data_2ZH7
# 
_entry.id   2ZH7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZH7         
NDB   PR0324       
RCSB  RCSB027967   
WWPDB D_1000027967 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH1 . unspecified 
PDB 2ZH2 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH5 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHA . unspecified 
PDB 2ZHB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZH7 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZH7 
_cell.length_a           57.926 
_cell.length_b           57.926 
_cell.length_c           440.576 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZH7 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (33-MER)'     10639.345 1  ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme' 51337.941 1  '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'       96.063    2  ?                    ? ? ? 
4 water       nat water               18.015    40 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAG GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAG B ? 
2 'polypeptide(L)'   no no 
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  G   n 
2 1   LYS n 
2 2   VAL n 
2 3   GLU n 
2 4   GLU n 
2 5   ILE n 
2 6   LEU n 
2 7   GLU n 
2 8   LYS n 
2 9   ALA n 
2 10  LEU n 
2 11  GLU n 
2 12  LEU n 
2 13  VAL n 
2 14  ILE n 
2 15  PRO n 
2 16  ASP n 
2 17  GLU n 
2 18  GLU n 
2 19  GLU n 
2 20  VAL n 
2 21  ARG n 
2 22  LYS n 
2 23  GLY n 
2 24  ARG n 
2 25  GLU n 
2 26  ALA n 
2 27  GLU n 
2 28  GLU n 
2 29  GLU n 
2 30  LEU n 
2 31  ARG n 
2 32  ARG n 
2 33  ARG n 
2 34  LEU n 
2 35  ASP n 
2 36  GLU n 
2 37  LEU n 
2 38  GLY n 
2 39  VAL n 
2 40  GLU n 
2 41  TYR n 
2 42  VAL n 
2 43  PHE n 
2 44  VAL n 
2 45  GLY n 
2 46  SER n 
2 47  TYR n 
2 48  ALA n 
2 49  ARG n 
2 50  ASN n 
2 51  THR n 
2 52  TRP n 
2 53  LEU n 
2 54  LYS n 
2 55  GLY n 
2 56  SER n 
2 57  LEU n 
2 58  GLU n 
2 59  ILE n 
2 60  ASP n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  LEU n 
2 65  PHE n 
2 66  PRO n 
2 67  GLU n 
2 68  GLU n 
2 69  PHE n 
2 70  SER n 
2 71  LYS n 
2 72  GLU n 
2 73  GLU n 
2 74  LEU n 
2 75  ARG n 
2 76  GLU n 
2 77  ARG n 
2 78  GLY n 
2 79  LEU n 
2 80  GLU n 
2 81  ILE n 
2 82  GLY n 
2 83  LYS n 
2 84  ALA n 
2 85  VAL n 
2 86  LEU n 
2 87  ASP n 
2 88  SER n 
2 89  TYR n 
2 90  GLU n 
2 91  ILE n 
2 92  ARG n 
2 93  TYR n 
2 94  ALA n 
2 95  GLU n 
2 96  HIS n 
2 97  PRO n 
2 98  TYR n 
2 99  VAL n 
2 100 HIS n 
2 101 GLY n 
2 102 VAL n 
2 103 VAL n 
2 104 LYS n 
2 105 GLY n 
2 106 VAL n 
2 107 GLU n 
2 108 VAL n 
2 109 ASP n 
2 110 VAL n 
2 111 VAL n 
2 112 PRO n 
2 113 CYS n 
2 114 TYR n 
2 115 LYS n 
2 116 LEU n 
2 117 LYS n 
2 118 GLU n 
2 119 PRO n 
2 120 LYS n 
2 121 ASN n 
2 122 ILE n 
2 123 LYS n 
2 124 SER n 
2 125 ALA n 
2 126 VAL n 
2 127 ASP n 
2 128 ARG n 
2 129 THR n 
2 130 PRO n 
2 131 PHE n 
2 132 HIS n 
2 133 HIS n 
2 134 LYS n 
2 135 TRP n 
2 136 LEU n 
2 137 GLU n 
2 138 GLY n 
2 139 ARG n 
2 140 ILE n 
2 141 LYS n 
2 142 GLY n 
2 143 LYS n 
2 144 GLU n 
2 145 ASN n 
2 146 GLU n 
2 147 VAL n 
2 148 ARG n 
2 149 LEU n 
2 150 LEU n 
2 151 LYS n 
2 152 GLY n 
2 153 PHE n 
2 154 LEU n 
2 155 LYS n 
2 156 ALA n 
2 157 ASN n 
2 158 GLY n 
2 159 ILE n 
2 160 TYR n 
2 161 GLY n 
2 162 ALA n 
2 163 GLU n 
2 164 TYR n 
2 165 LYS n 
2 166 VAL n 
2 167 ARG n 
2 168 GLY n 
2 169 PHE n 
2 170 SER n 
2 171 GLY n 
2 172 TYR n 
2 173 LEU n 
2 174 CYS n 
2 175 GLU n 
2 176 LEU n 
2 177 LEU n 
2 178 ILE n 
2 179 VAL n 
2 180 PHE n 
2 181 TYR n 
2 182 GLY n 
2 183 SER n 
2 184 PHE n 
2 185 LEU n 
2 186 GLU n 
2 187 THR n 
2 188 VAL n 
2 189 LYS n 
2 190 ASN n 
2 191 ALA n 
2 192 ARG n 
2 193 ARG n 
2 194 TRP n 
2 195 THR n 
2 196 ARG n 
2 197 ARG n 
2 198 THR n 
2 199 VAL n 
2 200 ILE n 
2 201 ASP n 
2 202 VAL n 
2 203 ALA n 
2 204 LYS n 
2 205 GLY n 
2 206 GLU n 
2 207 VAL n 
2 208 ARG n 
2 209 LYS n 
2 210 GLY n 
2 211 GLU n 
2 212 GLU n 
2 213 PHE n 
2 214 PHE n 
2 215 VAL n 
2 216 VAL n 
2 217 ASP n 
2 218 PRO n 
2 219 VAL n 
2 220 ASP n 
2 221 GLU n 
2 222 LYS n 
2 223 ARG n 
2 224 ASN n 
2 225 VAL n 
2 226 ALA n 
2 227 ALA n 
2 228 ASN n 
2 229 LEU n 
2 230 SER n 
2 231 LEU n 
2 232 ASP n 
2 233 ASN n 
2 234 LEU n 
2 235 ALA n 
2 236 ARG n 
2 237 PHE n 
2 238 VAL n 
2 239 HIS n 
2 240 LEU n 
2 241 CYS n 
2 242 ARG n 
2 243 GLU n 
2 244 PHE n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 PRO n 
2 249 SER n 
2 250 LEU n 
2 251 GLY n 
2 252 PHE n 
2 253 PHE n 
2 254 LYS n 
2 255 PRO n 
2 256 LYS n 
2 257 HIS n 
2 258 PRO n 
2 259 LEU n 
2 260 GLU n 
2 261 ILE n 
2 262 GLU n 
2 263 PRO n 
2 264 GLU n 
2 265 ARG n 
2 266 LEU n 
2 267 ARG n 
2 268 LYS n 
2 269 ILE n 
2 270 VAL n 
2 271 GLU n 
2 272 GLU n 
2 273 ARG n 
2 274 GLY n 
2 275 THR n 
2 276 ALA n 
2 277 VAL n 
2 278 PHE n 
2 279 ALA n 
2 280 VAL n 
2 281 LYS n 
2 282 PHE n 
2 283 ARG n 
2 284 LYS n 
2 285 PRO n 
2 286 ASP n 
2 287 ILE n 
2 288 VAL n 
2 289 ASP n 
2 290 ASP n 
2 291 ASN n 
2 292 LEU n 
2 293 TYR n 
2 294 PRO n 
2 295 GLN n 
2 296 LEU n 
2 297 GLU n 
2 298 ARG n 
2 299 ALA n 
2 300 SER n 
2 301 ARG n 
2 302 LYS n 
2 303 ILE n 
2 304 PHE n 
2 305 GLU n 
2 306 PHE n 
2 307 LEU n 
2 308 GLU n 
2 309 ARG n 
2 310 GLU n 
2 311 ASN n 
2 312 PHE n 
2 313 MET n 
2 314 PRO n 
2 315 LEU n 
2 316 ARG n 
2 317 SER n 
2 318 ALA n 
2 319 PHE n 
2 320 LYS n 
2 321 ALA n 
2 322 SER n 
2 323 GLU n 
2 324 GLU n 
2 325 PHE n 
2 326 CYS n 
2 327 TYR n 
2 328 LEU n 
2 329 LEU n 
2 330 PHE n 
2 331 GLU n 
2 332 CYS n 
2 333 GLN n 
2 334 ILE n 
2 335 LYS n 
2 336 GLU n 
2 337 ILE n 
2 338 SER n 
2 339 ARG n 
2 340 VAL n 
2 341 PHE n 
2 342 ARG n 
2 343 ARG n 
2 344 MET n 
2 345 GLY n 
2 346 PRO n 
2 347 GLN n 
2 348 PHE n 
2 349 GLU n 
2 350 ASP n 
2 351 GLU n 
2 352 ARG n 
2 353 ASN n 
2 354 VAL n 
2 355 LYS n 
2 356 LYS n 
2 357 PHE n 
2 358 LEU n 
2 359 SER n 
2 360 ARG n 
2 361 ASN n 
2 362 ARG n 
2 363 ALA n 
2 364 PHE n 
2 365 ARG n 
2 366 PRO n 
2 367 PHE n 
2 368 ILE n 
2 369 GLU n 
2 370 ASN n 
2 371 GLY n 
2 372 ARG n 
2 373 TRP n 
2 374 TRP n 
2 375 ALA n 
2 376 PHE n 
2 377 GLU n 
2 378 MET n 
2 379 ARG n 
2 380 LYS n 
2 381 PHE n 
2 382 THR n 
2 383 THR n 
2 384 PRO n 
2 385 GLU n 
2 386 GLU n 
2 387 GLY n 
2 388 VAL n 
2 389 ARG n 
2 390 SER n 
2 391 TYR n 
2 392 ALA n 
2 393 SER n 
2 394 THR n 
2 395 HIS n 
2 396 TRP n 
2 397 HIS n 
2 398 THR n 
2 399 LEU n 
2 400 GLY n 
2 401 LYS n 
2 402 ASN n 
2 403 VAL n 
2 404 GLY n 
2 405 GLU n 
2 406 SER n 
2 407 ILE n 
2 408 ARG n 
2 409 GLU n 
2 410 TYR n 
2 411 PHE n 
2 412 GLU n 
2 413 ILE n 
2 414 ILE n 
2 415 SER n 
2 416 GLY n 
2 417 GLU n 
2 418 LYS n 
2 419 LEU n 
2 420 PHE n 
2 421 LYS n 
2 422 GLU n 
2 423 PRO n 
2 424 VAL n 
2 425 THR n 
2 426 ALA n 
2 427 GLU n 
2 428 LEU n 
2 429 CYS n 
2 430 GLU n 
2 431 MET n 
2 432 MET n 
2 433 GLY n 
2 434 VAL n 
2 435 LYS n 
2 436 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
2 ? 
2 PDB 2ZH7      2ZH7   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZH7 A 1 ? 436 ? O28126 2 ? 437 ? 2 437 
2 2 2ZH7 B 1 ? 33  ? 2ZH7   1 ? 33  ? 1 33  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ZH7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-11-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZH7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   16195 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.18 
_reflns.pdbx_netI_over_sigmaI        34.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.430 
_reflns_shell.meanI_over_sigI_obs    4.5 
_reflns_shell.pdbx_redundancy        6.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1506 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZH7 
_refine.ls_number_reflns_obs                     16096 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1551149.23 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.14 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_R_factor_R_free                       0.281 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  788 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               50.1 
_refine.aniso_B[1][1]                            -4.11 
_refine.aniso_B[2][2]                            -4.11 
_refine.aniso_B[3][3]                            8.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.313963 
_refine.solvent_model_param_bsol                 13.4619 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZH7 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.65 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3622 
_refine_hist.pdbx_number_atoms_nucleic_acid   706 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             40 
_refine_hist.number_atoms_total               4378 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        37.14 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.22  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.99  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.31  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.18  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             2390 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               96.0 
_refine_ls_shell.R_factor_R_free                  0.441 
_refine_ls_shell.R_factor_R_free_error            0.042 
_refine_ls_shell.percent_reflns_R_free            4.4 
_refine_ls_shell.number_reflns_R_free             109 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 SO4.param         ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZH7 
_struct.title                     'Complex structure of AFCCA with tRNAminiDG' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZH7 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 1   ? ILE B 14  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 16  ? GLU B 36  ? ASP A 17  GLU A 37  1 ? 21 
HELX_P HELX_P3  3  GLY B 45  ? ARG B 49  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 70  ? LEU B 86  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 124 ? ASP B 127 ? SER A 125 ASP A 128 5 ? 4  
HELX_P HELX_P6  6  ARG B 128 ? ILE B 140 ? ARG A 129 ILE A 141 1 ? 13 
HELX_P HELX_P7  7  LYS B 143 ? ASN B 157 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P8  8  SER B 170 ? GLY B 182 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P9  9  SER B 183 ? ARG B 192 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P10 10 ALA B 203 ? GLY B 205 ? ALA A 204 GLY A 206 5 ? 3  
HELX_P HELX_P11 11 SER B 230 ? ALA B 247 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P12 12 SER B 249 ? LYS B 254 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P13 13 GLU B 262 ? GLY B 274 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P14 14 VAL B 288 ? GLU B 310 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P15 15 ASP B 350 ? ARG B 360 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P16 16 THR B 383 ? TRP B 396 ? THR A 384 TRP A 397 1 ? 14 
HELX_P HELX_P17 17 HIS B 397 ? LEU B 399 ? HIS A 398 LEU A 400 5 ? 3  
HELX_P HELX_P18 18 GLY B 400 ? TYR B 410 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P19 19 GLU B 417 ? PHE B 420 ? GLU A 418 PHE A 421 5 ? 4  
HELX_P HELX_P20 20 VAL B 424 ? MET B 432 ? VAL A 425 MET A 433 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 31 N3 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 31 O2 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 31 N4 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 30 N3 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 30 O2 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 30 N4 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? A C 3  N3 ? ? ? 1_555 A G 29 N1 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8  hydrog ? ? A C 3  N4 ? ? ? 1_555 A G 29 O6 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? A C 3  O2 ? ? ? 1_555 A G 29 N2 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? A C 4  N3 ? ? ? 1_555 A G 28 N1 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11 hydrog ? ? A C 4  N4 ? ? ? 1_555 A G 28 O6 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? A C 4  O2 ? ? ? 1_555 A G 28 N2 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 27 N1 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 27 O6 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog15 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 27 N2 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog16 hydrog ? ? A G 6  N1 ? ? ? 1_555 A U 26 O2 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog17 hydrog ? ? A G 6  O6 ? ? ? 1_555 A U 26 N3 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog18 hydrog ? ? A G 7  N1 ? ? ? 1_555 A C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? A G 7  N2 ? ? ? 1_555 A C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? A G 7  O6 ? ? ? 1_555 A C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 24 O2 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 24 N4 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog24 hydrog ? ? A G 9  N1 ? ? ? 1_555 A C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog25 hydrog ? ? A G 9  N2 ? ? ? 1_555 A C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog26 hydrog ? ? A G 9  O6 ? ? ? 1_555 A C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog27 hydrog ? ? A C 10 N3 ? ? ? 1_555 A G 22 N1 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? A C 10 N4 ? ? ? 1_555 A G 22 O6 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? A C 10 O2 ? ? ? 1_555 A G 22 N2 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? A G 11 N1 ? ? ? 1_555 A C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? A G 11 N2 ? ? ? 1_555 A C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? A G 11 O6 ? ? ? 1_555 A C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? A G 12 N1 ? ? ? 1_555 A C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? A G 12 N2 ? ? ? 1_555 A C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36 hydrog ? ? A U 13 N3 ? ? ? 1_555 A A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog37 hydrog ? ? A U 13 O2 ? ? ? 1_555 A A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 41  ? VAL B 44  ? TYR A 42  VAL A 45  
A 2 GLU B 58  ? PHE B 65  ? GLU A 59  PHE A 66  
A 3 VAL B 106 ? TYR B 114 ? VAL A 107 TYR A 115 
A 4 PRO B 97  ? VAL B 103 ? PRO A 98  VAL A 104 
A 5 SER B 88  ? TYR B 93  ? SER A 89  TYR A 94  
B 1 GLU B 206 ? LYS B 209 ? GLU A 207 LYS A 210 
B 2 THR B 198 ? ASP B 201 ? THR A 199 ASP A 202 
B 3 PHE B 214 ? VAL B 216 ? PHE A 215 VAL A 217 
C 1 PRO B 314 ? ALA B 321 ? PRO A 315 ALA A 322 
C 2 PHE B 325 ? CYS B 332 ? PHE A 326 CYS A 333 
C 3 ALA B 276 ? ARG B 283 ? ALA A 277 ARG A 284 
C 4 GLU B 412 ? SER B 415 ? GLU A 413 SER A 416 
D 1 VAL B 340 ? GLN B 347 ? VAL A 341 GLN A 348 
D 2 ARG B 372 ? MET B 378 ? ARG A 373 MET A 379 
D 3 PHE B 367 ? GLU B 369 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 44  ? N VAL A 45  O ASP B 60  ? O ASP A 61  
A 2 3 N VAL B 61  ? N VAL A 62  O ASP B 109 ? O ASP A 110 
A 3 4 O VAL B 108 ? O VAL A 109 N GLY B 101 ? N GLY A 102 
A 4 5 O TYR B 98  ? O TYR A 99  N ARG B 92  ? N ARG A 93  
B 1 2 O ARG B 208 ? O ARG A 209 N VAL B 199 ? N VAL A 200 
B 2 3 N ILE B 200 ? N ILE A 201 O PHE B 214 ? O PHE A 215 
C 1 2 N LEU B 315 ? N LEU A 316 O GLU B 331 ? O GLU A 332 
C 2 3 O CYS B 332 ? O CYS A 333 N ALA B 276 ? N ALA A 277 
C 3 4 N LYS B 281 ? N LYS A 282 O GLU B 412 ? O GLU A 413 
D 1 2 N PHE B 341 ? N PHE A 342 O GLU B 377 ? O GLU A 378 
D 2 3 O TRP B 374 ? O TRP A 375 N PHE B 367 ? N PHE A 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 701' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 702' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER B 46  ? SER A 47  . ? 1_555 ? 
2 AC1 6 TRP B 52  ? TRP A 53  . ? 1_555 ? 
3 AC1 6 LEU B 53  ? LEU A 54  . ? 1_555 ? 
4 AC1 6 SER B 56  ? SER A 57  . ? 1_555 ? 
5 AC1 6 LYS B 151 ? LYS A 152 . ? 1_555 ? 
6 AC1 6 TYR B 160 ? TYR A 161 . ? 1_555 ? 
7 AC2 3 ARG B 298 ? ARG A 299 . ? 1_555 ? 
8 AC2 3 ARG B 301 ? ARG A 302 . ? 1_555 ? 
9 AC2 3 LYS B 302 ? LYS A 303 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZH7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZH7 
_atom_sites.fract_transf_matrix[1][1]   0.017263 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002270 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . G   A 1 1   ? -15.184 35.477 36.355  1.00 59.07  ? 1   G   B P     1 
ATOM   2    O OP1   . G   A 1 1   ? -15.534 34.200 37.121  1.00 58.75  ? 1   G   B OP1   1 
ATOM   3    O OP2   . G   A 1 1   ? -14.014 36.222 36.994  1.00 56.92  ? 1   G   B OP2   1 
ATOM   4    O "O5'" . G   A 1 1   ? -14.647 34.984 34.887  1.00 56.57  ? 1   G   B "O5'" 1 
ATOM   5    C "C5'" . G   A 1 1   ? -13.752 35.805 34.106  1.00 53.29  ? 1   G   B "C5'" 1 
ATOM   6    C "C4'" . G   A 1 1   ? -12.809 34.947 33.282  1.00 51.29  ? 1   G   B "C4'" 1 
ATOM   7    O "O4'" . G   A 1 1   ? -12.442 33.755 34.024  1.00 50.72  ? 1   G   B "O4'" 1 
ATOM   8    C "C3'" . G   A 1 1   ? -13.330 34.397 31.962  1.00 50.10  ? 1   G   B "C3'" 1 
ATOM   9    O "O3'" . G   A 1 1   ? -13.239 35.363 30.931  1.00 49.49  ? 1   G   B "O3'" 1 
ATOM   10   C "C2'" . G   A 1 1   ? -12.381 33.229 31.699  1.00 49.70  ? 1   G   B "C2'" 1 
ATOM   11   O "O2'" . G   A 1 1   ? -11.135 33.594 31.134  1.00 49.34  ? 1   G   B "O2'" 1 
ATOM   12   C "C1'" . G   A 1 1   ? -12.166 32.692 33.114  1.00 49.64  ? 1   G   B "C1'" 1 
ATOM   13   N N9    . G   A 1 1   ? -13.033 31.555 33.425  1.00 48.75  ? 1   G   B N9    1 
ATOM   14   C C8    . G   A 1 1   ? -13.968 31.468 34.431  1.00 48.18  ? 1   G   B C8    1 
ATOM   15   N N7    . G   A 1 1   ? -14.605 30.330 34.441  1.00 47.24  ? 1   G   B N7    1 
ATOM   16   C C5    . G   A 1 1   ? -14.052 29.616 33.385  1.00 46.96  ? 1   G   B C5    1 
ATOM   17   C C6    . G   A 1 1   ? -14.346 28.317 32.905  1.00 46.23  ? 1   G   B C6    1 
ATOM   18   O O6    . G   A 1 1   ? -15.185 27.514 33.331  1.00 45.92  ? 1   G   B O6    1 
ATOM   19   N N1    . G   A 1 1   ? -13.553 27.983 31.808  1.00 45.97  ? 1   G   B N1    1 
ATOM   20   C C2    . G   A 1 1   ? -12.603 28.797 31.241  1.00 47.01  ? 1   G   B C2    1 
ATOM   21   N N2    . G   A 1 1   ? -11.945 28.294 30.190  1.00 46.83  ? 1   G   B N2    1 
ATOM   22   N N3    . G   A 1 1   ? -12.322 30.015 31.678  1.00 48.25  ? 1   G   B N3    1 
ATOM   23   C C4    . G   A 1 1   ? -13.079 30.356 32.748  1.00 48.24  ? 1   G   B C4    1 
ATOM   24   P P     . G   A 1 2   ? -14.439 35.515 29.881  1.00 42.27  ? 2   G   B P     1 
ATOM   25   O OP1   . G   A 1 2   ? -14.161 36.729 29.076  1.00 43.58  ? 2   G   B OP1   1 
ATOM   26   O OP2   . G   A 1 2   ? -15.711 35.415 30.651  1.00 41.90  ? 2   G   B OP2   1 
ATOM   27   O "O5'" . G   A 1 2   ? -14.284 34.251 28.920  1.00 42.42  ? 2   G   B "O5'" 1 
ATOM   28   C "C5'" . G   A 1 2   ? -13.185 34.170 28.014  1.00 41.16  ? 2   G   B "C5'" 1 
ATOM   29   C "C4'" . G   A 1 2   ? -13.179 32.847 27.282  1.00 39.26  ? 2   G   B "C4'" 1 
ATOM   30   O "O4'" . G   A 1 2   ? -12.890 31.769 28.209  1.00 40.15  ? 2   G   B "O4'" 1 
ATOM   31   C "C3'" . G   A 1 2   ? -14.458 32.410 26.588  1.00 38.32  ? 2   G   B "C3'" 1 
ATOM   32   O "O3'" . G   A 1 2   ? -14.619 33.063 25.323  1.00 35.34  ? 2   G   B "O3'" 1 
ATOM   33   C "C2'" . G   A 1 2   ? -14.201 30.913 26.445  1.00 39.64  ? 2   G   B "C2'" 1 
ATOM   34   O "O2'" . G   A 1 2   ? -13.253 30.621 25.438  1.00 39.36  ? 2   G   B "O2'" 1 
ATOM   35   C "C1'" . G   A 1 2   ? -13.554 30.591 27.792  1.00 40.44  ? 2   G   B "C1'" 1 
ATOM   36   N N9    . G   A 1 2   ? -14.499 30.202 28.836  1.00 41.92  ? 2   G   B N9    1 
ATOM   37   C C8    . G   A 1 2   ? -14.935 30.985 29.877  1.00 42.36  ? 2   G   B C8    1 
ATOM   38   N N7    . G   A 1 2   ? -15.785 30.377 30.663  1.00 42.86  ? 2   G   B N7    1 
ATOM   39   C C5    . G   A 1 2   ? -15.919 29.111 30.111  1.00 43.13  ? 2   G   B C5    1 
ATOM   40   C C6    . G   A 1 2   ? -16.701 27.996 30.536  1.00 43.56  ? 2   G   B C6    1 
ATOM   41   O O6    . G   A 1 2   ? -17.457 27.909 31.516  1.00 42.71  ? 2   G   B O6    1 
ATOM   42   N N1    . G   A 1 2   ? -16.532 26.901 29.689  1.00 43.87  ? 2   G   B N1    1 
ATOM   43   C C2    . G   A 1 2   ? -15.715 26.874 28.583  1.00 44.54  ? 2   G   B C2    1 
ATOM   44   N N2    . G   A 1 2   ? -15.686 25.715 27.918  1.00 44.99  ? 2   G   B N2    1 
ATOM   45   N N3    . G   A 1 2   ? -14.982 27.905 28.170  1.00 44.47  ? 2   G   B N3    1 
ATOM   46   C C4    . G   A 1 2   ? -15.131 28.983 28.978  1.00 43.15  ? 2   G   B C4    1 
ATOM   47   P P     . C   A 1 3   ? -16.071 33.104 24.605  1.00 46.17  ? 3   C   B P     1 
ATOM   48   O OP1   . C   A 1 3   ? -15.949 33.842 23.320  1.00 47.10  ? 3   C   B OP1   1 
ATOM   49   O OP2   . C   A 1 3   ? -17.108 33.530 25.587  1.00 47.99  ? 3   C   B OP2   1 
ATOM   50   O "O5'" . C   A 1 3   ? -16.369 31.577 24.263  1.00 47.27  ? 3   C   B "O5'" 1 
ATOM   51   C "C5'" . C   A 1 3   ? -15.645 30.894 23.249  1.00 48.13  ? 3   C   B "C5'" 1 
ATOM   52   C "C4'" . C   A 1 3   ? -16.154 29.480 23.126  1.00 49.80  ? 3   C   B "C4'" 1 
ATOM   53   O "O4'" . C   A 1 3   ? -15.910 28.776 24.379  1.00 51.69  ? 3   C   B "O4'" 1 
ATOM   54   C "C3'" . C   A 1 3   ? -17.653 29.336 22.926  1.00 49.55  ? 3   C   B "C3'" 1 
ATOM   55   O "O3'" . C   A 1 3   ? -18.020 29.510 21.568  1.00 47.04  ? 3   C   B "O3'" 1 
ATOM   56   C "C2'" . C   A 1 3   ? -17.889 27.908 23.395  1.00 50.57  ? 3   C   B "C2'" 1 
ATOM   57   O "O2'" . C   A 1 3   ? -17.506 26.971 22.402  1.00 50.01  ? 3   C   B "O2'" 1 
ATOM   58   C "C1'" . C   A 1 3   ? -16.946 27.831 24.606  1.00 51.17  ? 3   C   B "C1'" 1 
ATOM   59   N N1    . C   A 1 3   ? -17.608 28.173 25.880  1.00 51.59  ? 3   C   B N1    1 
ATOM   60   C C2    . C   A 1 3   ? -18.375 27.201 26.516  1.00 51.81  ? 3   C   B C2    1 
ATOM   61   O O2    . C   A 1 3   ? -18.423 26.068 26.023  1.00 52.54  ? 3   C   B O2    1 
ATOM   62   N N3    . C   A 1 3   ? -19.045 27.522 27.655  1.00 51.67  ? 3   C   B N3    1 
ATOM   63   C C4    . C   A 1 3   ? -18.955 28.760 28.157  1.00 51.05  ? 3   C   B C4    1 
ATOM   64   N N4    . C   A 1 3   ? -19.666 29.046 29.248  1.00 49.90  ? 3   C   B N4    1 
ATOM   65   C C5    . C   A 1 3   ? -18.141 29.760 27.551  1.00 51.20  ? 3   C   B C5    1 
ATOM   66   C C6    . C   A 1 3   ? -17.492 29.427 26.422  1.00 51.58  ? 3   C   B C6    1 
ATOM   67   P P     . C   A 1 4   ? -19.528 29.927 21.203  1.00 60.42  ? 4   C   B P     1 
ATOM   68   O OP1   . C   A 1 4   ? -19.582 30.104 19.729  1.00 62.03  ? 4   C   B OP1   1 
ATOM   69   O OP2   . C   A 1 4   ? -19.954 31.035 22.085  1.00 60.67  ? 4   C   B OP2   1 
ATOM   70   O "O5'" . C   A 1 4   ? -20.385 28.639 21.591  1.00 60.53  ? 4   C   B "O5'" 1 
ATOM   71   C "C5'" . C   A 1 4   ? -20.147 27.409 20.916  1.00 61.53  ? 4   C   B "C5'" 1 
ATOM   72   C "C4'" . C   A 1 4   ? -21.055 26.329 21.430  1.00 60.71  ? 4   C   B "C4'" 1 
ATOM   73   O "O4'" . C   A 1 4   ? -20.681 25.962 22.777  1.00 61.20  ? 4   C   B "O4'" 1 
ATOM   74   C "C3'" . C   A 1 4   ? -22.526 26.678 21.523  1.00 60.33  ? 4   C   B "C3'" 1 
ATOM   75   O "O3'" . C   A 1 4   ? -23.135 26.542 20.246  1.00 58.98  ? 4   C   B "O3'" 1 
ATOM   76   C "C2'" . C   A 1 4   ? -23.006 25.627 22.512  1.00 60.53  ? 4   C   B "C2'" 1 
ATOM   77   O "O2'" . C   A 1 4   ? -23.067 24.347 21.918  1.00 59.68  ? 4   C   B "O2'" 1 
ATOM   78   C "C1'" . C   A 1 4   ? -21.843 25.613 23.502  1.00 62.09  ? 4   C   B "C1'" 1 
ATOM   79   N N1    . C   A 1 4   ? -22.000 26.586 24.585  1.00 64.20  ? 4   C   B N1    1 
ATOM   80   C C2    . C   A 1 4   ? -22.932 26.331 25.593  1.00 65.44  ? 4   C   B C2    1 
ATOM   81   O O2    . C   A 1 4   ? -23.633 25.303 25.512  1.00 66.65  ? 4   C   B O2    1 
ATOM   82   N N3    . C   A 1 4   ? -23.046 27.212 26.629  1.00 65.73  ? 4   C   B N3    1 
ATOM   83   C C4    . C   A 1 4   ? -22.275 28.308 26.661  1.00 64.97  ? 4   C   B C4    1 
ATOM   84   N N4    . C   A 1 4   ? -22.397 29.144 27.698  1.00 64.00  ? 4   C   B N4    1 
ATOM   85   C C5    . C   A 1 4   ? -21.338 28.596 25.630  1.00 64.94  ? 4   C   B C5    1 
ATOM   86   C C6    . C   A 1 4   ? -21.235 27.718 24.621  1.00 64.60  ? 4   C   B C6    1 
ATOM   87   P P     . C   A 1 5   ? -24.349 27.513 19.834  1.00 79.81  ? 5   C   B P     1 
ATOM   88   O OP1   . C   A 1 5   ? -24.713 27.254 18.412  1.00 78.92  ? 5   C   B OP1   1 
ATOM   89   O OP2   . C   A 1 5   ? -24.011 28.894 20.272  1.00 79.16  ? 5   C   B OP2   1 
ATOM   90   O "O5'" . C   A 1 5   ? -25.556 27.014 20.746  1.00 79.82  ? 5   C   B "O5'" 1 
ATOM   91   C "C5'" . C   A 1 5   ? -26.084 25.698 20.602  1.00 78.78  ? 5   C   B "C5'" 1 
ATOM   92   C "C4'" . C   A 1 5   ? -27.096 25.411 21.687  1.00 78.07  ? 5   C   B "C4'" 1 
ATOM   93   O "O4'" . C   A 1 5   ? -26.454 25.353 22.993  1.00 78.32  ? 5   C   B "O4'" 1 
ATOM   94   C "C3'" . C   A 1 5   ? -28.162 26.466 21.896  1.00 77.43  ? 5   C   B "C3'" 1 
ATOM   95   O "O3'" . C   A 1 5   ? -29.191 26.377 20.931  1.00 76.44  ? 5   C   B "O3'" 1 
ATOM   96   C "C2'" . C   A 1 5   ? -28.688 26.097 23.275  1.00 77.69  ? 5   C   B "C2'" 1 
ATOM   97   O "O2'" . C   A 1 5   ? -29.580 24.998 23.247  1.00 77.69  ? 5   C   B "O2'" 1 
ATOM   98   C "C1'" . C   A 1 5   ? -27.397 25.710 23.994  1.00 77.61  ? 5   C   B "C1'" 1 
ATOM   99   N N1    . C   A 1 5   ? -26.878 26.847 24.768  1.00 77.58  ? 5   C   B N1    1 
ATOM   100  C C2    . C   A 1 5   ? -27.354 27.032 26.071  1.00 77.89  ? 5   C   B C2    1 
ATOM   101  O O2    . C   A 1 5   ? -28.184 26.220 26.530  1.00 77.86  ? 5   C   B O2    1 
ATOM   102  N N3    . C   A 1 5   ? -26.902 28.083 26.797  1.00 77.47  ? 5   C   B N3    1 
ATOM   103  C C4    . C   A 1 5   ? -26.011 28.925 26.269  1.00 77.02  ? 5   C   B C4    1 
ATOM   104  N N4    . C   A 1 5   ? -25.592 29.943 27.024  1.00 77.56  ? 5   C   B N4    1 
ATOM   105  C C5    . C   A 1 5   ? -25.510 28.759 24.944  1.00 76.81  ? 5   C   B C5    1 
ATOM   106  C C6    . C   A 1 5   ? -25.963 27.715 24.236  1.00 76.75  ? 5   C   B C6    1 
ATOM   107  P P     . G   A 1 6   ? -30.200 27.611 20.743  1.00 89.31  ? 6   G   B P     1 
ATOM   108  O OP1   . G   A 1 6   ? -31.287 27.122 19.859  1.00 89.87  ? 6   G   B OP1   1 
ATOM   109  O OP2   . G   A 1 6   ? -29.408 28.801 20.351  1.00 88.51  ? 6   G   B OP2   1 
ATOM   110  O "O5'" . G   A 1 6   ? -30.805 27.884 22.201  1.00 88.20  ? 6   G   B "O5'" 1 
ATOM   111  C "C5'" . G   A 1 6   ? -31.734 26.970 22.779  1.00 86.86  ? 6   G   B "C5'" 1 
ATOM   112  C "C4'" . G   A 1 6   ? -32.323 27.518 24.066  1.00 86.83  ? 6   G   B "C4'" 1 
ATOM   113  O "O4'" . G   A 1 6   ? -31.317 27.668 25.102  1.00 86.72  ? 6   G   B "O4'" 1 
ATOM   114  C "C3'" . G   A 1 6   ? -32.969 28.893 24.061  1.00 86.86  ? 6   G   B "C3'" 1 
ATOM   115  O "O3'" . G   A 1 6   ? -34.248 28.881 23.431  1.00 87.72  ? 6   G   B "O3'" 1 
ATOM   116  C "C2'" . G   A 1 6   ? -33.107 29.166 25.560  1.00 86.43  ? 6   G   B "C2'" 1 
ATOM   117  O "O2'" . G   A 1 6   ? -34.239 28.559 26.149  1.00 85.22  ? 6   G   B "O2'" 1 
ATOM   118  C "C1'" . G   A 1 6   ? -31.840 28.514 26.114  1.00 86.16  ? 6   G   B "C1'" 1 
ATOM   119  N N9    . G   A 1 6   ? -30.847 29.510 26.492  1.00 86.09  ? 6   G   B N9    1 
ATOM   120  C C8    . G   A 1 6   ? -29.749 29.936 25.784  1.00 85.74  ? 6   G   B C8    1 
ATOM   121  N N7    . G   A 1 6   ? -29.055 30.841 26.421  1.00 85.97  ? 6   G   B N7    1 
ATOM   122  C C5    . G   A 1 6   ? -29.738 31.020 27.618  1.00 86.16  ? 6   G   B C5    1 
ATOM   123  C C6    . G   A 1 6   ? -29.452 31.863 28.732  1.00 86.44  ? 6   G   B C6    1 
ATOM   124  O O6    . G   A 1 6   ? -28.501 32.635 28.897  1.00 87.06  ? 6   G   B O6    1 
ATOM   125  N N1    . G   A 1 6   ? -30.411 31.734 29.732  1.00 87.21  ? 6   G   B N1    1 
ATOM   126  C C2    . G   A 1 6   ? -31.502 30.897 29.682  1.00 87.37  ? 6   G   B C2    1 
ATOM   127  N N2    . G   A 1 6   ? -32.326 30.911 30.758  1.00 86.63  ? 6   G   B N2    1 
ATOM   128  N N3    . G   A 1 6   ? -31.771 30.100 28.656  1.00 86.68  ? 6   G   B N3    1 
ATOM   129  C C4    . G   A 1 6   ? -30.851 30.214 27.669  1.00 86.20  ? 6   G   B C4    1 
ATOM   130  P P     . G   A 1 7   ? -35.114 30.228 23.378  1.00 84.87  ? 7   G   B P     1 
ATOM   131  O OP1   . G   A 1 7   ? -36.328 30.021 22.546  1.00 85.19  ? 7   G   B OP1   1 
ATOM   132  O OP2   . G   A 1 7   ? -34.171 31.321 23.052  1.00 83.95  ? 7   G   B OP2   1 
ATOM   133  O "O5'" . G   A 1 7   ? -35.589 30.396 24.885  1.00 85.69  ? 7   G   B "O5'" 1 
ATOM   134  C "C5'" . G   A 1 7   ? -36.156 31.606 25.331  1.00 85.11  ? 7   G   B "C5'" 1 
ATOM   135  C "C4'" . G   A 1 7   ? -36.426 31.543 26.808  1.00 85.05  ? 7   G   B "C4'" 1 
ATOM   136  O "O4'" . G   A 1 7   ? -35.226 31.136 27.518  1.00 84.67  ? 7   G   B "O4'" 1 
ATOM   137  C "C3'" . G   A 1 7   ? -36.775 32.908 27.363  1.00 85.52  ? 7   G   B "C3'" 1 
ATOM   138  O "O3'" . G   A 1 7   ? -38.165 33.149 27.199  1.00 86.26  ? 7   G   B "O3'" 1 
ATOM   139  C "C2'" . G   A 1 7   ? -36.307 32.797 28.805  1.00 85.01  ? 7   G   B "C2'" 1 
ATOM   140  O "O2'" . G   A 1 7   ? -37.221 32.075 29.604  1.00 83.75  ? 7   G   B "O2'" 1 
ATOM   141  C "C1'" . G   A 1 7   ? -35.008 32.003 28.619  1.00 85.13  ? 7   G   B "C1'" 1 
ATOM   142  N N9    . G   A 1 7   ? -33.845 32.827 28.289  1.00 85.38  ? 7   G   B N9    1 
ATOM   143  C C8    . G   A 1 7   ? -33.083 32.743 27.142  1.00 85.04  ? 7   G   B C8    1 
ATOM   144  N N7    . G   A 1 7   ? -32.089 33.590 27.120  1.00 85.07  ? 7   G   B N7    1 
ATOM   145  C C5    . G   A 1 7   ? -32.197 34.284 28.320  1.00 85.24  ? 7   G   B C5    1 
ATOM   146  C C6    . G   A 1 7   ? -31.387 35.327 28.858  1.00 85.22  ? 7   G   B C6    1 
ATOM   147  O O6    . G   A 1 7   ? -30.369 35.851 28.372  1.00 85.18  ? 7   G   B O6    1 
ATOM   148  N N1    . G   A 1 7   ? -31.862 35.755 30.094  1.00 85.42  ? 7   G   B N1    1 
ATOM   149  C C2    . G   A 1 7   ? -32.963 35.248 30.739  1.00 85.56  ? 7   G   B C2    1 
ATOM   150  N N2    . G   A 1 7   ? -33.265 35.816 31.921  1.00 85.39  ? 7   G   B N2    1 
ATOM   151  N N3    . G   A 1 7   ? -33.716 34.262 30.260  1.00 85.13  ? 7   G   B N3    1 
ATOM   152  C C4    . G   A 1 7   ? -33.280 33.833 29.053  1.00 85.26  ? 7   G   B C4    1 
ATOM   153  P P     . G   A 1 8   ? -38.646 34.390 26.306  1.00 77.41  ? 8   G   B P     1 
ATOM   154  O OP1   . G   A 1 8   ? -40.088 34.199 26.008  1.00 76.68  ? 8   G   B OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? -37.675 34.554 25.189  1.00 75.20  ? 8   G   B OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? -38.488 35.613 27.313  1.00 76.91  ? 8   G   B "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? -39.126 35.575 28.591  1.00 77.48  ? 8   G   B "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? -38.658 36.718 29.462  1.00 78.11  ? 8   G   B "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? -37.347 36.449 30.029  1.00 78.45  ? 8   G   B "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? -38.460 38.053 28.774  1.00 78.30  ? 8   G   B "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? -39.675 38.717 28.483  1.00 78.92  ? 8   G   B "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? -37.620 38.791 29.805  1.00 78.03  ? 8   G   B "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? -38.361 39.239 30.923  1.00 77.06  ? 8   G   B "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? -36.657 37.682 30.221  1.00 77.87  ? 8   G   B "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? -35.491 37.719 29.343  1.00 77.32  ? 8   G   B N9    1 
ATOM   166  C C8    . G   A 1 8   ? -35.305 37.061 28.145  1.00 77.12  ? 8   G   B C8    1 
ATOM   167  N N7    . G   A 1 8   ? -34.164 37.345 27.576  1.00 76.35  ? 8   G   B N7    1 
ATOM   168  C C5    . G   A 1 8   ? -33.556 38.233 28.456  1.00 76.15  ? 8   G   B C5    1 
ATOM   169  C C6    . G   A 1 8   ? -32.300 38.892 28.382  1.00 75.71  ? 8   G   B C6    1 
ATOM   170  O O6    . G   A 1 8   ? -31.437 38.817 27.498  1.00 74.88  ? 8   G   B O6    1 
ATOM   171  N N1    . G   A 1 8   ? -32.089 39.713 29.487  1.00 76.06  ? 8   G   B N1    1 
ATOM   172  C C2    . G   A 1 8   ? -32.971 39.880 30.531  1.00 75.86  ? 8   G   B C2    1 
ATOM   173  N N2    . G   A 1 8   ? -32.595 40.724 31.504  1.00 75.59  ? 8   G   B N2    1 
ATOM   174  N N3    . G   A 1 8   ? -34.137 39.267 30.614  1.00 75.47  ? 8   G   B N3    1 
ATOM   175  C C4    . G   A 1 8   ? -34.364 38.467 29.552  1.00 76.28  ? 8   G   B C4    1 
ATOM   176  P P     . G   A 1 9   ? -39.648 40.035 27.567  1.00 89.57  ? 9   G   B P     1 
ATOM   177  O OP1   . G   A 1 9   ? -41.016 40.242 27.015  1.00 90.40  ? 9   G   B OP1   1 
ATOM   178  O OP2   . G   A 1 9   ? -38.480 39.939 26.642  1.00 88.71  ? 9   G   B OP2   1 
ATOM   179  O "O5'" . G   A 1 9   ? -39.367 41.190 28.620  1.00 88.54  ? 9   G   B "O5'" 1 
ATOM   180  C "C5'" . G   A 1 9   ? -38.788 42.413 28.221  1.00 87.35  ? 9   G   B "C5'" 1 
ATOM   181  C "C4'" . G   A 1 9   ? -37.871 42.907 29.298  1.00 86.91  ? 9   G   B "C4'" 1 
ATOM   182  O "O4'" . G   A 1 9   ? -36.827 41.927 29.520  1.00 86.36  ? 9   G   B "O4'" 1 
ATOM   183  C "C3'" . G   A 1 9   ? -37.136 44.180 28.942  1.00 87.22  ? 9   G   B "C3'" 1 
ATOM   184  O "O3'" . G   A 1 9   ? -37.952 45.311 29.233  1.00 88.59  ? 9   G   B "O3'" 1 
ATOM   185  C "C2'" . G   A 1 9   ? -35.887 44.093 29.811  1.00 86.98  ? 9   G   B "C2'" 1 
ATOM   186  O "O2'" . G   A 1 9   ? -36.066 44.542 31.142  1.00 87.09  ? 9   G   B "O2'" 1 
ATOM   187  C "C1'" . G   A 1 9   ? -35.599 42.589 29.775  1.00 85.89  ? 9   G   B "C1'" 1 
ATOM   188  N N9    . G   A 1 9   ? -34.654 42.236 28.721  1.00 84.25  ? 9   G   B N9    1 
ATOM   189  C C8    . G   A 1 9   ? -34.812 41.299 27.728  1.00 83.47  ? 9   G   B C8    1 
ATOM   190  N N7    . G   A 1 9   ? -33.778 41.214 26.938  1.00 82.84  ? 9   G   B N7    1 
ATOM   191  C C5    . G   A 1 9   ? -32.886 42.151 27.437  1.00 82.81  ? 9   G   B C5    1 
ATOM   192  C C6    . G   A 1 9   ? -31.590 42.513 26.995  1.00 82.77  ? 9   G   B C6    1 
ATOM   193  O O6    . G   A 1 9   ? -30.942 42.055 26.044  1.00 82.63  ? 9   G   B O6    1 
ATOM   194  N N1    . G   A 1 9   ? -31.043 43.521 27.783  1.00 83.11  ? 9   G   B N1    1 
ATOM   195  C C2    . G   A 1 9   ? -31.660 44.102 28.866  1.00 83.54  ? 9   G   B C2    1 
ATOM   196  N N2    . G   A 1 9   ? -30.971 45.063 29.511  1.00 83.11  ? 9   G   B N2    1 
ATOM   197  N N3    . G   A 1 9   ? -32.864 43.768 29.290  1.00 83.54  ? 9   G   B N3    1 
ATOM   198  C C4    . G   A 1 9   ? -33.415 42.792 28.534  1.00 83.46  ? 9   G   B C4    1 
ATOM   199  P P     . C   A 1 10  ? -38.225 46.398 28.087  1.00 85.52  ? 10  C   B P     1 
ATOM   200  O OP1   . C   A 1 10  ? -38.030 47.749 28.699  1.00 85.22  ? 10  C   B OP1   1 
ATOM   201  O OP2   . C   A 1 10  ? -39.518 46.061 27.420  1.00 85.66  ? 10  C   B OP2   1 
ATOM   202  O "O5'" . C   A 1 10  ? -37.050 46.101 27.050  1.00 83.10  ? 10  C   B "O5'" 1 
ATOM   203  C "C5'" . C   A 1 10  ? -36.428 47.144 26.324  1.00 78.40  ? 10  C   B "C5'" 1 
ATOM   204  C "C4'" . C   A 1 10  ? -35.257 47.693 27.103  1.00 74.84  ? 10  C   B "C4'" 1 
ATOM   205  O "O4'" . C   A 1 10  ? -34.426 46.617 27.622  1.00 72.28  ? 10  C   B "O4'" 1 
ATOM   206  C "C3'" . C   A 1 10  ? -34.336 48.510 26.227  1.00 73.93  ? 10  C   B "C3'" 1 
ATOM   207  O "O3'" . C   A 1 10  ? -34.797 49.841 26.139  1.00 74.23  ? 10  C   B "O3'" 1 
ATOM   208  C "C2'" . C   A 1 10  ? -32.988 48.347 26.909  1.00 72.32  ? 10  C   B "C2'" 1 
ATOM   209  O "O2'" . C   A 1 10  ? -32.846 49.184 28.041  1.00 71.06  ? 10  C   B "O2'" 1 
ATOM   210  C "C1'" . C   A 1 10  ? -33.063 46.875 27.319  1.00 70.80  ? 10  C   B "C1'" 1 
ATOM   211  N N1    . C   A 1 10  ? -32.677 45.944 26.240  1.00 68.96  ? 10  C   B N1    1 
ATOM   212  C C2    . C   A 1 10  ? -31.387 46.005 25.694  1.00 67.74  ? 10  C   B C2    1 
ATOM   213  O O2    . C   A 1 10  ? -30.599 46.862 26.106  1.00 67.39  ? 10  C   B O2    1 
ATOM   214  N N3    . C   A 1 10  ? -31.040 45.123 24.728  1.00 67.56  ? 10  C   B N3    1 
ATOM   215  C C4    . C   A 1 10  ? -31.922 44.209 24.307  1.00 68.11  ? 10  C   B C4    1 
ATOM   216  N N4    . C   A 1 10  ? -31.534 43.335 23.373  1.00 67.68  ? 10  C   B N4    1 
ATOM   217  C C5    . C   A 1 10  ? -33.242 44.140 24.832  1.00 68.35  ? 10  C   B C5    1 
ATOM   218  C C6    . C   A 1 10  ? -33.574 45.017 25.786  1.00 68.60  ? 10  C   B C6    1 
ATOM   219  P P     . G   A 1 11  ? -34.865 50.538 24.704  1.00 72.49  ? 11  G   B P     1 
ATOM   220  O OP1   . G   A 1 11  ? -35.782 51.708 24.808  1.00 72.16  ? 11  G   B OP1   1 
ATOM   221  O OP2   . G   A 1 11  ? -35.146 49.457 23.716  1.00 71.58  ? 11  G   B OP2   1 
ATOM   222  O "O5'" . G   A 1 11  ? -33.363 51.019 24.477  1.00 70.35  ? 11  G   B "O5'" 1 
ATOM   223  C "C5'" . G   A 1 11  ? -32.694 51.784 25.471  1.00 68.64  ? 11  G   B "C5'" 1 
ATOM   224  C "C4'" . G   A 1 11  ? -31.229 51.903 25.142  1.00 66.96  ? 11  G   B "C4'" 1 
ATOM   225  O "O4'" . G   A 1 11  ? -30.584 50.610 25.322  1.00 65.87  ? 11  G   B "O4'" 1 
ATOM   226  C "C3'" . G   A 1 11  ? -30.916 52.248 23.696  1.00 67.02  ? 11  G   B "C3'" 1 
ATOM   227  O "O3'" . G   A 1 11  ? -31.098 53.626 23.391  1.00 67.77  ? 11  G   B "O3'" 1 
ATOM   228  C "C2'" . G   A 1 11  ? -29.473 51.781 23.598  1.00 66.21  ? 11  G   B "C2'" 1 
ATOM   229  O "O2'" . G   A 1 11  ? -28.590 52.635 24.302  1.00 65.88  ? 11  G   B "O2'" 1 
ATOM   230  C "C1'" . G   A 1 11  ? -29.567 50.447 24.340  1.00 64.95  ? 11  G   B "C1'" 1 
ATOM   231  N N9    . G   A 1 11  ? -29.940 49.339 23.462  1.00 63.61  ? 11  G   B N9    1 
ATOM   232  C C8    . G   A 1 11  ? -31.161 48.707 23.393  1.00 62.70  ? 11  G   B C8    1 
ATOM   233  N N7    . G   A 1 11  ? -31.182 47.722 22.533  1.00 62.25  ? 11  G   B N7    1 
ATOM   234  C C5    . G   A 1 11  ? -29.900 47.703 21.996  1.00 61.97  ? 11  G   B C5    1 
ATOM   235  C C6    . G   A 1 11  ? -29.319 46.837 21.025  1.00 61.10  ? 11  G   B C6    1 
ATOM   236  O O6    . G   A 1 11  ? -29.831 45.874 20.453  1.00 59.91  ? 11  G   B O6    1 
ATOM   237  N N1    . G   A 1 11  ? -27.997 47.180 20.753  1.00 61.21  ? 11  G   B N1    1 
ATOM   238  C C2    . G   A 1 11  ? -27.309 48.216 21.349  1.00 62.67  ? 11  G   B C2    1 
ATOM   239  N N2    . G   A 1 11  ? -26.033 48.394 20.945  1.00 62.40  ? 11  G   B N2    1 
ATOM   240  N N3    . G   A 1 11  ? -27.833 49.020 22.274  1.00 63.09  ? 11  G   B N3    1 
ATOM   241  C C4    . G   A 1 11  ? -29.125 48.707 22.545  1.00 63.05  ? 11  G   B C4    1 
ATOM   242  P P     . G   A 1 12  ? -31.572 54.051 21.909  1.00 67.54  ? 12  G   B P     1 
ATOM   243  O OP1   . G   A 1 12  ? -31.848 55.519 21.900  1.00 67.68  ? 12  G   B OP1   1 
ATOM   244  O OP2   . G   A 1 12  ? -32.634 53.092 21.467  1.00 67.43  ? 12  G   B OP2   1 
ATOM   245  O "O5'" . G   A 1 12  ? -30.282 53.788 21.016  1.00 64.51  ? 12  G   B "O5'" 1 
ATOM   246  C "C5'" . G   A 1 12  ? -29.038 54.382 21.352  1.00 61.91  ? 12  G   B "C5'" 1 
ATOM   247  C "C4'" . G   A 1 12  ? -27.960 53.843 20.458  1.00 61.11  ? 12  G   B "C4'" 1 
ATOM   248  O "O4'" . G   A 1 12  ? -27.794 52.425 20.717  1.00 60.90  ? 12  G   B "O4'" 1 
ATOM   249  C "C3'" . G   A 1 12  ? -28.291 53.887 18.980  1.00 61.08  ? 12  G   B "C3'" 1 
ATOM   250  O "O3'" . G   A 1 12  ? -28.048 55.170 18.431  1.00 62.00  ? 12  G   B "O3'" 1 
ATOM   251  C "C2'" . G   A 1 12  ? -27.355 52.827 18.425  1.00 60.52  ? 12  G   B "C2'" 1 
ATOM   252  O "O2'" . G   A 1 12  ? -26.016 53.278 18.348  1.00 60.86  ? 12  G   B "O2'" 1 
ATOM   253  C "C1'" . G   A 1 12  ? -27.466 51.755 19.509  1.00 59.49  ? 12  G   B "C1'" 1 
ATOM   254  N N9    . G   A 1 12  ? -28.506 50.767 19.240  1.00 57.10  ? 12  G   B N9    1 
ATOM   255  C C8    . G   A 1 12  ? -29.755 50.695 19.814  1.00 56.60  ? 12  G   B C8    1 
ATOM   256  N N7    . G   A 1 12  ? -30.462 49.686 19.379  1.00 55.78  ? 12  G   B N7    1 
ATOM   257  C C5    . G   A 1 12  ? -29.631 49.054 18.460  1.00 55.15  ? 12  G   B C5    1 
ATOM   258  C C6    . G   A 1 12  ? -29.846 47.888 17.658  1.00 54.06  ? 12  G   B C6    1 
ATOM   259  O O6    . G   A 1 12  ? -30.852 47.154 17.603  1.00 53.19  ? 12  G   B O6    1 
ATOM   260  N N1    . G   A 1 12  ? -28.736 47.606 16.866  1.00 53.35  ? 12  G   B N1    1 
ATOM   261  C C2    . G   A 1 12  ? -27.575 48.344 16.838  1.00 53.38  ? 12  G   B C2    1 
ATOM   262  N N2    . G   A 1 12  ? -26.618 47.924 15.995  1.00 53.17  ? 12  G   B N2    1 
ATOM   263  N N3    . G   A 1 12  ? -27.363 49.419 17.577  1.00 54.14  ? 12  G   B N3    1 
ATOM   264  C C4    . G   A 1 12  ? -28.422 49.714 18.359  1.00 55.58  ? 12  G   B C4    1 
ATOM   265  P P     . U   A 1 13  ? -28.862 55.629 17.127  1.00 60.96  ? 13  U   B P     1 
ATOM   266  O OP1   . U   A 1 13  ? -28.430 57.004 16.781  1.00 61.66  ? 13  U   B OP1   1 
ATOM   267  O OP2   . U   A 1 13  ? -30.312 55.349 17.333  1.00 61.22  ? 13  U   B OP2   1 
ATOM   268  O "O5'" . U   A 1 13  ? -28.344 54.617 16.014  1.00 59.82  ? 13  U   B "O5'" 1 
ATOM   269  C "C5'" . U   A 1 13  ? -26.965 54.538 15.662  1.00 58.05  ? 13  U   B "C5'" 1 
ATOM   270  C "C4'" . U   A 1 13  ? -26.769 53.474 14.606  1.00 57.46  ? 13  U   B "C4'" 1 
ATOM   271  O "O4'" . U   A 1 13  ? -26.992 52.159 15.192  1.00 58.50  ? 13  U   B "O4'" 1 
ATOM   272  C "C3'" . U   A 1 13  ? -27.784 53.530 13.480  1.00 56.63  ? 13  U   B "C3'" 1 
ATOM   273  O "O3'" . U   A 1 13  ? -27.437 54.477 12.488  1.00 55.90  ? 13  U   B "O3'" 1 
ATOM   274  C "C2'" . U   A 1 13  ? -27.761 52.106 12.953  1.00 56.78  ? 13  U   B "C2'" 1 
ATOM   275  O "O2'" . U   A 1 13  ? -26.652 51.861 12.118  1.00 55.93  ? 13  U   B "O2'" 1 
ATOM   276  C "C1'" . U   A 1 13  ? -27.644 51.314 14.255  1.00 57.44  ? 13  U   B "C1'" 1 
ATOM   277  N N1    . U   A 1 13  ? -28.971 50.974 14.782  1.00 57.38  ? 13  U   B N1    1 
ATOM   278  C C2    . U   A 1 13  ? -29.548 49.814 14.318  1.00 57.27  ? 13  U   B C2    1 
ATOM   279  O O2    . U   A 1 13  ? -28.984 49.075 13.534  1.00 56.86  ? 13  U   B O2    1 
ATOM   280  N N3    . U   A 1 13  ? -30.810 49.551 14.807  1.00 57.56  ? 13  U   B N3    1 
ATOM   281  C C4    . U   A 1 13  ? -31.533 50.321 15.708  1.00 58.24  ? 13  U   B C4    1 
ATOM   282  O O4    . U   A 1 13  ? -32.654 49.945 16.076  1.00 58.08  ? 13  U   B O4    1 
ATOM   283  C C5    . U   A 1 13  ? -30.856 51.508 16.151  1.00 58.21  ? 13  U   B C5    1 
ATOM   284  C C6    . U   A 1 13  ? -29.627 51.785 15.686  1.00 58.19  ? 13  U   B C6    1 
ATOM   285  P P     . U   A 1 14  ? -28.608 55.268 11.721  1.00 57.23  ? 14  U   B P     1 
ATOM   286  O OP1   . U   A 1 14  ? -27.983 56.229 10.773  1.00 55.70  ? 14  U   B OP1   1 
ATOM   287  O OP2   . U   A 1 14  ? -29.554 55.767 12.760  1.00 55.66  ? 14  U   B OP2   1 
ATOM   288  O "O5'" . U   A 1 14  ? -29.348 54.120 10.890  1.00 56.30  ? 14  U   B "O5'" 1 
ATOM   289  C "C5'" . U   A 1 14  ? -28.632 53.346 9.922   1.00 54.17  ? 14  U   B "C5'" 1 
ATOM   290  C "C4'" . U   A 1 14  ? -29.524 52.284 9.299   1.00 52.70  ? 14  U   B "C4'" 1 
ATOM   291  O "O4'" . U   A 1 14  ? -29.790 51.199 10.236  1.00 51.48  ? 14  U   B "O4'" 1 
ATOM   292  C "C3'" . U   A 1 14  ? -30.904 52.731 8.847   1.00 51.68  ? 14  U   B "C3'" 1 
ATOM   293  O "O3'" . U   A 1 14  ? -30.850 53.417 7.600   1.00 51.48  ? 14  U   B "O3'" 1 
ATOM   294  C "C2'" . U   A 1 14  ? -31.646 51.399 8.776   1.00 50.37  ? 14  U   B "C2'" 1 
ATOM   295  O "O2'" . U   A 1 14  ? -31.331 50.637 7.636   1.00 47.78  ? 14  U   B "O2'" 1 
ATOM   296  C "C1'" . U   A 1 14  ? -31.097 50.686 10.014  1.00 50.17  ? 14  U   B "C1'" 1 
ATOM   297  N N1    . U   A 1 14  ? -31.923 51.012 11.181  1.00 49.47  ? 14  U   B N1    1 
ATOM   298  C C2    . U   A 1 14  ? -33.043 50.249 11.398  1.00 49.41  ? 14  U   B C2    1 
ATOM   299  O O2    . U   A 1 14  ? -33.320 49.280 10.714  1.00 50.21  ? 14  U   B O2    1 
ATOM   300  N N3    . U   A 1 14  ? -33.827 50.657 12.448  1.00 49.62  ? 14  U   B N3    1 
ATOM   301  C C4    . U   A 1 14  ? -33.592 51.726 13.295  1.00 50.03  ? 14  U   B C4    1 
ATOM   302  O O4    . U   A 1 14  ? -34.439 52.031 14.146  1.00 51.31  ? 14  U   B O4    1 
ATOM   303  C C5    . U   A 1 14  ? -32.381 52.438 13.027  1.00 49.75  ? 14  U   B C5    1 
ATOM   304  C C6    . U   A 1 14  ? -31.609 52.065 12.008  1.00 49.44  ? 14  U   B C6    1 
ATOM   305  P P     . C   A 1 15  ? -31.773 54.715 7.369   1.00 47.00  ? 15  C   B P     1 
ATOM   306  O OP1   . C   A 1 15  ? -31.177 55.520 6.275   1.00 48.37  ? 15  C   B OP1   1 
ATOM   307  O OP2   . C   A 1 15  ? -31.966 55.325 8.709   1.00 48.00  ? 15  C   B OP2   1 
ATOM   308  O "O5'" . C   A 1 15  ? -33.164 54.118 6.861   1.00 46.95  ? 15  C   B "O5'" 1 
ATOM   309  C "C5'" . C   A 1 15  ? -34.284 54.963 6.578   1.00 45.73  ? 15  C   B "C5'" 1 
ATOM   310  C "C4'" . C   A 1 15  ? -35.548 54.133 6.430   1.00 44.70  ? 15  C   B "C4'" 1 
ATOM   311  O "O4'" . C   A 1 15  ? -35.608 53.467 5.137   1.00 43.36  ? 15  C   B "O4'" 1 
ATOM   312  C "C3'" . C   A 1 15  ? -35.695 53.012 7.450   1.00 44.42  ? 15  C   B "C3'" 1 
ATOM   313  O "O3'" . C   A 1 15  ? -36.220 53.504 8.681   1.00 46.95  ? 15  C   B "O3'" 1 
ATOM   314  C "C2'" . C   A 1 15  ? -36.644 52.031 6.763   1.00 42.70  ? 15  C   B "C2'" 1 
ATOM   315  O "O2'" . C   A 1 15  ? -38.008 52.335 6.969   1.00 41.36  ? 15  C   B "O2'" 1 
ATOM   316  C "C1'" . C   A 1 15  ? -36.308 52.245 5.286   1.00 41.30  ? 15  C   B "C1'" 1 
ATOM   317  N N1    . C   A 1 15  ? -35.590 51.163 4.586   1.00 37.84  ? 15  C   B N1    1 
ATOM   318  C C2    . C   A 1 15  ? -34.195 51.167 4.557   1.00 36.37  ? 15  C   B C2    1 
ATOM   319  O O2    . C   A 1 15  ? -33.588 52.110 5.067   1.00 34.97  ? 15  C   B O2    1 
ATOM   320  N N3    . C   A 1 15  ? -33.543 50.147 3.957   1.00 36.30  ? 15  C   B N3    1 
ATOM   321  C C4    . C   A 1 15  ? -34.233 49.159 3.390   1.00 36.43  ? 15  C   B C4    1 
ATOM   322  N N4    . C   A 1 15  ? -33.549 48.166 2.807   1.00 36.73  ? 15  C   B N4    1 
ATOM   323  C C5    . C   A 1 15  ? -35.655 49.139 3.394   1.00 36.49  ? 15  C   B C5    1 
ATOM   324  C C6    . C   A 1 15  ? -36.286 50.151 3.995   1.00 36.01  ? 15  C   B C6    1 
ATOM   325  P P     . G   A 1 16  ? -35.856 52.753 10.055  1.00 50.02  ? 16  G   B P     1 
ATOM   326  O OP1   . G   A 1 16  ? -36.714 53.316 11.127  1.00 48.70  ? 16  G   B OP1   1 
ATOM   327  O OP2   . G   A 1 16  ? -34.380 52.802 10.201  1.00 50.04  ? 16  G   B OP2   1 
ATOM   328  O "O5'" . G   A 1 16  ? -36.307 51.243 9.788   1.00 49.23  ? 16  G   B "O5'" 1 
ATOM   329  C "C5'" . G   A 1 16  ? -37.694 50.896 9.784   1.00 49.86  ? 16  G   B "C5'" 1 
ATOM   330  C "C4'" . G   A 1 16  ? -37.889 49.448 9.384   1.00 50.14  ? 16  G   B "C4'" 1 
ATOM   331  O "O4'" . G   A 1 16  ? -37.386 49.238 8.039   1.00 50.84  ? 16  G   B "O4'" 1 
ATOM   332  C "C3'" . G   A 1 16  ? -37.146 48.425 10.224  1.00 50.69  ? 16  G   B "C3'" 1 
ATOM   333  O "O3'" . G   A 1 16  ? -37.887 48.148 11.406  1.00 51.69  ? 16  G   B "O3'" 1 
ATOM   334  C "C2'" . G   A 1 16  ? -37.068 47.231 9.276   1.00 50.26  ? 16  G   B "C2'" 1 
ATOM   335  O "O2'" . G   A 1 16  ? -38.275 46.494 9.211   1.00 49.56  ? 16  G   B "O2'" 1 
ATOM   336  C "C1'" . G   A 1 16  ? -36.844 47.930 7.930   1.00 50.41  ? 16  G   B "C1'" 1 
ATOM   337  N N9    . G   A 1 16  ? -35.448 48.058 7.513   1.00 49.71  ? 16  G   B N9    1 
ATOM   338  C C8    . G   A 1 16  ? -34.578 49.061 7.861   1.00 50.07  ? 16  G   B C8    1 
ATOM   339  N N7    . G   A 1 16  ? -33.399 48.931 7.313   1.00 50.02  ? 16  G   B N7    1 
ATOM   340  C C5    . G   A 1 16  ? -33.493 47.772 6.558   1.00 49.20  ? 16  G   B C5    1 
ATOM   341  C C6    . G   A 1 16  ? -32.530 47.135 5.726   1.00 49.70  ? 16  G   B C6    1 
ATOM   342  O O6    . G   A 1 16  ? -31.376 47.494 5.458   1.00 50.57  ? 16  G   B O6    1 
ATOM   343  N N1    . G   A 1 16  ? -33.033 45.969 5.167   1.00 50.05  ? 16  G   B N1    1 
ATOM   344  C C2    . G   A 1 16  ? -34.298 45.484 5.361   1.00 49.50  ? 16  G   B C2    1 
ATOM   345  N N2    . G   A 1 16  ? -34.579 44.336 4.739   1.00 49.85  ? 16  G   B N2    1 
ATOM   346  N N3    . G   A 1 16  ? -35.216 46.078 6.112   1.00 49.08  ? 16  G   B N3    1 
ATOM   347  C C4    . G   A 1 16  ? -34.746 47.210 6.679   1.00 49.16  ? 16  G   B C4    1 
ATOM   348  P P     . A   A 1 17  ? -37.141 48.127 12.832  1.00 57.77  ? 17  A   B P     1 
ATOM   349  O OP1   . A   A 1 17  ? -38.185 48.122 13.881  1.00 58.19  ? 17  A   B OP1   1 
ATOM   350  O OP2   . A   A 1 17  ? -36.071 49.156 12.874  1.00 56.36  ? 17  A   B OP2   1 
ATOM   351  O "O5'" . A   A 1 17  ? -36.414 46.716 12.838  1.00 58.33  ? 17  A   B "O5'" 1 
ATOM   352  C "C5'" . A   A 1 17  ? -37.162 45.517 12.888  1.00 60.33  ? 17  A   B "C5'" 1 
ATOM   353  C "C4'" . A   A 1 17  ? -36.325 44.435 13.499  1.00 62.59  ? 17  A   B "C4'" 1 
ATOM   354  O "O4'" . A   A 1 17  ? -35.127 44.307 12.692  1.00 63.04  ? 17  A   B "O4'" 1 
ATOM   355  C "C3'" . A   A 1 17  ? -35.796 44.733 14.895  1.00 64.68  ? 17  A   B "C3'" 1 
ATOM   356  O "O3'" . A   A 1 17  ? -36.760 44.525 15.943  1.00 64.93  ? 17  A   B "O3'" 1 
ATOM   357  C "C2'" . A   A 1 17  ? -34.521 43.904 14.960  1.00 65.94  ? 17  A   B "C2'" 1 
ATOM   358  O "O2'" . A   A 1 17  ? -34.694 42.538 15.263  1.00 70.28  ? 17  A   B "O2'" 1 
ATOM   359  C "C1'" . A   A 1 17  ? -34.015 44.015 13.522  1.00 64.26  ? 17  A   B "C1'" 1 
ATOM   360  N N9    . A   A 1 17  ? -32.985 45.035 13.331  1.00 62.40  ? 17  A   B N9    1 
ATOM   361  C C8    . A   A 1 17  ? -32.935 46.324 13.807  1.00 61.58  ? 17  A   B C8    1 
ATOM   362  N N7    . A   A 1 17  ? -31.847 46.972 13.466  1.00 60.85  ? 17  A   B N7    1 
ATOM   363  C C5    . A   A 1 17  ? -31.135 46.050 12.709  1.00 61.98  ? 17  A   B C5    1 
ATOM   364  C C6    . A   A 1 17  ? -29.891 46.120 12.040  1.00 62.30  ? 17  A   B C6    1 
ATOM   365  N N6    . A   A 1 17  ? -29.112 47.207 12.028  1.00 62.21  ? 17  A   B N6    1 
ATOM   366  N N1    . A   A 1 17  ? -29.473 45.015 11.374  1.00 61.89  ? 17  A   B N1    1 
ATOM   367  C C2    . A   A 1 17  ? -30.254 43.924 11.385  1.00 61.63  ? 17  A   B C2    1 
ATOM   368  N N3    . A   A 1 17  ? -31.436 43.738 11.971  1.00 61.18  ? 17  A   B N3    1 
ATOM   369  C C4    . A   A 1 17  ? -31.825 44.852 12.621  1.00 62.07  ? 17  A   B C4    1 
ATOM   370  P P     . U   A 1 18  ? -37.508 43.097 16.122  1.00 95.82  ? 18  U   B P     1 
ATOM   371  O OP1   . U   A 1 18  ? -38.027 42.646 14.797  1.00 96.85  ? 18  U   B OP1   1 
ATOM   372  O OP2   . U   A 1 18  ? -38.446 43.243 17.268  1.00 96.10  ? 18  U   B OP2   1 
ATOM   373  O "O5'" . U   A 1 18  ? -36.383 42.066 16.579  1.00 96.76  ? 18  U   B "O5'" 1 
ATOM   374  C "C5'" . U   A 1 18  ? -36.378 41.491 17.887  1.00 97.21  ? 18  U   B "C5'" 1 
ATOM   375  C "C4'" . U   A 1 18  ? -35.783 40.104 17.834  1.00 98.08  ? 18  U   B "C4'" 1 
ATOM   376  O "O4'" . U   A 1 18  ? -36.750 39.193 17.247  1.00 98.45  ? 18  U   B "O4'" 1 
ATOM   377  C "C3'" . U   A 1 18  ? -34.549 39.955 16.948  1.00 98.90  ? 18  U   B "C3'" 1 
ATOM   378  O "O3'" . U   A 1 18  ? -33.338 40.358 17.606  1.00 99.04  ? 18  U   B "O3'" 1 
ATOM   379  C "C2'" . U   A 1 18  ? -34.563 38.461 16.619  1.00 99.00  ? 18  U   B "C2'" 1 
ATOM   380  O "O2'" . U   A 1 18  ? -33.974 37.662 17.627  1.00 98.99  ? 18  U   B "O2'" 1 
ATOM   381  C "C1'" . U   A 1 18  ? -36.066 38.166 16.544  1.00 98.96  ? 18  U   B "C1'" 1 
ATOM   382  N N1    . U   A 1 18  ? -36.629 38.047 15.186  1.00 99.74  ? 18  U   B N1    1 
ATOM   383  C C2    . U   A 1 18  ? -36.031 37.137 14.311  1.00 100.33 ? 18  U   B C2    1 
ATOM   384  O O2    . U   A 1 18  ? -35.058 36.460 14.609  1.00 100.44 ? 18  U   B O2    1 
ATOM   385  N N3    . U   A 1 18  ? -36.620 37.050 13.072  1.00 100.62 ? 18  U   B N3    1 
ATOM   386  C C4    . U   A 1 18  ? -37.718 37.756 12.617  1.00 100.81 ? 18  U   B C4    1 
ATOM   387  O O4    . U   A 1 18  ? -38.147 37.531 11.484  1.00 101.11 ? 18  U   B O4    1 
ATOM   388  C C5    . U   A 1 18  ? -38.275 38.684 13.567  1.00 100.30 ? 18  U   B C5    1 
ATOM   389  C C6    . U   A 1 18  ? -37.724 38.797 14.787  1.00 99.72  ? 18  U   B C6    1 
ATOM   390  P P     . U   A 1 19  ? -32.085 40.894 16.736  1.00 78.16  ? 19  U   B P     1 
ATOM   391  O OP1   . U   A 1 19  ? -30.825 40.636 17.483  1.00 78.29  ? 19  U   B OP1   1 
ATOM   392  O OP2   . U   A 1 19  ? -32.415 42.280 16.310  1.00 77.69  ? 19  U   B OP2   1 
ATOM   393  O "O5'" . U   A 1 19  ? -32.058 39.948 15.453  1.00 78.25  ? 19  U   B "O5'" 1 
ATOM   394  C "C5'" . U   A 1 19  ? -31.151 38.849 15.367  1.00 77.60  ? 19  U   B "C5'" 1 
ATOM   395  C "C4'" . U   A 1 19  ? -30.943 38.476 13.923  1.00 77.36  ? 19  U   B "C4'" 1 
ATOM   396  O "O4'" . U   A 1 19  ? -32.208 38.041 13.370  1.00 77.15  ? 19  U   B "O4'" 1 
ATOM   397  C "C3'" . U   A 1 19  ? -30.505 39.635 13.046  1.00 77.97  ? 19  U   B "C3'" 1 
ATOM   398  O "O3'" . U   A 1 19  ? -29.088 39.840 13.109  1.00 78.72  ? 19  U   B "O3'" 1 
ATOM   399  C "C2'" . U   A 1 19  ? -31.104 39.323 11.676  1.00 77.82  ? 19  U   B "C2'" 1 
ATOM   400  O "O2'" . U   A 1 19  ? -30.298 38.556 10.806  1.00 78.84  ? 19  U   B "O2'" 1 
ATOM   401  C "C1'" . U   A 1 19  ? -32.368 38.547 12.056  1.00 77.47  ? 19  U   B "C1'" 1 
ATOM   402  N N1    . U   A 1 19  ? -33.618 39.319 12.015  1.00 77.04  ? 19  U   B N1    1 
ATOM   403  C C2    . U   A 1 19  ? -34.239 39.476 10.792  1.00 76.15  ? 19  U   B C2    1 
ATOM   404  O O2    . U   A 1 19  ? -33.764 39.048 9.759   1.00 75.70  ? 19  U   B O2    1 
ATOM   405  N N3    . U   A 1 19  ? -35.430 40.162 10.829  1.00 76.17  ? 19  U   B N3    1 
ATOM   406  C C4    . U   A 1 19  ? -36.046 40.707 11.945  1.00 76.96  ? 19  U   B C4    1 
ATOM   407  O O4    . U   A 1 19  ? -37.159 41.235 11.833  1.00 77.13  ? 19  U   B O4    1 
ATOM   408  C C5    . U   A 1 19  ? -35.324 40.528 13.168  1.00 77.10  ? 19  U   B C5    1 
ATOM   409  C C6    . U   A 1 19  ? -34.164 39.857 13.162  1.00 77.16  ? 19  U   B C6    1 
ATOM   410  P P     . C   A 1 20  ? -28.063 38.600 12.933  1.00 63.44  ? 20  C   B P     1 
ATOM   411  O OP1   . C   A 1 20  ? -28.581 37.550 12.024  1.00 64.12  ? 20  C   B OP1   1 
ATOM   412  O OP2   . C   A 1 20  ? -27.631 38.235 14.304  1.00 62.26  ? 20  C   B OP2   1 
ATOM   413  O "O5'" . C   A 1 20  ? -26.801 39.265 12.238  1.00 62.54  ? 20  C   B "O5'" 1 
ATOM   414  C "C5'" . C   A 1 20  ? -25.868 39.962 13.034  1.00 61.13  ? 20  C   B "C5'" 1 
ATOM   415  C "C4'" . C   A 1 20  ? -25.535 41.309 12.442  1.00 57.90  ? 20  C   B "C4'" 1 
ATOM   416  O "O4'" . C   A 1 20  ? -26.725 42.055 12.088  1.00 57.48  ? 20  C   B "O4'" 1 
ATOM   417  C "C3'" . C   A 1 20  ? -24.860 42.171 13.480  1.00 56.21  ? 20  C   B "C3'" 1 
ATOM   418  O "O3'" . C   A 1 20  ? -23.507 41.792 13.559  1.00 55.34  ? 20  C   B "O3'" 1 
ATOM   419  C "C2'" . C   A 1 20  ? -25.143 43.578 12.993  1.00 55.13  ? 20  C   B "C2'" 1 
ATOM   420  O "O2'" . C   A 1 20  ? -24.273 44.005 11.972  1.00 53.12  ? 20  C   B "O2'" 1 
ATOM   421  C "C1'" . C   A 1 20  ? -26.572 43.411 12.478  1.00 56.70  ? 20  C   B "C1'" 1 
ATOM   422  N N1    . C   A 1 20  ? -27.577 43.687 13.511  1.00 58.53  ? 20  C   B N1    1 
ATOM   423  C C2    . C   A 1 20  ? -27.625 44.958 14.072  1.00 59.58  ? 20  C   B C2    1 
ATOM   424  O O2    . C   A 1 20  ? -26.808 45.808 13.683  1.00 61.21  ? 20  C   B O2    1 
ATOM   425  N N3    . C   A 1 20  ? -28.554 45.230 15.025  1.00 60.15  ? 20  C   B N3    1 
ATOM   426  C C4    . C   A 1 20  ? -29.411 44.278 15.414  1.00 60.57  ? 20  C   B C4    1 
ATOM   427  N N4    . C   A 1 20  ? -30.314 44.588 16.357  1.00 61.15  ? 20  C   B N4    1 
ATOM   428  C C5    . C   A 1 20  ? -29.380 42.967 14.854  1.00 59.50  ? 20  C   B C5    1 
ATOM   429  C C6    . C   A 1 20  ? -28.453 42.718 13.916  1.00 58.98  ? 20  C   B C6    1 
ATOM   430  P P     . C   A 1 21  ? -22.983 41.066 14.886  1.00 53.16  ? 21  C   B P     1 
ATOM   431  O OP1   . C   A 1 21  ? -21.839 40.201 14.514  1.00 54.86  ? 21  C   B OP1   1 
ATOM   432  O OP2   . C   A 1 21  ? -24.151 40.477 15.595  1.00 54.25  ? 21  C   B OP2   1 
ATOM   433  O "O5'" . C   A 1 21  ? -22.456 42.303 15.729  1.00 50.68  ? 21  C   B "O5'" 1 
ATOM   434  C "C5'" . C   A 1 21  ? -21.663 43.289 15.084  1.00 46.90  ? 21  C   B "C5'" 1 
ATOM   435  C "C4'" . C   A 1 21  ? -21.743 44.594 15.822  1.00 44.23  ? 21  C   B "C4'" 1 
ATOM   436  O "O4'" . C   A 1 21  ? -23.056 45.188 15.680  1.00 42.85  ? 21  C   B "O4'" 1 
ATOM   437  C "C3'" . C   A 1 21  ? -21.571 44.487 17.317  1.00 42.46  ? 21  C   B "C3'" 1 
ATOM   438  O "O3'" . C   A 1 21  ? -20.201 44.350 17.609  1.00 40.83  ? 21  C   B "O3'" 1 
ATOM   439  C "C2'" . C   A 1 21  ? -22.146 45.817 17.768  1.00 41.67  ? 21  C   B "C2'" 1 
ATOM   440  O "O2'" . C   A 1 21  ? -21.272 46.875 17.429  1.00 40.22  ? 21  C   B "O2'" 1 
ATOM   441  C "C1'" . C   A 1 21  ? -23.367 45.919 16.855  1.00 41.36  ? 21  C   B "C1'" 1 
ATOM   442  N N1    . C   A 1 21  ? -24.621 45.384 17.405  1.00 40.10  ? 21  C   B N1    1 
ATOM   443  C C2    . C   A 1 21  ? -25.303 46.125 18.376  1.00 40.71  ? 21  C   B C2    1 
ATOM   444  O O2    . C   A 1 21  ? -24.771 47.168 18.821  1.00 40.72  ? 21  C   B O2    1 
ATOM   445  N N3    . C   A 1 21  ? -26.521 45.687 18.809  1.00 39.16  ? 21  C   B N3    1 
ATOM   446  C C4    . C   A 1 21  ? -27.036 44.557 18.311  1.00 37.61  ? 21  C   B C4    1 
ATOM   447  N N4    . C   A 1 21  ? -28.259 44.186 18.708  1.00 35.66  ? 21  C   B N4    1 
ATOM   448  C C5    . C   A 1 21  ? -26.326 43.760 17.369  1.00 38.13  ? 21  C   B C5    1 
ATOM   449  C C6    . C   A 1 21  ? -25.134 44.203 16.951  1.00 38.62  ? 21  C   B C6    1 
ATOM   450  P P     . G   A 1 22  ? -19.747 43.329 18.748  1.00 44.36  ? 22  G   B P     1 
ATOM   451  O OP1   . G   A 1 22  ? -18.273 43.152 18.652  1.00 43.11  ? 22  G   B OP1   1 
ATOM   452  O OP2   . G   A 1 22  ? -20.643 42.148 18.659  1.00 43.91  ? 22  G   B OP2   1 
ATOM   453  O "O5'" . G   A 1 22  ? -20.085 44.132 20.081  1.00 45.74  ? 22  G   B "O5'" 1 
ATOM   454  C "C5'" . G   A 1 22  ? -20.896 43.578 21.106  1.00 44.49  ? 22  G   B "C5'" 1 
ATOM   455  C "C4'" . G   A 1 22  ? -21.526 44.691 21.911  1.00 44.66  ? 22  G   B "C4'" 1 
ATOM   456  O "O4'" . G   A 1 22  ? -22.656 45.228 21.184  1.00 45.15  ? 22  G   B "O4'" 1 
ATOM   457  C "C3'" . G   A 1 22  ? -22.125 44.282 23.246  1.00 44.16  ? 22  G   B "C3'" 1 
ATOM   458  O "O3'" . G   A 1 22  ? -21.111 44.290 24.225  1.00 45.51  ? 22  G   B "O3'" 1 
ATOM   459  C "C2'" . G   A 1 22  ? -23.121 45.397 23.516  1.00 43.91  ? 22  G   B "C2'" 1 
ATOM   460  O "O2'" . G   A 1 22  ? -22.530 46.569 24.034  1.00 43.01  ? 22  G   B "O2'" 1 
ATOM   461  C "C1'" . G   A 1 22  ? -23.652 45.655 22.108  1.00 45.25  ? 22  G   B "C1'" 1 
ATOM   462  N N9    . G   A 1 22  ? -24.858 44.873 21.882  1.00 45.94  ? 22  G   B N9    1 
ATOM   463  C C8    . G   A 1 22  ? -25.008 43.798 21.036  1.00 45.56  ? 22  G   B C8    1 
ATOM   464  N N7    . G   A 1 22  ? -26.209 43.286 21.070  1.00 46.01  ? 22  G   B N7    1 
ATOM   465  C C5    . G   A 1 22  ? -26.899 44.079 21.985  1.00 45.84  ? 22  G   B C5    1 
ATOM   466  C C6    . G   A 1 22  ? -28.249 44.014 22.432  1.00 44.33  ? 22  G   B C6    1 
ATOM   467  O O6    . G   A 1 22  ? -29.135 43.226 22.083  1.00 42.61  ? 22  G   B O6    1 
ATOM   468  N N1    . G   A 1 22  ? -28.526 45.004 23.377  1.00 44.10  ? 22  G   B N1    1 
ATOM   469  C C2    . G   A 1 22  ? -27.628 45.944 23.829  1.00 44.47  ? 22  G   B C2    1 
ATOM   470  N N2    . G   A 1 22  ? -28.093 46.823 24.739  1.00 44.20  ? 22  G   B N2    1 
ATOM   471  N N3    . G   A 1 22  ? -26.368 46.018 23.415  1.00 45.68  ? 22  G   B N3    1 
ATOM   472  C C4    . G   A 1 22  ? -26.076 45.061 22.499  1.00 46.41  ? 22  G   B C4    1 
ATOM   473  P P     . C   A 1 23  ? -21.207 43.292 25.458  1.00 56.84  ? 23  C   B P     1 
ATOM   474  O OP1   . C   A 1 23  ? -19.896 43.323 26.162  1.00 56.48  ? 23  C   B OP1   1 
ATOM   475  O OP2   . C   A 1 23  ? -21.735 42.013 24.919  1.00 56.08  ? 23  C   B OP2   1 
ATOM   476  O "O5'" . C   A 1 23  ? -22.292 43.994 26.380  1.00 57.61  ? 23  C   B "O5'" 1 
ATOM   477  C "C5'" . C   A 1 23  ? -22.040 45.296 26.892  1.00 59.21  ? 23  C   B "C5'" 1 
ATOM   478  C "C4'" . C   A 1 23  ? -23.137 45.705 27.830  1.00 60.70  ? 23  C   B "C4'" 1 
ATOM   479  O "O4'" . C   A 1 23  ? -24.330 46.055 27.087  1.00 61.03  ? 23  C   B "O4'" 1 
ATOM   480  C "C3'" . C   A 1 23  ? -23.597 44.611 28.769  1.00 62.40  ? 23  C   B "C3'" 1 
ATOM   481  O "O3'" . C   A 1 23  ? -22.689 44.503 29.854  1.00 65.80  ? 23  C   B "O3'" 1 
ATOM   482  C "C2'" . C   A 1 23  ? -24.980 45.114 29.155  1.00 62.33  ? 23  C   B "C2'" 1 
ATOM   483  O "O2'" . C   A 1 23  ? -24.933 46.192 30.072  1.00 62.31  ? 23  C   B "O2'" 1 
ATOM   484  C "C1'" . C   A 1 23  ? -25.473 45.632 27.803  1.00 61.30  ? 23  C   B "C1'" 1 
ATOM   485  N N1    . C   A 1 23  ? -26.126 44.589 27.010  1.00 61.72  ? 23  C   B N1    1 
ATOM   486  C C2    . C   A 1 23  ? -27.508 44.573 26.962  1.00 62.78  ? 23  C   B C2    1 
ATOM   487  O O2    . C   A 1 23  ? -28.133 45.448 27.591  1.00 63.53  ? 23  C   B O2    1 
ATOM   488  N N3    . C   A 1 23  ? -28.136 43.616 26.235  1.00 62.92  ? 23  C   B N3    1 
ATOM   489  C C4    . C   A 1 23  ? -27.419 42.702 25.575  1.00 62.55  ? 23  C   B C4    1 
ATOM   490  N N4    . C   A 1 23  ? -28.079 41.775 24.873  1.00 62.74  ? 23  C   B N4    1 
ATOM   491  C C5    . C   A 1 23  ? -25.997 42.698 25.607  1.00 62.22  ? 23  C   B C5    1 
ATOM   492  C C6    . C   A 1 23  ? -25.396 43.651 26.331  1.00 61.61  ? 23  C   B C6    1 
ATOM   493  P P     . C   A 1 24  ? -22.959 43.434 31.009  1.00 69.33  ? 24  C   B P     1 
ATOM   494  O OP1   . C   A 1 24  ? -21.793 43.417 31.933  1.00 68.92  ? 24  C   B OP1   1 
ATOM   495  O OP2   . C   A 1 24  ? -23.436 42.163 30.399  1.00 68.80  ? 24  C   B OP2   1 
ATOM   496  O "O5'" . C   A 1 24  ? -24.176 44.094 31.777  1.00 71.04  ? 24  C   B "O5'" 1 
ATOM   497  C "C5'" . C   A 1 24  ? -24.914 43.329 32.692  1.00 73.57  ? 24  C   B "C5'" 1 
ATOM   498  C "C4'" . C   A 1 24  ? -26.211 44.006 33.020  1.00 73.97  ? 24  C   B "C4'" 1 
ATOM   499  O "O4'" . C   A 1 24  ? -26.887 44.405 31.798  1.00 72.95  ? 24  C   B "O4'" 1 
ATOM   500  C "C3'" . C   A 1 24  ? -27.152 43.042 33.716  1.00 75.05  ? 24  C   B "C3'" 1 
ATOM   501  O "O3'" . C   A 1 24  ? -26.871 43.023 35.120  1.00 76.67  ? 24  C   B "O3'" 1 
ATOM   502  C "C2'" . C   A 1 24  ? -28.516 43.584 33.303  1.00 73.94  ? 24  C   B "C2'" 1 
ATOM   503  O "O2'" . C   A 1 24  ? -28.909 44.731 34.033  1.00 73.67  ? 24  C   B "O2'" 1 
ATOM   504  C "C1'" . C   A 1 24  ? -28.237 43.987 31.850  1.00 72.63  ? 24  C   B "C1'" 1 
ATOM   505  N N1    . C   A 1 24  ? -28.394 42.901 30.868  1.00 70.33  ? 24  C   B N1    1 
ATOM   506  C C2    . C   A 1 24  ? -29.600 42.204 30.812  1.00 69.22  ? 24  C   B C2    1 
ATOM   507  O O2    . C   A 1 24  ? -30.505 42.514 31.598  1.00 68.18  ? 24  C   B O2    1 
ATOM   508  N N3    . C   A 1 24  ? -29.749 41.210 29.904  1.00 68.91  ? 24  C   B N3    1 
ATOM   509  C C4    . C   A 1 24  ? -28.748 40.909 29.075  1.00 69.55  ? 24  C   B C4    1 
ATOM   510  N N4    . C   A 1 24  ? -28.938 39.923 28.197  1.00 69.46  ? 24  C   B N4    1 
ATOM   511  C C5    . C   A 1 24  ? -27.506 41.605 29.110  1.00 70.09  ? 24  C   B C5    1 
ATOM   512  C C6    . C   A 1 24  ? -27.373 42.584 30.015  1.00 70.23  ? 24  C   B C6    1 
ATOM   513  P P     . C   A 1 25  ? -25.728 42.031 35.699  1.00 88.61  ? 25  C   B P     1 
ATOM   514  O OP1   . C   A 1 25  ? -24.753 42.821 36.499  1.00 87.83  ? 25  C   B OP1   1 
ATOM   515  O OP2   . C   A 1 25  ? -25.231 41.125 34.622  1.00 87.89  ? 25  C   B OP2   1 
ATOM   516  O "O5'" . C   A 1 25  ? -26.544 41.096 36.680  1.00 89.18  ? 25  C   B "O5'" 1 
ATOM   517  C "C5'" . C   A 1 25  ? -27.197 39.949 36.178  1.00 90.18  ? 25  C   B "C5'" 1 
ATOM   518  C "C4'" . C   A 1 25  ? -28.688 40.089 36.328  1.00 90.62  ? 25  C   B "C4'" 1 
ATOM   519  O "O4'" . C   A 1 25  ? -29.255 40.770 35.171  1.00 90.24  ? 25  C   B "O4'" 1 
ATOM   520  C "C3'" . C   A 1 25  ? -29.368 38.738 36.336  1.00 91.03  ? 25  C   B "C3'" 1 
ATOM   521  O "O3'" . C   A 1 25  ? -29.297 38.214 37.648  1.00 92.32  ? 25  C   B "O3'" 1 
ATOM   522  C "C2'" . C   A 1 25  ? -30.757 39.073 35.826  1.00 90.51  ? 25  C   B "C2'" 1 
ATOM   523  O "O2'" . C   A 1 25  ? -31.569 39.705 36.796  1.00 91.28  ? 25  C   B "O2'" 1 
ATOM   524  C "C1'" . C   A 1 25  ? -30.399 40.061 34.717  1.00 89.81  ? 25  C   B "C1'" 1 
ATOM   525  N N1    . C   A 1 25  ? -30.007 39.364 33.487  1.00 89.22  ? 25  C   B N1    1 
ATOM   526  C C2    . C   A 1 25  ? -30.887 38.436 32.921  1.00 89.35  ? 25  C   B C2    1 
ATOM   527  O O2    . C   A 1 25  ? -31.977 38.219 33.481  1.00 89.70  ? 25  C   B O2    1 
ATOM   528  N N3    . C   A 1 25  ? -30.524 37.795 31.782  1.00 89.31  ? 25  C   B N3    1 
ATOM   529  C C4    . C   A 1 25  ? -29.339 38.051 31.219  1.00 88.99  ? 25  C   B C4    1 
ATOM   530  N N4    . C   A 1 25  ? -29.022 37.398 30.094  1.00 88.41  ? 25  C   B N4    1 
ATOM   531  C C5    . C   A 1 25  ? -28.425 38.989 31.782  1.00 88.82  ? 25  C   B C5    1 
ATOM   532  C C6    . C   A 1 25  ? -28.796 39.615 32.904  1.00 88.90  ? 25  C   B C6    1 
ATOM   533  P P     . U   A 1 26  ? -28.269 37.020 37.951  1.00 97.87  ? 26  U   B P     1 
ATOM   534  O OP1   . U   A 1 26  ? -28.143 36.840 39.423  1.00 98.32  ? 26  U   B OP1   1 
ATOM   535  O OP2   . U   A 1 26  ? -27.047 37.269 37.140  1.00 98.14  ? 26  U   B OP2   1 
ATOM   536  O "O5'" . U   A 1 26  ? -29.051 35.784 37.328  1.00 96.82  ? 26  U   B "O5'" 1 
ATOM   537  C "C5'" . U   A 1 26  ? -30.466 35.726 37.441  1.00 94.79  ? 26  U   B "C5'" 1 
ATOM   538  C "C4'" . U   A 1 26  ? -31.072 34.978 36.280  1.00 94.10  ? 26  U   B "C4'" 1 
ATOM   539  O "O4'" . U   A 1 26  ? -30.941 35.736 35.045  1.00 93.13  ? 26  U   B "O4'" 1 
ATOM   540  C "C3'" . U   A 1 26  ? -30.439 33.649 35.912  1.00 93.72  ? 26  U   B "C3'" 1 
ATOM   541  O "O3'" . U   A 1 26  ? -30.752 32.599 36.814  1.00 94.51  ? 26  U   B "O3'" 1 
ATOM   542  C "C2'" . U   A 1 26  ? -31.032 33.418 34.531  1.00 93.08  ? 26  U   B "C2'" 1 
ATOM   543  O "O2'" . U   A 1 26  ? -32.378 32.976 34.567  1.00 93.26  ? 26  U   B "O2'" 1 
ATOM   544  C "C1'" . U   A 1 26  ? -30.940 34.827 33.945  1.00 92.22  ? 26  U   B "C1'" 1 
ATOM   545  N N1    . U   A 1 26  ? -29.670 34.941 33.217  1.00 90.78  ? 26  U   B N1    1 
ATOM   546  C C2    . U   A 1 26  ? -29.583 34.253 32.020  1.00 89.94  ? 26  U   B C2    1 
ATOM   547  O O2    . U   A 1 26  ? -30.515 33.624 31.551  1.00 88.95  ? 26  U   B O2    1 
ATOM   548  N N3    . U   A 1 26  ? -28.366 34.324 31.397  1.00 89.72  ? 26  U   B N3    1 
ATOM   549  C C4    . U   A 1 26  ? -27.251 35.005 31.832  1.00 90.01  ? 26  U   B C4    1 
ATOM   550  O O4    . U   A 1 26  ? -26.212 34.925 31.180  1.00 89.54  ? 26  U   B O4    1 
ATOM   551  C C5    . U   A 1 26  ? -27.423 35.718 33.068  1.00 90.38  ? 26  U   B C5    1 
ATOM   552  C C6    . U   A 1 26  ? -28.600 35.665 33.702  1.00 90.51  ? 26  U   B C6    1 
ATOM   553  P P     . G   A 1 27  ? -29.646 31.473 37.115  1.00 87.44  ? 27  G   B P     1 
ATOM   554  O OP1   . G   A 1 27  ? -29.701 31.154 38.563  1.00 87.40  ? 27  G   B OP1   1 
ATOM   555  O OP2   . G   A 1 27  ? -28.373 31.955 36.512  1.00 86.62  ? 27  G   B OP2   1 
ATOM   556  O "O5'" . G   A 1 27  ? -30.159 30.205 36.296  1.00 86.27  ? 27  G   B "O5'" 1 
ATOM   557  C "C5'" . G   A 1 27  ? -31.411 29.594 36.608  1.00 84.96  ? 27  G   B "C5'" 1 
ATOM   558  C "C4'" . G   A 1 27  ? -31.748 28.529 35.591  1.00 84.76  ? 27  G   B "C4'" 1 
ATOM   559  O "O4'" . G   A 1 27  ? -32.032 29.147 34.302  1.00 84.06  ? 27  G   B "O4'" 1 
ATOM   560  C "C3'" . G   A 1 27  ? -30.619 27.561 35.283  1.00 84.57  ? 27  G   B "C3'" 1 
ATOM   561  O "O3'" . G   A 1 27  ? -30.479 26.532 36.254  1.00 85.29  ? 27  G   B "O3'" 1 
ATOM   562  C "C2'" . G   A 1 27  ? -31.031 27.044 33.913  1.00 83.92  ? 27  G   B "C2'" 1 
ATOM   563  O "O2'" . G   A 1 27  ? -32.103 26.120 33.986  1.00 82.61  ? 27  G   B "O2'" 1 
ATOM   564  C "C1'" . G   A 1 27  ? -31.484 28.350 33.258  1.00 83.40  ? 27  G   B "C1'" 1 
ATOM   565  N N9    . G   A 1 27  ? -30.337 29.067 32.708  1.00 82.20  ? 27  G   B N9    1 
ATOM   566  C C8    . G   A 1 27  ? -29.693 30.145 33.266  1.00 81.62  ? 27  G   B C8    1 
ATOM   567  N N7    . G   A 1 27  ? -28.667 30.550 32.568  1.00 81.48  ? 27  G   B N7    1 
ATOM   568  C C5    . G   A 1 27  ? -28.635 29.694 31.477  1.00 81.50  ? 27  G   B C5    1 
ATOM   569  C C6    . G   A 1 27  ? -27.737 29.642 30.374  1.00 81.32  ? 27  G   B C6    1 
ATOM   570  O O6    . G   A 1 27  ? -26.761 30.370 30.133  1.00 80.34  ? 27  G   B O6    1 
ATOM   571  N N1    . G   A 1 27  ? -28.069 28.611 29.497  1.00 81.33  ? 27  G   B N1    1 
ATOM   572  C C2    . G   A 1 27  ? -29.123 27.740 29.658  1.00 81.01  ? 27  G   B C2    1 
ATOM   573  N N2    . G   A 1 27  ? -29.266 26.798 28.712  1.00 80.59  ? 27  G   B N2    1 
ATOM   574  N N3    . G   A 1 27  ? -29.970 27.785 30.677  1.00 80.62  ? 27  G   B N3    1 
ATOM   575  C C4    . G   A 1 27  ? -29.667 28.777 31.543  1.00 81.45  ? 27  G   B C4    1 
ATOM   576  P P     . G   A 1 28  ? -29.014 25.958 36.577  1.00 103.61 ? 28  G   B P     1 
ATOM   577  O OP1   . G   A 1 28  ? -29.075 25.159 37.830  1.00 103.43 ? 28  G   B OP1   1 
ATOM   578  O OP2   . G   A 1 28  ? -28.083 27.121 36.483  1.00 103.73 ? 28  G   B OP2   1 
ATOM   579  O "O5'" . G   A 1 28  ? -28.719 24.977 35.350  1.00 100.22 ? 28  G   B "O5'" 1 
ATOM   580  C "C5'" . G   A 1 28  ? -29.562 23.849 35.100  1.00 96.17  ? 28  G   B "C5'" 1 
ATOM   581  C "C4'" . G   A 1 28  ? -29.228 23.213 33.769  1.00 93.71  ? 28  G   B "C4'" 1 
ATOM   582  O "O4'" . G   A 1 28  ? -29.472 24.167 32.698  1.00 92.22  ? 28  G   B "O4'" 1 
ATOM   583  C "C3'" . G   A 1 28  ? -27.777 22.819 33.546  1.00 93.06  ? 28  G   B "C3'" 1 
ATOM   584  O "O3'" . G   A 1 28  ? -27.402 21.606 34.189  1.00 94.73  ? 28  G   B "O3'" 1 
ATOM   585  C "C2'" . G   A 1 28  ? -27.735 22.705 32.028  1.00 91.74  ? 28  G   B "C2'" 1 
ATOM   586  O "O2'" . G   A 1 28  ? -28.336 21.519 31.526  1.00 90.10  ? 28  G   B "O2'" 1 
ATOM   587  C "C1'" . G   A 1 28  ? -28.546 23.942 31.639  1.00 90.25  ? 28  G   B "C1'" 1 
ATOM   588  N N9    . G   A 1 28  ? -27.656 25.096 31.549  1.00 87.29  ? 28  G   B N9    1 
ATOM   589  C C8    . G   A 1 28  ? -27.410 26.043 32.516  1.00 86.28  ? 28  G   B C8    1 
ATOM   590  N N7    . G   A 1 28  ? -26.513 26.921 32.156  1.00 85.12  ? 28  G   B N7    1 
ATOM   591  C C5    . G   A 1 28  ? -26.157 26.540 30.871  1.00 84.16  ? 28  G   B C5    1 
ATOM   592  C C6    . G   A 1 28  ? -25.228 27.112 29.976  1.00 82.97  ? 28  G   B C6    1 
ATOM   593  O O6    . G   A 1 28  ? -24.521 28.111 30.138  1.00 82.27  ? 28  G   B O6    1 
ATOM   594  N N1    . G   A 1 28  ? -25.166 26.403 28.781  1.00 81.52  ? 28  G   B N1    1 
ATOM   595  C C2    . G   A 1 28  ? -25.913 25.291 28.485  1.00 81.80  ? 28  G   B C2    1 
ATOM   596  N N2    . G   A 1 28  ? -25.709 24.741 27.288  1.00 80.76  ? 28  G   B N2    1 
ATOM   597  N N3    . G   A 1 28  ? -26.796 24.755 29.306  1.00 83.13  ? 28  G   B N3    1 
ATOM   598  C C4    . G   A 1 28  ? -26.862 25.423 30.477  1.00 85.18  ? 28  G   B C4    1 
ATOM   599  P P     . G   A 1 29  ? -25.850 21.329 34.497  1.00 79.78  ? 29  G   B P     1 
ATOM   600  O OP1   . G   A 1 29  ? -25.761 20.082 35.299  1.00 79.50  ? 29  G   B OP1   1 
ATOM   601  O OP2   . G   A 1 29  ? -25.248 22.591 35.019  1.00 79.03  ? 29  G   B OP2   1 
ATOM   602  O "O5'" . G   A 1 29  ? -25.225 21.064 33.053  1.00 78.53  ? 29  G   B "O5'" 1 
ATOM   603  C "C5'" . G   A 1 29  ? -25.737 20.034 32.209  1.00 77.14  ? 29  G   B "C5'" 1 
ATOM   604  C "C4'" . G   A 1 29  ? -25.071 20.083 30.847  1.00 76.46  ? 29  G   B "C4'" 1 
ATOM   605  O "O4'" . G   A 1 29  ? -25.453 21.310 30.154  1.00 76.49  ? 29  G   B "O4'" 1 
ATOM   606  C "C3'" . G   A 1 29  ? -23.549 20.127 30.832  1.00 75.52  ? 29  G   B "C3'" 1 
ATOM   607  O "O3'" . G   A 1 29  ? -22.967 18.843 30.987  1.00 75.09  ? 29  G   B "O3'" 1 
ATOM   608  C "C2'" . G   A 1 29  ? -23.290 20.670 29.436  1.00 75.47  ? 29  G   B "C2'" 1 
ATOM   609  O "O2'" . G   A 1 29  ? -23.498 19.689 28.439  1.00 75.51  ? 29  G   B "O2'" 1 
ATOM   610  C "C1'" . G   A 1 29  ? -24.367 21.754 29.347  1.00 74.96  ? 29  G   B "C1'" 1 
ATOM   611  N N9    . G   A 1 29  ? -23.840 22.991 29.913  1.00 73.56  ? 29  G   B N9    1 
ATOM   612  C C8    . G   A 1 29  ? -24.120 23.544 31.143  1.00 73.13  ? 29  G   B C8    1 
ATOM   613  N N7    . G   A 1 29  ? -23.424 24.620 31.391  1.00 72.15  ? 29  G   B N7    1 
ATOM   614  C C5    . G   A 1 29  ? -22.650 24.795 30.253  1.00 71.77  ? 29  G   B C5    1 
ATOM   615  C C6    . G   A 1 29  ? -21.680 25.781 29.943  1.00 71.39  ? 29  G   B C6    1 
ATOM   616  O O6    . G   A 1 29  ? -21.287 26.725 30.642  1.00 70.72  ? 29  G   B O6    1 
ATOM   617  N N1    . G   A 1 29  ? -21.141 25.583 28.674  1.00 71.02  ? 29  G   B N1    1 
ATOM   618  C C2    . G   A 1 29  ? -21.484 24.563 27.817  1.00 70.41  ? 29  G   B C2    1 
ATOM   619  N N2    . G   A 1 29  ? -20.858 24.542 26.636  1.00 69.95  ? 29  G   B N2    1 
ATOM   620  N N3    . G   A 1 29  ? -22.376 23.633 28.099  1.00 71.08  ? 29  G   B N3    1 
ATOM   621  C C4    . G   A 1 29  ? -22.913 23.808 29.324  1.00 72.19  ? 29  G   B C4    1 
ATOM   622  P P     . C   A 1 30  ? -21.597 18.688 31.816  1.00 67.83  ? 30  C   B P     1 
ATOM   623  O OP1   . C   A 1 30  ? -21.407 17.237 32.107  1.00 66.89  ? 30  C   B OP1   1 
ATOM   624  O OP2   . C   A 1 30  ? -21.650 19.674 32.938  1.00 67.23  ? 30  C   B OP2   1 
ATOM   625  O "O5'" . C   A 1 30  ? -20.460 19.157 30.799  1.00 63.14  ? 30  C   B "O5'" 1 
ATOM   626  C "C5'" . C   A 1 30  ? -20.338 18.554 29.514  1.00 58.24  ? 30  C   B "C5'" 1 
ATOM   627  C "C4'" . C   A 1 30  ? -19.383 19.340 28.651  1.00 54.89  ? 30  C   B "C4'" 1 
ATOM   628  O "O4'" . C   A 1 30  ? -19.931 20.666 28.414  1.00 52.83  ? 30  C   B "O4'" 1 
ATOM   629  C "C3'" . C   A 1 30  ? -18.010 19.614 29.245  1.00 54.11  ? 30  C   B "C3'" 1 
ATOM   630  O "O3'" . C   A 1 30  ? -17.120 18.510 29.087  1.00 53.39  ? 30  C   B "O3'" 1 
ATOM   631  C "C2'" . C   A 1 30  ? -17.564 20.815 28.422  1.00 53.23  ? 30  C   B "C2'" 1 
ATOM   632  O "O2'" . C   A 1 30  ? -17.119 20.449 27.132  1.00 54.17  ? 30  C   B "O2'" 1 
ATOM   633  C "C1'" . C   A 1 30  ? -18.871 21.606 28.320  1.00 51.60  ? 30  C   B "C1'" 1 
ATOM   634  N N1    . C   A 1 30  ? -18.994 22.570 29.425  1.00 48.86  ? 30  C   B N1    1 
ATOM   635  C C2    . C   A 1 30  ? -18.145 23.676 29.439  1.00 47.73  ? 30  C   B C2    1 
ATOM   636  O O2    . C   A 1 30  ? -17.343 23.825 28.507  1.00 46.87  ? 30  C   B O2    1 
ATOM   637  N N3    . C   A 1 30  ? -18.216 24.555 30.464  1.00 47.64  ? 30  C   B N3    1 
ATOM   638  C C4    . C   A 1 30  ? -19.095 24.362 31.447  1.00 47.51  ? 30  C   B C4    1 
ATOM   639  N N4    . C   A 1 30  ? -19.119 25.252 32.437  1.00 47.60  ? 30  C   B N4    1 
ATOM   640  C C5    . C   A 1 30  ? -19.985 23.248 31.454  1.00 47.44  ? 30  C   B C5    1 
ATOM   641  C C6    . C   A 1 30  ? -19.904 22.387 30.429  1.00 48.09  ? 30  C   B C6    1 
ATOM   642  P P     . C   A 1 31  ? -15.836 18.366 30.059  1.00 51.28  ? 31  C   B P     1 
ATOM   643  O OP1   . C   A 1 31  ? -15.257 17.004 29.847  1.00 51.67  ? 31  C   B OP1   1 
ATOM   644  O OP2   . C   A 1 31  ? -16.250 18.785 31.427  1.00 50.91  ? 31  C   B OP2   1 
ATOM   645  O "O5'" . C   A 1 31  ? -14.797 19.451 29.515  1.00 49.90  ? 31  C   B "O5'" 1 
ATOM   646  C "C5'" . C   A 1 31  ? -14.472 19.522 28.128  1.00 47.86  ? 31  C   B "C5'" 1 
ATOM   647  C "C4'" . C   A 1 31  ? -13.510 20.655 27.874  1.00 45.82  ? 31  C   B "C4'" 1 
ATOM   648  O "O4'" . C   A 1 31  ? -14.173 21.937 28.022  1.00 45.86  ? 31  C   B "O4'" 1 
ATOM   649  C "C3'" . C   A 1 31  ? -12.353 20.716 28.843  1.00 45.52  ? 31  C   B "C3'" 1 
ATOM   650  O "O3'" . C   A 1 31  ? -11.331 19.842 28.414  1.00 44.25  ? 31  C   B "O3'" 1 
ATOM   651  C "C2'" . C   A 1 31  ? -11.933 22.179 28.770  1.00 45.48  ? 31  C   B "C2'" 1 
ATOM   652  O "O2'" . C   A 1 31  ? -11.102 22.470 27.662  1.00 46.14  ? 31  C   B "O2'" 1 
ATOM   653  C "C1'" . C   A 1 31  ? -13.284 22.874 28.604  1.00 44.69  ? 31  C   B "C1'" 1 
ATOM   654  N N1    . C   A 1 31  ? -13.885 23.326 29.859  1.00 45.02  ? 31  C   B N1    1 
ATOM   655  C C2    . C   A 1 31  ? -13.511 24.556 30.397  1.00 46.25  ? 31  C   B C2    1 
ATOM   656  O O2    . C   A 1 31  ? -12.625 25.222 29.830  1.00 47.94  ? 31  C   B O2    1 
ATOM   657  N N3    . C   A 1 31  ? -14.123 24.993 31.523  1.00 46.07  ? 31  C   B N3    1 
ATOM   658  C C4    . C   A 1 31  ? -15.070 24.251 32.099  1.00 45.09  ? 31  C   B C4    1 
ATOM   659  N N4    . C   A 1 31  ? -15.690 24.745 33.158  1.00 45.82  ? 31  C   B N4    1 
ATOM   660  C C5    . C   A 1 31  ? -15.435 22.980 31.597  1.00 45.90  ? 31  C   B C5    1 
ATOM   661  C C6    . C   A 1 31  ? -14.823 22.558 30.486  1.00 46.23  ? 31  C   B C6    1 
ATOM   662  P P     . A   A 1 32  ? -10.275 19.297 29.478  1.00 45.50  ? 32  A   B P     1 
ATOM   663  O OP1   . A   A 1 32  ? -9.356  18.358 28.793  1.00 45.97  ? 32  A   B OP1   1 
ATOM   664  O OP2   . A   A 1 32  ? -11.069 18.836 30.638  1.00 47.24  ? 32  A   B OP2   1 
ATOM   665  O "O5'" . A   A 1 32  ? -9.440  20.591 29.895  1.00 46.89  ? 32  A   B "O5'" 1 
ATOM   666  C "C5'" . A   A 1 32  ? -8.382  21.060 29.064  1.00 46.05  ? 32  A   B "C5'" 1 
ATOM   667  C "C4'" . A   A 1 32  ? -7.665  22.216 29.715  1.00 45.81  ? 32  A   B "C4'" 1 
ATOM   668  O "O4'" . A   A 1 32  ? -8.607  23.296 29.899  1.00 47.18  ? 32  A   B "O4'" 1 
ATOM   669  C "C3'" . A   A 1 32  ? -7.098  21.974 31.107  1.00 45.98  ? 32  A   B "C3'" 1 
ATOM   670  O "O3'" . A   A 1 32  ? -5.812  21.355 31.017  1.00 46.68  ? 32  A   B "O3'" 1 
ATOM   671  C "C2'" . A   A 1 32  ? -7.004  23.398 31.657  1.00 46.32  ? 32  A   B "C2'" 1 
ATOM   672  O "O2'" . A   A 1 32  ? -5.889  24.111 31.166  1.00 46.23  ? 32  A   B "O2'" 1 
ATOM   673  C "C1'" . A   A 1 32  ? -8.249  24.044 31.052  1.00 47.97  ? 32  A   B "C1'" 1 
ATOM   674  N N9    . A   A 1 32  ? -9.415  24.123 31.933  1.00 48.94  ? 32  A   B N9    1 
ATOM   675  C C8    . A   A 1 32  ? -10.320 23.135 32.239  1.00 49.00  ? 32  A   B C8    1 
ATOM   676  N N7    . A   A 1 32  ? -11.307 23.538 33.007  1.00 49.52  ? 32  A   B N7    1 
ATOM   677  C C5    . A   A 1 32  ? -11.026 24.877 33.235  1.00 49.41  ? 32  A   B C5    1 
ATOM   678  C C6    . A   A 1 32  ? -11.700 25.878 33.966  1.00 49.30  ? 32  A   B C6    1 
ATOM   679  N N6    . A   A 1 32  ? -12.849 25.676 34.606  1.00 49.40  ? 32  A   B N6    1 
ATOM   680  N N1    . A   A 1 32  ? -11.144 27.110 34.009  1.00 49.38  ? 32  A   B N1    1 
ATOM   681  C C2    . A   A 1 32  ? -9.992  27.315 33.348  1.00 49.92  ? 32  A   B C2    1 
ATOM   682  N N3    . A   A 1 32  ? -9.270  26.459 32.615  1.00 49.66  ? 32  A   B N3    1 
ATOM   683  C C4    . A   A 1 32  ? -9.849  25.245 32.599  1.00 49.48  ? 32  A   B C4    1 
ATOM   684  P P     . G   A 1 33  ? -5.471  20.047 31.903  1.00 55.81  ? 33  G   B P     1 
ATOM   685  O OP1   . G   A 1 33  ? -4.379  19.288 31.234  1.00 53.91  ? 33  G   B OP1   1 
ATOM   686  O OP2   . G   A 1 33  ? -6.746  19.357 32.237  1.00 55.90  ? 33  G   B OP2   1 
ATOM   687  O "O5'" . G   A 1 33  ? -4.908  20.628 33.272  1.00 57.62  ? 33  G   B "O5'" 1 
ATOM   688  C "C5'" . G   A 1 33  ? -3.762  21.474 33.309  1.00 60.26  ? 33  G   B "C5'" 1 
ATOM   689  C "C4'" . G   A 1 33  ? -3.799  22.333 34.554  1.00 62.60  ? 33  G   B "C4'" 1 
ATOM   690  O "O4'" . G   A 1 33  ? -4.978  23.182 34.502  1.00 63.90  ? 33  G   B "O4'" 1 
ATOM   691  C "C3'" . G   A 1 33  ? -3.949  21.572 35.861  1.00 63.58  ? 33  G   B "C3'" 1 
ATOM   692  O "O3'" . G   A 1 33  ? -2.722  20.974 36.307  1.00 62.00  ? 33  G   B "O3'" 1 
ATOM   693  C "C2'" . G   A 1 33  ? -4.578  22.618 36.776  1.00 64.51  ? 33  G   B "C2'" 1 
ATOM   694  O "O2'" . G   A 1 33  ? -3.638  23.540 37.305  1.00 66.07  ? 33  G   B "O2'" 1 
ATOM   695  C "C1'" . G   A 1 33  ? -5.507  23.353 35.806  1.00 64.25  ? 33  G   B "C1'" 1 
ATOM   696  N N9    . G   A 1 33  ? -6.888  22.878 35.799  1.00 64.14  ? 33  G   B N9    1 
ATOM   697  C C8    . G   A 1 33  ? -7.342  21.634 35.423  1.00 63.94  ? 33  G   B C8    1 
ATOM   698  N N7    . G   A 1 33  ? -8.641  21.513 35.511  1.00 64.02  ? 33  G   B N7    1 
ATOM   699  C C5    . G   A 1 33  ? -9.074  22.748 35.978  1.00 63.91  ? 33  G   B C5    1 
ATOM   700  C C6    . G   A 1 33  ? -10.385 23.212 36.278  1.00 63.77  ? 33  G   B C6    1 
ATOM   701  O O6    . G   A 1 33  ? -11.466 22.593 36.197  1.00 63.82  ? 33  G   B O6    1 
ATOM   702  N N1    . G   A 1 33  ? -10.370 24.540 36.720  1.00 63.19  ? 33  G   B N1    1 
ATOM   703  C C2    . G   A 1 33  ? -9.238  25.319 36.863  1.00 63.06  ? 33  G   B C2    1 
ATOM   704  N N2    . G   A 1 33  ? -9.420  26.576 37.300  1.00 61.88  ? 33  G   B N2    1 
ATOM   705  N N3    . G   A 1 33  ? -8.012  24.893 36.595  1.00 64.20  ? 33  G   B N3    1 
ATOM   706  C C4    . G   A 1 33  ? -8.004  23.606 36.161  1.00 64.56  ? 33  G   B C4    1 
ATOM   707  N N     . LYS B 2 1   ? 16.113  5.653  7.597   1.00 75.49  ? 2   LYS A N     1 
ATOM   708  C CA    . LYS B 2 1   ? 14.771  5.097  7.413   1.00 76.19  ? 2   LYS A CA    1 
ATOM   709  C C     . LYS B 2 1   ? 14.070  5.105  8.776   1.00 76.72  ? 2   LYS A C     1 
ATOM   710  O O     . LYS B 2 1   ? 14.722  5.239  9.818   1.00 77.01  ? 2   LYS A O     1 
ATOM   711  C CB    . LYS B 2 1   ? 14.830  3.665  6.878   1.00 75.88  ? 2   LYS A CB    1 
ATOM   712  C CG    . LYS B 2 1   ? 13.456  3.093  6.546   1.00 75.91  ? 2   LYS A CG    1 
ATOM   713  C CD    . LYS B 2 1   ? 13.521  1.606  6.258   1.00 76.11  ? 2   LYS A CD    1 
ATOM   714  C CE    . LYS B 2 1   ? 13.746  0.791  7.529   1.00 75.63  ? 2   LYS A CE    1 
ATOM   715  N NZ    . LYS B 2 1   ? 15.008  1.116  8.233   1.00 74.47  ? 2   LYS A NZ    1 
ATOM   716  N N     . VAL B 2 2   ? 12.748  4.961  8.762   1.00 76.36  ? 3   VAL A N     1 
ATOM   717  C CA    . VAL B 2 2   ? 11.943  4.974  9.983   1.00 75.51  ? 3   VAL A CA    1 
ATOM   718  C C     . VAL B 2 2   ? 12.469  4.413  11.307  1.00 74.99  ? 3   VAL A C     1 
ATOM   719  O O     . VAL B 2 2   ? 12.624  5.146  12.285  1.00 74.69  ? 3   VAL A O     1 
ATOM   720  C CB    . VAL B 2 2   ? 10.650  4.168  9.788   1.00 75.40  ? 3   VAL A CB    1 
ATOM   721  C CG1   . VAL B 2 2   ? 9.637   4.577  10.838  1.00 74.97  ? 3   VAL A CG1   1 
ATOM   722  C CG2   . VAL B 2 2   ? 10.108  4.368  8.375   1.00 75.39  ? 3   VAL A CG2   1 
ATOM   723  N N     . GLU B 2 3   ? 12.731  3.106  11.316  1.00 74.70  ? 4   GLU A N     1 
ATOM   724  C CA    . GLU B 2 3   ? 13.363  2.400  12.435  1.00 74.01  ? 4   GLU A CA    1 
ATOM   725  C C     . GLU B 2 3   ? 14.674  3.059  12.844  1.00 73.41  ? 4   GLU A C     1 
ATOM   726  O O     . GLU B 2 3   ? 14.918  3.319  14.026  1.00 72.42  ? 4   GLU A O     1 
ATOM   727  C CB    . GLU B 2 3   ? 13.630  0.943  12.043  1.00 73.94  ? 4   GLU A CB    1 
ATOM   728  C CG    . GLU B 2 3   ? 12.408  0.206  11.523  1.00 74.40  ? 4   GLU A CG    1 
ATOM   729  C CD    . GLU B 2 3   ? 12.767  -1.055 10.758  1.00 74.67  ? 4   GLU A CD    1 
ATOM   730  O OE1   . GLU B 2 3   ? 13.479  -0.943 9.733   1.00 74.80  ? 4   GLU A OE1   1 
ATOM   731  O OE2   . GLU B 2 3   ? 12.336  -2.154 11.177  1.00 74.32  ? 4   GLU A OE2   1 
ATOM   732  N N     . GLU B 2 4   ? 15.518  3.321  11.853  1.00 73.04  ? 5   GLU A N     1 
ATOM   733  C CA    . GLU B 2 4   ? 16.797  3.956  12.106  1.00 72.71  ? 5   GLU A CA    1 
ATOM   734  C C     . GLU B 2 4   ? 16.529  5.180  12.975  1.00 71.22  ? 5   GLU A C     1 
ATOM   735  O O     . GLU B 2 4   ? 16.863  5.203  14.161  1.00 71.16  ? 5   GLU A O     1 
ATOM   736  C CB    . GLU B 2 4   ? 17.438  4.393  10.786  1.00 74.61  ? 5   GLU A CB    1 
ATOM   737  C CG    . GLU B 2 4   ? 17.321  3.369  9.650   1.00 77.51  ? 5   GLU A CG    1 
ATOM   738  C CD    . GLU B 2 4   ? 18.181  2.124  9.850   1.00 79.21  ? 5   GLU A CD    1 
ATOM   739  O OE1   . GLU B 2 4   ? 18.001  1.416  10.868  1.00 79.42  ? 5   GLU A OE1   1 
ATOM   740  O OE2   . GLU B 2 4   ? 19.038  1.852  8.973   1.00 80.31  ? 5   GLU A OE2   1 
ATOM   741  N N     . ILE B 2 5   ? 15.888  6.176  12.370  1.00 69.09  ? 6   ILE A N     1 
ATOM   742  C CA    . ILE B 2 5   ? 15.555  7.432  13.030  1.00 66.97  ? 6   ILE A CA    1 
ATOM   743  C C     . ILE B 2 5   ? 14.898  7.306  14.407  1.00 66.17  ? 6   ILE A C     1 
ATOM   744  O O     . ILE B 2 5   ? 15.237  8.058  15.318  1.00 65.71  ? 6   ILE A O     1 
ATOM   745  C CB    . ILE B 2 5   ? 14.648  8.286  12.128  1.00 66.34  ? 6   ILE A CB    1 
ATOM   746  C CG1   . ILE B 2 5   ? 15.232  8.342  10.710  1.00 65.75  ? 6   ILE A CG1   1 
ATOM   747  C CG2   . ILE B 2 5   ? 14.511  9.687  12.702  1.00 64.84  ? 6   ILE A CG2   1 
ATOM   748  C CD1   . ILE B 2 5   ? 16.670  8.869  10.615  1.00 64.42  ? 6   ILE A CD1   1 
ATOM   749  N N     . LEU B 2 6   ? 13.958  6.378  14.567  1.00 65.57  ? 7   LEU A N     1 
ATOM   750  C CA    . LEU B 2 6   ? 13.312  6.218  15.868  1.00 65.28  ? 7   LEU A CA    1 
ATOM   751  C C     . LEU B 2 6   ? 14.339  5.757  16.891  1.00 66.27  ? 7   LEU A C     1 
ATOM   752  O O     . LEU B 2 6   ? 14.254  6.082  18.076  1.00 65.91  ? 7   LEU A O     1 
ATOM   753  C CB    . LEU B 2 6   ? 12.169  5.202  15.804  1.00 63.67  ? 7   LEU A CB    1 
ATOM   754  C CG    . LEU B 2 6   ? 10.883  5.598  15.082  1.00 62.43  ? 7   LEU A CG    1 
ATOM   755  C CD1   . LEU B 2 6   ? 9.863   4.499  15.255  1.00 61.83  ? 7   LEU A CD1   1 
ATOM   756  C CD2   . LEU B 2 6   ? 10.345  6.889  15.644  1.00 62.03  ? 7   LEU A CD2   1 
ATOM   757  N N     . GLU B 2 7   ? 15.318  4.997  16.415  1.00 67.86  ? 8   GLU A N     1 
ATOM   758  C CA    . GLU B 2 7   ? 16.372  4.479  17.273  1.00 68.76  ? 8   GLU A CA    1 
ATOM   759  C C     . GLU B 2 7   ? 17.247  5.562  17.885  1.00 67.62  ? 8   GLU A C     1 
ATOM   760  O O     . GLU B 2 7   ? 17.654  5.452  19.035  1.00 67.85  ? 8   GLU A O     1 
ATOM   761  C CB    . GLU B 2 7   ? 17.239  3.490  16.495  1.00 71.86  ? 8   GLU A CB    1 
ATOM   762  C CG    . GLU B 2 7   ? 16.669  2.081  16.502  1.00 75.77  ? 8   GLU A CG    1 
ATOM   763  C CD    . GLU B 2 7   ? 16.371  1.591  17.917  1.00 78.15  ? 8   GLU A CD    1 
ATOM   764  O OE1   . GLU B 2 7   ? 15.190  1.290  18.208  1.00 79.55  ? 8   GLU A OE1   1 
ATOM   765  O OE2   . GLU B 2 7   ? 17.315  1.516  18.740  1.00 79.83  ? 8   GLU A OE2   1 
ATOM   766  N N     . LYS B 2 8   ? 17.542  6.606  17.125  1.00 66.18  ? 9   LYS A N     1 
ATOM   767  C CA    . LYS B 2 8   ? 18.369  7.684  17.647  1.00 65.32  ? 9   LYS A CA    1 
ATOM   768  C C     . LYS B 2 8   ? 17.481  8.659  18.410  1.00 64.16  ? 9   LYS A C     1 
ATOM   769  O O     . LYS B 2 8   ? 17.972  9.470  19.192  1.00 63.96  ? 9   LYS A O     1 
ATOM   770  C CB    . LYS B 2 8   ? 19.067  8.422  16.498  1.00 66.37  ? 9   LYS A CB    1 
ATOM   771  C CG    . LYS B 2 8   ? 19.677  7.511  15.434  1.00 66.70  ? 9   LYS A CG    1 
ATOM   772  C CD    . LYS B 2 8   ? 20.023  8.294  14.179  1.00 66.63  ? 9   LYS A CD    1 
ATOM   773  C CE    . LYS B 2 8   ? 20.278  7.364  13.013  1.00 67.20  ? 9   LYS A CE    1 
ATOM   774  N NZ    . LYS B 2 8   ? 20.454  8.103  11.730  1.00 67.49  ? 9   LYS A NZ    1 
ATOM   775  N N     . ALA B 2 9   ? 16.172  8.572  18.174  1.00 63.16  ? 10  ALA A N     1 
ATOM   776  C CA    . ALA B 2 9   ? 15.200  9.455  18.820  1.00 61.89  ? 10  ALA A CA    1 
ATOM   777  C C     . ALA B 2 9   ? 14.988  9.107  20.280  1.00 61.03  ? 10  ALA A C     1 
ATOM   778  O O     . ALA B 2 9   ? 14.837  9.994  21.117  1.00 60.03  ? 10  ALA A O     1 
ATOM   779  C CB    . ALA B 2 9   ? 13.873  9.402  18.085  1.00 61.50  ? 10  ALA A CB    1 
ATOM   780  N N     . LEU B 2 10  ? 14.973  7.811  20.580  1.00 61.06  ? 11  LEU A N     1 
ATOM   781  C CA    . LEU B 2 10  ? 14.781  7.342  21.945  1.00 61.86  ? 11  LEU A CA    1 
ATOM   782  C C     . LEU B 2 10  ? 15.767  8.060  22.860  1.00 62.28  ? 11  LEU A C     1 
ATOM   783  O O     . LEU B 2 10  ? 15.561  8.155  24.069  1.00 62.51  ? 11  LEU A O     1 
ATOM   784  C CB    . LEU B 2 10  ? 15.030  5.834  22.027  1.00 62.56  ? 11  LEU A CB    1 
ATOM   785  C CG    . LEU B 2 10  ? 14.186  4.867  21.183  1.00 64.15  ? 11  LEU A CG    1 
ATOM   786  C CD1   . LEU B 2 10  ? 14.729  3.448  21.334  1.00 63.58  ? 11  LEU A CD1   1 
ATOM   787  C CD2   . LEU B 2 10  ? 12.732  4.918  21.623  1.00 64.70  ? 11  LEU A CD2   1 
ATOM   788  N N     . GLU B 2 11  ? 16.830  8.581  22.260  1.00 62.14  ? 12  GLU A N     1 
ATOM   789  C CA    . GLU B 2 11  ? 17.884  9.272  22.983  1.00 61.74  ? 12  GLU A CA    1 
ATOM   790  C C     . GLU B 2 11  ? 17.494  10.684 23.405  1.00 61.36  ? 12  GLU A C     1 
ATOM   791  O O     . GLU B 2 11  ? 18.140  11.278 24.271  1.00 60.63  ? 12  GLU A O     1 
ATOM   792  C CB    . GLU B 2 11  ? 19.129  9.315  22.104  1.00 62.79  ? 12  GLU A CB    1 
ATOM   793  C CG    . GLU B 2 11  ? 20.429  9.376  22.860  1.00 65.31  ? 12  GLU A CG    1 
ATOM   794  C CD    . GLU B 2 11  ? 21.602  8.923  22.006  1.00 66.61  ? 12  GLU A CD    1 
ATOM   795  O OE1   . GLU B 2 11  ? 21.494  7.831  21.390  1.00 67.07  ? 12  GLU A OE1   1 
ATOM   796  O OE2   . GLU B 2 11  ? 22.625  9.651  21.954  1.00 66.96  ? 12  GLU A OE2   1 
ATOM   797  N N     . LEU B 2 12  ? 16.443  11.222 22.788  1.00 61.11  ? 13  LEU A N     1 
ATOM   798  C CA    . LEU B 2 12  ? 15.966  12.571 23.108  1.00 60.55  ? 13  LEU A CA    1 
ATOM   799  C C     . LEU B 2 12  ? 14.755  12.544 24.040  1.00 60.55  ? 13  LEU A C     1 
ATOM   800  O O     . LEU B 2 12  ? 14.515  13.498 24.789  1.00 59.98  ? 13  LEU A O     1 
ATOM   801  C CB    . LEU B 2 12  ? 15.586  13.325 21.833  1.00 59.88  ? 13  LEU A CB    1 
ATOM   802  C CG    . LEU B 2 12  ? 16.684  13.461 20.782  1.00 59.44  ? 13  LEU A CG    1 
ATOM   803  C CD1   . LEU B 2 12  ? 16.183  14.312 19.612  1.00 58.91  ? 13  LEU A CD1   1 
ATOM   804  C CD2   . LEU B 2 12  ? 17.921  14.081 21.437  1.00 59.37  ? 13  LEU A CD2   1 
ATOM   805  N N     . VAL B 2 13  ? 14.006  11.442 23.997  1.00 60.21  ? 14  VAL A N     1 
ATOM   806  C CA    . VAL B 2 13  ? 12.814  11.289 24.819  1.00 59.70  ? 14  VAL A CA    1 
ATOM   807  C C     . VAL B 2 13  ? 12.999  10.507 26.122  1.00 59.84  ? 14  VAL A C     1 
ATOM   808  O O     . VAL B 2 13  ? 12.413  10.863 27.145  1.00 59.59  ? 14  VAL A O     1 
ATOM   809  C CB    . VAL B 2 13  ? 11.699  10.642 24.005  1.00 58.79  ? 14  VAL A CB    1 
ATOM   810  C CG1   . VAL B 2 13  ? 11.197  11.617 22.963  1.00 57.88  ? 14  VAL A CG1   1 
ATOM   811  C CG2   . VAL B 2 13  ? 12.223  9.396  23.339  1.00 58.34  ? 14  VAL A CG2   1 
ATOM   812  N N     . ILE B 2 14  ? 13.808  9.452  26.095  1.00 59.90  ? 15  ILE A N     1 
ATOM   813  C CA    . ILE B 2 14  ? 14.036  8.650  27.302  1.00 60.17  ? 15  ILE A CA    1 
ATOM   814  C C     . ILE B 2 14  ? 14.973  9.332  28.309  1.00 60.62  ? 15  ILE A C     1 
ATOM   815  O O     . ILE B 2 14  ? 16.098  9.681  27.975  1.00 60.40  ? 15  ILE A O     1 
ATOM   816  C CB    . ILE B 2 14  ? 14.644  7.269  26.955  1.00 59.61  ? 15  ILE A CB    1 
ATOM   817  C CG1   . ILE B 2 14  ? 13.906  6.650  25.764  1.00 59.37  ? 15  ILE A CG1   1 
ATOM   818  C CG2   . ILE B 2 14  ? 14.551  6.345  28.174  1.00 58.88  ? 15  ILE A CG2   1 
ATOM   819  C CD1   . ILE B 2 14  ? 14.573  5.420  25.198  1.00 58.06  ? 15  ILE A CD1   1 
ATOM   820  N N     . PRO B 2 15  ? 14.519  9.519  29.559  1.00 61.50  ? 16  PRO A N     1 
ATOM   821  C CA    . PRO B 2 15  ? 15.307  10.153 30.626  1.00 62.56  ? 16  PRO A CA    1 
ATOM   822  C C     . PRO B 2 15  ? 16.563  9.331  30.906  1.00 64.08  ? 16  PRO A C     1 
ATOM   823  O O     . PRO B 2 15  ? 16.484  8.110  30.965  1.00 64.36  ? 16  PRO A O     1 
ATOM   824  C CB    . PRO B 2 15  ? 14.367  10.109 31.824  1.00 62.14  ? 16  PRO A CB    1 
ATOM   825  C CG    . PRO B 2 15  ? 13.015  10.051 31.202  1.00 62.40  ? 16  PRO A CG    1 
ATOM   826  C CD    . PRO B 2 15  ? 13.201  9.109  30.063  1.00 61.70  ? 16  PRO A CD    1 
ATOM   827  N N     . ASP B 2 16  ? 17.715  9.972  31.088  1.00 65.98  ? 17  ASP A N     1 
ATOM   828  C CA    . ASP B 2 16  ? 18.928  9.205  31.375  1.00 67.86  ? 17  ASP A CA    1 
ATOM   829  C C     . ASP B 2 16  ? 18.981  8.736  32.838  1.00 69.36  ? 17  ASP A C     1 
ATOM   830  O O     . ASP B 2 16  ? 18.230  9.221  33.695  1.00 69.53  ? 17  ASP A O     1 
ATOM   831  C CB    . ASP B 2 16  ? 20.188  10.007 31.016  1.00 68.44  ? 17  ASP A CB    1 
ATOM   832  C CG    . ASP B 2 16  ? 20.297  11.315 31.773  1.00 69.56  ? 17  ASP A CG    1 
ATOM   833  O OD1   . ASP B 2 16  ? 21.308  12.028 31.580  1.00 69.71  ? 17  ASP A OD1   1 
ATOM   834  O OD2   . ASP B 2 16  ? 19.378  11.632 32.556  1.00 70.49  ? 17  ASP A OD2   1 
ATOM   835  N N     . GLU B 2 17  ? 19.873  7.784  33.104  1.00 70.87  ? 18  GLU A N     1 
ATOM   836  C CA    . GLU B 2 17  ? 20.045  7.176  34.428  1.00 72.41  ? 18  GLU A CA    1 
ATOM   837  C C     . GLU B 2 17  ? 20.163  8.101  35.645  1.00 72.62  ? 18  GLU A C     1 
ATOM   838  O O     . GLU B 2 17  ? 19.601  7.820  36.710  1.00 72.46  ? 18  GLU A O     1 
ATOM   839  C CB    . GLU B 2 17  ? 21.235  6.215  34.373  1.00 74.08  ? 18  GLU A CB    1 
ATOM   840  C CG    . GLU B 2 17  ? 20.988  5.037  33.422  1.00 77.36  ? 18  GLU A CG    1 
ATOM   841  C CD    . GLU B 2 17  ? 22.270  4.381  32.921  1.00 78.96  ? 18  GLU A CD    1 
ATOM   842  O OE1   . GLU B 2 17  ? 23.010  5.021  32.132  1.00 78.25  ? 18  GLU A OE1   1 
ATOM   843  O OE2   . GLU B 2 17  ? 22.532  3.221  33.320  1.00 80.76  ? 18  GLU A OE2   1 
ATOM   844  N N     . GLU B 2 18  ? 20.897  9.195  35.495  1.00 72.47  ? 19  GLU A N     1 
ATOM   845  C CA    . GLU B 2 18  ? 21.055  10.145 36.585  1.00 71.78  ? 19  GLU A CA    1 
ATOM   846  C C     . GLU B 2 18  ? 19.732  10.873 36.811  1.00 70.87  ? 19  GLU A C     1 
ATOM   847  O O     . GLU B 2 18  ? 19.413  11.240 37.942  1.00 71.15  ? 19  GLU A O     1 
ATOM   848  C CB    . GLU B 2 18  ? 22.177  11.155 36.276  1.00 73.06  ? 19  GLU A CB    1 
ATOM   849  C CG    . GLU B 2 18  ? 22.650  11.163 34.817  1.00 75.54  ? 19  GLU A CG    1 
ATOM   850  C CD    . GLU B 2 18  ? 23.440  9.906  34.415  1.00 76.66  ? 19  GLU A CD    1 
ATOM   851  O OE1   . GLU B 2 18  ? 23.744  9.748  33.212  1.00 76.69  ? 19  GLU A OE1   1 
ATOM   852  O OE2   . GLU B 2 18  ? 23.766  9.075  35.293  1.00 78.01  ? 19  GLU A OE2   1 
ATOM   853  N N     . GLU B 2 19  ? 18.956  11.070 35.742  1.00 69.33  ? 20  GLU A N     1 
ATOM   854  C CA    . GLU B 2 19  ? 17.668  11.756 35.857  1.00 67.86  ? 20  GLU A CA    1 
ATOM   855  C C     . GLU B 2 19  ? 16.606  10.785 36.345  1.00 66.50  ? 20  GLU A C     1 
ATOM   856  O O     . GLU B 2 19  ? 15.610  11.186 36.956  1.00 65.63  ? 20  GLU A O     1 
ATOM   857  C CB    . GLU B 2 19  ? 17.222  12.340 34.518  1.00 68.68  ? 20  GLU A CB    1 
ATOM   858  C CG    . GLU B 2 19  ? 16.078  13.353 34.670  1.00 70.50  ? 20  GLU A CG    1 
ATOM   859  C CD    . GLU B 2 19  ? 15.305  13.601 33.378  1.00 71.07  ? 20  GLU A CD    1 
ATOM   860  O OE1   . GLU B 2 19  ? 15.955  13.754 32.321  1.00 72.34  ? 20  GLU A OE1   1 
ATOM   861  O OE2   . GLU B 2 19  ? 14.053  13.657 33.426  1.00 70.51  ? 20  GLU A OE2   1 
ATOM   862  N N     . VAL B 2 20  ? 16.824  9.504  36.060  1.00 65.51  ? 21  VAL A N     1 
ATOM   863  C CA    . VAL B 2 20  ? 15.911  8.451  36.482  1.00 64.42  ? 21  VAL A CA    1 
ATOM   864  C C     . VAL B 2 20  ? 16.147  8.136  37.954  1.00 63.21  ? 21  VAL A C     1 
ATOM   865  O O     . VAL B 2 20  ? 15.200  7.991  38.723  1.00 61.83  ? 21  VAL A O     1 
ATOM   866  C CB    . VAL B 2 20  ? 16.107  7.179  35.622  1.00 64.26  ? 21  VAL A CB    1 
ATOM   867  C CG1   . VAL B 2 20  ? 15.338  6.007  36.215  1.00 64.32  ? 21  VAL A CG1   1 
ATOM   868  C CG2   . VAL B 2 20  ? 15.611  7.447  34.206  1.00 65.02  ? 21  VAL A CG2   1 
ATOM   869  N N     . ARG B 2 21  ? 17.415  8.043  38.340  1.00 63.06  ? 22  ARG A N     1 
ATOM   870  C CA    . ARG B 2 21  ? 17.768  7.770  39.729  1.00 63.48  ? 22  ARG A CA    1 
ATOM   871  C C     . ARG B 2 21  ? 17.320  8.922  40.625  1.00 62.48  ? 22  ARG A C     1 
ATOM   872  O O     . ARG B 2 21  ? 16.741  8.710  41.687  1.00 62.73  ? 22  ARG A O     1 
ATOM   873  C CB    . ARG B 2 21  ? 19.282  7.572  39.875  1.00 65.52  ? 22  ARG A CB    1 
ATOM   874  C CG    . ARG B 2 21  ? 19.780  7.661  41.321  1.00 68.15  ? 22  ARG A CG    1 
ATOM   875  C CD    . ARG B 2 21  ? 21.234  7.234  41.464  1.00 71.36  ? 22  ARG A CD    1 
ATOM   876  N NE    . ARG B 2 21  ? 22.159  8.030  40.649  1.00 74.67  ? 22  ARG A NE    1 
ATOM   877  C CZ    . ARG B 2 21  ? 22.475  9.303  40.885  1.00 75.37  ? 22  ARG A CZ    1 
ATOM   878  N NH1   . ARG B 2 21  ? 21.934  9.944  41.921  1.00 75.62  ? 22  ARG A NH1   1 
ATOM   879  N NH2   . ARG B 2 21  ? 23.346  9.929  40.095  1.00 75.36  ? 22  ARG A NH2   1 
ATOM   880  N N     . LYS B 2 22  ? 17.595  10.144 40.194  1.00 61.06  ? 23  LYS A N     1 
ATOM   881  C CA    . LYS B 2 22  ? 17.209  11.317 40.955  1.00 59.91  ? 23  LYS A CA    1 
ATOM   882  C C     . LYS B 2 22  ? 15.739  11.227 41.300  1.00 59.12  ? 23  LYS A C     1 
ATOM   883  O O     . LYS B 2 22  ? 15.334  11.561 42.411  1.00 58.99  ? 23  LYS A O     1 
ATOM   884  C CB    . LYS B 2 22  ? 17.476  12.568 40.128  1.00 60.74  ? 23  LYS A CB    1 
ATOM   885  C CG    . LYS B 2 22  ? 16.942  13.875 40.705  1.00 61.84  ? 23  LYS A CG    1 
ATOM   886  C CD    . LYS B 2 22  ? 17.395  15.019 39.800  1.00 62.83  ? 23  LYS A CD    1 
ATOM   887  C CE    . LYS B 2 22  ? 16.813  16.369 40.170  1.00 62.76  ? 23  LYS A CE    1 
ATOM   888  N NZ    . LYS B 2 22  ? 17.341  17.379 39.207  1.00 61.64  ? 23  LYS A NZ    1 
ATOM   889  N N     . GLY B 2 23  ? 14.947  10.769 40.335  1.00 58.97  ? 24  GLY A N     1 
ATOM   890  C CA    . GLY B 2 23  ? 13.516  10.634 40.536  1.00 59.36  ? 24  GLY A CA    1 
ATOM   891  C C     . GLY B 2 23  ? 13.200  9.534  41.523  1.00 59.83  ? 24  GLY A C     1 
ATOM   892  O O     . GLY B 2 23  ? 12.291  9.672  42.343  1.00 59.49  ? 24  GLY A O     1 
ATOM   893  N N     . ARG B 2 24  ? 13.959  8.442  41.433  1.00 60.42  ? 25  ARG A N     1 
ATOM   894  C CA    . ARG B 2 24  ? 13.813  7.284  42.312  1.00 60.11  ? 25  ARG A CA    1 
ATOM   895  C C     . ARG B 2 24  ? 14.001  7.670  43.775  1.00 59.78  ? 25  ARG A C     1 
ATOM   896  O O     . ARG B 2 24  ? 13.099  7.488  44.588  1.00 59.69  ? 25  ARG A O     1 
ATOM   897  C CB    . ARG B 2 24  ? 14.847  6.219  41.943  1.00 61.24  ? 25  ARG A CB    1 
ATOM   898  C CG    . ARG B 2 24  ? 14.640  5.592  40.586  1.00 62.33  ? 25  ARG A CG    1 
ATOM   899  C CD    . ARG B 2 24  ? 13.596  4.494  40.649  1.00 63.15  ? 25  ARG A CD    1 
ATOM   900  N NE    . ARG B 2 24  ? 13.109  4.143  39.319  1.00 64.01  ? 25  ARG A NE    1 
ATOM   901  C CZ    . ARG B 2 24  ? 12.274  4.897  38.612  1.00 64.17  ? 25  ARG A CZ    1 
ATOM   902  N NH1   . ARG B 2 24  ? 11.831  6.046  39.109  1.00 64.67  ? 25  ARG A NH1   1 
ATOM   903  N NH2   . ARG B 2 24  ? 11.876  4.502  37.411  1.00 64.27  ? 25  ARG A NH2   1 
ATOM   904  N N     . GLU B 2 25  ? 15.182  8.203  44.094  1.00 59.23  ? 26  GLU A N     1 
ATOM   905  C CA    . GLU B 2 25  ? 15.519  8.614  45.456  1.00 58.63  ? 26  GLU A CA    1 
ATOM   906  C C     . GLU B 2 25  ? 14.521  9.647  45.998  1.00 57.30  ? 26  GLU A C     1 
ATOM   907  O O     . GLU B 2 25  ? 14.353  9.795  47.211  1.00 56.52  ? 26  GLU A O     1 
ATOM   908  C CB    . GLU B 2 25  ? 16.956  9.155  45.494  1.00 59.75  ? 26  GLU A CB    1 
ATOM   909  C CG    . GLU B 2 25  ? 17.976  8.206  44.848  1.00 62.23  ? 26  GLU A CG    1 
ATOM   910  C CD    . GLU B 2 25  ? 19.427  8.634  45.040  1.00 64.12  ? 26  GLU A CD    1 
ATOM   911  O OE1   . GLU B 2 25  ? 19.713  9.852  44.985  1.00 65.00  ? 26  GLU A OE1   1 
ATOM   912  O OE2   . GLU B 2 25  ? 20.288  7.745  45.232  1.00 64.94  ? 26  GLU A OE2   1 
ATOM   913  N N     . ALA B 2 26  ? 13.852  10.346 45.089  1.00 56.51  ? 27  ALA A N     1 
ATOM   914  C CA    . ALA B 2 26  ? 12.837  11.320 45.461  1.00 56.81  ? 27  ALA A CA    1 
ATOM   915  C C     . ALA B 2 26  ? 11.589  10.519 45.857  1.00 57.69  ? 27  ALA A C     1 
ATOM   916  O O     . ALA B 2 26  ? 11.044  10.696 46.950  1.00 57.09  ? 27  ALA A O     1 
ATOM   917  C CB    . ALA B 2 26  ? 12.535  12.226 44.283  1.00 56.67  ? 27  ALA A CB    1 
ATOM   918  N N     . GLU B 2 27  ? 11.146  9.639  44.956  1.00 59.19  ? 28  GLU A N     1 
ATOM   919  C CA    . GLU B 2 27  ? 9.986   8.782  45.201  1.00 60.07  ? 28  GLU A CA    1 
ATOM   920  C C     . GLU B 2 27  ? 10.240  8.039  46.501  1.00 60.47  ? 28  GLU A C     1 
ATOM   921  O O     . GLU B 2 27  ? 9.345   7.867  47.327  1.00 59.93  ? 28  GLU A O     1 
ATOM   922  C CB    . GLU B 2 27  ? 9.807   7.771  44.056  1.00 61.15  ? 28  GLU A CB    1 
ATOM   923  C CG    . GLU B 2 27  ? 9.273   6.389  44.499  1.00 62.64  ? 28  GLU A CG    1 
ATOM   924  C CD    . GLU B 2 27  ? 8.796   5.509  43.339  1.00 62.21  ? 28  GLU A CD    1 
ATOM   925  O OE1   . GLU B 2 27  ? 9.469   5.477  42.285  1.00 62.63  ? 28  GLU A OE1   1 
ATOM   926  O OE2   . GLU B 2 27  ? 7.749   4.834  43.486  1.00 61.79  ? 28  GLU A OE2   1 
ATOM   927  N N     . GLU B 2 28  ? 11.480  7.595  46.666  1.00 61.64  ? 29  GLU A N     1 
ATOM   928  C CA    . GLU B 2 28  ? 11.897  6.881  47.865  1.00 62.63  ? 29  GLU A CA    1 
ATOM   929  C C     . GLU B 2 28  ? 11.674  7.688  49.146  1.00 61.85  ? 29  GLU A C     1 
ATOM   930  O O     . GLU B 2 28  ? 10.852  7.318  49.994  1.00 61.99  ? 29  GLU A O     1 
ATOM   931  C CB    . GLU B 2 28  ? 13.406  6.586  47.797  1.00 64.59  ? 29  GLU A CB    1 
ATOM   932  C CG    . GLU B 2 28  ? 13.944  5.695  48.911  1.00 66.95  ? 29  GLU A CG    1 
ATOM   933  C CD    . GLU B 2 28  ? 13.368  4.280  48.883  1.00 68.42  ? 29  GLU A CD    1 
ATOM   934  O OE1   . GLU B 2 28  ? 13.771  3.466  49.753  1.00 68.66  ? 29  GLU A OE1   1 
ATOM   935  O OE2   . GLU B 2 28  ? 12.518  3.986  48.001  1.00 69.35  ? 29  GLU A OE2   1 
ATOM   936  N N     . GLU B 2 29  ? 12.393  8.803  49.264  1.00 60.32  ? 30  GLU A N     1 
ATOM   937  C CA    . GLU B 2 29  ? 12.229  9.729  50.381  1.00 59.26  ? 30  GLU A CA    1 
ATOM   938  C C     . GLU B 2 29  ? 10.797  10.190 50.646  1.00 58.27  ? 30  GLU A C     1 
ATOM   939  O O     . GLU B 2 29  ? 10.380  10.330 51.795  1.00 58.52  ? 30  GLU A O     1 
ATOM   940  C CB    . GLU B 2 29  ? 13.103  10.963 50.172  1.00 59.54  ? 30  GLU A CB    1 
ATOM   941  C CG    . GLU B 2 29  ? 12.835  12.078 51.183  1.00 59.17  ? 30  GLU A CG    1 
ATOM   942  C CD    . GLU B 2 29  ? 13.169  11.684 52.618  1.00 58.50  ? 30  GLU A CD    1 
ATOM   943  O OE1   . GLU B 2 29  ? 12.969  12.526 53.517  1.00 58.37  ? 30  GLU A OE1   1 
ATOM   944  O OE2   . GLU B 2 29  ? 13.633  10.543 52.841  1.00 57.63  ? 30  GLU A OE2   1 
ATOM   945  N N     . LEU B 2 30  ? 10.052  10.435 49.578  1.00 56.83  ? 31  LEU A N     1 
ATOM   946  C CA    . LEU B 2 30  ? 8.676   10.902 49.689  1.00 54.92  ? 31  LEU A CA    1 
ATOM   947  C C     . LEU B 2 30  ? 7.755   9.845  50.293  1.00 53.70  ? 31  LEU A C     1 
ATOM   948  O O     . LEU B 2 30  ? 6.899   10.156 51.131  1.00 52.64  ? 31  LEU A O     1 
ATOM   949  C CB    . LEU B 2 30  ? 8.177   11.310 48.304  1.00 54.66  ? 31  LEU A CB    1 
ATOM   950  C CG    . LEU B 2 30  ? 6.797   11.939 48.189  1.00 54.25  ? 31  LEU A CG    1 
ATOM   951  C CD1   . LEU B 2 30  ? 6.664   13.145 49.098  1.00 54.54  ? 31  LEU A CD1   1 
ATOM   952  C CD2   . LEU B 2 30  ? 6.599   12.328 46.751  1.00 54.02  ? 31  LEU A CD2   1 
ATOM   953  N N     . ARG B 2 31  ? 7.932   8.602  49.849  1.00 53.40  ? 32  ARG A N     1 
ATOM   954  C CA    . ARG B 2 31  ? 7.137   7.482  50.343  1.00 52.87  ? 32  ARG A CA    1 
ATOM   955  C C     . ARG B 2 31  ? 7.415   7.372  51.826  1.00 51.60  ? 32  ARG A C     1 
ATOM   956  O O     . ARG B 2 31  ? 6.498   7.204  52.621  1.00 51.69  ? 32  ARG A O     1 
ATOM   957  C CB    . ARG B 2 31  ? 7.531   6.172  49.636  1.00 54.64  ? 32  ARG A CB    1 
ATOM   958  C CG    . ARG B 2 31  ? 6.883   5.936  48.261  1.00 56.80  ? 32  ARG A CG    1 
ATOM   959  C CD    . ARG B 2 31  ? 5.669   5.012  48.394  1.00 59.08  ? 32  ARG A CD    1 
ATOM   960  N NE    . ARG B 2 31  ? 4.936   4.762  47.151  1.00 60.10  ? 32  ARG A NE    1 
ATOM   961  C CZ    . ARG B 2 31  ? 5.474   4.269  46.038  1.00 60.52  ? 32  ARG A CZ    1 
ATOM   962  N NH1   . ARG B 2 31  ? 6.769   3.975  45.991  1.00 61.05  ? 32  ARG A NH1   1 
ATOM   963  N NH2   . ARG B 2 31  ? 4.708   4.043  44.978  1.00 59.86  ? 32  ARG A NH2   1 
ATOM   964  N N     . ARG B 2 32  ? 8.688   7.489  52.197  1.00 50.00  ? 33  ARG A N     1 
ATOM   965  C CA    . ARG B 2 32  ? 9.082   7.410  53.604  1.00 49.02  ? 33  ARG A CA    1 
ATOM   966  C C     . ARG B 2 32  ? 8.372   8.468  54.448  1.00 48.44  ? 33  ARG A C     1 
ATOM   967  O O     . ARG B 2 32  ? 7.766   8.157  55.478  1.00 48.40  ? 33  ARG A O     1 
ATOM   968  C CB    . ARG B 2 32  ? 10.598  7.603  53.765  1.00 48.43  ? 33  ARG A CB    1 
ATOM   969  C CG    . ARG B 2 32  ? 11.484  6.563  53.077  1.00 46.68  ? 33  ARG A CG    1 
ATOM   970  C CD    . ARG B 2 32  ? 12.748  6.367  53.889  1.00 45.38  ? 33  ARG A CD    1 
ATOM   971  N NE    . ARG B 2 32  ? 13.781  5.652  53.157  1.00 45.56  ? 33  ARG A NE    1 
ATOM   972  C CZ    . ARG B 2 32  ? 14.634  6.221  52.307  1.00 47.09  ? 33  ARG A CZ    1 
ATOM   973  N NH1   . ARG B 2 32  ? 14.583  7.531  52.071  1.00 46.98  ? 33  ARG A NH1   1 
ATOM   974  N NH2   . ARG B 2 32  ? 15.556  5.474  51.707  1.00 48.02  ? 33  ARG A NH2   1 
ATOM   975  N N     . ARG B 2 33  ? 8.462   9.717  53.997  1.00 47.86  ? 34  ARG A N     1 
ATOM   976  C CA    . ARG B 2 33  ? 7.861   10.850 54.688  1.00 47.67  ? 34  ARG A CA    1 
ATOM   977  C C     . ARG B 2 33  ? 6.368   10.702 54.894  1.00 48.58  ? 34  ARG A C     1 
ATOM   978  O O     . ARG B 2 33  ? 5.848   11.006 55.977  1.00 48.95  ? 34  ARG A O     1 
ATOM   979  C CB    . ARG B 2 33  ? 8.129   12.136 53.916  1.00 46.47  ? 34  ARG A CB    1 
ATOM   980  C CG    . ARG B 2 33  ? 9.573   12.558 53.924  1.00 45.82  ? 34  ARG A CG    1 
ATOM   981  C CD    . ARG B 2 33  ? 9.746   13.844 53.157  1.00 44.81  ? 34  ARG A CD    1 
ATOM   982  N NE    . ARG B 2 33  ? 11.143  14.250 53.090  1.00 42.58  ? 34  ARG A NE    1 
ATOM   983  C CZ    . ARG B 2 33  ? 11.566  15.331 52.449  1.00 41.75  ? 34  ARG A CZ    1 
ATOM   984  N NH1   . ARG B 2 33  ? 10.698  16.108 51.816  1.00 40.08  ? 34  ARG A NH1   1 
ATOM   985  N NH2   . ARG B 2 33  ? 12.852  15.642 52.457  1.00 42.26  ? 34  ARG A NH2   1 
ATOM   986  N N     . LEU B 2 34  ? 5.677   10.257 53.851  1.00 48.71  ? 35  LEU A N     1 
ATOM   987  C CA    . LEU B 2 34  ? 4.240   10.071 53.937  1.00 48.75  ? 35  LEU A CA    1 
ATOM   988  C C     . LEU B 2 34  ? 3.873   8.927  54.862  1.00 49.07  ? 35  LEU A C     1 
ATOM   989  O O     . LEU B 2 34  ? 2.844   8.968  55.539  1.00 48.39  ? 35  LEU A O     1 
ATOM   990  C CB    . LEU B 2 34  ? 3.673   9.807  52.555  1.00 47.59  ? 35  LEU A CB    1 
ATOM   991  C CG    . LEU B 2 34  ? 3.331   11.080 51.804  1.00 46.51  ? 35  LEU A CG    1 
ATOM   992  C CD1   . LEU B 2 34  ? 3.346   10.793 50.328  1.00 47.86  ? 35  LEU A CD1   1 
ATOM   993  C CD2   . LEU B 2 34  ? 1.973   11.594 52.254  1.00 46.06  ? 35  LEU A CD2   1 
ATOM   994  N N     . ASP B 2 35  ? 4.722   7.905  54.877  1.00 50.02  ? 36  ASP A N     1 
ATOM   995  C CA    . ASP B 2 35  ? 4.496   6.737  55.709  1.00 51.35  ? 36  ASP A CA    1 
ATOM   996  C C     . ASP B 2 35  ? 4.752   7.032  57.168  1.00 52.66  ? 36  ASP A C     1 
ATOM   997  O O     . ASP B 2 35  ? 4.074   6.482  58.040  1.00 53.74  ? 36  ASP A O     1 
ATOM   998  C CB    . ASP B 2 35  ? 5.378   5.578  55.261  1.00 50.89  ? 36  ASP A CB    1 
ATOM   999  C CG    . ASP B 2 35  ? 4.801   4.847  54.075  1.00 51.60  ? 36  ASP A CG    1 
ATOM   1000 O OD1   . ASP B 2 35  ? 3.551   4.754  53.999  1.00 50.36  ? 36  ASP A OD1   1 
ATOM   1001 O OD2   . ASP B 2 35  ? 5.589   4.360  53.233  1.00 52.67  ? 36  ASP A OD2   1 
ATOM   1002 N N     . GLU B 2 36  ? 5.726   7.896  57.444  1.00 53.13  ? 37  GLU A N     1 
ATOM   1003 C CA    . GLU B 2 36  ? 6.014   8.243  58.824  1.00 52.71  ? 37  GLU A CA    1 
ATOM   1004 C C     . GLU B 2 36  ? 4.832   9.029  59.413  1.00 51.68  ? 37  GLU A C     1 
ATOM   1005 O O     . GLU B 2 36  ? 4.818   9.349  60.588  1.00 52.04  ? 37  GLU A O     1 
ATOM   1006 C CB    . GLU B 2 36  ? 7.316   9.038  58.915  1.00 54.13  ? 37  GLU A CB    1 
ATOM   1007 C CG    . GLU B 2 36  ? 7.859   9.182  60.342  1.00 59.40  ? 37  GLU A CG    1 
ATOM   1008 C CD    . GLU B 2 36  ? 7.712   7.901  61.214  1.00 62.03  ? 37  GLU A CD    1 
ATOM   1009 O OE1   . GLU B 2 36  ? 7.876   6.773  60.679  1.00 63.55  ? 37  GLU A OE1   1 
ATOM   1010 O OE2   . GLU B 2 36  ? 7.446   8.030  62.440  1.00 61.90  ? 37  GLU A OE2   1 
ATOM   1011 N N     . LEU B 2 37  ? 3.839   9.334  58.585  1.00 50.75  ? 38  LEU A N     1 
ATOM   1012 C CA    . LEU B 2 37  ? 2.646   10.029 59.049  1.00 50.09  ? 38  LEU A CA    1 
ATOM   1013 C C     . LEU B 2 37  ? 1.479   9.146  58.649  1.00 49.95  ? 38  LEU A C     1 
ATOM   1014 O O     . LEU B 2 37  ? 0.318   9.483  58.873  1.00 48.55  ? 38  LEU A O     1 
ATOM   1015 C CB    . LEU B 2 37  ? 2.498   11.393 58.380  1.00 50.47  ? 38  LEU A CB    1 
ATOM   1016 C CG    . LEU B 2 37  ? 3.733   12.292 58.297  1.00 51.31  ? 38  LEU A CG    1 
ATOM   1017 C CD1   . LEU B 2 37  ? 3.290   13.706 57.930  1.00 50.59  ? 38  LEU A CD1   1 
ATOM   1018 C CD2   . LEU B 2 37  ? 4.481   12.302 59.627  1.00 51.95  ? 38  LEU A CD2   1 
ATOM   1019 N N     . GLY B 2 38  ? 1.821   8.013  58.036  1.00 50.55  ? 39  GLY A N     1 
ATOM   1020 C CA    . GLY B 2 38  ? 0.846   7.043  57.574  1.00 51.89  ? 39  GLY A CA    1 
ATOM   1021 C C     . GLY B 2 38  ? -0.369  7.631  56.881  1.00 53.32  ? 39  GLY A C     1 
ATOM   1022 O O     . GLY B 2 38  ? -1.489  7.485  57.364  1.00 53.49  ? 39  GLY A O     1 
ATOM   1023 N N     . VAL B 2 39  ? -0.169  8.287  55.745  1.00 54.33  ? 40  VAL A N     1 
ATOM   1024 C CA    . VAL B 2 39  ? -1.296  8.881  55.034  1.00 54.48  ? 40  VAL A CA    1 
ATOM   1025 C C     . VAL B 2 39  ? -1.677  7.989  53.872  1.00 54.52  ? 40  VAL A C     1 
ATOM   1026 O O     . VAL B 2 39  ? -0.808  7.387  53.245  1.00 54.72  ? 40  VAL A O     1 
ATOM   1027 C CB    . VAL B 2 39  ? -0.950  10.262 54.452  1.00 55.04  ? 40  VAL A CB    1 
ATOM   1028 C CG1   . VAL B 2 39  ? -2.235  11.014 54.171  1.00 55.01  ? 40  VAL A CG1   1 
ATOM   1029 C CG2   . VAL B 2 39  ? -0.033  11.041 55.404  1.00 54.74  ? 40  VAL A CG2   1 
ATOM   1030 N N     . GLU B 2 40  ? -2.965  7.904  53.567  1.00 54.49  ? 41  GLU A N     1 
ATOM   1031 C CA    . GLU B 2 40  ? -3.373  7.063  52.456  1.00 54.58  ? 41  GLU A CA    1 
ATOM   1032 C C     . GLU B 2 40  ? -3.155  7.807  51.139  1.00 54.22  ? 41  GLU A C     1 
ATOM   1033 O O     . GLU B 2 40  ? -3.922  8.710  50.791  1.00 54.62  ? 41  GLU A O     1 
ATOM   1034 C CB    . GLU B 2 40  ? -4.835  6.646  52.612  1.00 55.66  ? 41  GLU A CB    1 
ATOM   1035 C CG    . GLU B 2 40  ? -5.182  5.395  51.798  1.00 58.68  ? 41  GLU A CG    1 
ATOM   1036 C CD    . GLU B 2 40  ? -6.466  4.719  52.254  1.00 60.02  ? 41  GLU A CD    1 
ATOM   1037 O OE1   . GLU B 2 40  ? -7.533  5.372  52.201  1.00 61.45  ? 41  GLU A OE1   1 
ATOM   1038 O OE2   . GLU B 2 40  ? -6.404  3.535  52.665  1.00 60.21  ? 41  GLU A OE2   1 
ATOM   1039 N N     . TYR B 2 41  ? -2.100  7.422  50.418  1.00 53.35  ? 42  TYR A N     1 
ATOM   1040 C CA    . TYR B 2 41  ? -1.748  8.057  49.147  1.00 52.26  ? 42  TYR A CA    1 
ATOM   1041 C C     . TYR B 2 41  ? -1.528  7.086  47.984  1.00 51.07  ? 42  TYR A C     1 
ATOM   1042 O O     . TYR B 2 41  ? -1.517  5.869  48.161  1.00 51.04  ? 42  TYR A O     1 
ATOM   1043 C CB    . TYR B 2 41  ? -0.480  8.896  49.323  1.00 52.03  ? 42  TYR A CB    1 
ATOM   1044 C CG    . TYR B 2 41  ? 0.749   8.076  49.634  1.00 52.05  ? 42  TYR A CG    1 
ATOM   1045 C CD1   . TYR B 2 41  ? 1.391   7.343  48.641  1.00 52.09  ? 42  TYR A CD1   1 
ATOM   1046 C CD2   . TYR B 2 41  ? 1.242   8.000  50.933  1.00 51.95  ? 42  TYR A CD2   1 
ATOM   1047 C CE1   . TYR B 2 41  ? 2.488   6.551  48.931  1.00 52.61  ? 42  TYR A CE1   1 
ATOM   1048 C CE2   . TYR B 2 41  ? 2.338   7.216  51.238  1.00 52.17  ? 42  TYR A CE2   1 
ATOM   1049 C CZ    . TYR B 2 41  ? 2.957   6.491  50.235  1.00 53.16  ? 42  TYR A CZ    1 
ATOM   1050 O OH    . TYR B 2 41  ? 4.033   5.690  50.545  1.00 54.66  ? 42  TYR A OH    1 
ATOM   1051 N N     . VAL B 2 42  ? -1.333  7.652  46.794  1.00 49.98  ? 43  VAL A N     1 
ATOM   1052 C CA    . VAL B 2 42  ? -1.093  6.877  45.577  1.00 48.78  ? 43  VAL A CA    1 
ATOM   1053 C C     . VAL B 2 42  ? -0.439  7.740  44.494  1.00 48.44  ? 43  VAL A C     1 
ATOM   1054 O O     . VAL B 2 42  ? -0.957  8.799  44.125  1.00 48.91  ? 43  VAL A O     1 
ATOM   1055 C CB    . VAL B 2 42  ? -2.407  6.299  44.993  1.00 48.05  ? 43  VAL A CB    1 
ATOM   1056 C CG1   . VAL B 2 42  ? -3.349  7.427  44.603  1.00 47.30  ? 43  VAL A CG1   1 
ATOM   1057 C CG2   . VAL B 2 42  ? -2.105  5.420  43.789  1.00 46.42  ? 43  VAL A CG2   1 
ATOM   1058 N N     . PHE B 2 43  ? 0.712   7.291  44.000  1.00 47.50  ? 44  PHE A N     1 
ATOM   1059 C CA    . PHE B 2 43  ? 1.418   8.004  42.942  1.00 45.79  ? 44  PHE A CA    1 
ATOM   1060 C C     . PHE B 2 43  ? 0.722   7.735  41.610  1.00 44.55  ? 44  PHE A C     1 
ATOM   1061 O O     . PHE B 2 43  ? 0.434   6.588  41.271  1.00 44.08  ? 44  PHE A O     1 
ATOM   1062 C CB    . PHE B 2 43  ? 2.851   7.505  42.817  1.00 46.66  ? 44  PHE A CB    1 
ATOM   1063 C CG    . PHE B 2 43  ? 3.741   7.878  43.958  1.00 47.43  ? 44  PHE A CG    1 
ATOM   1064 C CD1   . PHE B 2 43  ? 3.347   7.680  45.276  1.00 48.96  ? 44  PHE A CD1   1 
ATOM   1065 C CD2   . PHE B 2 43  ? 5.011   8.378  43.708  1.00 47.67  ? 44  PHE A CD2   1 
ATOM   1066 C CE1   . PHE B 2 43  ? 4.221   7.980  46.333  1.00 49.09  ? 44  PHE A CE1   1 
ATOM   1067 C CE2   . PHE B 2 43  ? 5.880   8.675  44.743  1.00 48.12  ? 44  PHE A CE2   1 
ATOM   1068 C CZ    . PHE B 2 43  ? 5.490   8.478  46.057  1.00 48.92  ? 44  PHE A CZ    1 
ATOM   1069 N N     . VAL B 2 44  ? 0.454   8.787  40.851  1.00 43.71  ? 45  VAL A N     1 
ATOM   1070 C CA    . VAL B 2 44  ? -0.168  8.636  39.544  1.00 42.39  ? 45  VAL A CA    1 
ATOM   1071 C C     . VAL B 2 44  ? 0.631   9.519  38.577  1.00 42.42  ? 45  VAL A C     1 
ATOM   1072 O O     . VAL B 2 44  ? 1.707   10.021 38.932  1.00 43.06  ? 45  VAL A O     1 
ATOM   1073 C CB    . VAL B 2 44  ? -1.645  9.075  39.575  1.00 41.59  ? 45  VAL A CB    1 
ATOM   1074 C CG1   . VAL B 2 44  ? -2.381  8.286  40.634  1.00 40.66  ? 45  VAL A CG1   1 
ATOM   1075 C CG2   . VAL B 2 44  ? -1.752  10.574 39.850  1.00 40.49  ? 45  VAL A CG2   1 
ATOM   1076 N N     . GLY B 2 45  ? 0.128   9.705  37.362  1.00 41.84  ? 46  GLY A N     1 
ATOM   1077 C CA    . GLY B 2 45  ? 0.838   10.549 36.420  1.00 41.14  ? 46  GLY A CA    1 
ATOM   1078 C C     . GLY B 2 45  ? 1.950   9.786  35.745  1.00 40.64  ? 46  GLY A C     1 
ATOM   1079 O O     . GLY B 2 45  ? 2.275   8.671  36.165  1.00 39.38  ? 46  GLY A O     1 
ATOM   1080 N N     . SER B 2 46  ? 2.532   10.401 34.714  1.00 40.63  ? 47  SER A N     1 
ATOM   1081 C CA    . SER B 2 46  ? 3.595   9.797  33.916  1.00 40.77  ? 47  SER A CA    1 
ATOM   1082 C C     . SER B 2 46  ? 4.776   9.284  34.712  1.00 40.68  ? 47  SER A C     1 
ATOM   1083 O O     . SER B 2 46  ? 5.491   8.401  34.248  1.00 40.86  ? 47  SER A O     1 
ATOM   1084 C CB    . SER B 2 46  ? 4.104   10.775 32.867  1.00 40.53  ? 47  SER A CB    1 
ATOM   1085 O OG    . SER B 2 46  ? 4.840   11.809 33.485  1.00 42.38  ? 47  SER A OG    1 
ATOM   1086 N N     . TYR B 2 47  ? 5.016   9.834  35.895  1.00 40.50  ? 48  TYR A N     1 
ATOM   1087 C CA    . TYR B 2 47  ? 6.131   9.319  36.670  1.00 40.88  ? 48  TYR A CA    1 
ATOM   1088 C C     . TYR B 2 47  ? 5.776   7.921  37.169  1.00 40.98  ? 48  TYR A C     1 
ATOM   1089 O O     . TYR B 2 47  ? 6.571   6.987  37.055  1.00 41.81  ? 48  TYR A O     1 
ATOM   1090 C CB    . TYR B 2 47  ? 6.445   10.191 37.874  1.00 40.47  ? 48  TYR A CB    1 
ATOM   1091 C CG    . TYR B 2 47  ? 7.556   9.584  38.697  1.00 40.30  ? 48  TYR A CG    1 
ATOM   1092 C CD1   . TYR B 2 47  ? 8.893   9.691  38.292  1.00 40.15  ? 48  TYR A CD1   1 
ATOM   1093 C CD2   . TYR B 2 47  ? 7.275   8.858  39.857  1.00 39.43  ? 48  TYR A CD2   1 
ATOM   1094 C CE1   . TYR B 2 47  ? 9.921   9.094  39.027  1.00 40.43  ? 48  TYR A CE1   1 
ATOM   1095 C CE2   . TYR B 2 47  ? 8.295   8.254  40.595  1.00 39.22  ? 48  TYR A CE2   1 
ATOM   1096 C CZ    . TYR B 2 47  ? 9.609   8.380  40.176  1.00 40.67  ? 48  TYR A CZ    1 
ATOM   1097 O OH    . TYR B 2 47  ? 10.608  7.810  40.924  1.00 42.85  ? 48  TYR A OH    1 
ATOM   1098 N N     . ALA B 2 48  ? 4.584   7.780  37.735  1.00 40.51  ? 49  ALA A N     1 
ATOM   1099 C CA    . ALA B 2 48  ? 4.155   6.492  38.242  1.00 41.23  ? 49  ALA A CA    1 
ATOM   1100 C C     . ALA B 2 48  ? 4.400   5.440  37.179  1.00 42.66  ? 49  ALA A C     1 
ATOM   1101 O O     . ALA B 2 48  ? 5.074   4.446  37.423  1.00 42.87  ? 49  ALA A O     1 
ATOM   1102 C CB    . ALA B 2 48  ? 2.696   6.535  38.584  1.00 41.44  ? 49  ALA A CB    1 
ATOM   1103 N N     . ARG B 2 49  ? 3.863   5.689  35.989  1.00 44.45  ? 50  ARG A N     1 
ATOM   1104 C CA    . ARG B 2 49  ? 3.976   4.776  34.857  1.00 45.54  ? 50  ARG A CA    1 
ATOM   1105 C C     . ARG B 2 49  ? 5.237   4.918  33.988  1.00 47.68  ? 50  ARG A C     1 
ATOM   1106 O O     . ARG B 2 49  ? 5.265   4.461  32.838  1.00 48.87  ? 50  ARG A O     1 
ATOM   1107 C CB    . ARG B 2 49  ? 2.734   4.920  33.985  1.00 44.07  ? 50  ARG A CB    1 
ATOM   1108 C CG    . ARG B 2 49  ? 1.481   4.325  34.599  1.00 43.55  ? 50  ARG A CG    1 
ATOM   1109 C CD    . ARG B 2 49  ? 0.230   4.926  33.966  1.00 42.75  ? 50  ARG A CD    1 
ATOM   1110 N NE    . ARG B 2 49  ? -0.103  6.185  34.614  1.00 41.76  ? 50  ARG A NE    1 
ATOM   1111 C CZ    . ARG B 2 49  ? -0.397  7.305  33.974  1.00 40.84  ? 50  ARG A CZ    1 
ATOM   1112 N NH1   . ARG B 2 49  ? -0.402  7.345  32.655  1.00 39.54  ? 50  ARG A NH1   1 
ATOM   1113 N NH2   . ARG B 2 49  ? -0.689  8.389  34.668  1.00 43.00  ? 50  ARG A NH2   1 
ATOM   1114 N N     . ASN B 2 50  ? 6.277   5.540  34.534  1.00 49.23  ? 51  ASN A N     1 
ATOM   1115 C CA    . ASN B 2 50  ? 7.536   5.719  33.810  1.00 51.02  ? 51  ASN A CA    1 
ATOM   1116 C C     . ASN B 2 50  ? 7.471   6.202  32.359  1.00 50.78  ? 51  ASN A C     1 
ATOM   1117 O O     . ASN B 2 50  ? 8.284   5.801  31.518  1.00 51.71  ? 51  ASN A O     1 
ATOM   1118 C CB    . ASN B 2 50  ? 8.398   4.458  33.931  1.00 52.76  ? 51  ASN A CB    1 
ATOM   1119 C CG    . ASN B 2 50  ? 8.639   4.045  35.383  1.00 55.84  ? 51  ASN A CG    1 
ATOM   1120 O OD1   . ASN B 2 50  ? 9.080   4.855  36.209  1.00 56.74  ? 51  ASN A OD1   1 
ATOM   1121 N ND2   . ASN B 2 50  ? 8.356   2.773  35.699  1.00 56.31  ? 51  ASN A ND2   1 
ATOM   1122 N N     . THR B 2 51  ? 6.497   7.062  32.075  1.00 49.72  ? 52  THR A N     1 
ATOM   1123 C CA    . THR B 2 51  ? 6.225   7.507  30.719  1.00 49.02  ? 52  THR A CA    1 
ATOM   1124 C C     . THR B 2 51  ? 6.641   8.963  30.550  1.00 49.78  ? 52  THR A C     1 
ATOM   1125 O O     . THR B 2 51  ? 6.596   9.508  29.444  1.00 50.77  ? 52  THR A O     1 
ATOM   1126 C CB    . THR B 2 51  ? 4.746   7.404  30.393  1.00 47.98  ? 52  THR A CB    1 
ATOM   1127 O OG1   . THR B 2 51  ? 4.002   8.188  31.331  1.00 46.60  ? 52  THR A OG1   1 
ATOM   1128 C CG2   . THR B 2 51  ? 4.302   5.963  30.449  1.00 48.45  ? 52  THR A CG2   1 
ATOM   1129 N N     . TRP B 2 52  ? 7.051   9.591  31.649  1.00 50.17  ? 53  TRP A N     1 
ATOM   1130 C CA    . TRP B 2 52  ? 7.470   10.989 31.609  1.00 49.84  ? 53  TRP A CA    1 
ATOM   1131 C C     . TRP B 2 52  ? 8.566   11.194 30.573  1.00 49.67  ? 53  TRP A C     1 
ATOM   1132 O O     . TRP B 2 52  ? 9.416   10.322 30.344  1.00 49.04  ? 53  TRP A O     1 
ATOM   1133 C CB    . TRP B 2 52  ? 7.939   11.468 33.005  1.00 49.67  ? 53  TRP A CB    1 
ATOM   1134 C CG    . TRP B 2 52  ? 9.393   11.213 33.352  1.00 48.50  ? 53  TRP A CG    1 
ATOM   1135 C CD1   . TRP B 2 52  ? 10.463  12.013 33.061  1.00 47.80  ? 53  TRP A CD1   1 
ATOM   1136 C CD2   . TRP B 2 52  ? 9.911   10.110 34.107  1.00 48.69  ? 53  TRP A CD2   1 
ATOM   1137 N NE1   . TRP B 2 52  ? 11.613  11.479 33.599  1.00 48.03  ? 53  TRP A NE1   1 
ATOM   1138 C CE2   . TRP B 2 52  ? 11.304  10.314 34.244  1.00 48.19  ? 53  TRP A CE2   1 
ATOM   1139 C CE3   . TRP B 2 52  ? 9.330   8.972  34.685  1.00 49.30  ? 53  TRP A CE3   1 
ATOM   1140 C CZ2   . TRP B 2 52  ? 12.130  9.418  34.934  1.00 48.69  ? 53  TRP A CZ2   1 
ATOM   1141 C CZ3   . TRP B 2 52  ? 10.155  8.073  35.377  1.00 50.23  ? 53  TRP A CZ3   1 
ATOM   1142 C CH2   . TRP B 2 52  ? 11.542  8.306  35.495  1.00 49.36  ? 53  TRP A CH2   1 
ATOM   1143 N N     . LEU B 2 53  ? 8.517   12.359 29.944  1.00 49.22  ? 54  LEU A N     1 
ATOM   1144 C CA    . LEU B 2 53  ? 9.470   12.723 28.920  1.00 48.64  ? 54  LEU A CA    1 
ATOM   1145 C C     . LEU B 2 53  ? 10.741  13.297 29.529  1.00 49.58  ? 54  LEU A C     1 
ATOM   1146 O O     . LEU B 2 53  ? 10.693  14.122 30.442  1.00 49.61  ? 54  LEU A O     1 
ATOM   1147 C CB    . LEU B 2 53  ? 8.838   13.746 27.998  1.00 46.95  ? 54  LEU A CB    1 
ATOM   1148 C CG    . LEU B 2 53  ? 9.683   14.114 26.796  1.00 46.11  ? 54  LEU A CG    1 
ATOM   1149 C CD1   . LEU B 2 53  ? 9.966   12.868 25.982  1.00 46.08  ? 54  LEU A CD1   1 
ATOM   1150 C CD2   . LEU B 2 53  ? 8.929   15.143 25.979  1.00 44.67  ? 54  LEU A CD2   1 
ATOM   1151 N N     . LYS B 2 54  ? 11.876  12.837 29.020  1.00 50.22  ? 55  LYS A N     1 
ATOM   1152 C CA    . LYS B 2 54  ? 13.181  13.293 29.470  1.00 50.09  ? 55  LYS A CA    1 
ATOM   1153 C C     . LYS B 2 54  ? 13.232  14.804 29.689  1.00 49.77  ? 55  LYS A C     1 
ATOM   1154 O O     . LYS B 2 54  ? 12.894  15.584 28.793  1.00 49.85  ? 55  LYS A O     1 
ATOM   1155 C CB    . LYS B 2 54  ? 14.204  12.974 28.377  1.00 50.96  ? 55  LYS A CB    1 
ATOM   1156 C CG    . LYS B 2 54  ? 15.612  13.436 28.633  1.00 51.98  ? 55  LYS A CG    1 
ATOM   1157 C CD    . LYS B 2 54  ? 16.541  12.761 27.638  1.00 53.61  ? 55  LYS A CD    1 
ATOM   1158 C CE    . LYS B 2 54  ? 17.962  13.250 27.784  1.00 54.24  ? 55  LYS A CE    1 
ATOM   1159 N NZ    . LYS B 2 54  ? 18.040  14.679 27.400  1.00 55.27  ? 55  LYS A NZ    1 
ATOM   1160 N N     . GLY B 2 55  ? 13.625  15.214 30.888  1.00 49.58  ? 56  GLY A N     1 
ATOM   1161 C CA    . GLY B 2 55  ? 13.601  16.626 31.231  1.00 49.33  ? 56  GLY A CA    1 
ATOM   1162 C C     . GLY B 2 55  ? 12.310  17.149 31.853  1.00 49.37  ? 56  GLY A C     1 
ATOM   1163 O O     . GLY B 2 55  ? 12.247  18.318 32.234  1.00 49.89  ? 56  GLY A O     1 
ATOM   1164 N N     . SER B 2 56  ? 11.277  16.314 31.960  1.00 48.76  ? 57  SER A N     1 
ATOM   1165 C CA    . SER B 2 56  ? 10.015  16.759 32.555  1.00 47.83  ? 57  SER A CA    1 
ATOM   1166 C C     . SER B 2 56  ? 9.613   15.910 33.743  1.00 46.66  ? 57  SER A C     1 
ATOM   1167 O O     . SER B 2 56  ? 8.432   15.587 33.908  1.00 46.65  ? 57  SER A O     1 
ATOM   1168 C CB    . SER B 2 56  ? 8.881   16.734 31.529  1.00 49.13  ? 57  SER A CB    1 
ATOM   1169 O OG    . SER B 2 56  ? 9.165   17.584 30.432  1.00 52.03  ? 57  SER A OG    1 
ATOM   1170 N N     . LEU B 2 57  ? 10.600  15.553 34.564  1.00 45.27  ? 58  LEU A N     1 
ATOM   1171 C CA    . LEU B 2 57  ? 10.368  14.758 35.763  1.00 44.29  ? 58  LEU A CA    1 
ATOM   1172 C C     . LEU B 2 57  ? 9.520   15.518 36.772  1.00 44.10  ? 58  LEU A C     1 
ATOM   1173 O O     . LEU B 2 57  ? 9.838   16.644 37.155  1.00 43.83  ? 58  LEU A O     1 
ATOM   1174 C CB    . LEU B 2 57  ? 11.693  14.373 36.414  1.00 44.41  ? 58  LEU A CB    1 
ATOM   1175 C CG    . LEU B 2 57  ? 11.548  13.670 37.771  1.00 44.69  ? 58  LEU A CG    1 
ATOM   1176 C CD1   . LEU B 2 57  ? 10.602  12.481 37.643  1.00 44.74  ? 58  LEU A CD1   1 
ATOM   1177 C CD2   . LEU B 2 57  ? 12.916  13.212 38.267  1.00 44.21  ? 58  LEU A CD2   1 
ATOM   1178 N N     . GLU B 2 58  ? 8.433   14.897 37.202  1.00 44.69  ? 59  GLU A N     1 
ATOM   1179 C CA    . GLU B 2 58  ? 7.534   15.522 38.162  1.00 45.15  ? 59  GLU A CA    1 
ATOM   1180 C C     . GLU B 2 58  ? 6.864   14.267 38.706  1.00 45.20  ? 59  GLU A C     1 
ATOM   1181 O O     . GLU B 2 58  ? 6.476   13.368 37.937  1.00 46.10  ? 59  GLU A O     1 
ATOM   1182 C CB    . GLU B 2 58  ? 6.718   16.621 37.487  1.00 45.49  ? 59  GLU A CB    1 
ATOM   1183 C CG    . GLU B 2 58  ? 5.966   17.493 38.470  1.00 46.54  ? 59  GLU A CG    1 
ATOM   1184 C CD    . GLU B 2 58  ? 4.964   18.400 37.791  1.00 46.93  ? 59  GLU A CD    1 
ATOM   1185 O OE1   . GLU B 2 58  ? 3.896   17.893 37.380  1.00 47.32  ? 59  GLU A OE1   1 
ATOM   1186 O OE2   . GLU B 2 58  ? 5.247   19.614 37.663  1.00 47.85  ? 59  GLU A OE2   1 
ATOM   1187 N N     . ILE B 2 59  ? 6.744   14.217 40.033  1.00 44.34  ? 60  ILE A N     1 
ATOM   1188 C CA    . ILE B 2 59  ? 5.955   13.213 40.738  1.00 43.60  ? 60  ILE A CA    1 
ATOM   1189 C C     . ILE B 2 59  ? 4.621   13.781 41.145  1.00 42.98  ? 60  ILE A C     1 
ATOM   1190 O O     . ILE B 2 59  ? 4.556   14.893 41.641  1.00 42.87  ? 60  ILE A O     1 
ATOM   1191 C CB    . ILE B 2 59  ? 6.694   12.722 41.997  1.00 43.21  ? 60  ILE A CB    1 
ATOM   1192 C CG1   . ILE B 2 59  ? 8.016   12.060 41.589  1.00 42.55  ? 60  ILE A CG1   1 
ATOM   1193 C CG2   . ILE B 2 59  ? 5.810   11.767 42.783  1.00 42.98  ? 60  ILE A CG2   1 
ATOM   1194 C CD1   . ILE B 2 59  ? 8.940   11.701 42.759  1.00 42.98  ? 60  ILE A CD1   1 
ATOM   1195 N N     . ASP B 2 60  ? 3.557   13.021 40.928  1.00 43.75  ? 61  ASP A N     1 
ATOM   1196 C CA    . ASP B 2 60  ? 2.230   13.492 41.285  1.00 45.82  ? 61  ASP A CA    1 
ATOM   1197 C C     . ASP B 2 60  ? 1.619   12.589 42.336  1.00 45.22  ? 61  ASP A C     1 
ATOM   1198 O O     . ASP B 2 60  ? 1.084   11.533 42.017  1.00 46.08  ? 61  ASP A O     1 
ATOM   1199 C CB    . ASP B 2 60  ? 1.311   13.533 40.054  1.00 49.17  ? 61  ASP A CB    1 
ATOM   1200 C CG    . ASP B 2 60  ? 1.873   14.385 38.925  1.00 52.39  ? 61  ASP A CG    1 
ATOM   1201 O OD1   . ASP B 2 60  ? 2.679   13.840 38.125  1.00 54.89  ? 61  ASP A OD1   1 
ATOM   1202 O OD2   . ASP B 2 60  ? 1.514   15.593 38.846  1.00 52.76  ? 61  ASP A OD2   1 
ATOM   1203 N N     . VAL B 2 61  ? 1.689   13.011 43.591  1.00 44.10  ? 62  VAL A N     1 
ATOM   1204 C CA    . VAL B 2 61  ? 1.147   12.225 44.691  1.00 43.52  ? 62  VAL A CA    1 
ATOM   1205 C C     . VAL B 2 61  ? -0.306  12.571 45.015  1.00 42.85  ? 62  VAL A C     1 
ATOM   1206 O O     . VAL B 2 61  ? -0.647  13.729 45.258  1.00 42.78  ? 62  VAL A O     1 
ATOM   1207 C CB    . VAL B 2 61  ? 2.012   12.410 45.947  1.00 43.14  ? 62  VAL A CB    1 
ATOM   1208 C CG1   . VAL B 2 61  ? 1.312   11.831 47.164  1.00 43.07  ? 62  VAL A CG1   1 
ATOM   1209 C CG2   . VAL B 2 61  ? 3.348   11.739 45.728  1.00 42.97  ? 62  VAL A CG2   1 
ATOM   1210 N N     . PHE B 2 62  ? -1.165  11.562 45.022  1.00 42.28  ? 63  PHE A N     1 
ATOM   1211 C CA    . PHE B 2 62  ? -2.572  11.793 45.319  1.00 42.56  ? 63  PHE A CA    1 
ATOM   1212 C C     . PHE B 2 62  ? -2.967  11.226 46.676  1.00 42.93  ? 63  PHE A C     1 
ATOM   1213 O O     . PHE B 2 62  ? -2.722  10.061 46.963  1.00 44.09  ? 63  PHE A O     1 
ATOM   1214 C CB    . PHE B 2 62  ? -3.450  11.180 44.224  1.00 42.52  ? 63  PHE A CB    1 
ATOM   1215 C CG    . PHE B 2 62  ? -3.814  12.141 43.129  1.00 42.05  ? 63  PHE A CG    1 
ATOM   1216 C CD1   . PHE B 2 62  ? -2.847  12.959 42.556  1.00 41.82  ? 63  PHE A CD1   1 
ATOM   1217 C CD2   . PHE B 2 62  ? -5.132  12.237 42.677  1.00 42.06  ? 63  PHE A CD2   1 
ATOM   1218 C CE1   . PHE B 2 62  ? -3.185  13.860 41.554  1.00 40.74  ? 63  PHE A CE1   1 
ATOM   1219 C CE2   . PHE B 2 62  ? -5.481  13.137 41.671  1.00 40.94  ? 63  PHE A CE2   1 
ATOM   1220 C CZ    . PHE B 2 62  ? -4.506  13.949 41.112  1.00 40.67  ? 63  PHE A CZ    1 
ATOM   1221 N N     . LEU B 2 63  ? -3.590  12.060 47.499  1.00 42.58  ? 64  LEU A N     1 
ATOM   1222 C CA    . LEU B 2 63  ? -4.017  11.660 48.822  1.00 41.95  ? 64  LEU A CA    1 
ATOM   1223 C C     . LEU B 2 63  ? -5.483  11.251 48.785  1.00 43.55  ? 64  LEU A C     1 
ATOM   1224 O O     . LEU B 2 63  ? -6.358  12.074 48.493  1.00 43.15  ? 64  LEU A O     1 
ATOM   1225 C CB    . LEU B 2 63  ? -3.828  12.827 49.775  1.00 39.93  ? 64  LEU A CB    1 
ATOM   1226 C CG    . LEU B 2 63  ? -2.452  13.485 49.685  1.00 38.84  ? 64  LEU A CG    1 
ATOM   1227 C CD1   . LEU B 2 63  ? -2.357  14.630 50.694  1.00 38.87  ? 64  LEU A CD1   1 
ATOM   1228 C CD2   . LEU B 2 63  ? -1.368  12.434 49.950  1.00 38.96  ? 64  LEU A CD2   1 
ATOM   1229 N N     . LEU B 2 64  ? -5.743  9.980  49.083  1.00 45.50  ? 65  LEU A N     1 
ATOM   1230 C CA    . LEU B 2 64  ? -7.104  9.442  49.090  1.00 47.63  ? 65  LEU A CA    1 
ATOM   1231 C C     . LEU B 2 64  ? -7.880  9.825  50.356  1.00 49.00  ? 65  LEU A C     1 
ATOM   1232 O O     . LEU B 2 64  ? -7.398  9.618  51.476  1.00 50.10  ? 65  LEU A O     1 
ATOM   1233 C CB    . LEU B 2 64  ? -7.072  7.915  48.961  1.00 47.19  ? 65  LEU A CB    1 
ATOM   1234 C CG    . LEU B 2 64  ? -6.525  7.285  47.671  1.00 47.05  ? 65  LEU A CG    1 
ATOM   1235 C CD1   . LEU B 2 64  ? -7.166  7.960  46.461  1.00 45.12  ? 65  LEU A CD1   1 
ATOM   1236 C CD2   . LEU B 2 64  ? -5.001  7.409  47.639  1.00 46.15  ? 65  LEU A CD2   1 
ATOM   1237 N N     . PHE B 2 65  ? -9.084  10.368 50.172  1.00 49.73  ? 66  PHE A N     1 
ATOM   1238 C CA    . PHE B 2 65  ? -9.926  10.791 51.291  1.00 50.22  ? 66  PHE A CA    1 
ATOM   1239 C C     . PHE B 2 65  ? -11.306 10.139 51.269  1.00 49.98  ? 66  PHE A C     1 
ATOM   1240 O O     . PHE B 2 65  ? -11.880 9.880  50.214  1.00 49.49  ? 66  PHE A O     1 
ATOM   1241 C CB    . PHE B 2 65  ? -10.082 12.318 51.285  1.00 51.68  ? 66  PHE A CB    1 
ATOM   1242 C CG    . PHE B 2 65  ? -8.898  13.062 51.878  1.00 53.98  ? 66  PHE A CG    1 
ATOM   1243 C CD1   . PHE B 2 65  ? -8.633  12.995 53.248  1.00 54.90  ? 66  PHE A CD1   1 
ATOM   1244 C CD2   . PHE B 2 65  ? -8.061  13.849 51.075  1.00 54.56  ? 66  PHE A CD2   1 
ATOM   1245 C CE1   . PHE B 2 65  ? -7.554  13.702 53.813  1.00 55.05  ? 66  PHE A CE1   1 
ATOM   1246 C CE2   . PHE B 2 65  ? -6.982  14.558 51.627  1.00 54.40  ? 66  PHE A CE2   1 
ATOM   1247 C CZ    . PHE B 2 65  ? -6.729  14.484 52.998  1.00 54.92  ? 66  PHE A CZ    1 
ATOM   1248 N N     . PRO B 2 66  ? -11.845 9.842  52.448  1.00 50.20  ? 67  PRO A N     1 
ATOM   1249 C CA    . PRO B 2 66  ? -13.160 9.223  52.567  1.00 50.63  ? 67  PRO A CA    1 
ATOM   1250 C C     . PRO B 2 66  ? -14.214 10.000 51.793  1.00 51.38  ? 67  PRO A C     1 
ATOM   1251 O O     . PRO B 2 66  ? -14.130 11.214 51.629  1.00 51.07  ? 67  PRO A O     1 
ATOM   1252 C CB    . PRO B 2 66  ? -13.403 9.241  54.062  1.00 50.75  ? 67  PRO A CB    1 
ATOM   1253 C CG    . PRO B 2 66  ? -12.034 8.972  54.590  1.00 50.81  ? 67  PRO A CG    1 
ATOM   1254 C CD    . PRO B 2 66  ? -11.167 9.890  53.752  1.00 50.44  ? 67  PRO A CD    1 
ATOM   1255 N N     . GLU B 2 67  ? -15.217 9.273  51.334  1.00 52.23  ? 68  GLU A N     1 
ATOM   1256 C CA    . GLU B 2 67  ? -16.304 9.822  50.549  1.00 52.93  ? 68  GLU A CA    1 
ATOM   1257 C C     . GLU B 2 67  ? -17.120 10.907 51.263  1.00 52.86  ? 68  GLU A C     1 
ATOM   1258 O O     . GLU B 2 67  ? -17.627 11.827 50.622  1.00 53.00  ? 68  GLU A O     1 
ATOM   1259 C CB    . GLU B 2 67  ? -17.210 8.661  50.131  1.00 54.40  ? 68  GLU A CB    1 
ATOM   1260 C CG    . GLU B 2 67  ? -17.812 8.765  48.750  1.00 56.62  ? 68  GLU A CG    1 
ATOM   1261 C CD    . GLU B 2 67  ? -18.620 7.531  48.393  1.00 58.47  ? 68  GLU A CD    1 
ATOM   1262 O OE1   . GLU B 2 67  ? -18.059 6.408  48.495  1.00 58.00  ? 68  GLU A OE1   1 
ATOM   1263 O OE2   . GLU B 2 67  ? -19.808 7.686  48.014  1.00 59.02  ? 68  GLU A OE2   1 
ATOM   1264 N N     . GLU B 2 68  ? -17.232 10.813 52.587  1.00 53.55  ? 69  GLU A N     1 
ATOM   1265 C CA    . GLU B 2 68  ? -18.036 11.773 53.349  1.00 53.84  ? 69  GLU A CA    1 
ATOM   1266 C C     . GLU B 2 68  ? -17.357 13.076 53.708  1.00 53.80  ? 69  GLU A C     1 
ATOM   1267 O O     . GLU B 2 68  ? -18.022 14.042 54.086  1.00 54.15  ? 69  GLU A O     1 
ATOM   1268 C CB    . GLU B 2 68  ? -18.565 11.143 54.638  1.00 53.97  ? 69  GLU A CB    1 
ATOM   1269 C CG    . GLU B 2 68  ? -19.431 9.935  54.402  1.00 54.86  ? 69  GLU A CG    1 
ATOM   1270 C CD    . GLU B 2 68  ? -18.634 8.779  53.865  1.00 54.16  ? 69  GLU A CD    1 
ATOM   1271 O OE1   . GLU B 2 68  ? -19.240 7.919  53.191  1.00 55.22  ? 69  GLU A OE1   1 
ATOM   1272 O OE2   . GLU B 2 68  ? -17.408 8.744  54.128  1.00 52.41  ? 69  GLU A OE2   1 
ATOM   1273 N N     . PHE B 2 69  ? -16.038 13.111 53.611  1.00 53.41  ? 70  PHE A N     1 
ATOM   1274 C CA    . PHE B 2 69  ? -15.336 14.332 53.939  1.00 53.12  ? 70  PHE A CA    1 
ATOM   1275 C C     . PHE B 2 69  ? -15.860 15.532 53.153  1.00 53.98  ? 70  PHE A C     1 
ATOM   1276 O O     . PHE B 2 69  ? -16.222 15.428 51.973  1.00 52.90  ? 70  PHE A O     1 
ATOM   1277 C CB    . PHE B 2 69  ? -13.837 14.155 53.700  1.00 51.42  ? 70  PHE A CB    1 
ATOM   1278 C CG    . PHE B 2 69  ? -13.109 13.585 54.873  1.00 51.05  ? 70  PHE A CG    1 
ATOM   1279 C CD1   . PHE B 2 69  ? -13.676 12.561 55.625  1.00 50.90  ? 70  PHE A CD1   1 
ATOM   1280 C CD2   . PHE B 2 69  ? -11.862 14.073 55.239  1.00 50.30  ? 70  PHE A CD2   1 
ATOM   1281 C CE1   . PHE B 2 69  ? -13.008 12.032 56.731  1.00 49.35  ? 70  PHE A CE1   1 
ATOM   1282 C CE2   . PHE B 2 69  ? -11.187 13.552 56.341  1.00 49.64  ? 70  PHE A CE2   1 
ATOM   1283 C CZ    . PHE B 2 69  ? -11.761 12.532 57.086  1.00 48.83  ? 70  PHE A CZ    1 
ATOM   1284 N N     . SER B 2 70  ? -15.926 16.666 53.847  1.00 55.38  ? 71  SER A N     1 
ATOM   1285 C CA    . SER B 2 70  ? -16.356 17.927 53.259  1.00 56.53  ? 71  SER A CA    1 
ATOM   1286 C C     . SER B 2 70  ? -15.137 18.404 52.472  1.00 58.33  ? 71  SER A C     1 
ATOM   1287 O O     . SER B 2 70  ? -14.000 18.291 52.962  1.00 58.48  ? 71  SER A O     1 
ATOM   1288 C CB    . SER B 2 70  ? -16.685 18.940 54.361  1.00 55.67  ? 71  SER A CB    1 
ATOM   1289 O OG    . SER B 2 70  ? -15.504 19.348 55.039  1.00 54.39  ? 71  SER A OG    1 
ATOM   1290 N N     . LYS B 2 71  ? -15.365 18.932 51.268  1.00 59.17  ? 72  LYS A N     1 
ATOM   1291 C CA    . LYS B 2 71  ? -14.266 19.398 50.426  1.00 60.18  ? 72  LYS A CA    1 
ATOM   1292 C C     . LYS B 2 71  ? -13.201 20.176 51.233  1.00 60.12  ? 72  LYS A C     1 
ATOM   1293 O O     . LYS B 2 71  ? -12.000 19.883 51.147  1.00 60.42  ? 72  LYS A O     1 
ATOM   1294 C CB    . LYS B 2 71  ? -14.812 20.260 49.276  1.00 61.55  ? 72  LYS A CB    1 
ATOM   1295 C CG    . LYS B 2 71  ? -14.970 21.742 49.592  1.00 63.39  ? 72  LYS A CG    1 
ATOM   1296 C CD    . LYS B 2 71  ? -15.157 22.566 48.315  1.00 64.80  ? 72  LYS A CD    1 
ATOM   1297 C CE    . LYS B 2 71  ? -14.770 24.042 48.509  1.00 65.39  ? 72  LYS A CE    1 
ATOM   1298 N NZ    . LYS B 2 71  ? -15.650 24.779 49.480  1.00 66.70  ? 72  LYS A NZ    1 
ATOM   1299 N N     . GLU B 2 72  ? -13.664 21.150 52.020  1.00 59.24  ? 73  GLU A N     1 
ATOM   1300 C CA    . GLU B 2 72  ? -12.829 21.998 52.870  1.00 57.73  ? 73  GLU A CA    1 
ATOM   1301 C C     . GLU B 2 72  ? -11.864 21.170 53.710  1.00 55.98  ? 73  GLU A C     1 
ATOM   1302 O O     . GLU B 2 72  ? -10.697 21.533 53.857  1.00 54.84  ? 73  GLU A O     1 
ATOM   1303 C CB    . GLU B 2 72  ? -13.720 22.831 53.786  1.00 59.89  ? 73  GLU A CB    1 
ATOM   1304 C CG    . GLU B 2 72  ? -14.924 23.442 53.068  1.00 63.71  ? 73  GLU A CG    1 
ATOM   1305 C CD    . GLU B 2 72  ? -16.083 22.449 52.844  1.00 66.04  ? 73  GLU A CD    1 
ATOM   1306 O OE1   . GLU B 2 72  ? -15.836 21.259 52.545  1.00 67.33  ? 73  GLU A OE1   1 
ATOM   1307 O OE2   . GLU B 2 72  ? -17.259 22.864 52.949  1.00 67.11  ? 73  GLU A OE2   1 
ATOM   1308 N N     . GLU B 2 73  ? -12.357 20.066 54.268  1.00 53.96  ? 74  GLU A N     1 
ATOM   1309 C CA    . GLU B 2 73  ? -11.513 19.189 55.066  1.00 52.86  ? 74  GLU A CA    1 
ATOM   1310 C C     . GLU B 2 73  ? -10.377 18.667 54.187  1.00 52.26  ? 74  GLU A C     1 
ATOM   1311 O O     . GLU B 2 73  ? -9.233  18.570 54.631  1.00 51.20  ? 74  GLU A O     1 
ATOM   1312 C CB    . GLU B 2 73  ? -12.327 18.019 55.621  1.00 53.15  ? 74  GLU A CB    1 
ATOM   1313 C CG    . GLU B 2 73  ? -12.388 17.977 57.144  1.00 52.96  ? 74  GLU A CG    1 
ATOM   1314 C CD    . GLU B 2 73  ? -11.013 17.869 57.796  1.00 52.94  ? 74  GLU A CD    1 
ATOM   1315 O OE1   . GLU B 2 73  ? -10.289 16.867 57.560  1.00 51.14  ? 74  GLU A OE1   1 
ATOM   1316 O OE2   . GLU B 2 73  ? -10.658 18.796 58.553  1.00 53.17  ? 74  GLU A OE2   1 
ATOM   1317 N N     . LEU B 2 74  ? -10.695 18.346 52.934  1.00 52.46  ? 75  LEU A N     1 
ATOM   1318 C CA    . LEU B 2 74  ? -9.694  17.852 51.988  1.00 52.57  ? 75  LEU A CA    1 
ATOM   1319 C C     . LEU B 2 74  ? -8.598  18.880 51.684  1.00 53.24  ? 75  LEU A C     1 
ATOM   1320 O O     . LEU B 2 74  ? -7.438  18.513 51.487  1.00 52.56  ? 75  LEU A O     1 
ATOM   1321 C CB    . LEU B 2 74  ? -10.354 17.434 50.670  1.00 51.81  ? 75  LEU A CB    1 
ATOM   1322 C CG    . LEU B 2 74  ? -10.976 16.043 50.559  1.00 51.10  ? 75  LEU A CG    1 
ATOM   1323 C CD1   . LEU B 2 74  ? -12.202 15.969 51.438  1.00 51.11  ? 75  LEU A CD1   1 
ATOM   1324 C CD2   . LEU B 2 74  ? -11.357 15.768 49.109  1.00 52.02  ? 75  LEU A CD2   1 
ATOM   1325 N N     . ARG B 2 75  ? -8.962  20.160 51.629  1.00 54.31  ? 76  ARG A N     1 
ATOM   1326 C CA    . ARG B 2 75  ? -7.979  21.197 51.341  1.00 55.31  ? 76  ARG A CA    1 
ATOM   1327 C C     . ARG B 2 75  ? -7.125  21.451 52.577  1.00 55.12  ? 76  ARG A C     1 
ATOM   1328 O O     . ARG B 2 75  ? -5.901  21.574 52.488  1.00 55.05  ? 76  ARG A O     1 
ATOM   1329 C CB    . ARG B 2 75  ? -8.664  22.496 50.902  1.00 57.03  ? 76  ARG A CB    1 
ATOM   1330 C CG    . ARG B 2 75  ? -9.471  23.187 51.984  1.00 60.89  ? 76  ARG A CG    1 
ATOM   1331 C CD    . ARG B 2 75  ? -9.781  24.638 51.606  1.00 63.11  ? 76  ARG A CD    1 
ATOM   1332 N NE    . ARG B 2 75  ? -8.568  25.362 51.232  1.00 65.57  ? 76  ARG A NE    1 
ATOM   1333 C CZ    . ARG B 2 75  ? -7.572  25.661 52.066  1.00 66.67  ? 76  ARG A CZ    1 
ATOM   1334 N NH1   . ARG B 2 75  ? -7.630  25.308 53.351  1.00 66.11  ? 76  ARG A NH1   1 
ATOM   1335 N NH2   . ARG B 2 75  ? -6.498  26.296 51.603  1.00 67.57  ? 76  ARG A NH2   1 
ATOM   1336 N N     . GLU B 2 76  ? -7.776  21.507 53.734  1.00 54.92  ? 77  GLU A N     1 
ATOM   1337 C CA    . GLU B 2 76  ? -7.078  21.754 54.985  1.00 54.54  ? 77  GLU A CA    1 
ATOM   1338 C C     . GLU B 2 76  ? -6.129  20.621 55.381  1.00 52.88  ? 77  GLU A C     1 
ATOM   1339 O O     . GLU B 2 76  ? -4.979  20.875 55.735  1.00 52.05  ? 77  GLU A O     1 
ATOM   1340 C CB    . GLU B 2 76  ? -8.095  22.047 56.084  1.00 56.12  ? 77  GLU A CB    1 
ATOM   1341 C CG    . GLU B 2 76  ? -8.855  23.336 55.811  1.00 58.68  ? 77  GLU A CG    1 
ATOM   1342 C CD    . GLU B 2 76  ? -10.132 23.476 56.628  1.00 60.41  ? 77  GLU A CD    1 
ATOM   1343 O OE1   . GLU B 2 76  ? -10.856 24.480 56.423  1.00 61.47  ? 77  GLU A OE1   1 
ATOM   1344 O OE2   . GLU B 2 76  ? -10.419 22.590 57.466  1.00 60.77  ? 77  GLU A OE2   1 
ATOM   1345 N N     . ARG B 2 77  ? -6.580  19.375 55.333  1.00 51.88  ? 78  ARG A N     1 
ATOM   1346 C CA    . ARG B 2 77  ? -5.669  18.289 55.669  1.00 52.51  ? 78  ARG A CA    1 
ATOM   1347 C C     . ARG B 2 77  ? -4.705  18.113 54.504  1.00 52.13  ? 78  ARG A C     1 
ATOM   1348 O O     . ARG B 2 77  ? -3.557  17.689 54.683  1.00 52.32  ? 78  ARG A O     1 
ATOM   1349 C CB    . ARG B 2 77  ? -6.420  16.981 55.920  1.00 53.99  ? 78  ARG A CB    1 
ATOM   1350 C CG    . ARG B 2 77  ? -7.257  16.945 57.204  1.00 56.54  ? 78  ARG A CG    1 
ATOM   1351 C CD    . ARG B 2 77  ? -6.513  17.447 58.463  1.00 59.01  ? 78  ARG A CD    1 
ATOM   1352 N NE    . ARG B 2 77  ? -5.050  17.265 58.459  1.00 62.05  ? 78  ARG A NE    1 
ATOM   1353 C CZ    . ARG B 2 77  ? -4.400  16.110 58.276  1.00 62.84  ? 78  ARG A CZ    1 
ATOM   1354 N NH1   . ARG B 2 77  ? -5.069  14.980 58.071  1.00 63.28  ? 78  ARG A NH1   1 
ATOM   1355 N NH2   . ARG B 2 77  ? -3.067  16.084 58.303  1.00 62.28  ? 78  ARG A NH2   1 
ATOM   1356 N N     . GLY B 2 78  ? -5.180  18.450 53.308  1.00 51.38  ? 79  GLY A N     1 
ATOM   1357 C CA    . GLY B 2 78  ? -4.352  18.346 52.123  1.00 50.91  ? 79  GLY A CA    1 
ATOM   1358 C C     . GLY B 2 78  ? -3.216  19.341 52.217  1.00 51.37  ? 79  GLY A C     1 
ATOM   1359 O O     . GLY B 2 78  ? -2.070  19.030 51.880  1.00 50.95  ? 79  GLY A O     1 
ATOM   1360 N N     . LEU B 2 79  ? -3.530  20.549 52.673  1.00 51.78  ? 80  LEU A N     1 
ATOM   1361 C CA    . LEU B 2 79  ? -2.504  21.573 52.825  1.00 52.77  ? 80  LEU A CA    1 
ATOM   1362 C C     . LEU B 2 79  ? -1.555  21.174 53.940  1.00 52.53  ? 80  LEU A C     1 
ATOM   1363 O O     . LEU B 2 79  ? -0.338  21.283 53.807  1.00 52.44  ? 80  LEU A O     1 
ATOM   1364 C CB    . LEU B 2 79  ? -3.131  22.929 53.161  1.00 54.55  ? 80  LEU A CB    1 
ATOM   1365 C CG    . LEU B 2 79  ? -2.178  23.996 53.734  1.00 56.37  ? 80  LEU A CG    1 
ATOM   1366 C CD1   . LEU B 2 79  ? -0.974  24.216 52.814  1.00 57.12  ? 80  LEU A CD1   1 
ATOM   1367 C CD2   . LEU B 2 79  ? -2.950  25.294 53.917  1.00 58.38  ? 80  LEU A CD2   1 
ATOM   1368 N N     . GLU B 2 80  ? -2.128  20.712 55.043  1.00 52.32  ? 81  GLU A N     1 
ATOM   1369 C CA    . GLU B 2 80  ? -1.344  20.302 56.187  1.00 51.74  ? 81  GLU A CA    1 
ATOM   1370 C C     . GLU B 2 80  ? -0.330  19.272 55.767  1.00 50.54  ? 81  GLU A C     1 
ATOM   1371 O O     . GLU B 2 80  ? 0.874   19.459 55.957  1.00 48.96  ? 81  GLU A O     1 
ATOM   1372 C CB    . GLU B 2 80  ? -2.250  19.703 57.251  1.00 54.94  ? 81  GLU A CB    1 
ATOM   1373 C CG    . GLU B 2 80  ? -2.150  20.377 58.601  1.00 59.13  ? 81  GLU A CG    1 
ATOM   1374 C CD    . GLU B 2 80  ? -2.398  21.876 58.510  1.00 62.13  ? 81  GLU A CD    1 
ATOM   1375 O OE1   . GLU B 2 80  ? -1.439  22.646 58.248  1.00 63.23  ? 81  GLU A OE1   1 
ATOM   1376 O OE2   . GLU B 2 80  ? -3.568  22.279 58.686  1.00 64.50  ? 81  GLU A OE2   1 
ATOM   1377 N N     . ILE B 2 81  ? -0.825  18.183 55.183  1.00 49.73  ? 82  ILE A N     1 
ATOM   1378 C CA    . ILE B 2 81  ? 0.053   17.098 54.757  1.00 49.06  ? 82  ILE A CA    1 
ATOM   1379 C C     . ILE B 2 81  ? 1.203   17.576 53.888  1.00 49.26  ? 82  ILE A C     1 
ATOM   1380 O O     . ILE B 2 81  ? 2.359   17.355 54.235  1.00 49.12  ? 82  ILE A O     1 
ATOM   1381 C CB    . ILE B 2 81  ? -0.721  15.988 54.013  1.00 47.85  ? 82  ILE A CB    1 
ATOM   1382 C CG1   . ILE B 2 81  ? -1.762  15.360 54.956  1.00 46.67  ? 82  ILE A CG1   1 
ATOM   1383 C CG2   . ILE B 2 81  ? 0.266   14.945 53.496  1.00 46.04  ? 82  ILE A CG2   1 
ATOM   1384 C CD1   . ILE B 2 81  ? -2.613  14.260 54.334  1.00 44.94  ? 82  ILE A CD1   1 
ATOM   1385 N N     . GLY B 2 82  ? 0.884   18.242 52.781  1.00 50.22  ? 83  GLY A N     1 
ATOM   1386 C CA    . GLY B 2 82  ? 1.919   18.734 51.887  1.00 51.94  ? 83  GLY A CA    1 
ATOM   1387 C C     . GLY B 2 82  ? 2.966   19.554 52.616  1.00 53.46  ? 83  GLY A C     1 
ATOM   1388 O O     . GLY B 2 82  ? 4.172   19.432 52.371  1.00 53.29  ? 83  GLY A O     1 
ATOM   1389 N N     . LYS B 2 83  ? 2.485   20.398 53.519  1.00 54.51  ? 84  LYS A N     1 
ATOM   1390 C CA    . LYS B 2 83  ? 3.331   21.265 54.318  1.00 55.20  ? 84  LYS A CA    1 
ATOM   1391 C C     . LYS B 2 83  ? 4.437   20.461 55.016  1.00 54.77  ? 84  LYS A C     1 
ATOM   1392 O O     . LYS B 2 83  ? 5.627   20.623 54.722  1.00 55.12  ? 84  LYS A O     1 
ATOM   1393 C CB    . LYS B 2 83  ? 2.455   21.972 55.350  1.00 56.87  ? 84  LYS A CB    1 
ATOM   1394 C CG    . LYS B 2 83  ? 3.186   22.878 56.310  1.00 59.29  ? 84  LYS A CG    1 
ATOM   1395 C CD    . LYS B 2 83  ? 2.216   23.518 57.295  1.00 61.15  ? 84  LYS A CD    1 
ATOM   1396 C CE    . LYS B 2 83  ? 1.156   24.339 56.566  1.00 62.18  ? 84  LYS A CE    1 
ATOM   1397 N NZ    . LYS B 2 83  ? 1.762   25.351 55.654  1.00 63.06  ? 84  LYS A NZ    1 
ATOM   1398 N N     . ALA B 2 84  ? 4.033   19.580 55.923  1.00 54.15  ? 85  ALA A N     1 
ATOM   1399 C CA    . ALA B 2 84  ? 4.963   18.755 56.682  1.00 53.71  ? 85  ALA A CA    1 
ATOM   1400 C C     . ALA B 2 84  ? 5.773   17.781 55.855  1.00 53.54  ? 85  ALA A C     1 
ATOM   1401 O O     . ALA B 2 84  ? 6.785   17.261 56.320  1.00 53.50  ? 85  ALA A O     1 
ATOM   1402 C CB    . ALA B 2 84  ? 4.208   17.978 57.737  1.00 53.63  ? 85  ALA A CB    1 
ATOM   1403 N N     . VAL B 2 85  ? 5.345   17.535 54.626  1.00 53.29  ? 86  VAL A N     1 
ATOM   1404 C CA    . VAL B 2 85  ? 6.034   16.561 53.798  1.00 53.23  ? 86  VAL A CA    1 
ATOM   1405 C C     . VAL B 2 85  ? 6.997   17.088 52.724  1.00 53.04  ? 86  VAL A C     1 
ATOM   1406 O O     . VAL B 2 85  ? 7.787   16.322 52.162  1.00 52.03  ? 86  VAL A O     1 
ATOM   1407 C CB    . VAL B 2 85  ? 4.992   15.623 53.153  1.00 52.73  ? 86  VAL A CB    1 
ATOM   1408 C CG1   . VAL B 2 85  ? 4.611   16.117 51.779  1.00 52.75  ? 86  VAL A CG1   1 
ATOM   1409 C CG2   . VAL B 2 85  ? 5.522   14.227 53.119  1.00 53.64  ? 86  VAL A CG2   1 
ATOM   1410 N N     . LEU B 2 86  ? 6.950   18.390 52.463  1.00 53.42  ? 87  LEU A N     1 
ATOM   1411 C CA    . LEU B 2 86  ? 7.798   18.983 51.439  1.00 54.77  ? 87  LEU A CA    1 
ATOM   1412 C C     . LEU B 2 86  ? 8.928   19.842 51.962  1.00 55.66  ? 87  LEU A C     1 
ATOM   1413 O O     . LEU B 2 86  ? 8.819   20.453 53.028  1.00 57.10  ? 87  LEU A O     1 
ATOM   1414 C CB    . LEU B 2 86  ? 6.960   19.835 50.491  1.00 54.81  ? 87  LEU A CB    1 
ATOM   1415 C CG    . LEU B 2 86  ? 5.986   19.094 49.586  1.00 55.61  ? 87  LEU A CG    1 
ATOM   1416 C CD1   . LEU B 2 86  ? 5.175   20.095 48.773  1.00 56.57  ? 87  LEU A CD1   1 
ATOM   1417 C CD2   . LEU B 2 86  ? 6.765   18.169 48.674  1.00 55.56  ? 87  LEU A CD2   1 
ATOM   1418 N N     . ASP B 2 87  ? 10.007  19.890 51.185  1.00 55.68  ? 88  ASP A N     1 
ATOM   1419 C CA    . ASP B 2 87  ? 11.178  20.692 51.511  1.00 55.82  ? 88  ASP A CA    1 
ATOM   1420 C C     . ASP B 2 87  ? 10.751  22.157 51.386  1.00 56.54  ? 88  ASP A C     1 
ATOM   1421 O O     . ASP B 2 87  ? 11.077  22.991 52.235  1.00 57.14  ? 88  ASP A O     1 
ATOM   1422 C CB    . ASP B 2 87  ? 12.309  20.400 50.511  1.00 55.99  ? 88  ASP A CB    1 
ATOM   1423 C CG    . ASP B 2 87  ? 12.900  19.010 50.671  1.00 55.94  ? 88  ASP A CG    1 
ATOM   1424 O OD1   . ASP B 2 87  ? 12.158  18.065 51.000  1.00 56.25  ? 88  ASP A OD1   1 
ATOM   1425 O OD2   . ASP B 2 87  ? 14.114  18.852 50.446  1.00 56.74  ? 88  ASP A OD2   1 
ATOM   1426 N N     . SER B 2 88  ? 10.019  22.450 50.309  1.00 56.58  ? 89  SER A N     1 
ATOM   1427 C CA    . SER B 2 88  ? 9.508   23.789 50.011  1.00 55.55  ? 89  SER A CA    1 
ATOM   1428 C C     . SER B 2 88  ? 8.078   23.601 49.514  1.00 55.82  ? 89  SER A C     1 
ATOM   1429 O O     . SER B 2 88  ? 7.800   22.685 48.735  1.00 56.21  ? 89  SER A O     1 
ATOM   1430 C CB    . SER B 2 88  ? 10.320  24.445 48.891  1.00 54.75  ? 89  SER A CB    1 
ATOM   1431 O OG    . SER B 2 88  ? 11.701  24.132 48.983  1.00 55.93  ? 89  SER A OG    1 
ATOM   1432 N N     . TYR B 2 89  ? 7.165   24.454 49.952  1.00 55.71  ? 90  TYR A N     1 
ATOM   1433 C CA    . TYR B 2 89  ? 5.802   24.315 49.490  1.00 56.74  ? 90  TYR A CA    1 
ATOM   1434 C C     . TYR B 2 89  ? 5.218   25.637 49.038  1.00 57.63  ? 90  TYR A C     1 
ATOM   1435 O O     . TYR B 2 89  ? 5.537   26.694 49.585  1.00 58.56  ? 90  TYR A O     1 
ATOM   1436 C CB    . TYR B 2 89  ? 4.918   23.705 50.576  1.00 57.35  ? 90  TYR A CB    1 
ATOM   1437 C CG    . TYR B 2 89  ? 4.427   24.684 51.615  1.00 57.96  ? 90  TYR A CG    1 
ATOM   1438 C CD1   . TYR B 2 89  ? 3.078   24.724 51.976  1.00 58.06  ? 90  TYR A CD1   1 
ATOM   1439 C CD2   . TYR B 2 89  ? 5.313   25.543 52.266  1.00 58.25  ? 90  TYR A CD2   1 
ATOM   1440 C CE1   . TYR B 2 89  ? 2.626   25.591 52.959  1.00 58.79  ? 90  TYR A CE1   1 
ATOM   1441 C CE2   . TYR B 2 89  ? 4.873   26.412 53.253  1.00 58.99  ? 90  TYR A CE2   1 
ATOM   1442 C CZ    . TYR B 2 89  ? 3.531   26.432 53.599  1.00 59.13  ? 90  TYR A CZ    1 
ATOM   1443 O OH    . TYR B 2 89  ? 3.114   27.276 54.605  1.00 59.40  ? 90  TYR A OH    1 
ATOM   1444 N N     . GLU B 2 90  ? 4.352   25.556 48.034  1.00 58.01  ? 91  GLU A N     1 
ATOM   1445 C CA    . GLU B 2 90  ? 3.696   26.718 47.459  1.00 57.87  ? 91  GLU A CA    1 
ATOM   1446 C C     . GLU B 2 90  ? 2.336   26.284 46.935  1.00 57.42  ? 91  GLU A C     1 
ATOM   1447 O O     . GLU B 2 90  ? 2.252   25.450 46.037  1.00 58.34  ? 91  GLU A O     1 
ATOM   1448 C CB    . GLU B 2 90  ? 4.543   27.256 46.312  1.00 59.26  ? 91  GLU A CB    1 
ATOM   1449 C CG    . GLU B 2 90  ? 3.850   28.260 45.423  1.00 61.11  ? 91  GLU A CG    1 
ATOM   1450 C CD    . GLU B 2 90  ? 4.558   28.422 44.081  1.00 62.95  ? 91  GLU A CD    1 
ATOM   1451 O OE1   . GLU B 2 90  ? 5.786   28.701 44.072  1.00 63.50  ? 91  GLU A OE1   1 
ATOM   1452 O OE2   . GLU B 2 90  ? 3.877   28.268 43.038  1.00 63.84  ? 91  GLU A OE2   1 
ATOM   1453 N N     . ILE B 2 91  ? 1.275   26.844 47.505  1.00 56.26  ? 92  ILE A N     1 
ATOM   1454 C CA    . ILE B 2 91  ? -0.083  26.519 47.093  1.00 55.41  ? 92  ILE A CA    1 
ATOM   1455 C C     . ILE B 2 91  ? -0.364  26.951 45.642  1.00 56.31  ? 92  ILE A C     1 
ATOM   1456 O O     . ILE B 2 91  ? 0.053   28.028 45.205  1.00 56.24  ? 92  ILE A O     1 
ATOM   1457 C CB    . ILE B 2 91  ? -1.093  27.183 48.054  1.00 54.20  ? 92  ILE A CB    1 
ATOM   1458 C CG1   . ILE B 2 91  ? -0.905  26.597 49.454  1.00 53.70  ? 92  ILE A CG1   1 
ATOM   1459 C CG2   . ILE B 2 91  ? -2.526  27.001 47.546  1.00 52.66  ? 92  ILE A CG2   1 
ATOM   1460 C CD1   . ILE B 2 91  ? -1.772  27.232 50.526  1.00 54.13  ? 92  ILE A CD1   1 
ATOM   1461 N N     . ARG B 2 92  ? -1.061  26.087 44.906  1.00 56.43  ? 93  ARG A N     1 
ATOM   1462 C CA    . ARG B 2 92  ? -1.419  26.323 43.508  1.00 56.76  ? 93  ARG A CA    1 
ATOM   1463 C C     . ARG B 2 92  ? -2.930  26.137 43.383  1.00 57.07  ? 93  ARG A C     1 
ATOM   1464 O O     . ARG B 2 92  ? -3.575  25.680 44.321  1.00 56.92  ? 93  ARG A O     1 
ATOM   1465 C CB    . ARG B 2 92  ? -0.713  25.314 42.607  1.00 57.25  ? 93  ARG A CB    1 
ATOM   1466 C CG    . ARG B 2 92  ? -0.057  25.917 41.391  1.00 59.06  ? 93  ARG A CG    1 
ATOM   1467 C CD    . ARG B 2 92  ? 1.342   26.424 41.721  1.00 60.58  ? 93  ARG A CD    1 
ATOM   1468 N NE    . ARG B 2 92  ? 2.383   25.406 41.560  1.00 62.23  ? 93  ARG A NE    1 
ATOM   1469 C CZ    . ARG B 2 92  ? 2.742   24.871 40.391  1.00 63.30  ? 93  ARG A CZ    1 
ATOM   1470 N NH1   . ARG B 2 92  ? 2.146   25.243 39.263  1.00 63.88  ? 93  ARG A NH1   1 
ATOM   1471 N NH2   . ARG B 2 92  ? 3.718   23.976 40.340  1.00 63.42  ? 93  ARG A NH2   1 
ATOM   1472 N N     . TYR B 2 93  ? -3.511  26.478 42.238  1.00 57.29  ? 94  TYR A N     1 
ATOM   1473 C CA    . TYR B 2 93  ? -4.955  26.322 42.112  1.00 57.52  ? 94  TYR A CA    1 
ATOM   1474 C C     . TYR B 2 93  ? -5.475  25.875 40.748  1.00 57.59  ? 94  TYR A C     1 
ATOM   1475 O O     . TYR B 2 93  ? -5.232  26.521 39.736  1.00 57.17  ? 94  TYR A O     1 
ATOM   1476 C CB    . TYR B 2 93  ? -5.670  27.628 42.479  1.00 58.33  ? 94  TYR A CB    1 
ATOM   1477 C CG    . TYR B 2 93  ? -5.267  28.254 43.795  1.00 58.33  ? 94  TYR A CG    1 
ATOM   1478 C CD1   . TYR B 2 93  ? -4.006  28.826 43.963  1.00 58.28  ? 94  TYR A CD1   1 
ATOM   1479 C CD2   . TYR B 2 93  ? -6.160  28.294 44.870  1.00 59.36  ? 94  TYR A CD2   1 
ATOM   1480 C CE1   . TYR B 2 93  ? -3.640  29.422 45.169  1.00 59.70  ? 94  TYR A CE1   1 
ATOM   1481 C CE2   . TYR B 2 93  ? -5.806  28.891 46.086  1.00 60.09  ? 94  TYR A CE2   1 
ATOM   1482 C CZ    . TYR B 2 93  ? -4.544  29.453 46.225  1.00 60.37  ? 94  TYR A CZ    1 
ATOM   1483 O OH    . TYR B 2 93  ? -4.195  30.054 47.411  1.00 60.65  ? 94  TYR A OH    1 
ATOM   1484 N N     . ALA B 2 94  ? -6.203  24.762 40.753  1.00 57.76  ? 95  ALA A N     1 
ATOM   1485 C CA    . ALA B 2 94  ? -6.842  24.200 39.566  1.00 56.87  ? 95  ALA A CA    1 
ATOM   1486 C C     . ALA B 2 94  ? -8.324  24.251 39.936  1.00 57.32  ? 95  ALA A C     1 
ATOM   1487 O O     . ALA B 2 94  ? -8.803  25.305 40.370  1.00 57.71  ? 95  ALA A O     1 
ATOM   1488 C CB    . ALA B 2 94  ? -6.405  22.775 39.350  1.00 56.81  ? 95  ALA A CB    1 
ATOM   1489 N N     . GLU B 2 95  ? -9.048  23.137 39.804  1.00 57.61  ? 96  GLU A N     1 
ATOM   1490 C CA    . GLU B 2 95  ? -10.476 23.133 40.165  1.00 58.88  ? 96  GLU A CA    1 
ATOM   1491 C C     . GLU B 2 95  ? -10.619 23.365 41.669  1.00 58.49  ? 96  GLU A C     1 
ATOM   1492 O O     . GLU B 2 95  ? -11.605 23.950 42.146  1.00 58.57  ? 96  GLU A O     1 
ATOM   1493 C CB    . GLU B 2 95  ? -11.150 21.807 39.769  1.00 60.37  ? 96  GLU A CB    1 
ATOM   1494 C CG    . GLU B 2 95  ? -12.620 21.684 40.219  1.00 61.78  ? 96  GLU A CG    1 
ATOM   1495 C CD    . GLU B 2 95  ? -13.414 20.651 39.407  1.00 63.02  ? 96  GLU A CD    1 
ATOM   1496 O OE1   . GLU B 2 95  ? -12.786 19.690 38.894  1.00 62.24  ? 96  GLU A OE1   1 
ATOM   1497 O OE2   . GLU B 2 95  ? -14.662 20.802 39.295  1.00 62.92  ? 96  GLU A OE2   1 
ATOM   1498 N N     . HIS B 2 96  ? -9.610  22.902 42.401  1.00 57.56  ? 97  HIS A N     1 
ATOM   1499 C CA    . HIS B 2 96  ? -9.545  23.054 43.846  1.00 55.82  ? 97  HIS A CA    1 
ATOM   1500 C C     . HIS B 2 96  ? -8.097  23.350 44.157  1.00 53.17  ? 97  HIS A C     1 
ATOM   1501 O O     . HIS B 2 96  ? -7.205  22.998 43.388  1.00 53.65  ? 97  HIS A O     1 
ATOM   1502 C CB    . HIS B 2 96  ? -9.990  21.769 44.515  1.00 57.91  ? 97  HIS A CB    1 
ATOM   1503 C CG    . HIS B 2 96  ? -11.396 21.401 44.179  1.00 60.92  ? 97  HIS A CG    1 
ATOM   1504 N ND1   . HIS B 2 96  ? -12.479 22.081 44.694  1.00 62.09  ? 97  HIS A ND1   1 
ATOM   1505 C CD2   . HIS B 2 96  ? -11.898 20.480 43.322  1.00 62.15  ? 97  HIS A CD2   1 
ATOM   1506 C CE1   . HIS B 2 96  ? -13.591 21.594 44.168  1.00 62.86  ? 97  HIS A CE1   1 
ATOM   1507 N NE2   . HIS B 2 96  ? -13.266 20.622 43.332  1.00 62.94  ? 97  HIS A NE2   1 
ATOM   1508 N N     . PRO B 2 97  ? -7.832  24.017 45.277  1.00 50.01  ? 98  PRO A N     1 
ATOM   1509 C CA    . PRO B 2 97  ? -6.426  24.299 45.559  1.00 48.41  ? 98  PRO A CA    1 
ATOM   1510 C C     . PRO B 2 97  ? -5.630  23.069 45.994  1.00 47.04  ? 98  PRO A C     1 
ATOM   1511 O O     . PRO B 2 97  ? -6.172  22.165 46.630  1.00 47.42  ? 98  PRO A O     1 
ATOM   1512 C CB    . PRO B 2 97  ? -6.507  25.381 46.632  1.00 47.65  ? 98  PRO A CB    1 
ATOM   1513 C CG    . PRO B 2 97  ? -7.782  25.064 47.334  1.00 47.94  ? 98  PRO A CG    1 
ATOM   1514 C CD    . PRO B 2 97  ? -8.724  24.704 46.223  1.00 48.54  ? 98  PRO A CD    1 
ATOM   1515 N N     . TYR B 2 98  ? -4.351  23.038 45.621  1.00 45.96  ? 99  TYR A N     1 
ATOM   1516 C CA    . TYR B 2 98  ? -3.445  21.943 45.966  1.00 45.70  ? 99  TYR A CA    1 
ATOM   1517 C C     . TYR B 2 98  ? -2.049  22.499 46.299  1.00 46.71  ? 99  TYR A C     1 
ATOM   1518 O O     . TYR B 2 98  ? -1.803  23.702 46.169  1.00 47.21  ? 99  TYR A O     1 
ATOM   1519 C CB    . TYR B 2 98  ? -3.357  20.935 44.808  1.00 44.21  ? 99  TYR A CB    1 
ATOM   1520 C CG    . TYR B 2 98  ? -2.757  21.476 43.514  1.00 43.14  ? 99  TYR A CG    1 
ATOM   1521 C CD1   . TYR B 2 98  ? -1.388  21.406 43.278  1.00 42.47  ? 99  TYR A CD1   1 
ATOM   1522 C CD2   . TYR B 2 98  ? -3.564  22.074 42.537  1.00 42.73  ? 99  TYR A CD2   1 
ATOM   1523 C CE1   . TYR B 2 98  ? -0.836  21.912 42.112  1.00 42.71  ? 99  TYR A CE1   1 
ATOM   1524 C CE2   . TYR B 2 98  ? -3.020  22.589 41.366  1.00 42.28  ? 99  TYR A CE2   1 
ATOM   1525 C CZ    . TYR B 2 98  ? -1.654  22.505 41.164  1.00 43.13  ? 99  TYR A CZ    1 
ATOM   1526 O OH    . TYR B 2 98  ? -1.087  23.034 40.031  1.00 43.20  ? 99  TYR A OH    1 
ATOM   1527 N N     . VAL B 2 99  ? -1.136  21.630 46.726  1.00 46.36  ? 100 VAL A N     1 
ATOM   1528 C CA    . VAL B 2 99  ? 0.205   22.069 47.078  1.00 45.92  ? 100 VAL A CA    1 
ATOM   1529 C C     . VAL B 2 99  ? 1.238   21.542 46.116  1.00 46.00  ? 100 VAL A C     1 
ATOM   1530 O O     . VAL B 2 99  ? 1.204   20.369 45.756  1.00 47.08  ? 100 VAL A O     1 
ATOM   1531 C CB    . VAL B 2 99  ? 0.603   21.583 48.480  1.00 45.89  ? 100 VAL A CB    1 
ATOM   1532 C CG1   . VAL B 2 99  ? 2.045   21.982 48.781  1.00 44.93  ? 100 VAL A CG1   1 
ATOM   1533 C CG2   . VAL B 2 99  ? -0.363  22.149 49.515  1.00 44.77  ? 100 VAL A CG2   1 
ATOM   1534 N N     . HIS B 2 100 ? 2.163   22.400 45.706  1.00 45.68  ? 101 HIS A N     1 
ATOM   1535 C CA    . HIS B 2 100 ? 3.225   21.986 44.798  1.00 45.49  ? 101 HIS A CA    1 
ATOM   1536 C C     . HIS B 2 100 ? 4.556   22.218 45.492  1.00 45.53  ? 101 HIS A C     1 
ATOM   1537 O O     . HIS B 2 100 ? 4.740   23.253 46.139  1.00 45.61  ? 101 HIS A O     1 
ATOM   1538 C CB    . HIS B 2 100 ? 3.187   22.800 43.507  1.00 45.66  ? 101 HIS A CB    1 
ATOM   1539 C CG    . HIS B 2 100 ? 4.302   22.469 42.570  1.00 46.30  ? 101 HIS A CG    1 
ATOM   1540 N ND1   . HIS B 2 100 ? 4.228   21.433 41.664  1.00 45.99  ? 101 HIS A ND1   1 
ATOM   1541 C CD2   . HIS B 2 100 ? 5.554   22.973 42.465  1.00 46.11  ? 101 HIS A CD2   1 
ATOM   1542 C CE1   . HIS B 2 100 ? 5.387   21.309 41.045  1.00 46.14  ? 101 HIS A CE1   1 
ATOM   1543 N NE2   . HIS B 2 100 ? 6.210   22.231 41.514  1.00 46.73  ? 101 HIS A NE2   1 
ATOM   1544 N N     . GLY B 2 101 ? 5.489   21.279 45.350  1.00 44.70  ? 102 GLY A N     1 
ATOM   1545 C CA    . GLY B 2 101 ? 6.773   21.451 46.010  1.00 44.60  ? 102 GLY A CA    1 
ATOM   1546 C C     . GLY B 2 101 ? 7.992   20.721 45.470  1.00 44.77  ? 102 GLY A C     1 
ATOM   1547 O O     . GLY B 2 101 ? 8.034   20.290 44.315  1.00 45.41  ? 102 GLY A O     1 
ATOM   1548 N N     . VAL B 2 102 ? 8.995   20.585 46.331  1.00 44.23  ? 103 VAL A N     1 
ATOM   1549 C CA    . VAL B 2 102 ? 10.249  19.938 45.963  1.00 43.65  ? 103 VAL A CA    1 
ATOM   1550 C C     . VAL B 2 102 ? 10.726  18.973 47.047  1.00 44.48  ? 103 VAL A C     1 
ATOM   1551 O O     . VAL B 2 102 ? 10.687  19.300 48.242  1.00 44.35  ? 103 VAL A O     1 
ATOM   1552 C CB    . VAL B 2 102 ? 11.363  20.985 45.742  1.00 41.74  ? 103 VAL A CB    1 
ATOM   1553 C CG1   . VAL B 2 102 ? 12.612  20.306 45.213  1.00 40.98  ? 103 VAL A CG1   1 
ATOM   1554 C CG2   . VAL B 2 102 ? 10.880  22.059 44.792  1.00 40.35  ? 103 VAL A CG2   1 
ATOM   1555 N N     . VAL B 2 103 ? 11.177  17.789 46.627  1.00 44.29  ? 104 VAL A N     1 
ATOM   1556 C CA    . VAL B 2 103 ? 11.678  16.778 47.553  1.00 43.88  ? 104 VAL A CA    1 
ATOM   1557 C C     . VAL B 2 103 ? 12.912  16.128 46.931  1.00 43.97  ? 104 VAL A C     1 
ATOM   1558 O O     . VAL B 2 103 ? 12.839  15.561 45.844  1.00 43.45  ? 104 VAL A O     1 
ATOM   1559 C CB    . VAL B 2 103 ? 10.613  15.688 47.848  1.00 43.10  ? 104 VAL A CB    1 
ATOM   1560 C CG1   . VAL B 2 103 ? 11.163  14.691 48.838  1.00 44.24  ? 104 VAL A CG1   1 
ATOM   1561 C CG2   . VAL B 2 103 ? 9.365   16.310 48.414  1.00 41.57  ? 104 VAL A CG2   1 
ATOM   1562 N N     . LYS B 2 104 ? 14.035  16.203 47.640  1.00 44.89  ? 105 LYS A N     1 
ATOM   1563 C CA    . LYS B 2 104 ? 15.303  15.666 47.155  1.00 46.45  ? 105 LYS A CA    1 
ATOM   1564 C C     . LYS B 2 104 ? 15.560  16.123 45.733  1.00 46.48  ? 105 LYS A C     1 
ATOM   1565 O O     . LYS B 2 104 ? 15.999  15.352 44.881  1.00 46.54  ? 105 LYS A O     1 
ATOM   1566 C CB    . LYS B 2 104 ? 15.361  14.134 47.235  1.00 46.93  ? 105 LYS A CB    1 
ATOM   1567 C CG    . LYS B 2 104 ? 15.597  13.614 48.655  1.00 48.51  ? 105 LYS A CG    1 
ATOM   1568 C CD    . LYS B 2 104 ? 16.152  12.183 48.694  1.00 47.70  ? 105 LYS A CD    1 
ATOM   1569 C CE    . LYS B 2 104 ? 17.656  12.145 48.465  1.00 47.11  ? 105 LYS A CE    1 
ATOM   1570 N NZ    . LYS B 2 104 ? 18.208  10.773 48.659  1.00 45.61  ? 105 LYS A NZ    1 
ATOM   1571 N N     . GLY B 2 105 ? 15.255  17.392 45.488  1.00 47.10  ? 106 GLY A N     1 
ATOM   1572 C CA    . GLY B 2 105 ? 15.490  17.984 44.184  1.00 48.07  ? 106 GLY A CA    1 
ATOM   1573 C C     . GLY B 2 105 ? 14.443  17.916 43.083  1.00 48.48  ? 106 GLY A C     1 
ATOM   1574 O O     . GLY B 2 105 ? 14.586  18.626 42.084  1.00 48.12  ? 106 GLY A O     1 
ATOM   1575 N N     . VAL B 2 106 ? 13.399  17.099 43.227  1.00 49.16  ? 107 VAL A N     1 
ATOM   1576 C CA    . VAL B 2 106 ? 12.412  17.014 42.153  1.00 49.14  ? 107 VAL A CA    1 
ATOM   1577 C C     . VAL B 2 106 ? 11.076  17.652 42.458  1.00 48.77  ? 107 VAL A C     1 
ATOM   1578 O O     . VAL B 2 106 ? 10.705  17.863 43.614  1.00 47.80  ? 107 VAL A O     1 
ATOM   1579 C CB    . VAL B 2 106 ? 12.131  15.554 41.716  1.00 49.06  ? 107 VAL A CB    1 
ATOM   1580 C CG1   . VAL B 2 106 ? 13.422  14.815 41.454  1.00 49.70  ? 107 VAL A CG1   1 
ATOM   1581 C CG2   . VAL B 2 106 ? 11.332  14.857 42.768  1.00 50.38  ? 107 VAL A CG2   1 
ATOM   1582 N N     . GLU B 2 107 ? 10.361  17.954 41.383  1.00 49.67  ? 108 GLU A N     1 
ATOM   1583 C CA    . GLU B 2 107 ? 9.049   18.562 41.466  1.00 50.34  ? 108 GLU A CA    1 
ATOM   1584 C C     . GLU B 2 107 ? 8.099   17.519 41.994  1.00 49.21  ? 108 GLU A C     1 
ATOM   1585 O O     . GLU B 2 107 ? 8.233   16.329 41.679  1.00 48.86  ? 108 GLU A O     1 
ATOM   1586 C CB    . GLU B 2 107 ? 8.570   19.017 40.081  1.00 53.05  ? 108 GLU A CB    1 
ATOM   1587 C CG    . GLU B 2 107 ? 9.399   20.111 39.466  1.00 56.68  ? 108 GLU A CG    1 
ATOM   1588 C CD    . GLU B 2 107 ? 9.640   21.235 40.447  1.00 60.59  ? 108 GLU A CD    1 
ATOM   1589 O OE1   . GLU B 2 107 ? 8.649   21.780 40.993  1.00 61.59  ? 108 GLU A OE1   1 
ATOM   1590 O OE2   . GLU B 2 107 ? 10.826  21.565 40.678  1.00 63.56  ? 108 GLU A OE2   1 
ATOM   1591 N N     . VAL B 2 108 ? 7.137   17.971 42.789  1.00 48.20  ? 109 VAL A N     1 
ATOM   1592 C CA    . VAL B 2 108 ? 6.132   17.089 43.364  1.00 46.88  ? 109 VAL A CA    1 
ATOM   1593 C C     . VAL B 2 108 ? 4.831   17.836 43.442  1.00 46.04  ? 109 VAL A C     1 
ATOM   1594 O O     . VAL B 2 108 ? 4.806   19.019 43.772  1.00 46.76  ? 109 VAL A O     1 
ATOM   1595 C CB    . VAL B 2 108 ? 6.505   16.630 44.793  1.00 47.16  ? 109 VAL A CB    1 
ATOM   1596 C CG1   . VAL B 2 108 ? 5.260   16.088 45.513  1.00 46.35  ? 109 VAL A CG1   1 
ATOM   1597 C CG2   . VAL B 2 108 ? 7.598   15.546 44.730  1.00 46.81  ? 109 VAL A CG2   1 
ATOM   1598 N N     . ASP B 2 109 ? 3.750   17.144 43.121  1.00 45.14  ? 110 ASP A N     1 
ATOM   1599 C CA    . ASP B 2 109 ? 2.432   17.733 43.184  1.00 45.37  ? 110 ASP A CA    1 
ATOM   1600 C C     . ASP B 2 109 ? 1.663   16.945 44.220  1.00 45.38  ? 110 ASP A C     1 
ATOM   1601 O O     . ASP B 2 109 ? 1.709   15.720 44.232  1.00 46.34  ? 110 ASP A O     1 
ATOM   1602 C CB    . ASP B 2 109 ? 1.748   17.660 41.820  1.00 46.78  ? 110 ASP A CB    1 
ATOM   1603 C CG    . ASP B 2 109 ? 2.006   18.895 40.982  1.00 47.82  ? 110 ASP A CG    1 
ATOM   1604 O OD1   . ASP B 2 109 ? 1.673   19.995 41.469  1.00 48.67  ? 110 ASP A OD1   1 
ATOM   1605 O OD2   . ASP B 2 109 ? 2.533   18.778 39.853  1.00 48.48  ? 110 ASP A OD2   1 
ATOM   1606 N N     . VAL B 2 110 ? 0.982   17.644 45.113  1.00 44.65  ? 111 VAL A N     1 
ATOM   1607 C CA    . VAL B 2 110 ? 0.220   16.971 46.144  1.00 44.19  ? 111 VAL A CA    1 
ATOM   1608 C C     . VAL B 2 110 ? -1.229  17.351 45.971  1.00 45.30  ? 111 VAL A C     1 
ATOM   1609 O O     . VAL B 2 110 ? -1.645  18.458 46.305  1.00 46.00  ? 111 VAL A O     1 
ATOM   1610 C CB    . VAL B 2 110 ? 0.705   17.368 47.520  1.00 42.44  ? 111 VAL A CB    1 
ATOM   1611 C CG1   . VAL B 2 110 ? -0.120  16.678 48.574  1.00 40.81  ? 111 VAL A CG1   1 
ATOM   1612 C CG2   . VAL B 2 110 ? 2.158   16.994 47.651  1.00 41.18  ? 111 VAL A CG2   1 
ATOM   1613 N N     . VAL B 2 111 ? -1.997  16.411 45.447  1.00 45.69  ? 112 VAL A N     1 
ATOM   1614 C CA    . VAL B 2 111 ? -3.390  16.660 45.181  1.00 46.27  ? 112 VAL A CA    1 
ATOM   1615 C C     . VAL B 2 111 ? -4.349  15.860 46.030  1.00 47.09  ? 112 VAL A C     1 
ATOM   1616 O O     . VAL B 2 111 ? -4.268  14.640 46.111  1.00 47.74  ? 112 VAL A O     1 
ATOM   1617 C CB    . VAL B 2 111 ? -3.701  16.366 43.720  1.00 45.73  ? 112 VAL A CB    1 
ATOM   1618 C CG1   . VAL B 2 111 ? -5.127  16.746 43.430  1.00 44.99  ? 112 VAL A CG1   1 
ATOM   1619 C CG2   . VAL B 2 111 ? -2.708  17.091 42.819  1.00 44.30  ? 112 VAL A CG2   1 
ATOM   1620 N N     . PRO B 2 112 ? -5.268  16.548 46.696  1.00 48.14  ? 113 PRO A N     1 
ATOM   1621 C CA    . PRO B 2 112 ? -6.252  15.860 47.536  1.00 48.48  ? 113 PRO A CA    1 
ATOM   1622 C C     . PRO B 2 112 ? -7.413  15.355 46.665  1.00 48.56  ? 113 PRO A C     1 
ATOM   1623 O O     . PRO B 2 112 ? -7.753  15.981 45.659  1.00 47.79  ? 113 PRO A O     1 
ATOM   1624 C CB    . PRO B 2 112 ? -6.698  16.952 48.512  1.00 48.31  ? 113 PRO A CB    1 
ATOM   1625 C CG    . PRO B 2 112 ? -5.516  17.898 48.554  1.00 48.15  ? 113 PRO A CG    1 
ATOM   1626 C CD    . PRO B 2 112 ? -5.104  17.952 47.109  1.00 48.36  ? 113 PRO A CD    1 
ATOM   1627 N N     . CYS B 2 113 ? -8.008  14.226 47.048  1.00 48.97  ? 114 CYS A N     1 
ATOM   1628 C CA    . CYS B 2 113 ? -9.140  13.665 46.305  1.00 49.75  ? 114 CYS A CA    1 
ATOM   1629 C C     . CYS B 2 113 ? -9.893  12.599 47.108  1.00 50.51  ? 114 CYS A C     1 
ATOM   1630 O O     . CYS B 2 113 ? -9.438  12.173 48.167  1.00 50.56  ? 114 CYS A O     1 
ATOM   1631 C CB    . CYS B 2 113 ? -8.663  13.043 44.999  1.00 48.23  ? 114 CYS A CB    1 
ATOM   1632 S SG    . CYS B 2 113 ? -7.741  11.549 45.255  1.00 46.61  ? 114 CYS A SG    1 
ATOM   1633 N N     . TYR B 2 114 ? -11.040 12.167 46.591  1.00 51.71  ? 115 TYR A N     1 
ATOM   1634 C CA    . TYR B 2 114 ? -11.847 11.149 47.258  1.00 53.44  ? 115 TYR A CA    1 
ATOM   1635 C C     . TYR B 2 114 ? -11.549 9.704  46.824  1.00 54.38  ? 115 TYR A C     1 
ATOM   1636 O O     . TYR B 2 114 ? -11.526 9.401  45.627  1.00 54.88  ? 115 TYR A O     1 
ATOM   1637 C CB    . TYR B 2 114 ? -13.336 11.418 47.030  1.00 53.94  ? 115 TYR A CB    1 
ATOM   1638 C CG    . TYR B 2 114 ? -13.869 12.650 47.715  1.00 55.04  ? 115 TYR A CG    1 
ATOM   1639 C CD1   . TYR B 2 114 ? -14.244 13.774 46.983  1.00 56.34  ? 115 TYR A CD1   1 
ATOM   1640 C CD2   . TYR B 2 114 ? -14.024 12.683 49.095  1.00 55.58  ? 115 TYR A CD2   1 
ATOM   1641 C CE1   . TYR B 2 114 ? -14.765 14.905 47.612  1.00 57.35  ? 115 TYR A CE1   1 
ATOM   1642 C CE2   . TYR B 2 114 ? -14.544 13.806 49.735  1.00 57.20  ? 115 TYR A CE2   1 
ATOM   1643 C CZ    . TYR B 2 114 ? -14.914 14.914 48.988  1.00 57.36  ? 115 TYR A CZ    1 
ATOM   1644 O OH    . TYR B 2 114 ? -15.434 16.015 49.629  1.00 58.23  ? 115 TYR A OH    1 
ATOM   1645 N N     . LYS B 2 115 ? -11.318 8.822  47.800  1.00 55.25  ? 116 LYS A N     1 
ATOM   1646 C CA    . LYS B 2 115 ? -11.079 7.406  47.522  1.00 55.91  ? 116 LYS A CA    1 
ATOM   1647 C C     . LYS B 2 115 ? -12.469 6.877  47.179  1.00 56.57  ? 116 LYS A C     1 
ATOM   1648 O O     . LYS B 2 115 ? -13.370 6.899  48.016  1.00 56.26  ? 116 LYS A O     1 
ATOM   1649 C CB    . LYS B 2 115 ? -10.533 6.692  48.763  1.00 55.96  ? 116 LYS A CB    1 
ATOM   1650 C CG    . LYS B 2 115 ? -10.358 5.183  48.595  1.00 56.14  ? 116 LYS A CG    1 
ATOM   1651 C CD    . LYS B 2 115 ? -9.871  4.498  49.885  1.00 56.02  ? 116 LYS A CD    1 
ATOM   1652 C CE    . LYS B 2 115 ? -9.700  2.985  49.689  1.00 55.83  ? 116 LYS A CE    1 
ATOM   1653 N NZ    . LYS B 2 115 ? -9.458  2.217  50.945  1.00 54.70  ? 116 LYS A NZ    1 
ATOM   1654 N N     . LEU B 2 116 ? -12.647 6.418  45.945  1.00 57.86  ? 117 LEU A N     1 
ATOM   1655 C CA    . LEU B 2 116 ? -13.951 5.944  45.499  1.00 59.14  ? 117 LEU A CA    1 
ATOM   1656 C C     . LEU B 2 116 ? -13.936 4.613  44.757  1.00 61.15  ? 117 LEU A C     1 
ATOM   1657 O O     . LEU B 2 116 ? -12.895 4.140  44.279  1.00 61.29  ? 117 LEU A O     1 
ATOM   1658 C CB    . LEU B 2 116 ? -14.581 6.988  44.576  1.00 57.57  ? 117 LEU A CB    1 
ATOM   1659 C CG    . LEU B 2 116 ? -14.842 8.389  45.112  1.00 56.91  ? 117 LEU A CG    1 
ATOM   1660 C CD1   . LEU B 2 116 ? -14.824 9.391  43.976  1.00 56.33  ? 117 LEU A CD1   1 
ATOM   1661 C CD2   . LEU B 2 116 ? -16.167 8.403  45.834  1.00 56.94  ? 117 LEU A CD2   1 
ATOM   1662 N N     . LYS B 2 117 ? -15.113 4.011  44.662  1.00 63.39  ? 118 LYS A N     1 
ATOM   1663 C CA    . LYS B 2 117 ? -15.246 2.767  43.937  1.00 66.90  ? 118 LYS A CA    1 
ATOM   1664 C C     . LYS B 2 117 ? -16.265 3.037  42.836  1.00 68.68  ? 118 LYS A C     1 
ATOM   1665 O O     . LYS B 2 117 ? -17.411 3.408  43.111  1.00 68.64  ? 118 LYS A O     1 
ATOM   1666 C CB    . LYS B 2 117 ? -15.721 1.639  44.858  1.00 67.03  ? 118 LYS A CB    1 
ATOM   1667 C CG    . LYS B 2 117 ? -15.793 0.267  44.166  1.00 67.69  ? 118 LYS A CG    1 
ATOM   1668 C CD    . LYS B 2 117 ? -14.410 -0.274 43.760  1.00 68.03  ? 118 LYS A CD    1 
ATOM   1669 C CE    . LYS B 2 117 ? -14.507 -1.633 43.047  1.00 67.05  ? 118 LYS A CE    1 
ATOM   1670 N NZ    . LYS B 2 117 ? -13.203 -2.353 42.941  1.00 65.62  ? 118 LYS A NZ    1 
ATOM   1671 N N     . GLU B 2 118 ? -15.823 2.874  41.594  1.00 70.67  ? 119 GLU A N     1 
ATOM   1672 C CA    . GLU B 2 118 ? -16.652 3.123  40.435  1.00 73.59  ? 119 GLU A CA    1 
ATOM   1673 C C     . GLU B 2 118 ? -17.227 4.282  39.641  1.00 73.82  ? 119 GLU A C     1 
ATOM   1674 O O     . GLU B 2 118 ? -18.380 4.674  39.843  1.00 75.17  ? 119 GLU A O     1 
ATOM   1675 C CB    . GLU B 2 118 ? -18.064 2.548  40.634  1.00 76.00  ? 119 GLU A CB    1 
ATOM   1676 C CG    . GLU B 2 118 ? -18.115 1.025  40.657  1.00 78.70  ? 119 GLU A CG    1 
ATOM   1677 C CD    . GLU B 2 118 ? -17.555 0.392  39.380  1.00 80.28  ? 119 GLU A CD    1 
ATOM   1678 O OE1   . GLU B 2 118 ? -16.326 0.489  39.144  1.00 80.90  ? 119 GLU A OE1   1 
ATOM   1679 O OE2   . GLU B 2 118 ? -18.345 -0.205 38.610  1.00 80.93  ? 119 GLU A OE2   1 
ATOM   1680 N N     . PRO B 2 119 ? -16.418 4.883  38.753  1.00 73.24  ? 120 PRO A N     1 
ATOM   1681 C CA    . PRO B 2 119 ? -16.396 6.187  38.083  1.00 72.51  ? 120 PRO A CA    1 
ATOM   1682 C C     . PRO B 2 119 ? -17.430 7.182  38.520  1.00 71.81  ? 120 PRO A C     1 
ATOM   1683 O O     . PRO B 2 119 ? -17.071 8.319  38.809  1.00 71.36  ? 120 PRO A O     1 
ATOM   1684 C CB    . PRO B 2 119 ? -16.543 5.789  36.602  1.00 72.97  ? 120 PRO A CB    1 
ATOM   1685 C CG    . PRO B 2 119 ? -15.666 4.576  36.530  1.00 73.69  ? 120 PRO A CG    1 
ATOM   1686 C CD    . PRO B 2 119 ? -16.085 3.793  37.774  1.00 73.36  ? 120 PRO A CD    1 
ATOM   1687 N N     . LYS B 2 120 ? -18.706 6.803  38.565  1.00 71.62  ? 121 LYS A N     1 
ATOM   1688 C CA    . LYS B 2 120 ? -19.731 7.742  39.028  1.00 71.92  ? 121 LYS A CA    1 
ATOM   1689 C C     . LYS B 2 120 ? -19.344 8.069  40.477  1.00 73.06  ? 121 LYS A C     1 
ATOM   1690 O O     . LYS B 2 120 ? -18.485 7.391  41.056  1.00 73.32  ? 121 LYS A O     1 
ATOM   1691 C CB    . LYS B 2 120 ? -21.125 7.106  39.005  1.00 70.79  ? 121 LYS A CB    1 
ATOM   1692 C CG    . LYS B 2 120 ? -21.233 5.845  38.171  1.00 70.04  ? 121 LYS A CG    1 
ATOM   1693 C CD    . LYS B 2 120 ? -20.962 6.110  36.688  1.00 70.03  ? 121 LYS A CD    1 
ATOM   1694 C CE    . LYS B 2 120 ? -21.057 4.812  35.867  1.00 68.82  ? 121 LYS A CE    1 
ATOM   1695 N NZ    . LYS B 2 120 ? -20.675 4.994  34.442  1.00 66.20  ? 121 LYS A NZ    1 
ATOM   1696 N N     . ASN B 2 121 ? -19.979 9.085  41.060  1.00 73.37  ? 122 ASN A N     1 
ATOM   1697 C CA    . ASN B 2 121 ? -19.701 9.524  42.438  1.00 73.73  ? 122 ASN A CA    1 
ATOM   1698 C C     . ASN B 2 121 ? -18.480 10.427 42.447  1.00 73.87  ? 122 ASN A C     1 
ATOM   1699 O O     . ASN B 2 121 ? -18.093 10.960 43.488  1.00 74.53  ? 122 ASN A O     1 
ATOM   1700 C CB    . ASN B 2 121 ? -19.252 8.361  43.345  1.00 74.05  ? 122 ASN A CB    1 
ATOM   1701 C CG    . ASN B 2 121 ? -20.281 7.235  43.423  1.00 74.31  ? 122 ASN A CG    1 
ATOM   1702 O OD1   . ASN B 2 121 ? -21.430 7.455  43.810  1.00 73.89  ? 122 ASN A OD1   1 
ATOM   1703 N ND2   . ASN B 2 121 ? -19.866 6.021  43.055  1.00 74.20  ? 122 ASN A ND2   1 
ATOM   1704 N N     . ILE B 2 122 ? -17.872 10.590 41.276  1.00 74.04  ? 123 ILE A N     1 
ATOM   1705 C CA    . ILE B 2 122 ? -16.797 11.555 41.074  1.00 73.65  ? 123 ILE A CA    1 
ATOM   1706 C C     . ILE B 2 122 ? -17.385 12.950 41.207  1.00 72.96  ? 123 ILE A C     1 
ATOM   1707 O O     . ILE B 2 122 ? -18.429 13.254 40.611  1.00 72.63  ? 123 ILE A O     1 
ATOM   1708 C CB    . ILE B 2 122 ? -16.148 11.394 39.670  1.00 73.88  ? 123 ILE A CB    1 
ATOM   1709 C CG1   . ILE B 2 122 ? -14.840 10.611 39.801  1.00 74.02  ? 123 ILE A CG1   1 
ATOM   1710 C CG2   . ILE B 2 122 ? -15.900 12.758 39.030  1.00 74.29  ? 123 ILE A CG2   1 
ATOM   1711 C CD1   . ILE B 2 122 ? -14.186 10.288 38.484  1.00 73.70  ? 123 ILE A CD1   1 
ATOM   1712 N N     . LYS B 2 123 ? -16.714 13.785 41.997  1.00 72.00  ? 124 LYS A N     1 
ATOM   1713 C CA    . LYS B 2 123 ? -17.163 15.152 42.216  1.00 70.94  ? 124 LYS A CA    1 
ATOM   1714 C C     . LYS B 2 123 ? -16.319 16.174 41.429  1.00 70.34  ? 124 LYS A C     1 
ATOM   1715 O O     . LYS B 2 123 ? -16.842 17.195 40.968  1.00 70.96  ? 124 LYS A O     1 
ATOM   1716 C CB    . LYS B 2 123 ? -17.154 15.462 43.720  1.00 70.83  ? 124 LYS A CB    1 
ATOM   1717 C CG    . LYS B 2 123 ? -17.952 14.465 44.573  1.00 69.95  ? 124 LYS A CG    1 
ATOM   1718 C CD    . LYS B 2 123 ? -18.228 15.028 45.969  1.00 69.40  ? 124 LYS A CD    1 
ATOM   1719 C CE    . LYS B 2 123 ? -18.923 14.021 46.873  1.00 68.98  ? 124 LYS A CE    1 
ATOM   1720 N NZ    . LYS B 2 123 ? -18.028 12.924 47.339  1.00 67.74  ? 124 LYS A NZ    1 
ATOM   1721 N N     . SER B 2 124 ? -15.022 15.893 41.274  1.00 68.95  ? 125 SER A N     1 
ATOM   1722 C CA    . SER B 2 124 ? -14.101 16.768 40.530  1.00 67.05  ? 125 SER A CA    1 
ATOM   1723 C C     . SER B 2 124 ? -13.304 15.937 39.534  1.00 65.15  ? 125 SER A C     1 
ATOM   1724 O O     . SER B 2 124 ? -13.280 14.710 39.621  1.00 65.24  ? 125 SER A O     1 
ATOM   1725 C CB    . SER B 2 124 ? -13.117 17.474 41.474  1.00 67.65  ? 125 SER A CB    1 
ATOM   1726 O OG    . SER B 2 124 ? -13.791 18.294 42.412  1.00 68.70  ? 125 SER A OG    1 
ATOM   1727 N N     . ALA B 2 125 ? -12.646 16.600 38.590  1.00 62.80  ? 126 ALA A N     1 
ATOM   1728 C CA    . ALA B 2 125 ? -11.858 15.877 37.603  1.00 60.15  ? 126 ALA A CA    1 
ATOM   1729 C C     . ALA B 2 125 ? -10.768 15.102 38.333  1.00 58.18  ? 126 ALA A C     1 
ATOM   1730 O O     . ALA B 2 125 ? -10.448 13.977 37.973  1.00 58.34  ? 126 ALA A O     1 
ATOM   1731 C CB    . ALA B 2 125 ? -11.247 16.848 36.592  1.00 60.05  ? 126 ALA A CB    1 
ATOM   1732 N N     . VAL B 2 126 ? -10.204 15.703 39.371  1.00 55.91  ? 127 VAL A N     1 
ATOM   1733 C CA    . VAL B 2 126 ? -9.161  15.033 40.138  1.00 53.90  ? 127 VAL A CA    1 
ATOM   1734 C C     . VAL B 2 126 ? -9.602  13.628 40.541  1.00 53.09  ? 127 VAL A C     1 
ATOM   1735 O O     . VAL B 2 126 ? -8.822  12.685 40.459  1.00 53.05  ? 127 VAL A O     1 
ATOM   1736 C CB    . VAL B 2 126 ? -8.794  15.827 41.417  1.00 52.88  ? 127 VAL A CB    1 
ATOM   1737 C CG1   . VAL B 2 126 ? -7.907  17.000 41.062  1.00 51.35  ? 127 VAL A CG1   1 
ATOM   1738 C CG2   . VAL B 2 126 ? -10.053 16.326 42.109  1.00 52.23  ? 127 VAL A CG2   1 
ATOM   1739 N N     . ASP B 2 127 ? -10.859 13.499 40.969  1.00 52.19  ? 128 ASP A N     1 
ATOM   1740 C CA    . ASP B 2 127 ? -11.423 12.215 41.396  1.00 50.86  ? 128 ASP A CA    1 
ATOM   1741 C C     . ASP B 2 127 ? -11.446 11.152 40.306  1.00 49.92  ? 128 ASP A C     1 
ATOM   1742 O O     . ASP B 2 127 ? -11.802 10.004 40.561  1.00 48.61  ? 128 ASP A O     1 
ATOM   1743 C CB    . ASP B 2 127 ? -12.851 12.401 41.919  1.00 50.09  ? 128 ASP A CB    1 
ATOM   1744 C CG    . ASP B 2 127 ? -12.892 13.147 43.219  1.00 49.65  ? 128 ASP A CG    1 
ATOM   1745 O OD1   . ASP B 2 127 ? -11.939 12.966 44.010  1.00 48.15  ? 128 ASP A OD1   1 
ATOM   1746 O OD2   . ASP B 2 127 ? -13.874 13.895 43.450  1.00 49.85  ? 128 ASP A OD2   1 
ATOM   1747 N N     . ARG B 2 128 ? -11.076 11.540 39.091  1.00 49.72  ? 129 ARG A N     1 
ATOM   1748 C CA    . ARG B 2 128 ? -11.063 10.613 37.965  1.00 49.04  ? 129 ARG A CA    1 
ATOM   1749 C C     . ARG B 2 128 ? -9.634  10.146 37.681  1.00 47.18  ? 129 ARG A C     1 
ATOM   1750 O O     . ARG B 2 128 ? -9.411  9.021  37.231  1.00 47.24  ? 129 ARG A O     1 
ATOM   1751 C CB    . ARG B 2 128 ? -11.656 11.286 36.717  1.00 49.83  ? 129 ARG A CB    1 
ATOM   1752 C CG    . ARG B 2 128 ? -12.023 10.298 35.632  1.00 52.82  ? 129 ARG A CG    1 
ATOM   1753 C CD    . ARG B 2 128 ? -12.456 10.951 34.318  1.00 56.35  ? 129 ARG A CD    1 
ATOM   1754 N NE    . ARG B 2 128 ? -13.657 11.770 34.425  1.00 58.76  ? 129 ARG A NE    1 
ATOM   1755 C CZ    . ARG B 2 128 ? -13.656 13.059 34.751  1.00 60.38  ? 129 ARG A CZ    1 
ATOM   1756 N NH1   . ARG B 2 128 ? -12.509 13.684 35.002  1.00 60.54  ? 129 ARG A NH1   1 
ATOM   1757 N NH2   . ARG B 2 128 ? -14.802 13.724 34.829  1.00 60.86  ? 129 ARG A NH2   1 
ATOM   1758 N N     . THR B 2 129 ? -8.670  11.013 37.965  1.00 44.76  ? 130 THR A N     1 
ATOM   1759 C CA    . THR B 2 129 ? -7.268  10.708 37.739  1.00 42.95  ? 130 THR A CA    1 
ATOM   1760 C C     . THR B 2 129 ? -6.896  9.359  38.317  1.00 42.60  ? 130 THR A C     1 
ATOM   1761 O O     . THR B 2 129 ? -6.184  8.590  37.686  1.00 42.76  ? 130 THR A O     1 
ATOM   1762 C CB    . THR B 2 129 ? -6.395  11.781 38.363  1.00 42.63  ? 130 THR A CB    1 
ATOM   1763 O OG1   . THR B 2 129 ? -6.894  13.061 37.960  1.00 44.21  ? 130 THR A OG1   1 
ATOM   1764 C CG2   . THR B 2 129 ? -4.951  11.642 37.913  1.00 42.41  ? 130 THR A CG2   1 
ATOM   1765 N N     . PRO B 2 130 ? -7.376  9.048  39.531  1.00 42.45  ? 131 PRO A N     1 
ATOM   1766 C CA    . PRO B 2 130 ? -7.054  7.753  40.144  1.00 41.56  ? 131 PRO A CA    1 
ATOM   1767 C C     . PRO B 2 130 ? -7.450  6.578  39.229  1.00 41.32  ? 131 PRO A C     1 
ATOM   1768 O O     . PRO B 2 130 ? -6.668  5.641  39.022  1.00 40.71  ? 131 PRO A O     1 
ATOM   1769 C CB    . PRO B 2 130 ? -7.871  7.776  41.438  1.00 41.37  ? 131 PRO A CB    1 
ATOM   1770 C CG    . PRO B 2 130 ? -7.965  9.234  41.767  1.00 41.24  ? 131 PRO A CG    1 
ATOM   1771 C CD    . PRO B 2 130 ? -8.241  9.845  40.422  1.00 42.73  ? 131 PRO A CD    1 
ATOM   1772 N N     . PHE B 2 131 ? -8.670  6.636  38.690  1.00 40.76  ? 132 PHE A N     1 
ATOM   1773 C CA    . PHE B 2 131 ? -9.153  5.584  37.802  1.00 39.84  ? 132 PHE A CA    1 
ATOM   1774 C C     . PHE B 2 131 ? -8.253  5.499  36.579  1.00 39.29  ? 132 PHE A C     1 
ATOM   1775 O O     . PHE B 2 131 ? -7.676  4.448  36.286  1.00 40.37  ? 132 PHE A O     1 
ATOM   1776 C CB    . PHE B 2 131 ? -10.594 5.855  37.373  1.00 39.01  ? 132 PHE A CB    1 
ATOM   1777 C CG    . PHE B 2 131 ? -11.580 5.786  38.502  1.00 38.97  ? 132 PHE A CG    1 
ATOM   1778 C CD1   . PHE B 2 131 ? -11.966 6.928  39.181  1.00 39.69  ? 132 PHE A CD1   1 
ATOM   1779 C CD2   . PHE B 2 131 ? -12.097 4.572  38.908  1.00 39.10  ? 132 PHE A CD2   1 
ATOM   1780 C CE1   . PHE B 2 131 ? -12.858 6.858  40.254  1.00 39.20  ? 132 PHE A CE1   1 
ATOM   1781 C CE2   . PHE B 2 131 ? -12.979 4.495  39.971  1.00 39.20  ? 132 PHE A CE2   1 
ATOM   1782 C CZ    . PHE B 2 131 ? -13.362 5.640  40.647  1.00 38.73  ? 132 PHE A CZ    1 
ATOM   1783 N N     . HIS B 2 132 ? -8.132  6.618  35.877  1.00 38.17  ? 133 HIS A N     1 
ATOM   1784 C CA    . HIS B 2 132 ? -7.293  6.708  34.699  1.00 37.83  ? 133 HIS A CA    1 
ATOM   1785 C C     . HIS B 2 132 ? -5.957  6.038  34.977  1.00 38.46  ? 133 HIS A C     1 
ATOM   1786 O O     . HIS B 2 132 ? -5.320  5.493  34.084  1.00 39.70  ? 133 HIS A O     1 
ATOM   1787 C CB    . HIS B 2 132 ? -7.058  8.172  34.342  1.00 38.03  ? 133 HIS A CB    1 
ATOM   1788 C CG    . HIS B 2 132 ? -8.269  8.873  33.814  1.00 38.60  ? 133 HIS A CG    1 
ATOM   1789 N ND1   . HIS B 2 132 ? -8.393  10.247 33.818  1.00 38.22  ? 133 HIS A ND1   1 
ATOM   1790 C CD2   . HIS B 2 132 ? -9.394  8.398  33.228  1.00 38.23  ? 133 HIS A CD2   1 
ATOM   1791 C CE1   . HIS B 2 132 ? -9.538  10.585 33.258  1.00 37.78  ? 133 HIS A CE1   1 
ATOM   1792 N NE2   . HIS B 2 132 ? -10.165 9.481  32.890  1.00 37.66  ? 133 HIS A NE2   1 
ATOM   1793 N N     . HIS B 2 133 ? -5.505  6.078  36.213  1.00 38.29  ? 134 HIS A N     1 
ATOM   1794 C CA    . HIS B 2 133 ? -4.248  5.434  36.462  1.00 39.32  ? 134 HIS A CA    1 
ATOM   1795 C C     . HIS B 2 133 ? -4.491  3.937  36.519  1.00 41.22  ? 134 HIS A C     1 
ATOM   1796 O O     . HIS B 2 133 ? -3.832  3.177  35.812  1.00 42.24  ? 134 HIS A O     1 
ATOM   1797 C CB    . HIS B 2 133 ? -3.635  5.918  37.761  1.00 40.05  ? 134 HIS A CB    1 
ATOM   1798 C CG    . HIS B 2 133 ? -2.301  5.314  38.044  1.00 40.07  ? 134 HIS A CG    1 
ATOM   1799 N ND1   . HIS B 2 133 ? -1.204  5.536  37.241  1.00 40.45  ? 134 HIS A ND1   1 
ATOM   1800 C CD2   . HIS B 2 133 ? -1.893  4.467  39.017  1.00 40.65  ? 134 HIS A CD2   1 
ATOM   1801 C CE1   . HIS B 2 133 ? -0.175  4.850  37.707  1.00 41.21  ? 134 HIS A CE1   1 
ATOM   1802 N NE2   . HIS B 2 133 ? -0.567  4.192  38.784  1.00 41.59  ? 134 HIS A NE2   1 
ATOM   1803 N N     . LYS B 2 134 ? -5.444  3.502  37.340  1.00 42.42  ? 135 LYS A N     1 
ATOM   1804 C CA    . LYS B 2 134 ? -5.719  2.071  37.449  1.00 43.70  ? 135 LYS A CA    1 
ATOM   1805 C C     . LYS B 2 134 ? -5.936  1.413  36.105  1.00 44.01  ? 135 LYS A C     1 
ATOM   1806 O O     . LYS B 2 134 ? -5.478  0.289  35.873  1.00 45.01  ? 135 LYS A O     1 
ATOM   1807 C CB    . LYS B 2 134 ? -6.941  1.802  38.320  1.00 44.99  ? 135 LYS A CB    1 
ATOM   1808 C CG    . LYS B 2 134 ? -6.613  1.697  39.799  1.00 48.58  ? 135 LYS A CG    1 
ATOM   1809 C CD    . LYS B 2 134 ? -5.769  0.458  40.122  1.00 49.59  ? 135 LYS A CD    1 
ATOM   1810 C CE    . LYS B 2 134 ? -5.135  0.557  41.515  1.00 49.33  ? 135 LYS A CE    1 
ATOM   1811 N NZ    . LYS B 2 134 ? -6.147  0.865  42.571  1.00 49.44  ? 135 LYS A NZ    1 
ATOM   1812 N N     . TRP B 2 135 ? -6.635  2.114  35.222  1.00 43.15  ? 136 TRP A N     1 
ATOM   1813 C CA    . TRP B 2 135 ? -6.926  1.586  33.900  1.00 43.40  ? 136 TRP A CA    1 
ATOM   1814 C C     . TRP B 2 135 ? -5.672  1.544  33.045  1.00 43.69  ? 136 TRP A C     1 
ATOM   1815 O O     . TRP B 2 135 ? -5.443  0.597  32.291  1.00 44.23  ? 136 TRP A O     1 
ATOM   1816 C CB    . TRP B 2 135 ? -7.969  2.464  33.201  1.00 43.55  ? 136 TRP A CB    1 
ATOM   1817 C CG    . TRP B 2 135 ? -8.576  1.841  31.975  1.00 43.52  ? 136 TRP A CG    1 
ATOM   1818 C CD1   . TRP B 2 135 ? -9.744  1.134  31.903  1.00 43.44  ? 136 TRP A CD1   1 
ATOM   1819 C CD2   . TRP B 2 135 ? -8.022  1.829  30.655  1.00 43.40  ? 136 TRP A CD2   1 
ATOM   1820 N NE1   . TRP B 2 135 ? -9.949  0.680  30.619  1.00 43.16  ? 136 TRP A NE1   1 
ATOM   1821 C CE2   . TRP B 2 135 ? -8.906  1.092  29.835  1.00 42.70  ? 136 TRP A CE2   1 
ATOM   1822 C CE3   . TRP B 2 135 ? -6.861  2.364  30.087  1.00 42.95  ? 136 TRP A CE3   1 
ATOM   1823 C CZ2   . TRP B 2 135 ? -8.665  0.881  28.484  1.00 42.16  ? 136 TRP A CZ2   1 
ATOM   1824 C CZ3   . TRP B 2 135 ? -6.622  2.149  28.738  1.00 42.61  ? 136 TRP A CZ3   1 
ATOM   1825 C CH2   . TRP B 2 135 ? -7.519  1.413  27.956  1.00 42.41  ? 136 TRP A CH2   1 
ATOM   1826 N N     . LEU B 2 136 ? -4.851  2.574  33.183  1.00 43.46  ? 137 LEU A N     1 
ATOM   1827 C CA    . LEU B 2 136 ? -3.646  2.705  32.380  1.00 43.43  ? 137 LEU A CA    1 
ATOM   1828 C C     . LEU B 2 136 ? -2.427  1.921  32.849  1.00 43.67  ? 137 LEU A C     1 
ATOM   1829 O O     . LEU B 2 136 ? -1.568  1.540  32.040  1.00 42.03  ? 137 LEU A O     1 
ATOM   1830 C CB    . LEU B 2 136 ? -3.282  4.184  32.304  1.00 43.33  ? 137 LEU A CB    1 
ATOM   1831 C CG    . LEU B 2 136 ? -3.046  4.775  30.923  1.00 44.09  ? 137 LEU A CG    1 
ATOM   1832 C CD1   . LEU B 2 136 ? -4.113  4.275  29.972  1.00 42.56  ? 137 LEU A CD1   1 
ATOM   1833 C CD2   . LEU B 2 136 ? -3.046  6.304  31.020  1.00 43.72  ? 137 LEU A CD2   1 
ATOM   1834 N N     . GLU B 2 137 ? -2.357  1.670  34.153  1.00 44.10  ? 138 GLU A N     1 
ATOM   1835 C CA    . GLU B 2 137 ? -1.200  1.000  34.709  1.00 44.00  ? 138 GLU A CA    1 
ATOM   1836 C C     . GLU B 2 137 ? -0.943  -0.412 34.224  1.00 42.45  ? 138 GLU A C     1 
ATOM   1837 O O     . GLU B 2 137 ? 0.206   -0.815 34.096  1.00 42.70  ? 138 GLU A O     1 
ATOM   1838 C CB    . GLU B 2 137 ? -1.244  1.050  36.239  1.00 45.94  ? 138 GLU A CB    1 
ATOM   1839 C CG    . GLU B 2 137 ? -2.228  0.128  36.944  1.00 48.71  ? 138 GLU A CG    1 
ATOM   1840 C CD    . GLU B 2 137 ? -2.046  0.174  38.466  1.00 50.90  ? 138 GLU A CD    1 
ATOM   1841 O OE1   . GLU B 2 137 ? -0.921  0.497  38.907  1.00 52.12  ? 138 GLU A OE1   1 
ATOM   1842 O OE2   . GLU B 2 137 ? -3.002  -0.115 39.223  1.00 51.86  ? 138 GLU A OE2   1 
ATOM   1843 N N     . GLY B 2 138 ? -1.993  -1.161 33.925  1.00 41.13  ? 139 GLY A N     1 
ATOM   1844 C CA    . GLY B 2 138 ? -1.780  -2.519 33.469  1.00 40.78  ? 139 GLY A CA    1 
ATOM   1845 C C     . GLY B 2 138 ? -1.532  -2.648 31.978  1.00 41.07  ? 139 GLY A C     1 
ATOM   1846 O O     . GLY B 2 138 ? -0.704  -3.455 31.541  1.00 41.42  ? 139 GLY A O     1 
ATOM   1847 N N     . ARG B 2 139 ? -2.233  -1.837 31.192  1.00 40.88  ? 140 ARG A N     1 
ATOM   1848 C CA    . ARG B 2 139 ? -2.130  -1.899 29.743  1.00 40.61  ? 140 ARG A CA    1 
ATOM   1849 C C     . ARG B 2 139 ? -0.942  -1.200 29.093  1.00 41.62  ? 140 ARG A C     1 
ATOM   1850 O O     . ARG B 2 139 ? -0.535  -1.569 27.987  1.00 42.17  ? 140 ARG A O     1 
ATOM   1851 C CB    . ARG B 2 139 ? -3.420  -1.367 29.141  1.00 40.22  ? 140 ARG A CB    1 
ATOM   1852 C CG    . ARG B 2 139 ? -4.659  -2.082 29.663  1.00 40.94  ? 140 ARG A CG    1 
ATOM   1853 C CD    . ARG B 2 139 ? -5.908  -1.328 29.258  1.00 40.58  ? 140 ARG A CD    1 
ATOM   1854 N NE    . ARG B 2 139 ? -6.924  -1.384 30.298  1.00 38.75  ? 140 ARG A NE    1 
ATOM   1855 C CZ    . ARG B 2 139 ? -7.904  -2.269 30.323  1.00 39.14  ? 140 ARG A CZ    1 
ATOM   1856 N NH1   . ARG B 2 139 ? -7.997  -3.164 29.352  1.00 40.30  ? 140 ARG A NH1   1 
ATOM   1857 N NH2   . ARG B 2 139 ? -8.780  -2.262 31.318  1.00 39.78  ? 140 ARG A NH2   1 
ATOM   1858 N N     . ILE B 2 140 ? -0.366  -0.211 29.767  1.00 43.05  ? 141 ILE A N     1 
ATOM   1859 C CA    . ILE B 2 140 ? 0.760   0.520  29.190  1.00 43.95  ? 141 ILE A CA    1 
ATOM   1860 C C     . ILE B 2 140 ? 2.104   -0.172 29.401  1.00 44.46  ? 141 ILE A C     1 
ATOM   1861 O O     . ILE B 2 140 ? 3.038   0.050  28.642  1.00 44.96  ? 141 ILE A O     1 
ATOM   1862 C CB    . ILE B 2 140 ? 0.841   1.949  29.766  1.00 43.95  ? 141 ILE A CB    1 
ATOM   1863 C CG1   . ILE B 2 140 ? 1.769   2.804  28.906  1.00 43.78  ? 141 ILE A CG1   1 
ATOM   1864 C CG2   . ILE B 2 140 ? 1.303   1.906  31.200  1.00 44.30  ? 141 ILE A CG2   1 
ATOM   1865 C CD1   . ILE B 2 140 ? 1.208   3.074  27.518  1.00 43.19  ? 141 ILE A CD1   1 
ATOM   1866 N N     . LYS B 2 141 ? 2.193   -1.010 30.428  1.00 45.05  ? 142 LYS A N     1 
ATOM   1867 C CA    . LYS B 2 141 ? 3.429   -1.718 30.741  1.00 45.72  ? 142 LYS A CA    1 
ATOM   1868 C C     . LYS B 2 141 ? 4.096   -2.280 29.481  1.00 45.84  ? 142 LYS A C     1 
ATOM   1869 O O     . LYS B 2 141 ? 3.484   -3.037 28.726  1.00 46.49  ? 142 LYS A O     1 
ATOM   1870 C CB    . LYS B 2 141 ? 3.137   -2.860 31.721  1.00 46.36  ? 142 LYS A CB    1 
ATOM   1871 C CG    . LYS B 2 141 ? 4.337   -3.297 32.564  1.00 47.28  ? 142 LYS A CG    1 
ATOM   1872 C CD    . LYS B 2 141 ? 4.525   -2.390 33.778  1.00 48.26  ? 142 LYS A CD    1 
ATOM   1873 C CE    . LYS B 2 141 ? 5.803   -2.733 34.540  1.00 48.95  ? 142 LYS A CE    1 
ATOM   1874 N NZ    . LYS B 2 141 ? 5.886   -4.186 34.900  1.00 51.71  ? 142 LYS A NZ    1 
ATOM   1875 N N     . GLY B 2 142 ? 5.351   -1.903 29.258  1.00 45.57  ? 143 GLY A N     1 
ATOM   1876 C CA    . GLY B 2 142 ? 6.069   -2.395 28.096  1.00 45.07  ? 143 GLY A CA    1 
ATOM   1877 C C     . GLY B 2 142 ? 5.941   -1.552 26.840  1.00 44.56  ? 143 GLY A C     1 
ATOM   1878 O O     . GLY B 2 142 ? 6.261   -2.015 25.747  1.00 44.17  ? 143 GLY A O     1 
ATOM   1879 N N     . LYS B 2 143 ? 5.474   -0.315 26.980  1.00 44.76  ? 144 LYS A N     1 
ATOM   1880 C CA    . LYS B 2 143 ? 5.311   0.568  25.827  1.00 45.04  ? 144 LYS A CA    1 
ATOM   1881 C C     . LYS B 2 143 ? 5.729   1.992  26.154  1.00 46.02  ? 144 LYS A C     1 
ATOM   1882 O O     . LYS B 2 143 ? 5.744   2.845  25.262  1.00 46.84  ? 144 LYS A O     1 
ATOM   1883 C CB    . LYS B 2 143 ? 3.856   0.600  25.339  1.00 44.03  ? 144 LYS A CB    1 
ATOM   1884 C CG    . LYS B 2 143 ? 3.241   -0.742 24.933  1.00 44.19  ? 144 LYS A CG    1 
ATOM   1885 C CD    . LYS B 2 143 ? 1.931   -0.500 24.166  1.00 43.81  ? 144 LYS A CD    1 
ATOM   1886 C CE    . LYS B 2 143 ? 1.195   -1.787 23.815  1.00 43.32  ? 144 LYS A CE    1 
ATOM   1887 N NZ    . LYS B 2 143 ? 0.429   -2.344 24.965  1.00 42.44  ? 144 LYS A NZ    1 
ATOM   1888 N N     . GLU B 2 144 ? 6.062   2.255  27.422  1.00 46.01  ? 145 GLU A N     1 
ATOM   1889 C CA    . GLU B 2 144 ? 6.486   3.599  27.856  1.00 45.71  ? 145 GLU A CA    1 
ATOM   1890 C C     . GLU B 2 144 ? 7.271   4.374  26.789  1.00 46.04  ? 145 GLU A C     1 
ATOM   1891 O O     . GLU B 2 144 ? 6.930   5.503  26.444  1.00 46.54  ? 145 GLU A O     1 
ATOM   1892 C CB    . GLU B 2 144 ? 7.326   3.506  29.133  1.00 43.78  ? 145 GLU A CB    1 
ATOM   1893 C CG    . GLU B 2 144 ? 8.057   2.201  29.278  1.00 41.29  ? 145 GLU A CG    1 
ATOM   1894 C CD    . GLU B 2 144 ? 7.121   1.068  29.650  1.00 40.46  ? 145 GLU A CD    1 
ATOM   1895 O OE1   . GLU B 2 144 ? 7.141   0.031  28.956  1.00 39.72  ? 145 GLU A OE1   1 
ATOM   1896 O OE2   . GLU B 2 144 ? 6.367   1.218  30.639  1.00 39.68  ? 145 GLU A OE2   1 
ATOM   1897 N N     . ASN B 2 145 ? 8.316   3.755  26.262  1.00 46.68  ? 146 ASN A N     1 
ATOM   1898 C CA    . ASN B 2 145 ? 9.143   4.390  25.250  1.00 46.93  ? 146 ASN A CA    1 
ATOM   1899 C C     . ASN B 2 145 ? 8.341   4.846  24.031  1.00 46.34  ? 146 ASN A C     1 
ATOM   1900 O O     . ASN B 2 145 ? 8.727   5.797  23.344  1.00 45.46  ? 146 ASN A O     1 
ATOM   1901 C CB    . ASN B 2 145 ? 10.262  3.431  24.854  1.00 47.96  ? 146 ASN A CB    1 
ATOM   1902 C CG    . ASN B 2 145 ? 11.389  3.408  25.877  1.00 49.42  ? 146 ASN A CG    1 
ATOM   1903 O OD1   . ASN B 2 145 ? 11.165  3.450  27.094  1.00 48.67  ? 146 ASN A OD1   1 
ATOM   1904 N ND2   . ASN B 2 145 ? 12.612  3.336  25.382  1.00 51.42  ? 146 ASN A ND2   1 
ATOM   1905 N N     . GLU B 2 146 ? 7.227   4.172  23.761  1.00 45.87  ? 147 GLU A N     1 
ATOM   1906 C CA    . GLU B 2 146 ? 6.384   4.555  22.633  1.00 45.30  ? 147 GLU A CA    1 
ATOM   1907 C C     . GLU B 2 146 ? 5.650   5.829  23.054  1.00 44.67  ? 147 GLU A C     1 
ATOM   1908 O O     . GLU B 2 146 ? 5.591   6.815  22.300  1.00 45.38  ? 147 GLU A O     1 
ATOM   1909 C CB    . GLU B 2 146 ? 5.356   3.466  22.304  1.00 45.78  ? 147 GLU A CB    1 
ATOM   1910 C CG    . GLU B 2 146 ? 5.936   2.124  21.836  1.00 46.03  ? 147 GLU A CG    1 
ATOM   1911 C CD    . GLU B 2 146 ? 6.910   2.251  20.673  1.00 45.85  ? 147 GLU A CD    1 
ATOM   1912 O OE1   . GLU B 2 146 ? 6.598   2.956  19.689  1.00 45.72  ? 147 GLU A OE1   1 
ATOM   1913 O OE2   . GLU B 2 146 ? 7.987   1.626  20.744  1.00 45.53  ? 147 GLU A OE2   1 
ATOM   1914 N N     . VAL B 2 147 ? 5.090   5.803  24.261  1.00 42.71  ? 148 VAL A N     1 
ATOM   1915 C CA    . VAL B 2 147 ? 4.389   6.962  24.774  1.00 42.10  ? 148 VAL A CA    1 
ATOM   1916 C C     . VAL B 2 147 ? 5.340   8.142  24.684  1.00 42.68  ? 148 VAL A C     1 
ATOM   1917 O O     . VAL B 2 147 ? 4.958   9.209  24.207  1.00 44.11  ? 148 VAL A O     1 
ATOM   1918 C CB    . VAL B 2 147 ? 3.971   6.781  26.253  1.00 41.58  ? 148 VAL A CB    1 
ATOM   1919 C CG1   . VAL B 2 147 ? 3.607   8.146  26.871  1.00 39.42  ? 148 VAL A CG1   1 
ATOM   1920 C CG2   . VAL B 2 147 ? 2.779   5.815  26.339  1.00 41.56  ? 148 VAL A CG2   1 
ATOM   1921 N N     . ARG B 2 148 ? 6.581   7.940  25.137  1.00 42.50  ? 149 ARG A N     1 
ATOM   1922 C CA    . ARG B 2 148 ? 7.607   8.994  25.124  1.00 41.24  ? 149 ARG A CA    1 
ATOM   1923 C C     . ARG B 2 148 ? 7.882   9.516  23.711  1.00 39.88  ? 149 ARG A C     1 
ATOM   1924 O O     . ARG B 2 148 ? 7.725   10.724 23.461  1.00 39.63  ? 149 ARG A O     1 
ATOM   1925 C CB    . ARG B 2 148 ? 8.907   8.501  25.771  1.00 41.38  ? 149 ARG A CB    1 
ATOM   1926 C CG    . ARG B 2 148 ? 8.803   8.386  27.283  1.00 41.13  ? 149 ARG A CG    1 
ATOM   1927 C CD    . ARG B 2 148 ? 10.060  7.809  27.908  1.00 42.42  ? 149 ARG A CD    1 
ATOM   1928 N NE    . ARG B 2 148 ? 10.015  7.956  29.359  1.00 41.97  ? 149 ARG A NE    1 
ATOM   1929 C CZ    . ARG B 2 148 ? 10.276  6.980  30.222  1.00 41.93  ? 149 ARG A CZ    1 
ATOM   1930 N NH1   . ARG B 2 148 ? 10.607  5.766  29.788  1.00 40.42  ? 149 ARG A NH1   1 
ATOM   1931 N NH2   . ARG B 2 148 ? 10.200  7.225  31.523  1.00 41.11  ? 149 ARG A NH2   1 
ATOM   1932 N N     . LEU B 2 149 ? 8.287   8.639  22.789  1.00 37.80  ? 150 LEU A N     1 
ATOM   1933 C CA    . LEU B 2 149 ? 8.528   9.097  21.423  1.00 36.85  ? 150 LEU A CA    1 
ATOM   1934 C C     . LEU B 2 149 ? 7.387   10.029 21.017  1.00 36.33  ? 150 LEU A C     1 
ATOM   1935 O O     . LEU B 2 149 ? 7.621   11.192 20.666  1.00 35.54  ? 150 LEU A O     1 
ATOM   1936 C CB    . LEU B 2 149 ? 8.562   7.928  20.438  1.00 36.34  ? 150 LEU A CB    1 
ATOM   1937 C CG    . LEU B 2 149 ? 9.695   6.911  20.493  1.00 34.92  ? 150 LEU A CG    1 
ATOM   1938 C CD1   . LEU B 2 149 ? 9.573   6.041  19.275  1.00 34.11  ? 150 LEU A CD1   1 
ATOM   1939 C CD2   . LEU B 2 149 ? 11.052  7.584  20.526  1.00 33.89  ? 150 LEU A CD2   1 
ATOM   1940 N N     . LEU B 2 150 ? 6.158   9.504  21.086  1.00 35.96  ? 151 LEU A N     1 
ATOM   1941 C CA    . LEU B 2 150 ? 4.953   10.252 20.717  1.00 36.25  ? 151 LEU A CA    1 
ATOM   1942 C C     . LEU B 2 150 ? 4.779   11.585 21.457  1.00 37.61  ? 151 LEU A C     1 
ATOM   1943 O O     . LEU B 2 150 ? 4.172   12.519 20.923  1.00 37.63  ? 151 LEU A O     1 
ATOM   1944 C CB    . LEU B 2 150 ? 3.704   9.374  20.906  1.00 33.49  ? 151 LEU A CB    1 
ATOM   1945 C CG    . LEU B 2 150 ? 2.323   10.042 20.794  1.00 32.70  ? 151 LEU A CG    1 
ATOM   1946 C CD1   . LEU B 2 150 ? 2.239   10.919 19.570  1.00 29.85  ? 151 LEU A CD1   1 
ATOM   1947 C CD2   . LEU B 2 150 ? 1.251   8.974  20.731  1.00 31.81  ? 151 LEU A CD2   1 
ATOM   1948 N N     . LYS B 2 151 ? 5.295   11.693 22.679  1.00 38.36  ? 152 LYS A N     1 
ATOM   1949 C CA    . LYS B 2 151 ? 5.154   12.954 23.394  1.00 38.46  ? 152 LYS A CA    1 
ATOM   1950 C C     . LYS B 2 151 ? 6.194   13.886 22.825  1.00 39.17  ? 152 LYS A C     1 
ATOM   1951 O O     . LYS B 2 151 ? 5.907   15.048 22.524  1.00 39.36  ? 152 LYS A O     1 
ATOM   1952 C CB    . LYS B 2 151 ? 5.408   12.789 24.887  1.00 38.52  ? 152 LYS A CB    1 
ATOM   1953 C CG    . LYS B 2 151 ? 4.359   12.006 25.635  1.00 39.05  ? 152 LYS A CG    1 
ATOM   1954 C CD    . LYS B 2 151 ? 4.616   12.121 27.119  1.00 39.64  ? 152 LYS A CD    1 
ATOM   1955 C CE    . LYS B 2 151 ? 3.691   11.238 27.906  1.00 41.41  ? 152 LYS A CE    1 
ATOM   1956 N NZ    . LYS B 2 151 ? 3.945   11.400 29.362  1.00 43.35  ? 152 LYS A NZ    1 
ATOM   1957 N N     . GLY B 2 152 ? 7.408   13.356 22.679  1.00 39.12  ? 153 GLY A N     1 
ATOM   1958 C CA    . GLY B 2 152 ? 8.505   14.141 22.147  1.00 39.88  ? 153 GLY A CA    1 
ATOM   1959 C C     . GLY B 2 152 ? 8.172   14.740 20.793  1.00 40.80  ? 153 GLY A C     1 
ATOM   1960 O O     . GLY B 2 152 ? 8.549   15.871 20.491  1.00 41.90  ? 153 GLY A O     1 
ATOM   1961 N N     . PHE B 2 153 ? 7.466   13.967 19.977  1.00 40.86  ? 154 PHE A N     1 
ATOM   1962 C CA    . PHE B 2 153 ? 7.045   14.374 18.637  1.00 40.18  ? 154 PHE A CA    1 
ATOM   1963 C C     . PHE B 2 153 ? 6.150   15.629 18.725  1.00 39.96  ? 154 PHE A C     1 
ATOM   1964 O O     . PHE B 2 153 ? 6.439   16.682 18.116  1.00 39.45  ? 154 PHE A O     1 
ATOM   1965 C CB    . PHE B 2 153 ? 6.255   13.222 18.023  1.00 40.36  ? 154 PHE A CB    1 
ATOM   1966 C CG    . PHE B 2 153 ? 6.012   13.357 16.559  1.00 40.70  ? 154 PHE A CG    1 
ATOM   1967 C CD1   . PHE B 2 153 ? 7.011   13.044 15.651  1.00 40.96  ? 154 PHE A CD1   1 
ATOM   1968 C CD2   . PHE B 2 153 ? 4.766   13.746 16.083  1.00 41.15  ? 154 PHE A CD2   1 
ATOM   1969 C CE1   . PHE B 2 153 ? 6.777   13.107 14.292  1.00 40.69  ? 154 PHE A CE1   1 
ATOM   1970 C CE2   . PHE B 2 153 ? 4.519   13.814 14.725  1.00 41.84  ? 154 PHE A CE2   1 
ATOM   1971 C CZ    . PHE B 2 153 ? 5.528   13.492 13.826  1.00 41.73  ? 154 PHE A CZ    1 
ATOM   1972 N N     . LEU B 2 154 ? 5.066   15.494 19.498  1.00 39.34  ? 155 LEU A N     1 
ATOM   1973 C CA    . LEU B 2 154 ? 4.080   16.561 19.703  1.00 38.73  ? 155 LEU A CA    1 
ATOM   1974 C C     . LEU B 2 154 ? 4.697   17.790 20.347  1.00 38.67  ? 155 LEU A C     1 
ATOM   1975 O O     . LEU B 2 154 ? 4.321   18.926 20.049  1.00 38.59  ? 155 LEU A O     1 
ATOM   1976 C CB    . LEU B 2 154 ? 2.938   16.063 20.593  1.00 37.34  ? 155 LEU A CB    1 
ATOM   1977 C CG    . LEU B 2 154 ? 2.173   14.837 20.113  1.00 36.12  ? 155 LEU A CG    1 
ATOM   1978 C CD1   . LEU B 2 154 ? 1.196   14.402 21.178  1.00 36.53  ? 155 LEU A CD1   1 
ATOM   1979 C CD2   . LEU B 2 154 ? 1.446   15.160 18.828  1.00 36.69  ? 155 LEU A CD2   1 
ATOM   1980 N N     . LYS B 2 155 ? 5.633   17.552 21.254  1.00 38.70  ? 156 LYS A N     1 
ATOM   1981 C CA    . LYS B 2 155 ? 6.292   18.640 21.947  1.00 38.77  ? 156 LYS A CA    1 
ATOM   1982 C C     . LYS B 2 155 ? 7.143   19.365 20.928  1.00 37.96  ? 156 LYS A C     1 
ATOM   1983 O O     . LYS B 2 155 ? 6.950   20.554 20.685  1.00 38.15  ? 156 LYS A O     1 
ATOM   1984 C CB    . LYS B 2 155 ? 7.167   18.092 23.069  1.00 39.35  ? 156 LYS A CB    1 
ATOM   1985 C CG    . LYS B 2 155 ? 7.788   19.149 23.956  1.00 39.89  ? 156 LYS A CG    1 
ATOM   1986 C CD    . LYS B 2 155 ? 6.951   19.400 25.200  1.00 39.58  ? 156 LYS A CD    1 
ATOM   1987 C CE    . LYS B 2 155 ? 7.758   20.124 26.282  1.00 39.20  ? 156 LYS A CE    1 
ATOM   1988 N NZ    . LYS B 2 155 ? 8.982   19.354 26.679  1.00 38.28  ? 156 LYS A NZ    1 
ATOM   1989 N N     . ALA B 2 156 ? 8.079   18.635 20.327  1.00 37.72  ? 157 ALA A N     1 
ATOM   1990 C CA    . ALA B 2 156 ? 8.974   19.192 19.321  1.00 37.37  ? 157 ALA A CA    1 
ATOM   1991 C C     . ALA B 2 156 ? 8.232   20.135 18.375  1.00 37.58  ? 157 ALA A C     1 
ATOM   1992 O O     . ALA B 2 156 ? 8.734   21.214 18.038  1.00 37.66  ? 157 ALA A O     1 
ATOM   1993 C CB    . ALA B 2 156 ? 9.631   18.070 18.531  1.00 36.78  ? 157 ALA A CB    1 
ATOM   1994 N N     . ASN B 2 157 ? 7.036   19.737 17.953  1.00 37.24  ? 158 ASN A N     1 
ATOM   1995 C CA    . ASN B 2 157 ? 6.259   20.576 17.047  1.00 37.33  ? 158 ASN A CA    1 
ATOM   1996 C C     . ASN B 2 157 ? 5.209   21.487 17.674  1.00 37.35  ? 158 ASN A C     1 
ATOM   1997 O O     . ASN B 2 157 ? 4.220   21.823 17.026  1.00 36.99  ? 158 ASN A O     1 
ATOM   1998 C CB    . ASN B 2 157 ? 5.628   19.717 15.974  1.00 37.68  ? 158 ASN A CB    1 
ATOM   1999 C CG    . ASN B 2 157 ? 6.650   18.941 15.207  1.00 39.46  ? 158 ASN A CG    1 
ATOM   2000 O OD1   . ASN B 2 157 ? 7.454   19.513 14.468  1.00 39.91  ? 158 ASN A OD1   1 
ATOM   2001 N ND2   . ASN B 2 157 ? 6.649   17.626 15.389  1.00 41.17  ? 158 ASN A ND2   1 
ATOM   2002 N N     . GLY B 2 158 ? 5.420   21.861 18.937  1.00 37.60  ? 159 GLY A N     1 
ATOM   2003 C CA    . GLY B 2 158 ? 4.499   22.729 19.670  1.00 36.64  ? 159 GLY A CA    1 
ATOM   2004 C C     . GLY B 2 158 ? 3.028   22.397 19.870  1.00 35.92  ? 159 GLY A C     1 
ATOM   2005 O O     . GLY B 2 158 ? 2.195   23.300 19.926  1.00 34.79  ? 159 GLY A O     1 
ATOM   2006 N N     . ILE B 2 159 ? 2.694   21.121 19.998  1.00 35.97  ? 160 ILE A N     1 
ATOM   2007 C CA    . ILE B 2 159 ? 1.304   20.743 20.205  1.00 37.06  ? 160 ILE A CA    1 
ATOM   2008 C C     . ILE B 2 159 ? 1.144   19.627 21.242  1.00 38.81  ? 160 ILE A C     1 
ATOM   2009 O O     . ILE B 2 159 ? 0.241   18.793 21.128  1.00 39.13  ? 160 ILE A O     1 
ATOM   2010 C CB    . ILE B 2 159 ? 0.628   20.296 18.877  1.00 35.48  ? 160 ILE A CB    1 
ATOM   2011 C CG1   . ILE B 2 159 ? 1.491   19.263 18.161  1.00 33.15  ? 160 ILE A CG1   1 
ATOM   2012 C CG2   . ILE B 2 159 ? 0.364   21.493 17.998  1.00 34.73  ? 160 ILE A CG2   1 
ATOM   2013 C CD1   . ILE B 2 159 ? 0.883   18.794 16.877  1.00 32.76  ? 160 ILE A CD1   1 
ATOM   2014 N N     . TYR B 2 160 ? 2.011   19.618 22.255  1.00 40.49  ? 161 TYR A N     1 
ATOM   2015 C CA    . TYR B 2 160 ? 1.936   18.600 23.295  1.00 42.13  ? 161 TYR A CA    1 
ATOM   2016 C C     . TYR B 2 160 ? 1.007   18.913 24.479  1.00 43.02  ? 161 TYR A C     1 
ATOM   2017 O O     . TYR B 2 160 ? 0.204   18.068 24.867  1.00 44.30  ? 161 TYR A O     1 
ATOM   2018 C CB    . TYR B 2 160 ? 3.323   18.257 23.832  1.00 42.59  ? 161 TYR A CB    1 
ATOM   2019 C CG    . TYR B 2 160 ? 3.253   17.292 24.996  1.00 43.70  ? 161 TYR A CG    1 
ATOM   2020 C CD1   . TYR B 2 160 ? 2.378   16.199 24.967  1.00 43.49  ? 161 TYR A CD1   1 
ATOM   2021 C CD2   . TYR B 2 160 ? 4.038   17.479 26.139  1.00 44.22  ? 161 TYR A CD2   1 
ATOM   2022 C CE1   . TYR B 2 160 ? 2.281   15.323 26.049  1.00 44.01  ? 161 TYR A CE1   1 
ATOM   2023 C CE2   . TYR B 2 160 ? 3.952   16.598 27.230  1.00 43.61  ? 161 TYR A CE2   1 
ATOM   2024 C CZ    . TYR B 2 160 ? 3.070   15.525 27.174  1.00 43.56  ? 161 TYR A CZ    1 
ATOM   2025 O OH    . TYR B 2 160 ? 2.978   14.640 28.225  1.00 42.68  ? 161 TYR A OH    1 
ATOM   2026 N N     . GLY B 2 161 ? 1.101   20.095 25.075  1.00 42.54  ? 162 GLY A N     1 
ATOM   2027 C CA    . GLY B 2 161 ? 0.206   20.383 26.190  1.00 42.51  ? 162 GLY A CA    1 
ATOM   2028 C C     . GLY B 2 161 ? -1.284  20.371 25.852  1.00 41.59  ? 162 GLY A C     1 
ATOM   2029 O O     . GLY B 2 161 ? -1.669  20.456 24.690  1.00 41.57  ? 162 GLY A O     1 
ATOM   2030 N N     . ALA B 2 162 ? -2.134  20.251 26.866  1.00 42.11  ? 163 ALA A N     1 
ATOM   2031 C CA    . ALA B 2 162 ? -3.585  20.265 26.643  1.00 42.28  ? 163 ALA A CA    1 
ATOM   2032 C C     . ALA B 2 162 ? -4.205  21.511 27.260  1.00 41.64  ? 163 ALA A C     1 
ATOM   2033 O O     . ALA B 2 162 ? -5.404  21.742 27.151  1.00 40.55  ? 163 ALA A O     1 
ATOM   2034 C CB    . ALA B 2 162 ? -4.244  19.016 27.231  1.00 43.03  ? 163 ALA A CB    1 
ATOM   2035 N N     . GLU B 2 163 ? -3.377  22.307 27.923  1.00 42.04  ? 164 GLU A N     1 
ATOM   2036 C CA    . GLU B 2 163 ? -3.833  23.544 28.534  1.00 41.77  ? 164 GLU A CA    1 
ATOM   2037 C C     . GLU B 2 163 ? -4.218  24.498 27.410  1.00 41.01  ? 164 GLU A C     1 
ATOM   2038 O O     . GLU B 2 163 ? -3.924  24.245 26.238  1.00 41.11  ? 164 GLU A O     1 
ATOM   2039 C CB    . GLU B 2 163 ? -2.724  24.163 29.389  1.00 43.52  ? 164 GLU A CB    1 
ATOM   2040 C CG    . GLU B 2 163 ? -1.437  24.543 28.644  1.00 45.24  ? 164 GLU A CG    1 
ATOM   2041 C CD    . GLU B 2 163 ? -0.489  23.364 28.412  1.00 47.14  ? 164 GLU A CD    1 
ATOM   2042 O OE1   . GLU B 2 163 ? 0.733   23.603 28.258  1.00 46.97  ? 164 GLU A OE1   1 
ATOM   2043 O OE2   . GLU B 2 163 ? -0.951  22.199 28.375  1.00 47.59  ? 164 GLU A OE2   1 
ATOM   2044 N N     . TYR B 2 164 ? -4.870  25.596 27.768  1.00 39.07  ? 165 TYR A N     1 
ATOM   2045 C CA    . TYR B 2 164 ? -5.323  26.556 26.776  1.00 36.94  ? 165 TYR A CA    1 
ATOM   2046 C C     . TYR B 2 164 ? -4.252  27.307 25.998  1.00 36.51  ? 165 TYR A C     1 
ATOM   2047 O O     . TYR B 2 164 ? -4.568  28.038 25.058  1.00 35.92  ? 165 TYR A O     1 
ATOM   2048 C CB    . TYR B 2 164 ? -6.301  27.532 27.416  1.00 35.68  ? 165 TYR A CB    1 
ATOM   2049 C CG    . TYR B 2 164 ? -7.723  27.020 27.427  1.00 35.64  ? 165 TYR A CG    1 
ATOM   2050 C CD1   . TYR B 2 164 ? -8.321  26.551 28.598  1.00 35.27  ? 165 TYR A CD1   1 
ATOM   2051 C CD2   . TYR B 2 164 ? -8.496  27.059 26.262  1.00 36.13  ? 165 TYR A CD2   1 
ATOM   2052 C CE1   . TYR B 2 164 ? -9.671  26.146 28.601  1.00 35.08  ? 165 TYR A CE1   1 
ATOM   2053 C CE2   . TYR B 2 164 ? -9.826  26.664 26.254  1.00 34.72  ? 165 TYR A CE2   1 
ATOM   2054 C CZ    . TYR B 2 164 ? -10.413 26.217 27.416  1.00 34.72  ? 165 TYR A CZ    1 
ATOM   2055 O OH    . TYR B 2 164 ? -11.753 25.902 27.386  1.00 34.94  ? 165 TYR A OH    1 
ATOM   2056 N N     . LYS B 2 165 ? -2.985  27.138 26.365  1.00 36.37  ? 166 LYS A N     1 
ATOM   2057 C CA    . LYS B 2 165 ? -1.926  27.805 25.613  1.00 35.46  ? 166 LYS A CA    1 
ATOM   2058 C C     . LYS B 2 165 ? -1.494  26.953 24.423  1.00 34.85  ? 166 LYS A C     1 
ATOM   2059 O O     . LYS B 2 165 ? -0.974  27.468 23.456  1.00 34.43  ? 166 LYS A O     1 
ATOM   2060 C CB    . LYS B 2 165 ? -0.706  28.072 26.486  1.00 36.11  ? 166 LYS A CB    1 
ATOM   2061 C CG    . LYS B 2 165 ? 0.473   28.630 25.688  1.00 36.89  ? 166 LYS A CG    1 
ATOM   2062 C CD    . LYS B 2 165 ? 1.691   28.933 26.557  1.00 37.83  ? 166 LYS A CD    1 
ATOM   2063 C CE    . LYS B 2 165 ? 2.648   29.904 25.849  1.00 38.47  ? 166 LYS A CE    1 
ATOM   2064 N NZ    . LYS B 2 165 ? 3.814   30.311 26.699  1.00 40.02  ? 166 LYS A NZ    1 
ATOM   2065 N N     . VAL B 2 166 ? -1.705  25.646 24.505  1.00 35.04  ? 167 VAL A N     1 
ATOM   2066 C CA    . VAL B 2 166 ? -1.321  24.736 23.441  1.00 34.06  ? 167 VAL A CA    1 
ATOM   2067 C C     . VAL B 2 166 ? -2.522  24.186 22.699  1.00 35.38  ? 167 VAL A C     1 
ATOM   2068 O O     . VAL B 2 166 ? -2.547  24.185 21.472  1.00 36.20  ? 167 VAL A O     1 
ATOM   2069 C CB    . VAL B 2 166 ? -0.574  23.522 23.993  1.00 33.09  ? 167 VAL A CB    1 
ATOM   2070 C CG1   . VAL B 2 166 ? -0.125  22.631 22.849  1.00 32.14  ? 167 VAL A CG1   1 
ATOM   2071 C CG2   . VAL B 2 166 ? 0.594   23.964 24.830  1.00 31.86  ? 167 VAL A CG2   1 
ATOM   2072 N N     . ARG B 2 167 ? -3.516  23.712 23.450  1.00 37.00  ? 168 ARG A N     1 
ATOM   2073 C CA    . ARG B 2 167 ? -4.697  23.110 22.852  1.00 38.04  ? 168 ARG A CA    1 
ATOM   2074 C C     . ARG B 2 167 ? -4.221  21.973 21.954  1.00 37.76  ? 168 ARG A C     1 
ATOM   2075 O O     . ARG B 2 167 ? -4.482  21.943 20.748  1.00 37.73  ? 168 ARG A O     1 
ATOM   2076 C CB    . ARG B 2 167 ? -5.462  24.147 22.043  1.00 40.59  ? 168 ARG A CB    1 
ATOM   2077 C CG    . ARG B 2 167 ? -6.358  25.037 22.877  1.00 44.02  ? 168 ARG A CG    1 
ATOM   2078 C CD    . ARG B 2 167 ? -6.630  26.301 22.117  1.00 46.52  ? 168 ARG A CD    1 
ATOM   2079 N NE    . ARG B 2 167 ? -7.770  27.039 22.641  1.00 49.76  ? 168 ARG A NE    1 
ATOM   2080 C CZ    . ARG B 2 167 ? -9.017  26.584 22.639  1.00 51.37  ? 168 ARG A CZ    1 
ATOM   2081 N NH1   . ARG B 2 167 ? -9.288  25.372 22.149  1.00 52.19  ? 168 ARG A NH1   1 
ATOM   2082 N NH2   . ARG B 2 167 ? -9.998  27.364 23.083  1.00 50.33  ? 168 ARG A NH2   1 
ATOM   2083 N N     . GLY B 2 168 ? -3.507  21.042 22.576  1.00 37.35  ? 169 GLY A N     1 
ATOM   2084 C CA    . GLY B 2 168 ? -2.968  19.901 21.873  1.00 37.85  ? 169 GLY A CA    1 
ATOM   2085 C C     . GLY B 2 168 ? -3.408  18.596 22.499  1.00 38.88  ? 169 GLY A C     1 
ATOM   2086 O O     . GLY B 2 168 ? -4.568  18.451 22.876  1.00 39.40  ? 169 GLY A O     1 
ATOM   2087 N N     . PHE B 2 169 ? -2.469  17.661 22.633  1.00 39.32  ? 170 PHE A N     1 
ATOM   2088 C CA    . PHE B 2 169 ? -2.734  16.326 23.176  1.00 39.40  ? 170 PHE A CA    1 
ATOM   2089 C C     . PHE B 2 169 ? -2.297  16.199 24.633  1.00 39.36  ? 170 PHE A C     1 
ATOM   2090 O O     . PHE B 2 169 ? -1.107  16.302 24.925  1.00 40.08  ? 170 PHE A O     1 
ATOM   2091 C CB    . PHE B 2 169 ? -1.971  15.259 22.357  1.00 40.56  ? 170 PHE A CB    1 
ATOM   2092 C CG    . PHE B 2 169 ? -2.301  15.248 20.877  1.00 41.34  ? 170 PHE A CG    1 
ATOM   2093 C CD1   . PHE B 2 169 ? -2.288  16.426 20.125  1.00 41.98  ? 170 PHE A CD1   1 
ATOM   2094 C CD2   . PHE B 2 169 ? -2.621  14.061 20.236  1.00 40.95  ? 170 PHE A CD2   1 
ATOM   2095 C CE1   . PHE B 2 169 ? -2.591  16.416 18.769  1.00 40.72  ? 170 PHE A CE1   1 
ATOM   2096 C CE2   . PHE B 2 169 ? -2.926  14.043 18.875  1.00 41.45  ? 170 PHE A CE2   1 
ATOM   2097 C CZ    . PHE B 2 169 ? -2.911  15.224 18.144  1.00 41.42  ? 170 PHE A CZ    1 
ATOM   2098 N N     . SER B 2 170 ? -3.230  15.956 25.550  1.00 38.20  ? 171 SER A N     1 
ATOM   2099 C CA    . SER B 2 170 ? -2.831  15.800 26.945  1.00 36.33  ? 171 SER A CA    1 
ATOM   2100 C C     . SER B 2 170 ? -2.070  14.484 27.052  1.00 36.05  ? 171 SER A C     1 
ATOM   2101 O O     . SER B 2 170 ? -2.278  13.563 26.250  1.00 35.09  ? 171 SER A O     1 
ATOM   2102 C CB    . SER B 2 170 ? -4.046  15.768 27.876  1.00 36.13  ? 171 SER A CB    1 
ATOM   2103 O OG    . SER B 2 170 ? -4.672  14.496 27.863  1.00 35.19  ? 171 SER A OG    1 
ATOM   2104 N N     . GLY B 2 171 ? -1.174  14.412 28.033  1.00 36.34  ? 172 GLY A N     1 
ATOM   2105 C CA    . GLY B 2 171 ? -0.387  13.208 28.246  1.00 36.84  ? 172 GLY A CA    1 
ATOM   2106 C C     . GLY B 2 171 ? -1.255  11.961 28.259  1.00 37.04  ? 172 GLY A C     1 
ATOM   2107 O O     . GLY B 2 171 ? -0.913  10.958 27.625  1.00 37.74  ? 172 GLY A O     1 
ATOM   2108 N N     . TYR B 2 172 ? -2.376  12.016 28.982  1.00 36.69  ? 173 TYR A N     1 
ATOM   2109 C CA    . TYR B 2 172 ? -3.302  10.887 29.062  1.00 35.37  ? 173 TYR A CA    1 
ATOM   2110 C C     . TYR B 2 172 ? -3.671  10.486 27.648  1.00 35.42  ? 173 TYR A C     1 
ATOM   2111 O O     . TYR B 2 172 ? -3.458  9.342  27.246  1.00 35.98  ? 173 TYR A O     1 
ATOM   2112 C CB    . TYR B 2 172 ? -4.553  11.300 29.825  1.00 35.31  ? 173 TYR A CB    1 
ATOM   2113 C CG    . TYR B 2 172 ? -5.626  10.240 29.949  1.00 35.00  ? 173 TYR A CG    1 
ATOM   2114 C CD1   . TYR B 2 172 ? -5.317  8.944  30.358  1.00 34.92  ? 173 TYR A CD1   1 
ATOM   2115 C CD2   . TYR B 2 172 ? -6.965  10.562 29.736  1.00 34.46  ? 173 TYR A CD2   1 
ATOM   2116 C CE1   . TYR B 2 172 ? -6.321  7.994  30.561  1.00 34.69  ? 173 TYR A CE1   1 
ATOM   2117 C CE2   . TYR B 2 172 ? -7.971  9.628  29.934  1.00 36.22  ? 173 TYR A CE2   1 
ATOM   2118 C CZ    . TYR B 2 172 ? -7.645  8.345  30.348  1.00 35.77  ? 173 TYR A CZ    1 
ATOM   2119 O OH    . TYR B 2 172 ? -8.656  7.429  30.556  1.00 36.85  ? 173 TYR A OH    1 
ATOM   2120 N N     . LEU B 2 173 ? -4.215  11.432 26.887  1.00 34.37  ? 174 LEU A N     1 
ATOM   2121 C CA    . LEU B 2 173 ? -4.581  11.149 25.509  1.00 34.56  ? 174 LEU A CA    1 
ATOM   2122 C C     . LEU B 2 173 ? -3.438  10.428 24.805  1.00 35.68  ? 174 LEU A C     1 
ATOM   2123 O O     . LEU B 2 173 ? -3.668  9.477  24.059  1.00 35.24  ? 174 LEU A O     1 
ATOM   2124 C CB    . LEU B 2 173 ? -4.896  12.439 24.753  1.00 33.24  ? 174 LEU A CB    1 
ATOM   2125 C CG    . LEU B 2 173 ? -5.207  12.201 23.275  1.00 30.46  ? 174 LEU A CG    1 
ATOM   2126 C CD1   . LEU B 2 173 ? -6.316  11.168 23.138  1.00 28.87  ? 174 LEU A CD1   1 
ATOM   2127 C CD2   . LEU B 2 173 ? -5.615  13.510 22.640  1.00 30.77  ? 174 LEU A CD2   1 
ATOM   2128 N N     . CYS B 2 174 ? -2.207  10.883 25.031  1.00 36.60  ? 175 CYS A N     1 
ATOM   2129 C CA    . CYS B 2 174 ? -1.064  10.237 24.402  1.00 37.94  ? 175 CYS A CA    1 
ATOM   2130 C C     . CYS B 2 174 ? -1.003  8.746  24.713  1.00 38.26  ? 175 CYS A C     1 
ATOM   2131 O O     . CYS B 2 174 ? -1.028  7.917  23.799  1.00 39.53  ? 175 CYS A O     1 
ATOM   2132 C CB    . CYS B 2 174 ? 0.230   10.893 24.839  1.00 39.10  ? 175 CYS A CB    1 
ATOM   2133 S SG    . CYS B 2 174 ? 0.645   12.335 23.852  1.00 43.12  ? 175 CYS A SG    1 
ATOM   2134 N N     . GLU B 2 175 ? -0.910  8.400  25.994  1.00 36.62  ? 176 GLU A N     1 
ATOM   2135 C CA    . GLU B 2 175 ? -0.863  7.003  26.378  1.00 35.29  ? 176 GLU A CA    1 
ATOM   2136 C C     . GLU B 2 175 ? -2.080  6.246  25.828  1.00 34.41  ? 176 GLU A C     1 
ATOM   2137 O O     . GLU B 2 175 ? -1.951  5.141  25.296  1.00 33.96  ? 176 GLU A O     1 
ATOM   2138 C CB    . GLU B 2 175 ? -0.800  6.898  27.893  1.00 36.68  ? 176 GLU A CB    1 
ATOM   2139 C CG    . GLU B 2 175 ? 0.535   7.345  28.450  1.00 40.72  ? 176 GLU A CG    1 
ATOM   2140 C CD    . GLU B 2 175 ? 0.650   7.135  29.947  1.00 41.91  ? 176 GLU A CD    1 
ATOM   2141 O OE1   . GLU B 2 175 ? 0.277   6.041  30.424  1.00 42.87  ? 176 GLU A OE1   1 
ATOM   2142 O OE2   . GLU B 2 175 ? 1.124   8.061  30.643  1.00 43.08  ? 176 GLU A OE2   1 
ATOM   2143 N N     . LEU B 2 176 ? -3.263  6.839  25.949  1.00 33.43  ? 177 LEU A N     1 
ATOM   2144 C CA    . LEU B 2 176 ? -4.465  6.205  25.434  1.00 33.44  ? 177 LEU A CA    1 
ATOM   2145 C C     . LEU B 2 176 ? -4.262  5.785  23.987  1.00 33.62  ? 177 LEU A C     1 
ATOM   2146 O O     . LEU B 2 176 ? -4.729  4.734  23.584  1.00 33.42  ? 177 LEU A O     1 
ATOM   2147 C CB    . LEU B 2 176 ? -5.663  7.151  25.510  1.00 33.57  ? 177 LEU A CB    1 
ATOM   2148 C CG    . LEU B 2 176 ? -6.363  7.344  26.862  1.00 34.29  ? 177 LEU A CG    1 
ATOM   2149 C CD1   . LEU B 2 176 ? -7.737  7.951  26.602  1.00 33.30  ? 177 LEU A CD1   1 
ATOM   2150 C CD2   . LEU B 2 176 ? -6.526  6.008  27.600  1.00 34.02  ? 177 LEU A CD2   1 
ATOM   2151 N N     . LEU B 2 177 ? -3.561  6.611  23.211  1.00 34.48  ? 178 LEU A N     1 
ATOM   2152 C CA    . LEU B 2 177 ? -3.310  6.310  21.801  1.00 34.56  ? 178 LEU A CA    1 
ATOM   2153 C C     . LEU B 2 177 ? -2.314  5.179  21.606  1.00 35.24  ? 178 LEU A C     1 
ATOM   2154 O O     . LEU B 2 177 ? -2.474  4.373  20.686  1.00 36.97  ? 178 LEU A O     1 
ATOM   2155 C CB    . LEU B 2 177 ? -2.828  7.554  21.040  1.00 33.59  ? 178 LEU A CB    1 
ATOM   2156 C CG    . LEU B 2 177 ? -3.930  8.590  20.804  1.00 33.42  ? 178 LEU A CG    1 
ATOM   2157 C CD1   . LEU B 2 177 ? -3.410  9.819  20.062  1.00 31.97  ? 178 LEU A CD1   1 
ATOM   2158 C CD2   . LEU B 2 177 ? -5.056  7.918  20.022  1.00 32.17  ? 178 LEU A CD2   1 
ATOM   2159 N N     . ILE B 2 178 ? -1.285  5.119  22.452  1.00 35.13  ? 179 ILE A N     1 
ATOM   2160 C CA    . ILE B 2 178 ? -0.306  4.046  22.345  1.00 35.14  ? 179 ILE A CA    1 
ATOM   2161 C C     . ILE B 2 178 ? -0.997  2.732  22.676  1.00 35.35  ? 179 ILE A C     1 
ATOM   2162 O O     . ILE B 2 178 ? -0.714  1.712  22.054  1.00 36.40  ? 179 ILE A O     1 
ATOM   2163 C CB    . ILE B 2 178 ? 0.880   4.217  23.315  1.00 34.84  ? 179 ILE A CB    1 
ATOM   2164 C CG1   . ILE B 2 178 ? 1.718   5.424  22.915  1.00 35.07  ? 179 ILE A CG1   1 
ATOM   2165 C CG2   . ILE B 2 178 ? 1.738   2.963  23.288  1.00 33.85  ? 179 ILE A CG2   1 
ATOM   2166 C CD1   . ILE B 2 178 ? 2.315   5.299  21.540  1.00 35.99  ? 179 ILE A CD1   1 
ATOM   2167 N N     . VAL B 2 179 ? -1.905  2.763  23.648  1.00 34.42  ? 180 VAL A N     1 
ATOM   2168 C CA    . VAL B 2 179 ? -2.650  1.571  24.044  1.00 35.47  ? 180 VAL A CA    1 
ATOM   2169 C C     . VAL B 2 179 ? -3.549  1.082  22.908  1.00 36.23  ? 180 VAL A C     1 
ATOM   2170 O O     . VAL B 2 179 ? -3.828  -0.105 22.793  1.00 37.00  ? 180 VAL A O     1 
ATOM   2171 C CB    . VAL B 2 179 ? -3.554  1.859  25.258  1.00 36.72  ? 180 VAL A CB    1 
ATOM   2172 C CG1   . VAL B 2 179 ? -4.594  0.777  25.415  1.00 37.33  ? 180 VAL A CG1   1 
ATOM   2173 C CG2   . VAL B 2 179 ? -2.720  1.945  26.513  1.00 37.72  ? 180 VAL A CG2   1 
ATOM   2174 N N     . PHE B 2 180 ? -4.006  2.010  22.077  1.00 36.32  ? 181 PHE A N     1 
ATOM   2175 C CA    . PHE B 2 180 ? -4.887  1.687  20.969  1.00 36.33  ? 181 PHE A CA    1 
ATOM   2176 C C     . PHE B 2 180 ? -4.144  1.213  19.727  1.00 37.30  ? 181 PHE A C     1 
ATOM   2177 O O     . PHE B 2 180 ? -4.488  0.184  19.131  1.00 36.85  ? 181 PHE A O     1 
ATOM   2178 C CB    . PHE B 2 180 ? -5.712  2.917  20.599  1.00 36.09  ? 181 PHE A CB    1 
ATOM   2179 C CG    . PHE B 2 180 ? -6.941  2.607  19.774  1.00 35.98  ? 181 PHE A CG    1 
ATOM   2180 C CD1   . PHE B 2 180 ? -8.116  2.184  20.384  1.00 34.49  ? 181 PHE A CD1   1 
ATOM   2181 C CD2   . PHE B 2 180 ? -6.927  2.759  18.389  1.00 35.89  ? 181 PHE A CD2   1 
ATOM   2182 C CE1   . PHE B 2 180 ? -9.247  1.927  19.630  1.00 33.83  ? 181 PHE A CE1   1 
ATOM   2183 C CE2   . PHE B 2 180 ? -8.056  2.501  17.633  1.00 33.73  ? 181 PHE A CE2   1 
ATOM   2184 C CZ    . PHE B 2 180 ? -9.214  2.087  18.254  1.00 33.76  ? 181 PHE A CZ    1 
ATOM   2185 N N     . TYR B 2 181 ? -3.130  1.973  19.330  1.00 38.16  ? 182 TYR A N     1 
ATOM   2186 C CA    . TYR B 2 181 ? -2.363  1.654  18.132  1.00 38.86  ? 182 TYR A CA    1 
ATOM   2187 C C     . TYR B 2 181 ? -1.193  0.710  18.342  1.00 39.34  ? 182 TYR A C     1 
ATOM   2188 O O     . TYR B 2 181 ? -0.650  0.167  17.375  1.00 39.24  ? 182 TYR A O     1 
ATOM   2189 C CB    . TYR B 2 181 ? -1.889  2.948  17.474  1.00 39.45  ? 182 TYR A CB    1 
ATOM   2190 C CG    . TYR B 2 181 ? -3.027  3.713  16.861  1.00 40.12  ? 182 TYR A CG    1 
ATOM   2191 C CD1   . TYR B 2 181 ? -3.819  3.130  15.874  1.00 41.31  ? 182 TYR A CD1   1 
ATOM   2192 C CD2   . TYR B 2 181 ? -3.343  4.996  17.288  1.00 39.90  ? 182 TYR A CD2   1 
ATOM   2193 C CE1   . TYR B 2 181 ? -4.906  3.805  15.325  1.00 41.50  ? 182 TYR A CE1   1 
ATOM   2194 C CE2   . TYR B 2 181 ? -4.429  5.685  16.748  1.00 40.54  ? 182 TYR A CE2   1 
ATOM   2195 C CZ    . TYR B 2 181 ? -5.207  5.080  15.767  1.00 41.10  ? 182 TYR A CZ    1 
ATOM   2196 O OH    . TYR B 2 181 ? -6.294  5.732  15.232  1.00 41.07  ? 182 TYR A OH    1 
ATOM   2197 N N     . GLY B 2 182 ? -0.798  0.517  19.600  1.00 39.43  ? 183 GLY A N     1 
ATOM   2198 C CA    . GLY B 2 182 ? 0.293   -0.405 19.893  1.00 40.26  ? 183 GLY A CA    1 
ATOM   2199 C C     . GLY B 2 182 ? 1.702   0.163  19.924  1.00 40.51  ? 183 GLY A C     1 
ATOM   2200 O O     . GLY B 2 182 ? 2.597   -0.418 20.554  1.00 41.36  ? 183 GLY A O     1 
ATOM   2201 N N     . SER B 2 183 ? 1.912   1.282  19.240  1.00 39.84  ? 184 SER A N     1 
ATOM   2202 C CA    . SER B 2 183 ? 3.222   1.907  19.214  1.00 40.27  ? 184 SER A CA    1 
ATOM   2203 C C     . SER B 2 183 ? 3.182   3.239  18.476  1.00 40.83  ? 184 SER A C     1 
ATOM   2204 O O     . SER B 2 183 ? 2.238   3.529  17.732  1.00 41.02  ? 184 SER A O     1 
ATOM   2205 C CB    . SER B 2 183 ? 4.242   0.984  18.544  1.00 40.51  ? 184 SER A CB    1 
ATOM   2206 O OG    . SER B 2 183 ? 3.976   0.825  17.157  1.00 41.29  ? 184 SER A OG    1 
ATOM   2207 N N     . PHE B 2 184 ? 4.218   4.047  18.692  1.00 40.46  ? 185 PHE A N     1 
ATOM   2208 C CA    . PHE B 2 184 ? 4.325   5.347  18.057  1.00 39.67  ? 185 PHE A CA    1 
ATOM   2209 C C     . PHE B 2 184 ? 4.082   5.280  16.561  1.00 39.75  ? 185 PHE A C     1 
ATOM   2210 O O     . PHE B 2 184 ? 3.253   6.009  16.023  1.00 40.25  ? 185 PHE A O     1 
ATOM   2211 C CB    . PHE B 2 184 ? 5.705   5.938  18.302  1.00 39.71  ? 185 PHE A CB    1 
ATOM   2212 C CG    . PHE B 2 184 ? 5.972   7.163  17.502  1.00 40.49  ? 185 PHE A CG    1 
ATOM   2213 C CD1   . PHE B 2 184 ? 6.793   7.109  16.384  1.00 41.19  ? 185 PHE A CD1   1 
ATOM   2214 C CD2   . PHE B 2 184 ? 5.388   8.375  17.853  1.00 41.06  ? 185 PHE A CD2   1 
ATOM   2215 C CE1   . PHE B 2 184 ? 7.032   8.247  15.622  1.00 42.13  ? 185 PHE A CE1   1 
ATOM   2216 C CE2   . PHE B 2 184 ? 5.616   9.521  17.104  1.00 41.54  ? 185 PHE A CE2   1 
ATOM   2217 C CZ    . PHE B 2 184 ? 6.442   9.461  15.984  1.00 42.57  ? 185 PHE A CZ    1 
ATOM   2218 N N     . LEU B 2 185 ? 4.809   4.397  15.889  1.00 39.44  ? 186 LEU A N     1 
ATOM   2219 C CA    . LEU B 2 185 ? 4.681   4.273  14.454  1.00 38.72  ? 186 LEU A CA    1 
ATOM   2220 C C     . LEU B 2 185 ? 3.262   3.944  14.011  1.00 38.74  ? 186 LEU A C     1 
ATOM   2221 O O     . LEU B 2 185 ? 2.739   4.562  13.083  1.00 38.69  ? 186 LEU A O     1 
ATOM   2222 C CB    . LEU B 2 185 ? 5.656   3.227  13.924  1.00 39.19  ? 186 LEU A CB    1 
ATOM   2223 C CG    . LEU B 2 185 ? 5.937   3.371  12.425  1.00 39.73  ? 186 LEU A CG    1 
ATOM   2224 C CD1   . LEU B 2 185 ? 6.478   4.765  12.142  1.00 39.66  ? 186 LEU A CD1   1 
ATOM   2225 C CD2   . LEU B 2 185 ? 6.926   2.325  11.972  1.00 39.18  ? 186 LEU A CD2   1 
ATOM   2226 N N     . GLU B 2 186 ? 2.621   2.982  14.658  1.00 39.09  ? 187 GLU A N     1 
ATOM   2227 C CA    . GLU B 2 186 ? 1.261   2.648  14.252  1.00 39.66  ? 187 GLU A CA    1 
ATOM   2228 C C     . GLU B 2 186 ? 0.349   3.839  14.445  1.00 39.00  ? 187 GLU A C     1 
ATOM   2229 O O     . GLU B 2 186 ? -0.616  4.033  13.702  1.00 39.78  ? 187 GLU A O     1 
ATOM   2230 C CB    . GLU B 2 186 ? 0.727   1.457  15.045  1.00 41.01  ? 187 GLU A CB    1 
ATOM   2231 C CG    . GLU B 2 186 ? 1.196   0.132  14.502  1.00 43.31  ? 187 GLU A CG    1 
ATOM   2232 C CD    . GLU B 2 186 ? 0.912   0.001  13.017  1.00 44.65  ? 187 GLU A CD    1 
ATOM   2233 O OE1   . GLU B 2 186 ? -0.279  -0.132 12.643  1.00 45.27  ? 187 GLU A OE1   1 
ATOM   2234 O OE2   . GLU B 2 186 ? 1.885   0.044  12.229  1.00 45.24  ? 187 GLU A OE2   1 
ATOM   2235 N N     . THR B 2 187 ? 0.657   4.641  15.453  1.00 37.85  ? 188 THR A N     1 
ATOM   2236 C CA    . THR B 2 187 ? -0.135  5.817  15.735  1.00 36.65  ? 188 THR A CA    1 
ATOM   2237 C C     . THR B 2 187 ? 0.023   6.797  14.569  1.00 36.86  ? 188 THR A C     1 
ATOM   2238 O O     . THR B 2 187 ? -0.956  7.206  13.941  1.00 37.00  ? 188 THR A O     1 
ATOM   2239 C CB    . THR B 2 187 ? 0.332   6.459  17.035  1.00 35.30  ? 188 THR A CB    1 
ATOM   2240 O OG1   . THR B 2 187 ? 0.436   5.446  18.044  1.00 34.64  ? 188 THR A OG1   1 
ATOM   2241 C CG2   . THR B 2 187 ? -0.661  7.513  17.490  1.00 35.08  ? 188 THR A CG2   1 
ATOM   2242 N N     . VAL B 2 188 ? 1.267   7.144  14.268  1.00 36.88  ? 189 VAL A N     1 
ATOM   2243 C CA    . VAL B 2 188 ? 1.584   8.068  13.187  1.00 37.08  ? 189 VAL A CA    1 
ATOM   2244 C C     . VAL B 2 188 ? 1.076   7.564  11.833  1.00 37.69  ? 189 VAL A C     1 
ATOM   2245 O O     . VAL B 2 188 ? 0.630   8.351  11.001  1.00 38.24  ? 189 VAL A O     1 
ATOM   2246 C CB    . VAL B 2 188 ? 3.123   8.306  13.109  1.00 37.27  ? 189 VAL A CB    1 
ATOM   2247 C CG1   . VAL B 2 188 ? 3.475   9.074  11.843  1.00 38.75  ? 189 VAL A CG1   1 
ATOM   2248 C CG2   . VAL B 2 188 ? 3.599   9.075  14.334  1.00 36.39  ? 189 VAL A CG2   1 
ATOM   2249 N N     . LYS B 2 189 ? 1.144   6.255  11.611  1.00 38.11  ? 190 LYS A N     1 
ATOM   2250 C CA    . LYS B 2 189 ? 0.684   5.673  10.352  1.00 37.85  ? 190 LYS A CA    1 
ATOM   2251 C C     . LYS B 2 189 ? -0.824  5.785  10.192  1.00 36.65  ? 190 LYS A C     1 
ATOM   2252 O O     . LYS B 2 189 ? -1.331  5.898  9.078   1.00 36.89  ? 190 LYS A O     1 
ATOM   2253 C CB    . LYS B 2 189 ? 1.072   4.201  10.272  1.00 40.03  ? 190 LYS A CB    1 
ATOM   2254 C CG    . LYS B 2 189 ? 2.532   3.958  9.946   1.00 43.57  ? 190 LYS A CG    1 
ATOM   2255 C CD    . LYS B 2 189 ? 2.799   2.471  9.758   1.00 46.25  ? 190 LYS A CD    1 
ATOM   2256 C CE    . LYS B 2 189 ? 4.239   2.235  9.351   1.00 49.09  ? 190 LYS A CE    1 
ATOM   2257 N NZ    . LYS B 2 189 ? 4.518   0.793  9.087   1.00 51.64  ? 190 LYS A NZ    1 
ATOM   2258 N N     . ASN B 2 190 ? -1.534  5.747  11.310  1.00 36.03  ? 191 ASN A N     1 
ATOM   2259 C CA    . ASN B 2 190 ? -2.980  5.829  11.290  1.00 36.08  ? 191 ASN A CA    1 
ATOM   2260 C C     . ASN B 2 190 ? -3.529  7.233  11.365  1.00 35.39  ? 191 ASN A C     1 
ATOM   2261 O O     . ASN B 2 190 ? -4.581  7.522  10.806  1.00 35.28  ? 191 ASN A O     1 
ATOM   2262 C CB    . ASN B 2 190 ? -3.548  4.993  12.421  1.00 37.44  ? 191 ASN A CB    1 
ATOM   2263 C CG    . ASN B 2 190 ? -3.527  3.522  12.103  1.00 38.91  ? 191 ASN A CG    1 
ATOM   2264 O OD1   . ASN B 2 190 ? -4.294  3.046  11.264  1.00 38.55  ? 191 ASN A OD1   1 
ATOM   2265 N ND2   . ASN B 2 190 ? -2.638  2.793  12.757  1.00 40.12  ? 191 ASN A ND2   1 
ATOM   2266 N N     . ALA B 2 191 ? -2.822  8.112  12.054  1.00 34.88  ? 192 ALA A N     1 
ATOM   2267 C CA    . ALA B 2 191 ? -3.274  9.486  12.179  1.00 34.80  ? 192 ALA A CA    1 
ATOM   2268 C C     . ALA B 2 191 ? -3.436  10.123 10.802  1.00 35.30  ? 192 ALA A C     1 
ATOM   2269 O O     . ALA B 2 191 ? -4.207  11.069 10.631  1.00 35.71  ? 192 ALA A O     1 
ATOM   2270 C CB    . ALA B 2 191 ? -2.285  10.274 13.003  1.00 33.97  ? 192 ALA A CB    1 
ATOM   2271 N N     . ARG B 2 192 ? -2.700  9.601  9.826   1.00 35.58  ? 193 ARG A N     1 
ATOM   2272 C CA    . ARG B 2 192 ? -2.753  10.119 8.470   1.00 36.47  ? 193 ARG A CA    1 
ATOM   2273 C C     . ARG B 2 192 ? -4.115  9.933  7.841   1.00 37.84  ? 193 ARG A C     1 
ATOM   2274 O O     . ARG B 2 192 ? -4.432  10.554 6.827   1.00 37.80  ? 193 ARG A O     1 
ATOM   2275 C CB    . ARG B 2 192 ? -1.718  9.430  7.601   1.00 36.76  ? 193 ARG A CB    1 
ATOM   2276 C CG    . ARG B 2 192 ? -0.316  9.856  7.887   1.00 38.20  ? 193 ARG A CG    1 
ATOM   2277 C CD    . ARG B 2 192 ? 0.601   9.288  6.849   1.00 38.70  ? 193 ARG A CD    1 
ATOM   2278 N NE    . ARG B 2 192 ? 0.592   7.835  6.897   1.00 39.24  ? 193 ARG A NE    1 
ATOM   2279 C CZ    . ARG B 2 192 ? 1.276   7.058  6.062   1.00 39.63  ? 193 ARG A CZ    1 
ATOM   2280 N NH1   . ARG B 2 192 ? 2.024   7.608  5.103   1.00 40.34  ? 193 ARG A NH1   1 
ATOM   2281 N NH2   . ARG B 2 192 ? 1.229   5.734  6.199   1.00 37.84  ? 193 ARG A NH2   1 
ATOM   2282 N N     . ARG B 2 193 ? -4.921  9.065  8.435   1.00 39.46  ? 194 ARG A N     1 
ATOM   2283 C CA    . ARG B 2 193 ? -6.254  8.806  7.921   1.00 41.01  ? 194 ARG A CA    1 
ATOM   2284 C C     . ARG B 2 193 ? -7.284  9.412  8.862   1.00 40.63  ? 194 ARG A C     1 
ATOM   2285 O O     . ARG B 2 193 ? -8.466  9.095  8.792   1.00 41.93  ? 194 ARG A O     1 
ATOM   2286 C CB    . ARG B 2 193 ? -6.478  7.305  7.792   1.00 43.29  ? 194 ARG A CB    1 
ATOM   2287 C CG    . ARG B 2 193 ? -5.396  6.604  6.992   1.00 48.68  ? 194 ARG A CG    1 
ATOM   2288 C CD    . ARG B 2 193 ? -5.708  6.598  5.505   1.00 53.98  ? 194 ARG A CD    1 
ATOM   2289 N NE    . ARG B 2 193 ? -6.503  5.427  5.132   1.00 58.13  ? 194 ARG A NE    1 
ATOM   2290 C CZ    . ARG B 2 193 ? -6.019  4.191  5.048   1.00 59.56  ? 194 ARG A CZ    1 
ATOM   2291 N NH1   . ARG B 2 193 ? -4.734  3.967  5.305   1.00 60.48  ? 194 ARG A NH1   1 
ATOM   2292 N NH2   . ARG B 2 193 ? -6.819  3.177  4.723   1.00 60.62  ? 194 ARG A NH2   1 
ATOM   2293 N N     . TRP B 2 194 ? -6.832  10.280 9.757   1.00 39.63  ? 195 TRP A N     1 
ATOM   2294 C CA    . TRP B 2 194 ? -7.744  10.937 10.678  1.00 38.56  ? 195 TRP A CA    1 
ATOM   2295 C C     . TRP B 2 194 ? -8.427  12.111 9.962   1.00 38.77  ? 195 TRP A C     1 
ATOM   2296 O O     . TRP B 2 194 ? -7.841  12.760 9.090   1.00 38.79  ? 195 TRP A O     1 
ATOM   2297 C CB    . TRP B 2 194 ? -6.989  11.457 11.905  1.00 37.23  ? 195 TRP A CB    1 
ATOM   2298 C CG    . TRP B 2 194 ? -6.609  10.418 12.927  1.00 35.03  ? 195 TRP A CG    1 
ATOM   2299 C CD1   . TRP B 2 194 ? -6.871  9.085  12.876  1.00 34.83  ? 195 TRP A CD1   1 
ATOM   2300 C CD2   . TRP B 2 194 ? -5.889  10.638 14.156  1.00 33.20  ? 195 TRP A CD2   1 
ATOM   2301 N NE1   . TRP B 2 194 ? -6.360  8.454  13.989  1.00 33.49  ? 195 TRP A NE1   1 
ATOM   2302 C CE2   . TRP B 2 194 ? -5.755  9.382  14.790  1.00 33.22  ? 195 TRP A CE2   1 
ATOM   2303 C CE3   . TRP B 2 194 ? -5.349  11.770 14.776  1.00 31.52  ? 195 TRP A CE3   1 
ATOM   2304 C CZ2   . TRP B 2 194 ? -5.097  9.227  16.017  1.00 32.70  ? 195 TRP A CZ2   1 
ATOM   2305 C CZ3   . TRP B 2 194 ? -4.698  11.616 15.990  1.00 31.17  ? 195 TRP A CZ3   1 
ATOM   2306 C CH2   . TRP B 2 194 ? -4.578  10.353 16.600  1.00 31.54  ? 195 TRP A CH2   1 
ATOM   2307 N N     . THR B 2 195 ? -9.669  12.373 10.341  1.00 38.50  ? 196 THR A N     1 
ATOM   2308 C CA    . THR B 2 195 ? -10.447 13.451 9.764   1.00 38.66  ? 196 THR A CA    1 
ATOM   2309 C C     . THR B 2 195 ? -11.028 14.187 10.946  1.00 40.60  ? 196 THR A C     1 
ATOM   2310 O O     . THR B 2 195 ? -10.845 13.742 12.083  1.00 42.25  ? 196 THR A O     1 
ATOM   2311 C CB    . THR B 2 195 ? -11.609 12.910 8.944   1.00 37.84  ? 196 THR A CB    1 
ATOM   2312 O OG1   . THR B 2 195 ? -12.687 12.530 9.822   1.00 35.86  ? 196 THR A OG1   1 
ATOM   2313 C CG2   . THR B 2 195 ? -11.141 11.722 8.123   1.00 35.48  ? 196 THR A CG2   1 
ATOM   2314 N N     . ARG B 2 196 ? -11.736 15.289 10.708  1.00 41.01  ? 197 ARG A N     1 
ATOM   2315 C CA    . ARG B 2 196 ? -12.324 16.019 11.829  1.00 41.91  ? 197 ARG A CA    1 
ATOM   2316 C C     . ARG B 2 196 ? -13.580 15.298 12.314  1.00 42.05  ? 197 ARG A C     1 
ATOM   2317 O O     . ARG B 2 196 ? -14.192 15.685 13.305  1.00 42.17  ? 197 ARG A O     1 
ATOM   2318 C CB    . ARG B 2 196 ? -12.634 17.479 11.431  1.00 42.17  ? 197 ARG A CB    1 
ATOM   2319 C CG    . ARG B 2 196 ? -13.726 17.683 10.385  1.00 42.58  ? 197 ARG A CG    1 
ATOM   2320 C CD    . ARG B 2 196 ? -13.623 19.057 9.702   1.00 42.96  ? 197 ARG A CD    1 
ATOM   2321 N NE    . ARG B 2 196 ? -12.454 19.124 8.830   1.00 43.49  ? 197 ARG A NE    1 
ATOM   2322 C CZ    . ARG B 2 196 ? -12.076 20.193 8.133   1.00 43.52  ? 197 ARG A CZ    1 
ATOM   2323 N NH1   . ARG B 2 196 ? -12.773 21.316 8.200   1.00 42.67  ? 197 ARG A NH1   1 
ATOM   2324 N NH2   . ARG B 2 196 ? -11.004 20.129 7.346   1.00 43.69  ? 197 ARG A NH2   1 
ATOM   2325 N N     . ARG B 2 197 ? -13.951 14.225 11.626  1.00 42.68  ? 198 ARG A N     1 
ATOM   2326 C CA    . ARG B 2 197 ? -15.140 13.489 12.021  1.00 43.54  ? 198 ARG A CA    1 
ATOM   2327 C C     . ARG B 2 197 ? -14.841 12.150 12.673  1.00 42.52  ? 198 ARG A C     1 
ATOM   2328 O O     . ARG B 2 197 ? -15.758 11.390 13.005  1.00 42.86  ? 198 ARG A O     1 
ATOM   2329 C CB    . ARG B 2 197 ? -16.060 13.281 10.818  1.00 45.73  ? 198 ARG A CB    1 
ATOM   2330 C CG    . ARG B 2 197 ? -16.903 14.497 10.500  1.00 48.08  ? 198 ARG A CG    1 
ATOM   2331 C CD    . ARG B 2 197 ? -17.523 15.039 11.774  1.00 51.72  ? 198 ARG A CD    1 
ATOM   2332 N NE    . ARG B 2 197 ? -18.473 16.127 11.542  1.00 55.86  ? 198 ARG A NE    1 
ATOM   2333 C CZ    . ARG B 2 197 ? -18.223 17.223 10.823  1.00 57.26  ? 198 ARG A CZ    1 
ATOM   2334 N NH1   . ARG B 2 197 ? -17.040 17.391 10.240  1.00 58.31  ? 198 ARG A NH1   1 
ATOM   2335 N NH2   . ARG B 2 197 ? -19.154 18.167 10.703  1.00 56.74  ? 198 ARG A NH2   1 
ATOM   2336 N N     . THR B 2 198 ? -13.558 11.879 12.887  1.00 40.31  ? 199 THR A N     1 
ATOM   2337 C CA    . THR B 2 198 ? -13.125 10.622 13.474  1.00 38.01  ? 199 THR A CA    1 
ATOM   2338 C C     . THR B 2 198 ? -13.284 10.431 14.978  1.00 36.88  ? 199 THR A C     1 
ATOM   2339 O O     . THR B 2 198 ? -12.858 11.269 15.769  1.00 36.91  ? 199 THR A O     1 
ATOM   2340 C CB    . THR B 2 198 ? -11.684 10.388 13.113  1.00 37.62  ? 199 THR A CB    1 
ATOM   2341 O OG1   . THR B 2 198 ? -11.576 10.349 11.688  1.00 37.31  ? 199 THR A OG1   1 
ATOM   2342 C CG2   . THR B 2 198 ? -11.194 9.076  13.698  1.00 37.74  ? 199 THR A CG2   1 
ATOM   2343 N N     . VAL B 2 199 ? -13.895 9.306  15.356  1.00 35.89  ? 200 VAL A N     1 
ATOM   2344 C CA    . VAL B 2 199 ? -14.101 8.930  16.770  1.00 35.22  ? 200 VAL A CA    1 
ATOM   2345 C C     . VAL B 2 199 ? -13.220 7.734  17.155  1.00 34.97  ? 200 VAL A C     1 
ATOM   2346 O O     . VAL B 2 199 ? -13.046 6.810  16.373  1.00 35.25  ? 200 VAL A O     1 
ATOM   2347 C CB    . VAL B 2 199 ? -15.556 8.523  17.067  1.00 34.03  ? 200 VAL A CB    1 
ATOM   2348 C CG1   . VAL B 2 199 ? -15.670 8.062  18.495  1.00 33.43  ? 200 VAL A CG1   1 
ATOM   2349 C CG2   . VAL B 2 199 ? -16.470 9.686  16.840  1.00 33.96  ? 200 VAL A CG2   1 
ATOM   2350 N N     . ILE B 2 200 ? -12.675 7.748  18.364  1.00 35.17  ? 201 ILE A N     1 
ATOM   2351 C CA    . ILE B 2 200 ? -11.815 6.663  18.813  1.00 36.08  ? 201 ILE A CA    1 
ATOM   2352 C C     . ILE B 2 200 ? -12.195 6.161  20.201  1.00 36.47  ? 201 ILE A C     1 
ATOM   2353 O O     . ILE B 2 200 ? -11.772 6.722  21.213  1.00 36.77  ? 201 ILE A O     1 
ATOM   2354 C CB    . ILE B 2 200 ? -10.317 7.091  18.825  1.00 35.25  ? 201 ILE A CB    1 
ATOM   2355 C CG1   . ILE B 2 200 ? -9.834  7.330  17.388  1.00 34.50  ? 201 ILE A CG1   1 
ATOM   2356 C CG2   . ILE B 2 200 ? -9.468  6.011  19.500  1.00 34.90  ? 201 ILE A CG2   1 
ATOM   2357 C CD1   . ILE B 2 200 ? -8.415  7.855  17.261  1.00 30.73  ? 201 ILE A CD1   1 
ATOM   2358 N N     . ASP B 2 201 ? -12.998 5.099  20.227  1.00 36.83  ? 202 ASP A N     1 
ATOM   2359 C CA    . ASP B 2 201 ? -13.448 4.485  21.468  1.00 36.58  ? 202 ASP A CA    1 
ATOM   2360 C C     . ASP B 2 201 ? -12.492 3.363  21.869  1.00 37.48  ? 202 ASP A C     1 
ATOM   2361 O O     . ASP B 2 201 ? -12.709 2.199  21.513  1.00 37.59  ? 202 ASP A O     1 
ATOM   2362 C CB    . ASP B 2 201 ? -14.857 3.918  21.301  1.00 35.89  ? 202 ASP A CB    1 
ATOM   2363 C CG    . ASP B 2 201 ? -15.484 3.522  22.631  1.00 36.67  ? 202 ASP A CG    1 
ATOM   2364 O OD1   . ASP B 2 201 ? -14.711 3.343  23.604  1.00 36.54  ? 202 ASP A OD1   1 
ATOM   2365 O OD2   . ASP B 2 201 ? -16.735 3.389  22.692  1.00 36.16  ? 202 ASP A OD2   1 
ATOM   2366 N N     . VAL B 2 202 ? -11.436 3.715  22.602  1.00 38.15  ? 203 VAL A N     1 
ATOM   2367 C CA    . VAL B 2 202 ? -10.452 2.732  23.052  1.00 38.31  ? 203 VAL A CA    1 
ATOM   2368 C C     . VAL B 2 202 ? -11.135 1.535  23.689  1.00 38.72  ? 203 VAL A C     1 
ATOM   2369 O O     . VAL B 2 202 ? -10.828 0.397  23.375  1.00 40.10  ? 203 VAL A O     1 
ATOM   2370 C CB    . VAL B 2 202 ? -9.497  3.330  24.094  1.00 37.15  ? 203 VAL A CB    1 
ATOM   2371 C CG1   . VAL B 2 202 ? -8.301  2.404  24.293  1.00 35.66  ? 203 VAL A CG1   1 
ATOM   2372 C CG2   . VAL B 2 202 ? -9.052  4.710  23.646  1.00 37.33  ? 203 VAL A CG2   1 
ATOM   2373 N N     . ALA B 2 203 ? -12.071 1.807  24.584  1.00 39.20  ? 204 ALA A N     1 
ATOM   2374 C CA    . ALA B 2 203 ? -12.801 0.754  25.283  1.00 39.52  ? 204 ALA A CA    1 
ATOM   2375 C C     . ALA B 2 203 ? -13.412 -0.327 24.380  1.00 39.08  ? 204 ALA A C     1 
ATOM   2376 O O     . ALA B 2 203 ? -13.365 -1.514 24.693  1.00 38.06  ? 204 ALA A O     1 
ATOM   2377 C CB    . ALA B 2 203 ? -13.898 1.389  26.156  1.00 41.38  ? 204 ALA A CB    1 
ATOM   2378 N N     . LYS B 2 204 ? -14.003 0.086  23.270  1.00 39.81  ? 205 LYS A N     1 
ATOM   2379 C CA    . LYS B 2 204 ? -14.610 -0.857 22.344  1.00 40.69  ? 205 LYS A CA    1 
ATOM   2380 C C     . LYS B 2 204 ? -13.647 -1.205 21.211  1.00 40.68  ? 205 LYS A C     1 
ATOM   2381 O O     . LYS B 2 204 ? -14.053 -1.773 20.200  1.00 41.67  ? 205 LYS A O     1 
ATOM   2382 C CB    . LYS B 2 204 ? -15.906 -0.266 21.795  1.00 41.39  ? 205 LYS A CB    1 
ATOM   2383 C CG    . LYS B 2 204 ? -16.890 0.063  22.910  1.00 43.83  ? 205 LYS A CG    1 
ATOM   2384 C CD    . LYS B 2 204 ? -18.219 0.619  22.406  1.00 45.77  ? 205 LYS A CD    1 
ATOM   2385 C CE    . LYS B 2 204 ? -19.215 0.777  23.567  1.00 46.02  ? 205 LYS A CE    1 
ATOM   2386 N NZ    . LYS B 2 204 ? -20.544 1.300  23.125  1.00 46.71  ? 205 LYS A NZ    1 
ATOM   2387 N N     . GLY B 2 205 ? -12.371 -0.866 21.403  1.00 40.84  ? 206 GLY A N     1 
ATOM   2388 C CA    . GLY B 2 205 ? -11.343 -1.141 20.414  1.00 41.19  ? 206 GLY A CA    1 
ATOM   2389 C C     . GLY B 2 205 ? -11.805 -0.838 19.007  1.00 41.98  ? 206 GLY A C     1 
ATOM   2390 O O     . GLY B 2 205 ? -11.371 -1.479 18.044  1.00 42.64  ? 206 GLY A O     1 
ATOM   2391 N N     . GLU B 2 206 ? -12.678 0.156  18.884  1.00 43.20  ? 207 GLU A N     1 
ATOM   2392 C CA    . GLU B 2 206 ? -13.237 0.519  17.591  1.00 43.65  ? 207 GLU A CA    1 
ATOM   2393 C C     . GLU B 2 206 ? -12.900 1.945  17.143  1.00 43.16  ? 207 GLU A C     1 
ATOM   2394 O O     . GLU B 2 206 ? -12.366 2.760  17.903  1.00 42.59  ? 207 GLU A O     1 
ATOM   2395 C CB    . GLU B 2 206 ? -14.765 0.340  17.642  1.00 44.77  ? 207 GLU A CB    1 
ATOM   2396 C CG    . GLU B 2 206 ? -15.501 0.592  16.325  1.00 47.89  ? 207 GLU A CG    1 
ATOM   2397 C CD    . GLU B 2 206 ? -17.027 0.636  16.477  1.00 49.53  ? 207 GLU A CD    1 
ATOM   2398 O OE1   . GLU B 2 206 ? -17.534 1.488  17.250  1.00 50.54  ? 207 GLU A OE1   1 
ATOM   2399 O OE2   . GLU B 2 206 ? -17.715 -0.176 15.812  1.00 50.49  ? 207 GLU A OE2   1 
ATOM   2400 N N     . VAL B 2 207 ? -13.200 2.219  15.880  1.00 42.42  ? 208 VAL A N     1 
ATOM   2401 C CA    . VAL B 2 207 ? -13.004 3.531  15.290  1.00 41.20  ? 208 VAL A CA    1 
ATOM   2402 C C     . VAL B 2 207 ? -14.241 3.811  14.442  1.00 41.80  ? 208 VAL A C     1 
ATOM   2403 O O     . VAL B 2 207 ? -14.668 2.971  13.643  1.00 41.18  ? 208 VAL A O     1 
ATOM   2404 C CB    . VAL B 2 207 ? -11.769 3.585  14.384  1.00 39.81  ? 208 VAL A CB    1 
ATOM   2405 C CG1   . VAL B 2 207 ? -11.641 4.983  13.780  1.00 38.09  ? 208 VAL A CG1   1 
ATOM   2406 C CG2   . VAL B 2 207 ? -10.527 3.237  15.176  1.00 39.70  ? 208 VAL A CG2   1 
ATOM   2407 N N     . ARG B 2 208 ? -14.831 4.983  14.625  1.00 42.71  ? 209 ARG A N     1 
ATOM   2408 C CA    . ARG B 2 208 ? -16.005 5.320  13.847  1.00 44.46  ? 209 ARG A CA    1 
ATOM   2409 C C     . ARG B 2 208 ? -16.065 6.788  13.453  1.00 46.52  ? 209 ARG A C     1 
ATOM   2410 O O     . ARG B 2 208 ? -15.150 7.574  13.739  1.00 46.21  ? 209 ARG A O     1 
ATOM   2411 C CB    . ARG B 2 208 ? -17.271 4.911  14.606  1.00 43.43  ? 209 ARG A CB    1 
ATOM   2412 C CG    . ARG B 2 208 ? -17.338 5.417  16.025  1.00 41.60  ? 209 ARG A CG    1 
ATOM   2413 C CD    . ARG B 2 208 ? -18.499 4.793  16.755  1.00 39.78  ? 209 ARG A CD    1 
ATOM   2414 N NE    . ARG B 2 208 ? -18.731 5.478  18.018  1.00 39.35  ? 209 ARG A NE    1 
ATOM   2415 C CZ    . ARG B 2 208 ? -18.355 5.029  19.211  1.00 38.32  ? 209 ARG A CZ    1 
ATOM   2416 N NH1   . ARG B 2 208 ? -17.720 3.869  19.328  1.00 38.24  ? 209 ARG A NH1   1 
ATOM   2417 N NH2   . ARG B 2 208 ? -18.613 5.753  20.292  1.00 36.44  ? 209 ARG A NH2   1 
ATOM   2418 N N     . LYS B 2 209 ? -17.144 7.138  12.767  1.00 48.19  ? 210 LYS A N     1 
ATOM   2419 C CA    . LYS B 2 209 ? -17.367 8.498  12.324  1.00 50.28  ? 210 LYS A CA    1 
ATOM   2420 C C     . LYS B 2 209 ? -18.287 9.117  13.373  1.00 51.46  ? 210 LYS A C     1 
ATOM   2421 O O     . LYS B 2 209 ? -19.235 8.468  13.830  1.00 51.47  ? 210 LYS A O     1 
ATOM   2422 C CB    . LYS B 2 209 ? -18.055 8.472  10.957  1.00 52.17  ? 210 LYS A CB    1 
ATOM   2423 C CG    . LYS B 2 209 ? -17.924 9.737  10.115  1.00 55.79  ? 210 LYS A CG    1 
ATOM   2424 C CD    . LYS B 2 209 ? -18.829 10.886 10.579  1.00 58.23  ? 210 LYS A CD    1 
ATOM   2425 C CE    . LYS B 2 209 ? -18.895 11.993 9.512   1.00 59.44  ? 210 LYS A CE    1 
ATOM   2426 N NZ    . LYS B 2 209 ? -19.707 13.176 9.928   1.00 60.78  ? 210 LYS A NZ    1 
ATOM   2427 N N     . GLY B 2 210 ? -17.993 10.354 13.773  1.00 52.64  ? 211 GLY A N     1 
ATOM   2428 C CA    . GLY B 2 210 ? -18.823 11.050 14.747  1.00 52.69  ? 211 GLY A CA    1 
ATOM   2429 C C     . GLY B 2 210 ? -19.185 12.426 14.216  1.00 53.69  ? 211 GLY A C     1 
ATOM   2430 O O     . GLY B 2 210 ? -19.174 12.665 13.002  1.00 53.24  ? 211 GLY A O     1 
ATOM   2431 N N     . GLU B 2 211 ? -19.515 13.341 15.117  1.00 55.01  ? 212 GLU A N     1 
ATOM   2432 C CA    . GLU B 2 211 ? -19.849 14.695 14.701  1.00 56.23  ? 212 GLU A CA    1 
ATOM   2433 C C     . GLU B 2 211 ? -18.700 15.647 15.019  1.00 55.49  ? 212 GLU A C     1 
ATOM   2434 O O     . GLU B 2 211 ? -18.830 16.861 14.846  1.00 56.23  ? 212 GLU A O     1 
ATOM   2435 C CB    . GLU B 2 211 ? -21.130 15.169 15.400  1.00 59.26  ? 212 GLU A CB    1 
ATOM   2436 C CG    . GLU B 2 211 ? -22.422 14.719 14.712  1.00 64.02  ? 212 GLU A CG    1 
ATOM   2437 C CD    . GLU B 2 211 ? -23.685 15.060 15.509  1.00 67.02  ? 212 GLU A CD    1 
ATOM   2438 O OE1   . GLU B 2 211 ? -23.941 16.256 15.790  1.00 68.31  ? 212 GLU A OE1   1 
ATOM   2439 O OE2   . GLU B 2 211 ? -24.434 14.121 15.853  1.00 69.46  ? 212 GLU A OE2   1 
ATOM   2440 N N     . GLU B 2 212 ? -17.571 15.081 15.455  1.00 54.46  ? 213 GLU A N     1 
ATOM   2441 C CA    . GLU B 2 212 ? -16.374 15.839 15.851  1.00 52.13  ? 213 GLU A CA    1 
ATOM   2442 C C     . GLU B 2 212 ? -15.272 14.845 16.212  1.00 49.57  ? 213 GLU A C     1 
ATOM   2443 O O     . GLU B 2 212 ? -15.557 13.666 16.410  1.00 50.09  ? 213 GLU A O     1 
ATOM   2444 C CB    . GLU B 2 212 ? -16.698 16.683 17.083  1.00 54.41  ? 213 GLU A CB    1 
ATOM   2445 C CG    . GLU B 2 212 ? -17.692 15.990 18.025  1.00 58.20  ? 213 GLU A CG    1 
ATOM   2446 C CD    . GLU B 2 212 ? -17.654 16.517 19.455  1.00 61.43  ? 213 GLU A CD    1 
ATOM   2447 O OE1   . GLU B 2 212 ? -18.608 16.225 20.222  1.00 62.14  ? 213 GLU A OE1   1 
ATOM   2448 O OE2   . GLU B 2 212 ? -16.669 17.207 19.821  1.00 63.71  ? 213 GLU A OE2   1 
ATOM   2449 N N     . PHE B 2 213 ? -14.021 15.294 16.305  1.00 46.54  ? 214 PHE A N     1 
ATOM   2450 C CA    . PHE B 2 213 ? -12.939 14.376 16.668  1.00 43.15  ? 214 PHE A CA    1 
ATOM   2451 C C     . PHE B 2 213 ? -13.222 13.999 18.105  1.00 42.44  ? 214 PHE A C     1 
ATOM   2452 O O     . PHE B 2 213 ? -13.352 14.878 18.950  1.00 42.06  ? 214 PHE A O     1 
ATOM   2453 C CB    . PHE B 2 213 ? -11.582 15.055 16.593  1.00 41.42  ? 214 PHE A CB    1 
ATOM   2454 C CG    . PHE B 2 213 ? -10.436 14.091 16.602  1.00 39.37  ? 214 PHE A CG    1 
ATOM   2455 C CD1   . PHE B 2 213 ? -10.114 13.361 15.457  1.00 38.62  ? 214 PHE A CD1   1 
ATOM   2456 C CD2   . PHE B 2 213 ? -9.703  13.876 17.757  1.00 37.86  ? 214 PHE A CD2   1 
ATOM   2457 C CE1   . PHE B 2 213 ? -9.085  12.439 15.464  1.00 36.37  ? 214 PHE A CE1   1 
ATOM   2458 C CE2   . PHE B 2 213 ? -8.666  12.949 17.771  1.00 36.35  ? 214 PHE A CE2   1 
ATOM   2459 C CZ    . PHE B 2 213 ? -8.360  12.229 16.617  1.00 36.06  ? 214 PHE A CZ    1 
ATOM   2460 N N     . PHE B 2 214 ? -13.314 12.706 18.396  1.00 41.36  ? 215 PHE A N     1 
ATOM   2461 C CA    . PHE B 2 214 ? -13.656 12.287 19.751  1.00 40.34  ? 215 PHE A CA    1 
ATOM   2462 C C     . PHE B 2 214 ? -12.949 11.015 20.201  1.00 39.69  ? 215 PHE A C     1 
ATOM   2463 O O     . PHE B 2 214 ? -13.101 9.971  19.576  1.00 40.33  ? 215 PHE A O     1 
ATOM   2464 C CB    . PHE B 2 214 ? -15.171 12.088 19.816  1.00 40.35  ? 215 PHE A CB    1 
ATOM   2465 C CG    . PHE B 2 214 ? -15.742 12.102 21.210  1.00 41.35  ? 215 PHE A CG    1 
ATOM   2466 C CD1   . PHE B 2 214 ? -16.780 12.977 21.536  1.00 39.99  ? 215 PHE A CD1   1 
ATOM   2467 C CD2   . PHE B 2 214 ? -15.275 11.223 22.191  1.00 41.58  ? 215 PHE A CD2   1 
ATOM   2468 C CE1   . PHE B 2 214 ? -17.347 12.983 22.808  1.00 38.45  ? 215 PHE A CE1   1 
ATOM   2469 C CE2   . PHE B 2 214 ? -15.837 11.217 23.480  1.00 40.30  ? 215 PHE A CE2   1 
ATOM   2470 C CZ    . PHE B 2 214 ? -16.876 12.101 23.784  1.00 39.11  ? 215 PHE A CZ    1 
ATOM   2471 N N     . VAL B 2 215 ? -12.177 11.105 21.283  1.00 39.25  ? 216 VAL A N     1 
ATOM   2472 C CA    . VAL B 2 215 ? -11.470 9.946  21.835  1.00 38.87  ? 216 VAL A CA    1 
ATOM   2473 C C     . VAL B 2 215 ? -12.163 9.648  23.168  1.00 39.32  ? 216 VAL A C     1 
ATOM   2474 O O     . VAL B 2 215 ? -11.896 10.320 24.168  1.00 39.98  ? 216 VAL A O     1 
ATOM   2475 C CB    . VAL B 2 215 ? -9.975  10.265 22.079  1.00 37.89  ? 216 VAL A CB    1 
ATOM   2476 C CG1   . VAL B 2 215 ? -9.275  9.090  22.727  1.00 37.37  ? 216 VAL A CG1   1 
ATOM   2477 C CG2   . VAL B 2 215 ? -9.308  10.582 20.772  1.00 37.58  ? 216 VAL A CG2   1 
ATOM   2478 N N     . VAL B 2 216 ? -13.052 8.651  23.191  1.00 38.68  ? 217 VAL A N     1 
ATOM   2479 C CA    . VAL B 2 216 ? -13.785 8.365  24.419  1.00 38.24  ? 217 VAL A CA    1 
ATOM   2480 C C     . VAL B 2 216 ? -13.001 7.738  25.539  1.00 38.54  ? 217 VAL A C     1 
ATOM   2481 O O     . VAL B 2 216 ? -12.370 6.686  25.398  1.00 39.66  ? 217 VAL A O     1 
ATOM   2482 C CB    . VAL B 2 216 ? -15.075 7.538  24.163  1.00 36.79  ? 217 VAL A CB    1 
ATOM   2483 C CG1   . VAL B 2 216 ? -14.980 6.845  22.862  1.00 37.65  ? 217 VAL A CG1   1 
ATOM   2484 C CG2   . VAL B 2 216 ? -15.311 6.550  25.282  1.00 35.14  ? 217 VAL A CG2   1 
ATOM   2485 N N     . ASP B 2 217 ? -13.065 8.434  26.664  1.00 38.49  ? 218 ASP A N     1 
ATOM   2486 C CA    . ASP B 2 217 ? -12.410 8.053  27.902  1.00 39.46  ? 218 ASP A CA    1 
ATOM   2487 C C     . ASP B 2 217 ? -12.744 6.589  28.237  1.00 40.46  ? 218 ASP A C     1 
ATOM   2488 O O     . ASP B 2 217 ? -13.916 6.198  28.231  1.00 41.83  ? 218 ASP A O     1 
ATOM   2489 C CB    . ASP B 2 217 ? -12.941 8.966  29.007  1.00 39.68  ? 218 ASP A CB    1 
ATOM   2490 C CG    . ASP B 2 217 ? -12.019 9.051  30.198  1.00 39.91  ? 218 ASP A CG    1 
ATOM   2491 O OD1   . ASP B 2 217 ? -11.359 8.039  30.536  1.00 39.67  ? 218 ASP A OD1   1 
ATOM   2492 O OD2   . ASP B 2 217 ? -11.970 10.146 30.797  1.00 40.19  ? 218 ASP A OD2   1 
ATOM   2493 N N     . PRO B 2 218 ? -11.729 5.751  28.507  1.00 40.34  ? 219 PRO A N     1 
ATOM   2494 C CA    . PRO B 2 218 ? -12.071 4.364  28.838  1.00 39.98  ? 219 PRO A CA    1 
ATOM   2495 C C     . PRO B 2 218 ? -12.958 4.348  30.081  1.00 40.03  ? 219 PRO A C     1 
ATOM   2496 O O     . PRO B 2 218 ? -13.939 3.608  30.161  1.00 40.07  ? 219 PRO A O     1 
ATOM   2497 C CB    . PRO B 2 218 ? -10.715 3.730  29.110  1.00 39.28  ? 219 PRO A CB    1 
ATOM   2498 C CG    . PRO B 2 218 ? -9.836  4.430  28.153  1.00 40.33  ? 219 PRO A CG    1 
ATOM   2499 C CD    . PRO B 2 218 ? -10.291 5.888  28.237  1.00 40.32  ? 219 PRO A CD    1 
ATOM   2500 N N     . VAL B 2 219 ? -12.607 5.199  31.039  1.00 40.56  ? 220 VAL A N     1 
ATOM   2501 C CA    . VAL B 2 219 ? -13.332 5.300  32.301  1.00 41.90  ? 220 VAL A CA    1 
ATOM   2502 C C     . VAL B 2 219 ? -14.714 5.945  32.216  1.00 43.24  ? 220 VAL A C     1 
ATOM   2503 O O     . VAL B 2 219 ? -15.577 5.650  33.045  1.00 43.26  ? 220 VAL A O     1 
ATOM   2504 C CB    . VAL B 2 219 ? -12.517 6.096  33.343  1.00 41.53  ? 220 VAL A CB    1 
ATOM   2505 C CG1   . VAL B 2 219 ? -13.161 5.981  34.711  1.00 41.37  ? 220 VAL A CG1   1 
ATOM   2506 C CG2   . VAL B 2 219 ? -11.094 5.581  33.378  1.00 41.98  ? 220 VAL A CG2   1 
ATOM   2507 N N     . ASP B 2 220 ? -14.933 6.821  31.233  1.00 44.56  ? 221 ASP A N     1 
ATOM   2508 C CA    . ASP B 2 220 ? -16.214 7.517  31.113  1.00 44.87  ? 221 ASP A CA    1 
ATOM   2509 C C     . ASP B 2 220 ? -16.621 7.741  29.657  1.00 45.34  ? 221 ASP A C     1 
ATOM   2510 O O     . ASP B 2 220 ? -16.105 8.633  28.984  1.00 44.63  ? 221 ASP A O     1 
ATOM   2511 C CB    . ASP B 2 220 ? -16.104 8.850  31.831  1.00 45.15  ? 221 ASP A CB    1 
ATOM   2512 C CG    . ASP B 2 220 ? -17.432 9.421  32.192  1.00 46.51  ? 221 ASP A CG    1 
ATOM   2513 O OD1   . ASP B 2 220 ? -18.249 9.654  31.272  1.00 48.46  ? 221 ASP A OD1   1 
ATOM   2514 O OD2   . ASP B 2 220 ? -17.656 9.638  33.399  1.00 48.07  ? 221 ASP A OD2   1 
ATOM   2515 N N     . GLU B 2 221 ? -17.566 6.934  29.191  1.00 47.26  ? 222 GLU A N     1 
ATOM   2516 C CA    . GLU B 2 221 ? -18.046 6.988  27.809  1.00 49.82  ? 222 GLU A CA    1 
ATOM   2517 C C     . GLU B 2 221 ? -18.531 8.333  27.276  1.00 49.59  ? 222 GLU A C     1 
ATOM   2518 O O     . GLU B 2 221 ? -18.635 8.523  26.060  1.00 48.32  ? 222 GLU A O     1 
ATOM   2519 C CB    . GLU B 2 221 ? -19.159 5.952  27.598  1.00 51.61  ? 222 GLU A CB    1 
ATOM   2520 C CG    . GLU B 2 221 ? -18.732 4.505  27.843  1.00 55.66  ? 222 GLU A CG    1 
ATOM   2521 C CD    . GLU B 2 221 ? -17.383 4.147  27.210  1.00 58.13  ? 222 GLU A CD    1 
ATOM   2522 O OE1   . GLU B 2 221 ? -16.336 4.254  27.905  1.00 58.20  ? 222 GLU A OE1   1 
ATOM   2523 O OE2   . GLU B 2 221 ? -17.375 3.760  26.015  1.00 59.87  ? 222 GLU A OE2   1 
ATOM   2524 N N     . LYS B 2 222 ? -18.836 9.270  28.161  1.00 49.76  ? 223 LYS A N     1 
ATOM   2525 C CA    . LYS B 2 222 ? -19.322 10.559 27.693  1.00 50.90  ? 223 LYS A CA    1 
ATOM   2526 C C     . LYS B 2 222 ? -18.247 11.663 27.660  1.00 50.73  ? 223 LYS A C     1 
ATOM   2527 O O     . LYS B 2 222 ? -18.434 12.728 27.059  1.00 50.78  ? 223 LYS A O     1 
ATOM   2528 C CB    . LYS B 2 222 ? -20.527 10.979 28.545  1.00 52.19  ? 223 LYS A CB    1 
ATOM   2529 C CG    . LYS B 2 222 ? -21.720 10.042 28.404  1.00 55.44  ? 223 LYS A CG    1 
ATOM   2530 C CD    . LYS B 2 222 ? -22.120 9.877  26.936  1.00 58.15  ? 223 LYS A CD    1 
ATOM   2531 C CE    . LYS B 2 222 ? -23.207 8.808  26.741  1.00 59.79  ? 223 LYS A CE    1 
ATOM   2532 N NZ    . LYS B 2 222 ? -22.761 7.427  27.150  1.00 61.13  ? 223 LYS A NZ    1 
ATOM   2533 N N     . ARG B 2 223 ? -17.107 11.391 28.281  1.00 50.01  ? 224 ARG A N     1 
ATOM   2534 C CA    . ARG B 2 223 ? -16.037 12.366 28.329  1.00 49.44  ? 224 ARG A CA    1 
ATOM   2535 C C     . ARG B 2 223 ? -15.090 12.217 27.143  1.00 48.18  ? 224 ARG A C     1 
ATOM   2536 O O     . ARG B 2 223 ? -14.602 11.118 26.852  1.00 48.73  ? 224 ARG A O     1 
ATOM   2537 C CB    . ARG B 2 223 ? -15.274 12.203 29.642  1.00 51.84  ? 224 ARG A CB    1 
ATOM   2538 C CG    . ARG B 2 223 ? -14.304 13.321 29.970  1.00 55.01  ? 224 ARG A CG    1 
ATOM   2539 C CD    . ARG B 2 223 ? -13.967 13.274 31.464  1.00 58.53  ? 224 ARG A CD    1 
ATOM   2540 N NE    . ARG B 2 223 ? -12.958 14.253 31.858  1.00 62.03  ? 224 ARG A NE    1 
ATOM   2541 C CZ    . ARG B 2 223 ? -11.739 14.315 31.330  1.00 64.01  ? 224 ARG A CZ    1 
ATOM   2542 N NH1   . ARG B 2 223 ? -11.383 13.452 30.384  1.00 65.55  ? 224 ARG A NH1   1 
ATOM   2543 N NH2   . ARG B 2 223 ? -10.874 15.237 31.739  1.00 64.23  ? 224 ARG A NH2   1 
ATOM   2544 N N     . ASN B 2 224 ? -14.843 13.319 26.446  1.00 44.86  ? 225 ASN A N     1 
ATOM   2545 C CA    . ASN B 2 224 ? -13.926 13.283 25.323  1.00 41.67  ? 225 ASN A CA    1 
ATOM   2546 C C     . ASN B 2 224 ? -12.556 13.657 25.865  1.00 40.92  ? 225 ASN A C     1 
ATOM   2547 O O     . ASN B 2 224 ? -12.396 14.717 26.458  1.00 40.77  ? 225 ASN A O     1 
ATOM   2548 C CB    . ASN B 2 224 ? -14.344 14.280 24.258  1.00 40.60  ? 225 ASN A CB    1 
ATOM   2549 C CG    . ASN B 2 224 ? -13.337 14.378 23.149  1.00 40.19  ? 225 ASN A CG    1 
ATOM   2550 O OD1   . ASN B 2 224 ? -12.313 13.700 23.177  1.00 41.29  ? 225 ASN A OD1   1 
ATOM   2551 N ND2   . ASN B 2 224 ? -13.615 15.223 22.163  1.00 39.61  ? 225 ASN A ND2   1 
ATOM   2552 N N     . VAL B 2 225 ? -11.566 12.795 25.672  1.00 39.81  ? 226 VAL A N     1 
ATOM   2553 C CA    . VAL B 2 225 ? -10.232 13.070 26.183  1.00 38.11  ? 226 VAL A CA    1 
ATOM   2554 C C     . VAL B 2 225 ? -9.528  14.131 25.361  1.00 37.53  ? 226 VAL A C     1 
ATOM   2555 O O     . VAL B 2 225 ? -8.742  14.916 25.893  1.00 38.77  ? 226 VAL A O     1 
ATOM   2556 C CB    . VAL B 2 225 ? -9.375  11.770 26.247  1.00 37.23  ? 226 VAL A CB    1 
ATOM   2557 C CG1   . VAL B 2 225 ? -7.911  12.105 26.475  1.00 36.67  ? 226 VAL A CG1   1 
ATOM   2558 C CG2   . VAL B 2 225 ? -9.868  10.896 27.393  1.00 36.90  ? 226 VAL A CG2   1 
ATOM   2559 N N     . ALA B 2 226 ? -9.815  14.171 24.067  1.00 36.21  ? 227 ALA A N     1 
ATOM   2560 C CA    . ALA B 2 226 ? -9.187  15.155 23.194  1.00 35.68  ? 227 ALA A CA    1 
ATOM   2561 C C     . ALA B 2 226 ? -10.075 16.388 23.069  1.00 35.23  ? 227 ALA A C     1 
ATOM   2562 O O     . ALA B 2 226 ? -9.966  17.180 22.135  1.00 34.48  ? 227 ALA A O     1 
ATOM   2563 C CB    . ALA B 2 226 ? -8.842  14.521 21.864  1.00 35.77  ? 227 ALA A CB    1 
ATOM   2564 N N     . ALA B 2 227 ? -10.961 16.535 24.037  1.00 36.25  ? 228 ALA A N     1 
ATOM   2565 C CA    . ALA B 2 227 ? -11.949 17.597 24.031  1.00 37.17  ? 228 ALA A CA    1 
ATOM   2566 C C     . ALA B 2 227 ? -11.357 18.977 23.735  1.00 37.68  ? 228 ALA A C     1 
ATOM   2567 O O     . ALA B 2 227 ? -11.892 19.728 22.926  1.00 38.12  ? 228 ALA A O     1 
ATOM   2568 C CB    . ALA B 2 227 ? -12.676 17.621 25.380  1.00 36.60  ? 228 ALA A CB    1 
ATOM   2569 N N     . ASN B 2 228 ? -10.257 19.316 24.392  1.00 38.39  ? 229 ASN A N     1 
ATOM   2570 C CA    . ASN B 2 228 ? -9.656  20.622 24.186  1.00 39.45  ? 229 ASN A CA    1 
ATOM   2571 C C     . ASN B 2 228 ? -8.727  20.847 22.991  1.00 39.62  ? 229 ASN A C     1 
ATOM   2572 O O     . ASN B 2 228 ? -8.036  21.860 22.908  1.00 41.38  ? 229 ASN A O     1 
ATOM   2573 C CB    . ASN B 2 228 ? -9.164  21.196 25.530  1.00 40.53  ? 229 ASN A CB    1 
ATOM   2574 C CG    . ASN B 2 228 ? -8.823  22.683 25.444  1.00 42.13  ? 229 ASN A CG    1 
ATOM   2575 O OD1   . ASN B 2 228 ? -9.581  23.474 24.867  1.00 42.57  ? 229 ASN A OD1   1 
ATOM   2576 N ND2   . ASN B 2 228 ? -7.691  23.072 26.029  1.00 42.54  ? 229 ASN A ND2   1 
ATOM   2577 N N     . LEU B 2 229 ? -8.706  19.895 22.067  1.00 38.64  ? 230 LEU A N     1 
ATOM   2578 C CA    . LEU B 2 229 ? -7.721  19.870 20.986  1.00 36.80  ? 230 LEU A CA    1 
ATOM   2579 C C     . LEU B 2 229 ? -8.294  20.757 19.884  1.00 35.85  ? 230 LEU A C     1 
ATOM   2580 O O     . LEU B 2 229 ? -9.436  20.573 19.464  1.00 34.92  ? 230 LEU A O     1 
ATOM   2581 C CB    . LEU B 2 229 ? -7.530  18.449 20.454  1.00 35.90  ? 230 LEU A CB    1 
ATOM   2582 C CG    . LEU B 2 229 ? -6.635  18.358 19.221  1.00 35.25  ? 230 LEU A CG    1 
ATOM   2583 C CD1   . LEU B 2 229 ? -5.225  18.800 19.551  1.00 34.55  ? 230 LEU A CD1   1 
ATOM   2584 C CD2   . LEU B 2 229 ? -6.623  16.937 18.735  1.00 35.43  ? 230 LEU A CD2   1 
ATOM   2585 N N     . SER B 2 230 ? -7.512  21.718 19.413  1.00 35.89  ? 231 SER A N     1 
ATOM   2586 C CA    . SER B 2 230 ? -8.010  22.622 18.383  1.00 36.94  ? 231 SER A CA    1 
ATOM   2587 C C     . SER B 2 230 ? -7.999  21.991 17.012  1.00 36.30  ? 231 SER A C     1 
ATOM   2588 O O     . SER B 2 230 ? -7.015  21.379 16.609  1.00 36.53  ? 231 SER A O     1 
ATOM   2589 C CB    . SER B 2 230 ? -7.166  23.888 18.312  1.00 38.55  ? 231 SER A CB    1 
ATOM   2590 O OG    . SER B 2 230 ? -5.995  23.644 17.538  1.00 39.22  ? 231 SER A OG    1 
ATOM   2591 N N     . LEU B 2 231 ? -9.098  22.169 16.296  1.00 35.21  ? 232 LEU A N     1 
ATOM   2592 C CA    . LEU B 2 231 ? -9.235  21.651 14.951  1.00 34.50  ? 232 LEU A CA    1 
ATOM   2593 C C     . LEU B 2 231 ? -7.968  21.876 14.110  1.00 35.30  ? 232 LEU A C     1 
ATOM   2594 O O     . LEU B 2 231 ? -7.482  20.959 13.446  1.00 35.66  ? 232 LEU A O     1 
ATOM   2595 C CB    . LEU B 2 231 ? -10.426 22.322 14.290  1.00 33.85  ? 232 LEU A CB    1 
ATOM   2596 C CG    . LEU B 2 231 ? -10.623 22.089 12.801  1.00 34.31  ? 232 LEU A CG    1 
ATOM   2597 C CD1   . LEU B 2 231 ? -10.667 20.596 12.541  1.00 34.79  ? 232 LEU A CD1   1 
ATOM   2598 C CD2   . LEU B 2 231 ? -11.912 22.776 12.330  1.00 35.11  ? 232 LEU A CD2   1 
ATOM   2599 N N     . ASP B 2 232 ? -7.427  23.092 14.126  1.00 35.74  ? 233 ASP A N     1 
ATOM   2600 C CA    . ASP B 2 232 ? -6.215  23.359 13.357  1.00 35.07  ? 233 ASP A CA    1 
ATOM   2601 C C     . ASP B 2 232 ? -5.068  22.470 13.849  1.00 34.70  ? 233 ASP A C     1 
ATOM   2602 O O     . ASP B 2 232 ? -4.380  21.825 13.057  1.00 33.81  ? 233 ASP A O     1 
ATOM   2603 C CB    . ASP B 2 232 ? -5.829  24.838 13.458  1.00 36.02  ? 233 ASP A CB    1 
ATOM   2604 C CG    . ASP B 2 232 ? -6.665  25.731 12.533  1.00 38.71  ? 233 ASP A CG    1 
ATOM   2605 O OD1   . ASP B 2 232 ? -7.031  25.269 11.425  1.00 39.58  ? 233 ASP A OD1   1 
ATOM   2606 O OD2   . ASP B 2 232 ? -6.940  26.900 12.895  1.00 39.61  ? 233 ASP A OD2   1 
ATOM   2607 N N     . ASN B 2 233 ? -4.862  22.431 15.161  1.00 34.79  ? 234 ASN A N     1 
ATOM   2608 C CA    . ASN B 2 233 ? -3.812  21.598 15.727  1.00 34.37  ? 234 ASN A CA    1 
ATOM   2609 C C     . ASN B 2 233 ? -4.008  20.150 15.315  1.00 34.40  ? 234 ASN A C     1 
ATOM   2610 O O     . ASN B 2 233 ? -3.044  19.467 15.008  1.00 34.50  ? 234 ASN A O     1 
ATOM   2611 C CB    . ASN B 2 233 ? -3.808  21.708 17.249  1.00 35.00  ? 234 ASN A CB    1 
ATOM   2612 C CG    . ASN B 2 233 ? -2.863  22.781 17.752  1.00 35.20  ? 234 ASN A CG    1 
ATOM   2613 O OD1   . ASN B 2 233 ? -2.938  23.208 18.908  1.00 35.90  ? 234 ASN A OD1   1 
ATOM   2614 N ND2   . ASN B 2 233 ? -1.961  23.220 16.886  1.00 35.27  ? 234 ASN A ND2   1 
ATOM   2615 N N     . LEU B 2 234 ? -5.249  19.675 15.321  1.00 34.88  ? 235 LEU A N     1 
ATOM   2616 C CA    . LEU B 2 234 ? -5.524  18.304 14.906  1.00 35.67  ? 235 LEU A CA    1 
ATOM   2617 C C     . LEU B 2 234 ? -5.070  18.129 13.462  1.00 35.24  ? 235 LEU A C     1 
ATOM   2618 O O     . LEU B 2 234 ? -4.588  17.065 13.070  1.00 35.15  ? 235 LEU A O     1 
ATOM   2619 C CB    . LEU B 2 234 ? -7.013  18.000 14.996  1.00 37.38  ? 235 LEU A CB    1 
ATOM   2620 C CG    . LEU B 2 234 ? -7.441  16.709 14.282  1.00 39.21  ? 235 LEU A CG    1 
ATOM   2621 C CD1   . LEU B 2 234 ? -6.633  15.518 14.796  1.00 36.73  ? 235 LEU A CD1   1 
ATOM   2622 C CD2   . LEU B 2 234 ? -8.941  16.480 14.498  1.00 39.78  ? 235 LEU A CD2   1 
ATOM   2623 N N     . ALA B 2 235 ? -5.239  19.182 12.669  1.00 35.19  ? 236 ALA A N     1 
ATOM   2624 C CA    . ALA B 2 235 ? -4.824  19.159 11.273  1.00 34.18  ? 236 ALA A CA    1 
ATOM   2625 C C     . ALA B 2 235 ? -3.311  19.076 11.223  1.00 33.69  ? 236 ALA A C     1 
ATOM   2626 O O     . ALA B 2 235 ? -2.755  18.126 10.678  1.00 34.52  ? 236 ALA A O     1 
ATOM   2627 C CB    . ALA B 2 235 ? -5.302  20.411 10.557  1.00 34.01  ? 236 ALA A CB    1 
ATOM   2628 N N     . ARG B 2 236 ? -2.643  20.060 11.812  1.00 33.05  ? 237 ARG A N     1 
ATOM   2629 C CA    . ARG B 2 236 ? -1.190  20.074 11.812  1.00 33.49  ? 237 ARG A CA    1 
ATOM   2630 C C     . ARG B 2 236 ? -0.598  18.707 12.130  1.00 33.56  ? 237 ARG A C     1 
ATOM   2631 O O     . ARG B 2 236 ? 0.401   18.302 11.525  1.00 33.74  ? 237 ARG A O     1 
ATOM   2632 C CB    . ARG B 2 236 ? -0.671  21.099 12.810  1.00 34.94  ? 237 ARG A CB    1 
ATOM   2633 C CG    . ARG B 2 236 ? -1.176  22.503 12.536  1.00 38.48  ? 237 ARG A CG    1 
ATOM   2634 C CD    . ARG B 2 236 ? -0.386  23.541 13.328  1.00 41.97  ? 237 ARG A CD    1 
ATOM   2635 N NE    . ARG B 2 236 ? -0.950  24.882 13.168  1.00 43.73  ? 237 ARG A NE    1 
ATOM   2636 C CZ    . ARG B 2 236 ? -1.879  25.417 13.962  1.00 45.79  ? 237 ARG A CZ    1 
ATOM   2637 N NH1   . ARG B 2 236 ? -2.364  24.742 15.001  1.00 44.56  ? 237 ARG A NH1   1 
ATOM   2638 N NH2   . ARG B 2 236 ? -2.348  26.631 13.696  1.00 48.08  ? 237 ARG A NH2   1 
ATOM   2639 N N     . PHE B 2 237 ? -1.210  17.994 13.072  1.00 34.50  ? 238 PHE A N     1 
ATOM   2640 C CA    . PHE B 2 237 ? -0.720  16.669 13.450  1.00 35.12  ? 238 PHE A CA    1 
ATOM   2641 C C     . PHE B 2 237 ? -0.852  15.673 12.291  1.00 34.56  ? 238 PHE A C     1 
ATOM   2642 O O     . PHE B 2 237 ? 0.129   15.026 11.918  1.00 34.65  ? 238 PHE A O     1 
ATOM   2643 C CB    . PHE B 2 237 ? -1.462  16.131 14.695  1.00 35.67  ? 238 PHE A CB    1 
ATOM   2644 C CG    . PHE B 2 237 ? -1.010  14.753 15.121  1.00 35.80  ? 238 PHE A CG    1 
ATOM   2645 C CD1   . PHE B 2 237 ? 0.241   14.561 15.684  1.00 36.43  ? 238 PHE A CD1   1 
ATOM   2646 C CD2   . PHE B 2 237 ? -1.823  13.641 14.926  1.00 37.02  ? 238 PHE A CD2   1 
ATOM   2647 C CE1   . PHE B 2 237 ? 0.680   13.276 16.047  1.00 37.80  ? 238 PHE A CE1   1 
ATOM   2648 C CE2   . PHE B 2 237 ? -1.393  12.347 15.284  1.00 37.26  ? 238 PHE A CE2   1 
ATOM   2649 C CZ    . PHE B 2 237 ? -0.143  12.165 15.844  1.00 36.98  ? 238 PHE A CZ    1 
ATOM   2650 N N     . VAL B 2 238 ? -2.053  15.543 11.731  1.00 34.13  ? 239 VAL A N     1 
ATOM   2651 C CA    . VAL B 2 238 ? -2.259  14.623 10.616  1.00 35.59  ? 239 VAL A CA    1 
ATOM   2652 C C     . VAL B 2 238 ? -1.210  14.923 9.542   1.00 35.85  ? 239 VAL A C     1 
ATOM   2653 O O     . VAL B 2 238 ? -0.529  14.023 9.027   1.00 36.07  ? 239 VAL A O     1 
ATOM   2654 C CB    . VAL B 2 238 ? -3.680  14.780 9.985   1.00 35.84  ? 239 VAL A CB    1 
ATOM   2655 C CG1   . VAL B 2 238 ? -3.822  13.872 8.766   1.00 35.41  ? 239 VAL A CG1   1 
ATOM   2656 C CG2   . VAL B 2 238 ? -4.736  14.443 11.003  1.00 35.93  ? 239 VAL A CG2   1 
ATOM   2657 N N     . HIS B 2 239 ? -1.074  16.203 9.220   1.00 35.86  ? 240 HIS A N     1 
ATOM   2658 C CA    . HIS B 2 239 ? -0.121  16.615 8.213   1.00 36.75  ? 240 HIS A CA    1 
ATOM   2659 C C     . HIS B 2 239 ? 1.312   16.282 8.631   1.00 37.70  ? 240 HIS A C     1 
ATOM   2660 O O     . HIS B 2 239 ? 2.164   15.986 7.785   1.00 36.82  ? 240 HIS A O     1 
ATOM   2661 C CB    . HIS B 2 239 ? -0.256  18.110 7.941   1.00 36.88  ? 240 HIS A CB    1 
ATOM   2662 C CG    . HIS B 2 239 ? 0.535   18.567 6.754   1.00 36.95  ? 240 HIS A CG    1 
ATOM   2663 N ND1   . HIS B 2 239 ? 1.799   19.100 6.863   1.00 36.42  ? 240 HIS A ND1   1 
ATOM   2664 C CD2   . HIS B 2 239 ? 0.263   18.509 5.429   1.00 36.28  ? 240 HIS A CD2   1 
ATOM   2665 C CE1   . HIS B 2 239 ? 2.276   19.351 5.656   1.00 35.76  ? 240 HIS A CE1   1 
ATOM   2666 N NE2   . HIS B 2 239 ? 1.364   19.000 4.770   1.00 35.85  ? 240 HIS A NE2   1 
ATOM   2667 N N     . LEU B 2 240 ? 1.577   16.326 9.934   1.00 38.92  ? 241 LEU A N     1 
ATOM   2668 C CA    . LEU B 2 240 ? 2.913   16.021 10.415  1.00 39.54  ? 241 LEU A CA    1 
ATOM   2669 C C     . LEU B 2 240 ? 3.190   14.546 10.292  1.00 40.34  ? 241 LEU A C     1 
ATOM   2670 O O     . LEU B 2 240 ? 4.328   14.147 10.059  1.00 41.61  ? 241 LEU A O     1 
ATOM   2671 C CB    . LEU B 2 240 ? 3.094   16.453 11.865  1.00 39.83  ? 241 LEU A CB    1 
ATOM   2672 C CG    . LEU B 2 240 ? 3.787   17.795 12.122  1.00 39.86  ? 241 LEU A CG    1 
ATOM   2673 C CD1   . LEU B 2 240 ? 4.000   17.943 13.620  1.00 40.48  ? 241 LEU A CD1   1 
ATOM   2674 C CD2   . LEU B 2 240 ? 5.129   17.850 11.416  1.00 38.86  ? 241 LEU A CD2   1 
ATOM   2675 N N     . CYS B 2 241 ? 2.150   13.732 10.442  1.00 40.65  ? 242 CYS A N     1 
ATOM   2676 C CA    . CYS B 2 241 ? 2.324   12.292 10.346  1.00 39.66  ? 242 CYS A CA    1 
ATOM   2677 C C     . CYS B 2 241 ? 2.537   11.902 8.916   1.00 39.68  ? 242 CYS A C     1 
ATOM   2678 O O     . CYS B 2 241 ? 3.339   11.019 8.640   1.00 40.53  ? 242 CYS A O     1 
ATOM   2679 C CB    . CYS B 2 241 ? 1.128   11.559 10.930  1.00 38.90  ? 242 CYS A CB    1 
ATOM   2680 S SG    . CYS B 2 241 ? 1.012   11.826 12.719  1.00 39.12  ? 242 CYS A SG    1 
ATOM   2681 N N     . ARG B 2 242 ? 1.851   12.572 7.996   1.00 40.46  ? 243 ARG A N     1 
ATOM   2682 C CA    . ARG B 2 242 ? 2.018   12.253 6.570   1.00 42.50  ? 243 ARG A CA    1 
ATOM   2683 C C     . ARG B 2 242 ? 3.416   12.618 6.059   1.00 43.78  ? 243 ARG A C     1 
ATOM   2684 O O     . ARG B 2 242 ? 3.980   11.930 5.204   1.00 43.68  ? 243 ARG A O     1 
ATOM   2685 C CB    . ARG B 2 242 ? 0.971   12.973 5.723   1.00 40.70  ? 243 ARG A CB    1 
ATOM   2686 C CG    . ARG B 2 242 ? -0.452  12.635 6.086   1.00 40.18  ? 243 ARG A CG    1 
ATOM   2687 C CD    . ARG B 2 242 ? -1.412  13.539 5.334   1.00 40.18  ? 243 ARG A CD    1 
ATOM   2688 N NE    . ARG B 2 242 ? -2.798  13.253 5.683   1.00 39.80  ? 243 ARG A NE    1 
ATOM   2689 C CZ    . ARG B 2 242 ? -3.840  13.915 5.198   1.00 38.87  ? 243 ARG A CZ    1 
ATOM   2690 N NH1   . ARG B 2 242 ? -3.654  14.912 4.340   1.00 38.92  ? 243 ARG A NH1   1 
ATOM   2691 N NH2   . ARG B 2 242 ? -5.068  13.572 5.563   1.00 38.76  ? 243 ARG A NH2   1 
ATOM   2692 N N     . GLU B 2 243 ? 3.968   13.703 6.584   1.00 45.61  ? 244 GLU A N     1 
ATOM   2693 C CA    . GLU B 2 243 ? 5.292   14.132 6.174   1.00 47.69  ? 244 GLU A CA    1 
ATOM   2694 C C     . GLU B 2 243 ? 6.346   13.260 6.807   1.00 46.91  ? 244 GLU A C     1 
ATOM   2695 O O     . GLU B 2 243 ? 7.343   12.940 6.171   1.00 47.78  ? 244 GLU A O     1 
ATOM   2696 C CB    . GLU B 2 243 ? 5.548   15.582 6.571   1.00 49.86  ? 244 GLU A CB    1 
ATOM   2697 C CG    . GLU B 2 243 ? 4.937   16.603 5.646   1.00 53.71  ? 244 GLU A CG    1 
ATOM   2698 C CD    . GLU B 2 243 ? 5.293   18.010 6.073   1.00 56.68  ? 244 GLU A CD    1 
ATOM   2699 O OE1   . GLU B 2 243 ? 5.136   18.309 7.283   1.00 56.67  ? 244 GLU A OE1   1 
ATOM   2700 O OE2   . GLU B 2 243 ? 5.728   18.809 5.209   1.00 57.58  ? 244 GLU A OE2   1 
ATOM   2701 N N     . PHE B 2 244 ? 6.140   12.873 8.059   1.00 46.41  ? 245 PHE A N     1 
ATOM   2702 C CA    . PHE B 2 244 ? 7.133   12.043 8.712   1.00 46.34  ? 245 PHE A CA    1 
ATOM   2703 C C     . PHE B 2 244 ? 7.221   10.704 8.014   1.00 46.65  ? 245 PHE A C     1 
ATOM   2704 O O     . PHE B 2 244 ? 8.307   10.197 7.757   1.00 46.58  ? 245 PHE A O     1 
ATOM   2705 C CB    . PHE B 2 244 ? 6.805   11.803 10.181  1.00 45.50  ? 245 PHE A CB    1 
ATOM   2706 C CG    . PHE B 2 244 ? 7.828   10.949 10.875  1.00 44.77  ? 245 PHE A CG    1 
ATOM   2707 C CD1   . PHE B 2 244 ? 9.114   11.429 11.089  1.00 44.96  ? 245 PHE A CD1   1 
ATOM   2708 C CD2   . PHE B 2 244 ? 7.531   9.647  11.254  1.00 43.63  ? 245 PHE A CD2   1 
ATOM   2709 C CE1   . PHE B 2 244 ? 10.094  10.623 11.665  1.00 43.92  ? 245 PHE A CE1   1 
ATOM   2710 C CE2   . PHE B 2 244 ? 8.503   8.830  11.832  1.00 43.31  ? 245 PHE A CE2   1 
ATOM   2711 C CZ    . PHE B 2 244 ? 9.788   9.320  12.038  1.00 43.64  ? 245 PHE A CZ    1 
ATOM   2712 N N     . MET B 2 245 ? 6.072   10.124 7.713   1.00 47.12  ? 246 MET A N     1 
ATOM   2713 C CA    . MET B 2 245 ? 6.057   8.842  7.035   1.00 48.60  ? 246 MET A CA    1 
ATOM   2714 C C     . MET B 2 245 ? 6.715   8.911  5.656   1.00 48.83  ? 246 MET A C     1 
ATOM   2715 O O     . MET B 2 245 ? 7.289   7.936  5.180   1.00 48.66  ? 246 MET A O     1 
ATOM   2716 C CB    . MET B 2 245 ? 4.618   8.352  6.893   1.00 49.83  ? 246 MET A CB    1 
ATOM   2717 C CG    . MET B 2 245 ? 4.049   7.782  8.167   1.00 51.53  ? 246 MET A CG    1 
ATOM   2718 S SD    . MET B 2 245 ? 5.050   6.408  8.738   1.00 54.30  ? 246 MET A SD    1 
ATOM   2719 C CE    . MET B 2 245 ? 6.201   7.252  9.812   1.00 53.08  ? 246 MET A CE    1 
ATOM   2720 N N     . GLU B 2 246 ? 6.631   10.068 5.018   1.00 49.34  ? 247 GLU A N     1 
ATOM   2721 C CA    . GLU B 2 246 ? 7.201   10.232 3.694   1.00 50.38  ? 247 GLU A CA    1 
ATOM   2722 C C     . GLU B 2 246 ? 8.721   10.407 3.702   1.00 50.14  ? 247 GLU A C     1 
ATOM   2723 O O     . GLU B 2 246 ? 9.425   9.867  2.846   1.00 50.76  ? 247 GLU A O     1 
ATOM   2724 C CB    . GLU B 2 246 ? 6.538   11.416 3.007   1.00 52.84  ? 247 GLU A CB    1 
ATOM   2725 C CG    . GLU B 2 246 ? 6.868   11.522 1.546   1.00 56.63  ? 247 GLU A CG    1 
ATOM   2726 C CD    . GLU B 2 246 ? 6.021   12.552 0.849   1.00 58.85  ? 247 GLU A CD    1 
ATOM   2727 O OE1   . GLU B 2 246 ? 6.268   12.795 -0.354  1.00 60.61  ? 247 GLU A OE1   1 
ATOM   2728 O OE2   . GLU B 2 246 ? 5.109   13.112 1.507   1.00 59.24  ? 247 GLU A OE2   1 
ATOM   2729 N N     . ALA B 2 247 ? 9.226   11.168 4.661   1.00 49.41  ? 248 ALA A N     1 
ATOM   2730 C CA    . ALA B 2 247 ? 10.658  11.386 4.780   1.00 48.94  ? 248 ALA A CA    1 
ATOM   2731 C C     . ALA B 2 247 ? 11.009  11.425 6.275   1.00 49.22  ? 248 ALA A C     1 
ATOM   2732 O O     . ALA B 2 247 ? 11.101  12.492 6.892   1.00 48.34  ? 248 ALA A O     1 
ATOM   2733 C CB    . ALA B 2 247 ? 11.043  12.689 4.092   1.00 48.44  ? 248 ALA A CB    1 
ATOM   2734 N N     . PRO B 2 248 ? 11.195  10.246 6.884   1.00 50.08  ? 249 PRO A N     1 
ATOM   2735 C CA    . PRO B 2 248 ? 11.531  10.211 8.312   1.00 50.68  ? 249 PRO A CA    1 
ATOM   2736 C C     . PRO B 2 248 ? 12.750  11.089 8.556   1.00 51.03  ? 249 PRO A C     1 
ATOM   2737 O O     . PRO B 2 248 ? 13.527  11.319 7.640   1.00 52.18  ? 249 PRO A O     1 
ATOM   2738 C CB    . PRO B 2 248 ? 11.824  8.733  8.565   1.00 50.98  ? 249 PRO A CB    1 
ATOM   2739 C CG    . PRO B 2 248 ? 10.983  8.024  7.520   1.00 50.42  ? 249 PRO A CG    1 
ATOM   2740 C CD    . PRO B 2 248 ? 11.182  8.892  6.302   1.00 50.55  ? 249 PRO A CD    1 
ATOM   2741 N N     . SER B 2 249 ? 12.916  11.581 9.779   1.00 51.05  ? 250 SER A N     1 
ATOM   2742 C CA    . SER B 2 249 ? 14.056  12.435 10.106  1.00 50.73  ? 250 SER A CA    1 
ATOM   2743 C C     . SER B 2 249 ? 14.099  12.582 11.618  1.00 50.92  ? 250 SER A C     1 
ATOM   2744 O O     . SER B 2 249 ? 13.072  12.452 12.289  1.00 51.94  ? 250 SER A O     1 
ATOM   2745 C CB    . SER B 2 249 ? 13.995  13.733 9.300   1.00 50.56  ? 250 SER A CB    1 
ATOM   2746 O OG    . SER B 2 249 ? 14.721  14.769 9.947   1.00 49.83  ? 250 SER A OG    1 
ATOM   2747 N N     . LEU B 2 250 ? 15.283  12.871 12.150  1.00 50.39  ? 251 LEU A N     1 
ATOM   2748 C CA    . LEU B 2 250 ? 15.439  13.187 13.566  1.00 49.65  ? 251 LEU A CA    1 
ATOM   2749 C C     . LEU B 2 250 ? 15.051  14.632 13.866  1.00 49.77  ? 251 LEU A C     1 
ATOM   2750 O O     . LEU B 2 250 ? 14.895  15.022 15.025  1.00 50.01  ? 251 LEU A O     1 
ATOM   2751 C CB    . LEU B 2 250 ? 16.883  12.955 13.995  1.00 48.79  ? 251 LEU A CB    1 
ATOM   2752 C CG    . LEU B 2 250 ? 17.114  13.027 15.502  1.00 47.54  ? 251 LEU A CG    1 
ATOM   2753 C CD1   . LEU B 2 250 ? 16.447  11.827 16.152  1.00 46.99  ? 251 LEU A CD1   1 
ATOM   2754 C CD2   . LEU B 2 250 ? 18.611  13.053 15.803  1.00 46.92  ? 251 LEU A CD2   1 
ATOM   2755 N N     . GLY B 2 251 ? 14.900  15.426 12.811  1.00 49.98  ? 252 GLY A N     1 
ATOM   2756 C CA    . GLY B 2 251 ? 14.529  16.821 12.980  1.00 49.93  ? 252 GLY A CA    1 
ATOM   2757 C C     . GLY B 2 251 ? 13.125  17.018 13.527  1.00 49.46  ? 252 GLY A C     1 
ATOM   2758 O O     . GLY B 2 251 ? 12.812  18.090 14.057  1.00 50.45  ? 252 GLY A O     1 
ATOM   2759 N N     . PHE B 2 252 ? 12.283  15.991 13.390  1.00 47.72  ? 253 PHE A N     1 
ATOM   2760 C CA    . PHE B 2 252 ? 10.905  16.033 13.878  1.00 45.95  ? 253 PHE A CA    1 
ATOM   2761 C C     . PHE B 2 252 ? 10.832  15.950 15.398  1.00 45.34  ? 253 PHE A C     1 
ATOM   2762 O O     . PHE B 2 252 ? 9.792   16.233 15.988  1.00 45.25  ? 253 PHE A O     1 
ATOM   2763 C CB    . PHE B 2 252 ? 10.085  14.886 13.284  1.00 44.69  ? 253 PHE A CB    1 
ATOM   2764 C CG    . PHE B 2 252 ? 9.701   15.089 11.849  1.00 43.57  ? 253 PHE A CG    1 
ATOM   2765 C CD1   . PHE B 2 252 ? 10.673  15.243 10.870  1.00 43.09  ? 253 PHE A CD1   1 
ATOM   2766 C CD2   . PHE B 2 252 ? 8.363   15.107 11.471  1.00 42.23  ? 253 PHE A CD2   1 
ATOM   2767 C CE1   . PHE B 2 252 ? 10.319  15.409 9.541   1.00 41.10  ? 253 PHE A CE1   1 
ATOM   2768 C CE2   . PHE B 2 252 ? 8.008   15.273 10.144  1.00 40.24  ? 253 PHE A CE2   1 
ATOM   2769 C CZ    . PHE B 2 252 ? 8.986   15.424 9.180   1.00 40.10  ? 253 PHE A CZ    1 
ATOM   2770 N N     . PHE B 2 253 ? 11.932  15.556 16.028  1.00 44.71  ? 254 PHE A N     1 
ATOM   2771 C CA    . PHE B 2 253 ? 11.959  15.443 17.478  1.00 45.59  ? 254 PHE A CA    1 
ATOM   2772 C C     . PHE B 2 253 ? 12.852  16.497 18.115  1.00 46.99  ? 254 PHE A C     1 
ATOM   2773 O O     . PHE B 2 253 ? 13.068  16.475 19.322  1.00 46.57  ? 254 PHE A O     1 
ATOM   2774 C CB    . PHE B 2 253 ? 12.431  14.050 17.913  1.00 44.76  ? 254 PHE A CB    1 
ATOM   2775 C CG    . PHE B 2 253 ? 11.582  12.926 17.390  1.00 43.22  ? 254 PHE A CG    1 
ATOM   2776 C CD1   . PHE B 2 253 ? 11.667  12.534 16.059  1.00 42.25  ? 254 PHE A CD1   1 
ATOM   2777 C CD2   . PHE B 2 253 ? 10.696  12.257 18.231  1.00 42.83  ? 254 PHE A CD2   1 
ATOM   2778 C CE1   . PHE B 2 253 ? 10.883  11.490 15.570  1.00 42.64  ? 254 PHE A CE1   1 
ATOM   2779 C CE2   . PHE B 2 253 ? 9.906   11.212 17.753  1.00 43.27  ? 254 PHE A CE2   1 
ATOM   2780 C CZ    . PHE B 2 253 ? 10.002  10.828 16.415  1.00 42.33  ? 254 PHE A CZ    1 
ATOM   2781 N N     . LYS B 2 254 ? 13.382  17.408 17.302  1.00 48.58  ? 255 LYS A N     1 
ATOM   2782 C CA    . LYS B 2 254 ? 14.234  18.484 17.804  1.00 48.85  ? 255 LYS A CA    1 
ATOM   2783 C C     . LYS B 2 254 ? 13.435  19.764 17.666  1.00 49.98  ? 255 LYS A C     1 
ATOM   2784 O O     . LYS B 2 254 ? 12.960  20.082 16.576  1.00 49.23  ? 255 LYS A O     1 
ATOM   2785 C CB    . LYS B 2 254 ? 15.502  18.622 16.966  1.00 48.51  ? 255 LYS A CB    1 
ATOM   2786 C CG    . LYS B 2 254 ? 16.308  17.360 16.825  1.00 48.63  ? 255 LYS A CG    1 
ATOM   2787 C CD    . LYS B 2 254 ? 17.650  17.649 16.174  1.00 49.31  ? 255 LYS A CD    1 
ATOM   2788 C CE    . LYS B 2 254 ? 18.539  16.409 16.172  1.00 50.86  ? 255 LYS A CE    1 
ATOM   2789 N NZ    . LYS B 2 254 ? 19.972  16.730 15.885  1.00 52.10  ? 255 LYS A NZ    1 
ATOM   2790 N N     . PRO B 2 255 ? 13.267  20.515 18.765  1.00 51.81  ? 256 PRO A N     1 
ATOM   2791 C CA    . PRO B 2 255 ? 12.505  21.766 18.701  1.00 53.68  ? 256 PRO A CA    1 
ATOM   2792 C C     . PRO B 2 255 ? 13.101  22.700 17.660  1.00 56.41  ? 256 PRO A C     1 
ATOM   2793 O O     . PRO B 2 255 ? 14.314  22.727 17.475  1.00 56.59  ? 256 PRO A O     1 
ATOM   2794 C CB    . PRO B 2 255 ? 12.631  22.314 20.112  1.00 52.21  ? 256 PRO A CB    1 
ATOM   2795 C CG    . PRO B 2 255 ? 12.707  21.063 20.945  1.00 51.71  ? 256 PRO A CG    1 
ATOM   2796 C CD    . PRO B 2 255 ? 13.686  20.230 20.147  1.00 51.74  ? 256 PRO A CD    1 
ATOM   2797 N N     . LYS B 2 256 ? 12.245  23.458 16.982  1.00 59.91  ? 257 LYS A N     1 
ATOM   2798 C CA    . LYS B 2 256 ? 12.683  24.384 15.937  1.00 63.68  ? 257 LYS A CA    1 
ATOM   2799 C C     . LYS B 2 256 ? 13.263  25.676 16.515  1.00 66.42  ? 257 LYS A C     1 
ATOM   2800 O O     . LYS B 2 256 ? 12.620  26.343 17.342  1.00 66.56  ? 257 LYS A O     1 
ATOM   2801 C CB    . LYS B 2 256 ? 11.502  24.715 15.024  1.00 63.86  ? 257 LYS A CB    1 
ATOM   2802 C CG    . LYS B 2 256 ? 10.487  23.580 14.893  1.00 65.05  ? 257 LYS A CG    1 
ATOM   2803 C CD    . LYS B 2 256 ? 11.103  22.306 14.311  1.00 65.62  ? 257 LYS A CD    1 
ATOM   2804 C CE    . LYS B 2 256 ? 10.097  21.153 14.290  1.00 64.61  ? 257 LYS A CE    1 
ATOM   2805 N NZ    . LYS B 2 256 ? 10.640  19.946 13.602  1.00 63.61  ? 257 LYS A NZ    1 
ATOM   2806 N N     . HIS B 2 257 ? 14.478  26.021 16.080  1.00 69.57  ? 258 HIS A N     1 
ATOM   2807 C CA    . HIS B 2 257 ? 15.153  27.237 16.558  1.00 72.76  ? 258 HIS A CA    1 
ATOM   2808 C C     . HIS B 2 257 ? 14.277  28.481 16.373  1.00 73.33  ? 258 HIS A C     1 
ATOM   2809 O O     . HIS B 2 257 ? 13.627  28.650 15.336  1.00 73.80  ? 258 HIS A O     1 
ATOM   2810 C CB    . HIS B 2 257 ? 16.500  27.442 15.831  1.00 74.16  ? 258 HIS A CB    1 
ATOM   2811 C CG    . HIS B 2 257 ? 17.659  26.734 16.472  1.00 75.81  ? 258 HIS A CG    1 
ATOM   2812 N ND1   . HIS B 2 257 ? 18.961  26.884 16.034  1.00 76.28  ? 258 HIS A ND1   1 
ATOM   2813 C CD2   . HIS B 2 257 ? 17.714  25.875 17.520  1.00 75.86  ? 258 HIS A CD2   1 
ATOM   2814 C CE1   . HIS B 2 257 ? 19.765  26.148 16.782  1.00 75.66  ? 258 HIS A CE1   1 
ATOM   2815 N NE2   . HIS B 2 257 ? 19.033  25.525 17.691  1.00 75.89  ? 258 HIS A NE2   1 
ATOM   2816 N N     . PRO B 2 258 ? 14.246  29.366 17.382  1.00 74.09  ? 259 PRO A N     1 
ATOM   2817 C CA    . PRO B 2 258 ? 13.436  30.588 17.302  1.00 75.45  ? 259 PRO A CA    1 
ATOM   2818 C C     . PRO B 2 258 ? 13.555  31.299 15.944  1.00 76.62  ? 259 PRO A C     1 
ATOM   2819 O O     . PRO B 2 258 ? 12.606  31.958 15.509  1.00 76.67  ? 259 PRO A O     1 
ATOM   2820 C CB    . PRO B 2 258 ? 13.878  31.367 18.538  1.00 74.89  ? 259 PRO A CB    1 
ATOM   2821 C CG    . PRO B 2 258 ? 14.144  30.266 19.532  1.00 74.23  ? 259 PRO A CG    1 
ATOM   2822 C CD    . PRO B 2 258 ? 14.903  29.253 18.699  1.00 73.57  ? 259 PRO A CD    1 
ATOM   2823 N N     . LEU B 2 259 ? 14.712  31.150 15.291  1.00 77.82  ? 260 LEU A N     1 
ATOM   2824 C CA    . LEU B 2 259 ? 15.059  31.840 14.034  1.00 78.98  ? 260 LEU A CA    1 
ATOM   2825 C C     . LEU B 2 259 ? 14.934  33.315 13.625  1.00 79.26  ? 260 LEU A C     1 
ATOM   2826 O O     . LEU B 2 259 ? 14.626  33.635 12.472  1.00 79.51  ? 260 LEU A O     1 
ATOM   2827 C CB    . LEU B 2 259 ? 14.600  31.021 12.821  1.00 79.40  ? 260 LEU A CB    1 
ATOM   2828 C CG    . LEU B 2 259 ? 15.147  31.488 11.462  1.00 80.56  ? 260 LEU A CG    1 
ATOM   2829 C CD1   . LEU B 2 259 ? 16.675  31.444 11.480  1.00 79.80  ? 260 LEU A CD1   1 
ATOM   2830 C CD2   . LEU B 2 259 ? 14.589  30.607 10.340  1.00 80.14  ? 260 LEU A CD2   1 
ATOM   2831 N N     . GLU B 2 260 ? 15.202  34.202 14.582  1.00 79.88  ? 261 GLU A N     1 
ATOM   2832 C CA    . GLU B 2 260 ? 14.801  35.608 14.618  1.00 79.73  ? 261 GLU A CA    1 
ATOM   2833 C C     . GLU B 2 260 ? 15.345  36.415 13.446  1.00 78.64  ? 261 GLU A C     1 
ATOM   2834 O O     . GLU B 2 260 ? 16.477  36.213 12.999  1.00 78.95  ? 261 GLU A O     1 
ATOM   2835 C CB    . GLU B 2 260 ? 15.219  36.219 15.963  1.00 80.97  ? 261 GLU A CB    1 
ATOM   2836 C CG    . GLU B 2 260 ? 14.743  35.356 17.150  1.00 82.53  ? 261 GLU A CG    1 
ATOM   2837 C CD    . GLU B 2 260 ? 15.291  35.787 18.500  1.00 82.62  ? 261 GLU A CD    1 
ATOM   2838 O OE1   . GLU B 2 260 ? 14.813  36.810 19.037  1.00 82.85  ? 261 GLU A OE1   1 
ATOM   2839 O OE2   . GLU B 2 260 ? 16.196  35.096 19.023  1.00 82.27  ? 261 GLU A OE2   1 
ATOM   2840 N N     . ILE B 2 261 ? 14.513  37.335 12.967  1.00 76.92  ? 262 ILE A N     1 
ATOM   2841 C CA    . ILE B 2 261 ? 14.818  38.171 11.810  1.00 74.89  ? 262 ILE A CA    1 
ATOM   2842 C C     . ILE B 2 261 ? 15.200  39.592 12.219  1.00 73.64  ? 262 ILE A C     1 
ATOM   2843 O O     . ILE B 2 261 ? 14.677  40.110 13.205  1.00 72.76  ? 262 ILE A O     1 
ATOM   2844 C CB    . ILE B 2 261 ? 13.568  38.209 10.886  1.00 74.34  ? 262 ILE A CB    1 
ATOM   2845 C CG1   . ILE B 2 261 ? 13.959  38.557 9.454   1.00 73.47  ? 262 ILE A CG1   1 
ATOM   2846 C CG2   . ILE B 2 261 ? 12.544  39.208 11.440  1.00 75.05  ? 262 ILE A CG2   1 
ATOM   2847 C CD1   . ILE B 2 261 ? 12.831  38.331 8.470   1.00 71.83  ? 262 ILE A CD1   1 
ATOM   2848 N N     . GLU B 2 262 ? 16.109  40.221 11.476  1.00 72.32  ? 263 GLU A N     1 
ATOM   2849 C CA    . GLU B 2 262 ? 16.483  41.588 11.819  1.00 71.85  ? 263 GLU A CA    1 
ATOM   2850 C C     . GLU B 2 262 ? 15.302  42.472 11.438  1.00 70.10  ? 263 GLU A C     1 
ATOM   2851 O O     . GLU B 2 262 ? 14.745  42.350 10.344  1.00 69.51  ? 263 GLU A O     1 
ATOM   2852 C CB    . GLU B 2 262 ? 17.768  42.047 11.096  1.00 72.41  ? 263 GLU A CB    1 
ATOM   2853 C CG    . GLU B 2 262 ? 17.706  42.067 9.576   1.00 73.90  ? 263 GLU A CG    1 
ATOM   2854 C CD    . GLU B 2 262 ? 18.312  40.823 8.943   1.00 75.26  ? 263 GLU A CD    1 
ATOM   2855 O OE1   . GLU B 2 262 ? 18.209  40.666 7.702   1.00 74.62  ? 263 GLU A OE1   1 
ATOM   2856 O OE2   . GLU B 2 262 ? 18.897  40.003 9.685   1.00 76.14  ? 263 GLU A OE2   1 
ATOM   2857 N N     . PRO B 2 263 ? 14.896  43.366 12.348  1.00 68.43  ? 264 PRO A N     1 
ATOM   2858 C CA    . PRO B 2 263 ? 13.767  44.261 12.088  1.00 68.32  ? 264 PRO A CA    1 
ATOM   2859 C C     . PRO B 2 263 ? 13.751  44.910 10.694  1.00 68.37  ? 264 PRO A C     1 
ATOM   2860 O O     . PRO B 2 263 ? 12.678  45.103 10.114  1.00 68.21  ? 264 PRO A O     1 
ATOM   2861 C CB    . PRO B 2 263 ? 13.864  45.284 13.224  1.00 66.99  ? 264 PRO A CB    1 
ATOM   2862 C CG    . PRO B 2 263 ? 15.312  45.249 13.596  1.00 67.06  ? 264 PRO A CG    1 
ATOM   2863 C CD    . PRO B 2 263 ? 15.635  43.792 13.545  1.00 67.42  ? 264 PRO A CD    1 
ATOM   2864 N N     . GLU B 2 264 ? 14.929  45.228 10.154  1.00 68.45  ? 265 GLU A N     1 
ATOM   2865 C CA    . GLU B 2 264 ? 15.023  45.863 8.838   1.00 68.58  ? 265 GLU A CA    1 
ATOM   2866 C C     . GLU B 2 264 ? 14.489  45.002 7.689   1.00 67.53  ? 265 GLU A C     1 
ATOM   2867 O O     . GLU B 2 264 ? 13.818  45.511 6.788   1.00 67.49  ? 265 GLU A O     1 
ATOM   2868 C CB    . GLU B 2 264 ? 16.470  46.280 8.542   1.00 69.96  ? 265 GLU A CB    1 
ATOM   2869 C CG    . GLU B 2 264 ? 16.620  47.190 7.304   1.00 72.18  ? 265 GLU A CG    1 
ATOM   2870 C CD    . GLU B 2 264 ? 15.684  48.409 7.325   1.00 73.11  ? 265 GLU A CD    1 
ATOM   2871 O OE1   . GLU B 2 264 ? 14.448  48.223 7.243   1.00 73.33  ? 265 GLU A OE1   1 
ATOM   2872 O OE2   . GLU B 2 264 ? 16.181  49.556 7.422   1.00 73.34  ? 265 GLU A OE2   1 
ATOM   2873 N N     . ARG B 2 265 ? 14.791  43.709 7.710   1.00 66.15  ? 266 ARG A N     1 
ATOM   2874 C CA    . ARG B 2 265 ? 14.302  42.811 6.672   1.00 65.22  ? 266 ARG A CA    1 
ATOM   2875 C C     . ARG B 2 265 ? 12.783  42.749 6.808   1.00 63.68  ? 266 ARG A C     1 
ATOM   2876 O O     . ARG B 2 265 ? 12.050  42.917 5.831   1.00 63.79  ? 266 ARG A O     1 
ATOM   2877 C CB    . ARG B 2 265 ? 14.894  41.413 6.856   1.00 67.08  ? 266 ARG A CB    1 
ATOM   2878 C CG    . ARG B 2 265 ? 14.430  40.364 5.835   1.00 69.05  ? 266 ARG A CG    1 
ATOM   2879 C CD    . ARG B 2 265 ? 15.047  38.992 6.157   1.00 71.29  ? 266 ARG A CD    1 
ATOM   2880 N NE    . ARG B 2 265 ? 14.434  37.878 5.430   1.00 72.67  ? 266 ARG A NE    1 
ATOM   2881 C CZ    . ARG B 2 265 ? 14.424  36.614 5.858   1.00 73.21  ? 266 ARG A CZ    1 
ATOM   2882 N NH1   . ARG B 2 265 ? 14.991  36.291 7.018   1.00 73.22  ? 266 ARG A NH1   1 
ATOM   2883 N NH2   . ARG B 2 265 ? 13.847  35.666 5.127   1.00 73.42  ? 266 ARG A NH2   1 
ATOM   2884 N N     . LEU B 2 266 ? 12.322  42.531 8.037   1.00 61.50  ? 267 LEU A N     1 
ATOM   2885 C CA    . LEU B 2 266 ? 10.896  42.443 8.326   1.00 59.03  ? 267 LEU A CA    1 
ATOM   2886 C C     . LEU B 2 266 ? 10.118  43.676 7.861   1.00 57.22  ? 267 LEU A C     1 
ATOM   2887 O O     . LEU B 2 266 ? 8.931   43.578 7.543   1.00 56.76  ? 267 LEU A O     1 
ATOM   2888 C CB    . LEU B 2 266 ? 10.683  42.227 9.827   1.00 58.80  ? 267 LEU A CB    1 
ATOM   2889 C CG    . LEU B 2 266 ? 9.253   41.953 10.300  1.00 58.15  ? 267 LEU A CG    1 
ATOM   2890 C CD1   . LEU B 2 266 ? 8.719   40.708 9.626   1.00 57.48  ? 267 LEU A CD1   1 
ATOM   2891 C CD2   . LEU B 2 266 ? 9.245   41.781 11.810  1.00 58.40  ? 267 LEU A CD2   1 
ATOM   2892 N N     . ARG B 2 267 ? 10.775  44.836 7.830   1.00 55.51  ? 268 ARG A N     1 
ATOM   2893 C CA    . ARG B 2 267 ? 10.108  46.057 7.377   1.00 53.31  ? 268 ARG A CA    1 
ATOM   2894 C C     . ARG B 2 267 ? 9.920   45.985 5.874   1.00 51.08  ? 268 ARG A C     1 
ATOM   2895 O O     . ARG B 2 267 ? 8.872   46.360 5.355   1.00 50.44  ? 268 ARG A O     1 
ATOM   2896 C CB    . ARG B 2 267 ? 10.921  47.320 7.707   1.00 54.20  ? 268 ARG A CB    1 
ATOM   2897 C CG    . ARG B 2 267 ? 10.247  48.605 7.176   1.00 55.90  ? 268 ARG A CG    1 
ATOM   2898 C CD    . ARG B 2 267 ? 10.982  49.906 7.529   1.00 57.12  ? 268 ARG A CD    1 
ATOM   2899 N NE    . ARG B 2 267 ? 12.294  50.052 6.879   1.00 59.03  ? 268 ARG A NE    1 
ATOM   2900 C CZ    . ARG B 2 267 ? 12.485  50.194 5.568   1.00 58.49  ? 268 ARG A CZ    1 
ATOM   2901 N NH1   . ARG B 2 267 ? 11.451  50.216 4.738   1.00 58.11  ? 268 ARG A NH1   1 
ATOM   2902 N NH2   . ARG B 2 267 ? 13.715  50.298 5.084   1.00 58.16  ? 268 ARG A NH2   1 
ATOM   2903 N N     . LYS B 2 268 ? 10.951  45.508 5.184   1.00 48.61  ? 269 LYS A N     1 
ATOM   2904 C CA    . LYS B 2 268 ? 10.908  45.387 3.735   1.00 46.34  ? 269 LYS A CA    1 
ATOM   2905 C C     . LYS B 2 268 ? 9.779   44.464 3.310   1.00 44.30  ? 269 LYS A C     1 
ATOM   2906 O O     . LYS B 2 268 ? 9.027   44.775 2.388   1.00 44.00  ? 269 LYS A O     1 
ATOM   2907 C CB    . LYS B 2 268 ? 12.230  44.827 3.197   1.00 46.63  ? 269 LYS A CB    1 
ATOM   2908 C CG    . LYS B 2 268 ? 13.429  45.741 3.369   1.00 47.09  ? 269 LYS A CG    1 
ATOM   2909 C CD    . LYS B 2 268 ? 14.593  45.240 2.521   1.00 48.43  ? 269 LYS A CD    1 
ATOM   2910 C CE    . LYS B 2 268 ? 15.810  46.168 2.569   1.00 48.53  ? 269 LYS A CE    1 
ATOM   2911 N NZ    . LYS B 2 268 ? 16.470  46.206 3.910   1.00 48.81  ? 269 LYS A NZ    1 
ATOM   2912 N N     . ILE B 2 269 ? 9.679   43.327 3.990   1.00 42.04  ? 270 ILE A N     1 
ATOM   2913 C CA    . ILE B 2 269 ? 8.666   42.333 3.698   1.00 39.97  ? 270 ILE A CA    1 
ATOM   2914 C C     . ILE B 2 269 ? 7.254   42.892 3.767   1.00 40.20  ? 270 ILE A C     1 
ATOM   2915 O O     . ILE B 2 269 ? 6.445   42.652 2.874   1.00 40.58  ? 270 ILE A O     1 
ATOM   2916 C CB    . ILE B 2 269 ? 8.786   41.143 4.653   1.00 39.83  ? 270 ILE A CB    1 
ATOM   2917 C CG1   . ILE B 2 269 ? 10.020  40.320 4.267   1.00 40.11  ? 270 ILE A CG1   1 
ATOM   2918 C CG2   . ILE B 2 269 ? 7.488   40.318 4.633   1.00 39.47  ? 270 ILE A CG2   1 
ATOM   2919 C CD1   . ILE B 2 269 ? 10.182  39.044 5.056   1.00 39.18  ? 270 ILE A CD1   1 
ATOM   2920 N N     . VAL B 2 270 ? 6.945   43.619 4.832   1.00 39.94  ? 271 VAL A N     1 
ATOM   2921 C CA    . VAL B 2 270 ? 5.630   44.214 4.972   1.00 40.27  ? 271 VAL A CA    1 
ATOM   2922 C C     . VAL B 2 270 ? 5.423   45.249 3.869   1.00 41.37  ? 271 VAL A C     1 
ATOM   2923 O O     . VAL B 2 270 ? 4.299   45.510 3.434   1.00 40.72  ? 271 VAL A O     1 
ATOM   2924 C CB    . VAL B 2 270 ? 5.497   44.910 6.313   1.00 40.12  ? 271 VAL A CB    1 
ATOM   2925 C CG1   . VAL B 2 270 ? 4.139   45.576 6.411   1.00 40.74  ? 271 VAL A CG1   1 
ATOM   2926 C CG2   . VAL B 2 270 ? 5.700   43.914 7.415   1.00 40.39  ? 271 VAL A CG2   1 
ATOM   2927 N N     . GLU B 2 271 ? 6.521   45.849 3.432   1.00 43.41  ? 272 GLU A N     1 
ATOM   2928 C CA    . GLU B 2 271 ? 6.474   46.852 2.378   1.00 46.40  ? 272 GLU A CA    1 
ATOM   2929 C C     . GLU B 2 271 ? 6.162   46.114 1.089   1.00 46.81  ? 272 GLU A C     1 
ATOM   2930 O O     . GLU B 2 271 ? 5.364   46.577 0.270   1.00 47.85  ? 272 GLU A O     1 
ATOM   2931 C CB    . GLU B 2 271 ? 7.831   47.532 2.271   1.00 49.50  ? 272 GLU A CB    1 
ATOM   2932 C CG    . GLU B 2 271 ? 7.855   48.887 1.597   1.00 53.82  ? 272 GLU A CG    1 
ATOM   2933 C CD    . GLU B 2 271 ? 9.175   49.610 1.862   1.00 57.01  ? 272 GLU A CD    1 
ATOM   2934 O OE1   . GLU B 2 271 ? 9.429   49.974 3.034   1.00 58.25  ? 272 GLU A OE1   1 
ATOM   2935 O OE2   . GLU B 2 271 ? 9.969   49.801 0.911   1.00 59.65  ? 272 GLU A OE2   1 
ATOM   2936 N N     . GLU B 2 272 ? 6.802   44.957 0.929   1.00 46.56  ? 273 GLU A N     1 
ATOM   2937 C CA    . GLU B 2 272 ? 6.619   44.101 -0.239  1.00 46.96  ? 273 GLU A CA    1 
ATOM   2938 C C     . GLU B 2 272 ? 5.187   43.559 -0.284  1.00 45.62  ? 273 GLU A C     1 
ATOM   2939 O O     . GLU B 2 272 ? 4.637   43.290 -1.363  1.00 45.26  ? 273 GLU A O     1 
ATOM   2940 C CB    . GLU B 2 272 ? 7.596   42.920 -0.184  1.00 51.02  ? 273 GLU A CB    1 
ATOM   2941 C CG    . GLU B 2 272 ? 9.097   43.280 -0.203  1.00 57.48  ? 273 GLU A CG    1 
ATOM   2942 C CD    . GLU B 2 272 ? 10.014  42.076 0.133   1.00 60.16  ? 273 GLU A CD    1 
ATOM   2943 O OE1   . GLU B 2 272 ? 9.797   40.965 -0.421  1.00 61.43  ? 273 GLU A OE1   1 
ATOM   2944 O OE2   . GLU B 2 272 ? 10.957  42.246 0.949   1.00 60.52  ? 273 GLU A OE2   1 
ATOM   2945 N N     . ARG B 2 273 ? 4.594   43.381 0.896   1.00 43.13  ? 274 ARG A N     1 
ATOM   2946 C CA    . ARG B 2 273 ? 3.231   42.874 0.997   1.00 40.30  ? 274 ARG A CA    1 
ATOM   2947 C C     . ARG B 2 273 ? 2.243   44.025 0.836   1.00 39.47  ? 274 ARG A C     1 
ATOM   2948 O O     . ARG B 2 273 ? 1.099   43.829 0.427   1.00 39.56  ? 274 ARG A O     1 
ATOM   2949 C CB    . ARG B 2 273 ? 3.044   42.170 2.340   1.00 40.17  ? 274 ARG A CB    1 
ATOM   2950 C CG    . ARG B 2 273 ? 3.737   40.798 2.409   1.00 38.09  ? 274 ARG A CG    1 
ATOM   2951 C CD    . ARG B 2 273 ? 3.791   40.259 3.833   1.00 35.24  ? 274 ARG A CD    1 
ATOM   2952 N NE    . ARG B 2 273 ? 3.432   38.847 3.894   1.00 33.78  ? 274 ARG A NE    1 
ATOM   2953 C CZ    . ARG B 2 273 ? 2.227   38.402 4.230   1.00 33.64  ? 274 ARG A CZ    1 
ATOM   2954 N NH1   . ARG B 2 273 ? 1.272   39.260 4.539   1.00 34.33  ? 274 ARG A NH1   1 
ATOM   2955 N NH2   . ARG B 2 273 ? 1.970   37.105 4.254   1.00 33.39  ? 274 ARG A NH2   1 
ATOM   2956 N N     . GLY B 2 274 ? 2.712   45.230 1.140   1.00 38.20  ? 275 GLY A N     1 
ATOM   2957 C CA    . GLY B 2 274 ? 1.890   46.418 1.008   1.00 36.16  ? 275 GLY A CA    1 
ATOM   2958 C C     . GLY B 2 274 ? 0.607   46.385 1.802   1.00 34.99  ? 275 GLY A C     1 
ATOM   2959 O O     . GLY B 2 274 ? -0.390  46.970 1.395   1.00 35.47  ? 275 GLY A O     1 
ATOM   2960 N N     . THR B 2 275 ? 0.630   45.701 2.939   1.00 34.57  ? 276 THR A N     1 
ATOM   2961 C CA    . THR B 2 275 ? -0.547  45.583 3.790   1.00 34.06  ? 276 THR A CA    1 
ATOM   2962 C C     . THR B 2 275 ? -0.455  46.520 4.980   1.00 34.33  ? 276 THR A C     1 
ATOM   2963 O O     . THR B 2 275 ? 0.543   47.241 5.153   1.00 35.56  ? 276 THR A O     1 
ATOM   2964 C CB    . THR B 2 275 ? -0.679  44.174 4.363   1.00 34.34  ? 276 THR A CB    1 
ATOM   2965 O OG1   . THR B 2 275 ? 0.541   43.825 5.028   1.00 34.76  ? 276 THR A OG1   1 
ATOM   2966 C CG2   . THR B 2 275 ? -0.974  43.166 3.266   1.00 34.82  ? 276 THR A CG2   1 
ATOM   2967 N N     . ALA B 2 276 ? -1.501  46.513 5.800   1.00 32.56  ? 277 ALA A N     1 
ATOM   2968 C CA    . ALA B 2 276 ? -1.519  47.329 6.998   1.00 31.03  ? 277 ALA A CA    1 
ATOM   2969 C C     . ALA B 2 276 ? -1.201  46.326 8.088   1.00 30.58  ? 277 ALA A C     1 
ATOM   2970 O O     . ALA B 2 276 ? -1.879  45.305 8.214   1.00 30.89  ? 277 ALA A O     1 
ATOM   2971 C CB    . ALA B 2 276 ? -2.899  47.934 7.214   1.00 31.20  ? 277 ALA A CB    1 
ATOM   2972 N N     . VAL B 2 277 ? -0.140  46.593 8.840   1.00 29.70  ? 278 VAL A N     1 
ATOM   2973 C CA    . VAL B 2 277 ? 0.275   45.718 9.925   1.00 27.37  ? 278 VAL A CA    1 
ATOM   2974 C C     . VAL B 2 277 ? 0.450   46.538 11.175  1.00 27.43  ? 278 VAL A C     1 
ATOM   2975 O O     . VAL B 2 277 ? 1.355   47.356 11.274  1.00 27.69  ? 278 VAL A O     1 
ATOM   2976 C CB    . VAL B 2 277 ? 1.576   45.057 9.611   1.00 26.06  ? 278 VAL A CB    1 
ATOM   2977 C CG1   . VAL B 2 277 ? 1.957   44.148 10.758  1.00 27.28  ? 278 VAL A CG1   1 
ATOM   2978 C CG2   . VAL B 2 277 ? 1.448   44.299 8.297   1.00 24.46  ? 278 VAL A CG2   1 
ATOM   2979 N N     . PHE B 2 278 ? -0.428  46.310 12.135  1.00 28.05  ? 279 PHE A N     1 
ATOM   2980 C CA    . PHE B 2 278 ? -0.403  47.051 13.379  1.00 28.36  ? 279 PHE A CA    1 
ATOM   2981 C C     . PHE B 2 278 ? -0.749  46.122 14.536  1.00 29.34  ? 279 PHE A C     1 
ATOM   2982 O O     . PHE B 2 278 ? -1.246  45.019 14.330  1.00 30.22  ? 279 PHE A O     1 
ATOM   2983 C CB    . PHE B 2 278 ? -1.422  48.177 13.290  1.00 28.52  ? 279 PHE A CB    1 
ATOM   2984 C CG    . PHE B 2 278 ? -2.835  47.699 13.108  1.00 29.17  ? 279 PHE A CG    1 
ATOM   2985 C CD1   . PHE B 2 278 ? -3.655  47.474 14.201  1.00 30.12  ? 279 PHE A CD1   1 
ATOM   2986 C CD2   . PHE B 2 278 ? -3.347  47.472 11.842  1.00 30.55  ? 279 PHE A CD2   1 
ATOM   2987 C CE1   . PHE B 2 278 ? -4.961  47.039 14.039  1.00 29.93  ? 279 PHE A CE1   1 
ATOM   2988 C CE2   . PHE B 2 278 ? -4.666  47.030 11.671  1.00 30.46  ? 279 PHE A CE2   1 
ATOM   2989 C CZ    . PHE B 2 278 ? -5.468  46.816 12.772  1.00 30.00  ? 279 PHE A CZ    1 
ATOM   2990 N N     . ALA B 2 279 ? -0.483  46.560 15.755  1.00 29.77  ? 280 ALA A N     1 
ATOM   2991 C CA    . ALA B 2 279 ? -0.795  45.732 16.900  1.00 31.48  ? 280 ALA A CA    1 
ATOM   2992 C C     . ALA B 2 279 ? -1.526  46.571 17.919  1.00 32.12  ? 280 ALA A C     1 
ATOM   2993 O O     . ALA B 2 279 ? -1.473  47.796 17.851  1.00 32.02  ? 280 ALA A O     1 
ATOM   2994 C CB    . ALA B 2 279 ? 0.476   45.166 17.504  1.00 31.78  ? 280 ALA A CB    1 
ATOM   2995 N N     . VAL B 2 280 ? -2.221  45.909 18.843  1.00 32.76  ? 281 VAL A N     1 
ATOM   2996 C CA    . VAL B 2 280 ? -2.946  46.593 19.906  1.00 34.19  ? 281 VAL A CA    1 
ATOM   2997 C C     . VAL B 2 280 ? -2.239  46.200 21.183  1.00 35.48  ? 281 VAL A C     1 
ATOM   2998 O O     . VAL B 2 280 ? -2.320  45.050 21.602  1.00 35.89  ? 281 VAL A O     1 
ATOM   2999 C CB    . VAL B 2 280 ? -4.421  46.135 20.003  1.00 34.31  ? 281 VAL A CB    1 
ATOM   3000 C CG1   . VAL B 2 280 ? -5.052  46.685 21.274  1.00 31.55  ? 281 VAL A CG1   1 
ATOM   3001 C CG2   . VAL B 2 280 ? -5.200  46.621 18.767  1.00 34.86  ? 281 VAL A CG2   1 
ATOM   3002 N N     . LYS B 2 281 ? -1.537  47.151 21.790  1.00 36.55  ? 282 LYS A N     1 
ATOM   3003 C CA    . LYS B 2 281 ? -0.800  46.896 23.022  1.00 37.78  ? 282 LYS A CA    1 
ATOM   3004 C C     . LYS B 2 281 ? -1.570  47.311 24.285  1.00 39.00  ? 282 LYS A C     1 
ATOM   3005 O O     . LYS B 2 281 ? -2.228  48.354 24.318  1.00 39.35  ? 282 LYS A O     1 
ATOM   3006 C CB    . LYS B 2 281 ? 0.541   47.626 22.960  1.00 37.25  ? 282 LYS A CB    1 
ATOM   3007 C CG    . LYS B 2 281 ? 1.413   47.416 24.163  1.00 37.36  ? 282 LYS A CG    1 
ATOM   3008 C CD    . LYS B 2 281 ? 2.727   48.131 23.966  1.00 38.30  ? 282 LYS A CD    1 
ATOM   3009 C CE    . LYS B 2 281 ? 3.578   48.079 25.221  1.00 38.76  ? 282 LYS A CE    1 
ATOM   3010 N NZ    . LYS B 2 281 ? 4.886   48.749 25.000  1.00 40.17  ? 282 LYS A NZ    1 
ATOM   3011 N N     . PHE B 2 282 ? -1.487  46.486 25.324  1.00 40.10  ? 283 PHE A N     1 
ATOM   3012 C CA    . PHE B 2 282 ? -2.160  46.785 26.586  1.00 41.20  ? 283 PHE A CA    1 
ATOM   3013 C C     . PHE B 2 282 ? -1.485  45.981 27.690  1.00 41.42  ? 283 PHE A C     1 
ATOM   3014 O O     . PHE B 2 282 ? -0.783  45.012 27.403  1.00 40.96  ? 283 PHE A O     1 
ATOM   3015 C CB    . PHE B 2 282 ? -3.655  46.451 26.487  1.00 41.96  ? 283 PHE A CB    1 
ATOM   3016 C CG    . PHE B 2 282 ? -3.936  45.014 26.191  1.00 43.15  ? 283 PHE A CG    1 
ATOM   3017 C CD1   . PHE B 2 282 ? -4.325  44.146 27.207  1.00 43.60  ? 283 PHE A CD1   1 
ATOM   3018 C CD2   . PHE B 2 282 ? -3.780  44.515 24.907  1.00 42.79  ? 283 PHE A CD2   1 
ATOM   3019 C CE1   . PHE B 2 282 ? -4.550  42.798 26.945  1.00 43.23  ? 283 PHE A CE1   1 
ATOM   3020 C CE2   . PHE B 2 282 ? -4.005  43.165 24.635  1.00 42.25  ? 283 PHE A CE2   1 
ATOM   3021 C CZ    . PHE B 2 282 ? -4.388  42.309 25.654  1.00 42.63  ? 283 PHE A CZ    1 
ATOM   3022 N N     . ARG B 2 283 ? -1.688  46.373 28.945  1.00 42.56  ? 284 ARG A N     1 
ATOM   3023 C CA    . ARG B 2 283 ? -1.033  45.676 30.054  1.00 43.98  ? 284 ARG A CA    1 
ATOM   3024 C C     . ARG B 2 283 ? -1.598  44.298 30.365  1.00 44.12  ? 284 ARG A C     1 
ATOM   3025 O O     . ARG B 2 283 ? -2.814  44.118 30.473  1.00 44.05  ? 284 ARG A O     1 
ATOM   3026 C CB    . ARG B 2 283 ? -1.034  46.553 31.313  1.00 44.20  ? 284 ARG A CB    1 
ATOM   3027 C CG    . ARG B 2 283 ? 0.033   47.640 31.263  1.00 46.27  ? 284 ARG A CG    1 
ATOM   3028 C CD    . ARG B 2 283 ? -0.022  48.591 32.457  1.00 48.63  ? 284 ARG A CD    1 
ATOM   3029 N NE    . ARG B 2 283 ? 0.993   49.647 32.364  1.00 51.30  ? 284 ARG A NE    1 
ATOM   3030 C CZ    . ARG B 2 283 ? 2.308   49.426 32.294  1.00 52.87  ? 284 ARG A CZ    1 
ATOM   3031 N NH1   . ARG B 2 283 ? 2.778   48.182 32.309  1.00 54.18  ? 284 ARG A NH1   1 
ATOM   3032 N NH2   . ARG B 2 283 ? 3.158   50.445 32.194  1.00 52.86  ? 284 ARG A NH2   1 
ATOM   3033 N N     . LYS B 2 284 ? -0.697  43.328 30.512  1.00 43.96  ? 285 LYS A N     1 
ATOM   3034 C CA    . LYS B 2 284 ? -1.097  41.954 30.785  1.00 44.27  ? 285 LYS A CA    1 
ATOM   3035 C C     . LYS B 2 284 ? -1.866  41.819 32.076  1.00 44.62  ? 285 LYS A C     1 
ATOM   3036 O O     . LYS B 2 284 ? -1.385  42.220 33.125  1.00 43.36  ? 285 LYS A O     1 
ATOM   3037 C CB    . LYS B 2 284 ? 0.121   41.029 30.849  1.00 44.11  ? 285 LYS A CB    1 
ATOM   3038 C CG    . LYS B 2 284 ? -0.263  39.588 31.140  1.00 43.19  ? 285 LYS A CG    1 
ATOM   3039 C CD    . LYS B 2 284 ? 0.896   38.771 31.669  1.00 43.92  ? 285 LYS A CD    1 
ATOM   3040 C CE    . LYS B 2 284 ? 0.378   37.575 32.467  1.00 44.46  ? 285 LYS A CE    1 
ATOM   3041 N NZ    . LYS B 2 284 ? 1.471   36.791 33.116  1.00 46.64  ? 285 LYS A NZ    1 
ATOM   3042 N N     . PRO B 2 285 ? -3.088  41.267 32.015  1.00 46.17  ? 286 PRO A N     1 
ATOM   3043 C CA    . PRO B 2 285 ? -3.808  41.135 33.278  1.00 47.43  ? 286 PRO A CA    1 
ATOM   3044 C C     . PRO B 2 285 ? -3.013  40.120 34.084  1.00 49.38  ? 286 PRO A C     1 
ATOM   3045 O O     . PRO B 2 285 ? -2.595  39.095 33.550  1.00 50.36  ? 286 PRO A O     1 
ATOM   3046 C CB    . PRO B 2 285 ? -5.167  40.580 32.852  1.00 46.01  ? 286 PRO A CB    1 
ATOM   3047 C CG    . PRO B 2 285 ? -5.336  41.088 31.467  1.00 45.32  ? 286 PRO A CG    1 
ATOM   3048 C CD    . PRO B 2 285 ? -3.950  40.883 30.884  1.00 46.24  ? 286 PRO A CD    1 
ATOM   3049 N N     . ASP B 2 286 ? -2.772  40.413 35.354  1.00 51.66  ? 287 ASP A N     1 
ATOM   3050 C CA    . ASP B 2 286 ? -2.042  39.479 36.197  1.00 52.33  ? 287 ASP A CA    1 
ATOM   3051 C C     . ASP B 2 286 ? -2.972  38.289 36.508  1.00 51.62  ? 287 ASP A C     1 
ATOM   3052 O O     . ASP B 2 286 ? -3.644  38.255 37.543  1.00 51.40  ? 287 ASP A O     1 
ATOM   3053 C CB    . ASP B 2 286 ? -1.593  40.178 37.489  1.00 54.22  ? 287 ASP A CB    1 
ATOM   3054 C CG    . ASP B 2 286 ? -0.662  39.316 38.329  1.00 56.16  ? 287 ASP A CG    1 
ATOM   3055 O OD1   . ASP B 2 286 ? 0.317   38.770 37.761  1.00 57.91  ? 287 ASP A OD1   1 
ATOM   3056 O OD2   . ASP B 2 286 ? -0.907  39.194 39.555  1.00 55.97  ? 287 ASP A OD2   1 
ATOM   3057 N N     . ILE B 2 287 ? -3.028  37.333 35.585  1.00 50.32  ? 288 ILE A N     1 
ATOM   3058 C CA    . ILE B 2 287 ? -3.852  36.152 35.763  1.00 49.18  ? 288 ILE A CA    1 
ATOM   3059 C C     . ILE B 2 287 ? -3.129  34.954 35.182  1.00 49.32  ? 288 ILE A C     1 
ATOM   3060 O O     . ILE B 2 287 ? -2.089  35.104 34.538  1.00 49.35  ? 288 ILE A O     1 
ATOM   3061 C CB    . ILE B 2 287 ? -5.206  36.278 35.056  1.00 48.76  ? 288 ILE A CB    1 
ATOM   3062 C CG1   . ILE B 2 287 ? -5.006  36.275 33.540  1.00 48.12  ? 288 ILE A CG1   1 
ATOM   3063 C CG2   . ILE B 2 287 ? -5.922  37.529 35.519  1.00 48.23  ? 288 ILE A CG2   1 
ATOM   3064 C CD1   . ILE B 2 287 ? -6.298  36.194 32.765  1.00 47.72  ? 288 ILE A CD1   1 
ATOM   3065 N N     . VAL B 2 288 ? -3.689  33.766 35.406  1.00 49.38  ? 289 VAL A N     1 
ATOM   3066 C CA    . VAL B 2 288 ? -3.098  32.524 34.915  1.00 48.01  ? 289 VAL A CA    1 
ATOM   3067 C C     . VAL B 2 288 ? -3.394  32.269 33.442  1.00 47.39  ? 289 VAL A C     1 
ATOM   3068 O O     . VAL B 2 288 ? -4.498  32.515 32.947  1.00 46.68  ? 289 VAL A O     1 
ATOM   3069 C CB    . VAL B 2 288 ? -3.577  31.316 35.754  1.00 47.88  ? 289 VAL A CB    1 
ATOM   3070 C CG1   . VAL B 2 288 ? -3.016  31.415 37.150  1.00 47.29  ? 289 VAL A CG1   1 
ATOM   3071 C CG2   . VAL B 2 288 ? -5.088  31.294 35.832  1.00 48.10  ? 289 VAL A CG2   1 
ATOM   3072 N N     . ASP B 2 289 ? -2.379  31.768 32.755  1.00 47.16  ? 290 ASP A N     1 
ATOM   3073 C CA    . ASP B 2 289 ? -2.449  31.472 31.331  1.00 46.46  ? 290 ASP A CA    1 
ATOM   3074 C C     . ASP B 2 289 ? -3.757  30.812 30.872  1.00 44.94  ? 290 ASP A C     1 
ATOM   3075 O O     . ASP B 2 289 ? -4.237  31.101 29.782  1.00 45.51  ? 290 ASP A O     1 
ATOM   3076 C CB    . ASP B 2 289 ? -1.222  30.628 30.939  1.00 48.62  ? 290 ASP A CB    1 
ATOM   3077 C CG    . ASP B 2 289 ? 0.081   31.462 30.888  1.00 51.45  ? 290 ASP A CG    1 
ATOM   3078 O OD1   . ASP B 2 289 ? 0.244   32.394 31.720  1.00 50.93  ? 290 ASP A OD1   1 
ATOM   3079 O OD2   . ASP B 2 289 ? 0.944   31.181 30.017  1.00 52.40  ? 290 ASP A OD2   1 
ATOM   3080 N N     . ASP B 2 290 ? -4.343  29.949 31.697  1.00 43.33  ? 291 ASP A N     1 
ATOM   3081 C CA    . ASP B 2 290 ? -5.596  29.285 31.328  1.00 41.15  ? 291 ASP A CA    1 
ATOM   3082 C C     . ASP B 2 290 ? -6.781  30.251 31.214  1.00 39.77  ? 291 ASP A C     1 
ATOM   3083 O O     . ASP B 2 290 ? -7.849  29.894 30.701  1.00 39.34  ? 291 ASP A O     1 
ATOM   3084 C CB    . ASP B 2 290 ? -5.930  28.183 32.340  1.00 41.86  ? 291 ASP A CB    1 
ATOM   3085 C CG    . ASP B 2 290 ? -5.287  26.851 31.996  1.00 42.12  ? 291 ASP A CG    1 
ATOM   3086 O OD1   . ASP B 2 290 ? -5.457  25.896 32.782  1.00 43.11  ? 291 ASP A OD1   1 
ATOM   3087 O OD2   . ASP B 2 290 ? -4.625  26.752 30.943  1.00 42.01  ? 291 ASP A OD2   1 
ATOM   3088 N N     . ASN B 2 291 ? -6.608  31.471 31.707  1.00 38.64  ? 292 ASN A N     1 
ATOM   3089 C CA    . ASN B 2 291 ? -7.680  32.458 31.625  1.00 38.91  ? 292 ASN A CA    1 
ATOM   3090 C C     . ASN B 2 291 ? -7.279  33.583 30.687  1.00 38.37  ? 292 ASN A C     1 
ATOM   3091 O O     . ASN B 2 291 ? -8.126  34.172 30.012  1.00 38.03  ? 292 ASN A O     1 
ATOM   3092 C CB    . ASN B 2 291 ? -7.987  33.029 33.007  1.00 40.34  ? 292 ASN A CB    1 
ATOM   3093 C CG    . ASN B 2 291 ? -8.691  32.033 33.892  1.00 42.11  ? 292 ASN A CG    1 
ATOM   3094 O OD1   . ASN B 2 291 ? -9.880  31.768 33.716  1.00 43.87  ? 292 ASN A OD1   1 
ATOM   3095 N ND2   . ASN B 2 291 ? -7.957  31.448 34.834  1.00 42.61  ? 292 ASN A ND2   1 
ATOM   3096 N N     . LEU B 2 292 ? -5.980  33.859 30.642  1.00 37.67  ? 293 LEU A N     1 
ATOM   3097 C CA    . LEU B 2 292 ? -5.452  34.913 29.799  1.00 37.27  ? 293 LEU A CA    1 
ATOM   3098 C C     . LEU B 2 292 ? -5.639  34.622 28.315  1.00 37.58  ? 293 LEU A C     1 
ATOM   3099 O O     . LEU B 2 292 ? -6.180  35.449 27.563  1.00 37.80  ? 293 LEU A O     1 
ATOM   3100 C CB    . LEU B 2 292 ? -3.967  35.114 30.087  1.00 36.33  ? 293 LEU A CB    1 
ATOM   3101 C CG    . LEU B 2 292 ? -3.297  36.195 29.240  1.00 36.07  ? 293 LEU A CG    1 
ATOM   3102 C CD1   . LEU B 2 292 ? -3.750  37.558 29.701  1.00 35.98  ? 293 LEU A CD1   1 
ATOM   3103 C CD2   . LEU B 2 292 ? -1.811  36.087 29.357  1.00 36.37  ? 293 LEU A CD2   1 
ATOM   3104 N N     . TYR B 2 293 ? -5.197  33.442 27.893  1.00 37.11  ? 294 TYR A N     1 
ATOM   3105 C CA    . TYR B 2 293 ? -5.288  33.082 26.492  1.00 36.28  ? 294 TYR A CA    1 
ATOM   3106 C C     . TYR B 2 293 ? -6.697  32.937 25.912  1.00 36.71  ? 294 TYR A C     1 
ATOM   3107 O O     . TYR B 2 293 ? -6.985  33.472 24.840  1.00 36.36  ? 294 TYR A O     1 
ATOM   3108 C CB    . TYR B 2 293 ? -4.452  31.832 26.226  1.00 34.39  ? 294 TYR A CB    1 
ATOM   3109 C CG    . TYR B 2 293 ? -2.969  32.113 26.313  1.00 34.80  ? 294 TYR A CG    1 
ATOM   3110 C CD1   . TYR B 2 293 ? -2.303  32.079 27.533  1.00 34.13  ? 294 TYR A CD1   1 
ATOM   3111 C CD2   . TYR B 2 293 ? -2.240  32.474 25.176  1.00 34.36  ? 294 TYR A CD2   1 
ATOM   3112 C CE1   . TYR B 2 293 ? -0.957  32.398 27.623  1.00 33.98  ? 294 TYR A CE1   1 
ATOM   3113 C CE2   . TYR B 2 293 ? -0.892  32.797 25.252  1.00 34.05  ? 294 TYR A CE2   1 
ATOM   3114 C CZ    . TYR B 2 293 ? -0.254  32.761 26.481  1.00 35.03  ? 294 TYR A CZ    1 
ATOM   3115 O OH    . TYR B 2 293 ? 1.084   33.115 26.582  1.00 37.17  ? 294 TYR A OH    1 
ATOM   3116 N N     . PRO B 2 294 ? -7.597  32.203 26.592  1.00 37.22  ? 295 PRO A N     1 
ATOM   3117 C CA    . PRO B 2 294 ? -8.936  32.102 25.994  1.00 37.19  ? 295 PRO A CA    1 
ATOM   3118 C C     . PRO B 2 294 ? -9.494  33.514 25.743  1.00 37.21  ? 295 PRO A C     1 
ATOM   3119 O O     . PRO B 2 294 ? -10.297 33.728 24.821  1.00 35.24  ? 295 PRO A O     1 
ATOM   3120 C CB    . PRO B 2 294 ? -9.728  31.331 27.057  1.00 36.76  ? 295 PRO A CB    1 
ATOM   3121 C CG    . PRO B 2 294 ? -8.683  30.406 27.629  1.00 36.26  ? 295 PRO A CG    1 
ATOM   3122 C CD    . PRO B 2 294 ? -7.470  31.322 27.769  1.00 36.93  ? 295 PRO A CD    1 
ATOM   3123 N N     . GLN B 2 295 ? -9.046  34.470 26.569  1.00 37.98  ? 296 GLN A N     1 
ATOM   3124 C CA    . GLN B 2 295 ? -9.480  35.869 26.456  1.00 38.14  ? 296 GLN A CA    1 
ATOM   3125 C C     . GLN B 2 295 ? -8.795  36.538 25.285  1.00 37.12  ? 296 GLN A C     1 
ATOM   3126 O O     . GLN B 2 295 ? -9.460  37.154 24.449  1.00 37.50  ? 296 GLN A O     1 
ATOM   3127 C CB    . GLN B 2 295 ? -9.191  36.645 27.740  1.00 38.56  ? 296 GLN A CB    1 
ATOM   3128 C CG    . GLN B 2 295 ? -10.136 36.283 28.891  1.00 39.89  ? 296 GLN A CG    1 
ATOM   3129 C CD    . GLN B 2 295 ? -9.898  37.134 30.126  1.00 40.90  ? 296 GLN A CD    1 
ATOM   3130 O OE1   . GLN B 2 295 ? -9.880  38.370 30.048  1.00 42.10  ? 296 GLN A OE1   1 
ATOM   3131 N NE2   . GLN B 2 295 ? -9.724  36.482 31.274  1.00 38.48  ? 296 GLN A NE2   1 
ATOM   3132 N N     . LEU B 2 296 ? -7.472  36.410 25.213  1.00 36.57  ? 297 LEU A N     1 
ATOM   3133 C CA    . LEU B 2 296 ? -6.739  36.990 24.094  1.00 36.57  ? 297 LEU A CA    1 
ATOM   3134 C C     . LEU B 2 296 ? -7.348  36.546 22.756  1.00 37.54  ? 297 LEU A C     1 
ATOM   3135 O O     . LEU B 2 296 ? -7.421  37.338 21.818  1.00 39.04  ? 297 LEU A O     1 
ATOM   3136 C CB    . LEU B 2 296 ? -5.257  36.604 24.148  1.00 33.50  ? 297 LEU A CB    1 
ATOM   3137 C CG    . LEU B 2 296 ? -4.465  37.238 25.290  1.00 31.44  ? 297 LEU A CG    1 
ATOM   3138 C CD1   . LEU B 2 296 ? -3.002  37.002 25.043  1.00 30.92  ? 297 LEU A CD1   1 
ATOM   3139 C CD2   . LEU B 2 296 ? -4.727  38.732 25.373  1.00 29.80  ? 297 LEU A CD2   1 
ATOM   3140 N N     . GLU B 2 297 ? -7.792  35.292 22.668  1.00 37.69  ? 298 GLU A N     1 
ATOM   3141 C CA    . GLU B 2 297 ? -8.391  34.811 21.432  1.00 38.19  ? 298 GLU A CA    1 
ATOM   3142 C C     . GLU B 2 297 ? -9.654  35.582 21.190  1.00 37.06  ? 298 GLU A C     1 
ATOM   3143 O O     . GLU B 2 297 ? -9.828  36.172 20.124  1.00 37.18  ? 298 GLU A O     1 
ATOM   3144 C CB    . GLU B 2 297 ? -8.732  33.329 21.498  1.00 40.74  ? 298 GLU A CB    1 
ATOM   3145 C CG    . GLU B 2 297 ? -7.525  32.445 21.310  1.00 47.04  ? 298 GLU A CG    1 
ATOM   3146 C CD    . GLU B 2 297 ? -7.822  30.976 21.550  1.00 50.44  ? 298 GLU A CD    1 
ATOM   3147 O OE1   . GLU B 2 297 ? -6.867  30.160 21.464  1.00 52.24  ? 298 GLU A OE1   1 
ATOM   3148 O OE2   . GLU B 2 297 ? -9.006  30.641 21.819  1.00 52.89  ? 298 GLU A OE2   1 
ATOM   3149 N N     . ARG B 2 298 ? -10.538 35.589 22.179  1.00 35.89  ? 299 ARG A N     1 
ATOM   3150 C CA    . ARG B 2 298 ? -11.785 36.310 22.018  1.00 35.73  ? 299 ARG A CA    1 
ATOM   3151 C C     . ARG B 2 298 ? -11.458 37.711 21.515  1.00 35.77  ? 299 ARG A C     1 
ATOM   3152 O O     . ARG B 2 298 ? -11.957 38.144 20.473  1.00 36.63  ? 299 ARG A O     1 
ATOM   3153 C CB    . ARG B 2 298 ? -12.553 36.384 23.345  1.00 35.28  ? 299 ARG A CB    1 
ATOM   3154 C CG    . ARG B 2 298 ? -13.602 37.494 23.367  1.00 35.88  ? 299 ARG A CG    1 
ATOM   3155 C CD    . ARG B 2 298 ? -14.418 37.500 24.648  1.00 36.63  ? 299 ARG A CD    1 
ATOM   3156 N NE    . ARG B 2 298 ? -15.721 36.884 24.435  1.00 38.40  ? 299 ARG A NE    1 
ATOM   3157 C CZ    . ARG B 2 298 ? -16.735 37.466 23.798  1.00 39.30  ? 299 ARG A CZ    1 
ATOM   3158 N NH1   . ARG B 2 298 ? -16.620 38.695 23.313  1.00 40.41  ? 299 ARG A NH1   1 
ATOM   3159 N NH2   . ARG B 2 298 ? -17.861 36.797 23.608  1.00 40.57  ? 299 ARG A NH2   1 
ATOM   3160 N N     . ALA B 2 299 ? -10.595 38.407 22.238  1.00 34.63  ? 300 ALA A N     1 
ATOM   3161 C CA    . ALA B 2 299 ? -10.235 39.760 21.854  1.00 35.35  ? 300 ALA A CA    1 
ATOM   3162 C C     . ALA B 2 299 ? -9.791  39.819 20.390  1.00 35.56  ? 300 ALA A C     1 
ATOM   3163 O O     . ALA B 2 299 ? -10.387 40.520 19.569  1.00 36.15  ? 300 ALA A O     1 
ATOM   3164 C CB    . ALA B 2 299 ? -9.127  40.279 22.766  1.00 36.15  ? 300 ALA A CB    1 
ATOM   3165 N N     . SER B 2 300 ? -8.742  39.077 20.071  1.00 34.42  ? 301 SER A N     1 
ATOM   3166 C CA    . SER B 2 300 ? -8.220  39.056 18.729  1.00 34.22  ? 301 SER A CA    1 
ATOM   3167 C C     . SER B 2 300 ? -9.355  38.828 17.737  1.00 33.94  ? 301 SER A C     1 
ATOM   3168 O O     . SER B 2 300 ? -9.446  39.495 16.709  1.00 34.95  ? 301 SER A O     1 
ATOM   3169 C CB    . SER B 2 300 ? -7.199  37.937 18.611  1.00 35.42  ? 301 SER A CB    1 
ATOM   3170 O OG    . SER B 2 300 ? -6.164  38.283 17.705  1.00 39.96  ? 301 SER A OG    1 
ATOM   3171 N N     . ARG B 2 301 ? -10.239 37.897 18.060  1.00 33.68  ? 302 ARG A N     1 
ATOM   3172 C CA    . ARG B 2 301 ? -11.347 37.564 17.177  1.00 32.90  ? 302 ARG A CA    1 
ATOM   3173 C C     . ARG B 2 301 ? -12.379 38.684 16.995  1.00 31.63  ? 302 ARG A C     1 
ATOM   3174 O O     . ARG B 2 301 ? -12.730 39.025 15.865  1.00 30.37  ? 302 ARG A O     1 
ATOM   3175 C CB    . ARG B 2 301 ? -12.023 36.296 17.698  1.00 34.30  ? 302 ARG A CB    1 
ATOM   3176 C CG    . ARG B 2 301 ? -12.836 35.536 16.682  1.00 36.11  ? 302 ARG A CG    1 
ATOM   3177 C CD    . ARG B 2 301 ? -13.601 34.402 17.364  1.00 39.39  ? 302 ARG A CD    1 
ATOM   3178 N NE    . ARG B 2 301 ? -14.806 34.839 18.078  1.00 41.67  ? 302 ARG A NE    1 
ATOM   3179 C CZ    . ARG B 2 301 ? -15.045 34.599 19.370  1.00 43.60  ? 302 ARG A CZ    1 
ATOM   3180 N NH1   . ARG B 2 301 ? -14.158 33.937 20.116  1.00 43.26  ? 302 ARG A NH1   1 
ATOM   3181 N NH2   . ARG B 2 301 ? -16.196 34.979 19.911  1.00 43.10  ? 302 ARG A NH2   1 
ATOM   3182 N N     . LYS B 2 302 ? -12.873 39.256 18.093  1.00 30.50  ? 303 LYS A N     1 
ATOM   3183 C CA    . LYS B 2 302 ? -13.882 40.323 17.995  1.00 29.67  ? 303 LYS A CA    1 
ATOM   3184 C C     . LYS B 2 302 ? -13.404 41.440 17.079  1.00 29.39  ? 303 LYS A C     1 
ATOM   3185 O O     . LYS B 2 302 ? -14.175 41.997 16.291  1.00 30.08  ? 303 LYS A O     1 
ATOM   3186 C CB    . LYS B 2 302 ? -14.186 40.913 19.373  1.00 28.75  ? 303 LYS A CB    1 
ATOM   3187 C CG    . LYS B 2 302 ? -14.732 39.905 20.371  1.00 28.96  ? 303 LYS A CG    1 
ATOM   3188 C CD    . LYS B 2 302 ? -15.945 39.179 19.829  1.00 28.64  ? 303 LYS A CD    1 
ATOM   3189 C CE    . LYS B 2 302 ? -17.126 40.104 19.683  1.00 27.61  ? 303 LYS A CE    1 
ATOM   3190 N NZ    . LYS B 2 302 ? -18.173 39.458 18.853  1.00 28.28  ? 303 LYS A NZ    1 
ATOM   3191 N N     . ILE B 2 303 ? -12.118 41.751 17.199  1.00 28.49  ? 304 ILE A N     1 
ATOM   3192 C CA    . ILE B 2 303 ? -11.471 42.792 16.426  1.00 26.83  ? 304 ILE A CA    1 
ATOM   3193 C C     . ILE B 2 303 ? -11.272 42.356 14.992  1.00 26.87  ? 304 ILE A C     1 
ATOM   3194 O O     . ILE B 2 303 ? -11.374 43.166 14.073  1.00 26.10  ? 304 ILE A O     1 
ATOM   3195 C CB    . ILE B 2 303 ? -10.119 43.149 17.051  1.00 26.27  ? 304 ILE A CB    1 
ATOM   3196 C CG1   . ILE B 2 303 ? -10.356 43.899 18.367  1.00 26.16  ? 304 ILE A CG1   1 
ATOM   3197 C CG2   . ILE B 2 303 ? -9.293  43.953 16.069  1.00 25.69  ? 304 ILE A CG2   1 
ATOM   3198 C CD1   . ILE B 2 303 ? -9.088  44.318 19.092  1.00 26.36  ? 304 ILE A CD1   1 
ATOM   3199 N N     . PHE B 2 304 ? -10.968 41.078 14.799  1.00 27.75  ? 305 PHE A N     1 
ATOM   3200 C CA    . PHE B 2 304 ? -10.771 40.554 13.451  1.00 28.33  ? 305 PHE A CA    1 
ATOM   3201 C C     . PHE B 2 304 ? -12.105 40.758 12.752  1.00 29.58  ? 305 PHE A C     1 
ATOM   3202 O O     . PHE B 2 304 ? -12.193 41.292 11.639  1.00 29.46  ? 305 PHE A O     1 
ATOM   3203 C CB    . PHE B 2 304 ? -10.457 39.063 13.491  1.00 27.29  ? 305 PHE A CB    1 
ATOM   3204 C CG    . PHE B 2 304 ? -10.097 38.492 12.155  1.00 28.30  ? 305 PHE A CG    1 
ATOM   3205 C CD1   . PHE B 2 304 ? -8.795  38.600 11.656  1.00 29.50  ? 305 PHE A CD1   1 
ATOM   3206 C CD2   . PHE B 2 304 ? -11.061 37.880 11.363  1.00 28.09  ? 305 PHE A CD2   1 
ATOM   3207 C CE1   . PHE B 2 304 ? -8.461  38.102 10.377  1.00 27.93  ? 305 PHE A CE1   1 
ATOM   3208 C CE2   . PHE B 2 304 ? -10.742 37.385 10.089  1.00 27.38  ? 305 PHE A CE2   1 
ATOM   3209 C CZ    . PHE B 2 304 ? -9.439  37.496 9.597   1.00 27.12  ? 305 PHE A CZ    1 
ATOM   3210 N N     . GLU B 2 305 ? -13.151 40.346 13.451  1.00 31.14  ? 306 GLU A N     1 
ATOM   3211 C CA    . GLU B 2 305 ? -14.495 40.436 12.936  1.00 32.95  ? 306 GLU A CA    1 
ATOM   3212 C C     . GLU B 2 305 ? -14.961 41.867 12.778  1.00 32.69  ? 306 GLU A C     1 
ATOM   3213 O O     . GLU B 2 305 ? -15.778 42.153 11.895  1.00 33.27  ? 306 GLU A O     1 
ATOM   3214 C CB    . GLU B 2 305 ? -15.422 39.626 13.827  1.00 35.79  ? 306 GLU A CB    1 
ATOM   3215 C CG    . GLU B 2 305 ? -14.984 38.174 13.825  1.00 42.17  ? 306 GLU A CG    1 
ATOM   3216 C CD    . GLU B 2 305 ? -15.697 37.305 14.842  1.00 46.37  ? 306 GLU A CD    1 
ATOM   3217 O OE1   . GLU B 2 305 ? -16.481 37.850 15.664  1.00 47.84  ? 306 GLU A OE1   1 
ATOM   3218 O OE2   . GLU B 2 305 ? -15.454 36.068 14.811  1.00 48.63  ? 306 GLU A OE2   1 
ATOM   3219 N N     . PHE B 2 306 ? -14.463 42.779 13.610  1.00 31.36  ? 307 PHE A N     1 
ATOM   3220 C CA    . PHE B 2 306 ? -14.866 44.171 13.437  1.00 29.71  ? 307 PHE A CA    1 
ATOM   3221 C C     . PHE B 2 306 ? -14.199 44.585 12.128  1.00 30.51  ? 307 PHE A C     1 
ATOM   3222 O O     . PHE B 2 306 ? -14.816 45.223 11.259  1.00 29.84  ? 307 PHE A O     1 
ATOM   3223 C CB    . PHE B 2 306 ? -14.367 45.046 14.586  1.00 27.76  ? 307 PHE A CB    1 
ATOM   3224 C CG    . PHE B 2 306 ? -14.202 46.493 14.213  1.00 26.10  ? 307 PHE A CG    1 
ATOM   3225 C CD1   . PHE B 2 306 ? -15.307 47.285 13.929  1.00 25.08  ? 307 PHE A CD1   1 
ATOM   3226 C CD2   . PHE B 2 306 ? -12.931 47.059 14.109  1.00 27.04  ? 307 PHE A CD2   1 
ATOM   3227 C CE1   . PHE B 2 306 ? -15.155 48.610 13.547  1.00 23.90  ? 307 PHE A CE1   1 
ATOM   3228 C CE2   . PHE B 2 306 ? -12.765 48.396 13.723  1.00 27.06  ? 307 PHE A CE2   1 
ATOM   3229 C CZ    . PHE B 2 306 ? -13.882 49.171 13.441  1.00 25.82  ? 307 PHE A CZ    1 
ATOM   3230 N N     . LEU B 2 307 ? -12.942 44.172 11.978  1.00 30.88  ? 308 LEU A N     1 
ATOM   3231 C CA    . LEU B 2 307 ? -12.189 44.484 10.783  1.00 31.83  ? 308 LEU A CA    1 
ATOM   3232 C C     . LEU B 2 307 ? -12.807 43.979 9.474   1.00 33.40  ? 308 LEU A C     1 
ATOM   3233 O O     . LEU B 2 307 ? -12.949 44.770 8.544   1.00 33.97  ? 308 LEU A O     1 
ATOM   3234 C CB    . LEU B 2 307 ? -10.750 43.993 10.918  1.00 31.26  ? 308 LEU A CB    1 
ATOM   3235 C CG    . LEU B 2 307 ? -9.859  44.882 11.784  1.00 30.91  ? 308 LEU A CG    1 
ATOM   3236 C CD1   . LEU B 2 307 ? -8.405  44.546 11.552  1.00 30.41  ? 308 LEU A CD1   1 
ATOM   3237 C CD2   . LEU B 2 307 ? -10.075 46.320 11.423  1.00 30.72  ? 308 LEU A CD2   1 
ATOM   3238 N N     . GLU B 2 308 ? -13.191 42.704 9.366   1.00 34.72  ? 309 GLU A N     1 
ATOM   3239 C CA    . GLU B 2 308 ? -13.772 42.285 8.091   1.00 36.64  ? 309 GLU A CA    1 
ATOM   3240 C C     . GLU B 2 308 ? -15.168 42.824 7.795   1.00 35.89  ? 309 GLU A C     1 
ATOM   3241 O O     . GLU B 2 308 ? -15.493 43.087 6.633   1.00 36.06  ? 309 GLU A O     1 
ATOM   3242 C CB    . GLU B 2 308 ? -13.763 40.762 7.904   1.00 38.61  ? 309 GLU A CB    1 
ATOM   3243 C CG    . GLU B 2 308 ? -14.284 39.904 9.037   1.00 43.98  ? 309 GLU A CG    1 
ATOM   3244 C CD    . GLU B 2 308 ? -14.248 38.406 8.678   1.00 46.82  ? 309 GLU A CD    1 
ATOM   3245 O OE1   . GLU B 2 308 ? -14.045 37.553 9.589   1.00 46.19  ? 309 GLU A OE1   1 
ATOM   3246 O OE2   . GLU B 2 308 ? -14.431 38.094 7.473   1.00 48.56  ? 309 GLU A OE2   1 
ATOM   3247 N N     . ARG B 2 309 ? -16.001 43.013 8.808   1.00 35.52  ? 310 ARG A N     1 
ATOM   3248 C CA    . ARG B 2 309 ? -17.311 43.548 8.490   1.00 36.70  ? 310 ARG A CA    1 
ATOM   3249 C C     . ARG B 2 309 ? -17.139 45.012 8.133   1.00 36.94  ? 310 ARG A C     1 
ATOM   3250 O O     . ARG B 2 309 ? -18.010 45.623 7.519   1.00 37.87  ? 310 ARG A O     1 
ATOM   3251 C CB    . ARG B 2 309 ? -18.298 43.398 9.653   1.00 36.62  ? 310 ARG A CB    1 
ATOM   3252 C CG    . ARG B 2 309 ? -18.249 44.455 10.716  1.00 37.46  ? 310 ARG A CG    1 
ATOM   3253 C CD    . ARG B 2 309 ? -19.478 44.349 11.622  1.00 38.89  ? 310 ARG A CD    1 
ATOM   3254 N NE    . ARG B 2 309 ? -19.152 44.619 13.023  1.00 40.43  ? 310 ARG A NE    1 
ATOM   3255 C CZ    . ARG B 2 309 ? -18.464 43.786 13.798  1.00 40.08  ? 310 ARG A CZ    1 
ATOM   3256 N NH1   . ARG B 2 309 ? -18.032 42.629 13.312  1.00 41.74  ? 310 ARG A NH1   1 
ATOM   3257 N NH2   . ARG B 2 309 ? -18.200 44.108 15.054  1.00 40.81  ? 310 ARG A NH2   1 
ATOM   3258 N N     . GLU B 2 310 ? -15.994 45.571 8.501   1.00 37.02  ? 311 GLU A N     1 
ATOM   3259 C CA    . GLU B 2 310 ? -15.731 46.963 8.207   1.00 35.94  ? 311 GLU A CA    1 
ATOM   3260 C C     . GLU B 2 310 ? -15.005 47.135 6.874   1.00 34.85  ? 311 GLU A C     1 
ATOM   3261 O O     . GLU B 2 310 ? -14.578 48.233 6.516   1.00 33.12  ? 311 GLU A O     1 
ATOM   3262 C CB    . GLU B 2 310 ? -14.927 47.570 9.338   1.00 37.29  ? 311 GLU A CB    1 
ATOM   3263 C CG    . GLU B 2 310 ? -15.275 49.008 9.572   1.00 39.41  ? 311 GLU A CG    1 
ATOM   3264 C CD    . GLU B 2 310 ? -16.739 49.191 9.910   1.00 40.29  ? 311 GLU A CD    1 
ATOM   3265 O OE1   . GLU B 2 310 ? -17.180 48.647 10.945  1.00 40.09  ? 311 GLU A OE1   1 
ATOM   3266 O OE2   . GLU B 2 310 ? -17.447 49.875 9.139   1.00 41.18  ? 311 GLU A OE2   1 
ATOM   3267 N N     . ASN B 2 311 ? -14.876 46.027 6.150   1.00 34.99  ? 312 ASN A N     1 
ATOM   3268 C CA    . ASN B 2 311 ? -14.235 45.997 4.835   1.00 35.42  ? 312 ASN A CA    1 
ATOM   3269 C C     . ASN B 2 311 ? -12.763 46.292 4.788   1.00 35.36  ? 312 ASN A C     1 
ATOM   3270 O O     . ASN B 2 311 ? -12.240 46.728 3.767   1.00 35.48  ? 312 ASN A O     1 
ATOM   3271 C CB    . ASN B 2 311 ? -14.947 46.942 3.883   1.00 34.70  ? 312 ASN A CB    1 
ATOM   3272 C CG    . ASN B 2 311 ? -16.332 46.493 3.591   1.00 33.05  ? 312 ASN A CG    1 
ATOM   3273 O OD1   . ASN B 2 311 ? -17.282 47.245 3.748   1.00 34.26  ? 312 ASN A OD1   1 
ATOM   3274 N ND2   . ASN B 2 311 ? -16.466 45.245 3.172   1.00 32.39  ? 312 ASN A ND2   1 
ATOM   3275 N N     . PHE B 2 312 ? -12.081 46.057 5.889   1.00 35.77  ? 313 PHE A N     1 
ATOM   3276 C CA    . PHE B 2 312 ? -10.665 46.298 5.891   1.00 36.18  ? 313 PHE A CA    1 
ATOM   3277 C C     . PHE B 2 312 ? -9.891  45.064 5.442   1.00 36.60  ? 313 PHE A C     1 
ATOM   3278 O O     . PHE B 2 312 ? -8.660  45.036 5.474   1.00 37.57  ? 313 PHE A O     1 
ATOM   3279 C CB    . PHE B 2 312 ? -10.237 46.775 7.264   1.00 35.84  ? 313 PHE A CB    1 
ATOM   3280 C CG    . PHE B 2 312 ? -10.523 48.222 7.492   1.00 34.54  ? 313 PHE A CG    1 
ATOM   3281 C CD1   . PHE B 2 312 ? -10.021 49.178 6.622   1.00 34.33  ? 313 PHE A CD1   1 
ATOM   3282 C CD2   . PHE B 2 312 ? -11.263 48.635 8.584   1.00 34.28  ? 313 PHE A CD2   1 
ATOM   3283 C CE1   . PHE B 2 312 ? -10.251 50.522 6.843   1.00 35.18  ? 313 PHE A CE1   1 
ATOM   3284 C CE2   . PHE B 2 312 ? -11.498 49.976 8.815   1.00 33.86  ? 313 PHE A CE2   1 
ATOM   3285 C CZ    . PHE B 2 312 ? -10.989 50.923 7.944   1.00 34.18  ? 313 PHE A CZ    1 
ATOM   3286 N N     . MET B 2 313 ? -10.638 44.049 5.011   1.00 36.63  ? 314 MET A N     1 
ATOM   3287 C CA    . MET B 2 313 ? -10.075 42.804 4.488   1.00 35.22  ? 314 MET A CA    1 
ATOM   3288 C C     . MET B 2 313 ? -8.920  42.187 5.260   1.00 33.38  ? 314 MET A C     1 
ATOM   3289 O O     . MET B 2 313 ? -7.814  42.082 4.749   1.00 33.23  ? 314 MET A O     1 
ATOM   3290 C CB    . MET B 2 313 ? -9.681  43.026 3.026   1.00 34.81  ? 314 MET A CB    1 
ATOM   3291 C CG    . MET B 2 313 ? -10.904 43.250 2.153   1.00 35.76  ? 314 MET A CG    1 
ATOM   3292 S SD    . MET B 2 313 ? -10.531 43.560 0.433   1.00 39.33  ? 314 MET A SD    1 
ATOM   3293 C CE    . MET B 2 313 ? -10.119 41.826 -0.165  1.00 37.85  ? 314 MET A CE    1 
ATOM   3294 N N     . PRO B 2 314 ? -9.179  41.736 6.491   1.00 32.19  ? 315 PRO A N     1 
ATOM   3295 C CA    . PRO B 2 314 ? -8.179  41.116 7.366   1.00 32.05  ? 315 PRO A CA    1 
ATOM   3296 C C     . PRO B 2 314 ? -7.607  39.836 6.776   1.00 33.04  ? 315 PRO A C     1 
ATOM   3297 O O     . PRO B 2 314 ? -8.344  39.029 6.224   1.00 33.29  ? 315 PRO A O     1 
ATOM   3298 C CB    . PRO B 2 314 ? -8.963  40.816 8.636   1.00 31.53  ? 315 PRO A CB    1 
ATOM   3299 C CG    . PRO B 2 314 ? -10.036 41.825 8.629   1.00 33.35  ? 315 PRO A CG    1 
ATOM   3300 C CD    . PRO B 2 314 ? -10.464 41.875 7.190   1.00 32.40  ? 315 PRO A CD    1 
ATOM   3301 N N     . LEU B 2 315 ? -6.299  39.646 6.890   1.00 33.30  ? 316 LEU A N     1 
ATOM   3302 C CA    . LEU B 2 315 ? -5.698  38.428 6.389   1.00 34.95  ? 316 LEU A CA    1 
ATOM   3303 C C     . LEU B 2 315 ? -5.313  37.377 7.417   1.00 36.45  ? 316 LEU A C     1 
ATOM   3304 O O     . LEU B 2 315 ? -5.544  36.186 7.212   1.00 37.37  ? 316 LEU A O     1 
ATOM   3305 C CB    . LEU B 2 315 ? -4.322  38.704 5.789   1.00 35.98  ? 316 LEU A CB    1 
ATOM   3306 C CG    . LEU B 2 315 ? -4.285  39.579 4.526   1.00 36.96  ? 316 LEU A CG    1 
ATOM   3307 C CD1   . LEU B 2 315 ? -2.845  39.721 4.050   1.00 36.15  ? 316 LEU A CD1   1 
ATOM   3308 C CD2   . LEU B 2 315 ? -5.150  38.964 3.437   1.00 36.64  ? 316 LEU A CD2   1 
ATOM   3309 N N     . ARG B 2 316 ? -4.745  37.813 8.538   1.00 38.10  ? 317 ARG A N     1 
ATOM   3310 C CA    . ARG B 2 316 ? -4.582  36.966 9.717   1.00 39.65  ? 317 ARG A CA    1 
ATOM   3311 C C     . ARG B 2 316 ? -4.417  37.717 11.037  1.00 40.11  ? 317 ARG A C     1 
ATOM   3312 O O     . ARG B 2 316 ? -3.858  38.818 11.080  1.00 40.39  ? 317 ARG A O     1 
ATOM   3313 C CB    . ARG B 2 316 ? -3.386  36.043 9.535   1.00 40.37  ? 317 ARG A CB    1 
ATOM   3314 C CG    . ARG B 2 316 ? -3.513  35.102 8.360   1.00 42.77  ? 317 ARG A CG    1 
ATOM   3315 C CD    . ARG B 2 316 ? -2.449  34.016 8.437   1.00 43.87  ? 317 ARG A CD    1 
ATOM   3316 N NE    . ARG B 2 316 ? -2.656  33.160 9.601   1.00 44.90  ? 317 ARG A NE    1 
ATOM   3317 C CZ    . ARG B 2 316 ? -1.856  32.155 9.946   1.00 45.74  ? 317 ARG A CZ    1 
ATOM   3318 N NH1   . ARG B 2 316 ? -0.781  31.864 9.219   1.00 44.49  ? 317 ARG A NH1   1 
ATOM   3319 N NH2   . ARG B 2 316 ? -2.129  31.443 11.032  1.00 47.12  ? 317 ARG A NH2   1 
ATOM   3320 N N     . SER B 2 317 ? -4.910  37.119 12.120  1.00 40.05  ? 318 SER A N     1 
ATOM   3321 C CA    . SER B 2 317 ? -4.760  37.739 13.427  1.00 39.27  ? 318 SER A CA    1 
ATOM   3322 C C     . SER B 2 317 ? -3.695  36.939 14.147  1.00 38.72  ? 318 SER A C     1 
ATOM   3323 O O     . SER B 2 317 ? -3.247  35.904 13.647  1.00 38.31  ? 318 SER A O     1 
ATOM   3324 C CB    . SER B 2 317 ? -6.057  37.682 14.225  1.00 39.24  ? 318 SER A CB    1 
ATOM   3325 O OG    . SER B 2 317 ? -6.242  36.393 14.774  1.00 37.70  ? 318 SER A OG    1 
ATOM   3326 N N     . ALA B 2 318 ? -3.288  37.427 15.314  1.00 38.07  ? 319 ALA A N     1 
ATOM   3327 C CA    . ALA B 2 318 ? -2.276  36.759 16.134  1.00 38.33  ? 319 ALA A CA    1 
ATOM   3328 C C     . ALA B 2 318 ? -2.097  37.533 17.435  1.00 38.02  ? 319 ALA A C     1 
ATOM   3329 O O     . ALA B 2 318 ? -2.389  38.729 17.486  1.00 38.76  ? 319 ALA A O     1 
ATOM   3330 C CB    . ALA B 2 318 ? -0.941  36.672 15.380  1.00 36.85  ? 319 ALA A CB    1 
ATOM   3331 N N     . PHE B 2 319 ? -1.633  36.856 18.482  1.00 37.24  ? 320 PHE A N     1 
ATOM   3332 C CA    . PHE B 2 319 ? -1.415  37.519 19.762  1.00 38.08  ? 320 PHE A CA    1 
ATOM   3333 C C     . PHE B 2 319 ? -0.199  36.964 20.490  1.00 39.32  ? 320 PHE A C     1 
ATOM   3334 O O     . PHE B 2 319 ? 0.245   35.845 20.219  1.00 40.17  ? 320 PHE A O     1 
ATOM   3335 C CB    . PHE B 2 319 ? -2.667  37.402 20.640  1.00 36.78  ? 320 PHE A CB    1 
ATOM   3336 C CG    . PHE B 2 319 ? -3.164  36.007 20.791  1.00 36.47  ? 320 PHE A CG    1 
ATOM   3337 C CD1   . PHE B 2 319 ? -2.463  35.081 21.549  1.00 35.14  ? 320 PHE A CD1   1 
ATOM   3338 C CD2   . PHE B 2 319 ? -4.322  35.599 20.147  1.00 37.66  ? 320 PHE A CD2   1 
ATOM   3339 C CE1   . PHE B 2 319 ? -2.909  33.762 21.666  1.00 35.48  ? 320 PHE A CE1   1 
ATOM   3340 C CE2   . PHE B 2 319 ? -4.777  34.275 20.258  1.00 37.14  ? 320 PHE A CE2   1 
ATOM   3341 C CZ    . PHE B 2 319 ? -4.063  33.361 21.021  1.00 36.00  ? 320 PHE A CZ    1 
ATOM   3342 N N     . LYS B 2 320 ? 0.344   37.755 21.409  1.00 39.53  ? 321 LYS A N     1 
ATOM   3343 C CA    . LYS B 2 320 ? 1.511   37.338 22.172  1.00 39.70  ? 321 LYS A CA    1 
ATOM   3344 C C     . LYS B 2 320 ? 1.382   37.874 23.583  1.00 39.58  ? 321 LYS A C     1 
ATOM   3345 O O     . LYS B 2 320 ? 0.701   38.877 23.806  1.00 39.26  ? 321 LYS A O     1 
ATOM   3346 C CB    . LYS B 2 320 ? 2.787   37.869 21.510  1.00 39.98  ? 321 LYS A CB    1 
ATOM   3347 C CG    . LYS B 2 320 ? 4.083   37.329 22.099  1.00 39.98  ? 321 LYS A CG    1 
ATOM   3348 C CD    . LYS B 2 320 ? 4.731   38.345 23.015  1.00 41.28  ? 321 LYS A CD    1 
ATOM   3349 C CE    . LYS B 2 320 ? 6.043   37.804 23.569  1.00 41.77  ? 321 LYS A CE    1 
ATOM   3350 N NZ    . LYS B 2 320 ? 6.964   37.399 22.469  1.00 43.28  ? 321 LYS A NZ    1 
ATOM   3351 N N     . ALA B 2 321 ? 2.028   37.207 24.535  1.00 40.01  ? 322 ALA A N     1 
ATOM   3352 C CA    . ALA B 2 321 ? 1.958   37.635 25.924  1.00 40.49  ? 322 ALA A CA    1 
ATOM   3353 C C     . ALA B 2 321 ? 3.342   37.922 26.494  1.00 41.41  ? 322 ALA A C     1 
ATOM   3354 O O     . ALA B 2 321 ? 4.344   37.472 25.957  1.00 40.79  ? 322 ALA A O     1 
ATOM   3355 C CB    . ALA B 2 321 ? 1.262   36.576 26.747  1.00 39.89  ? 322 ALA A CB    1 
ATOM   3356 N N     . SER B 2 322 ? 3.385   38.684 27.583  1.00 43.95  ? 323 SER A N     1 
ATOM   3357 C CA    . SER B 2 322 ? 4.636   39.041 28.253  1.00 46.25  ? 323 SER A CA    1 
ATOM   3358 C C     . SER B 2 322 ? 4.416   39.293 29.746  1.00 48.54  ? 323 SER A C     1 
ATOM   3359 O O     . SER B 2 322 ? 3.278   39.424 30.205  1.00 48.61  ? 323 SER A O     1 
ATOM   3360 C CB    . SER B 2 322 ? 5.223   40.300 27.628  1.00 44.61  ? 323 SER A CB    1 
ATOM   3361 O OG    . SER B 2 322 ? 5.407   40.131 26.242  1.00 45.40  ? 323 SER A OG    1 
ATOM   3362 N N     . GLU B 2 323 ? 5.511   39.341 30.502  1.00 51.65  ? 324 GLU A N     1 
ATOM   3363 C CA    . GLU B 2 323 ? 5.444   39.612 31.940  1.00 54.72  ? 324 GLU A CA    1 
ATOM   3364 C C     . GLU B 2 323 ? 4.851   41.011 32.032  1.00 55.47  ? 324 GLU A C     1 
ATOM   3365 O O     . GLU B 2 323 ? 4.087   41.361 32.945  1.00 55.49  ? 324 GLU A O     1 
ATOM   3366 C CB    . GLU B 2 323 ? 6.853   39.629 32.535  1.00 56.24  ? 324 GLU A CB    1 
ATOM   3367 C CG    . GLU B 2 323 ? 7.503   38.277 32.586  1.00 60.38  ? 324 GLU A CG    1 
ATOM   3368 C CD    . GLU B 2 323 ? 6.982   37.444 33.740  1.00 62.73  ? 324 GLU A CD    1 
ATOM   3369 O OE1   . GLU B 2 323 ? 5.747   37.469 33.976  1.00 64.12  ? 324 GLU A OE1   1 
ATOM   3370 O OE2   . GLU B 2 323 ? 7.805   36.764 34.404  1.00 63.24  ? 324 GLU A OE2   1 
ATOM   3371 N N     . GLU B 2 324 ? 5.218   41.781 31.020  1.00 55.44  ? 325 GLU A N     1 
ATOM   3372 C CA    . GLU B 2 324 ? 4.860   43.168 30.841  1.00 56.00  ? 325 GLU A CA    1 
ATOM   3373 C C     . GLU B 2 324 ? 3.609   43.679 30.101  1.00 54.93  ? 325 GLU A C     1 
ATOM   3374 O O     . GLU B 2 324 ? 2.852   44.501 30.631  1.00 55.24  ? 325 GLU A O     1 
ATOM   3375 C CB    . GLU B 2 324 ? 5.975   43.780 30.013  1.00 59.41  ? 325 GLU A CB    1 
ATOM   3376 C CG    . GLU B 2 324 ? 6.234   42.937 28.761  1.00 64.45  ? 325 GLU A CG    1 
ATOM   3377 C CD    . GLU B 2 324 ? 7.416   43.403 27.942  1.00 66.60  ? 325 GLU A CD    1 
ATOM   3378 O OE1   . GLU B 2 324 ? 7.342   43.302 26.686  1.00 66.10  ? 325 GLU A OE1   1 
ATOM   3379 O OE2   . GLU B 2 324 ? 8.412   43.857 28.563  1.00 68.11  ? 325 GLU A OE2   1 
ATOM   3380 N N     . PHE B 2 325 ? 3.406   43.191 28.873  1.00 53.05  ? 326 PHE A N     1 
ATOM   3381 C CA    . PHE B 2 325 ? 2.181   43.455 28.099  1.00 51.06  ? 326 PHE A CA    1 
ATOM   3382 C C     . PHE B 2 325 ? 1.724   42.344 27.178  1.00 49.74  ? 326 PHE A C     1 
ATOM   3383 O O     . PHE B 2 325 ? 2.247   41.235 27.176  1.00 50.24  ? 326 PHE A O     1 
ATOM   3384 C CB    . PHE B 2 325 ? 2.482   44.591 27.081  1.00 50.78  ? 326 PHE A CB    1 
ATOM   3385 C CG    . PHE B 2 325 ? 3.195   45.773 27.662  1.00 49.73  ? 326 PHE A CG    1 
ATOM   3386 C CD1   . PHE B 2 325 ? 4.575   45.814 27.694  1.00 49.07  ? 326 PHE A CD1   1 
ATOM   3387 C CD2   . PHE B 2 325 ? 2.483   46.830 28.212  1.00 49.92  ? 326 PHE A CD2   1 
ATOM   3388 C CE1   . PHE B 2 325 ? 5.237   46.890 28.270  1.00 49.54  ? 326 PHE A CE1   1 
ATOM   3389 C CE2   . PHE B 2 325 ? 3.137   47.903 28.787  1.00 49.54  ? 326 PHE A CE2   1 
ATOM   3390 C CZ    . PHE B 2 325 ? 4.517   47.935 28.817  1.00 49.66  ? 326 PHE A CZ    1 
ATOM   3391 N N     . CYS B 2 326 ? 0.698   42.665 26.389  1.00 48.17  ? 327 CYS A N     1 
ATOM   3392 C CA    . CYS B 2 326 ? 0.007   41.745 25.496  1.00 45.88  ? 327 CYS A CA    1 
ATOM   3393 C C     . CYS B 2 326 ? -0.165  42.462 24.162  1.00 43.06  ? 327 CYS A C     1 
ATOM   3394 O O     . CYS B 2 326 ? -0.512  43.646 24.117  1.00 42.75  ? 327 CYS A O     1 
ATOM   3395 C CB    . CYS B 2 326 ? -1.329  41.372 26.068  1.00 47.26  ? 327 CYS A CB    1 
ATOM   3396 S SG    . CYS B 2 326 ? -1.162  40.076 27.289  1.00 50.64  ? 327 CYS A SG    1 
ATOM   3397 N N     . TYR B 2 327 ? 0.062   41.734 23.078  1.00 39.80  ? 328 TYR A N     1 
ATOM   3398 C CA    . TYR B 2 327 ? -0.068  42.317 21.756  1.00 37.10  ? 328 TYR A CA    1 
ATOM   3399 C C     . TYR B 2 327 ? -1.069  41.577 20.898  1.00 35.20  ? 328 TYR A C     1 
ATOM   3400 O O     . TYR B 2 327 ? -1.011  40.366 20.773  1.00 34.88  ? 328 TYR A O     1 
ATOM   3401 C CB    . TYR B 2 327 ? 1.289   42.316 21.055  1.00 37.23  ? 328 TYR A CB    1 
ATOM   3402 C CG    . TYR B 2 327 ? 2.409   42.850 21.908  1.00 39.54  ? 328 TYR A CG    1 
ATOM   3403 C CD1   . TYR B 2 327 ? 2.860   42.136 23.025  1.00 40.10  ? 328 TYR A CD1   1 
ATOM   3404 C CD2   . TYR B 2 327 ? 3.035   44.063 21.595  1.00 40.25  ? 328 TYR A CD2   1 
ATOM   3405 C CE1   . TYR B 2 327 ? 3.910   42.610 23.808  1.00 40.79  ? 328 TYR A CE1   1 
ATOM   3406 C CE2   . TYR B 2 327 ? 4.094   44.555 22.373  1.00 40.84  ? 328 TYR A CE2   1 
ATOM   3407 C CZ    . TYR B 2 327 ? 4.530   43.817 23.478  1.00 41.94  ? 328 TYR A CZ    1 
ATOM   3408 O OH    . TYR B 2 327 ? 5.598   44.255 24.235  1.00 43.07  ? 328 TYR A OH    1 
ATOM   3409 N N     . LEU B 2 328 ? -2.011  42.307 20.333  1.00 33.73  ? 329 LEU A N     1 
ATOM   3410 C CA    . LEU B 2 328 ? -2.982  41.711 19.444  1.00 33.59  ? 329 LEU A CA    1 
ATOM   3411 C C     . LEU B 2 328 ? -2.538  42.238 18.095  1.00 33.59  ? 329 LEU A C     1 
ATOM   3412 O O     . LEU B 2 328 ? -2.703  43.417 17.799  1.00 33.98  ? 329 LEU A O     1 
ATOM   3413 C CB    . LEU B 2 328 ? -4.389  42.205 19.762  1.00 33.45  ? 329 LEU A CB    1 
ATOM   3414 C CG    . LEU B 2 328 ? -4.998  41.648 21.044  1.00 34.12  ? 329 LEU A CG    1 
ATOM   3415 C CD1   . LEU B 2 328 ? -6.385  42.227 21.195  1.00 35.27  ? 329 LEU A CD1   1 
ATOM   3416 C CD2   . LEU B 2 328 ? -5.083  40.122 20.990  1.00 34.65  ? 329 LEU A CD2   1 
ATOM   3417 N N     . LEU B 2 329 ? -1.955  41.367 17.287  1.00 33.44  ? 330 LEU A N     1 
ATOM   3418 C CA    . LEU B 2 329 ? -1.463  41.755 15.972  1.00 33.46  ? 330 LEU A CA    1 
ATOM   3419 C C     . LEU B 2 329 ? -2.475  41.504 14.864  1.00 33.42  ? 330 LEU A C     1 
ATOM   3420 O O     . LEU B 2 329 ? -3.333  40.620 14.969  1.00 34.57  ? 330 LEU A O     1 
ATOM   3421 C CB    . LEU B 2 329 ? -0.185  40.980 15.649  1.00 33.92  ? 330 LEU A CB    1 
ATOM   3422 C CG    . LEU B 2 329 ? 0.933   41.010 16.692  1.00 33.87  ? 330 LEU A CG    1 
ATOM   3423 C CD1   . LEU B 2 329 ? 0.493   40.314 17.965  1.00 33.84  ? 330 LEU A CD1   1 
ATOM   3424 C CD2   . LEU B 2 329 ? 2.143   40.319 16.123  1.00 34.36  ? 330 LEU A CD2   1 
ATOM   3425 N N     . PHE B 2 330 ? -2.368  42.283 13.794  1.00 32.87  ? 331 PHE A N     1 
ATOM   3426 C CA    . PHE B 2 330 ? -3.253  42.116 12.646  1.00 31.67  ? 331 PHE A CA    1 
ATOM   3427 C C     . PHE B 2 330 ? -2.536  42.499 11.374  1.00 31.94  ? 331 PHE A C     1 
ATOM   3428 O O     . PHE B 2 330 ? -1.465  43.120 11.399  1.00 31.25  ? 331 PHE A O     1 
ATOM   3429 C CB    . PHE B 2 330 ? -4.484  42.992 12.776  1.00 29.92  ? 331 PHE A CB    1 
ATOM   3430 C CG    . PHE B 2 330 ? -5.262  42.739 14.000  1.00 29.53  ? 331 PHE A CG    1 
ATOM   3431 C CD1   . PHE B 2 330 ? -6.253  41.785 14.011  1.00 30.69  ? 331 PHE A CD1   1 
ATOM   3432 C CD2   . PHE B 2 330 ? -4.987  43.439 15.162  1.00 29.14  ? 331 PHE A CD2   1 
ATOM   3433 C CE1   . PHE B 2 330 ? -6.970  41.529 15.171  1.00 30.95  ? 331 PHE A CE1   1 
ATOM   3434 C CE2   . PHE B 2 330 ? -5.694  43.191 16.318  1.00 30.10  ? 331 PHE A CE2   1 
ATOM   3435 C CZ    . PHE B 2 330 ? -6.688  42.232 16.325  1.00 30.16  ? 331 PHE A CZ    1 
ATOM   3436 N N     . GLU B 2 331 ? -3.143  42.107 10.261  1.00 32.65  ? 332 GLU A N     1 
ATOM   3437 C CA    . GLU B 2 331 ? -2.642  42.424 8.936   1.00 32.59  ? 332 GLU A CA    1 
ATOM   3438 C C     . GLU B 2 331 ? -3.861  42.531 8.062   1.00 32.68  ? 332 GLU A C     1 
ATOM   3439 O O     . GLU B 2 331 ? -4.614  41.565 7.916   1.00 33.04  ? 332 GLU A O     1 
ATOM   3440 C CB    . GLU B 2 331 ? -1.747  41.332 8.388   1.00 32.13  ? 332 GLU A CB    1 
ATOM   3441 C CG    . GLU B 2 331 ? -1.151  41.694 7.057   1.00 35.31  ? 332 GLU A CG    1 
ATOM   3442 C CD    . GLU B 2 331 ? -0.239  40.606 6.526   1.00 38.81  ? 332 GLU A CD    1 
ATOM   3443 O OE1   . GLU B 2 331 ? -0.718  39.455 6.406   1.00 42.03  ? 332 GLU A OE1   1 
ATOM   3444 O OE2   . GLU B 2 331 ? 0.947   40.895 6.226   1.00 39.06  ? 332 GLU A OE2   1 
ATOM   3445 N N     . CYS B 2 332 ? -4.069  43.716 7.505   1.00 32.20  ? 333 CYS A N     1 
ATOM   3446 C CA    . CYS B 2 332 ? -5.197  43.946 6.633   1.00 32.52  ? 333 CYS A CA    1 
ATOM   3447 C C     . CYS B 2 332 ? -4.727  44.189 5.225   1.00 31.96  ? 333 CYS A C     1 
ATOM   3448 O O     . CYS B 2 332 ? -3.567  44.508 5.006   1.00 33.90  ? 333 CYS A O     1 
ATOM   3449 C CB    . CYS B 2 332 ? -5.994  45.145 7.109   1.00 32.46  ? 333 CYS A CB    1 
ATOM   3450 S SG    . CYS B 2 332 ? -6.896  44.808 8.597   1.00 37.00  ? 333 CYS A SG    1 
ATOM   3451 N N     . GLN B 2 333 ? -5.629  44.039 4.268   1.00 31.08  ? 334 GLN A N     1 
ATOM   3452 C CA    . GLN B 2 333 ? -5.296  44.269 2.878   1.00 30.06  ? 334 GLN A CA    1 
ATOM   3453 C C     . GLN B 2 333 ? -5.607  45.719 2.526   1.00 29.39  ? 334 GLN A C     1 
ATOM   3454 O O     . GLN B 2 333 ? -5.212  46.206 1.471   1.00 30.40  ? 334 GLN A O     1 
ATOM   3455 C CB    . GLN B 2 333 ? -6.106  43.323 1.993   1.00 29.57  ? 334 GLN A CB    1 
ATOM   3456 C CG    . GLN B 2 333 ? -5.597  41.903 2.003   1.00 32.00  ? 334 GLN A CG    1 
ATOM   3457 C CD    . GLN B 2 333 ? -6.442  40.979 1.161   1.00 34.68  ? 334 GLN A CD    1 
ATOM   3458 O OE1   . GLN B 2 333 ? -7.366  40.324 1.660   1.00 36.99  ? 334 GLN A OE1   1 
ATOM   3459 N NE2   . GLN B 2 333 ? -6.145  40.927 -0.130  1.00 34.09  ? 334 GLN A NE2   1 
ATOM   3460 N N     . ILE B 2 334 ? -6.299  46.416 3.420   1.00 28.42  ? 335 ILE A N     1 
ATOM   3461 C CA    . ILE B 2 334 ? -6.676  47.798 3.147   1.00 29.64  ? 335 ILE A CA    1 
ATOM   3462 C C     . ILE B 2 334 ? -6.112  48.806 4.140   1.00 30.03  ? 335 ILE A C     1 
ATOM   3463 O O     . ILE B 2 334 ? -6.595  48.914 5.263   1.00 29.25  ? 335 ILE A O     1 
ATOM   3464 C CB    . ILE B 2 334 ? -8.224  47.976 3.135   1.00 29.35  ? 335 ILE A CB    1 
ATOM   3465 C CG1   . ILE B 2 334 ? -8.885  46.883 2.289   1.00 27.91  ? 335 ILE A CG1   1 
ATOM   3466 C CG2   . ILE B 2 334 ? -8.582  49.362 2.581   1.00 28.55  ? 335 ILE A CG2   1 
ATOM   3467 C CD1   . ILE B 2 334 ? -8.446  46.882 0.855   1.00 25.30  ? 335 ILE A CD1   1 
ATOM   3468 N N     . LYS B 2 335 ? -5.104  49.560 3.720   1.00 30.38  ? 336 LYS A N     1 
ATOM   3469 C CA    . LYS B 2 335 ? -4.532  50.555 4.604   1.00 31.99  ? 336 LYS A CA    1 
ATOM   3470 C C     . LYS B 2 335 ? -5.533  51.704 4.724   1.00 33.60  ? 336 LYS A C     1 
ATOM   3471 O O     . LYS B 2 335 ? -5.766  52.237 5.818   1.00 34.62  ? 336 LYS A O     1 
ATOM   3472 C CB    . LYS B 2 335 ? -3.214  51.094 4.046   1.00 31.84  ? 336 LYS A CB    1 
ATOM   3473 C CG    . LYS B 2 335 ? -2.125  50.071 3.852   1.00 32.20  ? 336 LYS A CG    1 
ATOM   3474 C CD    . LYS B 2 335 ? -0.941  50.663 3.100   1.00 33.51  ? 336 LYS A CD    1 
ATOM   3475 C CE    . LYS B 2 335 ? 0.172   49.637 3.016   1.00 37.36  ? 336 LYS A CE    1 
ATOM   3476 N NZ    . LYS B 2 335 ? 1.308   50.062 2.159   1.00 40.20  ? 336 LYS A NZ    1 
ATOM   3477 N N     . GLU B 2 336 ? -6.125  52.079 3.594   1.00 34.06  ? 337 GLU A N     1 
ATOM   3478 C CA    . GLU B 2 336 ? -7.079  53.172 3.576   1.00 35.10  ? 337 GLU A CA    1 
ATOM   3479 C C     . GLU B 2 336 ? -8.228  52.935 2.614   1.00 34.44  ? 337 GLU A C     1 
ATOM   3480 O O     . GLU B 2 336 ? -8.015  52.701 1.431   1.00 34.58  ? 337 GLU A O     1 
ATOM   3481 C CB    . GLU B 2 336 ? -6.362  54.488 3.218   1.00 37.74  ? 337 GLU A CB    1 
ATOM   3482 C CG    . GLU B 2 336 ? -7.297  55.699 2.910   1.00 41.75  ? 337 GLU A CG    1 
ATOM   3483 C CD    . GLU B 2 336 ? -6.576  57.060 2.971   1.00 43.88  ? 337 GLU A CD    1 
ATOM   3484 O OE1   . GLU B 2 336 ? -5.461  57.168 2.410   1.00 45.97  ? 337 GLU A OE1   1 
ATOM   3485 O OE2   . GLU B 2 336 ? -7.121  58.024 3.567   1.00 44.16  ? 337 GLU A OE2   1 
ATOM   3486 N N     . ILE B 2 337 ? -9.448  53.007 3.130   1.00 33.35  ? 338 ILE A N     1 
ATOM   3487 C CA    . ILE B 2 337 ? -10.629 52.823 2.305   1.00 32.63  ? 338 ILE A CA    1 
ATOM   3488 C C     . ILE B 2 337 ? -11.225 54.201 2.067   1.00 33.58  ? 338 ILE A C     1 
ATOM   3489 O O     . ILE B 2 337 ? -10.856 55.161 2.742   1.00 33.94  ? 338 ILE A O     1 
ATOM   3490 C CB    . ILE B 2 337 ? -11.661 51.890 2.993   1.00 32.53  ? 338 ILE A CB    1 
ATOM   3491 C CG1   . ILE B 2 337 ? -12.877 51.700 2.089   1.00 32.70  ? 338 ILE A CG1   1 
ATOM   3492 C CG2   . ILE B 2 337 ? -12.076 52.445 4.345   1.00 30.71  ? 338 ILE A CG2   1 
ATOM   3493 C CD1   . ILE B 2 337 ? -13.815 50.612 2.569   1.00 32.59  ? 338 ILE A CD1   1 
ATOM   3494 N N     . SER B 2 338 ? -12.118 54.318 1.092   1.00 33.86  ? 339 SER A N     1 
ATOM   3495 C CA    . SER B 2 338 ? -12.739 55.601 0.796   1.00 34.26  ? 339 SER A CA    1 
ATOM   3496 C C     . SER B 2 338 ? -13.609 56.062 1.954   1.00 34.43  ? 339 SER A C     1 
ATOM   3497 O O     . SER B 2 338 ? -13.948 55.285 2.854   1.00 33.47  ? 339 SER A O     1 
ATOM   3498 C CB    . SER B 2 338 ? -13.606 55.477 -0.450  1.00 35.66  ? 339 SER A CB    1 
ATOM   3499 O OG    . SER B 2 338 ? -14.605 54.485 -0.258  1.00 38.79  ? 339 SER A OG    1 
ATOM   3500 N N     . ARG B 2 339 ? -13.982 57.333 1.923   1.00 35.18  ? 340 ARG A N     1 
ATOM   3501 C CA    . ARG B 2 339 ? -14.826 57.875 2.973   1.00 36.00  ? 340 ARG A CA    1 
ATOM   3502 C C     . ARG B 2 339 ? -16.275 57.577 2.620   1.00 36.02  ? 340 ARG A C     1 
ATOM   3503 O O     . ARG B 2 339 ? -17.048 57.170 3.480   1.00 36.56  ? 340 ARG A O     1 
ATOM   3504 C CB    . ARG B 2 339 ? -14.597 59.382 3.140   1.00 37.46  ? 340 ARG A CB    1 
ATOM   3505 C CG    . ARG B 2 339 ? -15.260 59.947 4.388   1.00 40.71  ? 340 ARG A CG    1 
ATOM   3506 C CD    . ARG B 2 339 ? -14.444 61.056 5.066   1.00 43.46  ? 340 ARG A CD    1 
ATOM   3507 N NE    . ARG B 2 339 ? -14.180 60.724 6.470   1.00 44.93  ? 340 ARG A NE    1 
ATOM   3508 C CZ    . ARG B 2 339 ? -12.963 60.603 7.004   1.00 46.05  ? 340 ARG A CZ    1 
ATOM   3509 N NH1   . ARG B 2 339 ? -11.877 60.797 6.255   1.00 45.40  ? 340 ARG A NH1   1 
ATOM   3510 N NH2   . ARG B 2 339 ? -12.833 60.253 8.283   1.00 46.42  ? 340 ARG A NH2   1 
ATOM   3511 N N     . VAL B 2 340 ? -16.657 57.769 1.359   1.00 35.94  ? 341 VAL A N     1 
ATOM   3512 C CA    . VAL B 2 340 ? -18.033 57.450 0.981   1.00 35.10  ? 341 VAL A CA    1 
ATOM   3513 C C     . VAL B 2 340 ? -18.123 55.950 0.752   1.00 36.63  ? 341 VAL A C     1 
ATOM   3514 O O     . VAL B 2 340 ? -17.138 55.294 0.389   1.00 35.21  ? 341 VAL A O     1 
ATOM   3515 C CB    . VAL B 2 340 ? -18.495 58.114 -0.336  1.00 32.65  ? 341 VAL A CB    1 
ATOM   3516 C CG1   . VAL B 2 340 ? -18.435 59.598 -0.233  1.00 33.53  ? 341 VAL A CG1   1 
ATOM   3517 C CG2   . VAL B 2 340 ? -17.649 57.641 -1.467  1.00 32.27  ? 341 VAL A CG2   1 
ATOM   3518 N N     . PHE B 2 341 ? -19.316 55.418 0.974   1.00 38.39  ? 342 PHE A N     1 
ATOM   3519 C CA    . PHE B 2 341 ? -19.586 54.009 0.759   1.00 40.45  ? 342 PHE A CA    1 
ATOM   3520 C C     . PHE B 2 341 ? -21.071 53.983 0.447   1.00 41.61  ? 342 PHE A C     1 
ATOM   3521 O O     . PHE B 2 341 ? -21.770 54.964 0.738   1.00 41.91  ? 342 PHE A O     1 
ATOM   3522 C CB    . PHE B 2 341 ? -19.243 53.192 2.012   1.00 40.70  ? 342 PHE A CB    1 
ATOM   3523 C CG    . PHE B 2 341 ? -20.162 53.427 3.176   1.00 41.69  ? 342 PHE A CG    1 
ATOM   3524 C CD1   . PHE B 2 341 ? -21.321 52.666 3.331   1.00 42.01  ? 342 PHE A CD1   1 
ATOM   3525 C CD2   . PHE B 2 341 ? -19.861 54.394 4.132   1.00 42.56  ? 342 PHE A CD2   1 
ATOM   3526 C CE1   . PHE B 2 341 ? -22.167 52.862 4.421   1.00 42.58  ? 342 PHE A CE1   1 
ATOM   3527 C CE2   . PHE B 2 341 ? -20.700 54.599 5.229   1.00 42.90  ? 342 PHE A CE2   1 
ATOM   3528 C CZ    . PHE B 2 341 ? -21.858 53.826 5.369   1.00 43.11  ? 342 PHE A CZ    1 
ATOM   3529 N N     . ARG B 2 342 ? -21.554 52.895 -0.154  1.00 42.70  ? 343 ARG A N     1 
ATOM   3530 C CA    . ARG B 2 342 ? -22.971 52.804 -0.512  1.00 43.58  ? 343 ARG A CA    1 
ATOM   3531 C C     . ARG B 2 342 ? -23.829 51.984 0.454   1.00 44.27  ? 343 ARG A C     1 
ATOM   3532 O O     . ARG B 2 342 ? -23.406 50.930 0.926   1.00 45.19  ? 343 ARG A O     1 
ATOM   3533 C CB    . ARG B 2 342 ? -23.114 52.276 -1.951  1.00 43.35  ? 343 ARG A CB    1 
ATOM   3534 C CG    . ARG B 2 342 ? -21.972 51.381 -2.425  1.00 44.26  ? 343 ARG A CG    1 
ATOM   3535 C CD    . ARG B 2 342 ? -22.193 50.945 -3.873  1.00 43.77  ? 343 ARG A CD    1 
ATOM   3536 N NE    . ARG B 2 342 ? -23.487 50.287 -4.049  1.00 43.54  ? 343 ARG A NE    1 
ATOM   3537 C CZ    . ARG B 2 342 ? -24.094 50.109 -5.220  1.00 43.45  ? 343 ARG A CZ    1 
ATOM   3538 N NH1   . ARG B 2 342 ? -23.535 50.534 -6.343  1.00 43.93  ? 343 ARG A NH1   1 
ATOM   3539 N NH2   . ARG B 2 342 ? -25.275 49.511 -5.269  1.00 43.73  ? 343 ARG A NH2   1 
ATOM   3540 N N     . ARG B 2 343 ? -25.029 52.491 0.752   1.00 45.14  ? 344 ARG A N     1 
ATOM   3541 C CA    . ARG B 2 343 ? -25.981 51.828 1.656   1.00 45.29  ? 344 ARG A CA    1 
ATOM   3542 C C     . ARG B 2 343 ? -27.199 51.374 0.871   1.00 44.62  ? 344 ARG A C     1 
ATOM   3543 O O     . ARG B 2 343 ? -27.687 52.108 0.015   1.00 44.78  ? 344 ARG A O     1 
ATOM   3544 C CB    . ARG B 2 343 ? -26.430 52.782 2.769   1.00 47.23  ? 344 ARG A CB    1 
ATOM   3545 C CG    . ARG B 2 343 ? -27.594 52.273 3.631   1.00 48.99  ? 344 ARG A CG    1 
ATOM   3546 C CD    . ARG B 2 343 ? -27.697 53.091 4.908   1.00 50.25  ? 344 ARG A CD    1 
ATOM   3547 N NE    . ARG B 2 343 ? -26.478 52.927 5.694   1.00 53.14  ? 344 ARG A NE    1 
ATOM   3548 C CZ    . ARG B 2 343 ? -26.133 53.686 6.730   1.00 55.21  ? 344 ARG A CZ    1 
ATOM   3549 N NH1   . ARG B 2 343 ? -26.914 54.688 7.124   1.00 56.80  ? 344 ARG A NH1   1 
ATOM   3550 N NH2   . ARG B 2 343 ? -25.005 53.435 7.381   1.00 55.99  ? 344 ARG A NH2   1 
ATOM   3551 N N     . MET B 2 344 ? -27.693 50.173 1.169   1.00 43.78  ? 345 MET A N     1 
ATOM   3552 C CA    . MET B 2 344 ? -28.846 49.634 0.459   1.00 43.15  ? 345 MET A CA    1 
ATOM   3553 C C     . MET B 2 344 ? -30.207 50.074 1.020   1.00 42.83  ? 345 MET A C     1 
ATOM   3554 O O     . MET B 2 344 ? -30.528 49.843 2.187   1.00 42.05  ? 345 MET A O     1 
ATOM   3555 C CB    . MET B 2 344 ? -28.754 48.119 0.433   1.00 42.69  ? 345 MET A CB    1 
ATOM   3556 C CG    . MET B 2 344 ? -29.684 47.474 -0.562  1.00 43.39  ? 345 MET A CG    1 
ATOM   3557 S SD    . MET B 2 344 ? -29.594 45.658 -0.515  1.00 42.97  ? 345 MET A SD    1 
ATOM   3558 C CE    . MET B 2 344 ? -30.957 45.270 0.628   1.00 42.20  ? 345 MET A CE    1 
ATOM   3559 N N     . GLY B 2 345 ? -30.998 50.724 0.175   1.00 43.31  ? 346 GLY A N     1 
ATOM   3560 C CA    . GLY B 2 345 ? -32.310 51.185 0.591   1.00 43.59  ? 346 GLY A CA    1 
ATOM   3561 C C     . GLY B 2 345 ? -33.361 50.185 0.152   1.00 43.93  ? 346 GLY A C     1 
ATOM   3562 O O     . GLY B 2 345 ? -33.008 49.087 -0.297  1.00 44.42  ? 346 GLY A O     1 
ATOM   3563 N N     . PRO B 2 346 ? -34.657 50.527 0.251   1.00 43.54  ? 347 PRO A N     1 
ATOM   3564 C CA    . PRO B 2 346 ? -35.771 49.650 -0.139  1.00 43.05  ? 347 PRO A CA    1 
ATOM   3565 C C     . PRO B 2 346 ? -35.987 49.621 -1.647  1.00 43.23  ? 347 PRO A C     1 
ATOM   3566 O O     . PRO B 2 346 ? -35.311 50.321 -2.390  1.00 42.96  ? 347 PRO A O     1 
ATOM   3567 C CB    . PRO B 2 346 ? -36.954 50.280 0.566   1.00 43.82  ? 347 PRO A CB    1 
ATOM   3568 C CG    . PRO B 2 346 ? -36.639 51.768 0.427   1.00 43.65  ? 347 PRO A CG    1 
ATOM   3569 C CD    . PRO B 2 346 ? -35.147 51.828 0.743   1.00 43.16  ? 347 PRO A CD    1 
ATOM   3570 N N     . GLN B 2 347 ? -36.945 48.818 -2.096  1.00 44.01  ? 348 GLN A N     1 
ATOM   3571 C CA    . GLN B 2 347 ? -37.251 48.732 -3.517  1.00 44.47  ? 348 GLN A CA    1 
ATOM   3572 C C     . GLN B 2 347 ? -38.234 49.863 -3.889  1.00 44.80  ? 348 GLN A C     1 
ATOM   3573 O O     . GLN B 2 347 ? -39.094 50.233 -3.085  1.00 44.16  ? 348 GLN A O     1 
ATOM   3574 C CB    . GLN B 2 347 ? -37.851 47.361 -3.823  1.00 45.06  ? 348 GLN A CB    1 
ATOM   3575 C CG    . GLN B 2 347 ? -36.987 46.190 -3.407  1.00 45.15  ? 348 GLN A CG    1 
ATOM   3576 C CD    . GLN B 2 347 ? -37.416 44.906 -4.103  1.00 47.23  ? 348 GLN A CD    1 
ATOM   3577 O OE1   . GLN B 2 347 ? -38.588 44.522 -4.055  1.00 47.51  ? 348 GLN A OE1   1 
ATOM   3578 N NE2   . GLN B 2 347 ? -36.469 44.238 -4.760  1.00 48.05  ? 348 GLN A NE2   1 
ATOM   3579 N N     . PHE B 2 348 ? -38.121 50.400 -5.103  1.00 45.06  ? 349 PHE A N     1 
ATOM   3580 C CA    . PHE B 2 348 ? -38.987 51.507 -5.516  1.00 45.33  ? 349 PHE A CA    1 
ATOM   3581 C C     . PHE B 2 348 ? -40.474 51.332 -5.232  1.00 45.60  ? 349 PHE A C     1 
ATOM   3582 O O     . PHE B 2 348 ? -41.153 52.293 -4.882  1.00 45.91  ? 349 PHE A O     1 
ATOM   3583 C CB    . PHE B 2 348 ? -38.755 51.850 -7.000  1.00 44.73  ? 349 PHE A CB    1 
ATOM   3584 C CG    . PHE B 2 348 ? -39.520 50.987 -7.983  1.00 45.26  ? 349 PHE A CG    1 
ATOM   3585 C CD1   . PHE B 2 348 ? -40.718 51.442 -8.542  1.00 44.86  ? 349 PHE A CD1   1 
ATOM   3586 C CD2   . PHE B 2 348 ? -38.989 49.772 -8.444  1.00 45.90  ? 349 PHE A CD2   1 
ATOM   3587 C CE1   . PHE B 2 348 ? -41.377 50.708 -9.555  1.00 43.97  ? 349 PHE A CE1   1 
ATOM   3588 C CE2   . PHE B 2 348 ? -39.641 49.033 -9.456  1.00 44.71  ? 349 PHE A CE2   1 
ATOM   3589 C CZ    . PHE B 2 348 ? -40.835 49.509 -10.012 1.00 43.82  ? 349 PHE A CZ    1 
ATOM   3590 N N     . GLU B 2 349 ? -40.974 50.111 -5.368  1.00 46.10  ? 350 GLU A N     1 
ATOM   3591 C CA    . GLU B 2 349 ? -42.384 49.812 -5.121  1.00 46.89  ? 350 GLU A CA    1 
ATOM   3592 C C     . GLU B 2 349 ? -42.870 50.200 -3.722  1.00 47.22  ? 350 GLU A C     1 
ATOM   3593 O O     . GLU B 2 349 ? -44.013 50.599 -3.541  1.00 46.43  ? 350 GLU A O     1 
ATOM   3594 C CB    . GLU B 2 349 ? -42.634 48.317 -5.286  1.00 48.02  ? 350 GLU A CB    1 
ATOM   3595 C CG    . GLU B 2 349 ? -41.450 47.537 -5.824  1.00 49.73  ? 350 GLU A CG    1 
ATOM   3596 C CD    . GLU B 2 349 ? -41.607 47.248 -7.288  1.00 51.25  ? 350 GLU A CD    1 
ATOM   3597 O OE1   . GLU B 2 349 ? -40.701 46.640 -7.889  1.00 52.15  ? 350 GLU A OE1   1 
ATOM   3598 O OE2   . GLU B 2 349 ? -42.657 47.631 -7.837  1.00 53.60  ? 350 GLU A OE2   1 
ATOM   3599 N N     . ASP B 2 350 ? -41.999 50.059 -2.733  1.00 49.03  ? 351 ASP A N     1 
ATOM   3600 C CA    . ASP B 2 350 ? -42.346 50.346 -1.348  1.00 50.66  ? 351 ASP A CA    1 
ATOM   3601 C C     . ASP B 2 350 ? -42.316 51.836 -1.007  1.00 51.65  ? 351 ASP A C     1 
ATOM   3602 O O     . ASP B 2 350 ? -41.449 52.303 -0.270  1.00 52.09  ? 351 ASP A O     1 
ATOM   3603 C CB    . ASP B 2 350 ? -41.398 49.560 -0.443  1.00 52.09  ? 351 ASP A CB    1 
ATOM   3604 C CG    . ASP B 2 350 ? -41.829 49.560 1.007   1.00 54.34  ? 351 ASP A CG    1 
ATOM   3605 O OD1   . ASP B 2 350 ? -41.248 48.763 1.768   1.00 54.43  ? 351 ASP A OD1   1 
ATOM   3606 O OD2   . ASP B 2 350 ? -42.731 50.348 1.380   1.00 56.25  ? 351 ASP A OD2   1 
ATOM   3607 N N     . GLU B 2 351 ? -43.278 52.577 -1.545  1.00 53.14  ? 352 GLU A N     1 
ATOM   3608 C CA    . GLU B 2 351 ? -43.371 54.011 -1.303  1.00 54.75  ? 352 GLU A CA    1 
ATOM   3609 C C     . GLU B 2 351 ? -43.145 54.396 0.152   1.00 55.10  ? 352 GLU A C     1 
ATOM   3610 O O     . GLU B 2 351 ? -42.378 55.307 0.439   1.00 55.05  ? 352 GLU A O     1 
ATOM   3611 C CB    . GLU B 2 351 ? -44.733 54.529 -1.751  1.00 56.15  ? 352 GLU A CB    1 
ATOM   3612 C CG    . GLU B 2 351 ? -45.044 55.920 -1.246  1.00 59.80  ? 352 GLU A CG    1 
ATOM   3613 C CD    . GLU B 2 351 ? -46.488 56.329 -1.503  1.00 62.34  ? 352 GLU A CD    1 
ATOM   3614 O OE1   . GLU B 2 351 ? -46.773 56.916 -2.578  1.00 62.48  ? 352 GLU A OE1   1 
ATOM   3615 O OE2   . GLU B 2 351 ? -47.336 56.047 -0.620  1.00 63.89  ? 352 GLU A OE2   1 
ATOM   3616 N N     . ARG B 2 352 ? -43.814 53.712 1.073   1.00 56.22  ? 353 ARG A N     1 
ATOM   3617 C CA    . ARG B 2 352 ? -43.656 54.033 2.487   1.00 57.45  ? 353 ARG A CA    1 
ATOM   3618 C C     . ARG B 2 352 ? -42.185 54.084 2.894   1.00 57.62  ? 353 ARG A C     1 
ATOM   3619 O O     . ARG B 2 352 ? -41.659 55.147 3.223   1.00 57.79  ? 353 ARG A O     1 
ATOM   3620 C CB    . ARG B 2 352 ? -44.380 53.006 3.354   1.00 58.91  ? 353 ARG A CB    1 
ATOM   3621 C CG    . ARG B 2 352 ? -44.363 53.335 4.837   1.00 61.41  ? 353 ARG A CG    1 
ATOM   3622 C CD    . ARG B 2 352 ? -45.769 53.625 5.320   1.00 64.50  ? 353 ARG A CD    1 
ATOM   3623 N NE    . ARG B 2 352 ? -46.476 54.525 4.405   1.00 66.90  ? 353 ARG A NE    1 
ATOM   3624 C CZ    . ARG B 2 352 ? -47.701 55.009 4.613   1.00 67.91  ? 353 ARG A CZ    1 
ATOM   3625 N NH1   . ARG B 2 352 ? -48.372 54.684 5.716   1.00 69.17  ? 353 ARG A NH1   1 
ATOM   3626 N NH2   . ARG B 2 352 ? -48.259 55.820 3.717   1.00 67.39  ? 353 ARG A NH2   1 
ATOM   3627 N N     . ASN B 2 353 ? -41.521 52.935 2.860   1.00 57.36  ? 354 ASN A N     1 
ATOM   3628 C CA    . ASN B 2 353 ? -40.119 52.865 3.247   1.00 57.30  ? 354 ASN A CA    1 
ATOM   3629 C C     . ASN B 2 353 ? -39.186 53.789 2.477   1.00 56.33  ? 354 ASN A C     1 
ATOM   3630 O O     . ASN B 2 353 ? -38.316 54.422 3.069   1.00 56.66  ? 354 ASN A O     1 
ATOM   3631 C CB    . ASN B 2 353 ? -39.646 51.426 3.163   1.00 58.51  ? 354 ASN A CB    1 
ATOM   3632 C CG    . ASN B 2 353 ? -40.165 50.600 4.312   1.00 60.26  ? 354 ASN A CG    1 
ATOM   3633 O OD1   . ASN B 2 353 ? -39.728 50.762 5.456   1.00 60.70  ? 354 ASN A OD1   1 
ATOM   3634 N ND2   . ASN B 2 353 ? -41.123 49.727 4.027   1.00 61.24  ? 354 ASN A ND2   1 
ATOM   3635 N N     . VAL B 2 354 ? -39.355 53.857 1.163   1.00 54.72  ? 355 VAL A N     1 
ATOM   3636 C CA    . VAL B 2 354 ? -38.547 54.747 0.341   1.00 52.24  ? 355 VAL A CA    1 
ATOM   3637 C C     . VAL B 2 354 ? -38.634 56.164 0.923   1.00 51.78  ? 355 VAL A C     1 
ATOM   3638 O O     . VAL B 2 354 ? -37.619 56.811 1.191   1.00 50.67  ? 355 VAL A O     1 
ATOM   3639 C CB    . VAL B 2 354 ? -39.079 54.781 -1.098  1.00 50.51  ? 355 VAL A CB    1 
ATOM   3640 C CG1   . VAL B 2 354 ? -38.534 56.004 -1.830  1.00 50.31  ? 355 VAL A CG1   1 
ATOM   3641 C CG2   . VAL B 2 354 ? -38.699 53.508 -1.810  1.00 49.35  ? 355 VAL A CG2   1 
ATOM   3642 N N     . LYS B 2 355 ? -39.864 56.629 1.117   1.00 52.03  ? 356 LYS A N     1 
ATOM   3643 C CA    . LYS B 2 355 ? -40.122 57.960 1.649   1.00 52.69  ? 356 LYS A CA    1 
ATOM   3644 C C     . LYS B 2 355 ? -39.262 58.219 2.883   1.00 52.44  ? 356 LYS A C     1 
ATOM   3645 O O     . LYS B 2 355 ? -38.604 59.255 2.985   1.00 53.78  ? 356 LYS A O     1 
ATOM   3646 C CB    . LYS B 2 355 ? -41.614 58.103 1.991   1.00 53.97  ? 356 LYS A CB    1 
ATOM   3647 C CG    . LYS B 2 355 ? -42.057 59.492 2.471   1.00 55.70  ? 356 LYS A CG    1 
ATOM   3648 C CD    . LYS B 2 355 ? -42.987 60.135 1.434   1.00 57.22  ? 356 LYS A CD    1 
ATOM   3649 C CE    . LYS B 2 355 ? -44.401 59.548 1.456   1.00 57.67  ? 356 LYS A CE    1 
ATOM   3650 N NZ    . LYS B 2 355 ? -45.226 60.092 2.598   1.00 58.76  ? 356 LYS A NZ    1 
ATOM   3651 N N     . LYS B 2 356 ? -39.267 57.275 3.818   1.00 51.27  ? 357 LYS A N     1 
ATOM   3652 C CA    . LYS B 2 356 ? -38.470 57.411 5.028   1.00 49.42  ? 357 LYS A CA    1 
ATOM   3653 C C     . LYS B 2 356 ? -36.979 57.342 4.688   1.00 48.44  ? 357 LYS A C     1 
ATOM   3654 O O     . LYS B 2 356 ? -36.165 58.046 5.284   1.00 48.18  ? 357 LYS A O     1 
ATOM   3655 C CB    . LYS B 2 356 ? -38.835 56.313 6.027   1.00 50.46  ? 357 LYS A CB    1 
ATOM   3656 C CG    . LYS B 2 356 ? -40.252 56.421 6.579   1.00 51.52  ? 357 LYS A CG    1 
ATOM   3657 C CD    . LYS B 2 356 ? -40.543 55.319 7.588   1.00 52.88  ? 357 LYS A CD    1 
ATOM   3658 C CE    . LYS B 2 356 ? -39.542 55.351 8.744   1.00 53.87  ? 357 LYS A CE    1 
ATOM   3659 N NZ    . LYS B 2 356 ? -39.760 54.231 9.717   1.00 55.47  ? 357 LYS A NZ    1 
ATOM   3660 N N     . PHE B 2 357 ? -36.619 56.499 3.725   1.00 47.74  ? 358 PHE A N     1 
ATOM   3661 C CA    . PHE B 2 357 ? -35.222 56.378 3.322   1.00 46.69  ? 358 PHE A CA    1 
ATOM   3662 C C     . PHE B 2 357 ? -34.727 57.710 2.770   1.00 46.87  ? 358 PHE A C     1 
ATOM   3663 O O     . PHE B 2 357 ? -33.544 58.031 2.867   1.00 46.17  ? 358 PHE A O     1 
ATOM   3664 C CB    . PHE B 2 357 ? -35.050 55.295 2.254   1.00 44.60  ? 358 PHE A CB    1 
ATOM   3665 C CG    . PHE B 2 357 ? -33.617 55.074 1.842   1.00 42.75  ? 358 PHE A CG    1 
ATOM   3666 C CD1   . PHE B 2 357 ? -32.670 54.649 2.769   1.00 41.57  ? 358 PHE A CD1   1 
ATOM   3667 C CD2   . PHE B 2 357 ? -33.217 55.281 0.527   1.00 41.32  ? 358 PHE A CD2   1 
ATOM   3668 C CE1   . PHE B 2 357 ? -31.352 54.432 2.388   1.00 40.27  ? 358 PHE A CE1   1 
ATOM   3669 C CE2   . PHE B 2 357 ? -31.899 55.067 0.137   1.00 39.23  ? 358 PHE A CE2   1 
ATOM   3670 C CZ    . PHE B 2 357 ? -30.969 54.643 1.065   1.00 39.89  ? 358 PHE A CZ    1 
ATOM   3671 N N     . LEU B 2 358 ? -35.631 58.491 2.190   1.00 47.30  ? 359 LEU A N     1 
ATOM   3672 C CA    . LEU B 2 358 ? -35.229 59.773 1.649   1.00 48.88  ? 359 LEU A CA    1 
ATOM   3673 C C     . LEU B 2 358 ? -35.423 60.920 2.645   1.00 51.01  ? 359 LEU A C     1 
ATOM   3674 O O     . LEU B 2 358 ? -34.999 62.052 2.385   1.00 52.13  ? 359 LEU A O     1 
ATOM   3675 C CB    . LEU B 2 358 ? -35.979 60.045 0.347   1.00 47.80  ? 359 LEU A CB    1 
ATOM   3676 C CG    . LEU B 2 358 ? -35.813 58.928 -0.695  1.00 47.48  ? 359 LEU A CG    1 
ATOM   3677 C CD1   . LEU B 2 358 ? -36.450 59.314 -2.024  1.00 46.10  ? 359 LEU A CD1   1 
ATOM   3678 C CD2   . LEU B 2 358 ? -34.350 58.650 -0.897  1.00 46.48  ? 359 LEU A CD2   1 
ATOM   3679 N N     . SER B 2 359 ? -36.040 60.635 3.793   1.00 52.16  ? 360 SER A N     1 
ATOM   3680 C CA    . SER B 2 359 ? -36.253 61.673 4.799   1.00 53.48  ? 360 SER A CA    1 
ATOM   3681 C C     . SER B 2 359 ? -34.916 62.010 5.472   1.00 54.71  ? 360 SER A C     1 
ATOM   3682 O O     . SER B 2 359 ? -34.745 63.087 6.043   1.00 55.65  ? 360 SER A O     1 
ATOM   3683 C CB    . SER B 2 359 ? -37.287 61.214 5.843   1.00 53.00  ? 360 SER A CB    1 
ATOM   3684 O OG    . SER B 2 359 ? -36.780 60.199 6.705   1.00 53.57  ? 360 SER A OG    1 
ATOM   3685 N N     . ARG B 2 360 ? -33.968 61.085 5.385   1.00 55.62  ? 361 ARG A N     1 
ATOM   3686 C CA    . ARG B 2 360 ? -32.640 61.266 5.961   1.00 56.83  ? 361 ARG A CA    1 
ATOM   3687 C C     . ARG B 2 360 ? -31.809 62.229 5.119   1.00 57.13  ? 361 ARG A C     1 
ATOM   3688 O O     . ARG B 2 360 ? -31.337 61.850 4.042   1.00 58.07  ? 361 ARG A O     1 
ATOM   3689 C CB    . ARG B 2 360 ? -31.905 59.931 5.986   1.00 58.80  ? 361 ARG A CB    1 
ATOM   3690 C CG    . ARG B 2 360 ? -32.287 58.990 7.086   1.00 61.74  ? 361 ARG A CG    1 
ATOM   3691 C CD    . ARG B 2 360 ? -31.419 59.275 8.279   1.00 65.15  ? 361 ARG A CD    1 
ATOM   3692 N NE    . ARG B 2 360 ? -31.411 58.152 9.200   1.00 67.57  ? 361 ARG A NE    1 
ATOM   3693 C CZ    . ARG B 2 360 ? -30.710 58.123 10.324  1.00 68.56  ? 361 ARG A CZ    1 
ATOM   3694 N NH1   . ARG B 2 360 ? -29.958 59.167 10.660  1.00 68.57  ? 361 ARG A NH1   1 
ATOM   3695 N NH2   . ARG B 2 360 ? -30.774 57.056 11.110  1.00 68.61  ? 361 ARG A NH2   1 
ATOM   3696 N N     . ASN B 2 361 ? -31.616 63.461 5.578   1.00 56.54  ? 362 ASN A N     1 
ATOM   3697 C CA    . ASN B 2 361 ? -30.803 64.372 4.787   1.00 55.74  ? 362 ASN A CA    1 
ATOM   3698 C C     . ASN B 2 361 ? -29.383 63.797 4.753   1.00 54.25  ? 362 ASN A C     1 
ATOM   3699 O O     . ASN B 2 361 ? -28.828 63.389 5.775   1.00 53.49  ? 362 ASN A O     1 
ATOM   3700 C CB    . ASN B 2 361 ? -30.814 65.800 5.365   1.00 57.40  ? 362 ASN A CB    1 
ATOM   3701 C CG    . ASN B 2 361 ? -29.841 65.989 6.527   1.00 59.00  ? 362 ASN A CG    1 
ATOM   3702 O OD1   . ASN B 2 361 ? -29.866 65.240 7.510   1.00 59.59  ? 362 ASN A OD1   1 
ATOM   3703 N ND2   . ASN B 2 361 ? -28.984 67.010 6.422   1.00 59.25  ? 362 ASN A ND2   1 
ATOM   3704 N N     . ARG B 2 362 ? -28.822 63.721 3.556   1.00 52.46  ? 363 ARG A N     1 
ATOM   3705 C CA    . ARG B 2 362 ? -27.483 63.197 3.365   1.00 50.27  ? 363 ARG A CA    1 
ATOM   3706 C C     . ARG B 2 362 ? -26.813 64.184 2.436   1.00 49.09  ? 363 ARG A C     1 
ATOM   3707 O O     . ARG B 2 362 ? -27.496 64.950 1.751   1.00 48.87  ? 363 ARG A O     1 
ATOM   3708 C CB    . ARG B 2 362 ? -27.549 61.820 2.724   1.00 50.19  ? 363 ARG A CB    1 
ATOM   3709 C CG    . ARG B 2 362 ? -28.578 60.937 3.379   1.00 51.00  ? 363 ARG A CG    1 
ATOM   3710 C CD    . ARG B 2 362 ? -28.546 59.534 2.829   1.00 51.97  ? 363 ARG A CD    1 
ATOM   3711 N NE    . ARG B 2 362 ? -29.845 58.887 2.968   1.00 52.68  ? 363 ARG A NE    1 
ATOM   3712 C CZ    . ARG B 2 362 ? -30.064 57.817 3.719   1.00 53.34  ? 363 ARG A CZ    1 
ATOM   3713 N NH1   . ARG B 2 362 ? -29.068 57.265 4.405   1.00 52.64  ? 363 ARG A NH1   1 
ATOM   3714 N NH2   . ARG B 2 362 ? -31.282 57.301 3.783   1.00 54.78  ? 363 ARG A NH2   1 
ATOM   3715 N N     . ALA B 2 363 ? -25.485 64.164 2.394   1.00 47.38  ? 364 ALA A N     1 
ATOM   3716 C CA    . ALA B 2 363 ? -24.755 65.114 1.569   1.00 45.68  ? 364 ALA A CA    1 
ATOM   3717 C C     . ALA B 2 363 ? -24.706 64.768 0.095   1.00 45.60  ? 364 ALA A C     1 
ATOM   3718 O O     . ALA B 2 363 ? -24.340 65.615 -0.731  1.00 44.97  ? 364 ALA A O     1 
ATOM   3719 C CB    . ALA B 2 363 ? -23.345 65.282 2.106   1.00 45.00  ? 364 ALA A CB    1 
ATOM   3720 N N     . PHE B 2 364 ? -25.102 63.550 -0.260  1.00 45.38  ? 365 PHE A N     1 
ATOM   3721 C CA    . PHE B 2 364 ? -25.009 63.183 -1.657  1.00 44.42  ? 365 PHE A CA    1 
ATOM   3722 C C     . PHE B 2 364 ? -26.215 62.813 -2.510  1.00 44.30  ? 365 PHE A C     1 
ATOM   3723 O O     . PHE B 2 364 ? -26.044 62.547 -3.699  1.00 45.63  ? 365 PHE A O     1 
ATOM   3724 C CB    . PHE B 2 364 ? -23.917 62.123 -1.819  1.00 44.37  ? 365 PHE A CB    1 
ATOM   3725 C CG    . PHE B 2 364 ? -22.524 62.694 -1.790  1.00 43.71  ? 365 PHE A CG    1 
ATOM   3726 C CD1   . PHE B 2 364 ? -21.668 62.441 -0.727  1.00 43.47  ? 365 PHE A CD1   1 
ATOM   3727 C CD2   . PHE B 2 364 ? -22.077 63.512 -2.815  1.00 43.32  ? 365 PHE A CD2   1 
ATOM   3728 C CE1   . PHE B 2 364 ? -20.391 63.001 -0.689  1.00 42.74  ? 365 PHE A CE1   1 
ATOM   3729 C CE2   . PHE B 2 364 ? -20.799 64.075 -2.779  1.00 42.99  ? 365 PHE A CE2   1 
ATOM   3730 C CZ    . PHE B 2 364 ? -19.959 63.818 -1.717  1.00 41.94  ? 365 PHE A CZ    1 
ATOM   3731 N N     . ARG B 2 365 ? -27.423 62.780 -1.969  1.00 43.25  ? 366 ARG A N     1 
ATOM   3732 C CA    . ARG B 2 365 ? -28.548 62.475 -2.853  1.00 43.25  ? 366 ARG A CA    1 
ATOM   3733 C C     . ARG B 2 365 ? -28.503 61.046 -3.405  1.00 41.83  ? 366 ARG A C     1 
ATOM   3734 O O     . ARG B 2 365 ? -27.785 60.746 -4.362  1.00 40.50  ? 366 ARG A O     1 
ATOM   3735 C CB    . ARG B 2 365 ? -28.557 63.477 -4.021  1.00 45.10  ? 366 ARG A CB    1 
ATOM   3736 C CG    . ARG B 2 365 ? -29.676 63.294 -5.031  1.00 49.20  ? 366 ARG A CG    1 
ATOM   3737 C CD    . ARG B 2 365 ? -29.461 64.150 -6.287  1.00 52.79  ? 366 ARG A CD    1 
ATOM   3738 N NE    . ARG B 2 365 ? -29.653 65.587 -6.055  1.00 56.69  ? 366 ARG A NE    1 
ATOM   3739 C CZ    . ARG B 2 365 ? -30.837 66.177 -5.891  1.00 58.11  ? 366 ARG A CZ    1 
ATOM   3740 N NH1   . ARG B 2 365 ? -31.964 65.464 -5.929  1.00 58.26  ? 366 ARG A NH1   1 
ATOM   3741 N NH2   . ARG B 2 365 ? -30.896 67.490 -5.699  1.00 58.37  ? 366 ARG A NH2   1 
ATOM   3742 N N     . PRO B 2 366 ? -29.298 60.151 -2.808  1.00 41.53  ? 367 PRO A N     1 
ATOM   3743 C CA    . PRO B 2 366 ? -29.407 58.736 -3.175  1.00 40.80  ? 367 PRO A CA    1 
ATOM   3744 C C     . PRO B 2 366 ? -29.934 58.546 -4.594  1.00 40.14  ? 367 PRO A C     1 
ATOM   3745 O O     . PRO B 2 366 ? -30.617 59.426 -5.129  1.00 39.19  ? 367 PRO A O     1 
ATOM   3746 C CB    . PRO B 2 366 ? -30.339 58.178 -2.100  1.00 41.38  ? 367 PRO A CB    1 
ATOM   3747 C CG    . PRO B 2 366 ? -31.198 59.338 -1.762  1.00 41.28  ? 367 PRO A CG    1 
ATOM   3748 C CD    . PRO B 2 366 ? -30.229 60.482 -1.715  1.00 41.46  ? 367 PRO A CD    1 
ATOM   3749 N N     . PHE B 2 367 ? -29.625 57.388 -5.182  1.00 38.82  ? 368 PHE A N     1 
ATOM   3750 C CA    . PHE B 2 367 ? -30.002 57.065 -6.557  1.00 37.05  ? 368 PHE A CA    1 
ATOM   3751 C C     . PHE B 2 367 ? -30.668 55.705 -6.673  1.00 37.58  ? 368 PHE A C     1 
ATOM   3752 O O     . PHE B 2 367 ? -30.682 54.941 -5.702  1.00 38.31  ? 368 PHE A O     1 
ATOM   3753 C CB    . PHE B 2 367 ? -28.747 57.039 -7.416  1.00 36.70  ? 368 PHE A CB    1 
ATOM   3754 C CG    . PHE B 2 367 ? -27.697 56.096 -6.900  1.00 34.95  ? 368 PHE A CG    1 
ATOM   3755 C CD1   . PHE B 2 367 ? -26.816 56.494 -5.901  1.00 32.93  ? 368 PHE A CD1   1 
ATOM   3756 C CD2   . PHE B 2 367 ? -27.635 54.789 -7.366  1.00 34.21  ? 368 PHE A CD2   1 
ATOM   3757 C CE1   . PHE B 2 367 ? -25.896 55.611 -5.372  1.00 31.38  ? 368 PHE A CE1   1 
ATOM   3758 C CE2   . PHE B 2 367 ? -26.714 53.899 -6.839  1.00 33.94  ? 368 PHE A CE2   1 
ATOM   3759 C CZ    . PHE B 2 367 ? -25.843 54.314 -5.836  1.00 31.66  ? 368 PHE A CZ    1 
ATOM   3760 N N     . ILE B 2 368 ? -31.191 55.405 -7.869  1.00 37.16  ? 369 ILE A N     1 
ATOM   3761 C CA    . ILE B 2 368 ? -31.834 54.119 -8.152  1.00 36.71  ? 369 ILE A CA    1 
ATOM   3762 C C     . ILE B 2 368 ? -30.939 53.228 -9.018  1.00 38.11  ? 369 ILE A C     1 
ATOM   3763 O O     . ILE B 2 368 ? -30.206 53.708 -9.876  1.00 38.54  ? 369 ILE A O     1 
ATOM   3764 C CB    . ILE B 2 368 ? -33.165 54.298 -8.875  1.00 34.77  ? 369 ILE A CB    1 
ATOM   3765 C CG1   . ILE B 2 368 ? -34.145 55.011 -7.962  1.00 35.65  ? 369 ILE A CG1   1 
ATOM   3766 C CG2   . ILE B 2 368 ? -33.738 52.955 -9.253  1.00 32.88  ? 369 ILE A CG2   1 
ATOM   3767 C CD1   . ILE B 2 368 ? -35.512 55.207 -8.588  1.00 36.90  ? 369 ILE A CD1   1 
ATOM   3768 N N     . GLU B 2 369 ? -31.015 51.926 -8.787  1.00 39.05  ? 370 GLU A N     1 
ATOM   3769 C CA    . GLU B 2 369 ? -30.213 50.963 -9.520  1.00 40.23  ? 370 GLU A CA    1 
ATOM   3770 C C     . GLU B 2 369 ? -30.835 49.599 -9.296  1.00 40.94  ? 370 GLU A C     1 
ATOM   3771 O O     . GLU B 2 369 ? -31.067 49.188 -8.161  1.00 40.65  ? 370 GLU A O     1 
ATOM   3772 C CB    . GLU B 2 369 ? -28.782 50.996 -8.992  1.00 42.51  ? 370 GLU A CB    1 
ATOM   3773 C CG    . GLU B 2 369 ? -27.839 49.913 -9.486  1.00 44.29  ? 370 GLU A CG    1 
ATOM   3774 C CD    . GLU B 2 369 ? -26.413 50.146 -8.985  1.00 46.32  ? 370 GLU A CD    1 
ATOM   3775 O OE1   . GLU B 2 369 ? -25.808 51.171 -9.385  1.00 48.04  ? 370 GLU A OE1   1 
ATOM   3776 O OE2   . GLU B 2 369 ? -25.897 49.326 -8.189  1.00 46.49  ? 370 GLU A OE2   1 
ATOM   3777 N N     . ASN B 2 370 ? -31.122 48.909 -10.389 1.00 41.66  ? 371 ASN A N     1 
ATOM   3778 C CA    . ASN B 2 370 ? -31.738 47.593 -10.331 1.00 42.33  ? 371 ASN A CA    1 
ATOM   3779 C C     . ASN B 2 370 ? -33.029 47.517 -9.513  1.00 42.75  ? 371 ASN A C     1 
ATOM   3780 O O     . ASN B 2 370 ? -33.291 46.519 -8.845  1.00 43.58  ? 371 ASN A O     1 
ATOM   3781 C CB    . ASN B 2 370 ? -30.730 46.566 -9.821  1.00 42.65  ? 371 ASN A CB    1 
ATOM   3782 C CG    . ASN B 2 370 ? -29.703 46.208 -10.867 1.00 43.93  ? 371 ASN A CG    1 
ATOM   3783 O OD1   . ASN B 2 370 ? -30.054 45.730 -11.945 1.00 45.38  ? 371 ASN A OD1   1 
ATOM   3784 N ND2   . ASN B 2 370 ? -28.422 46.442 -10.563 1.00 44.84  ? 371 ASN A ND2   1 
ATOM   3785 N N     . GLY B 2 371 ? -33.838 48.568 -9.564  1.00 42.16  ? 372 GLY A N     1 
ATOM   3786 C CA    . GLY B 2 371 ? -35.102 48.526 -8.855  1.00 42.12  ? 372 GLY A CA    1 
ATOM   3787 C C     . GLY B 2 371 ? -35.163 49.053 -7.435  1.00 42.13  ? 372 GLY A C     1 
ATOM   3788 O O     . GLY B 2 371 ? -36.257 49.356 -6.919  1.00 41.26  ? 372 GLY A O     1 
ATOM   3789 N N     . ARG B 2 372 ? -34.012 49.160 -6.780  1.00 41.06  ? 373 ARG A N     1 
ATOM   3790 C CA    . ARG B 2 372 ? -34.034 49.671 -5.427  1.00 40.25  ? 373 ARG A CA    1 
ATOM   3791 C C     . ARG B 2 372 ? -33.186 50.903 -5.255  1.00 39.89  ? 373 ARG A C     1 
ATOM   3792 O O     . ARG B 2 372 ? -32.298 51.193 -6.057  1.00 40.79  ? 373 ARG A O     1 
ATOM   3793 C CB    . ARG B 2 372 ? -33.617 48.592 -4.425  1.00 40.15  ? 373 ARG A CB    1 
ATOM   3794 C CG    . ARG B 2 372 ? -32.215 48.077 -4.570  1.00 40.67  ? 373 ARG A CG    1 
ATOM   3795 C CD    . ARG B 2 372 ? -32.065 46.734 -3.848  1.00 39.91  ? 373 ARG A CD    1 
ATOM   3796 N NE    . ARG B 2 372 ? -32.483 46.804 -2.450  1.00 39.69  ? 373 ARG A NE    1 
ATOM   3797 C CZ    . ARG B 2 372 ? -33.388 45.999 -1.902  1.00 40.94  ? 373 ARG A CZ    1 
ATOM   3798 N NH1   . ARG B 2 372 ? -33.978 45.061 -2.631  1.00 40.49  ? 373 ARG A NH1   1 
ATOM   3799 N NH2   . ARG B 2 372 ? -33.707 46.128 -0.623  1.00 42.01  ? 373 ARG A NH2   1 
ATOM   3800 N N     . TRP B 2 373 ? -33.499 51.637 -4.198  1.00 39.20  ? 374 TRP A N     1 
ATOM   3801 C CA    . TRP B 2 373 ? -32.808 52.858 -3.856  1.00 38.10  ? 374 TRP A CA    1 
ATOM   3802 C C     . TRP B 2 373 ? -31.517 52.586 -3.109  1.00 38.11  ? 374 TRP A C     1 
ATOM   3803 O O     . TRP B 2 373 ? -31.389 51.599 -2.390  1.00 37.21  ? 374 TRP A O     1 
ATOM   3804 C CB    . TRP B 2 373 ? -33.707 53.737 -2.995  1.00 38.04  ? 374 TRP A CB    1 
ATOM   3805 C CG    . TRP B 2 373 ? -34.783 54.435 -3.753  1.00 37.96  ? 374 TRP A CG    1 
ATOM   3806 C CD1   . TRP B 2 373 ? -36.070 54.021 -3.938  1.00 37.41  ? 374 TRP A CD1   1 
ATOM   3807 C CD2   . TRP B 2 373 ? -34.652 55.675 -4.458  1.00 37.92  ? 374 TRP A CD2   1 
ATOM   3808 N NE1   . TRP B 2 373 ? -36.752 54.932 -4.718  1.00 37.37  ? 374 TRP A NE1   1 
ATOM   3809 C CE2   . TRP B 2 373 ? -35.901 55.956 -5.049  1.00 38.04  ? 374 TRP A CE2   1 
ATOM   3810 C CE3   . TRP B 2 373 ? -33.595 56.579 -4.647  1.00 37.80  ? 374 TRP A CE3   1 
ATOM   3811 C CZ2   . TRP B 2 373 ? -36.123 57.104 -5.817  1.00 38.59  ? 374 TRP A CZ2   1 
ATOM   3812 C CZ3   . TRP B 2 373 ? -33.817 57.722 -5.411  1.00 37.05  ? 374 TRP A CZ3   1 
ATOM   3813 C CH2   . TRP B 2 373 ? -35.073 57.972 -5.985  1.00 37.73  ? 374 TRP A CH2   1 
ATOM   3814 N N     . TRP B 2 374 ? -30.557 53.480 -3.295  1.00 38.80  ? 375 TRP A N     1 
ATOM   3815 C CA    . TRP B 2 374 ? -29.263 53.378 -2.634  1.00 38.95  ? 375 TRP A CA    1 
ATOM   3816 C C     . TRP B 2 374 ? -28.886 54.771 -2.179  1.00 39.73  ? 375 TRP A C     1 
ATOM   3817 O O     . TRP B 2 374 ? -29.444 55.758 -2.663  1.00 40.15  ? 375 TRP A O     1 
ATOM   3818 C CB    . TRP B 2 374 ? -28.182 52.875 -3.596  1.00 37.63  ? 375 TRP A CB    1 
ATOM   3819 C CG    . TRP B 2 374 ? -28.431 51.519 -4.126  1.00 36.42  ? 375 TRP A CG    1 
ATOM   3820 C CD1   . TRP B 2 374 ? -29.299 51.175 -5.116  1.00 36.15  ? 375 TRP A CD1   1 
ATOM   3821 C CD2   . TRP B 2 374 ? -27.825 50.303 -3.678  1.00 36.33  ? 375 TRP A CD2   1 
ATOM   3822 N NE1   . TRP B 2 374 ? -29.271 49.817 -5.316  1.00 37.11  ? 375 TRP A NE1   1 
ATOM   3823 C CE2   . TRP B 2 374 ? -28.374 49.259 -4.443  1.00 36.28  ? 375 TRP A CE2   1 
ATOM   3824 C CE3   . TRP B 2 374 ? -26.868 49.994 -2.704  1.00 36.11  ? 375 TRP A CE3   1 
ATOM   3825 C CZ2   . TRP B 2 374 ? -28.004 47.926 -4.261  1.00 36.09  ? 375 TRP A CZ2   1 
ATOM   3826 C CZ3   . TRP B 2 374 ? -26.501 48.672 -2.525  1.00 34.99  ? 375 TRP A CZ3   1 
ATOM   3827 C CH2   . TRP B 2 374 ? -27.067 47.655 -3.299  1.00 35.08  ? 375 TRP A CH2   1 
ATOM   3828 N N     . ALA B 2 375 ? -27.929 54.845 -1.260  1.00 40.03  ? 376 ALA A N     1 
ATOM   3829 C CA    . ALA B 2 375 ? -27.457 56.118 -0.746  1.00 39.47  ? 376 ALA A CA    1 
ATOM   3830 C C     . ALA B 2 375 ? -25.956 56.027 -0.570  1.00 38.96  ? 376 ALA A C     1 
ATOM   3831 O O     . ALA B 2 375 ? -25.397 54.937 -0.578  1.00 37.09  ? 376 ALA A O     1 
ATOM   3832 C CB    . ALA B 2 375 ? -28.123 56.424 0.575   1.00 39.95  ? 376 ALA A CB    1 
ATOM   3833 N N     . PHE B 2 376 ? -25.315 57.186 -0.441  1.00 39.50  ? 377 PHE A N     1 
ATOM   3834 C CA    . PHE B 2 376 ? -23.870 57.283 -0.245  1.00 40.07  ? 377 PHE A CA    1 
ATOM   3835 C C     . PHE B 2 376 ? -23.670 57.830 1.151   1.00 41.31  ? 377 PHE A C     1 
ATOM   3836 O O     . PHE B 2 376 ? -24.157 58.916 1.470   1.00 41.17  ? 377 PHE A O     1 
ATOM   3837 C CB    . PHE B 2 376 ? -23.233 58.273 -1.222  1.00 39.18  ? 377 PHE A CB    1 
ATOM   3838 C CG    . PHE B 2 376 ? -23.085 57.761 -2.619  1.00 38.36  ? 377 PHE A CG    1 
ATOM   3839 C CD1   . PHE B 2 376 ? -23.533 58.520 -3.695  1.00 37.81  ? 377 PHE A CD1   1 
ATOM   3840 C CD2   . PHE B 2 376 ? -22.449 56.557 -2.869  1.00 38.32  ? 377 PHE A CD2   1 
ATOM   3841 C CE1   . PHE B 2 376 ? -23.346 58.089 -5.009  1.00 37.93  ? 377 PHE A CE1   1 
ATOM   3842 C CE2   . PHE B 2 376 ? -22.255 56.113 -4.179  1.00 39.58  ? 377 PHE A CE2   1 
ATOM   3843 C CZ    . PHE B 2 376 ? -22.706 56.885 -5.254  1.00 38.73  ? 377 PHE A CZ    1 
ATOM   3844 N N     . GLU B 2 377 ? -22.960 57.088 1.988   1.00 43.54  ? 378 GLU A N     1 
ATOM   3845 C CA    . GLU B 2 377 ? -22.710 57.548 3.339   1.00 45.62  ? 378 GLU A CA    1 
ATOM   3846 C C     . GLU B 2 377 ? -21.221 57.790 3.508   1.00 45.89  ? 378 GLU A C     1 
ATOM   3847 O O     . GLU B 2 377 ? -20.417 57.453 2.625   1.00 46.03  ? 378 GLU A O     1 
ATOM   3848 C CB    . GLU B 2 377 ? -23.172 56.509 4.352   1.00 48.36  ? 378 GLU A CB    1 
ATOM   3849 C CG    . GLU B 2 377 ? -24.213 57.011 5.317   1.00 52.97  ? 378 GLU A CG    1 
ATOM   3850 C CD    . GLU B 2 377 ? -25.550 57.220 4.644   1.00 55.82  ? 378 GLU A CD    1 
ATOM   3851 O OE1   . GLU B 2 377 ? -25.644 58.127 3.790   1.00 57.29  ? 378 GLU A OE1   1 
ATOM   3852 O OE2   . GLU B 2 377 ? -26.505 56.471 4.962   1.00 57.99  ? 378 GLU A OE2   1 
ATOM   3853 N N     . MET B 2 378 ? -20.866 58.371 4.652   1.00 45.45  ? 379 MET A N     1 
ATOM   3854 C CA    . MET B 2 378 ? -19.480 58.673 4.989   1.00 44.15  ? 379 MET A CA    1 
ATOM   3855 C C     . MET B 2 378 ? -19.054 57.853 6.193   1.00 42.71  ? 379 MET A C     1 
ATOM   3856 O O     . MET B 2 378 ? -19.801 57.729 7.161   1.00 43.19  ? 379 MET A O     1 
ATOM   3857 C CB    . MET B 2 378 ? -19.328 60.154 5.323   1.00 45.46  ? 379 MET A CB    1 
ATOM   3858 C CG    . MET B 2 378 ? -19.786 61.077 4.224   1.00 46.89  ? 379 MET A CG    1 
ATOM   3859 S SD    . MET B 2 378 ? -18.916 60.629 2.739   1.00 49.95  ? 379 MET A SD    1 
ATOM   3860 C CE    . MET B 2 378 ? -17.446 61.705 2.808   1.00 49.31  ? 379 MET A CE    1 
ATOM   3861 N N     . ARG B 2 379 ? -17.851 57.294 6.133   1.00 40.78  ? 380 ARG A N     1 
ATOM   3862 C CA    . ARG B 2 379 ? -17.341 56.502 7.236   1.00 39.05  ? 380 ARG A CA    1 
ATOM   3863 C C     . ARG B 2 379 ? -16.809 57.411 8.339   1.00 39.82  ? 380 ARG A C     1 
ATOM   3864 O O     . ARG B 2 379 ? -16.422 58.560 8.091   1.00 39.17  ? 380 ARG A O     1 
ATOM   3865 C CB    . ARG B 2 379 ? -16.220 55.579 6.764   1.00 36.26  ? 380 ARG A CB    1 
ATOM   3866 C CG    . ARG B 2 379 ? -16.652 54.533 5.773   1.00 33.64  ? 380 ARG A CG    1 
ATOM   3867 C CD    . ARG B 2 379 ? -15.519 53.565 5.508   1.00 32.56  ? 380 ARG A CD    1 
ATOM   3868 N NE    . ARG B 2 379 ? -15.975 52.353 4.833   1.00 31.32  ? 380 ARG A NE    1 
ATOM   3869 C CZ    . ARG B 2 379 ? -16.294 52.284 3.547   1.00 30.76  ? 380 ARG A CZ    1 
ATOM   3870 N NH1   . ARG B 2 379 ? -16.208 53.357 2.777   1.00 30.99  ? 380 ARG A NH1   1 
ATOM   3871 N NH2   . ARG B 2 379 ? -16.694 51.136 3.031   1.00 29.89  ? 380 ARG A NH2   1 
ATOM   3872 N N     . LYS B 2 380 ? -16.810 56.882 9.560   1.00 41.44  ? 381 LYS A N     1 
ATOM   3873 C CA    . LYS B 2 380 ? -16.305 57.592 10.727  1.00 42.13  ? 381 LYS A CA    1 
ATOM   3874 C C     . LYS B 2 380 ? -14.773 57.419 10.770  1.00 41.15  ? 381 LYS A C     1 
ATOM   3875 O O     . LYS B 2 380 ? -14.064 58.204 11.416  1.00 41.63  ? 381 LYS A O     1 
ATOM   3876 C CB    . LYS B 2 380 ? -16.949 57.026 11.999  1.00 45.10  ? 381 LYS A CB    1 
ATOM   3877 C CG    . LYS B 2 380 ? -18.339 57.598 12.345  1.00 47.93  ? 381 LYS A CG    1 
ATOM   3878 C CD    . LYS B 2 380 ? -18.224 58.922 13.118  1.00 48.63  ? 381 LYS A CD    1 
ATOM   3879 C CE    . LYS B 2 380 ? -19.550 59.371 13.702  1.00 48.46  ? 381 LYS A CE    1 
ATOM   3880 N NZ    . LYS B 2 380 ? -20.527 59.651 12.621  1.00 50.15  ? 381 LYS A NZ    1 
ATOM   3881 N N     . PHE B 2 381 ? -14.275 56.390 10.081  1.00 38.99  ? 382 PHE A N     1 
ATOM   3882 C CA    . PHE B 2 381 ? -12.840 56.121 10.004  1.00 37.86  ? 382 PHE A CA    1 
ATOM   3883 C C     . PHE B 2 381 ? -12.485 55.607 8.609   1.00 36.81  ? 382 PHE A C     1 
ATOM   3884 O O     . PHE B 2 381 ? -13.361 55.139 7.887   1.00 37.02  ? 382 PHE A O     1 
ATOM   3885 C CB    . PHE B 2 381 ? -12.399 55.122 11.098  1.00 37.25  ? 382 PHE A CB    1 
ATOM   3886 C CG    . PHE B 2 381 ? -13.365 53.994 11.335  1.00 36.63  ? 382 PHE A CG    1 
ATOM   3887 C CD1   . PHE B 2 381 ? -13.692 53.107 10.318  1.00 36.79  ? 382 PHE A CD1   1 
ATOM   3888 C CD2   . PHE B 2 381 ? -13.954 53.818 12.583  1.00 37.21  ? 382 PHE A CD2   1 
ATOM   3889 C CE1   . PHE B 2 381 ? -14.599 52.059 10.545  1.00 35.58  ? 382 PHE A CE1   1 
ATOM   3890 C CE2   . PHE B 2 381 ? -14.862 52.769 12.813  1.00 36.39  ? 382 PHE A CE2   1 
ATOM   3891 C CZ    . PHE B 2 381 ? -15.181 51.893 11.793  1.00 34.40  ? 382 PHE A CZ    1 
ATOM   3892 N N     . THR B 2 382 ? -11.215 55.696 8.221   1.00 35.00  ? 383 THR A N     1 
ATOM   3893 C CA    . THR B 2 382 ? -10.834 55.249 6.890   1.00 34.49  ? 383 THR A CA    1 
ATOM   3894 C C     . THR B 2 382 ? -9.632  54.324 6.827   1.00 35.00  ? 383 THR A C     1 
ATOM   3895 O O     . THR B 2 382 ? -9.247  53.870 5.750   1.00 34.21  ? 383 THR A O     1 
ATOM   3896 C CB    . THR B 2 382 ? -10.559 56.434 5.975   1.00 33.07  ? 383 THR A CB    1 
ATOM   3897 O OG1   . THR B 2 382 ? -9.288  57.007 6.302   1.00 33.49  ? 383 THR A OG1   1 
ATOM   3898 C CG2   . THR B 2 382 ? -11.636 57.472 6.142   1.00 32.48  ? 383 THR A CG2   1 
ATOM   3899 N N     . THR B 2 383 ? -9.024  54.051 7.971   1.00 35.70  ? 384 THR A N     1 
ATOM   3900 C CA    . THR B 2 383 ? -7.877  53.151 8.003   1.00 37.24  ? 384 THR A CA    1 
ATOM   3901 C C     . THR B 2 383 ? -8.174  52.049 9.007   1.00 37.44  ? 384 THR A C     1 
ATOM   3902 O O     . THR B 2 383 ? -9.076  52.187 9.825   1.00 38.86  ? 384 THR A O     1 
ATOM   3903 C CB    . THR B 2 383 ? -6.601  53.891 8.415   1.00 36.96  ? 384 THR A CB    1 
ATOM   3904 O OG1   . THR B 2 383 ? -6.738  54.370 9.755   1.00 38.21  ? 384 THR A OG1   1 
ATOM   3905 C CG2   . THR B 2 383 ? -6.361  55.054 7.499   1.00 37.06  ? 384 THR A CG2   1 
ATOM   3906 N N     . PRO B 2 384 ? -7.426  50.938 8.966   1.00 37.35  ? 385 PRO A N     1 
ATOM   3907 C CA    . PRO B 2 384 ? -7.750  49.903 9.948   1.00 37.54  ? 385 PRO A CA    1 
ATOM   3908 C C     . PRO B 2 384 ? -7.518  50.450 11.351  1.00 38.47  ? 385 PRO A C     1 
ATOM   3909 O O     . PRO B 2 384 ? -8.430  50.468 12.189  1.00 38.45  ? 385 PRO A O     1 
ATOM   3910 C CB    . PRO B 2 384 ? -6.771  48.776 9.619   1.00 36.92  ? 385 PRO A CB    1 
ATOM   3911 C CG    . PRO B 2 384 ? -6.295  49.083 8.232   1.00 37.73  ? 385 PRO A CG    1 
ATOM   3912 C CD    . PRO B 2 384 ? -6.219  50.581 8.213   1.00 37.27  ? 385 PRO A CD    1 
ATOM   3913 N N     . GLU B 2 385 ? -6.295  50.917 11.594  1.00 39.15  ? 386 GLU A N     1 
ATOM   3914 C CA    . GLU B 2 385 ? -5.936  51.433 12.909  1.00 40.14  ? 386 GLU A CA    1 
ATOM   3915 C C     . GLU B 2 385 ? -6.935  52.448 13.468  1.00 40.24  ? 386 GLU A C     1 
ATOM   3916 O O     . GLU B 2 385 ? -7.370  52.338 14.626  1.00 40.16  ? 386 GLU A O     1 
ATOM   3917 C CB    . GLU B 2 385 ? -4.537  52.035 12.865  1.00 40.84  ? 386 GLU A CB    1 
ATOM   3918 C CG    . GLU B 2 385 ? -3.489  51.077 12.337  1.00 42.88  ? 386 GLU A CG    1 
ATOM   3919 C CD    . GLU B 2 385 ? -3.102  51.387 10.902  1.00 45.14  ? 386 GLU A CD    1 
ATOM   3920 O OE1   . GLU B 2 385 ? -4.020  51.556 10.062  1.00 45.70  ? 386 GLU A OE1   1 
ATOM   3921 O OE2   . GLU B 2 385 ? -1.877  51.459 10.623  1.00 45.75  ? 386 GLU A OE2   1 
ATOM   3922 N N     . GLU B 2 386 ? -7.299  53.425 12.644  1.00 39.31  ? 387 GLU A N     1 
ATOM   3923 C CA    . GLU B 2 386 ? -8.253  54.448 13.035  1.00 38.75  ? 387 GLU A CA    1 
ATOM   3924 C C     . GLU B 2 386 ? -9.516  53.763 13.586  1.00 37.82  ? 387 GLU A C     1 
ATOM   3925 O O     . GLU B 2 386 ? -10.063 54.157 14.621  1.00 36.67  ? 387 GLU A O     1 
ATOM   3926 C CB    . GLU B 2 386 ? -8.561  55.296 11.801  1.00 40.34  ? 387 GLU A CB    1 
ATOM   3927 C CG    . GLU B 2 386 ? -9.449  56.505 12.003  1.00 44.36  ? 387 GLU A CG    1 
ATOM   3928 C CD    . GLU B 2 386 ? -9.298  57.510 10.859  1.00 47.48  ? 387 GLU A CD    1 
ATOM   3929 O OE1   . GLU B 2 386 ? -10.224 58.323 10.632  1.00 49.67  ? 387 GLU A OE1   1 
ATOM   3930 O OE2   . GLU B 2 386 ? -8.237  57.499 10.191  1.00 48.52  ? 387 GLU A OE2   1 
ATOM   3931 N N     . GLY B 2 387 ? -9.942  52.710 12.897  1.00 36.46  ? 388 GLY A N     1 
ATOM   3932 C CA    . GLY B 2 387 ? -11.126 51.983 13.298  1.00 36.03  ? 388 GLY A CA    1 
ATOM   3933 C C     . GLY B 2 387 ? -10.962 51.152 14.560  1.00 36.25  ? 388 GLY A C     1 
ATOM   3934 O O     . GLY B 2 387 ? -11.847 51.132 15.435  1.00 36.82  ? 388 GLY A O     1 
ATOM   3935 N N     . VAL B 2 388 ? -9.842  50.446 14.668  1.00 34.84  ? 389 VAL A N     1 
ATOM   3936 C CA    . VAL B 2 388 ? -9.612  49.632 15.851  1.00 33.40  ? 389 VAL A CA    1 
ATOM   3937 C C     . VAL B 2 388 ? -9.547  50.499 17.120  1.00 32.29  ? 389 VAL A C     1 
ATOM   3938 O O     . VAL B 2 388 ? -9.904  50.048 18.213  1.00 30.56  ? 389 VAL A O     1 
ATOM   3939 C CB    . VAL B 2 388 ? -8.321  48.810 15.703  1.00 33.14  ? 389 VAL A CB    1 
ATOM   3940 C CG1   . VAL B 2 388 ? -8.066  47.988 16.984  1.00 31.32  ? 389 VAL A CG1   1 
ATOM   3941 C CG2   . VAL B 2 388 ? -8.453  47.902 14.481  1.00 31.58  ? 389 VAL A CG2   1 
ATOM   3942 N N     . ARG B 2 389 ? -9.101  51.744 16.974  1.00 30.89  ? 390 ARG A N     1 
ATOM   3943 C CA    . ARG B 2 389 ? -9.026  52.625 18.128  1.00 29.89  ? 390 ARG A CA    1 
ATOM   3944 C C     . ARG B 2 389 ? -10.433 53.023 18.499  1.00 28.62  ? 390 ARG A C     1 
ATOM   3945 O O     . ARG B 2 389 ? -10.714 53.444 19.617  1.00 28.36  ? 390 ARG A O     1 
ATOM   3946 C CB    . ARG B 2 389 ? -8.226  53.878 17.824  1.00 30.86  ? 390 ARG A CB    1 
ATOM   3947 C CG    . ARG B 2 389 ? -8.234  54.830 18.984  1.00 32.65  ? 390 ARG A CG    1 
ATOM   3948 C CD    . ARG B 2 389 ? -8.352  56.219 18.471  1.00 35.19  ? 390 ARG A CD    1 
ATOM   3949 N NE    . ARG B 2 389 ? -7.213  56.590 17.638  1.00 37.94  ? 390 ARG A NE    1 
ATOM   3950 C CZ    . ARG B 2 389 ? -7.311  57.335 16.542  1.00 38.64  ? 390 ARG A CZ    1 
ATOM   3951 N NH1   . ARG B 2 389 ? -8.500  57.777 16.142  1.00 37.79  ? 390 ARG A NH1   1 
ATOM   3952 N NH2   . ARG B 2 389 ? -6.219  57.652 15.855  1.00 40.25  ? 390 ARG A NH2   1 
ATOM   3953 N N     . SER B 2 390 ? -11.319 52.903 17.535  1.00 28.03  ? 391 SER A N     1 
ATOM   3954 C CA    . SER B 2 390 ? -12.700 53.228 17.781  1.00 29.17  ? 391 SER A CA    1 
ATOM   3955 C C     . SER B 2 390 ? -13.374 52.015 18.435  1.00 30.19  ? 391 SER A C     1 
ATOM   3956 O O     . SER B 2 390 ? -14.005 52.126 19.499  1.00 29.50  ? 391 SER A O     1 
ATOM   3957 C CB    . SER B 2 390 ? -13.398 53.574 16.463  1.00 29.06  ? 391 SER A CB    1 
ATOM   3958 O OG    . SER B 2 390 ? -14.779 53.835 16.667  1.00 28.89  ? 391 SER A OG    1 
ATOM   3959 N N     . TYR B 2 391 ? -13.231 50.856 17.797  1.00 30.52  ? 392 TYR A N     1 
ATOM   3960 C CA    . TYR B 2 391 ? -13.841 49.634 18.306  1.00 31.77  ? 392 TYR A CA    1 
ATOM   3961 C C     . TYR B 2 391 ? -13.415 49.318 19.743  1.00 32.40  ? 392 TYR A C     1 
ATOM   3962 O O     . TYR B 2 391 ? -14.249 49.017 20.599  1.00 31.91  ? 392 TYR A O     1 
ATOM   3963 C CB    . TYR B 2 391 ? -13.495 48.457 17.390  1.00 31.85  ? 392 TYR A CB    1 
ATOM   3964 C CG    . TYR B 2 391 ? -14.088 47.149 17.853  1.00 32.36  ? 392 TYR A CG    1 
ATOM   3965 C CD1   . TYR B 2 391 ? -15.476 46.954 17.885  1.00 31.48  ? 392 TYR A CD1   1 
ATOM   3966 C CD2   . TYR B 2 391 ? -13.261 46.115 18.295  1.00 32.60  ? 392 TYR A CD2   1 
ATOM   3967 C CE1   . TYR B 2 391 ? -16.022 45.758 18.348  1.00 33.03  ? 392 TYR A CE1   1 
ATOM   3968 C CE2   . TYR B 2 391 ? -13.791 44.919 18.761  1.00 33.90  ? 392 TYR A CE2   1 
ATOM   3969 C CZ    . TYR B 2 391 ? -15.168 44.748 18.785  1.00 34.24  ? 392 TYR A CZ    1 
ATOM   3970 O OH    . TYR B 2 391 ? -15.675 43.564 19.259  1.00 37.61  ? 392 TYR A OH    1 
ATOM   3971 N N     . ALA B 2 392 ? -12.113 49.382 19.997  1.00 33.05  ? 393 ALA A N     1 
ATOM   3972 C CA    . ALA B 2 392 ? -11.576 49.110 21.319  1.00 33.80  ? 393 ALA A CA    1 
ATOM   3973 C C     . ALA B 2 392 ? -12.122 50.089 22.357  1.00 35.27  ? 393 ALA A C     1 
ATOM   3974 O O     . ALA B 2 392 ? -12.780 49.681 23.313  1.00 36.03  ? 393 ALA A O     1 
ATOM   3975 C CB    . ALA B 2 392 ? -10.057 49.182 21.286  1.00 31.82  ? 393 ALA A CB    1 
ATOM   3976 N N     . SER B 2 393 ? -11.856 51.378 22.159  1.00 36.89  ? 394 SER A N     1 
ATOM   3977 C CA    . SER B 2 393 ? -12.303 52.418 23.085  1.00 37.94  ? 394 SER A CA    1 
ATOM   3978 C C     . SER B 2 393 ? -13.752 52.311 23.507  1.00 37.49  ? 394 SER A C     1 
ATOM   3979 O O     . SER B 2 393 ? -14.109 52.757 24.586  1.00 37.63  ? 394 SER A O     1 
ATOM   3980 C CB    . SER B 2 393 ? -12.052 53.816 22.496  1.00 39.62  ? 394 SER A CB    1 
ATOM   3981 O OG    . SER B 2 393 ? -10.666 54.148 22.510  1.00 42.26  ? 394 SER A OG    1 
ATOM   3982 N N     . THR B 2 394 ? -14.586 51.705 22.672  1.00 38.36  ? 395 THR A N     1 
ATOM   3983 C CA    . THR B 2 394 ? -16.012 51.580 22.988  1.00 38.93  ? 395 THR A CA    1 
ATOM   3984 C C     . THR B 2 394 ? -16.554 50.157 23.237  1.00 38.96  ? 395 THR A C     1 
ATOM   3985 O O     . THR B 2 394 ? -17.613 49.989 23.849  1.00 39.15  ? 395 THR A O     1 
ATOM   3986 C CB    . THR B 2 394 ? -16.863 52.234 21.878  1.00 38.30  ? 395 THR A CB    1 
ATOM   3987 O OG1   . THR B 2 394 ? -16.534 51.644 20.615  1.00 37.00  ? 395 THR A OG1   1 
ATOM   3988 C CG2   . THR B 2 394 ? -16.585 53.726 21.824  1.00 37.42  ? 395 THR A CG2   1 
ATOM   3989 N N     . HIS B 2 395 ? -15.845 49.133 22.771  1.00 39.38  ? 396 HIS A N     1 
ATOM   3990 C CA    . HIS B 2 395 ? -16.309 47.756 22.958  1.00 39.91  ? 396 HIS A CA    1 
ATOM   3991 C C     . HIS B 2 395 ? -15.407 46.914 23.852  1.00 39.23  ? 396 HIS A C     1 
ATOM   3992 O O     . HIS B 2 395 ? -15.514 45.688 23.867  1.00 38.51  ? 396 HIS A O     1 
ATOM   3993 C CB    . HIS B 2 395 ? -16.454 47.069 21.600  1.00 40.14  ? 396 HIS A CB    1 
ATOM   3994 C CG    . HIS B 2 395 ? -17.581 47.608 20.775  1.00 40.76  ? 396 HIS A CG    1 
ATOM   3995 N ND1   . HIS B 2 395 ? -17.694 48.944 20.455  1.00 41.71  ? 396 HIS A ND1   1 
ATOM   3996 C CD2   . HIS B 2 395 ? -18.653 46.996 20.217  1.00 41.34  ? 396 HIS A CD2   1 
ATOM   3997 C CE1   . HIS B 2 395 ? -18.787 49.132 19.734  1.00 41.87  ? 396 HIS A CE1   1 
ATOM   3998 N NE2   . HIS B 2 395 ? -19.387 47.966 19.575  1.00 41.49  ? 396 HIS A NE2   1 
ATOM   3999 N N     . TRP B 2 396 ? -14.531 47.572 24.603  1.00 38.84  ? 397 TRP A N     1 
ATOM   4000 C CA    . TRP B 2 396 ? -13.617 46.859 25.484  1.00 39.47  ? 397 TRP A CA    1 
ATOM   4001 C C     . TRP B 2 396 ? -14.337 45.809 26.329  1.00 40.21  ? 397 TRP A C     1 
ATOM   4002 O O     . TRP B 2 396 ? -13.821 44.722 26.566  1.00 39.11  ? 397 TRP A O     1 
ATOM   4003 C CB    . TRP B 2 396 ? -12.895 47.841 26.405  1.00 37.90  ? 397 TRP A CB    1 
ATOM   4004 C CG    . TRP B 2 396 ? -13.826 48.625 27.230  1.00 35.95  ? 397 TRP A CG    1 
ATOM   4005 C CD1   . TRP B 2 396 ? -14.401 49.819 26.911  1.00 35.11  ? 397 TRP A CD1   1 
ATOM   4006 C CD2   . TRP B 2 396 ? -14.382 48.230 28.485  1.00 36.00  ? 397 TRP A CD2   1 
ATOM   4007 N NE1   . TRP B 2 396 ? -15.290 50.192 27.891  1.00 34.80  ? 397 TRP A NE1   1 
ATOM   4008 C CE2   . TRP B 2 396 ? -15.300 49.233 28.869  1.00 35.22  ? 397 TRP A CE2   1 
ATOM   4009 C CE3   . TRP B 2 396 ? -14.197 47.121 29.322  1.00 36.38  ? 397 TRP A CE3   1 
ATOM   4010 C CZ2   . TRP B 2 396 ? -16.037 49.162 30.053  1.00 35.40  ? 397 TRP A CZ2   1 
ATOM   4011 C CZ3   . TRP B 2 396 ? -14.939 47.051 30.513  1.00 36.98  ? 397 TRP A CZ3   1 
ATOM   4012 C CH2   . TRP B 2 396 ? -15.845 48.068 30.859  1.00 35.91  ? 397 TRP A CH2   1 
ATOM   4013 N N     . HIS B 2 397 ? -15.540 46.126 26.772  1.00 42.39  ? 398 HIS A N     1 
ATOM   4014 C CA    . HIS B 2 397 ? -16.263 45.188 27.598  1.00 44.71  ? 398 HIS A CA    1 
ATOM   4015 C C     . HIS B 2 397 ? -16.490 43.828 26.956  1.00 44.76  ? 398 HIS A C     1 
ATOM   4016 O O     . HIS B 2 397 ? -16.640 42.818 27.653  1.00 45.03  ? 398 HIS A O     1 
ATOM   4017 C CB    . HIS B 2 397 ? -17.610 45.761 28.029  1.00 48.06  ? 398 HIS A CB    1 
ATOM   4018 C CG    . HIS B 2 397 ? -18.318 44.888 29.021  1.00 52.81  ? 398 HIS A CG    1 
ATOM   4019 N ND1   . HIS B 2 397 ? -18.895 43.684 28.671  1.00 53.78  ? 398 HIS A ND1   1 
ATOM   4020 C CD2   . HIS B 2 397 ? -18.446 44.987 30.369  1.00 53.81  ? 398 HIS A CD2   1 
ATOM   4021 C CE1   . HIS B 2 397 ? -19.343 43.079 29.759  1.00 54.02  ? 398 HIS A CE1   1 
ATOM   4022 N NE2   . HIS B 2 397 ? -19.082 43.847 30.802  1.00 53.63  ? 398 HIS A NE2   1 
ATOM   4023 N N     . THR B 2 398 ? -16.516 43.784 25.631  1.00 44.74  ? 399 THR A N     1 
ATOM   4024 C CA    . THR B 2 398 ? -16.756 42.516 24.958  1.00 43.40  ? 399 THR A CA    1 
ATOM   4025 C C     . THR B 2 398 ? -15.478 41.789 24.582  1.00 42.44  ? 399 THR A C     1 
ATOM   4026 O O     . THR B 2 398 ? -15.519 40.825 23.832  1.00 42.62  ? 399 THR A O     1 
ATOM   4027 C CB    . THR B 2 398 ? -17.588 42.709 23.688  1.00 42.98  ? 399 THR A CB    1 
ATOM   4028 O OG1   . THR B 2 398 ? -18.126 41.444 23.287  1.00 44.18  ? 399 THR A OG1   1 
ATOM   4029 C CG2   . THR B 2 398 ? -16.718 43.276 22.562  1.00 43.26  ? 399 THR A CG2   1 
ATOM   4030 N N     . LEU B 2 399 ? -14.345 42.239 25.104  1.00 42.02  ? 400 LEU A N     1 
ATOM   4031 C CA    . LEU B 2 399 ? -13.080 41.597 24.774  1.00 42.23  ? 400 LEU A CA    1 
ATOM   4032 C C     . LEU B 2 399 ? -12.536 40.733 25.916  1.00 43.21  ? 400 LEU A C     1 
ATOM   4033 O O     . LEU B 2 399 ? -11.320 40.539 26.047  1.00 43.00  ? 400 LEU A O     1 
ATOM   4034 C CB    . LEU B 2 399 ? -12.052 42.656 24.372  1.00 42.78  ? 400 LEU A CB    1 
ATOM   4035 C CG    . LEU B 2 399 ? -12.530 43.635 23.292  1.00 43.11  ? 400 LEU A CG    1 
ATOM   4036 C CD1   . LEU B 2 399 ? -11.442 44.651 23.000  1.00 42.28  ? 400 LEU A CD1   1 
ATOM   4037 C CD2   . LEU B 2 399 ? -12.915 42.874 22.028  1.00 44.18  ? 400 LEU A CD2   1 
ATOM   4038 N N     . GLY B 2 400 ? -13.442 40.209 26.735  1.00 43.80  ? 401 GLY A N     1 
ATOM   4039 C CA    . GLY B 2 400 ? -13.022 39.363 27.833  1.00 44.25  ? 401 GLY A CA    1 
ATOM   4040 C C     . GLY B 2 400 ? -12.977 40.132 29.129  1.00 44.95  ? 401 GLY A C     1 
ATOM   4041 O O     . GLY B 2 400 ? -12.414 41.223 29.171  1.00 45.64  ? 401 GLY A O     1 
ATOM   4042 N N     . LYS B 2 401 ? -13.572 39.557 30.176  1.00 44.83  ? 402 LYS A N     1 
ATOM   4043 C CA    . LYS B 2 401 ? -13.630 40.162 31.505  1.00 43.92  ? 402 LYS A CA    1 
ATOM   4044 C C     . LYS B 2 401 ? -12.304 40.814 31.860  1.00 42.11  ? 402 LYS A C     1 
ATOM   4045 O O     . LYS B 2 401 ? -12.242 42.020 32.053  1.00 41.45  ? 402 LYS A O     1 
ATOM   4046 C CB    . LYS B 2 401 ? -13.648 39.055 32.590  1.00 45.65  ? 402 LYS A CB    1 
ATOM   4047 C CG    . LYS B 2 401 ? -14.759 39.114 33.691  1.00 48.06  ? 402 LYS A CG    1 
ATOM   4048 C CD    . LYS B 2 401 ? -14.827 40.429 34.509  1.00 50.37  ? 402 LYS A CD    1 
ATOM   4049 C CE    . LYS B 2 401 ? -15.935 40.455 35.604  1.00 53.13  ? 402 LYS A CE    1 
ATOM   4050 N NZ    . LYS B 2 401 ? -17.312 39.937 35.255  1.00 52.38  ? 402 LYS A NZ    1 
ATOM   4051 N N     . ASN B 2 402 ? -11.231 40.043 31.918  1.00 40.96  ? 403 ASN A N     1 
ATOM   4052 C CA    . ASN B 2 402 ? -9.958  40.641 32.292  1.00 40.83  ? 403 ASN A CA    1 
ATOM   4053 C C     . ASN B 2 402 ? -9.269  41.424 31.181  1.00 41.59  ? 403 ASN A C     1 
ATOM   4054 O O     . ASN B 2 402 ? -9.000  42.619 31.340  1.00 42.27  ? 403 ASN A O     1 
ATOM   4055 C CB    . ASN B 2 402 ? -9.026  39.568 32.849  1.00 39.37  ? 403 ASN A CB    1 
ATOM   4056 C CG    . ASN B 2 402 ? -9.655  38.815 33.987  1.00 37.95  ? 403 ASN A CG    1 
ATOM   4057 O OD1   . ASN B 2 402 ? -9.998  39.392 35.003  1.00 35.07  ? 403 ASN A OD1   1 
ATOM   4058 N ND2   . ASN B 2 402 ? -9.833  37.520 33.812  1.00 39.25  ? 403 ASN A ND2   1 
ATOM   4059 N N     . VAL B 2 403 ? -8.980  40.771 30.061  1.00 41.86  ? 404 VAL A N     1 
ATOM   4060 C CA    . VAL B 2 403 ? -8.314  41.454 28.972  1.00 41.63  ? 404 VAL A CA    1 
ATOM   4061 C C     . VAL B 2 403 ? -9.023  42.767 28.704  1.00 42.55  ? 404 VAL A C     1 
ATOM   4062 O O     . VAL B 2 403 ? -8.400  43.835 28.650  1.00 42.63  ? 404 VAL A O     1 
ATOM   4063 C CB    . VAL B 2 403 ? -8.351  40.614 27.723  1.00 41.82  ? 404 VAL A CB    1 
ATOM   4064 C CG1   . VAL B 2 403 ? -7.825  41.413 26.555  1.00 42.61  ? 404 VAL A CG1   1 
ATOM   4065 C CG2   . VAL B 2 403 ? -7.535  39.363 27.936  1.00 41.98  ? 404 VAL A CG2   1 
ATOM   4066 N N     . GLY B 2 404 ? -10.340 42.674 28.549  1.00 42.63  ? 405 GLY A N     1 
ATOM   4067 C CA    . GLY B 2 404 ? -11.143 43.849 28.281  1.00 42.39  ? 405 GLY A CA    1 
ATOM   4068 C C     . GLY B 2 404 ? -11.022 44.934 29.334  1.00 42.40  ? 405 GLY A C     1 
ATOM   4069 O O     . GLY B 2 404 ? -11.102 46.117 29.003  1.00 43.43  ? 405 GLY A O     1 
ATOM   4070 N N     . GLU B 2 405 ? -10.836 44.558 30.594  1.00 41.50  ? 406 GLU A N     1 
ATOM   4071 C CA    . GLU B 2 405 ? -10.726 45.560 31.651  1.00 42.10  ? 406 GLU A CA    1 
ATOM   4072 C C     . GLU B 2 405 ? -9.417  46.341 31.582  1.00 41.57  ? 406 GLU A C     1 
ATOM   4073 O O     . GLU B 2 405 ? -9.387  47.535 31.885  1.00 41.35  ? 406 GLU A O     1 
ATOM   4074 C CB    . GLU B 2 405 ? -10.887 44.914 33.037  1.00 43.29  ? 406 GLU A CB    1 
ATOM   4075 C CG    . GLU B 2 405 ? -12.363 44.707 33.458  1.00 45.75  ? 406 GLU A CG    1 
ATOM   4076 C CD    . GLU B 2 405 ? -12.578 43.689 34.604  1.00 46.77  ? 406 GLU A CD    1 
ATOM   4077 O OE1   . GLU B 2 405 ? -13.764 43.366 34.879  1.00 46.21  ? 406 GLU A OE1   1 
ATOM   4078 O OE2   . GLU B 2 405 ? -11.581 43.214 35.219  1.00 46.93  ? 406 GLU A OE2   1 
ATOM   4079 N N     . SER B 2 406 ? -8.340  45.675 31.178  1.00 40.73  ? 407 SER A N     1 
ATOM   4080 C CA    . SER B 2 406 ? -7.049  46.338 31.076  1.00 40.72  ? 407 SER A CA    1 
ATOM   4081 C C     . SER B 2 406 ? -7.014  47.184 29.823  1.00 42.05  ? 407 SER A C     1 
ATOM   4082 O O     . SER B 2 406 ? -6.324  48.204 29.771  1.00 43.47  ? 407 SER A O     1 
ATOM   4083 C CB    . SER B 2 406 ? -5.916  45.322 31.033  1.00 39.87  ? 407 SER A CB    1 
ATOM   4084 O OG    . SER B 2 406 ? -4.722  45.947 30.613  1.00 40.50  ? 407 SER A OG    1 
ATOM   4085 N N     . ILE B 2 407 ? -7.741  46.758 28.797  1.00 42.70  ? 408 ILE A N     1 
ATOM   4086 C CA    . ILE B 2 407 ? -7.775  47.543 27.576  1.00 43.44  ? 408 ILE A CA    1 
ATOM   4087 C C     . ILE B 2 407 ? -8.554  48.825 27.879  1.00 43.74  ? 408 ILE A C     1 
ATOM   4088 O O     . ILE B 2 407 ? -8.109  49.918 27.539  1.00 43.88  ? 408 ILE A O     1 
ATOM   4089 C CB    . ILE B 2 407 ? -8.424  46.756 26.414  1.00 43.95  ? 408 ILE A CB    1 
ATOM   4090 C CG1   . ILE B 2 407 ? -7.540  45.555 26.068  1.00 44.43  ? 408 ILE A CG1   1 
ATOM   4091 C CG2   . ILE B 2 407 ? -8.574  47.650 25.174  1.00 43.00  ? 408 ILE A CG2   1 
ATOM   4092 C CD1   . ILE B 2 407 ? -8.056  44.729 24.903  1.00 43.61  ? 408 ILE A CD1   1 
ATOM   4093 N N     . ARG B 2 408 ? -9.701  48.697 28.537  1.00 44.44  ? 409 ARG A N     1 
ATOM   4094 C CA    . ARG B 2 408 ? -10.477 49.874 28.889  1.00 46.34  ? 409 ARG A CA    1 
ATOM   4095 C C     . ARG B 2 408 ? -9.599  50.959 29.529  1.00 47.34  ? 409 ARG A C     1 
ATOM   4096 O O     . ARG B 2 408 ? -9.596  52.108 29.080  1.00 48.45  ? 409 ARG A O     1 
ATOM   4097 C CB    . ARG B 2 408 ? -11.586 49.521 29.881  1.00 47.78  ? 409 ARG A CB    1 
ATOM   4098 C CG    . ARG B 2 408 ? -12.253 50.762 30.539  1.00 50.46  ? 409 ARG A CG    1 
ATOM   4099 C CD    . ARG B 2 408 ? -12.730 50.430 31.949  1.00 52.81  ? 409 ARG A CD    1 
ATOM   4100 N NE    . ARG B 2 408 ? -11.678 49.706 32.657  1.00 55.10  ? 409 ARG A NE    1 
ATOM   4101 C CZ    . ARG B 2 408 ? -11.890 48.882 33.675  1.00 55.65  ? 409 ARG A CZ    1 
ATOM   4102 N NH1   . ARG B 2 408 ? -13.129 48.681 34.117  1.00 56.06  ? 409 ARG A NH1   1 
ATOM   4103 N NH2   . ARG B 2 408 ? -10.867 48.238 34.230  1.00 55.27  ? 409 ARG A NH2   1 
ATOM   4104 N N     . GLU B 2 409 ? -8.861  50.590 30.577  1.00 46.95  ? 410 GLU A N     1 
ATOM   4105 C CA    . GLU B 2 409 ? -8.016  51.537 31.301  1.00 46.00  ? 410 GLU A CA    1 
ATOM   4106 C C     . GLU B 2 409 ? -6.805  52.022 30.543  1.00 44.38  ? 410 GLU A C     1 
ATOM   4107 O O     . GLU B 2 409 ? -6.335  53.137 30.773  1.00 45.17  ? 410 GLU A O     1 
ATOM   4108 C CB    . GLU B 2 409 ? -7.579  50.939 32.626  1.00 47.87  ? 410 GLU A CB    1 
ATOM   4109 C CG    . GLU B 2 409 ? -6.980  49.584 32.465  1.00 51.22  ? 410 GLU A CG    1 
ATOM   4110 C CD    . GLU B 2 409 ? -6.747  48.912 33.791  1.00 52.92  ? 410 GLU A CD    1 
ATOM   4111 O OE1   . GLU B 2 409 ? -7.625  49.050 34.678  1.00 53.07  ? 410 GLU A OE1   1 
ATOM   4112 O OE2   . GLU B 2 409 ? -5.696  48.238 33.936  1.00 54.29  ? 410 GLU A OE2   1 
ATOM   4113 N N     . TYR B 2 410 ? -6.274  51.197 29.655  1.00 42.52  ? 411 TYR A N     1 
ATOM   4114 C CA    . TYR B 2 410 ? -5.136  51.636 28.854  1.00 41.36  ? 411 TYR A CA    1 
ATOM   4115 C C     . TYR B 2 410 ? -4.804  50.697 27.726  1.00 40.79  ? 411 TYR A C     1 
ATOM   4116 O O     . TYR B 2 410 ? -4.798  49.478 27.907  1.00 40.94  ? 411 TYR A O     1 
ATOM   4117 C CB    . TYR B 2 410 ? -3.873  51.820 29.698  1.00 40.76  ? 411 TYR A CB    1 
ATOM   4118 C CG    . TYR B 2 410 ? -2.614  51.688 28.854  1.00 39.99  ? 411 TYR A CG    1 
ATOM   4119 C CD1   . TYR B 2 410 ? -2.098  50.428 28.521  1.00 38.69  ? 411 TYR A CD1   1 
ATOM   4120 C CD2   . TYR B 2 410 ? -1.997  52.814 28.306  1.00 39.86  ? 411 TYR A CD2   1 
ATOM   4121 C CE1   . TYR B 2 410 ? -1.017  50.298 27.663  1.00 39.00  ? 411 TYR A CE1   1 
ATOM   4122 C CE2   . TYR B 2 410 ? -0.910  52.695 27.449  1.00 39.35  ? 411 TYR A CE2   1 
ATOM   4123 C CZ    . TYR B 2 410 ? -0.426  51.434 27.129  1.00 40.01  ? 411 TYR A CZ    1 
ATOM   4124 O OH    . TYR B 2 410 ? 0.647   51.307 26.267  1.00 41.29  ? 411 TYR A OH    1 
ATOM   4125 N N     . PHE B 2 411 ? -4.491  51.283 26.576  1.00 40.31  ? 412 PHE A N     1 
ATOM   4126 C CA    . PHE B 2 411 ? -4.109  50.525 25.395  1.00 40.03  ? 412 PHE A CA    1 
ATOM   4127 C C     . PHE B 2 411 ? -3.685  51.514 24.333  1.00 40.07  ? 412 PHE A C     1 
ATOM   4128 O O     . PHE B 2 411 ? -4.113  52.664 24.349  1.00 40.37  ? 412 PHE A O     1 
ATOM   4129 C CB    . PHE B 2 411 ? -5.278  49.692 24.877  1.00 39.09  ? 412 PHE A CB    1 
ATOM   4130 C CG    . PHE B 2 411 ? -6.152  50.412 23.902  1.00 38.96  ? 412 PHE A CG    1 
ATOM   4131 C CD1   . PHE B 2 411 ? -5.732  50.624 22.590  1.00 40.34  ? 412 PHE A CD1   1 
ATOM   4132 C CD2   . PHE B 2 411 ? -7.394  50.883 24.285  1.00 39.75  ? 412 PHE A CD2   1 
ATOM   4133 C CE1   . PHE B 2 411 ? -6.537  51.296 21.673  1.00 40.45  ? 412 PHE A CE1   1 
ATOM   4134 C CE2   . PHE B 2 411 ? -8.216  51.561 23.374  1.00 40.98  ? 412 PHE A CE2   1 
ATOM   4135 C CZ    . PHE B 2 411 ? -7.785  51.767 22.067  1.00 40.72  ? 412 PHE A CZ    1 
ATOM   4136 N N     . GLU B 2 412 ? -2.838  51.062 23.417  1.00 40.83  ? 413 GLU A N     1 
ATOM   4137 C CA    . GLU B 2 412 ? -2.377  51.901 22.323  1.00 41.35  ? 413 GLU A CA    1 
ATOM   4138 C C     . GLU B 2 412 ? -2.128  51.048 21.084  1.00 41.06  ? 413 GLU A C     1 
ATOM   4139 O O     . GLU B 2 412 ? -1.804  49.861 21.183  1.00 41.13  ? 413 GLU A O     1 
ATOM   4140 C CB    . GLU B 2 412 ? -1.092  52.627 22.694  1.00 41.96  ? 413 GLU A CB    1 
ATOM   4141 C CG    . GLU B 2 412 ? 0.104   51.729 22.740  1.00 44.88  ? 413 GLU A CG    1 
ATOM   4142 C CD    . GLU B 2 412 ? 1.400   52.513 22.818  1.00 47.75  ? 413 GLU A CD    1 
ATOM   4143 O OE1   . GLU B 2 412 ? 1.726   53.201 21.820  1.00 48.13  ? 413 GLU A OE1   1 
ATOM   4144 O OE2   . GLU B 2 412 ? 2.081   52.444 23.874  1.00 48.87  ? 413 GLU A OE2   1 
ATOM   4145 N N     . ILE B 2 413 ? -2.282  51.663 19.917  1.00 40.07  ? 414 ILE A N     1 
ATOM   4146 C CA    . ILE B 2 413 ? -2.081  50.973 18.652  1.00 38.36  ? 414 ILE A CA    1 
ATOM   4147 C C     . ILE B 2 413 ? -0.685  51.304 18.125  1.00 37.81  ? 414 ILE A C     1 
ATOM   4148 O O     . ILE B 2 413 ? -0.320  52.467 18.039  1.00 38.09  ? 414 ILE A O     1 
ATOM   4149 C CB    . ILE B 2 413 ? -3.188  51.404 17.639  1.00 37.15  ? 414 ILE A CB    1 
ATOM   4150 C CG1   . ILE B 2 413 ? -4.560  51.159 18.277  1.00 35.66  ? 414 ILE A CG1   1 
ATOM   4151 C CG2   . ILE B 2 413 ? -3.035  50.656 16.307  1.00 34.49  ? 414 ILE A CG2   1 
ATOM   4152 C CD1   . ILE B 2 413 ? -5.731  51.432 17.381  1.00 35.15  ? 414 ILE A CD1   1 
ATOM   4153 N N     . ILE B 2 414 ? 0.087   50.275 17.785  1.00 37.92  ? 415 ILE A N     1 
ATOM   4154 C CA    . ILE B 2 414 ? 1.453   50.444 17.285  1.00 39.57  ? 415 ILE A CA    1 
ATOM   4155 C C     . ILE B 2 414 ? 1.502   50.193 15.785  1.00 41.01  ? 415 ILE A C     1 
ATOM   4156 O O     . ILE B 2 414 ? 0.517   49.751 15.211  1.00 42.21  ? 415 ILE A O     1 
ATOM   4157 C CB    . ILE B 2 414 ? 2.416   49.448 17.959  1.00 39.85  ? 415 ILE A CB    1 
ATOM   4158 C CG1   . ILE B 2 414 ? 2.110   49.353 19.453  1.00 40.45  ? 415 ILE A CG1   1 
ATOM   4159 C CG2   . ILE B 2 414 ? 3.855   49.895 17.764  1.00 40.24  ? 415 ILE A CG2   1 
ATOM   4160 C CD1   . ILE B 2 414 ? 1.986   50.694 20.143  1.00 41.35  ? 415 ILE A CD1   1 
ATOM   4161 N N     . SER B 2 415 ? 2.642   50.472 15.152  1.00 42.89  ? 416 SER A N     1 
ATOM   4162 C CA    . SER B 2 415 ? 2.801   50.263 13.702  1.00 45.24  ? 416 SER A CA    1 
ATOM   4163 C C     . SER B 2 415 ? 4.098   50.848 13.124  1.00 47.65  ? 416 SER A C     1 
ATOM   4164 O O     . SER B 2 415 ? 4.746   51.694 13.735  1.00 48.33  ? 416 SER A O     1 
ATOM   4165 C CB    . SER B 2 415 ? 1.637   50.874 12.926  1.00 43.03  ? 416 SER A CB    1 
ATOM   4166 O OG    . SER B 2 415 ? 2.091   52.021 12.246  1.00 39.88  ? 416 SER A OG    1 
ATOM   4167 N N     . GLY B 2 416 ? 4.455   50.413 11.924  1.00 50.38  ? 417 GLY A N     1 
ATOM   4168 C CA    . GLY B 2 416 ? 5.672   50.909 11.312  1.00 54.56  ? 417 GLY A CA    1 
ATOM   4169 C C     . GLY B 2 416 ? 6.896   50.372 12.029  1.00 57.42  ? 417 GLY A C     1 
ATOM   4170 O O     . GLY B 2 416 ? 6.870   49.254 12.545  1.00 58.54  ? 417 GLY A O     1 
ATOM   4171 N N     . GLU B 2 417 ? 7.964   51.169 12.071  1.00 59.55  ? 418 GLU A N     1 
ATOM   4172 C CA    . GLU B 2 417 ? 9.211   50.769 12.732  1.00 61.32  ? 418 GLU A CA    1 
ATOM   4173 C C     . GLU B 2 417 ? 8.922   50.514 14.205  1.00 60.80  ? 418 GLU A C     1 
ATOM   4174 O O     . GLU B 2 417 ? 9.214   49.439 14.734  1.00 60.03  ? 418 GLU A O     1 
ATOM   4175 C CB    . GLU B 2 417 ? 10.272  51.878 12.599  1.00 63.70  ? 418 GLU A CB    1 
ATOM   4176 C CG    . GLU B 2 417 ? 10.253  52.647 11.253  1.00 67.49  ? 418 GLU A CG    1 
ATOM   4177 C CD    . GLU B 2 417 ? 10.763  51.835 10.048  1.00 69.37  ? 418 GLU A CD    1 
ATOM   4178 O OE1   . GLU B 2 417 ? 10.673  52.350 8.902   1.00 69.07  ? 418 GLU A OE1   1 
ATOM   4179 O OE2   . GLU B 2 417 ? 11.254  50.696 10.248  1.00 70.33  ? 418 GLU A OE2   1 
ATOM   4180 N N     . LYS B 2 418 ? 8.345   51.519 14.861  1.00 60.43  ? 419 LYS A N     1 
ATOM   4181 C CA    . LYS B 2 418 ? 8.002   51.408 16.270  1.00 60.52  ? 419 LYS A CA    1 
ATOM   4182 C C     . LYS B 2 418 ? 7.423   50.030 16.590  1.00 59.65  ? 419 LYS A C     1 
ATOM   4183 O O     . LYS B 2 418 ? 7.522   49.550 17.717  1.00 60.07  ? 419 LYS A O     1 
ATOM   4184 C CB    . LYS B 2 418 ? 6.886   52.404 16.618  1.00 61.54  ? 419 LYS A CB    1 
ATOM   4185 C CG    . LYS B 2 418 ? 6.399   52.339 18.074  1.00 63.20  ? 419 LYS A CG    1 
ATOM   4186 C CD    . LYS B 2 418 ? 5.299   53.373 18.324  1.00 65.65  ? 419 LYS A CD    1 
ATOM   4187 C CE    . LYS B 2 418 ? 5.042   53.639 19.809  1.00 66.74  ? 419 LYS A CE    1 
ATOM   4188 N NZ    . LYS B 2 418 ? 4.154   54.840 20.008  1.00 67.62  ? 419 LYS A NZ    1 
ATOM   4189 N N     . LEU B 2 419 ? 6.856   49.382 15.575  1.00 58.62  ? 420 LEU A N     1 
ATOM   4190 C CA    . LEU B 2 419 ? 6.325   48.034 15.729  1.00 58.05  ? 420 LEU A CA    1 
ATOM   4191 C C     . LEU B 2 419 ? 7.306   46.860 15.666  1.00 58.27  ? 420 LEU A C     1 
ATOM   4192 O O     . LEU B 2 419 ? 7.177   45.920 16.447  1.00 57.56  ? 420 LEU A O     1 
ATOM   4193 C CB    . LEU B 2 419 ? 5.210   47.807 14.717  1.00 57.05  ? 420 LEU A CB    1 
ATOM   4194 C CG    . LEU B 2 419 ? 4.532   46.459 14.922  1.00 56.06  ? 420 LEU A CG    1 
ATOM   4195 C CD1   . LEU B 2 419 ? 4.126   46.297 16.375  1.00 55.26  ? 420 LEU A CD1   1 
ATOM   4196 C CD2   . LEU B 2 419 ? 3.340   46.374 14.018  1.00 55.66  ? 420 LEU A CD2   1 
ATOM   4197 N N     . PHE B 2 420 ? 8.264   46.901 14.739  1.00 59.01  ? 421 PHE A N     1 
ATOM   4198 C CA    . PHE B 2 420 ? 9.256   45.825 14.602  1.00 59.91  ? 421 PHE A CA    1 
ATOM   4199 C C     . PHE B 2 420 ? 10.323  45.917 15.685  1.00 60.09  ? 421 PHE A C     1 
ATOM   4200 O O     . PHE B 2 420 ? 11.385  45.307 15.582  1.00 60.01  ? 421 PHE A O     1 
ATOM   4201 C CB    . PHE B 2 420 ? 9.956   45.885 13.246  1.00 61.13  ? 421 PHE A CB    1 
ATOM   4202 C CG    . PHE B 2 420 ? 9.021   46.053 12.088  1.00 63.03  ? 421 PHE A CG    1 
ATOM   4203 C CD1   . PHE B 2 420 ? 9.086   47.194 11.290  1.00 63.48  ? 421 PHE A CD1   1 
ATOM   4204 C CD2   . PHE B 2 420 ? 8.063   45.082 11.798  1.00 63.56  ? 421 PHE A CD2   1 
ATOM   4205 C CE1   . PHE B 2 420 ? 8.208   47.371 10.220  1.00 64.40  ? 421 PHE A CE1   1 
ATOM   4206 C CE2   . PHE B 2 420 ? 7.180   45.249 10.730  1.00 64.12  ? 421 PHE A CE2   1 
ATOM   4207 C CZ    . PHE B 2 420 ? 7.251   46.396 9.938   1.00 64.45  ? 421 PHE A CZ    1 
ATOM   4208 N N     . LYS B 2 421 ? 10.047  46.705 16.712  1.00 60.03  ? 422 LYS A N     1 
ATOM   4209 C CA    . LYS B 2 421 ? 10.979  46.856 17.805  1.00 60.12  ? 422 LYS A CA    1 
ATOM   4210 C C     . LYS B 2 421 ? 10.362  46.199 19.028  1.00 59.37  ? 422 LYS A C     1 
ATOM   4211 O O     . LYS B 2 421 ? 11.055  45.839 19.984  1.00 58.84  ? 422 LYS A O     1 
ATOM   4212 C CB    . LYS B 2 421 ? 11.241  48.339 18.048  1.00 62.41  ? 422 LYS A CB    1 
ATOM   4213 C CG    . LYS B 2 421 ? 12.256  48.947 17.079  1.00 64.16  ? 422 LYS A CG    1 
ATOM   4214 C CD    . LYS B 2 421 ? 11.906  50.390 16.707  1.00 66.50  ? 422 LYS A CD    1 
ATOM   4215 C CE    . LYS B 2 421 ? 11.569  51.257 17.922  1.00 67.24  ? 422 LYS A CE    1 
ATOM   4216 N NZ    . LYS B 2 421 ? 12.700  51.397 18.876  1.00 69.06  ? 422 LYS A NZ    1 
ATOM   4217 N N     . GLU B 2 422 ? 9.045   46.043 18.992  1.00 58.30  ? 423 GLU A N     1 
ATOM   4218 C CA    . GLU B 2 422 ? 8.342   45.402 20.088  1.00 57.71  ? 423 GLU A CA    1 
ATOM   4219 C C     . GLU B 2 422 ? 8.732   43.927 20.077  1.00 56.75  ? 423 GLU A C     1 
ATOM   4220 O O     . GLU B 2 422 ? 9.256   43.422 19.086  1.00 56.82  ? 423 GLU A O     1 
ATOM   4221 C CB    . GLU B 2 422 ? 6.831   45.537 19.902  1.00 59.54  ? 423 GLU A CB    1 
ATOM   4222 C CG    . GLU B 2 422 ? 6.285   46.962 19.979  1.00 61.46  ? 423 GLU A CG    1 
ATOM   4223 C CD    . GLU B 2 422 ? 6.521   47.597 21.334  1.00 62.57  ? 423 GLU A CD    1 
ATOM   4224 O OE1   . GLU B 2 422 ? 6.797   46.841 22.297  1.00 64.13  ? 423 GLU A OE1   1 
ATOM   4225 O OE2   . GLU B 2 422 ? 6.422   48.843 21.440  1.00 61.91  ? 423 GLU A OE2   1 
ATOM   4226 N N     . PRO B 2 423 ? 8.478   43.217 21.180  1.00 55.81  ? 424 PRO A N     1 
ATOM   4227 C CA    . PRO B 2 423 ? 8.786   41.790 21.348  1.00 54.68  ? 424 PRO A CA    1 
ATOM   4228 C C     . PRO B 2 423 ? 7.780   40.899 20.618  1.00 54.11  ? 424 PRO A C     1 
ATOM   4229 O O     . PRO B 2 423 ? 7.185   39.997 21.221  1.00 54.24  ? 424 PRO A O     1 
ATOM   4230 C CB    . PRO B 2 423 ? 8.684   41.585 22.858  1.00 55.39  ? 424 PRO A CB    1 
ATOM   4231 C CG    . PRO B 2 423 ? 8.686   42.996 23.443  1.00 56.81  ? 424 PRO A CG    1 
ATOM   4232 C CD    . PRO B 2 423 ? 7.946   43.784 22.427  1.00 56.28  ? 424 PRO A CD    1 
ATOM   4233 N N     . VAL B 2 424 ? 7.586   41.134 19.326  1.00 53.07  ? 425 VAL A N     1 
ATOM   4234 C CA    . VAL B 2 424 ? 6.607   40.345 18.589  1.00 51.47  ? 425 VAL A CA    1 
ATOM   4235 C C     . VAL B 2 424 ? 7.008   40.012 17.157  1.00 51.65  ? 425 VAL A C     1 
ATOM   4236 O O     . VAL B 2 424 ? 6.198   39.502 16.391  1.00 51.94  ? 425 VAL A O     1 
ATOM   4237 C CB    . VAL B 2 424 ? 5.271   41.083 18.545  1.00 49.76  ? 425 VAL A CB    1 
ATOM   4238 C CG1   . VAL B 2 424 ? 4.872   41.529 19.944  1.00 49.17  ? 425 VAL A CG1   1 
ATOM   4239 C CG2   . VAL B 2 424 ? 5.395   42.281 17.637  1.00 49.18  ? 425 VAL A CG2   1 
ATOM   4240 N N     . THR B 2 425 ? 8.252   40.290 16.796  1.00 51.62  ? 426 THR A N     1 
ATOM   4241 C CA    . THR B 2 425 ? 8.714   40.021 15.441  1.00 51.35  ? 426 THR A CA    1 
ATOM   4242 C C     . THR B 2 425 ? 8.524   38.552 15.068  1.00 51.14  ? 426 THR A C     1 
ATOM   4243 O O     . THR B 2 425 ? 8.273   38.221 13.908  1.00 51.45  ? 426 THR A O     1 
ATOM   4244 C CB    . THR B 2 425 ? 10.202  40.346 15.284  1.00 51.36  ? 426 THR A CB    1 
ATOM   4245 O OG1   . THR B 2 425 ? 10.961  39.158 15.531  1.00 52.57  ? 426 THR A OG1   1 
ATOM   4246 C CG2   . THR B 2 425 ? 10.629  41.420 16.280  1.00 51.02  ? 426 THR A CG2   1 
ATOM   4247 N N     . ALA B 2 426 ? 8.653   37.675 16.056  1.00 50.95  ? 427 ALA A N     1 
ATOM   4248 C CA    . ALA B 2 426 ? 8.516   36.239 15.833  1.00 51.04  ? 427 ALA A CA    1 
ATOM   4249 C C     . ALA B 2 426 ? 7.110   35.828 15.384  1.00 50.98  ? 427 ALA A C     1 
ATOM   4250 O O     . ALA B 2 426 ? 6.951   35.147 14.371  1.00 50.47  ? 427 ALA A O     1 
ATOM   4251 C CB    . ALA B 2 426 ? 8.905   35.485 17.100  1.00 51.54  ? 427 ALA A CB    1 
ATOM   4252 N N     . GLU B 2 427 ? 6.093   36.240 16.137  1.00 51.29  ? 428 GLU A N     1 
ATOM   4253 C CA    . GLU B 2 427 ? 4.709   35.913 15.803  1.00 51.19  ? 428 GLU A CA    1 
ATOM   4254 C C     . GLU B 2 427 ? 4.352   36.470 14.421  1.00 49.89  ? 428 GLU A C     1 
ATOM   4255 O O     . GLU B 2 427 ? 3.766   35.781 13.585  1.00 48.97  ? 428 GLU A O     1 
ATOM   4256 C CB    . GLU B 2 427 ? 3.761   36.490 16.864  1.00 53.11  ? 428 GLU A CB    1 
ATOM   4257 C CG    . GLU B 2 427 ? 3.758   35.776 18.235  1.00 57.45  ? 428 GLU A CG    1 
ATOM   4258 C CD    . GLU B 2 427 ? 5.059   35.926 19.058  1.00 60.04  ? 428 GLU A CD    1 
ATOM   4259 O OE1   . GLU B 2 427 ? 5.629   37.041 19.126  1.00 61.16  ? 428 GLU A OE1   1 
ATOM   4260 O OE2   . GLU B 2 427 ? 5.501   34.923 19.667  1.00 61.67  ? 428 GLU A OE2   1 
ATOM   4261 N N     . LEU B 2 428 ? 4.713   37.726 14.190  1.00 49.41  ? 429 LEU A N     1 
ATOM   4262 C CA    . LEU B 2 428 ? 4.457   38.390 12.917  1.00 49.46  ? 429 LEU A CA    1 
ATOM   4263 C C     . LEU B 2 428 ? 4.981   37.575 11.740  1.00 49.37  ? 429 LEU A C     1 
ATOM   4264 O O     . LEU B 2 428 ? 4.376   37.548 10.674  1.00 49.35  ? 429 LEU A O     1 
ATOM   4265 C CB    . LEU B 2 428 ? 5.125   39.763 12.899  1.00 49.08  ? 429 LEU A CB    1 
ATOM   4266 C CG    . LEU B 2 428 ? 4.497   40.853 13.761  1.00 48.80  ? 429 LEU A CG    1 
ATOM   4267 C CD1   . LEU B 2 428 ? 5.409   42.078 13.783  1.00 49.04  ? 429 LEU A CD1   1 
ATOM   4268 C CD2   . LEU B 2 428 ? 3.120   41.202 13.214  1.00 48.13  ? 429 LEU A CD2   1 
ATOM   4269 N N     . CYS B 2 429 ? 6.122   36.927 11.923  1.00 49.57  ? 430 CYS A N     1 
ATOM   4270 C CA    . CYS B 2 429 ? 6.682   36.125 10.846  1.00 49.74  ? 430 CYS A CA    1 
ATOM   4271 C C     . CYS B 2 429 ? 5.835   34.878 10.624  1.00 49.68  ? 430 CYS A C     1 
ATOM   4272 O O     . CYS B 2 429 ? 5.661   34.424 9.489   1.00 49.84  ? 430 CYS A O     1 
ATOM   4273 C CB    . CYS B 2 429 ? 8.135   35.743 11.161  1.00 49.23  ? 430 CYS A CB    1 
ATOM   4274 S SG    . CYS B 2 429 ? 9.344   37.059 10.771  1.00 49.26  ? 430 CYS A SG    1 
ATOM   4275 N N     . GLU B 2 430 ? 5.317   34.333 11.723  1.00 49.21  ? 431 GLU A N     1 
ATOM   4276 C CA    . GLU B 2 430 ? 4.473   33.146 11.690  1.00 48.32  ? 431 GLU A CA    1 
ATOM   4277 C C     . GLU B 2 430 ? 3.155   33.569 11.061  1.00 47.41  ? 431 GLU A C     1 
ATOM   4278 O O     . GLU B 2 430 ? 2.615   32.904 10.173  1.00 46.92  ? 431 GLU A O     1 
ATOM   4279 C CB    . GLU B 2 430 ? 4.249   32.645 13.114  1.00 49.97  ? 431 GLU A CB    1 
ATOM   4280 C CG    . GLU B 2 430 ? 3.145   31.616 13.277  1.00 53.53  ? 431 GLU A CG    1 
ATOM   4281 C CD    . GLU B 2 430 ? 3.452   30.295 12.581  1.00 56.40  ? 431 GLU A CD    1 
ATOM   4282 O OE1   . GLU B 2 430 ? 4.561   29.760 12.816  1.00 58.31  ? 431 GLU A OE1   1 
ATOM   4283 O OE2   . GLU B 2 430 ? 2.590   29.788 11.810  1.00 57.24  ? 431 GLU A OE2   1 
ATOM   4284 N N     . MET B 2 431 ? 2.642   34.699 11.520  1.00 46.43  ? 432 MET A N     1 
ATOM   4285 C CA    . MET B 2 431 ? 1.393   35.207 10.994  1.00 45.42  ? 432 MET A CA    1 
ATOM   4286 C C     . MET B 2 431 ? 1.464   35.472 9.479   1.00 44.86  ? 432 MET A C     1 
ATOM   4287 O O     . MET B 2 431 ? 0.488   35.246 8.764   1.00 45.84  ? 432 MET A O     1 
ATOM   4288 C CB    . MET B 2 431 ? 1.016   36.479 11.736  1.00 44.65  ? 432 MET A CB    1 
ATOM   4289 C CG    . MET B 2 431 ? -0.323  37.001 11.354  1.00 45.98  ? 432 MET A CG    1 
ATOM   4290 S SD    . MET B 2 431 ? -0.672  38.432 12.334  1.00 48.65  ? 432 MET A SD    1 
ATOM   4291 C CE    . MET B 2 431 ? 0.353   39.669 11.467  1.00 47.16  ? 432 MET A CE    1 
ATOM   4292 N N     . MET B 2 432 ? 2.620   35.928 8.994   1.00 43.40  ? 433 MET A N     1 
ATOM   4293 C CA    . MET B 2 432 ? 2.814   36.245 7.574   1.00 41.09  ? 433 MET A CA    1 
ATOM   4294 C C     . MET B 2 432 ? 3.424   35.156 6.722   1.00 41.26  ? 433 MET A C     1 
ATOM   4295 O O     . MET B 2 432 ? 3.686   35.376 5.544   1.00 41.19  ? 433 MET A O     1 
ATOM   4296 C CB    . MET B 2 432 ? 3.698   37.473 7.413   1.00 39.55  ? 433 MET A CB    1 
ATOM   4297 C CG    . MET B 2 432 ? 3.084   38.746 7.875   1.00 39.37  ? 433 MET A CG    1 
ATOM   4298 S SD    . MET B 2 432 ? 4.199   40.118 7.592   1.00 39.78  ? 433 MET A SD    1 
ATOM   4299 C CE    . MET B 2 432 ? 5.467   39.787 8.806   1.00 39.76  ? 433 MET A CE    1 
ATOM   4300 N N     . GLY B 2 433 ? 3.673   33.994 7.300   1.00 41.62  ? 434 GLY A N     1 
ATOM   4301 C CA    . GLY B 2 433 ? 4.270   32.928 6.518   1.00 42.57  ? 434 GLY A CA    1 
ATOM   4302 C C     . GLY B 2 433 ? 5.695   33.228 6.076   1.00 43.62  ? 434 GLY A C     1 
ATOM   4303 O O     . GLY B 2 433 ? 6.232   32.543 5.212   1.00 43.52  ? 434 GLY A O     1 
ATOM   4304 N N     . VAL B 2 434 ? 6.320   34.248 6.656   1.00 45.23  ? 435 VAL A N     1 
ATOM   4305 C CA    . VAL B 2 434 ? 7.701   34.575 6.288   1.00 46.83  ? 435 VAL A CA    1 
ATOM   4306 C C     . VAL B 2 434 ? 8.499   33.268 6.318   1.00 48.94  ? 435 VAL A C     1 
ATOM   4307 O O     . VAL B 2 434 ? 8.351   32.492 7.255   1.00 49.25  ? 435 VAL A O     1 
ATOM   4308 C CB    . VAL B 2 434 ? 8.365   35.533 7.318   1.00 45.24  ? 435 VAL A CB    1 
ATOM   4309 C CG1   . VAL B 2 434 ? 9.670   36.060 6.766   1.00 45.21  ? 435 VAL A CG1   1 
ATOM   4310 C CG2   . VAL B 2 434 ? 7.434   36.657 7.686   1.00 44.27  ? 435 VAL A CG2   1 
ATOM   4311 N N     . LYS B 2 435 ? 9.322   32.998 5.310   1.00 51.47  ? 436 LYS A N     1 
ATOM   4312 C CA    . LYS B 2 435 ? 10.110  31.772 5.357   1.00 55.22  ? 436 LYS A CA    1 
ATOM   4313 C C     . LYS B 2 435 ? 11.596  32.037 5.133   1.00 57.36  ? 436 LYS A C     1 
ATOM   4314 O O     . LYS B 2 435 ? 12.018  33.189 5.065   1.00 57.79  ? 436 LYS A O     1 
ATOM   4315 C CB    . LYS B 2 435 ? 9.692   30.787 4.253   1.00 55.73  ? 436 LYS A CB    1 
ATOM   4316 C CG    . LYS B 2 435 ? 9.850   31.246 2.823   1.00 55.99  ? 436 LYS A CG    1 
ATOM   4317 C CD    . LYS B 2 435 ? 9.341   30.151 1.884   1.00 55.99  ? 436 LYS A CD    1 
ATOM   4318 C CE    . LYS B 2 435 ? 9.517   30.528 0.427   1.00 55.86  ? 436 LYS A CE    1 
ATOM   4319 N NZ    . LYS B 2 435 ? 9.006   29.461 -0.464  1.00 55.42  ? 436 LYS A NZ    1 
ATOM   4320 N N     . ASP B 2 436 ? 12.378  30.965 5.046   1.00 60.33  ? 437 ASP A N     1 
ATOM   4321 C CA    . ASP B 2 436 ? 13.846  31.010 5.008   1.00 63.21  ? 437 ASP A CA    1 
ATOM   4322 C C     . ASP B 2 436 ? 14.442  30.705 6.381   1.00 64.17  ? 437 ASP A C     1 
ATOM   4323 O O     . ASP B 2 436 ? 13.724  30.866 7.396   1.00 64.88  ? 437 ASP A O     1 
ATOM   4324 C CB    . ASP B 2 436 ? 14.367  32.382 4.548   1.00 64.31  ? 437 ASP A CB    1 
ATOM   4325 C CG    . ASP B 2 436 ? 15.857  32.562 4.829   1.00 65.20  ? 437 ASP A CG    1 
ATOM   4326 O OD1   . ASP B 2 436 ? 16.641  31.663 4.448   1.00 65.71  ? 437 ASP A OD1   1 
ATOM   4327 O OD2   . ASP B 2 436 ? 16.246  33.591 5.429   1.00 65.28  ? 437 ASP A OD2   1 
ATOM   4328 O OXT   . ASP B 2 436 ? 15.636  30.328 6.418   1.00 64.67  ? 437 ASP A OXT   1 
HETATM 4329 S S     . SO4 C 3 .   ? 5.267   14.636 31.077  1.00 55.65  ? 701 SO4 A S     1 
HETATM 4330 O O1    . SO4 C 3 .   ? 6.154   14.438 32.308  1.00 56.35  ? 701 SO4 A O1    1 
HETATM 4331 O O2    . SO4 C 3 .   ? 3.892   14.051 31.417  1.00 54.27  ? 701 SO4 A O2    1 
HETATM 4332 O O3    . SO4 C 3 .   ? 5.103   16.042 30.905  1.00 55.62  ? 701 SO4 A O3    1 
HETATM 4333 O O4    . SO4 C 3 .   ? 5.809   13.764 30.091  1.00 55.19  ? 701 SO4 A O4    1 
HETATM 4334 S S     . SO4 D 3 .   ? -19.705 36.917 20.482  1.00 99.33  ? 702 SO4 A S     1 
HETATM 4335 O O1    . SO4 D 3 .   ? -19.490 35.647 21.305  1.00 99.68  ? 702 SO4 A O1    1 
HETATM 4336 O O2    . SO4 D 3 .   ? -20.508 36.511 19.243  1.00 99.45  ? 702 SO4 A O2    1 
HETATM 4337 O O3    . SO4 D 3 .   ? -20.527 37.781 21.259  1.00 99.08  ? 702 SO4 A O3    1 
HETATM 4338 O O4    . SO4 D 3 .   ? -18.412 37.252 19.994  1.00 99.63  ? 702 SO4 A O4    1 
HETATM 4339 O O     . HOH E 4 .   ? -22.288 32.243 28.250  1.00 31.97  ? 34  HOH B O     1 
HETATM 4340 O O     . HOH E 4 .   ? -18.140 34.069 39.160  1.00 38.46  ? 37  HOH B O     1 
HETATM 4341 O O     . HOH E 4 .   ? -34.129 50.922 21.015  1.00 40.55  ? 40  HOH B O     1 
HETATM 4342 O O     . HOH E 4 .   ? -34.360 35.829 25.271  1.00 45.68  ? 41  HOH B O     1 
HETATM 4343 O O     . HOH E 4 .   ? -3.642  19.438 38.806  1.00 47.54  ? 42  HOH B O     1 
HETATM 4344 O O     . HOH E 4 .   ? -34.345 28.294 32.189  1.00 57.78  ? 45  HOH B O     1 
HETATM 4345 O O     . HOH E 4 .   ? -27.100 27.278 38.464  1.00 49.36  ? 48  HOH B O     1 
HETATM 4346 O O     . HOH E 4 .   ? -32.119 40.591 38.882  1.00 46.46  ? 49  HOH B O     1 
HETATM 4347 O O     . HOH F 4 .   ? -9.330  39.032 3.087   1.00 17.68  ? 703 HOH A O     1 
HETATM 4348 O O     . HOH F 4 .   ? -2.905  33.209 13.795  1.00 32.01  ? 704 HOH A O     1 
HETATM 4349 O O     . HOH F 4 .   ? -9.556  42.557 35.989  1.00 27.05  ? 705 HOH A O     1 
HETATM 4350 O O     . HOH F 4 .   ? -18.646 19.252 50.650  1.00 37.42  ? 706 HOH A O     1 
HETATM 4351 O O     . HOH F 4 .   ? -7.274  -3.707 26.602  1.00 31.58  ? 707 HOH A O     1 
HETATM 4352 O O     . HOH F 4 .   ? -9.604  -2.949 33.897  1.00 23.16  ? 708 HOH A O     1 
HETATM 4353 O O     . HOH F 4 .   ? -6.188  -2.317 22.391  1.00 38.07  ? 710 HOH A O     1 
HETATM 4354 O O     . HOH F 4 .   ? 14.055  -2.695 7.789   1.00 56.40  ? 711 HOH A O     1 
HETATM 4355 O O     . HOH F 4 .   ? -11.281 26.201 53.196  1.00 46.15  ? 712 HOH A O     1 
HETATM 4356 O O     . HOH F 4 .   ? 10.820  1.333  18.832  1.00 36.43  ? 713 HOH A O     1 
HETATM 4357 O O     . HOH F 4 .   ? -18.407 24.551 49.645  1.00 43.10  ? 714 HOH A O     1 
HETATM 4358 O O     . HOH F 4 .   ? -14.522 49.050 36.025  1.00 35.53  ? 716 HOH A O     1 
HETATM 4359 O O     . HOH F 4 .   ? -15.109 63.491 6.362   1.00 33.78  ? 717 HOH A O     1 
HETATM 4360 O O     . HOH F 4 .   ? 4.520   2.999  50.918  1.00 28.88  ? 719 HOH A O     1 
HETATM 4361 O O     . HOH F 4 .   ? -10.357 8.147  10.658  1.00 34.82  ? 721 HOH A O     1 
HETATM 4362 O O     . HOH F 4 .   ? -3.418  54.698 19.502  1.00 34.35  ? 724 HOH A O     1 
HETATM 4363 O O     . HOH F 4 .   ? 9.201   34.347 2.690   1.00 39.72  ? 725 HOH A O     1 
HETATM 4364 O O     . HOH F 4 .   ? 18.306  15.437 36.637  1.00 39.14  ? 726 HOH A O     1 
HETATM 4365 O O     . HOH F 4 .   ? -38.506 61.835 1.949   1.00 44.57  ? 728 HOH A O     1 
HETATM 4366 O O     . HOH F 4 .   ? -6.867  5.714  10.894  1.00 24.97  ? 729 HOH A O     1 
HETATM 4367 O O     . HOH F 4 .   ? -7.089  34.491 11.877  1.00 35.89  ? 733 HOH A O     1 
HETATM 4368 O O     . HOH F 4 .   ? -5.231  34.491 17.407  1.00 42.26  ? 734 HOH A O     1 
HETATM 4369 O O     . HOH F 4 .   ? -13.004 16.622 44.689  1.00 34.64  ? 739 HOH A O     1 
HETATM 4370 O O     . HOH F 4 .   ? 3.173   15.058 2.648   1.00 53.09  ? 740 HOH A O     1 
HETATM 4371 O O     . HOH F 4 .   ? -11.591 61.835 3.865   1.00 46.61  ? 744 HOH A O     1 
HETATM 4372 O O     . HOH F 4 .   ? 3.992   0.738  45.044  1.00 45.59  ? 747 HOH A O     1 
HETATM 4373 O O     . HOH F 4 .   ? 8.650   46.257 30.383  1.00 35.56  ? 748 HOH A O     1 
HETATM 4374 O O     . HOH F 4 .   ? 8.210   50.527 23.781  1.00 42.23  ? 749 HOH A O     1 
HETATM 4375 O O     . HOH F 4 .   ? 17.734  12.606 44.392  1.00 39.04  ? 752 HOH A O     1 
HETATM 4376 O O     . HOH F 4 .   ? 18.188  34.459 14.410  1.00 28.38  ? 757 HOH A O     1 
HETATM 4377 O O     . HOH F 4 .   ? 1.366   3.495  45.124  1.00 40.61  ? 759 HOH A O     1 
HETATM 4378 O O     . HOH F 4 .   ? -11.921 17.653 19.861  1.00 35.70  ? 760 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  G   33  33  33  G   G   B . n 
B 2 1   LYS 1   2   2   LYS LYS A . n 
B 2 2   VAL 2   3   3   VAL VAL A . n 
B 2 3   GLU 3   4   4   GLU GLU A . n 
B 2 4   GLU 4   5   5   GLU GLU A . n 
B 2 5   ILE 5   6   6   ILE ILE A . n 
B 2 6   LEU 6   7   7   LEU LEU A . n 
B 2 7   GLU 7   8   8   GLU GLU A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ALA 9   10  10  ALA ALA A . n 
B 2 10  LEU 10  11  11  LEU LEU A . n 
B 2 11  GLU 11  12  12  GLU GLU A . n 
B 2 12  LEU 12  13  13  LEU LEU A . n 
B 2 13  VAL 13  14  14  VAL VAL A . n 
B 2 14  ILE 14  15  15  ILE ILE A . n 
B 2 15  PRO 15  16  16  PRO PRO A . n 
B 2 16  ASP 16  17  17  ASP ASP A . n 
B 2 17  GLU 17  18  18  GLU GLU A . n 
B 2 18  GLU 18  19  19  GLU GLU A . n 
B 2 19  GLU 19  20  20  GLU GLU A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ARG 21  22  22  ARG ARG A . n 
B 2 22  LYS 22  23  23  LYS LYS A . n 
B 2 23  GLY 23  24  24  GLY GLY A . n 
B 2 24  ARG 24  25  25  ARG ARG A . n 
B 2 25  GLU 25  26  26  GLU GLU A . n 
B 2 26  ALA 26  27  27  ALA ALA A . n 
B 2 27  GLU 27  28  28  GLU GLU A . n 
B 2 28  GLU 28  29  29  GLU GLU A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  LEU 30  31  31  LEU LEU A . n 
B 2 31  ARG 31  32  32  ARG ARG A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ARG 33  34  34  ARG ARG A . n 
B 2 34  LEU 34  35  35  LEU LEU A . n 
B 2 35  ASP 35  36  36  ASP ASP A . n 
B 2 36  GLU 36  37  37  GLU GLU A . n 
B 2 37  LEU 37  38  38  LEU LEU A . n 
B 2 38  GLY 38  39  39  GLY GLY A . n 
B 2 39  VAL 39  40  40  VAL VAL A . n 
B 2 40  GLU 40  41  41  GLU GLU A . n 
B 2 41  TYR 41  42  42  TYR TYR A . n 
B 2 42  VAL 42  43  43  VAL VAL A . n 
B 2 43  PHE 43  44  44  PHE PHE A . n 
B 2 44  VAL 44  45  45  VAL VAL A . n 
B 2 45  GLY 45  46  46  GLY GLY A . n 
B 2 46  SER 46  47  47  SER SER A . n 
B 2 47  TYR 47  48  48  TYR TYR A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  ARG 49  50  50  ARG ARG A . n 
B 2 50  ASN 50  51  51  ASN ASN A . n 
B 2 51  THR 51  52  52  THR THR A . n 
B 2 52  TRP 52  53  53  TRP TRP A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  LYS 54  55  55  LYS LYS A . n 
B 2 55  GLY 55  56  56  GLY GLY A . n 
B 2 56  SER 56  57  57  SER SER A . n 
B 2 57  LEU 57  58  58  LEU LEU A . n 
B 2 58  GLU 58  59  59  GLU GLU A . n 
B 2 59  ILE 59  60  60  ILE ILE A . n 
B 2 60  ASP 60  61  61  ASP ASP A . n 
B 2 61  VAL 61  62  62  VAL VAL A . n 
B 2 62  PHE 62  63  63  PHE PHE A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  PHE 65  66  66  PHE PHE A . n 
B 2 66  PRO 66  67  67  PRO PRO A . n 
B 2 67  GLU 67  68  68  GLU GLU A . n 
B 2 68  GLU 68  69  69  GLU GLU A . n 
B 2 69  PHE 69  70  70  PHE PHE A . n 
B 2 70  SER 70  71  71  SER SER A . n 
B 2 71  LYS 71  72  72  LYS LYS A . n 
B 2 72  GLU 72  73  73  GLU GLU A . n 
B 2 73  GLU 73  74  74  GLU GLU A . n 
B 2 74  LEU 74  75  75  LEU LEU A . n 
B 2 75  ARG 75  76  76  ARG ARG A . n 
B 2 76  GLU 76  77  77  GLU GLU A . n 
B 2 77  ARG 77  78  78  ARG ARG A . n 
B 2 78  GLY 78  79  79  GLY GLY A . n 
B 2 79  LEU 79  80  80  LEU LEU A . n 
B 2 80  GLU 80  81  81  GLU GLU A . n 
B 2 81  ILE 81  82  82  ILE ILE A . n 
B 2 82  GLY 82  83  83  GLY GLY A . n 
B 2 83  LYS 83  84  84  LYS LYS A . n 
B 2 84  ALA 84  85  85  ALA ALA A . n 
B 2 85  VAL 85  86  86  VAL VAL A . n 
B 2 86  LEU 86  87  87  LEU LEU A . n 
B 2 87  ASP 87  88  88  ASP ASP A . n 
B 2 88  SER 88  89  89  SER SER A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  GLU 90  91  91  GLU GLU A . n 
B 2 91  ILE 91  92  92  ILE ILE A . n 
B 2 92  ARG 92  93  93  ARG ARG A . n 
B 2 93  TYR 93  94  94  TYR TYR A . n 
B 2 94  ALA 94  95  95  ALA ALA A . n 
B 2 95  GLU 95  96  96  GLU GLU A . n 
B 2 96  HIS 96  97  97  HIS HIS A . n 
B 2 97  PRO 97  98  98  PRO PRO A . n 
B 2 98  TYR 98  99  99  TYR TYR A . n 
B 2 99  VAL 99  100 100 VAL VAL A . n 
B 2 100 HIS 100 101 101 HIS HIS A . n 
B 2 101 GLY 101 102 102 GLY GLY A . n 
B 2 102 VAL 102 103 103 VAL VAL A . n 
B 2 103 VAL 103 104 104 VAL VAL A . n 
B 2 104 LYS 104 105 105 LYS LYS A . n 
B 2 105 GLY 105 106 106 GLY GLY A . n 
B 2 106 VAL 106 107 107 VAL VAL A . n 
B 2 107 GLU 107 108 108 GLU GLU A . n 
B 2 108 VAL 108 109 109 VAL VAL A . n 
B 2 109 ASP 109 110 110 ASP ASP A . n 
B 2 110 VAL 110 111 111 VAL VAL A . n 
B 2 111 VAL 111 112 112 VAL VAL A . n 
B 2 112 PRO 112 113 113 PRO PRO A . n 
B 2 113 CYS 113 114 114 CYS CYS A . n 
B 2 114 TYR 114 115 115 TYR TYR A . n 
B 2 115 LYS 115 116 116 LYS LYS A . n 
B 2 116 LEU 116 117 117 LEU LEU A . n 
B 2 117 LYS 117 118 118 LYS LYS A . n 
B 2 118 GLU 118 119 119 GLU GLU A . n 
B 2 119 PRO 119 120 120 PRO PRO A . n 
B 2 120 LYS 120 121 121 LYS LYS A . n 
B 2 121 ASN 121 122 122 ASN ASN A . n 
B 2 122 ILE 122 123 123 ILE ILE A . n 
B 2 123 LYS 123 124 124 LYS LYS A . n 
B 2 124 SER 124 125 125 SER SER A . n 
B 2 125 ALA 125 126 126 ALA ALA A . n 
B 2 126 VAL 126 127 127 VAL VAL A . n 
B 2 127 ASP 127 128 128 ASP ASP A . n 
B 2 128 ARG 128 129 129 ARG ARG A . n 
B 2 129 THR 129 130 130 THR THR A . n 
B 2 130 PRO 130 131 131 PRO PRO A . n 
B 2 131 PHE 131 132 132 PHE PHE A . n 
B 2 132 HIS 132 133 133 HIS HIS A . n 
B 2 133 HIS 133 134 134 HIS HIS A . n 
B 2 134 LYS 134 135 135 LYS LYS A . n 
B 2 135 TRP 135 136 136 TRP TRP A . n 
B 2 136 LEU 136 137 137 LEU LEU A . n 
B 2 137 GLU 137 138 138 GLU GLU A . n 
B 2 138 GLY 138 139 139 GLY GLY A . n 
B 2 139 ARG 139 140 140 ARG ARG A . n 
B 2 140 ILE 140 141 141 ILE ILE A . n 
B 2 141 LYS 141 142 142 LYS LYS A . n 
B 2 142 GLY 142 143 143 GLY GLY A . n 
B 2 143 LYS 143 144 144 LYS LYS A . n 
B 2 144 GLU 144 145 145 GLU GLU A . n 
B 2 145 ASN 145 146 146 ASN ASN A . n 
B 2 146 GLU 146 147 147 GLU GLU A . n 
B 2 147 VAL 147 148 148 VAL VAL A . n 
B 2 148 ARG 148 149 149 ARG ARG A . n 
B 2 149 LEU 149 150 150 LEU LEU A . n 
B 2 150 LEU 150 151 151 LEU LEU A . n 
B 2 151 LYS 151 152 152 LYS LYS A . n 
B 2 152 GLY 152 153 153 GLY GLY A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 LEU 154 155 155 LEU LEU A . n 
B 2 155 LYS 155 156 156 LYS LYS A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 ASN 157 158 158 ASN ASN A . n 
B 2 158 GLY 158 159 159 GLY GLY A . n 
B 2 159 ILE 159 160 160 ILE ILE A . n 
B 2 160 TYR 160 161 161 TYR TYR A . n 
B 2 161 GLY 161 162 162 GLY GLY A . n 
B 2 162 ALA 162 163 163 ALA ALA A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 TYR 164 165 165 TYR TYR A . n 
B 2 165 LYS 165 166 166 LYS LYS A . n 
B 2 166 VAL 166 167 167 VAL VAL A . n 
B 2 167 ARG 167 168 168 ARG ARG A . n 
B 2 168 GLY 168 169 169 GLY GLY A . n 
B 2 169 PHE 169 170 170 PHE PHE A . n 
B 2 170 SER 170 171 171 SER SER A . n 
B 2 171 GLY 171 172 172 GLY GLY A . n 
B 2 172 TYR 172 173 173 TYR TYR A . n 
B 2 173 LEU 173 174 174 LEU LEU A . n 
B 2 174 CYS 174 175 175 CYS CYS A . n 
B 2 175 GLU 175 176 176 GLU GLU A . n 
B 2 176 LEU 176 177 177 LEU LEU A . n 
B 2 177 LEU 177 178 178 LEU LEU A . n 
B 2 178 ILE 178 179 179 ILE ILE A . n 
B 2 179 VAL 179 180 180 VAL VAL A . n 
B 2 180 PHE 180 181 181 PHE PHE A . n 
B 2 181 TYR 181 182 182 TYR TYR A . n 
B 2 182 GLY 182 183 183 GLY GLY A . n 
B 2 183 SER 183 184 184 SER SER A . n 
B 2 184 PHE 184 185 185 PHE PHE A . n 
B 2 185 LEU 185 186 186 LEU LEU A . n 
B 2 186 GLU 186 187 187 GLU GLU A . n 
B 2 187 THR 187 188 188 THR THR A . n 
B 2 188 VAL 188 189 189 VAL VAL A . n 
B 2 189 LYS 189 190 190 LYS LYS A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 ALA 191 192 192 ALA ALA A . n 
B 2 192 ARG 192 193 193 ARG ARG A . n 
B 2 193 ARG 193 194 194 ARG ARG A . n 
B 2 194 TRP 194 195 195 TRP TRP A . n 
B 2 195 THR 195 196 196 THR THR A . n 
B 2 196 ARG 196 197 197 ARG ARG A . n 
B 2 197 ARG 197 198 198 ARG ARG A . n 
B 2 198 THR 198 199 199 THR THR A . n 
B 2 199 VAL 199 200 200 VAL VAL A . n 
B 2 200 ILE 200 201 201 ILE ILE A . n 
B 2 201 ASP 201 202 202 ASP ASP A . n 
B 2 202 VAL 202 203 203 VAL VAL A . n 
B 2 203 ALA 203 204 204 ALA ALA A . n 
B 2 204 LYS 204 205 205 LYS LYS A . n 
B 2 205 GLY 205 206 206 GLY GLY A . n 
B 2 206 GLU 206 207 207 GLU GLU A . n 
B 2 207 VAL 207 208 208 VAL VAL A . n 
B 2 208 ARG 208 209 209 ARG ARG A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 GLY 210 211 211 GLY GLY A . n 
B 2 211 GLU 211 212 212 GLU GLU A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 PHE 213 214 214 PHE PHE A . n 
B 2 214 PHE 214 215 215 PHE PHE A . n 
B 2 215 VAL 215 216 216 VAL VAL A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 ASP 217 218 218 ASP ASP A . n 
B 2 218 PRO 218 219 219 PRO PRO A . n 
B 2 219 VAL 219 220 220 VAL VAL A . n 
B 2 220 ASP 220 221 221 ASP ASP A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 LYS 222 223 223 LYS LYS A . n 
B 2 223 ARG 223 224 224 ARG ARG A . n 
B 2 224 ASN 224 225 225 ASN ASN A . n 
B 2 225 VAL 225 226 226 VAL VAL A . n 
B 2 226 ALA 226 227 227 ALA ALA A . n 
B 2 227 ALA 227 228 228 ALA ALA A . n 
B 2 228 ASN 228 229 229 ASN ASN A . n 
B 2 229 LEU 229 230 230 LEU LEU A . n 
B 2 230 SER 230 231 231 SER SER A . n 
B 2 231 LEU 231 232 232 LEU LEU A . n 
B 2 232 ASP 232 233 233 ASP ASP A . n 
B 2 233 ASN 233 234 234 ASN ASN A . n 
B 2 234 LEU 234 235 235 LEU LEU A . n 
B 2 235 ALA 235 236 236 ALA ALA A . n 
B 2 236 ARG 236 237 237 ARG ARG A . n 
B 2 237 PHE 237 238 238 PHE PHE A . n 
B 2 238 VAL 238 239 239 VAL VAL A . n 
B 2 239 HIS 239 240 240 HIS HIS A . n 
B 2 240 LEU 240 241 241 LEU LEU A . n 
B 2 241 CYS 241 242 242 CYS CYS A . n 
B 2 242 ARG 242 243 243 ARG ARG A . n 
B 2 243 GLU 243 244 244 GLU GLU A . n 
B 2 244 PHE 244 245 245 PHE PHE A . n 
B 2 245 MET 245 246 246 MET MET A . n 
B 2 246 GLU 246 247 247 GLU GLU A . n 
B 2 247 ALA 247 248 248 ALA ALA A . n 
B 2 248 PRO 248 249 249 PRO PRO A . n 
B 2 249 SER 249 250 250 SER SER A . n 
B 2 250 LEU 250 251 251 LEU LEU A . n 
B 2 251 GLY 251 252 252 GLY GLY A . n 
B 2 252 PHE 252 253 253 PHE PHE A . n 
B 2 253 PHE 253 254 254 PHE PHE A . n 
B 2 254 LYS 254 255 255 LYS LYS A . n 
B 2 255 PRO 255 256 256 PRO PRO A . n 
B 2 256 LYS 256 257 257 LYS LYS A . n 
B 2 257 HIS 257 258 258 HIS HIS A . n 
B 2 258 PRO 258 259 259 PRO PRO A . n 
B 2 259 LEU 259 260 260 LEU LEU A . n 
B 2 260 GLU 260 261 261 GLU GLU A . n 
B 2 261 ILE 261 262 262 ILE ILE A . n 
B 2 262 GLU 262 263 263 GLU GLU A . n 
B 2 263 PRO 263 264 264 PRO PRO A . n 
B 2 264 GLU 264 265 265 GLU GLU A . n 
B 2 265 ARG 265 266 266 ARG ARG A . n 
B 2 266 LEU 266 267 267 LEU LEU A . n 
B 2 267 ARG 267 268 268 ARG ARG A . n 
B 2 268 LYS 268 269 269 LYS LYS A . n 
B 2 269 ILE 269 270 270 ILE ILE A . n 
B 2 270 VAL 270 271 271 VAL VAL A . n 
B 2 271 GLU 271 272 272 GLU GLU A . n 
B 2 272 GLU 272 273 273 GLU GLU A . n 
B 2 273 ARG 273 274 274 ARG ARG A . n 
B 2 274 GLY 274 275 275 GLY GLY A . n 
B 2 275 THR 275 276 276 THR THR A . n 
B 2 276 ALA 276 277 277 ALA ALA A . n 
B 2 277 VAL 277 278 278 VAL VAL A . n 
B 2 278 PHE 278 279 279 PHE PHE A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 VAL 280 281 281 VAL VAL A . n 
B 2 281 LYS 281 282 282 LYS LYS A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 ARG 283 284 284 ARG ARG A . n 
B 2 284 LYS 284 285 285 LYS LYS A . n 
B 2 285 PRO 285 286 286 PRO PRO A . n 
B 2 286 ASP 286 287 287 ASP ASP A . n 
B 2 287 ILE 287 288 288 ILE ILE A . n 
B 2 288 VAL 288 289 289 VAL VAL A . n 
B 2 289 ASP 289 290 290 ASP ASP A . n 
B 2 290 ASP 290 291 291 ASP ASP A . n 
B 2 291 ASN 291 292 292 ASN ASN A . n 
B 2 292 LEU 292 293 293 LEU LEU A . n 
B 2 293 TYR 293 294 294 TYR TYR A . n 
B 2 294 PRO 294 295 295 PRO PRO A . n 
B 2 295 GLN 295 296 296 GLN GLN A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLU 297 298 298 GLU GLU A . n 
B 2 298 ARG 298 299 299 ARG ARG A . n 
B 2 299 ALA 299 300 300 ALA ALA A . n 
B 2 300 SER 300 301 301 SER SER A . n 
B 2 301 ARG 301 302 302 ARG ARG A . n 
B 2 302 LYS 302 303 303 LYS LYS A . n 
B 2 303 ILE 303 304 304 ILE ILE A . n 
B 2 304 PHE 304 305 305 PHE PHE A . n 
B 2 305 GLU 305 306 306 GLU GLU A . n 
B 2 306 PHE 306 307 307 PHE PHE A . n 
B 2 307 LEU 307 308 308 LEU LEU A . n 
B 2 308 GLU 308 309 309 GLU GLU A . n 
B 2 309 ARG 309 310 310 ARG ARG A . n 
B 2 310 GLU 310 311 311 GLU GLU A . n 
B 2 311 ASN 311 312 312 ASN ASN A . n 
B 2 312 PHE 312 313 313 PHE PHE A . n 
B 2 313 MET 313 314 314 MET MET A . n 
B 2 314 PRO 314 315 315 PRO PRO A . n 
B 2 315 LEU 315 316 316 LEU LEU A . n 
B 2 316 ARG 316 317 317 ARG ARG A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ALA 318 319 319 ALA ALA A . n 
B 2 319 PHE 319 320 320 PHE PHE A . n 
B 2 320 LYS 320 321 321 LYS LYS A . n 
B 2 321 ALA 321 322 322 ALA ALA A . n 
B 2 322 SER 322 323 323 SER SER A . n 
B 2 323 GLU 323 324 324 GLU GLU A . n 
B 2 324 GLU 324 325 325 GLU GLU A . n 
B 2 325 PHE 325 326 326 PHE PHE A . n 
B 2 326 CYS 326 327 327 CYS CYS A . n 
B 2 327 TYR 327 328 328 TYR TYR A . n 
B 2 328 LEU 328 329 329 LEU LEU A . n 
B 2 329 LEU 329 330 330 LEU LEU A . n 
B 2 330 PHE 330 331 331 PHE PHE A . n 
B 2 331 GLU 331 332 332 GLU GLU A . n 
B 2 332 CYS 332 333 333 CYS CYS A . n 
B 2 333 GLN 333 334 334 GLN GLN A . n 
B 2 334 ILE 334 335 335 ILE ILE A . n 
B 2 335 LYS 335 336 336 LYS LYS A . n 
B 2 336 GLU 336 337 337 GLU GLU A . n 
B 2 337 ILE 337 338 338 ILE ILE A . n 
B 2 338 SER 338 339 339 SER SER A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 VAL 340 341 341 VAL VAL A . n 
B 2 341 PHE 341 342 342 PHE PHE A . n 
B 2 342 ARG 342 343 343 ARG ARG A . n 
B 2 343 ARG 343 344 344 ARG ARG A . n 
B 2 344 MET 344 345 345 MET MET A . n 
B 2 345 GLY 345 346 346 GLY GLY A . n 
B 2 346 PRO 346 347 347 PRO PRO A . n 
B 2 347 GLN 347 348 348 GLN GLN A . n 
B 2 348 PHE 348 349 349 PHE PHE A . n 
B 2 349 GLU 349 350 350 GLU GLU A . n 
B 2 350 ASP 350 351 351 ASP ASP A . n 
B 2 351 GLU 351 352 352 GLU GLU A . n 
B 2 352 ARG 352 353 353 ARG ARG A . n 
B 2 353 ASN 353 354 354 ASN ASN A . n 
B 2 354 VAL 354 355 355 VAL VAL A . n 
B 2 355 LYS 355 356 356 LYS LYS A . n 
B 2 356 LYS 356 357 357 LYS LYS A . n 
B 2 357 PHE 357 358 358 PHE PHE A . n 
B 2 358 LEU 358 359 359 LEU LEU A . n 
B 2 359 SER 359 360 360 SER SER A . n 
B 2 360 ARG 360 361 361 ARG ARG A . n 
B 2 361 ASN 361 362 362 ASN ASN A . n 
B 2 362 ARG 362 363 363 ARG ARG A . n 
B 2 363 ALA 363 364 364 ALA ALA A . n 
B 2 364 PHE 364 365 365 PHE PHE A . n 
B 2 365 ARG 365 366 366 ARG ARG A . n 
B 2 366 PRO 366 367 367 PRO PRO A . n 
B 2 367 PHE 367 368 368 PHE PHE A . n 
B 2 368 ILE 368 369 369 ILE ILE A . n 
B 2 369 GLU 369 370 370 GLU GLU A . n 
B 2 370 ASN 370 371 371 ASN ASN A . n 
B 2 371 GLY 371 372 372 GLY GLY A . n 
B 2 372 ARG 372 373 373 ARG ARG A . n 
B 2 373 TRP 373 374 374 TRP TRP A . n 
B 2 374 TRP 374 375 375 TRP TRP A . n 
B 2 375 ALA 375 376 376 ALA ALA A . n 
B 2 376 PHE 376 377 377 PHE PHE A . n 
B 2 377 GLU 377 378 378 GLU GLU A . n 
B 2 378 MET 378 379 379 MET MET A . n 
B 2 379 ARG 379 380 380 ARG ARG A . n 
B 2 380 LYS 380 381 381 LYS LYS A . n 
B 2 381 PHE 381 382 382 PHE PHE A . n 
B 2 382 THR 382 383 383 THR THR A . n 
B 2 383 THR 383 384 384 THR THR A . n 
B 2 384 PRO 384 385 385 PRO PRO A . n 
B 2 385 GLU 385 386 386 GLU GLU A . n 
B 2 386 GLU 386 387 387 GLU GLU A . n 
B 2 387 GLY 387 388 388 GLY GLY A . n 
B 2 388 VAL 388 389 389 VAL VAL A . n 
B 2 389 ARG 389 390 390 ARG ARG A . n 
B 2 390 SER 390 391 391 SER SER A . n 
B 2 391 TYR 391 392 392 TYR TYR A . n 
B 2 392 ALA 392 393 393 ALA ALA A . n 
B 2 393 SER 393 394 394 SER SER A . n 
B 2 394 THR 394 395 395 THR THR A . n 
B 2 395 HIS 395 396 396 HIS HIS A . n 
B 2 396 TRP 396 397 397 TRP TRP A . n 
B 2 397 HIS 397 398 398 HIS HIS A . n 
B 2 398 THR 398 399 399 THR THR A . n 
B 2 399 LEU 399 400 400 LEU LEU A . n 
B 2 400 GLY 400 401 401 GLY GLY A . n 
B 2 401 LYS 401 402 402 LYS LYS A . n 
B 2 402 ASN 402 403 403 ASN ASN A . n 
B 2 403 VAL 403 404 404 VAL VAL A . n 
B 2 404 GLY 404 405 405 GLY GLY A . n 
B 2 405 GLU 405 406 406 GLU GLU A . n 
B 2 406 SER 406 407 407 SER SER A . n 
B 2 407 ILE 407 408 408 ILE ILE A . n 
B 2 408 ARG 408 409 409 ARG ARG A . n 
B 2 409 GLU 409 410 410 GLU GLU A . n 
B 2 410 TYR 410 411 411 TYR TYR A . n 
B 2 411 PHE 411 412 412 PHE PHE A . n 
B 2 412 GLU 412 413 413 GLU GLU A . n 
B 2 413 ILE 413 414 414 ILE ILE A . n 
B 2 414 ILE 414 415 415 ILE ILE A . n 
B 2 415 SER 415 416 416 SER SER A . n 
B 2 416 GLY 416 417 417 GLY GLY A . n 
B 2 417 GLU 417 418 418 GLU GLU A . n 
B 2 418 LYS 418 419 419 LYS LYS A . n 
B 2 419 LEU 419 420 420 LEU LEU A . n 
B 2 420 PHE 420 421 421 PHE PHE A . n 
B 2 421 LYS 421 422 422 LYS LYS A . n 
B 2 422 GLU 422 423 423 GLU GLU A . n 
B 2 423 PRO 423 424 424 PRO PRO A . n 
B 2 424 VAL 424 425 425 VAL VAL A . n 
B 2 425 THR 425 426 426 THR THR A . n 
B 2 426 ALA 426 427 427 ALA ALA A . n 
B 2 427 GLU 427 428 428 GLU GLU A . n 
B 2 428 LEU 428 429 429 LEU LEU A . n 
B 2 429 CYS 429 430 430 CYS CYS A . n 
B 2 430 GLU 430 431 431 GLU GLU A . n 
B 2 431 MET 431 432 432 MET MET A . n 
B 2 432 MET 432 433 433 MET MET A . n 
B 2 433 GLY 433 434 434 GLY GLY A . n 
B 2 434 VAL 434 435 435 VAL VAL A . n 
B 2 435 LYS 435 436 436 LYS LYS A . n 
B 2 436 ASP 436 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  701 701 SO4 SO4 A . 
D 3 SO4 1  702 702 SO4 SO4 A . 
E 4 HOH 1  34  34  HOH HOH B . 
E 4 HOH 2  37  37  HOH HOH B . 
E 4 HOH 3  40  40  HOH HOH B . 
E 4 HOH 4  41  41  HOH HOH B . 
E 4 HOH 5  42  42  HOH HOH B . 
E 4 HOH 6  45  45  HOH HOH B . 
E 4 HOH 7  48  48  HOH HOH B . 
E 4 HOH 8  49  49  HOH HOH B . 
F 4 HOH 1  703 703 HOH HOH A . 
F 4 HOH 2  704 704 HOH HOH A . 
F 4 HOH 3  705 705 HOH HOH A . 
F 4 HOH 4  706 706 HOH HOH A . 
F 4 HOH 5  707 707 HOH HOH A . 
F 4 HOH 6  708 708 HOH HOH A . 
F 4 HOH 7  710 710 HOH HOH A . 
F 4 HOH 8  711 711 HOH HOH A . 
F 4 HOH 9  712 712 HOH HOH A . 
F 4 HOH 10 713 713 HOH HOH A . 
F 4 HOH 11 714 714 HOH HOH A . 
F 4 HOH 12 716 716 HOH HOH A . 
F 4 HOH 13 717 717 HOH HOH A . 
F 4 HOH 14 719 719 HOH HOH A . 
F 4 HOH 15 721 721 HOH HOH A . 
F 4 HOH 16 724 724 HOH HOH A . 
F 4 HOH 17 725 725 HOH HOH A . 
F 4 HOH 18 726 726 HOH HOH A . 
F 4 HOH 19 728 728 HOH HOH A . 
F 4 HOH 20 729 729 HOH HOH A . 
F 4 HOH 21 733 733 HOH HOH A . 
F 4 HOH 22 734 734 HOH HOH A . 
F 4 HOH 23 739 739 HOH HOH A . 
F 4 HOH 24 740 740 HOH HOH A . 
F 4 HOH 25 744 744 HOH HOH A . 
F 4 HOH 26 747 747 HOH HOH A . 
F 4 HOH 27 748 748 HOH HOH A . 
F 4 HOH 28 749 749 HOH HOH A . 
F 4 HOH 29 752 752 HOH HOH A . 
F 4 HOH 30 757 757 HOH HOH A . 
F 4 HOH 31 759 759 HOH HOH A . 
F 4 HOH 32 760 760 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2890  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  27300 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A GLU 119 ? ? CA A GLU 119 ? ? C  A GLU 119 ? ? 90.31  110.40 -20.09 2.00 N 
2 1 N  A GLU 119 ? ? CA A GLU 119 ? ? C  A GLU 119 ? ? 140.14 111.00 29.14  2.70 N 
3 1 C  A GLU 119 ? ? N  A PRO 120 ? ? CA A PRO 120 ? ? 135.16 119.30 15.86  1.50 Y 
4 1 C  A GLU 119 ? ? N  A PRO 120 ? ? CD A PRO 120 ? ? 103.87 128.40 -24.53 2.10 Y 
5 1 N  A LEU 260 ? ? CA A LEU 260 ? ? C  A LEU 260 ? ? 131.07 111.00 20.07  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 95  ? ? -118.28 -128.63 
2 1 GLU A 119 ? ? 74.65   80.80   
3 1 PRO A 120 ? ? 5.98    -50.59  
4 1 ASN A 122 ? ? 81.98   -3.33   
5 1 ARG A 366 ? ? 66.22   100.71  
6 1 SER A 416 ? ? 170.76  163.75  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZH7 'a-form double helix'  
2ZH7 'hairpin loop'         
2ZH7 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 -0.667 -0.266 0.733  4.552   -1.809  -6.837  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.632 -0.032 0.451  12.972  -3.777  6.774   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.171  0.037  -0.225 7.823   -16.493 2.852   3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 0.299  0.161  0.034  -5.977  -6.746  6.201   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 -0.008 0.108  -0.002 10.487  -7.638  8.989   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.462 -0.452 -0.138 3.002   -14.827 9.711   6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 0.533  -0.083 0.101  -3.808  -10.856 -8.025  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.248  -0.190 0.221  1.384   -12.780 -0.968  8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -1.218 -0.112 -0.795 -22.155 -16.516 -3.487  9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 -0.242 -0.161 -0.092 -3.215  -1.227  -3.628  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 -0.014 -0.131 0.099  1.368   -10.849 -0.106  11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 0.314  0.014  -0.204 -11.353 -19.578 -3.053  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.366  -2.670 -0.084 -6.835  9.725   -80.016 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.611  -1.907 2.938 -1.378 2.884  36.393 -3.390 -1.141 2.759 4.606  2.202   
36.529 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.472 -1.831 3.345 2.151  3.757  34.299 -3.656 1.124  3.098 6.339  -3.629  
34.563 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.174 -1.911 3.471 -3.003 6.513  31.319 -4.630 -0.227 3.025 11.871 5.473   
32.109 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 0.056  -1.879 2.786 -0.598 3.924  26.100 -4.963 -0.251 2.480 8.625  1.313   
26.395 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.214  -2.451 3.185 -1.395 17.285 21.392 -8.166 -2.799 0.905 39.280 3.170   
27.474 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.541 -1.919 3.497 -4.744 -3.733 40.774 -2.275 1.616  3.799 -5.323 6.764   
41.200 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.036  -1.968 3.090 3.015  7.111  30.620 -4.780 0.426  2.571 13.203 -5.598  
31.556 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.396  -2.252 3.855 8.367  11.653 20.180 -8.913 1.697  2.238 28.993 -20.815 
24.716 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.799  -1.993 2.849 -5.878 1.971  33.593 -3.654 -2.137 2.559 3.375  10.064  
34.144 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.843 -2.135 3.003 -1.971 5.390  28.068 -5.372 1.317  2.608 10.967 4.011   
28.638 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.156  -1.753 3.550 2.002  10.867 36.904 -4.031 0.015  2.941 16.712 -3.078  
38.468 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.406 -1.637 3.291 -0.677 -6.183 80.477 -1.100 1.068  3.398 -4.779 0.523   
80.676 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#