data_2ZH5
# 
_entry.id   2ZH5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZH5         
NDB   PR0322       
RCSB  RCSB027965   
WWPDB D_1000027965 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH1 . unspecified 
PDB 2ZH2 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH7 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHA . unspecified 
PDB 2ZHB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZH5 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZH5 
_cell.length_a           57.991 
_cell.length_b           57.991 
_cell.length_c           442.386 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZH5 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (34-MER)'     10905.486 1  ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme' 51469.137 1  '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'       96.063    2  ?                    ? ? ? 
4 water       nat water               18.015    94 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCACU GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCACU B ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  C   n 
1 34  U   n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 ? 
2 PDB 2ZH5      2ZH5   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCACU 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZH5 A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 2ZH5 B 1 ? 34  ? 2ZH5   1 ? 34  ? 1 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ZH5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-12-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZH5 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   24783 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.114 
_reflns.pdbx_netI_over_sigmaI        41.2 
_reflns.B_iso_Wilson_estimate        39.1 
_reflns.pdbx_redundancy              11.5 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.358 
_reflns_shell.meanI_over_sigI_obs    5.5 
_reflns_shell.pdbx_redundancy        7.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2388 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZH5 
_refine.ls_number_reflns_obs                     24673 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1915414.36 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.51 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.243 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.243 
_refine.ls_R_factor_R_free                       0.293 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1196 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.6 
_refine.aniso_B[1][1]                            -0.08 
_refine.aniso_B[2][2]                            -0.08 
_refine.aniso_B[3][3]                            0.17 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.329811 
_refine.solvent_model_param_bsol                 28.1832 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZH5 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.46 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3630 
_refine_hist.pdbx_number_atoms_nucleic_acid   723 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             94 
_refine_hist.number_atoms_total               4457 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        39.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.41  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.13  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.58  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.48  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             3809 
_refine_ls_shell.R_factor_R_work                  0.336 
_refine_ls_shell.percent_reflns_obs               99.6 
_refine_ls_shell.R_factor_R_free                  0.386 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             200 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 SO4.param         ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZH5 
_struct.title                     'Complex structure of AFCCA with tRNAminiDCU' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZH5 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 2   ? ILE B 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 17  ? LEU B 38  ? ASP A 17  LEU A 38  1 ? 22 
HELX_P HELX_P3  3  GLY B 46  ? ARG B 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 71  ? LEU B 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 125 ? GLY B 139 ? SER A 125 GLY A 139 1 ? 15 
HELX_P HELX_P6  6  LYS B 144 ? ASN B 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER B 171 ? GLY B 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER B 184 ? ARG B 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER B 231 ? ALA B 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER B 250 ? LYS B 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU B 263 ? GLY B 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL B 289 ? GLU B 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP B 351 ? ARG B 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR B 384 ? HIS B 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP B 397 ? LEU B 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY B 401 ? TYR B 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLY B 417 ? LYS B 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL B 425 ? GLY B 434 ? VAL A 425 GLY A 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 31 N3 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 31 O2 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 31 N4 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 30 N3 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 30 O2 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 30 N4 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? A C 3  N3 ? ? ? 1_555 A G 29 N1 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8  hydrog ? ? A C 3  N4 ? ? ? 1_555 A G 29 O6 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? A C 3  O2 ? ? ? 1_555 A G 29 N2 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? A C 4  N3 ? ? ? 1_555 A G 28 N1 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11 hydrog ? ? A C 4  N4 ? ? ? 1_555 A G 28 O6 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? A C 4  O2 ? ? ? 1_555 A G 28 N2 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 27 N1 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 27 O6 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog15 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 27 N2 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog16 hydrog ? ? A G 6  N1 ? ? ? 1_555 A U 26 O2 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog17 hydrog ? ? A G 6  O6 ? ? ? 1_555 A U 26 N3 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog18 hydrog ? ? A G 7  N1 ? ? ? 1_555 A C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? A G 7  N2 ? ? ? 1_555 A C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? A G 7  O6 ? ? ? 1_555 A C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 24 O2 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 24 N4 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog24 hydrog ? ? A G 9  N1 ? ? ? 1_555 A C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog25 hydrog ? ? A G 9  N2 ? ? ? 1_555 A C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog26 hydrog ? ? A G 9  O6 ? ? ? 1_555 A C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog27 hydrog ? ? A C 10 N3 ? ? ? 1_555 A G 22 N1 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? A C 10 N4 ? ? ? 1_555 A G 22 O6 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? A C 10 O2 ? ? ? 1_555 A G 22 N2 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? A G 11 N1 ? ? ? 1_555 A C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? A G 11 N2 ? ? ? 1_555 A C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? A G 11 O6 ? ? ? 1_555 A C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? A G 12 N1 ? ? ? 1_555 A C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? A G 12 N2 ? ? ? 1_555 A C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36 hydrog ? ? A U 13 N3 ? ? ? 1_555 A A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog37 hydrog ? ? A U 13 O2 ? ? ? 1_555 A A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 42  ? VAL B 45  ? TYR A 42  VAL A 45  
A 2 GLU B 59  ? PRO B 67  ? GLU A 59  PRO A 67  
A 3 VAL B 107 ? LYS B 116 ? VAL A 107 LYS A 116 
A 4 TYR B 99  ? VAL B 104 ? TYR A 99  VAL A 104 
A 5 SER B 89  ? ARG B 93  ? SER A 89  ARG A 93  
B 1 GLU B 207 ? LYS B 210 ? GLU A 207 LYS A 210 
B 2 THR B 199 ? ASP B 202 ? THR A 199 ASP A 202 
B 3 PHE B 215 ? ASP B 218 ? PHE A 215 ASP A 218 
B 4 ASP B 221 ? ASN B 225 ? ASP A 221 ASN A 225 
C 1 PRO B 315 ? ALA B 322 ? PRO A 315 ALA A 322 
C 2 PHE B 326 ? CYS B 333 ? PHE A 326 CYS A 333 
C 3 ALA B 277 ? ARG B 284 ? ALA A 277 ARG A 284 
C 4 PHE B 412 ? ILE B 415 ? PHE A 412 ILE A 415 
D 1 VAL B 341 ? GLN B 348 ? VAL A 341 GLN A 348 
D 2 ARG B 373 ? MET B 379 ? ARG A 373 MET A 379 
D 3 PHE B 368 ? GLU B 370 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 43  ? N VAL A 43  O PHE B 63  ? O PHE A 63  
A 2 3 N LEU B 64  ? N LEU A 64  O VAL B 112 ? O VAL A 112 
A 3 4 O VAL B 109 ? O VAL A 109 N GLY B 102 ? N GLY A 102 
A 4 5 O TYR B 99  ? O TYR A 99  N ARG B 93  ? N ARG A 93  
B 1 2 O GLU B 207 ? O GLU A 207 N ASP B 202 ? N ASP A 202 
B 2 3 N ILE B 201 ? N ILE A 201 O PHE B 215 ? O PHE A 215 
B 3 4 N ASP B 218 ? N ASP A 218 O ARG B 224 ? O ARG A 224 
C 1 2 N LEU B 316 ? N LEU A 316 O GLU B 332 ? O GLU A 332 
C 2 3 O CYS B 333 ? O CYS A 333 N ALA B 277 ? N ALA A 277 
C 3 4 N LYS B 282 ? N LYS A 282 O GLU B 413 ? O GLU A 413 
D 1 2 N ARG B 344 ? N ARG A 344 O ALA B 376 ? O ALA A 376 
D 2 3 O TRP B 375 ? O TRP A 375 N PHE B 368 ? N PHE A 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 4770' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 4771' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER B 47  ? SER A 47  . ? 1_555 ? 
2 AC1 6 TRP B 53  ? TRP A 53  . ? 1_555 ? 
3 AC1 6 LEU B 54  ? LEU A 54  . ? 1_555 ? 
4 AC1 6 SER B 57  ? SER A 57  . ? 1_555 ? 
5 AC1 6 LYS B 152 ? LYS A 152 . ? 1_555 ? 
6 AC1 6 TYR B 161 ? TYR A 161 . ? 1_555 ? 
7 AC2 3 ARG B 299 ? ARG A 299 . ? 1_555 ? 
8 AC2 3 ARG B 302 ? ARG A 302 . ? 1_555 ? 
9 AC2 3 LYS B 303 ? LYS A 303 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZH5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZH5 
_atom_sites.fract_transf_matrix[1][1]   0.017244 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017244 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002260 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . G   A 1 1   ? 36.015 -14.553 -36.198 1.00 63.45  ? 1    G   B P     1 
ATOM   2    O OP1   . G   A 1 1   ? 34.797 -14.657 -37.114 1.00 63.50  ? 1    G   B OP1   1 
ATOM   3    O OP2   . G   A 1 1   ? 37.055 -13.566 -36.723 1.00 60.65  ? 1    G   B OP2   1 
ATOM   4    O "O5'" . G   A 1 1   ? 35.484 -13.887 -34.800 1.00 59.59  ? 1    G   B "O5'" 1 
ATOM   5    C "C5'" . G   A 1 1   ? 36.276 -12.894 -34.122 1.00 53.22  ? 1    G   B "C5'" 1 
ATOM   6    C "C4'" . G   A 1 1   ? 35.433 -12.085 -33.154 1.00 50.71  ? 1    G   B "C4'" 1 
ATOM   7    O "O4'" . G   A 1 1   ? 34.239 -11.583 -33.810 1.00 48.63  ? 1    G   B "O4'" 1 
ATOM   8    C "C3'" . G   A 1 1   ? 34.927 -12.801 -31.908 1.00 48.48  ? 1    G   B "C3'" 1 
ATOM   9    O "O3'" . G   A 1 1   ? 35.931 -12.784 -30.901 1.00 46.62  ? 1    G   B "O3'" 1 
ATOM   10   C "C2'" . G   A 1 1   ? 33.741 -11.931 -31.511 1.00 47.74  ? 1    G   B "C2'" 1 
ATOM   11   O "O2'" . G   A 1 1   ? 34.126 -10.757 -30.833 1.00 49.70  ? 1    G   B "O2'" 1 
ATOM   12   C "C1'" . G   A 1 1   ? 33.169 -11.550 -32.881 1.00 46.90  ? 1    G   B "C1'" 1 
ATOM   13   N N9    . G   A 1 1   ? 32.146 -12.492 -33.324 1.00 44.86  ? 1    G   B N9    1 
ATOM   14   C C8    . G   A 1 1   ? 32.259 -13.453 -34.303 1.00 42.46  ? 1    G   B C8    1 
ATOM   15   N N7    . G   A 1 1   ? 31.176 -14.168 -34.447 1.00 41.39  ? 1    G   B N7    1 
ATOM   16   C C5    . G   A 1 1   ? 30.288 -13.639 -33.514 1.00 42.63  ? 1    G   B C5    1 
ATOM   17   C C6    . G   A 1 1   ? 28.939 -14.001 -33.198 1.00 41.51  ? 1    G   B C6    1 
ATOM   18   O O6    . G   A 1 1   ? 28.245 -14.890 -33.693 1.00 39.16  ? 1    G   B O6    1 
ATOM   19   N N1    . G   A 1 1   ? 28.416 -13.197 -32.187 1.00 40.67  ? 1    G   B N1    1 
ATOM   20   C C2    . G   A 1 1   ? 29.092 -12.177 -31.560 1.00 40.57  ? 1    G   B C2    1 
ATOM   21   N N2    . G   A 1 1   ? 28.415 -11.503 -30.628 1.00 39.22  ? 1    G   B N2    1 
ATOM   22   N N3    . G   A 1 1   ? 30.342 -11.838 -31.834 1.00 42.88  ? 1    G   B N3    1 
ATOM   23   C C4    . G   A 1 1   ? 30.873 -12.603 -32.816 1.00 43.97  ? 1    G   B C4    1 
ATOM   24   P P     . G   A 1 2   ? 36.040 -13.997 -29.853 1.00 41.63  ? 2    G   B P     1 
ATOM   25   O OP1   . G   A 1 2   ? 37.311 -13.854 -29.097 1.00 41.86  ? 2    G   B OP1   1 
ATOM   26   O OP2   . G   A 1 2   ? 35.762 -15.266 -30.563 1.00 41.71  ? 2    G   B OP2   1 
ATOM   27   O "O5'" . G   A 1 2   ? 34.837 -13.715 -28.848 1.00 44.88  ? 2    G   B "O5'" 1 
ATOM   28   C "C5'" . G   A 1 2   ? 34.848 -12.579 -27.986 1.00 44.04  ? 2    G   B "C5'" 1 
ATOM   29   C "C4'" . G   A 1 2   ? 33.550 -12.496 -27.223 1.00 45.89  ? 2    G   B "C4'" 1 
ATOM   30   O "O4'" . G   A 1 2   ? 32.462 -12.238 -28.155 1.00 47.12  ? 2    G   B "O4'" 1 
ATOM   31   C "C3'" . G   A 1 2   ? 33.114 -13.767 -26.506 1.00 46.32  ? 2    G   B "C3'" 1 
ATOM   32   O "O3'" . G   A 1 2   ? 33.740 -13.931 -25.238 1.00 43.75  ? 2    G   B "O3'" 1 
ATOM   33   C "C2'" . G   A 1 2   ? 31.617 -13.543 -26.359 1.00 47.19  ? 2    G   B "C2'" 1 
ATOM   34   O "O2'" . G   A 1 2   ? 31.296 -12.660 -25.300 1.00 47.54  ? 2    G   B "O2'" 1 
ATOM   35   C "C1'" . G   A 1 2   ? 31.285 -12.886 -27.700 1.00 48.78  ? 2    G   B "C1'" 1 
ATOM   36   N N9    . G   A 1 2   ? 30.882 -13.864 -28.704 1.00 51.46  ? 2    G   B N9    1 
ATOM   37   C C8    . G   A 1 2   ? 31.669 -14.443 -29.670 1.00 52.20  ? 2    G   B C8    1 
ATOM   38   N N7    . G   A 1 2   ? 31.020 -15.293 -30.419 1.00 52.37  ? 2    G   B N7    1 
ATOM   39   C C5    . G   A 1 2   ? 29.724 -15.272 -29.918 1.00 52.34  ? 2    G   B C5    1 
ATOM   40   C C6    . G   A 1 2   ? 28.572 -15.989 -30.324 1.00 51.90  ? 2    G   B C6    1 
ATOM   41   O O6    . G   A 1 2   ? 28.458 -16.807 -31.239 1.00 51.20  ? 2    G   B O6    1 
ATOM   42   N N1    . G   A 1 2   ? 27.470 -15.670 -29.537 1.00 52.21  ? 2    G   B N1    1 
ATOM   43   C C2    . G   A 1 2   ? 27.477 -14.775 -28.492 1.00 53.07  ? 2    G   B C2    1 
ATOM   44   N N2    . G   A 1 2   ? 26.313 -14.600 -27.844 1.00 53.12  ? 2    G   B N2    1 
ATOM   45   N N3    . G   A 1 2   ? 28.544 -14.101 -28.108 1.00 52.43  ? 2    G   B N3    1 
ATOM   46   C C4    . G   A 1 2   ? 29.624 -14.395 -28.859 1.00 52.21  ? 2    G   B C4    1 
ATOM   47   P P     . C   A 1 3   ? 33.816 -15.392 -24.585 1.00 40.50  ? 3    C   B P     1 
ATOM   48   O OP1   . C   A 1 3   ? 34.607 -15.329 -23.337 1.00 42.45  ? 3    C   B OP1   1 
ATOM   49   O OP2   . C   A 1 3   ? 34.193 -16.357 -25.646 1.00 42.44  ? 3    C   B OP2   1 
ATOM   50   O "O5'" . C   A 1 3   ? 32.302 -15.715 -24.212 1.00 44.44  ? 3    C   B "O5'" 1 
ATOM   51   C "C5'" . C   A 1 3   ? 31.652 -15.032 -23.143 1.00 44.62  ? 3    C   B "C5'" 1 
ATOM   52   C "C4'" . C   A 1 3   ? 30.216 -15.469 -23.039 1.00 44.45  ? 3    C   B "C4'" 1 
ATOM   53   O "O4'" . C   A 1 3   ? 29.543 -15.170 -24.293 1.00 45.82  ? 3    C   B "O4'" 1 
ATOM   54   C "C3'" . C   A 1 3   ? 29.994 -16.963 -22.877 1.00 45.00  ? 3    C   B "C3'" 1 
ATOM   55   O "O3'" . C   A 1 3   ? 30.135 -17.402 -21.534 1.00 44.53  ? 3    C   B "O3'" 1 
ATOM   56   C "C2'" . C   A 1 3   ? 28.562 -17.117 -23.356 1.00 44.91  ? 3    C   B "C2'" 1 
ATOM   57   O "O2'" . C   A 1 3   ? 27.637 -16.707 -22.372 1.00 44.75  ? 3    C   B "O2'" 1 
ATOM   58   C "C1'" . C   A 1 3   ? 28.546 -16.150 -24.540 1.00 45.55  ? 3    C   B "C1'" 1 
ATOM   59   N N1    . C   A 1 3   ? 28.874 -16.852 -25.787 1.00 46.49  ? 3    C   B N1    1 
ATOM   60   C C2    . C   A 1 3   ? 27.895 -17.664 -26.364 1.00 45.67  ? 3    C   B C2    1 
ATOM   61   O O2    . C   A 1 3   ? 26.782 -17.728 -25.825 1.00 47.59  ? 3    C   B O2    1 
ATOM   62   N N3    . C   A 1 3   ? 28.185 -18.358 -27.485 1.00 45.50  ? 3    C   B N3    1 
ATOM   63   C C4    . C   A 1 3   ? 29.400 -18.266 -28.029 1.00 46.04  ? 3    C   B C4    1 
ATOM   64   N N4    . C   A 1 3   ? 29.650 -18.998 -29.117 1.00 44.41  ? 3    C   B N4    1 
ATOM   65   C C5    . C   A 1 3   ? 30.414 -17.427 -27.475 1.00 44.35  ? 3    C   B C5    1 
ATOM   66   C C6    . C   A 1 3   ? 30.109 -16.741 -26.365 1.00 45.84  ? 3    C   B C6    1 
ATOM   67   P P     . C   A 1 4   ? 30.365 -18.964 -21.247 1.00 56.29  ? 4    C   B P     1 
ATOM   68   O OP1   . C   A 1 4   ? 30.562 -19.168 -19.790 1.00 54.40  ? 4    C   B OP1   1 
ATOM   69   O OP2   . C   A 1 4   ? 31.394 -19.444 -22.207 1.00 56.57  ? 4    C   B OP2   1 
ATOM   70   O "O5'" . C   A 1 4   ? 28.990 -19.646 -21.675 1.00 56.87  ? 4    C   B "O5'" 1 
ATOM   71   C "C5'" . C   A 1 4   ? 27.872 -19.635 -20.798 1.00 56.83  ? 4    C   B "C5'" 1 
ATOM   72   C "C4'" . C   A 1 4   ? 26.846 -20.632 -21.257 1.00 56.55  ? 4    C   B "C4'" 1 
ATOM   73   O "O4'" . C   A 1 4   ? 26.456 -20.283 -22.606 1.00 57.63  ? 4    C   B "O4'" 1 
ATOM   74   C "C3'" . C   A 1 4   ? 27.316 -22.072 -21.390 1.00 56.82  ? 4    C   B "C3'" 1 
ATOM   75   O "O3'" . C   A 1 4   ? 27.245 -22.756 -20.149 1.00 56.91  ? 4    C   B "O3'" 1 
ATOM   76   C "C2'" . C   A 1 4   ? 26.294 -22.637 -22.361 1.00 57.65  ? 4    C   B "C2'" 1 
ATOM   77   O "O2'" . C   A 1 4   ? 25.053 -22.889 -21.730 1.00 57.59  ? 4    C   B "O2'" 1 
ATOM   78   C "C1'" . C   A 1 4   ? 26.129 -21.461 -23.323 1.00 58.23  ? 4    C   B "C1'" 1 
ATOM   79   N N1    . C   A 1 4   ? 27.009 -21.556 -24.497 1.00 59.14  ? 4    C   B N1    1 
ATOM   80   C C2    . C   A 1 4   ? 26.688 -22.479 -25.490 1.00 59.07  ? 4    C   B C2    1 
ATOM   81   O O2    . C   A 1 4   ? 25.690 -23.195 -25.336 1.00 59.43  ? 4    C   B O2    1 
ATOM   82   N N3    . C   A 1 4   ? 27.474 -22.572 -26.587 1.00 58.86  ? 4    C   B N3    1 
ATOM   83   C C4    . C   A 1 4   ? 28.549 -21.788 -26.707 1.00 58.37  ? 4    C   B C4    1 
ATOM   84   N N4    . C   A 1 4   ? 29.287 -21.908 -27.816 1.00 58.38  ? 4    C   B N4    1 
ATOM   85   C C5    . C   A 1 4   ? 28.908 -20.846 -25.701 1.00 57.81  ? 4    C   B C5    1 
ATOM   86   C C6    . C   A 1 4   ? 28.116 -20.761 -24.621 1.00 58.97  ? 4    C   B C6    1 
ATOM   87   P P     . C   A 1 5   ? 28.158 -24.058 -19.905 1.00 78.14  ? 5    C   B P     1 
ATOM   88   O OP1   . C   A 1 5   ? 27.855 -24.556 -18.540 1.00 77.77  ? 5    C   B OP1   1 
ATOM   89   O OP2   . C   A 1 5   ? 29.562 -23.730 -20.276 1.00 76.49  ? 5    C   B OP2   1 
ATOM   90   O "O5'" . C   A 1 5   ? 27.590 -25.132 -20.937 1.00 78.20  ? 5    C   B "O5'" 1 
ATOM   91   C "C5'" . C   A 1 5   ? 26.367 -25.812 -20.659 1.00 78.49  ? 5    C   B "C5'" 1 
ATOM   92   C "C4'" . C   A 1 5   ? 26.046 -26.819 -21.742 1.00 78.21  ? 5    C   B "C4'" 1 
ATOM   93   O "O4'" . C   A 1 5   ? 25.848 -26.144 -23.019 1.00 77.82  ? 5    C   B "O4'" 1 
ATOM   94   C "C3'" . C   A 1 5   ? 27.120 -27.837 -22.069 1.00 78.08  ? 5    C   B "C3'" 1 
ATOM   95   O "O3'" . C   A 1 5   ? 27.181 -28.895 -21.119 1.00 78.83  ? 5    C   B "O3'" 1 
ATOM   96   C "C2'" . C   A 1 5   ? 26.639 -28.338 -23.424 1.00 78.12  ? 5    C   B "C2'" 1 
ATOM   97   O "O2'" . C   A 1 5   ? 25.543 -29.224 -23.303 1.00 77.27  ? 5    C   B "O2'" 1 
ATOM   98   C "C1'" . C   A 1 5   ? 26.189 -27.030 -24.076 1.00 77.42  ? 5    C   B "C1'" 1 
ATOM   99   N N1    . C   A 1 5   ? 27.294 -26.447 -24.845 1.00 77.09  ? 5    C   B N1    1 
ATOM   100  C C2    . C   A 1 5   ? 27.485 -26.869 -26.165 1.00 76.80  ? 5    C   B C2    1 
ATOM   101  O O2    . C   A 1 5   ? 26.685 -27.675 -26.657 1.00 75.94  ? 5    C   B O2    1 
ATOM   102  N N3    . C   A 1 5   ? 28.529 -26.384 -26.873 1.00 76.88  ? 5    C   B N3    1 
ATOM   103  C C4    . C   A 1 5   ? 29.358 -25.500 -26.314 1.00 77.22  ? 5    C   B C4    1 
ATOM   104  N N4    . C   A 1 5   ? 30.378 -25.052 -27.049 1.00 77.40  ? 5    C   B N4    1 
ATOM   105  C C5    . C   A 1 5   ? 29.177 -25.037 -24.975 1.00 77.11  ? 5    C   B C5    1 
ATOM   106  C C6    . C   A 1 5   ? 28.140 -25.529 -24.284 1.00 77.34  ? 5    C   B C6    1 
ATOM   107  P P     . G   A 1 6   ? 28.558 -29.711 -20.932 1.00 85.71  ? 6    G   B P     1 
ATOM   108  O OP1   . G   A 1 6   ? 28.350 -30.727 -19.872 1.00 84.92  ? 6    G   B OP1   1 
ATOM   109  O OP2   . G   A 1 6   ? 29.654 -28.718 -20.793 1.00 85.39  ? 6    G   B OP2   1 
ATOM   110  O "O5'" . G   A 1 6   ? 28.763 -30.447 -22.332 1.00 83.79  ? 6    G   B "O5'" 1 
ATOM   111  C "C5'" . G   A 1 6   ? 27.701 -31.191 -22.913 1.00 84.09  ? 6    G   B "C5'" 1 
ATOM   112  C "C4'" . G   A 1 6   ? 28.123 -31.792 -24.232 1.00 84.41  ? 6    G   B "C4'" 1 
ATOM   113  O "O4'" . G   A 1 6   ? 28.288 -30.776 -25.252 1.00 84.16  ? 6    G   B "O4'" 1 
ATOM   114  C "C3'" . G   A 1 6   ? 29.456 -32.510 -24.260 1.00 84.43  ? 6    G   B "C3'" 1 
ATOM   115  O "O3'" . G   A 1 6   ? 29.341 -33.791 -23.652 1.00 84.84  ? 6    G   B "O3'" 1 
ATOM   116  C "C2'" . G   A 1 6   ? 29.726 -32.606 -25.761 1.00 84.31  ? 6    G   B "C2'" 1 
ATOM   117  O "O2'" . G   A 1 6   ? 29.080 -33.706 -26.370 1.00 84.00  ? 6    G   B "O2'" 1 
ATOM   118  C "C1'" . G   A 1 6   ? 29.116 -31.297 -26.278 1.00 83.88  ? 6    G   B "C1'" 1 
ATOM   119  N N9    . G   A 1 6   ? 30.114 -30.303 -26.651 1.00 84.03  ? 6    G   B N9    1 
ATOM   120  C C8    . G   A 1 6   ? 30.543 -29.223 -25.919 1.00 84.33  ? 6    G   B C8    1 
ATOM   121  N N7    . G   A 1 6   ? 31.460 -28.522 -26.531 1.00 84.02  ? 6    G   B N7    1 
ATOM   122  C C5    . G   A 1 6   ? 31.646 -29.178 -27.741 1.00 83.51  ? 6    G   B C5    1 
ATOM   123  C C6    . G   A 1 6   ? 32.518 -28.885 -28.829 1.00 83.14  ? 6    G   B C6    1 
ATOM   124  O O6    . G   A 1 6   ? 33.329 -27.959 -28.946 1.00 82.79  ? 6    G   B O6    1 
ATOM   125  N N1    . G   A 1 6   ? 32.382 -29.811 -29.855 1.00 82.78  ? 6    G   B N1    1 
ATOM   126  C C2    . G   A 1 6   ? 31.524 -30.884 -29.843 1.00 83.37  ? 6    G   B C2    1 
ATOM   127  N N2    . G   A 1 6   ? 31.543 -31.672 -30.930 1.00 83.53  ? 6    G   B N2    1 
ATOM   128  N N3    . G   A 1 6   ? 30.708 -31.167 -28.840 1.00 83.73  ? 6    G   B N3    1 
ATOM   129  C C4    . G   A 1 6   ? 30.821 -30.278 -27.830 1.00 83.77  ? 6    G   B C4    1 
ATOM   130  P P     . G   A 1 7   ? 30.668 -34.621 -23.291 1.00 98.40  ? 7    G   B P     1 
ATOM   131  O OP1   . G   A 1 7   ? 30.327 -35.595 -22.221 1.00 97.90  ? 7    G   B OP1   1 
ATOM   132  O OP2   . G   A 1 7   ? 31.780 -33.659 -23.082 1.00 97.52  ? 7    G   B OP2   1 
ATOM   133  O "O5'" . G   A 1 7   ? 30.956 -35.427 -24.631 1.00 96.70  ? 7    G   B "O5'" 1 
ATOM   134  C "C5'" . G   A 1 7   ? 32.275 -35.583 -25.125 1.00 94.79  ? 7    G   B "C5'" 1 
ATOM   135  C "C4'" . G   A 1 7   ? 32.247 -35.682 -26.628 1.00 94.11  ? 7    G   B "C4'" 1 
ATOM   136  O "O4'" . G   A 1 7   ? 31.869 -34.396 -27.195 1.00 93.01  ? 7    G   B "O4'" 1 
ATOM   137  C "C3'" . G   A 1 7   ? 33.591 -35.981 -27.261 1.00 94.22  ? 7    G   B "C3'" 1 
ATOM   138  O "O3'" . G   A 1 7   ? 33.854 -37.379 -27.218 1.00 94.55  ? 7    G   B "O3'" 1 
ATOM   139  C "C2'" . G   A 1 7   ? 33.393 -35.451 -28.675 1.00 93.89  ? 7    G   B "C2'" 1 
ATOM   140  O "O2'" . G   A 1 7   ? 32.631 -36.323 -29.483 1.00 93.60  ? 7    G   B "O2'" 1 
ATOM   141  C "C1'" . G   A 1 7   ? 32.591 -34.178 -28.400 1.00 93.02  ? 7    G   B "C1'" 1 
ATOM   142  N N9    . G   A 1 7   ? 33.443 -33.006 -28.216 1.00 91.86  ? 7    G   B N9    1 
ATOM   143  C C8    . G   A 1 7   ? 33.419 -32.135 -27.156 1.00 91.50  ? 7    G   B C8    1 
ATOM   144  N N7    . G   A 1 7   ? 34.292 -31.171 -27.264 1.00 90.76  ? 7    G   B N7    1 
ATOM   145  C C5    . G   A 1 7   ? 34.934 -31.418 -28.470 1.00 90.18  ? 7    G   B C5    1 
ATOM   146  C C6    . G   A 1 7   ? 35.973 -30.700 -29.122 1.00 89.84  ? 7    G   B C6    1 
ATOM   147  O O6    . G   A 1 7   ? 36.545 -29.667 -28.755 1.00 89.41  ? 7    G   B O6    1 
ATOM   148  N N1    . G   A 1 7   ? 36.330 -31.296 -30.325 1.00 89.60  ? 7    G   B N1    1 
ATOM   149  C C2    . G   A 1 7   ? 35.761 -32.431 -30.843 1.00 90.02  ? 7    G   B C2    1 
ATOM   150  N N2    . G   A 1 7   ? 36.245 -32.841 -32.026 1.00 89.93  ? 7    G   B N2    1 
ATOM   151  N N3    . G   A 1 7   ? 34.789 -33.112 -30.248 1.00 90.07  ? 7    G   B N3    1 
ATOM   152  C C4    . G   A 1 7   ? 34.427 -32.549 -29.072 1.00 90.66  ? 7    G   B C4    1 
ATOM   153  P P     . G   A 1 8   ? 35.239 -37.897 -26.594 1.00 87.91  ? 8    G   B P     1 
ATOM   154  O OP1   . G   A 1 8   ? 35.169 -39.370 -26.454 1.00 87.69  ? 8    G   B OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? 35.522 -37.061 -25.397 1.00 87.84  ? 8    G   B OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? 36.300 -37.538 -27.726 1.00 85.98  ? 8    G   B "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? 36.187 -38.119 -29.020 1.00 84.36  ? 8    G   B "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? 37.348 -37.706 -29.891 1.00 82.89  ? 8    G   B "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? 37.150 -36.363 -30.410 1.00 82.07  ? 8    G   B "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? 38.693 -37.618 -29.198 1.00 82.23  ? 8    G   B "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? 39.296 -38.882 -28.996 1.00 82.19  ? 8    G   B "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? 39.477 -36.744 -30.165 1.00 81.50  ? 8    G   B "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? 39.930 -37.436 -31.310 1.00 81.07  ? 8    G   B "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? 38.409 -35.722 -30.554 1.00 80.53  ? 8    G   B "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? 38.449 -34.590 -29.637 1.00 78.63  ? 8    G   B N9    1 
ATOM   166  C C8    . G   A 1 8   ? 37.724 -34.430 -28.480 1.00 77.86  ? 8    G   B C8    1 
ATOM   167  N N7    . G   A 1 8   ? 38.002 -33.318 -27.855 1.00 77.12  ? 8    G   B N7    1 
ATOM   168  C C5    . G   A 1 8   ? 38.962 -32.707 -28.648 1.00 76.10  ? 8    G   B C5    1 
ATOM   169  C C6    . G   A 1 8   ? 39.647 -31.477 -28.479 1.00 75.67  ? 8    G   B C6    1 
ATOM   170  O O6    . G   A 1 8   ? 39.540 -30.654 -27.561 1.00 75.09  ? 8    G   B O6    1 
ATOM   171  N N1    . G   A 1 8   ? 40.536 -31.240 -29.521 1.00 75.17  ? 8    G   B N1    1 
ATOM   172  C C2    . G   A 1 8   ? 40.743 -32.079 -30.587 1.00 75.64  ? 8    G   B C2    1 
ATOM   173  N N2    . G   A 1 8   ? 41.648 -31.677 -31.488 1.00 75.27  ? 8    G   B N2    1 
ATOM   174  N N3    . G   A 1 8   ? 40.112 -33.227 -30.756 1.00 75.52  ? 8    G   B N3    1 
ATOM   175  C C4    . G   A 1 8   ? 39.243 -33.476 -29.756 1.00 76.66  ? 8    G   B C4    1 
ATOM   176  P P     . G   A 1 9   ? 40.593 -38.988 -28.060 1.00 86.48  ? 9    G   B P     1 
ATOM   177  O OP1   . G   A 1 9   ? 40.765 -40.410 -27.669 1.00 86.83  ? 9    G   B OP1   1 
ATOM   178  O OP2   . G   A 1 9   ? 40.490 -37.940 -27.007 1.00 85.15  ? 9    G   B OP2   1 
ATOM   179  O "O5'" . G   A 1 9   ? 41.771 -38.590 -29.051 1.00 84.29  ? 9    G   B "O5'" 1 
ATOM   180  C "C5'" . G   A 1 9   ? 42.954 -37.976 -28.573 1.00 82.20  ? 9    G   B "C5'" 1 
ATOM   181  C "C4'" . G   A 1 9   ? 43.453 -36.976 -29.583 1.00 80.77  ? 9    G   B "C4'" 1 
ATOM   182  O "O4'" . G   A 1 9   ? 42.465 -35.923 -29.740 1.00 79.72  ? 9    G   B "O4'" 1 
ATOM   183  C "C3'" . G   A 1 9   ? 44.718 -36.249 -29.166 1.00 80.30  ? 9    G   B "C3'" 1 
ATOM   184  O "O3'" . G   A 1 9   ? 45.869 -37.014 -29.491 1.00 80.41  ? 9    G   B "O3'" 1 
ATOM   185  C "C2'" . G   A 1 9   ? 44.619 -34.951 -29.953 1.00 78.99  ? 9    G   B "C2'" 1 
ATOM   186  O "O2'" . G   A 1 9   ? 45.026 -35.082 -31.300 1.00 77.61  ? 9    G   B "O2'" 1 
ATOM   187  C "C1'" . G   A 1 9   ? 43.119 -34.667 -29.853 1.00 78.02  ? 9    G   B "C1'" 1 
ATOM   188  N N9    . G   A 1 9   ? 42.790 -33.879 -28.669 1.00 75.91  ? 9    G   B N9    1 
ATOM   189  C C8    . G   A 1 9   ? 41.923 -34.222 -27.657 1.00 75.32  ? 9    G   B C8    1 
ATOM   190  N N7    . G   A 1 9   ? 41.848 -33.316 -26.721 1.00 74.66  ? 9    G   B N7    1 
ATOM   191  C C5    . G   A 1 9   ? 42.715 -32.314 -27.140 1.00 74.22  ? 9    G   B C5    1 
ATOM   192  C C6    . G   A 1 9   ? 43.056 -31.070 -26.534 1.00 73.34  ? 9    G   B C6    1 
ATOM   193  O O6    . G   A 1 9   ? 42.648 -30.590 -25.474 1.00 71.91  ? 9    G   B O6    1 
ATOM   194  N N1    . G   A 1 9   ? 43.975 -30.363 -27.300 1.00 73.35  ? 9    G   B N1    1 
ATOM   195  C C2    . G   A 1 9   ? 44.499 -30.785 -28.494 1.00 74.67  ? 9    G   B C2    1 
ATOM   196  N N2    . G   A 1 9   ? 45.378 -29.954 -29.079 1.00 75.26  ? 9    G   B N2    1 
ATOM   197  N N3    . G   A 1 9   ? 44.189 -31.936 -29.073 1.00 75.04  ? 9    G   B N3    1 
ATOM   198  C C4    . G   A 1 9   ? 43.300 -32.645 -28.343 1.00 74.93  ? 9    G   B C4    1 
ATOM   199  P P     . C   A 1 10  ? 46.804 -37.553 -28.306 1.00 79.09  ? 10   C   B P     1 
ATOM   200  O OP1   . C   A 1 10  ? 48.190 -37.719 -28.832 1.00 78.88  ? 10   C   B OP1   1 
ATOM   201  O OP2   . C   A 1 10  ? 46.104 -38.704 -27.678 1.00 78.96  ? 10   C   B OP2   1 
ATOM   202  O "O5'" . C   A 1 10  ? 46.772 -36.356 -27.256 1.00 76.92  ? 10   C   B "O5'" 1 
ATOM   203  C "C5'" . C   A 1 10  ? 47.956 -35.884 -26.636 1.00 73.16  ? 10   C   B "C5'" 1 
ATOM   204  C "C4'" . C   A 1 10  ? 48.381 -34.573 -27.251 1.00 70.73  ? 10   C   B "C4'" 1 
ATOM   205  O "O4'" . C   A 1 10  ? 47.221 -33.744 -27.539 1.00 69.75  ? 10   C   B "O4'" 1 
ATOM   206  C "C3'" . C   A 1 10  ? 49.230 -33.731 -26.322 1.00 70.40  ? 10   C   B "C3'" 1 
ATOM   207  O "O3'" . C   A 1 10  ? 50.587 -34.138 -26.349 1.00 70.86  ? 10   C   B "O3'" 1 
ATOM   208  C "C2'" . C   A 1 10  ? 48.970 -32.319 -26.828 1.00 69.22  ? 10   C   B "C2'" 1 
ATOM   209  O "O2'" . C   A 1 10  ? 49.697 -31.995 -27.994 1.00 67.64  ? 10   C   B "O2'" 1 
ATOM   210  C "C1'" . C   A 1 10  ? 47.477 -32.402 -27.149 1.00 68.25  ? 10   C   B "C1'" 1 
ATOM   211  N N1    . C   A 1 10  ? 46.609 -32.098 -25.994 1.00 66.05  ? 10   C   B N1    1 
ATOM   212  C C2    . C   A 1 10  ? 46.577 -30.792 -25.483 1.00 64.49  ? 10   C   B C2    1 
ATOM   213  O O2    . C   A 1 10  ? 47.294 -29.926 -25.998 1.00 64.49  ? 10   C   B O2    1 
ATOM   214  N N3    . C   A 1 10  ? 45.766 -30.511 -24.436 1.00 64.27  ? 10   C   B N3    1 
ATOM   215  C C4    . C   A 1 10  ? 45.011 -31.474 -23.899 1.00 65.27  ? 10   C   B C4    1 
ATOM   216  N N4    . C   A 1 10  ? 44.211 -31.150 -22.878 1.00 64.03  ? 10   C   B N4    1 
ATOM   217  C C5    . C   A 1 10  ? 45.036 -32.814 -24.391 1.00 65.17  ? 10   C   B C5    1 
ATOM   218  C C6    . C   A 1 10  ? 45.840 -33.077 -25.430 1.00 65.53  ? 10   C   B C6    1 
ATOM   219  P P     . G   A 1 11  ? 51.388 -34.277 -24.964 1.00 66.63  ? 11   G   B P     1 
ATOM   220  O OP1   . G   A 1 11  ? 52.654 -35.016 -25.234 1.00 65.97  ? 11   G   B OP1   1 
ATOM   221  O OP2   . G   A 1 11  ? 50.425 -34.814 -23.963 1.00 64.73  ? 11   G   B OP2   1 
ATOM   222  O "O5'" . G   A 1 11  ? 51.741 -32.758 -24.613 1.00 64.29  ? 11   G   B "O5'" 1 
ATOM   223  C "C5'" . G   A 1 11  ? 52.501 -31.970 -25.537 1.00 61.97  ? 11   G   B "C5'" 1 
ATOM   224  C "C4'" . G   A 1 11  ? 52.546 -30.513 -25.116 1.00 60.10  ? 11   G   B "C4'" 1 
ATOM   225  O "O4'" . G   A 1 11  ? 51.244 -29.887 -25.287 1.00 57.46  ? 11   G   B "O4'" 1 
ATOM   226  C "C3'" . G   A 1 11  ? 52.898 -30.216 -23.667 1.00 59.21  ? 11   G   B "C3'" 1 
ATOM   227  O "O3'" . G   A 1 11  ? 54.298 -30.301 -23.426 1.00 61.08  ? 11   G   B "O3'" 1 
ATOM   228  C "C2'" . G   A 1 11  ? 52.391 -28.788 -23.527 1.00 57.33  ? 11   G   B "C2'" 1 
ATOM   229  O "O2'" . G   A 1 11  ? 53.256 -27.850 -24.131 1.00 56.21  ? 11   G   B "O2'" 1 
ATOM   230  C "C1'" . G   A 1 11  ? 51.080 -28.866 -24.311 1.00 55.30  ? 11   G   B "C1'" 1 
ATOM   231  N N9    . G   A 1 11  ? 49.970 -29.239 -23.444 1.00 52.10  ? 11   G   B N9    1 
ATOM   232  C C8    . G   A 1 11  ? 49.303 -30.441 -23.418 1.00 51.93  ? 11   G   B C8    1 
ATOM   233  N N7    . G   A 1 11  ? 48.370 -30.490 -22.506 1.00 50.92  ? 11   G   B N7    1 
ATOM   234  C C5    . G   A 1 11  ? 48.418 -29.241 -21.899 1.00 49.97  ? 11   G   B C5    1 
ATOM   235  C C6    . G   A 1 11  ? 47.645 -28.704 -20.836 1.00 48.68  ? 11   G   B C6    1 
ATOM   236  O O6    . G   A 1 11  ? 46.723 -29.237 -20.205 1.00 48.97  ? 11   G   B O6    1 
ATOM   237  N N1    . G   A 1 11  ? 48.034 -27.406 -20.527 1.00 47.76  ? 11   G   B N1    1 
ATOM   238  C C2    . G   A 1 11  ? 49.029 -26.708 -21.159 1.00 48.97  ? 11   G   B C2    1 
ATOM   239  N N2    . G   A 1 11  ? 49.258 -25.468 -20.704 1.00 47.70  ? 11   G   B N2    1 
ATOM   240  N N3    . G   A 1 11  ? 49.750 -27.190 -22.161 1.00 50.34  ? 11   G   B N3    1 
ATOM   241  C C4    . G   A 1 11  ? 49.397 -28.455 -22.472 1.00 50.96  ? 11   G   B C4    1 
ATOM   242  P P     . G   A 1 12  ? 54.831 -30.782 -21.983 1.00 65.80  ? 12   G   B P     1 
ATOM   243  O OP1   . G   A 1 12  ? 56.301 -30.991 -22.113 1.00 63.33  ? 12   G   B OP1   1 
ATOM   244  O OP2   . G   A 1 12  ? 53.964 -31.901 -21.518 1.00 64.69  ? 12   G   B OP2   1 
ATOM   245  O "O5'" . G   A 1 12  ? 54.547 -29.539 -21.023 1.00 61.86  ? 12   G   B "O5'" 1 
ATOM   246  C "C5'" . G   A 1 12  ? 55.058 -28.250 -21.335 1.00 59.62  ? 12   G   B "C5'" 1 
ATOM   247  C "C4'" . G   A 1 12  ? 54.463 -27.216 -20.414 1.00 58.52  ? 12   G   B "C4'" 1 
ATOM   248  O "O4'" . G   A 1 12  ? 53.036 -27.092 -20.672 1.00 57.60  ? 12   G   B "O4'" 1 
ATOM   249  C "C3'" . G   A 1 12  ? 54.523 -27.552 -18.935 1.00 58.00  ? 12   G   B "C3'" 1 
ATOM   250  O "O3'" . G   A 1 12  ? 55.797 -27.277 -18.375 1.00 59.41  ? 12   G   B "O3'" 1 
ATOM   251  C "C2'" . G   A 1 12  ? 53.427 -26.658 -18.374 1.00 57.31  ? 12   G   B "C2'" 1 
ATOM   252  O "O2'" . G   A 1 12  ? 53.812 -25.305 -18.249 1.00 56.65  ? 12   G   B "O2'" 1 
ATOM   253  C "C1'" . G   A 1 12  ? 52.362 -26.786 -19.463 1.00 56.62  ? 12   G   B "C1'" 1 
ATOM   254  N N9    . G   A 1 12  ? 51.426 -27.863 -19.163 1.00 53.73  ? 12   G   B N9    1 
ATOM   255  C C8    . G   A 1 12  ? 51.400 -29.134 -19.689 1.00 52.98  ? 12   G   B C8    1 
ATOM   256  N N7    . G   A 1 12  ? 50.438 -29.869 -19.200 1.00 51.29  ? 12   G   B N7    1 
ATOM   257  C C5    . G   A 1 12  ? 49.789 -29.030 -18.303 1.00 51.92  ? 12   G   B C5    1 
ATOM   258  C C6    . G   A 1 12  ? 48.658 -29.264 -17.468 1.00 52.17  ? 12   G   B C6    1 
ATOM   259  O O6    . G   A 1 12  ? 47.975 -30.292 -17.362 1.00 52.45  ? 12   G   B O6    1 
ATOM   260  N N1    . G   A 1 12  ? 48.344 -28.141 -16.707 1.00 51.82  ? 12   G   B N1    1 
ATOM   261  C C2    . G   A 1 12  ? 49.023 -26.946 -16.746 1.00 52.10  ? 12   G   B C2    1 
ATOM   262  N N2    . G   A 1 12  ? 48.578 -25.975 -15.930 1.00 51.31  ? 12   G   B N2    1 
ATOM   263  N N3    . G   A 1 12  ? 50.065 -26.715 -17.525 1.00 51.32  ? 12   G   B N3    1 
ATOM   264  C C4    . G   A 1 12  ? 50.390 -27.792 -18.269 1.00 52.20  ? 12   G   B C4    1 
ATOM   265  P P     . U   A 1 13  ? 56.296 -28.115 -17.097 1.00 56.58  ? 13   U   B P     1 
ATOM   266  O OP1   . U   A 1 13  ? 57.651 -27.633 -16.721 1.00 55.88  ? 13   U   B OP1   1 
ATOM   267  O OP2   . U   A 1 13  ? 56.082 -29.559 -17.375 1.00 53.78  ? 13   U   B OP2   1 
ATOM   268  O "O5'" . U   A 1 13  ? 55.286 -27.668 -15.949 1.00 53.35  ? 13   U   B "O5'" 1 
ATOM   269  C "C5'" . U   A 1 13  ? 55.237 -26.315 -15.518 1.00 50.84  ? 13   U   B "C5'" 1 
ATOM   270  C "C4'" . U   A 1 13  ? 54.121 -26.123 -14.525 1.00 50.64  ? 13   U   B "C4'" 1 
ATOM   271  O "O4'" . U   A 1 13  ? 52.838 -26.370 -15.163 1.00 49.42  ? 13   U   B "O4'" 1 
ATOM   272  C "C3'" . U   A 1 13  ? 54.121 -27.092 -13.361 1.00 50.56  ? 13   U   B "C3'" 1 
ATOM   273  O "O3'" . U   A 1 13  ? 55.056 -26.698 -12.376 1.00 50.60  ? 13   U   B "O3'" 1 
ATOM   274  C "C2'" . U   A 1 13  ? 52.677 -27.003 -12.883 1.00 49.85  ? 13   U   B "C2'" 1 
ATOM   275  O "O2'" . U   A 1 13  ? 52.403 -25.841 -12.114 1.00 48.97  ? 13   U   B "O2'" 1 
ATOM   276  C "C1'" . U   A 1 13  ? 51.939 -26.932 -14.221 1.00 48.08  ? 13   U   B "C1'" 1 
ATOM   277  N N1    . U   A 1 13  ? 51.563 -28.268 -14.692 1.00 46.71  ? 13   U   B N1    1 
ATOM   278  C C2    . U   A 1 13  ? 50.393 -28.800 -14.207 1.00 46.85  ? 13   U   B C2    1 
ATOM   279  O O2    . U   A 1 13  ? 49.664 -28.196 -13.447 1.00 48.73  ? 13   U   B O2    1 
ATOM   280  N N3    . U   A 1 13  ? 50.104 -30.067 -14.649 1.00 45.45  ? 13   U   B N3    1 
ATOM   281  C C4    . U   A 1 13  ? 50.848 -30.829 -15.518 1.00 44.84  ? 13   U   B C4    1 
ATOM   282  O O4    . U   A 1 13  ? 50.450 -31.955 -15.828 1.00 45.25  ? 13   U   B O4    1 
ATOM   283  C C5    . U   A 1 13  ? 52.044 -30.198 -15.991 1.00 45.06  ? 13   U   B C5    1 
ATOM   284  C C6    . U   A 1 13  ? 52.353 -28.968 -15.570 1.00 46.13  ? 13   U   B C6    1 
ATOM   285  P P     . U   A 1 14  ? 55.886 -27.821 -11.594 1.00 52.19  ? 14   U   B P     1 
ATOM   286  O OP1   . U   A 1 14  ? 56.783 -27.126 -10.632 1.00 51.70  ? 14   U   B OP1   1 
ATOM   287  O OP2   . U   A 1 14  ? 56.458 -28.753 -12.599 1.00 51.14  ? 14   U   B OP2   1 
ATOM   288  O "O5'" . U   A 1 14  ? 54.772 -28.614 -10.780 1.00 50.62  ? 14   U   B "O5'" 1 
ATOM   289  C "C5'" . U   A 1 14  ? 53.962 -27.943 -9.824  1.00 50.85  ? 14   U   B "C5'" 1 
ATOM   290  C "C4'" . U   A 1 14  ? 52.900 -28.873 -9.282  1.00 50.65  ? 14   U   B "C4'" 1 
ATOM   291  O "O4'" . U   A 1 14  ? 51.916 -29.182 -10.309 1.00 49.98  ? 14   U   B "O4'" 1 
ATOM   292  C "C3'" . U   A 1 14  ? 53.376 -30.240 -8.820  1.00 49.28  ? 14   U   B "C3'" 1 
ATOM   293  O "O3'" . U   A 1 14  ? 53.949 -30.158 -7.518  1.00 50.15  ? 14   U   B "O3'" 1 
ATOM   294  C "C2'" . U   A 1 14  ? 52.068 -31.019 -8.812  1.00 47.93  ? 14   U   B "C2'" 1 
ATOM   295  O "O2'" . U   A 1 14  ? 51.287 -30.711 -7.680  1.00 47.56  ? 14   U   B "O2'" 1 
ATOM   296  C "C1'" . U   A 1 14  ? 51.383 -30.474 -10.070 1.00 48.45  ? 14   U   B "C1'" 1 
ATOM   297  N N1    . U   A 1 14  ? 51.662 -31.321 -11.237 1.00 49.34  ? 14   U   B N1    1 
ATOM   298  C C2    . U   A 1 14  ? 50.825 -32.403 -11.461 1.00 49.54  ? 14   U   B C2    1 
ATOM   299  O O2    . U   A 1 14  ? 49.838 -32.633 -10.773 1.00 50.37  ? 14   U   B O2    1 
ATOM   300  N N3    . U   A 1 14  ? 51.186 -33.205 -12.516 1.00 48.34  ? 14   U   B N3    1 
ATOM   301  C C4    . U   A 1 14  ? 52.274 -33.037 -13.351 1.00 48.98  ? 14   U   B C4    1 
ATOM   302  O O4    . U   A 1 14  ? 52.569 -33.935 -14.151 1.00 48.88  ? 14   U   B O4    1 
ATOM   303  C C5    . U   A 1 14  ? 53.058 -31.868 -13.079 1.00 48.50  ? 14   U   B C5    1 
ATOM   304  C C6    . U   A 1 14  ? 52.731 -31.072 -12.060 1.00 49.23  ? 14   U   B C6    1 
ATOM   305  P P     . C   A 1 15  ? 55.256 -31.023 -7.164  1.00 42.77  ? 15   C   B P     1 
ATOM   306  O OP1   . C   A 1 15  ? 55.784 -30.504 -5.875  1.00 45.26  ? 15   C   B OP1   1 
ATOM   307  O OP2   . C   A 1 15  ? 56.126 -31.016 -8.367  1.00 42.55  ? 15   C   B OP2   1 
ATOM   308  O "O5'" . C   A 1 15  ? 54.677 -32.492 -6.938  1.00 41.76  ? 15   C   B "O5'" 1 
ATOM   309  C "C5'" . C   A 1 15  ? 55.527 -33.605 -6.674  1.00 39.45  ? 15   C   B "C5'" 1 
ATOM   310  C "C4'" . C   A 1 15  ? 54.695 -34.856 -6.478  1.00 42.26  ? 15   C   B "C4'" 1 
ATOM   311  O "O4'" . C   A 1 15  ? 54.076 -34.902 -5.158  1.00 41.10  ? 15   C   B "O4'" 1 
ATOM   312  C "C3'" . C   A 1 15  ? 53.538 -35.028 -7.454  1.00 41.64  ? 15   C   B "C3'" 1 
ATOM   313  O "O3'" . C   A 1 15  ? 54.020 -35.600 -8.670  1.00 44.33  ? 15   C   B "O3'" 1 
ATOM   314  C "C2'" . C   A 1 15  ? 52.625 -36.002 -6.712  1.00 42.09  ? 15   C   B "C2'" 1 
ATOM   315  O "O2'" . C   A 1 15  ? 53.034 -37.343 -6.877  1.00 41.69  ? 15   C   B "O2'" 1 
ATOM   316  C "C1'" . C   A 1 15  ? 52.853 -35.613 -5.249  1.00 41.09  ? 15   C   B "C1'" 1 
ATOM   317  N N1    . C   A 1 15  ? 51.782 -34.831 -4.596  1.00 41.25  ? 15   C   B N1    1 
ATOM   318  C C2    . C   A 1 15  ? 51.805 -33.439 -4.706  1.00 42.13  ? 15   C   B C2    1 
ATOM   319  O O2    . C   A 1 15  ? 52.734 -32.905 -5.312  1.00 46.14  ? 15   C   B O2    1 
ATOM   320  N N3    . C   A 1 15  ? 50.819 -32.706 -4.145  1.00 41.67  ? 15   C   B N3    1 
ATOM   321  C C4    . C   A 1 15  ? 49.834 -33.311 -3.492  1.00 39.73  ? 15   C   B C4    1 
ATOM   322  N N4    . C   A 1 15  ? 48.899 -32.535 -2.951  1.00 38.27  ? 15   C   B N4    1 
ATOM   323  C C5    . C   A 1 15  ? 49.775 -34.735 -3.362  1.00 38.73  ? 15   C   B C5    1 
ATOM   324  C C6    . C   A 1 15  ? 50.766 -35.450 -3.921  1.00 38.65  ? 15   C   B C6    1 
ATOM   325  P P     . G   A 1 16  ? 53.321 -35.230 -10.070 1.00 47.77  ? 16   G   B P     1 
ATOM   326  O OP1   . G   A 1 16  ? 53.962 -36.055 -11.124 1.00 47.47  ? 16   G   B OP1   1 
ATOM   327  O OP2   . G   A 1 16  ? 53.281 -33.753 -10.213 1.00 47.47  ? 16   G   B OP2   1 
ATOM   328  O "O5'" . G   A 1 16  ? 51.838 -35.773 -9.906  1.00 48.97  ? 16   G   B "O5'" 1 
ATOM   329  C "C5'" . G   A 1 16  ? 51.597 -37.167 -9.797  1.00 50.11  ? 16   G   B "C5'" 1 
ATOM   330  C "C4'" . G   A 1 16  ? 50.182 -37.400 -9.358  1.00 50.61  ? 16   G   B "C4'" 1 
ATOM   331  O "O4'" . G   A 1 16  ? 50.016 -36.908 -8.004  1.00 50.84  ? 16   G   B "O4'" 1 
ATOM   332  C "C3'" . G   A 1 16  ? 49.152 -36.628 -10.163 1.00 50.56  ? 16   G   B "C3'" 1 
ATOM   333  O "O3'" . G   A 1 16  ? 48.824 -37.340 -11.350 1.00 51.67  ? 16   G   B "O3'" 1 
ATOM   334  C "C2'" . G   A 1 16  ? 47.983 -36.565 -9.188  1.00 51.50  ? 16   G   B "C2'" 1 
ATOM   335  O "O2'" . G   A 1 16  ? 47.228 -37.766 -9.158  1.00 51.15  ? 16   G   B "O2'" 1 
ATOM   336  C "C1'" . G   A 1 16  ? 48.717 -36.358 -7.856  1.00 50.97  ? 16   G   B "C1'" 1 
ATOM   337  N N9    . G   A 1 16  ? 48.863 -34.952 -7.498  1.00 50.18  ? 16   G   B N9    1 
ATOM   338  C C8    . G   A 1 16  ? 49.875 -34.097 -7.872  1.00 49.15  ? 16   G   B C8    1 
ATOM   339  N N7    . G   A 1 16  ? 49.716 -32.884 -7.414  1.00 48.00  ? 16   G   B N7    1 
ATOM   340  C C5    . G   A 1 16  ? 48.534 -32.943 -6.687  1.00 48.85  ? 16   G   B C5    1 
ATOM   341  C C6    . G   A 1 16  ? 47.849 -31.934 -5.954  1.00 48.95  ? 16   G   B C6    1 
ATOM   342  O O6    . G   A 1 16  ? 48.158 -30.748 -5.800  1.00 50.14  ? 16   G   B O6    1 
ATOM   343  N N1    . G   A 1 16  ? 46.689 -32.430 -5.363  1.00 49.16  ? 16   G   B N1    1 
ATOM   344  C C2    . G   A 1 16  ? 46.243 -33.730 -5.463  1.00 49.14  ? 16   G   B C2    1 
ATOM   345  N N2    . G   A 1 16  ? 45.101 -34.018 -4.825  1.00 47.71  ? 16   G   B N2    1 
ATOM   346  N N3    . G   A 1 16  ? 46.871 -34.676 -6.142  1.00 49.23  ? 16   G   B N3    1 
ATOM   347  C C4    . G   A 1 16  ? 47.999 -34.216 -6.725  1.00 49.50  ? 16   G   B C4    1 
ATOM   348  P P     . A   A 1 17  ? 48.769 -36.570 -12.759 1.00 58.15  ? 17   A   B P     1 
ATOM   349  O OP1   . A   A 1 17  ? 48.760 -37.590 -13.833 1.00 58.08  ? 17   A   B OP1   1 
ATOM   350  O OP2   . A   A 1 17  ? 49.830 -35.533 -12.748 1.00 60.00  ? 17   A   B OP2   1 
ATOM   351  O "O5'" . A   A 1 17  ? 47.354 -35.839 -12.751 1.00 57.54  ? 17   A   B "O5'" 1 
ATOM   352  C "C5'" . A   A 1 17  ? 46.150 -36.587 -12.755 1.00 59.79  ? 17   A   B "C5'" 1 
ATOM   353  C "C4'" . A   A 1 17  ? 45.039 -35.769 -13.352 1.00 62.85  ? 17   A   B "C4'" 1 
ATOM   354  O "O4'" . A   A 1 17  ? 44.887 -34.567 -12.548 1.00 64.36  ? 17   A   B "O4'" 1 
ATOM   355  C "C3'" . A   A 1 17  ? 45.286 -35.240 -14.756 1.00 63.94  ? 17   A   B "C3'" 1 
ATOM   356  O "O3'" . A   A 1 17  ? 45.107 -36.216 -15.798 1.00 66.33  ? 17   A   B "O3'" 1 
ATOM   357  C "C2'" . A   A 1 17  ? 44.414 -33.993 -14.813 1.00 65.46  ? 17   A   B "C2'" 1 
ATOM   358  O "O2'" . A   A 1 17  ? 43.052 -34.238 -15.089 1.00 68.04  ? 17   A   B "O2'" 1 
ATOM   359  C "C1'" . A   A 1 17  ? 44.530 -33.471 -13.379 1.00 64.63  ? 17   A   B "C1'" 1 
ATOM   360  N N9    . A   A 1 17  ? 45.504 -32.392 -13.195 1.00 62.98  ? 17   A   B N9    1 
ATOM   361  C C8    . A   A 1 17  ? 46.763 -32.262 -13.730 1.00 62.19  ? 17   A   B C8    1 
ATOM   362  N N7    . A   A 1 17  ? 47.385 -31.168 -13.356 1.00 60.80  ? 17   A   B N7    1 
ATOM   363  C C5    . A   A 1 17  ? 46.476 -30.536 -12.517 1.00 61.62  ? 17   A   B C5    1 
ATOM   364  C C6    . A   A 1 17  ? 46.530 -29.327 -11.783 1.00 61.95  ? 17   A   B C6    1 
ATOM   365  N N6    . A   A 1 17  ? 47.584 -28.501 -11.773 1.00 61.36  ? 17   A   B N6    1 
ATOM   366  N N1    . A   A 1 17  ? 45.444 -28.992 -11.048 1.00 62.00  ? 17   A   B N1    1 
ATOM   367  C C2    . A   A 1 17  ? 44.385 -29.813 -11.054 1.00 60.76  ? 17   A   B C2    1 
ATOM   368  N N3    . A   A 1 17  ? 44.217 -30.967 -11.697 1.00 61.47  ? 17   A   B N3    1 
ATOM   369  C C4    . A   A 1 17  ? 45.311 -31.276 -12.416 1.00 62.06  ? 17   A   B C4    1 
ATOM   370  P P     . U   A 1 18  ? 43.704 -37.010 -15.987 1.00 80.18  ? 18   U   B P     1 
ATOM   371  O OP1   . U   A 1 18  ? 43.303 -37.653 -14.704 1.00 80.31  ? 18   U   B OP1   1 
ATOM   372  O OP2   . U   A 1 18  ? 43.877 -37.848 -17.196 1.00 78.77  ? 18   U   B OP2   1 
ATOM   373  O "O5'" . U   A 1 18  ? 42.613 -35.911 -16.358 1.00 80.93  ? 18   U   B "O5'" 1 
ATOM   374  C "C5'" . U   A 1 18  ? 42.147 -35.745 -17.698 1.00 81.21  ? 18   U   B "C5'" 1 
ATOM   375  C "C4'" . U   A 1 18  ? 40.757 -35.146 -17.693 1.00 81.26  ? 18   U   B "C4'" 1 
ATOM   376  O "O4'" . U   A 1 18  ? 39.819 -36.118 -17.169 1.00 81.18  ? 18   U   B "O4'" 1 
ATOM   377  C "C3'" . U   A 1 18  ? 40.585 -33.916 -16.810 1.00 81.43  ? 18   U   B "C3'" 1 
ATOM   378  O "O3'" . U   A 1 18  ? 40.927 -32.737 -17.548 1.00 82.25  ? 18   U   B "O3'" 1 
ATOM   379  C "C2'" . U   A 1 18  ? 39.091 -33.947 -16.474 1.00 81.80  ? 18   U   B "C2'" 1 
ATOM   380  O "O2'" . U   A 1 18  ? 38.280 -33.287 -17.426 1.00 81.36  ? 18   U   B "O2'" 1 
ATOM   381  C "C1'" . U   A 1 18  ? 38.780 -35.450 -16.480 1.00 81.86  ? 18   U   B "C1'" 1 
ATOM   382  N N1    . U   A 1 18  ? 38.623 -36.065 -15.154 1.00 82.58  ? 18   U   B N1    1 
ATOM   383  C C2    . U   A 1 18  ? 37.611 -35.586 -14.339 1.00 82.84  ? 18   U   B C2    1 
ATOM   384  O O2    . U   A 1 18  ? 36.868 -34.680 -14.673 1.00 83.56  ? 18   U   B O2    1 
ATOM   385  N N3    . U   A 1 18  ? 37.501 -36.207 -13.118 1.00 83.02  ? 18   U   B N3    1 
ATOM   386  C C4    . U   A 1 18  ? 38.284 -37.239 -12.635 1.00 83.34  ? 18   U   B C4    1 
ATOM   387  O O4    . U   A 1 18  ? 38.053 -37.705 -11.515 1.00 82.64  ? 18   U   B O4    1 
ATOM   388  C C5    . U   A 1 18  ? 39.315 -37.677 -13.536 1.00 83.39  ? 18   U   B C5    1 
ATOM   389  C C6    . U   A 1 18  ? 39.445 -37.087 -14.735 1.00 82.95  ? 18   U   B C6    1 
ATOM   390  P P     . U   A 1 19  ? 41.927 -31.639 -16.916 1.00 71.50  ? 19   U   B P     1 
ATOM   391  O OP1   . U   A 1 19  ? 41.991 -30.490 -17.858 1.00 72.22  ? 19   U   B OP1   1 
ATOM   392  O OP2   . U   A 1 19  ? 43.182 -32.305 -16.499 1.00 71.25  ? 19   U   B OP2   1 
ATOM   393  O "O5'" . U   A 1 19  ? 41.173 -31.135 -15.612 1.00 71.05  ? 19   U   B "O5'" 1 
ATOM   394  C "C5'" . U   A 1 19  ? 39.990 -30.364 -15.723 1.00 70.89  ? 19   U   B "C5'" 1 
ATOM   395  C "C4'" . U   A 1 19  ? 39.266 -30.359 -14.411 1.00 71.18  ? 19   U   B "C4'" 1 
ATOM   396  O "O4'" . U   A 1 19  ? 38.926 -31.726 -14.067 1.00 70.95  ? 19   U   B "O4'" 1 
ATOM   397  C "C3'" . U   A 1 19  ? 40.089 -29.895 -13.224 1.00 71.90  ? 19   U   B "C3'" 1 
ATOM   398  O "O3'" . U   A 1 19  ? 40.289 -28.470 -13.256 1.00 71.79  ? 19   U   B "O3'" 1 
ATOM   399  C "C2'" . U   A 1 19  ? 39.364 -30.545 -12.047 1.00 72.29  ? 19   U   B "C2'" 1 
ATOM   400  O "O2'" . U   A 1 19  ? 38.148 -29.938 -11.665 1.00 74.56  ? 19   U   B "O2'" 1 
ATOM   401  C "C1'" . U   A 1 19  ? 38.951 -31.882 -12.657 1.00 72.11  ? 19   U   B "C1'" 1 
ATOM   402  N N1    . U   A 1 19  ? 39.783 -33.044 -12.310 1.00 71.92  ? 19   U   B N1    1 
ATOM   403  C C2    . U   A 1 19  ? 39.669 -33.555 -11.024 1.00 71.40  ? 19   U   B C2    1 
ATOM   404  O O2    . U   A 1 19  ? 38.978 -33.037 -10.160 1.00 69.65  ? 19   U   B O2    1 
ATOM   405  N N3    . U   A 1 19  ? 40.400 -34.694 -10.790 1.00 71.55  ? 19   U   B N3    1 
ATOM   406  C C4    . U   A 1 19  ? 41.228 -35.354 -11.688 1.00 72.11  ? 19   U   B C4    1 
ATOM   407  O O4    . U   A 1 19  ? 41.745 -36.429 -11.363 1.00 71.91  ? 19   U   B O4    1 
ATOM   408  C C5    . U   A 1 19  ? 41.324 -34.734 -12.976 1.00 71.21  ? 19   U   B C5    1 
ATOM   409  C C6    . U   A 1 19  ? 40.620 -33.628 -13.236 1.00 71.68  ? 19   U   B C6    1 
ATOM   410  P P     . C   A 1 20  ? 39.219 -27.458 -12.602 1.00 64.28  ? 20   C   B P     1 
ATOM   411  O OP1   . C   A 1 20  ? 38.589 -27.985 -11.366 1.00 66.40  ? 20   C   B OP1   1 
ATOM   412  O OP2   . C   A 1 20  ? 38.369 -26.934 -13.706 1.00 61.88  ? 20   C   B OP2   1 
ATOM   413  O "O5'" . C   A 1 20  ? 40.119 -26.258 -12.087 1.00 62.21  ? 20   C   B "O5'" 1 
ATOM   414  C "C5'" . C   A 1 20  ? 40.832 -25.478 -13.001 1.00 59.87  ? 20   C   B "C5'" 1 
ATOM   415  C "C4'" . C   A 1 20  ? 42.132 -25.031 -12.405 1.00 57.38  ? 20   C   B "C4'" 1 
ATOM   416  O "O4'" . C   A 1 20  ? 42.972 -26.156 -12.037 1.00 55.89  ? 20   C   B "O4'" 1 
ATOM   417  C "C3'" . C   A 1 20  ? 42.921 -24.287 -13.448 1.00 55.86  ? 20   C   B "C3'" 1 
ATOM   418  O "O3'" . C   A 1 20  ? 42.438 -22.968 -13.456 1.00 54.12  ? 20   C   B "O3'" 1 
ATOM   419  C "C2'" . C   A 1 20  ? 44.355 -24.484 -13.002 1.00 54.98  ? 20   C   B "C2'" 1 
ATOM   420  O "O2'" . C   A 1 20  ? 44.716 -23.584 -11.977 1.00 54.26  ? 20   C   B "O2'" 1 
ATOM   421  C "C1'" . C   A 1 20  ? 44.296 -25.929 -12.495 1.00 54.18  ? 20   C   B "C1'" 1 
ATOM   422  N N1    . C   A 1 20  ? 44.568 -26.946 -13.521 1.00 53.75  ? 20   C   B N1    1 
ATOM   423  C C2    . C   A 1 20  ? 45.844 -27.028 -14.099 1.00 53.61  ? 20   C   B C2    1 
ATOM   424  O O2    . C   A 1 20  ? 46.701 -26.192 -13.787 1.00 53.37  ? 20   C   B O2    1 
ATOM   425  N N3    . C   A 1 20  ? 46.104 -28.022 -14.986 1.00 53.80  ? 20   C   B N3    1 
ATOM   426  C C4    . C   A 1 20  ? 45.146 -28.903 -15.302 1.00 53.75  ? 20   C   B C4    1 
ATOM   427  N N4    . C   A 1 20  ? 45.454 -29.893 -16.151 1.00 52.77  ? 20   C   B N4    1 
ATOM   428  C C5    . C   A 1 20  ? 43.829 -28.813 -14.756 1.00 52.60  ? 20   C   B C5    1 
ATOM   429  C C6    . C   A 1 20  ? 43.587 -27.828 -13.885 1.00 53.04  ? 20   C   B C6    1 
ATOM   430  P P     . C   A 1 21  ? 41.786 -22.406 -14.793 1.00 54.88  ? 21   C   B P     1 
ATOM   431  O OP1   . C   A 1 21  ? 40.954 -21.212 -14.496 1.00 54.38  ? 21   C   B OP1   1 
ATOM   432  O OP2   . C   A 1 21  ? 41.177 -23.571 -15.484 1.00 53.78  ? 21   C   B OP2   1 
ATOM   433  O "O5'" . C   A 1 21  ? 43.088 -21.954 -15.579 1.00 51.76  ? 21   C   B "O5'" 1 
ATOM   434  C "C5'" . C   A 1 21  ? 44.141 -21.311 -14.874 1.00 47.56  ? 21   C   B "C5'" 1 
ATOM   435  C "C4'" . C   A 1 21  ? 45.362 -21.243 -15.734 1.00 45.29  ? 21   C   B "C4'" 1 
ATOM   436  O "O4'" . C   A 1 21  ? 46.065 -22.505 -15.724 1.00 44.59  ? 21   C   B "O4'" 1 
ATOM   437  C "C3'" . C   A 1 21  ? 45.044 -21.005 -17.189 1.00 44.19  ? 21   C   B "C3'" 1 
ATOM   438  O "O3'" . C   A 1 21  ? 44.775 -19.627 -17.382 1.00 42.84  ? 21   C   B "O3'" 1 
ATOM   439  C "C2'" . C   A 1 21  ? 46.301 -21.529 -17.877 1.00 43.47  ? 21   C   B "C2'" 1 
ATOM   440  O "O2'" . C   A 1 21  ? 47.382 -20.615 -17.848 1.00 42.57  ? 21   C   B "O2'" 1 
ATOM   441  C "C1'" . C   A 1 21  ? 46.640 -22.735 -16.996 1.00 42.33  ? 21   C   B "C1'" 1 
ATOM   442  N N1    . C   A 1 21  ? 46.131 -24.022 -17.478 1.00 41.63  ? 21   C   B N1    1 
ATOM   443  C C2    . C   A 1 21  ? 46.921 -24.781 -18.342 1.00 40.93  ? 21   C   B C2    1 
ATOM   444  O O2    . C   A 1 21  ? 47.995 -24.316 -18.732 1.00 42.04  ? 21   C   B O2    1 
ATOM   445  N N3    . C   A 1 21  ? 46.492 -25.998 -18.734 1.00 41.06  ? 21   C   B N3    1 
ATOM   446  C C4    . C   A 1 21  ? 45.315 -26.455 -18.308 1.00 41.97  ? 21   C   B C4    1 
ATOM   447  N N4    . C   A 1 21  ? 44.941 -27.677 -18.703 1.00 42.19  ? 21   C   B N4    1 
ATOM   448  C C5    . C   A 1 21  ? 44.472 -25.686 -17.452 1.00 40.95  ? 21   C   B C5    1 
ATOM   449  C C6    . C   A 1 21  ? 44.914 -24.486 -17.068 1.00 40.66  ? 21   C   B C6    1 
ATOM   450  P P     . G   A 1 22  ? 43.931 -19.167 -18.651 1.00 44.86  ? 22   G   B P     1 
ATOM   451  O OP1   . G   A 1 22  ? 43.965 -17.675 -18.687 1.00 42.96  ? 22   G   B OP1   1 
ATOM   452  O OP2   . G   A 1 22  ? 42.625 -19.874 -18.608 1.00 43.55  ? 22   G   B OP2   1 
ATOM   453  O "O5'" . G   A 1 22  ? 44.816 -19.748 -19.843 1.00 44.83  ? 22   G   B "O5'" 1 
ATOM   454  C "C5'" . G   A 1 22  ? 44.251 -20.318 -21.015 1.00 43.85  ? 22   G   B "C5'" 1 
ATOM   455  C "C4'" . G   A 1 22  ? 45.359 -20.922 -21.846 1.00 44.41  ? 22   G   B "C4'" 1 
ATOM   456  O "O4'" . G   A 1 22  ? 45.967 -22.015 -21.107 1.00 45.71  ? 22   G   B "O4'" 1 
ATOM   457  C "C3'" . G   A 1 22  ? 44.979 -21.532 -23.183 1.00 43.71  ? 22   G   B "C3'" 1 
ATOM   458  O "O3'" . G   A 1 22  ? 44.928 -20.500 -24.160 1.00 46.08  ? 22   G   B "O3'" 1 
ATOM   459  C "C2'" . G   A 1 22  ? 46.141 -22.494 -23.420 1.00 44.72  ? 22   G   B "C2'" 1 
ATOM   460  O "O2'" . G   A 1 22  ? 47.331 -21.869 -23.861 1.00 43.89  ? 22   G   B "O2'" 1 
ATOM   461  C "C1'" . G   A 1 22  ? 46.366 -23.033 -22.008 1.00 44.63  ? 22   G   B "C1'" 1 
ATOM   462  N N9    . G   A 1 22  ? 45.538 -24.208 -21.772 1.00 44.38  ? 22   G   B N9    1 
ATOM   463  C C8    . G   A 1 22  ? 44.451 -24.324 -20.937 1.00 43.32  ? 22   G   B C8    1 
ATOM   464  N N7    . G   A 1 22  ? 43.884 -25.500 -20.998 1.00 43.37  ? 22   G   B N7    1 
ATOM   465  C C5    . G   A 1 22  ? 44.654 -26.205 -21.918 1.00 43.69  ? 22   G   B C5    1 
ATOM   466  C C6    . G   A 1 22  ? 44.529 -27.534 -22.408 1.00 43.68  ? 22   G   B C6    1 
ATOM   467  O O6    . G   A 1 22  ? 43.683 -28.389 -22.115 1.00 44.95  ? 22   G   B O6    1 
ATOM   468  N N1    . G   A 1 22  ? 45.525 -27.836 -23.331 1.00 42.66  ? 22   G   B N1    1 
ATOM   469  C C2    . G   A 1 22  ? 46.521 -26.981 -23.729 1.00 43.88  ? 22   G   B C2    1 
ATOM   470  N N2    . G   A 1 22  ? 47.407 -27.470 -24.618 1.00 44.37  ? 22   G   B N2    1 
ATOM   471  N N3    . G   A 1 22  ? 46.648 -25.742 -23.286 1.00 44.30  ? 22   G   B N3    1 
ATOM   472  C C4    . G   A 1 22  ? 45.686 -25.423 -22.391 1.00 44.46  ? 22   G   B C4    1 
ATOM   473  P P     . C   A 1 23  ? 44.057 -20.694 -25.497 1.00 47.08  ? 23   C   B P     1 
ATOM   474  O OP1   . C   A 1 23  ? 44.080 -19.410 -26.241 1.00 47.08  ? 23   C   B OP1   1 
ATOM   475  O OP2   . C   A 1 23  ? 42.758 -21.307 -25.130 1.00 46.80  ? 23   C   B OP2   1 
ATOM   476  O "O5'" . C   A 1 23  ? 44.894 -21.754 -26.328 1.00 48.12  ? 23   C   B "O5'" 1 
ATOM   477  C "C5'" . C   A 1 23  ? 46.222 -21.471 -26.724 1.00 48.57  ? 23   C   B "C5'" 1 
ATOM   478  C "C4'" . C   A 1 23  ? 46.740 -22.596 -27.564 1.00 50.51  ? 23   C   B "C4'" 1 
ATOM   479  O "O4'" . C   A 1 23  ? 46.959 -23.775 -26.737 1.00 53.01  ? 23   C   B "O4'" 1 
ATOM   480  C "C3'" . C   A 1 23  ? 45.732 -23.076 -28.585 1.00 51.55  ? 23   C   B "C3'" 1 
ATOM   481  O "O3'" . C   A 1 23  ? 45.699 -22.216 -29.706 1.00 53.07  ? 23   C   B "O3'" 1 
ATOM   482  C "C2'" . C   A 1 23  ? 46.239 -24.482 -28.881 1.00 51.80  ? 23   C   B "C2'" 1 
ATOM   483  O "O2'" . C   A 1 23  ? 47.391 -24.490 -29.703 1.00 51.10  ? 23   C   B "O2'" 1 
ATOM   484  C "C1'" . C   A 1 23  ? 46.623 -24.944 -27.475 1.00 51.65  ? 23   C   B "C1'" 1 
ATOM   485  N N1    . C   A 1 23  ? 45.511 -25.612 -26.785 1.00 51.06  ? 23   C   B N1    1 
ATOM   486  C C2    . C   A 1 23  ? 45.245 -26.948 -27.078 1.00 50.26  ? 23   C   B C2    1 
ATOM   487  O O2    . C   A 1 23  ? 45.940 -27.523 -27.926 1.00 48.66  ? 23   C   B O2    1 
ATOM   488  N N3    . C   A 1 23  ? 44.237 -27.578 -26.432 1.00 50.53  ? 23   C   B N3    1 
ATOM   489  C C4    . C   A 1 23  ? 43.505 -26.917 -25.531 1.00 50.09  ? 23   C   B C4    1 
ATOM   490  N N4    . C   A 1 23  ? 42.533 -27.580 -24.903 1.00 49.89  ? 23   C   B N4    1 
ATOM   491  C C5    . C   A 1 23  ? 43.743 -25.548 -25.229 1.00 50.82  ? 23   C   B C5    1 
ATOM   492  C C6    . C   A 1 23  ? 44.749 -24.940 -25.870 1.00 51.17  ? 23   C   B C6    1 
ATOM   493  P P     . C   A 1 24  ? 44.498 -22.345 -30.759 1.00 60.40  ? 24   C   B P     1 
ATOM   494  O OP1   . C   A 1 24  ? 44.154 -21.005 -31.278 1.00 61.36  ? 24   C   B OP1   1 
ATOM   495  O OP2   . C   A 1 24  ? 43.443 -23.191 -30.159 1.00 60.43  ? 24   C   B OP2   1 
ATOM   496  O "O5'" . C   A 1 24  ? 45.156 -23.174 -31.936 1.00 62.56  ? 24   C   B "O5'" 1 
ATOM   497  C "C5'" . C   A 1 24  ? 44.336 -23.847 -32.852 1.00 66.32  ? 24   C   B "C5'" 1 
ATOM   498  C "C4'" . C   A 1 24  ? 44.843 -25.239 -33.090 1.00 67.56  ? 24   C   B "C4'" 1 
ATOM   499  O "O4'" . C   A 1 24  ? 45.057 -25.946 -31.843 1.00 67.32  ? 24   C   B "O4'" 1 
ATOM   500  C "C3'" . C   A 1 24  ? 43.815 -26.069 -33.820 1.00 68.31  ? 24   C   B "C3'" 1 
ATOM   501  O "O3'" . C   A 1 24  ? 43.931 -25.769 -35.197 1.00 70.78  ? 24   C   B "O3'" 1 
ATOM   502  C "C2'" . C   A 1 24  ? 44.215 -27.487 -33.450 1.00 68.52  ? 24   C   B "C2'" 1 
ATOM   503  O "O2'" . C   A 1 24  ? 45.294 -27.942 -34.238 1.00 69.80  ? 24   C   B "O2'" 1 
ATOM   504  C "C1'" . C   A 1 24  ? 44.667 -27.301 -31.997 1.00 67.35  ? 24   C   B "C1'" 1 
ATOM   505  N N1    . C   A 1 24  ? 43.643 -27.597 -30.984 1.00 66.38  ? 24   C   B N1    1 
ATOM   506  C C2    . C   A 1 24  ? 43.058 -28.864 -30.957 1.00 65.60  ? 24   C   B C2    1 
ATOM   507  O O2    . C   A 1 24  ? 43.400 -29.697 -31.803 1.00 64.89  ? 24   C   B O2    1 
ATOM   508  N N3    . C   A 1 24  ? 42.134 -29.146 -30.007 1.00 65.61  ? 24   C   B N3    1 
ATOM   509  C C4    . C   A 1 24  ? 41.786 -28.212 -29.115 1.00 65.84  ? 24   C   B C4    1 
ATOM   510  N N4    . C   A 1 24  ? 40.869 -28.526 -28.200 1.00 64.86  ? 24   C   B N4    1 
ATOM   511  C C5    . C   A 1 24  ? 42.363 -26.910 -29.126 1.00 65.90  ? 24   C   B C5    1 
ATOM   512  C C6    . C   A 1 24  ? 43.277 -26.647 -30.070 1.00 66.66  ? 24   C   B C6    1 
ATOM   513  P P     . C   A 1 25  ? 42.657 -25.193 -35.986 1.00 78.42  ? 25   C   B P     1 
ATOM   514  O OP1   . C   A 1 25  ? 43.104 -24.218 -37.018 1.00 76.76  ? 25   C   B OP1   1 
ATOM   515  O OP2   . C   A 1 25  ? 41.648 -24.782 -34.972 1.00 75.65  ? 25   C   B OP2   1 
ATOM   516  O "O5'" . C   A 1 25  ? 42.117 -26.492 -36.724 1.00 77.53  ? 25   C   B "O5'" 1 
ATOM   517  C "C5'" . C   A 1 25  ? 40.799 -26.941 -36.502 1.00 77.30  ? 25   C   B "C5'" 1 
ATOM   518  C "C4'" . C   A 1 25  ? 40.737 -28.440 -36.577 1.00 75.91  ? 25   C   B "C4'" 1 
ATOM   519  O "O4'" . C   A 1 25  ? 41.334 -29.032 -35.389 1.00 74.88  ? 25   C   B "O4'" 1 
ATOM   520  C "C3'" . C   A 1 25  ? 39.303 -28.915 -36.560 1.00 75.97  ? 25   C   B "C3'" 1 
ATOM   521  O "O3'" . C   A 1 25  ? 38.792 -28.857 -37.884 1.00 76.36  ? 25   C   B "O3'" 1 
ATOM   522  C "C2'" . C   A 1 25  ? 39.427 -30.308 -35.966 1.00 75.70  ? 25   C   B "C2'" 1 
ATOM   523  O "O2'" . C   A 1 25  ? 39.867 -31.272 -36.903 1.00 76.79  ? 25   C   B "O2'" 1 
ATOM   524  C "C1'" . C   A 1 25  ? 40.492 -30.063 -34.894 1.00 74.00  ? 25   C   B "C1'" 1 
ATOM   525  N N1    . C   A 1 25  ? 39.910 -29.579 -33.635 1.00 72.89  ? 25   C   B N1    1 
ATOM   526  C C2    . C   A 1 25  ? 39.052 -30.414 -32.912 1.00 72.71  ? 25   C   B C2    1 
ATOM   527  O O2    . C   A 1 25  ? 38.806 -31.551 -33.346 1.00 72.91  ? 25   C   B O2    1 
ATOM   528  N N3    . C   A 1 25  ? 38.508 -29.961 -31.757 1.00 71.86  ? 25   C   B N3    1 
ATOM   529  C C4    . C   A 1 25  ? 38.795 -28.729 -31.323 1.00 72.15  ? 25   C   B C4    1 
ATOM   530  N N4    . C   A 1 25  ? 38.235 -28.321 -30.183 1.00 71.91  ? 25   C   B N4    1 
ATOM   531  C C5    . C   A 1 25  ? 39.669 -27.860 -32.040 1.00 72.05  ? 25   C   B C5    1 
ATOM   532  C C6    . C   A 1 25  ? 40.200 -28.322 -33.178 1.00 72.81  ? 25   C   B C6    1 
ATOM   533  P P     . U   A 1 26  ? 37.580 -27.856 -38.213 1.00 79.18  ? 26   U   B P     1 
ATOM   534  O OP1   . U   A 1 26  ? 37.353 -27.892 -39.681 1.00 79.31  ? 26   U   B OP1   1 
ATOM   535  O OP2   . U   A 1 26  ? 37.872 -26.556 -37.550 1.00 77.19  ? 26   U   B OP2   1 
ATOM   536  O "O5'" . U   A 1 26  ? 36.357 -28.565 -37.480 1.00 78.63  ? 26   U   B "O5'" 1 
ATOM   537  C "C5'" . U   A 1 26  ? 36.166 -29.969 -37.623 1.00 79.24  ? 26   U   B "C5'" 1 
ATOM   538  C "C4'" . U   A 1 26  ? 35.350 -30.522 -36.482 1.00 80.27  ? 26   U   B "C4'" 1 
ATOM   539  O "O4'" . U   A 1 26  ? 36.083 -30.438 -35.229 1.00 79.89  ? 26   U   B "O4'" 1 
ATOM   540  C "C3'" . U   A 1 26  ? 34.066 -29.787 -36.157 1.00 80.96  ? 26   U   B "C3'" 1 
ATOM   541  O "O3'" . U   A 1 26  ? 33.032 -30.063 -37.086 1.00 82.79  ? 26   U   B "O3'" 1 
ATOM   542  C "C2'" . U   A 1 26  ? 33.752 -30.331 -34.771 1.00 80.99  ? 26   U   B "C2'" 1 
ATOM   543  O "O2'" . U   A 1 26  ? 33.180 -31.626 -34.804 1.00 80.82  ? 26   U   B "O2'" 1 
ATOM   544  C "C1'" . U   A 1 26  ? 35.151 -30.377 -34.152 1.00 80.58  ? 26   U   B "C1'" 1 
ATOM   545  N N1    . U   A 1 26  ? 35.399 -29.163 -33.360 1.00 80.32  ? 26   U   B N1    1 
ATOM   546  C C2    . U   A 1 26  ? 34.795 -29.093 -32.116 1.00 79.86  ? 26   U   B C2    1 
ATOM   547  O O2    . U   A 1 26  ? 34.115 -29.991 -31.664 1.00 79.86  ? 26   U   B O2    1 
ATOM   548  N N3    . U   A 1 26  ? 35.018 -27.931 -31.425 1.00 79.61  ? 26   U   B N3    1 
ATOM   549  C C4    . U   A 1 26  ? 35.772 -26.854 -31.837 1.00 80.11  ? 26   U   B C4    1 
ATOM   550  O O4    . U   A 1 26  ? 35.855 -25.861 -31.109 1.00 80.14  ? 26   U   B O4    1 
ATOM   551  C C5    . U   A 1 26  ? 36.379 -27.007 -33.130 1.00 80.41  ? 26   U   B C5    1 
ATOM   552  C C6    . U   A 1 26  ? 36.178 -28.130 -33.830 1.00 80.19  ? 26   U   B C6    1 
ATOM   553  P P     . G   A 1 27  ? 31.950 -28.926 -37.415 1.00 81.35  ? 27   G   B P     1 
ATOM   554  O OP1   . G   A 1 27  ? 31.701 -28.941 -38.879 1.00 80.04  ? 27   G   B OP1   1 
ATOM   555  O OP2   . G   A 1 27  ? 32.437 -27.681 -36.764 1.00 80.66  ? 27   G   B OP2   1 
ATOM   556  O "O5'" . G   A 1 27  ? 30.646 -29.411 -36.636 1.00 79.03  ? 27   G   B "O5'" 1 
ATOM   557  C "C5'" . G   A 1 27  ? 30.077 -30.692 -36.886 1.00 78.50  ? 27   G   B "C5'" 1 
ATOM   558  C "C4'" . G   A 1 27  ? 29.087 -31.051 -35.803 1.00 79.02  ? 27   G   B "C4'" 1 
ATOM   559  O "O4'" . G   A 1 27  ? 29.789 -31.296 -34.548 1.00 79.19  ? 27   G   B "O4'" 1 
ATOM   560  C "C3'" . G   A 1 27  ? 28.093 -29.964 -35.435 1.00 79.05  ? 27   G   B "C3'" 1 
ATOM   561  O "O3'" . G   A 1 27  ? 27.025 -29.828 -36.361 1.00 78.88  ? 27   G   B "O3'" 1 
ATOM   562  C "C2'" . G   A 1 27  ? 27.648 -30.422 -34.054 1.00 79.44  ? 27   G   B "C2'" 1 
ATOM   563  O "O2'" . G   A 1 27  ? 26.756 -31.523 -34.091 1.00 78.59  ? 27   G   B "O2'" 1 
ATOM   564  C "C1'" . G   A 1 27  ? 28.995 -30.837 -33.458 1.00 79.42  ? 27   G   B "C1'" 1 
ATOM   565  N N9    . G   A 1 27  ? 29.670 -29.688 -32.859 1.00 79.44  ? 27   G   B N9    1 
ATOM   566  C C8    . G   A 1 27  ? 30.739 -28.995 -33.374 1.00 79.37  ? 27   G   B C8    1 
ATOM   567  N N7    . G   A 1 27  ? 31.114 -27.996 -32.622 1.00 79.18  ? 27   G   B N7    1 
ATOM   568  C C5    . G   A 1 27  ? 30.246 -28.033 -31.541 1.00 79.13  ? 27   G   B C5    1 
ATOM   569  C C6    . G   A 1 27  ? 30.166 -27.193 -30.397 1.00 79.27  ? 27   G   B C6    1 
ATOM   570  O O6    . G   A 1 27  ? 30.872 -26.221 -30.103 1.00 78.85  ? 27   G   B O6    1 
ATOM   571  N N1    . G   A 1 27  ? 29.134 -27.582 -29.548 1.00 78.94  ? 27   G   B N1    1 
ATOM   572  C C2    . G   A 1 27  ? 28.289 -28.639 -29.767 1.00 79.08  ? 27   G   B C2    1 
ATOM   573  N N2    . G   A 1 27  ? 27.355 -28.853 -28.834 1.00 78.70  ? 27   G   B N2    1 
ATOM   574  N N3    . G   A 1 27  ? 28.353 -29.431 -30.826 1.00 78.87  ? 27   G   B N3    1 
ATOM   575  C C4    . G   A 1 27  ? 29.349 -29.072 -31.668 1.00 79.15  ? 27   G   B C4    1 
ATOM   576  P P     . G   A 1 28  ? 26.437 -28.361 -36.668 1.00 91.85  ? 28   G   B P     1 
ATOM   577  O OP1   . G   A 1 28  ? 25.597 -28.435 -37.890 1.00 91.78  ? 28   G   B OP1   1 
ATOM   578  O OP2   . G   A 1 28  ? 27.582 -27.413 -36.622 1.00 92.00  ? 28   G   B OP2   1 
ATOM   579  O "O5'" . G   A 1 28  ? 25.499 -28.059 -35.414 1.00 89.63  ? 28   G   B "O5'" 1 
ATOM   580  C "C5'" . G   A 1 28  ? 24.423 -28.934 -35.096 1.00 87.77  ? 28   G   B "C5'" 1 
ATOM   581  C "C4'" . G   A 1 28  ? 23.846 -28.600 -33.741 1.00 86.78  ? 28   G   B "C4'" 1 
ATOM   582  O "O4'" . G   A 1 28  ? 24.855 -28.808 -32.712 1.00 85.84  ? 28   G   B "O4'" 1 
ATOM   583  C "C3'" . G   A 1 28  ? 23.436 -27.157 -33.509 1.00 86.32  ? 28   G   B "C3'" 1 
ATOM   584  O "O3'" . G   A 1 28  ? 22.203 -26.798 -34.109 1.00 85.81  ? 28   G   B "O3'" 1 
ATOM   585  C "C2'" . G   A 1 28  ? 23.366 -27.113 -31.992 1.00 86.07  ? 28   G   B "C2'" 1 
ATOM   586  O "O2'" . G   A 1 28  ? 22.204 -27.732 -31.464 1.00 85.22  ? 28   G   B "O2'" 1 
ATOM   587  C "C1'" . G   A 1 28  ? 24.623 -27.905 -31.634 1.00 85.16  ? 28   G   B "C1'" 1 
ATOM   588  N N9    . G   A 1 28  ? 25.750 -26.983 -31.538 1.00 83.83  ? 28   G   B N9    1 
ATOM   589  C C8    . G   A 1 28  ? 26.735 -26.754 -32.471 1.00 83.65  ? 28   G   B C8    1 
ATOM   590  N N7    . G   A 1 28  ? 27.571 -25.816 -32.112 1.00 82.58  ? 28   G   B N7    1 
ATOM   591  C C5    . G   A 1 28  ? 27.118 -25.412 -30.862 1.00 81.97  ? 28   G   B C5    1 
ATOM   592  C C6    . G   A 1 28  ? 27.613 -24.415 -29.978 1.00 81.24  ? 28   G   B C6    1 
ATOM   593  O O6    . G   A 1 28  ? 28.581 -23.659 -30.128 1.00 80.65  ? 28   G   B O6    1 
ATOM   594  N N1    . G   A 1 28  ? 26.852 -24.337 -28.819 1.00 80.30  ? 28   G   B N1    1 
ATOM   595  C C2    . G   A 1 28  ? 25.753 -25.106 -28.544 1.00 80.35  ? 28   G   B C2    1 
ATOM   596  N N2    . G   A 1 28  ? 25.149 -24.871 -27.378 1.00 79.86  ? 28   G   B N2    1 
ATOM   597  N N3    . G   A 1 28  ? 25.279 -26.035 -29.354 1.00 81.40  ? 28   G   B N3    1 
ATOM   598  C C4    . G   A 1 28  ? 26.004 -26.133 -30.489 1.00 82.42  ? 28   G   B C4    1 
ATOM   599  P P     . G   A 1 29  ? 21.928 -25.255 -34.463 1.00 78.84  ? 29   G   B P     1 
ATOM   600  O OP1   . G   A 1 29  ? 20.643 -25.181 -35.201 1.00 79.61  ? 29   G   B OP1   1 
ATOM   601  O OP2   . G   A 1 29  ? 23.164 -24.709 -35.087 1.00 77.52  ? 29   G   B OP2   1 
ATOM   602  O "O5'" . G   A 1 29  ? 21.718 -24.584 -33.031 1.00 76.66  ? 29   G   B "O5'" 1 
ATOM   603  C "C5'" . G   A 1 29  ? 20.683 -25.057 -32.171 1.00 75.57  ? 29   G   B "C5'" 1 
ATOM   604  C "C4'" . G   A 1 29  ? 20.710 -24.340 -30.839 1.00 74.30  ? 29   G   B "C4'" 1 
ATOM   605  O "O4'" . G   A 1 29  ? 21.948 -24.646 -30.139 1.00 73.87  ? 29   G   B "O4'" 1 
ATOM   606  C "C3'" . G   A 1 29  ? 20.683 -22.819 -30.862 1.00 73.29  ? 29   G   B "C3'" 1 
ATOM   607  O "O3'" . G   A 1 29  ? 19.380 -22.279 -31.058 1.00 71.65  ? 29   G   B "O3'" 1 
ATOM   608  C "C2'" . G   A 1 29  ? 21.210 -22.495 -29.473 1.00 73.02  ? 29   G   B "C2'" 1 
ATOM   609  O "O2'" . G   A 1 29  ? 20.226 -22.693 -28.478 1.00 72.21  ? 29   G   B "O2'" 1 
ATOM   610  C "C1'" . G   A 1 29  ? 22.324 -23.535 -29.338 1.00 72.93  ? 29   G   B "C1'" 1 
ATOM   611  N N9    . G   A 1 29  ? 23.589 -23.011 -29.842 1.00 72.40  ? 29   G   B N9    1 
ATOM   612  C C8    . G   A 1 29  ? 24.247 -23.373 -30.993 1.00 72.36  ? 29   G   B C8    1 
ATOM   613  N N7    . G   A 1 29  ? 25.346 -22.698 -31.186 1.00 71.26  ? 29   G   B N7    1 
ATOM   614  C C5    . G   A 1 29  ? 25.419 -21.845 -30.095 1.00 71.93  ? 29   G   B C5    1 
ATOM   615  C C6    . G   A 1 29  ? 26.389 -20.864 -29.757 1.00 72.41  ? 29   G   B C6    1 
ATOM   616  O O6    . G   A 1 29  ? 27.415 -20.543 -30.376 1.00 72.12  ? 29   G   B O6    1 
ATOM   617  N N1    . G   A 1 29  ? 26.071 -20.224 -28.563 1.00 72.21  ? 29   G   B N1    1 
ATOM   618  C C2    . G   A 1 29  ? 24.963 -20.486 -27.796 1.00 72.59  ? 29   G   B C2    1 
ATOM   619  N N2    . G   A 1 29  ? 24.819 -19.749 -26.684 1.00 72.51  ? 29   G   B N2    1 
ATOM   620  N N3    . G   A 1 29  ? 24.057 -21.400 -28.097 1.00 72.92  ? 29   G   B N3    1 
ATOM   621  C C4    . G   A 1 29  ? 24.345 -22.034 -29.254 1.00 72.16  ? 29   G   B C4    1 
ATOM   622  P P     . C   A 1 30  ? 19.215 -20.946 -31.939 1.00 62.31  ? 30   C   B P     1 
ATOM   623  O OP1   . C   A 1 30  ? 17.794 -20.775 -32.333 1.00 61.90  ? 30   C   B OP1   1 
ATOM   624  O OP2   . C   A 1 30  ? 20.266 -21.015 -32.986 1.00 61.82  ? 30   C   B OP2   1 
ATOM   625  O "O5'" . C   A 1 30  ? 19.631 -19.766 -30.950 1.00 58.96  ? 30   C   B "O5'" 1 
ATOM   626  C "C5'" . C   A 1 30  ? 19.109 -19.694 -29.629 1.00 55.86  ? 30   C   B "C5'" 1 
ATOM   627  C "C4'" . C   A 1 30  ? 19.913 -18.717 -28.799 1.00 54.89  ? 30   C   B "C4'" 1 
ATOM   628  O "O4'" . C   A 1 30  ? 21.257 -19.238 -28.590 1.00 54.56  ? 30   C   B "O4'" 1 
ATOM   629  C "C3'" . C   A 1 30  ? 20.144 -17.340 -29.407 1.00 52.90  ? 30   C   B "C3'" 1 
ATOM   630  O "O3'" . C   A 1 30  ? 19.033 -16.479 -29.181 1.00 47.89  ? 30   C   B "O3'" 1 
ATOM   631  C "C2'" . C   A 1 30  ? 21.364 -16.866 -28.629 1.00 52.15  ? 30   C   B "C2'" 1 
ATOM   632  O "O2'" . C   A 1 30  ? 21.016 -16.419 -27.340 1.00 52.55  ? 30   C   B "O2'" 1 
ATOM   633  C "C1'" . C   A 1 30  ? 22.175 -18.159 -28.509 1.00 53.18  ? 30   C   B "C1'" 1 
ATOM   634  N N1    . C   A 1 30  ? 23.156 -18.300 -29.593 1.00 53.41  ? 30   C   B N1    1 
ATOM   635  C C2    . C   A 1 30  ? 24.343 -17.554 -29.535 1.00 53.56  ? 30   C   B C2    1 
ATOM   636  O O2    . C   A 1 30  ? 24.545 -16.816 -28.554 1.00 52.68  ? 30   C   B O2    1 
ATOM   637  N N3    . C   A 1 30  ? 25.236 -17.659 -30.545 1.00 53.36  ? 30   C   B N3    1 
ATOM   638  C C4    . C   A 1 30  ? 24.985 -18.468 -31.577 1.00 52.40  ? 30   C   B C4    1 
ATOM   639  N N4    . C   A 1 30  ? 25.885 -18.530 -32.557 1.00 51.83  ? 30   C   B N4    1 
ATOM   640  C C5    . C   A 1 30  ? 23.796 -19.247 -31.651 1.00 52.69  ? 30   C   B C5    1 
ATOM   641  C C6    . C   A 1 30  ? 22.917 -19.134 -30.647 1.00 53.13  ? 30   C   B C6    1 
ATOM   642  P P     . C   A 1 31  ? 18.874 -15.128 -30.042 1.00 42.90  ? 31   C   B P     1 
ATOM   643  O OP1   . C   A 1 31  ? 17.551 -14.540 -29.728 1.00 41.26  ? 31   C   B OP1   1 
ATOM   644  O OP2   . C   A 1 31  ? 19.221 -15.458 -31.451 1.00 41.61  ? 31   C   B OP2   1 
ATOM   645  O "O5'" . C   A 1 31  ? 20.002 -14.143 -29.489 1.00 42.62  ? 31   C   B "O5'" 1 
ATOM   646  C "C5'" . C   A 1 31  ? 20.084 -13.813 -28.105 1.00 42.81  ? 31   C   B "C5'" 1 
ATOM   647  C "C4'" . C   A 1 31  ? 21.237 -12.863 -27.861 1.00 43.88  ? 31   C   B "C4'" 1 
ATOM   648  O "O4'" . C   A 1 31  ? 22.509 -13.543 -28.056 1.00 43.83  ? 31   C   B "O4'" 1 
ATOM   649  C "C3'" . C   A 1 31  ? 21.305 -11.675 -28.802 1.00 42.76  ? 31   C   B "C3'" 1 
ATOM   650  O "O3'" . C   A 1 31  ? 20.441 -10.632 -28.383 1.00 39.24  ? 31   C   B "O3'" 1 
ATOM   651  C "C2'" . C   A 1 31  ? 22.773 -11.279 -28.708 1.00 42.63  ? 31   C   B "C2'" 1 
ATOM   652  O "O2'" . C   A 1 31  ? 23.067 -10.561 -27.531 1.00 45.18  ? 31   C   B "O2'" 1 
ATOM   653  C "C1'" . C   A 1 31  ? 23.446 -12.647 -28.624 1.00 43.97  ? 31   C   B "C1'" 1 
ATOM   654  N N1    . C   A 1 31  ? 23.879 -13.192 -29.922 1.00 46.12  ? 31   C   B N1    1 
ATOM   655  C C2    . C   A 1 31  ? 25.097 -12.757 -30.472 1.00 46.00  ? 31   C   B C2    1 
ATOM   656  O O2    . C   A 1 31  ? 25.732 -11.867 -29.893 1.00 47.86  ? 31   C   B O2    1 
ATOM   657  N N3    . C   A 1 31  ? 25.538 -13.310 -31.624 1.00 46.06  ? 31   C   B N3    1 
ATOM   658  C C4    . C   A 1 31  ? 24.801 -14.237 -32.244 1.00 47.35  ? 31   C   B C4    1 
ATOM   659  N N4    . C   A 1 31  ? 25.275 -14.761 -33.372 1.00 48.18  ? 31   C   B N4    1 
ATOM   660  C C5    . C   A 1 31  ? 23.540 -14.670 -31.731 1.00 47.70  ? 31   C   B C5    1 
ATOM   661  C C6    . C   A 1 31  ? 23.122 -14.126 -30.577 1.00 47.28  ? 31   C   B C6    1 
ATOM   662  P P     . A   A 1 32  ? 19.856 -9.610  -29.472 1.00 49.41  ? 32   A   B P     1 
ATOM   663  O OP1   . A   A 1 32  ? 18.847 -8.739  -28.818 1.00 50.89  ? 32   A   B OP1   1 
ATOM   664  O OP2   . A   A 1 32  ? 19.470 -10.425 -30.651 1.00 50.38  ? 32   A   B OP2   1 
ATOM   665  O "O5'" . A   A 1 32  ? 21.103 -8.715  -29.901 1.00 50.66  ? 32   A   B "O5'" 1 
ATOM   666  C "C5'" . A   A 1 32  ? 21.637 -7.724  -29.029 1.00 50.33  ? 32   A   B "C5'" 1 
ATOM   667  C "C4'" . A   A 1 32  ? 22.820 -7.038  -29.676 1.00 51.38  ? 32   A   B "C4'" 1 
ATOM   668  O "O4'" . A   A 1 32  ? 23.900 -7.986  -29.859 1.00 51.23  ? 32   A   B "O4'" 1 
ATOM   669  C "C3'" . A   A 1 32  ? 22.590 -6.486  -31.074 1.00 51.48  ? 32   A   B "C3'" 1 
ATOM   670  O "O3'" . A   A 1 32  ? 21.981 -5.202  -31.021 1.00 53.69  ? 32   A   B "O3'" 1 
ATOM   671  C "C2'" . A   A 1 32  ? 24.009 -6.377  -31.609 1.00 51.16  ? 32   A   B "C2'" 1 
ATOM   672  O "O2'" . A   A 1 32  ? 24.638 -5.204  -31.142 1.00 53.69  ? 32   A   B "O2'" 1 
ATOM   673  C "C1'" . A   A 1 32  ? 24.677 -7.605  -30.980 1.00 50.95  ? 32   A   B "C1'" 1 
ATOM   674  N N9    . A   A 1 32  ? 24.780 -8.748  -31.886 1.00 51.48  ? 32   A   B N9    1 
ATOM   675  C C8    . A   A 1 32  ? 23.784 -9.602  -32.304 1.00 51.42  ? 32   A   B C8    1 
ATOM   676  N N7    . A   A 1 32  ? 24.195 -10.521 -33.147 1.00 51.11  ? 32   A   B N7    1 
ATOM   677  C C5    . A   A 1 32  ? 25.552 -10.259 -33.291 1.00 50.82  ? 32   A   B C5    1 
ATOM   678  C C6    . A   A 1 32  ? 26.566 -10.880 -34.052 1.00 50.44  ? 32   A   B C6    1 
ATOM   679  N N6    . A   A 1 32  ? 26.368 -11.948 -34.827 1.00 47.67  ? 32   A   B N6    1 
ATOM   680  N N1    . A   A 1 32  ? 27.811 -10.363 -33.977 1.00 51.94  ? 32   A   B N1    1 
ATOM   681  C C2    . A   A 1 32  ? 28.022 -9.308  -33.177 1.00 51.96  ? 32   A   B C2    1 
ATOM   682  N N3    . A   A 1 32  ? 27.159 -8.647  -32.408 1.00 52.58  ? 32   A   B N3    1 
ATOM   683  C C4    . A   A 1 32  ? 25.926 -9.175  -32.514 1.00 51.09  ? 32   A   B C4    1 
ATOM   684  P P     . C   A 1 33  ? 20.844 -4.812  -32.092 1.00 76.07  ? 33   C   B P     1 
ATOM   685  O OP1   . C   A 1 33  ? 20.066 -3.685  -31.517 1.00 75.42  ? 33   C   B OP1   1 
ATOM   686  O OP2   . C   A 1 33  ? 20.147 -6.071  -32.471 1.00 75.97  ? 33   C   B OP2   1 
ATOM   687  O "O5'" . C   A 1 33  ? 21.652 -4.274  -33.357 1.00 78.10  ? 33   C   B "O5'" 1 
ATOM   688  C "C5'" . C   A 1 33  ? 22.477 -3.116  -33.253 1.00 81.21  ? 33   C   B "C5'" 1 
ATOM   689  C "C4'" . C   A 1 33  ? 23.445 -3.051  -34.414 1.00 83.10  ? 33   C   B "C4'" 1 
ATOM   690  O "O4'" . C   A 1 33  ? 24.261 -4.244  -34.413 1.00 83.66  ? 33   C   B "O4'" 1 
ATOM   691  C "C3'" . C   A 1 33  ? 22.820 -3.002  -35.801 1.00 83.65  ? 33   C   B "C3'" 1 
ATOM   692  O "O3'" . C   A 1 33  ? 22.613 -1.635  -36.170 1.00 83.83  ? 33   C   B "O3'" 1 
ATOM   693  C "C2'" . C   A 1 33  ? 23.905 -3.604  -36.696 1.00 84.44  ? 33   C   B "C2'" 1 
ATOM   694  O "O2'" . C   A 1 33  ? 24.781 -2.625  -37.221 1.00 85.28  ? 33   C   B "O2'" 1 
ATOM   695  C "C1'" . C   A 1 33  ? 24.659 -4.536  -35.735 1.00 84.85  ? 33   C   B "C1'" 1 
ATOM   696  N N1    . C   A 1 33  ? 24.470 -5.974  -35.975 1.00 85.50  ? 33   C   B N1    1 
ATOM   697  C C2    . C   A 1 33  ? 25.309 -6.609  -36.890 1.00 85.95  ? 33   C   B C2    1 
ATOM   698  O O2    . C   A 1 33  ? 26.182 -5.936  -37.464 1.00 86.62  ? 33   C   B O2    1 
ATOM   699  N N3    . C   A 1 33  ? 25.155 -7.933  -37.127 1.00 85.15  ? 33   C   B N3    1 
ATOM   700  C C4    . C   A 1 33  ? 24.209 -8.619  -36.483 1.00 84.95  ? 33   C   B C4    1 
ATOM   701  N N4    . C   A 1 33  ? 24.093 -9.924  -36.749 1.00 84.76  ? 33   C   B N4    1 
ATOM   702  C C5    . C   A 1 33  ? 23.339 -7.997  -35.538 1.00 84.84  ? 33   C   B C5    1 
ATOM   703  C C6    . C   A 1 33  ? 23.501 -6.682  -35.319 1.00 85.24  ? 33   C   B C6    1 
ATOM   704  P P     . U   A 1 34  ? 21.163 -0.957  -35.981 1.00 113.56 ? 34   U   B P     1 
ATOM   705  O OP1   . U   A 1 34  ? 21.275 0.504   -36.255 1.00 111.97 ? 34   U   B OP1   1 
ATOM   706  O OP2   . U   A 1 34  ? 20.589 -1.420  -34.689 1.00 113.00 ? 34   U   B OP2   1 
ATOM   707  O "O5'" . U   A 1 34  ? 20.290 -1.596  -37.144 1.00 112.74 ? 34   U   B "O5'" 1 
ATOM   708  C "C5'" . U   A 1 34  ? 20.252 -0.982  -38.419 1.00 112.56 ? 34   U   B "C5'" 1 
ATOM   709  C "C4'" . U   A 1 34  ? 19.864 -1.984  -39.473 1.00 112.34 ? 34   U   B "C4'" 1 
ATOM   710  O "O4'" . U   A 1 34  ? 20.852 -3.039  -39.561 1.00 112.18 ? 34   U   B "O4'" 1 
ATOM   711  C "C3'" . U   A 1 34  ? 18.581 -2.759  -39.242 1.00 112.22 ? 34   U   B "C3'" 1 
ATOM   712  O "O3'" . U   A 1 34  ? 17.401 -1.957  -39.403 1.00 111.90 ? 34   U   B "O3'" 1 
ATOM   713  C "C2'" . U   A 1 34  ? 18.739 -3.908  -40.235 1.00 112.12 ? 34   U   B "C2'" 1 
ATOM   714  O "O2'" . U   A 1 34  ? 18.424 -3.523  -41.556 1.00 112.39 ? 34   U   B "O2'" 1 
ATOM   715  C "C1'" . U   A 1 34  ? 20.247 -4.175  -40.163 1.00 111.98 ? 34   U   B "C1'" 1 
ATOM   716  N N1    . U   A 1 34  ? 20.577 -5.381  -39.391 1.00 111.69 ? 34   U   B N1    1 
ATOM   717  C C2    . U   A 1 34  ? 20.829 -6.542  -40.110 1.00 111.64 ? 34   U   B C2    1 
ATOM   718  O O2    . U   A 1 34  ? 20.835 -6.584  -41.331 1.00 111.89 ? 34   U   B O2    1 
ATOM   719  N N3    . U   A 1 34  ? 21.083 -7.653  -39.349 1.00 111.18 ? 34   U   B N3    1 
ATOM   720  C C4    . U   A 1 34  ? 21.122 -7.725  -37.977 1.00 111.26 ? 34   U   B C4    1 
ATOM   721  O O4    . U   A 1 34  ? 21.325 -8.816  -37.436 1.00 111.15 ? 34   U   B O4    1 
ATOM   722  C C5    . U   A 1 34  ? 20.874 -6.480  -37.304 1.00 111.34 ? 34   U   B C5    1 
ATOM   723  C C6    . U   A 1 34  ? 20.617 -5.378  -38.017 1.00 111.46 ? 34   U   B C6    1 
ATOM   724  N N     . MET B 2 1   ? 7.296  17.884  -7.563  1.00 95.48  ? 1    MET A N     1 
ATOM   725  C CA    . MET B 2 1   ? 8.253  16.928  -7.137  1.00 94.93  ? 1    MET A CA    1 
ATOM   726  C C     . MET B 2 1   ? 7.394  16.010  -6.481  1.00 93.98  ? 1    MET A C     1 
ATOM   727  O O     . MET B 2 1   ? 7.883  15.403  -5.609  1.00 94.03  ? 1    MET A O     1 
ATOM   728  C CB    . MET B 2 1   ? 9.154  17.491  -6.096  1.00 95.81  ? 1    MET A CB    1 
ATOM   729  C CG    . MET B 2 1   ? 9.547  18.878  -6.408  1.00 97.23  ? 1    MET A CG    1 
ATOM   730  S SD    . MET B 2 1   ? 8.984  19.365  -8.000  1.00 98.96  ? 1    MET A SD    1 
ATOM   731  C CE    . MET B 2 1   ? 7.429  20.164  -7.706  1.00 98.63  ? 1    MET A CE    1 
ATOM   732  N N     . LYS B 2 2   ? 6.089  16.043  -6.817  1.00 92.20  ? 2    LYS A N     1 
ATOM   733  C CA    . LYS B 2 2   ? 5.331  14.953  -7.414  1.00 90.26  ? 2    LYS A CA    1 
ATOM   734  C C     . LYS B 2 2   ? 5.804  14.478  -8.805  1.00 89.04  ? 2    LYS A C     1 
ATOM   735  O O     . LYS B 2 2   ? 6.420  15.176  -9.613  1.00 88.88  ? 2    LYS A O     1 
ATOM   736  C CB    . LYS B 2 2   ? 3.916  14.887  -6.898  1.00 89.82  ? 2    LYS A CB    1 
ATOM   737  C CG    . LYS B 2 2   ? 3.423  13.528  -6.594  1.00 89.07  ? 2    LYS A CG    1 
ATOM   738  C CD    . LYS B 2 2   ? 2.071  13.086  -7.238  1.00 88.69  ? 2    LYS A CD    1 
ATOM   739  C CE    . LYS B 2 2   ? 1.229  14.160  -7.806  1.00 88.11  ? 2    LYS A CE    1 
ATOM   740  N NZ    . LYS B 2 2   ? 1.992  15.294  -8.072  1.00 87.73  ? 2    LYS A NZ    1 
ATOM   741  N N     . VAL B 2 3   ? 5.469  13.221  -9.010  1.00 87.23  ? 3    VAL A N     1 
ATOM   742  C CA    . VAL B 2 3   ? 5.705  12.538  -10.278 1.00 85.21  ? 3    VAL A CA    1 
ATOM   743  C C     . VAL B 2 3   ? 5.077  13.217  -11.497 1.00 83.94  ? 3    VAL A C     1 
ATOM   744  O O     . VAL B 2 3   ? 5.789  13.635  -12.412 1.00 83.67  ? 3    VAL A O     1 
ATOM   745  C CB    . VAL B 2 3   ? 5.217  11.075  -10.207 1.00 84.75  ? 3    VAL A CB    1 
ATOM   746  C CG1   . VAL B 2 3   ? 5.714  10.303  -11.416 1.00 84.35  ? 3    VAL A CG1   1 
ATOM   747  C CG2   . VAL B 2 3   ? 5.718  10.426  -8.932  1.00 83.88  ? 3    VAL A CG2   1 
ATOM   748  N N     . GLU B 2 4   ? 3.750  13.322  -11.509 1.00 82.85  ? 4    GLU A N     1 
ATOM   749  C CA    . GLU B 2 4   ? 3.025  13.946  -12.623 1.00 81.80  ? 4    GLU A CA    1 
ATOM   750  C C     . GLU B 2 4   ? 3.699  15.246  -13.061 1.00 80.00  ? 4    GLU A C     1 
ATOM   751  O O     . GLU B 2 4   ? 3.823  15.533  -14.253 1.00 79.07  ? 4    GLU A O     1 
ATOM   752  C CB    . GLU B 2 4   ? 1.515  13.930  -12.352 1.00 83.05  ? 4    GLU A CB    1 
ATOM   753  C CG    . GLU B 2 4   ? 1.032  14.904  -11.289 1.00 85.26  ? 4    GLU A CG    1 
ATOM   754  C CD    . GLU B 2 4   ? -0.209 14.399  -10.562 1.00 86.77  ? 4    GLU A CD    1 
ATOM   755  O OE1   . GLU B 2 4   ? -0.288 13.180  -10.295 1.00 87.32  ? 4    GLU A OE1   1 
ATOM   756  O OE2   . GLU B 2 4   ? -1.108 15.216  -10.263 1.00 86.86  ? 4    GLU A OE2   1 
ATOM   757  N N     . GLU B 2 5   ? 4.125  16.028  -12.074 1.00 78.37  ? 5    GLU A N     1 
ATOM   758  C CA    . GLU B 2 5   ? 4.763  17.318  -12.307 1.00 76.43  ? 5    GLU A CA    1 
ATOM   759  C C     . GLU B 2 5   ? 6.010  17.171  -13.164 1.00 74.03  ? 5    GLU A C     1 
ATOM   760  O O     . GLU B 2 5   ? 6.173  17.856  -14.174 1.00 73.82  ? 5    GLU A O     1 
ATOM   761  C CB    . GLU B 2 5   ? 5.145  17.959  -10.968 1.00 78.34  ? 5    GLU A CB    1 
ATOM   762  C CG    . GLU B 2 5   ? 4.103  17.809  -9.852  1.00 81.27  ? 5    GLU A CG    1 
ATOM   763  C CD    . GLU B 2 5   ? 2.850  18.649  -10.066 1.00 82.61  ? 5    GLU A CD    1 
ATOM   764  O OE1   . GLU B 2 5   ? 2.154  18.446  -11.084 1.00 83.03  ? 5    GLU A OE1   1 
ATOM   765  O OE2   . GLU B 2 5   ? 2.559  19.511  -9.207  1.00 82.83  ? 5    GLU A OE2   1 
ATOM   766  N N     . ILE B 2 6   ? 6.889  16.268  -12.741 1.00 71.04  ? 6    ILE A N     1 
ATOM   767  C CA    . ILE B 2 6   ? 8.146  16.012  -13.431 1.00 67.67  ? 6    ILE A CA    1 
ATOM   768  C C     . ILE B 2 6   ? 7.926  15.450  -14.832 1.00 65.54  ? 6    ILE A C     1 
ATOM   769  O O     . ILE B 2 6   ? 8.530  15.908  -15.798 1.00 64.84  ? 6    ILE A O     1 
ATOM   770  C CB    . ILE B 2 6   ? 9.018  15.014  -12.627 1.00 67.59  ? 6    ILE A CB    1 
ATOM   771  C CG1   . ILE B 2 6   ? 9.191  15.511  -11.190 1.00 67.78  ? 6    ILE A CG1   1 
ATOM   772  C CG2   . ILE B 2 6   ? 10.371 14.839  -13.294 1.00 67.46  ? 6    ILE A CG2   1 
ATOM   773  C CD1   . ILE B 2 6   ? 9.787  16.893  -11.083 1.00 67.91  ? 6    ILE A CD1   1 
ATOM   774  N N     . LEU B 2 7   ? 7.049  14.462  -14.940 1.00 63.19  ? 7    LEU A N     1 
ATOM   775  C CA    . LEU B 2 7   ? 6.792  13.842  -16.225 1.00 61.94  ? 7    LEU A CA    1 
ATOM   776  C C     . LEU B 2 7   ? 6.335  14.847  -17.282 1.00 62.77  ? 7    LEU A C     1 
ATOM   777  O O     . LEU B 2 7   ? 6.668  14.714  -18.463 1.00 62.64  ? 7    LEU A O     1 
ATOM   778  C CB    . LEU B 2 7   ? 5.776  12.714  -16.053 1.00 58.90  ? 7    LEU A CB    1 
ATOM   779  C CG    . LEU B 2 7   ? 6.207  11.652  -15.033 1.00 56.04  ? 7    LEU A CG    1 
ATOM   780  C CD1   . LEU B 2 7   ? 5.218  10.499  -15.030 1.00 54.60  ? 7    LEU A CD1   1 
ATOM   781  C CD2   . LEU B 2 7   ? 7.593  11.138  -15.375 1.00 54.51  ? 7    LEU A CD2   1 
ATOM   782  N N     . GLU B 2 8   ? 5.574  15.853  -16.869 1.00 63.48  ? 8    GLU A N     1 
ATOM   783  C CA    . GLU B 2 8   ? 5.130  16.868  -17.813 1.00 64.60  ? 8    GLU A CA    1 
ATOM   784  C C     . GLU B 2 8   ? 6.366  17.587  -18.338 1.00 64.03  ? 8    GLU A C     1 
ATOM   785  O O     . GLU B 2 8   ? 6.550  17.750  -19.543 1.00 64.13  ? 8    GLU A O     1 
ATOM   786  C CB    . GLU B 2 8   ? 4.195  17.870  -17.131 1.00 66.67  ? 8    GLU A CB    1 
ATOM   787  C CG    . GLU B 2 8   ? 2.790  17.341  -16.901 1.00 71.18  ? 8    GLU A CG    1 
ATOM   788  C CD    . GLU B 2 8   ? 2.026  17.127  -18.197 1.00 73.32  ? 8    GLU A CD    1 
ATOM   789  O OE1   . GLU B 2 8   ? 0.925  16.544  -18.146 1.00 73.79  ? 8    GLU A OE1   1 
ATOM   790  O OE2   . GLU B 2 8   ? 2.520  17.546  -19.268 1.00 75.06  ? 8    GLU A OE2   1 
ATOM   791  N N     . LYS B 2 9   ? 7.227  18.000  -17.419 1.00 63.22  ? 9    LYS A N     1 
ATOM   792  C CA    . LYS B 2 9   ? 8.445  18.702  -17.784 1.00 62.65  ? 9    LYS A CA    1 
ATOM   793  C C     . LYS B 2 9   ? 9.388  17.782  -18.557 1.00 61.12  ? 9    LYS A C     1 
ATOM   794  O O     . LYS B 2 9   ? 10.202 18.247  -19.353 1.00 60.65  ? 9    LYS A O     1 
ATOM   795  C CB    . LYS B 2 9   ? 9.133  19.221  -16.519 1.00 64.56  ? 9    LYS A CB    1 
ATOM   796  C CG    . LYS B 2 9   ? 8.221  20.048  -15.623 1.00 67.06  ? 9    LYS A CG    1 
ATOM   797  C CD    . LYS B 2 9   ? 8.818  20.236  -14.232 1.00 68.99  ? 9    LYS A CD    1 
ATOM   798  C CE    . LYS B 2 9   ? 7.854  20.968  -13.303 1.00 69.88  ? 9    LYS A CE    1 
ATOM   799  N NZ    . LYS B 2 9   ? 8.350  20.998  -11.897 1.00 69.89  ? 9    LYS A NZ    1 
ATOM   800  N N     . ALA B 2 10  ? 9.262  16.478  -18.325 1.00 59.52  ? 10   ALA A N     1 
ATOM   801  C CA    . ALA B 2 10  ? 10.117 15.489  -18.979 1.00 58.22  ? 10   ALA A CA    1 
ATOM   802  C C     . ALA B 2 10  ? 9.781  15.296  -20.446 1.00 57.87  ? 10   ALA A C     1 
ATOM   803  O O     . ALA B 2 10  ? 10.677 15.139  -21.276 1.00 56.79  ? 10   ALA A O     1 
ATOM   804  C CB    . ALA B 2 10  ? 10.032 14.148  -18.248 1.00 58.13  ? 10   ALA A CB    1 
ATOM   805  N N     . LEU B 2 11  ? 8.490  15.292  -20.762 1.00 58.12  ? 11   LEU A N     1 
ATOM   806  C CA    . LEU B 2 11  ? 8.050  15.125  -22.140 1.00 59.08  ? 11   LEU A CA    1 
ATOM   807  C C     . LEU B 2 11  ? 8.797  16.123  -23.002 1.00 60.18  ? 11   LEU A C     1 
ATOM   808  O O     . LEU B 2 11  ? 9.081  15.874  -24.173 1.00 60.63  ? 11   LEU A O     1 
ATOM   809  C CB    . LEU B 2 11  ? 6.547  15.381  -22.251 1.00 58.54  ? 11   LEU A CB    1 
ATOM   810  C CG    . LEU B 2 11  ? 5.652  14.313  -21.623 1.00 59.37  ? 11   LEU A CG    1 
ATOM   811  C CD1   . LEU B 2 11  ? 4.229  14.837  -21.503 1.00 57.87  ? 11   LEU A CD1   1 
ATOM   812  C CD2   . LEU B 2 11  ? 5.708  13.044  -22.474 1.00 59.27  ? 11   LEU A CD2   1 
ATOM   813  N N     . GLU B 2 12  ? 9.119  17.255  -22.391 1.00 60.45  ? 12   GLU A N     1 
ATOM   814  C CA    . GLU B 2 12  ? 9.824  18.336  -23.050 1.00 60.79  ? 12   GLU A CA    1 
ATOM   815  C C     . GLU B 2 12  ? 11.166 17.891  -23.615 1.00 60.68  ? 12   GLU A C     1 
ATOM   816  O O     . GLU B 2 12  ? 11.574 18.341  -24.683 1.00 61.63  ? 12   GLU A O     1 
ATOM   817  C CB    . GLU B 2 12  ? 10.036 19.465  -22.049 1.00 62.39  ? 12   GLU A CB    1 
ATOM   818  C CG    . GLU B 2 12  ? 10.282 20.816  -22.657 1.00 64.38  ? 12   GLU A CG    1 
ATOM   819  C CD    . GLU B 2 12  ? 9.408  21.875  -22.020 1.00 66.27  ? 12   GLU A CD    1 
ATOM   820  O OE1   . GLU B 2 12  ? 8.173  21.826  -22.223 1.00 66.40  ? 12   GLU A OE1   1 
ATOM   821  O OE2   . GLU B 2 12  ? 9.951  22.748  -21.307 1.00 67.60  ? 12   GLU A OE2   1 
ATOM   822  N N     . LEU B 2 13  ? 11.847 17.000  -22.900 1.00 59.90  ? 13   LEU A N     1 
ATOM   823  C CA    . LEU B 2 13  ? 13.159 16.509  -23.317 1.00 58.46  ? 13   LEU A CA    1 
ATOM   824  C C     . LEU B 2 13  ? 13.107 15.282  -24.230 1.00 57.94  ? 13   LEU A C     1 
ATOM   825  O O     . LEU B 2 13  ? 14.017 15.063  -25.027 1.00 58.11  ? 13   LEU A O     1 
ATOM   826  C CB    . LEU B 2 13  ? 13.995 16.157  -22.083 1.00 58.60  ? 13   LEU A CB    1 
ATOM   827  C CG    . LEU B 2 13  ? 14.075 17.158  -20.927 1.00 59.34  ? 13   LEU A CG    1 
ATOM   828  C CD1   . LEU B 2 13  ? 14.703 16.488  -19.705 1.00 58.81  ? 13   LEU A CD1   1 
ATOM   829  C CD2   . LEU B 2 13  ? 14.883 18.376  -21.359 1.00 58.95  ? 13   LEU A CD2   1 
ATOM   830  N N     . VAL B 2 14  ? 12.049 14.484  -24.107 1.00 57.13  ? 14   VAL A N     1 
ATOM   831  C CA    . VAL B 2 14  ? 11.909 13.259  -24.896 1.00 56.69  ? 14   VAL A CA    1 
ATOM   832  C C     . VAL B 2 14  ? 11.155 13.395  -26.223 1.00 57.38  ? 14   VAL A C     1 
ATOM   833  O O     . VAL B 2 14  ? 11.469 12.707  -27.196 1.00 56.72  ? 14   VAL A O     1 
ATOM   834  C CB    . VAL B 2 14  ? 11.222 12.133  -24.056 1.00 56.09  ? 14   VAL A CB    1 
ATOM   835  C CG1   . VAL B 2 14  ? 12.051 11.826  -22.818 1.00 56.01  ? 14   VAL A CG1   1 
ATOM   836  C CG2   . VAL B 2 14  ? 9.807  12.549  -23.650 1.00 55.41  ? 14   VAL A CG2   1 
ATOM   837  N N     . ILE B 2 15  ? 10.161 14.275  -26.267 1.00 58.41  ? 15   ILE A N     1 
ATOM   838  C CA    . ILE B 2 15  ? 9.374  14.454  -27.480 1.00 59.21  ? 15   ILE A CA    1 
ATOM   839  C C     . ILE B 2 15  ? 10.024 15.405  -28.473 1.00 59.60  ? 15   ILE A C     1 
ATOM   840  O O     . ILE B 2 15  ? 10.553 16.448  -28.094 1.00 60.00  ? 15   ILE A O     1 
ATOM   841  C CB    . ILE B 2 15  ? 7.966  14.992  -27.164 1.00 59.02  ? 15   ILE A CB    1 
ATOM   842  C CG1   . ILE B 2 15  ? 7.243  14.039  -26.215 1.00 58.87  ? 15   ILE A CG1   1 
ATOM   843  C CG2   . ILE B 2 15  ? 7.167  15.153  -28.453 1.00 58.86  ? 15   ILE A CG2   1 
ATOM   844  C CD1   . ILE B 2 15  ? 5.869  14.529  -25.798 1.00 59.58  ? 15   ILE A CD1   1 
ATOM   845  N N     . PRO B 2 16  ? 9.991  15.049  -29.765 1.00 59.98  ? 16   PRO A N     1 
ATOM   846  C CA    . PRO B 2 16  ? 10.570 15.864  -30.837 1.00 60.25  ? 16   PRO A CA    1 
ATOM   847  C C     . PRO B 2 16  ? 9.806  17.174  -30.990 1.00 61.02  ? 16   PRO A C     1 
ATOM   848  O O     . PRO B 2 16  ? 8.575  17.187  -30.914 1.00 60.56  ? 16   PRO A O     1 
ATOM   849  C CB    . PRO B 2 16  ? 10.408 14.979  -32.070 1.00 60.50  ? 16   PRO A CB    1 
ATOM   850  C CG    . PRO B 2 16  ? 10.442 13.586  -31.505 1.00 60.91  ? 16   PRO A CG    1 
ATOM   851  C CD    . PRO B 2 16  ? 9.589  13.724  -30.275 1.00 60.30  ? 16   PRO A CD    1 
ATOM   852  N N     . ASP B 2 17  ? 10.529 18.274  -31.198 1.00 62.58  ? 17   ASP A N     1 
ATOM   853  C CA    . ASP B 2 17  ? 9.896  19.578  -31.392 1.00 63.89  ? 17   ASP A CA    1 
ATOM   854  C C     . ASP B 2 17  ? 9.280  19.568  -32.789 1.00 64.72  ? 17   ASP A C     1 
ATOM   855  O O     . ASP B 2 17  ? 9.562  18.669  -33.581 1.00 63.95  ? 17   ASP A O     1 
ATOM   856  C CB    . ASP B 2 17  ? 10.932 20.701  -31.269 1.00 64.00  ? 17   ASP A CB    1 
ATOM   857  C CG    . ASP B 2 17  ? 12.045 20.586  -32.293 1.00 64.45  ? 17   ASP A CG    1 
ATOM   858  O OD1   . ASP B 2 17  ? 13.047 21.323  -32.173 1.00 63.77  ? 17   ASP A OD1   1 
ATOM   859  O OD2   . ASP B 2 17  ? 11.920 19.761  -33.223 1.00 64.76  ? 17   ASP A OD2   1 
ATOM   860  N N     . GLU B 2 18  ? 8.452  20.560  -33.099 1.00 66.34  ? 18   GLU A N     1 
ATOM   861  C CA    . GLU B 2 18  ? 7.794  20.613  -34.405 1.00 68.26  ? 18   GLU A CA    1 
ATOM   862  C C     . GLU B 2 18  ? 8.722  20.608  -35.632 1.00 68.26  ? 18   GLU A C     1 
ATOM   863  O O     . GLU B 2 18  ? 8.388  20.013  -36.659 1.00 68.21  ? 18   GLU A O     1 
ATOM   864  C CB    . GLU B 2 18  ? 6.848  21.817  -34.461 1.00 70.02  ? 18   GLU A CB    1 
ATOM   865  C CG    . GLU B 2 18  ? 5.727  21.742  -33.430 1.00 73.37  ? 18   GLU A CG    1 
ATOM   866  C CD    . GLU B 2 18  ? 4.699  22.850  -33.582 1.00 75.60  ? 18   GLU A CD    1 
ATOM   867  O OE1   . GLU B 2 18  ? 5.086  24.038  -33.527 1.00 76.28  ? 18   GLU A OE1   1 
ATOM   868  O OE2   . GLU B 2 18  ? 3.500  22.531  -33.752 1.00 76.30  ? 18   GLU A OE2   1 
ATOM   869  N N     . GLU B 2 19  ? 9.880  21.256  -35.533 1.00 68.22  ? 19   GLU A N     1 
ATOM   870  C CA    . GLU B 2 19  ? 10.811 21.285  -36.660 1.00 67.84  ? 19   GLU A CA    1 
ATOM   871  C C     . GLU B 2 19  ? 11.391 19.903  -36.944 1.00 66.77  ? 19   GLU A C     1 
ATOM   872  O O     . GLU B 2 19  ? 11.554 19.525  -38.106 1.00 66.39  ? 19   GLU A O     1 
ATOM   873  C CB    . GLU B 2 19  ? 11.957 22.282  -36.420 1.00 68.70  ? 19   GLU A CB    1 
ATOM   874  C CG    . GLU B 2 19  ? 12.029 22.866  -35.019 1.00 71.51  ? 19   GLU A CG    1 
ATOM   875  C CD    . GLU B 2 19  ? 10.885 23.825  -34.713 1.00 73.41  ? 19   GLU A CD    1 
ATOM   876  O OE1   . GLU B 2 19  ? 10.829 24.329  -33.569 1.00 73.66  ? 19   GLU A OE1   1 
ATOM   877  O OE2   . GLU B 2 19  ? 10.047 24.077  -35.610 1.00 73.14  ? 19   GLU A OE2   1 
ATOM   878  N N     . GLU B 2 20  ? 11.703 19.148  -35.892 1.00 64.93  ? 20   GLU A N     1 
ATOM   879  C CA    . GLU B 2 20  ? 12.260 17.816  -36.080 1.00 63.18  ? 20   GLU A CA    1 
ATOM   880  C C     . GLU B 2 20  ? 11.191 16.903  -36.674 1.00 61.91  ? 20   GLU A C     1 
ATOM   881  O O     . GLU B 2 20  ? 11.486 16.037  -37.501 1.00 61.51  ? 20   GLU A O     1 
ATOM   882  C CB    . GLU B 2 20  ? 12.774 17.239  -34.757 1.00 63.57  ? 20   GLU A CB    1 
ATOM   883  C CG    . GLU B 2 20  ? 13.433 15.867  -34.917 1.00 65.73  ? 20   GLU A CG    1 
ATOM   884  C CD    . GLU B 2 20  ? 14.003 15.307  -33.619 1.00 66.98  ? 20   GLU A CD    1 
ATOM   885  O OE1   . GLU B 2 20  ? 13.241 15.154  -32.645 1.00 67.91  ? 20   GLU A OE1   1 
ATOM   886  O OE2   . GLU B 2 20  ? 15.217 15.010  -33.575 1.00 68.16  ? 20   GLU A OE2   1 
ATOM   887  N N     . VAL B 2 21  ? 9.946  17.109  -36.258 1.00 59.87  ? 21   VAL A N     1 
ATOM   888  C CA    . VAL B 2 21  ? 8.840  16.312  -36.767 1.00 58.75  ? 21   VAL A CA    1 
ATOM   889  C C     . VAL B 2 21  ? 8.672  16.572  -38.259 1.00 58.83  ? 21   VAL A C     1 
ATOM   890  O O     . VAL B 2 21  ? 8.759  15.655  -39.075 1.00 58.42  ? 21   VAL A O     1 
ATOM   891  C CB    . VAL B 2 21  ? 7.530  16.670  -36.051 1.00 58.25  ? 21   VAL A CB    1 
ATOM   892  C CG1   . VAL B 2 21  ? 6.354  16.001  -36.748 1.00 57.54  ? 21   VAL A CG1   1 
ATOM   893  C CG2   . VAL B 2 21  ? 7.611  16.235  -34.594 1.00 57.75  ? 21   VAL A CG2   1 
ATOM   894  N N     . ARG B 2 22  ? 8.423  17.833  -38.599 1.00 58.92  ? 22   ARG A N     1 
ATOM   895  C CA    . ARG B 2 22  ? 8.258  18.253  -39.984 1.00 59.78  ? 22   ARG A CA    1 
ATOM   896  C C     . ARG B 2 22  ? 9.411  17.726  -40.837 1.00 58.72  ? 22   ARG A C     1 
ATOM   897  O O     . ARG B 2 22  ? 9.207  17.057  -41.853 1.00 58.83  ? 22   ARG A O     1 
ATOM   898  C CB    . ARG B 2 22  ? 8.216  19.781  -40.050 1.00 62.28  ? 22   ARG A CB    1 
ATOM   899  C CG    . ARG B 2 22  ? 8.239  20.361  -41.453 1.00 65.53  ? 22   ARG A CG    1 
ATOM   900  C CD    . ARG B 2 22  ? 8.206  21.881  -41.403 1.00 68.04  ? 22   ARG A CD    1 
ATOM   901  N NE    . ARG B 2 22  ? 9.236  22.416  -40.514 1.00 70.31  ? 22   ARG A NE    1 
ATOM   902  C CZ    . ARG B 2 22  ? 10.544 22.327  -40.738 1.00 71.69  ? 22   ARG A CZ    1 
ATOM   903  N NH1   . ARG B 2 22  ? 10.994 21.725  -41.833 1.00 71.84  ? 22   ARG A NH1   1 
ATOM   904  N NH2   . ARG B 2 22  ? 11.404 22.830  -39.860 1.00 71.57  ? 22   ARG A NH2   1 
ATOM   905  N N     . LYS B 2 23  ? 10.626 18.035  -40.411 1.00 57.75  ? 23   LYS A N     1 
ATOM   906  C CA    . LYS B 2 23  ? 11.822 17.599  -41.111 1.00 56.71  ? 23   LYS A CA    1 
ATOM   907  C C     . LYS B 2 23  ? 11.709 16.121  -41.481 1.00 55.88  ? 23   LYS A C     1 
ATOM   908  O O     . LYS B 2 23  ? 12.057 15.726  -42.590 1.00 56.08  ? 23   LYS A O     1 
ATOM   909  C CB    . LYS B 2 23  ? 13.042 17.841  -40.217 1.00 57.57  ? 23   LYS A CB    1 
ATOM   910  C CG    . LYS B 2 23  ? 14.386 17.630  -40.876 1.00 58.19  ? 23   LYS A CG    1 
ATOM   911  C CD    . LYS B 2 23  ? 15.503 18.044  -39.933 1.00 58.92  ? 23   LYS A CD    1 
ATOM   912  C CE    . LYS B 2 23  ? 16.876 17.771  -40.532 1.00 60.61  ? 23   LYS A CE    1 
ATOM   913  N NZ    . LYS B 2 23  ? 17.972 18.139  -39.592 1.00 60.77  ? 23   LYS A NZ    1 
ATOM   914  N N     . GLY B 2 24  ? 11.204 15.311  -40.555 1.00 54.79  ? 24   GLY A N     1 
ATOM   915  C CA    . GLY B 2 24  ? 11.057 13.887  -40.810 1.00 54.67  ? 24   GLY A CA    1 
ATOM   916  C C     . GLY B 2 24  ? 9.892  13.578  -41.731 1.00 54.90  ? 24   GLY A C     1 
ATOM   917  O O     . GLY B 2 24  ? 9.992  12.749  -42.642 1.00 54.07  ? 24   GLY A O     1 
ATOM   918  N N     . ARG B 2 25  ? 8.774  14.244  -41.484 1.00 55.91  ? 25   ARG A N     1 
ATOM   919  C CA    . ARG B 2 25  ? 7.591  14.057  -42.307 1.00 57.09  ? 25   ARG A CA    1 
ATOM   920  C C     . ARG B 2 25  ? 7.953  14.347  -43.758 1.00 56.00  ? 25   ARG A C     1 
ATOM   921  O O     . ARG B 2 25  ? 7.705  13.531  -44.647 1.00 55.59  ? 25   ARG A O     1 
ATOM   922  C CB    . ARG B 2 25  ? 6.479  15.010  -41.857 1.00 59.35  ? 25   ARG A CB    1 
ATOM   923  C CG    . ARG B 2 25  ? 5.820  14.641  -40.538 1.00 62.66  ? 25   ARG A CG    1 
ATOM   924  C CD    . ARG B 2 25  ? 4.878  13.465  -40.715 1.00 66.20  ? 25   ARG A CD    1 
ATOM   925  N NE    . ARG B 2 25  ? 4.221  13.084  -39.468 1.00 69.20  ? 25   ARG A NE    1 
ATOM   926  C CZ    . ARG B 2 25  ? 4.851  12.565  -38.419 1.00 71.77  ? 25   ARG A CZ    1 
ATOM   927  N NH1   . ARG B 2 25  ? 6.163  12.362  -38.461 1.00 73.03  ? 25   ARG A NH1   1 
ATOM   928  N NH2   . ARG B 2 25  ? 4.169  12.244  -37.328 1.00 71.97  ? 25   ARG A NH2   1 
ATOM   929  N N     . GLU B 2 26  ? 8.547  15.512  -43.994 1.00 54.97  ? 26   GLU A N     1 
ATOM   930  C CA    . GLU B 2 26  ? 8.926  15.902  -45.345 1.00 55.01  ? 26   GLU A CA    1 
ATOM   931  C C     . GLU B 2 26  ? 9.810  14.876  -46.042 1.00 53.85  ? 26   GLU A C     1 
ATOM   932  O O     . GLU B 2 26  ? 9.692  14.661  -47.254 1.00 53.36  ? 26   GLU A O     1 
ATOM   933  C CB    . GLU B 2 26  ? 9.609  17.271  -45.320 1.00 55.95  ? 26   GLU A CB    1 
ATOM   934  C CG    . GLU B 2 26  ? 8.624  18.430  -45.430 1.00 57.95  ? 26   GLU A CG    1 
ATOM   935  C CD    . GLU B 2 26  ? 9.256  19.771  -45.119 1.00 59.39  ? 26   GLU A CD    1 
ATOM   936  O OE1   . GLU B 2 26  ? 10.467 19.931  -45.398 1.00 60.83  ? 26   GLU A OE1   1 
ATOM   937  O OE2   . GLU B 2 26  ? 8.537  20.661  -44.607 1.00 58.67  ? 26   GLU A OE2   1 
ATOM   938  N N     . ALA B 2 27  ? 10.683 14.235  -45.273 1.00 52.42  ? 27   ALA A N     1 
ATOM   939  C CA    . ALA B 2 27  ? 11.573 13.229  -45.823 1.00 52.17  ? 27   ALA A CA    1 
ATOM   940  C C     . ALA B 2 27  ? 10.788 11.957  -46.134 1.00 52.42  ? 27   ALA A C     1 
ATOM   941  O O     . ALA B 2 27  ? 11.052 11.279  -47.130 1.00 52.38  ? 27   ALA A O     1 
ATOM   942  C CB    . ALA B 2 27  ? 12.693 12.934  -44.841 1.00 51.81  ? 27   ALA A CB    1 
ATOM   943  N N     . GLU B 2 28  ? 9.831  11.622  -45.274 1.00 52.06  ? 28   GLU A N     1 
ATOM   944  C CA    . GLU B 2 28  ? 9.010  10.439  -45.504 1.00 51.27  ? 28   GLU A CA    1 
ATOM   945  C C     . GLU B 2 28  ? 8.235  10.658  -46.811 1.00 51.63  ? 28   GLU A C     1 
ATOM   946  O O     . GLU B 2 28  ? 8.140  9.764   -47.654 1.00 50.74  ? 28   GLU A O     1 
ATOM   947  C CB    . GLU B 2 28  ? 8.044  10.227  -44.330 1.00 50.04  ? 28   GLU A CB    1 
ATOM   948  C CG    . GLU B 2 28  ? 6.903  9.260   -44.632 1.00 50.25  ? 28   GLU A CG    1 
ATOM   949  C CD    . GLU B 2 28  ? 5.904  9.111   -43.486 1.00 49.49  ? 28   GLU A CD    1 
ATOM   950  O OE1   . GLU B 2 28  ? 5.723  10.088  -42.721 1.00 49.30  ? 28   GLU A OE1   1 
ATOM   951  O OE2   . GLU B 2 28  ? 5.290  8.021   -43.366 1.00 46.58  ? 28   GLU A OE2   1 
ATOM   952  N N     . GLU B 2 29  ? 7.693  11.861  -46.978 1.00 53.10  ? 29   GLU A N     1 
ATOM   953  C CA    . GLU B 2 29  ? 6.937  12.195  -48.181 1.00 54.79  ? 29   GLU A CA    1 
ATOM   954  C C     . GLU B 2 29  ? 7.807  11.986  -49.422 1.00 54.26  ? 29   GLU A C     1 
ATOM   955  O O     . GLU B 2 29  ? 7.424  11.256  -50.339 1.00 53.70  ? 29   GLU A O     1 
ATOM   956  C CB    . GLU B 2 29  ? 6.457  13.650  -48.125 1.00 58.34  ? 29   GLU A CB    1 
ATOM   957  C CG    . GLU B 2 29  ? 5.645  14.092  -49.340 1.00 64.02  ? 29   GLU A CG    1 
ATOM   958  C CD    . GLU B 2 29  ? 4.330  13.333  -49.487 1.00 68.17  ? 29   GLU A CD    1 
ATOM   959  O OE1   . GLU B 2 29  ? 3.608  13.578  -50.479 1.00 69.29  ? 29   GLU A OE1   1 
ATOM   960  O OE2   . GLU B 2 29  ? 4.013  12.494  -48.613 1.00 69.58  ? 29   GLU A OE2   1 
ATOM   961  N N     . GLU B 2 30  ? 8.980  12.617  -49.442 1.00 52.96  ? 30   GLU A N     1 
ATOM   962  C CA    . GLU B 2 30  ? 9.891  12.494  -50.575 1.00 52.35  ? 30   GLU A CA    1 
ATOM   963  C C     . GLU B 2 30  ? 10.328 11.048  -50.797 1.00 51.62  ? 30   GLU A C     1 
ATOM   964  O O     . GLU B 2 30  ? 10.362 10.545  -51.924 1.00 52.28  ? 30   GLU A O     1 
ATOM   965  C CB    . GLU B 2 30  ? 11.127 13.368  -50.360 1.00 52.72  ? 30   GLU A CB    1 
ATOM   966  C CG    . GLU B 2 30  ? 12.120 13.289  -51.514 1.00 55.29  ? 30   GLU A CG    1 
ATOM   967  C CD    . GLU B 2 30  ? 11.510 13.679  -52.859 1.00 55.64  ? 30   GLU A CD    1 
ATOM   968  O OE1   . GLU B 2 30  ? 12.126 13.368  -53.895 1.00 55.08  ? 30   GLU A OE1   1 
ATOM   969  O OE2   . GLU B 2 30  ? 10.423 14.299  -52.880 1.00 56.94  ? 30   GLU A OE2   1 
ATOM   970  N N     . LEU B 2 31  ? 10.658 10.376  -49.708 1.00 50.40  ? 31   LEU A N     1 
ATOM   971  C CA    . LEU B 2 31  ? 11.091 8.999   -49.787 1.00 49.54  ? 31   LEU A CA    1 
ATOM   972  C C     . LEU B 2 31  ? 10.020 8.097   -50.407 1.00 48.41  ? 31   LEU A C     1 
ATOM   973  O O     . LEU B 2 31  ? 10.338 7.193   -51.177 1.00 47.79  ? 31   LEU A O     1 
ATOM   974  C CB    . LEU B 2 31  ? 11.482 8.523   -48.391 1.00 48.93  ? 31   LEU A CB    1 
ATOM   975  C CG    . LEU B 2 31  ? 12.058 7.124   -48.241 1.00 47.20  ? 31   LEU A CG    1 
ATOM   976  C CD1   . LEU B 2 31  ? 13.085 6.861   -49.324 1.00 46.95  ? 31   LEU A CD1   1 
ATOM   977  C CD2   . LEU B 2 31  ? 12.672 7.008   -46.855 1.00 47.37  ? 31   LEU A CD2   1 
ATOM   978  N N     . ARG B 2 32  ? 8.754  8.340   -50.084 1.00 48.92  ? 32   ARG A N     1 
ATOM   979  C CA    . ARG B 2 32  ? 7.673  7.534   -50.656 1.00 50.24  ? 32   ARG A CA    1 
ATOM   980  C C     . ARG B 2 32  ? 7.569  7.782   -52.158 1.00 49.91  ? 32   ARG A C     1 
ATOM   981  O O     . ARG B 2 32  ? 7.507  6.841   -52.950 1.00 49.03  ? 32   ARG A O     1 
ATOM   982  C CB    . ARG B 2 32  ? 6.329  7.865   -49.998 1.00 51.90  ? 32   ARG A CB    1 
ATOM   983  C CG    . ARG B 2 32  ? 6.154  7.304   -48.589 1.00 54.68  ? 32   ARG A CG    1 
ATOM   984  C CD    . ARG B 2 32  ? 4.905  6.429   -48.497 1.00 56.96  ? 32   ARG A CD    1 
ATOM   985  N NE    . ARG B 2 32  ? 4.788  5.780   -47.195 1.00 56.74  ? 32   ARG A NE    1 
ATOM   986  C CZ    . ARG B 2 32  ? 4.635  6.434   -46.051 1.00 56.83  ? 32   ARG A CZ    1 
ATOM   987  N NH1   . ARG B 2 32  ? 4.577  7.758   -46.047 1.00 56.94  ? 32   ARG A NH1   1 
ATOM   988  N NH2   . ARG B 2 32  ? 4.549  5.764   -44.912 1.00 56.86  ? 32   ARG A NH2   1 
ATOM   989  N N     . ARG B 2 33  ? 7.555  9.053   -52.545 1.00 49.60  ? 33   ARG A N     1 
ATOM   990  C CA    . ARG B 2 33  ? 7.465  9.405   -53.956 1.00 50.62  ? 33   ARG A CA    1 
ATOM   991  C C     . ARG B 2 33  ? 8.573  8.738   -54.759 1.00 51.19  ? 33   ARG A C     1 
ATOM   992  O O     . ARG B 2 33  ? 8.299  8.031   -55.729 1.00 52.65  ? 33   ARG A O     1 
ATOM   993  C CB    . ARG B 2 33  ? 7.559  10.915  -54.132 1.00 50.67  ? 33   ARG A CB    1 
ATOM   994  C CG    . ARG B 2 33  ? 6.340  11.684  -53.687 1.00 50.07  ? 33   ARG A CG    1 
ATOM   995  C CD    . ARG B 2 33  ? 6.748  13.104  -53.381 1.00 51.04  ? 33   ARG A CD    1 
ATOM   996  N NE    . ARG B 2 33  ? 5.616  13.976  -53.122 1.00 53.07  ? 33   ARG A NE    1 
ATOM   997  C CZ    . ARG B 2 33  ? 5.738  15.235  -52.721 1.00 55.65  ? 33   ARG A CZ    1 
ATOM   998  N NH1   . ARG B 2 33  ? 6.950  15.745  -52.529 1.00 57.56  ? 33   ARG A NH1   1 
ATOM   999  N NH2   . ARG B 2 33  ? 4.659  15.992  -52.533 1.00 55.43  ? 33   ARG A NH2   1 
ATOM   1000 N N     . ARG B 2 34  ? 9.821  8.966   -54.353 1.00 50.22  ? 34   ARG A N     1 
ATOM   1001 C CA    . ARG B 2 34  ? 10.962 8.383   -55.046 1.00 49.66  ? 34   ARG A CA    1 
ATOM   1002 C C     . ARG B 2 34  ? 10.810 6.875   -55.173 1.00 49.97  ? 34   ARG A C     1 
ATOM   1003 O O     . ARG B 2 34  ? 11.131 6.296   -56.214 1.00 51.24  ? 34   ARG A O     1 
ATOM   1004 C CB    . ARG B 2 34  ? 12.262 8.702   -54.314 1.00 48.20  ? 34   ARG A CB    1 
ATOM   1005 C CG    . ARG B 2 34  ? 12.592 10.171  -54.234 1.00 47.81  ? 34   ARG A CG    1 
ATOM   1006 C CD    . ARG B 2 34  ? 13.982 10.361  -53.655 1.00 48.33  ? 34   ARG A CD    1 
ATOM   1007 N NE    . ARG B 2 34  ? 14.272 11.753  -53.312 1.00 48.75  ? 34   ARG A NE    1 
ATOM   1008 C CZ    . ARG B 2 34  ? 15.440 12.169  -52.824 1.00 48.18  ? 34   ARG A CZ    1 
ATOM   1009 N NH1   . ARG B 2 34  ? 16.424 11.295  -52.630 1.00 46.56  ? 34   ARG A NH1   1 
ATOM   1010 N NH2   . ARG B 2 34  ? 15.622 13.450  -52.522 1.00 45.21  ? 34   ARG A NH2   1 
ATOM   1011 N N     . LEU B 2 35  ? 10.317 6.241   -54.113 1.00 49.55  ? 35   LEU A N     1 
ATOM   1012 C CA    . LEU B 2 35  ? 10.118 4.793   -54.122 1.00 49.53  ? 35   LEU A CA    1 
ATOM   1013 C C     . LEU B 2 35  ? 8.964  4.385   -55.022 1.00 49.65  ? 35   LEU A C     1 
ATOM   1014 O O     . LEU B 2 35  ? 9.017  3.336   -55.662 1.00 49.52  ? 35   LEU A O     1 
ATOM   1015 C CB    . LEU B 2 35  ? 9.853  4.278   -52.707 1.00 49.39  ? 35   LEU A CB    1 
ATOM   1016 C CG    . LEU B 2 35  ? 11.071 4.026   -51.826 1.00 48.51  ? 35   LEU A CG    1 
ATOM   1017 C CD1   . LEU B 2 35  ? 10.642 3.952   -50.369 1.00 49.66  ? 35   LEU A CD1   1 
ATOM   1018 C CD2   . LEU B 2 35  ? 11.745 2.740   -52.254 1.00 48.21  ? 35   LEU A CD2   1 
ATOM   1019 N N     . ASP B 2 36  ? 7.919  5.206   -55.068 1.00 50.50  ? 36   ASP A N     1 
ATOM   1020 C CA    . ASP B 2 36  ? 6.765  4.888   -55.901 1.00 52.19  ? 36   ASP A CA    1 
ATOM   1021 C C     . ASP B 2 36  ? 7.069  5.094   -57.382 1.00 53.52  ? 36   ASP A C     1 
ATOM   1022 O O     . ASP B 2 36  ? 6.578  4.345   -58.236 1.00 53.02  ? 36   ASP A O     1 
ATOM   1023 C CB    . ASP B 2 36  ? 5.544  5.727   -55.499 1.00 51.86  ? 36   ASP A CB    1 
ATOM   1024 C CG    . ASP B 2 36  ? 5.030  5.396   -54.097 1.00 52.10  ? 36   ASP A CG    1 
ATOM   1025 O OD1   . ASP B 2 36  ? 5.134  4.219   -53.672 1.00 51.88  ? 36   ASP A OD1   1 
ATOM   1026 O OD2   . ASP B 2 36  ? 4.503  6.314   -53.431 1.00 49.66  ? 36   ASP A OD2   1 
ATOM   1027 N N     . GLU B 2 37  ? 7.881  6.104   -57.689 1.00 54.68  ? 37   GLU A N     1 
ATOM   1028 C CA    . GLU B 2 37  ? 8.237  6.369   -59.076 1.00 55.27  ? 37   GLU A CA    1 
ATOM   1029 C C     . GLU B 2 37  ? 8.978  5.155   -59.614 1.00 54.26  ? 37   GLU A C     1 
ATOM   1030 O O     . GLU B 2 37  ? 9.031  4.931   -60.821 1.00 55.10  ? 37   GLU A O     1 
ATOM   1031 C CB    . GLU B 2 37  ? 9.099  7.629   -59.187 1.00 56.07  ? 37   GLU A CB    1 
ATOM   1032 C CG    . GLU B 2 37  ? 9.543  7.981   -60.611 1.00 60.80  ? 37   GLU A CG    1 
ATOM   1033 C CD    . GLU B 2 37  ? 8.425  7.868   -61.657 1.00 64.00  ? 37   GLU A CD    1 
ATOM   1034 O OE1   . GLU B 2 37  ? 7.276  8.284   -61.372 1.00 65.46  ? 37   GLU A OE1   1 
ATOM   1035 O OE2   . GLU B 2 37  ? 8.707  7.375   -62.777 1.00 63.22  ? 37   GLU A OE2   1 
ATOM   1036 N N     . LEU B 2 38  ? 9.534  4.358   -58.710 1.00 52.92  ? 38   LEU A N     1 
ATOM   1037 C CA    . LEU B 2 38  ? 10.240 3.150   -59.112 1.00 52.36  ? 38   LEU A CA    1 
ATOM   1038 C C     . LEU B 2 38  ? 9.314  1.962   -58.901 1.00 51.64  ? 38   LEU A C     1 
ATOM   1039 O O     . LEU B 2 38  ? 9.648  0.831   -59.245 1.00 51.79  ? 38   LEU A O     1 
ATOM   1040 C CB    . LEU B 2 38  ? 11.521 2.975   -58.295 1.00 52.55  ? 38   LEU A CB    1 
ATOM   1041 C CG    . LEU B 2 38  ? 12.509 4.144   -58.387 1.00 53.84  ? 38   LEU A CG    1 
ATOM   1042 C CD1   . LEU B 2 38  ? 13.764 3.838   -57.585 1.00 54.13  ? 38   LEU A CD1   1 
ATOM   1043 C CD2   . LEU B 2 38  ? 12.866 4.396   -59.844 1.00 55.26  ? 38   LEU A CD2   1 
ATOM   1044 N N     . GLY B 2 39  ? 8.144  2.234   -58.333 1.00 51.12  ? 39   GLY A N     1 
ATOM   1045 C CA    . GLY B 2 39  ? 7.176  1.182   -58.086 1.00 51.13  ? 39   GLY A CA    1 
ATOM   1046 C C     . GLY B 2 39  ? 7.701  0.048   -57.227 1.00 51.81  ? 39   GLY A C     1 
ATOM   1047 O O     . GLY B 2 39  ? 7.464  -1.121  -57.526 1.00 50.84  ? 39   GLY A O     1 
ATOM   1048 N N     . VAL B 2 40  ? 8.405  0.388   -56.151 1.00 52.48  ? 40   VAL A N     1 
ATOM   1049 C CA    . VAL B 2 40  ? 8.964  -0.621  -55.254 1.00 52.74  ? 40   VAL A CA    1 
ATOM   1050 C C     . VAL B 2 40  ? 8.029  -0.947  -54.086 1.00 53.10  ? 40   VAL A C     1 
ATOM   1051 O O     . VAL B 2 40  ? 7.383  -0.059  -53.530 1.00 52.48  ? 40   VAL A O     1 
ATOM   1052 C CB    . VAL B 2 40  ? 10.324 -0.154  -54.672 1.00 53.11  ? 40   VAL A CB    1 
ATOM   1053 C CG1   . VAL B 2 40  ? 10.928 -1.252  -53.806 1.00 53.43  ? 40   VAL A CG1   1 
ATOM   1054 C CG2   . VAL B 2 40  ? 11.273 0.212   -55.801 1.00 52.79  ? 40   VAL A CG2   1 
ATOM   1055 N N     . GLU B 2 41  ? 7.956  -2.225  -53.722 1.00 52.75  ? 41   GLU A N     1 
ATOM   1056 C CA    . GLU B 2 41  ? 7.116  -2.643  -52.609 1.00 52.98  ? 41   GLU A CA    1 
ATOM   1057 C C     . GLU B 2 41  ? 7.916  -2.534  -51.308 1.00 51.69  ? 41   GLU A C     1 
ATOM   1058 O O     . GLU B 2 41  ? 8.849  -3.305  -51.067 1.00 51.98  ? 41   GLU A O     1 
ATOM   1059 C CB    . GLU B 2 41  ? 6.625  -4.077  -52.817 1.00 55.16  ? 41   GLU A CB    1 
ATOM   1060 C CG    . GLU B 2 41  ? 5.816  -4.619  -51.652 1.00 58.91  ? 41   GLU A CG    1 
ATOM   1061 C CD    . GLU B 2 41  ? 5.152  -5.946  -51.966 1.00 62.41  ? 41   GLU A CD    1 
ATOM   1062 O OE1   . GLU B 2 41  ? 5.689  -6.699  -52.809 1.00 64.77  ? 41   GLU A OE1   1 
ATOM   1063 O OE2   . GLU B 2 41  ? 4.101  -6.248  -51.360 1.00 63.54  ? 41   GLU A OE2   1 
ATOM   1064 N N     . TYR B 2 42  ? 7.530  -1.576  -50.470 1.00 50.09  ? 42   TYR A N     1 
ATOM   1065 C CA    . TYR B 2 42  ? 8.218  -1.330  -49.211 1.00 48.53  ? 42   TYR A CA    1 
ATOM   1066 C C     . TYR B 2 42  ? 7.283  -1.117  -48.020 1.00 47.37  ? 42   TYR A C     1 
ATOM   1067 O O     . TYR B 2 42  ? 6.063  -1.080  -48.164 1.00 47.84  ? 42   TYR A O     1 
ATOM   1068 C CB    . TYR B 2 42  ? 9.089  -0.094  -49.372 1.00 47.55  ? 42   TYR A CB    1 
ATOM   1069 C CG    . TYR B 2 42  ? 8.279  1.129   -49.714 1.00 47.37  ? 42   TYR A CG    1 
ATOM   1070 C CD1   . TYR B 2 42  ? 7.647  1.878   -48.717 1.00 46.89  ? 42   TYR A CD1   1 
ATOM   1071 C CD2   . TYR B 2 42  ? 8.105  1.516   -51.040 1.00 47.25  ? 42   TYR A CD2   1 
ATOM   1072 C CE1   . TYR B 2 42  ? 6.864  2.981   -49.041 1.00 46.94  ? 42   TYR A CE1   1 
ATOM   1073 C CE2   . TYR B 2 42  ? 7.324  2.611   -51.372 1.00 47.24  ? 42   TYR A CE2   1 
ATOM   1074 C CZ    . TYR B 2 42  ? 6.709  3.340   -50.373 1.00 47.26  ? 42   TYR A CZ    1 
ATOM   1075 O OH    . TYR B 2 42  ? 5.947  4.433   -50.716 1.00 49.18  ? 42   TYR A OH    1 
ATOM   1076 N N     . VAL B 2 43  ? 7.876  -0.970  -46.841 1.00 45.89  ? 43   VAL A N     1 
ATOM   1077 C CA    . VAL B 2 43  ? 7.122  -0.726  -45.615 1.00 44.07  ? 43   VAL A CA    1 
ATOM   1078 C C     . VAL B 2 43  ? 7.981  -0.016  -44.575 1.00 43.10  ? 43   VAL A C     1 
ATOM   1079 O O     . VAL B 2 43  ? 9.066  -0.482  -44.229 1.00 42.31  ? 43   VAL A O     1 
ATOM   1080 C CB    . VAL B 2 43  ? 6.594  -2.037  -44.981 1.00 43.11  ? 43   VAL A CB    1 
ATOM   1081 C CG1   . VAL B 2 43  ? 7.750  -2.934  -44.571 1.00 42.77  ? 43   VAL A CG1   1 
ATOM   1082 C CG2   . VAL B 2 43  ? 5.737  -1.707  -43.762 1.00 42.21  ? 43   VAL A CG2   1 
ATOM   1083 N N     . PHE B 2 44  ? 7.500  1.121   -44.089 1.00 42.27  ? 44   PHE A N     1 
ATOM   1084 C CA    . PHE B 2 44  ? 8.216  1.866   -43.059 1.00 42.11  ? 44   PHE A CA    1 
ATOM   1085 C C     . PHE B 2 44  ? 8.012  1.178   -41.709 1.00 41.68  ? 44   PHE A C     1 
ATOM   1086 O O     . PHE B 2 44  ? 6.887  0.861   -41.324 1.00 42.97  ? 44   PHE A O     1 
ATOM   1087 C CB    . PHE B 2 44  ? 7.691  3.294   -42.968 1.00 41.38  ? 44   PHE A CB    1 
ATOM   1088 C CG    . PHE B 2 44  ? 8.113  4.173   -44.105 1.00 42.11  ? 44   PHE A CG    1 
ATOM   1089 C CD1   . PHE B 2 44  ? 7.981  3.750   -45.419 1.00 41.92  ? 44   PHE A CD1   1 
ATOM   1090 C CD2   . PHE B 2 44  ? 8.592  5.454   -43.862 1.00 42.49  ? 44   PHE A CD2   1 
ATOM   1091 C CE1   . PHE B 2 44  ? 8.314  4.591   -46.477 1.00 42.78  ? 44   PHE A CE1   1 
ATOM   1092 C CE2   . PHE B 2 44  ? 8.925  6.304   -44.915 1.00 43.39  ? 44   PHE A CE2   1 
ATOM   1093 C CZ    . PHE B 2 44  ? 8.785  5.872   -46.223 1.00 42.47  ? 44   PHE A CZ    1 
ATOM   1094 N N     . VAL B 2 45  ? 9.101  0.939   -40.995 1.00 40.71  ? 45   VAL A N     1 
ATOM   1095 C CA    . VAL B 2 45  ? 9.025  0.309   -39.687 1.00 39.45  ? 45   VAL A CA    1 
ATOM   1096 C C     . VAL B 2 45  ? 9.969  1.060   -38.750 1.00 39.94  ? 45   VAL A C     1 
ATOM   1097 O O     . VAL B 2 45  ? 10.590 2.051   -39.150 1.00 41.42  ? 45   VAL A O     1 
ATOM   1098 C CB    . VAL B 2 45  ? 9.606  -1.101  -39.744 1.00 38.88  ? 45   VAL A CB    1 
ATOM   1099 C CG1   . VAL B 2 45  ? 8.829  -1.931  -40.749 1.00 38.37  ? 45   VAL A CG1   1 
ATOM   1100 C CG2   . VAL B 2 45  ? 11.064 -1.046  -40.143 1.00 36.54  ? 45   VAL A CG2   1 
ATOM   1101 N N     . GLY B 2 46  ? 10.069 0.610   -37.502 1.00 40.13  ? 46   GLY A N     1 
ATOM   1102 C CA    . GLY B 2 46  ? 10.831 1.349   -36.508 1.00 39.72  ? 46   GLY A CA    1 
ATOM   1103 C C     . GLY B 2 46  ? 10.096 2.473   -35.804 1.00 39.75  ? 46   GLY A C     1 
ATOM   1104 O O     . GLY B 2 46  ? 8.971  2.822   -36.151 1.00 38.97  ? 46   GLY A O     1 
ATOM   1105 N N     . SER B 2 47  ? 10.756 3.054   -34.810 1.00 40.28  ? 47   SER A N     1 
ATOM   1106 C CA    . SER B 2 47  ? 10.178 4.125   -34.019 1.00 41.39  ? 47   SER A CA    1 
ATOM   1107 C C     . SER B 2 47  ? 9.699  5.323   -34.826 1.00 40.81  ? 47   SER A C     1 
ATOM   1108 O O     . SER B 2 47  ? 8.842  6.072   -34.365 1.00 42.23  ? 47   SER A O     1 
ATOM   1109 C CB    . SER B 2 47  ? 11.170 4.584   -32.941 1.00 41.09  ? 47   SER A CB    1 
ATOM   1110 O OG    . SER B 2 47  ? 12.379 5.040   -33.513 1.00 44.11  ? 47   SER A OG    1 
ATOM   1111 N N     . TYR B 2 48  ? 10.234 5.523   -36.022 1.00 39.76  ? 48   TYR A N     1 
ATOM   1112 C CA    . TYR B 2 48  ? 9.767  6.655   -36.801 1.00 39.94  ? 48   TYR A CA    1 
ATOM   1113 C C     . TYR B 2 48  ? 8.377  6.356   -37.334 1.00 40.18  ? 48   TYR A C     1 
ATOM   1114 O O     . TYR B 2 48  ? 7.469  7.181   -37.234 1.00 41.06  ? 48   TYR A O     1 
ATOM   1115 C CB    . TYR B 2 48  ? 10.667 6.967   -37.994 1.00 40.52  ? 48   TYR A CB    1 
ATOM   1116 C CG    . TYR B 2 48  ? 10.045 8.068   -38.821 1.00 40.39  ? 48   TYR A CG    1 
ATOM   1117 C CD1   . TYR B 2 48  ? 10.034 9.381   -38.356 1.00 39.31  ? 48   TYR A CD1   1 
ATOM   1118 C CD2   . TYR B 2 48  ? 9.323  7.772   -39.983 1.00 41.12  ? 48   TYR A CD2   1 
ATOM   1119 C CE1   . TYR B 2 48  ? 9.312  10.371  -39.014 1.00 40.64  ? 48   TYR A CE1   1 
ATOM   1120 C CE2   . TYR B 2 48  ? 8.591  8.754   -40.648 1.00 40.68  ? 48   TYR A CE2   1 
ATOM   1121 C CZ    . TYR B 2 48  ? 8.587  10.052  -40.155 1.00 41.07  ? 48   TYR A CZ    1 
ATOM   1122 O OH    . TYR B 2 48  ? 7.836  11.026  -40.779 1.00 43.09  ? 48   TYR A OH    1 
ATOM   1123 N N     . ALA B 2 49  ? 8.224  5.171   -37.914 1.00 39.42  ? 49   ALA A N     1 
ATOM   1124 C CA    . ALA B 2 49  ? 6.948  4.754   -38.473 1.00 38.62  ? 49   ALA A CA    1 
ATOM   1125 C C     . ALA B 2 49  ? 5.856  4.798   -37.423 1.00 39.32  ? 49   ALA A C     1 
ATOM   1126 O O     . ALA B 2 49  ? 4.691  5.018   -37.751 1.00 40.41  ? 49   ALA A O     1 
ATOM   1127 C CB    . ALA B 2 49  ? 7.062  3.348   -39.034 1.00 38.67  ? 49   ALA A CB    1 
ATOM   1128 N N     . ARG B 2 50  ? 6.239  4.597   -36.163 1.00 38.57  ? 50   ARG A N     1 
ATOM   1129 C CA    . ARG B 2 50  ? 5.292  4.578   -35.056 1.00 38.81  ? 50   ARG A CA    1 
ATOM   1130 C C     . ARG B 2 50  ? 5.378  5.783   -34.140 1.00 40.30  ? 50   ARG A C     1 
ATOM   1131 O O     . ARG B 2 50  ? 4.914  5.726   -33.002 1.00 40.27  ? 50   ARG A O     1 
ATOM   1132 C CB    . ARG B 2 50  ? 5.489  3.317   -34.217 1.00 38.21  ? 50   ARG A CB    1 
ATOM   1133 C CG    . ARG B 2 50  ? 5.203  2.025   -34.942 1.00 39.34  ? 50   ARG A CG    1 
ATOM   1134 C CD    . ARG B 2 50  ? 5.544  0.826   -34.065 1.00 41.31  ? 50   ARG A CD    1 
ATOM   1135 N NE    . ARG B 2 50  ? 6.683  0.089   -34.603 1.00 44.15  ? 50   ARG A NE    1 
ATOM   1136 C CZ    . ARG B 2 50  ? 7.873  -0.003  -34.021 1.00 44.04  ? 50   ARG A CZ    1 
ATOM   1137 N NH1   . ARG B 2 50  ? 8.116  0.592   -32.862 1.00 43.07  ? 50   ARG A NH1   1 
ATOM   1138 N NH2   . ARG B 2 50  ? 8.828  -0.696  -34.613 1.00 47.15  ? 50   ARG A NH2   1 
ATOM   1139 N N     . ASN B 2 51  ? 5.965  6.869   -34.630 1.00 42.04  ? 51   ASN A N     1 
ATOM   1140 C CA    . ASN B 2 51  ? 6.104  8.095   -33.841 1.00 44.43  ? 51   ASN A CA    1 
ATOM   1141 C C     . ASN B 2 51  ? 6.573  7.984   -32.393 1.00 43.13  ? 51   ASN A C     1 
ATOM   1142 O O     . ASN B 2 51  ? 6.121  8.718   -31.531 1.00 45.06  ? 51   ASN A O     1 
ATOM   1143 C CB    . ASN B 2 51  ? 4.826  8.932   -33.939 1.00 48.10  ? 51   ASN A CB    1 
ATOM   1144 C CG    . ASN B 2 51  ? 4.506  9.336   -35.368 1.00 53.94  ? 51   ASN A CG    1 
ATOM   1145 O OD1   . ASN B 2 51  ? 5.314  9.979   -36.041 1.00 56.43  ? 51   ASN A OD1   1 
ATOM   1146 N ND2   . ASN B 2 51  ? 3.320  8.958   -35.840 1.00 55.83  ? 51   ASN A ND2   1 
ATOM   1147 N N     . THR B 2 52  ? 7.489  7.064   -32.140 1.00 42.40  ? 52   THR A N     1 
ATOM   1148 C CA    . THR B 2 52  ? 7.934  6.738   -30.796 1.00 42.76  ? 52   THR A CA    1 
ATOM   1149 C C     . THR B 2 52  ? 9.421  7.061   -30.632 1.00 43.82  ? 52   THR A C     1 
ATOM   1150 O O     . THR B 2 52  ? 9.988  6.890   -29.554 1.00 43.75  ? 52   THR A O     1 
ATOM   1151 C CB    . THR B 2 52  ? 7.742  5.241   -30.502 1.00 42.48  ? 52   THR A CB    1 
ATOM   1152 O OG1   . THR B 2 52  ? 8.440  4.466   -31.482 1.00 41.85  ? 52   THR A OG1   1 
ATOM   1153 C CG2   . THR B 2 52  ? 6.278  4.875   -30.540 1.00 43.43  ? 52   THR A CG2   1 
ATOM   1154 N N     . TRP B 2 53  ? 10.050 7.524   -31.708 1.00 45.06  ? 53   TRP A N     1 
ATOM   1155 C CA    . TRP B 2 53  ? 11.468 7.854   -31.678 1.00 45.14  ? 53   TRP A CA    1 
ATOM   1156 C C     . TRP B 2 53  ? 11.774 8.987   -30.701 1.00 44.77  ? 53   TRP A C     1 
ATOM   1157 O O     . TRP B 2 53  ? 11.014 9.940   -30.571 1.00 45.13  ? 53   TRP A O     1 
ATOM   1158 C CB    . TRP B 2 53  ? 11.955 8.206   -33.092 1.00 45.53  ? 53   TRP A CB    1 
ATOM   1159 C CG    . TRP B 2 53  ? 11.746 9.634   -33.523 1.00 46.22  ? 53   TRP A CG    1 
ATOM   1160 C CD1   . TRP B 2 53  ? 12.591 10.691  -33.313 1.00 47.09  ? 53   TRP A CD1   1 
ATOM   1161 C CD2   . TRP B 2 53  ? 10.645 10.147  -34.277 1.00 46.20  ? 53   TRP A CD2   1 
ATOM   1162 N NE1   . TRP B 2 53  ? 12.087 11.828  -33.896 1.00 45.94  ? 53   TRP A NE1   1 
ATOM   1163 C CE2   . TRP B 2 53  ? 10.893 11.523  -34.496 1.00 46.47  ? 53   TRP A CE2   1 
ATOM   1164 C CE3   . TRP B 2 53  ? 9.476  9.580   -34.796 1.00 46.96  ? 53   TRP A CE3   1 
ATOM   1165 C CZ2   . TRP B 2 53  ? 10.011 12.340  -35.212 1.00 47.24  ? 53   TRP A CZ2   1 
ATOM   1166 C CZ3   . TRP B 2 53  ? 8.597  10.394  -35.510 1.00 48.30  ? 53   TRP A CZ3   1 
ATOM   1167 C CH2   . TRP B 2 53  ? 8.873  11.759  -35.712 1.00 47.34  ? 53   TRP A CH2   1 
ATOM   1168 N N     . LEU B 2 54  ? 12.901 8.865   -30.016 1.00 45.31  ? 54   LEU A N     1 
ATOM   1169 C CA    . LEU B 2 54  ? 13.326 9.851   -29.036 1.00 46.05  ? 54   LEU A CA    1 
ATOM   1170 C C     . LEU B 2 54  ? 13.875 11.099  -29.717 1.00 46.84  ? 54   LEU A C     1 
ATOM   1171 O O     . LEU B 2 54  ? 14.460 11.024  -30.798 1.00 46.75  ? 54   LEU A O     1 
ATOM   1172 C CB    . LEU B 2 54  ? 14.406 9.241   -28.140 1.00 44.56  ? 54   LEU A CB    1 
ATOM   1173 C CG    . LEU B 2 54  ? 14.742 9.961   -26.837 1.00 44.36  ? 54   LEU A CG    1 
ATOM   1174 C CD1   . LEU B 2 54  ? 13.532 9.930   -25.900 1.00 43.65  ? 54   LEU A CD1   1 
ATOM   1175 C CD2   . LEU B 2 54  ? 15.946 9.284   -26.190 1.00 43.55  ? 54   LEU A CD2   1 
ATOM   1176 N N     . LYS B 2 55  ? 13.688 12.245  -29.073 1.00 47.87  ? 55   LYS A N     1 
ATOM   1177 C CA    . LYS B 2 55  ? 14.173 13.514  -29.602 1.00 48.80  ? 55   LYS A CA    1 
ATOM   1178 C C     . LYS B 2 55  ? 15.661 13.447  -29.967 1.00 48.77  ? 55   LYS A C     1 
ATOM   1179 O O     . LYS B 2 55  ? 16.485 12.940  -29.203 1.00 49.52  ? 55   LYS A O     1 
ATOM   1180 C CB    . LYS B 2 55  ? 13.923 14.621  -28.572 1.00 49.10  ? 55   LYS A CB    1 
ATOM   1181 C CG    . LYS B 2 55  ? 14.438 15.993  -28.964 1.00 50.74  ? 55   LYS A CG    1 
ATOM   1182 C CD    . LYS B 2 55  ? 13.814 17.067  -28.073 1.00 52.14  ? 55   LYS A CD    1 
ATOM   1183 C CE    . LYS B 2 55  ? 14.378 18.449  -28.348 1.00 52.48  ? 55   LYS A CE    1 
ATOM   1184 N NZ    . LYS B 2 55  ? 15.804 18.538  -27.931 1.00 54.40  ? 55   LYS A NZ    1 
ATOM   1185 N N     . GLY B 2 56  ? 15.993 13.947  -31.152 1.00 49.03  ? 56   GLY A N     1 
ATOM   1186 C CA    . GLY B 2 56  ? 17.375 13.949  -31.598 1.00 48.89  ? 56   GLY A CA    1 
ATOM   1187 C C     . GLY B 2 56  ? 17.860 12.640  -32.192 1.00 49.03  ? 56   GLY A C     1 
ATOM   1188 O O     . GLY B 2 56  ? 19.040 12.511  -32.526 1.00 49.39  ? 56   GLY A O     1 
ATOM   1189 N N     . SER B 2 57  ? 16.965 11.663  -32.318 1.00 48.67  ? 57   SER A N     1 
ATOM   1190 C CA    . SER B 2 57  ? 17.323 10.365  -32.886 1.00 48.68  ? 57   SER A CA    1 
ATOM   1191 C C     . SER B 2 57  ? 16.490 10.066  -34.128 1.00 49.31  ? 57   SER A C     1 
ATOM   1192 O O     . SER B 2 57  ? 16.113 8.918   -34.374 1.00 49.75  ? 57   SER A O     1 
ATOM   1193 C CB    . SER B 2 57  ? 17.111 9.250   -31.857 1.00 48.90  ? 57   SER A CB    1 
ATOM   1194 O OG    . SER B 2 57  ? 18.002 9.374   -30.765 1.00 50.37  ? 57   SER A OG    1 
ATOM   1195 N N     . LEU B 2 58  ? 16.207 11.097  -34.913 1.00 49.44  ? 58   LEU A N     1 
ATOM   1196 C CA    . LEU B 2 58  ? 15.412 10.922  -36.117 1.00 49.39  ? 58   LEU A CA    1 
ATOM   1197 C C     . LEU B 2 58  ? 16.118 10.082  -37.174 1.00 49.59  ? 58   LEU A C     1 
ATOM   1198 O O     . LEU B 2 58  ? 17.157 10.469  -37.708 1.00 50.99  ? 58   LEU A O     1 
ATOM   1199 C CB    . LEU B 2 58  ? 15.042 12.283  -36.704 1.00 49.34  ? 58   LEU A CB    1 
ATOM   1200 C CG    . LEU B 2 58  ? 14.130 12.278  -37.933 1.00 48.80  ? 58   LEU A CG    1 
ATOM   1201 C CD1   . LEU B 2 58  ? 12.829 11.563  -37.616 1.00 48.55  ? 58   LEU A CD1   1 
ATOM   1202 C CD2   . LEU B 2 58  ? 13.850 13.712  -38.356 1.00 50.21  ? 58   LEU A CD2   1 
ATOM   1203 N N     . GLU B 2 59  ? 15.546 8.922   -37.464 1.00 48.92  ? 59   GLU A N     1 
ATOM   1204 C CA    . GLU B 2 59  ? 16.089 8.019   -38.468 1.00 49.19  ? 59   GLU A CA    1 
ATOM   1205 C C     . GLU B 2 59  ? 14.897 7.254   -39.039 1.00 47.85  ? 59   GLU A C     1 
ATOM   1206 O O     . GLU B 2 59  ? 14.031 6.797   -38.303 1.00 47.01  ? 59   GLU A O     1 
ATOM   1207 C CB    . GLU B 2 59  ? 17.103 7.040   -37.849 1.00 50.95  ? 59   GLU A CB    1 
ATOM   1208 C CG    . GLU B 2 59  ? 17.761 6.089   -38.875 1.00 54.09  ? 59   GLU A CG    1 
ATOM   1209 C CD    . GLU B 2 59  ? 18.681 5.024   -38.252 1.00 56.34  ? 59   GLU A CD    1 
ATOM   1210 O OE1   . GLU B 2 59  ? 18.175 4.123   -37.542 1.00 56.65  ? 59   GLU A OE1   1 
ATOM   1211 O OE2   . GLU B 2 59  ? 19.913 5.087   -38.483 1.00 57.13  ? 59   GLU A OE2   1 
ATOM   1212 N N     . ILE B 2 60  ? 14.848 7.132   -40.357 1.00 46.61  ? 60   ILE A N     1 
ATOM   1213 C CA    . ILE B 2 60  ? 13.757 6.425   -41.006 1.00 45.33  ? 60   ILE A CA    1 
ATOM   1214 C C     . ILE B 2 60  ? 14.197 5.041   -41.466 1.00 45.18  ? 60   ILE A C     1 
ATOM   1215 O O     . ILE B 2 60  ? 15.264 4.884   -42.058 1.00 45.46  ? 60   ILE A O     1 
ATOM   1216 C CB    . ILE B 2 60  ? 13.253 7.206   -42.230 1.00 44.96  ? 60   ILE A CB    1 
ATOM   1217 C CG1   . ILE B 2 60  ? 12.722 8.568   -41.788 1.00 43.51  ? 60   ILE A CG1   1 
ATOM   1218 C CG2   . ILE B 2 60  ? 12.201 6.396   -42.970 1.00 45.74  ? 60   ILE A CG2   1 
ATOM   1219 C CD1   . ILE B 2 60  ? 12.158 9.398   -42.907 1.00 42.18  ? 60   ILE A CD1   1 
ATOM   1220 N N     . ASP B 2 61  ? 13.377 4.038   -41.185 1.00 45.25  ? 61   ASP A N     1 
ATOM   1221 C CA    . ASP B 2 61  ? 13.688 2.683   -41.598 1.00 46.02  ? 61   ASP A CA    1 
ATOM   1222 C C     . ASP B 2 61  ? 12.701 2.228   -42.663 1.00 47.05  ? 61   ASP A C     1 
ATOM   1223 O O     . ASP B 2 61  ? 11.484 2.285   -42.468 1.00 48.01  ? 61   ASP A O     1 
ATOM   1224 C CB    . ASP B 2 61  ? 13.660 1.729   -40.401 1.00 46.06  ? 61   ASP A CB    1 
ATOM   1225 C CG    . ASP B 2 61  ? 14.791 1.992   -39.422 1.00 45.88  ? 61   ASP A CG    1 
ATOM   1226 O OD1   . ASP B 2 61  ? 14.522 2.469   -38.300 1.00 47.50  ? 61   ASP A OD1   1 
ATOM   1227 O OD2   . ASP B 2 61  ? 15.955 1.725   -39.780 1.00 45.77  ? 61   ASP A OD2   1 
ATOM   1228 N N     . VAL B 2 62  ? 13.240 1.794   -43.797 1.00 46.62  ? 62   VAL A N     1 
ATOM   1229 C CA    . VAL B 2 62  ? 12.425 1.325   -44.905 1.00 46.40  ? 62   VAL A CA    1 
ATOM   1230 C C     . VAL B 2 62  ? 12.836 -0.082  -45.273 1.00 46.27  ? 62   VAL A C     1 
ATOM   1231 O O     . VAL B 2 62  ? 13.928 -0.292  -45.783 1.00 47.08  ? 62   VAL A O     1 
ATOM   1232 C CB    . VAL B 2 62  ? 12.604 2.207   -46.157 1.00 47.70  ? 62   VAL A CB    1 
ATOM   1233 C CG1   . VAL B 2 62  ? 11.798 1.629   -47.312 1.00 47.60  ? 62   VAL A CG1   1 
ATOM   1234 C CG2   . VAL B 2 62  ? 12.172 3.636   -45.862 1.00 47.31  ? 62   VAL A CG2   1 
ATOM   1235 N N     . PHE B 2 63  ? 11.970 -1.050  -45.011 1.00 45.47  ? 63   PHE A N     1 
ATOM   1236 C CA    . PHE B 2 63  ? 12.284 -2.426  -45.353 1.00 44.89  ? 63   PHE A CA    1 
ATOM   1237 C C     . PHE B 2 63  ? 11.682 -2.776  -46.707 1.00 45.95  ? 63   PHE A C     1 
ATOM   1238 O O     . PHE B 2 63  ? 10.506 -2.509  -46.966 1.00 47.00  ? 63   PHE A O     1 
ATOM   1239 C CB    . PHE B 2 63  ? 11.758 -3.377  -44.274 1.00 42.51  ? 63   PHE A CB    1 
ATOM   1240 C CG    . PHE B 2 63  ? 12.718 -3.590  -43.131 1.00 40.21  ? 63   PHE A CG    1 
ATOM   1241 C CD1   . PHE B 2 63  ? 13.439 -2.523  -42.596 1.00 38.70  ? 63   PHE A CD1   1 
ATOM   1242 C CD2   . PHE B 2 63  ? 12.886 -4.855  -42.576 1.00 39.72  ? 63   PHE A CD2   1 
ATOM   1243 C CE1   . PHE B 2 63  ? 14.316 -2.712  -41.526 1.00 36.72  ? 63   PHE A CE1   1 
ATOM   1244 C CE2   . PHE B 2 63  ? 13.765 -5.057  -41.500 1.00 37.77  ? 63   PHE A CE2   1 
ATOM   1245 C CZ    . PHE B 2 63  ? 14.478 -3.980  -40.976 1.00 36.41  ? 63   PHE A CZ    1 
ATOM   1246 N N     . LEU B 2 64  ? 12.497 -3.363  -47.575 1.00 46.20  ? 64   LEU A N     1 
ATOM   1247 C CA    . LEU B 2 64  ? 12.035 -3.749  -48.895 1.00 46.42  ? 64   LEU A CA    1 
ATOM   1248 C C     . LEU B 2 64  ? 11.534 -5.185  -48.837 1.00 47.74  ? 64   LEU A C     1 
ATOM   1249 O O     . LEU B 2 64  ? 12.259 -6.089  -48.417 1.00 47.85  ? 64   LEU A O     1 
ATOM   1250 C CB    . LEU B 2 64  ? 13.172 -3.598  -49.905 1.00 44.61  ? 64   LEU A CB    1 
ATOM   1251 C CG    . LEU B 2 64  ? 13.780 -2.182  -49.904 1.00 44.68  ? 64   LEU A CG    1 
ATOM   1252 C CD1   . LEU B 2 64  ? 14.894 -2.086  -50.941 1.00 44.37  ? 64   LEU A CD1   1 
ATOM   1253 C CD2   . LEU B 2 64  ? 12.694 -1.141  -50.177 1.00 41.60  ? 64   LEU A CD2   1 
ATOM   1254 N N     . LEU B 2 65  ? 10.280 -5.382  -49.237 1.00 49.35  ? 65   LEU A N     1 
ATOM   1255 C CA    . LEU B 2 65  ? 9.662  -6.705  -49.219 1.00 50.31  ? 65   LEU A CA    1 
ATOM   1256 C C     . LEU B 2 65  ? 9.916  -7.484  -50.506 1.00 51.39  ? 65   LEU A C     1 
ATOM   1257 O O     . LEU B 2 65  ? 9.447  -7.103  -51.578 1.00 52.45  ? 65   LEU A O     1 
ATOM   1258 C CB    . LEU B 2 65  ? 8.152  -6.578  -48.983 1.00 49.87  ? 65   LEU A CB    1 
ATOM   1259 C CG    . LEU B 2 65  ? 7.551  -6.233  -47.607 1.00 50.08  ? 65   LEU A CG    1 
ATOM   1260 C CD1   . LEU B 2 65  ? 8.627  -6.022  -46.572 1.00 50.13  ? 65   LEU A CD1   1 
ATOM   1261 C CD2   . LEU B 2 65  ? 6.681  -4.986  -47.742 1.00 50.40  ? 65   LEU A CD2   1 
ATOM   1262 N N     . PHE B 2 66  ? 10.650 -8.586  -50.386 1.00 51.81  ? 66   PHE A N     1 
ATOM   1263 C CA    . PHE B 2 66  ? 10.986 -9.426  -51.528 1.00 52.68  ? 66   PHE A CA    1 
ATOM   1264 C C     . PHE B 2 66  ? 10.296 -10.772 -51.463 1.00 52.65  ? 66   PHE A C     1 
ATOM   1265 O O     . PHE B 2 66  ? 10.076 -11.319 -50.390 1.00 52.65  ? 66   PHE A O     1 
ATOM   1266 C CB    . PHE B 2 66  ? 12.501 -9.640  -51.605 1.00 53.36  ? 66   PHE A CB    1 
ATOM   1267 C CG    . PHE B 2 66  ? 13.253 -8.457  -52.137 1.00 54.55  ? 66   PHE A CG    1 
ATOM   1268 C CD1   . PHE B 2 66  ? 13.229 -8.155  -53.496 1.00 55.26  ? 66   PHE A CD1   1 
ATOM   1269 C CD2   . PHE B 2 66  ? 13.972 -7.627  -51.280 1.00 55.88  ? 66   PHE A CD2   1 
ATOM   1270 C CE1   . PHE B 2 66  ? 13.911 -7.038  -53.998 1.00 55.06  ? 66   PHE A CE1   1 
ATOM   1271 C CE2   . PHE B 2 66  ? 14.659 -6.505  -51.770 1.00 55.55  ? 66   PHE A CE2   1 
ATOM   1272 C CZ    . PHE B 2 66  ? 14.627 -6.212  -53.132 1.00 55.41  ? 66   PHE A CZ    1 
ATOM   1273 N N     . PRO B 2 67  ? 9.945  -11.326 -52.626 1.00 53.48  ? 67   PRO A N     1 
ATOM   1274 C CA    . PRO B 2 67  ? 9.275  -12.623 -52.685 1.00 54.32  ? 67   PRO A CA    1 
ATOM   1275 C C     . PRO B 2 67  ? 10.057 -13.718 -51.971 1.00 55.59  ? 67   PRO A C     1 
ATOM   1276 O O     . PRO B 2 67  ? 11.271 -13.853 -52.125 1.00 55.73  ? 67   PRO A O     1 
ATOM   1277 C CB    . PRO B 2 67  ? 9.149  -12.874 -54.184 1.00 53.92  ? 67   PRO A CB    1 
ATOM   1278 C CG    . PRO B 2 67  ? 8.973  -11.489 -54.722 1.00 53.42  ? 67   PRO A CG    1 
ATOM   1279 C CD    . PRO B 2 67  ? 10.020 -10.714 -53.963 1.00 53.17  ? 67   PRO A CD    1 
ATOM   1280 N N     . GLU B 2 68  ? 9.330  -14.505 -51.195 1.00 56.77  ? 68   GLU A N     1 
ATOM   1281 C CA    . GLU B 2 68  ? 9.891  -15.605 -50.429 1.00 58.13  ? 68   GLU A CA    1 
ATOM   1282 C C     . GLU B 2 68  ? 10.883 -16.475 -51.208 1.00 57.21  ? 68   GLU A C     1 
ATOM   1283 O O     . GLU B 2 68  ? 11.700 -17.169 -50.606 1.00 57.16  ? 68   GLU A O     1 
ATOM   1284 C CB    . GLU B 2 68  ? 8.743  -16.477 -49.915 1.00 59.75  ? 68   GLU A CB    1 
ATOM   1285 C CG    . GLU B 2 68  ? 9.092  -17.409 -48.774 1.00 64.50  ? 68   GLU A CG    1 
ATOM   1286 C CD    . GLU B 2 68  ? 7.895  -18.237 -48.327 1.00 67.29  ? 68   GLU A CD    1 
ATOM   1287 O OE1   . GLU B 2 68  ? 6.788  -17.664 -48.192 1.00 67.52  ? 68   GLU A OE1   1 
ATOM   1288 O OE2   . GLU B 2 68  ? 8.062  -19.456 -48.102 1.00 68.29  ? 68   GLU A OE2   1 
ATOM   1289 N N     . GLU B 2 69  ? 10.822 -16.431 -52.537 1.00 56.61  ? 69   GLU A N     1 
ATOM   1290 C CA    . GLU B 2 69  ? 11.693 -17.275 -53.361 1.00 56.11  ? 69   GLU A CA    1 
ATOM   1291 C C     . GLU B 2 69  ? 13.021 -16.713 -53.859 1.00 55.42  ? 69   GLU A C     1 
ATOM   1292 O O     . GLU B 2 69  ? 13.868 -17.476 -54.327 1.00 55.58  ? 69   GLU A O     1 
ATOM   1293 C CB    . GLU B 2 69  ? 10.916 -17.816 -54.565 1.00 56.53  ? 69   GLU A CB    1 
ATOM   1294 C CG    . GLU B 2 69  ? 9.755  -18.722 -54.200 1.00 56.60  ? 69   GLU A CG    1 
ATOM   1295 C CD    . GLU B 2 69  ? 8.440  -17.969 -54.075 1.00 56.86  ? 69   GLU A CD    1 
ATOM   1296 O OE1   . GLU B 2 69  ? 7.433  -18.602 -53.686 1.00 55.16  ? 69   GLU A OE1   1 
ATOM   1297 O OE2   . GLU B 2 69  ? 8.412  -16.751 -54.375 1.00 56.31  ? 69   GLU A OE2   1 
ATOM   1298 N N     . PHE B 2 70  ? 13.213 -15.401 -53.776 1.00 53.94  ? 70   PHE A N     1 
ATOM   1299 C CA    . PHE B 2 70  ? 14.471 -14.816 -54.230 1.00 52.44  ? 70   PHE A CA    1 
ATOM   1300 C C     . PHE B 2 70  ? 15.653 -15.358 -53.428 1.00 52.88  ? 70   PHE A C     1 
ATOM   1301 O O     . PHE B 2 70  ? 15.511 -15.754 -52.270 1.00 52.17  ? 70   PHE A O     1 
ATOM   1302 C CB    . PHE B 2 70  ? 14.433 -13.293 -54.107 1.00 49.78  ? 70   PHE A CB    1 
ATOM   1303 C CG    . PHE B 2 70  ? 13.650 -12.610 -55.190 1.00 48.92  ? 70   PHE A CG    1 
ATOM   1304 C CD1   . PHE B 2 70  ? 12.482 -13.179 -55.697 1.00 49.23  ? 70   PHE A CD1   1 
ATOM   1305 C CD2   . PHE B 2 70  ? 14.061 -11.377 -55.687 1.00 48.41  ? 70   PHE A CD2   1 
ATOM   1306 C CE1   . PHE B 2 70  ? 11.732 -12.529 -56.684 1.00 47.80  ? 70   PHE A CE1   1 
ATOM   1307 C CE2   . PHE B 2 70  ? 13.319 -10.715 -56.673 1.00 48.38  ? 70   PHE A CE2   1 
ATOM   1308 C CZ    . PHE B 2 70  ? 12.155 -11.293 -57.172 1.00 47.57  ? 70   PHE A CZ    1 
ATOM   1309 N N     . SER B 2 71  ? 16.815 -15.384 -54.073 1.00 53.38  ? 71   SER A N     1 
ATOM   1310 C CA    . SER B 2 71  ? 18.053 -15.847 -53.460 1.00 53.74  ? 71   SER A CA    1 
ATOM   1311 C C     . SER B 2 71  ? 18.555 -14.715 -52.564 1.00 54.96  ? 71   SER A C     1 
ATOM   1312 O O     . SER B 2 71  ? 18.211 -13.546 -52.784 1.00 54.20  ? 71   SER A O     1 
ATOM   1313 C CB    . SER B 2 71  ? 19.090 -16.139 -54.550 1.00 52.80  ? 71   SER A CB    1 
ATOM   1314 O OG    . SER B 2 71  ? 19.366 -14.963 -55.306 1.00 49.70  ? 71   SER A OG    1 
ATOM   1315 N N     . LYS B 2 72  ? 19.369 -15.050 -51.566 1.00 55.86  ? 72   LYS A N     1 
ATOM   1316 C CA    . LYS B 2 72  ? 19.884 -14.024 -50.662 1.00 58.05  ? 72   LYS A CA    1 
ATOM   1317 C C     . LYS B 2 72  ? 20.648 -12.942 -51.435 1.00 56.92  ? 72   LYS A C     1 
ATOM   1318 O O     . LYS B 2 72  ? 20.650 -11.774 -51.047 1.00 57.25  ? 72   LYS A O     1 
ATOM   1319 C CB    . LYS B 2 72  ? 20.774 -14.653 -49.582 1.00 60.80  ? 72   LYS A CB    1 
ATOM   1320 C CG    . LYS B 2 72  ? 22.211 -14.929 -49.993 1.00 65.01  ? 72   LYS A CG    1 
ATOM   1321 C CD    . LYS B 2 72  ? 23.009 -15.493 -48.822 1.00 66.90  ? 72   LYS A CD    1 
ATOM   1322 C CE    . LYS B 2 72  ? 24.495 -15.182 -48.950 1.00 68.64  ? 72   LYS A CE    1 
ATOM   1323 N NZ    . LYS B 2 72  ? 25.110 -15.758 -50.178 1.00 69.38  ? 72   LYS A NZ    1 
ATOM   1324 N N     . GLU B 2 73  ? 21.266 -13.328 -52.546 1.00 56.28  ? 73   GLU A N     1 
ATOM   1325 C CA    . GLU B 2 73  ? 22.021 -12.390 -53.374 1.00 56.69  ? 73   GLU A CA    1 
ATOM   1326 C C     . GLU B 2 73  ? 21.118 -11.409 -54.123 1.00 55.65  ? 73   GLU A C     1 
ATOM   1327 O O     . GLU B 2 73  ? 21.451 -10.231 -54.262 1.00 55.11  ? 73   GLU A O     1 
ATOM   1328 C CB    . GLU B 2 73  ? 22.896 -13.152 -54.376 1.00 58.52  ? 73   GLU A CB    1 
ATOM   1329 C CG    . GLU B 2 73  ? 23.913 -14.081 -53.722 1.00 61.32  ? 73   GLU A CG    1 
ATOM   1330 C CD    . GLU B 2 73  ? 23.328 -15.434 -53.321 1.00 63.67  ? 73   GLU A CD    1 
ATOM   1331 O OE1   . GLU B 2 73  ? 22.103 -15.526 -53.075 1.00 64.14  ? 73   GLU A OE1   1 
ATOM   1332 O OE2   . GLU B 2 73  ? 24.105 -16.411 -53.238 1.00 64.37  ? 73   GLU A OE2   1 
ATOM   1333 N N     . GLU B 2 74  ? 19.979 -11.884 -54.614 1.00 54.76  ? 74   GLU A N     1 
ATOM   1334 C CA    . GLU B 2 74  ? 19.072 -10.992 -55.324 1.00 54.56  ? 74   GLU A CA    1 
ATOM   1335 C C     . GLU B 2 74  ? 18.707 -9.821  -54.424 1.00 54.13  ? 74   GLU A C     1 
ATOM   1336 O O     . GLU B 2 74  ? 18.786 -8.661  -54.835 1.00 53.24  ? 74   GLU A O     1 
ATOM   1337 C CB    . GLU B 2 74  ? 17.799 -11.725 -55.744 1.00 55.67  ? 74   GLU A CB    1 
ATOM   1338 C CG    . GLU B 2 74  ? 17.761 -12.094 -57.210 1.00 57.05  ? 74   GLU A CG    1 
ATOM   1339 C CD    . GLU B 2 74  ? 17.837 -10.884 -58.118 1.00 57.69  ? 74   GLU A CD    1 
ATOM   1340 O OE1   . GLU B 2 74  ? 16.924 -10.035 -58.056 1.00 57.73  ? 74   GLU A OE1   1 
ATOM   1341 O OE2   . GLU B 2 74  ? 18.812 -10.783 -58.895 1.00 58.98  ? 74   GLU A OE2   1 
ATOM   1342 N N     . LEU B 2 75  ? 18.319 -10.136 -53.191 1.00 53.89  ? 75   LEU A N     1 
ATOM   1343 C CA    . LEU B 2 75  ? 17.935 -9.120  -52.214 1.00 53.59  ? 75   LEU A CA    1 
ATOM   1344 C C     . LEU B 2 75  ? 19.025 -8.078  -52.015 1.00 53.00  ? 75   LEU A C     1 
ATOM   1345 O O     . LEU B 2 75  ? 18.751 -6.876  -52.030 1.00 51.65  ? 75   LEU A O     1 
ATOM   1346 C CB    . LEU B 2 75  ? 17.609 -9.767  -50.863 1.00 54.43  ? 75   LEU A CB    1 
ATOM   1347 C CG    . LEU B 2 75  ? 16.257 -10.469 -50.703 1.00 55.44  ? 75   LEU A CG    1 
ATOM   1348 C CD1   . LEU B 2 75  ? 16.059 -11.498 -51.811 1.00 55.85  ? 75   LEU A CD1   1 
ATOM   1349 C CD2   . LEU B 2 75  ? 16.197 -11.132 -49.331 1.00 54.70  ? 75   LEU A CD2   1 
ATOM   1350 N N     . ARG B 2 76  ? 20.260 -8.533  -51.831 1.00 53.06  ? 76   ARG A N     1 
ATOM   1351 C CA    . ARG B 2 76  ? 21.357 -7.600  -51.620 1.00 54.44  ? 76   ARG A CA    1 
ATOM   1352 C C     . ARG B 2 76  ? 21.598 -6.754  -52.877 1.00 54.40  ? 76   ARG A C     1 
ATOM   1353 O O     . ARG B 2 76  ? 21.636 -5.516  -52.806 1.00 54.36  ? 76   ARG A O     1 
ATOM   1354 C CB    . ARG B 2 76  ? 22.624 -8.359  -51.181 1.00 56.38  ? 76   ARG A CB    1 
ATOM   1355 C CG    . ARG B 2 76  ? 23.910 -7.555  -51.102 1.00 59.50  ? 76   ARG A CG    1 
ATOM   1356 C CD    . ARG B 2 76  ? 25.090 -8.407  -51.537 1.00 62.94  ? 76   ARG A CD    1 
ATOM   1357 N NE    . ARG B 2 76  ? 25.292 -8.345  -52.980 1.00 67.40  ? 76   ARG A NE    1 
ATOM   1358 C CZ    . ARG B 2 76  ? 25.743 -7.274  -53.625 1.00 69.73  ? 76   ARG A CZ    1 
ATOM   1359 N NH1   . ARG B 2 76  ? 25.888 -7.300  -54.944 1.00 70.77  ? 76   ARG A NH1   1 
ATOM   1360 N NH2   . ARG B 2 76  ? 26.046 -6.170  -52.953 1.00 71.47  ? 76   ARG A NH2   1 
ATOM   1361 N N     . GLU B 2 77  ? 21.720 -7.408  -54.029 1.00 54.26  ? 77   GLU A N     1 
ATOM   1362 C CA    . GLU B 2 77  ? 21.944 -6.688  -55.282 1.00 55.17  ? 77   GLU A CA    1 
ATOM   1363 C C     . GLU B 2 77  ? 20.809 -5.700  -55.568 1.00 54.64  ? 77   GLU A C     1 
ATOM   1364 O O     . GLU B 2 77  ? 21.041 -4.506  -55.782 1.00 53.60  ? 77   GLU A O     1 
ATOM   1365 C CB    . GLU B 2 77  ? 22.078 -7.680  -56.440 1.00 56.18  ? 77   GLU A CB    1 
ATOM   1366 C CG    . GLU B 2 77  ? 23.271 -8.612  -56.311 1.00 59.42  ? 77   GLU A CG    1 
ATOM   1367 C CD    . GLU B 2 77  ? 23.332 -9.657  -57.415 1.00 61.75  ? 77   GLU A CD    1 
ATOM   1368 O OE1   . GLU B 2 77  ? 24.312 -10.436 -57.440 1.00 63.17  ? 77   GLU A OE1   1 
ATOM   1369 O OE2   . GLU B 2 77  ? 22.403 -9.702  -58.253 1.00 61.16  ? 77   GLU A OE2   1 
ATOM   1370 N N     . ARG B 2 78  ? 19.579 -6.202  -55.567 1.00 54.46  ? 78   ARG A N     1 
ATOM   1371 C CA    . ARG B 2 78  ? 18.423 -5.357  -55.826 1.00 54.61  ? 78   ARG A CA    1 
ATOM   1372 C C     . ARG B 2 78  ? 18.258 -4.294  -54.741 1.00 53.97  ? 78   ARG A C     1 
ATOM   1373 O O     . ARG B 2 78  ? 17.899 -3.141  -55.026 1.00 53.11  ? 78   ARG A O     1 
ATOM   1374 C CB    . ARG B 2 78  ? 17.170 -6.228  -55.930 1.00 56.63  ? 78   ARG A CB    1 
ATOM   1375 C CG    . ARG B 2 78  ? 17.075 -6.998  -57.243 1.00 58.73  ? 78   ARG A CG    1 
ATOM   1376 C CD    . ARG B 2 78  ? 16.360 -6.168  -58.295 1.00 60.81  ? 78   ARG A CD    1 
ATOM   1377 N NE    . ARG B 2 78  ? 16.882 -4.805  -58.369 1.00 63.98  ? 78   ARG A NE    1 
ATOM   1378 C CZ    . ARG B 2 78  ? 16.133 -3.728  -58.606 1.00 64.68  ? 78   ARG A CZ    1 
ATOM   1379 N NH1   . ARG B 2 78  ? 14.826 -3.856  -58.790 1.00 64.35  ? 78   ARG A NH1   1 
ATOM   1380 N NH2   . ARG B 2 78  ? 16.691 -2.523  -58.662 1.00 64.25  ? 78   ARG A NH2   1 
ATOM   1381 N N     . GLY B 2 79  ? 18.534 -4.683  -53.496 1.00 52.82  ? 79   GLY A N     1 
ATOM   1382 C CA    . GLY B 2 79  ? 18.417 -3.750  -52.389 1.00 51.06  ? 79   GLY A CA    1 
ATOM   1383 C C     . GLY B 2 79  ? 19.369 -2.584  -52.559 1.00 51.17  ? 79   GLY A C     1 
ATOM   1384 O O     . GLY B 2 79  ? 19.017 -1.430  -52.312 1.00 50.20  ? 79   GLY A O     1 
ATOM   1385 N N     . LEU B 2 80  ? 20.586 -2.898  -52.990 1.00 50.89  ? 80   LEU A N     1 
ATOM   1386 C CA    . LEU B 2 80  ? 21.618 -1.896  -53.202 1.00 50.25  ? 80   LEU A CA    1 
ATOM   1387 C C     . LEU B 2 80  ? 21.274 -0.966  -54.361 1.00 50.20  ? 80   LEU A C     1 
ATOM   1388 O O     . LEU B 2 80  ? 21.602 0.218   -54.333 1.00 50.15  ? 80   LEU A O     1 
ATOM   1389 C CB    . LEU B 2 80  ? 22.958 -2.591  -53.459 1.00 51.05  ? 80   LEU A CB    1 
ATOM   1390 C CG    . LEU B 2 80  ? 24.142 -1.749  -53.943 1.00 51.51  ? 80   LEU A CG    1 
ATOM   1391 C CD1   . LEU B 2 80  ? 24.445 -0.627  -52.961 1.00 50.56  ? 80   LEU A CD1   1 
ATOM   1392 C CD2   . LEU B 2 80  ? 25.348 -2.664  -54.110 1.00 52.19  ? 80   LEU A CD2   1 
ATOM   1393 N N     . GLU B 2 81  ? 20.601 -1.496  -55.374 1.00 50.79  ? 81   GLU A N     1 
ATOM   1394 C CA    . GLU B 2 81  ? 20.228 -0.693  -56.536 1.00 52.17  ? 81   GLU A CA    1 
ATOM   1395 C C     . GLU B 2 81  ? 19.195 0.362   -56.135 1.00 51.72  ? 81   GLU A C     1 
ATOM   1396 O O     . GLU B 2 81  ? 19.291 1.532   -56.525 1.00 50.32  ? 81   GLU A O     1 
ATOM   1397 C CB    . GLU B 2 81  ? 19.661 -1.596  -57.639 1.00 55.59  ? 81   GLU A CB    1 
ATOM   1398 C CG    . GLU B 2 81  ? 20.464 -1.624  -58.942 1.00 60.90  ? 81   GLU A CG    1 
ATOM   1399 C CD    . GLU B 2 81  ? 21.878 -2.176  -58.776 1.00 64.56  ? 81   GLU A CD    1 
ATOM   1400 O OE1   . GLU B 2 81  ? 22.721 -1.500  -58.143 1.00 65.09  ? 81   GLU A OE1   1 
ATOM   1401 O OE2   . GLU B 2 81  ? 22.145 -3.290  -59.281 1.00 66.02  ? 81   GLU A OE2   1 
ATOM   1402 N N     . ILE B 2 82  ? 18.213 -0.061  -55.344 1.00 51.27  ? 82   ILE A N     1 
ATOM   1403 C CA    . ILE B 2 82  ? 17.155 0.829   -54.890 1.00 51.07  ? 82   ILE A CA    1 
ATOM   1404 C C     . ILE B 2 82  ? 17.652 1.898   -53.918 1.00 52.29  ? 82   ILE A C     1 
ATOM   1405 O O     . ILE B 2 82  ? 17.372 3.089   -54.094 1.00 51.76  ? 82   ILE A O     1 
ATOM   1406 C CB    . ILE B 2 82  ? 16.027 0.030   -54.224 1.00 50.31  ? 82   ILE A CB    1 
ATOM   1407 C CG1   . ILE B 2 82  ? 15.433 -0.959  -55.238 1.00 48.83  ? 82   ILE A CG1   1 
ATOM   1408 C CG2   . ILE B 2 82  ? 14.971 0.985   -53.678 1.00 50.78  ? 82   ILE A CG2   1 
ATOM   1409 C CD1   . ILE B 2 82  ? 14.405 -1.918  -54.664 1.00 44.61  ? 82   ILE A CD1   1 
ATOM   1410 N N     . GLY B 2 83  ? 18.382 1.476   -52.891 1.00 53.07  ? 83   GLY A N     1 
ATOM   1411 C CA    . GLY B 2 83  ? 18.890 2.436   -51.930 1.00 54.27  ? 83   GLY A CA    1 
ATOM   1412 C C     . GLY B 2 83  ? 19.741 3.450   -52.661 1.00 55.99  ? 83   GLY A C     1 
ATOM   1413 O O     . GLY B 2 83  ? 19.708 4.654   -52.373 1.00 56.16  ? 83   GLY A O     1 
ATOM   1414 N N     . LYS B 2 84  ? 20.498 2.945   -53.628 1.00 56.69  ? 84   LYS A N     1 
ATOM   1415 C CA    . LYS B 2 84  ? 21.400 3.756   -54.456 1.00 58.09  ? 84   LYS A CA    1 
ATOM   1416 C C     . LYS B 2 84  ? 20.745 4.738   -55.436 1.00 57.49  ? 84   LYS A C     1 
ATOM   1417 O O     . LYS B 2 84  ? 21.298 5.791   -55.742 1.00 58.39  ? 84   LYS A O     1 
ATOM   1418 C CB    . LYS B 2 84  ? 21.862 2.931   -55.647 1.00 60.30  ? 84   LYS A CB    1 
ATOM   1419 C CG    . LYS B 2 84  ? 23.301 3.173   -56.083 1.00 62.37  ? 84   LYS A CG    1 
ATOM   1420 C CD    . LYS B 2 84  ? 23.920 1.916   -56.706 1.00 63.87  ? 84   LYS A CD    1 
ATOM   1421 C CE    . LYS B 2 84  ? 25.439 1.868   -56.558 1.00 64.74  ? 84   LYS A CE    1 
ATOM   1422 N NZ    . LYS B 2 84  ? 26.024 0.569   -56.989 1.00 66.03  ? 84   LYS A NZ    1 
ATOM   1423 N N     . ALA B 2 85  ? 19.576 4.368   -55.931 1.00 56.58  ? 85   ALA A N     1 
ATOM   1424 C CA    . ALA B 2 85  ? 18.760 5.247   -56.752 1.00 55.11  ? 85   ALA A CA    1 
ATOM   1425 C C     . ALA B 2 85  ? 17.862 6.199   -55.951 1.00 54.97  ? 85   ALA A C     1 
ATOM   1426 O O     . ALA B 2 85  ? 17.534 7.293   -56.423 1.00 55.34  ? 85   ALA A O     1 
ATOM   1427 C CB    . ALA B 2 85  ? 17.878 4.411   -57.675 1.00 54.58  ? 85   ALA A CB    1 
ATOM   1428 N N     . VAL B 2 86  ? 17.488 5.794   -54.743 1.00 53.60  ? 86   VAL A N     1 
ATOM   1429 C CA    . VAL B 2 86  ? 16.586 6.608   -53.943 1.00 52.23  ? 86   VAL A CA    1 
ATOM   1430 C C     . VAL B 2 86  ? 17.174 7.568   -52.902 1.00 51.15  ? 86   VAL A C     1 
ATOM   1431 O O     . VAL B 2 86  ? 16.496 8.502   -52.464 1.00 49.10  ? 86   VAL A O     1 
ATOM   1432 C CB    . VAL B 2 86  ? 15.555 5.695   -53.263 1.00 52.74  ? 86   VAL A CB    1 
ATOM   1433 C CG1   . VAL B 2 86  ? 15.963 5.402   -51.825 1.00 52.22  ? 86   VAL A CG1   1 
ATOM   1434 C CG2   . VAL B 2 86  ? 14.192 6.324   -53.355 1.00 53.40  ? 86   VAL A CG2   1 
ATOM   1435 N N     . LEU B 2 87  ? 18.429 7.361   -52.520 1.00 51.13  ? 87   LEU A N     1 
ATOM   1436 C CA    . LEU B 2 87  ? 19.049 8.213   -51.508 1.00 51.28  ? 87   LEU A CA    1 
ATOM   1437 C C     . LEU B 2 87  ? 19.902 9.360   -52.042 1.00 51.88  ? 87   LEU A C     1 
ATOM   1438 O O     . LEU B 2 87  ? 20.613 9.204   -53.034 1.00 52.41  ? 87   LEU A O     1 
ATOM   1439 C CB    . LEU B 2 87  ? 19.910 7.353   -50.583 1.00 51.48  ? 87   LEU A CB    1 
ATOM   1440 C CG    . LEU B 2 87  ? 19.211 6.214   -49.842 1.00 51.93  ? 87   LEU A CG    1 
ATOM   1441 C CD1   . LEU B 2 87  ? 20.243 5.276   -49.226 1.00 51.32  ? 87   LEU A CD1   1 
ATOM   1442 C CD2   . LEU B 2 87  ? 18.294 6.803   -48.781 1.00 51.34  ? 87   LEU A CD2   1 
ATOM   1443 N N     . ASP B 2 88  ? 19.836 10.506  -51.367 1.00 52.75  ? 88   ASP A N     1 
ATOM   1444 C CA    . ASP B 2 88  ? 20.634 11.671  -51.735 1.00 54.05  ? 88   ASP A CA    1 
ATOM   1445 C C     . ASP B 2 88  ? 22.117 11.301  -51.620 1.00 55.09  ? 88   ASP A C     1 
ATOM   1446 O O     . ASP B 2 88  ? 22.937 11.738  -52.422 1.00 56.23  ? 88   ASP A O     1 
ATOM   1447 C CB    . ASP B 2 88  ? 20.345 12.851  -50.795 1.00 53.39  ? 88   ASP A CB    1 
ATOM   1448 C CG    . ASP B 2 88  ? 18.990 13.489  -51.041 1.00 54.19  ? 88   ASP A CG    1 
ATOM   1449 O OD1   . ASP B 2 88  ? 18.240 12.989  -51.906 1.00 55.16  ? 88   ASP A OD1   1 
ATOM   1450 O OD2   . ASP B 2 88  ? 18.672 14.496  -50.367 1.00 53.21  ? 88   ASP A OD2   1 
ATOM   1451 N N     . SER B 2 89  ? 22.449 10.499  -50.609 1.00 55.44  ? 89   SER A N     1 
ATOM   1452 C CA    . SER B 2 89  ? 23.820 10.046  -50.357 1.00 56.26  ? 89   SER A CA    1 
ATOM   1453 C C     . SER B 2 89  ? 23.712 8.661   -49.748 1.00 57.09  ? 89   SER A C     1 
ATOM   1454 O O     . SER B 2 89  ? 22.828 8.427   -48.933 1.00 58.34  ? 89   SER A O     1 
ATOM   1455 C CB    . SER B 2 89  ? 24.513 10.957  -49.341 1.00 56.03  ? 89   SER A CB    1 
ATOM   1456 O OG    . SER B 2 89  ? 24.306 12.325  -49.639 1.00 57.73  ? 89   SER A OG    1 
ATOM   1457 N N     . TYR B 2 90  ? 24.587 7.735   -50.120 1.00 57.74  ? 90   TYR A N     1 
ATOM   1458 C CA    . TYR B 2 90  ? 24.493 6.413   -49.519 1.00 58.92  ? 90   TYR A CA    1 
ATOM   1459 C C     . TYR B 2 90  ? 25.802 5.908   -48.929 1.00 59.67  ? 90   TYR A C     1 
ATOM   1460 O O     . TYR B 2 90  ? 26.817 6.601   -48.953 1.00 60.25  ? 90   TYR A O     1 
ATOM   1461 C CB    . TYR B 2 90  ? 23.930 5.400   -50.513 1.00 59.08  ? 90   TYR A CB    1 
ATOM   1462 C CG    . TYR B 2 90  ? 24.857 5.002   -51.632 1.00 59.87  ? 90   TYR A CG    1 
ATOM   1463 C CD1   . TYR B 2 90  ? 25.394 3.719   -51.681 1.00 59.69  ? 90   TYR A CD1   1 
ATOM   1464 C CD2   . TYR B 2 90  ? 25.142 5.881   -52.680 1.00 59.16  ? 90   TYR A CD2   1 
ATOM   1465 C CE1   . TYR B 2 90  ? 26.183 3.313   -52.746 1.00 60.56  ? 90   TYR A CE1   1 
ATOM   1466 C CE2   . TYR B 2 90  ? 25.931 5.487   -53.752 1.00 58.86  ? 90   TYR A CE2   1 
ATOM   1467 C CZ    . TYR B 2 90  ? 26.446 4.200   -53.780 1.00 59.60  ? 90   TYR A CZ    1 
ATOM   1468 O OH    . TYR B 2 90  ? 27.217 3.784   -54.839 1.00 60.24  ? 90   TYR A OH    1 
ATOM   1469 N N     . GLU B 2 91  ? 25.765 4.694   -48.393 1.00 59.96  ? 91   GLU A N     1 
ATOM   1470 C CA    . GLU B 2 91  ? 26.926 4.101   -47.753 1.00 60.14  ? 91   GLU A CA    1 
ATOM   1471 C C     . GLU B 2 91  ? 26.566 2.683   -47.348 1.00 59.46  ? 91   GLU A C     1 
ATOM   1472 O O     . GLU B 2 91  ? 25.869 2.491   -46.358 1.00 60.38  ? 91   GLU A O     1 
ATOM   1473 C CB    . GLU B 2 91  ? 27.276 4.912   -46.503 1.00 61.47  ? 91   GLU A CB    1 
ATOM   1474 C CG    . GLU B 2 91  ? 28.344 4.302   -45.607 1.00 64.25  ? 91   GLU A CG    1 
ATOM   1475 C CD    . GLU B 2 91  ? 28.377 4.945   -44.230 1.00 65.47  ? 91   GLU A CD    1 
ATOM   1476 O OE1   . GLU B 2 91  ? 28.511 6.187   -44.155 1.00 66.66  ? 91   GLU A OE1   1 
ATOM   1477 O OE2   . GLU B 2 91  ? 28.265 4.210   -43.223 1.00 65.50  ? 91   GLU A OE2   1 
ATOM   1478 N N     . ILE B 2 92  ? 27.026 1.690   -48.104 1.00 58.18  ? 92   ILE A N     1 
ATOM   1479 C CA    . ILE B 2 92  ? 26.722 0.307   -47.761 1.00 57.48  ? 92   ILE A CA    1 
ATOM   1480 C C     . ILE B 2 92  ? 27.094 0.038   -46.309 1.00 58.09  ? 92   ILE A C     1 
ATOM   1481 O O     . ILE B 2 92  ? 28.115 0.516   -45.816 1.00 57.99  ? 92   ILE A O     1 
ATOM   1482 C CB    . ILE B 2 92  ? 27.477 -0.689  -48.654 1.00 55.97  ? 92   ILE A CB    1 
ATOM   1483 C CG1   . ILE B 2 92  ? 27.004 -0.547  -50.097 1.00 56.01  ? 92   ILE A CG1   1 
ATOM   1484 C CG2   . ILE B 2 92  ? 27.229 -2.111  -48.170 1.00 54.99  ? 92   ILE A CG2   1 
ATOM   1485 C CD1   . ILE B 2 92  ? 27.577 -1.583  -51.043 1.00 56.16  ? 92   ILE A CD1   1 
ATOM   1486 N N     . ARG B 2 93  ? 26.254 -0.733  -45.631 1.00 58.34  ? 93   ARG A N     1 
ATOM   1487 C CA    . ARG B 2 93  ? 26.462 -1.069  -44.231 1.00 58.66  ? 93   ARG A CA    1 
ATOM   1488 C C     . ARG B 2 93  ? 26.381 -2.588  -44.101 1.00 59.19  ? 93   ARG A C     1 
ATOM   1489 O O     . ARG B 2 93  ? 25.868 -3.262  -44.989 1.00 58.59  ? 93   ARG A O     1 
ATOM   1490 C CB    . ARG B 2 93  ? 25.622 -0.134  -43.353 1.00 57.83  ? 93   ARG A CB    1 
ATOM   1491 C CG    . ARG B 2 93  ? 26.275 1.193   -43.008 1.00 57.95  ? 93   ARG A CG    1 
ATOM   1492 C CD    . ARG B 2 93  ? 25.513 1.953   -41.927 1.00 57.61  ? 93   ARG A CD    1 
ATOM   1493 N NE    . ARG B 2 93  ? 25.864 3.370   -41.857 1.00 59.75  ? 93   ARG A NE    1 
ATOM   1494 C CZ    . ARG B 2 93  ? 25.290 4.247   -41.037 1.00 60.98  ? 93   ARG A CZ    1 
ATOM   1495 N NH1   . ARG B 2 93  ? 24.330 3.862   -40.207 1.00 60.49  ? 93   ARG A NH1   1 
ATOM   1496 N NH2   . ARG B 2 93  ? 25.691 5.509   -41.020 1.00 62.05  ? 93   ARG A NH2   1 
ATOM   1497 N N     . TYR B 2 94  ? 26.887 -3.135  -43.003 1.00 61.11  ? 94   TYR A N     1 
ATOM   1498 C CA    . TYR B 2 94  ? 26.834 -4.576  -42.827 1.00 62.53  ? 94   TYR A CA    1 
ATOM   1499 C C     . TYR B 2 94  ? 26.253 -4.995  -41.488 1.00 63.64  ? 94   TYR A C     1 
ATOM   1500 O O     . TYR B 2 94  ? 26.082 -4.184  -40.574 1.00 63.78  ? 94   TYR A O     1 
ATOM   1501 C CB    . TYR B 2 94  ? 28.224 -5.189  -43.000 1.00 62.66  ? 94   TYR A CB    1 
ATOM   1502 C CG    . TYR B 2 94  ? 28.859 -4.865  -44.333 1.00 63.85  ? 94   TYR A CG    1 
ATOM   1503 C CD1   . TYR B 2 94  ? 29.454 -3.621  -44.563 1.00 63.83  ? 94   TYR A CD1   1 
ATOM   1504 C CD2   . TYR B 2 94  ? 28.838 -5.788  -45.378 1.00 64.88  ? 94   TYR A CD2   1 
ATOM   1505 C CE1   . TYR B 2 94  ? 30.012 -3.306  -45.803 1.00 64.24  ? 94   TYR A CE1   1 
ATOM   1506 C CE2   . TYR B 2 94  ? 29.394 -5.483  -46.625 1.00 65.29  ? 94   TYR A CE2   1 
ATOM   1507 C CZ    . TYR B 2 94  ? 29.978 -4.242  -46.828 1.00 64.88  ? 94   TYR A CZ    1 
ATOM   1508 O OH    . TYR B 2 94  ? 30.523 -3.939  -48.055 1.00 65.52  ? 94   TYR A OH    1 
ATOM   1509 N N     . ALA B 2 95  ? 25.943 -6.282  -41.398 1.00 65.04  ? 95   ALA A N     1 
ATOM   1510 C CA    . ALA B 2 95  ? 25.380 -6.873  -40.188 1.00 65.62  ? 95   ALA A CA    1 
ATOM   1511 C C     . ALA B 2 95  ? 25.024 -8.304  -40.670 1.00 65.97  ? 95   ALA A C     1 
ATOM   1512 O O     . ALA B 2 95  ? 25.709 -8.864  -41.528 1.00 65.70  ? 95   ALA A O     1 
ATOM   1513 C CB    . ALA B 2 95  ? 24.082 -6.177  -39.794 1.00 64.63  ? 95   ALA A CB    1 
ATOM   1514 N N     . GLU B 2 96  ? 24.008 -8.906  -40.072 1.00 67.10  ? 96   GLU A N     1 
ATOM   1515 C CA    . GLU B 2 96  ? 23.613 -10.237 -40.429 1.00 67.62  ? 96   GLU A CA    1 
ATOM   1516 C C     . GLU B 2 96  ? 23.715 -10.386 -41.965 1.00 66.96  ? 96   GLU A C     1 
ATOM   1517 O O     . GLU B 2 96  ? 24.222 -11.377 -42.488 1.00 66.72  ? 96   GLU A O     1 
ATOM   1518 C CB    . GLU B 2 96  ? 22.184 -10.540 -39.962 1.00 69.43  ? 96   GLU A CB    1 
ATOM   1519 C CG    . GLU B 2 96  ? 21.736 -11.989 -40.045 1.00 70.95  ? 96   GLU A CG    1 
ATOM   1520 C CD    . GLU B 2 96  ? 20.441 -12.222 -39.285 1.00 72.61  ? 96   GLU A CD    1 
ATOM   1521 O OE1   . GLU B 2 96  ? 19.467 -11.475 -39.528 1.00 73.23  ? 96   GLU A OE1   1 
ATOM   1522 O OE2   . GLU B 2 96  ? 20.396 -13.150 -38.447 1.00 72.26  ? 96   GLU A OE2   1 
ATOM   1523 N N     . HIS B 2 97  ? 23.239 -9.351  -42.655 1.00 65.44  ? 97   HIS A N     1 
ATOM   1524 C CA    . HIS B 2 97  ? 23.279 -9.259  -44.110 1.00 64.41  ? 97   HIS A CA    1 
ATOM   1525 C C     . HIS B 2 97  ? 23.570 -7.793  -44.413 1.00 62.49  ? 97   HIS A C     1 
ATOM   1526 O O     . HIS B 2 97  ? 23.320 -6.926  -43.580 1.00 62.90  ? 97   HIS A O     1 
ATOM   1527 C CB    . HIS B 2 97  ? 21.935 -9.662  -44.720 1.00 66.02  ? 97   HIS A CB    1 
ATOM   1528 C CG    . HIS B 2 97  ? 21.557 -11.085 -44.457 1.00 67.67  ? 97   HIS A CG    1 
ATOM   1529 N ND1   . HIS B 2 97  ? 22.309 -12.149 -44.907 1.00 68.07  ? 97   HIS A ND1   1 
ATOM   1530 C CD2   . HIS B 2 97  ? 20.516 -11.622 -43.776 1.00 67.93  ? 97   HIS A CD2   1 
ATOM   1531 C CE1   . HIS B 2 97  ? 21.748 -13.279 -44.516 1.00 67.81  ? 97   HIS A CE1   1 
ATOM   1532 N NE2   . HIS B 2 97  ? 20.658 -12.987 -43.828 1.00 67.95  ? 97   HIS A NE2   1 
ATOM   1533 N N     . PRO B 2 98  ? 24.112 -7.495  -45.600 1.00 60.43  ? 98   PRO A N     1 
ATOM   1534 C CA    . PRO B 2 98  ? 24.404 -6.097  -45.923 1.00 58.29  ? 98   PRO A CA    1 
ATOM   1535 C C     . PRO B 2 98  ? 23.146 -5.314  -46.283 1.00 56.03  ? 98   PRO A C     1 
ATOM   1536 O O     . PRO B 2 98  ? 22.132 -5.899  -46.657 1.00 56.60  ? 98   PRO A O     1 
ATOM   1537 C CB    . PRO B 2 98  ? 25.376 -6.217  -47.094 1.00 58.52  ? 98   PRO A CB    1 
ATOM   1538 C CG    . PRO B 2 98  ? 24.860 -7.415  -47.809 1.00 59.48  ? 98   PRO A CG    1 
ATOM   1539 C CD    . PRO B 2 98  ? 24.556 -8.390  -46.683 1.00 60.40  ? 98   PRO A CD    1 
ATOM   1540 N N     . TYR B 2 99  ? 23.219 -3.993  -46.158 1.00 52.89  ? 99   TYR A N     1 
ATOM   1541 C CA    . TYR B 2 99  ? 22.097 -3.120  -46.475 1.00 51.39  ? 99   TYR A CA    1 
ATOM   1542 C C     . TYR B 2 99  ? 22.641 -1.735  -46.786 1.00 49.85  ? 99   TYR A C     1 
ATOM   1543 O O     . TYR B 2 99  ? 23.846 -1.535  -46.771 1.00 50.28  ? 99   TYR A O     1 
ATOM   1544 C CB    . TYR B 2 99  ? 21.113 -3.062  -45.300 1.00 52.74  ? 99   TYR A CB    1 
ATOM   1545 C CG    . TYR B 2 99  ? 21.672 -2.448  -44.043 1.00 52.43  ? 99   TYR A CG    1 
ATOM   1546 C CD1   . TYR B 2 99  ? 21.396 -1.122  -43.710 1.00 53.03  ? 99   TYR A CD1   1 
ATOM   1547 C CD2   . TYR B 2 99  ? 22.492 -3.187  -43.191 1.00 53.32  ? 99   TYR A CD2   1 
ATOM   1548 C CE1   . TYR B 2 99  ? 21.927 -0.546  -42.552 1.00 53.58  ? 99   TYR A CE1   1 
ATOM   1549 C CE2   . TYR B 2 99  ? 23.030 -2.622  -42.036 1.00 53.42  ? 99   TYR A CE2   1 
ATOM   1550 C CZ    . TYR B 2 99  ? 22.744 -1.305  -41.723 1.00 53.42  ? 99   TYR A CZ    1 
ATOM   1551 O OH    . TYR B 2 99  ? 23.284 -0.751  -40.591 1.00 53.55  ? 99   TYR A OH    1 
ATOM   1552 N N     . VAL B 2 100 ? 21.771 -0.772  -47.057 1.00 47.60  ? 100  VAL A N     1 
ATOM   1553 C CA    . VAL B 2 100 ? 22.248 0.563   -47.389 1.00 46.47  ? 100  VAL A CA    1 
ATOM   1554 C C     . VAL B 2 100 ? 21.715 1.646   -46.475 1.00 46.15  ? 100  VAL A C     1 
ATOM   1555 O O     . VAL B 2 100 ? 20.515 1.731   -46.253 1.00 46.73  ? 100  VAL A O     1 
ATOM   1556 C CB    . VAL B 2 100 ? 21.849 0.965   -48.830 1.00 47.21  ? 100  VAL A CB    1 
ATOM   1557 C CG1   . VAL B 2 100 ? 22.324 2.382   -49.122 1.00 46.46  ? 100  VAL A CG1   1 
ATOM   1558 C CG2   . VAL B 2 100 ? 22.423 -0.017  -49.829 1.00 46.79  ? 100  VAL A CG2   1 
ATOM   1559 N N     . HIS B 2 101 ? 22.609 2.483   -45.962 1.00 45.47  ? 101  HIS A N     1 
ATOM   1560 C CA    . HIS B 2 101 ? 22.215 3.590   -45.105 1.00 45.23  ? 101  HIS A CA    1 
ATOM   1561 C C     . HIS B 2 101 ? 22.431 4.833   -45.945 1.00 45.70  ? 101  HIS A C     1 
ATOM   1562 O O     . HIS B 2 101 ? 23.171 4.791   -46.922 1.00 46.46  ? 101  HIS A O     1 
ATOM   1563 C CB    . HIS B 2 101 ? 23.098 3.666   -43.856 1.00 44.26  ? 101  HIS A CB    1 
ATOM   1564 C CG    . HIS B 2 101 ? 22.763 4.812   -42.951 1.00 42.85  ? 101  HIS A CG    1 
ATOM   1565 N ND1   . HIS B 2 101 ? 21.716 4.773   -42.054 1.00 43.22  ? 101  HIS A ND1   1 
ATOM   1566 C CD2   . HIS B 2 101 ? 23.312 6.045   -42.834 1.00 43.04  ? 101  HIS A CD2   1 
ATOM   1567 C CE1   . HIS B 2 101 ? 21.636 5.932   -41.423 1.00 43.40  ? 101  HIS A CE1   1 
ATOM   1568 N NE2   . HIS B 2 101 ? 22.593 6.722   -41.878 1.00 42.47  ? 101  HIS A NE2   1 
ATOM   1569 N N     . GLY B 2 102 ? 21.801 5.939   -45.573 1.00 45.91  ? 102  GLY A N     1 
ATOM   1570 C CA    . GLY B 2 102 ? 21.976 7.152   -46.346 1.00 46.45  ? 102  GLY A CA    1 
ATOM   1571 C C     . GLY B 2 102 ? 21.162 8.318   -45.829 1.00 47.13  ? 102  GLY A C     1 
ATOM   1572 O O     . GLY B 2 102 ? 20.668 8.280   -44.703 1.00 47.33  ? 102  GLY A O     1 
ATOM   1573 N N     . VAL B 2 103 ? 21.021 9.350   -46.659 1.00 47.86  ? 103  VAL A N     1 
ATOM   1574 C CA    . VAL B 2 103 ? 20.270 10.549  -46.293 1.00 48.55  ? 103  VAL A CA    1 
ATOM   1575 C C     . VAL B 2 103 ? 19.204 10.914  -47.329 1.00 49.09  ? 103  VAL A C     1 
ATOM   1576 O O     . VAL B 2 103 ? 19.254 10.469  -48.476 1.00 49.14  ? 103  VAL A O     1 
ATOM   1577 C CB    . VAL B 2 103 ? 21.217 11.762  -46.137 1.00 48.21  ? 103  VAL A CB    1 
ATOM   1578 C CG1   . VAL B 2 103 ? 20.439 12.979  -45.645 1.00 48.42  ? 103  VAL A CG1   1 
ATOM   1579 C CG2   . VAL B 2 103 ? 22.343 11.423  -45.184 1.00 47.58  ? 103  VAL A CG2   1 
ATOM   1580 N N     . VAL B 2 104 ? 18.241 11.726  -46.899 1.00 49.15  ? 104  VAL A N     1 
ATOM   1581 C CA    . VAL B 2 104 ? 17.150 12.210  -47.743 1.00 48.50  ? 104  VAL A CA    1 
ATOM   1582 C C     . VAL B 2 104 ? 16.652 13.499  -47.090 1.00 49.17  ? 104  VAL A C     1 
ATOM   1583 O O     . VAL B 2 104 ? 16.251 13.502  -45.930 1.00 49.27  ? 104  VAL A O     1 
ATOM   1584 C CB    . VAL B 2 104 ? 15.990 11.175  -47.830 1.00 47.97  ? 104  VAL A CB    1 
ATOM   1585 C CG1   . VAL B 2 104 ? 14.767 11.813  -48.457 1.00 48.21  ? 104  VAL A CG1   1 
ATOM   1586 C CG2   . VAL B 2 104 ? 16.419 9.973   -48.665 1.00 46.98  ? 104  VAL A CG2   1 
ATOM   1587 N N     . LYS B 2 105 ? 16.687 14.595  -47.837 1.00 50.09  ? 105  LYS A N     1 
ATOM   1588 C CA    . LYS B 2 105 ? 16.274 15.891  -47.316 1.00 50.91  ? 105  LYS A CA    1 
ATOM   1589 C C     . LYS B 2 105 ? 16.795 16.117  -45.902 1.00 51.49  ? 105  LYS A C     1 
ATOM   1590 O O     . LYS B 2 105 ? 16.085 16.616  -45.028 1.00 52.43  ? 105  LYS A O     1 
ATOM   1591 C CB    . LYS B 2 105 ? 14.750 16.033  -47.359 1.00 52.51  ? 105  LYS A CB    1 
ATOM   1592 C CG    . LYS B 2 105 ? 14.204 16.200  -48.777 1.00 54.43  ? 105  LYS A CG    1 
ATOM   1593 C CD    . LYS B 2 105 ? 12.808 16.810  -48.799 1.00 54.49  ? 105  LYS A CD    1 
ATOM   1594 C CE    . LYS B 2 105 ? 12.830 18.250  -48.332 1.00 54.98  ? 105  LYS A CE    1 
ATOM   1595 N NZ    . LYS B 2 105 ? 11.489 18.898  -48.425 1.00 57.34  ? 105  LYS A NZ    1 
ATOM   1596 N N     . GLY B 2 106 ? 18.044 15.723  -45.682 1.00 52.03  ? 106  GLY A N     1 
ATOM   1597 C CA    . GLY B 2 106 ? 18.668 15.910  -44.385 1.00 51.78  ? 106  GLY A CA    1 
ATOM   1598 C C     . GLY B 2 106 ? 18.407 14.921  -43.256 1.00 51.68  ? 106  GLY A C     1 
ATOM   1599 O O     . GLY B 2 106 ? 18.827 15.180  -42.130 1.00 51.88  ? 106  GLY A O     1 
ATOM   1600 N N     . VAL B 2 107 ? 17.732 13.805  -43.520 1.00 50.64  ? 107  VAL A N     1 
ATOM   1601 C CA    . VAL B 2 107 ? 17.480 12.848  -42.451 1.00 50.86  ? 107  VAL A CA    1 
ATOM   1602 C C     . VAL B 2 107 ? 17.988 11.436  -42.742 1.00 50.33  ? 107  VAL A C     1 
ATOM   1603 O O     . VAL B 2 107 ? 17.842 10.912  -43.850 1.00 50.28  ? 107  VAL A O     1 
ATOM   1604 C CB    . VAL B 2 107 ? 15.981 12.789  -42.085 1.00 51.53  ? 107  VAL A CB    1 
ATOM   1605 C CG1   . VAL B 2 107 ? 15.443 14.197  -41.861 1.00 51.48  ? 107  VAL A CG1   1 
ATOM   1606 C CG2   . VAL B 2 107 ? 15.217 12.085  -43.158 1.00 53.31  ? 107  VAL A CG2   1 
ATOM   1607 N N     . GLU B 2 108 ? 18.595 10.839  -41.721 1.00 49.62  ? 108  GLU A N     1 
ATOM   1608 C CA    . GLU B 2 108 ? 19.168 9.499   -41.802 1.00 49.09  ? 108  GLU A CA    1 
ATOM   1609 C C     . GLU B 2 108 ? 18.155 8.443   -42.220 1.00 47.68  ? 108  GLU A C     1 
ATOM   1610 O O     . GLU B 2 108 ? 17.061 8.337   -41.646 1.00 46.95  ? 108  GLU A O     1 
ATOM   1611 C CB    . GLU B 2 108 ? 19.770 9.119   -40.447 1.00 51.86  ? 108  GLU A CB    1 
ATOM   1612 C CG    . GLU B 2 108 ? 20.802 10.109  -39.930 1.00 54.37  ? 108  GLU A CG    1 
ATOM   1613 C CD    . GLU B 2 108 ? 22.036 10.152  -40.800 1.00 56.67  ? 108  GLU A CD    1 
ATOM   1614 O OE1   . GLU B 2 108 ? 22.726 9.117   -40.894 1.00 58.50  ? 108  GLU A OE1   1 
ATOM   1615 O OE2   . GLU B 2 108 ? 22.314 11.216  -41.395 1.00 57.90  ? 108  GLU A OE2   1 
ATOM   1616 N N     . VAL B 2 109 ? 18.531 7.637   -43.202 1.00 46.82  ? 109  VAL A N     1 
ATOM   1617 C CA    . VAL B 2 109 ? 17.640 6.596   -43.682 1.00 46.95  ? 109  VAL A CA    1 
ATOM   1618 C C     . VAL B 2 109 ? 18.318 5.241   -43.816 1.00 47.03  ? 109  VAL A C     1 
ATOM   1619 O O     . VAL B 2 109 ? 19.478 5.156   -44.211 1.00 46.61  ? 109  VAL A O     1 
ATOM   1620 C CB    . VAL B 2 109 ? 17.036 6.996   -45.046 1.00 46.40  ? 109  VAL A CB    1 
ATOM   1621 C CG1   . VAL B 2 109 ? 16.266 5.831   -45.647 1.00 46.51  ? 109  VAL A CG1   1 
ATOM   1622 C CG2   . VAL B 2 109 ? 16.136 8.206   -44.862 1.00 46.50  ? 109  VAL A CG2   1 
ATOM   1623 N N     . ASP B 2 110 ? 17.591 4.187   -43.466 1.00 47.14  ? 110  ASP A N     1 
ATOM   1624 C CA    . ASP B 2 110 ? 18.105 2.829   -43.590 1.00 48.53  ? 110  ASP A CA    1 
ATOM   1625 C C     . ASP B 2 110 ? 17.219 2.091   -44.588 1.00 48.49  ? 110  ASP A C     1 
ATOM   1626 O O     . ASP B 2 110 ? 16.015 1.981   -44.380 1.00 48.95  ? 110  ASP A O     1 
ATOM   1627 C CB    . ASP B 2 110 ? 18.084 2.090   -42.244 1.00 49.46  ? 110  ASP A CB    1 
ATOM   1628 C CG    . ASP B 2 110 ? 19.322 2.354   -41.403 1.00 50.26  ? 110  ASP A CG    1 
ATOM   1629 O OD1   . ASP B 2 110 ? 20.430 2.409   -41.970 1.00 52.92  ? 110  ASP A OD1   1 
ATOM   1630 O OD2   . ASP B 2 110 ? 19.195 2.485   -40.169 1.00 50.94  ? 110  ASP A OD2   1 
ATOM   1631 N N     . VAL B 2 111 ? 17.814 1.612   -45.678 1.00 47.47  ? 111  VAL A N     1 
ATOM   1632 C CA    . VAL B 2 111 ? 17.083 0.877   -46.701 1.00 46.71  ? 111  VAL A CA    1 
ATOM   1633 C C     . VAL B 2 111 ? 17.490 -0.577  -46.564 1.00 47.83  ? 111  VAL A C     1 
ATOM   1634 O O     . VAL B 2 111 ? 18.553 -0.985  -47.035 1.00 48.21  ? 111  VAL A O     1 
ATOM   1635 C CB    . VAL B 2 111 ? 17.426 1.382   -48.109 1.00 45.29  ? 111  VAL A CB    1 
ATOM   1636 C CG1   . VAL B 2 111 ? 16.618 0.619   -49.142 1.00 44.71  ? 111  VAL A CG1   1 
ATOM   1637 C CG2   . VAL B 2 111 ? 17.130 2.867   -48.210 1.00 43.66  ? 111  VAL A CG2   1 
ATOM   1638 N N     . VAL B 2 112 ? 16.628 -1.352  -45.916 1.00 48.34  ? 112  VAL A N     1 
ATOM   1639 C CA    . VAL B 2 112 ? 16.890 -2.758  -45.635 1.00 48.01  ? 112  VAL A CA    1 
ATOM   1640 C C     . VAL B 2 112 ? 16.065 -3.754  -46.437 1.00 49.65  ? 112  VAL A C     1 
ATOM   1641 O O     . VAL B 2 112 ? 14.838 -3.677  -46.474 1.00 49.65  ? 112  VAL A O     1 
ATOM   1642 C CB    . VAL B 2 112 ? 16.642 -3.036  -44.145 1.00 46.85  ? 112  VAL A CB    1 
ATOM   1643 C CG1   . VAL B 2 112 ? 17.103 -4.447  -43.777 1.00 43.99  ? 112  VAL A CG1   1 
ATOM   1644 C CG2   . VAL B 2 112 ? 17.323 -1.956  -43.317 1.00 45.50  ? 112  VAL A CG2   1 
ATOM   1645 N N     . PRO B 2 113 ? 16.737 -4.703  -47.097 1.00 50.35  ? 113  PRO A N     1 
ATOM   1646 C CA    . PRO B 2 113 ? 16.040 -5.717  -47.892 1.00 50.83  ? 113  PRO A CA    1 
ATOM   1647 C C     . PRO B 2 113 ? 15.680 -6.924  -47.031 1.00 51.82  ? 113  PRO A C     1 
ATOM   1648 O O     . PRO B 2 113 ? 16.526 -7.446  -46.310 1.00 51.89  ? 113  PRO A O     1 
ATOM   1649 C CB    . PRO B 2 113 ? 17.067 -6.089  -48.964 1.00 50.45  ? 113  PRO A CB    1 
ATOM   1650 C CG    . PRO B 2 113 ? 17.999 -4.910  -49.000 1.00 51.02  ? 113  PRO A CG    1 
ATOM   1651 C CD    . PRO B 2 113 ? 18.131 -4.578  -47.545 1.00 50.85  ? 113  PRO A CD    1 
ATOM   1652 N N     . CYS B 2 114 ? 14.431 -7.366  -47.101 1.00 52.94  ? 114  CYS A N     1 
ATOM   1653 C CA    . CYS B 2 114 ? 14.011 -8.535  -46.337 1.00 54.99  ? 114  CYS A CA    1 
ATOM   1654 C C     . CYS B 2 114 ? 12.970 -9.293  -47.139 1.00 55.79  ? 114  CYS A C     1 
ATOM   1655 O O     . CYS B 2 114 ? 12.468 -8.791  -48.138 1.00 56.25  ? 114  CYS A O     1 
ATOM   1656 C CB    . CYS B 2 114 ? 13.406 -8.128  -44.997 1.00 55.72  ? 114  CYS A CB    1 
ATOM   1657 S SG    . CYS B 2 114 ? 11.813 -7.314  -45.145 1.00 55.74  ? 114  CYS A SG    1 
ATOM   1658 N N     . TYR B 2 115 ? 12.648 -10.501 -46.696 1.00 56.34  ? 115  TYR A N     1 
ATOM   1659 C CA    . TYR B 2 115 ? 11.660 -11.315 -47.378 1.00 57.74  ? 115  TYR A CA    1 
ATOM   1660 C C     . TYR B 2 115 ? 10.250 -11.009 -46.896 1.00 58.78  ? 115  TYR A C     1 
ATOM   1661 O O     . TYR B 2 115 ? 10.001 -10.943 -45.694 1.00 59.26  ? 115  TYR A O     1 
ATOM   1662 C CB    . TYR B 2 115 ? 11.924 -12.800 -47.134 1.00 57.86  ? 115  TYR A CB    1 
ATOM   1663 C CG    . TYR B 2 115 ? 13.129 -13.367 -47.834 1.00 58.77  ? 115  TYR A CG    1 
ATOM   1664 C CD1   . TYR B 2 115 ? 14.269 -13.727 -47.116 1.00 58.88  ? 115  TYR A CD1   1 
ATOM   1665 C CD2   . TYR B 2 115 ? 13.119 -13.590 -49.213 1.00 58.58  ? 115  TYR A CD2   1 
ATOM   1666 C CE1   . TYR B 2 115 ? 15.370 -14.303 -47.749 1.00 58.67  ? 115  TYR A CE1   1 
ATOM   1667 C CE2   . TYR B 2 115 ? 14.215 -14.163 -49.856 1.00 59.16  ? 115  TYR A CE2   1 
ATOM   1668 C CZ    . TYR B 2 115 ? 15.335 -14.521 -49.116 1.00 59.00  ? 115  TYR A CZ    1 
ATOM   1669 O OH    . TYR B 2 115 ? 16.402 -15.124 -49.737 1.00 59.47  ? 115  TYR A OH    1 
ATOM   1670 N N     . LYS B 2 116 ? 9.328  -10.830 -47.831 1.00 60.44  ? 116  LYS A N     1 
ATOM   1671 C CA    . LYS B 2 116 ? 7.937  -10.591 -47.475 1.00 62.73  ? 116  LYS A CA    1 
ATOM   1672 C C     . LYS B 2 116 ? 7.324  -11.969 -47.237 1.00 64.21  ? 116  LYS A C     1 
ATOM   1673 O O     . LYS B 2 116 ? 7.222  -12.768 -48.161 1.00 64.74  ? 116  LYS A O     1 
ATOM   1674 C CB    . LYS B 2 116 ? 7.197  -9.894  -48.620 1.00 62.77  ? 116  LYS A CB    1 
ATOM   1675 C CG    . LYS B 2 116 ? 5.685  -9.861  -48.446 1.00 63.97  ? 116  LYS A CG    1 
ATOM   1676 C CD    . LYS B 2 116 ? 4.990  -9.276  -49.668 1.00 65.02  ? 116  LYS A CD    1 
ATOM   1677 C CE    . LYS B 2 116 ? 3.479  -9.429  -49.572 1.00 64.48  ? 116  LYS A CE    1 
ATOM   1678 N NZ    . LYS B 2 116 ? 2.798  -8.917  -50.788 1.00 64.62  ? 116  LYS A NZ    1 
ATOM   1679 N N     . LEU B 2 117 ? 6.930  -12.255 -46.002 1.00 66.30  ? 117  LEU A N     1 
ATOM   1680 C CA    . LEU B 2 117 ? 6.337  -13.550 -45.686 1.00 68.18  ? 117  LEU A CA    1 
ATOM   1681 C C     . LEU B 2 117 ? 5.167  -13.371 -44.744 1.00 70.15  ? 117  LEU A C     1 
ATOM   1682 O O     . LEU B 2 117 ? 4.955  -12.285 -44.212 1.00 70.29  ? 117  LEU A O     1 
ATOM   1683 C CB    . LEU B 2 117 ? 7.350  -14.439 -44.976 1.00 66.58  ? 117  LEU A CB    1 
ATOM   1684 C CG    . LEU B 2 117 ? 8.814  -14.029 -45.034 1.00 66.13  ? 117  LEU A CG    1 
ATOM   1685 C CD1   . LEU B 2 117 ? 9.509  -14.373 -43.720 1.00 65.24  ? 117  LEU A CD1   1 
ATOM   1686 C CD2   . LEU B 2 117 ? 9.465  -14.733 -46.209 1.00 66.21  ? 117  LEU A CD2   1 
ATOM   1687 N N     . LYS B 2 118 ? 4.397  -14.434 -44.552 1.00 72.83  ? 118  LYS A N     1 
ATOM   1688 C CA    . LYS B 2 118 ? 3.310  -14.382 -43.586 1.00 76.11  ? 118  LYS A CA    1 
ATOM   1689 C C     . LYS B 2 118 ? 3.564  -15.533 -42.629 1.00 77.58  ? 118  LYS A C     1 
ATOM   1690 O O     . LYS B 2 118 ? 3.958  -16.624 -43.049 1.00 78.12  ? 118  LYS A O     1 
ATOM   1691 C CB    . LYS B 2 118 ? 1.925  -14.525 -44.217 1.00 76.67  ? 118  LYS A CB    1 
ATOM   1692 C CG    . LYS B 2 118 ? 0.833  -14.349 -43.154 1.00 77.85  ? 118  LYS A CG    1 
ATOM   1693 C CD    . LYS B 2 118 ? -0.576 -14.238 -43.709 1.00 78.27  ? 118  LYS A CD    1 
ATOM   1694 C CE    . LYS B 2 118 ? -1.559 -13.919 -42.582 1.00 78.26  ? 118  LYS A CE    1 
ATOM   1695 N NZ    . LYS B 2 118 ? -2.951 -13.716 -43.070 1.00 78.15  ? 118  LYS A NZ    1 
ATOM   1696 N N     . GLU B 2 119 ? 3.346  -15.273 -41.345 1.00 78.82  ? 119  GLU A N     1 
ATOM   1697 C CA    . GLU B 2 119 ? 3.574  -16.252 -40.289 1.00 80.04  ? 119  GLU A CA    1 
ATOM   1698 C C     . GLU B 2 119 ? 5.055  -16.239 -39.924 1.00 79.53  ? 119  GLU A C     1 
ATOM   1699 O O     . GLU B 2 119 ? 5.911  -16.577 -40.742 1.00 78.96  ? 119  GLU A O     1 
ATOM   1700 C CB    . GLU B 2 119 ? 2.830  -17.566 -40.572 1.00 81.69  ? 119  GLU A CB    1 
ATOM   1701 C CG    . GLU B 2 119 ? 1.312  -17.432 -40.623 1.00 83.41  ? 119  GLU A CG    1 
ATOM   1702 C CD    . GLU B 2 119 ? 0.711  -16.987 -39.300 1.00 84.66  ? 119  GLU A CD    1 
ATOM   1703 O OE1   . GLU B 2 119 ? 0.378  -17.857 -38.465 1.00 84.76  ? 119  GLU A OE1   1 
ATOM   1704 O OE2   . GLU B 2 119 ? 0.576  -15.763 -39.094 1.00 85.00  ? 119  GLU A OE2   1 
ATOM   1705 N N     . PRO B 2 120 ? 5.371  -15.815 -38.689 1.00 79.36  ? 120  PRO A N     1 
ATOM   1706 C CA    . PRO B 2 120 ? 6.732  -15.733 -38.156 1.00 79.24  ? 120  PRO A CA    1 
ATOM   1707 C C     . PRO B 2 120 ? 7.566  -16.950 -38.520 1.00 78.97  ? 120  PRO A C     1 
ATOM   1708 O O     . PRO B 2 120 ? 8.791  -16.885 -38.543 1.00 79.51  ? 120  PRO A O     1 
ATOM   1709 C CB    . PRO B 2 120 ? 6.493  -15.537 -36.669 1.00 79.30  ? 120  PRO A CB    1 
ATOM   1710 C CG    . PRO B 2 120 ? 5.302  -14.641 -36.676 1.00 79.41  ? 120  PRO A CG    1 
ATOM   1711 C CD    . PRO B 2 120 ? 4.403  -15.282 -37.714 1.00 79.24  ? 120  PRO A CD    1 
ATOM   1712 N N     . LYS B 2 121 ? 6.899  -18.064 -38.789 1.00 79.08  ? 121  LYS A N     1 
ATOM   1713 C CA    . LYS B 2 121 ? 7.603  -19.293 -39.128 1.00 79.46  ? 121  LYS A CA    1 
ATOM   1714 C C     . LYS B 2 121 ? 8.305  -18.996 -40.452 1.00 79.88  ? 121  LYS A C     1 
ATOM   1715 O O     . LYS B 2 121 ? 7.959  -18.028 -41.133 1.00 80.47  ? 121  LYS A O     1 
ATOM   1716 C CB    . LYS B 2 121 ? 6.602  -20.434 -39.323 1.00 79.95  ? 121  LYS A CB    1 
ATOM   1717 C CG    . LYS B 2 121 ? 5.903  -20.890 -38.048 1.00 80.49  ? 121  LYS A CG    1 
ATOM   1718 C CD    . LYS B 2 121 ? 4.819  -19.914 -37.615 1.00 81.24  ? 121  LYS A CD    1 
ATOM   1719 C CE    . LYS B 2 121 ? 4.609  -19.943 -36.107 1.00 80.83  ? 121  LYS A CE    1 
ATOM   1720 N NZ    . LYS B 2 121 ? 3.612  -18.927 -35.661 1.00 80.98  ? 121  LYS A NZ    1 
ATOM   1721 N N     . ASN B 2 122 ? 9.291  -19.813 -40.812 1.00 79.79  ? 122  ASN A N     1 
ATOM   1722 C CA    . ASN B 2 122 ? 10.027 -19.645 -42.068 1.00 79.71  ? 122  ASN A CA    1 
ATOM   1723 C C     . ASN B 2 122 ? 10.907 -18.395 -42.149 1.00 79.24  ? 122  ASN A C     1 
ATOM   1724 O O     . ASN B 2 122 ? 11.428 -18.083 -43.217 1.00 79.67  ? 122  ASN A O     1 
ATOM   1725 C CB    . ASN B 2 122 ? 9.061  -19.383 -43.236 1.00 79.81  ? 122  ASN A CB    1 
ATOM   1726 C CG    . ASN B 2 122 ? 7.998  -20.465 -43.380 1.00 80.41  ? 122  ASN A CG    1 
ATOM   1727 O OD1   . ASN B 2 122 ? 8.308  -21.644 -43.545 1.00 80.08  ? 122  ASN A OD1   1 
ATOM   1728 N ND2   . ASN B 2 122 ? 6.732  -20.060 -43.321 1.00 80.08  ? 122  ASN A ND2   1 
ATOM   1729 N N     . ILE B 2 123 ? 11.073 -17.680 -41.035 1.00 78.59  ? 123  ILE A N     1 
ATOM   1730 C CA    . ILE B 2 123 ? 12.054 -16.594 -40.936 1.00 77.52  ? 123  ILE A CA    1 
ATOM   1731 C C     . ILE B 2 123 ? 13.490 -17.076 -41.134 1.00 76.97  ? 123  ILE A C     1 
ATOM   1732 O O     . ILE B 2 123 ? 13.990 -17.906 -40.374 1.00 77.15  ? 123  ILE A O     1 
ATOM   1733 C CB    . ILE B 2 123 ? 11.964 -15.864 -39.572 1.00 77.02  ? 123  ILE A CB    1 
ATOM   1734 C CG1   . ILE B 2 123 ? 10.766 -14.912 -39.579 1.00 76.32  ? 123  ILE A CG1   1 
ATOM   1735 C CG2   . ILE B 2 123 ? 13.255 -15.098 -39.294 1.00 76.75  ? 123  ILE A CG2   1 
ATOM   1736 C CD1   . ILE B 2 123 ? 10.644 -14.049 -38.344 1.00 75.27  ? 123  ILE A CD1   1 
ATOM   1737 N N     . LYS B 2 124 ? 14.149 -16.530 -42.153 1.00 76.07  ? 124  LYS A N     1 
ATOM   1738 C CA    . LYS B 2 124 ? 15.522 -16.899 -42.487 1.00 75.50  ? 124  LYS A CA    1 
ATOM   1739 C C     . LYS B 2 124 ? 16.561 -16.058 -41.745 1.00 74.12  ? 124  LYS A C     1 
ATOM   1740 O O     . LYS B 2 124 ? 17.683 -16.512 -41.505 1.00 74.00  ? 124  LYS A O     1 
ATOM   1741 C CB    . LYS B 2 124 ? 15.725 -16.773 -44.001 1.00 76.29  ? 124  LYS A CB    1 
ATOM   1742 C CG    . LYS B 2 124 ? 14.719 -17.592 -44.803 1.00 77.35  ? 124  LYS A CG    1 
ATOM   1743 C CD    . LYS B 2 124 ? 14.718 -17.228 -46.278 1.00 78.21  ? 124  LYS A CD    1 
ATOM   1744 C CE    . LYS B 2 124 ? 13.506 -17.825 -46.983 1.00 77.46  ? 124  LYS A CE    1 
ATOM   1745 N NZ    . LYS B 2 124 ? 13.366 -17.311 -48.368 1.00 77.29  ? 124  LYS A NZ    1 
ATOM   1746 N N     . SER B 2 125 ? 16.177 -14.837 -41.381 1.00 72.22  ? 125  SER A N     1 
ATOM   1747 C CA    . SER B 2 125 ? 17.063 -13.927 -40.667 1.00 69.39  ? 125  SER A CA    1 
ATOM   1748 C C     . SER B 2 125 ? 16.263 -12.951 -39.814 1.00 67.56  ? 125  SER A C     1 
ATOM   1749 O O     . SER B 2 125 ? 15.075 -12.736 -40.050 1.00 67.34  ? 125  SER A O     1 
ATOM   1750 C CB    . SER B 2 125 ? 17.927 -13.145 -41.655 1.00 70.20  ? 125  SER A CB    1 
ATOM   1751 O OG    . SER B 2 125 ? 18.797 -14.008 -42.363 1.00 71.80  ? 125  SER A OG    1 
ATOM   1752 N N     . ALA B 2 126 ? 16.928 -12.362 -38.824 1.00 64.96  ? 126  ALA A N     1 
ATOM   1753 C CA    . ALA B 2 126 ? 16.298 -11.404 -37.928 1.00 61.78  ? 126  ALA A CA    1 
ATOM   1754 C C     . ALA B 2 126 ? 15.563 -10.308 -38.692 1.00 59.78  ? 126  ALA A C     1 
ATOM   1755 O O     . ALA B 2 126 ? 14.446 -9.948  -38.333 1.00 60.14  ? 126  ALA A O     1 
ATOM   1756 C CB    . ALA B 2 126 ? 17.345 -10.788 -37.010 1.00 61.75  ? 126  ALA A CB    1 
ATOM   1757 N N     . VAL B 2 127 ? 16.185 -9.773  -39.738 1.00 57.09  ? 127  VAL A N     1 
ATOM   1758 C CA    . VAL B 2 127 ? 15.552 -8.719  -40.533 1.00 55.47  ? 127  VAL A CA    1 
ATOM   1759 C C     . VAL B 2 127 ? 14.147 -9.081  -41.018 1.00 54.10  ? 127  VAL A C     1 
ATOM   1760 O O     . VAL B 2 127 ? 13.344 -8.197  -41.301 1.00 53.27  ? 127  VAL A O     1 
ATOM   1761 C CB    . VAL B 2 127 ? 16.387 -8.344  -41.784 1.00 54.97  ? 127  VAL A CB    1 
ATOM   1762 C CG1   . VAL B 2 127 ? 17.568 -7.490  -41.381 1.00 54.01  ? 127  VAL A CG1   1 
ATOM   1763 C CG2   . VAL B 2 127 ? 16.837 -9.610  -42.512 1.00 53.58  ? 127  VAL A CG2   1 
ATOM   1764 N N     . ASP B 2 128 ? 13.858 -10.375 -41.137 1.00 52.06  ? 128  ASP A N     1 
ATOM   1765 C CA    . ASP B 2 128 ? 12.537 -10.802 -41.586 1.00 51.24  ? 128  ASP A CA    1 
ATOM   1766 C C     . ASP B 2 128 ? 11.510 -10.669 -40.466 1.00 50.58  ? 128  ASP A C     1 
ATOM   1767 O O     . ASP B 2 128 ? 10.330 -10.445 -40.720 1.00 51.18  ? 128  ASP A O     1 
ATOM   1768 C CB    . ASP B 2 128 ? 12.556 -12.263 -42.055 1.00 50.12  ? 128  ASP A CB    1 
ATOM   1769 C CG    . ASP B 2 128 ? 13.410 -12.472 -43.275 1.00 48.49  ? 128  ASP A CG    1 
ATOM   1770 O OD1   . ASP B 2 128 ? 13.582 -11.508 -44.056 1.00 47.17  ? 128  ASP A OD1   1 
ATOM   1771 O OD2   . ASP B 2 128 ? 13.894 -13.608 -43.457 1.00 47.83  ? 128  ASP A OD2   1 
ATOM   1772 N N     . ARG B 2 129 ? 11.972 -10.819 -39.230 1.00 49.71  ? 129  ARG A N     1 
ATOM   1773 C CA    . ARG B 2 129 ? 11.113 -10.741 -38.059 1.00 48.95  ? 129  ARG A CA    1 
ATOM   1774 C C     . ARG B 2 129 ? 10.678 -9.304  -37.793 1.00 47.86  ? 129  ARG A C     1 
ATOM   1775 O O     . ARG B 2 129 ? 9.611  -9.058  -37.227 1.00 47.50  ? 129  ARG A O     1 
ATOM   1776 C CB    . ARG B 2 129 ? 11.858 -11.304 -36.840 1.00 49.16  ? 129  ARG A CB    1 
ATOM   1777 C CG    . ARG B 2 129 ? 11.051 -11.290 -35.557 1.00 50.41  ? 129  ARG A CG    1 
ATOM   1778 C CD    . ARG B 2 129 ? 11.819 -11.841 -34.372 1.00 51.10  ? 129  ARG A CD    1 
ATOM   1779 N NE    . ARG B 2 129 ? 12.319 -13.188 -34.626 1.00 53.95  ? 129  ARG A NE    1 
ATOM   1780 C CZ    . ARG B 2 129 ? 13.550 -13.465 -35.052 1.00 54.74  ? 129  ARG A CZ    1 
ATOM   1781 N NH1   . ARG B 2 129 ? 14.422 -12.485 -35.269 1.00 54.71  ? 129  ARG A NH1   1 
ATOM   1782 N NH2   . ARG B 2 129 ? 13.906 -14.726 -35.268 1.00 54.80  ? 129  ARG A NH2   1 
ATOM   1783 N N     . THR B 2 130 ? 11.504 -8.357  -38.217 1.00 46.80  ? 130  THR A N     1 
ATOM   1784 C CA    . THR B 2 130 ? 11.217 -6.950  -37.992 1.00 46.32  ? 130  THR A CA    1 
ATOM   1785 C C     . THR B 2 130 ? 9.841  -6.506  -38.456 1.00 46.25  ? 130  THR A C     1 
ATOM   1786 O O     . THR B 2 130 ? 9.166  -5.749  -37.759 1.00 46.05  ? 130  THR A O     1 
ATOM   1787 C CB    . THR B 2 130 ? 12.276 -6.059  -38.646 1.00 46.61  ? 130  THR A CB    1 
ATOM   1788 O OG1   . THR B 2 130 ? 13.566 -6.409  -38.132 1.00 47.92  ? 130  THR A OG1   1 
ATOM   1789 C CG2   . THR B 2 130 ? 12.006 -4.603  -38.333 1.00 44.75  ? 130  THR A CG2   1 
ATOM   1790 N N     . PRO B 2 131 ? 9.406  -6.951  -39.645 1.00 46.93  ? 131  PRO A N     1 
ATOM   1791 C CA    . PRO B 2 131 ? 8.079  -6.548  -40.126 1.00 46.09  ? 131  PRO A CA    1 
ATOM   1792 C C     . PRO B 2 131 ? 6.949  -7.016  -39.197 1.00 44.87  ? 131  PRO A C     1 
ATOM   1793 O O     . PRO B 2 131 ? 5.961  -6.309  -39.006 1.00 44.95  ? 131  PRO A O     1 
ATOM   1794 C CB    . PRO B 2 131 ? 8.009  -7.192  -41.510 1.00 47.09  ? 131  PRO A CB    1 
ATOM   1795 C CG    . PRO B 2 131 ? 9.436  -7.161  -41.956 1.00 48.47  ? 131  PRO A CG    1 
ATOM   1796 C CD    . PRO B 2 131 ? 10.169 -7.614  -40.716 1.00 47.47  ? 131  PRO A CD    1 
ATOM   1797 N N     . PHE B 2 132 ? 7.088  -8.211  -38.632 1.00 43.42  ? 132  PHE A N     1 
ATOM   1798 C CA    . PHE B 2 132 ? 6.071  -8.722  -37.723 1.00 42.96  ? 132  PHE A CA    1 
ATOM   1799 C C     . PHE B 2 132 ? 6.095  -7.929  -36.420 1.00 42.62  ? 132  PHE A C     1 
ATOM   1800 O O     . PHE B 2 132 ? 5.050  -7.630  -35.843 1.00 43.17  ? 132  PHE A O     1 
ATOM   1801 C CB    . PHE B 2 132 ? 6.295  -10.204 -37.426 1.00 42.60  ? 132  PHE A CB    1 
ATOM   1802 C CG    . PHE B 2 132 ? 6.170  -11.091 -38.628 1.00 43.19  ? 132  PHE A CG    1 
ATOM   1803 C CD1   . PHE B 2 132 ? 7.306  -11.525 -39.313 1.00 43.48  ? 132  PHE A CD1   1 
ATOM   1804 C CD2   . PHE B 2 132 ? 4.917  -11.510 -39.071 1.00 43.41  ? 132  PHE A CD2   1 
ATOM   1805 C CE1   . PHE B 2 132 ? 7.200  -12.374 -40.429 1.00 42.81  ? 132  PHE A CE1   1 
ATOM   1806 C CE2   . PHE B 2 132 ? 4.793  -12.359 -40.185 1.00 43.93  ? 132  PHE A CE2   1 
ATOM   1807 C CZ    . PHE B 2 132 ? 5.938  -12.797 -40.867 1.00 43.13  ? 132  PHE A CZ    1 
ATOM   1808 N N     . HIS B 2 133 ? 7.289  -7.596  -35.948 1.00 41.37  ? 133  HIS A N     1 
ATOM   1809 C CA    . HIS B 2 133 ? 7.398  -6.817  -34.729 1.00 41.83  ? 133  HIS A CA    1 
ATOM   1810 C C     . HIS B 2 133 ? 6.640  -5.517  -34.940 1.00 41.67  ? 133  HIS A C     1 
ATOM   1811 O O     . HIS B 2 133 ? 5.921  -5.047  -34.060 1.00 41.71  ? 133  HIS A O     1 
ATOM   1812 C CB    . HIS B 2 133 ? 8.860  -6.495  -34.416 1.00 41.96  ? 133  HIS A CB    1 
ATOM   1813 C CG    . HIS B 2 133 ? 9.628  -7.644  -33.851 1.00 40.81  ? 133  HIS A CG    1 
ATOM   1814 N ND1   . HIS B 2 133 ? 10.992 -7.603  -33.664 1.00 41.15  ? 133  HIS A ND1   1 
ATOM   1815 C CD2   . HIS B 2 133 ? 9.222  -8.855  -33.401 1.00 41.28  ? 133  HIS A CD2   1 
ATOM   1816 C CE1   . HIS B 2 133 ? 11.394 -8.739  -33.124 1.00 41.26  ? 133  HIS A CE1   1 
ATOM   1817 N NE2   . HIS B 2 133 ? 10.339 -9.516  -32.953 1.00 41.21  ? 133  HIS A NE2   1 
ATOM   1818 N N     . HIS B 2 134 ? 6.805  -4.933  -36.119 1.00 40.99  ? 134  HIS A N     1 
ATOM   1819 C CA    . HIS B 2 134 ? 6.128  -3.688  -36.411 1.00 40.92  ? 134  HIS A CA    1 
ATOM   1820 C C     . HIS B 2 134 ? 4.614  -3.868  -36.431 1.00 41.50  ? 134  HIS A C     1 
ATOM   1821 O O     . HIS B 2 134 ? 3.892  -3.089  -35.817 1.00 42.69  ? 134  HIS A O     1 
ATOM   1822 C CB    . HIS B 2 134 ? 6.601  -3.124  -37.746 1.00 40.19  ? 134  HIS A CB    1 
ATOM   1823 C CG    . HIS B 2 134 ? 5.915  -1.852  -38.132 1.00 39.67  ? 134  HIS A CG    1 
ATOM   1824 N ND1   . HIS B 2 134 ? 6.064  -0.680  -37.421 1.00 40.04  ? 134  HIS A ND1   1 
ATOM   1825 C CD2   . HIS B 2 134 ? 5.051  -1.576  -39.139 1.00 39.10  ? 134  HIS A CD2   1 
ATOM   1826 C CE1   . HIS B 2 134 ? 5.321  0.264   -37.974 1.00 40.55  ? 134  HIS A CE1   1 
ATOM   1827 N NE2   . HIS B 2 134 ? 4.698  -0.254  -39.016 1.00 40.45  ? 134  HIS A NE2   1 
ATOM   1828 N N     . LYS B 2 135 ? 4.130  -4.894  -37.122 1.00 41.10  ? 135  LYS A N     1 
ATOM   1829 C CA    . LYS B 2 135 ? 2.688  -5.120  -37.194 1.00 41.20  ? 135  LYS A CA    1 
ATOM   1830 C C     . LYS B 2 135 ? 2.028  -5.395  -35.855 1.00 40.11  ? 135  LYS A C     1 
ATOM   1831 O O     . LYS B 2 135 ? 0.890  -5.002  -35.634 1.00 41.37  ? 135  LYS A O     1 
ATOM   1832 C CB    . LYS B 2 135 ? 2.372  -6.501  -37.768 1.00 43.26  ? 135  LYS A CB    1 
ATOM   1833 C CG    . LYS B 2 135 ? 1.903  -6.472  -39.210 1.00 47.71  ? 135  LYS A CG    1 
ATOM   1834 C CD    . LYS B 2 135 ? 1.957  -5.060  -39.790 1.00 52.02  ? 135  LYS A CD    1 
ATOM   1835 C CE    . LYS B 2 135 ? 2.173  -5.073  -41.300 1.00 53.58  ? 135  LYS A CE    1 
ATOM   1836 N NZ    . LYS B 2 135 ? 1.000  -5.618  -42.052 1.00 55.02  ? 135  LYS A NZ    1 
ATOM   1837 N N     . TRP B 2 136 ? 2.746  -6.058  -34.955 1.00 37.80  ? 136  TRP A N     1 
ATOM   1838 C CA    . TRP B 2 136 ? 2.206  -6.344  -33.639 1.00 36.18  ? 136  TRP A CA    1 
ATOM   1839 C C     . TRP B 2 136 ? 2.102  -5.095  -32.788 1.00 37.09  ? 136  TRP A C     1 
ATOM   1840 O O     . TRP B 2 136 ? 1.174  -4.942  -31.984 1.00 36.92  ? 136  TRP A O     1 
ATOM   1841 C CB    . TRP B 2 136 ? 3.083  -7.363  -32.924 1.00 33.87  ? 136  TRP A CB    1 
ATOM   1842 C CG    . TRP B 2 136 ? 2.438  -7.940  -31.713 1.00 31.70  ? 136  TRP A CG    1 
ATOM   1843 C CD1   . TRP B 2 136 ? 1.656  -9.046  -31.662 1.00 29.85  ? 136  TRP A CD1   1 
ATOM   1844 C CD2   . TRP B 2 136 ? 2.478  -7.409  -30.379 1.00 30.47  ? 136  TRP A CD2   1 
ATOM   1845 N NE1   . TRP B 2 136 ? 1.202  -9.244  -30.380 1.00 28.22  ? 136  TRP A NE1   1 
ATOM   1846 C CE2   . TRP B 2 136 ? 1.691  -8.253  -29.572 1.00 27.97  ? 136  TRP A CE2   1 
ATOM   1847 C CE3   . TRP B 2 136 ? 3.103  -6.299  -29.790 1.00 30.44  ? 136  TRP A CE3   1 
ATOM   1848 C CZ2   . TRP B 2 136 ? 1.507  -8.028  -28.201 1.00 28.83  ? 136  TRP A CZ2   1 
ATOM   1849 C CZ3   . TRP B 2 136 ? 2.920  -6.072  -28.423 1.00 30.30  ? 136  TRP A CZ3   1 
ATOM   1850 C CH2   . TRP B 2 136 ? 2.126  -6.936  -27.646 1.00 29.49  ? 136  TRP A CH2   1 
ATOM   1851 N N     . LEU B 2 137 ? 3.053  -4.195  -32.992 1.00 37.76  ? 137  LEU A N     1 
ATOM   1852 C CA    . LEU B 2 137 ? 3.147  -2.955  -32.247 1.00 38.41  ? 137  LEU A CA    1 
ATOM   1853 C C     . LEU B 2 137 ? 2.331  -1.783  -32.773 1.00 40.88  ? 137  LEU A C     1 
ATOM   1854 O O     . LEU B 2 137 ? 1.889  -0.939  -31.989 1.00 41.32  ? 137  LEU A O     1 
ATOM   1855 C CB    . LEU B 2 137 ? 4.617  -2.529  -32.196 1.00 37.61  ? 137  LEU A CB    1 
ATOM   1856 C CG    . LEU B 2 137 ? 5.498  -2.637  -30.942 1.00 38.28  ? 137  LEU A CG    1 
ATOM   1857 C CD1   . LEU B 2 137 ? 5.192  -3.895  -30.174 1.00 38.24  ? 137  LEU A CD1   1 
ATOM   1858 C CD2   . LEU B 2 137 ? 6.974  -2.603  -31.358 1.00 35.31  ? 137  LEU A CD2   1 
ATOM   1859 N N     . GLU B 2 138 ? 2.121  -1.722  -34.086 1.00 42.16  ? 138  GLU A N     1 
ATOM   1860 C CA    . GLU B 2 138 ? 1.435  -0.568  -34.660 1.00 43.51  ? 138  GLU A CA    1 
ATOM   1861 C C     . GLU B 2 138 ? 0.032  -0.255  -34.149 1.00 43.42  ? 138  GLU A C     1 
ATOM   1862 O O     . GLU B 2 138 ? -0.290 0.907   -33.895 1.00 44.60  ? 138  GLU A O     1 
ATOM   1863 C CB    . GLU B 2 138 ? 1.463  -0.635  -36.200 1.00 44.53  ? 138  GLU A CB    1 
ATOM   1864 C CG    . GLU B 2 138 ? 0.437  -1.508  -36.866 1.00 48.40  ? 138  GLU A CG    1 
ATOM   1865 C CD    . GLU B 2 138 ? 0.502  -1.388  -38.387 1.00 50.95  ? 138  GLU A CD    1 
ATOM   1866 O OE1   . GLU B 2 138 ? 0.774  -0.269  -38.883 1.00 50.61  ? 138  GLU A OE1   1 
ATOM   1867 O OE2   . GLU B 2 138 ? 0.273  -2.404  -39.084 1.00 52.33  ? 138  GLU A OE2   1 
ATOM   1868 N N     . GLY B 2 139 ? -0.802 -1.269  -33.973 1.00 41.93  ? 139  GLY A N     1 
ATOM   1869 C CA    . GLY B 2 139 ? -2.132 -0.993  -33.482 1.00 41.63  ? 139  GLY A CA    1 
ATOM   1870 C C     . GLY B 2 139 ? -2.220 -0.947  -31.969 1.00 42.40  ? 139  GLY A C     1 
ATOM   1871 O O     . GLY B 2 139 ? -3.146 -0.359  -31.418 1.00 44.81  ? 139  GLY A O     1 
ATOM   1872 N N     . ARG B 2 140 ? -1.254 -1.545  -31.286 1.00 41.99  ? 140  ARG A N     1 
ATOM   1873 C CA    . ARG B 2 140 ? -1.294 -1.586  -29.832 1.00 40.88  ? 140  ARG A CA    1 
ATOM   1874 C C     . ARG B 2 140 ? -0.599 -0.461  -29.074 1.00 40.95  ? 140  ARG A C     1 
ATOM   1875 O O     . ARG B 2 140 ? -0.967 -0.182  -27.943 1.00 42.54  ? 140  ARG A O     1 
ATOM   1876 C CB    . ARG B 2 140 ? -0.760 -2.937  -29.341 1.00 38.56  ? 140  ARG A CB    1 
ATOM   1877 C CG    . ARG B 2 140 ? -1.656 -4.119  -29.704 1.00 36.93  ? 140  ARG A CG    1 
ATOM   1878 C CD    . ARG B 2 140 ? -1.123 -5.435  -29.127 1.00 37.92  ? 140  ARG A CD    1 
ATOM   1879 N NE    . ARG B 2 140 ? -0.803 -6.366  -30.202 1.00 41.20  ? 140  ARG A NE    1 
ATOM   1880 C CZ    . ARG B 2 140 ? -1.528 -7.429  -30.522 1.00 41.13  ? 140  ARG A CZ    1 
ATOM   1881 N NH1   . ARG B 2 140 ? -2.616 -7.720  -29.839 1.00 41.29  ? 140  ARG A NH1   1 
ATOM   1882 N NH2   . ARG B 2 140 ? -1.186 -8.176  -31.564 1.00 44.43  ? 140  ARG A NH2   1 
ATOM   1883 N N     . ILE B 2 141 ? 0.388  0.190   -29.685 1.00 40.69  ? 141  ILE A N     1 
ATOM   1884 C CA    . ILE B 2 141 ? 1.126  1.260   -29.012 1.00 39.95  ? 141  ILE A CA    1 
ATOM   1885 C C     . ILE B 2 141 ? 0.595  2.638   -29.376 1.00 41.11  ? 141  ILE A C     1 
ATOM   1886 O O     . ILE B 2 141 ? 1.002  3.651   -28.807 1.00 39.80  ? 141  ILE A O     1 
ATOM   1887 C CB    . ILE B 2 141 ? 2.646  1.185   -29.351 1.00 40.03  ? 141  ILE A CB    1 
ATOM   1888 C CG1   . ILE B 2 141 ? 3.449  2.106   -28.421 1.00 39.25  ? 141  ILE A CG1   1 
ATOM   1889 C CG2   . ILE B 2 141 ? 2.877  1.561   -30.805 1.00 37.49  ? 141  ILE A CG2   1 
ATOM   1890 C CD1   . ILE B 2 141 ? 3.417  1.702   -26.965 1.00 37.48  ? 141  ILE A CD1   1 
ATOM   1891 N N     . LYS B 2 142 ? -0.316 2.672   -30.339 1.00 43.73  ? 142  LYS A N     1 
ATOM   1892 C CA    . LYS B 2 142 ? -0.927 3.923   -30.764 1.00 45.33  ? 142  LYS A CA    1 
ATOM   1893 C C     . LYS B 2 142 ? -1.465 4.603   -29.495 1.00 45.20  ? 142  LYS A C     1 
ATOM   1894 O O     . LYS B 2 142 ? -2.124 3.963   -28.669 1.00 44.85  ? 142  LYS A O     1 
ATOM   1895 C CB    . LYS B 2 142 ? -2.070 3.623   -31.741 1.00 47.21  ? 142  LYS A CB    1 
ATOM   1896 C CG    . LYS B 2 142 ? -2.140 4.539   -32.950 1.00 50.26  ? 142  LYS A CG    1 
ATOM   1897 C CD    . LYS B 2 142 ? -2.553 3.789   -34.215 1.00 53.37  ? 142  LYS A CD    1 
ATOM   1898 C CE    . LYS B 2 142 ? -2.629 4.732   -35.418 1.00 56.23  ? 142  LYS A CE    1 
ATOM   1899 N NZ    . LYS B 2 142 ? -3.632 5.832   -35.252 1.00 57.82  ? 142  LYS A NZ    1 
ATOM   1900 N N     . GLY B 2 143 ? -1.157 5.886   -29.328 1.00 45.10  ? 143  GLY A N     1 
ATOM   1901 C CA    . GLY B 2 143 ? -1.624 6.614   -28.161 1.00 45.40  ? 143  GLY A CA    1 
ATOM   1902 C C     . GLY B 2 143 ? -0.662 6.645   -26.985 1.00 46.63  ? 143  GLY A C     1 
ATOM   1903 O O     . GLY B 2 143 ? -0.763 7.512   -26.111 1.00 45.99  ? 143  GLY A O     1 
ATOM   1904 N N     . LYS B 2 144 ? 0.288  5.717   -26.955 1.00 47.13  ? 144  LYS A N     1 
ATOM   1905 C CA    . LYS B 2 144 ? 1.226  5.671   -25.842 1.00 47.41  ? 144  LYS A CA    1 
ATOM   1906 C C     . LYS B 2 144 ? 2.640  6.022   -26.258 1.00 47.43  ? 144  LYS A C     1 
ATOM   1907 O O     . LYS B 2 144 ? 3.598  5.771   -25.530 1.00 47.61  ? 144  LYS A O     1 
ATOM   1908 C CB    . LYS B 2 144 ? 0.946  4.445   -24.978 1.00 47.73  ? 144  LYS A CB    1 
ATOM   1909 C CG    . LYS B 2 144 ? -0.425 3.819   -25.201 1.00 50.06  ? 144  LYS A CG    1 
ATOM   1910 C CD    . LYS B 2 144 ? -1.171 3.706   -23.873 1.00 52.45  ? 144  LYS A CD    1 
ATOM   1911 C CE    . LYS B 2 144 ? -0.957 2.368   -23.203 1.00 52.05  ? 144  LYS A CE    1 
ATOM   1912 N NZ    . LYS B 2 144 ? -1.251 1.260   -24.142 1.00 55.42  ? 144  LYS A NZ    1 
ATOM   1913 N N     . GLU B 2 145 ? 2.761  6.625   -27.429 1.00 47.97  ? 145  GLU A N     1 
ATOM   1914 C CA    . GLU B 2 145 ? 4.057  7.004   -27.966 1.00 47.75  ? 145  GLU A CA    1 
ATOM   1915 C C     . GLU B 2 145 ? 4.917  7.824   -27.014 1.00 46.89  ? 145  GLU A C     1 
ATOM   1916 O O     . GLU B 2 145 ? 6.128  7.627   -26.946 1.00 47.48  ? 145  GLU A O     1 
ATOM   1917 C CB    . GLU B 2 145 ? 3.872  7.758   -29.290 1.00 48.42  ? 145  GLU A CB    1 
ATOM   1918 C CG    . GLU B 2 145 ? 2.606  8.603   -29.349 1.00 51.06  ? 145  GLU A CG    1 
ATOM   1919 C CD    . GLU B 2 145 ? 1.379  7.812   -29.783 1.00 51.51  ? 145  GLU A CD    1 
ATOM   1920 O OE1   . GLU B 2 145 ? 0.273  8.165   -29.333 1.00 53.56  ? 145  GLU A OE1   1 
ATOM   1921 O OE2   . GLU B 2 145 ? 1.512  6.856   -30.582 1.00 51.48  ? 145  GLU A OE2   1 
ATOM   1922 N N     . ASN B 2 146 ? 4.309  8.741   -26.273 1.00 45.94  ? 146  ASN A N     1 
ATOM   1923 C CA    . ASN B 2 146 ? 5.087  9.565   -25.354 1.00 44.98  ? 146  ASN A CA    1 
ATOM   1924 C C     . ASN B 2 146 ? 5.500  8.797   -24.119 1.00 43.33  ? 146  ASN A C     1 
ATOM   1925 O O     . ASN B 2 146 ? 6.469  9.155   -23.446 1.00 42.99  ? 146  ASN A O     1 
ATOM   1926 C CB    . ASN B 2 146 ? 4.304  10.810  -24.960 1.00 47.87  ? 146  ASN A CB    1 
ATOM   1927 C CG    . ASN B 2 146 ? 4.076  11.728  -26.132 1.00 50.82  ? 146  ASN A CG    1 
ATOM   1928 O OD1   . ASN B 2 146 ? 5.019  12.119  -26.818 1.00 52.34  ? 146  ASN A OD1   1 
ATOM   1929 N ND2   . ASN B 2 146 ? 2.821  12.072  -26.379 1.00 51.72  ? 146  ASN A ND2   1 
ATOM   1930 N N     . GLU B 2 147 ? 4.756  7.743   -23.811 1.00 40.87  ? 147  GLU A N     1 
ATOM   1931 C CA    . GLU B 2 147 ? 5.098  6.923   -22.670 1.00 38.52  ? 147  GLU A CA    1 
ATOM   1932 C C     . GLU B 2 147 ? 6.397  6.215   -23.070 1.00 37.02  ? 147  GLU A C     1 
ATOM   1933 O O     . GLU B 2 147 ? 7.335  6.119   -22.277 1.00 36.07  ? 147  GLU A O     1 
ATOM   1934 C CB    . GLU B 2 147 ? 3.977  5.928   -22.373 1.00 39.97  ? 147  GLU A CB    1 
ATOM   1935 C CG    . GLU B 2 147 ? 2.685  6.580   -21.865 1.00 39.72  ? 147  GLU A CG    1 
ATOM   1936 C CD    . GLU B 2 147 ? 2.892  7.440   -20.610 1.00 40.58  ? 147  GLU A CD    1 
ATOM   1937 O OE1   . GLU B 2 147 ? 3.584  6.984   -19.675 1.00 40.63  ? 147  GLU A OE1   1 
ATOM   1938 O OE2   . GLU B 2 147 ? 2.350  8.569   -20.549 1.00 38.37  ? 147  GLU A OE2   1 
ATOM   1939 N N     . VAL B 2 148 ? 6.452  5.750   -24.317 1.00 34.72  ? 148  VAL A N     1 
ATOM   1940 C CA    . VAL B 2 148 ? 7.644  5.095   -24.837 1.00 33.92  ? 148  VAL A CA    1 
ATOM   1941 C C     . VAL B 2 148 ? 8.835  6.062   -24.776 1.00 34.33  ? 148  VAL A C     1 
ATOM   1942 O O     . VAL B 2 148 ? 9.938  5.684   -24.383 1.00 34.13  ? 148  VAL A O     1 
ATOM   1943 C CB    . VAL B 2 148 ? 7.460  4.659   -26.315 1.00 33.48  ? 148  VAL A CB    1 
ATOM   1944 C CG1   . VAL B 2 148 ? 8.814  4.216   -26.907 1.00 30.85  ? 148  VAL A CG1   1 
ATOM   1945 C CG2   . VAL B 2 148 ? 6.450  3.529   -26.414 1.00 31.97  ? 148  VAL A CG2   1 
ATOM   1946 N N     . ARG B 2 149 ? 8.605  7.309   -25.171 1.00 33.45  ? 149  ARG A N     1 
ATOM   1947 C CA    . ARG B 2 149 ? 9.662  8.308   -25.164 1.00 34.03  ? 149  ARG A CA    1 
ATOM   1948 C C     . ARG B 2 149 ? 10.171 8.618   -23.761 1.00 34.97  ? 149  ARG A C     1 
ATOM   1949 O O     . ARG B 2 149 ? 11.368 8.780   -23.560 1.00 35.66  ? 149  ARG A O     1 
ATOM   1950 C CB    . ARG B 2 149 ? 9.179  9.572   -25.873 1.00 33.73  ? 149  ARG A CB    1 
ATOM   1951 C CG    . ARG B 2 149 ? 9.131  9.388   -27.385 1.00 35.25  ? 149  ARG A CG    1 
ATOM   1952 C CD    . ARG B 2 149 ? 8.266  10.398  -28.110 1.00 34.64  ? 149  ARG A CD    1 
ATOM   1953 N NE    . ARG B 2 149 ? 8.471  10.302  -29.555 1.00 37.29  ? 149  ARG A NE    1 
ATOM   1954 C CZ    . ARG B 2 149 ? 7.622  10.755  -30.475 1.00 38.25  ? 149  ARG A CZ    1 
ATOM   1955 N NH1   . ARG B 2 149 ? 6.488  11.342  -30.111 1.00 36.83  ? 149  ARG A NH1   1 
ATOM   1956 N NH2   . ARG B 2 149 ? 7.908  10.617  -31.765 1.00 38.04  ? 149  ARG A NH2   1 
ATOM   1957 N N     . LEU B 2 150 ? 9.277  8.698   -22.784 1.00 35.24  ? 150  LEU A N     1 
ATOM   1958 C CA    . LEU B 2 150 ? 9.719  8.951   -21.418 1.00 34.85  ? 150  LEU A CA    1 
ATOM   1959 C C     . LEU B 2 150 ? 10.610 7.793   -20.956 1.00 35.40  ? 150  LEU A C     1 
ATOM   1960 O O     . LEU B 2 150 ? 11.650 8.013   -20.328 1.00 35.21  ? 150  LEU A O     1 
ATOM   1961 C CB    . LEU B 2 150 ? 8.523  9.075   -20.478 1.00 35.15  ? 150  LEU A CB    1 
ATOM   1962 C CG    . LEU B 2 150 ? 7.746  10.391  -20.477 1.00 36.23  ? 150  LEU A CG    1 
ATOM   1963 C CD1   . LEU B 2 150 ? 6.529  10.232  -19.567 1.00 36.15  ? 150  LEU A CD1   1 
ATOM   1964 C CD2   . LEU B 2 150 ? 8.646  11.544  -19.993 1.00 34.47  ? 150  LEU A CD2   1 
ATOM   1965 N N     . LEU B 2 151 ? 10.196 6.564   -21.267 1.00 34.06  ? 151  LEU A N     1 
ATOM   1966 C CA    . LEU B 2 151 ? 10.963 5.384   -20.889 1.00 33.45  ? 151  LEU A CA    1 
ATOM   1967 C C     . LEU B 2 151 ? 12.333 5.402   -21.566 1.00 34.08  ? 151  LEU A C     1 
ATOM   1968 O O     . LEU B 2 151 ? 13.357 5.145   -20.930 1.00 35.15  ? 151  LEU A O     1 
ATOM   1969 C CB    . LEU B 2 151 ? 10.214 4.102   -21.276 1.00 31.49  ? 151  LEU A CB    1 
ATOM   1970 C CG    . LEU B 2 151 ? 10.867 2.777   -20.853 1.00 31.08  ? 151  LEU A CG    1 
ATOM   1971 C CD1   . LEU B 2 151 ? 11.298 2.816   -19.391 1.00 27.26  ? 151  LEU A CD1   1 
ATOM   1972 C CD2   . LEU B 2 151 ? 9.881  1.643   -21.061 1.00 31.47  ? 151  LEU A CD2   1 
ATOM   1973 N N     . LYS B 2 152 ? 12.350 5.711   -22.857 1.00 33.59  ? 152  LYS A N     1 
ATOM   1974 C CA    . LYS B 2 152 ? 13.597 5.767   -23.601 1.00 32.87  ? 152  LYS A CA    1 
ATOM   1975 C C     . LYS B 2 152 ? 14.493 6.854   -23.038 1.00 33.65  ? 152  LYS A C     1 
ATOM   1976 O O     . LYS B 2 152 ? 15.691 6.633   -22.817 1.00 33.64  ? 152  LYS A O     1 
ATOM   1977 C CB    . LYS B 2 152 ? 13.325 6.048   -25.078 1.00 33.53  ? 152  LYS A CB    1 
ATOM   1978 C CG    . LYS B 2 152 ? 12.655 4.905   -25.827 1.00 32.36  ? 152  LYS A CG    1 
ATOM   1979 C CD    . LYS B 2 152 ? 12.572 5.208   -27.314 1.00 31.07  ? 152  LYS A CD    1 
ATOM   1980 C CE    . LYS B 2 152 ? 12.153 3.972   -28.074 1.00 32.25  ? 152  LYS A CE    1 
ATOM   1981 N NZ    . LYS B 2 152 ? 12.130 4.198   -29.536 1.00 34.09  ? 152  LYS A NZ    1 
ATOM   1982 N N     . GLY B 2 153 ? 13.915 8.027   -22.798 1.00 32.17  ? 153  GLY A N     1 
ATOM   1983 C CA    . GLY B 2 153 ? 14.695 9.130   -22.270 1.00 33.17  ? 153  GLY A CA    1 
ATOM   1984 C C     . GLY B 2 153 ? 15.335 8.812   -20.935 1.00 33.52  ? 153  GLY A C     1 
ATOM   1985 O O     . GLY B 2 153 ? 16.489 9.165   -20.682 1.00 34.60  ? 153  GLY A O     1 
ATOM   1986 N N     . PHE B 2 154 ? 14.562 8.144   -20.085 1.00 33.38  ? 154  PHE A N     1 
ATOM   1987 C CA    . PHE B 2 154 ? 14.978 7.740   -18.750 1.00 33.31  ? 154  PHE A CA    1 
ATOM   1988 C C     . PHE B 2 154 ? 16.198 6.810   -18.836 1.00 35.05  ? 154  PHE A C     1 
ATOM   1989 O O     . PHE B 2 154 ? 17.224 7.047   -18.192 1.00 35.28  ? 154  PHE A O     1 
ATOM   1990 C CB    . PHE B 2 154 ? 13.796 7.022   -18.087 1.00 31.92  ? 154  PHE A CB    1 
ATOM   1991 C CG    . PHE B 2 154 ? 13.955 6.781   -16.609 1.00 30.34  ? 154  PHE A CG    1 
ATOM   1992 C CD1   . PHE B 2 154 ? 13.789 7.817   -15.700 1.00 29.51  ? 154  PHE A CD1   1 
ATOM   1993 C CD2   . PHE B 2 154 ? 14.206 5.497   -16.122 1.00 30.80  ? 154  PHE A CD2   1 
ATOM   1994 C CE1   . PHE B 2 154 ? 13.861 7.574   -14.322 1.00 29.14  ? 154  PHE A CE1   1 
ATOM   1995 C CE2   . PHE B 2 154 ? 14.280 5.241   -14.742 1.00 29.76  ? 154  PHE A CE2   1 
ATOM   1996 C CZ    . PHE B 2 154 ? 14.105 6.278   -13.844 1.00 27.73  ? 154  PHE A CZ    1 
ATOM   1997 N N     . LEU B 2 155 ? 16.080 5.762   -19.650 1.00 34.85  ? 155  LEU A N     1 
ATOM   1998 C CA    . LEU B 2 155 ? 17.149 4.777   -19.834 1.00 34.75  ? 155  LEU A CA    1 
ATOM   1999 C C     . LEU B 2 155 ? 18.408 5.404   -20.457 1.00 36.00  ? 155  LEU A C     1 
ATOM   2000 O O     . LEU B 2 155 ? 19.531 5.170   -20.006 1.00 35.86  ? 155  LEU A O     1 
ATOM   2001 C CB    . LEU B 2 155 ? 16.624 3.618   -20.704 1.00 32.82  ? 155  LEU A CB    1 
ATOM   2002 C CG    . LEU B 2 155 ? 15.415 2.858   -20.112 1.00 31.78  ? 155  LEU A CG    1 
ATOM   2003 C CD1   . LEU B 2 155 ? 14.673 2.071   -21.182 1.00 29.42  ? 155  LEU A CD1   1 
ATOM   2004 C CD2   . LEU B 2 155 ? 15.892 1.932   -19.002 1.00 31.01  ? 155  LEU A CD2   1 
ATOM   2005 N N     . LYS B 2 156 ? 18.211 6.203   -21.499 1.00 38.10  ? 156  LYS A N     1 
ATOM   2006 C CA    . LYS B 2 156 ? 19.314 6.875   -22.175 1.00 38.57  ? 156  LYS A CA    1 
ATOM   2007 C C     . LYS B 2 156 ? 20.084 7.734   -21.162 1.00 38.12  ? 156  LYS A C     1 
ATOM   2008 O O     . LYS B 2 156 ? 21.301 7.613   -21.019 1.00 37.72  ? 156  LYS A O     1 
ATOM   2009 C CB    . LYS B 2 156 ? 18.754 7.751   -23.293 1.00 40.53  ? 156  LYS A CB    1 
ATOM   2010 C CG    . LYS B 2 156 ? 19.769 8.569   -24.060 1.00 44.49  ? 156  LYS A CG    1 
ATOM   2011 C CD    . LYS B 2 156 ? 19.777 8.221   -25.537 1.00 47.22  ? 156  LYS A CD    1 
ATOM   2012 C CE    . LYS B 2 156 ? 20.520 9.281   -26.349 1.00 46.02  ? 156  LYS A CE    1 
ATOM   2013 N NZ    . LYS B 2 156 ? 20.682 8.885   -27.774 1.00 46.69  ? 156  LYS A NZ    1 
ATOM   2014 N N     . ALA B 2 157 ? 19.366 8.582   -20.436 1.00 37.47  ? 157  ALA A N     1 
ATOM   2015 C CA    . ALA B 2 157 ? 20.007 9.456   -19.462 1.00 37.03  ? 157  ALA A CA    1 
ATOM   2016 C C     . ALA B 2 157 ? 20.824 8.694   -18.421 1.00 37.19  ? 157  ALA A C     1 
ATOM   2017 O O     . ALA B 2 157 ? 21.743 9.246   -17.818 1.00 36.83  ? 157  ALA A O     1 
ATOM   2018 C CB    . ALA B 2 157 ? 18.959 10.315  -18.775 1.00 35.93  ? 157  ALA A CB    1 
ATOM   2019 N N     . ASN B 2 158 ? 20.504 7.421   -18.220 1.00 37.32  ? 158  ASN A N     1 
ATOM   2020 C CA    . ASN B 2 158 ? 21.206 6.624   -17.222 1.00 36.02  ? 158  ASN A CA    1 
ATOM   2021 C C     . ASN B 2 158 ? 22.123 5.571   -17.811 1.00 35.58  ? 158  ASN A C     1 
ATOM   2022 O O     . ASN B 2 158 ? 22.441 4.589   -17.154 1.00 36.14  ? 158  ASN A O     1 
ATOM   2023 C CB    . ASN B 2 158 ? 20.193 5.981   -16.276 1.00 35.87  ? 158  ASN A CB    1 
ATOM   2024 C CG    . ASN B 2 158 ? 19.429 7.013   -15.465 1.00 36.18  ? 158  ASN A CG    1 
ATOM   2025 O OD1   . ASN B 2 158 ? 19.885 7.472   -14.419 1.00 36.05  ? 158  ASN A OD1   1 
ATOM   2026 N ND2   . ASN B 2 158 ? 18.268 7.403   -15.965 1.00 37.30  ? 158  ASN A ND2   1 
ATOM   2027 N N     . GLY B 2 159 ? 22.529 5.782   -19.061 1.00 35.06  ? 159  GLY A N     1 
ATOM   2028 C CA    . GLY B 2 159 ? 23.452 4.879   -19.727 1.00 33.30  ? 159  GLY A CA    1 
ATOM   2029 C C     . GLY B 2 159 ? 23.063 3.440   -19.970 1.00 35.01  ? 159  GLY A C     1 
ATOM   2030 O O     . GLY B 2 159 ? 23.941 2.587   -20.118 1.00 34.63  ? 159  GLY A O     1 
ATOM   2031 N N     . ILE B 2 160 ? 21.767 3.152   -20.041 1.00 36.08  ? 160  ILE A N     1 
ATOM   2032 C CA    . ILE B 2 160 ? 21.331 1.784   -20.275 1.00 35.91  ? 160  ILE A CA    1 
ATOM   2033 C C     . ILE B 2 160 ? 20.254 1.650   -21.356 1.00 37.74  ? 160  ILE A C     1 
ATOM   2034 O O     . ILE B 2 160 ? 19.506 0.669   -21.369 1.00 37.63  ? 160  ILE A O     1 
ATOM   2035 C CB    . ILE B 2 160 ? 20.800 1.158   -18.974 1.00 35.18  ? 160  ILE A CB    1 
ATOM   2036 C CG1   . ILE B 2 160 ? 19.737 2.064   -18.360 1.00 34.96  ? 160  ILE A CG1   1 
ATOM   2037 C CG2   . ILE B 2 160 ? 21.928 0.951   -17.989 1.00 34.68  ? 160  ILE A CG2   1 
ATOM   2038 C CD1   . ILE B 2 160 ? 19.100 1.495   -17.117 1.00 36.19  ? 160  ILE A CD1   1 
ATOM   2039 N N     . TYR B 2 161 ? 20.191 2.598   -22.287 1.00 39.10  ? 161  TYR A N     1 
ATOM   2040 C CA    . TYR B 2 161 ? 19.156 2.535   -23.309 1.00 38.89  ? 161  TYR A CA    1 
ATOM   2041 C C     . TYR B 2 161 ? 19.259 1.572   -24.481 1.00 39.70  ? 161  TYR A C     1 
ATOM   2042 O O     . TYR B 2 161 ? 18.244 1.024   -24.873 1.00 44.57  ? 161  TYR A O     1 
ATOM   2043 C CB    . TYR B 2 161 ? 18.850 3.919   -23.877 1.00 38.21  ? 161  TYR A CB    1 
ATOM   2044 C CG    . TYR B 2 161 ? 17.876 3.852   -25.041 1.00 35.86  ? 161  TYR A CG    1 
ATOM   2045 C CD1   . TYR B 2 161 ? 16.682 3.122   -24.941 1.00 35.97  ? 161  TYR A CD1   1 
ATOM   2046 C CD2   . TYR B 2 161 ? 18.179 4.451   -26.260 1.00 36.11  ? 161  TYR A CD2   1 
ATOM   2047 C CE1   . TYR B 2 161 ? 15.826 2.979   -26.033 1.00 37.05  ? 161  TYR A CE1   1 
ATOM   2048 C CE2   . TYR B 2 161 ? 17.328 4.321   -27.360 1.00 37.12  ? 161  TYR A CE2   1 
ATOM   2049 C CZ    . TYR B 2 161 ? 16.159 3.583   -27.241 1.00 37.53  ? 161  TYR A CZ    1 
ATOM   2050 O OH    . TYR B 2 161 ? 15.341 3.438   -28.331 1.00 38.31  ? 161  TYR A OH    1 
ATOM   2051 N N     . GLY B 2 162 ? 20.422 1.357   -25.075 1.00 35.46  ? 162  GLY A N     1 
ATOM   2052 C CA    . GLY B 2 162 ? 20.443 0.431   -26.206 1.00 33.82  ? 162  GLY A CA    1 
ATOM   2053 C C     . GLY B 2 162 ? 20.765 -1.022  -25.880 1.00 34.38  ? 162  GLY A C     1 
ATOM   2054 O O     . GLY B 2 162 ? 21.262 -1.331  -24.801 1.00 34.92  ? 162  GLY A O     1 
ATOM   2055 N N     . ALA B 2 163 ? 20.501 -1.929  -26.810 1.00 34.09  ? 163  ALA A N     1 
ATOM   2056 C CA    . ALA B 2 163 ? 20.801 -3.337  -26.563 1.00 34.57  ? 163  ALA A CA    1 
ATOM   2057 C C     . ALA B 2 163 ? 22.139 -3.809  -27.177 1.00 34.60  ? 163  ALA A C     1 
ATOM   2058 O O     . ALA B 2 163 ? 22.498 -4.984  -27.059 1.00 34.54  ? 163  ALA A O     1 
ATOM   2059 C CB    . ALA B 2 163 ? 19.638 -4.228  -27.067 1.00 32.84  ? 163  ALA A CB    1 
ATOM   2060 N N     . GLU B 2 164 ? 22.882 -2.910  -27.820 1.00 34.00  ? 164  GLU A N     1 
ATOM   2061 C CA    . GLU B 2 164 ? 24.152 -3.317  -28.413 1.00 34.57  ? 164  GLU A CA    1 
ATOM   2062 C C     . GLU B 2 164 ? 25.197 -3.542  -27.317 1.00 34.08  ? 164  GLU A C     1 
ATOM   2063 O O     . GLU B 2 164 ? 25.089 -2.986  -26.231 1.00 34.08  ? 164  GLU A O     1 
ATOM   2064 C CB    . GLU B 2 164 ? 24.643 -2.288  -29.440 1.00 33.56  ? 164  GLU A CB    1 
ATOM   2065 C CG    . GLU B 2 164 ? 25.125 -0.965  -28.884 1.00 33.96  ? 164  GLU A CG    1 
ATOM   2066 C CD    . GLU B 2 164 ? 24.004 0.011   -28.563 1.00 35.95  ? 164  GLU A CD    1 
ATOM   2067 O OE1   . GLU B 2 164 ? 24.302 1.217   -28.384 1.00 36.63  ? 164  GLU A OE1   1 
ATOM   2068 O OE2   . GLU B 2 164 ? 22.836 -0.417  -28.481 1.00 34.61  ? 164  GLU A OE2   1 
ATOM   2069 N N     . TYR B 2 165 ? 26.204 -4.359  -27.608 1.00 33.72  ? 165  TYR A N     1 
ATOM   2070 C CA    . TYR B 2 165 ? 27.224 -4.685  -26.622 1.00 33.16  ? 165  TYR A CA    1 
ATOM   2071 C C     . TYR B 2 165 ? 27.924 -3.564  -25.861 1.00 33.46  ? 165  TYR A C     1 
ATOM   2072 O O     . TYR B 2 165 ? 28.342 -3.760  -24.718 1.00 33.38  ? 165  TYR A O     1 
ATOM   2073 C CB    . TYR B 2 165 ? 28.258 -5.613  -27.242 1.00 32.84  ? 165  TYR A CB    1 
ATOM   2074 C CG    . TYR B 2 165 ? 27.748 -7.025  -27.320 1.00 32.19  ? 165  TYR A CG    1 
ATOM   2075 C CD1   . TYR B 2 165 ? 27.478 -7.625  -28.549 1.00 32.31  ? 165  TYR A CD1   1 
ATOM   2076 C CD2   . TYR B 2 165 ? 27.475 -7.743  -26.158 1.00 31.04  ? 165  TYR A CD2   1 
ATOM   2077 C CE1   . TYR B 2 165 ? 26.940 -8.903  -28.619 1.00 33.07  ? 165  TYR A CE1   1 
ATOM   2078 C CE2   . TYR B 2 165 ? 26.936 -9.013  -26.212 1.00 31.67  ? 165  TYR A CE2   1 
ATOM   2079 C CZ    . TYR B 2 165 ? 26.667 -9.588  -27.444 1.00 33.39  ? 165  TYR A CZ    1 
ATOM   2080 O OH    . TYR B 2 165 ? 26.094 -10.832 -27.501 1.00 32.42  ? 165  TYR A OH    1 
ATOM   2081 N N     . LYS B 2 166 ? 28.060 -2.395  -26.462 1.00 33.67  ? 166  LYS A N     1 
ATOM   2082 C CA    . LYS B 2 166 ? 28.702 -1.317  -25.740 1.00 34.23  ? 166  LYS A CA    1 
ATOM   2083 C C     . LYS B 2 166 ? 27.821 -0.888  -24.565 1.00 34.68  ? 166  LYS A C     1 
ATOM   2084 O O     . LYS B 2 166 ? 28.294 -0.233  -23.633 1.00 36.21  ? 166  LYS A O     1 
ATOM   2085 C CB    . LYS B 2 166 ? 28.952 -0.121  -26.662 1.00 33.37  ? 166  LYS A CB    1 
ATOM   2086 C CG    . LYS B 2 166 ? 29.688 1.008   -25.976 1.00 34.10  ? 166  LYS A CG    1 
ATOM   2087 C CD    . LYS B 2 166 ? 29.783 2.226   -26.874 1.00 36.70  ? 166  LYS A CD    1 
ATOM   2088 C CE    . LYS B 2 166 ? 30.545 3.356   -26.197 1.00 36.26  ? 166  LYS A CE    1 
ATOM   2089 N NZ    . LYS B 2 166 ? 30.411 4.622   -26.971 1.00 39.32  ? 166  LYS A NZ    1 
ATOM   2090 N N     . VAL B 2 167 ? 26.548 -1.279  -24.603 1.00 33.21  ? 167  VAL A N     1 
ATOM   2091 C CA    . VAL B 2 167 ? 25.598 -0.904  -23.558 1.00 31.88  ? 167  VAL A CA    1 
ATOM   2092 C C     . VAL B 2 167 ? 24.939 -2.051  -22.808 1.00 32.45  ? 167  VAL A C     1 
ATOM   2093 O O     . VAL B 2 167 ? 24.822 -2.010  -21.584 1.00 33.19  ? 167  VAL A O     1 
ATOM   2094 C CB    . VAL B 2 167 ? 24.467 -0.023  -24.135 1.00 32.57  ? 167  VAL A CB    1 
ATOM   2095 C CG1   . VAL B 2 167 ? 23.534 0.408   -23.030 1.00 30.93  ? 167  VAL A CG1   1 
ATOM   2096 C CG2   . VAL B 2 167 ? 25.064 1.190   -24.837 1.00 29.36  ? 167  VAL A CG2   1 
ATOM   2097 N N     . ARG B 2 168 ? 24.497 -3.069  -23.535 1.00 32.79  ? 168  ARG A N     1 
ATOM   2098 C CA    . ARG B 2 168 ? 23.826 -4.201  -22.901 1.00 33.43  ? 168  ARG A CA    1 
ATOM   2099 C C     . ARG B 2 168 ? 22.595 -3.721  -22.111 1.00 32.90  ? 168  ARG A C     1 
ATOM   2100 O O     . ARG B 2 168 ? 22.295 -4.216  -21.023 1.00 31.52  ? 168  ARG A O     1 
ATOM   2101 C CB    . ARG B 2 168 ? 24.799 -4.936  -21.976 1.00 34.47  ? 168  ARG A CB    1 
ATOM   2102 C CG    . ARG B 2 168 ? 25.811 -5.802  -22.711 1.00 36.56  ? 168  ARG A CG    1 
ATOM   2103 C CD    . ARG B 2 168 ? 26.760 -6.421  -21.730 1.00 38.82  ? 168  ARG A CD    1 
ATOM   2104 N NE    . ARG B 2 168 ? 27.847 -7.162  -22.358 1.00 42.25  ? 168  ARG A NE    1 
ATOM   2105 C CZ    . ARG B 2 168 ? 27.753 -8.403  -22.833 1.00 43.74  ? 168  ARG A CZ    1 
ATOM   2106 N NH1   . ARG B 2 168 ? 26.602 -9.062  -22.765 1.00 42.48  ? 168  ARG A NH1   1 
ATOM   2107 N NH2   . ARG B 2 168 ? 28.829 -9.002  -23.338 1.00 42.68  ? 168  ARG A NH2   1 
ATOM   2108 N N     . GLY B 2 169 ? 21.893 -2.748  -22.676 1.00 33.45  ? 169  GLY A N     1 
ATOM   2109 C CA    . GLY B 2 169 ? 20.710 -2.208  -22.037 1.00 33.62  ? 169  GLY A CA    1 
ATOM   2110 C C     . GLY B 2 169 ? 19.418 -2.738  -22.638 1.00 33.88  ? 169  GLY A C     1 
ATOM   2111 O O     . GLY B 2 169 ? 19.358 -3.893  -23.073 1.00 34.51  ? 169  GLY A O     1 
ATOM   2112 N N     . PHE B 2 170 ? 18.400 -1.878  -22.674 1.00 33.21  ? 170  PHE A N     1 
ATOM   2113 C CA    . PHE B 2 170 ? 17.061 -2.213  -23.177 1.00 32.39  ? 170  PHE A CA    1 
ATOM   2114 C C     . PHE B 2 170 ? 16.733 -1.740  -24.579 1.00 32.41  ? 170  PHE A C     1 
ATOM   2115 O O     . PHE B 2 170 ? 16.646 -0.554  -24.793 1.00 33.59  ? 170  PHE A O     1 
ATOM   2116 C CB    . PHE B 2 170 ? 15.978 -1.470  -22.374 1.00 32.99  ? 170  PHE A CB    1 
ATOM   2117 C CG    . PHE B 2 170 ? 15.976 -1.757  -20.884 1.00 32.79  ? 170  PHE A CG    1 
ATOM   2118 C CD1   . PHE B 2 170 ? 17.069 -1.438  -20.091 1.00 32.59  ? 170  PHE A CD1   1 
ATOM   2119 C CD2   . PHE B 2 170 ? 14.859 -2.317  -20.278 1.00 32.77  ? 170  PHE A CD2   1 
ATOM   2120 C CE1   . PHE B 2 170 ? 17.054 -1.674  -18.728 1.00 32.49  ? 170  PHE A CE1   1 
ATOM   2121 C CE2   . PHE B 2 170 ? 14.836 -2.560  -18.907 1.00 32.74  ? 170  PHE A CE2   1 
ATOM   2122 C CZ    . PHE B 2 170 ? 15.935 -2.237  -18.132 1.00 32.24  ? 170  PHE A CZ    1 
ATOM   2123 N N     . SER B 2 171 ? 16.509 -2.634  -25.535 1.00 32.26  ? 171  SER A N     1 
ATOM   2124 C CA    . SER B 2 171 ? 16.348 -2.175  -26.916 1.00 31.80  ? 171  SER A CA    1 
ATOM   2125 C C     . SER B 2 171 ? 15.103 -1.304  -27.038 1.00 32.42  ? 171  SER A C     1 
ATOM   2126 O O     . SER B 2 171 ? 14.279 -1.243  -26.122 1.00 31.81  ? 171  SER A O     1 
ATOM   2127 C CB    . SER B 2 171 ? 16.208 -3.346  -27.878 1.00 33.15  ? 171  SER A CB    1 
ATOM   2128 O OG    . SER B 2 171 ? 14.981 -4.008  -27.683 1.00 34.39  ? 171  SER A OG    1 
ATOM   2129 N N     . GLY B 2 172 ? 14.974 -0.613  -28.165 1.00 32.97  ? 172  GLY A N     1 
ATOM   2130 C CA    . GLY B 2 172 ? 13.805 0.218   -28.367 1.00 32.72  ? 172  GLY A CA    1 
ATOM   2131 C C     . GLY B 2 172 ? 12.564 -0.662  -28.354 1.00 33.06  ? 172  GLY A C     1 
ATOM   2132 O O     . GLY B 2 172 ? 11.575 -0.342  -27.704 1.00 33.79  ? 172  GLY A O     1 
ATOM   2133 N N     . TYR B 2 173 ? 12.630 -1.781  -29.071 1.00 33.44  ? 173  TYR A N     1 
ATOM   2134 C CA    . TYR B 2 173 ? 11.525 -2.727  -29.154 1.00 35.45  ? 173  TYR A CA    1 
ATOM   2135 C C     . TYR B 2 173 ? 11.073 -3.142  -27.759 1.00 36.02  ? 173  TYR A C     1 
ATOM   2136 O O     . TYR B 2 173 ? 9.884  -3.123  -27.449 1.00 36.41  ? 173  TYR A O     1 
ATOM   2137 C CB    . TYR B 2 173 ? 11.955 -3.967  -29.952 1.00 35.50  ? 173  TYR A CB    1 
ATOM   2138 C CG    . TYR B 2 173 ? 10.881 -5.028  -30.111 1.00 36.60  ? 173  TYR A CG    1 
ATOM   2139 C CD1   . TYR B 2 173 ? 9.591  -4.689  -30.521 1.00 36.90  ? 173  TYR A CD1   1 
ATOM   2140 C CD2   . TYR B 2 173 ? 11.163 -6.372  -29.873 1.00 35.89  ? 173  TYR A CD2   1 
ATOM   2141 C CE1   . TYR B 2 173 ? 8.607  -5.667  -30.690 1.00 38.32  ? 173  TYR A CE1   1 
ATOM   2142 C CE2   . TYR B 2 173 ? 10.190 -7.358  -30.034 1.00 36.36  ? 173  TYR A CE2   1 
ATOM   2143 C CZ    . TYR B 2 173 ? 8.911  -7.002  -30.443 1.00 38.33  ? 173  TYR A CZ    1 
ATOM   2144 O OH    . TYR B 2 173 ? 7.932  -7.969  -30.588 1.00 37.18  ? 173  TYR A OH    1 
ATOM   2145 N N     . LEU B 2 174 ? 12.032 -3.524  -26.927 1.00 35.45  ? 174  LEU A N     1 
ATOM   2146 C CA    . LEU B 2 174 ? 11.744 -3.929  -25.566 1.00 34.84  ? 174  LEU A CA    1 
ATOM   2147 C C     . LEU B 2 174 ? 10.942 -2.854  -24.842 1.00 35.30  ? 174  LEU A C     1 
ATOM   2148 O O     . LEU B 2 174 ? 9.985  -3.158  -24.125 1.00 37.42  ? 174  LEU A O     1 
ATOM   2149 C CB    . LEU B 2 174 ? 13.051 -4.185  -24.813 1.00 32.84  ? 174  LEU A CB    1 
ATOM   2150 C CG    . LEU B 2 174 ? 12.859 -4.420  -23.311 1.00 33.04  ? 174  LEU A CG    1 
ATOM   2151 C CD1   . LEU B 2 174 ? 11.847 -5.556  -23.102 1.00 32.22  ? 174  LEU A CD1   1 
ATOM   2152 C CD2   . LEU B 2 174 ? 14.198 -4.728  -22.647 1.00 30.95  ? 174  LEU A CD2   1 
ATOM   2153 N N     . CYS B 2 175 ? 11.340 -1.600  -25.025 1.00 33.99  ? 175  CYS A N     1 
ATOM   2154 C CA    . CYS B 2 175 ? 10.658 -0.474  -24.385 1.00 34.97  ? 175  CYS A CA    1 
ATOM   2155 C C     . CYS B 2 175 ? 9.172  -0.408  -24.747 1.00 35.52  ? 175  CYS A C     1 
ATOM   2156 O O     . CYS B 2 175 ? 8.318  -0.157  -23.895 1.00 36.11  ? 175  CYS A O     1 
ATOM   2157 C CB    . CYS B 2 175 ? 11.327 0.852   -24.772 1.00 35.36  ? 175  CYS A CB    1 
ATOM   2158 S SG    . CYS B 2 175 ? 12.977 1.138   -24.060 1.00 39.78  ? 175  CYS A SG    1 
ATOM   2159 N N     . GLU B 2 176 ? 8.859  -0.622  -26.017 1.00 35.47  ? 176  GLU A N     1 
ATOM   2160 C CA    . GLU B 2 176 ? 7.477  -0.572  -26.443 1.00 35.04  ? 176  GLU A CA    1 
ATOM   2161 C C     . GLU B 2 176 ? 6.661  -1.732  -25.895 1.00 35.53  ? 176  GLU A C     1 
ATOM   2162 O O     . GLU B 2 176 ? 5.513  -1.543  -25.494 1.00 35.19  ? 176  GLU A O     1 
ATOM   2163 C CB    . GLU B 2 176 ? 7.414  -0.494  -27.960 1.00 34.35  ? 176  GLU A CB    1 
ATOM   2164 C CG    . GLU B 2 176 ? 7.842  0.883   -28.435 1.00 37.11  ? 176  GLU A CG    1 
ATOM   2165 C CD    . GLU B 2 176 ? 7.716  1.065   -29.930 1.00 37.21  ? 176  GLU A CD    1 
ATOM   2166 O OE1   . GLU B 2 176 ? 6.657  0.727   -30.492 1.00 37.55  ? 176  GLU A OE1   1 
ATOM   2167 O OE2   . GLU B 2 176 ? 8.677  1.563   -30.539 1.00 38.58  ? 176  GLU A OE2   1 
ATOM   2168 N N     . LEU B 2 177 ? 7.248  -2.925  -25.856 1.00 34.98  ? 177  LEU A N     1 
ATOM   2169 C CA    . LEU B 2 177 ? 6.543  -4.073  -25.308 1.00 35.34  ? 177  LEU A CA    1 
ATOM   2170 C C     . LEU B 2 177 ? 6.210  -3.796  -23.839 1.00 36.45  ? 177  LEU A C     1 
ATOM   2171 O O     . LEU B 2 177 ? 5.138  -4.157  -23.363 1.00 36.19  ? 177  LEU A O     1 
ATOM   2172 C CB    . LEU B 2 177 ? 7.399  -5.331  -25.409 1.00 33.66  ? 177  LEU A CB    1 
ATOM   2173 C CG    . LEU B 2 177 ? 7.692  -5.856  -26.817 1.00 34.37  ? 177  LEU A CG    1 
ATOM   2174 C CD1   . LEU B 2 177 ? 8.539  -7.110  -26.677 1.00 32.66  ? 177  LEU A CD1   1 
ATOM   2175 C CD2   . LEU B 2 177 ? 6.406  -6.159  -27.586 1.00 32.83  ? 177  LEU A CD2   1 
ATOM   2176 N N     . LEU B 2 178 ? 7.125  -3.135  -23.132 1.00 36.80  ? 178  LEU A N     1 
ATOM   2177 C CA    . LEU B 2 178 ? 6.919  -2.818  -21.720 1.00 37.26  ? 178  LEU A CA    1 
ATOM   2178 C C     . LEU B 2 178 ? 5.798  -1.806  -21.519 1.00 38.10  ? 178  LEU A C     1 
ATOM   2179 O O     . LEU B 2 178 ? 5.040  -1.895  -20.547 1.00 38.59  ? 178  LEU A O     1 
ATOM   2180 C CB    . LEU B 2 178 ? 8.217  -2.296  -21.095 1.00 36.26  ? 178  LEU A CB    1 
ATOM   2181 C CG    . LEU B 2 178 ? 9.346  -3.319  -20.912 1.00 35.47  ? 178  LEU A CG    1 
ATOM   2182 C CD1   . LEU B 2 178 ? 10.598 -2.634  -20.388 1.00 35.14  ? 178  LEU A CD1   1 
ATOM   2183 C CD2   . LEU B 2 178 ? 8.893  -4.405  -19.944 1.00 34.29  ? 178  LEU A CD2   1 
ATOM   2184 N N     . ILE B 2 179 ? 5.693  -0.841  -22.429 1.00 38.14  ? 179  ILE A N     1 
ATOM   2185 C CA    . ILE B 2 179 ? 4.632  0.156   -22.342 1.00 38.77  ? 179  ILE A CA    1 
ATOM   2186 C C     . ILE B 2 179 ? 3.299  -0.528  -22.653 1.00 39.22  ? 179  ILE A C     1 
ATOM   2187 O O     . ILE B 2 179 ? 2.285  -0.277  -22.001 1.00 38.98  ? 179  ILE A O     1 
ATOM   2188 C CB    . ILE B 2 179 ? 4.849  1.303   -23.339 1.00 38.96  ? 179  ILE A CB    1 
ATOM   2189 C CG1   . ILE B 2 179 ? 6.116  2.068   -22.965 1.00 40.66  ? 179  ILE A CG1   1 
ATOM   2190 C CG2   . ILE B 2 179 ? 3.642  2.243   -23.334 1.00 38.20  ? 179  ILE A CG2   1 
ATOM   2191 C CD1   . ILE B 2 179 ? 6.097  2.622   -21.561 1.00 39.77  ? 179  ILE A CD1   1 
ATOM   2192 N N     . VAL B 2 180 ? 3.306  -1.394  -23.655 1.00 39.03  ? 180  VAL A N     1 
ATOM   2193 C CA    . VAL B 2 180 ? 2.099  -2.108  -24.011 1.00 39.24  ? 180  VAL A CA    1 
ATOM   2194 C C     . VAL B 2 180 ? 1.661  -2.939  -22.809 1.00 39.35  ? 180  VAL A C     1 
ATOM   2195 O O     . VAL B 2 180 ? 0.471  -3.020  -22.504 1.00 39.91  ? 180  VAL A O     1 
ATOM   2196 C CB    . VAL B 2 180 ? 2.336  -3.049  -25.216 1.00 39.66  ? 180  VAL A CB    1 
ATOM   2197 C CG1   . VAL B 2 180 ? 1.158  -4.008  -25.374 1.00 37.67  ? 180  VAL A CG1   1 
ATOM   2198 C CG2   . VAL B 2 180 ? 2.524  -2.231  -26.483 1.00 38.31  ? 180  VAL A CG2   1 
ATOM   2199 N N     . PHE B 2 181 ? 2.629  -3.535  -22.122 1.00 37.49  ? 181  PHE A N     1 
ATOM   2200 C CA    . PHE B 2 181 ? 2.340  -4.382  -20.972 1.00 37.20  ? 181  PHE A CA    1 
ATOM   2201 C C     . PHE B 2 181 ? 1.824  -3.642  -19.735 1.00 36.77  ? 181  PHE A C     1 
ATOM   2202 O O     . PHE B 2 181 ? 0.838  -4.054  -19.127 1.00 37.24  ? 181  PHE A O     1 
ATOM   2203 C CB    . PHE B 2 181 ? 3.582  -5.179  -20.581 1.00 36.36  ? 181  PHE A CB    1 
ATOM   2204 C CG    . PHE B 2 181 ? 3.292  -6.366  -19.708 1.00 36.53  ? 181  PHE A CG    1 
ATOM   2205 C CD1   . PHE B 2 181 ? 2.952  -7.591  -20.269 1.00 36.29  ? 181  PHE A CD1   1 
ATOM   2206 C CD2   . PHE B 2 181 ? 3.374  -6.268  -18.322 1.00 37.09  ? 181  PHE A CD2   1 
ATOM   2207 C CE1   . PHE B 2 181 ? 2.703  -8.708  -19.465 1.00 35.79  ? 181  PHE A CE1   1 
ATOM   2208 C CE2   . PHE B 2 181 ? 3.126  -7.376  -17.508 1.00 36.04  ? 181  PHE A CE2   1 
ATOM   2209 C CZ    . PHE B 2 181 ? 2.792  -8.599  -18.084 1.00 36.11  ? 181  PHE A CZ    1 
ATOM   2210 N N     . TYR B 2 182 ? 2.496  -2.564  -19.355 1.00 36.23  ? 182  TYR A N     1 
ATOM   2211 C CA    . TYR B 2 182 ? 2.093  -1.808  -18.178 1.00 34.67  ? 182  TYR A CA    1 
ATOM   2212 C C     . TYR B 2 182 ? 1.185  -0.620  -18.482 1.00 34.90  ? 182  TYR A C     1 
ATOM   2213 O O     . TYR B 2 182 ? 0.514  -0.110  -17.591 1.00 35.46  ? 182  TYR A O     1 
ATOM   2214 C CB    . TYR B 2 182 ? 3.333  -1.352  -17.414 1.00 33.84  ? 182  TYR A CB    1 
ATOM   2215 C CG    . TYR B 2 182 ? 4.132  -2.498  -16.835 1.00 33.08  ? 182  TYR A CG    1 
ATOM   2216 C CD1   . TYR B 2 182 ? 3.611  -3.281  -15.803 1.00 32.56  ? 182  TYR A CD1   1 
ATOM   2217 C CD2   . TYR B 2 182 ? 5.409  -2.801  -17.317 1.00 33.17  ? 182  TYR A CD2   1 
ATOM   2218 C CE1   . TYR B 2 182 ? 4.334  -4.334  -15.260 1.00 33.74  ? 182  TYR A CE1   1 
ATOM   2219 C CE2   . TYR B 2 182 ? 6.150  -3.857  -16.783 1.00 32.36  ? 182  TYR A CE2   1 
ATOM   2220 C CZ    . TYR B 2 182 ? 5.606  -4.620  -15.750 1.00 34.21  ? 182  TYR A CZ    1 
ATOM   2221 O OH    . TYR B 2 182 ? 6.330  -5.649  -15.191 1.00 34.05  ? 182  TYR A OH    1 
ATOM   2222 N N     . GLY B 2 183 ? 1.170  -0.169  -19.731 1.00 35.28  ? 183  GLY A N     1 
ATOM   2223 C CA    . GLY B 2 183 ? 0.291  0.928   -20.103 1.00 35.22  ? 183  GLY A CA    1 
ATOM   2224 C C     . GLY B 2 183 ? 0.860  2.327   -20.062 1.00 36.00  ? 183  GLY A C     1 
ATOM   2225 O O     . GLY B 2 183 ? 0.292  3.245   -20.667 1.00 36.30  ? 183  GLY A O     1 
ATOM   2226 N N     . SER B 2 184 ? 1.963  2.508   -19.341 1.00 35.25  ? 184  SER A N     1 
ATOM   2227 C CA    . SER B 2 184 ? 2.590  3.823   -19.249 1.00 34.32  ? 184  SER A CA    1 
ATOM   2228 C C     . SER B 2 184 ? 3.957  3.743   -18.601 1.00 34.34  ? 184  SER A C     1 
ATOM   2229 O O     . SER B 2 184 ? 4.303  2.742   -17.978 1.00 34.58  ? 184  SER A O     1 
ATOM   2230 C CB    . SER B 2 184 ? 1.724  4.761   -18.425 1.00 34.01  ? 184  SER A CB    1 
ATOM   2231 O OG    . SER B 2 184 ? 1.766  4.382   -17.061 1.00 33.00  ? 184  SER A OG    1 
ATOM   2232 N N     . PHE B 2 185 ? 4.730  4.813   -18.742 1.00 34.80  ? 185  PHE A N     1 
ATOM   2233 C CA    . PHE B 2 185 ? 6.058  4.878   -18.148 1.00 35.26  ? 185  PHE A CA    1 
ATOM   2234 C C     . PHE B 2 185 ? 5.990  4.675   -16.632 1.00 36.27  ? 185  PHE A C     1 
ATOM   2235 O O     . PHE B 2 185 ? 6.763  3.905   -16.063 1.00 37.52  ? 185  PHE A O     1 
ATOM   2236 C CB    . PHE B 2 185 ? 6.713  6.226   -18.480 1.00 33.82  ? 185  PHE A CB    1 
ATOM   2237 C CG    . PHE B 2 185 ? 7.916  6.545   -17.637 1.00 34.04  ? 185  PHE A CG    1 
ATOM   2238 C CD1   . PHE B 2 185 ? 7.772  7.179   -16.409 1.00 32.34  ? 185  PHE A CD1   1 
ATOM   2239 C CD2   . PHE B 2 185 ? 9.196  6.188   -18.060 1.00 33.51  ? 185  PHE A CD2   1 
ATOM   2240 C CE1   . PHE B 2 185 ? 8.882  7.450   -15.616 1.00 32.56  ? 185  PHE A CE1   1 
ATOM   2241 C CE2   . PHE B 2 185 ? 10.310 6.455   -17.273 1.00 31.46  ? 185  PHE A CE2   1 
ATOM   2242 C CZ    . PHE B 2 185 ? 10.153 7.087   -16.052 1.00 32.11  ? 185  PHE A CZ    1 
ATOM   2243 N N     . LEU B 2 186 ? 5.057  5.355   -15.981 1.00 37.36  ? 186  LEU A N     1 
ATOM   2244 C CA    . LEU B 2 186 ? 4.914  5.227   -14.536 1.00 38.48  ? 186  LEU A CA    1 
ATOM   2245 C C     . LEU B 2 186 ? 4.617  3.786   -14.088 1.00 38.35  ? 186  LEU A C     1 
ATOM   2246 O O     . LEU B 2 186 ? 5.318  3.232   -13.238 1.00 38.00  ? 186  LEU A O     1 
ATOM   2247 C CB    . LEU B 2 186 ? 3.823  6.180   -14.034 1.00 40.71  ? 186  LEU A CB    1 
ATOM   2248 C CG    . LEU B 2 186 ? 3.766  6.400   -12.517 1.00 43.29  ? 186  LEU A CG    1 
ATOM   2249 C CD1   . LEU B 2 186 ? 5.152  6.764   -11.995 1.00 43.30  ? 186  LEU A CD1   1 
ATOM   2250 C CD2   . LEU B 2 186 ? 2.765  7.497   -12.192 1.00 42.10  ? 186  LEU A CD2   1 
ATOM   2251 N N     . GLU B 2 187 ? 3.585  3.172   -14.651 1.00 38.19  ? 187  GLU A N     1 
ATOM   2252 C CA    . GLU B 2 187 ? 3.266  1.805   -14.267 1.00 37.98  ? 187  GLU A CA    1 
ATOM   2253 C C     . GLU B 2 187 ? 4.452  0.866   -14.467 1.00 38.05  ? 187  GLU A C     1 
ATOM   2254 O O     . GLU B 2 187 ? 4.661  -0.053  -13.668 1.00 37.60  ? 187  GLU A O     1 
ATOM   2255 C CB    . GLU B 2 187 ? 2.066  1.293   -15.054 1.00 38.60  ? 187  GLU A CB    1 
ATOM   2256 C CG    . GLU B 2 187 ? 0.769  1.845   -14.552 1.00 39.94  ? 187  GLU A CG    1 
ATOM   2257 C CD    . GLU B 2 187 ? 0.575  1.554   -13.083 1.00 42.63  ? 187  GLU A CD    1 
ATOM   2258 O OE1   . GLU B 2 187 ? 0.557  0.352   -12.714 1.00 42.89  ? 187  GLU A OE1   1 
ATOM   2259 O OE2   . GLU B 2 187 ? 0.448  2.527   -12.301 1.00 43.39  ? 187  GLU A OE2   1 
ATOM   2260 N N     . THR B 2 188 ? 5.220  1.100   -15.533 1.00 37.28  ? 188  THR A N     1 
ATOM   2261 C CA    . THR B 2 188 ? 6.389  0.286   -15.830 1.00 36.65  ? 188  THR A CA    1 
ATOM   2262 C C     . THR B 2 188 ? 7.422  0.462   -14.722 1.00 36.88  ? 188  THR A C     1 
ATOM   2263 O O     . THR B 2 188 ? 7.970  -0.510  -14.204 1.00 37.58  ? 188  THR A O     1 
ATOM   2264 C CB    . THR B 2 188 ? 7.021  0.693   -17.172 1.00 36.65  ? 188  THR A CB    1 
ATOM   2265 O OG1   . THR B 2 188 ? 6.129  0.362   -18.242 1.00 37.27  ? 188  THR A OG1   1 
ATOM   2266 C CG2   . THR B 2 188 ? 8.334  -0.029  -17.384 1.00 37.04  ? 188  THR A CG2   1 
ATOM   2267 N N     . VAL B 2 189 ? 7.676  1.715   -14.361 1.00 35.89  ? 189  VAL A N     1 
ATOM   2268 C CA    . VAL B 2 189 ? 8.625  2.050   -13.312 1.00 35.43  ? 189  VAL A CA    1 
ATOM   2269 C C     . VAL B 2 189 ? 8.142  1.560   -11.949 1.00 36.78  ? 189  VAL A C     1 
ATOM   2270 O O     . VAL B 2 189 ? 8.933  1.064   -11.142 1.00 37.68  ? 189  VAL A O     1 
ATOM   2271 C CB    . VAL B 2 189 ? 8.851  3.580   -13.253 1.00 36.57  ? 189  VAL A CB    1 
ATOM   2272 C CG1   . VAL B 2 189 ? 9.614  3.952   -11.988 1.00 36.10  ? 189  VAL A CG1   1 
ATOM   2273 C CG2   . VAL B 2 189 ? 9.620  4.039   -14.499 1.00 35.75  ? 189  VAL A CG2   1 
ATOM   2274 N N     . LYS B 2 190 ? 6.843  1.695   -11.685 1.00 37.56  ? 190  LYS A N     1 
ATOM   2275 C CA    . LYS B 2 190 ? 6.298  1.245   -10.408 1.00 36.64  ? 190  LYS A CA    1 
ATOM   2276 C C     . LYS B 2 190 ? 6.491  -0.249  -10.226 1.00 35.32  ? 190  LYS A C     1 
ATOM   2277 O O     . LYS B 2 190 ? 6.963  -0.689  -9.186  1.00 35.93  ? 190  LYS A O     1 
ATOM   2278 C CB    . LYS B 2 190 ? 4.806  1.562   -10.303 1.00 40.05  ? 190  LYS A CB    1 
ATOM   2279 C CG    . LYS B 2 190 ? 4.465  2.996   -9.932  1.00 42.98  ? 190  LYS A CG    1 
ATOM   2280 C CD    . LYS B 2 190 ? 2.954  3.153   -9.781  1.00 45.64  ? 190  LYS A CD    1 
ATOM   2281 C CE    . LYS B 2 190 ? 2.560  4.582   -9.429  1.00 49.89  ? 190  LYS A CE    1 
ATOM   2282 N NZ    . LYS B 2 190 ? 1.079  4.783   -9.370  1.00 49.83  ? 190  LYS A NZ    1 
ATOM   2283 N N     . ASN B 2 191 ? 6.131  -1.030  -11.240 1.00 34.68  ? 191  ASN A N     1 
ATOM   2284 C CA    . ASN B 2 191 ? 6.249  -2.485  -11.163 1.00 33.90  ? 191  ASN A CA    1 
ATOM   2285 C C     . ASN B 2 191 ? 7.672  -3.020  -11.307 1.00 34.52  ? 191  ASN A C     1 
ATOM   2286 O O     . ASN B 2 191 ? 8.017  -4.046  -10.710 1.00 33.73  ? 191  ASN A O     1 
ATOM   2287 C CB    . ASN B 2 191 ? 5.336  -3.129  -12.209 1.00 34.57  ? 191  ASN A CB    1 
ATOM   2288 C CG    . ASN B 2 191 ? 3.856  -2.941  -11.886 1.00 35.03  ? 191  ASN A CG    1 
ATOM   2289 O OD1   . ASN B 2 191 ? 3.254  -3.755  -11.193 1.00 34.54  ? 191  ASN A OD1   1 
ATOM   2290 N ND2   . ASN B 2 191 ? 3.277  -1.850  -12.371 1.00 34.52  ? 191  ASN A ND2   1 
ATOM   2291 N N     . ALA B 2 192 ? 8.507  -2.331  -12.079 1.00 35.63  ? 192  ALA A N     1 
ATOM   2292 C CA    . ALA B 2 192 ? 9.886  -2.783  -12.257 1.00 36.26  ? 192  ALA A CA    1 
ATOM   2293 C C     . ALA B 2 192 ? 10.619 -2.860  -10.915 1.00 36.15  ? 192  ALA A C     1 
ATOM   2294 O O     . ALA B 2 192 ? 11.617 -3.572  -10.787 1.00 36.12  ? 192  ALA A O     1 
ATOM   2295 C CB    . ALA B 2 192 ? 10.626 -1.861  -13.203 1.00 36.20  ? 192  ALA A CB    1 
ATOM   2296 N N     . ARG B 2 193 ? 10.115 -2.129  -9.919  1.00 35.50  ? 193  ARG A N     1 
ATOM   2297 C CA    . ARG B 2 193 ? 10.726 -2.126  -8.589  1.00 36.68  ? 193  ARG A CA    1 
ATOM   2298 C C     . ARG B 2 193 ? 10.642 -3.494  -7.928  1.00 37.20  ? 193  ARG A C     1 
ATOM   2299 O O     . ARG B 2 193 ? 11.340 -3.747  -6.947  1.00 37.04  ? 193  ARG A O     1 
ATOM   2300 C CB    . ARG B 2 193 ? 10.041 -1.113  -7.669  1.00 35.55  ? 193  ARG A CB    1 
ATOM   2301 C CG    . ARG B 2 193 ? 10.245 0.336   -8.041  1.00 36.54  ? 193  ARG A CG    1 
ATOM   2302 C CD    . ARG B 2 193 ? 9.467  1.237   -7.097  1.00 36.34  ? 193  ARG A CD    1 
ATOM   2303 N NE    . ARG B 2 193 ? 8.038  0.921   -7.104  1.00 36.53  ? 193  ARG A NE    1 
ATOM   2304 C CZ    . ARG B 2 193 ? 7.121  1.538   -6.355  1.00 36.58  ? 193  ARG A CZ    1 
ATOM   2305 N NH1   . ARG B 2 193 ? 7.469  2.519   -5.521  1.00 35.52  ? 193  ARG A NH1   1 
ATOM   2306 N NH2   . ARG B 2 193 ? 5.846  1.170   -6.440  1.00 35.11  ? 193  ARG A NH2   1 
ATOM   2307 N N     . ARG B 2 194 ? 9.789  -4.361  -8.480  1.00 38.40  ? 194  ARG A N     1 
ATOM   2308 C CA    . ARG B 2 194 ? 9.560  -5.713  -7.965  1.00 38.64  ? 194  ARG A CA    1 
ATOM   2309 C C     . ARG B 2 194 ? 10.169 -6.767  -8.889  1.00 38.24  ? 194  ARG A C     1 
ATOM   2310 O O     . ARG B 2 194 ? 10.012 -7.967  -8.659  1.00 37.67  ? 194  ARG A O     1 
ATOM   2311 C CB    . ARG B 2 194 ? 8.059  -5.976  -7.837  1.00 41.75  ? 194  ARG A CB    1 
ATOM   2312 C CG    . ARG B 2 194 ? 7.507  -5.789  -6.435  1.00 49.15  ? 194  ARG A CG    1 
ATOM   2313 C CD    . ARG B 2 194 ? 6.739  -4.484  -6.267  1.00 53.78  ? 194  ARG A CD    1 
ATOM   2314 N NE    . ARG B 2 194 ? 5.761  -4.551  -5.182  1.00 58.83  ? 194  ARG A NE    1 
ATOM   2315 C CZ    . ARG B 2 194 ? 4.735  -5.401  -5.140  1.00 61.33  ? 194  ARG A CZ    1 
ATOM   2316 N NH1   . ARG B 2 194 ? 3.890  -5.382  -4.115  1.00 61.74  ? 194  ARG A NH1   1 
ATOM   2317 N NH2   . ARG B 2 194 ? 4.553  -6.277  -6.123  1.00 62.10  ? 194  ARG A NH2   1 
ATOM   2318 N N     . TRP B 2 195 ? 10.838 -6.320  -9.948  1.00 37.62  ? 195  TRP A N     1 
ATOM   2319 C CA    . TRP B 2 195 ? 11.480 -7.240  -10.875 1.00 37.36  ? 195  TRP A CA    1 
ATOM   2320 C C     . TRP B 2 195 ? 12.639 -7.945  -10.169 1.00 37.68  ? 195  TRP A C     1 
ATOM   2321 O O     . TRP B 2 195 ? 13.264 -7.391  -9.259  1.00 37.21  ? 195  TRP A O     1 
ATOM   2322 C CB    . TRP B 2 195 ? 12.021 -6.490  -12.101 1.00 38.37  ? 195  TRP A CB    1 
ATOM   2323 C CG    . TRP B 2 195 ? 10.960 -6.011  -13.071 1.00 38.84  ? 195  TRP A CG    1 
ATOM   2324 C CD1   . TRP B 2 195 ? 9.610  -6.196  -12.966 1.00 39.12  ? 195  TRP A CD1   1 
ATOM   2325 C CD2   . TRP B 2 195 ? 11.171 -5.290  -14.297 1.00 37.90  ? 195  TRP A CD2   1 
ATOM   2326 N NE1   . TRP B 2 195 ? 8.967  -5.640  -14.045 1.00 37.97  ? 195  TRP A NE1   1 
ATOM   2327 C CE2   . TRP B 2 195 ? 9.896  -5.074  -14.878 1.00 38.33  ? 195  TRP A CE2   1 
ATOM   2328 C CE3   . TRP B 2 195 ? 12.308 -4.800  -14.955 1.00 36.42  ? 195  TRP A CE3   1 
ATOM   2329 C CZ2   . TRP B 2 195 ? 9.724  -4.396  -16.098 1.00 35.78  ? 195  TRP A CZ2   1 
ATOM   2330 C CZ3   . TRP B 2 195 ? 12.140 -4.121  -16.169 1.00 36.58  ? 195  TRP A CZ3   1 
ATOM   2331 C CH2   . TRP B 2 195 ? 10.852 -3.925  -16.724 1.00 37.54  ? 195  TRP A CH2   1 
ATOM   2332 N N     . THR B 2 196 ? 12.908 -9.179  -10.581 1.00 37.33  ? 196  THR A N     1 
ATOM   2333 C CA    . THR B 2 196 ? 14.002 -9.951  -10.014 1.00 37.55  ? 196  THR A CA    1 
ATOM   2334 C C     . THR B 2 196 ? 14.754 -10.531 -11.192 1.00 38.78  ? 196  THR A C     1 
ATOM   2335 O O     . THR B 2 196 ? 14.327 -10.390 -12.347 1.00 37.72  ? 196  THR A O     1 
ATOM   2336 C CB    . THR B 2 196 ? 13.512 -11.131 -9.148  1.00 36.68  ? 196  THR A CB    1 
ATOM   2337 O OG1   . THR B 2 196 ? 12.924 -12.123 -9.992  1.00 38.39  ? 196  THR A OG1   1 
ATOM   2338 C CG2   . THR B 2 196 ? 12.484 -10.667 -8.130  1.00 35.18  ? 196  THR A CG2   1 
ATOM   2339 N N     . ARG B 2 197 ? 15.871 -11.188 -10.905 1.00 39.62  ? 197  ARG A N     1 
ATOM   2340 C CA    . ARG B 2 197 ? 16.665 -11.787 -11.963 1.00 40.11  ? 197  ARG A CA    1 
ATOM   2341 C C     . ARG B 2 197 ? 15.983 -13.054 -12.465 1.00 41.39  ? 197  ARG A C     1 
ATOM   2342 O O     . ARG B 2 197 ? 16.504 -13.737 -13.343 1.00 41.25  ? 197  ARG A O     1 
ATOM   2343 C CB    . ARG B 2 197 ? 18.062 -12.119 -11.445 1.00 39.81  ? 197  ARG A CB    1 
ATOM   2344 C CG    . ARG B 2 197 ? 18.115 -13.313 -10.505 1.00 38.77  ? 197  ARG A CG    1 
ATOM   2345 C CD    . ARG B 2 197 ? 19.469 -13.377 -9.810  1.00 37.15  ? 197  ARG A CD    1 
ATOM   2346 N NE    . ARG B 2 197 ? 19.634 -12.293 -8.844  1.00 32.91  ? 197  ARG A NE    1 
ATOM   2347 C CZ    . ARG B 2 197 ? 20.797 -11.936 -8.309  1.00 31.55  ? 197  ARG A CZ    1 
ATOM   2348 N NH1   . ARG B 2 197 ? 21.914 -12.572 -8.652  1.00 30.14  ? 197  ARG A NH1   1 
ATOM   2349 N NH2   . ARG B 2 197 ? 20.842 -10.957 -7.418  1.00 30.16  ? 197  ARG A NH2   1 
ATOM   2350 N N     . ARG B 2 198 ? 14.815 -13.360 -11.904 1.00 42.70  ? 198  ARG A N     1 
ATOM   2351 C CA    . ARG B 2 198 ? 14.071 -14.559 -12.289 1.00 44.27  ? 198  ARG A CA    1 
ATOM   2352 C C     . ARG B 2 198 ? 12.726 -14.220 -12.940 1.00 43.71  ? 198  ARG A C     1 
ATOM   2353 O O     . ARG B 2 198 ? 11.943 -15.110 -13.288 1.00 44.52  ? 198  ARG A O     1 
ATOM   2354 C CB    . ARG B 2 198 ? 13.838 -15.440 -11.057 1.00 46.52  ? 198  ARG A CB    1 
ATOM   2355 C CG    . ARG B 2 198 ? 15.065 -16.186 -10.573 1.00 50.65  ? 198  ARG A CG    1 
ATOM   2356 C CD    . ARG B 2 198 ? 15.465 -17.281 -11.555 1.00 56.26  ? 198  ARG A CD    1 
ATOM   2357 N NE    . ARG B 2 198 ? 16.609 -18.064 -11.089 1.00 59.34  ? 198  ARG A NE    1 
ATOM   2358 C CZ    . ARG B 2 198 ? 17.857 -17.604 -11.011 1.00 60.58  ? 198  ARG A CZ    1 
ATOM   2359 N NH1   . ARG B 2 198 ? 18.137 -16.357 -11.371 1.00 61.22  ? 198  ARG A NH1   1 
ATOM   2360 N NH2   . ARG B 2 198 ? 18.829 -18.392 -10.567 1.00 61.09  ? 198  ARG A NH2   1 
ATOM   2361 N N     . THR B 2 199 ? 12.478 -12.928 -13.111 1.00 40.93  ? 199  THR A N     1 
ATOM   2362 C CA    . THR B 2 199 ? 11.236 -12.446 -13.683 1.00 39.05  ? 199  THR A CA    1 
ATOM   2363 C C     . THR B 2 199 ? 11.053 -12.754 -15.158 1.00 39.44  ? 199  THR A C     1 
ATOM   2364 O O     . THR B 2 199 ? 11.981 -12.636 -15.956 1.00 40.19  ? 199  THR A O     1 
ATOM   2365 C CB    . THR B 2 199 ? 11.102 -10.924 -13.472 1.00 38.84  ? 199  THR A CB    1 
ATOM   2366 O OG1   . THR B 2 199 ? 10.873 -10.659 -12.083 1.00 39.44  ? 199  THR A OG1   1 
ATOM   2367 C CG2   . THR B 2 199 ? 9.956  -10.360 -14.292 1.00 36.80  ? 199  THR A CG2   1 
ATOM   2368 N N     . VAL B 2 200 ? 9.839  -13.162 -15.507 1.00 37.80  ? 200  VAL A N     1 
ATOM   2369 C CA    . VAL B 2 200 ? 9.502  -13.460 -16.881 1.00 37.62  ? 200  VAL A CA    1 
ATOM   2370 C C     . VAL B 2 200 ? 8.239  -12.681 -17.238 1.00 38.41  ? 200  VAL A C     1 
ATOM   2371 O O     . VAL B 2 200 ? 7.194  -12.811 -16.594 1.00 39.42  ? 200  VAL A O     1 
ATOM   2372 C CB    . VAL B 2 200 ? 9.245  -14.961 -17.094 1.00 38.73  ? 200  VAL A CB    1 
ATOM   2373 C CG1   . VAL B 2 200 ? 8.878  -15.221 -18.550 1.00 37.19  ? 200  VAL A CG1   1 
ATOM   2374 C CG2   . VAL B 2 200 ? 10.479 -15.761 -16.699 1.00 37.77  ? 200  VAL A CG2   1 
ATOM   2375 N N     . ILE B 2 201 ? 8.352  -11.850 -18.262 1.00 37.73  ? 201  ILE A N     1 
ATOM   2376 C CA    . ILE B 2 201 ? 7.238  -11.050 -18.712 1.00 36.53  ? 201  ILE A CA    1 
ATOM   2377 C C     . ILE B 2 201 ? 6.822  -11.564 -20.081 1.00 37.15  ? 201  ILE A C     1 
ATOM   2378 O O     . ILE B 2 201 ? 7.577  -11.493 -21.048 1.00 37.39  ? 201  ILE A O     1 
ATOM   2379 C CB    . ILE B 2 201 ? 7.639  -9.560  -18.778 1.00 36.42  ? 201  ILE A CB    1 
ATOM   2380 C CG1   . ILE B 2 201 ? 8.131  -9.119  -17.396 1.00 33.32  ? 201  ILE A CG1   1 
ATOM   2381 C CG2   . ILE B 2 201 ? 6.445  -8.697  -19.247 1.00 34.54  ? 201  ILE A CG2   1 
ATOM   2382 C CD1   . ILE B 2 201 ? 8.693  -7.727  -17.370 1.00 32.58  ? 201  ILE A CD1   1 
ATOM   2383 N N     . ASP B 2 202 ? 5.613  -12.103 -20.140 1.00 37.42  ? 202  ASP A N     1 
ATOM   2384 C CA    . ASP B 2 202 ? 5.059  -12.657 -21.366 1.00 38.26  ? 202  ASP A CA    1 
ATOM   2385 C C     . ASP B 2 202 ? 3.968  -11.704 -21.842 1.00 38.72  ? 202  ASP A C     1 
ATOM   2386 O O     . ASP B 2 202 ? 2.839  -11.745 -21.357 1.00 39.45  ? 202  ASP A O     1 
ATOM   2387 C CB    . ASP B 2 202 ? 4.471  -14.033 -21.057 1.00 38.84  ? 202  ASP A CB    1 
ATOM   2388 C CG    . ASP B 2 202 ? 4.143  -14.813 -22.287 1.00 37.65  ? 202  ASP A CG    1 
ATOM   2389 O OD1   . ASP B 2 202 ? 3.834  -14.186 -23.313 1.00 41.05  ? 202  ASP A OD1   1 
ATOM   2390 O OD2   . ASP B 2 202 ? 4.179  -16.052 -22.222 1.00 37.18  ? 202  ASP A OD2   1 
ATOM   2391 N N     . VAL B 2 203 ? 4.311  -10.841 -22.786 1.00 39.57  ? 203  VAL A N     1 
ATOM   2392 C CA    . VAL B 2 203 ? 3.376  -9.847  -23.317 1.00 40.29  ? 203  VAL A CA    1 
ATOM   2393 C C     . VAL B 2 203 ? 2.070  -10.409 -23.886 1.00 39.91  ? 203  VAL A C     1 
ATOM   2394 O O     . VAL B 2 203 ? 0.982  -9.969  -23.523 1.00 39.90  ? 203  VAL A O     1 
ATOM   2395 C CB    . VAL B 2 203 ? 4.049  -9.027  -24.431 1.00 40.32  ? 203  VAL A CB    1 
ATOM   2396 C CG1   . VAL B 2 203 ? 3.410  -7.666  -24.525 1.00 40.37  ? 203  VAL A CG1   1 
ATOM   2397 C CG2   . VAL B 2 203 ? 5.549  -8.931  -24.156 1.00 42.88  ? 203  VAL A CG2   1 
ATOM   2398 N N     . ALA B 2 204 ? 2.198  -11.373 -24.790 1.00 38.63  ? 204  ALA A N     1 
ATOM   2399 C CA    . ALA B 2 204 ? 1.052  -11.987 -25.441 1.00 38.41  ? 204  ALA A CA    1 
ATOM   2400 C C     . ALA B 2 204 ? 0.105  -12.688 -24.472 1.00 39.13  ? 204  ALA A C     1 
ATOM   2401 O O     . ALA B 2 204 ? -1.090 -12.821 -24.756 1.00 38.78  ? 204  ALA A O     1 
ATOM   2402 C CB    . ALA B 2 204 ? 1.526  -12.967 -26.506 1.00 36.19  ? 204  ALA A CB    1 
ATOM   2403 N N     . LYS B 2 205 ? 0.629  -13.158 -23.343 1.00 38.59  ? 205  LYS A N     1 
ATOM   2404 C CA    . LYS B 2 205 ? -0.233 -13.812 -22.370 1.00 38.65  ? 205  LYS A CA    1 
ATOM   2405 C C     . LYS B 2 205 ? -0.628 -12.854 -21.255 1.00 37.33  ? 205  LYS A C     1 
ATOM   2406 O O     . LYS B 2 205 ? -1.383 -13.215 -20.368 1.00 37.24  ? 205  LYS A O     1 
ATOM   2407 C CB    . LYS B 2 205 ? 0.445  -15.052 -21.790 1.00 40.35  ? 205  LYS A CB    1 
ATOM   2408 C CG    . LYS B 2 205 ? 0.495  -16.220 -22.754 1.00 43.33  ? 205  LYS A CG    1 
ATOM   2409 C CD    . LYS B 2 205 ? 1.047  -17.468 -22.079 1.00 46.58  ? 205  LYS A CD    1 
ATOM   2410 C CE    . LYS B 2 205 ? 1.174  -18.630 -23.067 1.00 48.48  ? 205  LYS A CE    1 
ATOM   2411 N NZ    . LYS B 2 205 ? 1.732  -19.856 -22.419 1.00 50.05  ? 205  LYS A NZ    1 
ATOM   2412 N N     . GLY B 2 206 ? -0.130 -11.625 -21.312 1.00 37.42  ? 206  GLY A N     1 
ATOM   2413 C CA    . GLY B 2 206 ? -0.453 -10.655 -20.278 1.00 38.80  ? 206  GLY A CA    1 
ATOM   2414 C C     . GLY B 2 206 ? -0.148 -11.225 -18.902 1.00 39.25  ? 206  GLY A C     1 
ATOM   2415 O O     . GLY B 2 206 ? -0.887 -11.022 -17.941 1.00 38.70  ? 206  GLY A O     1 
ATOM   2416 N N     . GLU B 2 207 ? 0.981  -11.913 -18.805 1.00 40.53  ? 207  GLU A N     1 
ATOM   2417 C CA    . GLU B 2 207 ? 1.365  -12.559 -17.564 1.00 41.51  ? 207  GLU A CA    1 
ATOM   2418 C C     . GLU B 2 207 ? 2.808  -12.320 -17.134 1.00 41.11  ? 207  GLU A C     1 
ATOM   2419 O O     . GLU B 2 207 ? 3.684  -12.040 -17.948 1.00 42.05  ? 207  GLU A O     1 
ATOM   2420 C CB    . GLU B 2 207 ? 1.119  -14.053 -17.732 1.00 43.58  ? 207  GLU A CB    1 
ATOM   2421 C CG    . GLU B 2 207 ? 1.546  -14.929 -16.598 1.00 46.93  ? 207  GLU A CG    1 
ATOM   2422 C CD    . GLU B 2 207 ? 1.233  -16.377 -16.892 1.00 49.61  ? 207  GLU A CD    1 
ATOM   2423 O OE1   . GLU B 2 207 ? 1.782  -16.906 -17.886 1.00 48.71  ? 207  GLU A OE1   1 
ATOM   2424 O OE2   . GLU B 2 207 ? 0.431  -16.977 -16.138 1.00 52.30  ? 207  GLU A OE2   1 
ATOM   2425 N N     . VAL B 2 208 ? 3.036  -12.426 -15.835 1.00 40.82  ? 208  VAL A N     1 
ATOM   2426 C CA    . VAL B 2 208 ? 4.365  -12.280 -15.267 1.00 41.06  ? 208  VAL A CA    1 
ATOM   2427 C C     . VAL B 2 208 ? 4.577  -13.535 -14.417 1.00 41.22  ? 208  VAL A C     1 
ATOM   2428 O O     . VAL B 2 208 ? 3.713  -13.900 -13.613 1.00 40.26  ? 208  VAL A O     1 
ATOM   2429 C CB    . VAL B 2 208 ? 4.477  -11.038 -14.342 1.00 40.85  ? 208  VAL A CB    1 
ATOM   2430 C CG1   . VAL B 2 208 ? 5.833  -11.028 -13.647 1.00 39.13  ? 208  VAL A CG1   1 
ATOM   2431 C CG2   . VAL B 2 208 ? 4.299  -9.757  -15.148 1.00 42.21  ? 208  VAL A CG2   1 
ATOM   2432 N N     . ARG B 2 209 ? 5.706  -14.209 -14.609 1.00 41.24  ? 209  ARG A N     1 
ATOM   2433 C CA    . ARG B 2 209 ? 5.989  -15.393 -13.821 1.00 42.80  ? 209  ARG A CA    1 
ATOM   2434 C C     . ARG B 2 209 ? 7.454  -15.505 -13.432 1.00 45.16  ? 209  ARG A C     1 
ATOM   2435 O O     . ARG B 2 209 ? 8.280  -14.676 -13.813 1.00 46.28  ? 209  ARG A O     1 
ATOM   2436 C CB    . ARG B 2 209 ? 5.541  -16.645 -14.564 1.00 41.63  ? 209  ARG A CB    1 
ATOM   2437 C CG    . ARG B 2 209 ? 5.967  -16.699 -15.998 1.00 40.88  ? 209  ARG A CG    1 
ATOM   2438 C CD    . ARG B 2 209 ? 5.615  -18.042 -16.582 1.00 39.94  ? 209  ARG A CD    1 
ATOM   2439 N NE    . ARG B 2 209 ? 6.174  -18.202 -17.918 1.00 42.49  ? 209  ARG A NE    1 
ATOM   2440 C CZ    . ARG B 2 209 ? 5.608  -17.751 -19.031 1.00 41.93  ? 209  ARG A CZ    1 
ATOM   2441 N NH1   . ARG B 2 209 ? 4.447  -17.107 -18.974 1.00 41.71  ? 209  ARG A NH1   1 
ATOM   2442 N NH2   . ARG B 2 209 ? 6.210  -17.943 -20.201 1.00 40.78  ? 209  ARG A NH2   1 
ATOM   2443 N N     . LYS B 2 210 ? 7.768  -16.531 -12.656 1.00 47.14  ? 210  LYS A N     1 
ATOM   2444 C CA    . LYS B 2 210 ? 9.124  -16.749 -12.196 1.00 49.75  ? 210  LYS A CA    1 
ATOM   2445 C C     . LYS B 2 210 ? 9.732  -17.784 -13.123 1.00 50.69  ? 210  LYS A C     1 
ATOM   2446 O O     . LYS B 2 210 ? 9.151  -18.841 -13.334 1.00 52.30  ? 210  LYS A O     1 
ATOM   2447 C CB    . LYS B 2 210 ? 9.092  -17.259 -10.753 1.00 51.05  ? 210  LYS A CB    1 
ATOM   2448 C CG    . LYS B 2 210 ? 10.394 -17.157 -9.972  1.00 55.22  ? 210  LYS A CG    1 
ATOM   2449 C CD    . LYS B 2 210 ? 11.425 -18.220 -10.367 1.00 58.23  ? 210  LYS A CD    1 
ATOM   2450 C CE    . LYS B 2 210 ? 12.618 -18.199 -9.395  1.00 59.39  ? 210  LYS A CE    1 
ATOM   2451 N NZ    . LYS B 2 210 ? 13.744 -19.099 -9.778  1.00 59.98  ? 210  LYS A NZ    1 
ATOM   2452 N N     . GLY B 2 211 ? 10.885 -17.466 -13.703 1.00 51.03  ? 211  GLY A N     1 
ATOM   2453 C CA    . GLY B 2 211 ? 11.550 -18.396 -14.598 1.00 50.59  ? 211  GLY A CA    1 
ATOM   2454 C C     . GLY B 2 211 ? 12.966 -18.655 -14.116 1.00 51.25  ? 211  GLY A C     1 
ATOM   2455 O O     . GLY B 2 211 ? 13.241 -18.582 -12.917 1.00 51.28  ? 211  GLY A O     1 
ATOM   2456 N N     . GLU B 2 212 ? 13.869 -18.958 -15.042 1.00 50.84  ? 212  GLU A N     1 
ATOM   2457 C CA    . GLU B 2 212 ? 15.257 -19.216 -14.680 1.00 50.80  ? 212  GLU A CA    1 
ATOM   2458 C C     . GLU B 2 212 ? 16.169 -18.015 -14.942 1.00 48.61  ? 212  GLU A C     1 
ATOM   2459 O O     . GLU B 2 212 ? 17.323 -18.003 -14.519 1.00 47.21  ? 212  GLU A O     1 
ATOM   2460 C CB    . GLU B 2 212 ? 15.766 -20.448 -15.431 1.00 52.68  ? 212  GLU A CB    1 
ATOM   2461 C CG    . GLU B 2 212 ? 15.503 -21.754 -14.690 1.00 58.82  ? 212  GLU A CG    1 
ATOM   2462 C CD    . GLU B 2 212 ? 15.561 -22.978 -15.591 1.00 62.75  ? 212  GLU A CD    1 
ATOM   2463 O OE1   . GLU B 2 212 ? 16.167 -22.901 -16.683 1.00 64.70  ? 212  GLU A OE1   1 
ATOM   2464 O OE2   . GLU B 2 212 ? 15.001 -24.027 -15.198 1.00 64.37  ? 212  GLU A OE2   1 
ATOM   2465 N N     . GLU B 2 213 ? 15.629 -16.998 -15.610 1.00 47.06  ? 213  GLU A N     1 
ATOM   2466 C CA    . GLU B 2 213 ? 16.378 -15.787 -15.951 1.00 45.78  ? 213  GLU A CA    1 
ATOM   2467 C C     . GLU B 2 213 ? 15.412 -14.657 -16.309 1.00 43.60  ? 213  GLU A C     1 
ATOM   2468 O O     . GLU B 2 213 ? 14.219 -14.897 -16.487 1.00 45.09  ? 213  GLU A O     1 
ATOM   2469 C CB    . GLU B 2 213 ? 17.265 -16.076 -17.150 1.00 47.64  ? 213  GLU A CB    1 
ATOM   2470 C CG    . GLU B 2 213 ? 16.522 -16.842 -18.214 1.00 52.62  ? 213  GLU A CG    1 
ATOM   2471 C CD    . GLU B 2 213 ? 17.253 -16.884 -19.524 1.00 55.09  ? 213  GLU A CD    1 
ATOM   2472 O OE1   . GLU B 2 213 ? 16.750 -17.556 -20.453 1.00 57.23  ? 213  GLU A OE1   1 
ATOM   2473 O OE2   . GLU B 2 213 ? 18.323 -16.243 -19.624 1.00 55.41  ? 213  GLU A OE2   1 
ATOM   2474 N N     . PHE B 2 214 ? 15.907 -13.427 -16.408 1.00 39.96  ? 214  PHE A N     1 
ATOM   2475 C CA    . PHE B 2 214 ? 15.025 -12.330 -16.780 1.00 37.63  ? 214  PHE A CA    1 
ATOM   2476 C C     . PHE B 2 214 ? 14.668 -12.611 -18.227 1.00 37.98  ? 214  PHE A C     1 
ATOM   2477 O O     . PHE B 2 214 ? 15.551 -12.725 -19.078 1.00 39.00  ? 214  PHE A O     1 
ATOM   2478 C CB    . PHE B 2 214 ? 15.712 -10.976 -16.686 1.00 34.42  ? 214  PHE A CB    1 
ATOM   2479 C CG    . PHE B 2 214 ? 14.769 -9.816  -16.877 1.00 32.95  ? 214  PHE A CG    1 
ATOM   2480 C CD1   . PHE B 2 214 ? 13.824 -9.508  -15.907 1.00 31.79  ? 214  PHE A CD1   1 
ATOM   2481 C CD2   . PHE B 2 214 ? 14.816 -9.043  -18.032 1.00 31.70  ? 214  PHE A CD2   1 
ATOM   2482 C CE1   . PHE B 2 214 ? 12.940 -8.447  -16.090 1.00 33.27  ? 214  PHE A CE1   1 
ATOM   2483 C CE2   . PHE B 2 214 ? 13.939 -7.983  -18.221 1.00 30.18  ? 214  PHE A CE2   1 
ATOM   2484 C CZ    . PHE B 2 214 ? 12.999 -7.679  -17.254 1.00 30.44  ? 214  PHE A CZ    1 
ATOM   2485 N N     . PHE B 2 215 ? 13.376 -12.713 -18.510 1.00 36.18  ? 215  PHE A N     1 
ATOM   2486 C CA    . PHE B 2 215 ? 12.948 -13.054 -19.852 1.00 34.51  ? 215  PHE A CA    1 
ATOM   2487 C C     . PHE B 2 215 ? 11.670 -12.341 -20.271 1.00 34.41  ? 215  PHE A C     1 
ATOM   2488 O O     . PHE B 2 215 ? 10.637 -12.437 -19.607 1.00 35.27  ? 215  PHE A O     1 
ATOM   2489 C CB    . PHE B 2 215 ? 12.759 -14.577 -19.910 1.00 31.88  ? 215  PHE A CB    1 
ATOM   2490 C CG    . PHE B 2 215 ? 12.738 -15.157 -21.302 1.00 30.09  ? 215  PHE A CG    1 
ATOM   2491 C CD1   . PHE B 2 215 ? 13.471 -16.312 -21.583 1.00 28.74  ? 215  PHE A CD1   1 
ATOM   2492 C CD2   . PHE B 2 215 ? 11.908 -14.631 -22.292 1.00 30.45  ? 215  PHE A CD2   1 
ATOM   2493 C CE1   . PHE B 2 215 ? 13.380 -16.945 -22.818 1.00 28.87  ? 215  PHE A CE1   1 
ATOM   2494 C CE2   . PHE B 2 215 ? 11.801 -15.253 -23.537 1.00 31.80  ? 215  PHE A CE2   1 
ATOM   2495 C CZ    . PHE B 2 215 ? 12.543 -16.420 -23.798 1.00 32.37  ? 215  PHE A CZ    1 
ATOM   2496 N N     . VAL B 2 216 ? 11.760 -11.621 -21.382 1.00 32.39  ? 216  VAL A N     1 
ATOM   2497 C CA    . VAL B 2 216 ? 10.628 -10.901 -21.940 1.00 31.52  ? 216  VAL A CA    1 
ATOM   2498 C C     . VAL B 2 216 ? 10.350 -11.634 -23.258 1.00 32.06  ? 216  VAL A C     1 
ATOM   2499 O O     . VAL B 2 216 ? 11.055 -11.438 -24.253 1.00 32.36  ? 216  VAL A O     1 
ATOM   2500 C CB    . VAL B 2 216 ? 10.998 -9.423  -22.205 1.00 30.80  ? 216  VAL A CB    1 
ATOM   2501 C CG1   . VAL B 2 216 ? 9.783  -8.651  -22.706 1.00 29.49  ? 216  VAL A CG1   1 
ATOM   2502 C CG2   . VAL B 2 216 ? 11.546 -8.791  -20.926 1.00 28.64  ? 216  VAL A CG2   1 
ATOM   2503 N N     . VAL B 2 217 ? 9.335  -12.493 -23.266 1.00 32.01  ? 217  VAL A N     1 
ATOM   2504 C CA    . VAL B 2 217 ? 9.054  -13.259 -24.469 1.00 34.19  ? 217  VAL A CA    1 
ATOM   2505 C C     . VAL B 2 217 ? 8.476  -12.419 -25.593 1.00 34.64  ? 217  VAL A C     1 
ATOM   2506 O O     . VAL B 2 217 ? 7.619  -11.560 -25.383 1.00 35.59  ? 217  VAL A O     1 
ATOM   2507 C CB    . VAL B 2 217 ? 8.157  -14.523 -24.171 1.00 33.89  ? 217  VAL A CB    1 
ATOM   2508 C CG1   . VAL B 2 217 ? 7.842  -14.611 -22.689 1.00 32.78  ? 217  VAL A CG1   1 
ATOM   2509 C CG2   . VAL B 2 217 ? 6.906  -14.513 -25.017 1.00 33.30  ? 217  VAL A CG2   1 
ATOM   2510 N N     . ASP B 2 218 ? 8.996  -12.664 -26.790 1.00 35.09  ? 218  ASP A N     1 
ATOM   2511 C CA    . ASP B 2 218 ? 8.581  -11.953 -27.985 1.00 35.98  ? 218  ASP A CA    1 
ATOM   2512 C C     . ASP B 2 218 ? 7.173  -12.399 -28.365 1.00 36.43  ? 218  ASP A C     1 
ATOM   2513 O O     . ASP B 2 218 ? 6.894  -13.601 -28.456 1.00 37.11  ? 218  ASP A O     1 
ATOM   2514 C CB    . ASP B 2 218 ? 9.544  -12.276 -29.127 1.00 37.45  ? 218  ASP A CB    1 
ATOM   2515 C CG    . ASP B 2 218 ? 9.444  -11.298 -30.273 1.00 39.23  ? 218  ASP A CG    1 
ATOM   2516 O OD1   . ASP B 2 218 ? 8.368  -10.692 -30.475 1.00 37.96  ? 218  ASP A OD1   1 
ATOM   2517 O OD2   . ASP B 2 218 ? 10.454 -11.144 -30.984 1.00 40.56  ? 218  ASP A OD2   1 
ATOM   2518 N N     . PRO B 2 219 ? 6.262  -11.438 -28.589 1.00 36.51  ? 219  PRO A N     1 
ATOM   2519 C CA    . PRO B 2 219 ? 4.874  -11.748 -28.967 1.00 35.96  ? 219  PRO A CA    1 
ATOM   2520 C C     . PRO B 2 219 ? 4.861  -12.492 -30.300 1.00 37.55  ? 219  PRO A C     1 
ATOM   2521 O O     . PRO B 2 219 ? 3.959  -13.275 -30.599 1.00 37.29  ? 219  PRO A O     1 
ATOM   2522 C CB    . PRO B 2 219 ? 4.231  -10.374 -29.111 1.00 34.55  ? 219  PRO A CB    1 
ATOM   2523 C CG    . PRO B 2 219 ? 5.088  -9.473  -28.286 1.00 35.78  ? 219  PRO A CG    1 
ATOM   2524 C CD    . PRO B 2 219 ? 6.481  -9.984  -28.497 1.00 35.66  ? 219  PRO A CD    1 
ATOM   2525 N N     . VAL B 2 220 ? 5.888  -12.237 -31.098 1.00 39.49  ? 220  VAL A N     1 
ATOM   2526 C CA    . VAL B 2 220 ? 6.009  -12.845 -32.406 1.00 41.62  ? 220  VAL A CA    1 
ATOM   2527 C C     . VAL B 2 220 ? 6.684  -14.208 -32.370 1.00 42.80  ? 220  VAL A C     1 
ATOM   2528 O O     . VAL B 2 220 ? 6.583  -14.979 -33.318 1.00 43.95  ? 220  VAL A O     1 
ATOM   2529 C CB    . VAL B 2 220 ? 6.784  -11.900 -33.347 1.00 41.84  ? 220  VAL A CB    1 
ATOM   2530 C CG1   . VAL B 2 220 ? 7.021  -12.560 -34.688 1.00 41.48  ? 220  VAL A CG1   1 
ATOM   2531 C CG2   . VAL B 2 220 ? 6.010  -10.603 -33.511 1.00 40.74  ? 220  VAL A CG2   1 
ATOM   2532 N N     . ASP B 2 221 ? 7.366  -14.515 -31.275 1.00 43.96  ? 221  ASP A N     1 
ATOM   2533 C CA    . ASP B 2 221 ? 8.053  -15.803 -31.156 1.00 46.48  ? 221  ASP A CA    1 
ATOM   2534 C C     . ASP B 2 221 ? 8.086  -15.856 -29.633 1.00 48.70  ? 221  ASP A C     1 
ATOM   2535 O O     . ASP B 2 221 ? 8.627  -14.954 -28.978 1.00 49.66  ? 221  ASP A O     1 
ATOM   2536 C CB    . ASP B 2 221 ? 9.370  -15.777 -31.946 1.00 46.41  ? 221  ASP A CB    1 
ATOM   2537 C CG    . ASP B 2 221 ? 10.086 -17.117 -31.953 1.00 47.28  ? 221  ASP A CG    1 
ATOM   2538 O OD1   . ASP B 2 221 ? 9.796  -17.972 -31.085 1.00 49.03  ? 221  ASP A OD1   1 
ATOM   2539 O OD2   . ASP B 2 221 ? 10.959 -17.313 -32.825 1.00 47.84  ? 221  ASP A OD2   1 
ATOM   2540 N N     . GLU B 2 222 ? 7.517  -16.931 -29.087 1.00 50.48  ? 222  GLU A N     1 
ATOM   2541 C CA    . GLU B 2 222 ? 7.617  -17.271 -27.671 1.00 52.07  ? 222  GLU A CA    1 
ATOM   2542 C C     . GLU B 2 222 ? 9.020  -17.690 -27.246 1.00 51.31  ? 222  GLU A C     1 
ATOM   2543 O O     . GLU B 2 222 ? 9.382  -17.539 -26.080 1.00 51.19  ? 222  GLU A O     1 
ATOM   2544 C CB    . GLU B 2 222 ? 6.489  -18.231 -27.273 1.00 54.60  ? 222  GLU A CB    1 
ATOM   2545 C CG    . GLU B 2 222 ? 5.065  -17.742 -27.577 1.00 61.07  ? 222  GLU A CG    1 
ATOM   2546 C CD    . GLU B 2 222 ? 4.579  -16.625 -26.648 1.00 63.96  ? 222  GLU A CD    1 
ATOM   2547 O OE1   . GLU B 2 222 ? 4.558  -15.452 -27.086 1.00 66.17  ? 222  GLU A OE1   1 
ATOM   2548 O OE2   . GLU B 2 222 ? 4.218  -16.920 -25.483 1.00 64.29  ? 222  GLU A OE2   1 
ATOM   2549 N N     . LYS B 2 223 ? 9.817  -18.211 -28.172 1.00 50.10  ? 223  LYS A N     1 
ATOM   2550 C CA    . LYS B 2 223 ? 11.102 -18.805 -27.800 1.00 49.68  ? 223  LYS A CA    1 
ATOM   2551 C C     . LYS B 2 223 ? 12.203 -17.760 -27.661 1.00 47.48  ? 223  LYS A C     1 
ATOM   2552 O O     . LYS B 2 223 ? 13.248 -18.000 -27.063 1.00 47.90  ? 223  LYS A O     1 
ATOM   2553 C CB    . LYS B 2 223 ? 11.504 -19.863 -28.831 1.00 51.23  ? 223  LYS A CB    1 
ATOM   2554 C CG    . LYS B 2 223 ? 10.507 -21.008 -28.917 1.00 55.18  ? 223  LYS A CG    1 
ATOM   2555 C CD    . LYS B 2 223 ? 10.391 -21.728 -27.576 1.00 57.11  ? 223  LYS A CD    1 
ATOM   2556 C CE    . LYS B 2 223 ? 9.159  -22.622 -27.497 1.00 58.91  ? 223  LYS A CE    1 
ATOM   2557 N NZ    . LYS B 2 223 ? 7.893  -21.831 -27.396 1.00 60.58  ? 223  LYS A NZ    1 
ATOM   2558 N N     . ARG B 2 224 ? 11.926 -16.584 -28.194 1.00 46.06  ? 224  ARG A N     1 
ATOM   2559 C CA    . ARG B 2 224 ? 12.858 -15.485 -28.194 1.00 43.59  ? 224  ARG A CA    1 
ATOM   2560 C C     . ARG B 2 224 ? 12.739 -14.584 -26.954 1.00 41.29  ? 224  ARG A C     1 
ATOM   2561 O O     . ARG B 2 224 ? 11.640 -14.266 -26.511 1.00 41.62  ? 224  ARG A O     1 
ATOM   2562 C CB    . ARG B 2 224 ? 12.608 -14.692 -29.473 1.00 45.96  ? 224  ARG A CB    1 
ATOM   2563 C CG    . ARG B 2 224 ? 13.792 -13.944 -30.008 1.00 52.35  ? 224  ARG A CG    1 
ATOM   2564 C CD    . ARG B 2 224 ? 13.679 -13.794 -31.516 1.00 55.29  ? 224  ARG A CD    1 
ATOM   2565 N NE    . ARG B 2 224 ? 14.684 -12.877 -32.041 1.00 59.75  ? 224  ARG A NE    1 
ATOM   2566 C CZ    . ARG B 2 224 ? 14.763 -11.591 -31.712 1.00 62.10  ? 224  ARG A CZ    1 
ATOM   2567 N NH1   . ARG B 2 224 ? 13.893 -11.068 -30.854 1.00 63.08  ? 224  ARG A NH1   1 
ATOM   2568 N NH2   . ARG B 2 224 ? 15.712 -10.825 -32.238 1.00 62.65  ? 224  ARG A NH2   1 
ATOM   2569 N N     . ASN B 2 225 ? 13.877 -14.206 -26.377 1.00 38.07  ? 225  ASN A N     1 
ATOM   2570 C CA    . ASN B 2 225 ? 13.891 -13.305 -25.231 1.00 34.70  ? 225  ASN A CA    1 
ATOM   2571 C C     . ASN B 2 225 ? 14.280 -11.924 -25.750 1.00 33.73  ? 225  ASN A C     1 
ATOM   2572 O O     . ASN B 2 225 ? 15.404 -11.717 -26.205 1.00 33.13  ? 225  ASN A O     1 
ATOM   2573 C CB    . ASN B 2 225 ? 14.905 -13.747 -24.177 1.00 32.72  ? 225  ASN A CB    1 
ATOM   2574 C CG    . ASN B 2 225 ? 15.053 -12.726 -23.046 1.00 33.63  ? 225  ASN A CG    1 
ATOM   2575 O OD1   . ASN B 2 225 ? 14.408 -11.663 -23.048 1.00 31.17  ? 225  ASN A OD1   1 
ATOM   2576 N ND2   . ASN B 2 225 ? 15.910 -13.044 -22.074 1.00 32.20  ? 225  ASN A ND2   1 
ATOM   2577 N N     . VAL B 2 226 ? 13.353 -10.979 -25.691 1.00 32.99  ? 226  VAL A N     1 
ATOM   2578 C CA    . VAL B 2 226 ? 13.637 -9.638  -26.183 1.00 32.70  ? 226  VAL A CA    1 
ATOM   2579 C C     . VAL B 2 226 ? 14.701 -8.938  -25.337 1.00 32.93  ? 226  VAL A C     1 
ATOM   2580 O O     . VAL B 2 226 ? 15.466 -8.125  -25.847 1.00 32.74  ? 226  VAL A O     1 
ATOM   2581 C CB    . VAL B 2 226 ? 12.335 -8.780  -26.231 1.00 31.41  ? 226  VAL A CB    1 
ATOM   2582 C CG1   . VAL B 2 226 ? 12.646 -7.332  -26.586 1.00 26.33  ? 226  VAL A CG1   1 
ATOM   2583 C CG2   . VAL B 2 226 ? 11.378 -9.371  -27.261 1.00 33.03  ? 226  VAL A CG2   1 
ATOM   2584 N N     . ALA B 2 227 ? 14.751 -9.264  -24.050 1.00 32.87  ? 227  ALA A N     1 
ATOM   2585 C CA    . ALA B 2 227 ? 15.715 -8.652  -23.142 1.00 32.44  ? 227  ALA A CA    1 
ATOM   2586 C C     . ALA B 2 227 ? 16.959 -9.524  -23.026 1.00 32.18  ? 227  ALA A C     1 
ATOM   2587 O O     . ALA B 2 227 ? 17.730 -9.409  -22.073 1.00 31.01  ? 227  ALA A O     1 
ATOM   2588 C CB    . ALA B 2 227 ? 15.085 -8.466  -21.772 1.00 32.33  ? 227  ALA A CB    1 
ATOM   2589 N N     . ALA B 2 228 ? 17.151 -10.387 -24.014 1.00 30.73  ? 228  ALA A N     1 
ATOM   2590 C CA    . ALA B 2 228 ? 18.274 -11.302 -24.022 1.00 30.37  ? 228  ALA A CA    1 
ATOM   2591 C C     . ALA B 2 228 ? 19.620 -10.646 -23.714 1.00 31.38  ? 228  ALA A C     1 
ATOM   2592 O O     . ALA B 2 228 ? 20.394 -11.176 -22.923 1.00 31.09  ? 228  ALA A O     1 
ATOM   2593 C CB    . ALA B 2 228 ? 18.333 -12.027 -25.359 1.00 29.79  ? 228  ALA A CB    1 
ATOM   2594 N N     . ASN B 2 229 ? 19.897 -9.489  -24.308 1.00 32.29  ? 229  ASN A N     1 
ATOM   2595 C CA    . ASN B 2 229 ? 21.182 -8.851  -24.072 1.00 34.14  ? 229  ASN A CA    1 
ATOM   2596 C C     . ASN B 2 229 ? 21.248 -7.761  -22.994 1.00 35.11  ? 229  ASN A C     1 
ATOM   2597 O O     . ASN B 2 229 ? 22.196 -6.975  -22.956 1.00 36.16  ? 229  ASN A O     1 
ATOM   2598 C CB    . ASN B 2 229 ? 21.758 -8.324  -25.393 1.00 35.21  ? 229  ASN A CB    1 
ATOM   2599 C CG    . ASN B 2 229 ? 23.285 -8.289  -25.385 1.00 37.12  ? 229  ASN A CG    1 
ATOM   2600 O OD1   . ASN B 2 229 ? 23.932 -9.226  -24.905 1.00 37.61  ? 229  ASN A OD1   1 
ATOM   2601 N ND2   . ASN B 2 229 ? 23.863 -7.219  -25.920 1.00 38.14  ? 229  ASN A ND2   1 
ATOM   2602 N N     . LEU B 2 230 ? 20.250 -7.714  -22.118 1.00 34.44  ? 230  LEU A N     1 
ATOM   2603 C CA    . LEU B 2 230 ? 20.253 -6.754  -21.022 1.00 33.08  ? 230  LEU A CA    1 
ATOM   2604 C C     . LEU B 2 230 ? 21.086 -7.446  -19.958 1.00 32.50  ? 230  LEU A C     1 
ATOM   2605 O O     . LEU B 2 230 ? 20.717 -8.519  -19.499 1.00 31.07  ? 230  LEU A O     1 
ATOM   2606 C CB    . LEU B 2 230 ? 18.837 -6.522  -20.492 1.00 33.28  ? 230  LEU A CB    1 
ATOM   2607 C CG    . LEU B 2 230 ? 18.725 -5.810  -19.137 1.00 32.07  ? 230  LEU A CG    1 
ATOM   2608 C CD1   . LEU B 2 230 ? 19.171 -4.338  -19.254 1.00 31.23  ? 230  LEU A CD1   1 
ATOM   2609 C CD2   . LEU B 2 230 ? 17.284 -5.916  -18.644 1.00 30.83  ? 230  LEU A CD2   1 
ATOM   2610 N N     . SER B 2 231 ? 22.210 -6.852  -19.574 1.00 33.46  ? 231  SER A N     1 
ATOM   2611 C CA    . SER B 2 231 ? 23.073 -7.486  -18.580 1.00 34.47  ? 231  SER A CA    1 
ATOM   2612 C C     . SER B 2 231 ? 22.424 -7.579  -17.203 1.00 35.09  ? 231  SER A C     1 
ATOM   2613 O O     . SER B 2 231 ? 21.541 -6.792  -16.852 1.00 33.39  ? 231  SER A O     1 
ATOM   2614 C CB    . SER B 2 231 ? 24.393 -6.730  -18.446 1.00 33.29  ? 231  SER A CB    1 
ATOM   2615 O OG    . SER B 2 231 ? 24.249 -5.629  -17.564 1.00 33.92  ? 231  SER A OG    1 
ATOM   2616 N N     . LEU B 2 232 ? 22.880 -8.549  -16.422 1.00 35.51  ? 232  LEU A N     1 
ATOM   2617 C CA    . LEU B 2 232 ? 22.353 -8.733  -15.086 1.00 35.41  ? 232  LEU A CA    1 
ATOM   2618 C C     . LEU B 2 232 ? 22.504 -7.445  -14.273 1.00 35.15  ? 232  LEU A C     1 
ATOM   2619 O O     . LEU B 2 232 ? 21.556 -6.964  -13.660 1.00 36.15  ? 232  LEU A O     1 
ATOM   2620 C CB    . LEU B 2 232 ? 23.077 -9.897  -14.397 1.00 34.08  ? 232  LEU A CB    1 
ATOM   2621 C CG    . LEU B 2 232 ? 22.919 -9.943  -12.875 1.00 35.02  ? 232  LEU A CG    1 
ATOM   2622 C CD1   . LEU B 2 232 ? 21.439 -10.011 -12.510 1.00 35.86  ? 232  LEU A CD1   1 
ATOM   2623 C CD2   . LEU B 2 232 ? 23.684 -11.116 -12.299 1.00 33.75  ? 232  LEU A CD2   1 
ATOM   2624 N N     . ASP B 2 233 ? 23.696 -6.869  -14.280 1.00 35.42  ? 233  ASP A N     1 
ATOM   2625 C CA    . ASP B 2 233 ? 23.916 -5.649  -13.518 1.00 34.72  ? 233  ASP A CA    1 
ATOM   2626 C C     . ASP B 2 233 ? 23.127 -4.460  -14.028 1.00 34.13  ? 233  ASP A C     1 
ATOM   2627 O O     . ASP B 2 233 ? 22.750 -3.595  -13.246 1.00 33.34  ? 233  ASP A O     1 
ATOM   2628 C CB    . ASP B 2 233 ? 25.407 -5.316  -13.460 1.00 34.17  ? 233  ASP A CB    1 
ATOM   2629 C CG    . ASP B 2 233 ? 26.177 -6.307  -12.617 1.00 36.16  ? 233  ASP A CG    1 
ATOM   2630 O OD1   . ASP B 2 233 ? 25.551 -6.895  -11.707 1.00 35.88  ? 233  ASP A OD1   1 
ATOM   2631 O OD2   . ASP B 2 233 ? 27.392 -6.493  -12.848 1.00 35.63  ? 233  ASP A OD2   1 
ATOM   2632 N N     . ASN B 2 234 ? 22.874 -4.414  -15.332 1.00 33.88  ? 234  ASN A N     1 
ATOM   2633 C CA    . ASN B 2 234 ? 22.109 -3.311  -15.895 1.00 35.03  ? 234  ASN A CA    1 
ATOM   2634 C C     . ASN B 2 234 ? 20.648 -3.462  -15.502 1.00 34.62  ? 234  ASN A C     1 
ATOM   2635 O O     . ASN B 2 234 ? 19.931 -2.475  -15.327 1.00 34.93  ? 234  ASN A O     1 
ATOM   2636 C CB    . ASN B 2 234 ? 22.271 -3.267  -17.415 1.00 36.66  ? 234  ASN A CB    1 
ATOM   2637 C CG    . ASN B 2 234 ? 23.497 -2.476  -17.847 1.00 37.65  ? 234  ASN A CG    1 
ATOM   2638 O OD1   . ASN B 2 234 ? 23.926 -2.550  -19.003 1.00 38.23  ? 234  ASN A OD1   1 
ATOM   2639 N ND2   . ASN B 2 234 ? 24.062 -1.702  -16.919 1.00 37.18  ? 234  ASN A ND2   1 
ATOM   2640 N N     . LEU B 2 235 ? 20.210 -4.706  -15.358 1.00 33.82  ? 235  LEU A N     1 
ATOM   2641 C CA    . LEU B 2 235 ? 18.849 -4.969  -14.931 1.00 33.16  ? 235  LEU A CA    1 
ATOM   2642 C C     . LEU B 2 235 ? 18.745 -4.407  -13.524 1.00 33.39  ? 235  LEU A C     1 
ATOM   2643 O O     . LEU B 2 235 ? 17.815 -3.667  -13.200 1.00 34.23  ? 235  LEU A O     1 
ATOM   2644 C CB    . LEU B 2 235 ? 18.567 -6.473  -14.891 1.00 31.24  ? 235  LEU A CB    1 
ATOM   2645 C CG    . LEU B 2 235 ? 17.289 -6.861  -14.136 1.00 30.41  ? 235  LEU A CG    1 
ATOM   2646 C CD1   . LEU B 2 235 ? 16.061 -6.290  -14.851 1.00 28.30  ? 235  LEU A CD1   1 
ATOM   2647 C CD2   . LEU B 2 235 ? 17.198 -8.386  -14.026 1.00 28.36  ? 235  LEU A CD2   1 
ATOM   2648 N N     . ALA B 2 236 ? 19.723 -4.757  -12.695 1.00 32.97  ? 236  ALA A N     1 
ATOM   2649 C CA    . ALA B 2 236 ? 19.748 -4.294  -11.311 1.00 33.48  ? 236  ALA A CA    1 
ATOM   2650 C C     . ALA B 2 236 ? 19.752 -2.776  -11.220 1.00 33.60  ? 236  ALA A C     1 
ATOM   2651 O O     . ALA B 2 236 ? 18.997 -2.195  -10.446 1.00 34.09  ? 236  ALA A O     1 
ATOM   2652 C CB    . ALA B 2 236 ? 20.966 -4.867  -10.578 1.00 33.69  ? 236  ALA A CB    1 
ATOM   2653 N N     . ARG B 2 237 ? 20.601 -2.126  -12.004 1.00 34.89  ? 237  ARG A N     1 
ATOM   2654 C CA    . ARG B 2 237 ? 20.662 -0.676  -11.955 1.00 36.12  ? 237  ARG A CA    1 
ATOM   2655 C C     . ARG B 2 237 ? 19.305 -0.070  -12.259 1.00 36.22  ? 237  ARG A C     1 
ATOM   2656 O O     . ARG B 2 237 ? 18.907 0.911   -11.639 1.00 36.82  ? 237  ARG A O     1 
ATOM   2657 C CB    . ARG B 2 237 ? 21.711 -0.151  -12.932 1.00 38.43  ? 237  ARG A CB    1 
ATOM   2658 C CG    . ARG B 2 237 ? 23.081 -0.701  -12.643 1.00 40.31  ? 237  ARG A CG    1 
ATOM   2659 C CD    . ARG B 2 237 ? 24.191 0.074   -13.321 1.00 42.37  ? 237  ARG A CD    1 
ATOM   2660 N NE    . ARG B 2 237 ? 25.482 -0.406  -12.835 1.00 44.46  ? 237  ARG A NE    1 
ATOM   2661 C CZ    . ARG B 2 237 ? 26.194 -1.385  -13.389 1.00 43.62  ? 237  ARG A CZ    1 
ATOM   2662 N NH1   . ARG B 2 237 ? 25.762 -2.006  -14.486 1.00 41.85  ? 237  ARG A NH1   1 
ATOM   2663 N NH2   . ARG B 2 237 ? 27.330 -1.765  -12.812 1.00 42.87  ? 237  ARG A NH2   1 
ATOM   2664 N N     . PHE B 2 238 ? 18.587 -0.664  -13.204 1.00 36.68  ? 238  PHE A N     1 
ATOM   2665 C CA    . PHE B 2 238 ? 17.268 -0.161  -13.567 1.00 36.24  ? 238  PHE A CA    1 
ATOM   2666 C C     . PHE B 2 238 ? 16.297 -0.288  -12.405 1.00 36.01  ? 238  PHE A C     1 
ATOM   2667 O O     . PHE B 2 238 ? 15.594 0.664   -12.061 1.00 35.92  ? 238  PHE A O     1 
ATOM   2668 C CB    . PHE B 2 238 ? 16.703 -0.926  -14.765 1.00 36.09  ? 238  PHE A CB    1 
ATOM   2669 C CG    . PHE B 2 238 ? 15.374 -0.416  -15.225 1.00 35.28  ? 238  PHE A CG    1 
ATOM   2670 C CD1   . PHE B 2 238 ? 15.251 0.874   -15.730 1.00 35.16  ? 238  PHE A CD1   1 
ATOM   2671 C CD2   . PHE B 2 238 ? 14.238 -1.214  -15.138 1.00 34.96  ? 238  PHE A CD2   1 
ATOM   2672 C CE1   . PHE B 2 238 ? 14.010 1.367   -16.145 1.00 35.79  ? 238  PHE A CE1   1 
ATOM   2673 C CE2   . PHE B 2 238 ? 12.991 -0.733  -15.551 1.00 35.82  ? 238  PHE A CE2   1 
ATOM   2674 C CZ    . PHE B 2 238 ? 12.877 0.560   -16.056 1.00 35.21  ? 238  PHE A CZ    1 
ATOM   2675 N N     . VAL B 2 239 ? 16.256 -1.475  -11.812 1.00 34.42  ? 239  VAL A N     1 
ATOM   2676 C CA    . VAL B 2 239 ? 15.366 -1.729  -10.700 1.00 34.94  ? 239  VAL A CA    1 
ATOM   2677 C C     . VAL B 2 239 ? 15.628 -0.743  -9.576  1.00 35.68  ? 239  VAL A C     1 
ATOM   2678 O O     . VAL B 2 239 ? 14.692 -0.184  -8.981  1.00 35.54  ? 239  VAL A O     1 
ATOM   2679 C CB    . VAL B 2 239 ? 15.553 -3.153  -10.177 1.00 36.24  ? 239  VAL A CB    1 
ATOM   2680 C CG1   . VAL B 2 239 ? 14.737 -3.353  -8.910  1.00 35.60  ? 239  VAL A CG1   1 
ATOM   2681 C CG2   . VAL B 2 239 ? 15.128 -4.149  -11.252 1.00 37.22  ? 239  VAL A CG2   1 
ATOM   2682 N N     . HIS B 2 240 ? 16.907 -0.529  -9.286  1.00 35.26  ? 240  HIS A N     1 
ATOM   2683 C CA    . HIS B 2 240 ? 17.285 0.390   -8.230  1.00 35.13  ? 240  HIS A CA    1 
ATOM   2684 C C     . HIS B 2 240 ? 16.868 1.801   -8.625  1.00 35.04  ? 240  HIS A C     1 
ATOM   2685 O O     . HIS B 2 240 ? 16.323 2.550   -7.816  1.00 34.06  ? 240  HIS A O     1 
ATOM   2686 C CB    . HIS B 2 240 ? 18.799 0.324   -7.987  1.00 36.03  ? 240  HIS A CB    1 
ATOM   2687 C CG    . HIS B 2 240 ? 19.244 1.055   -6.756  1.00 38.16  ? 240  HIS A CG    1 
ATOM   2688 N ND1   . HIS B 2 240 ? 19.831 2.302   -6.798  1.00 36.87  ? 240  HIS A ND1   1 
ATOM   2689 C CD2   . HIS B 2 240 ? 19.144 0.728   -5.444  1.00 36.12  ? 240  HIS A CD2   1 
ATOM   2690 C CE1   . HIS B 2 240 ? 20.072 2.713   -5.566  1.00 37.69  ? 240  HIS A CE1   1 
ATOM   2691 N NE2   . HIS B 2 240 ? 19.665 1.777   -4.726  1.00 36.67  ? 240  HIS A NE2   1 
ATOM   2692 N N     . LEU B 2 241 ? 17.119 2.156   -9.879  1.00 35.90  ? 241  LEU A N     1 
ATOM   2693 C CA    . LEU B 2 241 ? 16.761 3.479   -10.370 1.00 36.80  ? 241  LEU A CA    1 
ATOM   2694 C C     . LEU B 2 241 ? 15.271 3.771   -10.233 1.00 37.03  ? 241  LEU A C     1 
ATOM   2695 O O     . LEU B 2 241 ? 14.879 4.902   -9.942  1.00 37.68  ? 241  LEU A O     1 
ATOM   2696 C CB    . LEU B 2 241 ? 17.176 3.639   -11.839 1.00 36.73  ? 241  LEU A CB    1 
ATOM   2697 C CG    . LEU B 2 241 ? 18.617 4.073   -12.114 1.00 37.37  ? 241  LEU A CG    1 
ATOM   2698 C CD1   . LEU B 2 241 ? 18.890 3.963   -13.595 1.00 38.12  ? 241  LEU A CD1   1 
ATOM   2699 C CD2   . LEU B 2 241 ? 18.841 5.500   -11.643 1.00 36.28  ? 241  LEU A CD2   1 
ATOM   2700 N N     . CYS B 2 242 ? 14.436 2.762   -10.456 1.00 37.65  ? 242  CYS A N     1 
ATOM   2701 C CA    . CYS B 2 242 ? 13.000 2.970   -10.359 1.00 38.01  ? 242  CYS A CA    1 
ATOM   2702 C C     . CYS B 2 242 ? 12.618 3.207   -8.911  1.00 39.11  ? 242  CYS A C     1 
ATOM   2703 O O     . CYS B 2 242 ? 11.848 4.115   -8.615  1.00 39.68  ? 242  CYS A O     1 
ATOM   2704 C CB    . CYS B 2 242 ? 12.236 1.776   -10.934 1.00 38.13  ? 242  CYS A CB    1 
ATOM   2705 S SG    . CYS B 2 242 ? 12.391 1.577   -12.741 1.00 37.44  ? 242  CYS A SG    1 
ATOM   2706 N N     . ARG B 2 243 ? 13.167 2.414   -7.998  1.00 39.34  ? 243  ARG A N     1 
ATOM   2707 C CA    . ARG B 2 243 ? 12.854 2.607   -6.585  1.00 39.90  ? 243  ARG A CA    1 
ATOM   2708 C C     . ARG B 2 243 ? 13.187 4.041   -6.183  1.00 41.33  ? 243  ARG A C     1 
ATOM   2709 O O     . ARG B 2 243 ? 12.373 4.725   -5.560  1.00 42.21  ? 243  ARG A O     1 
ATOM   2710 C CB    . ARG B 2 243 ? 13.648 1.633   -5.711  1.00 37.46  ? 243  ARG A CB    1 
ATOM   2711 C CG    . ARG B 2 243 ? 13.240 0.184   -5.896  1.00 36.36  ? 243  ARG A CG    1 
ATOM   2712 C CD    . ARG B 2 243 ? 14.224 -0.788  -5.247  1.00 35.65  ? 243  ARG A CD    1 
ATOM   2713 N NE    . ARG B 2 243 ? 13.755 -2.158  -5.427  1.00 36.94  ? 243  ARG A NE    1 
ATOM   2714 C CZ    . ARG B 2 243 ? 14.465 -3.255  -5.183  1.00 36.19  ? 243  ARG A CZ    1 
ATOM   2715 N NH1   . ARG B 2 243 ? 15.711 -3.176  -4.737  1.00 35.32  ? 243  ARG A NH1   1 
ATOM   2716 N NH2   . ARG B 2 243 ? 13.917 -4.441  -5.398  1.00 36.53  ? 243  ARG A NH2   1 
ATOM   2717 N N     . GLU B 2 244 ? 14.385 4.490   -6.555  1.00 41.60  ? 244  GLU A N     1 
ATOM   2718 C CA    . GLU B 2 244 ? 14.828 5.834   -6.227  1.00 41.51  ? 244  GLU A CA    1 
ATOM   2719 C C     . GLU B 2 244 ? 13.960 6.917   -6.846  1.00 41.99  ? 244  GLU A C     1 
ATOM   2720 O O     . GLU B 2 244 ? 13.694 7.948   -6.225  1.00 42.67  ? 244  GLU A O     1 
ATOM   2721 C CB    . GLU B 2 244 ? 16.267 6.041   -6.676  1.00 42.05  ? 244  GLU A CB    1 
ATOM   2722 C CG    . GLU B 2 244 ? 17.297 5.327   -5.833  1.00 44.66  ? 244  GLU A CG    1 
ATOM   2723 C CD    . GLU B 2 244 ? 18.710 5.658   -6.273  1.00 48.26  ? 244  GLU A CD    1 
ATOM   2724 O OE1   . GLU B 2 244 ? 19.005 5.497   -7.482  1.00 48.82  ? 244  GLU A OE1   1 
ATOM   2725 O OE2   . GLU B 2 244 ? 19.520 6.078   -5.414  1.00 49.15  ? 244  GLU A OE2   1 
ATOM   2726 N N     . PHE B 2 245 ? 13.517 6.695   -8.073  1.00 41.70  ? 245  PHE A N     1 
ATOM   2727 C CA    . PHE B 2 245 ? 12.705 7.696   -8.729  1.00 41.59  ? 245  PHE A CA    1 
ATOM   2728 C C     . PHE B 2 245 ? 11.362 7.873   -8.043  1.00 42.45  ? 245  PHE A C     1 
ATOM   2729 O O     . PHE B 2 245 ? 10.895 8.990   -7.845  1.00 41.69  ? 245  PHE A O     1 
ATOM   2730 C CB    . PHE B 2 245 ? 12.474 7.328   -10.186 1.00 40.23  ? 245  PHE A CB    1 
ATOM   2731 C CG    . PHE B 2 245 ? 11.631 8.327   -10.918 1.00 40.36  ? 245  PHE A CG    1 
ATOM   2732 C CD1   . PHE B 2 245 ? 12.163 9.557   -11.304 1.00 39.87  ? 245  PHE A CD1   1 
ATOM   2733 C CD2   . PHE B 2 245 ? 10.294 8.062   -11.183 1.00 37.47  ? 245  PHE A CD2   1 
ATOM   2734 C CE1   . PHE B 2 245 ? 11.368 10.509  -11.944 1.00 38.51  ? 245  PHE A CE1   1 
ATOM   2735 C CE2   . PHE B 2 245 ? 9.492  9.008   -11.821 1.00 38.18  ? 245  PHE A CE2   1 
ATOM   2736 C CZ    . PHE B 2 245 ? 10.032 10.232  -12.202 1.00 37.79  ? 245  PHE A CZ    1 
ATOM   2737 N N     . MET B 2 246 ? 10.735 6.762   -7.689  1.00 44.57  ? 246  MET A N     1 
ATOM   2738 C CA    . MET B 2 246 ? 9.438  6.815   -7.040  1.00 46.91  ? 246  MET A CA    1 
ATOM   2739 C C     . MET B 2 246 ? 9.539  7.360   -5.629  1.00 49.21  ? 246  MET A C     1 
ATOM   2740 O O     . MET B 2 246 ? 8.564  7.876   -5.082  1.00 51.07  ? 246  MET A O     1 
ATOM   2741 C CB    . MET B 2 246 ? 8.816  5.427   -7.019  1.00 47.49  ? 246  MET A CB    1 
ATOM   2742 C CG    . MET B 2 246 ? 8.349  4.954   -8.378  1.00 49.04  ? 246  MET A CG    1 
ATOM   2743 S SD    . MET B 2 246 ? 6.908  5.876   -8.930  1.00 52.98  ? 246  MET A SD    1 
ATOM   2744 C CE    . MET B 2 246 ? 7.625  7.082   -9.919  1.00 52.25  ? 246  MET A CE    1 
ATOM   2745 N N     . GLU B 2 247 ? 10.722 7.260   -5.039  1.00 50.81  ? 247  GLU A N     1 
ATOM   2746 C CA    . GLU B 2 247 ? 10.925 7.742   -3.682  1.00 51.61  ? 247  GLU A CA    1 
ATOM   2747 C C     . GLU B 2 247 ? 11.277 9.235   -3.653  1.00 51.70  ? 247  GLU A C     1 
ATOM   2748 O O     . GLU B 2 247 ? 11.214 9.884   -2.606  1.00 51.93  ? 247  GLU A O     1 
ATOM   2749 C CB    . GLU B 2 247 ? 12.021 6.912   -3.011  1.00 53.21  ? 247  GLU A CB    1 
ATOM   2750 C CG    . GLU B 2 247 ? 12.176 7.159   -1.525  1.00 57.97  ? 247  GLU A CG    1 
ATOM   2751 C CD    . GLU B 2 247 ? 12.954 6.058   -0.827  1.00 62.09  ? 247  GLU A CD    1 
ATOM   2752 O OE1   . GLU B 2 247 ? 13.282 6.228   0.366   1.00 64.97  ? 247  GLU A OE1   1 
ATOM   2753 O OE2   . GLU B 2 247 ? 13.234 5.017   -1.462  1.00 63.99  ? 247  GLU A OE2   1 
ATOM   2754 N N     . ALA B 2 248 ? 11.629 9.784   -4.812  1.00 50.50  ? 248  ALA A N     1 
ATOM   2755 C CA    . ALA B 2 248 ? 11.999 11.187  -4.893  1.00 49.01  ? 248  ALA A CA    1 
ATOM   2756 C C     . ALA B 2 248 ? 12.078 11.639  -6.351  1.00 48.85  ? 248  ALA A C     1 
ATOM   2757 O O     . ALA B 2 248 ? 13.156 11.938  -6.862  1.00 49.30  ? 248  ALA A O     1 
ATOM   2758 C CB    . ALA B 2 248 ? 13.342 11.399  -4.198  1.00 46.49  ? 248  ALA A CB    1 
ATOM   2759 N N     . PRO B 2 249 ? 10.928 11.709  -7.035  1.00 48.90  ? 249  PRO A N     1 
ATOM   2760 C CA    . PRO B 2 249 ? 10.887 12.125  -8.440  1.00 49.24  ? 249  PRO A CA    1 
ATOM   2761 C C     . PRO B 2 249 ? 11.711 13.386  -8.692  1.00 49.74  ? 249  PRO A C     1 
ATOM   2762 O O     . PRO B 2 249 ? 11.684 14.326  -7.900  1.00 50.11  ? 249  PRO A O     1 
ATOM   2763 C CB    . PRO B 2 249 ? 9.396  12.350  -8.693  1.00 49.51  ? 249  PRO A CB    1 
ATOM   2764 C CG    . PRO B 2 249 ? 8.745  11.404  -7.756  1.00 49.02  ? 249  PRO A CG    1 
ATOM   2765 C CD    . PRO B 2 249 ? 9.565  11.560  -6.498  1.00 48.57  ? 249  PRO A CD    1 
ATOM   2766 N N     . SER B 2 250 ? 12.436 13.399  -9.804  1.00 49.03  ? 250  SER A N     1 
ATOM   2767 C CA    . SER B 2 250 ? 13.272 14.533  -10.161 1.00 48.09  ? 250  SER A CA    1 
ATOM   2768 C C     . SER B 2 250 ? 13.548 14.546  -11.661 1.00 47.85  ? 250  SER A C     1 
ATOM   2769 O O     . SER B 2 250 ? 13.774 13.506  -12.274 1.00 47.17  ? 250  SER A O     1 
ATOM   2770 C CB    . SER B 2 250 ? 14.589 14.461  -9.394  1.00 47.99  ? 250  SER A CB    1 
ATOM   2771 O OG    . SER B 2 250 ? 15.550 15.331  -9.956  1.00 50.96  ? 250  SER A OG    1 
ATOM   2772 N N     . LEU B 2 251 ? 13.529 15.732  -12.252 1.00 47.72  ? 251  LEU A N     1 
ATOM   2773 C CA    . LEU B 2 251 ? 13.782 15.858  -13.674 1.00 47.75  ? 251  LEU A CA    1 
ATOM   2774 C C     . LEU B 2 251 ? 15.209 15.416  -13.970 1.00 48.37  ? 251  LEU A C     1 
ATOM   2775 O O     . LEU B 2 251 ? 15.579 15.213  -15.126 1.00 48.21  ? 251  LEU A O     1 
ATOM   2776 C CB    . LEU B 2 251 ? 13.581 17.308  -14.111 1.00 47.85  ? 251  LEU A CB    1 
ATOM   2777 C CG    . LEU B 2 251 ? 13.671 17.601  -15.608 1.00 47.45  ? 251  LEU A CG    1 
ATOM   2778 C CD1   . LEU B 2 251 ? 12.663 16.740  -16.365 1.00 46.85  ? 251  LEU A CD1   1 
ATOM   2779 C CD2   . LEU B 2 251 ? 13.407 19.081  -15.844 1.00 46.60  ? 251  LEU A CD2   1 
ATOM   2780 N N     . GLY B 2 252 ? 16.002 15.265  -12.913 1.00 48.67  ? 252  GLY A N     1 
ATOM   2781 C CA    . GLY B 2 252 ? 17.386 14.855  -13.070 1.00 49.49  ? 252  GLY A CA    1 
ATOM   2782 C C     . GLY B 2 252 ? 17.546 13.493  -13.718 1.00 50.56  ? 252  GLY A C     1 
ATOM   2783 O O     . GLY B 2 252 ? 18.509 13.249  -14.450 1.00 51.32  ? 252  GLY A O     1 
ATOM   2784 N N     . PHE B 2 253 ? 16.599 12.602  -13.447 1.00 49.37  ? 253  PHE A N     1 
ATOM   2785 C CA    . PHE B 2 253 ? 16.630 11.264  -14.007 1.00 48.28  ? 253  PHE A CA    1 
ATOM   2786 C C     . PHE B 2 253 ? 16.526 11.251  -15.529 1.00 48.47  ? 253  PHE A C     1 
ATOM   2787 O O     . PHE B 2 253 ? 16.700 10.206  -16.148 1.00 47.56  ? 253  PHE A O     1 
ATOM   2788 C CB    . PHE B 2 253 ? 15.502 10.416  -13.413 1.00 48.52  ? 253  PHE A CB    1 
ATOM   2789 C CG    . PHE B 2 253 ? 15.662 10.140  -11.945 1.00 47.92  ? 253  PHE A CG    1 
ATOM   2790 C CD1   . PHE B 2 253 ? 15.368 11.118  -10.998 1.00 48.00  ? 253  PHE A CD1   1 
ATOM   2791 C CD2   . PHE B 2 253 ? 16.120 8.905   -11.508 1.00 47.54  ? 253  PHE A CD2   1 
ATOM   2792 C CE1   . PHE B 2 253 ? 15.533 10.868  -9.638  1.00 46.58  ? 253  PHE A CE1   1 
ATOM   2793 C CE2   . PHE B 2 253 ? 16.289 8.647   -10.152 1.00 47.05  ? 253  PHE A CE2   1 
ATOM   2794 C CZ    . PHE B 2 253 ? 15.994 9.630   -9.215  1.00 46.27  ? 253  PHE A CZ    1 
ATOM   2795 N N     . PHE B 2 254 ? 16.241 12.398  -16.139 1.00 48.73  ? 254  PHE A N     1 
ATOM   2796 C CA    . PHE B 2 254 ? 16.132 12.438  -17.588 1.00 50.04  ? 254  PHE A CA    1 
ATOM   2797 C C     . PHE B 2 254 ? 17.209 13.292  -18.237 1.00 53.15  ? 254  PHE A C     1 
ATOM   2798 O O     . PHE B 2 254 ? 17.267 13.401  -19.464 1.00 54.04  ? 254  PHE A O     1 
ATOM   2799 C CB    . PHE B 2 254 ? 14.758 12.948  -18.020 1.00 47.37  ? 254  PHE A CB    1 
ATOM   2800 C CG    . PHE B 2 254 ? 13.612 12.115  -17.518 1.00 45.56  ? 254  PHE A CG    1 
ATOM   2801 C CD1   . PHE B 2 254 ? 13.131 12.276  -16.220 1.00 44.77  ? 254  PHE A CD1   1 
ATOM   2802 C CD2   . PHE B 2 254 ? 13.011 11.169  -18.342 1.00 44.49  ? 254  PHE A CD2   1 
ATOM   2803 C CE1   . PHE B 2 254 ? 12.069 11.512  -15.751 1.00 42.68  ? 254  PHE A CE1   1 
ATOM   2804 C CE2   . PHE B 2 254 ? 11.950 10.398  -17.880 1.00 43.84  ? 254  PHE A CE2   1 
ATOM   2805 C CZ    . PHE B 2 254 ? 11.477 10.572  -16.579 1.00 41.34  ? 254  PHE A CZ    1 
ATOM   2806 N N     . LYS B 2 255 ? 18.058 13.901  -17.420 1.00 56.03  ? 255  LYS A N     1 
ATOM   2807 C CA    . LYS B 2 255 ? 19.133 14.732  -17.943 1.00 58.73  ? 255  LYS A CA    1 
ATOM   2808 C C     . LYS B 2 255 ? 20.450 13.991  -17.829 1.00 61.20  ? 255  LYS A C     1 
ATOM   2809 O O     . LYS B 2 255 ? 20.837 13.570  -16.738 1.00 61.92  ? 255  LYS A O     1 
ATOM   2810 C CB    . LYS B 2 255 ? 19.214 16.048  -17.170 1.00 58.79  ? 255  LYS A CB    1 
ATOM   2811 C CG    . LYS B 2 255 ? 17.981 16.914  -17.325 1.00 60.45  ? 255  LYS A CG    1 
ATOM   2812 C CD    . LYS B 2 255 ? 18.173 18.288  -16.707 1.00 62.12  ? 255  LYS A CD    1 
ATOM   2813 C CE    . LYS B 2 255 ? 16.954 19.171  -16.960 1.00 62.72  ? 255  LYS A CE    1 
ATOM   2814 N NZ    . LYS B 2 255 ? 17.157 20.582  -16.524 1.00 63.71  ? 255  LYS A NZ    1 
ATOM   2815 N N     . PRO B 2 256 ? 21.150 13.803  -18.961 1.00 63.93  ? 256  PRO A N     1 
ATOM   2816 C CA    . PRO B 2 256 ? 22.436 13.102  -18.958 1.00 65.90  ? 256  PRO A CA    1 
ATOM   2817 C C     . PRO B 2 256 ? 23.320 13.737  -17.898 1.00 68.46  ? 256  PRO A C     1 
ATOM   2818 O O     . PRO B 2 256 ? 23.318 14.959  -17.732 1.00 68.07  ? 256  PRO A O     1 
ATOM   2819 C CB    . PRO B 2 256 ? 22.965 13.349  -20.366 1.00 65.04  ? 256  PRO A CB    1 
ATOM   2820 C CG    . PRO B 2 256 ? 21.722 13.427  -21.177 1.00 65.48  ? 256  PRO A CG    1 
ATOM   2821 C CD    . PRO B 2 256 ? 20.824 14.282  -20.314 1.00 65.06  ? 256  PRO A CD    1 
ATOM   2822 N N     . LYS B 2 257 ? 24.066 12.916  -17.172 1.00 70.97  ? 257  LYS A N     1 
ATOM   2823 C CA    . LYS B 2 257 ? 24.932 13.442  -16.126 1.00 74.44  ? 257  LYS A CA    1 
ATOM   2824 C C     . LYS B 2 257 ? 26.206 14.007  -16.752 1.00 76.59  ? 257  LYS A C     1 
ATOM   2825 O O     . LYS B 2 257 ? 26.723 13.460  -17.733 1.00 76.00  ? 257  LYS A O     1 
ATOM   2826 C CB    . LYS B 2 257 ? 24.978 12.466  -14.947 1.00 74.09  ? 257  LYS A CB    1 
ATOM   2827 C CG    . LYS B 2 257 ? 23.615 12.226  -14.293 1.00 75.32  ? 257  LYS A CG    1 
ATOM   2828 C CD    . LYS B 2 257 ? 22.811 11.144  -15.009 1.00 75.12  ? 257  LYS A CD    1 
ATOM   2829 C CE    . LYS B 2 257 ? 21.317 11.344  -14.812 1.00 75.50  ? 257  LYS A CE    1 
ATOM   2830 N NZ    . LYS B 2 257 ? 20.923 11.253  -13.380 1.00 76.00  ? 257  LYS A NZ    1 
ATOM   2831 N N     . HIS B 2 258 ? 26.692 15.113  -16.191 1.00 79.48  ? 258  HIS A N     1 
ATOM   2832 C CA    . HIS B 2 258 ? 27.907 15.757  -16.681 1.00 82.31  ? 258  HIS A CA    1 
ATOM   2833 C C     . HIS B 2 258 ? 29.105 14.848  -16.436 1.00 83.02  ? 258  HIS A C     1 
ATOM   2834 O O     . HIS B 2 258 ? 29.258 14.291  -15.347 1.00 82.56  ? 258  HIS A O     1 
ATOM   2835 C CB    . HIS B 2 258 ? 28.131 17.096  -15.970 1.00 84.07  ? 258  HIS A CB    1 
ATOM   2836 C CG    . HIS B 2 258 ? 27.162 18.165  -16.368 1.00 86.78  ? 258  HIS A CG    1 
ATOM   2837 N ND1   . HIS B 2 258 ? 27.141 19.410  -15.772 1.00 87.86  ? 258  HIS A ND1   1 
ATOM   2838 C CD2   . HIS B 2 258 ? 26.188 18.185  -17.308 1.00 87.37  ? 258  HIS A CD2   1 
ATOM   2839 C CE1   . HIS B 2 258 ? 26.197 20.146  -16.326 1.00 87.94  ? 258  HIS A CE1   1 
ATOM   2840 N NE2   . HIS B 2 258 ? 25.602 19.427  -17.263 1.00 87.90  ? 258  HIS A NE2   1 
ATOM   2841 N N     . PRO B 2 259 ? 29.973 14.687  -17.449 1.00 83.72  ? 259  PRO A N     1 
ATOM   2842 C CA    . PRO B 2 259 ? 31.166 13.839  -17.348 1.00 84.45  ? 259  PRO A CA    1 
ATOM   2843 C C     . PRO B 2 259 ? 31.932 14.033  -16.041 1.00 84.99  ? 259  PRO A C     1 
ATOM   2844 O O     . PRO B 2 259 ? 32.698 13.163  -15.624 1.00 84.73  ? 259  PRO A O     1 
ATOM   2845 C CB    . PRO B 2 259 ? 31.982 14.258  -18.567 1.00 84.00  ? 259  PRO A CB    1 
ATOM   2846 C CG    . PRO B 2 259 ? 30.915 14.540  -19.579 1.00 83.80  ? 259  PRO A CG    1 
ATOM   2847 C CD    . PRO B 2 259 ? 29.903 15.335  -18.772 1.00 83.68  ? 259  PRO A CD    1 
ATOM   2848 N N     . LEU B 2 260 ? 31.708 15.176  -15.400 1.00 85.44  ? 260  LEU A N     1 
ATOM   2849 C CA    . LEU B 2 260 ? 32.368 15.514  -14.145 1.00 86.02  ? 260  LEU A CA    1 
ATOM   2850 C C     . LEU B 2 260 ? 33.843 15.143  -14.186 1.00 85.95  ? 260  LEU A C     1 
ATOM   2851 O O     . LEU B 2 260 ? 34.295 14.236  -13.481 1.00 85.84  ? 260  LEU A O     1 
ATOM   2852 C CB    . LEU B 2 260 ? 31.494 15.130  -12.948 1.00 86.62  ? 260  LEU A CB    1 
ATOM   2853 C CG    . LEU B 2 260 ? 31.836 15.858  -11.642 1.00 87.52  ? 260  LEU A CG    1 
ATOM   2854 C CD1   . LEU B 2 260 ? 32.239 17.300  -11.942 1.00 86.64  ? 260  LEU A CD1   1 
ATOM   2855 C CD2   . LEU B 2 260 ? 30.640 15.817  -10.704 1.00 87.86  ? 260  LEU A CD2   1 
ATOM   2856 N N     . GLU B 2 261 ? 34.585 15.849  -15.032 1.00 85.48  ? 261  GLU A N     1 
ATOM   2857 C CA    . GLU B 2 261 ? 36.011 15.616  -15.183 1.00 84.64  ? 261  GLU A CA    1 
ATOM   2858 C C     . GLU B 2 261 ? 36.720 16.019  -13.900 1.00 82.98  ? 261  GLU A C     1 
ATOM   2859 O O     . GLU B 2 261 ? 36.333 16.983  -13.239 1.00 82.32  ? 261  GLU A O     1 
ATOM   2860 C CB    . GLU B 2 261 ? 36.533 16.400  -16.389 1.00 85.96  ? 261  GLU A CB    1 
ATOM   2861 C CG    . GLU B 2 261 ? 36.021 15.828  -17.711 1.00 86.42  ? 261  GLU A CG    1 
ATOM   2862 C CD    . GLU B 2 261 ? 35.862 16.870  -18.799 1.00 86.61  ? 261  GLU A CD    1 
ATOM   2863 O OE1   . GLU B 2 261 ? 36.875 17.474  -19.210 1.00 86.75  ? 261  GLU A OE1   1 
ATOM   2864 O OE2   . GLU B 2 261 ? 34.714 17.082  -19.245 1.00 86.42  ? 261  GLU A OE2   1 
ATOM   2865 N N     . ILE B 2 262 ? 37.750 15.257  -13.551 1.00 81.28  ? 262  ILE A N     1 
ATOM   2866 C CA    . ILE B 2 262 ? 38.505 15.491  -12.328 1.00 79.12  ? 262  ILE A CA    1 
ATOM   2867 C C     . ILE B 2 262 ? 39.957 15.825  -12.634 1.00 77.43  ? 262  ILE A C     1 
ATOM   2868 O O     . ILE B 2 262 ? 40.480 15.452  -13.685 1.00 77.26  ? 262  ILE A O     1 
ATOM   2869 C CB    . ILE B 2 262 ? 38.469 14.229  -11.430 1.00 78.83  ? 262  ILE A CB    1 
ATOM   2870 C CG1   . ILE B 2 262 ? 38.992 14.549  -10.028 1.00 78.50  ? 262  ILE A CG1   1 
ATOM   2871 C CG2   . ILE B 2 262 ? 39.308 13.122  -12.067 1.00 77.74  ? 262  ILE A CG2   1 
ATOM   2872 C CD1   . ILE B 2 262 ? 38.870 13.385  -9.058  1.00 78.19  ? 262  ILE A CD1   1 
ATOM   2873 N N     . GLU B 2 263 ? 40.606 16.531  -11.715 1.00 75.14  ? 263  GLU A N     1 
ATOM   2874 C CA    . GLU B 2 263 ? 42.002 16.875  -11.908 1.00 73.51  ? 263  GLU A CA    1 
ATOM   2875 C C     . GLU B 2 263 ? 42.853 15.676  -11.524 1.00 70.82  ? 263  GLU A C     1 
ATOM   2876 O O     . GLU B 2 263 ? 42.673 15.085  -10.455 1.00 70.44  ? 263  GLU A O     1 
ATOM   2877 C CB    . GLU B 2 263 ? 42.400 18.099  -11.067 1.00 75.26  ? 263  GLU A CB    1 
ATOM   2878 C CG    . GLU B 2 263 ? 42.144 17.995  -9.568  1.00 77.47  ? 263  GLU A CG    1 
ATOM   2879 C CD    . GLU B 2 263 ? 40.736 18.408  -9.177  1.00 78.84  ? 263  GLU A CD    1 
ATOM   2880 O OE1   . GLU B 2 263 ? 40.476 18.560  -7.964  1.00 79.49  ? 263  GLU A OE1   1 
ATOM   2881 O OE2   . GLU B 2 263 ? 39.890 18.581  -10.079 1.00 79.80  ? 263  GLU A OE2   1 
ATOM   2882 N N     . PRO B 2 264 ? 43.786 15.287  -12.403 1.00 67.92  ? 264  PRO A N     1 
ATOM   2883 C CA    . PRO B 2 264 ? 44.639 14.141  -12.098 1.00 65.99  ? 264  PRO A CA    1 
ATOM   2884 C C     . PRO B 2 264 ? 45.299 14.210  -10.728 1.00 64.40  ? 264  PRO A C     1 
ATOM   2885 O O     . PRO B 2 264 ? 45.422 13.195  -10.043 1.00 64.65  ? 264  PRO A O     1 
ATOM   2886 C CB    . PRO B 2 264 ? 45.647 14.137  -13.253 1.00 65.96  ? 264  PRO A CB    1 
ATOM   2887 C CG    . PRO B 2 264 ? 45.614 15.535  -13.778 1.00 65.70  ? 264  PRO A CG    1 
ATOM   2888 C CD    . PRO B 2 264 ? 44.158 15.883  -13.696 1.00 66.70  ? 264  PRO A CD    1 
ATOM   2889 N N     . GLU B 2 265 ? 45.710 15.403  -10.314 1.00 62.53  ? 265  GLU A N     1 
ATOM   2890 C CA    . GLU B 2 265 ? 46.360 15.538  -9.019  1.00 60.56  ? 265  GLU A CA    1 
ATOM   2891 C C     . GLU B 2 265 ? 45.495 14.981  -7.901  1.00 59.07  ? 265  GLU A C     1 
ATOM   2892 O O     . GLU B 2 265 ? 45.994 14.310  -6.996  1.00 58.64  ? 265  GLU A O     1 
ATOM   2893 C CB    . GLU B 2 265 ? 46.692 17.002  -8.722  1.00 61.44  ? 265  GLU A CB    1 
ATOM   2894 C CG    . GLU B 2 265 ? 47.375 17.193  -7.373  1.00 61.71  ? 265  GLU A CG    1 
ATOM   2895 C CD    . GLU B 2 265 ? 48.704 16.451  -7.269  1.00 62.65  ? 265  GLU A CD    1 
ATOM   2896 O OE1   . GLU B 2 265 ? 49.058 16.027  -6.149  1.00 61.70  ? 265  GLU A OE1   1 
ATOM   2897 O OE2   . GLU B 2 265 ? 49.401 16.300  -8.299  1.00 63.80  ? 265  GLU A OE2   1 
ATOM   2898 N N     . ARG B 2 266 ? 44.201 15.264  -7.959  1.00 58.11  ? 266  ARG A N     1 
ATOM   2899 C CA    . ARG B 2 266 ? 43.288 14.776  -6.935  1.00 58.34  ? 266  ARG A CA    1 
ATOM   2900 C C     . ARG B 2 266 ? 43.201 13.251  -7.014  1.00 57.60  ? 266  ARG A C     1 
ATOM   2901 O O     . ARG B 2 266 ? 43.152 12.566  -5.989  1.00 57.26  ? 266  ARG A O     1 
ATOM   2902 C CB    . ARG B 2 266 ? 42.028 15.645  -6.881  1.00 59.99  ? 266  ARG A CB    1 
ATOM   2903 C CG    . ARG B 2 266 ? 41.065 15.269  -5.764  1.00 62.04  ? 266  ARG A CG    1 
ATOM   2904 C CD    . ARG B 2 266 ? 39.619 15.501  -6.183  1.00 65.04  ? 266  ARG A CD    1 
ATOM   2905 N NE    . ARG B 2 266 ? 38.664 14.853  -5.284  1.00 67.60  ? 266  ARG A NE    1 
ATOM   2906 C CZ    . ARG B 2 266 ? 37.388 14.620  -5.586  1.00 67.83  ? 266  ARG A CZ    1 
ATOM   2907 N NH1   . ARG B 2 266 ? 36.903 14.969  -6.773  1.00 67.47  ? 266  ARG A NH1   1 
ATOM   2908 N NH2   . ARG B 2 266 ? 36.597 14.031  -4.705  1.00 67.94  ? 266  ARG A NH2   1 
ATOM   2909 N N     . LEU B 2 267 ? 43.191 12.724  -8.236  1.00 56.49  ? 267  LEU A N     1 
ATOM   2910 C CA    . LEU B 2 267 ? 43.116 11.285  -8.445  1.00 55.26  ? 267  LEU A CA    1 
ATOM   2911 C C     . LEU B 2 267 ? 44.338 10.595  -7.846  1.00 54.37  ? 267  LEU A C     1 
ATOM   2912 O O     . LEU B 2 267 ? 44.233 9.516   -7.266  1.00 54.93  ? 267  LEU A O     1 
ATOM   2913 C CB    . LEU B 2 267 ? 43.030 10.975  -9.938  1.00 55.91  ? 267  LEU A CB    1 
ATOM   2914 C CG    . LEU B 2 267 ? 42.772 9.512   -10.300 1.00 57.02  ? 267  LEU A CG    1 
ATOM   2915 C CD1   . LEU B 2 267 ? 41.417 9.084   -9.744  1.00 56.53  ? 267  LEU A CD1   1 
ATOM   2916 C CD2   . LEU B 2 267 ? 42.816 9.341   -11.816 1.00 57.02  ? 267  LEU A CD2   1 
ATOM   2917 N N     . ARG B 2 268 ? 45.497 11.224  -7.991  1.00 52.99  ? 268  ARG A N     1 
ATOM   2918 C CA    . ARG B 2 268 ? 46.736 10.675  -7.458  1.00 52.21  ? 268  ARG A CA    1 
ATOM   2919 C C     . ARG B 2 268 ? 46.607 10.525  -5.948  1.00 51.02  ? 268  ARG A C     1 
ATOM   2920 O O     . ARG B 2 268 ? 46.942 9.479   -5.389  1.00 50.84  ? 268  ARG A O     1 
ATOM   2921 C CB    . ARG B 2 268 ? 47.910 11.605  -7.780  1.00 54.55  ? 268  ARG A CB    1 
ATOM   2922 C CG    . ARG B 2 268 ? 49.273 11.094  -7.324  1.00 56.99  ? 268  ARG A CG    1 
ATOM   2923 C CD    . ARG B 2 268 ? 50.346 12.172  -7.462  1.00 61.05  ? 268  ARG A CD    1 
ATOM   2924 N NE    . ARG B 2 268 ? 50.160 13.280  -6.519  1.00 63.99  ? 268  ARG A NE    1 
ATOM   2925 C CZ    . ARG B 2 268 ? 50.396 13.201  -5.211  1.00 64.83  ? 268  ARG A CZ    1 
ATOM   2926 N NH1   . ARG B 2 268 ? 50.838 12.067  -4.679  1.00 64.65  ? 268  ARG A NH1   1 
ATOM   2927 N NH2   . ARG B 2 268 ? 50.180 14.252  -4.430  1.00 65.04  ? 268  ARG A NH2   1 
ATOM   2928 N N     . LYS B 2 269 ? 46.111 11.572  -5.296  1.00 48.77  ? 269  LYS A N     1 
ATOM   2929 C CA    . LYS B 2 269 ? 45.939 11.555  -3.845  1.00 47.49  ? 269  LYS A CA    1 
ATOM   2930 C C     . LYS B 2 269 ? 44.984 10.463  -3.371  1.00 45.12  ? 269  LYS A C     1 
ATOM   2931 O O     . LYS B 2 269 ? 45.251 9.779   -2.384  1.00 44.68  ? 269  LYS A O     1 
ATOM   2932 C CB    . LYS B 2 269 ? 45.428 12.907  -3.336  1.00 49.11  ? 269  LYS A CB    1 
ATOM   2933 C CG    . LYS B 2 269 ? 46.471 14.009  -3.293  1.00 52.80  ? 269  LYS A CG    1 
ATOM   2934 C CD    . LYS B 2 269 ? 46.023 15.119  -2.344  1.00 55.25  ? 269  LYS A CD    1 
ATOM   2935 C CE    . LYS B 2 269 ? 46.938 16.335  -2.403  1.00 55.91  ? 269  LYS A CE    1 
ATOM   2936 N NZ    . LYS B 2 269 ? 46.814 17.079  -3.688  1.00 55.48  ? 269  LYS A NZ    1 
ATOM   2937 N N     . ILE B 2 270 ? 43.863 10.319  -4.064  1.00 42.14  ? 270  ILE A N     1 
ATOM   2938 C CA    . ILE B 2 270 ? 42.878 9.315   -3.704  1.00 39.59  ? 270  ILE A CA    1 
ATOM   2939 C C     . ILE B 2 270 ? 43.474 7.917   -3.801  1.00 38.87  ? 270  ILE A C     1 
ATOM   2940 O O     . ILE B 2 270 ? 43.281 7.093   -2.914  1.00 38.66  ? 270  ILE A O     1 
ATOM   2941 C CB    . ILE B 2 270 ? 41.641 9.432   -4.605  1.00 38.77  ? 270  ILE A CB    1 
ATOM   2942 C CG1   . ILE B 2 270 ? 40.861 10.694  -4.231  1.00 36.82  ? 270  ILE A CG1   1 
ATOM   2943 C CG2   . ILE B 2 270 ? 40.772 8.197   -4.475  1.00 37.61  ? 270  ILE A CG2   1 
ATOM   2944 C CD1   . ILE B 2 270 ? 39.791 11.056  -5.227  1.00 37.09  ? 270  ILE A CD1   1 
ATOM   2945 N N     . VAL B 2 271 ? 44.217 7.658   -4.868  1.00 38.13  ? 271  VAL A N     1 
ATOM   2946 C CA    . VAL B 2 271 ? 44.836 6.351   -5.046  1.00 37.77  ? 271  VAL A CA    1 
ATOM   2947 C C     . VAL B 2 271 ? 45.878 6.136   -3.944  1.00 39.93  ? 271  VAL A C     1 
ATOM   2948 O O     . VAL B 2 271 ? 46.150 5.014   -3.525  1.00 39.64  ? 271  VAL A O     1 
ATOM   2949 C CB    . VAL B 2 271 ? 45.477 6.244   -6.461  1.00 34.17  ? 271  VAL A CB    1 
ATOM   2950 C CG1   . VAL B 2 271 ? 46.371 5.017   -6.566  1.00 27.90  ? 271  VAL A CG1   1 
ATOM   2951 C CG2   . VAL B 2 271 ? 44.359 6.174   -7.501  1.00 32.51  ? 271  VAL A CG2   1 
ATOM   2952 N N     . GLU B 2 272 ? 46.443 7.233   -3.466  1.00 42.12  ? 272  GLU A N     1 
ATOM   2953 C CA    . GLU B 2 272 ? 47.438 7.177   -2.409  1.00 44.22  ? 272  GLU A CA    1 
ATOM   2954 C C     . GLU B 2 272 ? 46.724 6.778   -1.118  1.00 44.01  ? 272  GLU A C     1 
ATOM   2955 O O     . GLU B 2 272 ? 47.199 5.920   -0.376  1.00 44.07  ? 272  GLU A O     1 
ATOM   2956 C CB    . GLU B 2 272 ? 48.092 8.547   -2.264  1.00 48.02  ? 272  GLU A CB    1 
ATOM   2957 C CG    . GLU B 2 272 ? 49.371 8.561   -1.465  1.00 54.59  ? 272  GLU A CG    1 
ATOM   2958 C CD    . GLU B 2 272 ? 50.017 9.931   -1.460  1.00 58.39  ? 272  GLU A CD    1 
ATOM   2959 O OE1   . GLU B 2 272 ? 50.324 10.446  -2.556  1.00 60.92  ? 272  GLU A OE1   1 
ATOM   2960 O OE2   . GLU B 2 272 ? 50.212 10.491  -0.360  1.00 60.46  ? 272  GLU A OE2   1 
ATOM   2961 N N     . GLU B 2 273 ? 45.577 7.412   -0.869  1.00 43.56  ? 273  GLU A N     1 
ATOM   2962 C CA    . GLU B 2 273 ? 44.746 7.153   0.306   1.00 43.34  ? 273  GLU A CA    1 
ATOM   2963 C C     . GLU B 2 273 ? 44.300 5.689   0.337   1.00 41.57  ? 273  GLU A C     1 
ATOM   2964 O O     . GLU B 2 273 ? 44.262 5.060   1.393   1.00 40.77  ? 273  GLU A O     1 
ATOM   2965 C CB    . GLU B 2 273 ? 43.489 8.031   0.276   1.00 47.36  ? 273  GLU A CB    1 
ATOM   2966 C CG    . GLU B 2 273 ? 43.717 9.531   0.423   1.00 54.57  ? 273  GLU A CG    1 
ATOM   2967 C CD    . GLU B 2 273 ? 42.441 10.344  0.173   1.00 58.29  ? 273  GLU A CD    1 
ATOM   2968 O OE1   . GLU B 2 273 ? 41.336 9.821   0.454   1.00 60.22  ? 273  GLU A OE1   1 
ATOM   2969 O OE2   . GLU B 2 273 ? 42.544 11.505  -0.292  1.00 57.84  ? 273  GLU A OE2   1 
ATOM   2970 N N     . ARG B 2 274 ? 43.951 5.159   -0.832  1.00 38.95  ? 274  ARG A N     1 
ATOM   2971 C CA    . ARG B 2 274 ? 43.497 3.779   -0.955  1.00 37.18  ? 274  ARG A CA    1 
ATOM   2972 C C     . ARG B 2 274 ? 44.629 2.788   -0.742  1.00 36.84  ? 274  ARG A C     1 
ATOM   2973 O O     . ARG B 2 274 ? 44.397 1.652   -0.322  1.00 37.63  ? 274  ARG A O     1 
ATOM   2974 C CB    . ARG B 2 274 ? 42.882 3.554   -2.330  1.00 35.94  ? 274  ARG A CB    1 
ATOM   2975 C CG    . ARG B 2 274 ? 41.769 4.516   -2.673  1.00 34.57  ? 274  ARG A CG    1 
ATOM   2976 C CD    . ARG B 2 274 ? 41.044 4.048   -3.911  1.00 35.34  ? 274  ARG A CD    1 
ATOM   2977 N NE    . ARG B 2 274 ? 39.625 3.954   -3.625  1.00 37.32  ? 274  ARG A NE    1 
ATOM   2978 C CZ    . ARG B 2 274 ? 38.828 2.986   -4.058  1.00 36.18  ? 274  ARG A CZ    1 
ATOM   2979 N NH1   . ARG B 2 274 ? 39.296 2.005   -4.818  1.00 33.77  ? 274  ARG A NH1   1 
ATOM   2980 N NH2   . ARG B 2 274 ? 37.557 3.001   -3.701  1.00 36.45  ? 274  ARG A NH2   1 
ATOM   2981 N N     . GLY B 2 275 ? 45.847 3.228   -1.051  1.00 35.03  ? 275  GLY A N     1 
ATOM   2982 C CA    . GLY B 2 275 ? 47.021 2.397   -0.882  1.00 33.74  ? 275  GLY A CA    1 
ATOM   2983 C C     . GLY B 2 275 ? 47.026 1.171   -1.763  1.00 33.64  ? 275  GLY A C     1 
ATOM   2984 O O     . GLY B 2 275 ? 47.719 0.197   -1.476  1.00 34.32  ? 275  GLY A O     1 
ATOM   2985 N N     . THR B 2 276 ? 46.273 1.224   -2.852  1.00 33.78  ? 276  THR A N     1 
ATOM   2986 C CA    . THR B 2 276 ? 46.181 0.092   -3.756  1.00 33.35  ? 276  THR A CA    1 
ATOM   2987 C C     . THR B 2 276 ? 47.109 0.232   -4.938  1.00 34.43  ? 276  THR A C     1 
ATOM   2988 O O     . THR B 2 276 ? 47.752 1.261   -5.122  1.00 36.61  ? 276  THR A O     1 
ATOM   2989 C CB    . THR B 2 276 ? 44.780 -0.045  -4.334  1.00 32.75  ? 276  THR A CB    1 
ATOM   2990 O OG1   . THR B 2 276 ? 44.495 1.112   -5.132  1.00 30.66  ? 276  THR A OG1   1 
ATOM   2991 C CG2   . THR B 2 276 ? 43.745 -0.191  -3.220  1.00 31.70  ? 276  THR A CG2   1 
ATOM   2992 N N     . ALA B 2 277 ? 47.166 -0.823  -5.743  1.00 33.22  ? 277  ALA A N     1 
ATOM   2993 C CA    . ALA B 2 277 ? 47.972 -0.825  -6.942  1.00 32.04  ? 277  ALA A CA    1 
ATOM   2994 C C     . ALA B 2 277 ? 46.994 -0.587  -8.073  1.00 32.74  ? 277  ALA A C     1 
ATOM   2995 O O     . ALA B 2 277 ? 46.083 -1.375  -8.282  1.00 31.76  ? 277  ALA A O     1 
ATOM   2996 C CB    . ALA B 2 277 ? 48.652 -2.158  -7.123  1.00 29.83  ? 277  ALA A CB    1 
ATOM   2997 N N     . VAL B 2 278 ? 47.164 0.522   -8.781  1.00 33.62  ? 278  VAL A N     1 
ATOM   2998 C CA    . VAL B 2 278 ? 46.296 0.845   -9.892  1.00 33.40  ? 278  VAL A CA    1 
ATOM   2999 C C     . VAL B 2 278 ? 47.184 0.928   -11.113 1.00 33.72  ? 278  VAL A C     1 
ATOM   3000 O O     . VAL B 2 278 ? 48.237 1.551   -11.080 1.00 35.98  ? 278  VAL A O     1 
ATOM   3001 C CB    . VAL B 2 278 ? 45.586 2.188   -9.682  1.00 33.48  ? 278  VAL A CB    1 
ATOM   3002 C CG1   . VAL B 2 278 ? 44.685 2.482   -10.863 1.00 34.09  ? 278  VAL A CG1   1 
ATOM   3003 C CG2   . VAL B 2 278 ? 44.776 2.149   -8.413  1.00 32.23  ? 278  VAL A CG2   1 
ATOM   3004 N N     . PHE B 2 279 ? 46.759 0.294   -12.192 1.00 33.46  ? 279  PHE A N     1 
ATOM   3005 C CA    . PHE B 2 279 ? 47.542 0.282   -13.410 1.00 32.20  ? 279  PHE A CA    1 
ATOM   3006 C C     . PHE B 2 279 ? 46.641 -0.099  -14.573 1.00 33.95  ? 279  PHE A C     1 
ATOM   3007 O O     . PHE B 2 279 ? 45.472 -0.430  -14.387 1.00 33.26  ? 279  PHE A O     1 
ATOM   3008 C CB    . PHE B 2 279 ? 48.667 -0.729  -13.273 1.00 31.77  ? 279  PHE A CB    1 
ATOM   3009 C CG    . PHE B 2 279 ? 48.190 -2.146  -13.055 1.00 32.42  ? 279  PHE A CG    1 
ATOM   3010 C CD1   . PHE B 2 279 ? 47.891 -2.972  -14.137 1.00 33.67  ? 279  PHE A CD1   1 
ATOM   3011 C CD2   . PHE B 2 279 ? 48.069 -2.662  -11.777 1.00 32.17  ? 279  PHE A CD2   1 
ATOM   3012 C CE1   . PHE B 2 279 ? 47.482 -4.294  -13.943 1.00 31.52  ? 279  PHE A CE1   1 
ATOM   3013 C CE2   . PHE B 2 279 ? 47.660 -3.977  -11.571 1.00 31.95  ? 279  PHE A CE2   1 
ATOM   3014 C CZ    . PHE B 2 279 ? 47.369 -4.797  -12.658 1.00 31.43  ? 279  PHE A CZ    1 
ATOM   3015 N N     . ALA B 2 280 ? 47.193 -0.073  -15.777 1.00 34.45  ? 280  ALA A N     1 
ATOM   3016 C CA    . ALA B 2 280 ? 46.406 -0.393  -16.945 1.00 33.77  ? 280  ALA A CA    1 
ATOM   3017 C C     . ALA B 2 280 ? 47.239 -1.015  -18.034 1.00 33.99  ? 280  ALA A C     1 
ATOM   3018 O O     . ALA B 2 280 ? 48.427 -0.742  -18.160 1.00 35.24  ? 280  ALA A O     1 
ATOM   3019 C CB    . ALA B 2 280 ? 45.732 0.869   -17.475 1.00 34.22  ? 280  ALA A CB    1 
ATOM   3020 N N     . VAL B 2 281 ? 46.598 -1.876  -18.805 1.00 33.15  ? 281  VAL A N     1 
ATOM   3021 C CA    . VAL B 2 281 ? 47.234 -2.521  -19.929 1.00 34.36  ? 281  VAL A CA    1 
ATOM   3022 C C     . VAL B 2 281 ? 46.778 -1.681  -21.118 1.00 36.69  ? 281  VAL A C     1 
ATOM   3023 O O     . VAL B 2 281 ? 45.575 -1.496  -21.339 1.00 37.44  ? 281  VAL A O     1 
ATOM   3024 C CB    . VAL B 2 281 ? 46.743 -3.972  -20.092 1.00 33.67  ? 281  VAL A CB    1 
ATOM   3025 C CG1   . VAL B 2 281 ? 47.388 -4.617  -21.296 1.00 29.23  ? 281  VAL A CG1   1 
ATOM   3026 C CG2   . VAL B 2 281 ? 47.049 -4.749  -18.839 1.00 32.67  ? 281  VAL A CG2   1 
ATOM   3027 N N     . LYS B 2 282 ? 47.743 -1.140  -21.851 1.00 37.89  ? 282  LYS A N     1 
ATOM   3028 C CA    . LYS B 2 282 ? 47.461 -0.316  -23.012 1.00 38.06  ? 282  LYS A CA    1 
ATOM   3029 C C     . LYS B 2 282 ? 47.999 -0.975  -24.264 1.00 38.84  ? 282  LYS A C     1 
ATOM   3030 O O     . LYS B 2 282 ? 49.144 -1.430  -24.297 1.00 39.13  ? 282  LYS A O     1 
ATOM   3031 C CB    . LYS B 2 282 ? 48.101 1.056   -22.847 1.00 38.22  ? 282  LYS A CB    1 
ATOM   3032 C CG    . LYS B 2 282 ? 48.083 1.914   -24.103 1.00 38.11  ? 282  LYS A CG    1 
ATOM   3033 C CD    . LYS B 2 282 ? 48.635 3.295   -23.799 1.00 38.80  ? 282  LYS A CD    1 
ATOM   3034 C CE    . LYS B 2 282 ? 48.763 4.137   -25.055 1.00 39.73  ? 282  LYS A CE    1 
ATOM   3035 N NZ    . LYS B 2 282 ? 49.301 5.495   -24.750 1.00 40.64  ? 282  LYS A NZ    1 
ATOM   3036 N N     . PHE B 2 283 ? 47.158 -1.034  -25.289 1.00 39.07  ? 283  PHE A N     1 
ATOM   3037 C CA    . PHE B 2 283 ? 47.533 -1.619  -26.568 1.00 38.76  ? 283  PHE A CA    1 
ATOM   3038 C C     . PHE B 2 283 ? 46.752 -0.878  -27.645 1.00 39.89  ? 283  PHE A C     1 
ATOM   3039 O O     . PHE B 2 283 ? 45.962 0.003   -27.323 1.00 39.57  ? 283  PHE A O     1 
ATOM   3040 C CB    . PHE B 2 283 ? 47.223 -3.119  -26.580 1.00 38.01  ? 283  PHE A CB    1 
ATOM   3041 C CG    . PHE B 2 283 ? 45.806 -3.458  -26.236 1.00 37.42  ? 283  PHE A CG    1 
ATOM   3042 C CD1   . PHE B 2 283 ? 44.897 -3.799  -27.235 1.00 38.61  ? 283  PHE A CD1   1 
ATOM   3043 C CD2   . PHE B 2 283 ? 45.374 -3.445  -24.913 1.00 37.89  ? 283  PHE A CD2   1 
ATOM   3044 C CE1   . PHE B 2 283 ? 43.574 -4.123  -26.924 1.00 37.55  ? 283  PHE A CE1   1 
ATOM   3045 C CE2   . PHE B 2 283 ? 44.048 -3.767  -24.583 1.00 38.29  ? 283  PHE A CE2   1 
ATOM   3046 C CZ    . PHE B 2 283 ? 43.149 -4.107  -25.595 1.00 38.30  ? 283  PHE A CZ    1 
ATOM   3047 N N     . ARG B 2 284 ? 46.976 -1.213  -28.914 1.00 41.70  ? 284  ARG A N     1 
ATOM   3048 C CA    . ARG B 2 284 ? 46.271 -0.533  -30.000 1.00 43.28  ? 284  ARG A CA    1 
ATOM   3049 C C     . ARG B 2 284 ? 44.926 -1.169  -30.325 1.00 43.02  ? 284  ARG A C     1 
ATOM   3050 O O     . ARG B 2 284 ? 44.819 -2.383  -30.466 1.00 43.29  ? 284  ARG A O     1 
ATOM   3051 C CB    . ARG B 2 284 ? 47.143 -0.484  -31.261 1.00 45.71  ? 284  ARG A CB    1 
ATOM   3052 C CG    . ARG B 2 284 ? 48.352 0.426   -31.119 1.00 49.97  ? 284  ARG A CG    1 
ATOM   3053 C CD    . ARG B 2 284 ? 49.278 0.371   -32.324 1.00 53.06  ? 284  ARG A CD    1 
ATOM   3054 N NE    . ARG B 2 284 ? 50.627 0.820   -31.972 1.00 59.52  ? 284  ARG A NE    1 
ATOM   3055 C CZ    . ARG B 2 284 ? 50.950 2.073   -31.651 1.00 61.86  ? 284  ARG A CZ    1 
ATOM   3056 N NH1   . ARG B 2 284 ? 50.018 3.023   -31.645 1.00 62.05  ? 284  ARG A NH1   1 
ATOM   3057 N NH2   . ARG B 2 284 ? 52.202 2.371   -31.315 1.00 61.44  ? 284  ARG A NH2   1 
ATOM   3058 N N     . LYS B 2 285 ? 43.901 -0.333  -30.441 1.00 42.37  ? 285  LYS A N     1 
ATOM   3059 C CA    . LYS B 2 285 ? 42.559 -0.803  -30.753 1.00 41.94  ? 285  LYS A CA    1 
ATOM   3060 C C     . LYS B 2 285 ? 42.464 -1.437  -32.137 1.00 40.69  ? 285  LYS A C     1 
ATOM   3061 O O     . LYS B 2 285 ? 42.802 -0.808  -33.136 1.00 38.47  ? 285  LYS A O     1 
ATOM   3062 C CB    . LYS B 2 285 ? 41.550 0.351   -30.691 1.00 43.02  ? 285  LYS A CB    1 
ATOM   3063 C CG    . LYS B 2 285 ? 40.210 -0.022  -31.304 1.00 45.60  ? 285  LYS A CG    1 
ATOM   3064 C CD    . LYS B 2 285 ? 39.291 1.163   -31.485 1.00 48.73  ? 285  LYS A CD    1 
ATOM   3065 C CE    . LYS B 2 285 ? 38.053 0.746   -32.286 1.00 52.65  ? 285  LYS A CE    1 
ATOM   3066 N NZ    . LYS B 2 285 ? 37.016 1.826   -32.408 1.00 54.99  ? 285  LYS A NZ    1 
ATOM   3067 N N     . PRO B 2 286 ? 41.997 -2.695  -32.207 1.00 40.46  ? 286  PRO A N     1 
ATOM   3068 C CA    . PRO B 2 286 ? 41.855 -3.386  -33.490 1.00 41.21  ? 286  PRO A CA    1 
ATOM   3069 C C     . PRO B 2 286 ? 40.819 -2.601  -34.283 1.00 42.55  ? 286  PRO A C     1 
ATOM   3070 O O     . PRO B 2 286 ? 39.937 -1.969  -33.693 1.00 42.68  ? 286  PRO A O     1 
ATOM   3071 C CB    . PRO B 2 286 ? 41.329 -4.761  -33.084 1.00 40.44  ? 286  PRO A CB    1 
ATOM   3072 C CG    . PRO B 2 286 ? 41.895 -4.948  -31.720 1.00 40.07  ? 286  PRO A CG    1 
ATOM   3073 C CD    . PRO B 2 286 ? 41.675 -3.600  -31.094 1.00 39.32  ? 286  PRO A CD    1 
ATOM   3074 N N     . ASP B 2 287 ? 40.915 -2.626  -35.605 1.00 44.25  ? 287  ASP A N     1 
ATOM   3075 C CA    . ASP B 2 287 ? 39.957 -1.882  -36.407 1.00 45.79  ? 287  ASP A CA    1 
ATOM   3076 C C     . ASP B 2 287 ? 38.710 -2.715  -36.663 1.00 45.19  ? 287  ASP A C     1 
ATOM   3077 O O     . ASP B 2 287 ? 38.497 -3.250  -37.752 1.00 44.76  ? 287  ASP A O     1 
ATOM   3078 C CB    . ASP B 2 287 ? 40.592 -1.436  -37.720 1.00 47.72  ? 287  ASP A CB    1 
ATOM   3079 C CG    . ASP B 2 287 ? 39.755 -0.409  -38.441 1.00 49.93  ? 287  ASP A CG    1 
ATOM   3080 O OD1   . ASP B 2 287 ? 39.178 0.468   -37.758 1.00 51.22  ? 287  ASP A OD1   1 
ATOM   3081 O OD2   . ASP B 2 287 ? 39.685 -0.471  -39.687 1.00 51.39  ? 287  ASP A OD2   1 
ATOM   3082 N N     . ILE B 2 288 ? 37.888 -2.826  -35.627 1.00 43.19  ? 288  ILE A N     1 
ATOM   3083 C CA    . ILE B 2 288 ? 36.663 -3.585  -35.709 1.00 41.09  ? 288  ILE A CA    1 
ATOM   3084 C C     . ILE B 2 288 ? 35.568 -2.736  -35.109 1.00 40.76  ? 288  ILE A C     1 
ATOM   3085 O O     . ILE B 2 288 ? 35.849 -1.739  -34.445 1.00 40.27  ? 288  ILE A O     1 
ATOM   3086 C CB    . ILE B 2 288 ? 36.795 -4.911  -34.947 1.00 41.08  ? 288  ILE A CB    1 
ATOM   3087 C CG1   . ILE B 2 288 ? 37.172 -4.642  -33.489 1.00 39.27  ? 288  ILE A CG1   1 
ATOM   3088 C CG2   . ILE B 2 288 ? 37.862 -5.786  -35.620 1.00 38.55  ? 288  ILE A CG2   1 
ATOM   3089 C CD1   . ILE B 2 288 ? 37.294 -5.918  -32.648 1.00 39.91  ? 288  ILE A CD1   1 
ATOM   3090 N N     . VAL B 2 289 ? 34.320 -3.119  -35.357 1.00 40.89  ? 289  VAL A N     1 
ATOM   3091 C CA    . VAL B 2 289 ? 33.186 -2.364  -34.845 1.00 40.13  ? 289  VAL A CA    1 
ATOM   3092 C C     . VAL B 2 289 ? 32.983 -2.644  -33.373 1.00 40.01  ? 289  VAL A C     1 
ATOM   3093 O O     . VAL B 2 289 ? 33.258 -3.746  -32.900 1.00 40.23  ? 289  VAL A O     1 
ATOM   3094 C CB    . VAL B 2 289 ? 31.881 -2.700  -35.617 1.00 39.49  ? 289  VAL A CB    1 
ATOM   3095 C CG1   . VAL B 2 289 ? 32.004 -2.233  -37.065 1.00 38.29  ? 289  VAL A CG1   1 
ATOM   3096 C CG2   . VAL B 2 289 ? 31.602 -4.192  -35.560 1.00 38.11  ? 289  VAL A CG2   1 
ATOM   3097 N N     . ASP B 2 290 ? 32.509 -1.634  -32.652 1.00 39.75  ? 290  ASP A N     1 
ATOM   3098 C CA    . ASP B 2 290 ? 32.270 -1.766  -31.222 1.00 38.83  ? 290  ASP A CA    1 
ATOM   3099 C C     . ASP B 2 290 ? 31.632 -3.099  -30.869 1.00 38.83  ? 290  ASP A C     1 
ATOM   3100 O O     . ASP B 2 290 ? 31.934 -3.681  -29.832 1.00 39.96  ? 290  ASP A O     1 
ATOM   3101 C CB    . ASP B 2 290 ? 31.373 -0.635  -30.717 1.00 38.17  ? 290  ASP A CB    1 
ATOM   3102 C CG    . ASP B 2 290 ? 32.021 0.732   -30.840 1.00 39.38  ? 290  ASP A CG    1 
ATOM   3103 O OD1   . ASP B 2 290 ? 33.270 0.813   -30.908 1.00 40.94  ? 290  ASP A OD1   1 
ATOM   3104 O OD2   . ASP B 2 290 ? 31.276 1.733   -30.848 1.00 37.53  ? 290  ASP A OD2   1 
ATOM   3105 N N     . ASP B 2 291 ? 30.755 -3.589  -31.736 1.00 38.69  ? 291  ASP A N     1 
ATOM   3106 C CA    . ASP B 2 291 ? 30.077 -4.844  -31.473 1.00 39.67  ? 291  ASP A CA    1 
ATOM   3107 C C     . ASP B 2 291 ? 30.979 -6.058  -31.351 1.00 39.67  ? 291  ASP A C     1 
ATOM   3108 O O     . ASP B 2 291 ? 30.631 -7.030  -30.672 1.00 39.46  ? 291  ASP A O     1 
ATOM   3109 C CB    . ASP B 2 291 ? 28.991 -5.073  -32.511 1.00 40.72  ? 291  ASP A CB    1 
ATOM   3110 C CG    . ASP B 2 291 ? 27.668 -4.497  -32.074 1.00 42.14  ? 291  ASP A CG    1 
ATOM   3111 O OD1   . ASP B 2 291 ? 26.830 -4.175  -32.943 1.00 45.08  ? 291  ASP A OD1   1 
ATOM   3112 O OD2   . ASP B 2 291 ? 27.467 -4.376  -30.847 1.00 42.11  ? 291  ASP A OD2   1 
ATOM   3113 N N     . ASN B 2 292 ? 32.135 -6.022  -31.997 1.00 38.85  ? 292  ASN A N     1 
ATOM   3114 C CA    . ASN B 2 292 ? 33.046 -7.146  -31.868 1.00 39.67  ? 292  ASN A CA    1 
ATOM   3115 C C     . ASN B 2 292 ? 34.077 -6.823  -30.786 1.00 38.42  ? 292  ASN A C     1 
ATOM   3116 O O     . ASN B 2 292 ? 34.467 -7.695  -30.014 1.00 39.94  ? 292  ASN A O     1 
ATOM   3117 C CB    . ASN B 2 292 ? 33.757 -7.439  -33.198 1.00 41.29  ? 292  ASN A CB    1 
ATOM   3118 C CG    . ASN B 2 292 ? 32.799 -7.917  -34.286 1.00 42.14  ? 292  ASN A CG    1 
ATOM   3119 O OD1   . ASN B 2 292 ? 31.986 -8.816  -34.064 1.00 41.87  ? 292  ASN A OD1   1 
ATOM   3120 N ND2   . ASN B 2 292 ? 32.904 -7.323  -35.471 1.00 41.59  ? 292  ASN A ND2   1 
ATOM   3121 N N     . LEU B 2 293 ? 34.485 -5.559  -30.719 1.00 35.37  ? 293  LEU A N     1 
ATOM   3122 C CA    . LEU B 2 293 ? 35.498 -5.117  -29.769 1.00 33.90  ? 293  LEU A CA    1 
ATOM   3123 C C     . LEU B 2 293 ? 35.129 -5.126  -28.283 1.00 34.27  ? 293  LEU A C     1 
ATOM   3124 O O     . LEU B 2 293 ? 35.908 -5.614  -27.451 1.00 33.99  ? 293  LEU A O     1 
ATOM   3125 C CB    . LEU B 2 293 ? 35.978 -3.712  -30.136 1.00 32.41  ? 293  LEU A CB    1 
ATOM   3126 C CG    . LEU B 2 293 ? 36.897 -3.058  -29.099 1.00 31.80  ? 293  LEU A CG    1 
ATOM   3127 C CD1   . LEU B 2 293 ? 38.282 -3.660  -29.231 1.00 31.80  ? 293  LEU A CD1   1 
ATOM   3128 C CD2   . LEU B 2 293 ? 36.947 -1.556  -29.292 1.00 29.94  ? 293  LEU A CD2   1 
ATOM   3129 N N     . TYR B 2 294 ? 33.966 -4.581  -27.934 1.00 32.76  ? 294  TYR A N     1 
ATOM   3130 C CA    . TYR B 2 294 ? 33.597 -4.538  -26.525 1.00 31.75  ? 294  TYR A CA    1 
ATOM   3131 C C     . TYR B 2 294 ? 33.490 -5.904  -25.860 1.00 30.22  ? 294  TYR A C     1 
ATOM   3132 O O     . TYR B 2 294 ? 33.920 -6.076  -24.727 1.00 30.98  ? 294  TYR A O     1 
ATOM   3133 C CB    . TYR B 2 294 ? 32.338 -3.696  -26.321 1.00 29.99  ? 294  TYR A CB    1 
ATOM   3134 C CG    . TYR B 2 294 ? 32.665 -2.220  -26.369 1.00 29.81  ? 294  TYR A CG    1 
ATOM   3135 C CD1   . TYR B 2 294 ? 32.881 -1.569  -27.588 1.00 30.30  ? 294  TYR A CD1   1 
ATOM   3136 C CD2   . TYR B 2 294 ? 32.838 -1.487  -25.191 1.00 29.60  ? 294  TYR A CD2   1 
ATOM   3137 C CE1   . TYR B 2 294 ? 33.268 -0.220  -27.635 1.00 30.12  ? 294  TYR A CE1   1 
ATOM   3138 C CE2   . TYR B 2 294 ? 33.225 -0.140  -25.222 1.00 29.82  ? 294  TYR A CE2   1 
ATOM   3139 C CZ    . TYR B 2 294 ? 33.439 0.485   -26.448 1.00 30.99  ? 294  TYR A CZ    1 
ATOM   3140 O OH    . TYR B 2 294 ? 33.821 1.809   -26.485 1.00 32.32  ? 294  TYR A OH    1 
ATOM   3141 N N     . PRO B 2 295 ? 32.919 -6.896  -26.544 1.00 29.67  ? 295  PRO A N     1 
ATOM   3142 C CA    . PRO B 2 295 ? 32.869 -8.185  -25.854 1.00 29.44  ? 295  PRO A CA    1 
ATOM   3143 C C     . PRO B 2 295 ? 34.295 -8.711  -25.664 1.00 29.18  ? 295  PRO A C     1 
ATOM   3144 O O     . PRO B 2 295 ? 34.578 -9.463  -24.729 1.00 27.67  ? 295  PRO A O     1 
ATOM   3145 C CB    . PRO B 2 295 ? 32.051 -9.049  -26.810 1.00 28.92  ? 295  PRO A CB    1 
ATOM   3146 C CG    . PRO B 2 295 ? 31.074 -8.063  -27.369 1.00 27.97  ? 295  PRO A CG    1 
ATOM   3147 C CD    . PRO B 2 295 ? 31.965 -6.864  -27.667 1.00 30.50  ? 295  PRO A CD    1 
ATOM   3148 N N     . GLN B 2 296 ? 35.190 -8.315  -26.564 1.00 30.58  ? 296  GLN A N     1 
ATOM   3149 C CA    . GLN B 2 296 ? 36.580 -8.754  -26.473 1.00 31.41  ? 296  GLN A CA    1 
ATOM   3150 C C     . GLN B 2 296 ? 37.272 -8.026  -25.338 1.00 30.50  ? 296  GLN A C     1 
ATOM   3151 O O     . GLN B 2 296 ? 38.064 -8.618  -24.619 1.00 29.60  ? 296  GLN A O     1 
ATOM   3152 C CB    . GLN B 2 296 ? 37.322 -8.533  -27.801 1.00 31.60  ? 296  GLN A CB    1 
ATOM   3153 C CG    . GLN B 2 296 ? 36.980 -9.589  -28.853 1.00 33.13  ? 296  GLN A CG    1 
ATOM   3154 C CD    . GLN B 2 296 ? 37.805 -9.466  -30.128 1.00 35.09  ? 296  GLN A CD    1 
ATOM   3155 O OE1   . GLN B 2 296 ? 39.041 -9.448  -30.086 1.00 37.20  ? 296  GLN A OE1   1 
ATOM   3156 N NE2   . GLN B 2 296 ? 37.125 -9.398  -31.271 1.00 33.10  ? 296  GLN A NE2   1 
ATOM   3157 N N     . LEU B 2 297 ? 36.969 -6.741  -25.170 1.00 31.46  ? 297  LEU A N     1 
ATOM   3158 C CA    . LEU B 2 297 ? 37.562 -5.988  -24.073 1.00 31.50  ? 297  LEU A CA    1 
ATOM   3159 C C     . LEU B 2 297 ? 37.069 -6.599  -22.754 1.00 32.25  ? 297  LEU A C     1 
ATOM   3160 O O     . LEU B 2 297 ? 37.813 -6.672  -21.779 1.00 32.38  ? 297  LEU A O     1 
ATOM   3161 C CB    . LEU B 2 297 ? 37.185 -4.505  -24.160 1.00 29.31  ? 297  LEU A CB    1 
ATOM   3162 C CG    . LEU B 2 297 ? 37.781 -3.744  -25.349 1.00 29.57  ? 297  LEU A CG    1 
ATOM   3163 C CD1   . LEU B 2 297 ? 37.396 -2.274  -25.285 1.00 26.72  ? 297  LEU A CD1   1 
ATOM   3164 C CD2   . LEU B 2 297 ? 39.297 -3.893  -25.339 1.00 28.62  ? 297  LEU A CD2   1 
ATOM   3165 N N     . GLU B 2 298 ? 35.822 -7.056  -22.733 1.00 32.80  ? 298  GLU A N     1 
ATOM   3166 C CA    . GLU B 2 298 ? 35.274 -7.682  -21.531 1.00 34.04  ? 298  GLU A CA    1 
ATOM   3167 C C     . GLU B 2 298 ? 35.972 -9.002  -21.204 1.00 32.05  ? 298  GLU A C     1 
ATOM   3168 O O     . GLU B 2 298 ? 36.300 -9.262  -20.047 1.00 31.38  ? 298  GLU A O     1 
ATOM   3169 C CB    . GLU B 2 298 ? 33.767 -7.911  -21.684 1.00 35.87  ? 298  GLU A CB    1 
ATOM   3170 C CG    . GLU B 2 298 ? 32.956 -6.658  -21.431 1.00 40.96  ? 298  GLU A CG    1 
ATOM   3171 C CD    . GLU B 2 298 ? 31.473 -6.811  -21.750 1.00 43.88  ? 298  GLU A CD    1 
ATOM   3172 O OE1   . GLU B 2 298 ? 30.694 -5.915  -21.343 1.00 45.31  ? 298  GLU A OE1   1 
ATOM   3173 O OE2   . GLU B 2 298 ? 31.085 -7.806  -22.407 1.00 44.37  ? 298  GLU A OE2   1 
ATOM   3174 N N     . ARG B 2 299 ? 36.201 -9.826  -22.222 1.00 30.38  ? 299  ARG A N     1 
ATOM   3175 C CA    . ARG B 2 299 ? 36.858 -11.107 -22.015 1.00 30.78  ? 299  ARG A CA    1 
ATOM   3176 C C     . ARG B 2 299 ? 38.284 -10.906 -21.499 1.00 31.92  ? 299  ARG A C     1 
ATOM   3177 O O     . ARG B 2 299 ? 38.664 -11.441 -20.453 1.00 32.12  ? 299  ARG A O     1 
ATOM   3178 C CB    . ARG B 2 299 ? 36.910 -11.916 -23.315 1.00 29.57  ? 299  ARG A CB    1 
ATOM   3179 C CG    . ARG B 2 299 ? 37.790 -13.163 -23.191 1.00 30.24  ? 299  ARG A CG    1 
ATOM   3180 C CD    . ARG B 2 299 ? 37.919 -13.956 -24.471 1.00 28.85  ? 299  ARG A CD    1 
ATOM   3181 N NE    . ARG B 2 299 ? 37.440 -15.306 -24.233 1.00 33.42  ? 299  ARG A NE    1 
ATOM   3182 C CZ    . ARG B 2 299 ? 38.164 -16.309 -23.742 1.00 35.01  ? 299  ARG A CZ    1 
ATOM   3183 N NH1   . ARG B 2 299 ? 39.442 -16.152 -23.435 1.00 37.17  ? 299  ARG A NH1   1 
ATOM   3184 N NH2   . ARG B 2 299 ? 37.583 -17.473 -23.510 1.00 37.67  ? 299  ARG A NH2   1 
ATOM   3185 N N     . ALA B 2 300 ? 39.068 -10.142 -22.250 1.00 32.05  ? 300  ALA A N     1 
ATOM   3186 C CA    . ALA B 2 300 ? 40.449 -9.870  -21.893 1.00 33.67  ? 300  ALA A CA    1 
ATOM   3187 C C     . ALA B 2 300 ? 40.549 -9.326  -20.465 1.00 33.94  ? 300  ALA A C     1 
ATOM   3188 O O     . ALA B 2 300 ? 41.417 -9.712  -19.675 1.00 33.19  ? 300  ALA A O     1 
ATOM   3189 C CB    . ALA B 2 300 ? 41.047 -8.871  -22.889 1.00 33.78  ? 300  ALA A CB    1 
ATOM   3190 N N     . SER B 2 301 ? 39.648 -8.419  -20.148 1.00 33.71  ? 301  SER A N     1 
ATOM   3191 C CA    . SER B 2 301 ? 39.617 -7.808  -18.837 1.00 34.20  ? 301  SER A CA    1 
ATOM   3192 C C     . SER B 2 301 ? 39.392 -8.878  -17.767 1.00 33.38  ? 301  SER A C     1 
ATOM   3193 O O     . SER B 2 301 ? 40.078 -8.922  -16.756 1.00 33.42  ? 301  SER A O     1 
ATOM   3194 C CB    . SER B 2 301 ? 38.502 -6.773  -18.813 1.00 35.60  ? 301  SER A CB    1 
ATOM   3195 O OG    . SER B 2 301 ? 38.431 -6.170  -17.553 1.00 42.67  ? 301  SER A OG    1 
ATOM   3196 N N     . ARG B 2 302 ? 38.436 -9.757  -18.013 1.00 33.78  ? 302  ARG A N     1 
ATOM   3197 C CA    . ARG B 2 302 ? 38.109 -10.824 -17.083 1.00 33.72  ? 302  ARG A CA    1 
ATOM   3198 C C     . ARG B 2 302 ? 39.262 -11.812 -16.904 1.00 33.15  ? 302  ARG A C     1 
ATOM   3199 O O     . ARG B 2 302 ? 39.644 -12.134 -15.787 1.00 34.75  ? 302  ARG A O     1 
ATOM   3200 C CB    . ARG B 2 302 ? 36.866 -11.565 -17.587 1.00 34.60  ? 302  ARG A CB    1 
ATOM   3201 C CG    . ARG B 2 302 ? 36.302 -12.598 -16.634 1.00 36.75  ? 302  ARG A CG    1 
ATOM   3202 C CD    . ARG B 2 302 ? 35.100 -13.326 -17.261 1.00 38.53  ? 302  ARG A CD    1 
ATOM   3203 N NE    . ARG B 2 302 ? 35.486 -14.490 -18.064 1.00 40.24  ? 302  ARG A NE    1 
ATOM   3204 C CZ    . ARG B 2 302 ? 35.200 -14.645 -19.357 1.00 44.29  ? 302  ARG A CZ    1 
ATOM   3205 N NH1   . ARG B 2 302 ? 34.521 -13.707 -20.019 1.00 47.03  ? 302  ARG A NH1   1 
ATOM   3206 N NH2   . ARG B 2 302 ? 35.571 -15.749 -19.989 1.00 44.33  ? 302  ARG A NH2   1 
ATOM   3207 N N     . LYS B 2 303 ? 39.822 -12.296 -18.004 1.00 32.29  ? 303  LYS A N     1 
ATOM   3208 C CA    . LYS B 2 303 ? 40.901 -13.270 -17.917 1.00 31.74  ? 303  LYS A CA    1 
ATOM   3209 C C     . LYS B 2 303 ? 42.077 -12.755 -17.080 1.00 31.92  ? 303  LYS A C     1 
ATOM   3210 O O     . LYS B 2 303 ? 42.691 -13.506 -16.327 1.00 31.11  ? 303  LYS A O     1 
ATOM   3211 C CB    . LYS B 2 303 ? 41.365 -13.659 -19.322 1.00 30.71  ? 303  LYS A CB    1 
ATOM   3212 C CG    . LYS B 2 303 ? 40.254 -14.240 -20.200 1.00 32.78  ? 303  LYS A CG    1 
ATOM   3213 C CD    . LYS B 2 303 ? 39.625 -15.506 -19.616 1.00 31.73  ? 303  LYS A CD    1 
ATOM   3214 C CE    . LYS B 2 303 ? 40.622 -16.656 -19.559 1.00 36.27  ? 303  LYS A CE    1 
ATOM   3215 N NZ    . LYS B 2 303 ? 40.046 -17.910 -18.983 1.00 38.45  ? 303  LYS A NZ    1 
ATOM   3216 N N     . ILE B 2 304 ? 42.386 -11.471 -17.215 1.00 31.63  ? 304  ILE A N     1 
ATOM   3217 C CA    . ILE B 2 304 ? 43.473 -10.879 -16.449 1.00 31.25  ? 304  ILE A CA    1 
ATOM   3218 C C     . ILE B 2 304 ? 43.037 -10.744 -14.983 1.00 30.60  ? 304  ILE A C     1 
ATOM   3219 O O     . ILE B 2 304 ? 43.835 -10.974 -14.072 1.00 29.14  ? 304  ILE A O     1 
ATOM   3220 C CB    . ILE B 2 304 ? 43.853 -9.502  -17.020 1.00 32.52  ? 304  ILE A CB    1 
ATOM   3221 C CG1   . ILE B 2 304 ? 44.304 -9.656  -18.476 1.00 33.08  ? 304  ILE A CG1   1 
ATOM   3222 C CG2   . ILE B 2 304 ? 44.974 -8.885  -16.206 1.00 33.19  ? 304  ILE A CG2   1 
ATOM   3223 C CD1   . ILE B 2 304 ? 44.509 -8.329  -19.191 1.00 32.40  ? 304  ILE A CD1   1 
ATOM   3224 N N     . PHE B 2 305 ? 41.771 -10.383 -14.767 1.00 29.47  ? 305  PHE A N     1 
ATOM   3225 C CA    . PHE B 2 305 ? 41.228 -10.247 -13.415 1.00 28.93  ? 305  PHE A CA    1 
ATOM   3226 C C     . PHE B 2 305 ? 41.359 -11.584 -12.680 1.00 28.61  ? 305  PHE A C     1 
ATOM   3227 O O     . PHE B 2 305 ? 41.772 -11.638 -11.516 1.00 28.93  ? 305  PHE A O     1 
ATOM   3228 C CB    . PHE B 2 305 ? 39.746 -9.849  -13.457 1.00 29.54  ? 305  PHE A CB    1 
ATOM   3229 C CG    . PHE B 2 305 ? 39.196 -9.418  -12.121 1.00 29.09  ? 305  PHE A CG    1 
ATOM   3230 C CD1   . PHE B 2 305 ? 39.287 -8.090  -11.712 1.00 28.21  ? 305  PHE A CD1   1 
ATOM   3231 C CD2   . PHE B 2 305 ? 38.626 -10.350 -11.249 1.00 29.32  ? 305  PHE A CD2   1 
ATOM   3232 C CE1   . PHE B 2 305 ? 38.821 -7.694  -10.451 1.00 25.88  ? 305  PHE A CE1   1 
ATOM   3233 C CE2   . PHE B 2 305 ? 38.156 -9.967  -9.989  1.00 24.82  ? 305  PHE A CE2   1 
ATOM   3234 C CZ    . PHE B 2 305 ? 38.253 -8.641  -9.590  1.00 26.58  ? 305  PHE A CZ    1 
ATOM   3235 N N     . GLU B 2 306 ? 40.992 -12.655 -13.369 1.00 28.66  ? 306  GLU A N     1 
ATOM   3236 C CA    . GLU B 2 306 ? 41.062 -14.001 -12.817 1.00 29.09  ? 306  GLU A CA    1 
ATOM   3237 C C     . GLU B 2 306 ? 42.498 -14.400 -12.531 1.00 28.25  ? 306  GLU A C     1 
ATOM   3238 O O     . GLU B 2 306 ? 42.776 -15.082 -11.538 1.00 29.33  ? 306  GLU A O     1 
ATOM   3239 C CB    . GLU B 2 306 ? 40.428 -14.990 -13.789 1.00 31.33  ? 306  GLU A CB    1 
ATOM   3240 C CG    . GLU B 2 306 ? 38.936 -15.148 -13.588 1.00 35.49  ? 306  GLU A CG    1 
ATOM   3241 C CD    . GLU B 2 306 ? 38.235 -15.691 -14.813 1.00 38.50  ? 306  GLU A CD    1 
ATOM   3242 O OE1   . GLU B 2 306 ? 38.794 -16.607 -15.472 1.00 39.83  ? 306  GLU A OE1   1 
ATOM   3243 O OE2   . GLU B 2 306 ? 37.121 -15.197 -15.106 1.00 38.37  ? 306  GLU A OE2   1 
ATOM   3244 N N     . PHE B 2 307 ? 43.408 -13.985 -13.402 1.00 27.22  ? 307  PHE A N     1 
ATOM   3245 C CA    . PHE B 2 307 ? 44.815 -14.283 -13.206 1.00 26.78  ? 307  PHE A CA    1 
ATOM   3246 C C     . PHE B 2 307 ? 45.232 -13.576 -11.920 1.00 27.87  ? 307  PHE A C     1 
ATOM   3247 O O     . PHE B 2 307 ? 45.903 -14.157 -11.069 1.00 28.91  ? 307  PHE A O     1 
ATOM   3248 C CB    . PHE B 2 307 ? 45.635 -13.756 -14.384 1.00 26.00  ? 307  PHE A CB    1 
ATOM   3249 C CG    . PHE B 2 307 ? 47.111 -13.694 -14.127 1.00 26.57  ? 307  PHE A CG    1 
ATOM   3250 C CD1   . PHE B 2 307 ? 47.903 -14.825 -14.256 1.00 27.39  ? 307  PHE A CD1   1 
ATOM   3251 C CD2   . PHE B 2 307 ? 47.713 -12.494 -13.771 1.00 27.16  ? 307  PHE A CD2   1 
ATOM   3252 C CE1   . PHE B 2 307 ? 49.281 -14.761 -14.037 1.00 29.00  ? 307  PHE A CE1   1 
ATOM   3253 C CE2   . PHE B 2 307 ? 49.090 -12.418 -13.547 1.00 28.93  ? 307  PHE A CE2   1 
ATOM   3254 C CZ    . PHE B 2 307 ? 49.878 -13.551 -13.681 1.00 28.89  ? 307  PHE A CZ    1 
ATOM   3255 N N     . LEU B 2 308 ? 44.808 -12.326 -11.771 1.00 27.32  ? 308  LEU A N     1 
ATOM   3256 C CA    . LEU B 2 308 ? 45.156 -11.573 -10.589 1.00 29.42  ? 308  LEU A CA    1 
ATOM   3257 C C     . LEU B 2 308 ? 44.602 -12.204 -9.312  1.00 31.77  ? 308  LEU A C     1 
ATOM   3258 O O     . LEU B 2 308 ? 45.272 -12.192 -8.272  1.00 30.91  ? 308  LEU A O     1 
ATOM   3259 C CB    . LEU B 2 308 ? 44.678 -10.124 -10.713 1.00 27.69  ? 308  LEU A CB    1 
ATOM   3260 C CG    . LEU B 2 308 ? 45.401 -9.268  -11.758 1.00 27.23  ? 308  LEU A CG    1 
ATOM   3261 C CD1   . LEU B 2 308 ? 44.590 -8.043  -12.053 1.00 27.79  ? 308  LEU A CD1   1 
ATOM   3262 C CD2   . LEU B 2 308 ? 46.797 -8.878  -11.272 1.00 27.21  ? 308  LEU A CD2   1 
ATOM   3263 N N     . GLU B 2 309 ? 43.399 -12.770 -9.352  1.00 34.50  ? 309  GLU A N     1 
ATOM   3264 C CA    . GLU B 2 309 ? 42.922 -13.342 -8.103  1.00 36.06  ? 309  GLU A CA    1 
ATOM   3265 C C     . GLU B 2 309 ? 43.559 -14.667 -7.734  1.00 34.82  ? 309  GLU A C     1 
ATOM   3266 O O     . GLU B 2 309 ? 43.878 -14.872 -6.568  1.00 35.16  ? 309  GLU A O     1 
ATOM   3267 C CB    . GLU B 2 309 ? 41.387 -13.419 -8.033  1.00 36.85  ? 309  GLU A CB    1 
ATOM   3268 C CG    . GLU B 2 309 ? 40.664 -13.902 -9.244  1.00 42.97  ? 309  GLU A CG    1 
ATOM   3269 C CD    . GLU B 2 309 ? 39.144 -13.703 -9.132  1.00 46.92  ? 309  GLU A CD    1 
ATOM   3270 O OE1   . GLU B 2 309 ? 38.410 -14.213 -10.006 1.00 48.25  ? 309  GLU A OE1   1 
ATOM   3271 O OE2   . GLU B 2 309 ? 38.682 -13.034 -8.179  1.00 48.04  ? 309  GLU A OE2   1 
ATOM   3272 N N     . ARG B 2 310 ? 43.792 -15.556 -8.694  1.00 33.23  ? 310  ARG A N     1 
ATOM   3273 C CA    . ARG B 2 310 ? 44.410 -16.825 -8.322  1.00 33.52  ? 310  ARG A CA    1 
ATOM   3274 C C     . ARG B 2 310 ? 45.869 -16.632 -7.949  1.00 33.52  ? 310  ARG A C     1 
ATOM   3275 O O     . ARG B 2 310 ? 46.431 -17.419 -7.185  1.00 33.42  ? 310  ARG A O     1 
ATOM   3276 C CB    . ARG B 2 310 ? 44.290 -17.875 -9.430  1.00 33.93  ? 310  ARG A CB    1 
ATOM   3277 C CG    . ARG B 2 310 ? 44.921 -17.519 -10.738 1.00 35.40  ? 310  ARG A CG    1 
ATOM   3278 C CD    . ARG B 2 310 ? 44.930 -18.726 -11.657 1.00 36.07  ? 310  ARG A CD    1 
ATOM   3279 N NE    . ARG B 2 310 ? 45.276 -18.344 -13.021 1.00 38.55  ? 310  ARG A NE    1 
ATOM   3280 C CZ    . ARG B 2 310 ? 44.425 -17.789 -13.880 1.00 39.56  ? 310  ARG A CZ    1 
ATOM   3281 N NH1   . ARG B 2 310 ? 43.172 -17.556 -13.521 1.00 40.71  ? 310  ARG A NH1   1 
ATOM   3282 N NH2   . ARG B 2 310 ? 44.831 -17.451 -15.094 1.00 40.81  ? 310  ARG A NH2   1 
ATOM   3283 N N     . GLU B 2 311 ? 46.475 -15.572 -8.468  1.00 33.85  ? 311  GLU A N     1 
ATOM   3284 C CA    . GLU B 2 311 ? 47.868 -15.273 -8.164  1.00 33.01  ? 311  GLU A CA    1 
ATOM   3285 C C     . GLU B 2 311 ? 47.927 -14.415 -6.890  1.00 32.33  ? 311  GLU A C     1 
ATOM   3286 O O     . GLU B 2 311 ? 48.960 -13.853 -6.536  1.00 32.60  ? 311  GLU A O     1 
ATOM   3287 C CB    . GLU B 2 311 ? 48.508 -14.568 -9.364  1.00 33.67  ? 311  GLU A CB    1 
ATOM   3288 C CG    . GLU B 2 311 ? 49.845 -15.160 -9.794  1.00 37.31  ? 311  GLU A CG    1 
ATOM   3289 C CD    . GLU B 2 311 ? 49.804 -16.656 -10.089 1.00 38.28  ? 311  GLU A CD    1 
ATOM   3290 O OE1   . GLU B 2 311 ? 49.158 -17.082 -11.069 1.00 39.66  ? 311  GLU A OE1   1 
ATOM   3291 O OE2   . GLU B 2 311 ? 50.434 -17.421 -9.336  1.00 39.47  ? 311  GLU A OE2   1 
ATOM   3292 N N     . ASN B 2 312 ? 46.786 -14.342 -6.210  1.00 32.22  ? 312  ASN A N     1 
ATOM   3293 C CA    . ASN B 2 312 ? 46.614 -13.616 -4.948  1.00 32.22  ? 312  ASN A CA    1 
ATOM   3294 C C     . ASN B 2 312 ? 46.936 -12.131 -4.826  1.00 32.02  ? 312  ASN A C     1 
ATOM   3295 O O     . ASN B 2 312 ? 47.413 -11.688 -3.779  1.00 32.23  ? 312  ASN A O     1 
ATOM   3296 C CB    . ASN B 2 312 ? 47.338 -14.354 -3.821  1.00 32.32  ? 312  ASN A CB    1 
ATOM   3297 C CG    . ASN B 2 312 ? 46.563 -15.569 -3.333  1.00 33.21  ? 312  ASN A CG    1 
ATOM   3298 O OD1   . ASN B 2 312 ? 46.832 -16.689 -3.741  1.00 31.59  ? 312  ASN A OD1   1 
ATOM   3299 N ND2   . ASN B 2 312 ? 45.574 -15.337 -2.465  1.00 35.22  ? 312  ASN A ND2   1 
ATOM   3300 N N     . PHE B 2 313 ? 46.662 -11.347 -5.860  1.00 31.02  ? 313  PHE A N     1 
ATOM   3301 C CA    . PHE B 2 313 ? 46.930 -9.919  -5.762  1.00 30.56  ? 313  PHE A CA    1 
ATOM   3302 C C     . PHE B 2 313 ? 45.713 -9.167  -5.268  1.00 29.56  ? 313  PHE A C     1 
ATOM   3303 O O     . PHE B 2 313 ? 45.746 -7.951  -5.083  1.00 29.84  ? 313  PHE A O     1 
ATOM   3304 C CB    . PHE B 2 313 ? 47.435 -9.369  -7.100  1.00 30.05  ? 313  PHE A CB    1 
ATOM   3305 C CG    . PHE B 2 313 ? 48.863 -9.734  -7.374  1.00 30.39  ? 313  PHE A CG    1 
ATOM   3306 C CD1   . PHE B 2 313 ? 49.882 -9.249  -6.552  1.00 29.34  ? 313  PHE A CD1   1 
ATOM   3307 C CD2   . PHE B 2 313 ? 49.186 -10.628 -8.388  1.00 28.94  ? 313  PHE A CD2   1 
ATOM   3308 C CE1   . PHE B 2 313 ? 51.198 -9.659  -6.732  1.00 28.57  ? 313  PHE A CE1   1 
ATOM   3309 C CE2   . PHE B 2 313 ? 50.502 -11.045 -8.577  1.00 27.82  ? 313  PHE A CE2   1 
ATOM   3310 C CZ    . PHE B 2 313 ? 51.509 -10.561 -7.748  1.00 28.84  ? 313  PHE A CZ    1 
ATOM   3311 N N     . MET B 2 314 ? 44.649 -9.922  -5.024  1.00 29.18  ? 314  MET A N     1 
ATOM   3312 C CA    . MET B 2 314 ? 43.398 -9.381  -4.513  1.00 28.25  ? 314  MET A CA    1 
ATOM   3313 C C     . MET B 2 314 ? 42.861 -8.214  -5.322  1.00 27.91  ? 314  MET A C     1 
ATOM   3314 O O     . MET B 2 314 ? 42.757 -7.098  -4.821  1.00 28.08  ? 314  MET A O     1 
ATOM   3315 C CB    . MET B 2 314 ? 43.584 -8.972  -3.046  1.00 29.56  ? 314  MET A CB    1 
ATOM   3316 C CG    . MET B 2 314 ? 43.924 -10.152 -2.139  1.00 27.87  ? 314  MET A CG    1 
ATOM   3317 S SD    . MET B 2 314 ? 44.318 -9.702  -0.452  1.00 32.54  ? 314  MET A SD    1 
ATOM   3318 C CE    . MET B 2 314 ? 42.685 -9.610  0.289   1.00 29.18  ? 314  MET A CE    1 
ATOM   3319 N N     . PRO B 2 315 ? 42.506 -8.461  -6.589  1.00 28.08  ? 315  PRO A N     1 
ATOM   3320 C CA    . PRO B 2 315 ? 41.978 -7.382  -7.421  1.00 29.35  ? 315  PRO A CA    1 
ATOM   3321 C C     . PRO B 2 315 ? 40.632 -6.936  -6.858  1.00 30.86  ? 315  PRO A C     1 
ATOM   3322 O O     . PRO B 2 315 ? 39.843 -7.763  -6.394  1.00 29.17  ? 315  PRO A O     1 
ATOM   3323 C CB    . PRO B 2 315 ? 41.810 -8.030  -8.799  1.00 29.68  ? 315  PRO A CB    1 
ATOM   3324 C CG    . PRO B 2 315 ? 42.281 -9.451  -8.646  1.00 30.10  ? 315  PRO A CG    1 
ATOM   3325 C CD    . PRO B 2 315 ? 42.238 -9.770  -7.200  1.00 28.03  ? 315  PRO A CD    1 
ATOM   3326 N N     . LEU B 2 316 ? 40.381 -5.633  -6.896  1.00 32.67  ? 316  LEU A N     1 
ATOM   3327 C CA    . LEU B 2 316 ? 39.128 -5.082  -6.403  1.00 34.36  ? 316  LEU A CA    1 
ATOM   3328 C C     . LEU B 2 316 ? 38.108 -5.042  -7.522  1.00 34.79  ? 316  LEU A C     1 
ATOM   3329 O O     . LEU B 2 316 ? 37.031 -5.611  -7.397  1.00 36.19  ? 316  LEU A O     1 
ATOM   3330 C CB    . LEU B 2 316 ? 39.339 -3.673  -5.868  1.00 36.10  ? 316  LEU A CB    1 
ATOM   3331 C CG    . LEU B 2 316 ? 40.086 -3.546  -4.552  1.00 37.27  ? 316  LEU A CG    1 
ATOM   3332 C CD1   . LEU B 2 316 ? 40.330 -2.076  -4.283  1.00 37.02  ? 316  LEU A CD1   1 
ATOM   3333 C CD2   . LEU B 2 316 ? 39.267 -4.184  -3.425  1.00 38.71  ? 316  LEU A CD2   1 
ATOM   3334 N N     . ARG B 2 317 ? 38.444 -4.348  -8.608  1.00 34.13  ? 317  ARG A N     1 
ATOM   3335 C CA    . ARG B 2 317 ? 37.561 -4.250  -9.768  1.00 34.41  ? 317  ARG A CA    1 
ATOM   3336 C C     . ARG B 2 317 ? 38.394 -4.031  -11.024 1.00 34.65  ? 317  ARG A C     1 
ATOM   3337 O O     . ARG B 2 317 ? 39.604 -3.838  -10.958 1.00 34.68  ? 317  ARG A O     1 
ATOM   3338 C CB    . ARG B 2 317 ? 36.576 -3.084  -9.634  1.00 33.86  ? 317  ARG A CB    1 
ATOM   3339 C CG    . ARG B 2 317 ? 35.604 -3.151  -8.466  1.00 34.24  ? 317  ARG A CG    1 
ATOM   3340 C CD    . ARG B 2 317 ? 34.625 -1.958  -8.504  1.00 33.58  ? 317  ARG A CD    1 
ATOM   3341 N NE    . ARG B 2 317 ? 33.546 -2.131  -9.485  1.00 33.29  ? 317  ARG A NE    1 
ATOM   3342 C CZ    . ARG B 2 317 ? 32.708 -1.167  -9.868  1.00 32.70  ? 317  ARG A CZ    1 
ATOM   3343 N NH1   . ARG B 2 317 ? 32.813 0.061   -9.367  1.00 32.15  ? 317  ARG A NH1   1 
ATOM   3344 N NH2   . ARG B 2 317 ? 31.743 -1.432  -10.739 1.00 30.65  ? 317  ARG A NH2   1 
ATOM   3345 N N     . SER B 2 318 ? 37.743 -4.069  -12.175 1.00 34.92  ? 318  SER A N     1 
ATOM   3346 C CA    . SER B 2 318 ? 38.442 -3.836  -13.423 1.00 34.60  ? 318  SER A CA    1 
ATOM   3347 C C     . SER B 2 318 ? 37.537 -2.989  -14.287 1.00 34.63  ? 318  SER A C     1 
ATOM   3348 O O     . SER B 2 318 ? 36.347 -2.860  -14.012 1.00 34.52  ? 318  SER A O     1 
ATOM   3349 C CB    . SER B 2 318 ? 38.741 -5.147  -14.136 1.00 35.30  ? 318  SER A CB    1 
ATOM   3350 O OG    . SER B 2 318 ? 37.550 -5.725  -14.625 1.00 36.06  ? 318  SER A OG    1 
ATOM   3351 N N     . ALA B 2 319 ? 38.108 -2.393  -15.323 1.00 33.97  ? 319  ALA A N     1 
ATOM   3352 C CA    . ALA B 2 319 ? 37.334 -1.575  -16.235 1.00 33.12  ? 319  ALA A CA    1 
ATOM   3353 C C     . ALA B 2 319 ? 38.096 -1.541  -17.541 1.00 33.81  ? 319  ALA A C     1 
ATOM   3354 O O     . ALA B 2 319 ? 39.119 -2.197  -17.668 1.00 34.81  ? 319  ALA A O     1 
ATOM   3355 C CB    . ALA B 2 319 ? 37.165 -0.187  -15.675 1.00 30.06  ? 319  ALA A CB    1 
ATOM   3356 N N     . PHE B 2 320 ? 37.605 -0.794  -18.514 1.00 35.17  ? 320  PHE A N     1 
ATOM   3357 C CA    . PHE B 2 320 ? 38.275 -0.716  -19.799 1.00 37.00  ? 320  PHE A CA    1 
ATOM   3358 C C     . PHE B 2 320 ? 37.772 0.482   -20.580 1.00 38.10  ? 320  PHE A C     1 
ATOM   3359 O O     . PHE B 2 320 ? 36.659 0.953   -20.353 1.00 38.72  ? 320  PHE A O     1 
ATOM   3360 C CB    . PHE B 2 320 ? 38.065 -2.014  -20.596 1.00 36.10  ? 320  PHE A CB    1 
ATOM   3361 C CG    . PHE B 2 320 ? 36.617 -2.390  -20.796 1.00 36.33  ? 320  PHE A CG    1 
ATOM   3362 C CD1   . PHE B 2 320 ? 35.811 -1.696  -21.704 1.00 35.07  ? 320  PHE A CD1   1 
ATOM   3363 C CD2   . PHE B 2 320 ? 36.062 -3.468  -20.096 1.00 36.19  ? 320  PHE A CD2   1 
ATOM   3364 C CE1   . PHE B 2 320 ? 34.466 -2.069  -21.908 1.00 34.24  ? 320  PHE A CE1   1 
ATOM   3365 C CE2   . PHE B 2 320 ? 34.718 -3.850  -20.293 1.00 35.86  ? 320  PHE A CE2   1 
ATOM   3366 C CZ    . PHE B 2 320 ? 33.924 -3.150  -21.203 1.00 33.69  ? 320  PHE A CZ    1 
ATOM   3367 N N     . LYS B 2 321 ? 38.594 0.989   -21.488 1.00 39.31  ? 321  LYS A N     1 
ATOM   3368 C CA    . LYS B 2 321 ? 38.191 2.139   -22.279 1.00 41.36  ? 321  LYS A CA    1 
ATOM   3369 C C     . LYS B 2 321 ? 38.775 2.056   -23.675 1.00 42.20  ? 321  LYS A C     1 
ATOM   3370 O O     . LYS B 2 321 ? 39.893 1.591   -23.866 1.00 43.20  ? 321  LYS A O     1 
ATOM   3371 C CB    . LYS B 2 321 ? 38.640 3.430   -21.594 1.00 41.23  ? 321  LYS A CB    1 
ATOM   3372 C CG    . LYS B 2 321 ? 37.861 4.660   -21.997 1.00 42.02  ? 321  LYS A CG    1 
ATOM   3373 C CD    . LYS B 2 321 ? 38.399 5.296   -23.259 1.00 43.50  ? 321  LYS A CD    1 
ATOM   3374 C CE    . LYS B 2 321 ? 37.482 6.429   -23.714 1.00 44.85  ? 321  LYS A CE    1 
ATOM   3375 N NZ    . LYS B 2 321 ? 37.193 7.413   -22.622 1.00 45.84  ? 321  LYS A NZ    1 
ATOM   3376 N N     . ALA B 2 322 ? 37.999 2.489   -24.656 1.00 43.18  ? 322  ALA A N     1 
ATOM   3377 C CA    . ALA B 2 322 ? 38.460 2.474   -26.028 1.00 44.57  ? 322  ALA A CA    1 
ATOM   3378 C C     . ALA B 2 322 ? 38.505 3.906   -26.531 1.00 45.63  ? 322  ALA A C     1 
ATOM   3379 O O     . ALA B 2 322 ? 37.580 4.673   -26.298 1.00 45.28  ? 322  ALA A O     1 
ATOM   3380 C CB    . ALA B 2 322 ? 37.522 1.641   -26.890 1.00 43.01  ? 322  ALA A CB    1 
ATOM   3381 N N     . SER B 2 323 ? 39.606 4.257   -27.189 1.00 48.09  ? 323  SER A N     1 
ATOM   3382 C CA    . SER B 2 323 ? 39.796 5.577   -27.781 1.00 49.99  ? 323  SER A CA    1 
ATOM   3383 C C     . SER B 2 323 ? 39.931 5.307   -29.268 1.00 51.18  ? 323  SER A C     1 
ATOM   3384 O O     . SER B 2 323 ? 39.867 4.150   -29.701 1.00 50.90  ? 323  SER A O     1 
ATOM   3385 C CB    . SER B 2 323 ? 41.080 6.221   -27.271 1.00 50.96  ? 323  SER A CB    1 
ATOM   3386 O OG    . SER B 2 323 ? 41.093 6.249   -25.859 1.00 56.84  ? 323  SER A OG    1 
ATOM   3387 N N     . GLU B 2 324 ? 40.117 6.357   -30.058 1.00 53.10  ? 324  GLU A N     1 
ATOM   3388 C CA    . GLU B 2 324 ? 40.273 6.162   -31.497 1.00 55.62  ? 324  GLU A CA    1 
ATOM   3389 C C     . GLU B 2 324 ? 41.574 5.403   -31.674 1.00 55.32  ? 324  GLU A C     1 
ATOM   3390 O O     . GLU B 2 324 ? 41.697 4.482   -32.480 1.00 54.36  ? 324  GLU A O     1 
ATOM   3391 C CB    . GLU B 2 324 ? 40.000 7.469   -32.246 1.00 59.24  ? 324  GLU A CB    1 
ATOM   3392 C CG    . GLU B 2 324 ? 38.535 7.716   -32.547 1.00 63.63  ? 324  GLU A CG    1 
ATOM   3393 C CD    . GLU B 2 324 ? 37.867 6.516   -33.190 1.00 67.66  ? 324  GLU A CD    1 
ATOM   3394 O OE1   . GLU B 2 324 ? 36.673 6.269   -32.912 1.00 69.71  ? 324  GLU A OE1   1 
ATOM   3395 O OE2   . GLU B 2 324 ? 38.540 5.819   -33.979 1.00 68.19  ? 324  GLU A OE2   1 
ATOM   3396 N N     . GLU B 2 325 ? 42.531 5.812   -30.861 1.00 56.71  ? 325  GLU A N     1 
ATOM   3397 C CA    . GLU B 2 325 ? 43.879 5.290   -30.838 1.00 57.55  ? 325  GLU A CA    1 
ATOM   3398 C C     . GLU B 2 325 ? 44.348 4.009   -30.136 1.00 56.61  ? 325  GLU A C     1 
ATOM   3399 O O     . GLU B 2 325 ? 44.934 3.116   -30.756 1.00 57.75  ? 325  GLU A O     1 
ATOM   3400 C CB    . GLU B 2 325 ? 44.745 6.324   -30.117 1.00 61.62  ? 325  GLU A CB    1 
ATOM   3401 C CG    . GLU B 2 325 ? 44.071 6.805   -28.820 1.00 66.17  ? 325  GLU A CG    1 
ATOM   3402 C CD    . GLU B 2 325 ? 44.756 7.987   -28.158 1.00 68.94  ? 325  GLU A CD    1 
ATOM   3403 O OE1   . GLU B 2 325 ? 44.348 8.344   -27.029 1.00 69.92  ? 325  GLU A OE1   1 
ATOM   3404 O OE2   . GLU B 2 325 ? 45.691 8.561   -28.759 1.00 69.58  ? 325  GLU A OE2   1 
ATOM   3405 N N     . PHE B 2 326 ? 44.075 3.931   -28.834 1.00 53.89  ? 326  PHE A N     1 
ATOM   3406 C CA    . PHE B 2 326 ? 44.289 2.718   -28.056 1.00 50.39  ? 326  PHE A CA    1 
ATOM   3407 C C     . PHE B 2 326 ? 43.123 2.240   -27.197 1.00 48.44  ? 326  PHE A C     1 
ATOM   3408 O O     . PHE B 2 326 ? 42.065 2.863   -27.134 1.00 48.32  ? 326  PHE A O     1 
ATOM   3409 C CB    . PHE B 2 326 ? 45.496 2.913   -27.134 1.00 50.14  ? 326  PHE A CB    1 
ATOM   3410 C CG    . PHE B 2 326 ? 46.638 3.681   -27.757 1.00 48.79  ? 326  PHE A CG    1 
ATOM   3411 C CD1   . PHE B 2 326 ? 46.626 5.072   -27.781 1.00 48.54  ? 326  PHE A CD1   1 
ATOM   3412 C CD2   . PHE B 2 326 ? 47.734 3.015   -28.297 1.00 47.33  ? 326  PHE A CD2   1 
ATOM   3413 C CE1   . PHE B 2 326 ? 47.686 5.786   -28.329 1.00 47.93  ? 326  PHE A CE1   1 
ATOM   3414 C CE2   . PHE B 2 326 ? 48.794 3.719   -28.845 1.00 46.04  ? 326  PHE A CE2   1 
ATOM   3415 C CZ    . PHE B 2 326 ? 48.771 5.103   -28.861 1.00 46.48  ? 326  PHE A CZ    1 
ATOM   3416 N N     . CYS B 2 327 ? 43.348 1.111   -26.535 1.00 45.58  ? 327  CYS A N     1 
ATOM   3417 C CA    . CYS B 2 327 ? 42.376 0.514   -25.628 1.00 44.28  ? 327  CYS A CA    1 
ATOM   3418 C C     . CYS B 2 327 ? 43.084 0.330   -24.286 1.00 43.22  ? 327  CYS A C     1 
ATOM   3419 O O     . CYS B 2 327 ? 44.287 0.065   -24.244 1.00 42.72  ? 327  CYS A O     1 
ATOM   3420 C CB    . CYS B 2 327 ? 41.894 -0.844  -26.148 1.00 43.08  ? 327  CYS A CB    1 
ATOM   3421 S SG    . CYS B 2 327 ? 40.824 -0.757  -27.605 1.00 40.83  ? 327  CYS A SG    1 
ATOM   3422 N N     . TYR B 2 328 ? 42.342 0.476   -23.195 1.00 41.03  ? 328  TYR A N     1 
ATOM   3423 C CA    . TYR B 2 328 ? 42.929 0.328   -21.875 1.00 38.94  ? 328  TYR A CA    1 
ATOM   3424 C C     . TYR B 2 328 ? 42.154 -0.653  -21.039 1.00 37.17  ? 328  TYR A C     1 
ATOM   3425 O O     . TYR B 2 328 ? 40.931 -0.634  -21.037 1.00 37.94  ? 328  TYR A O     1 
ATOM   3426 C CB    . TYR B 2 328 ? 42.941 1.661   -21.123 1.00 40.26  ? 328  TYR A CB    1 
ATOM   3427 C CG    . TYR B 2 328 ? 43.598 2.795   -21.861 1.00 41.80  ? 328  TYR A CG    1 
ATOM   3428 C CD1   . TYR B 2 328 ? 42.905 3.510   -22.839 1.00 42.00  ? 328  TYR A CD1   1 
ATOM   3429 C CD2   . TYR B 2 328 ? 44.922 3.157   -21.584 1.00 41.85  ? 328  TYR A CD2   1 
ATOM   3430 C CE1   . TYR B 2 328 ? 43.508 4.559   -23.523 1.00 42.47  ? 328  TYR A CE1   1 
ATOM   3431 C CE2   . TYR B 2 328 ? 45.535 4.203   -22.264 1.00 41.88  ? 328  TYR A CE2   1 
ATOM   3432 C CZ    . TYR B 2 328 ? 44.821 4.896   -23.231 1.00 41.99  ? 328  TYR A CZ    1 
ATOM   3433 O OH    . TYR B 2 328 ? 45.423 5.917   -23.916 1.00 44.78  ? 328  TYR A OH    1 
ATOM   3434 N N     . LEU B 2 329 ? 42.875 -1.514  -20.333 1.00 36.05  ? 329  LEU A N     1 
ATOM   3435 C CA    . LEU B 2 329 ? 42.269 -2.470  -19.425 1.00 32.89  ? 329  LEU A CA    1 
ATOM   3436 C C     . LEU B 2 329 ? 42.740 -1.946  -18.087 1.00 32.91  ? 329  LEU A C     1 
ATOM   3437 O O     . LEU B 2 329 ? 43.935 -1.875  -17.847 1.00 33.29  ? 329  LEU A O     1 
ATOM   3438 C CB    . LEU B 2 329 ? 42.816 -3.875  -19.669 1.00 29.97  ? 329  LEU A CB    1 
ATOM   3439 C CG    . LEU B 2 329 ? 42.550 -4.386  -21.081 1.00 29.90  ? 329  LEU A CG    1 
ATOM   3440 C CD1   . LEU B 2 329 ? 43.027 -5.821  -21.227 1.00 28.91  ? 329  LEU A CD1   1 
ATOM   3441 C CD2   . LEU B 2 329 ? 41.060 -4.281  -21.380 1.00 29.03  ? 329  LEU A CD2   1 
ATOM   3442 N N     . LEU B 2 330 ? 41.812 -1.550  -17.225 1.00 33.61  ? 330  LEU A N     1 
ATOM   3443 C CA    . LEU B 2 330 ? 42.188 -1.010  -15.927 1.00 33.73  ? 330  LEU A CA    1 
ATOM   3444 C C     . LEU B 2 330 ? 41.969 -1.966  -14.766 1.00 33.75  ? 330  LEU A C     1 
ATOM   3445 O O     . LEU B 2 330 ? 41.021 -2.748  -14.749 1.00 33.33  ? 330  LEU A O     1 
ATOM   3446 C CB    . LEU B 2 330 ? 41.440 0.296   -15.670 1.00 34.77  ? 330  LEU A CB    1 
ATOM   3447 C CG    . LEU B 2 330 ? 41.706 1.336   -16.761 1.00 35.54  ? 330  LEU A CG    1 
ATOM   3448 C CD1   . LEU B 2 330 ? 40.746 1.101   -17.893 1.00 36.92  ? 330  LEU A CD1   1 
ATOM   3449 C CD2   . LEU B 2 330 ? 41.526 2.732   -16.220 1.00 36.37  ? 330  LEU A CD2   1 
ATOM   3450 N N     . PHE B 2 331 ? 42.854 -1.875  -13.783 1.00 33.43  ? 331  PHE A N     1 
ATOM   3451 C CA    . PHE B 2 331 ? 42.794 -2.727  -12.610 1.00 31.43  ? 331  PHE A CA    1 
ATOM   3452 C C     . PHE B 2 331 ? 43.201 -2.007  -11.343 1.00 31.03  ? 331  PHE A C     1 
ATOM   3453 O O     . PHE B 2 331 ? 43.962 -1.042  -11.381 1.00 30.48  ? 331  PHE A O     1 
ATOM   3454 C CB    . PHE B 2 331 ? 43.735 -3.905  -12.800 1.00 31.39  ? 331  PHE A CB    1 
ATOM   3455 C CG    . PHE B 2 331 ? 43.438 -4.713  -14.007 1.00 32.29  ? 331  PHE A CG    1 
ATOM   3456 C CD1   . PHE B 2 331 ? 42.401 -5.634  -14.000 1.00 31.35  ? 331  PHE A CD1   1 
ATOM   3457 C CD2   . PHE B 2 331 ? 44.174 -4.537  -15.166 1.00 32.62  ? 331  PHE A CD2   1 
ATOM   3458 C CE1   . PHE B 2 331 ? 42.111 -6.375  -15.128 1.00 31.85  ? 331  PHE A CE1   1 
ATOM   3459 C CE2   . PHE B 2 331 ? 43.890 -5.275  -16.299 1.00 33.81  ? 331  PHE A CE2   1 
ATOM   3460 C CZ    . PHE B 2 331 ? 42.849 -6.197  -16.281 1.00 32.50  ? 331  PHE A CZ    1 
ATOM   3461 N N     . GLU B 2 332 ? 42.674 -2.484  -10.219 1.00 30.85  ? 332  GLU A N     1 
ATOM   3462 C CA    . GLU B 2 332 ? 43.031 -1.964  -8.910  1.00 31.35  ? 332  GLU A CA    1 
ATOM   3463 C C     . GLU B 2 332 ? 43.159 -3.199  -8.022  1.00 32.31  ? 332  GLU A C     1 
ATOM   3464 O O     . GLU B 2 332 ? 42.254 -4.031  -7.997  1.00 33.28  ? 332  GLU A O     1 
ATOM   3465 C CB    . GLU B 2 332 ? 41.976 -1.020  -8.345  1.00 29.87  ? 332  GLU A CB    1 
ATOM   3466 C CG    . GLU B 2 332 ? 42.419 -0.461  -6.993  1.00 33.72  ? 332  GLU A CG    1 
ATOM   3467 C CD    . GLU B 2 332 ? 41.448 0.527   -6.380  1.00 34.37  ? 332  GLU A CD    1 
ATOM   3468 O OE1   . GLU B 2 332 ? 40.226 0.355   -6.571  1.00 37.72  ? 332  GLU A OE1   1 
ATOM   3469 O OE2   . GLU B 2 332 ? 41.907 1.463   -5.687  1.00 33.81  ? 332  GLU A OE2   1 
ATOM   3470 N N     . CYS B 2 333 ? 44.286 -3.326  -7.323  1.00 31.70  ? 333  CYS A N     1 
ATOM   3471 C CA    . CYS B 2 333 ? 44.543 -4.472  -6.451  1.00 32.23  ? 333  CYS A CA    1 
ATOM   3472 C C     . CYS B 2 333 ? 44.902 -4.007  -5.047  1.00 32.59  ? 333  CYS A C     1 
ATOM   3473 O O     . CYS B 2 333 ? 45.422 -2.907  -4.878  1.00 34.50  ? 333  CYS A O     1 
ATOM   3474 C CB    . CYS B 2 333 ? 45.696 -5.318  -7.012  1.00 31.86  ? 333  CYS A CB    1 
ATOM   3475 S SG    . CYS B 2 333 ? 45.397 -6.018  -8.661  1.00 33.32  ? 333  CYS A SG    1 
ATOM   3476 N N     . GLN B 2 334 ? 44.639 -4.840  -4.041  1.00 31.22  ? 334  GLN A N     1 
ATOM   3477 C CA    . GLN B 2 334 ? 44.950 -4.460  -2.665  1.00 30.24  ? 334  GLN A CA    1 
ATOM   3478 C C     . GLN B 2 334 ? 46.410 -4.756  -2.369  1.00 30.60  ? 334  GLN A C     1 
ATOM   3479 O O     . GLN B 2 334 ? 46.975 -4.215  -1.420  1.00 29.60  ? 334  GLN A O     1 
ATOM   3480 C CB    . GLN B 2 334 ? 44.091 -5.231  -1.663  1.00 30.24  ? 334  GLN A CB    1 
ATOM   3481 C CG    . GLN B 2 334 ? 42.610 -5.203  -1.944  1.00 32.43  ? 334  GLN A CG    1 
ATOM   3482 C CD    . GLN B 2 334 ? 41.772 -5.794  -0.810  1.00 33.92  ? 334  GLN A CD    1 
ATOM   3483 O OE1   . GLN B 2 334 ? 40.617 -6.157  -1.019  1.00 34.84  ? 334  GLN A OE1   1 
ATOM   3484 N NE2   . GLN B 2 334 ? 42.341 -5.870  0.392   1.00 30.84  ? 334  GLN A NE2   1 
ATOM   3485 N N     . ILE B 2 335 ? 47.015 -5.616  -3.183  1.00 29.59  ? 335  ILE A N     1 
ATOM   3486 C CA    . ILE B 2 335 ? 48.404 -5.988  -2.981  1.00 30.36  ? 335  ILE A CA    1 
ATOM   3487 C C     . ILE B 2 335 ? 49.349 -5.355  -3.994  1.00 31.53  ? 335  ILE A C     1 
ATOM   3488 O O     . ILE B 2 335 ? 49.336 -5.720  -5.163  1.00 30.86  ? 335  ILE A O     1 
ATOM   3489 C CB    . ILE B 2 335 ? 48.594 -7.521  -3.070  1.00 30.85  ? 335  ILE A CB    1 
ATOM   3490 C CG1   . ILE B 2 335 ? 47.501 -8.243  -2.270  1.00 32.23  ? 335  ILE A CG1   1 
ATOM   3491 C CG2   . ILE B 2 335 ? 49.967 -7.901  -2.557  1.00 27.80  ? 335  ILE A CG2   1 
ATOM   3492 C CD1   . ILE B 2 335 ? 47.519 -7.963  -0.793  1.00 31.75  ? 335  ILE A CD1   1 
ATOM   3493 N N     . LYS B 2 336 ? 50.174 -4.414  -3.545  1.00 33.04  ? 336  LYS A N     1 
ATOM   3494 C CA    . LYS B 2 336 ? 51.144 -3.778  -4.434  1.00 34.43  ? 336  LYS A CA    1 
ATOM   3495 C C     . LYS B 2 336 ? 52.322 -4.728  -4.594  1.00 35.20  ? 336  LYS A C     1 
ATOM   3496 O O     . LYS B 2 336 ? 52.930 -4.822  -5.663  1.00 35.18  ? 336  LYS A O     1 
ATOM   3497 C CB    . LYS B 2 336 ? 51.664 -2.473  -3.841  1.00 34.86  ? 336  LYS A CB    1 
ATOM   3498 C CG    . LYS B 2 336 ? 50.641 -1.374  -3.717  1.00 38.40  ? 336  LYS A CG    1 
ATOM   3499 C CD    . LYS B 2 336 ? 51.276 -0.127  -3.136  1.00 39.98  ? 336  LYS A CD    1 
ATOM   3500 C CE    . LYS B 2 336 ? 50.339 1.061   -3.234  1.00 43.58  ? 336  LYS A CE    1 
ATOM   3501 N NZ    . LYS B 2 336 ? 50.919 2.298   -2.628  1.00 44.31  ? 336  LYS A NZ    1 
ATOM   3502 N N     . GLU B 2 337 ? 52.636 -5.438  -3.519  1.00 35.78  ? 337  GLU A N     1 
ATOM   3503 C CA    . GLU B 2 337 ? 53.761 -6.360  -3.527  1.00 36.57  ? 337  GLU A CA    1 
ATOM   3504 C C     . GLU B 2 337 ? 53.541 -7.506  -2.573  1.00 35.49  ? 337  GLU A C     1 
ATOM   3505 O O     . GLU B 2 337 ? 53.087 -7.310  -1.450  1.00 35.70  ? 337  GLU A O     1 
ATOM   3506 C CB    . GLU B 2 337 ? 55.047 -5.631  -3.134  1.00 37.58  ? 337  GLU A CB    1 
ATOM   3507 C CG    . GLU B 2 337 ? 56.263 -6.531  -3.142  1.00 42.19  ? 337  GLU A CG    1 
ATOM   3508 C CD    . GLU B 2 337 ? 57.555 -5.768  -2.944  1.00 44.48  ? 337  GLU A CD    1 
ATOM   3509 O OE1   . GLU B 2 337 ? 57.745 -5.208  -1.843  1.00 45.90  ? 337  GLU A OE1   1 
ATOM   3510 O OE2   . GLU B 2 337 ? 58.376 -5.728  -3.890  1.00 43.78  ? 337  GLU A OE2   1 
ATOM   3511 N N     . ILE B 2 338 ? 53.876 -8.705  -3.030  1.00 35.58  ? 338  ILE A N     1 
ATOM   3512 C CA    . ILE B 2 338 ? 53.725 -9.914  -2.232  1.00 34.65  ? 338  ILE A CA    1 
ATOM   3513 C C     . ILE B 2 338 ? 55.089 -10.569 -2.134  1.00 34.96  ? 338  ILE A C     1 
ATOM   3514 O O     . ILE B 2 338 ? 55.953 -10.326 -2.983  1.00 35.77  ? 338  ILE A O     1 
ATOM   3515 C CB    . ILE B 2 338 ? 52.730 -10.886 -2.895  1.00 35.03  ? 338  ILE A CB    1 
ATOM   3516 C CG1   . ILE B 2 338 ? 52.402 -12.036 -1.945  1.00 34.98  ? 338  ILE A CG1   1 
ATOM   3517 C CG2   . ILE B 2 338 ? 53.306 -11.416 -4.202  1.00 35.59  ? 338  ILE A CG2   1 
ATOM   3518 C CD1   . ILE B 2 338 ? 51.295 -12.926 -2.464  1.00 34.80  ? 338  ILE A CD1   1 
ATOM   3519 N N     . SER B 2 339 ? 55.288 -11.391 -1.105  1.00 34.41  ? 339  SER A N     1 
ATOM   3520 C CA    . SER B 2 339 ? 56.571 -12.064 -0.902  1.00 32.70  ? 339  SER A CA    1 
ATOM   3521 C C     . SER B 2 339 ? 56.916 -13.011 -2.041  1.00 33.23  ? 339  SER A C     1 
ATOM   3522 O O     . SER B 2 339 ? 56.051 -13.396 -2.832  1.00 33.05  ? 339  SER A O     1 
ATOM   3523 C CB    . SER B 2 339 ? 56.567 -12.844 0.413   1.00 32.59  ? 339  SER A CB    1 
ATOM   3524 O OG    . SER B 2 339 ? 55.633 -13.914 0.378   1.00 32.72  ? 339  SER A OG    1 
ATOM   3525 N N     . ARG B 2 340 ? 58.190 -13.380 -2.118  1.00 33.28  ? 340  ARG A N     1 
ATOM   3526 C CA    . ARG B 2 340 ? 58.662 -14.298 -3.137  1.00 33.63  ? 340  ARG A CA    1 
ATOM   3527 C C     . ARG B 2 340 ? 58.201 -15.712 -2.763  1.00 34.24  ? 340  ARG A C     1 
ATOM   3528 O O     . ARG B 2 340 ? 57.824 -16.501 -3.634  1.00 33.89  ? 340  ARG A O     1 
ATOM   3529 C CB    . ARG B 2 340 ? 60.191 -14.235 -3.225  1.00 34.76  ? 340  ARG A CB    1 
ATOM   3530 C CG    . ARG B 2 340 ? 60.790 -14.874 -4.476  1.00 36.51  ? 340  ARG A CG    1 
ATOM   3531 C CD    . ARG B 2 340 ? 61.646 -13.859 -5.235  1.00 38.55  ? 340  ARG A CD    1 
ATOM   3532 N NE    . ARG B 2 340 ? 61.125 -13.545 -6.570  1.00 41.20  ? 340  ARG A NE    1 
ATOM   3533 C CZ    . ARG B 2 340 ? 61.165 -12.327 -7.111  1.00 43.08  ? 340  ARG A CZ    1 
ATOM   3534 N NH1   . ARG B 2 340 ? 61.694 -11.319 -6.429  1.00 42.52  ? 340  ARG A NH1   1 
ATOM   3535 N NH2   . ARG B 2 340 ? 60.682 -12.111 -8.328  1.00 44.23  ? 340  ARG A NH2   1 
ATOM   3536 N N     . VAL B 2 341 ? 58.236 -16.037 -1.470  1.00 33.64  ? 341  VAL A N     1 
ATOM   3537 C CA    . VAL B 2 341 ? 57.804 -17.364 -1.016  1.00 34.08  ? 341  VAL A CA    1 
ATOM   3538 C C     . VAL B 2 341 ? 56.313 -17.488 -0.761  1.00 33.96  ? 341  VAL A C     1 
ATOM   3539 O O     . VAL B 2 341 ? 55.651 -16.543 -0.311  1.00 32.94  ? 341  VAL A O     1 
ATOM   3540 C CB    . VAL B 2 341 ? 58.455 -17.807 0.321   1.00 35.16  ? 341  VAL A CB    1 
ATOM   3541 C CG1   . VAL B 2 341 ? 59.378 -18.961 0.090   1.00 36.29  ? 341  VAL A CG1   1 
ATOM   3542 C CG2   . VAL B 2 341 ? 59.159 -16.658 0.977   1.00 37.72  ? 341  VAL A CG2   1 
ATOM   3543 N N     . PHE B 2 342 ? 55.807 -18.685 -1.034  1.00 33.99  ? 342  PHE A N     1 
ATOM   3544 C CA    . PHE B 2 342 ? 54.415 -19.032 -0.799  1.00 35.42  ? 342  PHE A CA    1 
ATOM   3545 C C     . PHE B 2 342 ? 54.467 -20.521 -0.459  1.00 37.67  ? 342  PHE A C     1 
ATOM   3546 O O     . PHE B 2 342 ? 55.479 -21.181 -0.711  1.00 38.84  ? 342  PHE A O     1 
ATOM   3547 C CB    . PHE B 2 342 ? 53.561 -18.761 -2.042  1.00 33.32  ? 342  PHE A CB    1 
ATOM   3548 C CG    . PHE B 2 342 ? 53.870 -19.654 -3.202  1.00 34.34  ? 342  PHE A CG    1 
ATOM   3549 C CD1   . PHE B 2 342 ? 53.153 -20.837 -3.400  1.00 33.09  ? 342  PHE A CD1   1 
ATOM   3550 C CD2   . PHE B 2 342 ? 54.873 -19.315 -4.108  1.00 34.15  ? 342  PHE A CD2   1 
ATOM   3551 C CE1   . PHE B 2 342 ? 53.424 -21.669 -4.484  1.00 31.76  ? 342  PHE A CE1   1 
ATOM   3552 C CE2   . PHE B 2 342 ? 55.156 -20.136 -5.195  1.00 33.34  ? 342  PHE A CE2   1 
ATOM   3553 C CZ    . PHE B 2 342 ? 54.425 -21.318 -5.383  1.00 34.15  ? 342  PHE A CZ    1 
ATOM   3554 N N     . ARG B 2 343 ? 53.408 -21.055 0.137   1.00 39.72  ? 343  ARG A N     1 
ATOM   3555 C CA    . ARG B 2 343 ? 53.434 -22.464 0.491   1.00 41.93  ? 343  ARG A CA    1 
ATOM   3556 C C     . ARG B 2 343 ? 52.576 -23.338 -0.408  1.00 44.03  ? 343  ARG A C     1 
ATOM   3557 O O     . ARG B 2 343 ? 51.440 -22.997 -0.748  1.00 44.43  ? 343  ARG A O     1 
ATOM   3558 C CB    . ARG B 2 343 ? 53.041 -22.659 1.963   1.00 40.90  ? 343  ARG A CB    1 
ATOM   3559 C CG    . ARG B 2 343 ? 51.837 -21.868 2.415   1.00 42.34  ? 343  ARG A CG    1 
ATOM   3560 C CD    . ARG B 2 343 ? 51.604 -22.043 3.905   1.00 43.29  ? 343  ARG A CD    1 
ATOM   3561 N NE    . ARG B 2 343 ? 50.725 -23.167 4.193   1.00 44.91  ? 343  ARG A NE    1 
ATOM   3562 C CZ    . ARG B 2 343 ? 50.586 -23.722 5.390   1.00 45.77  ? 343  ARG A CZ    1 
ATOM   3563 N NH1   . ARG B 2 343 ? 51.272 -23.263 6.426   1.00 45.27  ? 343  ARG A NH1   1 
ATOM   3564 N NH2   . ARG B 2 343 ? 49.758 -24.742 5.552   1.00 47.32  ? 343  ARG A NH2   1 
ATOM   3565 N N     . ARG B 2 344 ? 53.141 -24.476 -0.795  1.00 45.29  ? 344  ARG A N     1 
ATOM   3566 C CA    . ARG B 2 344 ? 52.446 -25.422 -1.649  1.00 45.42  ? 344  ARG A CA    1 
ATOM   3567 C C     . ARG B 2 344 ? 52.024 -26.642 -0.836  1.00 44.58  ? 344  ARG A C     1 
ATOM   3568 O O     . ARG B 2 344 ? 52.844 -27.265 -0.163  1.00 44.28  ? 344  ARG A O     1 
ATOM   3569 C CB    . ARG B 2 344 ? 53.361 -25.831 -2.804  1.00 48.09  ? 344  ARG A CB    1 
ATOM   3570 C CG    . ARG B 2 344 ? 52.759 -26.816 -3.787  1.00 51.90  ? 344  ARG A CG    1 
ATOM   3571 C CD    . ARG B 2 344 ? 53.509 -26.758 -5.116  1.00 54.73  ? 344  ARG A CD    1 
ATOM   3572 N NE    . ARG B 2 344 ? 53.103 -25.598 -5.912  1.00 57.42  ? 344  ARG A NE    1 
ATOM   3573 C CZ    . ARG B 2 344 ? 53.750 -25.155 -6.988  1.00 58.22  ? 344  ARG A CZ    1 
ATOM   3574 N NH1   . ARG B 2 344 ? 54.849 -25.769 -7.406  1.00 58.64  ? 344  ARG A NH1   1 
ATOM   3575 N NH2   . ARG B 2 344 ? 53.288 -24.106 -7.659  1.00 58.44  ? 344  ARG A NH2   1 
ATOM   3576 N N     . MET B 2 345 ? 50.737 -26.967 -0.894  1.00 43.68  ? 345  MET A N     1 
ATOM   3577 C CA    . MET B 2 345 ? 50.199 -28.119 -0.178  1.00 42.95  ? 345  MET A CA    1 
ATOM   3578 C C     . MET B 2 345 ? 50.714 -29.418 -0.775  1.00 41.57  ? 345  MET A C     1 
ATOM   3579 O O     . MET B 2 345 ? 50.762 -29.579 -1.989  1.00 41.52  ? 345  MET A O     1 
ATOM   3580 C CB    . MET B 2 345 ? 48.673 -28.119 -0.229  1.00 44.31  ? 345  MET A CB    1 
ATOM   3581 C CG    . MET B 2 345 ? 48.034 -29.188 0.641   1.00 46.11  ? 345  MET A CG    1 
ATOM   3582 S SD    . MET B 2 345 ? 46.235 -29.153 0.571   1.00 47.92  ? 345  MET A SD    1 
ATOM   3583 C CE    . MET B 2 345 ? 45.977 -29.845 -1.079  1.00 48.00  ? 345  MET A CE    1 
ATOM   3584 N N     . GLY B 2 346 ? 51.100 -30.344 0.090   1.00 40.53  ? 346  GLY A N     1 
ATOM   3585 C CA    . GLY B 2 346 ? 51.601 -31.621 -0.381  1.00 39.40  ? 346  GLY A CA    1 
ATOM   3586 C C     . GLY B 2 346 ? 50.696 -32.764 0.032   1.00 37.90  ? 346  GLY A C     1 
ATOM   3587 O O     . GLY B 2 346 ? 49.586 -32.535 0.525   1.00 38.32  ? 346  GLY A O     1 
ATOM   3588 N N     . PRO B 2 347 ? 51.139 -34.014 -0.161  1.00 37.06  ? 347  PRO A N     1 
ATOM   3589 C CA    . PRO B 2 347 ? 50.340 -35.191 0.207   1.00 36.58  ? 347  PRO A CA    1 
ATOM   3590 C C     . PRO B 2 347 ? 50.301 -35.447 1.716   1.00 37.14  ? 347  PRO A C     1 
ATOM   3591 O O     . PRO B 2 347 ? 51.162 -34.970 2.460   1.00 36.58  ? 347  PRO A O     1 
ATOM   3592 C CB    . PRO B 2 347 ? 51.045 -36.320 -0.529  1.00 34.56  ? 347  PRO A CB    1 
ATOM   3593 C CG    . PRO B 2 347 ? 52.495 -35.891 -0.462  1.00 33.98  ? 347  PRO A CG    1 
ATOM   3594 C CD    . PRO B 2 347 ? 52.408 -34.412 -0.806  1.00 34.61  ? 347  PRO A CD    1 
ATOM   3595 N N     . GLN B 2 348 ? 49.301 -36.208 2.161   1.00 38.33  ? 348  GLN A N     1 
ATOM   3596 C CA    . GLN B 2 348 ? 49.180 -36.557 3.577   1.00 38.64  ? 348  GLN A CA    1 
ATOM   3597 C C     . GLN B 2 348 ? 50.343 -37.479 3.916   1.00 36.81  ? 348  GLN A C     1 
ATOM   3598 O O     . GLN B 2 348 ? 50.747 -38.286 3.089   1.00 36.19  ? 348  GLN A O     1 
ATOM   3599 C CB    . GLN B 2 348 ? 47.853 -37.255 3.844   1.00 41.47  ? 348  GLN A CB    1 
ATOM   3600 C CG    . GLN B 2 348 ? 46.651 -36.363 3.644   1.00 45.84  ? 348  GLN A CG    1 
ATOM   3601 C CD    . GLN B 2 348 ? 45.380 -36.996 4.160   1.00 49.75  ? 348  GLN A CD    1 
ATOM   3602 O OE1   . GLN B 2 348 ? 45.083 -38.153 3.859   1.00 51.87  ? 348  GLN A OE1   1 
ATOM   3603 N NE2   . GLN B 2 348 ? 44.615 -36.239 4.936   1.00 52.72  ? 348  GLN A NE2   1 
ATOM   3604 N N     . PHE B 2 349 ? 50.872 -37.366 5.130   1.00 36.03  ? 349  PHE A N     1 
ATOM   3605 C CA    . PHE B 2 349 ? 52.035 -38.159 5.541   1.00 36.09  ? 349  PHE A CA    1 
ATOM   3606 C C     . PHE B 2 349 ? 52.012 -39.669 5.293   1.00 36.43  ? 349  PHE A C     1 
ATOM   3607 O O     . PHE B 2 349 ? 53.049 -40.269 5.024   1.00 36.81  ? 349  PHE A O     1 
ATOM   3608 C CB    . PHE B 2 349 ? 52.353 -37.884 7.014   1.00 34.49  ? 349  PHE A CB    1 
ATOM   3609 C CG    . PHE B 2 349 ? 51.563 -38.713 7.989   1.00 33.00  ? 349  PHE A CG    1 
ATOM   3610 C CD1   . PHE B 2 349 ? 51.995 -39.989 8.349   1.00 32.17  ? 349  PHE A CD1   1 
ATOM   3611 C CD2   . PHE B 2 349 ? 50.411 -38.201 8.585   1.00 32.30  ? 349  PHE A CD2   1 
ATOM   3612 C CE1   . PHE B 2 349 ? 51.291 -40.745 9.303   1.00 32.23  ? 349  PHE A CE1   1 
ATOM   3613 C CE2   . PHE B 2 349 ? 49.701 -38.942 9.536   1.00 31.17  ? 349  PHE A CE2   1 
ATOM   3614 C CZ    . PHE B 2 349 ? 50.144 -40.219 9.897   1.00 31.98  ? 349  PHE A CZ    1 
ATOM   3615 N N     . GLU B 2 350 ? 50.842 -40.281 5.372   1.00 36.79  ? 350  GLU A N     1 
ATOM   3616 C CA    . GLU B 2 350 ? 50.738 -41.720 5.174   1.00 39.41  ? 350  GLU A CA    1 
ATOM   3617 C C     . GLU B 2 350 ? 51.017 -42.175 3.743   1.00 39.02  ? 350  GLU A C     1 
ATOM   3618 O O     . GLU B 2 350 ? 51.396 -43.323 3.511   1.00 38.81  ? 350  GLU A O     1 
ATOM   3619 C CB    . GLU B 2 350 ? 49.353 -42.195 5.617   1.00 40.40  ? 350  GLU A CB    1 
ATOM   3620 C CG    . GLU B 2 350 ? 48.343 -41.068 5.675   1.00 44.17  ? 350  GLU A CG    1 
ATOM   3621 C CD    . GLU B 2 350 ? 47.922 -40.721 7.081   1.00 44.15  ? 350  GLU A CD    1 
ATOM   3622 O OE1   . GLU B 2 350 ? 47.545 -39.559 7.310   1.00 45.89  ? 350  GLU A OE1   1 
ATOM   3623 O OE2   . GLU B 2 350 ? 47.948 -41.607 7.950   1.00 45.73  ? 350  GLU A OE2   1 
ATOM   3624 N N     . ASP B 2 351 ? 50.861 -41.266 2.789   1.00 39.42  ? 351  ASP A N     1 
ATOM   3625 C CA    . ASP B 2 351 ? 51.070 -41.584 1.383   1.00 40.75  ? 351  ASP A CA    1 
ATOM   3626 C C     . ASP B 2 351 ? 52.554 -41.610 1.018   1.00 41.59  ? 351  ASP A C     1 
ATOM   3627 O O     . ASP B 2 351 ? 53.076 -40.689 0.402   1.00 41.79  ? 351  ASP A O     1 
ATOM   3628 C CB    . ASP B 2 351 ? 50.305 -40.566 0.535   1.00 41.21  ? 351  ASP A CB    1 
ATOM   3629 C CG    . ASP B 2 351 ? 50.238 -40.944 -0.930  1.00 43.13  ? 351  ASP A CG    1 
ATOM   3630 O OD1   . ASP B 2 351 ? 49.370 -40.383 -1.625  1.00 44.37  ? 351  ASP A OD1   1 
ATOM   3631 O OD2   . ASP B 2 351 ? 51.048 -41.778 -1.393  1.00 44.02  ? 351  ASP A OD2   1 
ATOM   3632 N N     . GLU B 2 352 ? 53.225 -42.686 1.402   1.00 43.53  ? 352  GLU A N     1 
ATOM   3633 C CA    . GLU B 2 352 ? 54.656 -42.856 1.143   1.00 45.95  ? 352  GLU A CA    1 
ATOM   3634 C C     . GLU B 2 352 ? 55.101 -42.565 -0.290  1.00 46.91  ? 352  GLU A C     1 
ATOM   3635 O O     . GLU B 2 352 ? 56.068 -41.848 -0.507  1.00 46.77  ? 352  GLU A O     1 
ATOM   3636 C CB    . GLU B 2 352 ? 55.075 -44.274 1.509   1.00 46.80  ? 352  GLU A CB    1 
ATOM   3637 C CG    . GLU B 2 352 ? 56.567 -44.471 1.681   1.00 50.26  ? 352  GLU A CG    1 
ATOM   3638 C CD    . GLU B 2 352 ? 56.919 -45.930 1.924   1.00 53.44  ? 352  GLU A CD    1 
ATOM   3639 O OE1   . GLU B 2 352 ? 57.943 -46.200 2.588   1.00 53.11  ? 352  GLU A OE1   1 
ATOM   3640 O OE2   . GLU B 2 352 ? 56.171 -46.809 1.437   1.00 55.63  ? 352  GLU A OE2   1 
ATOM   3641 N N     . ARG B 2 353 ? 54.402 -43.124 -1.270  1.00 48.17  ? 353  ARG A N     1 
ATOM   3642 C CA    . ARG B 2 353 ? 54.772 -42.920 -2.667  1.00 49.09  ? 353  ARG A CA    1 
ATOM   3643 C C     . ARG B 2 353 ? 54.860 -41.446 -3.044  1.00 47.52  ? 353  ARG A C     1 
ATOM   3644 O O     . ARG B 2 353 ? 55.916 -40.950 -3.427  1.00 47.75  ? 353  ARG A O     1 
ATOM   3645 C CB    . ARG B 2 353 ? 53.765 -43.621 -3.582  1.00 52.35  ? 353  ARG A CB    1 
ATOM   3646 C CG    . ARG B 2 353 ? 54.131 -43.595 -5.058  1.00 56.43  ? 353  ARG A CG    1 
ATOM   3647 C CD    . ARG B 2 353 ? 54.044 -44.993 -5.641  1.00 62.13  ? 353  ARG A CD    1 
ATOM   3648 N NE    . ARG B 2 353 ? 54.889 -45.917 -4.886  1.00 65.81  ? 353  ARG A NE    1 
ATOM   3649 C CZ    . ARG B 2 353 ? 55.010 -47.218 -5.137  1.00 67.65  ? 353  ARG A CZ    1 
ATOM   3650 N NH1   . ARG B 2 353 ? 54.336 -47.778 -6.136  1.00 69.89  ? 353  ARG A NH1   1 
ATOM   3651 N NH2   . ARG B 2 353 ? 55.812 -47.961 -4.387  1.00 68.14  ? 353  ARG A NH2   1 
ATOM   3652 N N     . ASN B 2 354 ? 53.737 -40.750 -2.927  1.00 46.07  ? 354  ASN A N     1 
ATOM   3653 C CA    . ASN B 2 354 ? 53.677 -39.351 -3.284  1.00 45.24  ? 354  ASN A CA    1 
ATOM   3654 C C     . ASN B 2 354 ? 54.512 -38.486 -2.361  1.00 44.16  ? 354  ASN A C     1 
ATOM   3655 O O     . ASN B 2 354 ? 55.014 -37.443 -2.774  1.00 44.31  ? 354  ASN A O     1 
ATOM   3656 C CB    . ASN B 2 354 ? 52.221 -38.895 -3.311  1.00 46.03  ? 354  ASN A CB    1 
ATOM   3657 C CG    . ASN B 2 354 ? 51.401 -39.643 -4.361  1.00 47.31  ? 354  ASN A CG    1 
ATOM   3658 O OD1   . ASN B 2 354 ? 51.683 -39.571 -5.562  1.00 45.58  ? 354  ASN A OD1   1 
ATOM   3659 N ND2   . ASN B 2 354 ? 50.387 -40.372 -3.908  1.00 47.31  ? 354  ASN A ND2   1 
ATOM   3660 N N     . VAL B 2 355 ? 54.673 -38.910 -1.113  1.00 43.08  ? 355  VAL A N     1 
ATOM   3661 C CA    . VAL B 2 355 ? 55.491 -38.136 -0.201  1.00 41.64  ? 355  VAL A CA    1 
ATOM   3662 C C     . VAL B 2 355 ? 56.916 -38.183 -0.740  1.00 42.05  ? 355  VAL A C     1 
ATOM   3663 O O     . VAL B 2 355 ? 57.588 -37.160 -0.856  1.00 40.37  ? 355  VAL A O     1 
ATOM   3664 C CB    . VAL B 2 355 ? 55.463 -38.711 1.235   1.00 40.59  ? 355  VAL A CB    1 
ATOM   3665 C CG1   . VAL B 2 355 ? 56.517 -38.018 2.094   1.00 38.57  ? 355  VAL A CG1   1 
ATOM   3666 C CG2   . VAL B 2 355 ? 54.098 -38.504 1.848   1.00 39.26  ? 355  VAL A CG2   1 
ATOM   3667 N N     . LYS B 2 356 ? 57.365 -39.379 -1.093  1.00 43.91  ? 356  LYS A N     1 
ATOM   3668 C CA    . LYS B 2 356 ? 58.708 -39.523 -1.614  1.00 46.52  ? 356  LYS A CA    1 
ATOM   3669 C C     . LYS B 2 356 ? 58.850 -38.702 -2.889  1.00 46.84  ? 356  LYS A C     1 
ATOM   3670 O O     . LYS B 2 356 ? 59.889 -38.078 -3.122  1.00 47.21  ? 356  LYS A O     1 
ATOM   3671 C CB    . LYS B 2 356 ? 59.175 -40.979 -1.534  1.00 48.55  ? 356  LYS A CB    1 
ATOM   3672 C CG    . LYS B 2 356 ? 60.678 -41.122 -1.736  1.00 53.72  ? 356  LYS A CG    1 
ATOM   3673 C CD    . LYS B 2 356 ? 61.149 -42.560 -1.649  1.00 56.42  ? 356  LYS A CD    1 
ATOM   3674 C CE    . LYS B 2 356 ? 62.331 -42.793 -2.577  1.00 58.29  ? 356  LYS A CE    1 
ATOM   3675 N NZ    . LYS B 2 356 ? 63.524 -42.005 -2.156  1.00 59.01  ? 356  LYS A NZ    1 
ATOM   3676 N N     . LYS B 2 357 ? 57.808 -38.679 -3.713  1.00 46.65  ? 357  LYS A N     1 
ATOM   3677 C CA    . LYS B 2 357 ? 57.881 -37.895 -4.940  1.00 46.67  ? 357  LYS A CA    1 
ATOM   3678 C C     . LYS B 2 357 ? 57.941 -36.411 -4.604  1.00 45.59  ? 357  LYS A C     1 
ATOM   3679 O O     . LYS B 2 357 ? 58.723 -35.662 -5.187  1.00 46.06  ? 357  LYS A O     1 
ATOM   3680 C CB    . LYS B 2 357 ? 56.678 -38.180 -5.844  1.00 46.99  ? 357  LYS A CB    1 
ATOM   3681 C CG    . LYS B 2 357 ? 56.904 -39.324 -6.811  1.00 47.92  ? 357  LYS A CG    1 
ATOM   3682 C CD    . LYS B 2 357 ? 55.599 -39.888 -7.339  1.00 50.36  ? 357  LYS A CD    1 
ATOM   3683 C CE    . LYS B 2 357 ? 55.257 -39.324 -8.702  1.00 50.79  ? 357  LYS A CE    1 
ATOM   3684 N NZ    . LYS B 2 357 ? 54.025 -39.959 -9.232  1.00 54.50  ? 357  LYS A NZ    1 
ATOM   3685 N N     . PHE B 2 358 ? 57.119 -35.998 -3.648  1.00 44.54  ? 358  PHE A N     1 
ATOM   3686 C CA    . PHE B 2 358 ? 57.064 -34.610 -3.232  1.00 43.56  ? 358  PHE A CA    1 
ATOM   3687 C C     . PHE B 2 358 ? 58.383 -34.109 -2.641  1.00 44.70  ? 358  PHE A C     1 
ATOM   3688 O O     . PHE B 2 358 ? 58.716 -32.935 -2.761  1.00 44.96  ? 358  PHE A O     1 
ATOM   3689 C CB    . PHE B 2 358 ? 55.962 -34.431 -2.203  1.00 41.77  ? 358  PHE A CB    1 
ATOM   3690 C CG    . PHE B 2 358 ? 55.641 -32.993 -1.901  1.00 40.76  ? 358  PHE A CG    1 
ATOM   3691 C CD1   . PHE B 2 358 ? 55.102 -32.170 -2.884  1.00 38.59  ? 358  PHE A CD1   1 
ATOM   3692 C CD2   . PHE B 2 358 ? 55.825 -32.478 -0.619  1.00 39.61  ? 358  PHE A CD2   1 
ATOM   3693 C CE1   . PHE B 2 358 ? 54.742 -30.868 -2.594  1.00 38.66  ? 358  PHE A CE1   1 
ATOM   3694 C CE2   . PHE B 2 358 ? 55.468 -31.172 -0.319  1.00 37.95  ? 358  PHE A CE2   1 
ATOM   3695 C CZ    . PHE B 2 358 ? 54.924 -30.367 -1.309  1.00 39.19  ? 358  PHE A CZ    1 
ATOM   3696 N N     . LEU B 2 359 ? 59.130 -34.990 -1.992  1.00 45.28  ? 359  LEU A N     1 
ATOM   3697 C CA    . LEU B 2 359 ? 60.393 -34.580 -1.406  1.00 46.09  ? 359  LEU A CA    1 
ATOM   3698 C C     . LEU B 2 359 ? 61.557 -34.657 -2.396  1.00 47.63  ? 359  LEU A C     1 
ATOM   3699 O O     . LEU B 2 359 ? 62.619 -34.077 -2.151  1.00 47.53  ? 359  LEU A O     1 
ATOM   3700 C CB    . LEU B 2 359 ? 60.709 -35.431 -0.171  1.00 43.47  ? 359  LEU A CB    1 
ATOM   3701 C CG    . LEU B 2 359 ? 59.734 -35.374 1.008   1.00 42.37  ? 359  LEU A CG    1 
ATOM   3702 C CD1   . LEU B 2 359 ? 60.430 -35.899 2.268   1.00 41.42  ? 359  LEU A CD1   1 
ATOM   3703 C CD2   . LEU B 2 359 ? 59.269 -33.954 1.236   1.00 41.04  ? 359  LEU A CD2   1 
ATOM   3704 N N     . SER B 2 360 ? 61.358 -35.363 -3.508  1.00 48.54  ? 360  SER A N     1 
ATOM   3705 C CA    . SER B 2 360 ? 62.405 -35.512 -4.517  1.00 50.41  ? 360  SER A CA    1 
ATOM   3706 C C     . SER B 2 360 ? 62.728 -34.171 -5.164  1.00 52.56  ? 360  SER A C     1 
ATOM   3707 O O     . SER B 2 360 ? 63.870 -33.910 -5.535  1.00 52.29  ? 360  SER A O     1 
ATOM   3708 C CB    . SER B 2 360 ? 61.977 -36.508 -5.593  1.00 48.83  ? 360  SER A CB    1 
ATOM   3709 O OG    . SER B 2 360 ? 60.913 -35.990 -6.373  1.00 48.09  ? 360  SER A OG    1 
ATOM   3710 N N     . ARG B 2 361 ? 61.711 -33.329 -5.312  1.00 54.90  ? 361  ARG A N     1 
ATOM   3711 C CA    . ARG B 2 361 ? 61.888 -32.007 -5.890  1.00 56.97  ? 361  ARG A CA    1 
ATOM   3712 C C     . ARG B 2 361 ? 62.981 -31.259 -5.129  1.00 57.88  ? 361  ARG A C     1 
ATOM   3713 O O     . ARG B 2 361 ? 62.971 -31.199 -3.895  1.00 57.75  ? 361  ARG A O     1 
ATOM   3714 C CB    . ARG B 2 361 ? 60.585 -31.218 -5.785  1.00 60.21  ? 361  ARG A CB    1 
ATOM   3715 C CG    . ARG B 2 361 ? 59.622 -31.436 -6.918  1.00 65.76  ? 361  ARG A CG    1 
ATOM   3716 C CD    . ARG B 2 361 ? 60.038 -30.583 -8.097  1.00 70.34  ? 361  ARG A CD    1 
ATOM   3717 N NE    . ARG B 2 361 ? 59.078 -30.635 -9.191  1.00 73.34  ? 361  ARG A NE    1 
ATOM   3718 C CZ    . ARG B 2 361 ? 59.166 -29.893 -10.290 1.00 74.86  ? 361  ARG A CZ    1 
ATOM   3719 N NH1   . ARG B 2 361 ? 60.169 -29.039 -10.438 1.00 75.96  ? 361  ARG A NH1   1 
ATOM   3720 N NH2   . ARG B 2 361 ? 58.255 -30.010 -11.243 1.00 75.67  ? 361  ARG A NH2   1 
ATOM   3721 N N     . ASN B 2 362 ? 63.936 -30.697 -5.855  1.00 58.29  ? 362  ASN A N     1 
ATOM   3722 C CA    . ASN B 2 362 ? 64.975 -29.937 -5.191  1.00 58.82  ? 362  ASN A CA    1 
ATOM   3723 C C     . ASN B 2 362 ? 64.390 -28.546 -5.005  1.00 57.01  ? 362  ASN A C     1 
ATOM   3724 O O     . ASN B 2 362 ? 63.871 -27.944 -5.945  1.00 56.30  ? 362  ASN A O     1 
ATOM   3725 C CB    . ASN B 2 362 ? 66.253 -29.892 -6.034  1.00 61.87  ? 362  ASN A CB    1 
ATOM   3726 C CG    . ASN B 2 362 ? 66.016 -29.361 -7.426  1.00 65.85  ? 362  ASN A CG    1 
ATOM   3727 O OD1   . ASN B 2 362 ? 65.223 -29.917 -8.188  1.00 68.71  ? 362  ASN A OD1   1 
ATOM   3728 N ND2   . ASN B 2 362 ? 66.705 -28.279 -7.772  1.00 67.27  ? 362  ASN A ND2   1 
ATOM   3729 N N     . ARG B 2 363 ? 64.432 -28.059 -3.773  1.00 55.11  ? 363  ARG A N     1 
ATOM   3730 C CA    . ARG B 2 363 ? 63.902 -26.744 -3.465  1.00 52.94  ? 363  ARG A CA    1 
ATOM   3731 C C     . ARG B 2 363 ? 64.895 -26.010 -2.596  1.00 51.74  ? 363  ARG A C     1 
ATOM   3732 O O     . ARG B 2 363 ? 65.803 -26.606 -2.023  1.00 51.50  ? 363  ARG A O     1 
ATOM   3733 C CB    . ARG B 2 363 ? 62.562 -26.850 -2.731  1.00 52.16  ? 363  ARG A CB    1 
ATOM   3734 C CG    . ARG B 2 363 ? 61.436 -27.475 -3.545  1.00 51.85  ? 363  ARG A CG    1 
ATOM   3735 C CD    . ARG B 2 363 ? 60.173 -27.605 -2.701  1.00 50.41  ? 363  ARG A CD    1 
ATOM   3736 N NE    . ARG B 2 363 ? 59.618 -28.958 -2.716  1.00 47.99  ? 363  ARG A NE    1 
ATOM   3737 C CZ    . ARG B 2 363 ? 58.596 -29.333 -3.472  1.00 49.53  ? 363  ARG A CZ    1 
ATOM   3738 N NH1   . ARG B 2 363 ? 58.012 -28.454 -4.280  1.00 51.54  ? 363  ARG A NH1   1 
ATOM   3739 N NH2   . ARG B 2 363 ? 58.148 -30.581 -3.416  1.00 48.96  ? 363  ARG A NH2   1 
ATOM   3740 N N     . ALA B 2 364 ? 64.709 -24.706 -2.493  1.00 50.32  ? 364  ALA A N     1 
ATOM   3741 C CA    . ALA B 2 364 ? 65.599 -23.890 -1.697  1.00 49.63  ? 364  ALA A CA    1 
ATOM   3742 C C     . ALA B 2 364 ? 65.346 -24.030 -0.200  1.00 49.24  ? 364  ALA A C     1 
ATOM   3743 O O     . ALA B 2 364 ? 66.284 -23.949 0.588   1.00 48.19  ? 364  ALA A O     1 
ATOM   3744 C CB    . ALA B 2 364 ? 65.463 -22.418 -2.116  1.00 48.18  ? 364  ALA A CB    1 
ATOM   3745 N N     . PHE B 2 365 ? 64.099 -24.290 0.197   1.00 48.72  ? 365  PHE A N     1 
ATOM   3746 C CA    . PHE B 2 365 ? 63.806 -24.337 1.621   1.00 48.29  ? 365  PHE A CA    1 
ATOM   3747 C C     . PHE B 2 365 ? 63.223 -25.542 2.356   1.00 48.98  ? 365  PHE A C     1 
ATOM   3748 O O     . PHE B 2 365 ? 62.537 -25.340 3.347   1.00 53.73  ? 365  PHE A O     1 
ATOM   3749 C CB    . PHE B 2 365 ? 62.800 -23.237 1.940   1.00 44.55  ? 365  PHE A CB    1 
ATOM   3750 C CG    . PHE B 2 365 ? 63.365 -21.860 1.809   1.00 42.19  ? 365  PHE A CG    1 
ATOM   3751 C CD1   . PHE B 2 365 ? 63.143 -21.106 0.665   1.00 41.81  ? 365  PHE A CD1   1 
ATOM   3752 C CD2   . PHE B 2 365 ? 64.161 -21.332 2.812   1.00 40.83  ? 365  PHE A CD2   1 
ATOM   3753 C CE1   . PHE B 2 365 ? 63.704 -19.845 0.518   1.00 40.12  ? 365  PHE A CE1   1 
ATOM   3754 C CE2   . PHE B 2 365 ? 64.732 -20.069 2.677   1.00 40.06  ? 365  PHE A CE2   1 
ATOM   3755 C CZ    . PHE B 2 365 ? 64.503 -19.323 1.526   1.00 40.02  ? 365  PHE A CZ    1 
ATOM   3756 N N     . ARG B 2 366 ? 63.447 -26.776 1.932   1.00 48.33  ? 366  ARG A N     1 
ATOM   3757 C CA    . ARG B 2 366 ? 63.146 -27.917 2.822   1.00 48.16  ? 366  ARG A CA    1 
ATOM   3758 C C     . ARG B 2 366 ? 61.710 -27.932 3.356   1.00 45.89  ? 366  ARG A C     1 
ATOM   3759 O O     . ARG B 2 366 ? 61.345 -27.131 4.211   1.00 43.11  ? 366  ARG A O     1 
ATOM   3760 C CB    . ARG B 2 366 ? 64.112 -27.904 4.013   1.00 50.12  ? 366  ARG A CB    1 
ATOM   3761 C CG    . ARG B 2 366 ? 63.865 -28.981 5.051   1.00 56.39  ? 366  ARG A CG    1 
ATOM   3762 C CD    . ARG B 2 366 ? 64.830 -28.843 6.226   1.00 60.81  ? 366  ARG A CD    1 
ATOM   3763 N NE    . ARG B 2 366 ? 66.238 -28.879 5.821   1.00 66.74  ? 366  ARG A NE    1 
ATOM   3764 C CZ    . ARG B 2 366 ? 66.864 -29.953 5.336   1.00 69.87  ? 366  ARG A CZ    1 
ATOM   3765 N NH1   . ARG B 2 366 ? 66.208 -31.102 5.188   1.00 70.18  ? 366  ARG A NH1   1 
ATOM   3766 N NH2   . ARG B 2 366 ? 68.152 -29.881 5.002   1.00 69.37  ? 366  ARG A NH2   1 
ATOM   3767 N N     . PRO B 2 367 ? 60.879 -28.860 2.856   1.00 44.87  ? 367  PRO A N     1 
ATOM   3768 C CA    . PRO B 2 367 ? 59.486 -28.954 3.297   1.00 43.58  ? 367  PRO A CA    1 
ATOM   3769 C C     . PRO B 2 367 ? 59.268 -29.405 4.736   1.00 42.31  ? 367  PRO A C     1 
ATOM   3770 O O     . PRO B 2 367 ? 60.159 -29.961 5.374   1.00 42.72  ? 367  PRO A O     1 
ATOM   3771 C CB    . PRO B 2 367 ? 58.857 -29.897 2.266   1.00 45.23  ? 367  PRO A CB    1 
ATOM   3772 C CG    . PRO B 2 367 ? 59.995 -30.689 1.770   1.00 45.43  ? 367  PRO A CG    1 
ATOM   3773 C CD    . PRO B 2 367 ? 61.108 -29.695 1.666   1.00 44.54  ? 367  PRO A CD    1 
ATOM   3774 N N     . PHE B 2 368 ? 58.062 -29.159 5.232   1.00 40.15  ? 368  PHE A N     1 
ATOM   3775 C CA    . PHE B 2 368 ? 57.694 -29.489 6.602   1.00 38.12  ? 368  PHE A CA    1 
ATOM   3776 C C     . PHE B 2 368 ? 56.318 -30.135 6.696   1.00 37.94  ? 368  PHE A C     1 
ATOM   3777 O O     . PHE B 2 368 ? 55.570 -30.169 5.723   1.00 38.31  ? 368  PHE A O     1 
ATOM   3778 C CB    . PHE B 2 368 ? 57.685 -28.212 7.448   1.00 36.14  ? 368  PHE A CB    1 
ATOM   3779 C CG    . PHE B 2 368 ? 56.747 -27.158 6.935   1.00 33.87  ? 368  PHE A CG    1 
ATOM   3780 C CD1   . PHE B 2 368 ? 57.091 -26.376 5.829   1.00 35.00  ? 368  PHE A CD1   1 
ATOM   3781 C CD2   . PHE B 2 368 ? 55.506 -26.971 7.527   1.00 34.03  ? 368  PHE A CD2   1 
ATOM   3782 C CE1   . PHE B 2 368 ? 56.209 -25.421 5.317   1.00 34.67  ? 368  PHE A CE1   1 
ATOM   3783 C CE2   . PHE B 2 368 ? 54.608 -26.020 7.026   1.00 35.26  ? 368  PHE A CE2   1 
ATOM   3784 C CZ    . PHE B 2 368 ? 54.958 -25.243 5.918   1.00 34.29  ? 368  PHE A CZ    1 
ATOM   3785 N N     . ILE B 2 369 ? 55.995 -30.635 7.884   1.00 37.06  ? 369  ILE A N     1 
ATOM   3786 C CA    . ILE B 2 369 ? 54.700 -31.253 8.143   1.00 38.01  ? 369  ILE A CA    1 
ATOM   3787 C C     . ILE B 2 369 ? 53.827 -30.304 8.970   1.00 37.80  ? 369  ILE A C     1 
ATOM   3788 O O     . ILE B 2 369 ? 54.328 -29.562 9.802   1.00 38.54  ? 369  ILE A O     1 
ATOM   3789 C CB    . ILE B 2 369 ? 54.850 -32.571 8.925   1.00 37.67  ? 369  ILE A CB    1 
ATOM   3790 C CG1   . ILE B 2 369 ? 55.616 -33.586 8.088   1.00 38.58  ? 369  ILE A CG1   1 
ATOM   3791 C CG2   . ILE B 2 369 ? 53.487 -33.127 9.271   1.00 37.16  ? 369  ILE A CG2   1 
ATOM   3792 C CD1   . ILE B 2 369 ? 55.888 -34.876 8.823   1.00 38.89  ? 369  ILE A CD1   1 
ATOM   3793 N N     . GLU B 2 370 ? 52.521 -30.330 8.724   1.00 38.10  ? 370  GLU A N     1 
ATOM   3794 C CA    . GLU B 2 370 ? 51.565 -29.494 9.444   1.00 38.49  ? 370  GLU A CA    1 
ATOM   3795 C C     . GLU B 2 370 ? 50.190 -30.116 9.294   1.00 39.01  ? 370  GLU A C     1 
ATOM   3796 O O     . GLU B 2 370 ? 49.699 -30.287 8.177   1.00 38.94  ? 370  GLU A O     1 
ATOM   3797 C CB    . GLU B 2 370 ? 51.543 -28.077 8.876   1.00 40.22  ? 370  GLU A CB    1 
ATOM   3798 C CG    . GLU B 2 370 ? 50.454 -27.208 9.473   1.00 40.91  ? 370  GLU A CG    1 
ATOM   3799 C CD    . GLU B 2 370 ? 50.311 -25.865 8.779   1.00 42.95  ? 370  GLU A CD    1 
ATOM   3800 O OE1   . GLU B 2 370 ? 51.269 -25.068 8.828   1.00 41.01  ? 370  GLU A OE1   1 
ATOM   3801 O OE2   . GLU B 2 370 ? 49.234 -25.606 8.191   1.00 44.64  ? 370  GLU A OE2   1 
ATOM   3802 N N     . ASN B 2 371 ? 49.577 -30.448 10.427  1.00 38.15  ? 371  ASN A N     1 
ATOM   3803 C CA    . ASN B 2 371 ? 48.262 -31.077 10.459  1.00 39.15  ? 371  ASN A CA    1 
ATOM   3804 C C     . ASN B 2 371 ? 48.166 -32.285 9.533   1.00 38.77  ? 371  ASN A C     1 
ATOM   3805 O O     . ASN B 2 371 ? 47.276 -32.378 8.687   1.00 39.76  ? 371  ASN A O     1 
ATOM   3806 C CB    . ASN B 2 371 ? 47.159 -30.071 10.115  1.00 40.44  ? 371  ASN A CB    1 
ATOM   3807 C CG    . ASN B 2 371 ? 47.258 -28.800 10.931  1.00 44.60  ? 371  ASN A CG    1 
ATOM   3808 O OD1   . ASN B 2 371 ? 47.218 -28.831 12.160  1.00 45.92  ? 371  ASN A OD1   1 
ATOM   3809 N ND2   . ASN B 2 371 ? 47.398 -27.667 10.248  1.00 46.09  ? 371  ASN A ND2   1 
ATOM   3810 N N     . GLY B 2 372 ? 49.105 -33.204 9.675   1.00 37.45  ? 372  GLY A N     1 
ATOM   3811 C CA    . GLY B 2 372 ? 49.048 -34.417 8.889   1.00 38.21  ? 372  GLY A CA    1 
ATOM   3812 C C     . GLY B 2 372 ? 49.555 -34.454 7.467   1.00 39.15  ? 372  GLY A C     1 
ATOM   3813 O O     . GLY B 2 372 ? 49.636 -35.545 6.889   1.00 40.23  ? 372  GLY A O     1 
ATOM   3814 N N     . ARG B 2 373 ? 49.867 -33.308 6.872   1.00 38.92  ? 373  ARG A N     1 
ATOM   3815 C CA    . ARG B 2 373 ? 50.388 -33.346 5.513   1.00 39.31  ? 373  ARG A CA    1 
ATOM   3816 C C     . ARG B 2 373 ? 51.622 -32.496 5.328   1.00 39.66  ? 373  ARG A C     1 
ATOM   3817 O O     . ARG B 2 373 ? 51.904 -31.606 6.130   1.00 41.22  ? 373  ARG A O     1 
ATOM   3818 C CB    . ARG B 2 373 ? 49.315 -32.960 4.490   1.00 39.60  ? 373  ARG A CB    1 
ATOM   3819 C CG    . ARG B 2 373 ? 48.665 -31.622 4.676   1.00 40.18  ? 373  ARG A CG    1 
ATOM   3820 C CD    . ARG B 2 373 ? 47.320 -31.631 3.953   1.00 40.17  ? 373  ARG A CD    1 
ATOM   3821 N NE    . ARG B 2 373 ? 47.453 -32.192 2.614   1.00 40.22  ? 373  ARG A NE    1 
ATOM   3822 C CZ    . ARG B 2 373 ? 46.530 -32.941 2.016   1.00 39.67  ? 373  ARG A CZ    1 
ATOM   3823 N NH1   . ARG B 2 373 ? 45.400 -33.222 2.636   1.00 39.26  ? 373  ARG A NH1   1 
ATOM   3824 N NH2   . ARG B 2 373 ? 46.748 -33.425 0.803   1.00 39.55  ? 373  ARG A NH2   1 
ATOM   3825 N N     . TRP B 2 374 ? 52.376 -32.803 4.278   1.00 39.37  ? 374  TRP A N     1 
ATOM   3826 C CA    . TRP B 2 374 ? 53.592 -32.073 3.979   1.00 38.45  ? 374  TRP A CA    1 
ATOM   3827 C C     . TRP B 2 374 ? 53.294 -30.807 3.191   1.00 39.72  ? 374  TRP A C     1 
ATOM   3828 O O     . TRP B 2 374 ? 52.329 -30.741 2.426   1.00 39.84  ? 374  TRP A O     1 
ATOM   3829 C CB    . TRP B 2 374 ? 54.548 -32.930 3.162   1.00 36.74  ? 374  TRP A CB    1 
ATOM   3830 C CG    . TRP B 2 374 ? 55.205 -34.030 3.903   1.00 35.70  ? 374  TRP A CG    1 
ATOM   3831 C CD1   . TRP B 2 374 ? 54.715 -35.283 4.126   1.00 35.87  ? 374  TRP A CD1   1 
ATOM   3832 C CD2   . TRP B 2 374 ? 56.500 -33.992 4.498   1.00 35.25  ? 374  TRP A CD2   1 
ATOM   3833 N NE1   . TRP B 2 374 ? 55.632 -36.033 4.823   1.00 34.25  ? 374  TRP A NE1   1 
ATOM   3834 C CE2   . TRP B 2 374 ? 56.739 -35.263 5.062   1.00 34.88  ? 374  TRP A CE2   1 
ATOM   3835 C CE3   . TRP B 2 374 ? 57.488 -33.005 4.608   1.00 35.50  ? 374  TRP A CE3   1 
ATOM   3836 C CZ2   . TRP B 2 374 ? 57.927 -35.575 5.723   1.00 36.06  ? 374  TRP A CZ2   1 
ATOM   3837 C CZ3   . TRP B 2 374 ? 58.671 -33.317 5.267   1.00 35.15  ? 374  TRP A CZ3   1 
ATOM   3838 C CH2   . TRP B 2 374 ? 58.880 -34.593 5.814   1.00 35.24  ? 374  TRP A CH2   1 
ATOM   3839 N N     . TRP B 2 375 ? 54.134 -29.801 3.395   1.00 39.97  ? 375  TRP A N     1 
ATOM   3840 C CA    . TRP B 2 375 ? 54.010 -28.536 2.695   1.00 39.92  ? 375  TRP A CA    1 
ATOM   3841 C C     . TRP B 2 375 ? 55.407 -28.126 2.284   1.00 40.32  ? 375  TRP A C     1 
ATOM   3842 O O     . TRP B 2 375 ? 56.382 -28.463 2.951   1.00 41.18  ? 375  TRP A O     1 
ATOM   3843 C CB    . TRP B 2 375 ? 53.423 -27.453 3.596   1.00 38.96  ? 375  TRP A CB    1 
ATOM   3844 C CG    . TRP B 2 375 ? 52.047 -27.722 4.044   1.00 38.83  ? 375  TRP A CG    1 
ATOM   3845 C CD1   . TRP B 2 375 ? 51.665 -28.559 5.044   1.00 38.98  ? 375  TRP A CD1   1 
ATOM   3846 C CD2   . TRP B 2 375 ? 50.845 -27.167 3.500   1.00 38.43  ? 375  TRP A CD2   1 
ATOM   3847 N NE1   . TRP B 2 375 ? 50.296 -28.561 5.162   1.00 40.30  ? 375  TRP A NE1   1 
ATOM   3848 C CE2   . TRP B 2 375 ? 49.768 -27.718 4.224   1.00 39.08  ? 375  TRP A CE2   1 
ATOM   3849 C CE3   . TRP B 2 375 ? 50.576 -26.259 2.473   1.00 40.59  ? 375  TRP A CE3   1 
ATOM   3850 C CZ2   . TRP B 2 375 ? 48.438 -27.394 3.952   1.00 39.82  ? 375  TRP A CZ2   1 
ATOM   3851 C CZ3   . TRP B 2 375 ? 49.242 -25.932 2.201   1.00 40.59  ? 375  TRP A CZ3   1 
ATOM   3852 C CH2   . TRP B 2 375 ? 48.195 -26.499 2.940   1.00 39.75  ? 375  TRP A CH2   1 
ATOM   3853 N N     . ALA B 2 376 ? 55.504 -27.395 1.183   1.00 39.88  ? 376  ALA A N     1 
ATOM   3854 C CA    . ALA B 2 376 ? 56.796 -26.939 0.709   1.00 39.24  ? 376  ALA A CA    1 
ATOM   3855 C C     . ALA B 2 376 ? 56.734 -25.440 0.477   1.00 39.03  ? 376  ALA A C     1 
ATOM   3856 O O     . ALA B 2 376 ? 55.671 -24.899 0.155   1.00 38.88  ? 376  ALA A O     1 
ATOM   3857 C CB    . ALA B 2 376 ? 57.152 -27.654 -0.584  1.00 40.11  ? 376  ALA A CB    1 
ATOM   3858 N N     . PHE B 2 377 ? 57.862 -24.767 0.682   1.00 38.59  ? 377  PHE A N     1 
ATOM   3859 C CA    . PHE B 2 377 ? 57.943 -23.337 0.434   1.00 38.90  ? 377  PHE A CA    1 
ATOM   3860 C C     . PHE B 2 377 ? 58.397 -23.256 -1.011  1.00 40.96  ? 377  PHE A C     1 
ATOM   3861 O O     . PHE B 2 377 ? 59.274 -24.009 -1.429  1.00 40.76  ? 377  PHE A O     1 
ATOM   3862 C CB    . PHE B 2 377 ? 58.986 -22.673 1.332   1.00 36.19  ? 377  PHE A CB    1 
ATOM   3863 C CG    . PHE B 2 377 ? 58.547 -22.511 2.752   1.00 33.70  ? 377  PHE A CG    1 
ATOM   3864 C CD1   . PHE B 2 377 ? 59.280 -23.077 3.790   1.00 33.09  ? 377  PHE A CD1   1 
ATOM   3865 C CD2   . PHE B 2 377 ? 57.393 -21.797 3.059   1.00 32.63  ? 377  PHE A CD2   1 
ATOM   3866 C CE1   . PHE B 2 377 ? 58.873 -22.935 5.114   1.00 31.92  ? 377  PHE A CE1   1 
ATOM   3867 C CE2   . PHE B 2 377 ? 56.976 -21.648 4.388   1.00 32.65  ? 377  PHE A CE2   1 
ATOM   3868 C CZ    . PHE B 2 377 ? 57.719 -22.220 5.414   1.00 31.69  ? 377  PHE A CZ    1 
ATOM   3869 N N     . GLU B 2 378 ? 57.794 -22.359 -1.778  1.00 42.61  ? 378  GLU A N     1 
ATOM   3870 C CA    . GLU B 2 378 ? 58.152 -22.206 -3.180  1.00 43.99  ? 378  GLU A CA    1 
ATOM   3871 C C     . GLU B 2 378 ? 58.427 -20.726 -3.433  1.00 43.00  ? 378  GLU A C     1 
ATOM   3872 O O     . GLU B 2 378 ? 58.106 -19.883 -2.591  1.00 43.17  ? 378  GLU A O     1 
ATOM   3873 C CB    . GLU B 2 378 ? 57.001 -22.690 -4.067  1.00 47.13  ? 378  GLU A CB    1 
ATOM   3874 C CG    . GLU B 2 378 ? 57.398 -23.653 -5.177  1.00 51.50  ? 378  GLU A CG    1 
ATOM   3875 C CD    . GLU B 2 378 ? 57.658 -25.059 -4.672  1.00 54.43  ? 378  GLU A CD    1 
ATOM   3876 O OE1   . GLU B 2 378 ? 58.585 -25.241 -3.858  1.00 57.32  ? 378  GLU A OE1   1 
ATOM   3877 O OE2   . GLU B 2 378 ? 56.935 -25.989 -5.088  1.00 56.91  ? 378  GLU A OE2   1 
ATOM   3878 N N     . MET B 2 379 ? 59.017 -20.416 -4.585  1.00 41.82  ? 379  MET A N     1 
ATOM   3879 C CA    . MET B 2 379 ? 59.334 -19.035 -4.944  1.00 41.50  ? 379  MET A CA    1 
ATOM   3880 C C     . MET B 2 379 ? 58.589 -18.593 -6.207  1.00 40.63  ? 379  MET A C     1 
ATOM   3881 O O     . MET B 2 379 ? 58.521 -19.332 -7.186  1.00 40.77  ? 379  MET A O     1 
ATOM   3882 C CB    . MET B 2 379 ? 60.845 -18.880 -5.164  1.00 41.80  ? 379  MET A CB    1 
ATOM   3883 C CG    . MET B 2 379 ? 61.703 -19.290 -3.980  1.00 43.07  ? 379  MET A CG    1 
ATOM   3884 S SD    . MET B 2 379 ? 61.374 -18.333 -2.485  1.00 45.05  ? 379  MET A SD    1 
ATOM   3885 C CE    . MET B 2 379 ? 62.593 -17.060 -2.608  1.00 46.13  ? 379  MET A CE    1 
ATOM   3886 N N     . ARG B 2 380 ? 58.042 -17.381 -6.177  1.00 40.04  ? 380  ARG A N     1 
ATOM   3887 C CA    . ARG B 2 380 ? 57.304 -16.819 -7.314  1.00 39.18  ? 380  ARG A CA    1 
ATOM   3888 C C     . ARG B 2 380 ? 58.212 -16.198 -8.381  1.00 39.56  ? 380  ARG A C     1 
ATOM   3889 O O     . ARG B 2 380 ? 59.309 -15.712 -8.090  1.00 39.94  ? 380  ARG A O     1 
ATOM   3890 C CB    . ARG B 2 380 ? 56.329 -15.739 -6.829  1.00 37.17  ? 380  ARG A CB    1 
ATOM   3891 C CG    . ARG B 2 380 ? 55.236 -16.231 -5.886  1.00 36.85  ? 380  ARG A CG    1 
ATOM   3892 C CD    . ARG B 2 380 ? 54.328 -15.092 -5.472  1.00 34.27  ? 380  ARG A CD    1 
ATOM   3893 N NE    . ARG B 2 380 ? 53.181 -15.560 -4.700  1.00 35.77  ? 380  ARG A NE    1 
ATOM   3894 C CZ    . ARG B 2 380 ? 53.141 -15.666 -3.374  1.00 36.09  ? 380  ARG A CZ    1 
ATOM   3895 N NH1   . ARG B 2 380 ? 54.192 -15.335 -2.629  1.00 35.68  ? 380  ARG A NH1   1 
ATOM   3896 N NH2   . ARG B 2 380 ? 52.037 -16.105 -2.791  1.00 36.53  ? 380  ARG A NH2   1 
ATOM   3897 N N     . LYS B 2 381 ? 57.743 -16.204 -9.620  1.00 40.36  ? 381  LYS A N     1 
ATOM   3898 C CA    . LYS B 2 381 ? 58.495 -15.600 -10.719 1.00 41.31  ? 381  LYS A CA    1 
ATOM   3899 C C     . LYS B 2 381 ? 58.219 -14.095 -10.740 1.00 39.98  ? 381  LYS A C     1 
ATOM   3900 O O     . LYS B 2 381 ? 58.877 -13.349 -11.450 1.00 39.96  ? 381  LYS A O     1 
ATOM   3901 C CB    . LYS B 2 381 ? 58.064 -16.200 -12.065 1.00 46.26  ? 381  LYS A CB    1 
ATOM   3902 C CG    . LYS B 2 381 ? 58.508 -17.638 -12.339 1.00 49.67  ? 381  LYS A CG    1 
ATOM   3903 C CD    . LYS B 2 381 ? 59.959 -17.698 -12.792 1.00 53.48  ? 381  LYS A CD    1 
ATOM   3904 C CE    . LYS B 2 381 ? 60.291 -19.043 -13.427 1.00 55.67  ? 381  LYS A CE    1 
ATOM   3905 N NZ    . LYS B 2 381 ? 60.018 -20.189 -12.514 1.00 56.15  ? 381  LYS A NZ    1 
ATOM   3906 N N     . PHE B 2 382 ? 57.229 -13.653 -9.971  1.00 38.61  ? 382  PHE A N     1 
ATOM   3907 C CA    . PHE B 2 382 ? 56.875 -12.237 -9.929  1.00 36.63  ? 382  PHE A CA    1 
ATOM   3908 C C     . PHE B 2 382 ? 56.274 -11.884 -8.588  1.00 35.36  ? 382  PHE A C     1 
ATOM   3909 O O     . PHE B 2 382 ? 55.589 -12.700 -7.985  1.00 36.77  ? 382  PHE A O     1 
ATOM   3910 C CB    . PHE B 2 382 ? 55.892 -11.893 -11.065 1.00 36.48  ? 382  PHE A CB    1 
ATOM   3911 C CG    . PHE B 2 382 ? 54.803 -12.909 -11.265 1.00 35.36  ? 382  PHE A CG    1 
ATOM   3912 C CD1   . PHE B 2 382 ? 53.766 -13.040 -10.339 1.00 35.79  ? 382  PHE A CD1   1 
ATOM   3913 C CD2   . PHE B 2 382 ? 54.814 -13.740 -12.380 1.00 35.23  ? 382  PHE A CD2   1 
ATOM   3914 C CE1   . PHE B 2 382 ? 52.747 -13.990 -10.524 1.00 34.66  ? 382  PHE A CE1   1 
ATOM   3915 C CE2   . PHE B 2 382 ? 53.804 -14.690 -12.577 1.00 35.48  ? 382  PHE A CE2   1 
ATOM   3916 C CZ    . PHE B 2 382 ? 52.766 -14.815 -11.643 1.00 34.77  ? 382  PHE A CZ    1 
ATOM   3917 N N     . THR B 2 383 ? 56.524 -10.665 -8.123  1.00 33.74  ? 383  THR A N     1 
ATOM   3918 C CA    . THR B 2 383 ? 56.011 -10.248 -6.828  1.00 31.90  ? 383  THR A CA    1 
ATOM   3919 C C     . THR B 2 383 ? 55.163 -8.986  -6.852  1.00 31.99  ? 383  THR A C     1 
ATOM   3920 O O     . THR B 2 383 ? 54.867 -8.419  -5.806  1.00 32.25  ? 383  THR A O     1 
ATOM   3921 C CB    . THR B 2 383 ? 57.157 -10.046 -5.833  1.00 32.88  ? 383  THR A CB    1 
ATOM   3922 O OG1   . THR B 2 383 ? 57.945 -8.917  -6.228  1.00 31.07  ? 383  THR A OG1   1 
ATOM   3923 C CG2   . THR B 2 383 ? 58.035 -11.281 -5.793  1.00 30.03  ? 383  THR A CG2   1 
ATOM   3924 N N     . THR B 2 384 ? 54.777 -8.538  -8.043  1.00 31.24  ? 384  THR A N     1 
ATOM   3925 C CA    . THR B 2 384 ? 53.931 -7.361  -8.166  1.00 29.82  ? 384  THR A CA    1 
ATOM   3926 C C     . THR B 2 384 ? 52.856 -7.660  -9.179  1.00 31.24  ? 384  THR A C     1 
ATOM   3927 O O     . THR B 2 384 ? 53.045 -8.503  -10.057 1.00 32.20  ? 384  THR A O     1 
ATOM   3928 C CB    . THR B 2 384 ? 54.702 -6.105  -8.652  1.00 29.61  ? 384  THR A CB    1 
ATOM   3929 O OG1   . THR B 2 384 ? 55.298 -6.361  -9.931  1.00 30.24  ? 384  THR A OG1   1 
ATOM   3930 C CG2   . THR B 2 384 ? 55.771 -5.708  -7.637  1.00 27.40  ? 384  THR A CG2   1 
ATOM   3931 N N     . PRO B 2 385 ? 51.697 -6.992  -9.057  1.00 30.97  ? 385  PRO A N     1 
ATOM   3932 C CA    . PRO B 2 385 ? 50.577 -7.185  -9.980  1.00 30.04  ? 385  PRO A CA    1 
ATOM   3933 C C     . PRO B 2 385 ? 51.013 -6.849  -11.408 1.00 30.60  ? 385  PRO A C     1 
ATOM   3934 O O     . PRO B 2 385 ? 50.752 -7.598  -12.346 1.00 30.47  ? 385  PRO A O     1 
ATOM   3935 C CB    . PRO B 2 385 ? 49.539 -6.198  -9.469  1.00 31.19  ? 385  PRO A CB    1 
ATOM   3936 C CG    . PRO B 2 385 ? 49.838 -6.099  -8.015  1.00 30.63  ? 385  PRO A CG    1 
ATOM   3937 C CD    . PRO B 2 385 ? 51.324 -6.087  -7.954  1.00 30.01  ? 385  PRO A CD    1 
ATOM   3938 N N     . GLU B 2 386 ? 51.681 -5.711  -11.565 1.00 31.17  ? 386  GLU A N     1 
ATOM   3939 C CA    . GLU B 2 386 ? 52.139 -5.281  -12.880 1.00 32.17  ? 386  GLU A CA    1 
ATOM   3940 C C     . GLU B 2 386 ? 53.053 -6.329  -13.504 1.00 33.48  ? 386  GLU A C     1 
ATOM   3941 O O     . GLU B 2 386 ? 53.006 -6.564  -14.709 1.00 34.80  ? 386  GLU A O     1 
ATOM   3942 C CB    . GLU B 2 386 ? 52.871 -3.935  -12.784 1.00 31.00  ? 386  GLU A CB    1 
ATOM   3943 C CG    . GLU B 2 386 ? 52.004 -2.762  -12.317 1.00 31.71  ? 386  GLU A CG    1 
ATOM   3944 C CD    . GLU B 2 386 ? 51.950 -2.599  -10.786 1.00 33.34  ? 386  GLU A CD    1 
ATOM   3945 O OE1   . GLU B 2 386 ? 52.276 -3.563  -10.042 1.00 30.31  ? 386  GLU A OE1   1 
ATOM   3946 O OE2   . GLU B 2 386 ? 51.560 -1.497  -10.331 1.00 32.51  ? 386  GLU A OE2   1 
ATOM   3947 N N     . GLU B 2 387 ? 53.878 -6.963  -12.679 1.00 33.69  ? 387  GLU A N     1 
ATOM   3948 C CA    . GLU B 2 387 ? 54.795 -7.986  -13.161 1.00 35.30  ? 387  GLU A CA    1 
ATOM   3949 C C     . GLU B 2 387 ? 54.053 -9.223  -13.645 1.00 34.98  ? 387  GLU A C     1 
ATOM   3950 O O     . GLU B 2 387 ? 54.363 -9.777  -14.703 1.00 35.11  ? 387  GLU A O     1 
ATOM   3951 C CB    . GLU B 2 387 ? 55.756 -8.399  -12.052 1.00 37.67  ? 387  GLU A CB    1 
ATOM   3952 C CG    . GLU B 2 387 ? 57.045 -7.637  -12.023 1.00 40.75  ? 387  GLU A CG    1 
ATOM   3953 C CD    . GLU B 2 387 ? 57.898 -8.016  -10.826 1.00 43.82  ? 387  GLU A CD    1 
ATOM   3954 O OE1   . GLU B 2 387 ? 58.014 -9.226  -10.523 1.00 44.78  ? 387  GLU A OE1   1 
ATOM   3955 O OE2   . GLU B 2 387 ? 58.458 -7.102  -10.193 1.00 43.28  ? 387  GLU A OE2   1 
ATOM   3956 N N     . GLY B 2 388 ? 53.095 -9.668  -12.839 1.00 34.47  ? 388  GLY A N     1 
ATOM   3957 C CA    . GLY B 2 388 ? 52.320 -10.832 -13.198 1.00 33.51  ? 388  GLY A CA    1 
ATOM   3958 C C     . GLY B 2 388 ? 51.610 -10.622 -14.521 1.00 32.84  ? 388  GLY A C     1 
ATOM   3959 O O     . GLY B 2 388 ? 51.699 -11.467 -15.416 1.00 32.87  ? 388  GLY A O     1 
ATOM   3960 N N     . VAL B 2 389 ? 50.914 -9.493  -14.652 1.00 32.24  ? 389  VAL A N     1 
ATOM   3961 C CA    . VAL B 2 389 ? 50.184 -9.201  -15.877 1.00 32.34  ? 389  VAL A CA    1 
ATOM   3962 C C     . VAL B 2 389 ? 51.117 -9.092  -17.085 1.00 34.43  ? 389  VAL A C     1 
ATOM   3963 O O     . VAL B 2 389 ? 50.772 -9.564  -18.176 1.00 34.71  ? 389  VAL A O     1 
ATOM   3964 C CB    . VAL B 2 389 ? 49.319 -7.919  -15.724 1.00 31.04  ? 389  VAL A CB    1 
ATOM   3965 C CG1   . VAL B 2 389 ? 48.560 -7.620  -17.013 1.00 27.34  ? 389  VAL A CG1   1 
ATOM   3966 C CG2   . VAL B 2 389 ? 48.322 -8.122  -14.594 1.00 30.40  ? 389  VAL A CG2   1 
ATOM   3967 N N     . ARG B 2 390 ? 52.296 -8.492  -16.907 1.00 33.81  ? 390  ARG A N     1 
ATOM   3968 C CA    . ARG B 2 390 ? 53.226 -8.402  -18.023 1.00 33.49  ? 390  ARG A CA    1 
ATOM   3969 C C     . ARG B 2 390 ? 53.550 -9.816  -18.451 1.00 33.58  ? 390  ARG A C     1 
ATOM   3970 O O     . ARG B 2 390 ? 53.653 -10.115 -19.642 1.00 35.49  ? 390  ARG A O     1 
ATOM   3971 C CB    . ARG B 2 390 ? 54.527 -7.711  -17.647 1.00 35.33  ? 390  ARG A CB    1 
ATOM   3972 C CG    . ARG B 2 390 ? 55.521 -7.716  -18.814 1.00 34.06  ? 390  ARG A CG    1 
ATOM   3973 C CD    . ARG B 2 390 ? 56.948 -7.806  -18.332 1.00 35.37  ? 390  ARG A CD    1 
ATOM   3974 N NE    . ARG B 2 390 ? 57.432 -6.556  -17.758 1.00 36.96  ? 390  ARG A NE    1 
ATOM   3975 C CZ    . ARG B 2 390 ? 58.024 -6.458  -16.571 1.00 38.22  ? 390  ARG A CZ    1 
ATOM   3976 N NH1   . ARG B 2 390 ? 58.197 -7.546  -15.821 1.00 34.97  ? 390  ARG A NH1   1 
ATOM   3977 N NH2   . ARG B 2 390 ? 58.461 -5.273  -16.142 1.00 37.79  ? 390  ARG A NH2   1 
ATOM   3978 N N     . SER B 2 391 ? 53.712 -10.697 -17.477 1.00 32.43  ? 391  SER A N     1 
ATOM   3979 C CA    . SER B 2 391 ? 54.004 -12.085 -17.799 1.00 33.33  ? 391  SER A CA    1 
ATOM   3980 C C     . SER B 2 391 ? 52.808 -12.761 -18.480 1.00 33.30  ? 391  SER A C     1 
ATOM   3981 O O     . SER B 2 391 ? 52.949 -13.374 -19.548 1.00 33.47  ? 391  SER A O     1 
ATOM   3982 C CB    . SER B 2 391 ? 54.360 -12.869 -16.536 1.00 32.36  ? 391  SER A CB    1 
ATOM   3983 O OG    . SER B 2 391 ? 54.668 -14.211 -16.873 1.00 32.74  ? 391  SER A OG    1 
ATOM   3984 N N     . TYR B 2 392 ? 51.639 -12.636 -17.853 1.00 31.99  ? 392  TYR A N     1 
ATOM   3985 C CA    . TYR B 2 392 ? 50.405 -13.245 -18.349 1.00 32.49  ? 392  TYR A CA    1 
ATOM   3986 C C     . TYR B 2 392 ? 50.028 -12.841 -19.764 1.00 33.37  ? 392  TYR A C     1 
ATOM   3987 O O     . TYR B 2 392 ? 49.796 -13.699 -20.622 1.00 33.13  ? 392  TYR A O     1 
ATOM   3988 C CB    . TYR B 2 392 ? 49.239 -12.904 -17.418 1.00 31.20  ? 392  TYR A CB    1 
ATOM   3989 C CG    . TYR B 2 392 ? 47.934 -13.515 -17.850 1.00 30.42  ? 392  TYR A CG    1 
ATOM   3990 C CD1   . TYR B 2 392 ? 47.731 -14.896 -17.782 1.00 30.60  ? 392  TYR A CD1   1 
ATOM   3991 C CD2   . TYR B 2 392 ? 46.900 -12.722 -18.333 1.00 30.31  ? 392  TYR A CD2   1 
ATOM   3992 C CE1   . TYR B 2 392 ? 46.520 -15.471 -18.187 1.00 30.48  ? 392  TYR A CE1   1 
ATOM   3993 C CE2   . TYR B 2 392 ? 45.684 -13.285 -18.742 1.00 30.73  ? 392  TYR A CE2   1 
ATOM   3994 C CZ    . TYR B 2 392 ? 45.500 -14.657 -18.666 1.00 31.43  ? 392  TYR A CZ    1 
ATOM   3995 O OH    . TYR B 2 392 ? 44.298 -15.212 -19.072 1.00 34.22  ? 392  TYR A OH    1 
ATOM   3996 N N     . ALA B 2 393 ? 49.968 -11.530 -19.991 1.00 33.91  ? 393  ALA A N     1 
ATOM   3997 C CA    . ALA B 2 393 ? 49.606 -10.975 -21.285 1.00 34.26  ? 393  ALA A CA    1 
ATOM   3998 C C     . ALA B 2 393 ? 50.588 -11.335 -22.386 1.00 35.27  ? 393  ALA A C     1 
ATOM   3999 O O     . ALA B 2 393 ? 50.183 -11.529 -23.526 1.00 37.81  ? 393  ALA A O     1 
ATOM   4000 C CB    . ALA B 2 393 ? 49.471 -9.469  -21.186 1.00 33.85  ? 393  ALA A CB    1 
ATOM   4001 N N     . SER B 2 394 ? 51.874 -11.420 -22.058 1.00 34.72  ? 394  SER A N     1 
ATOM   4002 C CA    . SER B 2 394 ? 52.879 -11.776 -23.062 1.00 34.17  ? 394  SER A CA    1 
ATOM   4003 C C     . SER B 2 394 ? 52.728 -13.217 -23.528 1.00 33.08  ? 394  SER A C     1 
ATOM   4004 O O     . SER B 2 394 ? 52.969 -13.529 -24.685 1.00 31.96  ? 394  SER A O     1 
ATOM   4005 C CB    . SER B 2 394 ? 54.297 -11.594 -22.508 1.00 33.54  ? 394  SER A CB    1 
ATOM   4006 O OG    . SER B 2 394 ? 54.532 -10.252 -22.140 1.00 34.75  ? 394  SER A OG    1 
ATOM   4007 N N     . THR B 2 395 ? 52.331 -14.102 -22.624 1.00 34.31  ? 395  THR A N     1 
ATOM   4008 C CA    . THR B 2 395 ? 52.200 -15.509 -22.983 1.00 36.07  ? 395  THR A CA    1 
ATOM   4009 C C     . THR B 2 395 ? 50.769 -15.970 -23.224 1.00 37.20  ? 395  THR A C     1 
ATOM   4010 O O     . THR B 2 395 ? 50.548 -16.964 -23.914 1.00 37.45  ? 395  THR A O     1 
ATOM   4011 C CB    . THR B 2 395 ? 52.815 -16.406 -21.903 1.00 36.53  ? 395  THR A CB    1 
ATOM   4012 O OG1   . THR B 2 395 ? 52.070 -16.256 -20.694 1.00 39.93  ? 395  THR A OG1   1 
ATOM   4013 C CG2   . THR B 2 395 ? 54.259 -16.013 -21.643 1.00 36.55  ? 395  THR A CG2   1 
ATOM   4014 N N     . HIS B 2 396 ? 49.795 -15.252 -22.672 1.00 38.24  ? 396  HIS A N     1 
ATOM   4015 C CA    . HIS B 2 396 ? 48.403 -15.639 -22.852 1.00 39.32  ? 396  HIS A CA    1 
ATOM   4016 C C     . HIS B 2 396 ? 47.623 -14.680 -23.739 1.00 39.98  ? 396  HIS A C     1 
ATOM   4017 O O     . HIS B 2 396 ? 46.399 -14.580 -23.624 1.00 40.26  ? 396  HIS A O     1 
ATOM   4018 C CB    . HIS B 2 396 ? 47.716 -15.767 -21.492 1.00 39.36  ? 396  HIS A CB    1 
ATOM   4019 C CG    . HIS B 2 396 ? 48.218 -16.913 -20.672 1.00 41.72  ? 396  HIS A CG    1 
ATOM   4020 N ND1   . HIS B 2 396 ? 49.548 -17.057 -20.324 1.00 42.00  ? 396  HIS A ND1   1 
ATOM   4021 C CD2   . HIS B 2 396 ? 47.577 -17.978 -20.139 1.00 41.65  ? 396  HIS A CD2   1 
ATOM   4022 C CE1   . HIS B 2 396 ? 49.700 -18.158 -19.617 1.00 41.45  ? 396  HIS A CE1   1 
ATOM   4023 N NE2   . HIS B 2 396 ? 48.517 -18.738 -19.488 1.00 43.15  ? 396  HIS A NE2   1 
ATOM   4024 N N     . TRP B 2 397 ? 48.319 -13.991 -24.638 1.00 38.48  ? 397  TRP A N     1 
ATOM   4025 C CA    . TRP B 2 397 ? 47.651 -13.045 -25.515 1.00 38.37  ? 397  TRP A CA    1 
ATOM   4026 C C     . TRP B 2 397 ? 46.521 -13.695 -26.306 1.00 38.61  ? 397  TRP A C     1 
ATOM   4027 O O     . TRP B 2 397 ? 45.478 -13.083 -26.523 1.00 39.02  ? 397  TRP A O     1 
ATOM   4028 C CB    . TRP B 2 397 ? 48.651 -12.404 -26.490 1.00 38.39  ? 397  TRP A CB    1 
ATOM   4029 C CG    . TRP B 2 397 ? 49.362 -13.404 -27.325 1.00 37.56  ? 397  TRP A CG    1 
ATOM   4030 C CD1   . TRP B 2 397 ? 50.508 -14.063 -27.004 1.00 37.16  ? 397  TRP A CD1   1 
ATOM   4031 C CD2   . TRP B 2 397 ? 48.899 -13.978 -28.554 1.00 37.15  ? 397  TRP A CD2   1 
ATOM   4032 N NE1   . TRP B 2 397 ? 50.785 -15.024 -27.951 1.00 36.89  ? 397  TRP A NE1   1 
ATOM   4033 C CE2   . TRP B 2 397 ? 49.811 -14.994 -28.912 1.00 36.51  ? 397  TRP A CE2   1 
ATOM   4034 C CE3   . TRP B 2 397 ? 47.797 -13.735 -29.386 1.00 39.57  ? 397  TRP A CE3   1 
ATOM   4035 C CZ2   . TRP B 2 397 ? 49.656 -15.772 -30.064 1.00 35.92  ? 397  TRP A CZ2   1 
ATOM   4036 C CZ3   . TRP B 2 397 ? 47.642 -14.515 -30.542 1.00 39.54  ? 397  TRP A CZ3   1 
ATOM   4037 C CH2   . TRP B 2 397 ? 48.570 -15.520 -30.863 1.00 37.91  ? 397  TRP A CH2   1 
ATOM   4038 N N     . HIS B 2 398 ? 46.713 -14.938 -26.727 1.00 38.97  ? 398  HIS A N     1 
ATOM   4039 C CA    . HIS B 2 398 ? 45.695 -15.601 -27.531 1.00 40.33  ? 398  HIS A CA    1 
ATOM   4040 C C     . HIS B 2 398 ? 44.348 -15.847 -26.856 1.00 40.32  ? 398  HIS A C     1 
ATOM   4041 O O     . HIS B 2 398 ? 43.345 -16.026 -27.537 1.00 40.80  ? 398  HIS A O     1 
ATOM   4042 C CB    . HIS B 2 398 ? 46.235 -16.920 -28.095 1.00 41.43  ? 398  HIS A CB    1 
ATOM   4043 C CG    . HIS B 2 398 ? 45.280 -17.614 -29.022 1.00 44.94  ? 398  HIS A CG    1 
ATOM   4044 N ND1   . HIS B 2 398 ? 44.230 -18.380 -28.571 1.00 46.16  ? 398  HIS A ND1   1 
ATOM   4045 C CD2   . HIS B 2 398 ? 45.193 -17.611 -30.375 1.00 45.74  ? 398  HIS A CD2   1 
ATOM   4046 C CE1   . HIS B 2 398 ? 43.534 -18.823 -29.606 1.00 44.80  ? 398  HIS A CE1   1 
ATOM   4047 N NE2   . HIS B 2 398 ? 44.097 -18.371 -30.710 1.00 43.77  ? 398  HIS A NE2   1 
ATOM   4048 N N     . THR B 2 399 ? 44.308 -15.851 -25.530 1.00 40.29  ? 399  THR A N     1 
ATOM   4049 C CA    . THR B 2 399 ? 43.048 -16.090 -24.835 1.00 39.29  ? 399  THR A CA    1 
ATOM   4050 C C     . THR B 2 399 ? 42.384 -14.786 -24.423 1.00 38.58  ? 399  THR A C     1 
ATOM   4051 O O     . THR B 2 399 ? 41.515 -14.776 -23.562 1.00 38.89  ? 399  THR A O     1 
ATOM   4052 C CB    . THR B 2 399 ? 43.247 -16.956 -23.564 1.00 40.03  ? 399  THR A CB    1 
ATOM   4053 O OG1   . THR B 2 399 ? 41.976 -17.439 -23.121 1.00 40.58  ? 399  THR A OG1   1 
ATOM   4054 C CG2   . THR B 2 399 ? 43.872 -16.135 -22.433 1.00 39.41  ? 399  THR A CG2   1 
ATOM   4055 N N     . LEU B 2 400 ? 42.781 -13.687 -25.047 1.00 37.65  ? 400  LEU A N     1 
ATOM   4056 C CA    . LEU B 2 400 ? 42.215 -12.392 -24.698 1.00 37.45  ? 400  LEU A CA    1 
ATOM   4057 C C     . LEU B 2 400 ? 41.308 -11.805 -25.776 1.00 38.97  ? 400  LEU A C     1 
ATOM   4058 O O     . LEU B 2 400 ? 41.094 -10.597 -25.827 1.00 39.88  ? 400  LEU A O     1 
ATOM   4059 C CB    . LEU B 2 400 ? 43.350 -11.426 -24.378 1.00 36.66  ? 400  LEU A CB    1 
ATOM   4060 C CG    . LEU B 2 400 ? 44.401 -11.998 -23.413 1.00 36.18  ? 400  LEU A CG    1 
ATOM   4061 C CD1   . LEU B 2 400 ? 45.496 -10.962 -23.199 1.00 35.95  ? 400  LEU A CD1   1 
ATOM   4062 C CD2   . LEU B 2 400 ? 43.763 -12.390 -22.083 1.00 36.22  ? 400  LEU A CD2   1 
ATOM   4063 N N     . GLY B 2 401 ? 40.758 -12.665 -26.628 1.00 39.65  ? 401  GLY A N     1 
ATOM   4064 C CA    . GLY B 2 401 ? 39.894 -12.191 -27.688 1.00 39.40  ? 401  GLY A CA    1 
ATOM   4065 C C     . GLY B 2 401 ? 40.642 -12.282 -28.997 1.00 40.34  ? 401  GLY A C     1 
ATOM   4066 O O     . GLY B 2 401 ? 41.805 -11.884 -29.076 1.00 40.49  ? 401  GLY A O     1 
ATOM   4067 N N     . LYS B 2 402 ? 39.976 -12.798 -30.025 1.00 39.62  ? 402  LYS A N     1 
ATOM   4068 C CA    . LYS B 2 402 ? 40.597 -12.967 -31.326 1.00 39.78  ? 402  LYS A CA    1 
ATOM   4069 C C     . LYS B 2 402 ? 41.378 -11.732 -31.775 1.00 39.00  ? 402  LYS A C     1 
ATOM   4070 O O     . LYS B 2 402 ? 42.546 -11.836 -32.112 1.00 38.36  ? 402  LYS A O     1 
ATOM   4071 C CB    . LYS B 2 402 ? 39.638 -13.710 -32.277 1.00 41.11  ? 402  LYS A CB    1 
ATOM   4072 C CG    . LYS B 2 402 ? 39.917 -13.542 -33.780 1.00 43.92  ? 402  LYS A CG    1 
ATOM   4073 C CD    . LYS B 2 402 ? 40.654 -14.729 -34.416 1.00 48.07  ? 402  LYS A CD    1 
ATOM   4074 C CE    . LYS B 2 402 ? 41.273 -14.405 -35.780 1.00 49.13  ? 402  LYS A CE    1 
ATOM   4075 N NZ    . LYS B 2 402 ? 40.329 -13.729 -36.733 1.00 52.19  ? 402  LYS A NZ    1 
ATOM   4076 N N     . ASN B 2 403 ? 40.749 -10.563 -31.754 1.00 38.75  ? 403  ASN A N     1 
ATOM   4077 C CA    . ASN B 2 403 ? 41.412 -9.346  -32.206 1.00 38.34  ? 403  ASN A CA    1 
ATOM   4078 C C     . ASN B 2 403 ? 42.223 -8.647  -31.125 1.00 38.93  ? 403  ASN A C     1 
ATOM   4079 O O     . ASN B 2 403 ? 43.391 -8.331  -31.331 1.00 39.07  ? 403  ASN A O     1 
ATOM   4080 C CB    . ASN B 2 403 ? 40.381 -8.387  -32.796 1.00 38.62  ? 403  ASN A CB    1 
ATOM   4081 C CG    . ASN B 2 403 ? 39.577 -9.021  -33.926 1.00 40.81  ? 403  ASN A CG    1 
ATOM   4082 O OD1   . ASN B 2 403 ? 40.129 -9.441  -34.941 1.00 42.44  ? 403  ASN A OD1   1 
ATOM   4083 N ND2   . ASN B 2 403 ? 38.268 -9.097  -33.749 1.00 41.13  ? 403  ASN A ND2   1 
ATOM   4084 N N     . VAL B 2 404 ? 41.604 -8.401  -29.975 1.00 38.27  ? 404  VAL A N     1 
ATOM   4085 C CA    . VAL B 2 404 ? 42.297 -7.747  -28.873 1.00 36.96  ? 404  VAL A CA    1 
ATOM   4086 C C     . VAL B 2 404 ? 43.578 -8.506  -28.548 1.00 36.97  ? 404  VAL A C     1 
ATOM   4087 O O     . VAL B 2 404 ? 44.644 -7.912  -28.378 1.00 36.52  ? 404  VAL A O     1 
ATOM   4088 C CB    . VAL B 2 404 ? 41.393 -7.676  -27.616 1.00 35.77  ? 404  VAL A CB    1 
ATOM   4089 C CG1   . VAL B 2 404 ? 42.239 -7.650  -26.352 1.00 32.22  ? 404  VAL A CG1   1 
ATOM   4090 C CG2   . VAL B 2 404 ? 40.523 -6.424  -27.689 1.00 35.44  ? 404  VAL A CG2   1 
ATOM   4091 N N     . GLY B 2 405 ? 43.464 -9.825  -28.470 1.00 37.68  ? 405  GLY A N     1 
ATOM   4092 C CA    . GLY B 2 405 ? 44.624 -10.637 -28.168 1.00 39.58  ? 405  GLY A CA    1 
ATOM   4093 C C     . GLY B 2 405 ? 45.696 -10.467 -29.226 1.00 40.87  ? 405  GLY A C     1 
ATOM   4094 O O     . GLY B 2 405 ? 46.857 -10.227 -28.895 1.00 41.39  ? 405  GLY A O     1 
ATOM   4095 N N     . GLU B 2 406 ? 45.306 -10.578 -30.496 1.00 41.39  ? 406  GLU A N     1 
ATOM   4096 C CA    . GLU B 2 406 ? 46.244 -10.435 -31.604 1.00 42.02  ? 406  GLU A CA    1 
ATOM   4097 C C     . GLU B 2 406 ? 46.957 -9.095  -31.563 1.00 40.60  ? 406  GLU A C     1 
ATOM   4098 O O     . GLU B 2 406 ? 48.117 -8.990  -31.952 1.00 41.81  ? 406  GLU A O     1 
ATOM   4099 C CB    . GLU B 2 406 ? 45.523 -10.634 -32.949 1.00 42.95  ? 406  GLU A CB    1 
ATOM   4100 C CG    . GLU B 2 406 ? 45.312 -12.117 -33.284 1.00 45.72  ? 406  GLU A CG    1 
ATOM   4101 C CD    . GLU B 2 406 ? 44.299 -12.377 -34.397 1.00 49.06  ? 406  GLU A CD    1 
ATOM   4102 O OE1   . GLU B 2 406 ? 44.027 -13.572 -34.673 1.00 50.12  ? 406  GLU A OE1   1 
ATOM   4103 O OE2   . GLU B 2 406 ? 43.772 -11.406 -34.991 1.00 50.23  ? 406  GLU A OE2   1 
ATOM   4104 N N     . SER B 2 407 ? 46.271 -8.079  -31.064 1.00 38.91  ? 407  SER A N     1 
ATOM   4105 C CA    . SER B 2 407 ? 46.843 -6.748  -30.956 1.00 38.14  ? 407  SER A CA    1 
ATOM   4106 C C     . SER B 2 407 ? 47.846 -6.694  -29.800 1.00 39.31  ? 407  SER A C     1 
ATOM   4107 O O     . SER B 2 407 ? 48.954 -6.175  -29.945 1.00 38.37  ? 407  SER A O     1 
ATOM   4108 C CB    . SER B 2 407 ? 45.734 -5.736  -30.718 1.00 37.91  ? 407  SER A CB    1 
ATOM   4109 O OG    . SER B 2 407 ? 46.256 -4.431  -30.612 1.00 39.22  ? 407  SER A OG    1 
ATOM   4110 N N     . ILE B 2 408 ? 47.450 -7.227  -28.648 1.00 39.70  ? 408  ILE A N     1 
ATOM   4111 C CA    . ILE B 2 408 ? 48.326 -7.240  -27.477 1.00 40.19  ? 408  ILE A CA    1 
ATOM   4112 C C     . ILE B 2 408 ? 49.560 -8.084  -27.760 1.00 40.85  ? 408  ILE A C     1 
ATOM   4113 O O     . ILE B 2 408 ? 50.614 -7.862  -27.184 1.00 40.83  ? 408  ILE A O     1 
ATOM   4114 C CB    . ILE B 2 408 ? 47.600 -7.803  -26.234 1.00 39.52  ? 408  ILE A CB    1 
ATOM   4115 C CG1   . ILE B 2 408 ? 46.507 -6.826  -25.799 1.00 37.93  ? 408  ILE A CG1   1 
ATOM   4116 C CG2   . ILE B 2 408 ? 48.600 -8.043  -25.098 1.00 39.13  ? 408  ILE A CG2   1 
ATOM   4117 C CD1   . ILE B 2 408 ? 45.614 -7.366  -24.740 1.00 36.58  ? 408  ILE A CD1   1 
ATOM   4118 N N     . ARG B 2 409 ? 49.417 -9.056  -28.652 1.00 42.09  ? 409  ARG A N     1 
ATOM   4119 C CA    . ARG B 2 409 ? 50.525 -9.916  -29.027 1.00 43.47  ? 409  ARG A CA    1 
ATOM   4120 C C     . ARG B 2 409 ? 51.610 -9.101  -29.731 1.00 44.15  ? 409  ARG A C     1 
ATOM   4121 O O     . ARG B 2 409 ? 52.799 -9.383  -29.579 1.00 44.61  ? 409  ARG A O     1 
ATOM   4122 C CB    . ARG B 2 409 ? 50.033 -11.023 -29.958 1.00 45.45  ? 409  ARG A CB    1 
ATOM   4123 C CG    . ARG B 2 409 ? 51.130 -11.906 -30.548 1.00 48.93  ? 409  ARG A CG    1 
ATOM   4124 C CD    . ARG B 2 409 ? 50.635 -12.536 -31.844 1.00 53.43  ? 409  ARG A CD    1 
ATOM   4125 N NE    . ARG B 2 409 ? 50.091 -11.498 -32.728 1.00 58.15  ? 409  ARG A NE    1 
ATOM   4126 C CZ    . ARG B 2 409 ? 49.305 -11.717 -33.782 1.00 58.13  ? 409  ARG A CZ    1 
ATOM   4127 N NH1   . ARG B 2 409 ? 48.869 -10.708 -34.528 1.00 57.27  ? 409  ARG A NH1   1 
ATOM   4128 N NH2   . ARG B 2 409 ? 48.964 -12.961 -34.095 1.00 58.14  ? 409  ARG A NH2   1 
ATOM   4129 N N     . GLU B 2 410 ? 51.207 -8.085  -30.491 1.00 44.33  ? 410  GLU A N     1 
ATOM   4130 C CA    . GLU B 2 410 ? 52.176 -7.270  -31.217 1.00 44.19  ? 410  GLU A CA    1 
ATOM   4131 C C     . GLU B 2 410 ? 52.639 -6.039  -30.466 1.00 42.43  ? 410  GLU A C     1 
ATOM   4132 O O     . GLU B 2 410 ? 53.626 -5.413  -30.846 1.00 43.17  ? 410  GLU A O     1 
ATOM   4133 C CB    . GLU B 2 410 ? 51.626 -6.867  -32.590 1.00 45.74  ? 410  GLU A CB    1 
ATOM   4134 C CG    . GLU B 2 410 ? 50.304 -6.164  -32.554 1.00 50.20  ? 410  GLU A CG    1 
ATOM   4135 C CD    . GLU B 2 410 ? 49.674 -6.060  -33.926 1.00 53.57  ? 410  GLU A CD    1 
ATOM   4136 O OE1   . GLU B 2 410 ? 49.715 -7.064  -34.672 1.00 54.34  ? 410  GLU A OE1   1 
ATOM   4137 O OE2   . GLU B 2 410 ? 49.128 -4.982  -34.254 1.00 55.11  ? 410  GLU A OE2   1 
ATOM   4138 N N     . TYR B 2 411 ? 51.935 -5.695  -29.397 1.00 40.45  ? 411  TYR A N     1 
ATOM   4139 C CA    . TYR B 2 411 ? 52.314 -4.542  -28.596 1.00 39.21  ? 411  TYR A CA    1 
ATOM   4140 C C     . TYR B 2 411 ? 51.460 -4.007  -27.463 1.00 39.05  ? 411  TYR A C     1 
ATOM   4141 O O     . TYR B 2 411 ? 50.323 -3.610  -27.671 1.00 41.57  ? 411  TYR A O     1 
ATOM   4142 C CB    . TYR B 2 411 ? 52.382 -3.274  -29.450 1.00 35.63  ? 411  TYR A CB    1 
ATOM   4143 C CG    . TYR B 2 411 ? 52.259 -2.011  -28.620 1.00 36.02  ? 411  TYR A CG    1 
ATOM   4144 C CD1   . TYR B 2 411 ? 51.095 -1.237  -28.655 1.00 35.89  ? 411  TYR A CD1   1 
ATOM   4145 C CD2   . TYR B 2 411 ? 53.272 -1.636  -27.732 1.00 35.90  ? 411  TYR A CD2   1 
ATOM   4146 C CE1   . TYR B 2 411 ? 50.941 -0.121  -27.816 1.00 37.20  ? 411  TYR A CE1   1 
ATOM   4147 C CE2   . TYR B 2 411 ? 53.127 -0.526  -26.889 1.00 36.66  ? 411  TYR A CE2   1 
ATOM   4148 C CZ    . TYR B 2 411 ? 51.962 0.222   -26.933 1.00 37.05  ? 411  TYR A CZ    1 
ATOM   4149 O OH    . TYR B 2 411 ? 51.800 1.285   -26.065 1.00 36.17  ? 411  TYR A OH    1 
ATOM   4150 N N     . PHE B 2 412 ? 52.034 -3.988  -26.268 1.00 37.87  ? 412  PHE A N     1 
ATOM   4151 C CA    . PHE B 2 412 ? 51.309 -3.635  -25.062 1.00 38.48  ? 412  PHE A CA    1 
ATOM   4152 C C     . PHE B 2 412 ? 52.296 -3.072  -24.060 1.00 39.85  ? 412  PHE A C     1 
ATOM   4153 O O     . PHE B 2 412 ? 53.498 -3.326  -24.131 1.00 39.36  ? 412  PHE A O     1 
ATOM   4154 C CB    . PHE B 2 412 ? 50.460 -4.814  -24.549 1.00 36.82  ? 412  PHE A CB    1 
ATOM   4155 C CG    . PHE B 2 412 ? 51.203 -5.780  -23.668 1.00 34.09  ? 412  PHE A CG    1 
ATOM   4156 C CD1   . PHE B 2 412 ? 51.342 -5.534  -22.303 1.00 34.88  ? 412  PHE A CD1   1 
ATOM   4157 C CD2   . PHE B 2 412 ? 51.746 -6.950  -24.198 1.00 32.82  ? 412  PHE A CD2   1 
ATOM   4158 C CE1   . PHE B 2 412 ? 52.020 -6.445  -21.472 1.00 33.46  ? 412  PHE A CE1   1 
ATOM   4159 C CE2   . PHE B 2 412 ? 52.422 -7.866  -23.386 1.00 33.13  ? 412  PHE A CE2   1 
ATOM   4160 C CZ    . PHE B 2 412 ? 52.559 -7.615  -22.018 1.00 32.39  ? 412  PHE A CZ    1 
ATOM   4161 N N     . GLU B 2 413 ? 51.782 -2.284  -23.130 1.00 41.43  ? 413  GLU A N     1 
ATOM   4162 C CA    . GLU B 2 413 ? 52.587 -1.805  -22.027 1.00 41.71  ? 413  GLU A CA    1 
ATOM   4163 C C     . GLU B 2 413 ? 51.673 -1.661  -20.822 1.00 41.61  ? 413  GLU A C     1 
ATOM   4164 O O     . GLU B 2 413 ? 50.450 -1.642  -20.953 1.00 40.95  ? 413  GLU A O     1 
ATOM   4165 C CB    . GLU B 2 413 ? 53.245 -0.467  -22.374 1.00 42.33  ? 413  GLU A CB    1 
ATOM   4166 C CG    . GLU B 2 413 ? 52.283 0.645   -22.702 1.00 46.06  ? 413  GLU A CG    1 
ATOM   4167 C CD    . GLU B 2 413 ? 52.985 1.977   -22.922 1.00 49.06  ? 413  GLU A CD    1 
ATOM   4168 O OE1   . GLU B 2 413 ? 53.669 2.461   -21.987 1.00 48.55  ? 413  GLU A OE1   1 
ATOM   4169 O OE2   . GLU B 2 413 ? 52.848 2.541   -24.033 1.00 50.53  ? 413  GLU A OE2   1 
ATOM   4170 N N     . ILE B 2 414 ? 52.273 -1.591  -19.644 1.00 41.30  ? 414  ILE A N     1 
ATOM   4171 C CA    . ILE B 2 414 ? 51.517 -1.431  -18.420 1.00 40.67  ? 414  ILE A CA    1 
ATOM   4172 C C     . ILE B 2 414 ? 51.885 -0.064  -17.860 1.00 42.45  ? 414  ILE A C     1 
ATOM   4173 O O     . ILE B 2 414 ? 53.062 0.249   -17.692 1.00 41.21  ? 414  ILE A O     1 
ATOM   4174 C CB    . ILE B 2 414 ? 51.880 -2.532  -17.416 1.00 39.90  ? 414  ILE A CB    1 
ATOM   4175 C CG1   . ILE B 2 414 ? 51.555 -3.896  -18.033 1.00 38.15  ? 414  ILE A CG1   1 
ATOM   4176 C CG2   . ILE B 2 414 ? 51.130 -2.307  -16.094 1.00 38.84  ? 414  ILE A CG2   1 
ATOM   4177 C CD1   . ILE B 2 414 ? 52.113 -5.049  -17.261 1.00 40.69  ? 414  ILE A CD1   1 
ATOM   4178 N N     . ILE B 2 415 ? 50.870 0.748   -17.587 1.00 44.84  ? 415  ILE A N     1 
ATOM   4179 C CA    . ILE B 2 415 ? 51.069 2.093   -17.065 1.00 46.88  ? 415  ILE A CA    1 
ATOM   4180 C C     . ILE B 2 415 ? 50.540 2.199   -15.642 1.00 48.74  ? 415  ILE A C     1 
ATOM   4181 O O     . ILE B 2 415 ? 49.530 1.597   -15.311 1.00 49.88  ? 415  ILE A O     1 
ATOM   4182 C CB    . ILE B 2 415 ? 50.320 3.131   -17.921 1.00 47.44  ? 415  ILE A CB    1 
ATOM   4183 C CG1   . ILE B 2 415 ? 50.544 2.846   -19.404 1.00 46.58  ? 415  ILE A CG1   1 
ATOM   4184 C CG2   . ILE B 2 415 ? 50.775 4.530   -17.557 1.00 46.55  ? 415  ILE A CG2   1 
ATOM   4185 C CD1   . ILE B 2 415 ? 51.975 2.831   -19.802 1.00 48.74  ? 415  ILE A CD1   1 
ATOM   4186 N N     . SER B 2 416 ? 51.216 2.984   -14.812 1.00 51.63  ? 416  SER A N     1 
ATOM   4187 C CA    . SER B 2 416 ? 50.811 3.180   -13.427 1.00 54.72  ? 416  SER A CA    1 
ATOM   4188 C C     . SER B 2 416 ? 51.403 4.475   -12.894 1.00 57.68  ? 416  SER A C     1 
ATOM   4189 O O     . SER B 2 416 ? 52.468 4.906   -13.332 1.00 59.41  ? 416  SER A O     1 
ATOM   4190 C CB    . SER B 2 416 ? 51.275 2.002   -12.570 1.00 55.25  ? 416  SER A CB    1 
ATOM   4191 O OG    . SER B 2 416 ? 52.632 1.693   -12.826 1.00 55.96  ? 416  SER A OG    1 
ATOM   4192 N N     . GLY B 2 417 ? 50.710 5.100   -11.950 1.00 60.29  ? 417  GLY A N     1 
ATOM   4193 C CA    . GLY B 2 417 ? 51.203 6.345   -11.394 1.00 62.60  ? 417  GLY A CA    1 
ATOM   4194 C C     . GLY B 2 417 ? 50.849 7.555   -12.239 1.00 65.28  ? 417  GLY A C     1 
ATOM   4195 O O     . GLY B 2 417 ? 49.862 7.544   -12.978 1.00 64.77  ? 417  GLY A O     1 
ATOM   4196 N N     . GLU B 2 418 ? 51.666 8.599   -12.135 1.00 67.77  ? 418  GLU A N     1 
ATOM   4197 C CA    . GLU B 2 418 ? 51.447 9.839   -12.870 1.00 70.19  ? 418  GLU A CA    1 
ATOM   4198 C C     . GLU B 2 418 ? 51.250 9.571   -14.355 1.00 70.85  ? 418  GLU A C     1 
ATOM   4199 O O     . GLU B 2 418 ? 50.322 10.096  -14.977 1.00 71.81  ? 418  GLU A O     1 
ATOM   4200 C CB    . GLU B 2 418 ? 52.642 10.781  -12.679 1.00 72.48  ? 418  GLU A CB    1 
ATOM   4201 C CG    . GLU B 2 418 ? 53.227 10.780  -11.268 1.00 75.53  ? 418  GLU A CG    1 
ATOM   4202 C CD    . GLU B 2 418 ? 52.274 11.332  -10.220 1.00 77.00  ? 418  GLU A CD    1 
ATOM   4203 O OE1   . GLU B 2 418 ? 52.548 11.145  -9.014  1.00 76.88  ? 418  GLU A OE1   1 
ATOM   4204 O OE2   . GLU B 2 418 ? 51.259 11.957  -10.598 1.00 77.68  ? 418  GLU A OE2   1 
ATOM   4205 N N     . LYS B 2 419 ? 52.126 8.746   -14.918 1.00 70.19  ? 419  LYS A N     1 
ATOM   4206 C CA    . LYS B 2 419 ? 52.062 8.420   -16.334 1.00 70.41  ? 419  LYS A CA    1 
ATOM   4207 C C     . LYS B 2 419 ? 50.701 7.850   -16.716 1.00 69.01  ? 419  LYS A C     1 
ATOM   4208 O O     . LYS B 2 419 ? 50.304 7.910   -17.880 1.00 69.79  ? 419  LYS A O     1 
ATOM   4209 C CB    . LYS B 2 419 ? 53.168 7.421   -16.688 1.00 72.87  ? 419  LYS A CB    1 
ATOM   4210 C CG    . LYS B 2 419 ? 53.316 7.129   -18.176 1.00 75.48  ? 419  LYS A CG    1 
ATOM   4211 C CD    . LYS B 2 419 ? 54.438 6.120   -18.422 1.00 78.10  ? 419  LYS A CD    1 
ATOM   4212 C CE    . LYS B 2 419 ? 54.602 5.791   -19.902 1.00 79.03  ? 419  LYS A CE    1 
ATOM   4213 N NZ    . LYS B 2 419 ? 55.717 4.825   -20.133 1.00 80.07  ? 419  LYS A NZ    1 
ATOM   4214 N N     . LEU B 2 420 ? 49.986 7.309   -15.732 1.00 66.84  ? 420  LEU A N     1 
ATOM   4215 C CA    . LEU B 2 420 ? 48.670 6.723   -15.965 1.00 65.19  ? 420  LEU A CA    1 
ATOM   4216 C C     . LEU B 2 420 ? 47.567 7.761   -15.964 1.00 64.73  ? 420  LEU A C     1 
ATOM   4217 O O     . LEU B 2 420 ? 46.707 7.781   -16.851 1.00 63.29  ? 420  LEU A O     1 
ATOM   4218 C CB    . LEU B 2 420 ? 48.357 5.674   -14.899 1.00 64.90  ? 420  LEU A CB    1 
ATOM   4219 C CG    . LEU B 2 420 ? 46.927 5.121   -14.886 1.00 64.03  ? 420  LEU A CG    1 
ATOM   4220 C CD1   . LEU B 2 420 ? 46.477 4.722   -16.284 1.00 63.93  ? 420  LEU A CD1   1 
ATOM   4221 C CD2   . LEU B 2 420 ? 46.885 3.928   -13.962 1.00 64.94  ? 420  LEU A CD2   1 
ATOM   4222 N N     . PHE B 2 421 ? 47.604 8.619   -14.953 1.00 64.63  ? 421  PHE A N     1 
ATOM   4223 C CA    . PHE B 2 421 ? 46.623 9.675   -14.781 1.00 64.33  ? 421  PHE A CA    1 
ATOM   4224 C C     . PHE B 2 421 ? 46.563 10.589  -15.996 1.00 64.90  ? 421  PHE A C     1 
ATOM   4225 O O     . PHE B 2 421 ? 45.634 11.384  -16.137 1.00 65.35  ? 421  PHE A O     1 
ATOM   4226 C CB    . PHE B 2 421 ? 46.935 10.428  -13.494 1.00 64.22  ? 421  PHE A CB    1 
ATOM   4227 C CG    . PHE B 2 421 ? 47.069 9.530   -12.293 1.00 63.81  ? 421  PHE A CG    1 
ATOM   4228 C CD1   . PHE B 2 421 ? 48.170 9.628   -11.451 1.00 63.40  ? 421  PHE A CD1   1 
ATOM   4229 C CD2   . PHE B 2 421 ? 46.104 8.562   -12.025 1.00 64.01  ? 421  PHE A CD2   1 
ATOM   4230 C CE1   . PHE B 2 421 ? 48.315 8.773   -10.360 1.00 62.80  ? 421  PHE A CE1   1 
ATOM   4231 C CE2   . PHE B 2 421 ? 46.238 7.701   -10.938 1.00 63.71  ? 421  PHE A CE2   1 
ATOM   4232 C CZ    . PHE B 2 421 ? 47.348 7.806   -10.103 1.00 63.60  ? 421  PHE A CZ    1 
ATOM   4233 N N     . LYS B 2 422 ? 47.553 10.462  -16.879 1.00 64.92  ? 422  LYS A N     1 
ATOM   4234 C CA    . LYS B 2 422 ? 47.652 11.307  -18.063 1.00 64.51  ? 422  LYS A CA    1 
ATOM   4235 C C     . LYS B 2 422 ? 46.926 10.708  -19.260 1.00 62.68  ? 422  LYS A C     1 
ATOM   4236 O O     . LYS B 2 422 ? 46.704 11.394  -20.257 1.00 62.49  ? 422  LYS A O     1 
ATOM   4237 C CB    . LYS B 2 422 ? 49.125 11.541  -18.411 1.00 67.68  ? 422  LYS A CB    1 
ATOM   4238 C CG    . LYS B 2 422 ? 49.852 12.467  -17.439 1.00 71.32  ? 422  LYS A CG    1 
ATOM   4239 C CD    . LYS B 2 422 ? 51.372 12.370  -17.573 1.00 73.40  ? 422  LYS A CD    1 
ATOM   4240 C CE    . LYS B 2 422 ? 51.865 12.698  -18.980 1.00 74.41  ? 422  LYS A CE    1 
ATOM   4241 N NZ    . LYS B 2 422 ? 51.596 14.108  -19.378 1.00 74.88  ? 422  LYS A NZ    1 
ATOM   4242 N N     . GLU B 2 423 ? 46.558 9.432   -19.165 1.00 60.33  ? 423  GLU A N     1 
ATOM   4243 C CA    . GLU B 2 423 ? 45.851 8.756   -20.254 1.00 57.31  ? 423  GLU A CA    1 
ATOM   4244 C C     . GLU B 2 423 ? 44.368 9.136   -20.199 1.00 56.14  ? 423  GLU A C     1 
ATOM   4245 O O     . GLU B 2 423 ? 43.883 9.613   -19.177 1.00 55.21  ? 423  GLU A O     1 
ATOM   4246 C CB    . GLU B 2 423 ? 46.002 7.238   -20.124 1.00 57.80  ? 423  GLU A CB    1 
ATOM   4247 C CG    . GLU B 2 423 ? 47.437 6.703   -20.139 1.00 57.71  ? 423  GLU A CG    1 
ATOM   4248 C CD    . GLU B 2 423 ? 48.145 6.898   -21.474 1.00 58.54  ? 423  GLU A CD    1 
ATOM   4249 O OE1   . GLU B 2 423 ? 47.508 6.707   -22.531 1.00 57.50  ? 423  GLU A OE1   1 
ATOM   4250 O OE2   . GLU B 2 423 ? 49.353 7.227   -21.466 1.00 58.93  ? 423  GLU A OE2   1 
ATOM   4251 N N     . PRO B 2 424 ? 43.629 8.928   -21.299 1.00 55.56  ? 424  PRO A N     1 
ATOM   4252 C CA    . PRO B 2 424 ? 42.200 9.259   -21.356 1.00 55.62  ? 424  PRO A CA    1 
ATOM   4253 C C     . PRO B 2 424 ? 41.593 8.024   -20.684 1.00 55.06  ? 424  PRO A C     1 
ATOM   4254 O O     . PRO B 2 424 ? 40.955 7.200   -21.347 1.00 57.34  ? 424  PRO A O     1 
ATOM   4255 C CB    . PRO B 2 424 ? 41.885 9.195   -22.853 1.00 55.49  ? 424  PRO A CB    1 
ATOM   4256 C CG    . PRO B 2 424 ? 43.225 9.262   -23.526 1.00 55.39  ? 424  PRO A CG    1 
ATOM   4257 C CD    . PRO B 2 424 ? 44.109 8.486   -22.616 1.00 55.39  ? 424  PRO A CD    1 
ATOM   4258 N N     . VAL B 2 425 ? 41.775 7.902   -19.374 1.00 52.99  ? 425  VAL A N     1 
ATOM   4259 C CA    . VAL B 2 425 ? 41.028 6.938   -18.576 1.00 50.37  ? 425  VAL A CA    1 
ATOM   4260 C C     . VAL B 2 425 ? 40.615 7.419   -17.195 1.00 49.17  ? 425  VAL A C     1 
ATOM   4261 O O     . VAL B 2 425 ? 40.040 6.657   -16.425 1.00 48.91  ? 425  VAL A O     1 
ATOM   4262 C CB    . VAL B 2 425 ? 41.841 5.636   -18.391 1.00 49.20  ? 425  VAL A CB    1 
ATOM   4263 C CG1   . VAL B 2 425 ? 42.133 5.000   -19.748 1.00 47.38  ? 425  VAL A CG1   1 
ATOM   4264 C CG2   . VAL B 2 425 ? 43.140 5.941   -17.643 1.00 46.50  ? 425  VAL A CG2   1 
ATOM   4265 N N     . THR B 2 426 ? 40.888 8.678   -16.883 1.00 47.52  ? 426  THR A N     1 
ATOM   4266 C CA    . THR B 2 426 ? 40.560 9.206   -15.562 1.00 46.58  ? 426  THR A CA    1 
ATOM   4267 C C     . THR B 2 426 ? 39.096 9.054   -15.159 1.00 46.06  ? 426  THR A C     1 
ATOM   4268 O O     . THR B 2 426 ? 38.791 8.872   -13.982 1.00 46.32  ? 426  THR A O     1 
ATOM   4269 C CB    . THR B 2 426 ? 40.965 10.697  -15.437 1.00 46.14  ? 426  THR A CB    1 
ATOM   4270 O OG1   . THR B 2 426 ? 39.811 11.528  -15.606 1.00 47.15  ? 426  THR A OG1   1 
ATOM   4271 C CG2   . THR B 2 426 ? 41.996 11.055  -16.496 1.00 45.99  ? 426  THR A CG2   1 
ATOM   4272 N N     . ALA B 2 427 ? 38.181 9.126   -16.118 1.00 45.33  ? 427  ALA A N     1 
ATOM   4273 C CA    . ALA B 2 427 ? 36.770 8.993   -15.776 1.00 44.97  ? 427  ALA A CA    1 
ATOM   4274 C C     . ALA B 2 427 ? 36.431 7.552   -15.423 1.00 43.86  ? 427  ALA A C     1 
ATOM   4275 O O     . ALA B 2 427 ? 35.666 7.300   -14.494 1.00 43.22  ? 427  ALA A O     1 
ATOM   4276 C CB    . ALA B 2 427 ? 35.884 9.482   -16.928 1.00 44.33  ? 427  ALA A CB    1 
ATOM   4277 N N     . GLU B 2 428 ? 36.997 6.607   -16.166 1.00 43.67  ? 428  GLU A N     1 
ATOM   4278 C CA    . GLU B 2 428 ? 36.749 5.195   -15.904 1.00 44.23  ? 428  GLU A CA    1 
ATOM   4279 C C     . GLU B 2 428 ? 37.342 4.795   -14.547 1.00 43.81  ? 428  GLU A C     1 
ATOM   4280 O O     . GLU B 2 428 ? 36.804 3.930   -13.855 1.00 45.22  ? 428  GLU A O     1 
ATOM   4281 C CB    . GLU B 2 428 ? 37.356 4.330   -17.013 1.00 45.35  ? 428  GLU A CB    1 
ATOM   4282 C CG    . GLU B 2 428 ? 36.671 4.418   -18.382 1.00 46.04  ? 428  GLU A CG    1 
ATOM   4283 C CD    . GLU B 2 428 ? 36.663 5.824   -18.987 1.00 48.06  ? 428  GLU A CD    1 
ATOM   4284 O OE1   . GLU B 2 428 ? 37.620 6.603   -18.765 1.00 45.12  ? 428  GLU A OE1   1 
ATOM   4285 O OE2   . GLU B 2 428 ? 35.694 6.139   -19.712 1.00 49.68  ? 428  GLU A OE2   1 
ATOM   4286 N N     . LEU B 2 429 ? 38.444 5.436   -14.169 1.00 42.01  ? 429  LEU A N     1 
ATOM   4287 C CA    . LEU B 2 429 ? 39.095 5.157   -12.899 1.00 41.71  ? 429  LEU A CA    1 
ATOM   4288 C C     . LEU B 2 429 ? 38.258 5.637   -11.716 1.00 42.45  ? 429  LEU A C     1 
ATOM   4289 O O     . LEU B 2 429 ? 38.147 4.943   -10.698 1.00 41.70  ? 429  LEU A O     1 
ATOM   4290 C CB    . LEU B 2 429 ? 40.482 5.812   -12.852 1.00 40.70  ? 429  LEU A CB    1 
ATOM   4291 C CG    . LEU B 2 429 ? 41.556 5.111   -13.692 1.00 40.18  ? 429  LEU A CG    1 
ATOM   4292 C CD1   . LEU B 2 429 ? 42.841 5.923   -13.669 1.00 40.33  ? 429  LEU A CD1   1 
ATOM   4293 C CD2   . LEU B 2 429 ? 41.797 3.707   -13.156 1.00 37.83  ? 429  LEU A CD2   1 
ATOM   4294 N N     . CYS B 2 430 ? 37.671 6.822   -11.841 1.00 42.67  ? 430  CYS A N     1 
ATOM   4295 C CA    . CYS B 2 430 ? 36.850 7.349   -10.761 1.00 43.84  ? 430  CYS A CA    1 
ATOM   4296 C C     . CYS B 2 430 ? 35.639 6.457   -10.566 1.00 44.85  ? 430  CYS A C     1 
ATOM   4297 O O     . CYS B 2 430 ? 35.280 6.111   -9.438  1.00 46.18  ? 430  CYS A O     1 
ATOM   4298 C CB    . CYS B 2 430 ? 36.390 8.774   -11.074 1.00 43.80  ? 430  CYS A CB    1 
ATOM   4299 S SG    . CYS B 2 430 ? 37.723 9.970   -11.083 1.00 41.26  ? 430  CYS A SG    1 
ATOM   4300 N N     . GLU B 2 431 ? 35.011 6.083   -11.673 1.00 44.72  ? 431  GLU A N     1 
ATOM   4301 C CA    . GLU B 2 431 ? 33.837 5.226   -11.625 1.00 45.82  ? 431  GLU A CA    1 
ATOM   4302 C C     . GLU B 2 431 ? 34.204 3.893   -10.976 1.00 44.84  ? 431  GLU A C     1 
ATOM   4303 O O     . GLU B 2 431 ? 33.486 3.390   -10.116 1.00 44.94  ? 431  GLU A O     1 
ATOM   4304 C CB    . GLU B 2 431 ? 33.308 4.992   -13.040 1.00 48.57  ? 431  GLU A CB    1 
ATOM   4305 C CG    . GLU B 2 431 ? 32.281 3.878   -13.168 1.00 53.35  ? 431  GLU A CG    1 
ATOM   4306 C CD    . GLU B 2 431 ? 30.994 4.172   -12.422 1.00 57.51  ? 431  GLU A CD    1 
ATOM   4307 O OE1   . GLU B 2 431 ? 30.442 5.278   -12.617 1.00 58.55  ? 431  GLU A OE1   1 
ATOM   4308 O OE2   . GLU B 2 431 ? 30.531 3.297   -11.650 1.00 60.14  ? 431  GLU A OE2   1 
ATOM   4309 N N     . MET B 2 432 ? 35.338 3.341   -11.387 1.00 43.50  ? 432  MET A N     1 
ATOM   4310 C CA    . MET B 2 432 ? 35.807 2.061   -10.878 1.00 42.79  ? 432  MET A CA    1 
ATOM   4311 C C     . MET B 2 432 ? 36.077 2.051   -9.366  1.00 42.18  ? 432  MET A C     1 
ATOM   4312 O O     . MET B 2 432 ? 35.801 1.057   -8.688  1.00 40.72  ? 432  MET A O     1 
ATOM   4313 C CB    . MET B 2 432 ? 37.070 1.666   -11.636 1.00 42.12  ? 432  MET A CB    1 
ATOM   4314 C CG    . MET B 2 432 ? 37.503 0.236   -11.462 1.00 44.32  ? 432  MET A CG    1 
ATOM   4315 S SD    . MET B 2 432 ? 39.013 -0.090  -12.406 1.00 46.50  ? 432  MET A SD    1 
ATOM   4316 C CE    . MET B 2 432 ? 40.137 0.932   -11.543 1.00 44.76  ? 432  MET A CE    1 
ATOM   4317 N N     . MET B 2 433 ? 36.603 3.161   -8.848  1.00 40.85  ? 433  MET A N     1 
ATOM   4318 C CA    . MET B 2 433 ? 36.938 3.276   -7.429  1.00 40.12  ? 433  MET A CA    1 
ATOM   4319 C C     . MET B 2 433 ? 35.852 3.931   -6.586  1.00 40.09  ? 433  MET A C     1 
ATOM   4320 O O     . MET B 2 433 ? 36.027 4.147   -5.386  1.00 37.66  ? 433  MET A O     1 
ATOM   4321 C CB    . MET B 2 433 ? 38.240 4.056   -7.263  1.00 39.57  ? 433  MET A CB    1 
ATOM   4322 C CG    . MET B 2 433 ? 39.405 3.451   -8.001  1.00 40.10  ? 433  MET A CG    1 
ATOM   4323 S SD    . MET B 2 433 ? 40.910 4.386   -7.754  1.00 41.09  ? 433  MET A SD    1 
ATOM   4324 C CE    . MET B 2 433 ? 40.543 5.891   -8.566  1.00 39.24  ? 433  MET A CE    1 
ATOM   4325 N N     . GLY B 2 434 ? 34.730 4.250   -7.222  1.00 40.95  ? 434  GLY A N     1 
ATOM   4326 C CA    . GLY B 2 434 ? 33.635 4.871   -6.501  1.00 41.90  ? 434  GLY A CA    1 
ATOM   4327 C C     . GLY B 2 434 ? 33.933 6.280   -6.033  1.00 43.39  ? 434  GLY A C     1 
ATOM   4328 O O     . GLY B 2 434 ? 33.418 6.724   -5.011  1.00 42.17  ? 434  GLY A O     1 
ATOM   4329 N N     . VAL B 2 435 ? 34.771 6.998   -6.766  1.00 45.94  ? 435  VAL A N     1 
ATOM   4330 C CA    . VAL B 2 435 ? 35.076 8.362   -6.371  1.00 49.89  ? 435  VAL A CA    1 
ATOM   4331 C C     . VAL B 2 435 ? 33.775 9.150   -6.429  1.00 53.46  ? 435  VAL A C     1 
ATOM   4332 O O     . VAL B 2 435 ? 32.992 8.979   -7.369  1.00 53.75  ? 435  VAL A O     1 
ATOM   4333 C CB    . VAL B 2 435 ? 36.058 9.029   -7.336  1.00 49.04  ? 435  VAL A CB    1 
ATOM   4334 C CG1   . VAL B 2 435 ? 36.261 10.475  -6.933  1.00 48.38  ? 435  VAL A CG1   1 
ATOM   4335 C CG2   . VAL B 2 435 ? 37.367 8.285   -7.342  1.00 49.13  ? 435  VAL A CG2   1 
ATOM   4336 N N     . LYS B 2 436 ? 33.525 10.000  -5.439  1.00 57.55  ? 436  LYS A N     1 
ATOM   4337 C CA    . LYS B 2 436 ? 32.307 10.796  -5.482  1.00 61.89  ? 436  LYS A CA    1 
ATOM   4338 C C     . LYS B 2 436 ? 32.594 12.275  -5.256  1.00 64.26  ? 436  LYS A C     1 
ATOM   4339 O O     . LYS B 2 436 ? 33.752 12.675  -5.156  1.00 64.30  ? 436  LYS A O     1 
ATOM   4340 C CB    . LYS B 2 436 ? 31.358 10.425  -4.333  1.00 62.31  ? 436  LYS A CB    1 
ATOM   4341 C CG    . LYS B 2 436 ? 31.896 10.522  -2.928  1.00 62.41  ? 436  LYS A CG    1 
ATOM   4342 C CD    . LYS B 2 436 ? 31.080 9.583   -2.046  1.00 63.62  ? 436  LYS A CD    1 
ATOM   4343 C CE    . LYS B 2 436 ? 31.030 10.019  -0.603  1.00 64.00  ? 436  LYS A CE    1 
ATOM   4344 N NZ    . LYS B 2 436 ? 30.199 9.065   0.179   1.00 64.92  ? 436  LYS A NZ    1 
ATOM   4345 N N     . ASP B 2 437 ? 31.529 13.077  -5.202  1.00 68.19  ? 437  ASP A N     1 
ATOM   4346 C CA    . ASP B 2 437 ? 31.597 14.539  -5.206  1.00 70.70  ? 437  ASP A CA    1 
ATOM   4347 C C     . ASP B 2 437 ? 31.335 15.054  -6.619  1.00 71.70  ? 437  ASP A C     1 
ATOM   4348 O O     . ASP B 2 437 ? 31.138 14.212  -7.522  1.00 72.34  ? 437  ASP A O     1 
ATOM   4349 C CB    . ASP B 2 437 ? 32.967 15.027  -4.719  1.00 71.66  ? 437  ASP A CB    1 
ATOM   4350 C CG    . ASP B 2 437 ? 33.132 16.528  -4.843  1.00 73.42  ? 437  ASP A CG    1 
ATOM   4351 O OD1   . ASP B 2 437 ? 32.386 17.273  -4.170  1.00 74.06  ? 437  ASP A OD1   1 
ATOM   4352 O OD2   . ASP B 2 437 ? 34.010 16.966  -5.618  1.00 73.94  ? 437  ASP A OD2   1 
ATOM   4353 O OXT   . ASP B 2 437 ? 31.325 16.288  -6.810  1.00 72.84  ? 437  ASP A OXT   1 
HETATM 4354 S S     . SO4 C 3 .   ? 15.021 5.495   -31.092 1.00 53.56  ? 4770 SO4 A S     1 
HETATM 4355 O O1    . SO4 C 3 .   ? 14.652 4.089   -31.584 1.00 51.54  ? 4770 SO4 A O1    1 
HETATM 4356 O O2    . SO4 C 3 .   ? 15.060 6.405   -32.309 1.00 53.11  ? 4770 SO4 A O2    1 
HETATM 4357 O O3    . SO4 C 3 .   ? 13.968 5.954   -30.268 1.00 52.48  ? 4770 SO4 A O3    1 
HETATM 4358 O O4    . SO4 C 3 .   ? 16.374 5.396   -30.676 1.00 53.66  ? 4770 SO4 A O4    1 
HETATM 4359 S S     . SO4 D 3 .   ? 37.328 -19.188 -20.448 1.00 89.06  ? 4771 SO4 A S     1 
HETATM 4360 O O1    . SO4 D 3 .   ? 36.162 -19.116 -21.440 1.00 88.39  ? 4771 SO4 A O1    1 
HETATM 4361 O O2    . SO4 D 3 .   ? 38.506 -18.453 -21.085 1.00 88.93  ? 4771 SO4 A O2    1 
HETATM 4362 O O3    . SO4 D 3 .   ? 36.943 -18.445 -19.291 1.00 88.28  ? 4771 SO4 A O3    1 
HETATM 4363 O O4    . SO4 D 3 .   ? 37.715 -20.564 -20.439 1.00 88.36  ? 4771 SO4 A O4    1 
HETATM 4364 O O     . HOH E 4 .   ? 16.731 -15.637 -26.871 1.00 46.38  ? 35   HOH B O     1 
HETATM 4365 O O     . HOH E 4 .   ? 42.168 -28.286 -17.942 1.00 44.76  ? 36   HOH B O     1 
HETATM 4366 O O     . HOH E 4 .   ? 43.946 -33.793 -9.952  1.00 46.38  ? 37   HOH B O     1 
HETATM 4367 O O     . HOH E 4 .   ? 19.275 -2.022  -29.510 1.00 38.22  ? 38   HOH B O     1 
HETATM 4368 O O     . HOH E 4 .   ? 44.246 -30.802 -4.007  1.00 51.52  ? 39   HOH B O     1 
HETATM 4369 O O     . HOH E 4 .   ? 48.089 -18.649 -15.415 1.00 50.17  ? 40   HOH B O     1 
HETATM 4370 O O     . HOH E 4 .   ? 42.456 -31.637 -1.538  1.00 62.20  ? 42   HOH B O     1 
HETATM 4371 O O     . HOH E 4 .   ? 39.279 -32.665 -39.156 1.00 80.06  ? 44   HOH B O     1 
HETATM 4372 O O     . HOH E 4 .   ? 47.944 -28.347 -8.106  1.00 51.95  ? 45   HOH B O     1 
HETATM 4373 O O     . HOH E 4 .   ? 18.148 -6.434  -29.421 1.00 32.97  ? 46   HOH B O     1 
HETATM 4374 O O     . HOH E 4 .   ? 40.061 -25.888 -23.281 1.00 50.83  ? 47   HOH B O     1 
HETATM 4375 O O     . HOH E 4 .   ? 45.248 -32.231 -19.631 1.00 48.92  ? 48   HOH B O     1 
HETATM 4376 O O     . HOH E 4 .   ? 41.421 -29.212 -21.291 1.00 54.77  ? 49   HOH B O     1 
HETATM 4377 O O     . HOH E 4 .   ? 59.209 -27.741 -13.397 1.00 70.20  ? 50   HOH B O     1 
HETATM 4378 O O     . HOH E 4 .   ? 47.081 -31.228 -31.096 1.00 58.37  ? 51   HOH B O     1 
HETATM 4379 O O     . HOH E 4 .   ? 34.525 -14.762 -39.713 1.00 66.22  ? 52   HOH B O     1 
HETATM 4380 O O     . HOH E 4 .   ? 37.676 -30.967 -8.331  1.00 70.30  ? 54   HOH B O     1 
HETATM 4381 O O     . HOH E 4 .   ? 47.878 -28.056 -3.953  1.00 65.67  ? 55   HOH B O     1 
HETATM 4382 O O     . HOH E 4 .   ? 49.958 -25.165 -10.353 1.00 60.11  ? 57   HOH B O     1 
HETATM 4383 O O     . HOH F 4 .   ? 52.192 -6.643  -36.993 1.00 55.79  ? 4774 HOH A O     1 
HETATM 4384 O O     . HOH F 4 .   ? 43.434 -12.754 -4.906  1.00 26.92  ? 4775 HOH A O     1 
HETATM 4385 O O     . HOH F 4 .   ? 48.391 -22.041 2.757   1.00 45.76  ? 4776 HOH A O     1 
HETATM 4386 O O     . HOH F 4 .   ? 29.173 -2.073  -33.407 1.00 42.12  ? 4777 HOH A O     1 
HETATM 4387 O O     . HOH F 4 .   ? 31.414 0.825   -34.533 1.00 37.34  ? 4778 HOH A O     1 
HETATM 4388 O O     . HOH F 4 .   ? 53.005 -2.083  -7.493  1.00 44.47  ? 4779 HOH A O     1 
HETATM 4389 O O     . HOH F 4 .   ? 24.792 -10.946 -17.669 1.00 30.28  ? 4780 HOH A O     1 
HETATM 4390 O O     . HOH F 4 .   ? 33.424 -2.393  -14.236 1.00 49.43  ? 4783 HOH A O     1 
HETATM 4391 O O     . HOH F 4 .   ? 5.700  -6.702  -11.993 1.00 56.00  ? 4784 HOH A O     1 
HETATM 4392 O O     . HOH F 4 .   ? 55.332 -38.824 5.431   1.00 31.19  ? 4788 HOH A O     1 
HETATM 4393 O O     . HOH F 4 .   ? 35.272 9.663   -2.984  1.00 28.78  ? 4789 HOH A O     1 
HETATM 4394 O O     . HOH F 4 .   ? 20.983 -10.604 -48.054 1.00 80.28  ? 4790 HOH A O     1 
HETATM 4395 O O     . HOH F 4 .   ? 26.364 -7.914  -15.416 1.00 39.04  ? 4791 HOH A O     1 
HETATM 4396 O O     . HOH F 4 .   ? 62.483 -11.030 -3.322  1.00 43.59  ? 4792 HOH A O     1 
HETATM 4397 O O     . HOH F 4 .   ? 53.021 -25.023 10.637  1.00 33.33  ? 4795 HOH A O     1 
HETATM 4398 O O     . HOH F 4 .   ? 2.181  11.028  -18.580 1.00 42.52  ? 4796 HOH A O     1 
HETATM 4399 O O     . HOH F 4 .   ? 27.459 -0.013  -10.362 1.00 42.36  ? 4797 HOH A O     1 
HETATM 4400 O O     . HOH F 4 .   ? 42.826 -16.229 -16.523 1.00 34.30  ? 4798 HOH A O     1 
HETATM 4401 O O     . HOH F 4 .   ? 27.804 -2.285  -19.722 1.00 43.77  ? 4799 HOH A O     1 
HETATM 4402 O O     . HOH F 4 .   ? 54.295 0.387   -14.478 1.00 50.42  ? 4800 HOH A O     1 
HETATM 4403 O O     . HOH F 4 .   ? 19.745 -18.132 -51.252 1.00 55.78  ? 4801 HOH A O     1 
HETATM 4404 O O     . HOH F 4 .   ? 52.035 -19.023 -8.195  1.00 45.97  ? 4803 HOH A O     1 
HETATM 4405 O O     . HOH F 4 .   ? 5.633  -20.856 -27.354 1.00 52.78  ? 4805 HOH A O     1 
HETATM 4406 O O     . HOH F 4 .   ? 27.092 -4.698  -17.540 1.00 36.93  ? 4806 HOH A O     1 
HETATM 4407 O O     . HOH F 4 .   ? 34.506 -5.546  -37.500 1.00 45.71  ? 4807 HOH A O     1 
HETATM 4408 O O     . HOH F 4 .   ? 54.832 -17.416 -9.891  1.00 41.35  ? 4808 HOH A O     1 
HETATM 4409 O O     . HOH F 4 .   ? 43.324 -33.112 5.154   1.00 40.14  ? 4809 HOH A O     1 
HETATM 4410 O O     . HOH F 4 .   ? 24.395 -9.296  -21.386 1.00 41.02  ? 4810 HOH A O     1 
HETATM 4411 O O     . HOH F 4 .   ? 2.870  6.343   -50.564 1.00 56.02  ? 4811 HOH A O     1 
HETATM 4412 O O     . HOH F 4 .   ? 45.787 -3.456  -34.499 1.00 54.37  ? 4813 HOH A O     1 
HETATM 4413 O O     . HOH F 4 .   ? -0.248 -12.023 -29.688 1.00 31.85  ? 4815 HOH A O     1 
HETATM 4414 O O     . HOH F 4 .   ? 16.105 3.685   -2.709  1.00 55.52  ? 4816 HOH A O     1 
HETATM 4415 O O     . HOH F 4 .   ? 16.775 12.273  -22.678 1.00 48.48  ? 4818 HOH A O     1 
HETATM 4416 O O     . HOH F 4 .   ? 27.219 3.729   -11.882 1.00 46.23  ? 4819 HOH A O     1 
HETATM 4417 O O     . HOH F 4 .   ? 26.108 0.070   -19.471 1.00 42.79  ? 4820 HOH A O     1 
HETATM 4418 O O     . HOH F 4 .   ? -1.276 -16.071 -15.073 1.00 52.63  ? 4822 HOH A O     1 
HETATM 4419 O O     . HOH F 4 .   ? -0.742 -10.190 -15.577 1.00 46.55  ? 4825 HOH A O     1 
HETATM 4420 O O     . HOH F 4 .   ? 18.199 12.377  -39.228 1.00 50.84  ? 4826 HOH A O     1 
HETATM 4421 O O     . HOH F 4 .   ? 14.095 18.631  -10.711 1.00 67.70  ? 4827 HOH A O     1 
HETATM 4422 O O     . HOH F 4 .   ? 13.067 -18.119 -18.031 1.00 56.19  ? 4828 HOH A O     1 
HETATM 4423 O O     . HOH F 4 .   ? 47.142 -26.956 7.461   1.00 52.65  ? 4831 HOH A O     1 
HETATM 4424 O O     . HOH F 4 .   ? 35.952 -9.712  -35.735 1.00 56.86  ? 4832 HOH A O     1 
HETATM 4425 O O     . HOH F 4 .   ? 23.939 -12.058 -24.161 1.00 40.35  ? 4833 HOH A O     1 
HETATM 4426 O O     . HOH F 4 .   ? 38.202 -11.209 -6.138  1.00 43.25  ? 4837 HOH A O     1 
HETATM 4427 O O     . HOH F 4 .   ? 62.005 -23.435 -1.728  1.00 36.14  ? 4839 HOH A O     1 
HETATM 4428 O O     . HOH F 4 .   ? 54.223 3.659   -15.807 1.00 49.90  ? 4842 HOH A O     1 
HETATM 4429 O O     . HOH F 4 .   ? 29.326 -4.671  -13.842 1.00 48.25  ? 4843 HOH A O     1 
HETATM 4430 O O     . HOH F 4 .   ? 9.075  -12.889 -10.487 1.00 48.23  ? 4844 HOH A O     1 
HETATM 4431 O O     . HOH F 4 .   ? 35.002 2.844   -23.904 1.00 42.92  ? 4845 HOH A O     1 
HETATM 4432 O O     . HOH F 4 .   ? 25.720 -10.613 -52.743 1.00 66.65  ? 4849 HOH A O     1 
HETATM 4433 O O     . HOH F 4 .   ? 51.512 -44.624 -1.284  1.00 50.62  ? 4851 HOH A O     1 
HETATM 4434 O O     . HOH F 4 .   ? 15.228 21.522  -18.908 1.00 50.36  ? 4853 HOH A O     1 
HETATM 4435 O O     . HOH F 4 .   ? 36.511 -8.456  -15.041 1.00 42.42  ? 4854 HOH A O     1 
HETATM 4436 O O     . HOH F 4 .   ? 23.105 1.938   -39.561 1.00 55.34  ? 4856 HOH A O     1 
HETATM 4437 O O     . HOH F 4 .   ? 58.549 -9.429  -2.293  1.00 46.05  ? 4857 HOH A O     1 
HETATM 4438 O O     . HOH F 4 .   ? 40.892 -17.897 -7.676  1.00 35.41  ? 4858 HOH A O     1 
HETATM 4439 O O     . HOH F 4 .   ? 9.263  -9.486  -6.286  1.00 44.30  ? 4860 HOH A O     1 
HETATM 4440 O O     . HOH F 4 .   ? 39.738 -16.896 -10.117 1.00 48.40  ? 4862 HOH A O     1 
HETATM 4441 O O     . HOH F 4 .   ? 58.910 -4.599  -10.100 1.00 48.11  ? 4864 HOH A O     1 
HETATM 4442 O O     . HOH F 4 .   ? 18.226 -10.355 -19.432 1.00 43.09  ? 4865 HOH A O     1 
HETATM 4443 O O     . HOH F 4 .   ? 34.047 1.731   -21.743 1.00 56.19  ? 4866 HOH A O     1 
HETATM 4444 O O     . HOH F 4 .   ? 50.489 1.022   -8.794  1.00 55.13  ? 4869 HOH A O     1 
HETATM 4445 O O     . HOH F 4 .   ? 47.915 -18.885 -12.730 1.00 42.58  ? 4870 HOH A O     1 
HETATM 4446 O O     . HOH F 4 .   ? 10.183 4.442   -40.234 1.00 53.51  ? 4871 HOH A O     1 
HETATM 4447 O O     . HOH F 4 .   ? 10.762 -20.881 -47.344 1.00 53.62  ? 4872 HOH A O     1 
HETATM 4448 O O     . HOH F 4 .   ? 43.553 -3.990  -36.567 1.00 42.44  ? 4873 HOH A O     1 
HETATM 4449 O O     . HOH F 4 .   ? 43.307 -9.429  -35.856 1.00 41.69  ? 4875 HOH A O     1 
HETATM 4450 O O     . HOH F 4 .   ? 35.709 -4.791  -16.276 1.00 52.78  ? 4877 HOH A O     1 
HETATM 4451 O O     . HOH F 4 .   ? 56.036 -3.313  -10.418 1.00 44.92  ? 4878 HOH A O     1 
HETATM 4452 O O     . HOH F 4 .   ? 4.904  9.061   -38.957 1.00 74.41  ? 4879 HOH A O     1 
HETATM 4453 O O     . HOH F 4 .   ? 16.098 -0.203  -59.197 1.00 56.42  ? 4880 HOH A O     1 
HETATM 4454 O O     . HOH F 4 .   ? 65.781 -33.741 -2.801  1.00 60.03  ? 4881 HOH A O     1 
HETATM 4455 O O     . HOH F 4 .   ? 30.520 3.506   -8.179  1.00 65.79  ? 4882 HOH A O     1 
HETATM 4456 O O     . HOH F 4 .   ? 55.829 -2.415  -24.873 1.00 46.50  ? 4883 HOH A O     1 
HETATM 4457 O O     . HOH F 4 .   ? 3.848  -20.844 -20.321 1.00 59.64  ? 4885 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  C   33  33  33  C   C   B . n 
A 1 34  U   34  34  34  U   U   B . n 
B 2 1   MET 1   1   1   MET MET A . n 
B 2 2   LYS 2   2   2   LYS LYS A . n 
B 2 3   VAL 3   3   3   VAL VAL A . n 
B 2 4   GLU 4   4   4   GLU GLU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   ILE 6   6   6   ILE ILE A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  ALA 10  10  10  ALA ALA A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLU 12  12  12  GLU GLU A . n 
B 2 13  LEU 13  13  13  LEU LEU A . n 
B 2 14  VAL 14  14  14  VAL VAL A . n 
B 2 15  ILE 15  15  15  ILE ILE A . n 
B 2 16  PRO 16  16  16  PRO PRO A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  GLU 19  19  19  GLU GLU A . n 
B 2 20  GLU 20  20  20  GLU GLU A . n 
B 2 21  VAL 21  21  21  VAL VAL A . n 
B 2 22  ARG 22  22  22  ARG ARG A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  GLY 24  24  24  GLY GLY A . n 
B 2 25  ARG 25  25  25  ARG ARG A . n 
B 2 26  GLU 26  26  26  GLU GLU A . n 
B 2 27  ALA 27  27  27  ALA ALA A . n 
B 2 28  GLU 28  28  28  GLU GLU A . n 
B 2 29  GLU 29  29  29  GLU GLU A . n 
B 2 30  GLU 30  30  30  GLU GLU A . n 
B 2 31  LEU 31  31  31  LEU LEU A . n 
B 2 32  ARG 32  32  32  ARG ARG A . n 
B 2 33  ARG 33  33  33  ARG ARG A . n 
B 2 34  ARG 34  34  34  ARG ARG A . n 
B 2 35  LEU 35  35  35  LEU LEU A . n 
B 2 36  ASP 36  36  36  ASP ASP A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  LEU 38  38  38  LEU LEU A . n 
B 2 39  GLY 39  39  39  GLY GLY A . n 
B 2 40  VAL 40  40  40  VAL VAL A . n 
B 2 41  GLU 41  41  41  GLU GLU A . n 
B 2 42  TYR 42  42  42  TYR TYR A . n 
B 2 43  VAL 43  43  43  VAL VAL A . n 
B 2 44  PHE 44  44  44  PHE PHE A . n 
B 2 45  VAL 45  45  45  VAL VAL A . n 
B 2 46  GLY 46  46  46  GLY GLY A . n 
B 2 47  SER 47  47  47  SER SER A . n 
B 2 48  TYR 48  48  48  TYR TYR A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ARG 50  50  50  ARG ARG A . n 
B 2 51  ASN 51  51  51  ASN ASN A . n 
B 2 52  THR 52  52  52  THR THR A . n 
B 2 53  TRP 53  53  53  TRP TRP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LYS 55  55  55  LYS LYS A . n 
B 2 56  GLY 56  56  56  GLY GLY A . n 
B 2 57  SER 57  57  57  SER SER A . n 
B 2 58  LEU 58  58  58  LEU LEU A . n 
B 2 59  GLU 59  59  59  GLU GLU A . n 
B 2 60  ILE 60  60  60  ILE ILE A . n 
B 2 61  ASP 61  61  61  ASP ASP A . n 
B 2 62  VAL 62  62  62  VAL VAL A . n 
B 2 63  PHE 63  63  63  PHE PHE A . n 
B 2 64  LEU 64  64  64  LEU LEU A . n 
B 2 65  LEU 65  65  65  LEU LEU A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  PRO 67  67  67  PRO PRO A . n 
B 2 68  GLU 68  68  68  GLU GLU A . n 
B 2 69  GLU 69  69  69  GLU GLU A . n 
B 2 70  PHE 70  70  70  PHE PHE A . n 
B 2 71  SER 71  71  71  SER SER A . n 
B 2 72  LYS 72  72  72  LYS LYS A . n 
B 2 73  GLU 73  73  73  GLU GLU A . n 
B 2 74  GLU 74  74  74  GLU GLU A . n 
B 2 75  LEU 75  75  75  LEU LEU A . n 
B 2 76  ARG 76  76  76  ARG ARG A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  ARG 78  78  78  ARG ARG A . n 
B 2 79  GLY 79  79  79  GLY GLY A . n 
B 2 80  LEU 80  80  80  LEU LEU A . n 
B 2 81  GLU 81  81  81  GLU GLU A . n 
B 2 82  ILE 82  82  82  ILE ILE A . n 
B 2 83  GLY 83  83  83  GLY GLY A . n 
B 2 84  LYS 84  84  84  LYS LYS A . n 
B 2 85  ALA 85  85  85  ALA ALA A . n 
B 2 86  VAL 86  86  86  VAL VAL A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  ASP 88  88  88  ASP ASP A . n 
B 2 89  SER 89  89  89  SER SER A . n 
B 2 90  TYR 90  90  90  TYR TYR A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  ILE 92  92  92  ILE ILE A . n 
B 2 93  ARG 93  93  93  ARG ARG A . n 
B 2 94  TYR 94  94  94  TYR TYR A . n 
B 2 95  ALA 95  95  95  ALA ALA A . n 
B 2 96  GLU 96  96  96  GLU GLU A . n 
B 2 97  HIS 97  97  97  HIS HIS A . n 
B 2 98  PRO 98  98  98  PRO PRO A . n 
B 2 99  TYR 99  99  99  TYR TYR A . n 
B 2 100 VAL 100 100 100 VAL VAL A . n 
B 2 101 HIS 101 101 101 HIS HIS A . n 
B 2 102 GLY 102 102 102 GLY GLY A . n 
B 2 103 VAL 103 103 103 VAL VAL A . n 
B 2 104 VAL 104 104 104 VAL VAL A . n 
B 2 105 LYS 105 105 105 LYS LYS A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 VAL 107 107 107 VAL VAL A . n 
B 2 108 GLU 108 108 108 GLU GLU A . n 
B 2 109 VAL 109 109 109 VAL VAL A . n 
B 2 110 ASP 110 110 110 ASP ASP A . n 
B 2 111 VAL 111 111 111 VAL VAL A . n 
B 2 112 VAL 112 112 112 VAL VAL A . n 
B 2 113 PRO 113 113 113 PRO PRO A . n 
B 2 114 CYS 114 114 114 CYS CYS A . n 
B 2 115 TYR 115 115 115 TYR TYR A . n 
B 2 116 LYS 116 116 116 LYS LYS A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 LYS 118 118 118 LYS LYS A . n 
B 2 119 GLU 119 119 119 GLU GLU A . n 
B 2 120 PRO 120 120 120 PRO PRO A . n 
B 2 121 LYS 121 121 121 LYS LYS A . n 
B 2 122 ASN 122 122 122 ASN ASN A . n 
B 2 123 ILE 123 123 123 ILE ILE A . n 
B 2 124 LYS 124 124 124 LYS LYS A . n 
B 2 125 SER 125 125 125 SER SER A . n 
B 2 126 ALA 126 126 126 ALA ALA A . n 
B 2 127 VAL 127 127 127 VAL VAL A . n 
B 2 128 ASP 128 128 128 ASP ASP A . n 
B 2 129 ARG 129 129 129 ARG ARG A . n 
B 2 130 THR 130 130 130 THR THR A . n 
B 2 131 PRO 131 131 131 PRO PRO A . n 
B 2 132 PHE 132 132 132 PHE PHE A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 LYS 135 135 135 LYS LYS A . n 
B 2 136 TRP 136 136 136 TRP TRP A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 GLU 138 138 138 GLU GLU A . n 
B 2 139 GLY 139 139 139 GLY GLY A . n 
B 2 140 ARG 140 140 140 ARG ARG A . n 
B 2 141 ILE 141 141 141 ILE ILE A . n 
B 2 142 LYS 142 142 142 LYS LYS A . n 
B 2 143 GLY 143 143 143 GLY GLY A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 ASN 146 146 146 ASN ASN A . n 
B 2 147 GLU 147 147 147 GLU GLU A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 ARG 149 149 149 ARG ARG A . n 
B 2 150 LEU 150 150 150 LEU LEU A . n 
B 2 151 LEU 151 151 151 LEU LEU A . n 
B 2 152 LYS 152 152 152 LYS LYS A . n 
B 2 153 GLY 153 153 153 GLY GLY A . n 
B 2 154 PHE 154 154 154 PHE PHE A . n 
B 2 155 LEU 155 155 155 LEU LEU A . n 
B 2 156 LYS 156 156 156 LYS LYS A . n 
B 2 157 ALA 157 157 157 ALA ALA A . n 
B 2 158 ASN 158 158 158 ASN ASN A . n 
B 2 159 GLY 159 159 159 GLY GLY A . n 
B 2 160 ILE 160 160 160 ILE ILE A . n 
B 2 161 TYR 161 161 161 TYR TYR A . n 
B 2 162 GLY 162 162 162 GLY GLY A . n 
B 2 163 ALA 163 163 163 ALA ALA A . n 
B 2 164 GLU 164 164 164 GLU GLU A . n 
B 2 165 TYR 165 165 165 TYR TYR A . n 
B 2 166 LYS 166 166 166 LYS LYS A . n 
B 2 167 VAL 167 167 167 VAL VAL A . n 
B 2 168 ARG 168 168 168 ARG ARG A . n 
B 2 169 GLY 169 169 169 GLY GLY A . n 
B 2 170 PHE 170 170 170 PHE PHE A . n 
B 2 171 SER 171 171 171 SER SER A . n 
B 2 172 GLY 172 172 172 GLY GLY A . n 
B 2 173 TYR 173 173 173 TYR TYR A . n 
B 2 174 LEU 174 174 174 LEU LEU A . n 
B 2 175 CYS 175 175 175 CYS CYS A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 LEU 177 177 177 LEU LEU A . n 
B 2 178 LEU 178 178 178 LEU LEU A . n 
B 2 179 ILE 179 179 179 ILE ILE A . n 
B 2 180 VAL 180 180 180 VAL VAL A . n 
B 2 181 PHE 181 181 181 PHE PHE A . n 
B 2 182 TYR 182 182 182 TYR TYR A . n 
B 2 183 GLY 183 183 183 GLY GLY A . n 
B 2 184 SER 184 184 184 SER SER A . n 
B 2 185 PHE 185 185 185 PHE PHE A . n 
B 2 186 LEU 186 186 186 LEU LEU A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 THR 188 188 188 THR THR A . n 
B 2 189 VAL 189 189 189 VAL VAL A . n 
B 2 190 LYS 190 190 190 LYS LYS A . n 
B 2 191 ASN 191 191 191 ASN ASN A . n 
B 2 192 ALA 192 192 192 ALA ALA A . n 
B 2 193 ARG 193 193 193 ARG ARG A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 TRP 195 195 195 TRP TRP A . n 
B 2 196 THR 196 196 196 THR THR A . n 
B 2 197 ARG 197 197 197 ARG ARG A . n 
B 2 198 ARG 198 198 198 ARG ARG A . n 
B 2 199 THR 199 199 199 THR THR A . n 
B 2 200 VAL 200 200 200 VAL VAL A . n 
B 2 201 ILE 201 201 201 ILE ILE A . n 
B 2 202 ASP 202 202 202 ASP ASP A . n 
B 2 203 VAL 203 203 203 VAL VAL A . n 
B 2 204 ALA 204 204 204 ALA ALA A . n 
B 2 205 LYS 205 205 205 LYS LYS A . n 
B 2 206 GLY 206 206 206 GLY GLY A . n 
B 2 207 GLU 207 207 207 GLU GLU A . n 
B 2 208 VAL 208 208 208 VAL VAL A . n 
B 2 209 ARG 209 209 209 ARG ARG A . n 
B 2 210 LYS 210 210 210 LYS LYS A . n 
B 2 211 GLY 211 211 211 GLY GLY A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 GLU 213 213 213 GLU GLU A . n 
B 2 214 PHE 214 214 214 PHE PHE A . n 
B 2 215 PHE 215 215 215 PHE PHE A . n 
B 2 216 VAL 216 216 216 VAL VAL A . n 
B 2 217 VAL 217 217 217 VAL VAL A . n 
B 2 218 ASP 218 218 218 ASP ASP A . n 
B 2 219 PRO 219 219 219 PRO PRO A . n 
B 2 220 VAL 220 220 220 VAL VAL A . n 
B 2 221 ASP 221 221 221 ASP ASP A . n 
B 2 222 GLU 222 222 222 GLU GLU A . n 
B 2 223 LYS 223 223 223 LYS LYS A . n 
B 2 224 ARG 224 224 224 ARG ARG A . n 
B 2 225 ASN 225 225 225 ASN ASN A . n 
B 2 226 VAL 226 226 226 VAL VAL A . n 
B 2 227 ALA 227 227 227 ALA ALA A . n 
B 2 228 ALA 228 228 228 ALA ALA A . n 
B 2 229 ASN 229 229 229 ASN ASN A . n 
B 2 230 LEU 230 230 230 LEU LEU A . n 
B 2 231 SER 231 231 231 SER SER A . n 
B 2 232 LEU 232 232 232 LEU LEU A . n 
B 2 233 ASP 233 233 233 ASP ASP A . n 
B 2 234 ASN 234 234 234 ASN ASN A . n 
B 2 235 LEU 235 235 235 LEU LEU A . n 
B 2 236 ALA 236 236 236 ALA ALA A . n 
B 2 237 ARG 237 237 237 ARG ARG A . n 
B 2 238 PHE 238 238 238 PHE PHE A . n 
B 2 239 VAL 239 239 239 VAL VAL A . n 
B 2 240 HIS 240 240 240 HIS HIS A . n 
B 2 241 LEU 241 241 241 LEU LEU A . n 
B 2 242 CYS 242 242 242 CYS CYS A . n 
B 2 243 ARG 243 243 243 ARG ARG A . n 
B 2 244 GLU 244 244 244 GLU GLU A . n 
B 2 245 PHE 245 245 245 PHE PHE A . n 
B 2 246 MET 246 246 246 MET MET A . n 
B 2 247 GLU 247 247 247 GLU GLU A . n 
B 2 248 ALA 248 248 248 ALA ALA A . n 
B 2 249 PRO 249 249 249 PRO PRO A . n 
B 2 250 SER 250 250 250 SER SER A . n 
B 2 251 LEU 251 251 251 LEU LEU A . n 
B 2 252 GLY 252 252 252 GLY GLY A . n 
B 2 253 PHE 253 253 253 PHE PHE A . n 
B 2 254 PHE 254 254 254 PHE PHE A . n 
B 2 255 LYS 255 255 255 LYS LYS A . n 
B 2 256 PRO 256 256 256 PRO PRO A . n 
B 2 257 LYS 257 257 257 LYS LYS A . n 
B 2 258 HIS 258 258 258 HIS HIS A . n 
B 2 259 PRO 259 259 259 PRO PRO A . n 
B 2 260 LEU 260 260 260 LEU LEU A . n 
B 2 261 GLU 261 261 261 GLU GLU A . n 
B 2 262 ILE 262 262 262 ILE ILE A . n 
B 2 263 GLU 263 263 263 GLU GLU A . n 
B 2 264 PRO 264 264 264 PRO PRO A . n 
B 2 265 GLU 265 265 265 GLU GLU A . n 
B 2 266 ARG 266 266 266 ARG ARG A . n 
B 2 267 LEU 267 267 267 LEU LEU A . n 
B 2 268 ARG 268 268 268 ARG ARG A . n 
B 2 269 LYS 269 269 269 LYS LYS A . n 
B 2 270 ILE 270 270 270 ILE ILE A . n 
B 2 271 VAL 271 271 271 VAL VAL A . n 
B 2 272 GLU 272 272 272 GLU GLU A . n 
B 2 273 GLU 273 273 273 GLU GLU A . n 
B 2 274 ARG 274 274 274 ARG ARG A . n 
B 2 275 GLY 275 275 275 GLY GLY A . n 
B 2 276 THR 276 276 276 THR THR A . n 
B 2 277 ALA 277 277 277 ALA ALA A . n 
B 2 278 VAL 278 278 278 VAL VAL A . n 
B 2 279 PHE 279 279 279 PHE PHE A . n 
B 2 280 ALA 280 280 280 ALA ALA A . n 
B 2 281 VAL 281 281 281 VAL VAL A . n 
B 2 282 LYS 282 282 282 LYS LYS A . n 
B 2 283 PHE 283 283 283 PHE PHE A . n 
B 2 284 ARG 284 284 284 ARG ARG A . n 
B 2 285 LYS 285 285 285 LYS LYS A . n 
B 2 286 PRO 286 286 286 PRO PRO A . n 
B 2 287 ASP 287 287 287 ASP ASP A . n 
B 2 288 ILE 288 288 288 ILE ILE A . n 
B 2 289 VAL 289 289 289 VAL VAL A . n 
B 2 290 ASP 290 290 290 ASP ASP A . n 
B 2 291 ASP 291 291 291 ASP ASP A . n 
B 2 292 ASN 292 292 292 ASN ASN A . n 
B 2 293 LEU 293 293 293 LEU LEU A . n 
B 2 294 TYR 294 294 294 TYR TYR A . n 
B 2 295 PRO 295 295 295 PRO PRO A . n 
B 2 296 GLN 296 296 296 GLN GLN A . n 
B 2 297 LEU 297 297 297 LEU LEU A . n 
B 2 298 GLU 298 298 298 GLU GLU A . n 
B 2 299 ARG 299 299 299 ARG ARG A . n 
B 2 300 ALA 300 300 300 ALA ALA A . n 
B 2 301 SER 301 301 301 SER SER A . n 
B 2 302 ARG 302 302 302 ARG ARG A . n 
B 2 303 LYS 303 303 303 LYS LYS A . n 
B 2 304 ILE 304 304 304 ILE ILE A . n 
B 2 305 PHE 305 305 305 PHE PHE A . n 
B 2 306 GLU 306 306 306 GLU GLU A . n 
B 2 307 PHE 307 307 307 PHE PHE A . n 
B 2 308 LEU 308 308 308 LEU LEU A . n 
B 2 309 GLU 309 309 309 GLU GLU A . n 
B 2 310 ARG 310 310 310 ARG ARG A . n 
B 2 311 GLU 311 311 311 GLU GLU A . n 
B 2 312 ASN 312 312 312 ASN ASN A . n 
B 2 313 PHE 313 313 313 PHE PHE A . n 
B 2 314 MET 314 314 314 MET MET A . n 
B 2 315 PRO 315 315 315 PRO PRO A . n 
B 2 316 LEU 316 316 316 LEU LEU A . n 
B 2 317 ARG 317 317 317 ARG ARG A . n 
B 2 318 SER 318 318 318 SER SER A . n 
B 2 319 ALA 319 319 319 ALA ALA A . n 
B 2 320 PHE 320 320 320 PHE PHE A . n 
B 2 321 LYS 321 321 321 LYS LYS A . n 
B 2 322 ALA 322 322 322 ALA ALA A . n 
B 2 323 SER 323 323 323 SER SER A . n 
B 2 324 GLU 324 324 324 GLU GLU A . n 
B 2 325 GLU 325 325 325 GLU GLU A . n 
B 2 326 PHE 326 326 326 PHE PHE A . n 
B 2 327 CYS 327 327 327 CYS CYS A . n 
B 2 328 TYR 328 328 328 TYR TYR A . n 
B 2 329 LEU 329 329 329 LEU LEU A . n 
B 2 330 LEU 330 330 330 LEU LEU A . n 
B 2 331 PHE 331 331 331 PHE PHE A . n 
B 2 332 GLU 332 332 332 GLU GLU A . n 
B 2 333 CYS 333 333 333 CYS CYS A . n 
B 2 334 GLN 334 334 334 GLN GLN A . n 
B 2 335 ILE 335 335 335 ILE ILE A . n 
B 2 336 LYS 336 336 336 LYS LYS A . n 
B 2 337 GLU 337 337 337 GLU GLU A . n 
B 2 338 ILE 338 338 338 ILE ILE A . n 
B 2 339 SER 339 339 339 SER SER A . n 
B 2 340 ARG 340 340 340 ARG ARG A . n 
B 2 341 VAL 341 341 341 VAL VAL A . n 
B 2 342 PHE 342 342 342 PHE PHE A . n 
B 2 343 ARG 343 343 343 ARG ARG A . n 
B 2 344 ARG 344 344 344 ARG ARG A . n 
B 2 345 MET 345 345 345 MET MET A . n 
B 2 346 GLY 346 346 346 GLY GLY A . n 
B 2 347 PRO 347 347 347 PRO PRO A . n 
B 2 348 GLN 348 348 348 GLN GLN A . n 
B 2 349 PHE 349 349 349 PHE PHE A . n 
B 2 350 GLU 350 350 350 GLU GLU A . n 
B 2 351 ASP 351 351 351 ASP ASP A . n 
B 2 352 GLU 352 352 352 GLU GLU A . n 
B 2 353 ARG 353 353 353 ARG ARG A . n 
B 2 354 ASN 354 354 354 ASN ASN A . n 
B 2 355 VAL 355 355 355 VAL VAL A . n 
B 2 356 LYS 356 356 356 LYS LYS A . n 
B 2 357 LYS 357 357 357 LYS LYS A . n 
B 2 358 PHE 358 358 358 PHE PHE A . n 
B 2 359 LEU 359 359 359 LEU LEU A . n 
B 2 360 SER 360 360 360 SER SER A . n 
B 2 361 ARG 361 361 361 ARG ARG A . n 
B 2 362 ASN 362 362 362 ASN ASN A . n 
B 2 363 ARG 363 363 363 ARG ARG A . n 
B 2 364 ALA 364 364 364 ALA ALA A . n 
B 2 365 PHE 365 365 365 PHE PHE A . n 
B 2 366 ARG 366 366 366 ARG ARG A . n 
B 2 367 PRO 367 367 367 PRO PRO A . n 
B 2 368 PHE 368 368 368 PHE PHE A . n 
B 2 369 ILE 369 369 369 ILE ILE A . n 
B 2 370 GLU 370 370 370 GLU GLU A . n 
B 2 371 ASN 371 371 371 ASN ASN A . n 
B 2 372 GLY 372 372 372 GLY GLY A . n 
B 2 373 ARG 373 373 373 ARG ARG A . n 
B 2 374 TRP 374 374 374 TRP TRP A . n 
B 2 375 TRP 375 375 375 TRP TRP A . n 
B 2 376 ALA 376 376 376 ALA ALA A . n 
B 2 377 PHE 377 377 377 PHE PHE A . n 
B 2 378 GLU 378 378 378 GLU GLU A . n 
B 2 379 MET 379 379 379 MET MET A . n 
B 2 380 ARG 380 380 380 ARG ARG A . n 
B 2 381 LYS 381 381 381 LYS LYS A . n 
B 2 382 PHE 382 382 382 PHE PHE A . n 
B 2 383 THR 383 383 383 THR THR A . n 
B 2 384 THR 384 384 384 THR THR A . n 
B 2 385 PRO 385 385 385 PRO PRO A . n 
B 2 386 GLU 386 386 386 GLU GLU A . n 
B 2 387 GLU 387 387 387 GLU GLU A . n 
B 2 388 GLY 388 388 388 GLY GLY A . n 
B 2 389 VAL 389 389 389 VAL VAL A . n 
B 2 390 ARG 390 390 390 ARG ARG A . n 
B 2 391 SER 391 391 391 SER SER A . n 
B 2 392 TYR 392 392 392 TYR TYR A . n 
B 2 393 ALA 393 393 393 ALA ALA A . n 
B 2 394 SER 394 394 394 SER SER A . n 
B 2 395 THR 395 395 395 THR THR A . n 
B 2 396 HIS 396 396 396 HIS HIS A . n 
B 2 397 TRP 397 397 397 TRP TRP A . n 
B 2 398 HIS 398 398 398 HIS HIS A . n 
B 2 399 THR 399 399 399 THR THR A . n 
B 2 400 LEU 400 400 400 LEU LEU A . n 
B 2 401 GLY 401 401 401 GLY GLY A . n 
B 2 402 LYS 402 402 402 LYS LYS A . n 
B 2 403 ASN 403 403 403 ASN ASN A . n 
B 2 404 VAL 404 404 404 VAL VAL A . n 
B 2 405 GLY 405 405 405 GLY GLY A . n 
B 2 406 GLU 406 406 406 GLU GLU A . n 
B 2 407 SER 407 407 407 SER SER A . n 
B 2 408 ILE 408 408 408 ILE ILE A . n 
B 2 409 ARG 409 409 409 ARG ARG A . n 
B 2 410 GLU 410 410 410 GLU GLU A . n 
B 2 411 TYR 411 411 411 TYR TYR A . n 
B 2 412 PHE 412 412 412 PHE PHE A . n 
B 2 413 GLU 413 413 413 GLU GLU A . n 
B 2 414 ILE 414 414 414 ILE ILE A . n 
B 2 415 ILE 415 415 415 ILE ILE A . n 
B 2 416 SER 416 416 416 SER SER A . n 
B 2 417 GLY 417 417 417 GLY GLY A . n 
B 2 418 GLU 418 418 418 GLU GLU A . n 
B 2 419 LYS 419 419 419 LYS LYS A . n 
B 2 420 LEU 420 420 420 LEU LEU A . n 
B 2 421 PHE 421 421 421 PHE PHE A . n 
B 2 422 LYS 422 422 422 LYS LYS A . n 
B 2 423 GLU 423 423 423 GLU GLU A . n 
B 2 424 PRO 424 424 424 PRO PRO A . n 
B 2 425 VAL 425 425 425 VAL VAL A . n 
B 2 426 THR 426 426 426 THR THR A . n 
B 2 427 ALA 427 427 427 ALA ALA A . n 
B 2 428 GLU 428 428 428 GLU GLU A . n 
B 2 429 LEU 429 429 429 LEU LEU A . n 
B 2 430 CYS 430 430 430 CYS CYS A . n 
B 2 431 GLU 431 431 431 GLU GLU A . n 
B 2 432 MET 432 432 432 MET MET A . n 
B 2 433 MET 433 433 433 MET MET A . n 
B 2 434 GLY 434 434 434 GLY GLY A . n 
B 2 435 VAL 435 435 435 VAL VAL A . n 
B 2 436 LYS 436 436 436 LYS LYS A . n 
B 2 437 ASP 437 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  4770 4770 SO4 SO4 A . 
D 3 SO4 1  4771 4771 SO4 SO4 A . 
E 4 HOH 1  35   35   HOH HOH B . 
E 4 HOH 2  36   36   HOH HOH B . 
E 4 HOH 3  37   37   HOH HOH B . 
E 4 HOH 4  38   38   HOH HOH B . 
E 4 HOH 5  39   39   HOH HOH B . 
E 4 HOH 6  40   40   HOH HOH B . 
E 4 HOH 7  42   42   HOH HOH B . 
E 4 HOH 8  44   44   HOH HOH B . 
E 4 HOH 9  45   45   HOH HOH B . 
E 4 HOH 10 46   46   HOH HOH B . 
E 4 HOH 11 47   47   HOH HOH B . 
E 4 HOH 12 48   48   HOH HOH B . 
E 4 HOH 13 49   49   HOH HOH B . 
E 4 HOH 14 50   50   HOH HOH B . 
E 4 HOH 15 51   51   HOH HOH B . 
E 4 HOH 16 52   52   HOH HOH B . 
E 4 HOH 17 54   54   HOH HOH B . 
E 4 HOH 18 55   55   HOH HOH B . 
E 4 HOH 19 57   57   HOH HOH B . 
F 4 HOH 1  4774 4774 HOH HOH A . 
F 4 HOH 2  4775 4775 HOH HOH A . 
F 4 HOH 3  4776 4776 HOH HOH A . 
F 4 HOH 4  4777 4777 HOH HOH A . 
F 4 HOH 5  4778 4778 HOH HOH A . 
F 4 HOH 6  4779 4779 HOH HOH A . 
F 4 HOH 7  4780 4780 HOH HOH A . 
F 4 HOH 8  4783 4783 HOH HOH A . 
F 4 HOH 9  4784 4784 HOH HOH A . 
F 4 HOH 10 4788 4788 HOH HOH A . 
F 4 HOH 11 4789 4789 HOH HOH A . 
F 4 HOH 12 4790 4790 HOH HOH A . 
F 4 HOH 13 4791 4791 HOH HOH A . 
F 4 HOH 14 4792 4792 HOH HOH A . 
F 4 HOH 15 4795 4795 HOH HOH A . 
F 4 HOH 16 4796 4796 HOH HOH A . 
F 4 HOH 17 4797 4797 HOH HOH A . 
F 4 HOH 18 4798 4798 HOH HOH A . 
F 4 HOH 19 4799 4799 HOH HOH A . 
F 4 HOH 20 4800 4800 HOH HOH A . 
F 4 HOH 21 4801 4801 HOH HOH A . 
F 4 HOH 22 4803 4803 HOH HOH A . 
F 4 HOH 23 4805 4805 HOH HOH A . 
F 4 HOH 24 4806 4806 HOH HOH A . 
F 4 HOH 25 4807 4807 HOH HOH A . 
F 4 HOH 26 4808 4808 HOH HOH A . 
F 4 HOH 27 4809 4809 HOH HOH A . 
F 4 HOH 28 4810 4810 HOH HOH A . 
F 4 HOH 29 4811 4811 HOH HOH A . 
F 4 HOH 30 4813 4813 HOH HOH A . 
F 4 HOH 31 4815 4815 HOH HOH A . 
F 4 HOH 32 4816 4816 HOH HOH A . 
F 4 HOH 33 4818 4818 HOH HOH A . 
F 4 HOH 34 4819 4819 HOH HOH A . 
F 4 HOH 35 4820 4820 HOH HOH A . 
F 4 HOH 36 4822 4822 HOH HOH A . 
F 4 HOH 37 4825 4825 HOH HOH A . 
F 4 HOH 38 4826 4826 HOH HOH A . 
F 4 HOH 39 4827 4827 HOH HOH A . 
F 4 HOH 40 4828 4828 HOH HOH A . 
F 4 HOH 41 4831 4831 HOH HOH A . 
F 4 HOH 42 4832 4832 HOH HOH A . 
F 4 HOH 43 4833 4833 HOH HOH A . 
F 4 HOH 44 4837 4837 HOH HOH A . 
F 4 HOH 45 4839 4839 HOH HOH A . 
F 4 HOH 46 4842 4842 HOH HOH A . 
F 4 HOH 47 4843 4843 HOH HOH A . 
F 4 HOH 48 4844 4844 HOH HOH A . 
F 4 HOH 49 4845 4845 HOH HOH A . 
F 4 HOH 50 4849 4849 HOH HOH A . 
F 4 HOH 51 4851 4851 HOH HOH A . 
F 4 HOH 52 4853 4853 HOH HOH A . 
F 4 HOH 53 4854 4854 HOH HOH A . 
F 4 HOH 54 4856 4856 HOH HOH A . 
F 4 HOH 55 4857 4857 HOH HOH A . 
F 4 HOH 56 4858 4858 HOH HOH A . 
F 4 HOH 57 4860 4860 HOH HOH A . 
F 4 HOH 58 4862 4862 HOH HOH A . 
F 4 HOH 59 4864 4864 HOH HOH A . 
F 4 HOH 60 4865 4865 HOH HOH A . 
F 4 HOH 61 4866 4866 HOH HOH A . 
F 4 HOH 62 4869 4869 HOH HOH A . 
F 4 HOH 63 4870 4870 HOH HOH A . 
F 4 HOH 64 4871 4871 HOH HOH A . 
F 4 HOH 65 4872 4872 HOH HOH A . 
F 4 HOH 66 4873 4873 HOH HOH A . 
F 4 HOH 67 4875 4875 HOH HOH A . 
F 4 HOH 68 4877 4877 HOH HOH A . 
F 4 HOH 69 4878 4878 HOH HOH A . 
F 4 HOH 70 4879 4879 HOH HOH A . 
F 4 HOH 71 4880 4880 HOH HOH A . 
F 4 HOH 72 4881 4881 HOH HOH A . 
F 4 HOH 73 4882 4882 HOH HOH A . 
F 4 HOH 74 4883 4883 HOH HOH A . 
F 4 HOH 75 4885 4885 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3150  ? 
1 MORE         -51   ? 
1 'SSA (A^2)'  27240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LYS 2   ? ? CA A LYS 2   ? ? C A LYS 2   ? ? 125.62 110.40 15.22  2.00 N 
2 1 CB A LYS 84  ? ? CA A LYS 84  ? ? C A LYS 84  ? ? 88.66  110.40 -21.74 2.00 N 
3 1 CB A LYS 135 ? ? CA A LYS 135 ? ? C A LYS 135 ? ? 94.46  110.40 -15.94 2.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 91  ? ? -175.85 102.85  
2 1 ALA A 95  ? ? 172.29  -150.91 
3 1 GLU A 119 ? ? 82.79   114.20  
4 1 ALA A 248 ? ? -168.32 68.81   
5 1 ARG A 366 ? ? 54.44   107.85  
6 1 TYR A 411 ? ? 172.68  120.55  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   MET 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    1 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    2 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            118.42 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    U 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     14 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.063 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZH5 'double helix'         
2ZH5 'a-form double helix'  
2ZH5 'hairpin loop'         
2ZH5 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 0.008  -0.154 0.973  10.656  -7.913  -1.276  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -1.044 -0.050 0.129  11.045  -10.545 4.828   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.205  -0.018 0.070  8.053   -9.578  -1.113  3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 -0.117 -0.061 0.161  -0.514  -2.378  2.201   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 0.045  0.096  -0.149 10.089  -7.318  8.041   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.417 -0.489 -0.330 -1.454  -10.505 12.060  6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 0.068  -0.151 -0.297 -7.287  -10.464 -8.300  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.615  -0.341 -0.087 -6.712  -8.176  -2.535  8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.454 -0.146 0.315  -8.992  -15.548 1.014   9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 -0.079 -0.101 0.222  1.117   -12.301 -0.954  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 -0.125 -0.254 0.084  -8.368  -13.044 0.508   11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 0.169  -0.143 -0.251 -14.177 -20.355 -0.659  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.442  -2.375 -0.137 -8.131  4.442   -83.937 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.291  -1.716 3.318 3.407  3.968  30.526 -3.971 0.104  3.089 7.468  -6.412  
30.960 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.423 -1.708 3.330 -3.384 2.950  35.886 -3.169 0.203  3.210 4.765  5.465   
36.157 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.250 -2.356 3.195 -1.544 10.215 30.857 -5.760 0.212  2.327 18.557 2.804   
32.501 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 0.086  -1.977 2.996 1.519  2.527  28.883 -4.440 0.126  2.817 5.050  -3.036  
29.030 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.418  -2.439 3.488 0.321  14.125 18.820 -9.931 -3.394 1.367 37.152 -0.844  
23.495 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.299 -1.936 3.450 -4.070 2.549  35.097 -3.578 1.504  3.429 4.202  6.710   
35.414 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.032  -2.050 3.304 0.789  5.527  39.397 -3.634 0.042  3.001 8.149  -1.163  
39.775 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.878  -2.231 3.238 0.962  3.451  20.948 -7.391 -2.009 2.874 9.403  -2.621  
21.249 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.924  -2.353 2.859 6.087  3.597  30.367 -4.970 -0.721 2.699 6.752  -11.426 
31.160 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.949 -2.031 3.314 -1.711 9.155  27.082 -6.026 1.561  2.559 18.856 3.525   
28.610 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.288  -1.673 3.466 2.953  6.985  36.582 -3.552 -0.054 3.119 10.984 -4.644  
37.333 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.638 -1.996 3.140 0.142  -2.184 81.052 -1.481 1.264  3.181 -1.680 -0.109  
81.076 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#