4 HOH 37  477 477 HOH HOH A . 
F 4 HOH 38  478 478 HOH HOH A . 
F 4 HOH 39  479 479 HOH HOH A . 
F 4 HOH 40  480 480 HOH HOH A . 
F 4 HOH 41  481 481 HOH HOH A . 
F 4 HOH 42  482 482 HOH HOH A . 
F 4 HOH 43  483 483 HOH HOH A . 
F 4 HOH 44  484 484 HOH HOH A . 
F 4 HOH 45  485 485 HOH HOH A . 
F 4 HOH 46  486 486 HOH HOH A . 
F 4 HOH 47  487 487 HOH HOH A . 
F 4 HOH 48  488 488 HOH HOH A . 
F 4 HOH 49  489 489 HOH HOH A . 
F 4 HOH 50  490 490 HOH HOH A . 
F 4 HOH 51  491 491 HOH HOH A . 
F 4 HOH 52  492 492 HOH HOH A . 
F 4 HOH 53  493 493 HOH HOH A . 
F 4 HOH 54  494 494 HOH HOH A . 
F 4 HOH 55  495 495 HOH HOH A . 
F 4 HOH 56  496 496 HOH HOH A . 
F 4 HOH 57  497 497 HOH HOH A . 
F 4 HOH 58  498 498 HOH HOH A . 
F 4 HOH 59  499 499 HOH HOH A . 
F 4 HOH 60  500 500 HOH HOH A . 
F 4 HOH 61  501 501 HOH HOH A . 
F 4 HOH 62  502 502 HOH HOH A . 
F 4 HOH 63  503 503 HOH HOH A . 
F 4 HOH 64  504 504 HOH HOH A . 
F 4 HOH 65  505 505 HOH HOH A . 
F 4 HOH 66  506 506 HOH HOH A . 
F 4 HOH 67  507 507 HOH HOH A . 
F 4 HOH 68  508 508 HOH HOH A . 
F 4 HOH 69  509 509 HOH HOH A . 
F 4 HOH 70  510 510 HOH HOH A . 
F 4 HOH 71  511 511 HOH HOH A . 
F 4 HOH 72  512 512 HOH HOH A . 
F 4 HOH 73  513 513 HOH HOH A . 
F 4 HOH 74  514 514 HOH HOH A . 
F 4 HOH 75  515 515 HOH HOH A . 
F 4 HOH 76  516 516 HOH HOH A . 
F 4 HOH 77  517 517 HOH HOH A . 
F 4 HOH 78  518 518 HOH HOH A . 
F 4 HOH 79  519 519 HOH HOH A . 
F 4 HOH 80  520 520 HOH HOH A . 
F 4 HOH 81  521 521 HOH HOH A . 
F 4 HOH 82  522 522 HOH HOH A . 
F 4 HOH 83  523 523 HOH HOH A . 
F 4 HOH 84  524 524 HOH HOH A . 
F 4 HOH 85  525 525 HOH HOH A . 
F 4 HOH 86  526 526 HOH HOH A . 
F 4 HOH 87  527 527 HOH HOH A . 
F 4 HOH 88  528 528 HOH HOH A . 
F 4 HOH 89  529 529 HOH HOH A . 
F 4 HOH 90  530 530 HOH HOH A . 
F 4 HOH 91  531 531 HOH HOH A . 
F 4 HOH 92  532 532 HOH HOH A . 
F 4 HOH 93  533 533 HOH HOH A . 
F 4 HOH 94  534 534 HOH HOH A . 
F 4 HOH 95  535 535 HOH HOH A . 
F 4 HOH 96  536 536 HOH HOH A . 
F 4 HOH 97  537 537 HOH HOH A . 
F 4 HOH 98  538 538 HOH HOH A . 
F 4 HOH 99  539 539 HOH HOH A . 
F 4 HOH 100 540 540 HOH HOH A . 
F 4 HOH 101 541 541 HOH HOH A . 
F 4 HOH 102 542 542 HOH HOH A . 
F 4 HOH 103 543 543 HOH HOH A . 
F 4 HOH 104 544 544 HOH HOH A . 
F 4 HOH 105 545 545 HOH HOH A . 
F 4 HOH 106 546 546 HOH HOH A . 
F 4 HOH 107 547 547 HOH HOH A . 
F 4 HOH 108 548 548 HOH HOH A . 
F 4 HOH 109 549 549 HOH HOH A . 
F 4 HOH 110 550 550 HOH HOH A . 
F 4 HOH 111 551 551 HOH HOH A . 
F 4 HOH 112 552 552 HOH HOH A . 
F 4 HOH 113 554 554 HOH HOH A . 
F 4 HOH 114 555 555 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3200  ? 
1 MORE         -47   ? 
1 'SSA (A^2)'  27210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 95  ? ? -121.73 -126.00 
2 1 GLU A 119 ? ? 85.39   118.46  
3 1 ASN A 122 ? ? 86.59   8.81    
4 1 ASP A 221 ? ? -169.95 99.15   
5 1 ALA A 248 ? ? -156.99 76.99   
6 1 ARG A 366 ? ? 76.27   114.25  
7 1 TYR A 411 ? ? 177.72  139.63  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZH2 'double helix'         
2ZH2 'a-form double helix'  
2ZH2 'hairpin loop'         
2ZH2 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 -0.212 -0.245 0.985  12.131  -9.061  -2.734  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.991 -0.179 0.355  12.297  -11.676 0.716   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.107  -0.047 -0.034 10.075  -15.345 1.076   3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 -0.079 0.027  -0.184 1.601   -3.729  4.506   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 -0.280 -0.075 -0.155 7.323   -7.789  5.024   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.581 -0.749 -0.660 -4.835  -11.486 9.625   6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 -0.264 -0.198 -0.410 -12.407 -14.517 -7.501  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.557  -0.267 -0.435 -11.075 -8.918  0.558   8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.110 -0.182 -0.068 -12.364 -14.040 -3.504  9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 -0.214 -0.121 0.109  -0.021  -8.204  -4.099  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 -0.382 -0.189 -0.031 -9.306  -14.120 3.326   11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 -0.166 -0.096 -0.041 -8.837  -21.840 -0.391  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.332  -2.309 -0.438 -5.414  1.147   -84.710 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.226  -1.718 3.164 1.138  3.767  31.751 -3.757 -0.217 2.952 6.852  -2.070 
31.987 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.317 -1.858 3.329 -0.593 3.129  34.896 -3.554 0.439  3.160 5.204  0.986  
35.036 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 0.062  -2.176 3.265 0.422  8.848  31.866 -5.190 -0.044 2.585 15.740 -0.751 
33.043 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 -0.164 -1.833 3.180 -0.938 6.446  25.970 -5.476 0.134  2.659 14.065 2.046  
26.761 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.362  -2.441 3.658 1.290  13.647 19.631 -9.907 -2.910 1.704 35.030 -3.310 
23.905 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.089 -1.905 3.531 -5.482 2.199  35.785 -3.396 0.914  3.534 3.548  8.847  
36.254 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.127  -2.076 3.190 1.996  10.980 38.860 -4.113 0.017  2.538 16.103 -2.928 
40.371 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.309  -2.009 3.419 -1.275 2.058  23.169 -5.692 -1.209 3.210 5.107  3.164  
23.294 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.929  -2.452 2.881 4.079  2.362  28.740 -5.328 -1.072 2.777 4.718  -8.149 
29.116 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.564 -2.083 3.311 -0.579 10.576 26.323 -6.442 1.032  2.327 22.119 1.211  
28.340 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.306  -1.644 3.269 0.136  6.092  36.616 -3.365 -0.464 2.968 9.614  -0.215 
37.102 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.642 -1.840 3.188 2.097  -4.161 81.644 -1.302 1.307  3.227 -3.180 -1.603 
81.754 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#