data_2ZHA
# 
_entry.id   2ZHA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZHA         
NDB   PR0327       
RCSB  RCSB027970   
WWPDB D_1000027970 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH1 . unspecified 
PDB 2ZH2 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH5 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH7 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZHA 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZHA 
_cell.length_a           58.035 
_cell.length_b           58.035 
_cell.length_c           433.992 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZHA 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (33-MER)'            10600.305 1  ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme'        51469.137 1  '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'            24.305    1  ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'              96.063    1  ?                    ? ? ? 
5 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE" 483.156   1  ?                    ? ? ? 
6 water       nat water                      18.015    24 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAU GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAU B ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  U   n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 ? 
2 PDB 2ZHA      2ZHA   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAU 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZHA A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 2ZHA B 1 ? 33  ? 2ZHA   1 ? 33  ? 1 33  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'   323.197 
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'     121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                        ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2ZHA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.94 
_exptl_crystal.density_percent_sol   58.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZHA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.95 
_reflns.number_obs                   16595 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.122 
_reflns.pdbx_netI_over_sigmaI        30.0 
_reflns.B_iso_Wilson_estimate        61.8 
_reflns.pdbx_redundancy              8.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.06 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.353 
_reflns_shell.meanI_over_sigI_obs    6.7 
_reflns_shell.pdbx_redundancy        8.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1613 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZHA 
_refine.ls_number_reflns_obs                     16485 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1641763.40 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.63 
_refine.ls_d_res_high                            2.95 
_refine.ls_percent_reflns_obs                    98.0 
_refine.ls_R_factor_obs                          0.241 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.292 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  810 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               50.8 
_refine.aniso_B[1][1]                            -1.30 
_refine.aniso_B[2][2]                            -1.30 
_refine.aniso_B[3][3]                            2.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.318907 
_refine.solvent_model_param_bsol                 17.3005 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZHA 
_refine_analyze.Luzzati_coordinate_error_obs    0.39 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.65 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3630 
_refine_hist.pdbx_number_atoms_nucleic_acid   703 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               4392 
_refine_hist.d_res_high                       2.95 
_refine_hist.d_res_low                        39.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.24  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.99  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.75  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.27  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.09  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.95 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             2473 
_refine_ls_shell.R_factor_R_work                  0.354 
_refine_ls_shell.percent_reflns_obs               96.6 
_refine_ls_shell.R_factor_R_free                  0.446 
_refine_ls_shell.R_factor_R_free_error            0.041 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 atp2.param        ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZHA 
_struct.title                     'Complex structure of AFCCA with tRNAminiDU and CTP' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZHA 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 2   ? ILE B 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 17  ? GLU B 37  ? ASP A 17  GLU A 37  1 ? 21 
HELX_P HELX_P3  3  GLY B 46  ? ARG B 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 71  ? LEU B 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 125 ? ASP B 128 ? SER A 125 ASP A 128 5 ? 4  
HELX_P HELX_P6  6  ARG B 129 ? GLY B 139 ? ARG A 129 GLY A 139 1 ? 11 
HELX_P HELX_P7  7  LYS B 144 ? ASN B 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P8  8  SER B 171 ? GLY B 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P9  9  SER B 184 ? ARG B 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P10 10 ALA B 204 ? GLY B 206 ? ALA A 204 GLY A 206 5 ? 3  
HELX_P HELX_P11 11 SER B 231 ? ALA B 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P12 12 SER B 250 ? LYS B 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P13 13 GLU B 263 ? GLY B 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P14 14 VAL B 289 ? GLU B 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P15 15 ASP B 351 ? ARG B 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P16 16 THR B 384 ? TRP B 397 ? THR A 384 TRP A 397 1 ? 14 
HELX_P HELX_P17 17 HIS B 398 ? LEU B 400 ? HIS A 398 LEU A 400 5 ? 3  
HELX_P HELX_P18 18 GLY B 401 ? GLU B 410 ? GLY A 401 GLU A 410 1 ? 10 
HELX_P HELX_P19 19 GLU B 418 ? GLU B 423 ? GLU A 418 GLU A 423 5 ? 6  
HELX_P HELX_P20 20 VAL B 425 ? MET B 433 ? VAL A 425 MET A 433 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MG .  MG ? ? ? 1_555 E CTP .  O3G ? ? A MG 502 A CTP 501 1_555 ? ? ? ? ? ? ?                    2.429 ? 
metalc2  metalc ? ? C MG .  MG ? ? ? 1_555 E CTP .  O1A ? ? A MG 502 A CTP 501 1_555 ? ? ? ? ? ? ?                    2.117 ? 
hydrog1  hydrog ? ? A G  1  N1 ? ? ? 1_555 A C   31 N3  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? A G  1  N2 ? ? ? 1_555 A C   31 O2  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? A G  1  O6 ? ? ? 1_555 A C   31 N4  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? A G  2  N1 ? ? ? 1_555 A C   30 N3  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? A G  2  N2 ? ? ? 1_555 A C   30 O2  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? A G  2  O6 ? ? ? 1_555 A C   30 N4  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? A C  3  N3 ? ? ? 1_555 A G   29 N1  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? A C  3  N4 ? ? ? 1_555 A G   29 O6  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? A C  3  O2 ? ? ? 1_555 A G   29 N2  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? A C  4  N3 ? ? ? 1_555 A G   28 N1  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? A C  4  N4 ? ? ? 1_555 A G   28 O6  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? A C  4  O2 ? ? ? 1_555 A G   28 N2  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? A C  5  O2 ? ? ? 1_555 A G   27 N2  ? ? B C  5   B G   27  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog14 hydrog ? ? A G  6  N1 ? ? ? 1_555 A U   26 O2  ? ? B G  6   B U   26  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog15 hydrog ? ? A G  6  O6 ? ? ? 1_555 A U   26 N3  ? ? B G  6   B U   26  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog16 hydrog ? ? A G  7  N1 ? ? ? 1_555 A C   25 N3  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog17 hydrog ? ? A G  7  N2 ? ? ? 1_555 A C   25 O2  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18 hydrog ? ? A G  7  O6 ? ? ? 1_555 A C   25 N4  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? A G  8  N1 ? ? ? 1_555 A C   24 N3  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? A G  8  N2 ? ? ? 1_555 A C   24 O2  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? A G  8  O6 ? ? ? 1_555 A C   24 N4  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? A G  9  N1 ? ? ? 1_555 A C   23 N3  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? A G  9  N2 ? ? ? 1_555 A C   23 O2  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? A G  9  O6 ? ? ? 1_555 A C   23 N4  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? A C  10 N3 ? ? ? 1_555 A G   22 N1  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? A C  10 N4 ? ? ? 1_555 A G   22 O6  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? A C  10 O2 ? ? ? 1_555 A G   22 N2  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog28 hydrog ? ? A G  11 N1 ? ? ? 1_555 A C   21 N3  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? A G  11 N2 ? ? ? 1_555 A C   21 O2  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? A G  11 O6 ? ? ? 1_555 A C   21 N4  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? A G  12 N1 ? ? ? 1_555 A C   20 N3  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? A G  12 N2 ? ? ? 1_555 A C   20 O2  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? A G  12 O6 ? ? ? 1_555 A C   20 N4  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? A U  13 N3 ? ? ? 1_555 A A   17 N7  ? ? B U  13  B A   17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog35 hydrog ? ? A U  13 O2 ? ? ? 1_555 A A   17 N6  ? ? B U  13  B A   17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 42  ? VAL B 45  ? TYR A 42  VAL A 45  
A 2 ILE B 60  ? PHE B 66  ? ILE A 60  PHE A 66  
A 3 VAL B 107 ? TYR B 115 ? VAL A 107 TYR A 115 
A 4 TYR B 99  ? VAL B 104 ? TYR A 99  VAL A 104 
A 5 ILE B 92  ? ARG B 93  ? ILE A 92  ARG A 93  
B 1 GLU B 207 ? LYS B 210 ? GLU A 207 LYS A 210 
B 2 THR B 199 ? ASP B 202 ? THR A 199 ASP A 202 
B 3 PHE B 215 ? ASP B 218 ? PHE A 215 ASP A 218 
B 4 ASP B 221 ? ASN B 225 ? ASP A 221 ASN A 225 
C 1 ARG B 317 ? ALA B 322 ? ARG A 317 ALA A 322 
C 2 PHE B 326 ? CYS B 333 ? PHE A 326 CYS A 333 
C 3 ALA B 277 ? ARG B 284 ? ALA A 277 ARG A 284 
C 4 GLU B 413 ? SER B 416 ? GLU A 413 SER A 416 
D 1 VAL B 341 ? GLN B 348 ? VAL A 341 GLN A 348 
D 2 ARG B 373 ? MET B 379 ? ARG A 373 MET A 379 
D 3 PHE B 368 ? GLU B 370 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 43  ? N VAL A 43  O PHE B 63  ? O PHE A 63  
A 2 3 N ILE B 60  ? N ILE A 60  O ASP B 110 ? O ASP A 110 
A 3 4 O VAL B 111 ? O VAL A 111 N VAL B 100 ? N VAL A 100 
A 4 5 O TYR B 99  ? O TYR A 99  N ARG B 93  ? N ARG A 93  
B 1 2 O ARG B 209 ? O ARG A 209 N VAL B 200 ? N VAL A 200 
B 2 3 N ILE B 201 ? N ILE A 201 O PHE B 215 ? O PHE A 215 
B 3 4 N ASP B 218 ? N ASP A 218 O ARG B 224 ? O ARG A 224 
C 1 2 N ALA B 319 ? N ALA A 319 O LEU B 330 ? O LEU A 330 
C 2 3 O CYS B 333 ? O CYS A 333 N ALA B 277 ? N ALA A 277 
C 3 4 N LYS B 282 ? N LYS A 282 O GLU B 413 ? O GLU A 413 
D 1 2 N PHE B 342 ? N PHE A 342 O GLU B 378 ? O GLU A 378 
D 2 3 O ARG B 373 ? O ARG A 373 N GLU B 370 ? N GLU A 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 502'  
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 503' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CTP A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  GLU B 59  ? GLU A 59  . ? 1_555 ? 
2  AC1 2  ASP B 61  ? ASP A 61  . ? 1_555 ? 
3  AC2 3  ARG B 299 ? ARG A 299 . ? 1_555 ? 
4  AC2 3  ARG B 302 ? ARG A 302 . ? 1_555 ? 
5  AC2 3  LYS B 303 ? LYS A 303 . ? 1_555 ? 
6  AC3 10 GLY B 46  ? GLY A 46  . ? 1_555 ? 
7  AC3 10 SER B 47  ? SER A 47  . ? 1_555 ? 
8  AC3 10 ARG B 50  ? ARG A 50  . ? 1_555 ? 
9  AC3 10 ASP B 61  ? ASP A 61  . ? 1_555 ? 
10 AC3 10 THR B 130 ? THR A 130 . ? 1_555 ? 
11 AC3 10 HIS B 133 ? HIS A 133 . ? 1_555 ? 
12 AC3 10 LYS B 152 ? LYS A 152 . ? 1_555 ? 
13 AC3 10 TYR B 161 ? TYR A 161 . ? 1_555 ? 
14 AC3 10 TYR B 173 ? TYR A 173 . ? 1_555 ? 
15 AC3 10 ARG B 224 ? ARG A 224 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZHA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZHA 
_atom_sites.fract_transf_matrix[1][1]   0.017231 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017231 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002304 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . G   A 1 1   ? -17.375 33.564 35.778  1.00 57.37 ? 1   G   B P     1 
ATOM   2    O  OP1   . G   A 1 1   ? -18.276 32.408 36.205  1.00 56.60 ? 1   G   B OP1   1 
ATOM   3    O  OP2   . G   A 1 1   ? -16.197 33.806 36.728  1.00 56.80 ? 1   G   B OP2   1 
ATOM   4    O  "O5'" . G   A 1 1   ? -16.670 33.112 34.371  1.00 56.71 ? 1   G   B "O5'" 1 
ATOM   5    C  "C5'" . G   A 1 1   ? -15.514 33.819 33.869  1.00 55.13 ? 1   G   B "C5'" 1 
ATOM   6    C  "C4'" . G   A 1 1   ? -14.601 32.901 33.061  1.00 54.08 ? 1   G   B "C4'" 1 
ATOM   7    O  "O4'" . G   A 1 1   ? -14.263 31.708 33.822  1.00 52.57 ? 1   G   B "O4'" 1 
ATOM   8    C  "C3'" . G   A 1 1   ? -15.110 32.361 31.727  1.00 53.14 ? 1   G   B "C3'" 1 
ATOM   9    O  "O3'" . G   A 1 1   ? -15.007 33.315 30.672  1.00 51.02 ? 1   G   B "O3'" 1 
ATOM   10   C  "C2'" . G   A 1 1   ? -14.197 31.157 31.507  1.00 52.45 ? 1   G   B "C2'" 1 
ATOM   11   O  "O2'" . G   A 1 1   ? -12.909 31.468 31.007  1.00 52.01 ? 1   G   B "O2'" 1 
ATOM   12   C  "C1'" . G   A 1 1   ? -14.075 30.616 32.934  1.00 51.86 ? 1   G   B "C1'" 1 
ATOM   13   N  N9    . G   A 1 1   ? -15.105 29.623 33.210  1.00 51.39 ? 1   G   B N9    1 
ATOM   14   C  C8    . G   A 1 1   ? -16.193 29.758 34.037  1.00 51.00 ? 1   G   B C8    1 
ATOM   15   N  N7    . G   A 1 1   ? -16.949 28.695 34.066  1.00 50.93 ? 1   G   B N7    1 
ATOM   16   C  C5    . G   A 1 1   ? -16.316 27.801 33.211  1.00 51.81 ? 1   G   B C5    1 
ATOM   17   C  C6    . G   A 1 1   ? -16.665 26.476 32.838  1.00 51.63 ? 1   G   B C6    1 
ATOM   18   O  O6    . G   A 1 1   ? -17.622 25.798 33.220  1.00 52.09 ? 1   G   B O6    1 
ATOM   19   N  N1    . G   A 1 1   ? -15.761 25.945 31.920  1.00 51.97 ? 1   G   B N1    1 
ATOM   20   C  C2    . G   A 1 1   ? -14.653 26.596 31.430  1.00 51.87 ? 1   G   B C2    1 
ATOM   21   N  N2    . G   A 1 1   ? -13.908 25.916 30.535  1.00 50.96 ? 1   G   B N2    1 
ATOM   22   N  N3    . G   A 1 1   ? -14.303 27.824 31.787  1.00 52.26 ? 1   G   B N3    1 
ATOM   23   C  C4    . G   A 1 1   ? -15.178 28.363 32.671  1.00 52.04 ? 1   G   B C4    1 
ATOM   24   P  P     . G   A 1 2   ? -16.242 33.506 29.656  1.00 54.26 ? 2   G   B P     1 
ATOM   25   O  OP1   . G   A 1 2   ? -16.096 34.809 28.953  1.00 52.75 ? 2   G   B OP1   1 
ATOM   26   O  OP2   . G   A 1 2   ? -17.487 33.222 30.409  1.00 54.07 ? 2   G   B OP2   1 
ATOM   27   O  "O5'" . G   A 1 2   ? -16.041 32.327 28.596  1.00 57.75 ? 2   G   B "O5'" 1 
ATOM   28   C  "C5'" . G   A 1 2   ? -14.949 32.355 27.665  1.00 58.82 ? 2   G   B "C5'" 1 
ATOM   29   C  "C4'" . G   A 1 2   ? -14.837 31.038 26.921  1.00 59.03 ? 2   G   B "C4'" 1 
ATOM   30   O  "O4'" . G   A 1 2   ? -14.490 29.981 27.854  1.00 59.32 ? 2   G   B "O4'" 1 
ATOM   31   C  "C3'" . G   A 1 2   ? -16.088 30.527 26.216  1.00 58.62 ? 2   G   B "C3'" 1 
ATOM   32   O  "O3'" . G   A 1 2   ? -16.220 31.105 24.921  1.00 57.72 ? 2   G   B "O3'" 1 
ATOM   33   C  "C2'" . G   A 1 2   ? -15.780 29.042 26.108  1.00 59.36 ? 2   G   B "C2'" 1 
ATOM   34   O  "O2'" . G   A 1 2   ? -14.836 28.775 25.091  1.00 59.28 ? 2   G   B "O2'" 1 
ATOM   35   C  "C1'" . G   A 1 2   ? -15.131 28.776 27.467  1.00 60.50 ? 2   G   B "C1'" 1 
ATOM   36   N  N9    . G   A 1 2   ? -16.129 28.435 28.479  1.00 62.35 ? 2   G   B N9    1 
ATOM   37   C  C8    . G   A 1 2   ? -16.704 29.275 29.410  1.00 62.56 ? 2   G   B C8    1 
ATOM   38   N  N7    . G   A 1 2   ? -17.610 28.683 30.143  1.00 62.48 ? 2   G   B N7    1 
ATOM   39   C  C5    . G   A 1 2   ? -17.626 27.370 29.677  1.00 62.17 ? 2   G   B C5    1 
ATOM   40   C  C6    . G   A 1 2   ? -18.416 26.255 30.074  1.00 61.48 ? 2   G   B C6    1 
ATOM   41   O  O6    . G   A 1 2   ? -19.292 26.198 30.949  1.00 61.18 ? 2   G   B O6    1 
ATOM   42   N  N1    . G   A 1 2   ? -18.103 25.122 29.335  1.00 61.15 ? 2   G   B N1    1 
ATOM   43   C  C2    . G   A 1 2   ? -17.154 25.056 28.352  1.00 61.38 ? 2   G   B C2    1 
ATOM   44   N  N2    . G   A 1 2   ? -16.981 23.861 27.772  1.00 61.51 ? 2   G   B N2    1 
ATOM   45   N  N3    . G   A 1 2   ? -16.422 26.081 27.965  1.00 62.14 ? 2   G   B N3    1 
ATOM   46   C  C4    . G   A 1 2   ? -16.707 27.199 28.662  1.00 62.21 ? 2   G   B C4    1 
ATOM   47   P  P     . C   A 1 3   ? -17.677 31.271 24.264  1.00 39.47 ? 3   C   B P     1 
ATOM   48   O  OP1   . C   A 1 3   ? -17.562 32.085 23.025  1.00 40.58 ? 3   C   B OP1   1 
ATOM   49   O  OP2   . C   A 1 3   ? -18.585 31.709 25.347  1.00 41.15 ? 3   C   B OP2   1 
ATOM   50   O  "O5'" . C   A 1 3   ? -18.105 29.796 23.850  1.00 42.55 ? 3   C   B "O5'" 1 
ATOM   51   C  "C5'" . C   A 1 3   ? -17.322 29.025 22.949  1.00 43.71 ? 3   C   B "C5'" 1 
ATOM   52   C  "C4'" . C   A 1 3   ? -17.746 27.580 23.005  1.00 45.34 ? 3   C   B "C4'" 1 
ATOM   53   O  "O4'" . C   A 1 3   ? -17.450 27.035 24.319  1.00 47.65 ? 3   C   B "O4'" 1 
ATOM   54   C  "C3'" . C   A 1 3   ? -19.236 27.345 22.857  1.00 45.84 ? 3   C   B "C3'" 1 
ATOM   55   O  "O3'" . C   A 1 3   ? -19.629 27.363 21.497  1.00 45.96 ? 3   C   B "O3'" 1 
ATOM   56   C  "C2'" . C   A 1 3   ? -19.397 25.969 23.483  1.00 47.13 ? 3   C   B "C2'" 1 
ATOM   57   O  "O2'" . C   A 1 3   ? -18.979 24.925 22.632  1.00 46.29 ? 3   C   B "O2'" 1 
ATOM   58   C  "C1'" . C   A 1 3   ? -18.443 26.075 24.671  1.00 49.48 ? 3   C   B "C1'" 1 
ATOM   59   N  N1    . C   A 1 3   ? -19.154 26.535 25.883  1.00 52.50 ? 3   C   B N1    1 
ATOM   60   C  C2    . C   A 1 3   ? -19.875 25.602 26.628  1.00 52.68 ? 3   C   B C2    1 
ATOM   61   O  O2    . C   A 1 3   ? -19.844 24.415 26.285  1.00 53.59 ? 3   C   B O2    1 
ATOM   62   N  N3    . C   A 1 3   ? -20.586 26.018 27.698  1.00 53.48 ? 3   C   B N3    1 
ATOM   63   C  C4    . C   A 1 3   ? -20.593 27.311 28.032  1.00 53.79 ? 3   C   B C4    1 
ATOM   64   N  N4    . C   A 1 3   ? -21.335 27.687 29.076  1.00 54.37 ? 3   C   B N4    1 
ATOM   65   C  C5    . C   A 1 3   ? -19.841 28.278 27.310  1.00 53.54 ? 3   C   B C5    1 
ATOM   66   C  C6    . C   A 1 3   ? -19.137 27.850 26.255  1.00 53.26 ? 3   C   B C6    1 
ATOM   67   P  P     . C   A 1 4   ? -21.074 27.932 21.104  1.00 51.23 ? 4   C   B P     1 
ATOM   68   O  OP1   . C   A 1 4   ? -21.063 28.298 19.666  1.00 50.05 ? 4   C   B OP1   1 
ATOM   69   O  OP2   . C   A 1 4   ? -21.404 28.956 22.120  1.00 52.46 ? 4   C   B OP2   1 
ATOM   70   O  "O5'" . C   A 1 4   ? -22.055 26.699 21.339  1.00 52.52 ? 4   C   B "O5'" 1 
ATOM   71   C  "C5'" . C   A 1 4   ? -21.907 25.504 20.578  1.00 55.13 ? 4   C   B "C5'" 1 
ATOM   72   C  "C4'" . C   A 1 4   ? -22.821 24.422 21.099  1.00 55.60 ? 4   C   B "C4'" 1 
ATOM   73   O  "O4'" . C   A 1 4   ? -22.380 23.995 22.413  1.00 56.18 ? 4   C   B "O4'" 1 
ATOM   74   C  "C3'" . C   A 1 4   ? -24.262 24.833 21.311  1.00 56.46 ? 4   C   B "C3'" 1 
ATOM   75   O  "O3'" . C   A 1 4   ? -24.996 24.799 20.098  1.00 56.82 ? 4   C   B "O3'" 1 
ATOM   76   C  "C2'" . C   A 1 4   ? -24.734 23.786 22.308  1.00 56.92 ? 4   C   B "C2'" 1 
ATOM   77   O  "O2'" . C   A 1 4   ? -24.976 22.528 21.715  1.00 57.00 ? 4   C   B "O2'" 1 
ATOM   78   C  "C1'" . C   A 1 4   ? -23.509 23.678 23.210  1.00 57.25 ? 4   C   B "C1'" 1 
ATOM   79   N  N1    . C   A 1 4   ? -23.560 24.614 24.343  1.00 58.47 ? 4   C   B N1    1 
ATOM   80   C  C2    . C   A 1 4   ? -24.597 24.489 25.263  1.00 59.17 ? 4   C   B C2    1 
ATOM   81   O  O2    . C   A 1 4   ? -25.449 23.616 25.076  1.00 59.34 ? 4   C   B O2    1 
ATOM   82   N  N3    . C   A 1 4   ? -24.652 25.328 26.327  1.00 60.01 ? 4   C   B N3    1 
ATOM   83   C  C4    . C   A 1 4   ? -23.719 26.274 26.478  1.00 60.45 ? 4   C   B C4    1 
ATOM   84   N  N4    . C   A 1 4   ? -23.806 27.083 27.542  1.00 59.70 ? 4   C   B N4    1 
ATOM   85   C  C5    . C   A 1 4   ? -22.654 26.433 25.543  1.00 60.76 ? 4   C   B C5    1 
ATOM   86   C  C6    . C   A 1 4   ? -22.611 25.586 24.501  1.00 60.02 ? 4   C   B C6    1 
ATOM   87   P  P     . C   A 1 5   ? -26.304 25.727 19.939  1.00 69.62 ? 5   C   B P     1 
ATOM   88   O  OP1   . C   A 1 5   ? -26.777 25.625 18.530  1.00 68.98 ? 5   C   B OP1   1 
ATOM   89   O  OP2   . C   A 1 5   ? -25.989 27.060 20.517  1.00 69.04 ? 5   C   B OP2   1 
ATOM   90   O  "O5'" . C   A 1 5   ? -27.384 25.058 20.905  1.00 68.12 ? 5   C   B "O5'" 1 
ATOM   91   C  "C5'" . C   A 1 5   ? -27.989 23.814 20.580  1.00 67.01 ? 5   C   B "C5'" 1 
ATOM   92   C  "C4'" . C   A 1 5   ? -28.958 23.409 21.663  1.00 67.08 ? 5   C   B "C4'" 1 
ATOM   93   O  "O4'" . C   A 1 5   ? -28.241 23.232 22.917  1.00 66.37 ? 5   C   B "O4'" 1 
ATOM   94   C  "C3'" . C   A 1 5   ? -30.021 24.431 22.029  1.00 67.10 ? 5   C   B "C3'" 1 
ATOM   95   O  "O3'" . C   A 1 5   ? -31.118 24.459 21.128  1.00 67.39 ? 5   C   B "O3'" 1 
ATOM   96   C  "C2'" . C   A 1 5   ? -30.447 23.955 23.409  1.00 66.26 ? 5   C   B "C2'" 1 
ATOM   97   O  "O2'" . C   A 1 5   ? -31.330 22.852 23.357  1.00 65.02 ? 5   C   B "O2'" 1 
ATOM   98   C  "C1'" . C   A 1 5   ? -29.097 23.559 24.006  1.00 66.16 ? 5   C   B "C1'" 1 
ATOM   99   N  N1    . C   A 1 5   ? -28.506 24.690 24.738  1.00 66.51 ? 5   C   B N1    1 
ATOM   100  C  C2    . C   A 1 5   ? -28.906 24.920 26.062  1.00 66.28 ? 5   C   B C2    1 
ATOM   101  O  O2    . C   A 1 5   ? -29.718 24.144 26.587  1.00 65.52 ? 5   C   B O2    1 
ATOM   102  N  N3    . C   A 1 5   ? -28.397 25.979 26.732  1.00 66.57 ? 5   C   B N3    1 
ATOM   103  C  C4    . C   A 1 5   ? -27.521 26.791 26.132  1.00 67.15 ? 5   C   B C4    1 
ATOM   104  N  N4    . C   A 1 5   ? -27.058 27.839 26.826  1.00 67.18 ? 5   C   B N4    1 
ATOM   105  C  C5    . C   A 1 5   ? -27.083 26.570 24.789  1.00 67.15 ? 5   C   B C5    1 
ATOM   106  C  C6    . C   A 1 5   ? -27.594 25.516 24.137  1.00 66.84 ? 5   C   B C6    1 
ATOM   107  P  P     . G   A 1 6   ? -31.984 25.806 20.993  1.00 80.93 ? 6   G   B P     1 
ATOM   108  O  OP1   . G   A 1 6   ? -33.101 25.557 20.047  1.00 80.96 ? 6   G   B OP1   1 
ATOM   109  O  OP2   . G   A 1 6   ? -31.013 26.893 20.712  1.00 80.94 ? 6   G   B OP2   1 
ATOM   110  O  "O5'" . G   A 1 6   ? -32.581 26.044 22.458  1.00 80.00 ? 6   G   B "O5'" 1 
ATOM   111  C  "C5'" . G   A 1 6   ? -33.438 25.077 23.055  1.00 79.40 ? 6   G   B "C5'" 1 
ATOM   112  C  "C4'" . G   A 1 6   ? -34.113 25.631 24.293  1.00 79.65 ? 6   G   B "C4'" 1 
ATOM   113  O  "O4'" . G   A 1 6   ? -33.210 25.659 25.427  1.00 79.64 ? 6   G   B "O4'" 1 
ATOM   114  C  "C3'" . G   A 1 6   ? -34.645 27.050 24.250  1.00 79.98 ? 6   G   B "C3'" 1 
ATOM   115  O  "O3'" . G   A 1 6   ? -35.855 27.142 23.507  1.00 81.58 ? 6   G   B "O3'" 1 
ATOM   116  C  "C2'" . G   A 1 6   ? -34.875 27.330 25.731  1.00 79.78 ? 6   G   B "C2'" 1 
ATOM   117  O  "O2'" . G   A 1 6   ? -36.082 26.783 26.213  1.00 78.69 ? 6   G   B "O2'" 1 
ATOM   118  C  "C1'" . G   A 1 6   ? -33.683 26.612 26.370  1.00 80.03 ? 6   G   B "C1'" 1 
ATOM   119  N  N9    . G   A 1 6   ? -32.609 27.548 26.677  1.00 81.70 ? 6   G   B N9    1 
ATOM   120  C  C8    . G   A 1 6   ? -31.527 27.869 25.889  1.00 82.56 ? 6   G   B C8    1 
ATOM   121  N  N7    . G   A 1 6   ? -30.754 28.778 26.423  1.00 82.73 ? 6   G   B N7    1 
ATOM   122  C  C5    . G   A 1 6   ? -31.357 29.067 27.640  1.00 82.64 ? 6   G   B C5    1 
ATOM   123  C  C6    . G   A 1 6   ? -30.979 29.983 28.658  1.00 82.86 ? 6   G   B C6    1 
ATOM   124  O  O6    . G   A 1 6   ? -30.003 30.746 28.687  1.00 82.54 ? 6   G   B O6    1 
ATOM   125  N  N1    . G   A 1 6   ? -31.876 29.958 29.723  1.00 83.15 ? 6   G   B N1    1 
ATOM   126  C  C2    . G   A 1 6   ? -32.993 29.155 29.800  1.00 83.14 ? 6   G   B C2    1 
ATOM   127  N  N2    . G   A 1 6   ? -33.738 29.277 30.914  1.00 83.60 ? 6   G   B N2    1 
ATOM   128  N  N3    . G   A 1 6   ? -33.354 28.297 28.857  1.00 82.28 ? 6   G   B N3    1 
ATOM   129  C  C4    . G   A 1 6   ? -32.499 28.307 27.814  1.00 82.17 ? 6   G   B C4    1 
ATOM   130  P  P     . G   A 1 7   ? -36.588 28.570 23.345  1.00 88.87 ? 7   G   B P     1 
ATOM   131  O  OP1   . G   A 1 7   ? -37.603 28.438 22.262  1.00 88.18 ? 7   G   B OP1   1 
ATOM   132  O  OP2   . G   A 1 7   ? -35.564 29.643 23.262  1.00 88.05 ? 7   G   B OP2   1 
ATOM   133  O  "O5'" . G   A 1 7   ? -37.344 28.748 24.735  1.00 87.75 ? 7   G   B "O5'" 1 
ATOM   134  C  "C5'" . G   A 1 7   ? -37.732 30.027 25.197  1.00 87.11 ? 7   G   B "C5'" 1 
ATOM   135  C  "C4'" . G   A 1 7   ? -37.965 29.980 26.682  1.00 88.00 ? 7   G   B "C4'" 1 
ATOM   136  O  "O4'" . G   A 1 7   ? -36.762 29.506 27.347  1.00 88.32 ? 7   G   B "O4'" 1 
ATOM   137  C  "C3'" . G   A 1 7   ? -38.242 31.332 27.306  1.00 88.48 ? 7   G   B "C3'" 1 
ATOM   138  O  "O3'" . G   A 1 7   ? -39.623 31.648 27.172  1.00 89.14 ? 7   G   B "O3'" 1 
ATOM   139  C  "C2'" . G   A 1 7   ? -37.783 31.122 28.745  1.00 88.12 ? 7   G   B "C2'" 1 
ATOM   140  O  "O2'" . G   A 1 7   ? -38.710 30.409 29.533  1.00 87.29 ? 7   G   B "O2'" 1 
ATOM   141  C  "C1'" . G   A 1 7   ? -36.536 30.261 28.531  1.00 87.77 ? 7   G   B "C1'" 1 
ATOM   142  N  N9    . G   A 1 7   ? -35.325 31.056 28.332  1.00 87.33 ? 7   G   B N9    1 
ATOM   143  C  C8    . G   A 1 7   ? -34.493 31.032 27.235  1.00 86.86 ? 7   G   B C8    1 
ATOM   144  N  N7    . G   A 1 7   ? -33.488 31.859 27.334  1.00 86.04 ? 7   G   B N7    1 
ATOM   145  C  C5    . G   A 1 7   ? -33.661 32.463 28.570  1.00 86.48 ? 7   G   B C5    1 
ATOM   146  C  C6    . G   A 1 7   ? -32.878 33.443 29.222  1.00 86.95 ? 7   G   B C6    1 
ATOM   147  O  O6    . G   A 1 7   ? -31.839 33.987 28.823  1.00 87.62 ? 7   G   B O6    1 
ATOM   148  N  N1    . G   A 1 7   ? -33.412 33.783 30.462  1.00 86.42 ? 7   G   B N1    1 
ATOM   149  C  C2    . G   A 1 7   ? -34.556 33.245 31.005  1.00 86.14 ? 7   G   B C2    1 
ATOM   150  N  N2    . G   A 1 7   ? -34.915 33.713 32.211  1.00 86.00 ? 7   G   B N2    1 
ATOM   151  N  N3    . G   A 1 7   ? -35.292 32.319 30.408  1.00 86.07 ? 7   G   B N3    1 
ATOM   152  C  C4    . G   A 1 7   ? -34.790 31.979 29.201  1.00 86.56 ? 7   G   B C4    1 
ATOM   153  P  P     . G   A 1 8   ? -40.054 32.983 26.391  1.00 83.12 ? 8   G   B P     1 
ATOM   154  O  OP1   . G   A 1 8   ? -41.478 32.869 25.988  1.00 83.49 ? 8   G   B OP1   1 
ATOM   155  O  OP2   . G   A 1 8   ? -39.020 33.246 25.357  1.00 82.61 ? 8   G   B OP2   1 
ATOM   156  O  "O5'" . G   A 1 8   ? -39.943 34.101 27.516  1.00 81.89 ? 8   G   B "O5'" 1 
ATOM   157  C  "C5'" . G   A 1 8   ? -40.662 33.972 28.738  1.00 80.33 ? 8   G   B "C5'" 1 
ATOM   158  C  "C4'" . G   A 1 8   ? -40.126 34.941 29.760  1.00 79.73 ? 8   G   B "C4'" 1 
ATOM   159  O  "O4'" . G   A 1 8   ? -38.821 34.500 30.229  1.00 79.04 ? 8   G   B "O4'" 1 
ATOM   160  C  "C3'" . G   A 1 8   ? -39.844 36.333 29.227  1.00 79.63 ? 8   G   B "C3'" 1 
ATOM   161  O  "O3'" . G   A 1 8   ? -41.011 37.123 29.066  1.00 80.68 ? 8   G   B "O3'" 1 
ATOM   162  C  "C2'" . G   A 1 8   ? -38.877 36.865 30.273  1.00 78.74 ? 8   G   B "C2'" 1 
ATOM   163  O  "O2'" . G   A 1 8   ? -39.499 37.254 31.483  1.00 76.90 ? 8   G   B "O2'" 1 
ATOM   164  C  "C1'" . G   A 1 8   ? -37.999 35.632 30.481  1.00 78.01 ? 8   G   B "C1'" 1 
ATOM   165  N  N9    . G   A 1 8   ? -36.905 35.638 29.512  1.00 77.36 ? 8   G   B N9    1 
ATOM   166  C  C8    . G   A 1 8   ? -36.783 34.889 28.362  1.00 76.66 ? 8   G   B C8    1 
ATOM   167  N  N7    . G   A 1 8   ? -35.699 35.166 27.681  1.00 76.02 ? 8   G   B N7    1 
ATOM   168  C  C5    . G   A 1 8   ? -35.066 36.150 28.433  1.00 75.65 ? 8   G   B C5    1 
ATOM   169  C  C6    . G   A 1 8   ? -33.854 36.855 28.201  1.00 74.92 ? 8   G   B C6    1 
ATOM   170  O  O6    . G   A 1 8   ? -33.067 36.755 27.247  1.00 74.85 ? 8   G   B O6    1 
ATOM   171  N  N1    . G   A 1 8   ? -33.591 37.762 29.223  1.00 74.30 ? 8   G   B N1    1 
ATOM   172  C  C2    . G   A 1 8   ? -34.388 37.972 30.323  1.00 74.38 ? 8   G   B C2    1 
ATOM   173  N  N2    . G   A 1 8   ? -33.968 38.892 31.203  1.00 74.47 ? 8   G   B N2    1 
ATOM   174  N  N3    . G   A 1 8   ? -35.515 37.329 30.547  1.00 74.88 ? 8   G   B N3    1 
ATOM   175  C  C4    . G   A 1 8   ? -35.792 36.441 29.570  1.00 76.17 ? 8   G   B C4    1 
ATOM   176  P  P     . G   A 1 9   ? -41.072 38.202 27.872  1.00 90.53 ? 9   G   B P     1 
ATOM   177  O  OP1   . G   A 1 9   ? -42.303 37.948 27.079  1.00 90.05 ? 9   G   B OP1   1 
ATOM   178  O  OP2   . G   A 1 9   ? -39.751 38.210 27.185  1.00 89.97 ? 9   G   B OP2   1 
ATOM   179  O  "O5'" . G   A 1 9   ? -41.226 39.585 28.651  1.00 89.01 ? 9   G   B "O5'" 1 
ATOM   180  C  "C5'" . G   A 1 9   ? -40.432 40.716 28.312  1.00 86.45 ? 9   G   B "C5'" 1 
ATOM   181  C  "C4'" . G   A 1 9   ? -39.436 41.002 29.410  1.00 84.54 ? 9   G   B "C4'" 1 
ATOM   182  O  "O4'" . G   A 1 9   ? -38.460 39.929 29.456  1.00 83.77 ? 9   G   B "O4'" 1 
ATOM   183  C  "C3'" . G   A 1 9   ? -38.612 42.255 29.178  1.00 83.91 ? 9   G   B "C3'" 1 
ATOM   184  O  "O3'" . G   A 1 9   ? -39.307 43.388 29.682  1.00 84.44 ? 9   G   B "O3'" 1 
ATOM   185  C  "C2'" . G   A 1 9   ? -37.333 41.963 29.943  1.00 83.20 ? 9   G   B "C2'" 1 
ATOM   186  O  "O2'" . G   A 1 9   ? -37.475 42.191 31.329  1.00 82.73 ? 9   G   B "O2'" 1 
ATOM   187  C  "C1'" . G   A 1 9   ? -37.165 40.466 29.676  1.00 82.28 ? 9   G   B "C1'" 1 
ATOM   188  N  N9    . G   A 1 9   ? -36.333 40.136 28.520  1.00 80.25 ? 9   G   B N9    1 
ATOM   189  C  C8    . G   A 1 9   ? -36.642 39.259 27.508  1.00 79.58 ? 9   G   B C8    1 
ATOM   190  N  N7    . G   A 1 9   ? -35.675 39.109 26.644  1.00 78.70 ? 9   G   B N7    1 
ATOM   191  C  C5    . G   A 1 9   ? -34.670 39.947 27.105  1.00 78.60 ? 9   G   B C5    1 
ATOM   192  C  C6    . G   A 1 9   ? -33.365 40.190 26.591  1.00 78.38 ? 9   G   B C6    1 
ATOM   193  O  O6    . G   A 1 9   ? -32.811 39.669 25.613  1.00 78.47 ? 9   G   B O6    1 
ATOM   194  N  N1    . G   A 1 9   ? -32.686 41.135 27.353  1.00 77.70 ? 9   G   B N1    1 
ATOM   195  C  C2    . G   A 1 9   ? -33.185 41.752 28.473  1.00 77.77 ? 9   G   B C2    1 
ATOM   196  N  N2    . G   A 1 9   ? -32.379 42.641 29.065  1.00 77.72 ? 9   G   B N2    1 
ATOM   197  N  N3    . G   A 1 9   ? -34.387 41.515 28.977  1.00 78.27 ? 9   G   B N3    1 
ATOM   198  C  C4    . G   A 1 9   ? -35.070 40.609 28.248  1.00 79.05 ? 9   G   B C4    1 
ATOM   199  P  P     . C   A 1 10  ? -40.082 44.341 28.654  1.00 79.44 ? 10  C   B P     1 
ATOM   200  O  OP1   . C   A 1 10  ? -40.016 45.732 29.178  1.00 79.19 ? 10  C   B OP1   1 
ATOM   201  O  OP2   . C   A 1 10  ? -41.410 43.722 28.394  1.00 79.15 ? 10  C   B OP2   1 
ATOM   202  O  "O5'" . C   A 1 10  ? -39.196 44.187 27.331  1.00 76.22 ? 10  C   B "O5'" 1 
ATOM   203  C  "C5'" . C   A 1 10  ? -38.664 45.319 26.641  1.00 71.34 ? 10  C   B "C5'" 1 
ATOM   204  C  "C4'" . C   A 1 10  ? -37.383 45.800 27.296  1.00 67.09 ? 10  C   B "C4'" 1 
ATOM   205  O  "O4'" . C   A 1 10  ? -36.533 44.675 27.640  1.00 64.87 ? 10  C   B "O4'" 1 
ATOM   206  C  "C3'" . C   A 1 10  ? -36.511 46.664 26.399  1.00 66.14 ? 10  C   B "C3'" 1 
ATOM   207  O  "O3'" . C   A 1 10  ? -36.920 48.018 26.367  1.00 66.62 ? 10  C   B "O3'" 1 
ATOM   208  C  "C2'" . C   A 1 10  ? -35.127 46.489 27.005  1.00 64.81 ? 10  C   B "C2'" 1 
ATOM   209  O  "O2'" . C   A 1 10  ? -34.849 47.325 28.108  1.00 63.51 ? 10  C   B "O2'" 1 
ATOM   210  C  "C1'" . C   A 1 10  ? -35.172 45.017 27.407  1.00 63.72 ? 10  C   B "C1'" 1 
ATOM   211  N  N1    . C   A 1 10  ? -34.664 44.176 26.315  1.00 62.02 ? 10  C   B N1    1 
ATOM   212  C  C2    . C   A 1 10  ? -33.331 44.326 25.935  1.00 61.02 ? 10  C   B C2    1 
ATOM   213  O  O2    . C   A 1 10  ? -32.637 45.178 26.518  1.00 60.27 ? 10  C   B O2    1 
ATOM   214  N  N3    . C   A 1 10  ? -32.834 43.551 24.942  1.00 60.23 ? 10  C   B N3    1 
ATOM   215  C  C4    . C   A 1 10  ? -33.622 42.664 24.332  1.00 59.58 ? 10  C   B C4    1 
ATOM   216  N  N4    . C   A 1 10  ? -33.088 41.915 23.367  1.00 58.16 ? 10  C   B N4    1 
ATOM   217  C  C5    . C   A 1 10  ? -34.994 42.503 24.689  1.00 59.97 ? 10  C   B C5    1 
ATOM   218  C  C6    . C   A 1 10  ? -35.468 43.270 25.679  1.00 60.73 ? 10  C   B C6    1 
ATOM   219  P  P     . G   A 1 11  ? -36.868 48.816 24.977  1.00 64.99 ? 11  G   B P     1 
ATOM   220  O  OP1   . G   A 1 11  ? -37.531 50.137 25.184  1.00 64.86 ? 11  G   B OP1   1 
ATOM   221  O  OP2   . G   A 1 11  ? -37.388 47.882 23.933  1.00 63.60 ? 11  G   B OP2   1 
ATOM   222  O  "O5'" . G   A 1 11  ? -35.309 49.060 24.727  1.00 62.56 ? 11  G   B "O5'" 1 
ATOM   223  C  "C5'" . G   A 1 11  ? -34.584 49.985 25.533  1.00 61.21 ? 11  G   B "C5'" 1 
ATOM   224  C  "C4'" . G   A 1 11  ? -33.132 50.050 25.106  1.00 59.99 ? 11  G   B "C4'" 1 
ATOM   225  O  "O4'" . G   A 1 11  ? -32.522 48.740 25.267  1.00 59.07 ? 11  G   B "O4'" 1 
ATOM   226  C  "C3'" . G   A 1 11  ? -32.846 50.397 23.654  1.00 59.22 ? 11  G   B "C3'" 1 
ATOM   227  O  "O3'" . G   A 1 11  ? -32.929 51.799 23.403  1.00 59.85 ? 11  G   B "O3'" 1 
ATOM   228  C  "C2'" . G   A 1 11  ? -31.429 49.857 23.491  1.00 57.88 ? 11  G   B "C2'" 1 
ATOM   229  O  "O2'" . G   A 1 11  ? -30.443 50.671 24.098  1.00 56.51 ? 11  G   B "O2'" 1 
ATOM   230  C  "C1'" . G   A 1 11  ? -31.528 48.547 24.271  1.00 56.64 ? 11  G   B "C1'" 1 
ATOM   231  N  N9    . G   A 1 11  ? -31.937 47.428 23.429  1.00 53.63 ? 11  G   B N9    1 
ATOM   232  C  C8    . G   A 1 11  ? -33.171 46.827 23.387  1.00 53.33 ? 11  G   B C8    1 
ATOM   233  N  N7    . G   A 1 11  ? -33.242 45.863 22.511  1.00 52.34 ? 11  G   B N7    1 
ATOM   234  C  C5    . G   A 1 11  ? -31.975 45.822 21.947  1.00 52.53 ? 11  G   B C5    1 
ATOM   235  C  C6    . G   A 1 11  ? -31.447 44.977 20.938  1.00 52.91 ? 11  G   B C6    1 
ATOM   236  O  O6    . G   A 1 11  ? -32.011 44.058 20.321  1.00 53.89 ? 11  G   B O6    1 
ATOM   237  N  N1    . G   A 1 11  ? -30.120 45.285 20.661  1.00 51.55 ? 11  G   B N1    1 
ATOM   238  C  C2    . G   A 1 11  ? -29.396 46.273 21.276  1.00 50.92 ? 11  G   B C2    1 
ATOM   239  N  N2    . G   A 1 11  ? -28.146 46.432 20.843  1.00 51.45 ? 11  G   B N2    1 
ATOM   240  N  N3    . G   A 1 11  ? -29.868 47.050 22.232  1.00 51.07 ? 11  G   B N3    1 
ATOM   241  C  C4    . G   A 1 11  ? -31.157 46.777 22.509  1.00 52.04 ? 11  G   B C4    1 
ATOM   242  P  P     . G   A 1 12  ? -33.401 52.315 21.951  1.00 66.62 ? 12  G   B P     1 
ATOM   243  O  OP1   . G   A 1 12  ? -33.667 53.780 22.021  1.00 65.61 ? 12  G   B OP1   1 
ATOM   244  O  OP2   . G   A 1 12  ? -34.471 51.392 21.487  1.00 65.83 ? 12  G   B OP2   1 
ATOM   245  O  "O5'" . G   A 1 12  ? -32.125 52.074 21.030  1.00 63.94 ? 12  G   B "O5'" 1 
ATOM   246  C  "C5'" . G   A 1 12  ? -30.864 52.624 21.386  1.00 61.66 ? 12  G   B "C5'" 1 
ATOM   247  C  "C4'" . G   A 1 12  ? -29.777 52.000 20.554  1.00 60.40 ? 12  G   B "C4'" 1 
ATOM   248  O  "O4'" . G   A 1 12  ? -29.724 50.578 20.837  1.00 59.88 ? 12  G   B "O4'" 1 
ATOM   249  C  "C3'" . G   A 1 12  ? -29.990 52.050 19.051  1.00 59.62 ? 12  G   B "C3'" 1 
ATOM   250  O  "O3'" . G   A 1 12  ? -29.596 53.302 18.515  1.00 60.17 ? 12  G   B "O3'" 1 
ATOM   251  C  "C2'" . G   A 1 12  ? -29.096 50.916 18.576  1.00 59.05 ? 12  G   B "C2'" 1 
ATOM   252  O  "O2'" . G   A 1 12  ? -27.724 51.268 18.578  1.00 56.96 ? 12  G   B "O2'" 1 
ATOM   253  C  "C1'" . G   A 1 12  ? -29.355 49.874 19.664  1.00 58.94 ? 12  G   B "C1'" 1 
ATOM   254  N  N9    . G   A 1 12  ? -30.447 48.974 19.326  1.00 58.77 ? 12  G   B N9    1 
ATOM   255  C  C8    . G   A 1 12  ? -31.748 49.049 19.764  1.00 58.54 ? 12  G   B C8    1 
ATOM   256  N  N7    . G   A 1 12  ? -32.503 48.096 19.289  1.00 58.59 ? 12  G   B N7    1 
ATOM   257  C  C5    . G   A 1 12  ? -31.650 47.350 18.486  1.00 59.30 ? 12  G   B C5    1 
ATOM   258  C  C6    . G   A 1 12  ? -31.900 46.192 17.705  1.00 59.42 ? 12  G   B C6    1 
ATOM   259  O  O6    . G   A 1 12  ? -32.961 45.572 17.562  1.00 60.32 ? 12  G   B O6    1 
ATOM   260  N  N1    . G   A 1 12  ? -30.751 45.760 17.049  1.00 58.74 ? 12  G   B N1    1 
ATOM   261  C  C2    . G   A 1 12  ? -29.519 46.357 17.136  1.00 58.13 ? 12  G   B C2    1 
ATOM   262  N  N2    . G   A 1 12  ? -28.538 45.785 16.424  1.00 57.76 ? 12  G   B N2    1 
ATOM   263  N  N3    . G   A 1 12  ? -29.270 47.434 17.864  1.00 58.41 ? 12  G   B N3    1 
ATOM   264  C  C4    . G   A 1 12  ? -30.375 47.877 18.504  1.00 59.06 ? 12  G   B C4    1 
ATOM   265  P  P     . U   A 1 13  ? -30.420 53.927 17.285  1.00 56.72 ? 13  U   B P     1 
ATOM   266  O  OP1   . U   A 1 13  ? -29.831 55.262 16.987  1.00 55.93 ? 13  U   B OP1   1 
ATOM   267  O  OP2   . U   A 1 13  ? -31.870 53.821 17.615  1.00 55.77 ? 13  U   B OP2   1 
ATOM   268  O  "O5'" . U   A 1 13  ? -30.080 52.940 16.083  1.00 52.59 ? 13  U   B "O5'" 1 
ATOM   269  C  "C5'" . U   A 1 13  ? -28.747 52.827 15.614  1.00 50.47 ? 13  U   B "C5'" 1 
ATOM   270  C  "C4'" . U   A 1 13  ? -28.624 51.671 14.663  1.00 49.25 ? 13  U   B "C4'" 1 
ATOM   271  O  "O4'" . U   A 1 13  ? -29.000 50.455 15.353  1.00 49.59 ? 13  U   B "O4'" 1 
ATOM   272  C  "C3'" . U   A 1 13  ? -29.583 51.696 13.495  1.00 49.24 ? 13  U   B "C3'" 1 
ATOM   273  O  "O3'" . U   A 1 13  ? -29.137 52.549 12.461  1.00 47.67 ? 13  U   B "O3'" 1 
ATOM   274  C  "C2'" . U   A 1 13  ? -29.597 50.238 13.067  1.00 49.65 ? 13  U   B "C2'" 1 
ATOM   275  O  "O2'" . U   A 1 13  ? -28.456 49.903 12.295  1.00 50.86 ? 13  U   B "O2'" 1 
ATOM   276  C  "C1'" . U   A 1 13  ? -29.554 49.532 14.426  1.00 48.76 ? 13  U   B "C1'" 1 
ATOM   277  N  N1    . U   A 1 13  ? -30.879 49.123 14.914  1.00 47.07 ? 13  U   B N1    1 
ATOM   278  C  C2    . U   A 1 13  ? -31.380 47.912 14.464  1.00 46.06 ? 13  U   B C2    1 
ATOM   279  O  O2    . U   A 1 13  ? -30.757 47.186 13.718  1.00 44.53 ? 13  U   B O2    1 
ATOM   280  N  N3    . U   A 1 13  ? -32.633 47.588 14.928  1.00 45.16 ? 13  U   B N3    1 
ATOM   281  C  C4    . U   A 1 13  ? -33.415 48.338 15.789  1.00 46.26 ? 13  U   B C4    1 
ATOM   282  O  O4    . U   A 1 13  ? -34.541 47.938 16.085  1.00 46.22 ? 13  U   B O4    1 
ATOM   283  C  C5    . U   A 1 13  ? -32.819 49.570 16.225  1.00 46.63 ? 13  U   B C5    1 
ATOM   284  C  C6    . U   A 1 13  ? -31.602 49.913 15.783  1.00 46.72 ? 13  U   B C6    1 
ATOM   285  P  P     . U   A 1 14  ? -30.225 53.349 11.601  1.00 49.61 ? 14  U   B P     1 
ATOM   286  O  OP1   . U   A 1 14  ? -29.553 54.131 10.528  1.00 48.66 ? 14  U   B OP1   1 
ATOM   287  O  OP2   . U   A 1 14  ? -31.118 54.048 12.575  1.00 49.12 ? 14  U   B OP2   1 
ATOM   288  O  "O5'" . U   A 1 14  ? -31.039 52.178 10.898  1.00 47.35 ? 14  U   B "O5'" 1 
ATOM   289  C  "C5'" . U   A 1 14  ? -30.417 51.384 9.903   1.00 46.26 ? 14  U   B "C5'" 1 
ATOM   290  C  "C4'" . U   A 1 14  ? -31.381 50.351 9.384   1.00 46.01 ? 14  U   B "C4'" 1 
ATOM   291  O  "O4'" . U   A 1 14  ? -31.691 49.410 10.440  1.00 46.18 ? 14  U   B "O4'" 1 
ATOM   292  C  "C3'" . U   A 1 14  ? -32.749 50.864 8.966   1.00 45.48 ? 14  U   B "C3'" 1 
ATOM   293  O  "O3'" . U   A 1 14  ? -32.705 51.451 7.664   1.00 45.79 ? 14  U   B "O3'" 1 
ATOM   294  C  "C2'" . U   A 1 14  ? -33.567 49.578 8.993   1.00 44.50 ? 14  U   B "C2'" 1 
ATOM   295  O  "O2'" . U   A 1 14  ? -33.343 48.787 7.853   1.00 43.50 ? 14  U   B "O2'" 1 
ATOM   296  C  "C1'" . U   A 1 14  ? -32.980 48.867 10.216  1.00 45.01 ? 14  U   B "C1'" 1 
ATOM   297  N  N1    . U   A 1 14  ? -33.799 49.082 11.414  1.00 45.15 ? 14  U   B N1    1 
ATOM   298  C  C2    . U   A 1 14  ? -34.899 48.276 11.562  1.00 45.70 ? 14  U   B C2    1 
ATOM   299  O  O2    . U   A 1 14  ? -35.134 47.344 10.806  1.00 46.69 ? 14  U   B O2    1 
ATOM   300  N  N3    . U   A 1 14  ? -35.708 48.585 12.628  1.00 44.73 ? 14  U   B N3    1 
ATOM   301  C  C4    . U   A 1 14  ? -35.512 49.583 13.551  1.00 44.44 ? 14  U   B C4    1 
ATOM   302  O  O4    . U   A 1 14  ? -36.402 49.830 14.371  1.00 45.34 ? 14  U   B O4    1 
ATOM   303  C  C5    . U   A 1 14  ? -34.308 50.333 13.368  1.00 44.42 ? 14  U   B C5    1 
ATOM   304  C  C6    . U   A 1 14  ? -33.511 50.063 12.329  1.00 44.48 ? 14  U   B C6    1 
ATOM   305  P  P     . C   A 1 15  ? -33.520 52.810 7.364   1.00 44.46 ? 15  C   B P     1 
ATOM   306  O  OP1   . C   A 1 15  ? -32.791 53.500 6.271   1.00 44.36 ? 15  C   B OP1   1 
ATOM   307  O  OP2   . C   A 1 15  ? -33.766 53.531 8.645   1.00 43.86 ? 15  C   B OP2   1 
ATOM   308  O  "O5'" . C   A 1 15  ? -34.924 52.277 6.813   1.00 44.96 ? 15  C   B "O5'" 1 
ATOM   309  C  "C5'" . C   A 1 15  ? -36.065 53.137 6.706   1.00 44.23 ? 15  C   B "C5'" 1 
ATOM   310  C  "C4'" . C   A 1 15  ? -37.340 52.321 6.576   1.00 44.42 ? 15  C   B "C4'" 1 
ATOM   311  O  "O4'" . C   A 1 15  ? -37.448 51.703 5.263   1.00 44.53 ? 15  C   B "O4'" 1 
ATOM   312  C  "C3'" . C   A 1 15  ? -37.486 51.157 7.549   1.00 45.33 ? 15  C   B "C3'" 1 
ATOM   313  O  "O3'" . C   A 1 15  ? -38.001 51.609 8.793   1.00 47.75 ? 15  C   B "O3'" 1 
ATOM   314  C  "C2'" . C   A 1 15  ? -38.522 50.279 6.858   1.00 44.61 ? 15  C   B "C2'" 1 
ATOM   315  O  "O2'" . C   A 1 15  ? -39.842 50.738 7.077   1.00 44.45 ? 15  C   B "O2'" 1 
ATOM   316  C  "C1'" . C   A 1 15  ? -38.169 50.483 5.387   1.00 43.72 ? 15  C   B "C1'" 1 
ATOM   317  N  N1    . C   A 1 15  ? -37.410 49.379 4.763   1.00 42.28 ? 15  C   B N1    1 
ATOM   318  C  C2    . C   A 1 15  ? -36.009 49.352 4.877   1.00 42.15 ? 15  C   B C2    1 
ATOM   319  O  O2    . C   A 1 15  ? -35.428 50.295 5.444   1.00 41.71 ? 15  C   B O2    1 
ATOM   320  N  N3    . C   A 1 15  ? -35.326 48.304 4.359   1.00 40.52 ? 15  C   B N3    1 
ATOM   321  C  C4    . C   A 1 15  ? -35.982 47.323 3.744   1.00 39.06 ? 15  C   B C4    1 
ATOM   322  N  N4    . C   A 1 15  ? -35.264 46.313 3.249   1.00 38.38 ? 15  C   B N4    1 
ATOM   323  C  C5    . C   A 1 15  ? -37.401 47.335 3.605   1.00 38.15 ? 15  C   B C5    1 
ATOM   324  C  C6    . C   A 1 15  ? -38.066 48.372 4.116   1.00 39.07 ? 15  C   B C6    1 
ATOM   325  P  P     . G   A 1 16  ? -37.593 50.856 10.151  1.00 50.39 ? 16  G   B P     1 
ATOM   326  O  OP1   . G   A 1 16  ? -38.424 51.461 11.222  1.00 51.25 ? 16  G   B OP1   1 
ATOM   327  O  OP2   . G   A 1 16  ? -36.111 50.907 10.253  1.00 48.64 ? 16  G   B OP2   1 
ATOM   328  O  "O5'" . G   A 1 16  ? -38.104 49.360 9.945   1.00 47.80 ? 16  G   B "O5'" 1 
ATOM   329  C  "C5'" . G   A 1 16  ? -39.496 49.078 9.974   1.00 48.93 ? 16  G   B "C5'" 1 
ATOM   330  C  "C4'" . G   A 1 16  ? -39.768 47.673 9.491   1.00 50.66 ? 16  G   B "C4'" 1 
ATOM   331  O  "O4'" . G   A 1 16  ? -39.344 47.525 8.110   1.00 51.30 ? 16  G   B "O4'" 1 
ATOM   332  C  "C3'" . G   A 1 16  ? -39.051 46.565 10.238  1.00 51.25 ? 16  G   B "C3'" 1 
ATOM   333  O  "O3'" . G   A 1 16  ? -39.826 46.218 11.381  1.00 52.29 ? 16  G   B "O3'" 1 
ATOM   334  C  "C2'" . G   A 1 16  ? -39.043 45.440 9.204   1.00 51.07 ? 16  G   B "C2'" 1 
ATOM   335  O  "O2'" . G   A 1 16  ? -40.287 44.770 9.127   1.00 52.57 ? 16  G   B "O2'" 1 
ATOM   336  C  "C1'" . G   A 1 16  ? -38.827 46.220 7.905   1.00 49.64 ? 16  G   B "C1'" 1 
ATOM   337  N  N9    . G   A 1 16  ? -37.424 46.351 7.524   1.00 47.48 ? 16  G   B N9    1 
ATOM   338  C  C8    . G   A 1 16  ? -36.584 47.394 7.838   1.00 46.74 ? 16  G   B C8    1 
ATOM   339  N  N7    . G   A 1 16  ? -35.371 47.228 7.383   1.00 45.86 ? 16  G   B N7    1 
ATOM   340  C  C5    . G   A 1 16  ? -35.413 46.002 6.727   1.00 44.59 ? 16  G   B C5    1 
ATOM   341  C  C6    . G   A 1 16  ? -34.390 45.285 6.060   1.00 42.78 ? 16  G   B C6    1 
ATOM   342  O  O6    . G   A 1 16  ? -33.207 45.589 5.930   1.00 42.51 ? 16  G   B O6    1 
ATOM   343  N  N1    . G   A 1 16  ? -34.860 44.092 5.525   1.00 41.82 ? 16  G   B N1    1 
ATOM   344  C  C2    . G   A 1 16  ? -36.149 43.636 5.632   1.00 42.51 ? 16  G   B C2    1 
ATOM   345  N  N2    . G   A 1 16  ? -36.407 42.459 5.042   1.00 41.50 ? 16  G   B N2    1 
ATOM   346  N  N3    . G   A 1 16  ? -37.113 44.286 6.269   1.00 44.02 ? 16  G   B N3    1 
ATOM   347  C  C4    . G   A 1 16  ? -36.676 45.454 6.790   1.00 45.59 ? 16  G   B C4    1 
ATOM   348  P  P     . A   A 1 17  ? -39.122 46.085 12.818  1.00 57.97 ? 17  A   B P     1 
ATOM   349  O  OP1   . A   A 1 17  ? -40.205 45.885 13.810  1.00 57.02 ? 17  A   B OP1   1 
ATOM   350  O  OP2   . A   A 1 17  ? -38.161 47.202 12.994  1.00 58.71 ? 17  A   B OP2   1 
ATOM   351  O  "O5'" . A   A 1 17  ? -38.294 44.737 12.707  1.00 57.68 ? 17  A   B "O5'" 1 
ATOM   352  C  "C5'" . A   A 1 17  ? -38.959 43.489 12.764  1.00 59.56 ? 17  A   B "C5'" 1 
ATOM   353  C  "C4'" . A   A 1 17  ? -38.107 42.512 13.506  1.00 61.35 ? 17  A   B "C4'" 1 
ATOM   354  O  "O4'" . A   A 1 17  ? -36.831 42.466 12.824  1.00 61.68 ? 17  A   B "O4'" 1 
ATOM   355  C  "C3'" . A   A 1 17  ? -37.777 42.918 14.934  1.00 62.52 ? 17  A   B "C3'" 1 
ATOM   356  O  "O3'" . A   A 1 17  ? -38.834 42.545 15.844  1.00 63.73 ? 17  A   B "O3'" 1 
ATOM   357  C  "C2'" . A   A 1 17  ? -36.400 42.302 15.173  1.00 63.22 ? 17  A   B "C2'" 1 
ATOM   358  O  "O2'" . A   A 1 17  ? -36.437 40.959 15.602  1.00 66.11 ? 17  A   B "O2'" 1 
ATOM   359  C  "C1'" . A   A 1 17  ? -35.791 42.332 13.766  1.00 62.61 ? 17  A   B "C1'" 1 
ATOM   360  N  N9    . A   A 1 17  ? -34.772 43.346 13.487  1.00 61.38 ? 17  A   B N9    1 
ATOM   361  C  C8    . A   A 1 17  ? -34.680 44.663 13.878  1.00 61.77 ? 17  A   B C8    1 
ATOM   362  N  N7    . A   A 1 17  ? -33.598 45.269 13.440  1.00 60.70 ? 17  A   B N7    1 
ATOM   363  C  C5    . A   A 1 17  ? -32.942 44.284 12.710  1.00 60.27 ? 17  A   B C5    1 
ATOM   364  C  C6    . A   A 1 17  ? -31.732 44.280 11.992  1.00 60.04 ? 17  A   B C6    1 
ATOM   365  N  N6    . A   A 1 17  ? -30.928 45.339 11.878  1.00 60.86 ? 17  A   B N6    1 
ATOM   366  N  N1    . A   A 1 17  ? -31.369 43.130 11.386  1.00 58.81 ? 17  A   B N1    1 
ATOM   367  C  C2    . A   A 1 17  ? -32.171 42.068 11.495  1.00 58.32 ? 17  A   B C2    1 
ATOM   368  N  N3    . A   A 1 17  ? -33.325 41.948 12.134  1.00 58.45 ? 17  A   B N3    1 
ATOM   369  C  C4    . A   A 1 17  ? -33.656 43.102 12.729  1.00 59.83 ? 17  A   B C4    1 
ATOM   370  P  P     . U   A 1 18  ? -39.176 40.982 16.141  1.00 82.27 ? 18  U   B P     1 
ATOM   371  O  OP1   . U   A 1 18  ? -39.028 40.185 14.891  1.00 81.53 ? 18  U   B OP1   1 
ATOM   372  O  OP2   . U   A 1 18  ? -40.477 40.963 16.859  1.00 81.12 ? 18  U   B OP2   1 
ATOM   373  O  "O5'" . U   A 1 18  ? -38.041 40.506 17.157  1.00 82.45 ? 18  U   B "O5'" 1 
ATOM   374  C  "C5'" . U   A 1 18  ? -38.322 39.614 18.240  1.00 83.49 ? 18  U   B "C5'" 1 
ATOM   375  C  "C4'" . U   A 1 18  ? -37.589 38.295 18.049  1.00 84.55 ? 18  U   B "C4'" 1 
ATOM   376  O  "O4'" . U   A 1 18  ? -38.502 37.261 17.596  1.00 84.65 ? 18  U   B "O4'" 1 
ATOM   377  C  "C3'" . U   A 1 18  ? -36.436 38.295 17.051  1.00 85.02 ? 18  U   B "C3'" 1 
ATOM   378  O  "O3'" . U   A 1 18  ? -35.226 38.714 17.692  1.00 85.78 ? 18  U   B "O3'" 1 
ATOM   379  C  "C2'" . U   A 1 18  ? -36.358 36.827 16.631  1.00 84.80 ? 18  U   B "C2'" 1 
ATOM   380  O  "O2'" . U   A 1 18  ? -35.574 36.057 17.521  1.00 84.29 ? 18  U   B "O2'" 1 
ATOM   381  C  "C1'" . U   A 1 18  ? -37.823 36.379 16.724  1.00 84.24 ? 18  U   B "C1'" 1 
ATOM   382  N  N1    . U   A 1 18  ? -38.584 36.312 15.467  1.00 84.00 ? 18  U   B N1    1 
ATOM   383  C  C2    . U   A 1 18  ? -37.960 35.801 14.331  1.00 83.64 ? 18  U   B C2    1 
ATOM   384  O  O2    . U   A 1 18  ? -36.801 35.420 14.319  1.00 83.32 ? 18  U   B O2    1 
ATOM   385  N  N3    . U   A 1 18  ? -38.755 35.754 13.207  1.00 83.34 ? 18  U   B N3    1 
ATOM   386  C  C4    . U   A 1 18  ? -40.075 36.153 13.100  1.00 83.14 ? 18  U   B C4    1 
ATOM   387  O  O4    . U   A 1 18  ? -40.653 36.042 12.021  1.00 81.95 ? 18  U   B O4    1 
ATOM   388  C  C5    . U   A 1 18  ? -40.646 36.673 14.312  1.00 84.02 ? 18  U   B C5    1 
ATOM   389  C  C6    . U   A 1 18  ? -39.898 36.736 15.424  1.00 84.21 ? 18  U   B C6    1 
ATOM   390  P  P     . U   A 1 19  ? -34.013 39.324 16.823  1.00 77.58 ? 19  U   B P     1 
ATOM   391  O  OP1   . U   A 1 19  ? -32.761 39.123 17.594  1.00 77.59 ? 19  U   B OP1   1 
ATOM   392  O  OP2   . U   A 1 19  ? -34.387 40.692 16.396  1.00 76.52 ? 19  U   B OP2   1 
ATOM   393  O  "O5'" . U   A 1 19  ? -33.939 38.376 15.548  1.00 79.39 ? 19  U   B "O5'" 1 
ATOM   394  C  "C5'" . U   A 1 19  ? -33.064 37.254 15.520  1.00 82.61 ? 19  U   B "C5'" 1 
ATOM   395  C  "C4'" . U   A 1 19  ? -32.801 36.854 14.093  1.00 86.16 ? 19  U   B "C4'" 1 
ATOM   396  O  "O4'" . U   A 1 19  ? -34.049 36.440 13.483  1.00 87.98 ? 19  U   B "O4'" 1 
ATOM   397  C  "C3'" . U   A 1 19  ? -32.285 37.986 13.219  1.00 87.80 ? 19  U   B "C3'" 1 
ATOM   398  O  "O3'" . U   A 1 19  ? -30.861 38.105 13.329  1.00 88.35 ? 19  U   B "O3'" 1 
ATOM   399  C  "C2'" . U   A 1 19  ? -32.825 37.671 11.824  1.00 88.62 ? 19  U   B "C2'" 1 
ATOM   400  O  "O2'" . U   A 1 19  ? -31.956 36.916 11.012  1.00 89.58 ? 19  U   B "O2'" 1 
ATOM   401  C  "C1'" . U   A 1 19  ? -34.100 36.875 12.135  1.00 89.48 ? 19  U   B "C1'" 1 
ATOM   402  N  N1    . U   A 1 19  ? -35.363 37.604 11.935  1.00 91.12 ? 19  U   B N1    1 
ATOM   403  C  C2    . U   A 1 19  ? -36.152 37.247 10.845  1.00 91.99 ? 19  U   B C2    1 
ATOM   404  O  O2    . U   A 1 19  ? -35.837 36.365 10.052  1.00 91.94 ? 19  U   B O2    1 
ATOM   405  N  N3    . U   A 1 19  ? -37.323 37.958 10.721  1.00 92.43 ? 19  U   B N3    1 
ATOM   406  C  C4    . U   A 1 19  ? -37.778 38.967 11.552  1.00 92.54 ? 19  U   B C4    1 
ATOM   407  O  O4    . U   A 1 19  ? -38.863 39.505 11.315  1.00 92.99 ? 19  U   B O4    1 
ATOM   408  C  C5    . U   A 1 19  ? -36.905 39.278 12.649  1.00 92.28 ? 19  U   B C5    1 
ATOM   409  C  C6    . U   A 1 19  ? -35.757 38.604 12.798  1.00 91.62 ? 19  U   B C6    1 
ATOM   410  P  P     . C   A 1 20  ? -29.912 36.794 13.236  1.00 62.23 ? 20  C   B P     1 
ATOM   411  O  OP1   . C   A 1 20  ? -30.529 35.699 12.449  1.00 62.43 ? 20  C   B OP1   1 
ATOM   412  O  OP2   . C   A 1 20  ? -29.439 36.521 14.619  1.00 61.14 ? 20  C   B OP2   1 
ATOM   413  O  "O5'" . C   A 1 20  ? -28.648 37.330 12.446  1.00 60.04 ? 20  C   B "O5'" 1 
ATOM   414  C  "C5'" . C   A 1 20  ? -27.668 38.058 13.147  1.00 59.47 ? 20  C   B "C5'" 1 
ATOM   415  C  "C4'" . C   A 1 20  ? -27.520 39.448 12.585  1.00 57.89 ? 20  C   B "C4'" 1 
ATOM   416  O  "O4'" . C   A 1 20  ? -28.797 40.118 12.414  1.00 58.73 ? 20  C   B "O4'" 1 
ATOM   417  C  "C3'" . C   A 1 20  ? -26.806 40.339 13.566  1.00 57.37 ? 20  C   B "C3'" 1 
ATOM   418  O  "O3'" . C   A 1 20  ? -25.438 40.035 13.530  1.00 55.54 ? 20  C   B "O3'" 1 
ATOM   419  C  "C2'" . C   A 1 20  ? -27.181 41.727 13.088  1.00 57.75 ? 20  C   B "C2'" 1 
ATOM   420  O  "O2'" . C   A 1 20  ? -26.432 42.144 11.974  1.00 60.30 ? 20  C   B "O2'" 1 
ATOM   421  C  "C1'" . C   A 1 20  ? -28.638 41.508 12.681  1.00 58.37 ? 20  C   B "C1'" 1 
ATOM   422  N  N1    . C   A 1 20  ? -29.599 41.901 13.730  1.00 58.81 ? 20  C   B N1    1 
ATOM   423  C  C2    . C   A 1 20  ? -29.490 43.183 14.308  1.00 58.52 ? 20  C   B C2    1 
ATOM   424  O  O2    . C   A 1 20  ? -28.570 43.940 13.939  1.00 59.37 ? 20  C   B O2    1 
ATOM   425  N  N3    . C   A 1 20  ? -30.390 43.560 15.249  1.00 57.33 ? 20  C   B N3    1 
ATOM   426  C  C4    . C   A 1 20  ? -31.366 42.724 15.613  1.00 57.05 ? 20  C   B C4    1 
ATOM   427  N  N4    . C   A 1 20  ? -32.244 43.149 16.526  1.00 57.06 ? 20  C   B N4    1 
ATOM   428  C  C5    . C   A 1 20  ? -31.488 41.415 15.055  1.00 56.95 ? 20  C   B C5    1 
ATOM   429  C  C6    . C   A 1 20  ? -30.591 41.047 14.130  1.00 57.62 ? 20  C   B C6    1 
ATOM   430  P  P     . C   A 1 21  ? -24.781 39.336 14.803  1.00 55.17 ? 21  C   B P     1 
ATOM   431  O  OP1   . C   A 1 21  ? -23.622 38.508 14.387  1.00 55.82 ? 21  C   B OP1   1 
ATOM   432  O  OP2   . C   A 1 21  ? -25.910 38.704 15.536  1.00 54.65 ? 21  C   B OP2   1 
ATOM   433  O  "O5'" . C   A 1 21  ? -24.245 40.579 15.637  1.00 54.23 ? 21  C   B "O5'" 1 
ATOM   434  C  "C5'" . C   A 1 21  ? -23.485 41.604 15.004  1.00 51.56 ? 21  C   B "C5'" 1 
ATOM   435  C  "C4'" . C   A 1 21  ? -23.506 42.856 15.843  1.00 49.85 ? 21  C   B "C4'" 1 
ATOM   436  O  "O4'" . C   A 1 21  ? -24.790 43.522 15.740  1.00 50.76 ? 21  C   B "O4'" 1 
ATOM   437  C  "C3'" . C   A 1 21  ? -23.322 42.625 17.328  1.00 47.87 ? 21  C   B "C3'" 1 
ATOM   438  O  "O3'" . C   A 1 21  ? -21.942 42.499 17.589  1.00 46.02 ? 21  C   B "O3'" 1 
ATOM   439  C  "C2'" . C   A 1 21  ? -23.935 43.887 17.928  1.00 47.66 ? 21  C   B "C2'" 1 
ATOM   440  O  "O2'" . C   A 1 21  ? -23.083 45.015 17.840  1.00 46.66 ? 21  C   B "O2'" 1 
ATOM   441  C  "C1'" . C   A 1 21  ? -25.120 44.118 16.987  1.00 48.38 ? 21  C   B "C1'" 1 
ATOM   442  N  N1    . C   A 1 21  ? -26.396 43.544 17.432  1.00 48.28 ? 21  C   B N1    1 
ATOM   443  C  C2    . C   A 1 21  ? -27.091 44.158 18.477  1.00 48.12 ? 21  C   B C2    1 
ATOM   444  O  O2    . C   A 1 21  ? -26.575 45.125 19.050  1.00 47.40 ? 21  C   B O2    1 
ATOM   445  N  N3    . C   A 1 21  ? -28.305 43.670 18.838  1.00 48.35 ? 21  C   B N3    1 
ATOM   446  C  C4    . C   A 1 21  ? -28.806 42.597 18.213  1.00 48.25 ? 21  C   B C4    1 
ATOM   447  N  N4    . C   A 1 21  ? -30.010 42.148 18.589  1.00 47.52 ? 21  C   B N4    1 
ATOM   448  C  C5    . C   A 1 21  ? -28.096 41.935 17.170  1.00 48.26 ? 21  C   B C5    1 
ATOM   449  C  C6    . C   A 1 21  ? -26.910 42.436 16.815  1.00 47.90 ? 21  C   B C6    1 
ATOM   450  P  P     . G   A 1 22  ? -21.451 41.578 18.795  1.00 48.41 ? 22  G   B P     1 
ATOM   451  O  OP1   . G   A 1 22  ? -19.967 41.487 18.685  1.00 47.42 ? 22  G   B OP1   1 
ATOM   452  O  OP2   . G   A 1 22  ? -22.273 40.337 18.766  1.00 47.90 ? 22  G   B OP2   1 
ATOM   453  O  "O5'" . G   A 1 22  ? -21.830 42.451 20.077  1.00 48.32 ? 22  G   B "O5'" 1 
ATOM   454  C  "C5'" . G   A 1 22  ? -22.638 41.939 21.134  1.00 46.45 ? 22  G   B "C5'" 1 
ATOM   455  C  "C4'" . G   A 1 22  ? -23.333 43.080 21.839  1.00 46.07 ? 22  G   B "C4'" 1 
ATOM   456  O  "O4'" . G   A 1 22  ? -24.510 43.476 21.083  1.00 47.27 ? 22  G   B "O4'" 1 
ATOM   457  C  "C3'" . G   A 1 22  ? -23.899 42.761 23.206  1.00 46.26 ? 22  G   B "C3'" 1 
ATOM   458  O  "O3'" . G   A 1 22  ? -22.879 42.830 24.185  1.00 46.32 ? 22  G   B "O3'" 1 
ATOM   459  C  "C2'" . G   A 1 22  ? -24.936 43.862 23.384  1.00 46.71 ? 22  G   B "C2'" 1 
ATOM   460  O  "O2'" . G   A 1 22  ? -24.394 45.111 23.749  1.00 46.20 ? 22  G   B "O2'" 1 
ATOM   461  C  "C1'" . G   A 1 22  ? -25.514 43.950 21.973  1.00 47.10 ? 22  G   B "C1'" 1 
ATOM   462  N  N9    . G   A 1 22  ? -26.684 43.092 21.849  1.00 48.36 ? 22  G   B N9    1 
ATOM   463  C  C8    . G   A 1 22  ? -26.797 41.941 21.110  1.00 48.94 ? 22  G   B C8    1 
ATOM   464  N  N7    . G   A 1 22  ? -27.971 41.379 21.213  1.00 49.68 ? 22  G   B N7    1 
ATOM   465  C  C5    . G   A 1 22  ? -28.676 42.213 22.072  1.00 50.45 ? 22  G   B C5    1 
ATOM   466  C  C6    . G   A 1 22  ? -30.016 42.121 22.567  1.00 51.30 ? 22  G   B C6    1 
ATOM   467  O  O6    . G   A 1 22  ? -30.873 41.251 22.336  1.00 51.92 ? 22  G   B O6    1 
ATOM   468  N  N1    . G   A 1 22  ? -30.319 43.183 23.414  1.00 50.77 ? 22  G   B N1    1 
ATOM   469  C  C2    . G   A 1 22  ? -29.460 44.197 23.746  1.00 49.96 ? 22  G   B C2    1 
ATOM   470  N  N2    . G   A 1 22  ? -29.947 45.129 24.571  1.00 50.88 ? 22  G   B N2    1 
ATOM   471  N  N3    . G   A 1 22  ? -28.217 44.293 23.302  1.00 49.97 ? 22  G   B N3    1 
ATOM   472  C  C4    . G   A 1 22  ? -27.896 43.275 22.473  1.00 49.46 ? 22  G   B C4    1 
ATOM   473  P  P     . C   A 1 23  ? -22.909 41.815 25.428  1.00 54.18 ? 23  C   B P     1 
ATOM   474  O  OP1   . C   A 1 23  ? -21.571 41.852 26.091  1.00 52.42 ? 23  C   B OP1   1 
ATOM   475  O  OP2   . C   A 1 23  ? -23.465 40.516 24.959  1.00 53.76 ? 23  C   B OP2   1 
ATOM   476  O  "O5'" . C   A 1 23  ? -23.999 42.464 26.387  1.00 54.49 ? 23  C   B "O5'" 1 
ATOM   477  C  "C5'" . C   A 1 23  ? -23.868 43.811 26.818  1.00 56.43 ? 23  C   B "C5'" 1 
ATOM   478  C  "C4'" . C   A 1 23  ? -25.045 44.196 27.669  1.00 57.13 ? 23  C   B "C4'" 1 
ATOM   479  O  "O4'" . C   A 1 23  ? -26.240 44.271 26.851  1.00 57.25 ? 23  C   B "O4'" 1 
ATOM   480  C  "C3'" . C   A 1 23  ? -25.419 43.181 28.730  1.00 58.30 ? 23  C   B "C3'" 1 
ATOM   481  O  "O3'" . C   A 1 23  ? -24.570 43.282 29.864  1.00 58.68 ? 23  C   B "O3'" 1 
ATOM   482  C  "C2'" . C   A 1 23  ? -26.860 43.565 29.030  1.00 58.24 ? 23  C   B "C2'" 1 
ATOM   483  O  "O2'" . C   A 1 23  ? -26.948 44.693 29.871  1.00 59.12 ? 23  C   B "O2'" 1 
ATOM   484  C  "C1'" . C   A 1 23  ? -27.368 43.938 27.639  1.00 57.67 ? 23  C   B "C1'" 1 
ATOM   485  N  N1    . C   A 1 23  ? -28.080 42.845 26.978  1.00 58.41 ? 23  C   B N1    1 
ATOM   486  C  C2    . C   A 1 23  ? -29.460 42.762 27.141  1.00 58.89 ? 23  C   B C2    1 
ATOM   487  O  O2    . C   A 1 23  ? -30.020 43.601 27.862  1.00 58.42 ? 23  C   B O2    1 
ATOM   488  N  N3    . C   A 1 23  ? -30.147 41.777 26.506  1.00 59.49 ? 23  C   B N3    1 
ATOM   489  C  C4    . C   A 1 23  ? -29.495 40.904 25.727  1.00 59.77 ? 23  C   B C4    1 
ATOM   490  N  N4    . C   A 1 23  ? -30.210 39.979 25.080  1.00 58.38 ? 23  C   B N4    1 
ATOM   491  C  C5    . C   A 1 23  ? -28.076 40.953 25.566  1.00 60.28 ? 23  C   B C5    1 
ATOM   492  C  C6    . C   A 1 23  ? -27.415 41.931 26.207  1.00 59.91 ? 23  C   B C6    1 
ATOM   493  P  P     . C   A 1 24  ? -24.659 42.173 31.022  1.00 66.56 ? 24  C   B P     1 
ATOM   494  O  OP1   . C   A 1 24  ? -23.372 42.154 31.760  1.00 67.43 ? 24  C   B OP1   1 
ATOM   495  O  OP2   . C   A 1 24  ? -25.192 40.909 30.453  1.00 65.65 ? 24  C   B OP2   1 
ATOM   496  O  "O5'" . C   A 1 24  ? -25.781 42.755 31.983  1.00 67.63 ? 24  C   B "O5'" 1 
ATOM   497  C  "C5'" . C   A 1 24  ? -26.465 41.890 32.857  1.00 70.16 ? 24  C   B "C5'" 1 
ATOM   498  C  "C4'" . C   A 1 24  ? -27.903 42.306 32.998  1.00 71.76 ? 24  C   B "C4'" 1 
ATOM   499  O  "O4'" . C   A 1 24  ? -28.532 42.489 31.703  1.00 72.35 ? 24  C   B "O4'" 1 
ATOM   500  C  "C3'" . C   A 1 24  ? -28.727 41.217 33.645  1.00 73.07 ? 24  C   B "C3'" 1 
ATOM   501  O  "O3'" . C   A 1 24  ? -28.521 41.264 35.037  1.00 74.07 ? 24  C   B "O3'" 1 
ATOM   502  C  "C2'" . C   A 1 24  ? -30.139 41.558 33.198  1.00 73.13 ? 24  C   B "C2'" 1 
ATOM   503  O  "O2'" . C   A 1 24  ? -30.743 42.566 33.981  1.00 73.51 ? 24  C   B "O2'" 1 
ATOM   504  C  "C1'" . C   A 1 24  ? -29.884 42.053 31.770  1.00 72.70 ? 24  C   B "C1'" 1 
ATOM   505  N  N1    . C   A 1 24  ? -30.080 41.007 30.757  1.00 72.29 ? 24  C   B N1    1 
ATOM   506  C  C2    . C   A 1 24  ? -31.314 40.365 30.695  1.00 72.60 ? 24  C   B C2    1 
ATOM   507  O  O2    . C   A 1 24  ? -32.198 40.691 31.506  1.00 72.20 ? 24  C   B O2    1 
ATOM   508  N  N3    . C   A 1 24  ? -31.518 39.408 29.758  1.00 73.40 ? 24  C   B N3    1 
ATOM   509  C  C4    . C   A 1 24  ? -30.540 39.090 28.904  1.00 73.40 ? 24  C   B C4    1 
ATOM   510  N  N4    . C   A 1 24  ? -30.790 38.145 27.988  1.00 73.46 ? 24  C   B N4    1 
ATOM   511  C  C5    . C   A 1 24  ? -29.265 39.728 28.950  1.00 73.05 ? 24  C   B C5    1 
ATOM   512  C  C6    . C   A 1 24  ? -29.080 40.672 29.885  1.00 72.47 ? 24  C   B C6    1 
ATOM   513  P  P     . C   A 1 25  ? -27.609 40.143 35.730  1.00 79.08 ? 25  C   B P     1 
ATOM   514  O  OP1   . C   A 1 25  ? -26.499 40.800 36.470  1.00 78.09 ? 25  C   B OP1   1 
ATOM   515  O  OP2   . C   A 1 25  ? -27.293 39.112 34.703  1.00 77.66 ? 25  C   B OP2   1 
ATOM   516  O  "O5'" . C   A 1 25  ? -28.630 39.492 36.760  1.00 78.82 ? 25  C   B "O5'" 1 
ATOM   517  C  "C5'" . C   A 1 25  ? -29.036 38.147 36.597  1.00 78.18 ? 25  C   B "C5'" 1 
ATOM   518  C  "C4'" . C   A 1 25  ? -30.532 38.015 36.732  1.00 76.68 ? 25  C   B "C4'" 1 
ATOM   519  O  "O4'" . C   A 1 25  ? -31.217 38.647 35.613  1.00 74.81 ? 25  C   B "O4'" 1 
ATOM   520  C  "C3'" . C   A 1 25  ? -30.950 36.562 36.643  1.00 76.34 ? 25  C   B "C3'" 1 
ATOM   521  O  "O3'" . C   A 1 25  ? -30.766 35.931 37.898  1.00 76.68 ? 25  C   B "O3'" 1 
ATOM   522  C  "C2'" . C   A 1 25  ? -32.387 36.660 36.171  1.00 75.06 ? 25  C   B "C2'" 1 
ATOM   523  O  "O2'" . C   A 1 25  ? -33.282 36.998 37.201  1.00 76.43 ? 25  C   B "O2'" 1 
ATOM   524  C  "C1'" . C   A 1 25  ? -32.268 37.800 35.163  1.00 74.48 ? 25  C   B "C1'" 1 
ATOM   525  N  N1    . C   A 1 25  ? -31.886 37.270 33.850  1.00 73.84 ? 25  C   B N1    1 
ATOM   526  C  C2    . C   A 1 25  ? -32.790 36.446 33.169  1.00 73.76 ? 25  C   B C2    1 
ATOM   527  O  O2    . C   A 1 25  ? -33.892 36.196 33.693  1.00 72.96 ? 25  C   B O2    1 
ATOM   528  N  N3    . C   A 1 25  ? -32.440 35.942 31.961  1.00 73.61 ? 25  C   B N3    1 
ATOM   529  C  C4    . C   A 1 25  ? -31.248 36.236 31.436  1.00 73.21 ? 25  C   B C4    1 
ATOM   530  N  N4    . C   A 1 25  ? -30.946 35.717 30.245  1.00 72.67 ? 25  C   B N4    1 
ATOM   531  C  C5    . C   A 1 25  ? -30.311 37.076 32.110  1.00 72.86 ? 25  C   B C5    1 
ATOM   532  C  C6    . C   A 1 25  ? -30.668 37.565 33.301  1.00 73.12 ? 25  C   B C6    1 
ATOM   533  P  P     . U   A 1 26  ? -29.700 34.740 38.019  1.00 87.94 ? 26  U   B P     1 
ATOM   534  O  OP1   . U   A 1 26  ? -29.380 34.515 39.451  1.00 88.53 ? 26  U   B OP1   1 
ATOM   535  O  OP2   . U   A 1 26  ? -28.603 35.082 37.074  1.00 88.81 ? 26  U   B OP2   1 
ATOM   536  O  "O5'" . U   A 1 26  ? -30.521 33.489 37.461  1.00 85.80 ? 26  U   B "O5'" 1 
ATOM   537  C  "C5'" . U   A 1 26  ? -31.895 33.339 37.804  1.00 83.03 ? 26  U   B "C5'" 1 
ATOM   538  C  "C4'" . U   A 1 26  ? -32.649 32.649 36.701  1.00 81.73 ? 26  U   B "C4'" 1 
ATOM   539  O  "O4'" . U   A 1 26  ? -32.569 33.425 35.474  1.00 81.22 ? 26  U   B "O4'" 1 
ATOM   540  C  "C3'" . U   A 1 26  ? -32.104 31.304 36.272  1.00 82.22 ? 26  U   B "C3'" 1 
ATOM   541  O  "O3'" . U   A 1 26  ? -32.422 30.274 37.203  1.00 82.97 ? 26  U   B "O3'" 1 
ATOM   542  C  "C2'" . U   A 1 26  ? -32.785 31.129 34.918  1.00 81.86 ? 26  U   B "C2'" 1 
ATOM   543  O  "O2'" . U   A 1 26  ? -34.145 30.752 35.015  1.00 81.80 ? 26  U   B "O2'" 1 
ATOM   544  C  "C1'" . U   A 1 26  ? -32.691 32.549 34.355  1.00 80.95 ? 26  U   B "C1'" 1 
ATOM   545  N  N1    . U   A 1 26  ? -31.522 32.708 33.472  1.00 79.82 ? 26  U   B N1    1 
ATOM   546  C  C2    . U   A 1 26  ? -31.585 32.117 32.215  1.00 78.87 ? 26  U   B C2    1 
ATOM   547  O  O2    . U   A 1 26  ? -32.566 31.522 31.812  1.00 79.03 ? 26  U   B O2    1 
ATOM   548  N  N3    . U   A 1 26  ? -30.455 32.245 31.451  1.00 77.96 ? 26  U   B N3    1 
ATOM   549  C  C4    . U   A 1 26  ? -29.288 32.885 31.801  1.00 78.27 ? 26  U   B C4    1 
ATOM   550  O  O4    . U   A 1 26  ? -28.301 32.768 31.073  1.00 78.71 ? 26  U   B O4    1 
ATOM   551  C  C5    . U   A 1 26  ? -29.308 33.502 33.098  1.00 78.55 ? 26  U   B C5    1 
ATOM   552  C  C6    . U   A 1 26  ? -30.397 33.394 33.869  1.00 79.20 ? 26  U   B C6    1 
ATOM   553  P  P     . G   A 1 27  ? -31.357 29.093 37.475  1.00 75.65 ? 27  G   B P     1 
ATOM   554  O  OP1   . G   A 1 27  ? -31.538 28.616 38.868  1.00 75.09 ? 27  G   B OP1   1 
ATOM   555  O  OP2   . G   A 1 27  ? -30.020 29.599 37.045  1.00 74.87 ? 27  G   B OP2   1 
ATOM   556  O  "O5'" . G   A 1 27  ? -31.815 27.930 36.482  1.00 73.32 ? 27  G   B "O5'" 1 
ATOM   557  C  "C5'" . G   A 1 27  ? -33.074 27.288 36.658  1.00 72.51 ? 27  G   B "C5'" 1 
ATOM   558  C  "C4'" . G   A 1 27  ? -33.376 26.368 35.496  1.00 72.82 ? 27  G   B "C4'" 1 
ATOM   559  O  "O4'" . G   A 1 27  ? -33.593 27.133 34.275  1.00 72.71 ? 27  G   B "O4'" 1 
ATOM   560  C  "C3'" . G   A 1 27  ? -32.273 25.407 35.102  1.00 72.68 ? 27  G   B "C3'" 1 
ATOM   561  O  "O3'" . G   A 1 27  ? -32.188 24.296 35.973  1.00 74.34 ? 27  G   B "O3'" 1 
ATOM   562  C  "C2'" . G   A 1 27  ? -32.704 25.023 33.698  1.00 71.80 ? 27  G   B "C2'" 1 
ATOM   563  O  "O2'" . G   A 1 27  ? -33.809 24.136 33.686  1.00 69.40 ? 27  G   B "O2'" 1 
ATOM   564  C  "C1'" . G   A 1 27  ? -33.112 26.393 33.158  1.00 71.19 ? 27  G   B "C1'" 1 
ATOM   565  N  N9    . G   A 1 27  ? -31.938 27.079 32.636  1.00 69.83 ? 27  G   B N9    1 
ATOM   566  C  C8    . G   A 1 27  ? -31.217 28.076 33.250  1.00 69.47 ? 27  G   B C8    1 
ATOM   567  N  N7    . G   A 1 27  ? -30.178 28.458 32.557  1.00 69.40 ? 27  G   B N7    1 
ATOM   568  C  C5    . G   A 1 27  ? -30.220 27.673 31.413  1.00 69.25 ? 27  G   B C5    1 
ATOM   569  C  C6    . G   A 1 27  ? -29.347 27.631 30.292  1.00 68.98 ? 27  G   B C6    1 
ATOM   570  O  O6    . G   A 1 27  ? -28.323 28.299 30.086  1.00 67.90 ? 27  G   B O6    1 
ATOM   571  N  N1    . G   A 1 27  ? -29.769 26.690 29.352  1.00 68.34 ? 27  G   B N1    1 
ATOM   572  C  C2    . G   A 1 27  ? -30.886 25.891 29.475  1.00 67.56 ? 27  G   B C2    1 
ATOM   573  N  N2    . G   A 1 27  ? -31.132 25.050 28.462  1.00 66.54 ? 27  G   B N2    1 
ATOM   574  N  N3    . G   A 1 27  ? -31.701 25.919 30.516  1.00 67.81 ? 27  G   B N3    1 
ATOM   575  C  C4    . G   A 1 27  ? -31.311 26.826 31.441  1.00 69.15 ? 27  G   B C4    1 
ATOM   576  P  P     . G   A 1 28  ? -30.749 23.658 36.282  1.00 83.16 ? 28  G   B P     1 
ATOM   577  O  OP1   . G   A 1 28  ? -30.892 22.706 37.412  1.00 83.56 ? 28  G   B OP1   1 
ATOM   578  O  OP2   . G   A 1 28  ? -29.797 24.797 36.396  1.00 83.06 ? 28  G   B OP2   1 
ATOM   579  O  "O5'" . G   A 1 28  ? -30.421 22.838 34.958  1.00 80.92 ? 28  G   B "O5'" 1 
ATOM   580  C  "C5'" . G   A 1 28  ? -31.292 21.802 34.532  1.00 80.09 ? 28  G   B "C5'" 1 
ATOM   581  C  "C4'" . G   A 1 28  ? -30.877 21.279 33.181  1.00 79.90 ? 28  G   B "C4'" 1 
ATOM   582  O  "O4'" . G   A 1 28  ? -31.118 22.286 32.157  1.00 79.19 ? 28  G   B "O4'" 1 
ATOM   583  C  "C3'" . G   A 1 28  ? -29.403 20.956 33.004  1.00 80.11 ? 28  G   B "C3'" 1 
ATOM   584  O  "O3'" . G   A 1 28  ? -29.005 19.745 33.643  1.00 79.95 ? 28  G   B "O3'" 1 
ATOM   585  C  "C2'" . G   A 1 28  ? -29.303 20.925 31.483  1.00 80.03 ? 28  G   B "C2'" 1 
ATOM   586  O  "O2'" . G   A 1 28  ? -29.866 19.777 30.880  1.00 80.34 ? 28  G   B "O2'" 1 
ATOM   587  C  "C1'" . G   A 1 28  ? -30.148 22.149 31.125  1.00 79.08 ? 28  G   B "C1'" 1 
ATOM   588  N  N9    . G   A 1 28  ? -29.282 23.327 31.113  1.00 77.86 ? 28  G   B N9    1 
ATOM   589  C  C8    . G   A 1 28  ? -29.219 24.359 32.025  1.00 76.79 ? 28  G   B C8    1 
ATOM   590  N  N7    . G   A 1 28  ? -28.290 25.235 31.743  1.00 74.78 ? 28  G   B N7    1 
ATOM   591  C  C5    . G   A 1 28  ? -27.716 24.757 30.574  1.00 74.62 ? 28  G   B C5    1 
ATOM   592  C  C6    . G   A 1 28  ? -26.663 25.277 29.791  1.00 74.23 ? 28  G   B C6    1 
ATOM   593  O  O6    . G   A 1 28  ? -26.001 26.305 29.972  1.00 73.89 ? 28  G   B O6    1 
ATOM   594  N  N1    . G   A 1 28  ? -26.401 24.468 28.690  1.00 74.14 ? 28  G   B N1    1 
ATOM   595  C  C2    . G   A 1 28  ? -27.070 23.307 28.383  1.00 73.76 ? 28  G   B C2    1 
ATOM   596  N  N2    . G   A 1 28  ? -26.671 22.661 27.288  1.00 73.68 ? 28  G   B N2    1 
ATOM   597  N  N3    . G   A 1 28  ? -28.056 22.817 29.098  1.00 73.78 ? 28  G   B N3    1 
ATOM   598  C  C4    . G   A 1 28  ? -28.324 23.585 30.172  1.00 75.51 ? 28  G   B C4    1 
ATOM   599  P  P     . G   A 1 29  ? -27.623 19.701 34.478  1.00 77.03 ? 29  G   B P     1 
ATOM   600  O  OP1   . G   A 1 29  ? -27.795 18.701 35.560  1.00 76.78 ? 29  G   B OP1   1 
ATOM   601  O  OP2   . G   A 1 29  ? -27.225 21.091 34.833  1.00 75.39 ? 29  G   B OP2   1 
ATOM   602  O  "O5'" . G   A 1 29  ? -26.579 19.128 33.416  1.00 76.23 ? 29  G   B "O5'" 1 
ATOM   603  C  "C5'" . G   A 1 29  ? -26.966 18.086 32.522  1.00 74.68 ? 29  G   B "C5'" 1 
ATOM   604  C  "C4'" . G   A 1 29  ? -26.333 18.277 31.158  1.00 73.96 ? 29  G   B "C4'" 1 
ATOM   605  O  "O4'" . G   A 1 29  ? -26.672 19.587 30.621  1.00 73.44 ? 29  G   B "O4'" 1 
ATOM   606  C  "C3'" . G   A 1 29  ? -24.817 18.263 31.092  1.00 73.46 ? 29  G   B "C3'" 1 
ATOM   607  O  "O3'" . G   A 1 29  ? -24.306 16.935 31.120  1.00 73.53 ? 29  G   B "O3'" 1 
ATOM   608  C  "C2'" . G   A 1 29  ? -24.573 18.925 29.740  1.00 73.12 ? 29  G   B "C2'" 1 
ATOM   609  O  "O2'" . G   A 1 29  ? -24.815 18.062 28.648  1.00 72.56 ? 29  G   B "O2'" 1 
ATOM   610  C  "C1'" . G   A 1 29  ? -25.637 20.023 29.749  1.00 72.41 ? 29  G   B "C1'" 1 
ATOM   611  N  N9    . G   A 1 29  ? -25.104 21.298 30.229  1.00 70.94 ? 29  G   B N9    1 
ATOM   612  C  C8    . G   A 1 29  ? -25.406 21.949 31.401  1.00 70.23 ? 29  G   B C8    1 
ATOM   613  N  N7    . G   A 1 29  ? -24.755 23.072 31.546  1.00 69.33 ? 29  G   B N7    1 
ATOM   614  C  C5    . G   A 1 29  ? -23.974 23.169 30.401  1.00 69.17 ? 29  G   B C5    1 
ATOM   615  C  C6    . G   A 1 29  ? -23.057 24.175 29.991  1.00 68.37 ? 29  G   B C6    1 
ATOM   616  O  O6    . G   A 1 29  ? -22.741 25.216 30.574  1.00 68.47 ? 29  G   B O6    1 
ATOM   617  N  N1    . G   A 1 29  ? -22.484 23.874 28.762  1.00 67.46 ? 29  G   B N1    1 
ATOM   618  C  C2    . G   A 1 29  ? -22.754 22.758 28.019  1.00 67.74 ? 29  G   B C2    1 
ATOM   619  N  N2    . G   A 1 29  ? -22.096 22.646 26.859  1.00 67.10 ? 29  G   B N2    1 
ATOM   620  N  N3    . G   A 1 29  ? -23.607 21.816 28.384  1.00 69.17 ? 29  G   B N3    1 
ATOM   621  C  C4    . G   A 1 29  ? -24.177 22.084 29.579  1.00 69.68 ? 29  G   B C4    1 
ATOM   622  P  P     . C   A 1 30  ? -22.829 16.667 31.699  1.00 65.22 ? 30  C   B P     1 
ATOM   623  O  OP1   . C   A 1 30  ? -22.591 15.201 31.737  1.00 65.43 ? 30  C   B OP1   1 
ATOM   624  O  OP2   . C   A 1 30  ? -22.677 17.472 32.948  1.00 64.45 ? 30  C   B OP2   1 
ATOM   625  O  "O5'" . C   A 1 30  ? -21.863 17.275 30.590  1.00 62.09 ? 30  C   B "O5'" 1 
ATOM   626  C  "C5'" . C   A 1 30  ? -21.745 16.655 29.321  1.00 58.08 ? 30  C   B "C5'" 1 
ATOM   627  C  "C4'" . C   A 1 30  ? -20.735 17.389 28.481  1.00 56.14 ? 30  C   B "C4'" 1 
ATOM   628  O  "O4'" . C   A 1 30  ? -21.222 18.732 28.202  1.00 55.76 ? 30  C   B "O4'" 1 
ATOM   629  C  "C3'" . C   A 1 30  ? -19.385 17.633 29.133  1.00 54.86 ? 30  C   B "C3'" 1 
ATOM   630  O  "O3'" . C   A 1 30  ? -18.534 16.502 29.064  1.00 52.46 ? 30  C   B "O3'" 1 
ATOM   631  C  "C2'" . C   A 1 30  ? -18.846 18.781 28.292  1.00 55.47 ? 30  C   B "C2'" 1 
ATOM   632  O  "O2'" . C   A 1 30  ? -18.303 18.353 27.056  1.00 54.44 ? 30  C   B "O2'" 1 
ATOM   633  C  "C1'" . C   A 1 30  ? -20.116 19.616 28.083  1.00 55.44 ? 30  C   B "C1'" 1 
ATOM   634  N  N1    . C   A 1 30  ? -20.231 20.655 29.117  1.00 54.83 ? 30  C   B N1    1 
ATOM   635  C  C2    . C   A 1 30  ? -19.460 21.813 28.986  1.00 53.77 ? 30  C   B C2    1 
ATOM   636  O  O2    . C   A 1 30  ? -18.760 21.957 27.969  1.00 52.75 ? 30  C   B O2    1 
ATOM   637  N  N3    . C   A 1 30  ? -19.500 22.745 29.963  1.00 53.48 ? 30  C   B N3    1 
ATOM   638  C  C4    . C   A 1 30  ? -20.277 22.559 31.032  1.00 53.46 ? 30  C   B C4    1 
ATOM   639  N  N4    . C   A 1 30  ? -20.252 23.489 31.987  1.00 52.99 ? 30  C   B N4    1 
ATOM   640  C  C5    . C   A 1 30  ? -21.104 21.407 31.172  1.00 53.59 ? 30  C   B C5    1 
ATOM   641  C  C6    . C   A 1 30  ? -21.051 20.488 30.200  1.00 54.49 ? 30  C   B C6    1 
ATOM   642  P  P     . C   A 1 31  ? -17.367 16.320 30.156  1.00 46.15 ? 31  C   B P     1 
ATOM   643  O  OP1   . C   A 1 31  ? -16.891 14.914 30.141  1.00 48.77 ? 31  C   B OP1   1 
ATOM   644  O  OP2   . C   A 1 31  ? -17.823 16.925 31.432  1.00 45.97 ? 31  C   B OP2   1 
ATOM   645  O  "O5'" . C   A 1 31  ? -16.174 17.229 29.631  1.00 45.86 ? 31  C   B "O5'" 1 
ATOM   646  C  "C5'" . C   A 1 31  ? -15.758 17.190 28.277  1.00 43.95 ? 31  C   B "C5'" 1 
ATOM   647  C  "C4'" . C   A 1 31  ? -14.917 18.399 27.977  1.00 43.23 ? 31  C   B "C4'" 1 
ATOM   648  O  "O4'" . C   A 1 31  ? -15.719 19.583 28.191  1.00 43.32 ? 31  C   B "O4'" 1 
ATOM   649  C  "C3'" . C   A 1 31  ? -13.718 18.578 28.887  1.00 42.14 ? 31  C   B "C3'" 1 
ATOM   650  O  "O3'" . C   A 1 31  ? -12.622 17.839 28.353  1.00 41.08 ? 31  C   B "O3'" 1 
ATOM   651  C  "C2'" . C   A 1 31  ? -13.482 20.088 28.848  1.00 42.28 ? 31  C   B "C2'" 1 
ATOM   652  O  "O2'" . C   A 1 31  ? -12.693 20.507 27.754  1.00 41.26 ? 31  C   B "O2'" 1 
ATOM   653  C  "C1'" . C   A 1 31  ? -14.902 20.631 28.665  1.00 43.29 ? 31  C   B "C1'" 1 
ATOM   654  N  N1    . C   A 1 31  ? -15.551 21.209 29.848  1.00 45.79 ? 31  C   B N1    1 
ATOM   655  C  C2    . C   A 1 31  ? -15.054 22.405 30.385  1.00 46.67 ? 31  C   B C2    1 
ATOM   656  O  O2    . C   A 1 31  ? -14.074 22.932 29.862  1.00 48.34 ? 31  C   B O2    1 
ATOM   657  N  N3    . C   A 1 31  ? -15.665 22.954 31.457  1.00 46.91 ? 31  C   B N3    1 
ATOM   658  C  C4    . C   A 1 31  ? -16.743 22.366 31.981  1.00 47.38 ? 31  C   B C4    1 
ATOM   659  N  N4    . C   A 1 31  ? -17.341 22.966 33.013  1.00 47.66 ? 31  C   B N4    1 
ATOM   660  C  C5    . C   A 1 31  ? -17.265 21.140 31.462  1.00 47.37 ? 31  C   B C5    1 
ATOM   661  C  C6    . C   A 1 31  ? -16.641 20.601 30.408  1.00 46.42 ? 31  C   B C6    1 
ATOM   662  P  P     . A   A 1 32  ? -11.552 17.160 29.345  1.00 47.56 ? 32  A   B P     1 
ATOM   663  O  OP1   . A   A 1 32  ? -10.543 16.401 28.569  1.00 48.93 ? 32  A   B OP1   1 
ATOM   664  O  OP2   . A   A 1 32  ? -12.277 16.489 30.455  1.00 47.90 ? 32  A   B OP2   1 
ATOM   665  O  "O5'" . A   A 1 32  ? -10.787 18.410 29.936  1.00 47.76 ? 32  A   B "O5'" 1 
ATOM   666  C  "C5'" . A   A 1 32  ? -9.852  19.111 29.142  1.00 46.72 ? 32  A   B "C5'" 1 
ATOM   667  C  "C4'" . A   A 1 32  ? -9.204  20.169 29.970  1.00 46.01 ? 32  A   B "C4'" 1 
ATOM   668  O  "O4'" . A   A 1 32  ? -10.178 21.198 30.253  1.00 44.56 ? 32  A   B "O4'" 1 
ATOM   669  C  "C3'" . A   A 1 32  ? -8.787  19.678 31.343  1.00 46.95 ? 32  A   B "C3'" 1 
ATOM   670  O  "O3'" . A   A 1 32  ? -7.648  18.801 31.213  1.00 47.69 ? 32  A   B "O3'" 1 
ATOM   671  C  "C2'" . A   A 1 32  ? -8.751  20.968 32.156  1.00 46.69 ? 32  A   B "C2'" 1 
ATOM   672  O  "O2'" . A   A 1 32  ? -7.586  21.718 31.925  1.00 50.21 ? 32  A   B "O2'" 1 
ATOM   673  C  "C1'" . A   A 1 32  ? -9.884  21.773 31.504  1.00 45.72 ? 32  A   B "C1'" 1 
ATOM   674  N  N9    . A   A 1 32  ? -11.133 21.967 32.233  1.00 44.27 ? 32  A   B N9    1 
ATOM   675  C  C8    . A   A 1 32  ? -12.096 21.055 32.569  1.00 44.35 ? 32  A   B C8    1 
ATOM   676  N  N7    . A   A 1 32  ? -13.139 21.584 33.170  1.00 43.84 ? 32  A   B N7    1 
ATOM   677  C  C5    . A   A 1 32  ? -12.831 22.933 33.246  1.00 43.07 ? 32  A   B C5    1 
ATOM   678  C  C6    . A   A 1 32  ? -13.537 24.034 33.745  1.00 42.09 ? 32  A   B C6    1 
ATOM   679  N  N6    . A   A 1 32  ? -14.762 23.946 34.265  1.00 40.31 ? 32  A   B N6    1 
ATOM   680  N  N1    . A   A 1 32  ? -12.944 25.250 33.673  1.00 42.01 ? 32  A   B N1    1 
ATOM   681  C  C2    . A   A 1 32  ? -11.735 25.340 33.111  1.00 42.01 ? 32  A   B C2    1 
ATOM   682  N  N3    . A   A 1 32  ? -10.978 24.380 32.587  1.00 42.31 ? 32  A   B N3    1 
ATOM   683  C  C4    . A   A 1 32  ? -11.590 23.183 32.689  1.00 44.03 ? 32  A   B C4    1 
ATOM   684  P  P     . U   A 1 33  ? -6.161  19.248 31.650  1.00 62.90 ? 33  U   B P     1 
ATOM   685  O  OP1   . U   A 1 33  ? -6.139  20.508 32.411  1.00 63.68 ? 33  U   B OP1   1 
ATOM   686  O  OP2   . U   A 1 33  ? -5.264  19.086 30.473  1.00 61.03 ? 33  U   B OP2   1 
ATOM   687  O  "O5'" . U   A 1 33  ? -5.738  18.165 32.737  1.00 65.04 ? 33  U   B "O5'" 1 
ATOM   688  C  "C5'" . U   A 1 33  ? -4.855  18.534 33.793  1.00 66.19 ? 33  U   B "C5'" 1 
ATOM   689  C  "C4'" . U   A 1 33  ? -5.283  17.910 35.101  1.00 66.79 ? 33  U   B "C4'" 1 
ATOM   690  O  "O4'" . U   A 1 33  ? -6.733  17.868 35.184  1.00 67.39 ? 33  U   B "O4'" 1 
ATOM   691  C  "C3'" . U   A 1 33  ? -4.894  16.461 35.332  1.00 67.21 ? 33  U   B "C3'" 1 
ATOM   692  O  "O3'" . U   A 1 33  ? -3.518  16.330 35.697  1.00 68.50 ? 33  U   B "O3'" 1 
ATOM   693  C  "C2'" . U   A 1 33  ? -5.836  16.069 36.460  1.00 67.16 ? 33  U   B "C2'" 1 
ATOM   694  O  "O2'" . U   A 1 33  ? -5.391  16.569 37.701  1.00 65.40 ? 33  U   B "O2'" 1 
ATOM   695  C  "C1'" . U   A 1 33  ? -7.117  16.806 36.052  1.00 67.84 ? 33  U   B "C1'" 1 
ATOM   696  N  N1    . U   A 1 33  ? -8.123  15.964 35.378  1.00 69.34 ? 33  U   B N1    1 
ATOM   697  C  C2    . U   A 1 33  ? -8.543  14.805 36.030  1.00 70.53 ? 33  U   B C2    1 
ATOM   698  O  O2    . U   A 1 33  ? -8.102  14.453 37.112  1.00 71.77 ? 33  U   B O2    1 
ATOM   699  N  N3    . U   A 1 33  ? -9.501  14.074 35.366  1.00 70.39 ? 33  U   B N3    1 
ATOM   700  C  C4    . U   A 1 33  ? -10.079 14.369 34.146  1.00 70.17 ? 33  U   B C4    1 
ATOM   701  O  O4    . U   A 1 33  ? -10.973 13.632 33.696  1.00 69.77 ? 33  U   B O4    1 
ATOM   702  C  C5    . U   A 1 33  ? -9.584  15.571 33.532  1.00 69.65 ? 33  U   B C5    1 
ATOM   703  C  C6    . U   A 1 33  ? -8.647  16.307 34.153  1.00 69.27 ? 33  U   B C6    1 
ATOM   704  N  N     . MET B 2 1   ? 17.149  4.179  8.628   1.00 84.35 ? 1   MET A N     1 
ATOM   705  C  CA    . MET B 2 1   ? 16.585  5.013  7.523   1.00 85.14 ? 1   MET A CA    1 
ATOM   706  C  C     . MET B 2 1   ? 15.180  4.587  7.069   1.00 84.68 ? 1   MET A C     1 
ATOM   707  O  O     . MET B 2 1   ? 14.536  5.293  6.284   1.00 84.65 ? 1   MET A O     1 
ATOM   708  C  CB    . MET B 2 1   ? 17.544  5.029  6.324   1.00 86.14 ? 1   MET A CB    1 
ATOM   709  C  CG    . MET B 2 1   ? 18.785  5.920  6.520   1.00 88.11 ? 1   MET A CG    1 
ATOM   710  S  SD    . MET B 2 1   ? 18.441  7.722  6.671   1.00 89.93 ? 1   MET A SD    1 
ATOM   711  C  CE    . MET B 2 1   ? 18.896  8.046  8.414   1.00 89.40 ? 1   MET A CE    1 
ATOM   712  N  N     . LYS B 2 2   ? 14.706  3.440  7.553   1.00 83.67 ? 2   LYS A N     1 
ATOM   713  C  CA    . LYS B 2 2   ? 13.362  2.979  7.209   1.00 82.18 ? 2   LYS A CA    1 
ATOM   714  C  C     . LYS B 2 2   ? 12.513  2.892  8.474   1.00 81.90 ? 2   LYS A C     1 
ATOM   715  O  O     . LYS B 2 2   ? 13.020  2.589  9.556   1.00 81.82 ? 2   LYS A O     1 
ATOM   716  C  CB    . LYS B 2 2   ? 13.382  1.602  6.539   1.00 81.65 ? 2   LYS A CB    1 
ATOM   717  C  CG    . LYS B 2 2   ? 12.045  1.237  5.872   1.00 80.66 ? 2   LYS A CG    1 
ATOM   718  C  CD    . LYS B 2 2   ? 11.712  -0.249 5.963   1.00 79.94 ? 2   LYS A CD    1 
ATOM   719  C  CE    . LYS B 2 2   ? 11.106  -0.607 7.319   1.00 79.92 ? 2   LYS A CE    1 
ATOM   720  N  NZ    . LYS B 2 2   ? 12.013  -0.324 8.467   1.00 78.90 ? 2   LYS A NZ    1 
ATOM   721  N  N     . VAL B 2 3   ? 11.220  3.158  8.313   1.00 81.24 ? 3   VAL A N     1 
ATOM   722  C  CA    . VAL B 2 3   ? 10.227  3.126  9.385   1.00 80.31 ? 3   VAL A CA    1 
ATOM   723  C  C     . VAL B 2 3   ? 10.693  2.614  10.752  1.00 79.85 ? 3   VAL A C     1 
ATOM   724  O  O     . VAL B 2 3   ? 10.863  3.388  11.691  1.00 79.49 ? 3   VAL A O     1 
ATOM   725  C  CB    . VAL B 2 3   ? 9.018   2.270  8.963   1.00 80.39 ? 3   VAL A CB    1 
ATOM   726  C  CG1   . VAL B 2 3   ? 7.837   2.559  9.884   1.00 79.69 ? 3   VAL A CG1   1 
ATOM   727  C  CG2   . VAL B 2 3   ? 8.681   2.525  7.487   1.00 80.36 ? 3   VAL A CG2   1 
ATOM   728  N  N     . GLU B 2 4   ? 10.889  1.303  10.856  1.00 79.36 ? 4   GLU A N     1 
ATOM   729  C  CA    . GLU B 2 4   ? 11.303  0.683  12.107  1.00 78.81 ? 4   GLU A CA    1 
ATOM   730  C  C     . GLU B 2 4   ? 12.640  1.184  12.632  1.00 77.91 ? 4   GLU A C     1 
ATOM   731  O  O     . GLU B 2 4   ? 12.787  1.440  13.825  1.00 77.97 ? 4   GLU A O     1 
ATOM   732  C  CB    . GLU B 2 4   ? 11.339  -0.832 11.932  1.00 80.50 ? 4   GLU A CB    1 
ATOM   733  C  CG    . GLU B 2 4   ? 10.023  -1.401 11.411  1.00 83.46 ? 4   GLU A CG    1 
ATOM   734  C  CD    . GLU B 2 4   ? 10.106  -2.882 11.068  1.00 85.68 ? 4   GLU A CD    1 
ATOM   735  O  OE1   . GLU B 2 4   ? 10.973  -3.261 10.241  1.00 87.15 ? 4   GLU A OE1   1 
ATOM   736  O  OE2   . GLU B 2 4   ? 9.296   -3.664 11.620  1.00 86.69 ? 4   GLU A OE2   1 
ATOM   737  N  N     . GLU B 2 5   ? 13.620  1.327  11.752  1.00 76.96 ? 5   GLU A N     1 
ATOM   738  C  CA    . GLU B 2 5   ? 14.928  1.805  12.179  1.00 76.62 ? 5   GLU A CA    1 
ATOM   739  C  C     . GLU B 2 5   ? 14.771  3.180  12.825  1.00 74.87 ? 5   GLU A C     1 
ATOM   740  O  O     . GLU B 2 5   ? 15.328  3.441  13.893  1.00 73.97 ? 5   GLU A O     1 
ATOM   741  C  CB    . GLU B 2 5   ? 15.879  1.881  10.981  1.00 79.14 ? 5   GLU A CB    1 
ATOM   742  C  CG    . GLU B 2 5   ? 15.861  0.621  10.076  1.00 82.93 ? 5   GLU A CG    1 
ATOM   743  C  CD    . GLU B 2 5   ? 16.355  -0.676 10.757  1.00 84.15 ? 5   GLU A CD    1 
ATOM   744  O  OE1   . GLU B 2 5   ? 15.820  -1.061 11.830  1.00 84.64 ? 5   GLU A OE1   1 
ATOM   745  O  OE2   . GLU B 2 5   ? 17.274  -1.322 10.196  1.00 83.96 ? 5   GLU A OE2   1 
ATOM   746  N  N     . ILE B 2 6   ? 13.995  4.047  12.174  1.00 73.37 ? 6   ILE A N     1 
ATOM   747  C  CA    . ILE B 2 6   ? 13.735  5.402  12.669  1.00 70.99 ? 6   ILE A CA    1 
ATOM   748  C  C     . ILE B 2 6   ? 13.123  5.351  14.066  1.00 69.75 ? 6   ILE A C     1 
ATOM   749  O  O     . ILE B 2 6   ? 13.579  6.041  14.977  1.00 69.62 ? 6   ILE A O     1 
ATOM   750  C  CB    . ILE B 2 6   ? 12.756  6.163  11.742  1.00 70.75 ? 6   ILE A CB    1 
ATOM   751  C  CG1   . ILE B 2 6   ? 13.349  6.288  10.332  1.00 70.39 ? 6   ILE A CG1   1 
ATOM   752  C  CG2   . ILE B 2 6   ? 12.430  7.536  12.336  1.00 69.45 ? 6   ILE A CG2   1 
ATOM   753  C  CD1   . ILE B 2 6   ? 14.522  7.241  10.223  1.00 70.27 ? 6   ILE A CD1   1 
ATOM   754  N  N     . LEU B 2 7   ? 12.083  4.536  14.228  1.00 68.23 ? 7   LEU A N     1 
ATOM   755  C  CA    . LEU B 2 7   ? 11.425  4.393  15.519  1.00 66.77 ? 7   LEU A CA    1 
ATOM   756  C  C     . LEU B 2 7   ? 12.451  4.063  16.587  1.00 66.82 ? 7   LEU A C     1 
ATOM   757  O  O     . LEU B 2 7   ? 12.413  4.613  17.687  1.00 66.66 ? 7   LEU A O     1 
ATOM   758  C  CB    . LEU B 2 7   ? 10.373  3.287  15.466  1.00 65.38 ? 7   LEU A CB    1 
ATOM   759  C  CG    . LEU B 2 7   ? 9.139   3.592  14.614  1.00 64.75 ? 7   LEU A CG    1 
ATOM   760  C  CD1   . LEU B 2 7   ? 8.191   2.397  14.621  1.00 64.06 ? 7   LEU A CD1   1 
ATOM   761  C  CD2   . LEU B 2 7   ? 8.439   4.828  15.160  1.00 63.94 ? 7   LEU A CD2   1 
ATOM   762  N  N     . GLU B 2 8   ? 13.375  3.166  16.253  1.00 66.97 ? 8   GLU A N     1 
ATOM   763  C  CA    . GLU B 2 8   ? 14.416  2.765  17.187  1.00 66.31 ? 8   GLU A CA    1 
ATOM   764  C  C     . GLU B 2 8   ? 15.174  3.954  17.756  1.00 65.33 ? 8   GLU A C     1 
ATOM   765  O  O     . GLU B 2 8   ? 15.226  4.140  18.975  1.00 65.16 ? 8   GLU A O     1 
ATOM   766  C  CB    . GLU B 2 8   ? 15.390  1.802  16.512  1.00 67.02 ? 8   GLU A CB    1 
ATOM   767  C  CG    . GLU B 2 8   ? 15.052  0.351  16.784  1.00 69.19 ? 8   GLU A CG    1 
ATOM   768  C  CD    . GLU B 2 8   ? 15.058  0.029  18.277  1.00 70.90 ? 8   GLU A CD    1 
ATOM   769  O  OE1   . GLU B 2 8   ? 14.562  -1.051 18.663  1.00 71.39 ? 8   GLU A OE1   1 
ATOM   770  O  OE2   . GLU B 2 8   ? 15.567  0.856  19.068  1.00 71.93 ? 8   GLU A OE2   1 
ATOM   771  N  N     . LYS B 2 9   ? 15.761  4.756  16.874  1.00 64.10 ? 9   LYS A N     1 
ATOM   772  C  CA    . LYS B 2 9   ? 16.507  5.931  17.298  1.00 62.46 ? 9   LYS A CA    1 
ATOM   773  C  C     . LYS B 2 9   ? 15.570  6.785  18.145  1.00 61.73 ? 9   LYS A C     1 
ATOM   774  O  O     . LYS B 2 9   ? 15.980  7.359  19.147  1.00 61.80 ? 9   LYS A O     1 
ATOM   775  C  CB    . LYS B 2 9   ? 16.972  6.732  16.080  1.00 62.42 ? 9   LYS A CB    1 
ATOM   776  C  CG    . LYS B 2 9   ? 17.438  5.878  14.904  1.00 63.72 ? 9   LYS A CG    1 
ATOM   777  C  CD    . LYS B 2 9   ? 17.429  6.676  13.586  1.00 64.92 ? 9   LYS A CD    1 
ATOM   778  C  CE    . LYS B 2 9   ? 17.692  5.787  12.365  1.00 65.48 ? 9   LYS A CE    1 
ATOM   779  N  NZ    . LYS B 2 9   ? 17.647  6.536  11.070  1.00 64.47 ? 9   LYS A NZ    1 
ATOM   780  N  N     . ALA B 2 10  ? 14.300  6.836  17.747  1.00 60.92 ? 10  ALA A N     1 
ATOM   781  C  CA    . ALA B 2 10  ? 13.290  7.635  18.444  1.00 60.65 ? 10  ALA A CA    1 
ATOM   782  C  C     . ALA B 2 10  ? 13.074  7.297  19.923  1.00 60.36 ? 10  ALA A C     1 
ATOM   783  O  O     . ALA B 2 10  ? 12.756  8.178  20.720  1.00 60.09 ? 10  ALA A O     1 
ATOM   784  C  CB    . ALA B 2 10  ? 11.958  7.551  17.693  1.00 60.05 ? 10  ALA A CB    1 
ATOM   785  N  N     . LEU B 2 11  ? 13.239  6.029  20.291  1.00 60.33 ? 11  LEU A N     1 
ATOM   786  C  CA    . LEU B 2 11  ? 13.046  5.613  21.678  1.00 59.76 ? 11  LEU A CA    1 
ATOM   787  C  C     . LEU B 2 11  ? 14.013  6.338  22.593  1.00 60.91 ? 11  LEU A C     1 
ATOM   788  O  O     . LEU B 2 11  ? 13.703  6.597  23.757  1.00 61.36 ? 11  LEU A O     1 
ATOM   789  C  CB    . LEU B 2 11  ? 13.254  4.111  21.813  1.00 57.44 ? 11  LEU A CB    1 
ATOM   790  C  CG    . LEU B 2 11  ? 12.295  3.243  21.010  1.00 55.90 ? 11  LEU A CG    1 
ATOM   791  C  CD1   . LEU B 2 11  ? 12.844  1.842  20.947  1.00 56.32 ? 11  LEU A CD1   1 
ATOM   792  C  CD2   . LEU B 2 11  ? 10.917  3.254  21.644  1.00 55.78 ? 11  LEU A CD2   1 
ATOM   793  N  N     . GLU B 2 12  ? 15.183  6.663  22.053  1.00 62.36 ? 12  GLU A N     1 
ATOM   794  C  CA    . GLU B 2 12  ? 16.223  7.360  22.801  1.00 63.95 ? 12  GLU A CA    1 
ATOM   795  C  C     . GLU B 2 12  ? 15.874  8.819  23.026  1.00 63.73 ? 12  GLU A C     1 
ATOM   796  O  O     . GLU B 2 12  ? 16.715  9.599  23.463  1.00 64.78 ? 12  GLU A O     1 
ATOM   797  C  CB    . GLU B 2 12  ? 17.563  7.261  22.063  1.00 65.42 ? 12  GLU A CB    1 
ATOM   798  C  CG    . GLU B 2 12  ? 18.368  6.010  22.398  1.00 68.82 ? 12  GLU A CG    1 
ATOM   799  C  CD    . GLU B 2 12  ? 19.177  5.497  21.216  1.00 71.04 ? 12  GLU A CD    1 
ATOM   800  O  OE1   . GLU B 2 12  ? 18.660  4.639  20.458  1.00 71.91 ? 12  GLU A OE1   1 
ATOM   801  O  OE2   . GLU B 2 12  ? 20.326  5.960  21.036  1.00 72.21 ? 12  GLU A OE2   1 
ATOM   802  N  N     . LEU B 2 13  ? 14.635  9.186  22.728  1.00 63.08 ? 13  LEU A N     1 
ATOM   803  C  CA    . LEU B 2 13  ? 14.188  10.564 22.908  1.00 62.64 ? 13  LEU A CA    1 
ATOM   804  C  C     . LEU B 2 13  ? 12.993  10.621 23.859  1.00 62.89 ? 13  LEU A C     1 
ATOM   805  O  O     . LEU B 2 13  ? 12.786  11.616 24.555  1.00 62.62 ? 13  LEU A O     1 
ATOM   806  C  CB    . LEU B 2 13  ? 13.801  11.168 21.552  1.00 61.89 ? 13  LEU A CB    1 
ATOM   807  C  CG    . LEU B 2 13  ? 14.881  11.189 20.462  1.00 61.15 ? 13  LEU A CG    1 
ATOM   808  C  CD1   . LEU B 2 13  ? 14.271  11.591 19.134  1.00 61.17 ? 13  LEU A CD1   1 
ATOM   809  C  CD2   . LEU B 2 13  ? 15.981  12.152 20.849  1.00 60.67 ? 13  LEU A CD2   1 
ATOM   810  N  N     . VAL B 2 14  ? 12.223  9.538  23.894  1.00 63.30 ? 14  VAL A N     1 
ATOM   811  C  CA    . VAL B 2 14  ? 11.036  9.457  24.738  1.00 63.71 ? 14  VAL A CA    1 
ATOM   812  C  C     . VAL B 2 14  ? 11.235  8.716  26.058  1.00 64.33 ? 14  VAL A C     1 
ATOM   813  O  O     . VAL B 2 14  ? 10.763  9.170  27.101  1.00 64.42 ? 14  VAL A O     1 
ATOM   814  C  CB    . VAL B 2 14  ? 9.887   8.789  23.979  1.00 63.42 ? 14  VAL A CB    1 
ATOM   815  C  CG1   . VAL B 2 14  ? 9.334   9.743  22.939  1.00 62.69 ? 14  VAL A CG1   1 
ATOM   816  C  CG2   . VAL B 2 14  ? 10.390  7.517  23.316  1.00 63.42 ? 14  VAL A CG2   1 
ATOM   817  N  N     . ILE B 2 15  ? 11.916  7.575  26.016  1.00 64.77 ? 15  ILE A N     1 
ATOM   818  C  CA    . ILE B 2 15  ? 12.155  6.803  27.235  1.00 65.36 ? 15  ILE A CA    1 
ATOM   819  C  C     . ILE B 2 15  ? 13.195  7.503  28.096  1.00 65.69 ? 15  ILE A C     1 
ATOM   820  O  O     . ILE B 2 15  ? 14.167  8.043  27.576  1.00 67.01 ? 15  ILE A O     1 
ATOM   821  C  CB    . ILE B 2 15  ? 12.706  5.397  26.932  1.00 65.24 ? 15  ILE A CB    1 
ATOM   822  C  CG1   . ILE B 2 15  ? 11.773  4.659  25.975  1.00 66.06 ? 15  ILE A CG1   1 
ATOM   823  C  CG2   . ILE B 2 15  ? 12.878  4.617  28.240  1.00 64.76 ? 15  ILE A CG2   1 
ATOM   824  C  CD1   . ILE B 2 15  ? 12.272  3.277  25.582  1.00 66.27 ? 15  ILE A CD1   1 
ATOM   825  N  N     . PRO B 2 16  ? 13.006  7.507  29.423  1.00 65.19 ? 16  PRO A N     1 
ATOM   826  C  CA    . PRO B 2 16  ? 13.995  8.165  30.280  1.00 65.50 ? 16  PRO A CA    1 
ATOM   827  C  C     . PRO B 2 16  ? 15.222  7.267  30.440  1.00 67.23 ? 16  PRO A C     1 
ATOM   828  O  O     . PRO B 2 16  ? 15.293  6.192  29.850  1.00 67.26 ? 16  PRO A O     1 
ATOM   829  C  CB    . PRO B 2 16  ? 13.251  8.332  31.599  1.00 64.76 ? 16  PRO A CB    1 
ATOM   830  C  CG    . PRO B 2 16  ? 11.812  8.350  31.190  1.00 64.87 ? 16  PRO A CG    1 
ATOM   831  C  CD    . PRO B 2 16  ? 11.756  7.269  30.158  1.00 64.32 ? 16  PRO A CD    1 
ATOM   832  N  N     . ASP B 2 17  ? 16.192  7.722  31.224  1.00 69.24 ? 17  ASP A N     1 
ATOM   833  C  CA    . ASP B 2 17  ? 17.390  6.936  31.504  1.00 70.55 ? 17  ASP A CA    1 
ATOM   834  C  C     . ASP B 2 17  ? 17.384  6.616  33.003  1.00 71.68 ? 17  ASP A C     1 
ATOM   835  O  O     . ASP B 2 17  ? 16.594  7.192  33.758  1.00 72.07 ? 17  ASP A O     1 
ATOM   836  C  CB    . ASP B 2 17  ? 18.656  7.701  31.098  1.00 70.46 ? 17  ASP A CB    1 
ATOM   837  C  CG    . ASP B 2 17  ? 18.596  9.180  31.441  1.00 70.92 ? 17  ASP A CG    1 
ATOM   838  O  OD1   . ASP B 2 17  ? 19.473  9.926  30.952  1.00 71.00 ? 17  ASP A OD1   1 
ATOM   839  O  OD2   . ASP B 2 17  ? 17.689  9.600  32.192  1.00 71.31 ? 17  ASP A OD2   1 
ATOM   840  N  N     . GLU B 2 18  ? 18.239  5.697  33.443  1.00 72.53 ? 18  GLU A N     1 
ATOM   841  C  CA    . GLU B 2 18  ? 18.251  5.319  34.857  1.00 73.33 ? 18  GLU A CA    1 
ATOM   842  C  C     . GLU B 2 18  ? 18.220  6.527  35.773  1.00 73.29 ? 18  GLU A C     1 
ATOM   843  O  O     . GLU B 2 18  ? 17.279  6.702  36.540  1.00 73.16 ? 18  GLU A O     1 
ATOM   844  C  CB    . GLU B 2 18  ? 19.476  4.463  35.181  1.00 74.77 ? 18  GLU A CB    1 
ATOM   845  C  CG    . GLU B 2 18  ? 19.464  3.073  34.557  1.00 76.03 ? 18  GLU A CG    1 
ATOM   846  C  CD    . GLU B 2 18  ? 20.511  2.916  33.471  1.00 76.78 ? 18  GLU A CD    1 
ATOM   847  O  OE1   . GLU B 2 18  ? 20.432  3.644  32.452  1.00 76.78 ? 18  GLU A OE1   1 
ATOM   848  O  OE2   . GLU B 2 18  ? 21.413  2.066  33.644  1.00 76.93 ? 18  GLU A OE2   1 
ATOM   849  N  N     . GLU B 2 19  ? 19.257  7.352  35.677  1.00 73.61 ? 19  GLU A N     1 
ATOM   850  C  CA    . GLU B 2 19  ? 19.394  8.565  36.479  1.00 73.84 ? 19  GLU A CA    1 
ATOM   851  C  C     . GLU B 2 19  ? 18.074  9.282  36.723  1.00 72.55 ? 19  GLU A C     1 
ATOM   852  O  O     . GLU B 2 19  ? 17.772  9.666  37.857  1.00 72.53 ? 19  GLU A O     1 
ATOM   853  C  CB    . GLU B 2 19  ? 20.373  9.525  35.800  1.00 76.04 ? 19  GLU A CB    1 
ATOM   854  C  CG    . GLU B 2 19  ? 20.541  9.270  34.302  1.00 78.90 ? 19  GLU A CG    1 
ATOM   855  C  CD    . GLU B 2 19  ? 21.341  8.003  34.009  1.00 80.34 ? 19  GLU A CD    1 
ATOM   856  O  OE1   . GLU B 2 19  ? 21.383  7.580  32.831  1.00 81.10 ? 19  GLU A OE1   1 
ATOM   857  O  OE2   . GLU B 2 19  ? 21.933  7.436  34.956  1.00 81.02 ? 19  GLU A OE2   1 
ATOM   858  N  N     . GLU B 2 20  ? 17.296  9.463  35.659  1.00 70.64 ? 20  GLU A N     1 
ATOM   859  C  CA    . GLU B 2 20  ? 16.007  10.137 35.763  1.00 69.08 ? 20  GLU A CA    1 
ATOM   860  C  C     . GLU B 2 20  ? 14.936  9.276  36.429  1.00 67.93 ? 20  GLU A C     1 
ATOM   861  O  O     . GLU B 2 20  ? 14.106  9.785  37.188  1.00 67.52 ? 20  GLU A O     1 
ATOM   862  C  CB    . GLU B 2 20  ? 15.530  10.590 34.378  1.00 69.53 ? 20  GLU A CB    1 
ATOM   863  C  CG    . GLU B 2 20  ? 14.016  10.753 34.258  1.00 69.53 ? 20  GLU A CG    1 
ATOM   864  C  CD    . GLU B 2 20  ? 13.614  11.777 33.220  1.00 69.37 ? 20  GLU A CD    1 
ATOM   865  O  OE1   . GLU B 2 20  ? 14.322  11.897 32.192  1.00 68.86 ? 20  GLU A OE1   1 
ATOM   866  O  OE2   . GLU B 2 20  ? 12.582  12.453 33.437  1.00 69.10 ? 20  GLU A OE2   1 
ATOM   867  N  N     . VAL B 2 21  ? 14.948  7.978  36.144  1.00 66.74 ? 21  VAL A N     1 
ATOM   868  C  CA    . VAL B 2 21  ? 13.973  7.074  36.741  1.00 66.05 ? 21  VAL A CA    1 
ATOM   869  C  C     . VAL B 2 21  ? 14.331  6.813  38.205  1.00 66.11 ? 21  VAL A C     1 
ATOM   870  O  O     . VAL B 2 21  ? 13.461  6.784  39.077  1.00 65.79 ? 21  VAL A O     1 
ATOM   871  C  CB    . VAL B 2 21  ? 13.937  5.743  35.995  1.00 65.37 ? 21  VAL A CB    1 
ATOM   872  C  CG1   . VAL B 2 21  ? 12.874  4.839  36.607  1.00 65.24 ? 21  VAL A CG1   1 
ATOM   873  C  CG2   . VAL B 2 21  ? 13.673  5.994  34.524  1.00 64.32 ? 21  VAL A CG2   1 
ATOM   874  N  N     . ARG B 2 22  ? 15.623  6.620  38.455  1.00 66.00 ? 22  ARG A N     1 
ATOM   875  C  CA    . ARG B 2 22  ? 16.137  6.385  39.796  1.00 65.87 ? 22  ARG A CA    1 
ATOM   876  C  C     . ARG B 2 22  ? 15.668  7.565  40.622  1.00 65.00 ? 22  ARG A C     1 
ATOM   877  O  O     . ARG B 2 22  ? 15.054  7.407  41.681  1.00 63.96 ? 22  ARG A O     1 
ATOM   878  C  CB    . ARG B 2 22  ? 17.668  6.327  39.751  1.00 67.61 ? 22  ARG A CB    1 
ATOM   879  C  CG    . ARG B 2 22  ? 18.371  6.208  41.100  1.00 69.91 ? 22  ARG A CG    1 
ATOM   880  C  CD    . ARG B 2 22  ? 19.831  5.767  40.918  1.00 72.43 ? 22  ARG A CD    1 
ATOM   881  N  NE    . ARG B 2 22  ? 20.558  6.577  39.933  1.00 74.81 ? 22  ARG A NE    1 
ATOM   882  C  CZ    . ARG B 2 22  ? 20.938  7.843  40.118  1.00 75.54 ? 22  ARG A CZ    1 
ATOM   883  N  NH1   . ARG B 2 22  ? 20.666  8.463  41.263  1.00 75.84 ? 22  ARG A NH1   1 
ATOM   884  N  NH2   . ARG B 2 22  ? 21.587  8.495  39.153  1.00 75.10 ? 22  ARG A NH2   1 
ATOM   885  N  N     . LYS B 2 23  ? 15.952  8.755  40.103  1.00 64.56 ? 23  LYS A N     1 
ATOM   886  C  CA    . LYS B 2 23  ? 15.551  9.985  40.753  1.00 64.06 ? 23  LYS A CA    1 
ATOM   887  C  C     . LYS B 2 23  ? 14.045  9.946  40.975  1.00 63.91 ? 23  LYS A C     1 
ATOM   888  O  O     . LYS B 2 23  ? 13.543  10.455 41.975  1.00 64.07 ? 23  LYS A O     1 
ATOM   889  C  CB    . LYS B 2 23  ? 15.923  11.191 39.893  1.00 63.21 ? 23  LYS A CB    1 
ATOM   890  C  CG    . LYS B 2 23  ? 15.332  12.473 40.439  1.00 64.43 ? 23  LYS A CG    1 
ATOM   891  C  CD    . LYS B 2 23  ? 15.778  13.722 39.699  1.00 64.57 ? 23  LYS A CD    1 
ATOM   892  C  CE    . LYS B 2 23  ? 15.081  14.939 40.304  1.00 65.30 ? 23  LYS A CE    1 
ATOM   893  N  NZ    . LYS B 2 23  ? 15.478  16.233 39.681  1.00 65.34 ? 23  LYS A NZ    1 
ATOM   894  N  N     . GLY B 2 24  ? 13.325  9.339  40.038  1.00 63.77 ? 24  GLY A N     1 
ATOM   895  C  CA    . GLY B 2 24  ? 11.887  9.242  40.184  1.00 63.75 ? 24  GLY A CA    1 
ATOM   896  C  C     . GLY B 2 24  ? 11.555  8.232  41.265  1.00 64.07 ? 24  GLY A C     1 
ATOM   897  O  O     . GLY B 2 24  ? 10.582  8.383  42.018  1.00 62.87 ? 24  GLY A O     1 
ATOM   898  N  N     . ARG B 2 25  ? 12.380  7.192  41.344  1.00 65.39 ? 25  ARG A N     1 
ATOM   899  C  CA    . ARG B 2 25  ? 12.186  6.134  42.329  1.00 66.89 ? 25  ARG A CA    1 
ATOM   900  C  C     . ARG B 2 25  ? 12.353  6.665  43.749  1.00 66.16 ? 25  ARG A C     1 
ATOM   901  O  O     . ARG B 2 25  ? 11.413  6.612  44.548  1.00 65.47 ? 25  ARG A O     1 
ATOM   902  C  CB    . ARG B 2 25  ? 13.160  4.969  42.068  1.00 68.81 ? 25  ARG A CB    1 
ATOM   903  C  CG    . ARG B 2 25  ? 12.746  4.041  40.903  1.00 71.26 ? 25  ARG A CG    1 
ATOM   904  C  CD    . ARG B 2 25  ? 11.421  3.327  41.212  1.00 74.38 ? 25  ARG A CD    1 
ATOM   905  N  NE    . ARG B 2 25  ? 10.943  2.456  40.131  1.00 77.20 ? 25  ARG A NE    1 
ATOM   906  C  CZ    . ARG B 2 25  ? 10.276  2.870  39.053  1.00 78.07 ? 25  ARG A CZ    1 
ATOM   907  N  NH1   . ARG B 2 25  ? 9.994   4.161  38.894  1.00 78.64 ? 25  ARG A NH1   1 
ATOM   908  N  NH2   . ARG B 2 25  ? 9.882   1.990  38.135  1.00 77.48 ? 25  ARG A NH2   1 
ATOM   909  N  N     . GLU B 2 26  ? 13.540  7.180  44.056  1.00 65.43 ? 26  GLU A N     1 
ATOM   910  C  CA    . GLU B 2 26  ? 13.810  7.727  45.379  1.00 65.55 ? 26  GLU A CA    1 
ATOM   911  C  C     . GLU B 2 26  ? 12.796  8.800  45.702  1.00 65.75 ? 26  GLU A C     1 
ATOM   912  O  O     . GLU B 2 26  ? 12.465  9.034  46.863  1.00 66.28 ? 26  GLU A O     1 
ATOM   913  C  CB    . GLU B 2 26  ? 15.205  8.320  45.432  1.00 65.63 ? 26  GLU A CB    1 
ATOM   914  C  CG    . GLU B 2 26  ? 16.292  7.285  45.393  1.00 67.42 ? 26  GLU A CG    1 
ATOM   915  C  CD    . GLU B 2 26  ? 17.519  7.787  44.672  1.00 68.75 ? 26  GLU A CD    1 
ATOM   916  O  OE1   . GLU B 2 26  ? 17.779  9.012  44.739  1.00 69.06 ? 26  GLU A OE1   1 
ATOM   917  O  OE2   . GLU B 2 26  ? 18.222  6.957  44.049  1.00 68.93 ? 26  GLU A OE2   1 
ATOM   918  N  N     . ALA B 2 27  ? 12.307  9.462  44.664  1.00 66.14 ? 27  ALA A N     1 
ATOM   919  C  CA    . ALA B 2 27  ? 11.307  10.503 44.842  1.00 66.59 ? 27  ALA A CA    1 
ATOM   920  C  C     . ALA B 2 27  ? 10.033  9.841  45.372  1.00 66.54 ? 27  ALA A C     1 
ATOM   921  O  O     . ALA B 2 27  ? 9.565   10.148 46.470  1.00 65.81 ? 27  ALA A O     1 
ATOM   922  C  CB    . ALA B 2 27  ? 11.031  11.200 43.508  1.00 66.86 ? 27  ALA A CB    1 
ATOM   923  N  N     . GLU B 2 28  ? 9.476   8.925  44.586  1.00 66.70 ? 28  GLU A N     1 
ATOM   924  C  CA    . GLU B 2 28  ? 8.270   8.231  45.008  1.00 67.45 ? 28  GLU A CA    1 
ATOM   925  C  C     . GLU B 2 28  ? 8.471   7.622  46.395  1.00 68.59 ? 28  GLU A C     1 
ATOM   926  O  O     . GLU B 2 28  ? 7.528   7.494  47.177  1.00 68.32 ? 28  GLU A O     1 
ATOM   927  C  CB    . GLU B 2 28  ? 7.920   7.131  44.014  1.00 66.19 ? 28  GLU A CB    1 
ATOM   928  C  CG    . GLU B 2 28  ? 6.934   6.132  44.579  1.00 64.21 ? 28  GLU A CG    1 
ATOM   929  C  CD    . GLU B 2 28  ? 6.682   4.983  43.646  1.00 63.03 ? 28  GLU A CD    1 
ATOM   930  O  OE1   . GLU B 2 28  ? 7.638   4.563  42.953  1.00 61.35 ? 28  GLU A OE1   1 
ATOM   931  O  OE2   . GLU B 2 28  ? 5.529   4.498  43.622  1.00 62.99 ? 28  GLU A OE2   1 
ATOM   932  N  N     . GLU B 2 29  ? 9.714   7.244  46.679  1.00 70.06 ? 29  GLU A N     1 
ATOM   933  C  CA    . GLU B 2 29  ? 10.098  6.650  47.956  1.00 71.86 ? 29  GLU A CA    1 
ATOM   934  C  C     . GLU B 2 29  ? 9.735   7.428  49.227  1.00 71.76 ? 29  GLU A C     1 
ATOM   935  O  O     . GLU B 2 29  ? 8.935   6.969  50.054  1.00 71.22 ? 29  GLU A O     1 
ATOM   936  C  CB    . GLU B 2 29  ? 11.621  6.499  48.004  1.00 74.27 ? 29  GLU A CB    1 
ATOM   937  C  CG    . GLU B 2 29  ? 12.147  5.804  49.245  1.00 77.25 ? 29  GLU A CG    1 
ATOM   938  C  CD    . GLU B 2 29  ? 12.022  4.302  49.146  1.00 79.28 ? 29  GLU A CD    1 
ATOM   939  O  OE1   . GLU B 2 29  ? 12.098  3.628  50.204  1.00 80.61 ? 29  GLU A OE1   1 
ATOM   940  O  OE2   . GLU B 2 29  ? 11.858  3.799  48.004  1.00 79.91 ? 29  GLU A OE2   1 
ATOM   941  N  N     . GLU B 2 30  ? 10.350  8.602  49.374  1.00 71.42 ? 30  GLU A N     1 
ATOM   942  C  CA    . GLU B 2 30  ? 10.059  9.518  50.473  1.00 71.56 ? 30  GLU A CA    1 
ATOM   943  C  C     . GLU B 2 30  ? 8.598   9.937  50.490  1.00 70.71 ? 30  GLU A C     1 
ATOM   944  O  O     . GLU B 2 30  ? 7.960   9.954  51.545  1.00 71.09 ? 30  GLU A O     1 
ATOM   945  C  CB    . GLU B 2 30  ? 10.938  10.771 50.363  1.00 72.93 ? 30  GLU A CB    1 
ATOM   946  C  CG    . GLU B 2 30  ? 12.033  10.881 51.411  1.00 75.06 ? 30  GLU A CG    1 
ATOM   947  C  CD    . GLU B 2 30  ? 12.715  9.547  51.676  1.00 76.93 ? 30  GLU A CD    1 
ATOM   948  O  OE1   . GLU B 2 30  ? 12.265  8.839  52.595  1.00 77.91 ? 30  GLU A OE1   1 
ATOM   949  O  OE2   . GLU B 2 30  ? 13.690  9.195  50.969  1.00 77.38 ? 30  GLU A OE2   1 
ATOM   950  N  N     . LEU B 2 31  ? 8.078   10.277 49.314  1.00 68.97 ? 31  LEU A N     1 
ATOM   951  C  CA    . LEU B 2 31  ? 6.701   10.718 49.189  1.00 67.50 ? 31  LEU A CA    1 
ATOM   952  C  C     . LEU B 2 31  ? 5.723   9.762  49.871  1.00 67.27 ? 31  LEU A C     1 
ATOM   953  O  O     . LEU B 2 31  ? 4.739   10.203 50.468  1.00 67.04 ? 31  LEU A O     1 
ATOM   954  C  CB    . LEU B 2 31  ? 6.343   10.895 47.713  1.00 66.75 ? 31  LEU A CB    1 
ATOM   955  C  CG    . LEU B 2 31  ? 4.984   11.554 47.447  1.00 66.21 ? 31  LEU A CG    1 
ATOM   956  C  CD1   . LEU B 2 31  ? 4.931   12.912 48.114  1.00 65.15 ? 31  LEU A CD1   1 
ATOM   957  C  CD2   . LEU B 2 31  ? 4.762   11.692 45.951  1.00 65.77 ? 31  LEU A CD2   1 
ATOM   958  N  N     . ARG B 2 32  ? 5.977   8.457  49.784  1.00 66.76 ? 32  ARG A N     1 
ATOM   959  C  CA    . ARG B 2 32  ? 5.091   7.493  50.440  1.00 65.45 ? 32  ARG A CA    1 
ATOM   960  C  C     . ARG B 2 32  ? 5.359   7.556  51.933  1.00 63.62 ? 32  ARG A C     1 
ATOM   961  O  O     . ARG B 2 32  ? 4.436   7.731  52.737  1.00 63.70 ? 32  ARG A O     1 
ATOM   962  C  CB    . ARG B 2 32  ? 5.333   6.060  49.939  1.00 66.54 ? 32  ARG A CB    1 
ATOM   963  C  CG    . ARG B 2 32  ? 4.394   5.633  48.816  1.00 68.22 ? 32  ARG A CG    1 
ATOM   964  C  CD    . ARG B 2 32  ? 4.160   4.119  48.784  1.00 69.06 ? 32  ARG A CD    1 
ATOM   965  N  NE    . ARG B 2 32  ? 3.220   3.730  47.731  1.00 69.45 ? 32  ARG A NE    1 
ATOM   966  C  CZ    . ARG B 2 32  ? 3.481   3.797  46.426  1.00 70.13 ? 32  ARG A CZ    1 
ATOM   967  N  NH1   . ARG B 2 32  ? 4.663   4.229  46.000  1.00 69.42 ? 32  ARG A NH1   1 
ATOM   968  N  NH2   . ARG B 2 32  ? 2.550   3.449  45.542  1.00 69.91 ? 32  ARG A NH2   1 
ATOM   969  N  N     . ARG B 2 33  ? 6.634   7.426  52.291  1.00 60.43 ? 33  ARG A N     1 
ATOM   970  C  CA    . ARG B 2 33  ? 7.056   7.468  53.684  1.00 57.19 ? 33  ARG A CA    1 
ATOM   971  C  C     . ARG B 2 33  ? 6.348   8.580  54.449  1.00 56.39 ? 33  ARG A C     1 
ATOM   972  O  O     . ARG B 2 33  ? 5.663   8.319  55.442  1.00 54.78 ? 33  ARG A O     1 
ATOM   973  C  CB    . ARG B 2 33  ? 8.575   7.623  53.744  1.00 54.97 ? 33  ARG A CB    1 
ATOM   974  C  CG    . ARG B 2 33  ? 9.295   6.307  53.471  1.00 52.28 ? 33  ARG A CG    1 
ATOM   975  C  CD    . ARG B 2 33  ? 10.709  6.493  52.966  1.00 50.83 ? 33  ARG A CD    1 
ATOM   976  N  NE    . ARG B 2 33  ? 11.552  5.359  53.330  1.00 51.19 ? 33  ARG A NE    1 
ATOM   977  C  CZ    . ARG B 2 33  ? 12.835  5.226  53.003  1.00 51.19 ? 33  ARG A CZ    1 
ATOM   978  N  NH1   . ARG B 2 33  ? 13.455  6.159  52.284  1.00 49.72 ? 33  ARG A NH1   1 
ATOM   979  N  NH2   . ARG B 2 33  ? 13.506  4.160  53.420  1.00 50.09 ? 33  ARG A NH2   1 
ATOM   980  N  N     . ARG B 2 34  ? 6.496   9.811  53.963  1.00 56.76 ? 34  ARG A N     1 
ATOM   981  C  CA    . ARG B 2 34  ? 5.869   10.979 54.580  1.00 56.82 ? 34  ARG A CA    1 
ATOM   982  C  C     . ARG B 2 34  ? 4.359   10.798 54.613  1.00 56.97 ? 34  ARG A C     1 
ATOM   983  O  O     . ARG B 2 34  ? 3.711   10.974 55.654  1.00 56.21 ? 34  ARG A O     1 
ATOM   984  C  CB    . ARG B 2 34  ? 6.204   12.237 53.779  1.00 56.13 ? 34  ARG A CB    1 
ATOM   985  C  CG    . ARG B 2 34  ? 7.679   12.413 53.498  1.00 55.94 ? 34  ARG A CG    1 
ATOM   986  C  CD    . ARG B 2 34  ? 7.928   13.691 52.724  1.00 55.92 ? 34  ARG A CD    1 
ATOM   987  N  NE    . ARG B 2 34  ? 9.352   13.891 52.469  1.00 56.78 ? 34  ARG A NE    1 
ATOM   988  C  CZ    . ARG B 2 34  ? 9.852   14.928 51.803  1.00 56.32 ? 34  ARG A CZ    1 
ATOM   989  N  NH1   . ARG B 2 34  ? 9.034   15.856 51.325  1.00 55.20 ? 34  ARG A NH1   1 
ATOM   990  N  NH2   . ARG B 2 34  ? 11.165  15.036 51.626  1.00 55.71 ? 34  ARG A NH2   1 
ATOM   991  N  N     . LEU B 2 35  ? 3.815   10.439 53.454  1.00 57.82 ? 35  LEU A N     1 
ATOM   992  C  CA    . LEU B 2 35  ? 2.382   10.225 53.285  1.00 58.60 ? 35  LEU A CA    1 
ATOM   993  C  C     . LEU B 2 35  ? 1.856   9.196  54.268  1.00 59.39 ? 35  LEU A C     1 
ATOM   994  O  O     . LEU B 2 35  ? 0.718   9.302  54.747  1.00 58.90 ? 35  LEU A O     1 
ATOM   995  C  CB    . LEU B 2 35  ? 2.083   9.786  51.845  1.00 57.21 ? 35  LEU A CB    1 
ATOM   996  C  CG    . LEU B 2 35  ? 1.489   10.876 50.946  1.00 55.49 ? 35  LEU A CG    1 
ATOM   997  C  CD1   . LEU B 2 35  ? 1.528   10.420 49.498  1.00 54.95 ? 35  LEU A CD1   1 
ATOM   998  C  CD2   . LEU B 2 35  ? 0.054   11.194 51.401  1.00 54.24 ? 35  LEU A CD2   1 
ATOM   999  N  N     . ASP B 2 36  ? 2.696   8.203  54.557  1.00 60.79 ? 36  ASP A N     1 
ATOM   1000 C  CA    . ASP B 2 36  ? 2.349   7.138  55.493  1.00 62.21 ? 36  ASP A CA    1 
ATOM   1001 C  C     . ASP B 2 36  ? 2.460   7.614  56.926  1.00 63.75 ? 36  ASP A C     1 
ATOM   1002 O  O     . ASP B 2 36  ? 1.573   7.344  57.738  1.00 64.65 ? 36  ASP A O     1 
ATOM   1003 C  CB    . ASP B 2 36  ? 3.254   5.925  55.301  1.00 60.10 ? 36  ASP A CB    1 
ATOM   1004 C  CG    . ASP B 2 36  ? 2.938   5.175  54.040  1.00 58.64 ? 36  ASP A CG    1 
ATOM   1005 O  OD1   . ASP B 2 36  ? 1.733   5.054  53.720  1.00 56.82 ? 36  ASP A OD1   1 
ATOM   1006 O  OD2   . ASP B 2 36  ? 3.887   4.705  53.380  1.00 58.18 ? 36  ASP A OD2   1 
ATOM   1007 N  N     . GLU B 2 37  ? 3.544   8.321  57.237  1.00 64.74 ? 37  GLU A N     1 
ATOM   1008 C  CA    . GLU B 2 37  ? 3.731   8.828  58.584  1.00 65.80 ? 37  GLU A CA    1 
ATOM   1009 C  C     . GLU B 2 37  ? 2.764   9.982  58.847  1.00 65.03 ? 37  GLU A C     1 
ATOM   1010 O  O     . GLU B 2 37  ? 3.098   10.949 59.519  1.00 65.97 ? 37  GLU A O     1 
ATOM   1011 C  CB    . GLU B 2 37  ? 5.184   9.269  58.794  1.00 68.28 ? 37  GLU A CB    1 
ATOM   1012 C  CG    . GLU B 2 37  ? 5.539   9.605  60.251  1.00 72.60 ? 37  GLU A CG    1 
ATOM   1013 C  CD    . GLU B 2 37  ? 5.183   8.481  61.233  1.00 75.45 ? 37  GLU A CD    1 
ATOM   1014 O  OE1   . GLU B 2 37  ? 5.650   7.331  61.024  1.00 76.60 ? 37  GLU A OE1   1 
ATOM   1015 O  OE2   . GLU B 2 37  ? 4.440   8.752  62.212  1.00 75.65 ? 37  GLU A OE2   1 
ATOM   1016 N  N     . LEU B 2 38  ? 1.563   9.861  58.294  1.00 64.35 ? 38  LEU A N     1 
ATOM   1017 C  CA    . LEU B 2 38  ? 0.484   10.833 58.456  1.00 63.96 ? 38  LEU A CA    1 
ATOM   1018 C  C     . LEU B 2 38  ? -0.687  9.869  58.497  1.00 63.46 ? 38  LEU A C     1 
ATOM   1019 O  O     . LEU B 2 38  ? -1.649  10.035 59.245  1.00 62.72 ? 38  LEU A O     1 
ATOM   1020 C  CB    . LEU B 2 38  ? 0.487   11.865 57.327  1.00 64.33 ? 38  LEU A CB    1 
ATOM   1021 C  CG    . LEU B 2 38  ? 1.708   12.765 57.152  1.00 64.85 ? 38  LEU A CG    1 
ATOM   1022 C  CD1   . LEU B 2 38  ? 1.455   13.741 56.004  1.00 64.87 ? 38  LEU A CD1   1 
ATOM   1023 C  CD2   . LEU B 2 38  ? 1.977   13.521 58.436  1.00 64.68 ? 38  LEU A CD2   1 
ATOM   1024 N  N     . GLY B 2 39  ? -0.574  8.857  57.647  1.00 63.74 ? 39  GLY A N     1 
ATOM   1025 C  CA    . GLY B 2 39  ? -1.635  7.903  57.441  1.00 63.77 ? 39  GLY A CA    1 
ATOM   1026 C  C     . GLY B 2 39  ? -2.875  8.420  56.751  1.00 64.23 ? 39  GLY A C     1 
ATOM   1027 O  O     . GLY B 2 39  ? -3.904  8.593  57.411  1.00 64.43 ? 39  GLY A O     1 
ATOM   1028 N  N     . VAL B 2 40  ? -2.783  8.686  55.443  1.00 64.28 ? 40  VAL A N     1 
ATOM   1029 C  CA    . VAL B 2 40  ? -3.951  9.128  54.656  1.00 64.24 ? 40  VAL A CA    1 
ATOM   1030 C  C     . VAL B 2 40  ? -4.057  8.249  53.418  1.00 63.30 ? 40  VAL A C     1 
ATOM   1031 O  O     . VAL B 2 40  ? -3.054  7.980  52.758  1.00 63.66 ? 40  VAL A O     1 
ATOM   1032 C  CB    . VAL B 2 40  ? -3.866  10.608 54.181  1.00 64.60 ? 40  VAL A CB    1 
ATOM   1033 C  CG1   . VAL B 2 40  ? -5.067  10.929 53.264  1.00 63.55 ? 40  VAL A CG1   1 
ATOM   1034 C  CG2   . VAL B 2 40  ? -3.864  11.550 55.388  1.00 64.84 ? 40  VAL A CG2   1 
ATOM   1035 N  N     . GLU B 2 41  ? -5.264  7.802  53.096  1.00 62.27 ? 41  GLU A N     1 
ATOM   1036 C  CA    . GLU B 2 41  ? -5.424  6.943  51.937  1.00 62.66 ? 41  GLU A CA    1 
ATOM   1037 C  C     . GLU B 2 41  ? -5.086  7.702  50.655  1.00 63.41 ? 41  GLU A C     1 
ATOM   1038 O  O     . GLU B 2 41  ? -5.696  8.728  50.333  1.00 64.00 ? 41  GLU A O     1 
ATOM   1039 C  CB    . GLU B 2 41  ? -6.841  6.380  51.875  1.00 61.97 ? 41  GLU A CB    1 
ATOM   1040 C  CG    . GLU B 2 41  ? -6.892  5.016  51.213  1.00 60.92 ? 41  GLU A CG    1 
ATOM   1041 C  CD    . GLU B 2 41  ? -8.226  4.342  51.395  1.00 60.10 ? 41  GLU A CD    1 
ATOM   1042 O  OE1   . GLU B 2 41  ? -8.729  4.358  52.536  1.00 58.84 ? 41  GLU A OE1   1 
ATOM   1043 O  OE2   . GLU B 2 41  ? -8.764  3.793  50.408  1.00 59.54 ? 41  GLU A OE2   1 
ATOM   1044 N  N     . TYR B 2 42  ? -4.115  7.174  49.919  1.00 63.38 ? 42  TYR A N     1 
ATOM   1045 C  CA    . TYR B 2 42  ? -3.647  7.805  48.690  1.00 62.69 ? 42  TYR A CA    1 
ATOM   1046 C  C     . TYR B 2 42  ? -3.364  6.823  47.544  1.00 61.24 ? 42  TYR A C     1 
ATOM   1047 O  O     . TYR B 2 42  ? -2.886  5.709  47.768  1.00 61.09 ? 42  TYR A O     1 
ATOM   1048 C  CB    . TYR B 2 42  ? -2.367  8.555  49.014  1.00 63.42 ? 42  TYR A CB    1 
ATOM   1049 C  CG    . TYR B 2 42  ? -1.275  7.619  49.466  1.00 64.98 ? 42  TYR A CG    1 
ATOM   1050 C  CD1   . TYR B 2 42  ? -0.485  6.937  48.538  1.00 65.64 ? 42  TYR A CD1   1 
ATOM   1051 C  CD2   . TYR B 2 42  ? -1.059  7.374  50.822  1.00 65.41 ? 42  TYR A CD2   1 
ATOM   1052 C  CE1   . TYR B 2 42  ? 0.494   6.032  48.953  1.00 67.31 ? 42  TYR A CE1   1 
ATOM   1053 C  CE2   . TYR B 2 42  ? -0.082  6.472  51.248  1.00 66.65 ? 42  TYR A CE2   1 
ATOM   1054 C  CZ    . TYR B 2 42  ? 0.690   5.806  50.309  1.00 67.20 ? 42  TYR A CZ    1 
ATOM   1055 O  OH    . TYR B 2 42  ? 1.663   4.925  50.723  1.00 67.91 ? 42  TYR A OH    1 
ATOM   1056 N  N     . VAL B 2 43  ? -3.637  7.247  46.315  1.00 59.43 ? 43  VAL A N     1 
ATOM   1057 C  CA    . VAL B 2 43  ? -3.362  6.408  45.154  1.00 57.00 ? 43  VAL A CA    1 
ATOM   1058 C  C     . VAL B 2 43  ? -2.425  7.101  44.156  1.00 56.61 ? 43  VAL A C     1 
ATOM   1059 O  O     . VAL B 2 43  ? -2.651  8.250  43.774  1.00 56.06 ? 43  VAL A O     1 
ATOM   1060 C  CB    . VAL B 2 43  ? -4.655  6.009  44.417  1.00 55.04 ? 43  VAL A CB    1 
ATOM   1061 C  CG1   . VAL B 2 43  ? -5.417  7.236  43.986  1.00 53.97 ? 43  VAL A CG1   1 
ATOM   1062 C  CG2   . VAL B 2 43  ? -4.311  5.161  43.223  1.00 53.97 ? 43  VAL A CG2   1 
ATOM   1063 N  N     . PHE B 2 44  ? -1.359  6.407  43.764  1.00 55.95 ? 44  PHE A N     1 
ATOM   1064 C  CA    . PHE B 2 44  ? -0.418  6.940  42.782  1.00 55.76 ? 44  PHE A CA    1 
ATOM   1065 C  C     . PHE B 2 44  ? -1.001  6.617  41.404  1.00 55.04 ? 44  PHE A C     1 
ATOM   1066 O  O     . PHE B 2 44  ? -1.362  5.476  41.130  1.00 55.48 ? 44  PHE A O     1 
ATOM   1067 C  CB    . PHE B 2 44  ? 0.951   6.268  42.902  1.00 56.63 ? 44  PHE A CB    1 
ATOM   1068 C  CG    . PHE B 2 44  ? 1.846   6.872  43.941  1.00 58.75 ? 44  PHE A CG    1 
ATOM   1069 C  CD1   . PHE B 2 44  ? 1.445   6.961  45.268  1.00 60.35 ? 44  PHE A CD1   1 
ATOM   1070 C  CD2   . PHE B 2 44  ? 3.122   7.312  43.597  1.00 60.28 ? 44  PHE A CD2   1 
ATOM   1071 C  CE1   . PHE B 2 44  ? 2.310   7.479  46.246  1.00 61.03 ? 44  PHE A CE1   1 
ATOM   1072 C  CE2   . PHE B 2 44  ? 4.000   7.830  44.562  1.00 60.83 ? 44  PHE A CE2   1 
ATOM   1073 C  CZ    . PHE B 2 44  ? 3.594   7.914  45.887  1.00 60.91 ? 44  PHE A CZ    1 
ATOM   1074 N  N     . VAL B 2 45  ? -1.094  7.619  40.541  1.00 53.14 ? 45  VAL A N     1 
ATOM   1075 C  CA    . VAL B 2 45  ? -1.642  7.427  39.206  1.00 49.66 ? 45  VAL A CA    1 
ATOM   1076 C  C     . VAL B 2 45  ? -0.843  8.259  38.221  1.00 48.10 ? 45  VAL A C     1 
ATOM   1077 O  O     . VAL B 2 45  ? 0.280   8.667  38.507  1.00 47.70 ? 45  VAL A O     1 
ATOM   1078 C  CB    . VAL B 2 45  ? -3.116  7.872  39.150  1.00 49.10 ? 45  VAL A CB    1 
ATOM   1079 C  CG1   . VAL B 2 45  ? -3.900  7.165  40.219  1.00 47.25 ? 45  VAL A CG1   1 
ATOM   1080 C  CG2   . VAL B 2 45  ? -3.217  9.379  39.342  1.00 49.21 ? 45  VAL A CG2   1 
ATOM   1081 N  N     . GLY B 2 46  ? -1.436  8.513  37.062  1.00 46.64 ? 46  GLY A N     1 
ATOM   1082 C  CA    . GLY B 2 46  ? -0.766  9.303  36.049  1.00 45.40 ? 46  GLY A CA    1 
ATOM   1083 C  C     . GLY B 2 46  ? 0.271   8.509  35.286  1.00 43.95 ? 46  GLY A C     1 
ATOM   1084 O  O     . GLY B 2 46  ? 0.466   7.322  35.528  1.00 43.87 ? 46  GLY A O     1 
ATOM   1085 N  N     . SER B 2 47  ? 0.953   9.175  34.368  1.00 42.90 ? 47  SER A N     1 
ATOM   1086 C  CA    . SER B 2 47  ? 1.956   8.513  33.559  1.00 42.33 ? 47  SER A CA    1 
ATOM   1087 C  C     . SER B 2 47  ? 3.078   7.902  34.390  1.00 43.32 ? 47  SER A C     1 
ATOM   1088 O  O     . SER B 2 47  ? 3.663   6.881  34.002  1.00 43.52 ? 47  SER A O     1 
ATOM   1089 C  CB    . SER B 2 47  ? 2.539   9.497  32.539  1.00 40.74 ? 47  SER A CB    1 
ATOM   1090 O  OG    . SER B 2 47  ? 3.201   10.571 33.175  1.00 39.17 ? 47  SER A OG    1 
ATOM   1091 N  N     . TYR B 2 48  ? 3.374   8.504  35.539  1.00 43.87 ? 48  TYR A N     1 
ATOM   1092 C  CA    . TYR B 2 48  ? 4.468   7.992  36.358  1.00 44.18 ? 48  TYR A CA    1 
ATOM   1093 C  C     . TYR B 2 48  ? 4.185   6.605  36.881  1.00 43.80 ? 48  TYR A C     1 
ATOM   1094 O  O     . TYR B 2 48  ? 4.971   5.678  36.688  1.00 43.65 ? 48  TYR A O     1 
ATOM   1095 C  CB    . TYR B 2 48  ? 4.772   8.909  37.541  1.00 44.27 ? 48  TYR A CB    1 
ATOM   1096 C  CG    . TYR B 2 48  ? 5.959   8.404  38.326  1.00 44.23 ? 48  TYR A CG    1 
ATOM   1097 C  CD1   . TYR B 2 48  ? 7.196   8.225  37.703  1.00 43.57 ? 48  TYR A CD1   1 
ATOM   1098 C  CD2   . TYR B 2 48  ? 5.826   8.014  39.663  1.00 43.52 ? 48  TYR A CD2   1 
ATOM   1099 C  CE1   . TYR B 2 48  ? 8.268   7.663  38.380  1.00 44.34 ? 48  TYR A CE1   1 
ATOM   1100 C  CE2   . TYR B 2 48  ? 6.890   7.449  40.351  1.00 44.06 ? 48  TYR A CE2   1 
ATOM   1101 C  CZ    . TYR B 2 48  ? 8.110   7.270  39.702  1.00 45.38 ? 48  TYR A CZ    1 
ATOM   1102 O  OH    . TYR B 2 48  ? 9.160   6.656  40.359  1.00 47.55 ? 48  TYR A OH    1 
ATOM   1103 N  N     . ALA B 2 49  ? 3.058   6.481  37.557  1.00 43.75 ? 49  ALA A N     1 
ATOM   1104 C  CA    . ALA B 2 49  ? 2.631   5.222  38.118  1.00 43.75 ? 49  ALA A CA    1 
ATOM   1105 C  C     . ALA B 2 49  ? 2.680   4.145  37.053  1.00 44.01 ? 49  ALA A C     1 
ATOM   1106 O  O     . ALA B 2 49  ? 3.186   3.048  37.283  1.00 44.27 ? 49  ALA A O     1 
ATOM   1107 C  CB    . ALA B 2 49  ? 1.214   5.358  38.642  1.00 44.50 ? 49  ALA A CB    1 
ATOM   1108 N  N     . ARG B 2 50  ? 2.164   4.467  35.875  1.00 44.22 ? 50  ARG A N     1 
ATOM   1109 C  CA    . ARG B 2 50  ? 2.120   3.495  34.798  1.00 43.98 ? 50  ARG A CA    1 
ATOM   1110 C  C     . ARG B 2 50  ? 3.337   3.447  33.900  1.00 43.49 ? 50  ARG A C     1 
ATOM   1111 O  O     . ARG B 2 50  ? 3.300   2.792  32.863  1.00 42.83 ? 50  ARG A O     1 
ATOM   1112 C  CB    . ARG B 2 50  ? 0.873   3.725  33.957  1.00 44.36 ? 50  ARG A CB    1 
ATOM   1113 C  CG    . ARG B 2 50  ? -0.357  3.961  34.798  1.00 45.68 ? 50  ARG A CG    1 
ATOM   1114 C  CD    . ARG B 2 50  ? -1.612  3.740  34.002  1.00 46.61 ? 50  ARG A CD    1 
ATOM   1115 N  NE    . ARG B 2 50  ? -2.575  4.815  34.203  1.00 47.88 ? 50  ARG A NE    1 
ATOM   1116 C  CZ    . ARG B 2 50  ? -2.460  6.022  33.667  1.00 47.66 ? 50  ARG A CZ    1 
ATOM   1117 N  NH1   . ARG B 2 50  ? -1.422  6.309  32.899  1.00 47.18 ? 50  ARG A NH1   1 
ATOM   1118 N  NH2   . ARG B 2 50  ? -3.393  6.933  33.889  1.00 49.24 ? 50  ARG A NH2   1 
ATOM   1119 N  N     . ASN B 2 51  ? 4.414   4.122  34.285  1.00 43.94 ? 51  ASN A N     1 
ATOM   1120 C  CA    . ASN B 2 51  ? 5.623   4.099  33.465  1.00 46.49 ? 51  ASN A CA    1 
ATOM   1121 C  C     . ASN B 2 51  ? 5.364   4.513  32.017  1.00 46.98 ? 51  ASN A C     1 
ATOM   1122 O  O     . ASN B 2 51  ? 5.753   3.808  31.090  1.00 47.17 ? 51  ASN A O     1 
ATOM   1123 C  CB    . ASN B 2 51  ? 6.235   2.694  33.471  1.00 47.58 ? 51  ASN A CB    1 
ATOM   1124 C  CG    . ASN B 2 51  ? 7.174   2.479  34.636  1.00 50.34 ? 51  ASN A CG    1 
ATOM   1125 O  OD1   . ASN B 2 51  ? 8.273   3.041  34.669  1.00 52.70 ? 51  ASN A OD1   1 
ATOM   1126 N  ND2   . ASN B 2 51  ? 6.750   1.671  35.607  1.00 50.54 ? 51  ASN A ND2   1 
ATOM   1127 N  N     . THR B 2 52  ? 4.710   5.652  31.821  1.00 47.32 ? 52  THR A N     1 
ATOM   1128 C  CA    . THR B 2 52  ? 4.413   6.121  30.474  1.00 46.94 ? 52  THR A CA    1 
ATOM   1129 C  C     . THR B 2 52  ? 4.813   7.578  30.329  1.00 47.91 ? 52  THR A C     1 
ATOM   1130 O  O     . THR B 2 52  ? 4.471   8.222  29.338  1.00 47.90 ? 52  THR A O     1 
ATOM   1131 C  CB    . THR B 2 52  ? 2.915   6.033  30.155  1.00 46.58 ? 52  THR A CB    1 
ATOM   1132 O  OG1   . THR B 2 52  ? 2.214   7.040  30.894  1.00 46.19 ? 52  THR A OG1   1 
ATOM   1133 C  CG2   . THR B 2 52  ? 2.367   4.660  30.513  1.00 45.54 ? 52  THR A CG2   1 
ATOM   1134 N  N     . TRP B 2 53  ? 5.528   8.104  31.316  1.00 48.78 ? 53  TRP A N     1 
ATOM   1135 C  CA    . TRP B 2 53  ? 5.937   9.495  31.251  1.00 49.04 ? 53  TRP A CA    1 
ATOM   1136 C  C     . TRP B 2 53  ? 7.072   9.682  30.253  1.00 49.17 ? 53  TRP A C     1 
ATOM   1137 O  O     . TRP B 2 53  ? 7.873   8.779  30.016  1.00 47.50 ? 53  TRP A O     1 
ATOM   1138 C  CB    . TRP B 2 53  ? 6.323   10.012 32.647  1.00 49.45 ? 53  TRP A CB    1 
ATOM   1139 C  CG    . TRP B 2 53  ? 7.770   9.888  33.005  1.00 49.87 ? 53  TRP A CG    1 
ATOM   1140 C  CD1   . TRP B 2 53  ? 8.783   10.765 32.700  1.00 49.81 ? 53  TRP A CD1   1 
ATOM   1141 C  CD2   . TRP B 2 53  ? 8.366   8.833  33.757  1.00 49.80 ? 53  TRP A CD2   1 
ATOM   1142 N  NE1   . TRP B 2 53  ? 9.979   10.313 33.225  1.00 49.36 ? 53  TRP A NE1   1 
ATOM   1143 C  CE2   . TRP B 2 53  ? 9.748   9.128  33.878  1.00 49.30 ? 53  TRP A CE2   1 
ATOM   1144 C  CE3   . TRP B 2 53  ? 7.868   7.662  34.342  1.00 49.58 ? 53  TRP A CE3   1 
ATOM   1145 C  CZ2   . TRP B 2 53  ? 10.629  8.299  34.559  1.00 49.37 ? 53  TRP A CZ2   1 
ATOM   1146 C  CZ3   . TRP B 2 53  ? 8.741   6.839  35.017  1.00 50.56 ? 53  TRP A CZ3   1 
ATOM   1147 C  CH2   . TRP B 2 53  ? 10.112  7.160  35.122  1.00 50.44 ? 53  TRP A CH2   1 
ATOM   1148 N  N     . LEU B 2 54  ? 7.105   10.874 29.667  1.00 50.82 ? 54  LEU A N     1 
ATOM   1149 C  CA    . LEU B 2 54  ? 8.086   11.270 28.663  1.00 51.67 ? 54  LEU A CA    1 
ATOM   1150 C  C     . LEU B 2 54  ? 9.444   11.608 29.269  1.00 52.58 ? 54  LEU A C     1 
ATOM   1151 O  O     . LEU B 2 54  ? 9.521   12.163 30.359  1.00 52.70 ? 54  LEU A O     1 
ATOM   1152 C  CB    . LEU B 2 54  ? 7.542   12.484 27.916  1.00 51.70 ? 54  LEU A CB    1 
ATOM   1153 C  CG    . LEU B 2 54  ? 7.707   12.502 26.402  1.00 52.62 ? 54  LEU A CG    1 
ATOM   1154 C  CD1   . LEU B 2 54  ? 7.201   11.205 25.806  1.00 53.27 ? 54  LEU A CD1   1 
ATOM   1155 C  CD2   . LEU B 2 54  ? 6.940   13.687 25.838  1.00 53.61 ? 54  LEU A CD2   1 
ATOM   1156 N  N     . LYS B 2 55  ? 10.518  11.274 28.561  1.00 54.15 ? 55  LYS A N     1 
ATOM   1157 C  CA    . LYS B 2 55  ? 11.867  11.566 29.045  1.00 55.87 ? 55  LYS A CA    1 
ATOM   1158 C  C     . LYS B 2 55  ? 11.979  13.054 29.349  1.00 56.65 ? 55  LYS A C     1 
ATOM   1159 O  O     . LYS B 2 55  ? 11.678  13.890 28.495  1.00 57.25 ? 55  LYS A O     1 
ATOM   1160 C  CB    . LYS B 2 55  ? 12.905  11.184 27.989  1.00 56.72 ? 55  LYS A CB    1 
ATOM   1161 C  CG    . LYS B 2 55  ? 14.353  11.510 28.353  1.00 58.62 ? 55  LYS A CG    1 
ATOM   1162 C  CD    . LYS B 2 55  ? 15.306  10.962 27.277  1.00 60.11 ? 55  LYS A CD    1 
ATOM   1163 C  CE    . LYS B 2 55  ? 16.779  11.243 27.580  1.00 60.58 ? 55  LYS A CE    1 
ATOM   1164 N  NZ    . LYS B 2 55  ? 17.138  12.679 27.400  1.00 61.39 ? 55  LYS A NZ    1 
ATOM   1165 N  N     . GLY B 2 56  ? 12.404  13.389 30.562  1.00 56.85 ? 56  GLY A N     1 
ATOM   1166 C  CA    . GLY B 2 56  ? 12.528  14.788 30.922  1.00 57.64 ? 56  GLY A CA    1 
ATOM   1167 C  C     . GLY B 2 56  ? 11.190  15.456 31.205  1.00 58.42 ? 56  GLY A C     1 
ATOM   1168 O  O     . GLY B 2 56  ? 11.056  16.677 31.123  1.00 59.09 ? 56  GLY A O     1 
ATOM   1169 N  N     . SER B 2 57  ? 10.187  14.656 31.537  1.00 58.91 ? 57  SER A N     1 
ATOM   1170 C  CA    . SER B 2 57  ? 8.869   15.186 31.853  1.00 59.25 ? 57  SER A CA    1 
ATOM   1171 C  C     . SER B 2 57  ? 8.349   14.426 33.064  1.00 58.83 ? 57  SER A C     1 
ATOM   1172 O  O     . SER B 2 57  ? 7.190   14.021 33.113  1.00 58.83 ? 57  SER A O     1 
ATOM   1173 C  CB    . SER B 2 57  ? 7.921   15.002 30.662  1.00 60.89 ? 57  SER A CB    1 
ATOM   1174 O  OG    . SER B 2 57  ? 8.300   15.807 29.553  1.00 62.73 ? 57  SER A OG    1 
ATOM   1175 N  N     . LEU B 2 58  ? 9.229   14.227 34.039  1.00 58.98 ? 58  LEU A N     1 
ATOM   1176 C  CA    . LEU B 2 58  ? 8.873   13.509 35.254  1.00 58.87 ? 58  LEU A CA    1 
ATOM   1177 C  C     . LEU B 2 58  ? 7.921   14.352 36.087  1.00 58.26 ? 58  LEU A C     1 
ATOM   1178 O  O     . LEU B 2 58  ? 8.107   15.557 36.232  1.00 58.02 ? 58  LEU A O     1 
ATOM   1179 C  CB    . LEU B 2 58  ? 10.130  13.172 36.060  1.00 59.10 ? 58  LEU A CB    1 
ATOM   1180 C  CG    . LEU B 2 58  ? 9.901   12.225 37.240  1.00 59.33 ? 58  LEU A CG    1 
ATOM   1181 C  CD1   . LEU B 2 58  ? 9.154   10.990 36.772  1.00 59.51 ? 58  LEU A CD1   1 
ATOM   1182 C  CD2   . LEU B 2 58  ? 11.237  11.838 37.856  1.00 59.62 ? 58  LEU A CD2   1 
ATOM   1183 N  N     . GLU B 2 59  ? 6.893   13.712 36.624  1.00 58.30 ? 59  GLU A N     1 
ATOM   1184 C  CA    . GLU B 2 59  ? 5.903   14.416 37.420  1.00 59.37 ? 59  GLU A CA    1 
ATOM   1185 C  C     . GLU B 2 59  ? 5.133   13.267 38.077  1.00 59.03 ? 59  GLU A C     1 
ATOM   1186 O  O     . GLU B 2 59  ? 4.525   12.424 37.405  1.00 59.12 ? 59  GLU A O     1 
ATOM   1187 C  CB    . GLU B 2 59  ? 5.111   15.360 36.519  1.00 60.67 ? 59  GLU A CB    1 
ATOM   1188 C  CG    . GLU B 2 59  ? 4.035   16.155 37.220  1.00 63.51 ? 59  GLU A CG    1 
ATOM   1189 C  CD    . GLU B 2 59  ? 3.239   17.001 36.245  1.00 65.51 ? 59  GLU A CD    1 
ATOM   1190 O  OE1   . GLU B 2 59  ? 2.072   17.329 36.562  1.00 66.46 ? 59  GLU A OE1   1 
ATOM   1191 O  OE2   . GLU B 2 59  ? 3.782   17.337 35.162  1.00 65.93 ? 59  GLU A OE2   1 
ATOM   1192 N  N     . ILE B 2 60  ? 5.178   13.253 39.405  1.00 57.94 ? 60  ILE A N     1 
ATOM   1193 C  CA    . ILE B 2 60  ? 4.436   12.303 40.211  1.00 57.14 ? 60  ILE A CA    1 
ATOM   1194 C  C     . ILE B 2 60  ? 3.097   12.851 40.652  1.00 57.05 ? 60  ILE A C     1 
ATOM   1195 O  O     . ILE B 2 60  ? 3.032   13.864 41.335  1.00 57.42 ? 60  ILE A O     1 
ATOM   1196 C  CB    . ILE B 2 60  ? 5.284   11.883 41.445  1.00 56.58 ? 60  ILE A CB    1 
ATOM   1197 C  CG1   . ILE B 2 60  ? 6.575   11.198 40.963  1.00 56.03 ? 60  ILE A CG1   1 
ATOM   1198 C  CG2   . ILE B 2 60  ? 4.488   10.951 42.356  1.00 56.35 ? 60  ILE A CG2   1 
ATOM   1199 C  CD1   . ILE B 2 60  ? 7.646   11.001 42.034  1.00 55.43 ? 60  ILE A CD1   1 
ATOM   1200 N  N     . ASP B 2 61  ? 2.028   12.177 40.239  1.00 57.00 ? 61  ASP A N     1 
ATOM   1201 C  CA    . ASP B 2 61  ? 0.675   12.580 40.597  1.00 56.65 ? 61  ASP A CA    1 
ATOM   1202 C  C     . ASP B 2 61  ? 0.180   11.672 41.709  1.00 56.12 ? 61  ASP A C     1 
ATOM   1203 O  O     . ASP B 2 61  ? 0.400   10.456 41.668  1.00 56.01 ? 61  ASP A O     1 
ATOM   1204 C  CB    . ASP B 2 61  ? -0.270  12.461 39.397  1.00 57.35 ? 61  ASP A CB    1 
ATOM   1205 C  CG    . ASP B 2 61  ? 0.040   13.462 38.304  1.00 58.93 ? 61  ASP A CG    1 
ATOM   1206 O  OD1   . ASP B 2 61  ? 1.137   13.380 37.714  1.00 60.74 ? 61  ASP A OD1   1 
ATOM   1207 O  OD2   . ASP B 2 61  ? -0.813  14.335 38.032  1.00 59.30 ? 61  ASP A OD2   1 
ATOM   1208 N  N     . VAL B 2 62  ? -0.493  12.271 42.691  1.00 54.82 ? 62  VAL A N     1 
ATOM   1209 C  CA    . VAL B 2 62  ? -1.036  11.538 43.829  1.00 53.65 ? 62  VAL A CA    1 
ATOM   1210 C  C     . VAL B 2 62  ? -2.453  11.995 44.198  1.00 53.22 ? 62  VAL A C     1 
ATOM   1211 O  O     . VAL B 2 62  ? -2.674  13.149 44.564  1.00 53.52 ? 62  VAL A O     1 
ATOM   1212 C  CB    . VAL B 2 62  ? -0.126  11.702 45.046  1.00 52.49 ? 62  VAL A CB    1 
ATOM   1213 C  CG1   . VAL B 2 62  ? -0.651  10.891 46.205  1.00 52.97 ? 62  VAL A CG1   1 
ATOM   1214 C  CG2   . VAL B 2 62  ? 1.269   11.258 44.693  1.00 53.21 ? 62  VAL A CG2   1 
ATOM   1215 N  N     . PHE B 2 63  ? -3.414  11.087 44.097  1.00 52.45 ? 63  PHE A N     1 
ATOM   1216 C  CA    . PHE B 2 63  ? -4.785  11.430 44.435  1.00 52.60 ? 63  PHE A CA    1 
ATOM   1217 C  C     . PHE B 2 63  ? -5.164  10.953 45.832  1.00 53.77 ? 63  PHE A C     1 
ATOM   1218 O  O     . PHE B 2 63  ? -5.062  9.764  46.155  1.00 54.16 ? 63  PHE A O     1 
ATOM   1219 C  CB    . PHE B 2 63  ? -5.760  10.850 43.406  1.00 50.75 ? 63  PHE A CB    1 
ATOM   1220 C  CG    . PHE B 2 63  ? -5.877  11.671 42.147  1.00 49.00 ? 63  PHE A CG    1 
ATOM   1221 C  CD1   . PHE B 2 63  ? -4.729  12.120 41.473  1.00 47.32 ? 63  PHE A CD1   1 
ATOM   1222 C  CD2   . PHE B 2 63  ? -7.137  11.988 41.628  1.00 47.30 ? 63  PHE A CD2   1 
ATOM   1223 C  CE1   . PHE B 2 63  ? -4.834  12.873 40.304  1.00 45.72 ? 63  PHE A CE1   1 
ATOM   1224 C  CE2   . PHE B 2 63  ? -7.256  12.739 40.460  1.00 46.59 ? 63  PHE A CE2   1 
ATOM   1225 C  CZ    . PHE B 2 63  ? -6.101  13.184 39.793  1.00 46.08 ? 63  PHE A CZ    1 
ATOM   1226 N  N     . LEU B 2 64  ? -5.601  11.903 46.655  1.00 54.40 ? 64  LEU A N     1 
ATOM   1227 C  CA    . LEU B 2 64  ? -6.008  11.625 48.019  1.00 54.59 ? 64  LEU A CA    1 
ATOM   1228 C  C     . LEU B 2 64  ? -7.467  11.209 47.985  1.00 55.24 ? 64  LEU A C     1 
ATOM   1229 O  O     . LEU B 2 64  ? -8.342  12.007 47.634  1.00 55.03 ? 64  LEU A O     1 
ATOM   1230 C  CB    . LEU B 2 64  ? -5.833  12.875 48.875  1.00 54.83 ? 64  LEU A CB    1 
ATOM   1231 C  CG    . LEU B 2 64  ? -4.503  13.621 48.703  1.00 55.23 ? 64  LEU A CG    1 
ATOM   1232 C  CD1   . LEU B 2 64  ? -4.332  14.617 49.847  1.00 54.98 ? 64  LEU A CD1   1 
ATOM   1233 C  CD2   . LEU B 2 64  ? -3.337  12.639 48.691  1.00 54.91 ? 64  LEU A CD2   1 
ATOM   1234 N  N     . LEU B 2 65  ? -7.727  9.959  48.352  1.00 55.81 ? 65  LEU A N     1 
ATOM   1235 C  CA    . LEU B 2 65  ? -9.084  9.432  48.334  1.00 56.17 ? 65  LEU A CA    1 
ATOM   1236 C  C     . LEU B 2 65  ? -9.849  9.646  49.639  1.00 56.22 ? 65  LEU A C     1 
ATOM   1237 O  O     . LEU B 2 65  ? -9.503  9.088  50.676  1.00 56.81 ? 65  LEU A O     1 
ATOM   1238 C  CB    . LEU B 2 65  ? -9.046  7.943  47.986  1.00 56.28 ? 65  LEU A CB    1 
ATOM   1239 C  CG    . LEU B 2 65  ? -8.254  7.561  46.726  1.00 56.19 ? 65  LEU A CG    1 
ATOM   1240 C  CD1   . LEU B 2 65  ? -6.751  7.398  47.062  1.00 55.12 ? 65  LEU A CD1   1 
ATOM   1241 C  CD2   . LEU B 2 65  ? -8.817  6.267  46.168  1.00 55.37 ? 65  LEU A CD2   1 
ATOM   1242 N  N     . PHE B 2 66  ? -10.896 10.461 49.572  1.00 56.22 ? 66  PHE A N     1 
ATOM   1243 C  CA    . PHE B 2 66  ? -11.728 10.762 50.728  1.00 56.87 ? 66  PHE A CA    1 
ATOM   1244 C  C     . PHE B 2 66  ? -13.081 10.052 50.611  1.00 56.72 ? 66  PHE A C     1 
ATOM   1245 O  O     . PHE B 2 66  ? -13.504 9.685  49.524  1.00 55.95 ? 66  PHE A O     1 
ATOM   1246 C  CB    . PHE B 2 66  ? -11.943 12.278 50.840  1.00 57.93 ? 66  PHE A CB    1 
ATOM   1247 C  CG    . PHE B 2 66  ? -10.692 13.048 51.166  1.00 59.68 ? 66  PHE A CG    1 
ATOM   1248 C  CD1   . PHE B 2 66  ? -9.951  12.749 52.304  1.00 61.07 ? 66  PHE A CD1   1 
ATOM   1249 C  CD2   . PHE B 2 66  ? -10.265 14.087 50.355  1.00 60.54 ? 66  PHE A CD2   1 
ATOM   1250 C  CE1   . PHE B 2 66  ? -8.798  13.480 52.630  1.00 61.50 ? 66  PHE A CE1   1 
ATOM   1251 C  CE2   . PHE B 2 66  ? -9.116  14.821 50.671  1.00 61.39 ? 66  PHE A CE2   1 
ATOM   1252 C  CZ    . PHE B 2 66  ? -8.384  14.517 51.811  1.00 61.23 ? 66  PHE A CZ    1 
ATOM   1253 N  N     . PRO B 2 67  ? -13.779 9.859  51.741  1.00 56.98 ? 67  PRO A N     1 
ATOM   1254 C  CA    . PRO B 2 67  ? -15.089 9.192  51.797  1.00 57.23 ? 67  PRO A CA    1 
ATOM   1255 C  C     . PRO B 2 67  ? -16.168 9.909  51.006  1.00 57.80 ? 67  PRO A C     1 
ATOM   1256 O  O     . PRO B 2 67  ? -16.022 11.080 50.705  1.00 57.40 ? 67  PRO A O     1 
ATOM   1257 C  CB    . PRO B 2 67  ? -15.405 9.183  53.287  1.00 57.61 ? 67  PRO A CB    1 
ATOM   1258 C  CG    . PRO B 2 67  ? -14.027 9.182  53.936  1.00 56.72 ? 67  PRO A CG    1 
ATOM   1259 C  CD    . PRO B 2 67  ? -13.284 10.167 53.097  1.00 56.90 ? 67  PRO A CD    1 
ATOM   1260 N  N     . GLU B 2 68  ? -17.252 9.204  50.681  1.00 59.63 ? 68  GLU A N     1 
ATOM   1261 C  CA    . GLU B 2 68  ? -18.365 9.800  49.933  1.00 61.41 ? 68  GLU A CA    1 
ATOM   1262 C  C     . GLU B 2 68  ? -18.886 11.002 50.701  1.00 62.20 ? 68  GLU A C     1 
ATOM   1263 O  O     . GLU B 2 68  ? -18.994 12.104 50.176  1.00 63.26 ? 68  GLU A O     1 
ATOM   1264 C  CB    . GLU B 2 68  ? -19.568 8.857  49.820  1.00 62.33 ? 68  GLU A CB    1 
ATOM   1265 C  CG    . GLU B 2 68  ? -19.432 7.552  49.063  1.00 63.73 ? 68  GLU A CG    1 
ATOM   1266 C  CD    . GLU B 2 68  ? -20.737 6.741  49.150  1.00 64.55 ? 68  GLU A CD    1 
ATOM   1267 O  OE1   . GLU B 2 68  ? -21.157 6.424  50.287  1.00 63.81 ? 68  GLU A OE1   1 
ATOM   1268 O  OE2   . GLU B 2 68  ? -21.346 6.434  48.095  1.00 64.08 ? 68  GLU A OE2   1 
ATOM   1269 N  N     . GLU B 2 69  ? -19.227 10.745 51.957  1.00 63.02 ? 69  GLU A N     1 
ATOM   1270 C  CA    . GLU B 2 69  ? -19.807 11.721 52.871  1.00 63.94 ? 69  GLU A CA    1 
ATOM   1271 C  C     . GLU B 2 69  ? -19.122 13.072 53.016  1.00 63.66 ? 69  GLU A C     1 
ATOM   1272 O  O     . GLU B 2 69  ? -19.799 14.089 53.115  1.00 63.44 ? 69  GLU A O     1 
ATOM   1273 C  CB    . GLU B 2 69  ? -19.973 11.074 54.253  1.00 65.10 ? 69  GLU A CB    1 
ATOM   1274 C  CG    . GLU B 2 69  ? -20.615 9.683  54.190  1.00 65.38 ? 69  GLU A CG    1 
ATOM   1275 C  CD    . GLU B 2 69  ? -19.661 8.616  53.648  1.00 65.93 ? 69  GLU A CD    1 
ATOM   1276 O  OE1   . GLU B 2 69  ? -20.145 7.691  52.953  1.00 65.66 ? 69  GLU A OE1   1 
ATOM   1277 O  OE2   . GLU B 2 69  ? -18.435 8.699  53.923  1.00 64.56 ? 69  GLU A OE2   1 
ATOM   1278 N  N     . PHE B 2 70  ? -17.796 13.089 53.035  1.00 64.01 ? 70  PHE A N     1 
ATOM   1279 C  CA    . PHE B 2 70  ? -17.060 14.343 53.172  1.00 65.17 ? 70  PHE A CA    1 
ATOM   1280 C  C     . PHE B 2 70  ? -17.504 15.509 52.293  1.00 66.27 ? 70  PHE A C     1 
ATOM   1281 O  O     . PHE B 2 70  ? -18.133 15.335 51.247  1.00 66.43 ? 70  PHE A O     1 
ATOM   1282 C  CB    . PHE B 2 70  ? -15.589 14.132 52.813  1.00 64.42 ? 70  PHE A CB    1 
ATOM   1283 C  CG    . PHE B 2 70  ? -14.748 13.692 53.971  1.00 64.55 ? 70  PHE A CG    1 
ATOM   1284 C  CD1   . PHE B 2 70  ? -15.184 12.675 54.817  1.00 64.26 ? 70  PHE A CD1   1 
ATOM   1285 C  CD2   . PHE B 2 70  ? -13.519 14.296 54.226  1.00 65.19 ? 70  PHE A CD2   1 
ATOM   1286 C  CE1   . PHE B 2 70  ? -14.408 12.266 55.900  1.00 64.11 ? 70  PHE A CE1   1 
ATOM   1287 C  CE2   . PHE B 2 70  ? -12.730 13.890 55.314  1.00 64.71 ? 70  PHE A CE2   1 
ATOM   1288 C  CZ    . PHE B 2 70  ? -13.176 12.876 56.149  1.00 64.24 ? 70  PHE A CZ    1 
ATOM   1289 N  N     . SER B 2 71  ? -17.163 16.709 52.747  1.00 67.88 ? 71  SER A N     1 
ATOM   1290 C  CA    . SER B 2 71  ? -17.577 17.954 52.109  1.00 68.63 ? 71  SER A CA    1 
ATOM   1291 C  C     . SER B 2 71  ? -16.451 18.354 51.172  1.00 68.58 ? 71  SER A C     1 
ATOM   1292 O  O     . SER B 2 71  ? -15.275 18.265 51.544  1.00 69.13 ? 71  SER A O     1 
ATOM   1293 C  CB    . SER B 2 71  ? -17.760 19.041 53.174  1.00 69.35 ? 71  SER A CB    1 
ATOM   1294 O  OG    . SER B 2 71  ? -17.890 18.464 54.470  1.00 71.40 ? 71  SER A OG    1 
ATOM   1295 N  N     . LYS B 2 72  ? -16.792 18.796 49.965  1.00 67.14 ? 72  LYS A N     1 
ATOM   1296 C  CA    . LYS B 2 72  ? -15.753 19.191 49.024  1.00 66.40 ? 72  LYS A CA    1 
ATOM   1297 C  C     . LYS B 2 72  ? -14.782 20.177 49.677  1.00 65.25 ? 72  LYS A C     1 
ATOM   1298 O  O     . LYS B 2 72  ? -13.584 20.193 49.376  1.00 64.00 ? 72  LYS A O     1 
ATOM   1299 C  CB    . LYS B 2 72  ? -16.388 19.773 47.757  1.00 67.21 ? 72  LYS A CB    1 
ATOM   1300 C  CG    . LYS B 2 72  ? -17.748 20.402 47.965  1.00 68.51 ? 72  LYS A CG    1 
ATOM   1301 C  CD    . LYS B 2 72  ? -18.503 20.530 46.637  1.00 69.37 ? 72  LYS A CD    1 
ATOM   1302 C  CE    . LYS B 2 72  ? -19.834 21.252 46.840  1.00 70.08 ? 72  LYS A CE    1 
ATOM   1303 N  NZ    . LYS B 2 72  ? -20.521 20.795 48.092  1.00 71.03 ? 72  LYS A NZ    1 
ATOM   1304 N  N     . GLU B 2 73  ? -15.305 20.985 50.591  1.00 64.82 ? 73  GLU A N     1 
ATOM   1305 C  CA    . GLU B 2 73  ? -14.482 21.945 51.311  1.00 64.77 ? 73  GLU A CA    1 
ATOM   1306 C  C     . GLU B 2 73  ? -13.452 21.153 52.119  1.00 64.02 ? 73  GLU A C     1 
ATOM   1307 O  O     . GLU B 2 73  ? -12.269 21.525 52.177  1.00 63.39 ? 73  GLU A O     1 
ATOM   1308 C  CB    . GLU B 2 73  ? -15.342 22.797 52.250  1.00 65.96 ? 73  GLU A CB    1 
ATOM   1309 C  CG    . GLU B 2 73  ? -16.253 23.802 51.567  1.00 68.16 ? 73  GLU A CG    1 
ATOM   1310 C  CD    . GLU B 2 73  ? -17.176 23.162 50.541  1.00 70.88 ? 73  GLU A CD    1 
ATOM   1311 O  OE1   . GLU B 2 73  ? -17.676 22.043 50.798  1.00 72.23 ? 73  GLU A OE1   1 
ATOM   1312 O  OE2   . GLU B 2 73  ? -17.412 23.785 49.478  1.00 72.08 ? 73  GLU A OE2   1 
ATOM   1313 N  N     . GLU B 2 74  ? -13.905 20.061 52.743  1.00 62.50 ? 74  GLU A N     1 
ATOM   1314 C  CA    . GLU B 2 74  ? -13.007 19.211 53.525  1.00 61.28 ? 74  GLU A CA    1 
ATOM   1315 C  C     . GLU B 2 74  ? -11.957 18.682 52.567  1.00 61.17 ? 74  GLU A C     1 
ATOM   1316 O  O     . GLU B 2 74  ? -10.774 18.595 52.907  1.00 60.41 ? 74  GLU A O     1 
ATOM   1317 C  CB    . GLU B 2 74  ? -13.764 18.036 54.152  1.00 59.94 ? 74  GLU A CB    1 
ATOM   1318 C  CG    . GLU B 2 74  ? -14.013 18.176 55.648  1.00 57.84 ? 74  GLU A CG    1 
ATOM   1319 C  CD    . GLU B 2 74  ? -12.783 17.932 56.505  1.00 56.56 ? 74  GLU A CD    1 
ATOM   1320 O  OE1   . GLU B 2 74  ? -12.429 16.755 56.703  1.00 56.24 ? 74  GLU A OE1   1 
ATOM   1321 O  OE2   . GLU B 2 74  ? -12.168 18.909 56.984  1.00 55.92 ? 74  GLU A OE2   1 
ATOM   1322 N  N     . LEU B 2 75  ? -12.417 18.349 51.362  1.00 60.88 ? 75  LEU A N     1 
ATOM   1323 C  CA    . LEU B 2 75  ? -11.565 17.828 50.308  1.00 60.75 ? 75  LEU A CA    1 
ATOM   1324 C  C     . LEU B 2 75  ? -10.395 18.760 50.035  1.00 61.32 ? 75  LEU A C     1 
ATOM   1325 O  O     . LEU B 2 75  ? -9.240  18.316 49.989  1.00 60.37 ? 75  LEU A O     1 
ATOM   1326 C  CB    . LEU B 2 75  ? -12.375 17.626 49.028  1.00 59.98 ? 75  LEU A CB    1 
ATOM   1327 C  CG    . LEU B 2 75  ? -12.394 16.178 48.541  1.00 59.22 ? 75  LEU A CG    1 
ATOM   1328 C  CD1   . LEU B 2 75  ? -13.094 15.312 49.565  1.00 59.58 ? 75  LEU A CD1   1 
ATOM   1329 C  CD2   . LEU B 2 75  ? -13.094 16.083 47.215  1.00 58.87 ? 75  LEU A CD2   1 
ATOM   1330 N  N     . ARG B 2 76  ? -10.688 20.049 49.857  1.00 62.16 ? 76  ARG A N     1 
ATOM   1331 C  CA    . ARG B 2 76  ? -9.624  21.021 49.597  1.00 63.43 ? 76  ARG A CA    1 
ATOM   1332 C  C     . ARG B 2 76  ? -8.890  21.435 50.874  1.00 62.34 ? 76  ARG A C     1 
ATOM   1333 O  O     . ARG B 2 76  ? -7.653  21.519 50.891  1.00 61.44 ? 76  ARG A O     1 
ATOM   1334 C  CB    . ARG B 2 76  ? -10.177 22.245 48.849  1.00 65.44 ? 76  ARG A CB    1 
ATOM   1335 C  CG    . ARG B 2 76  ? -11.626 22.598 49.147  1.00 68.40 ? 76  ARG A CG    1 
ATOM   1336 C  CD    . ARG B 2 76  ? -11.773 23.481 50.384  1.00 71.51 ? 76  ARG A CD    1 
ATOM   1337 N  NE    . ARG B 2 76  ? -11.083 24.769 50.282  1.00 72.11 ? 76  ARG A NE    1 
ATOM   1338 C  CZ    . ARG B 2 76  ? -11.319 25.802 51.087  1.00 72.42 ? 76  ARG A CZ    1 
ATOM   1339 N  NH1   . ARG B 2 76  ? -12.235 25.702 52.049  1.00 72.12 ? 76  ARG A NH1   1 
ATOM   1340 N  NH2   . ARG B 2 76  ? -10.631 26.929 50.941  1.00 72.02 ? 76  ARG A NH2   1 
ATOM   1341 N  N     . GLU B 2 77  ? -9.641  21.678 51.946  1.00 61.26 ? 77  GLU A N     1 
ATOM   1342 C  CA    . GLU B 2 77  ? -9.013  22.047 53.210  1.00 60.68 ? 77  GLU A CA    1 
ATOM   1343 C  C     . GLU B 2 77  ? -8.012  20.948 53.565  1.00 59.32 ? 77  GLU A C     1 
ATOM   1344 O  O     . GLU B 2 77  ? -6.794  21.160 53.529  1.00 57.30 ? 77  GLU A O     1 
ATOM   1345 C  CB    . GLU B 2 77  ? -10.060 22.157 54.329  1.00 62.14 ? 77  GLU A CB    1 
ATOM   1346 C  CG    . GLU B 2 77  ? -11.072 23.294 54.200  1.00 62.46 ? 77  GLU A CG    1 
ATOM   1347 C  CD    . GLU B 2 77  ? -12.100 23.285 55.330  1.00 63.07 ? 77  GLU A CD    1 
ATOM   1348 O  OE1   . GLU B 2 77  ? -13.006 24.144 55.317  1.00 63.06 ? 77  GLU A OE1   1 
ATOM   1349 O  OE2   . GLU B 2 77  ? -12.006 22.419 56.232  1.00 62.62 ? 77  GLU A OE2   1 
ATOM   1350 N  N     . ARG B 2 78  ? -8.561  19.773 53.888  1.00 58.98 ? 78  ARG A N     1 
ATOM   1351 C  CA    . ARG B 2 78  ? -7.791  18.588 54.269  1.00 59.54 ? 78  ARG A CA    1 
ATOM   1352 C  C     . ARG B 2 78  ? -6.780  18.189 53.209  1.00 59.69 ? 78  ARG A C     1 
ATOM   1353 O  O     . ARG B 2 78  ? -5.696  17.687 53.531  1.00 58.85 ? 78  ARG A O     1 
ATOM   1354 C  CB    . ARG B 2 78  ? -8.736  17.416 54.553  1.00 60.17 ? 78  ARG A CB    1 
ATOM   1355 C  CG    . ARG B 2 78  ? -9.143  17.251 56.027  1.00 61.00 ? 78  ARG A CG    1 
ATOM   1356 C  CD    . ARG B 2 78  ? -8.188  16.311 56.782  1.00 62.38 ? 78  ARG A CD    1 
ATOM   1357 N  NE    . ARG B 2 78  ? -6.871  16.898 57.052  1.00 63.81 ? 78  ARG A NE    1 
ATOM   1358 C  CZ    . ARG B 2 78  ? -5.809  16.207 57.468  1.00 63.60 ? 78  ARG A CZ    1 
ATOM   1359 N  NH1   . ARG B 2 78  ? -5.895  14.896 57.663  1.00 63.19 ? 78  ARG A NH1   1 
ATOM   1360 N  NH2   . ARG B 2 78  ? -4.660  16.828 57.702  1.00 63.95 ? 78  ARG A NH2   1 
ATOM   1361 N  N     . GLY B 2 79  ? -7.142  18.403 51.947  1.00 59.91 ? 79  GLY A N     1 
ATOM   1362 C  CA    . GLY B 2 79  ? -6.234  18.090 50.863  1.00 60.36 ? 79  GLY A CA    1 
ATOM   1363 C  C     . GLY B 2 79  ? -5.004  18.980 50.947  1.00 61.10 ? 79  GLY A C     1 
ATOM   1364 O  O     . GLY B 2 79  ? -3.871  18.495 51.066  1.00 60.34 ? 79  GLY A O     1 
ATOM   1365 N  N     . LEU B 2 80  ? -5.229  20.292 50.900  1.00 62.05 ? 80  LEU A N     1 
ATOM   1366 C  CA    . LEU B 2 80  ? -4.139  21.258 50.970  1.00 63.14 ? 80  LEU A CA    1 
ATOM   1367 C  C     . LEU B 2 80  ? -3.279  21.023 52.200  1.00 63.26 ? 80  LEU A C     1 
ATOM   1368 O  O     . LEU B 2 80  ? -2.043  21.061 52.129  1.00 62.34 ? 80  LEU A O     1 
ATOM   1369 C  CB    . LEU B 2 80  ? -4.690  22.684 50.992  1.00 64.47 ? 80  LEU A CB    1 
ATOM   1370 C  CG    . LEU B 2 80  ? -3.732  23.763 51.522  1.00 66.32 ? 80  LEU A CG    1 
ATOM   1371 C  CD1   . LEU B 2 80  ? -2.358  23.638 50.860  1.00 67.43 ? 80  LEU A CD1   1 
ATOM   1372 C  CD2   . LEU B 2 80  ? -4.329  25.149 51.281  1.00 67.17 ? 80  LEU A CD2   1 
ATOM   1373 N  N     . GLU B 2 81  ? -3.943  20.785 53.326  1.00 63.76 ? 81  GLU A N     1 
ATOM   1374 C  CA    . GLU B 2 81  ? -3.251  20.532 54.582  1.00 64.36 ? 81  GLU A CA    1 
ATOM   1375 C  C     . GLU B 2 81  ? -2.198  19.455 54.354  1.00 63.14 ? 81  GLU A C     1 
ATOM   1376 O  O     . GLU B 2 81  ? -1.012  19.654 54.641  1.00 62.08 ? 81  GLU A O     1 
ATOM   1377 C  CB    . GLU B 2 81  ? -4.247  20.070 55.650  1.00 66.41 ? 81  GLU A CB    1 
ATOM   1378 C  CG    . GLU B 2 81  ? -3.611  19.808 57.007  1.00 70.13 ? 81  GLU A CG    1 
ATOM   1379 C  CD    . GLU B 2 81  ? -4.070  20.790 58.075  1.00 72.51 ? 81  GLU A CD    1 
ATOM   1380 O  OE1   . GLU B 2 81  ? -3.917  22.019 57.872  1.00 73.52 ? 81  GLU A OE1   1 
ATOM   1381 O  OE2   . GLU B 2 81  ? -4.578  20.327 59.120  1.00 73.45 ? 81  GLU A OE2   1 
ATOM   1382 N  N     . ILE B 2 82  ? -2.642  18.320 53.822  1.00 62.36 ? 82  ILE A N     1 
ATOM   1383 C  CA    . ILE B 2 82  ? -1.746  17.207 53.546  1.00 61.87 ? 82  ILE A CA    1 
ATOM   1384 C  C     . ILE B 2 82  ? -0.606  17.662 52.631  1.00 62.32 ? 82  ILE A C     1 
ATOM   1385 O  O     . ILE B 2 82  ? 0.564   17.603 53.018  1.00 61.86 ? 82  ILE A O     1 
ATOM   1386 C  CB    . ILE B 2 82  ? -2.513  16.026 52.893  1.00 60.80 ? 82  ILE A CB    1 
ATOM   1387 C  CG1   . ILE B 2 82  ? -3.692  15.624 53.784  1.00 60.31 ? 82  ILE A CG1   1 
ATOM   1388 C  CG2   . ILE B 2 82  ? -1.594  14.833 52.715  1.00 59.16 ? 82  ILE A CG2   1 
ATOM   1389 C  CD1   . ILE B 2 82  ? -4.522  14.493 53.241  1.00 60.44 ? 82  ILE A CD1   1 
ATOM   1390 N  N     . GLY B 2 83  ? -0.957  18.132 51.433  1.00 62.52 ? 83  GLY A N     1 
ATOM   1391 C  CA    . GLY B 2 83  ? 0.049   18.587 50.487  1.00 63.44 ? 83  GLY A CA    1 
ATOM   1392 C  C     . GLY B 2 83  ? 1.158   19.394 51.133  1.00 64.40 ? 83  GLY A C     1 
ATOM   1393 O  O     . GLY B 2 83  ? 2.335   19.252 50.788  1.00 63.76 ? 83  GLY A O     1 
ATOM   1394 N  N     . LYS B 2 84  ? 0.762   20.247 52.073  1.00 65.66 ? 84  LYS A N     1 
ATOM   1395 C  CA    . LYS B 2 84  ? 1.671   21.107 52.823  1.00 66.24 ? 84  LYS A CA    1 
ATOM   1396 C  C     . LYS B 2 84  ? 2.869   20.370 53.436  1.00 66.32 ? 84  LYS A C     1 
ATOM   1397 O  O     . LYS B 2 84  ? 4.020   20.582 53.030  1.00 65.53 ? 84  LYS A O     1 
ATOM   1398 C  CB    . LYS B 2 84  ? 0.880   21.818 53.938  1.00 68.40 ? 84  LYS A CB    1 
ATOM   1399 C  CG    . LYS B 2 84  ? 1.718   22.362 55.129  1.00 70.12 ? 84  LYS A CG    1 
ATOM   1400 C  CD    . LYS B 2 84  ? 1.558   21.534 56.426  1.00 70.08 ? 84  LYS A CD    1 
ATOM   1401 C  CE    . LYS B 2 84  ? 0.180   21.704 57.065  1.00 70.91 ? 84  LYS A CE    1 
ATOM   1402 N  NZ    . LYS B 2 84  ? -0.085  23.101 57.547  1.00 71.47 ? 84  LYS A NZ    1 
ATOM   1403 N  N     . ALA B 2 85  ? 2.580   19.506 54.414  1.00 66.06 ? 85  ALA A N     1 
ATOM   1404 C  CA    . ALA B 2 85  ? 3.601   18.750 55.149  1.00 65.18 ? 85  ALA A CA    1 
ATOM   1405 C  C     . ALA B 2 85  ? 4.428   17.790 54.318  1.00 64.47 ? 85  ALA A C     1 
ATOM   1406 O  O     . ALA B 2 85  ? 5.650   17.721 54.464  1.00 63.88 ? 85  ALA A O     1 
ATOM   1407 C  CB    . ALA B 2 85  ? 2.947   17.990 56.295  1.00 64.96 ? 85  ALA A CB    1 
ATOM   1408 N  N     . VAL B 2 86  ? 3.746   17.051 53.454  1.00 64.06 ? 86  VAL A N     1 
ATOM   1409 C  CA    . VAL B 2 86  ? 4.376   16.063 52.597  1.00 63.86 ? 86  VAL A CA    1 
ATOM   1410 C  C     . VAL B 2 86  ? 5.281   16.646 51.501  1.00 63.26 ? 86  VAL A C     1 
ATOM   1411 O  O     . VAL B 2 86  ? 6.209   15.980 51.043  1.00 62.93 ? 86  VAL A O     1 
ATOM   1412 C  CB    . VAL B 2 86  ? 3.282   15.142 51.977  1.00 64.44 ? 86  VAL A CB    1 
ATOM   1413 C  CG1   . VAL B 2 86  ? 2.129   15.980 51.443  1.00 64.12 ? 86  VAL A CG1   1 
ATOM   1414 C  CG2   . VAL B 2 86  ? 3.870   14.293 50.871  1.00 64.87 ? 86  VAL A CG2   1 
ATOM   1415 N  N     . LEU B 2 87  ? 5.033   17.892 51.106  1.00 62.93 ? 87  LEU A N     1 
ATOM   1416 C  CA    . LEU B 2 87  ? 5.823   18.541 50.053  1.00 62.80 ? 87  LEU A CA    1 
ATOM   1417 C  C     . LEU B 2 87  ? 6.937   19.482 50.502  1.00 62.77 ? 87  LEU A C     1 
ATOM   1418 O  O     . LEU B 2 87  ? 6.738   20.316 51.385  1.00 62.84 ? 87  LEU A O     1 
ATOM   1419 C  CB    . LEU B 2 87  ? 4.894   19.318 49.134  1.00 62.74 ? 87  LEU A CB    1 
ATOM   1420 C  CG    . LEU B 2 87  ? 4.074   18.448 48.203  1.00 63.53 ? 87  LEU A CG    1 
ATOM   1421 C  CD1   . LEU B 2 87  ? 2.857   19.224 47.702  1.00 64.05 ? 87  LEU A CD1   1 
ATOM   1422 C  CD2   . LEU B 2 87  ? 4.984   17.977 47.068  1.00 62.97 ? 87  LEU A CD2   1 
ATOM   1423 N  N     . ASP B 2 88  ? 8.102   19.365 49.875  1.00 62.46 ? 88  ASP A N     1 
ATOM   1424 C  CA    . ASP B 2 88  ? 9.215   20.242 50.210  1.00 63.26 ? 88  ASP A CA    1 
ATOM   1425 C  C     . ASP B 2 88  ? 8.784   21.699 50.047  1.00 64.97 ? 88  ASP A C     1 
ATOM   1426 O  O     . ASP B 2 88  ? 8.808   22.474 51.007  1.00 65.30 ? 88  ASP A O     1 
ATOM   1427 C  CB    . ASP B 2 88  ? 10.413  19.985 49.293  1.00 62.13 ? 88  ASP A CB    1 
ATOM   1428 C  CG    . ASP B 2 88  ? 11.097  18.672 49.579  1.00 61.70 ? 88  ASP A CG    1 
ATOM   1429 O  OD1   . ASP B 2 88  ? 10.540  17.881 50.365  1.00 62.18 ? 88  ASP A OD1   1 
ATOM   1430 O  OD2   . ASP B 2 88  ? 12.189  18.427 49.016  1.00 60.88 ? 88  ASP A OD2   1 
ATOM   1431 N  N     . SER B 2 89  ? 8.383   22.057 48.826  1.00 66.27 ? 89  SER A N     1 
ATOM   1432 C  CA    . SER B 2 89  ? 7.964   23.420 48.502  1.00 67.40 ? 89  SER A CA    1 
ATOM   1433 C  C     . SER B 2 89  ? 6.567   23.447 47.896  1.00 68.77 ? 89  SER A C     1 
ATOM   1434 O  O     . SER B 2 89  ? 6.432   23.422 46.674  1.00 69.76 ? 89  SER A O     1 
ATOM   1435 C  CB    . SER B 2 89  ? 8.932   24.026 47.488  1.00 66.44 ? 89  SER A CB    1 
ATOM   1436 O  OG    . SER B 2 89  ? 10.260  23.622 47.752  1.00 67.09 ? 89  SER A OG    1 
ATOM   1437 N  N     . TYR B 2 90  ? 5.526   23.523 48.718  1.00 70.17 ? 90  TYR A N     1 
ATOM   1438 C  CA    . TYR B 2 90  ? 4.184   23.530 48.148  1.00 71.15 ? 90  TYR A CA    1 
ATOM   1439 C  C     . TYR B 2 90  ? 3.851   24.836 47.432  1.00 71.34 ? 90  TYR A C     1 
ATOM   1440 O  O     . TYR B 2 90  ? 4.665   25.764 47.408  1.00 71.23 ? 90  TYR A O     1 
ATOM   1441 C  CB    . TYR B 2 90  ? 3.109   23.401 49.242  1.00 71.99 ? 90  TYR A CB    1 
ATOM   1442 C  CG    . TYR B 2 90  ? 2.750   24.645 50.039  1.00 72.38 ? 90  TYR A CG    1 
ATOM   1443 C  CD1   . TYR B 2 90  ? 1.499   24.741 50.659  1.00 73.20 ? 90  TYR A CD1   1 
ATOM   1444 C  CD2   . TYR B 2 90  ? 3.651   25.695 50.214  1.00 71.98 ? 90  TYR A CD2   1 
ATOM   1445 C  CE1   . TYR B 2 90  ? 1.154   25.841 51.430  1.00 73.23 ? 90  TYR A CE1   1 
ATOM   1446 C  CE2   . TYR B 2 90  ? 3.313   26.806 50.987  1.00 72.32 ? 90  TYR A CE2   1 
ATOM   1447 C  CZ    . TYR B 2 90  ? 2.061   26.867 51.592  1.00 72.89 ? 90  TYR A CZ    1 
ATOM   1448 O  OH    . TYR B 2 90  ? 1.702   27.946 52.365  1.00 73.32 ? 90  TYR A OH    1 
ATOM   1449 N  N     . GLU B 2 91  ? 2.660   24.883 46.835  1.00 71.55 ? 91  GLU A N     1 
ATOM   1450 C  CA    . GLU B 2 91  ? 2.220   25.977 45.969  1.00 71.55 ? 91  GLU A CA    1 
ATOM   1451 C  C     . GLU B 2 91  ? 0.773   25.518 45.871  1.00 71.41 ? 91  GLU A C     1 
ATOM   1452 O  O     . GLU B 2 91  ? 0.505   24.376 45.515  1.00 72.07 ? 91  GLU A O     1 
ATOM   1453 C  CB    . GLU B 2 91  ? 3.096   26.061 44.713  1.00 71.50 ? 91  GLU A CB    1 
ATOM   1454 C  CG    . GLU B 2 91  ? 2.596   27.049 43.670  1.00 72.27 ? 91  GLU A CG    1 
ATOM   1455 C  CD    . GLU B 2 91  ? 3.322   26.916 42.341  1.00 73.06 ? 91  GLU A CD    1 
ATOM   1456 O  OE1   . GLU B 2 91  ? 4.550   27.169 42.295  1.00 73.11 ? 91  GLU A OE1   1 
ATOM   1457 O  OE2   . GLU B 2 91  ? 2.662   26.551 41.341  1.00 72.91 ? 91  GLU A OE2   1 
ATOM   1458 N  N     . ILE B 2 92  ? -0.162  26.404 46.187  1.00 71.53 ? 92  ILE A N     1 
ATOM   1459 C  CA    . ILE B 2 92  ? -1.561  26.220 45.842  1.00 72.19 ? 92  ILE A CA    1 
ATOM   1460 C  C     . ILE B 2 92  ? -1.768  26.418 44.342  1.00 73.44 ? 92  ILE A C     1 
ATOM   1461 O  O     . ILE B 2 92  ? -1.265  27.376 43.755  1.00 74.05 ? 92  ILE A O     1 
ATOM   1462 C  CB    . ILE B 2 92  ? -2.455  27.194 46.617  1.00 71.26 ? 92  ILE A CB    1 
ATOM   1463 C  CG1   . ILE B 2 92  ? -2.399  26.856 48.110  1.00 70.87 ? 92  ILE A CG1   1 
ATOM   1464 C  CG2   . ILE B 2 92  ? -3.880  27.125 46.086  1.00 70.34 ? 92  ILE A CG2   1 
ATOM   1465 C  CD1   . ILE B 2 92  ? -3.279  27.745 48.996  1.00 70.84 ? 92  ILE A CD1   1 
ATOM   1466 N  N     . ARG B 2 93  ? -2.501  25.494 43.728  1.00 74.51 ? 93  ARG A N     1 
ATOM   1467 C  CA    . ARG B 2 93  ? -2.781  25.544 42.298  1.00 75.05 ? 93  ARG A CA    1 
ATOM   1468 C  C     . ARG B 2 93  ? -4.302  25.422 42.129  1.00 75.94 ? 93  ARG A C     1 
ATOM   1469 O  O     . ARG B 2 93  ? -4.983  24.896 43.016  1.00 76.34 ? 93  ARG A O     1 
ATOM   1470 C  CB    . ARG B 2 93  ? -2.052  24.388 41.600  1.00 74.20 ? 93  ARG A CB    1 
ATOM   1471 C  CG    . ARG B 2 93  ? -1.701  24.639 40.145  1.00 73.57 ? 93  ARG A CG    1 
ATOM   1472 C  CD    . ARG B 2 93  ? -0.604  25.681 39.990  1.00 72.77 ? 93  ARG A CD    1 
ATOM   1473 N  NE    . ARG B 2 93  ? 0.753   25.133 40.025  1.00 71.75 ? 93  ARG A NE    1 
ATOM   1474 C  CZ    . ARG B 2 93  ? 1.219   24.220 39.175  1.00 71.13 ? 93  ARG A CZ    1 
ATOM   1475 N  NH1   . ARG B 2 93  ? 0.430   23.733 38.225  1.00 70.47 ? 93  ARG A NH1   1 
ATOM   1476 N  NH2   . ARG B 2 93  ? 2.488   23.830 39.243  1.00 69.46 ? 93  ARG A NH2   1 
ATOM   1477 N  N     . TYR B 2 94  ? -4.844  25.910 41.015  1.00 76.79 ? 94  TYR A N     1 
ATOM   1478 C  CA    . TYR B 2 94  ? -6.292  25.843 40.811  1.00 78.08 ? 94  TYR A CA    1 
ATOM   1479 C  C     . TYR B 2 94  ? -6.736  25.187 39.518  1.00 78.96 ? 94  TYR A C     1 
ATOM   1480 O  O     . TYR B 2 94  ? -5.986  25.126 38.541  1.00 79.81 ? 94  TYR A O     1 
ATOM   1481 C  CB    . TYR B 2 94  ? -6.903  27.240 40.885  1.00 77.90 ? 94  TYR A CB    1 
ATOM   1482 C  CG    . TYR B 2 94  ? -6.519  27.993 42.134  1.00 78.74 ? 94  TYR A CG    1 
ATOM   1483 C  CD1   . TYR B 2 94  ? -5.210  28.447 42.319  1.00 78.57 ? 94  TYR A CD1   1 
ATOM   1484 C  CD2   . TYR B 2 94  ? -7.456  28.240 43.143  1.00 78.46 ? 94  TYR A CD2   1 
ATOM   1485 C  CE1   . TYR B 2 94  ? -4.837  29.129 43.476  1.00 78.66 ? 94  TYR A CE1   1 
ATOM   1486 C  CE2   . TYR B 2 94  ? -7.097  28.924 44.308  1.00 78.88 ? 94  TYR A CE2   1 
ATOM   1487 C  CZ    . TYR B 2 94  ? -5.782  29.367 44.468  1.00 79.03 ? 94  TYR A CZ    1 
ATOM   1488 O  OH    . TYR B 2 94  ? -5.406  30.049 45.608  1.00 79.14 ? 94  TYR A OH    1 
ATOM   1489 N  N     . ALA B 2 95  ? -7.977  24.709 39.532  1.00 79.79 ? 95  ALA A N     1 
ATOM   1490 C  CA    . ALA B 2 95  ? -8.602  24.046 38.388  1.00 80.18 ? 95  ALA A CA    1 
ATOM   1491 C  C     . ALA B 2 95  ? -9.631  23.421 39.329  1.00 80.95 ? 95  ALA A C     1 
ATOM   1492 O  O     . ALA B 2 95  ? -9.971  24.004 40.365  1.00 81.51 ? 95  ALA A O     1 
ATOM   1493 C  CB    . ALA B 2 95  ? -7.749  22.869 37.926  1.00 79.58 ? 95  ALA A CB    1 
ATOM   1494 N  N     . GLU B 2 96  ? -10.117 22.235 38.964  1.00 80.86 ? 96  GLU A N     1 
ATOM   1495 C  CA    . GLU B 2 96  ? -11.352 21.631 39.462  1.00 80.00 ? 96  GLU A CA    1 
ATOM   1496 C  C     . GLU B 2 96  ? -11.725 21.901 40.918  1.00 78.09 ? 96  GLU A C     1 
ATOM   1497 O  O     . GLU B 2 96  ? -12.363 22.913 41.216  1.00 77.94 ? 96  GLU A O     1 
ATOM   1498 C  CB    . GLU B 2 96  ? -11.298 20.110 39.279  1.00 81.04 ? 96  GLU A CB    1 
ATOM   1499 C  CG    . GLU B 2 96  ? -12.626 19.413 39.537  1.00 82.90 ? 96  GLU A CG    1 
ATOM   1500 C  CD    . GLU B 2 96  ? -12.755 18.123 38.764  1.00 83.82 ? 96  GLU A CD    1 
ATOM   1501 O  OE1   . GLU B 2 96  ? -12.030 17.162 39.090  1.00 84.81 ? 96  GLU A OE1   1 
ATOM   1502 O  OE2   . GLU B 2 96  ? -13.578 18.075 37.822  1.00 84.55 ? 96  GLU A OE2   1 
ATOM   1503 N  N     . HIS B 2 97  ? -11.351 21.011 41.832  1.00 76.06 ? 97  HIS A N     1 
ATOM   1504 C  CA    . HIS B 2 97  ? -11.261 21.357 43.245  1.00 73.79 ? 97  HIS A CA    1 
ATOM   1505 C  C     . HIS B 2 97  ? -9.853  21.971 43.202  1.00 70.80 ? 97  HIS A C     1 
ATOM   1506 O  O     . HIS B 2 97  ? -9.128  21.810 42.212  1.00 69.87 ? 97  HIS A O     1 
ATOM   1507 C  CB    . HIS B 2 97  ? -11.211 20.120 44.178  1.00 75.27 ? 97  HIS A CB    1 
ATOM   1508 C  CG    . HIS B 2 97  ? -12.239 19.059 43.894  1.00 76.62 ? 97  HIS A CG    1 
ATOM   1509 N  ND1   . HIS B 2 97  ? -13.569 19.336 43.660  1.00 77.80 ? 97  HIS A ND1   1 
ATOM   1510 C  CD2   . HIS B 2 97  ? -12.139 17.706 43.904  1.00 76.73 ? 97  HIS A CD2   1 
ATOM   1511 C  CE1   . HIS B 2 97  ? -14.244 18.204 43.543  1.00 77.67 ? 97  HIS A CE1   1 
ATOM   1512 N  NE2   . HIS B 2 97  ? -13.399 17.198 43.689  1.00 77.06 ? 97  HIS A NE2   1 
ATOM   1513 N  N     . PRO B 2 98  ? -9.447  22.704 44.240  1.00 68.32 ? 98  PRO A N     1 
ATOM   1514 C  CA    . PRO B 2 98  ? -8.083  23.205 44.053  1.00 65.14 ? 98  PRO A CA    1 
ATOM   1515 C  C     . PRO B 2 98  ? -7.165  22.030 44.359  1.00 61.84 ? 98  PRO A C     1 
ATOM   1516 O  O     . PRO B 2 98  ? -7.645  20.931 44.643  1.00 60.72 ? 98  PRO A O     1 
ATOM   1517 C  CB    . PRO B 2 98  ? -7.983  24.327 45.081  1.00 65.89 ? 98  PRO A CB    1 
ATOM   1518 C  CG    . PRO B 2 98  ? -8.883  23.825 46.203  1.00 67.33 ? 98  PRO A CG    1 
ATOM   1519 C  CD    . PRO B 2 98  ? -10.076 23.256 45.455  1.00 67.95 ? 98  PRO A CD    1 
ATOM   1520 N  N     . TYR B 2 99  ? -5.859  22.250 44.298  1.00 59.05 ? 99  TYR A N     1 
ATOM   1521 C  CA    . TYR B 2 99  ? -4.894  21.192 44.587  1.00 56.25 ? 99  TYR A CA    1 
ATOM   1522 C  C     . TYR B 2 99  ? -3.538  21.798 44.906  1.00 54.94 ? 99  TYR A C     1 
ATOM   1523 O  O     . TYR B 2 99  ? -3.379  23.017 44.878  1.00 54.73 ? 99  TYR A O     1 
ATOM   1524 C  CB    . TYR B 2 99  ? -4.791  20.219 43.405  1.00 55.43 ? 99  TYR A CB    1 
ATOM   1525 C  CG    . TYR B 2 99  ? -4.105  20.756 42.165  1.00 54.40 ? 99  TYR A CG    1 
ATOM   1526 C  CD1   . TYR B 2 99  ? -2.737  20.580 41.969  1.00 53.97 ? 99  TYR A CD1   1 
ATOM   1527 C  CD2   . TYR B 2 99  ? -4.829  21.417 41.174  1.00 54.13 ? 99  TYR A CD2   1 
ATOM   1528 C  CE1   . TYR B 2 99  ? -2.109  21.040 40.814  1.00 54.10 ? 99  TYR A CE1   1 
ATOM   1529 C  CE2   . TYR B 2 99  ? -4.207  21.885 40.018  1.00 54.09 ? 99  TYR A CE2   1 
ATOM   1530 C  CZ    . TYR B 2 99  ? -2.849  21.689 39.843  1.00 53.98 ? 99  TYR A CZ    1 
ATOM   1531 O  OH    . TYR B 2 99  ? -2.234  22.120 38.686  1.00 53.98 ? 99  TYR A OH    1 
ATOM   1532 N  N     . VAL B 2 100 ? -2.557  20.959 45.208  1.00 53.77 ? 100 VAL A N     1 
ATOM   1533 C  CA    . VAL B 2 100 ? -1.236  21.468 45.554  1.00 53.54 ? 100 VAL A CA    1 
ATOM   1534 C  C     . VAL B 2 100 ? -0.131  20.815 44.748  1.00 53.47 ? 100 VAL A C     1 
ATOM   1535 O  O     . VAL B 2 100 ? -0.135  19.602 44.535  1.00 54.62 ? 100 VAL A O     1 
ATOM   1536 C  CB    . VAL B 2 100 ? -0.954  21.260 47.074  1.00 53.48 ? 100 VAL A CB    1 
ATOM   1537 C  CG1   . VAL B 2 100 ? 0.510   21.536 47.400  1.00 52.21 ? 100 VAL A CG1   1 
ATOM   1538 C  CG2   . VAL B 2 100 ? -1.852  22.172 47.888  1.00 53.43 ? 100 VAL A CG2   1 
ATOM   1539 N  N     . HIS B 2 101 ? 0.819   21.627 44.308  1.00 52.61 ? 101 HIS A N     1 
ATOM   1540 C  CA    . HIS B 2 101 ? 1.946   21.130 43.533  1.00 52.91 ? 101 HIS A CA    1 
ATOM   1541 C  C     . HIS B 2 101 ? 3.251   21.576 44.200  1.00 52.85 ? 101 HIS A C     1 
ATOM   1542 O  O     . HIS B 2 101 ? 3.379   22.721 44.631  1.00 52.52 ? 101 HIS A O     1 
ATOM   1543 C  CB    . HIS B 2 101 ? 1.876   21.666 42.100  1.00 53.48 ? 101 HIS A CB    1 
ATOM   1544 C  CG    . HIS B 2 101 ? 3.062   21.311 41.265  1.00 54.84 ? 101 HIS A CG    1 
ATOM   1545 N  ND1   . HIS B 2 101 ? 3.163   20.118 40.582  1.00 56.20 ? 101 HIS A ND1   1 
ATOM   1546 C  CD2   . HIS B 2 101 ? 4.220   21.977 41.033  1.00 55.55 ? 101 HIS A CD2   1 
ATOM   1547 C  CE1   . HIS B 2 101 ? 4.332   20.064 39.965  1.00 56.56 ? 101 HIS A CE1   1 
ATOM   1548 N  NE2   . HIS B 2 101 ? 4.992   21.179 40.223  1.00 55.87 ? 101 HIS A NE2   1 
ATOM   1549 N  N     . GLY B 2 102 ? 4.218   20.668 44.287  1.00 52.97 ? 102 GLY A N     1 
ATOM   1550 C  CA    . GLY B 2 102 ? 5.479   21.015 44.918  1.00 52.99 ? 102 GLY A CA    1 
ATOM   1551 C  C     . GLY B 2 102 ? 6.639   20.161 44.460  1.00 53.01 ? 102 GLY A C     1 
ATOM   1552 O  O     . GLY B 2 102 ? 6.591   19.565 43.387  1.00 52.82 ? 102 GLY A O     1 
ATOM   1553 N  N     . VAL B 2 103 ? 7.688   20.100 45.272  1.00 53.34 ? 103 VAL A N     1 
ATOM   1554 C  CA    . VAL B 2 103 ? 8.855   19.300 44.920  1.00 54.11 ? 103 VAL A CA    1 
ATOM   1555 C  C     . VAL B 2 103 ? 9.287   18.362 46.062  1.00 54.72 ? 103 VAL A C     1 
ATOM   1556 O  O     . VAL B 2 103 ? 9.137   18.681 47.243  1.00 55.53 ? 103 VAL A O     1 
ATOM   1557 C  CB    . VAL B 2 103 ? 10.040  20.214 44.524  1.00 53.72 ? 103 VAL A CB    1 
ATOM   1558 C  CG1   . VAL B 2 103 ? 11.185  19.379 43.952  1.00 53.68 ? 103 VAL A CG1   1 
ATOM   1559 C  CG2   . VAL B 2 103 ? 9.576   21.247 43.517  1.00 52.95 ? 103 VAL A CG2   1 
ATOM   1560 N  N     . VAL B 2 104 ? 9.803   17.192 45.696  1.00 54.44 ? 104 VAL A N     1 
ATOM   1561 C  CA    . VAL B 2 104 ? 10.264  16.213 46.675  1.00 53.70 ? 104 VAL A CA    1 
ATOM   1562 C  C     . VAL B 2 104 ? 11.504  15.512 46.150  1.00 54.97 ? 104 VAL A C     1 
ATOM   1563 O  O     . VAL B 2 104 ? 11.482  14.917 45.068  1.00 55.85 ? 104 VAL A O     1 
ATOM   1564 C  CB    . VAL B 2 104 ? 9.211   15.148 46.943  1.00 51.84 ? 104 VAL A CB    1 
ATOM   1565 C  CG1   . VAL B 2 104 ? 9.795   14.083 47.817  1.00 50.89 ? 104 VAL A CG1   1 
ATOM   1566 C  CG2   . VAL B 2 104 ? 8.002   15.768 47.599  1.00 51.93 ? 104 VAL A CG2   1 
ATOM   1567 N  N     . LYS B 2 105 ? 12.585  15.573 46.915  1.00 55.62 ? 105 LYS A N     1 
ATOM   1568 C  CA    . LYS B 2 105 ? 13.826  14.936 46.497  1.00 56.02 ? 105 LYS A CA    1 
ATOM   1569 C  C     . LYS B 2 105 ? 14.201  15.335 45.072  1.00 55.71 ? 105 LYS A C     1 
ATOM   1570 O  O     . LYS B 2 105 ? 14.859  14.580 44.354  1.00 55.46 ? 105 LYS A O     1 
ATOM   1571 C  CB    . LYS B 2 105 ? 13.710  13.409 46.591  1.00 56.25 ? 105 LYS A CB    1 
ATOM   1572 C  CG    . LYS B 2 105 ? 13.482  12.885 48.000  1.00 56.36 ? 105 LYS A CG    1 
ATOM   1573 C  CD    . LYS B 2 105 ? 14.220  11.576 48.223  1.00 56.85 ? 105 LYS A CD    1 
ATOM   1574 C  CE    . LYS B 2 105 ? 15.728  11.757 48.107  1.00 56.57 ? 105 LYS A CE    1 
ATOM   1575 N  NZ    . LYS B 2 105 ? 16.436  10.460 48.252  1.00 57.47 ? 105 LYS A NZ    1 
ATOM   1576 N  N     . GLY B 2 106 ? 13.754  16.514 44.656  1.00 55.49 ? 106 GLY A N     1 
ATOM   1577 C  CA    . GLY B 2 106 ? 14.107  17.001 43.335  1.00 54.84 ? 106 GLY A CA    1 
ATOM   1578 C  C     . GLY B 2 106 ? 13.133  16.819 42.195  1.00 54.10 ? 106 GLY A C     1 
ATOM   1579 O  O     . GLY B 2 106 ? 13.471  17.142 41.055  1.00 53.43 ? 106 GLY A O     1 
ATOM   1580 N  N     . VAL B 2 107 ? 11.932  16.323 42.474  1.00 53.69 ? 107 VAL A N     1 
ATOM   1581 C  CA    . VAL B 2 107 ? 10.974  16.122 41.394  1.00 53.88 ? 107 VAL A CA    1 
ATOM   1582 C  C     . VAL B 2 107 ? 9.633   16.796 41.612  1.00 53.56 ? 107 VAL A C     1 
ATOM   1583 O  O     . VAL B 2 107 ? 9.181   16.995 42.753  1.00 52.69 ? 107 VAL A O     1 
ATOM   1584 C  CB    . VAL B 2 107 ? 10.709  14.602 41.102  1.00 54.28 ? 107 VAL A CB    1 
ATOM   1585 C  CG1   . VAL B 2 107 ? 12.027  13.819 41.101  1.00 54.11 ? 107 VAL A CG1   1 
ATOM   1586 C  CG2   . VAL B 2 107 ? 9.716   14.029 42.105  1.00 54.25 ? 107 VAL A CG2   1 
ATOM   1587 N  N     . GLU B 2 108 ? 9.010   17.143 40.487  1.00 53.45 ? 108 GLU A N     1 
ATOM   1588 C  CA    . GLU B 2 108 ? 7.703   17.783 40.468  1.00 53.86 ? 108 GLU A CA    1 
ATOM   1589 C  C     . GLU B 2 108 ? 6.681   16.795 41.028  1.00 52.94 ? 108 GLU A C     1 
ATOM   1590 O  O     . GLU B 2 108 ? 6.808   15.581 40.840  1.00 52.60 ? 108 GLU A O     1 
ATOM   1591 C  CB    . GLU B 2 108 ? 7.338   18.166 39.033  1.00 55.34 ? 108 GLU A CB    1 
ATOM   1592 C  CG    . GLU B 2 108 ? 8.335   19.099 38.357  1.00 57.41 ? 108 GLU A CG    1 
ATOM   1593 C  CD    . GLU B 2 108 ? 8.385   20.465 39.017  1.00 58.55 ? 108 GLU A CD    1 
ATOM   1594 O  OE1   . GLU B 2 108 ? 7.300   21.041 39.255  1.00 58.81 ? 108 GLU A OE1   1 
ATOM   1595 O  OE2   . GLU B 2 108 ? 9.501   20.962 39.291  1.00 58.47 ? 108 GLU A OE2   1 
ATOM   1596 N  N     . VAL B 2 109 ? 5.669   17.306 41.715  1.00 51.39 ? 109 VAL A N     1 
ATOM   1597 C  CA    . VAL B 2 109 ? 4.673   16.430 42.297  1.00 51.02 ? 109 VAL A CA    1 
ATOM   1598 C  C     . VAL B 2 109 ? 3.324   17.114 42.391  1.00 51.06 ? 109 VAL A C     1 
ATOM   1599 O  O     . VAL B 2 109 ? 3.242   18.297 42.690  1.00 51.24 ? 109 VAL A O     1 
ATOM   1600 C  CB    . VAL B 2 109 ? 5.085   15.999 43.733  1.00 51.05 ? 109 VAL A CB    1 
ATOM   1601 C  CG1   . VAL B 2 109 ? 4.163   14.904 44.235  1.00 49.97 ? 109 VAL A CG1   1 
ATOM   1602 C  CG2   . VAL B 2 109 ? 6.540   15.554 43.762  1.00 49.91 ? 109 VAL A CG2   1 
ATOM   1603 N  N     . ASP B 2 110 ? 2.264   16.363 42.133  1.00 51.24 ? 110 ASP A N     1 
ATOM   1604 C  CA    . ASP B 2 110 ? 0.915   16.895 42.237  1.00 51.95 ? 110 ASP A CA    1 
ATOM   1605 C  C     . ASP B 2 110 ? 0.191   16.087 43.314  1.00 52.49 ? 110 ASP A C     1 
ATOM   1606 O  O     . ASP B 2 110 ? 0.412   14.880 43.450  1.00 53.58 ? 110 ASP A O     1 
ATOM   1607 C  CB    . ASP B 2 110 ? 0.150   16.752 40.914  1.00 52.58 ? 110 ASP A CB    1 
ATOM   1608 C  CG    . ASP B 2 110 ? 0.461   17.860 39.917  1.00 53.55 ? 110 ASP A CG    1 
ATOM   1609 O  OD1   . ASP B 2 110 ? 0.255   19.052 40.240  1.00 53.84 ? 110 ASP A OD1   1 
ATOM   1610 O  OD2   . ASP B 2 110 ? 0.903   17.532 38.795  1.00 54.94 ? 110 ASP A OD2   1 
ATOM   1611 N  N     . VAL B 2 111 ? -0.658  16.757 44.086  1.00 51.41 ? 111 VAL A N     1 
ATOM   1612 C  CA    . VAL B 2 111 ? -1.442  16.100 45.120  1.00 50.28 ? 111 VAL A CA    1 
ATOM   1613 C  C     . VAL B 2 111 ? -2.852  16.612 44.894  1.00 50.80 ? 111 VAL A C     1 
ATOM   1614 O  O     . VAL B 2 111 ? -3.123  17.789 45.135  1.00 51.81 ? 111 VAL A O     1 
ATOM   1615 C  CB    . VAL B 2 111 ? -0.979  16.494 46.531  1.00 49.65 ? 111 VAL A CB    1 
ATOM   1616 C  CG1   . VAL B 2 111 ? -1.961  15.939 47.565  1.00 49.37 ? 111 VAL A CG1   1 
ATOM   1617 C  CG2   . VAL B 2 111 ? 0.425   15.963 46.790  1.00 47.03 ? 111 VAL A CG2   1 
ATOM   1618 N  N     . VAL B 2 112 ? -3.742  15.736 44.431  1.00 50.06 ? 112 VAL A N     1 
ATOM   1619 C  CA    . VAL B 2 112 ? -5.120  16.126 44.117  1.00 49.59 ? 112 VAL A CA    1 
ATOM   1620 C  C     . VAL B 2 112 ? -6.174  15.481 45.001  1.00 50.72 ? 112 VAL A C     1 
ATOM   1621 O  O     . VAL B 2 112 ? -6.141  14.282 45.244  1.00 51.54 ? 112 VAL A O     1 
ATOM   1622 C  CB    . VAL B 2 112 ? -5.454  15.783 42.640  1.00 48.07 ? 112 VAL A CB    1 
ATOM   1623 C  CG1   . VAL B 2 112 ? -6.844  16.269 42.278  1.00 45.30 ? 112 VAL A CG1   1 
ATOM   1624 C  CG2   . VAL B 2 112 ? -4.402  16.382 41.722  1.00 46.55 ? 112 VAL A CG2   1 
ATOM   1625 N  N     . PRO B 2 113 ? -7.131  16.274 45.492  1.00 51.81 ? 113 PRO A N     1 
ATOM   1626 C  CA    . PRO B 2 113 ? -8.184  15.727 46.350  1.00 52.74 ? 113 PRO A CA    1 
ATOM   1627 C  C     . PRO B 2 113 ? -9.324  15.135 45.531  1.00 53.84 ? 113 PRO A C     1 
ATOM   1628 O  O     . PRO B 2 113 ? -9.794  15.756 44.584  1.00 54.69 ? 113 PRO A O     1 
ATOM   1629 C  CB    . PRO B 2 113 ? -8.639  16.947 47.143  1.00 52.41 ? 113 PRO A CB    1 
ATOM   1630 C  CG    . PRO B 2 113 ? -8.519  18.052 46.116  1.00 52.18 ? 113 PRO A CG    1 
ATOM   1631 C  CD    . PRO B 2 113 ? -7.176  17.749 45.471  1.00 52.17 ? 113 PRO A CD    1 
ATOM   1632 N  N     . CYS B 2 114 ? -9.769  13.936 45.882  1.00 55.12 ? 114 CYS A N     1 
ATOM   1633 C  CA    . CYS B 2 114 ? -10.882 13.331 45.166  1.00 57.20 ? 114 CYS A CA    1 
ATOM   1634 C  C     . CYS B 2 114 ? -11.558 12.284 46.032  1.00 58.68 ? 114 CYS A C     1 
ATOM   1635 O  O     . CYS B 2 114 ? -10.949 11.731 46.947  1.00 59.06 ? 114 CYS A O     1 
ATOM   1636 C  CB    . CYS B 2 114 ? -10.421 12.683 43.868  1.00 57.08 ? 114 CYS A CB    1 
ATOM   1637 S  SG    . CYS B 2 114 ? -9.623  11.110 44.123  1.00 58.13 ? 114 CYS A SG    1 
ATOM   1638 N  N     . TYR B 2 115 ? -12.820 12.015 45.723  1.00 60.05 ? 115 TYR A N     1 
ATOM   1639 C  CA    . TYR B 2 115 ? -13.612 11.050 46.462  1.00 61.78 ? 115 TYR A CA    1 
ATOM   1640 C  C     . TYR B 2 115 ? -13.405 9.607  46.036  1.00 63.17 ? 115 TYR A C     1 
ATOM   1641 O  O     . TYR B 2 115 ? -13.762 9.235  44.923  1.00 63.73 ? 115 TYR A O     1 
ATOM   1642 C  CB    . TYR B 2 115 ? -15.097 11.376 46.323  1.00 61.48 ? 115 TYR A CB    1 
ATOM   1643 C  CG    . TYR B 2 115 ? -15.512 12.649 47.002  1.00 61.59 ? 115 TYR A CG    1 
ATOM   1644 C  CD1   . TYR B 2 115 ? -15.817 13.782 46.262  1.00 62.53 ? 115 TYR A CD1   1 
ATOM   1645 C  CD2   . TYR B 2 115 ? -15.602 12.720 48.389  1.00 61.92 ? 115 TYR A CD2   1 
ATOM   1646 C  CE1   . TYR B 2 115 ? -16.206 14.964 46.889  1.00 64.00 ? 115 TYR A CE1   1 
ATOM   1647 C  CE2   . TYR B 2 115 ? -15.985 13.888 49.027  1.00 62.95 ? 115 TYR A CE2   1 
ATOM   1648 C  CZ    . TYR B 2 115 ? -16.285 15.010 48.271  1.00 64.13 ? 115 TYR A CZ    1 
ATOM   1649 O  OH    . TYR B 2 115 ? -16.651 16.182 48.891  1.00 65.67 ? 115 TYR A OH    1 
ATOM   1650 N  N     . LYS B 2 116 ? -12.846 8.798  46.935  1.00 65.13 ? 116 LYS A N     1 
ATOM   1651 C  CA    . LYS B 2 116 ? -12.624 7.368  46.691  1.00 66.37 ? 116 LYS A CA    1 
ATOM   1652 C  C     . LYS B 2 116 ? -13.981 6.695  46.528  1.00 66.72 ? 116 LYS A C     1 
ATOM   1653 O  O     . LYS B 2 116 ? -14.812 6.745  47.432  1.00 65.93 ? 116 LYS A O     1 
ATOM   1654 C  CB    . LYS B 2 116 ? -11.898 6.734  47.879  1.00 66.73 ? 116 LYS A CB    1 
ATOM   1655 C  CG    . LYS B 2 116 ? -11.835 5.218  47.858  1.00 67.06 ? 116 LYS A CG    1 
ATOM   1656 C  CD    . LYS B 2 116 ? -11.362 4.703  49.206  1.00 67.18 ? 116 LYS A CD    1 
ATOM   1657 C  CE    . LYS B 2 116 ? -11.658 3.226  49.374  1.00 67.15 ? 116 LYS A CE    1 
ATOM   1658 N  NZ    . LYS B 2 116 ? -11.525 2.822  50.803  1.00 67.19 ? 116 LYS A NZ    1 
ATOM   1659 N  N     . LEU B 2 117 ? -14.205 6.054  45.387  1.00 67.97 ? 117 LEU A N     1 
ATOM   1660 C  CA    . LEU B 2 117 ? -15.486 5.420  45.166  1.00 70.20 ? 117 LEU A CA    1 
ATOM   1661 C  C     . LEU B 2 117 ? -15.397 3.963  44.748  1.00 72.49 ? 117 LEU A C     1 
ATOM   1662 O  O     . LEU B 2 117 ? -14.323 3.443  44.447  1.00 72.06 ? 117 LEU A O     1 
ATOM   1663 C  CB    . LEU B 2 117 ? -16.273 6.186  44.101  1.00 69.63 ? 117 LEU A CB    1 
ATOM   1664 C  CG    . LEU B 2 117 ? -16.195 7.716  44.041  1.00 69.08 ? 117 LEU A CG    1 
ATOM   1665 C  CD1   . LEU B 2 117 ? -17.242 8.218  43.061  1.00 68.12 ? 117 LEU A CD1   1 
ATOM   1666 C  CD2   . LEU B 2 117 ? -16.427 8.324  45.414  1.00 68.97 ? 117 LEU A CD2   1 
ATOM   1667 N  N     . LYS B 2 118 ? -16.555 3.314  44.769  1.00 75.74 ? 118 LYS A N     1 
ATOM   1668 C  CA    . LYS B 2 118 ? -16.707 1.934  44.342  1.00 79.55 ? 118 LYS A CA    1 
ATOM   1669 C  C     . LYS B 2 118 ? -17.692 2.104  43.189  1.00 81.63 ? 118 LYS A C     1 
ATOM   1670 O  O     . LYS B 2 118 ? -18.738 2.745  43.350  1.00 81.76 ? 118 LYS A O     1 
ATOM   1671 C  CB    . LYS B 2 118 ? -17.308 1.073  45.458  1.00 80.57 ? 118 LYS A CB    1 
ATOM   1672 C  CG    . LYS B 2 118 ? -17.913 -0.267 44.984  1.00 82.15 ? 118 LYS A CG    1 
ATOM   1673 C  CD    . LYS B 2 118 ? -16.945 -1.124 44.149  1.00 82.16 ? 118 LYS A CD    1 
ATOM   1674 C  CE    . LYS B 2 118 ? -17.625 -2.415 43.665  1.00 81.95 ? 118 LYS A CE    1 
ATOM   1675 N  NZ    . LYS B 2 118 ? -16.773 -3.254 42.760  1.00 81.45 ? 118 LYS A NZ    1 
ATOM   1676 N  N     . GLU B 2 119 ? -17.337 1.550  42.032  1.00 83.79 ? 119 GLU A N     1 
ATOM   1677 C  CA    . GLU B 2 119 ? -18.138 1.668  40.815  1.00 86.48 ? 119 GLU A CA    1 
ATOM   1678 C  C     . GLU B 2 119 ? -18.383 2.978  40.057  1.00 87.63 ? 119 GLU A C     1 
ATOM   1679 O  O     . GLU B 2 119 ? -19.145 3.839  40.508  1.00 88.37 ? 119 GLU A O     1 
ATOM   1680 C  CB    . GLU B 2 119 ? -19.621 1.379  41.080  1.00 87.33 ? 119 GLU A CB    1 
ATOM   1681 C  CG    . GLU B 2 119 ? -20.018 -0.082 40.843  1.00 89.43 ? 119 GLU A CG    1 
ATOM   1682 C  CD    . GLU B 2 119 ? -19.606 -0.607 39.457  1.00 90.18 ? 119 GLU A CD    1 
ATOM   1683 O  OE1   . GLU B 2 119 ? -18.391 -0.807 39.221  1.00 90.72 ? 119 GLU A OE1   1 
ATOM   1684 O  OE2   . GLU B 2 119 ? -20.496 -0.820 38.603  1.00 89.98 ? 119 GLU A OE2   1 
ATOM   1685 N  N     . PRO B 2 120 ? -17.725 3.143  38.894  1.00 87.98 ? 120 PRO A N     1 
ATOM   1686 C  CA    . PRO B 2 120 ? -17.532 4.393  38.151  1.00 88.31 ? 120 PRO A CA    1 
ATOM   1687 C  C     . PRO B 2 120 ? -18.663 5.381  38.384  1.00 88.50 ? 120 PRO A C     1 
ATOM   1688 O  O     . PRO B 2 120 ? -18.477 6.592  38.233  1.00 88.77 ? 120 PRO A O     1 
ATOM   1689 C  CB    . PRO B 2 120 ? -17.475 3.924  36.703  1.00 88.47 ? 120 PRO A CB    1 
ATOM   1690 C  CG    . PRO B 2 120 ? -16.893 2.544  36.822  1.00 88.64 ? 120 PRO A CG    1 
ATOM   1691 C  CD    . PRO B 2 120 ? -17.680 1.990  37.978  1.00 88.15 ? 120 PRO A CD    1 
ATOM   1692 N  N     . LYS B 2 121 ? -19.835 4.852  38.733  1.00 88.24 ? 121 LYS A N     1 
ATOM   1693 C  CA    . LYS B 2 121 ? -21.006 5.675  39.007  1.00 88.03 ? 121 LYS A CA    1 
ATOM   1694 C  C     . LYS B 2 121 ? -20.878 6.248  40.414  1.00 88.67 ? 121 LYS A C     1 
ATOM   1695 O  O     . LYS B 2 121 ? -20.075 5.751  41.216  1.00 89.44 ? 121 LYS A O     1 
ATOM   1696 C  CB    . LYS B 2 121 ? -22.274 4.838  38.858  1.00 87.16 ? 121 LYS A CB    1 
ATOM   1697 C  CG    . LYS B 2 121 ? -22.335 4.158  37.508  1.00 86.60 ? 121 LYS A CG    1 
ATOM   1698 C  CD    . LYS B 2 121 ? -21.947 5.148  36.415  1.00 85.52 ? 121 LYS A CD    1 
ATOM   1699 C  CE    . LYS B 2 121 ? -21.551 4.455  35.129  1.00 84.63 ? 121 LYS A CE    1 
ATOM   1700 N  NZ    . LYS B 2 121 ? -20.908 5.433  34.218  1.00 83.52 ? 121 LYS A NZ    1 
ATOM   1701 N  N     . ASN B 2 122 ? -21.678 7.273  40.711  1.00 88.16 ? 122 ASN A N     1 
ATOM   1702 C  CA    . ASN B 2 122 ? -21.631 7.992  41.993  1.00 86.85 ? 122 ASN A CA    1 
ATOM   1703 C  C     . ASN B 2 122 ? -20.562 9.047  41.722  1.00 85.70 ? 122 ASN A C     1 
ATOM   1704 O  O     . ASN B 2 122 ? -20.124 9.772  42.619  1.00 85.36 ? 122 ASN A O     1 
ATOM   1705 C  CB    . ASN B 2 122 ? -21.270 7.077  43.181  1.00 87.37 ? 122 ASN A CB    1 
ATOM   1706 C  CG    . ASN B 2 122 ? -22.169 5.854  43.291  1.00 87.65 ? 122 ASN A CG    1 
ATOM   1707 O  OD1   . ASN B 2 122 ? -23.394 5.967  43.389  1.00 87.44 ? 122 ASN A OD1   1 
ATOM   1708 N  ND2   . ASN B 2 122 ? -21.556 4.672  43.283  1.00 87.54 ? 122 ASN A ND2   1 
ATOM   1709 N  N     . ILE B 2 123 ? -20.150 9.092  40.453  1.00 84.25 ? 123 ILE A N     1 
ATOM   1710 C  CA    . ILE B 2 123 ? -19.060 9.934  39.969  1.00 82.57 ? 123 ILE A CA    1 
ATOM   1711 C  C     . ILE B 2 123 ? -19.417 11.424 39.961  1.00 81.41 ? 123 ILE A C     1 
ATOM   1712 O  O     . ILE B 2 123 ? -20.335 11.859 39.253  1.00 81.55 ? 123 ILE A O     1 
ATOM   1713 C  CB    . ILE B 2 123 ? -18.630 9.488  38.533  1.00 82.24 ? 123 ILE A CB    1 
ATOM   1714 C  CG1   . ILE B 2 123 ? -17.317 10.161 38.146  1.00 82.02 ? 123 ILE A CG1   1 
ATOM   1715 C  CG2   . ILE B 2 123 ? -19.724 9.800  37.520  1.00 81.59 ? 123 ILE A CG2   1 
ATOM   1716 C  CD1   . ILE B 2 123 ? -16.126 9.633  38.913  1.00 81.65 ? 123 ILE A CD1   1 
ATOM   1717 N  N     . LYS B 2 124 ? -18.690 12.204 40.757  1.00 79.40 ? 124 LYS A N     1 
ATOM   1718 C  CA    . LYS B 2 124 ? -18.937 13.639 40.834  1.00 77.98 ? 124 LYS A CA    1 
ATOM   1719 C  C     . LYS B 2 124 ? -18.203 14.606 39.904  1.00 76.94 ? 124 LYS A C     1 
ATOM   1720 O  O     . LYS B 2 124 ? -18.786 15.151 38.960  1.00 76.89 ? 124 LYS A O     1 
ATOM   1721 C  CB    . LYS B 2 124 ? -18.587 14.157 42.235  1.00 77.90 ? 124 LYS A CB    1 
ATOM   1722 C  CG    . LYS B 2 124 ? -19.328 13.448 43.366  1.00 77.99 ? 124 LYS A CG    1 
ATOM   1723 C  CD    . LYS B 2 124 ? -18.834 13.896 44.742  1.00 77.91 ? 124 LYS A CD    1 
ATOM   1724 C  CE    . LYS B 2 124 ? -19.509 13.110 45.873  1.00 77.87 ? 124 LYS A CE    1 
ATOM   1725 N  NZ    . LYS B 2 124 ? -18.958 13.455 47.222  1.00 76.61 ? 124 LYS A NZ    1 
ATOM   1726 N  N     . SER B 2 125 ? -16.914 14.793 40.171  1.00 75.47 ? 125 SER A N     1 
ATOM   1727 C  CA    . SER B 2 125 ? -16.012 15.536 39.302  1.00 73.44 ? 125 SER A CA    1 
ATOM   1728 C  C     . SER B 2 125 ? -14.975 14.680 38.561  1.00 72.13 ? 125 SER A C     1 
ATOM   1729 O  O     . SER B 2 125 ? -14.623 13.577 38.991  1.00 71.28 ? 125 SER A O     1 
ATOM   1730 C  CB    . SER B 2 125 ? -15.303 16.615 40.128  1.00 73.37 ? 125 SER A CB    1 
ATOM   1731 O  OG    . SER B 2 125 ? -14.752 16.070 41.318  1.00 73.15 ? 125 SER A OG    1 
ATOM   1732 N  N     . ALA B 2 126 ? -14.491 15.223 37.445  1.00 70.62 ? 126 ALA A N     1 
ATOM   1733 C  CA    . ALA B 2 126 ? -13.496 14.578 36.594  1.00 69.46 ? 126 ALA A CA    1 
ATOM   1734 C  C     . ALA B 2 126 ? -12.373 13.859 37.353  1.00 69.06 ? 126 ALA A C     1 
ATOM   1735 O  O     . ALA B 2 126 ? -11.848 12.841 36.894  1.00 69.70 ? 126 ALA A O     1 
ATOM   1736 C  CB    . ALA B 2 126 ? -12.901 15.608 35.653  1.00 68.94 ? 126 ALA A CB    1 
ATOM   1737 N  N     . VAL B 2 127 ? -11.989 14.386 38.508  1.00 67.27 ? 127 VAL A N     1 
ATOM   1738 C  CA    . VAL B 2 127 ? -10.928 13.757 39.278  1.00 65.78 ? 127 VAL A CA    1 
ATOM   1739 C  C     . VAL B 2 127 ? -11.372 12.422 39.887  1.00 64.72 ? 127 VAL A C     1 
ATOM   1740 O  O     . VAL B 2 127 ? -10.557 11.513 40.053  1.00 64.86 ? 127 VAL A O     1 
ATOM   1741 C  CB    . VAL B 2 127 ? -10.424 14.688 40.414  1.00 65.63 ? 127 VAL A CB    1 
ATOM   1742 C  CG1   . VAL B 2 127 ? -9.661  15.860 39.827  1.00 64.73 ? 127 VAL A CG1   1 
ATOM   1743 C  CG2   . VAL B 2 127 ? -11.599 15.183 41.240  1.00 65.78 ? 127 VAL A CG2   1 
ATOM   1744 N  N     . ASP B 2 128 ? -12.658 12.299 40.212  1.00 63.01 ? 128 ASP A N     1 
ATOM   1745 C  CA    . ASP B 2 128 ? -13.175 11.069 40.813  1.00 61.79 ? 128 ASP A CA    1 
ATOM   1746 C  C     . ASP B 2 128 ? -13.163 9.912  39.825  1.00 60.51 ? 128 ASP A C     1 
ATOM   1747 O  O     . ASP B 2 128 ? -13.527 8.774  40.160  1.00 60.58 ? 128 ASP A O     1 
ATOM   1748 C  CB    . ASP B 2 128 ? -14.610 11.262 41.308  1.00 62.21 ? 128 ASP A CB    1 
ATOM   1749 C  CG    . ASP B 2 128 ? -14.732 12.370 42.314  1.00 62.97 ? 128 ASP A CG    1 
ATOM   1750 O  OD1   . ASP B 2 128 ? -13.773 12.575 43.091  1.00 63.21 ? 128 ASP A OD1   1 
ATOM   1751 O  OD2   . ASP B 2 128 ? -15.796 13.023 42.333  1.00 63.20 ? 128 ASP A OD2   1 
ATOM   1752 N  N     . ARG B 2 129 ? -12.749 10.213 38.603  1.00 58.29 ? 129 ARG A N     1 
ATOM   1753 C  CA    . ARG B 2 129 ? -12.716 9.219  37.555  1.00 56.08 ? 129 ARG A CA    1 
ATOM   1754 C  C     . ARG B 2 129 ? -11.279 8.748  37.352  1.00 54.17 ? 129 ARG A C     1 
ATOM   1755 O  O     . ARG B 2 129 ? -11.030 7.601  36.993  1.00 53.12 ? 129 ARG A O     1 
ATOM   1756 C  CB    . ARG B 2 129 ? -13.283 9.845  36.278  1.00 56.70 ? 129 ARG A CB    1 
ATOM   1757 C  CG    . ARG B 2 129 ? -13.675 8.861  35.208  1.00 58.07 ? 129 ARG A CG    1 
ATOM   1758 C  CD    . ARG B 2 129 ? -13.916 9.559  33.871  1.00 60.20 ? 129 ARG A CD    1 
ATOM   1759 N  NE    . ARG B 2 129 ? -15.141 10.355 33.835  1.00 61.43 ? 129 ARG A NE    1 
ATOM   1760 C  CZ    . ARG B 2 129 ? -15.172 11.678 33.701  1.00 63.25 ? 129 ARG A CZ    1 
ATOM   1761 N  NH1   . ARG B 2 129 ? -14.041 12.381 33.592  1.00 62.97 ? 129 ARG A NH1   1 
ATOM   1762 N  NH2   . ARG B 2 129 ? -16.345 12.299 33.655  1.00 63.61 ? 129 ARG A NH2   1 
ATOM   1763 N  N     . THR B 2 130 ? -10.333 9.642  37.606  1.00 52.64 ? 130 THR A N     1 
ATOM   1764 C  CA    . THR B 2 130 ? -8.922  9.332  37.434  1.00 52.00 ? 130 THR A CA    1 
ATOM   1765 C  C     . THR B 2 130 ? -8.547  7.966  37.985  1.00 52.18 ? 130 THR A C     1 
ATOM   1766 O  O     . THR B 2 130 ? -7.986  7.137  37.273  1.00 51.80 ? 130 THR A O     1 
ATOM   1767 C  CB    . THR B 2 130 ? -8.026  10.385 38.119  1.00 51.71 ? 130 THR A CB    1 
ATOM   1768 O  OG1   . THR B 2 130 ? -8.347  11.690 37.620  1.00 52.73 ? 130 THR A OG1   1 
ATOM   1769 C  CG2   . THR B 2 130 ? -6.559  10.083 37.864  1.00 50.31 ? 130 THR A CG2   1 
ATOM   1770 N  N     . PRO B 2 131 ? -8.867  7.708  39.265  1.00 52.67 ? 131 PRO A N     1 
ATOM   1771 C  CA    . PRO B 2 131 ? -8.554  6.429  39.922  1.00 52.26 ? 131 PRO A CA    1 
ATOM   1772 C  C     . PRO B 2 131 ? -9.023  5.183  39.156  1.00 51.55 ? 131 PRO A C     1 
ATOM   1773 O  O     . PRO B 2 131 ? -8.339  4.162  39.149  1.00 50.76 ? 131 PRO A O     1 
ATOM   1774 C  CB    . PRO B 2 131 ? -9.234  6.567  41.284  1.00 52.61 ? 131 PRO A CB    1 
ATOM   1775 C  CG    . PRO B 2 131 ? -9.230  8.052  41.521  1.00 52.55 ? 131 PRO A CG    1 
ATOM   1776 C  CD    . PRO B 2 131 ? -9.639  8.577  40.172  1.00 52.32 ? 131 PRO A CD    1 
ATOM   1777 N  N     . PHE B 2 132 ? -10.193 5.266  38.531  1.00 51.16 ? 132 PHE A N     1 
ATOM   1778 C  CA    . PHE B 2 132 ? -10.716 4.151  37.754  1.00 51.01 ? 132 PHE A CA    1 
ATOM   1779 C  C     . PHE B 2 132 ? -9.852  3.991  36.522  1.00 50.15 ? 132 PHE A C     1 
ATOM   1780 O  O     . PHE B 2 132 ? -9.559  2.874  36.094  1.00 49.46 ? 132 PHE A O     1 
ATOM   1781 C  CB    . PHE B 2 132 ? -12.168 4.414  37.326  1.00 52.01 ? 132 PHE A CB    1 
ATOM   1782 C  CG    . PHE B 2 132 ? -13.151 4.258  38.434  1.00 52.42 ? 132 PHE A CG    1 
ATOM   1783 C  CD1   . PHE B 2 132 ? -13.199 5.180  39.470  1.00 53.81 ? 132 PHE A CD1   1 
ATOM   1784 C  CD2   . PHE B 2 132 ? -13.951 3.133  38.505  1.00 52.48 ? 132 PHE A CD2   1 
ATOM   1785 C  CE1   . PHE B 2 132 ? -14.028 4.972  40.568  1.00 54.66 ? 132 PHE A CE1   1 
ATOM   1786 C  CE2   . PHE B 2 132 ? -14.780 2.915  39.597  1.00 53.52 ? 132 PHE A CE2   1 
ATOM   1787 C  CZ    . PHE B 2 132 ? -14.818 3.832  40.631  1.00 53.78 ? 132 PHE A CZ    1 
ATOM   1788 N  N     . HIS B 2 133 ? -9.456  5.124  35.956  1.00 49.46 ? 133 HIS A N     1 
ATOM   1789 C  CA    . HIS B 2 133 ? -8.628  5.115  34.772  1.00 49.68 ? 133 HIS A CA    1 
ATOM   1790 C  C     . HIS B 2 133 ? -7.377  4.296  35.046  1.00 49.07 ? 133 HIS A C     1 
ATOM   1791 O  O     . HIS B 2 133 ? -7.098  3.318  34.362  1.00 50.02 ? 133 HIS A O     1 
ATOM   1792 C  CB    . HIS B 2 133 ? -8.235  6.543  34.375  1.00 51.02 ? 133 HIS A CB    1 
ATOM   1793 C  CG    . HIS B 2 133 ? -9.372  7.369  33.857  1.00 52.37 ? 133 HIS A CG    1 
ATOM   1794 N  ND1   . HIS B 2 133 ? -9.227  8.697  33.518  1.00 52.15 ? 133 HIS A ND1   1 
ATOM   1795 C  CD2   . HIS B 2 133 ? -10.670 7.060  33.620  1.00 53.05 ? 133 HIS A CD2   1 
ATOM   1796 C  CE1   . HIS B 2 133 ? -10.387 9.171  33.096  1.00 52.64 ? 133 HIS A CE1   1 
ATOM   1797 N  NE2   . HIS B 2 133 ? -11.279 8.199  33.148  1.00 52.59 ? 133 HIS A NE2   1 
ATOM   1798 N  N     . HIS B 2 134 ? -6.621  4.682  36.058  1.00 47.82 ? 134 HIS A N     1 
ATOM   1799 C  CA    . HIS B 2 134 ? -5.413  3.948  36.340  1.00 47.14 ? 134 HIS A CA    1 
ATOM   1800 C  C     . HIS B 2 134 ? -5.674  2.465  36.541  1.00 47.15 ? 134 HIS A C     1 
ATOM   1801 O  O     . HIS B 2 134 ? -4.832  1.636  36.201  1.00 47.91 ? 134 HIS A O     1 
ATOM   1802 C  CB    . HIS B 2 134 ? -4.719  4.497  37.572  1.00 47.99 ? 134 HIS A CB    1 
ATOM   1803 C  CG    . HIS B 2 134 ? -3.489  3.732  37.941  1.00 49.14 ? 134 HIS A CG    1 
ATOM   1804 N  ND1   . HIS B 2 134 ? -2.420  3.589  37.082  1.00 50.02 ? 134 HIS A ND1   1 
ATOM   1805 C  CD2   . HIS B 2 134 ? -3.178  3.025  39.052  1.00 49.44 ? 134 HIS A CD2   1 
ATOM   1806 C  CE1   . HIS B 2 134 ? -1.504  2.825  37.648  1.00 50.22 ? 134 HIS A CE1   1 
ATOM   1807 N  NE2   . HIS B 2 134 ? -1.939  2.469  38.843  1.00 50.37 ? 134 HIS A NE2   1 
ATOM   1808 N  N     . LYS B 2 135 ? -6.830  2.121  37.093  1.00 46.55 ? 135 LYS A N     1 
ATOM   1809 C  CA    . LYS B 2 135 ? -7.135  0.719  37.330  1.00 46.20 ? 135 LYS A CA    1 
ATOM   1810 C  C     . LYS B 2 135 ? -7.333  -0.036 36.040  1.00 46.09 ? 135 LYS A C     1 
ATOM   1811 O  O     . LYS B 2 135 ? -6.656  -1.029 35.777  1.00 47.35 ? 135 LYS A O     1 
ATOM   1812 C  CB    . LYS B 2 135 ? -8.395  0.562  38.165  1.00 46.80 ? 135 LYS A CB    1 
ATOM   1813 C  CG    . LYS B 2 135 ? -8.163  -0.213 39.444  1.00 49.71 ? 135 LYS A CG    1 
ATOM   1814 C  CD    . LYS B 2 135 ? -7.605  -1.617 39.207  1.00 50.01 ? 135 LYS A CD    1 
ATOM   1815 C  CE    . LYS B 2 135 ? -6.823  -2.103 40.438  1.00 50.34 ? 135 LYS A CE    1 
ATOM   1816 N  NZ    . LYS B 2 135 ? -7.533  -1.813 41.722  1.00 50.10 ? 135 LYS A NZ    1 
ATOM   1817 N  N     . TRP B 2 136 ? -8.282  0.436  35.244  1.00 44.77 ? 136 TRP A N     1 
ATOM   1818 C  CA    . TRP B 2 136 ? -8.599  -0.202 33.979  1.00 44.00 ? 136 TRP A CA    1 
ATOM   1819 C  C     . TRP B 2 136 ? -7.370  -0.338 33.107  1.00 43.75 ? 136 TRP A C     1 
ATOM   1820 O  O     . TRP B 2 136 ? -7.128  -1.383 32.507  1.00 43.38 ? 136 TRP A O     1 
ATOM   1821 C  CB    . TRP B 2 136 ? -9.636  0.626  33.228  1.00 42.22 ? 136 TRP A CB    1 
ATOM   1822 C  CG    . TRP B 2 136 ? -10.240 -0.077 32.061  1.00 39.65 ? 136 TRP A CG    1 
ATOM   1823 C  CD1   . TRP B 2 136 ? -11.349 -0.876 32.069  1.00 38.89 ? 136 TRP A CD1   1 
ATOM   1824 C  CD2   . TRP B 2 136 ? -9.779  -0.039 30.708  1.00 38.64 ? 136 TRP A CD2   1 
ATOM   1825 N  NE1   . TRP B 2 136 ? -11.611 -1.333 30.799  1.00 38.89 ? 136 TRP A NE1   1 
ATOM   1826 C  CE2   . TRP B 2 136 ? -10.662 -0.836 29.944  1.00 37.94 ? 136 TRP A CE2   1 
ATOM   1827 C  CE3   . TRP B 2 136 ? -8.700  0.589  30.065  1.00 39.05 ? 136 TRP A CE3   1 
ATOM   1828 C  CZ2   . TRP B 2 136 ? -10.505 -1.022 28.569  1.00 36.54 ? 136 TRP A CZ2   1 
ATOM   1829 C  CZ3   . TRP B 2 136 ? -8.541  0.401  28.685  1.00 38.59 ? 136 TRP A CZ3   1 
ATOM   1830 C  CH2   . TRP B 2 136 ? -9.442  -0.399 27.958  1.00 37.77 ? 136 TRP A CH2   1 
ATOM   1831 N  N     . LEU B 2 137 ? -6.593  0.734  33.077  1.00 44.24 ? 137 LEU A N     1 
ATOM   1832 C  CA    . LEU B 2 137 ? -5.399  0.844  32.254  1.00 45.65 ? 137 LEU A CA    1 
ATOM   1833 C  C     . LEU B 2 137 ? -4.125  0.138  32.727  1.00 46.21 ? 137 LEU A C     1 
ATOM   1834 O  O     . LEU B 2 137 ? -3.249  -0.175 31.913  1.00 45.92 ? 137 LEU A O     1 
ATOM   1835 C  CB    . LEU B 2 137 ? -5.107  2.339  32.030  1.00 45.05 ? 137 LEU A CB    1 
ATOM   1836 C  CG    . LEU B 2 137 ? -4.543  2.791  30.680  1.00 45.38 ? 137 LEU A CG    1 
ATOM   1837 C  CD1   . LEU B 2 137 ? -5.206  2.008  29.552  1.00 45.12 ? 137 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU B 2 137 ? -4.781  4.292  30.506  1.00 45.08 ? 137 LEU A CD2   1 
ATOM   1839 N  N     . GLU B 2 138 ? -4.015  -0.130 34.026  1.00 47.02 ? 138 GLU A N     1 
ATOM   1840 C  CA    . GLU B 2 138 ? -2.792  -0.743 34.537  1.00 47.13 ? 138 GLU A CA    1 
ATOM   1841 C  C     . GLU B 2 138 ? -2.577  -2.181 34.120  1.00 46.91 ? 138 GLU A C     1 
ATOM   1842 O  O     . GLU B 2 138 ? -1.452  -2.569 33.800  1.00 46.98 ? 138 GLU A O     1 
ATOM   1843 C  CB    . GLU B 2 138 ? -2.726  -0.616 36.056  1.00 47.87 ? 138 GLU A CB    1 
ATOM   1844 C  CG    . GLU B 2 138 ? -3.717  -1.455 36.824  1.00 50.45 ? 138 GLU A CG    1 
ATOM   1845 C  CD    . GLU B 2 138 ? -3.691  -1.120 38.307  1.00 52.55 ? 138 GLU A CD    1 
ATOM   1846 O  OE1   . GLU B 2 138 ? -2.579  -0.941 38.856  1.00 53.38 ? 138 GLU A OE1   1 
ATOM   1847 O  OE2   . GLU B 2 138 ? -4.776  -1.039 38.926  1.00 53.61 ? 138 GLU A OE2   1 
ATOM   1848 N  N     . GLY B 2 139 ? -3.648  -2.969 34.105  1.00 46.23 ? 139 GLY A N     1 
ATOM   1849 C  CA    . GLY B 2 139 ? -3.518  -4.358 33.709  1.00 44.94 ? 139 GLY A CA    1 
ATOM   1850 C  C     . GLY B 2 139 ? -3.457  -4.559 32.203  1.00 44.50 ? 139 GLY A C     1 
ATOM   1851 O  O     . GLY B 2 139 ? -3.324  -5.688 31.727  1.00 44.64 ? 139 GLY A O     1 
ATOM   1852 N  N     . ARG B 2 140 ? -3.536  -3.473 31.440  1.00 43.35 ? 140 ARG A N     1 
ATOM   1853 C  CA    . ARG B 2 140 ? -3.520  -3.593 29.995  1.00 42.85 ? 140 ARG A CA    1 
ATOM   1854 C  C     . ARG B 2 140 ? -2.353  -2.937 29.308  1.00 44.36 ? 140 ARG A C     1 
ATOM   1855 O  O     . ARG B 2 140 ? -1.809  -3.479 28.347  1.00 46.01 ? 140 ARG A O     1 
ATOM   1856 C  CB    . ARG B 2 140 ? -4.811  -3.028 29.407  1.00 40.36 ? 140 ARG A CB    1 
ATOM   1857 C  CG    . ARG B 2 140 ? -6.048  -3.835 29.777  1.00 39.46 ? 140 ARG A CG    1 
ATOM   1858 C  CD    . ARG B 2 140 ? -7.319  -3.160 29.309  1.00 37.43 ? 140 ARG A CD    1 
ATOM   1859 N  NE    . ARG B 2 140 ? -8.329  -3.139 30.357  1.00 37.96 ? 140 ARG A NE    1 
ATOM   1860 C  CZ    . ARG B 2 140 ? -9.042  -4.189 30.738  1.00 38.72 ? 140 ARG A CZ    1 
ATOM   1861 N  NH1   . ARG B 2 140 ? -8.862  -5.360 30.152  1.00 40.17 ? 140 ARG A NH1   1 
ATOM   1862 N  NH2   . ARG B 2 140 ? -9.934  -4.068 31.710  1.00 39.76 ? 140 ARG A NH2   1 
ATOM   1863 N  N     . ILE B 2 141 ? -1.938  -1.782 29.797  1.00 45.50 ? 141 ILE A N     1 
ATOM   1864 C  CA    . ILE B 2 141 ? -0.861  -1.061 29.133  1.00 46.36 ? 141 ILE A CA    1 
ATOM   1865 C  C     . ILE B 2 141 ? 0.571   -1.587 29.326  1.00 47.19 ? 141 ILE A C     1 
ATOM   1866 O  O     . ILE B 2 141 ? 1.522   -1.046 28.764  1.00 47.18 ? 141 ILE A O     1 
ATOM   1867 C  CB    . ILE B 2 141 ? -0.927  0.435  29.515  1.00 45.86 ? 141 ILE A CB    1 
ATOM   1868 C  CG1   . ILE B 2 141 ? -0.194  1.263  28.467  1.00 46.29 ? 141 ILE A CG1   1 
ATOM   1869 C  CG2   . ILE B 2 141 ? -0.337  0.654  30.904  1.00 44.58 ? 141 ILE A CG2   1 
ATOM   1870 C  CD1   . ILE B 2 141 ? -0.693  1.043  27.059  1.00 46.08 ? 141 ILE A CD1   1 
ATOM   1871 N  N     . LYS B 2 142 ? 0.732   -2.654 30.093  1.00 47.96 ? 142 LYS A N     1 
ATOM   1872 C  CA    . LYS B 2 142 ? 2.074   -3.164 30.329  1.00 49.40 ? 142 LYS A CA    1 
ATOM   1873 C  C     . LYS B 2 142 ? 2.697   -3.712 29.051  1.00 50.00 ? 142 LYS A C     1 
ATOM   1874 O  O     . LYS B 2 142 ? 1.986   -4.197 28.172  1.00 51.26 ? 142 LYS A O     1 
ATOM   1875 C  CB    . LYS B 2 142 ? 2.036   -4.237 31.415  1.00 49.11 ? 142 LYS A CB    1 
ATOM   1876 C  CG    . LYS B 2 142 ? 1.186   -3.841 32.617  1.00 50.13 ? 142 LYS A CG    1 
ATOM   1877 C  CD    . LYS B 2 142 ? 1.388   -4.784 33.799  1.00 51.05 ? 142 LYS A CD    1 
ATOM   1878 C  CE    . LYS B 2 142 ? 2.713   -4.520 34.515  1.00 51.76 ? 142 LYS A CE    1 
ATOM   1879 N  NZ    . LYS B 2 142 ? 3.904   -4.600 33.609  1.00 51.59 ? 142 LYS A NZ    1 
ATOM   1880 N  N     . GLY B 2 143 ? 4.021   -3.603 28.947  1.00 49.99 ? 143 GLY A N     1 
ATOM   1881 C  CA    . GLY B 2 143 ? 4.738   -4.097 27.786  1.00 49.94 ? 143 GLY A CA    1 
ATOM   1882 C  C     . GLY B 2 143 ? 4.724   -3.155 26.600  1.00 50.81 ? 143 GLY A C     1 
ATOM   1883 O  O     . GLY B 2 143 ? 5.618   -3.194 25.746  1.00 50.79 ? 143 GLY A O     1 
ATOM   1884 N  N     . LYS B 2 144 ? 3.705   -2.304 26.548  1.00 51.29 ? 144 LYS A N     1 
ATOM   1885 C  CA    . LYS B 2 144 ? 3.541   -1.349 25.458  1.00 51.56 ? 144 LYS A CA    1 
ATOM   1886 C  C     . LYS B 2 144 ? 3.898   0.052  25.930  1.00 51.45 ? 144 LYS A C     1 
ATOM   1887 O  O     . LYS B 2 144 ? 3.769   1.029  25.195  1.00 50.76 ? 144 LYS A O     1 
ATOM   1888 C  CB    . LYS B 2 144 ? 2.095   -1.387 24.974  1.00 52.41 ? 144 LYS A CB    1 
ATOM   1889 C  CG    . LYS B 2 144 ? 1.610   -2.794 24.673  1.00 54.68 ? 144 LYS A CG    1 
ATOM   1890 C  CD    . LYS B 2 144 ? 0.156   -2.806 24.236  1.00 57.10 ? 144 LYS A CD    1 
ATOM   1891 C  CE    . LYS B 2 144 ? -0.512  -4.135 24.580  1.00 58.57 ? 144 LYS A CE    1 
ATOM   1892 N  NZ    . LYS B 2 144 ? -0.471  -4.443 26.052  1.00 58.58 ? 144 LYS A NZ    1 
ATOM   1893 N  N     . GLU B 2 145 ? 4.350   0.123  27.175  1.00 51.94 ? 145 GLU A N     1 
ATOM   1894 C  CA    . GLU B 2 145 ? 4.740   1.369  27.814  1.00 51.71 ? 145 GLU A CA    1 
ATOM   1895 C  C     . GLU B 2 145 ? 5.447   2.301  26.831  1.00 50.76 ? 145 GLU A C     1 
ATOM   1896 O  O     . GLU B 2 145 ? 5.146   3.493  26.770  1.00 50.09 ? 145 GLU A O     1 
ATOM   1897 C  CB    . GLU B 2 145 ? 5.661   1.055  28.995  1.00 52.92 ? 145 GLU A CB    1 
ATOM   1898 C  CG    . GLU B 2 145 ? 5.662   -0.432 29.407  1.00 54.84 ? 145 GLU A CG    1 
ATOM   1899 C  CD    . GLU B 2 145 ? 4.981   -0.693 30.750  1.00 56.45 ? 145 GLU A CD    1 
ATOM   1900 O  OE1   . GLU B 2 145 ? 4.884   -1.874 31.152  1.00 56.17 ? 145 GLU A OE1   1 
ATOM   1901 O  OE2   . GLU B 2 145 ? 4.546   0.278  31.411  1.00 58.31 ? 145 GLU A OE2   1 
ATOM   1902 N  N     . ASN B 2 146 ? 6.371   1.752  26.046  1.00 49.89 ? 146 ASN A N     1 
ATOM   1903 C  CA    . ASN B 2 146 ? 7.120   2.563  25.091  1.00 49.04 ? 146 ASN A CA    1 
ATOM   1904 C  C     . ASN B 2 146 ? 6.359   2.970  23.849  1.00 47.30 ? 146 ASN A C     1 
ATOM   1905 O  O     . ASN B 2 146 ? 6.702   3.966  23.215  1.00 46.94 ? 146 ASN A O     1 
ATOM   1906 C  CB    . ASN B 2 146 ? 8.412   1.862  24.674  1.00 50.67 ? 146 ASN A CB    1 
ATOM   1907 C  CG    . ASN B 2 146 ? 9.417   1.780  25.800  1.00 52.64 ? 146 ASN A CG    1 
ATOM   1908 O  OD1   . ASN B 2 146 ? 9.573   2.722  26.588  1.00 53.12 ? 146 ASN A OD1   1 
ATOM   1909 N  ND2   . ASN B 2 146 ? 10.119  0.657  25.878  1.00 54.09 ? 146 ASN A ND2   1 
ATOM   1910 N  N     . GLU B 2 147 ? 5.346   2.203  23.474  1.00 45.66 ? 147 GLU A N     1 
ATOM   1911 C  CA    . GLU B 2 147 ? 4.573   2.581  22.301  1.00 44.49 ? 147 GLU A CA    1 
ATOM   1912 C  C     . GLU B 2 147 ? 3.839   3.867  22.663  1.00 43.47 ? 147 GLU A C     1 
ATOM   1913 O  O     . GLU B 2 147 ? 3.643   4.741  21.815  1.00 43.37 ? 147 GLU A O     1 
ATOM   1914 C  CB    . GLU B 2 147 ? 3.571   1.485  21.907  1.00 44.59 ? 147 GLU A CB    1 
ATOM   1915 C  CG    . GLU B 2 147 ? 4.210   0.216  21.338  1.00 43.45 ? 147 GLU A CG    1 
ATOM   1916 C  CD    . GLU B 2 147 ? 5.245   0.487  20.247  1.00 42.56 ? 147 GLU A CD    1 
ATOM   1917 O  OE1   . GLU B 2 147 ? 4.894   1.056  19.188  1.00 42.14 ? 147 GLU A OE1   1 
ATOM   1918 O  OE2   . GLU B 2 147 ? 6.417   0.121  20.449  1.00 41.30 ? 147 GLU A OE2   1 
ATOM   1919 N  N     . VAL B 2 148 ? 3.448   3.974  23.933  1.00 41.73 ? 148 VAL A N     1 
ATOM   1920 C  CA    . VAL B 2 148 ? 2.758   5.156  24.432  1.00 40.21 ? 148 VAL A CA    1 
ATOM   1921 C  C     . VAL B 2 148 ? 3.728   6.315  24.325  1.00 40.06 ? 148 VAL A C     1 
ATOM   1922 O  O     . VAL B 2 148 ? 3.432   7.331  23.704  1.00 40.99 ? 148 VAL A O     1 
ATOM   1923 C  CB    . VAL B 2 148 ? 2.338   4.992  25.911  1.00 39.76 ? 148 VAL A CB    1 
ATOM   1924 C  CG1   . VAL B 2 148 ? 1.770   6.295  26.449  1.00 38.79 ? 148 VAL A CG1   1 
ATOM   1925 C  CG2   . VAL B 2 148 ? 1.292   3.894  26.033  1.00 39.71 ? 148 VAL A CG2   1 
ATOM   1926 N  N     . ARG B 2 149 ? 4.902   6.149  24.915  1.00 40.26 ? 149 ARG A N     1 
ATOM   1927 C  CA    . ARG B 2 149 ? 5.923   7.188  24.880  1.00 40.65 ? 149 ARG A CA    1 
ATOM   1928 C  C     . ARG B 2 149 ? 6.225   7.685  23.477  1.00 40.09 ? 149 ARG A C     1 
ATOM   1929 O  O     . ARG B 2 149 ? 6.219   8.895  23.228  1.00 39.22 ? 149 ARG A O     1 
ATOM   1930 C  CB    . ARG B 2 149 ? 7.179   6.682  25.577  1.00 41.31 ? 149 ARG A CB    1 
ATOM   1931 C  CG    . ARG B 2 149 ? 6.919   6.602  27.058  1.00 43.32 ? 149 ARG A CG    1 
ATOM   1932 C  CD    . ARG B 2 149 ? 7.942   5.840  27.831  1.00 44.55 ? 149 ARG A CD    1 
ATOM   1933 N  NE    . ARG B 2 149 ? 7.655   5.992  29.253  1.00 46.55 ? 149 ARG A NE    1 
ATOM   1934 C  CZ    . ARG B 2 149 ? 8.346   5.394  30.210  1.00 47.15 ? 149 ARG A CZ    1 
ATOM   1935 N  NH1   . ARG B 2 149 ? 9.359   4.609  29.869  1.00 47.79 ? 149 ARG A NH1   1 
ATOM   1936 N  NH2   . ARG B 2 149 ? 8.028   5.573  31.491  1.00 46.52 ? 149 ARG A NH2   1 
ATOM   1937 N  N     . LEU B 2 150 ? 6.476   6.767  22.554  1.00 40.14 ? 150 LEU A N     1 
ATOM   1938 C  CA    . LEU B 2 150 ? 6.736   7.189  21.190  1.00 40.52 ? 150 LEU A CA    1 
ATOM   1939 C  C     . LEU B 2 150 ? 5.587   8.072  20.722  1.00 39.77 ? 150 LEU A C     1 
ATOM   1940 O  O     . LEU B 2 150 ? 5.826   9.077  20.061  1.00 40.70 ? 150 LEU A O     1 
ATOM   1941 C  CB    . LEU B 2 150 ? 6.862   5.993  20.233  1.00 42.02 ? 150 LEU A CB    1 
ATOM   1942 C  CG    . LEU B 2 150 ? 8.185   5.231  20.060  1.00 42.98 ? 150 LEU A CG    1 
ATOM   1943 C  CD1   . LEU B 2 150 ? 7.951   4.091  19.083  1.00 43.51 ? 150 LEU A CD1   1 
ATOM   1944 C  CD2   . LEU B 2 150 ? 9.287   6.144  19.530  1.00 42.68 ? 150 LEU A CD2   1 
ATOM   1945 N  N     . LEU B 2 151 ? 4.350   7.716  21.068  1.00 38.20 ? 151 LEU A N     1 
ATOM   1946 C  CA    . LEU B 2 151 ? 3.203   8.507  20.623  1.00 37.82 ? 151 LEU A CA    1 
ATOM   1947 C  C     . LEU B 2 151 ? 3.225   9.916  21.200  1.00 38.45 ? 151 LEU A C     1 
ATOM   1948 O  O     . LEU B 2 151 ? 3.190   10.902 20.457  1.00 37.97 ? 151 LEU A O     1 
ATOM   1949 C  CB    . LEU B 2 151 ? 1.896   7.809  20.988  1.00 37.23 ? 151 LEU A CB    1 
ATOM   1950 C  CG    . LEU B 2 151 ? 0.578   8.527  20.670  1.00 37.19 ? 151 LEU A CG    1 
ATOM   1951 C  CD1   . LEU B 2 151 ? 0.490   8.909  19.218  1.00 35.70 ? 151 LEU A CD1   1 
ATOM   1952 C  CD2   . LEU B 2 151 ? -0.569  7.602  21.025  1.00 38.19 ? 151 LEU A CD2   1 
ATOM   1953 N  N     . LYS B 2 152 ? 3.288   10.012 22.526  1.00 38.98 ? 152 LYS A N     1 
ATOM   1954 C  CA    . LYS B 2 152 ? 3.336   11.310 23.187  1.00 38.53 ? 152 LYS A CA    1 
ATOM   1955 C  C     . LYS B 2 152 ? 4.415   12.156 22.517  1.00 39.46 ? 152 LYS A C     1 
ATOM   1956 O  O     . LYS B 2 152 ? 4.118   13.188 21.914  1.00 40.34 ? 152 LYS A O     1 
ATOM   1957 C  CB    . LYS B 2 152 ? 3.655   11.153 24.682  1.00 36.78 ? 152 LYS A CB    1 
ATOM   1958 C  CG    . LYS B 2 152 ? 2.604   10.410 25.487  1.00 33.73 ? 152 LYS A CG    1 
ATOM   1959 C  CD    . LYS B 2 152 ? 3.004   10.301 26.946  1.00 33.12 ? 152 LYS A CD    1 
ATOM   1960 C  CE    . LYS B 2 152 ? 1.937   9.591  27.770  1.00 32.30 ? 152 LYS A CE    1 
ATOM   1961 N  NZ    . LYS B 2 152 ? 2.301   9.437  29.209  1.00 30.52 ? 152 LYS A NZ    1 
ATOM   1962 N  N     . GLY B 2 153 ? 5.664   11.711 22.606  1.00 39.55 ? 153 GLY A N     1 
ATOM   1963 C  CA    . GLY B 2 153 ? 6.744   12.463 21.995  1.00 40.72 ? 153 GLY A CA    1 
ATOM   1964 C  C     . GLY B 2 153 ? 6.402   12.968 20.604  1.00 40.89 ? 153 GLY A C     1 
ATOM   1965 O  O     . GLY B 2 153 ? 6.730   14.099 20.237  1.00 40.59 ? 153 GLY A O     1 
ATOM   1966 N  N     . PHE B 2 154 ? 5.730   12.123 19.831  1.00 41.34 ? 154 PHE A N     1 
ATOM   1967 C  CA    . PHE B 2 154 ? 5.335   12.467 18.470  1.00 41.88 ? 154 PHE A CA    1 
ATOM   1968 C  C     . PHE B 2 154 ? 4.412   13.673 18.515  1.00 41.59 ? 154 PHE A C     1 
ATOM   1969 O  O     . PHE B 2 154 ? 4.709   14.720 17.937  1.00 42.19 ? 154 PHE A O     1 
ATOM   1970 C  CB    . PHE B 2 154 ? 4.602   11.288 17.827  1.00 43.18 ? 154 PHE A CB    1 
ATOM   1971 C  CG    . PHE B 2 154 ? 4.271   11.491 16.371  1.00 44.27 ? 154 PHE A CG    1 
ATOM   1972 C  CD1   . PHE B 2 154 ? 5.268   11.416 15.399  1.00 44.58 ? 154 PHE A CD1   1 
ATOM   1973 C  CD2   . PHE B 2 154 ? 2.961   11.729 15.967  1.00 44.11 ? 154 PHE A CD2   1 
ATOM   1974 C  CE1   . PHE B 2 154 ? 4.962   11.566 14.045  1.00 44.80 ? 154 PHE A CE1   1 
ATOM   1975 C  CE2   . PHE B 2 154 ? 2.646   11.880 14.621  1.00 45.25 ? 154 PHE A CE2   1 
ATOM   1976 C  CZ    . PHE B 2 154 ? 3.649   11.798 13.656  1.00 45.52 ? 154 PHE A CZ    1 
ATOM   1977 N  N     . LEU B 2 155 ? 3.284   13.508 19.202  1.00 40.32 ? 155 LEU A N     1 
ATOM   1978 C  CA    . LEU B 2 155 ? 2.299   14.567 19.344  1.00 38.74 ? 155 LEU A CA    1 
ATOM   1979 C  C     . LEU B 2 155 ? 2.953   15.800 19.957  1.00 39.12 ? 155 LEU A C     1 
ATOM   1980 O  O     . LEU B 2 155 ? 2.707   16.936 19.537  1.00 38.56 ? 155 LEU A O     1 
ATOM   1981 C  CB    . LEU B 2 155 ? 1.160   14.081 20.230  1.00 36.67 ? 155 LEU A CB    1 
ATOM   1982 C  CG    . LEU B 2 155 ? 0.237   13.050 19.589  1.00 35.12 ? 155 LEU A CG    1 
ATOM   1983 C  CD1   . LEU B 2 155 ? -0.426  12.185 20.642  1.00 34.72 ? 155 LEU A CD1   1 
ATOM   1984 C  CD2   . LEU B 2 155 ? -0.791  13.776 18.757  1.00 34.59 ? 155 LEU A CD2   1 
ATOM   1985 N  N     . LYS B 2 156 ? 3.802   15.564 20.946  1.00 39.48 ? 156 LYS A N     1 
ATOM   1986 C  CA    . LYS B 2 156 ? 4.492   16.645 21.622  1.00 40.90 ? 156 LYS A CA    1 
ATOM   1987 C  C     . LYS B 2 156 ? 5.335   17.470 20.659  1.00 40.42 ? 156 LYS A C     1 
ATOM   1988 O  O     . LYS B 2 156 ? 5.071   18.648 20.445  1.00 39.68 ? 156 LYS A O     1 
ATOM   1989 C  CB    . LYS B 2 156 ? 5.387   16.083 22.728  1.00 43.22 ? 156 LYS A CB    1 
ATOM   1990 C  CG    . LYS B 2 156 ? 6.022   17.143 23.636  1.00 44.23 ? 156 LYS A CG    1 
ATOM   1991 C  CD    . LYS B 2 156 ? 5.041   17.671 24.678  1.00 44.30 ? 156 LYS A CD    1 
ATOM   1992 C  CE    . LYS B 2 156 ? 5.755   18.543 25.694  1.00 43.35 ? 156 LYS A CE    1 
ATOM   1993 N  NZ    . LYS B 2 156 ? 6.924   17.797 26.245  1.00 44.33 ? 156 LYS A NZ    1 
ATOM   1994 N  N     . ALA B 2 157 ? 6.353   16.847 20.082  1.00 40.86 ? 157 ALA A N     1 
ATOM   1995 C  CA    . ALA B 2 157 ? 7.241   17.542 19.158  1.00 41.40 ? 157 ALA A CA    1 
ATOM   1996 C  C     . ALA B 2 157 ? 6.468   18.438 18.172  1.00 41.67 ? 157 ALA A C     1 
ATOM   1997 O  O     . ALA B 2 157 ? 7.005   19.442 17.690  1.00 41.87 ? 157 ALA A O     1 
ATOM   1998 C  CB    . ALA B 2 157 ? 8.201   16.534 18.507  1.00 40.39 ? 157 ALA A CB    1 
ATOM   1999 N  N     . ASN B 2 158 ? 5.215   18.083 17.882  1.00 41.57 ? 158 ASN A N     1 
ATOM   2000 C  CA    . ASN B 2 158 ? 4.433   18.796 16.869  1.00 41.95 ? 158 ASN A CA    1 
ATOM   2001 C  C     . ASN B 2 158 ? 3.338   19.688 17.442  1.00 42.18 ? 158 ASN A C     1 
ATOM   2002 O  O     . ASN B 2 158 ? 2.373   20.034 16.756  1.00 41.73 ? 158 ASN A O     1 
ATOM   2003 C  CB    . ASN B 2 158 ? 3.834   17.803 15.881  1.00 41.68 ? 158 ASN A CB    1 
ATOM   2004 C  CG    . ASN B 2 158 ? 4.886   17.178 14.993  1.00 43.01 ? 158 ASN A CG    1 
ATOM   2005 O  OD1   . ASN B 2 158 ? 5.329   17.779 14.007  1.00 43.00 ? 158 ASN A OD1   1 
ATOM   2006 N  ND2   . ASN B 2 158 ? 5.315   15.970 15.349  1.00 43.43 ? 158 ASN A ND2   1 
ATOM   2007 N  N     . GLY B 2 159 ? 3.494   20.042 18.714  1.00 42.18 ? 159 GLY A N     1 
ATOM   2008 C  CA    . GLY B 2 159 ? 2.553   20.925 19.377  1.00 40.87 ? 159 GLY A CA    1 
ATOM   2009 C  C     . GLY B 2 159 ? 1.123   20.501 19.648  1.00 39.96 ? 159 GLY A C     1 
ATOM   2010 O  O     . GLY B 2 159 ? 0.297   21.366 19.934  1.00 40.08 ? 159 GLY A O     1 
ATOM   2011 N  N     . ILE B 2 160 ? 0.799   19.215 19.573  1.00 39.13 ? 160 ILE A N     1 
ATOM   2012 C  CA    . ILE B 2 160 ? -0.577  18.824 19.864  1.00 38.77 ? 160 ILE A CA    1 
ATOM   2013 C  C     . ILE B 2 160 ? -0.706  17.843 21.016  1.00 39.89 ? 160 ILE A C     1 
ATOM   2014 O  O     . ILE B 2 160 ? -1.639  17.045 21.043  1.00 39.95 ? 160 ILE A O     1 
ATOM   2015 C  CB    . ILE B 2 160 ? -1.283  18.204 18.644  1.00 37.12 ? 160 ILE A CB    1 
ATOM   2016 C  CG1   . ILE B 2 160 ? -0.387  17.148 18.009  1.00 36.85 ? 160 ILE A CG1   1 
ATOM   2017 C  CG2   . ILE B 2 160 ? -1.689  19.283 17.672  1.00 34.39 ? 160 ILE A CG2   1 
ATOM   2018 C  CD1   . ILE B 2 160 ? -1.027  16.455 16.830  1.00 37.80 ? 160 ILE A CD1   1 
ATOM   2019 N  N     . TYR B 2 161 ? 0.199   17.917 21.990  1.00 40.94 ? 161 TYR A N     1 
ATOM   2020 C  CA    . TYR B 2 161 ? 0.135   16.978 23.098  1.00 42.22 ? 161 TYR A CA    1 
ATOM   2021 C  C     . TYR B 2 161 ? -0.769  17.323 24.292  1.00 42.81 ? 161 TYR A C     1 
ATOM   2022 O  O     . TYR B 2 161 ? -1.314  16.429 24.937  1.00 44.18 ? 161 TYR A O     1 
ATOM   2023 C  CB    . TYR B 2 161 ? 1.549   16.642 23.599  1.00 42.59 ? 161 TYR A CB    1 
ATOM   2024 C  CG    . TYR B 2 161 ? 1.535   15.575 24.679  1.00 43.67 ? 161 TYR A CG    1 
ATOM   2025 C  CD1   . TYR B 2 161 ? 0.816   14.385 24.498  1.00 43.23 ? 161 TYR A CD1   1 
ATOM   2026 C  CD2   . TYR B 2 161 ? 2.152   15.792 25.910  1.00 43.38 ? 161 TYR A CD2   1 
ATOM   2027 C  CE1   . TYR B 2 161 ? 0.701   13.448 25.523  1.00 44.56 ? 161 TYR A CE1   1 
ATOM   2028 C  CE2   . TYR B 2 161 ? 2.045   14.860 26.939  1.00 45.23 ? 161 TYR A CE2   1 
ATOM   2029 C  CZ    . TYR B 2 161 ? 1.315   13.692 26.745  1.00 45.66 ? 161 TYR A CZ    1 
ATOM   2030 O  OH    . TYR B 2 161 ? 1.177   12.795 27.789  1.00 46.50 ? 161 TYR A OH    1 
ATOM   2031 N  N     . GLY B 2 162 ? -0.963  18.590 24.607  1.00 42.03 ? 162 GLY A N     1 
ATOM   2032 C  CA    . GLY B 2 162 ? -1.815  18.867 25.751  1.00 42.18 ? 162 GLY A CA    1 
ATOM   2033 C  C     . GLY B 2 162 ? -3.317  18.708 25.548  1.00 41.66 ? 162 GLY A C     1 
ATOM   2034 O  O     . GLY B 2 162 ? -3.813  18.769 24.427  1.00 42.14 ? 162 GLY A O     1 
ATOM   2035 N  N     . ALA B 2 163 ? -4.048  18.514 26.643  1.00 41.09 ? 163 ALA A N     1 
ATOM   2036 C  CA    . ALA B 2 163 ? -5.503  18.392 26.585  1.00 39.96 ? 163 ALA A CA    1 
ATOM   2037 C  C     . ALA B 2 163 ? -6.125  19.685 27.114  1.00 39.50 ? 163 ALA A C     1 
ATOM   2038 O  O     . ALA B 2 163 ? -7.331  19.904 26.988  1.00 38.32 ? 163 ALA A O     1 
ATOM   2039 C  CB    . ALA B 2 163 ? -5.958  17.229 27.427  1.00 41.61 ? 163 ALA A CB    1 
ATOM   2040 N  N     . GLU B 2 164 ? -5.290  20.528 27.723  1.00 38.86 ? 164 GLU A N     1 
ATOM   2041 C  CA    . GLU B 2 164 ? -5.742  21.793 28.274  1.00 38.54 ? 164 GLU A CA    1 
ATOM   2042 C  C     . GLU B 2 164 ? -6.035  22.781 27.151  1.00 38.94 ? 164 GLU A C     1 
ATOM   2043 O  O     . GLU B 2 164 ? -5.594  22.590 26.018  1.00 38.74 ? 164 GLU A O     1 
ATOM   2044 C  CB    . GLU B 2 164 ? -4.699  22.376 29.213  1.00 37.12 ? 164 GLU A CB    1 
ATOM   2045 C  CG    . GLU B 2 164 ? -3.410  22.754 28.541  1.00 38.69 ? 164 GLU A CG    1 
ATOM   2046 C  CD    . GLU B 2 164 ? -2.495  21.571 28.313  1.00 39.80 ? 164 GLU A CD    1 
ATOM   2047 O  OE1   . GLU B 2 164 ? -1.292  21.796 28.048  1.00 39.79 ? 164 GLU A OE1   1 
ATOM   2048 O  OE2   . GLU B 2 164 ? -2.972  20.417 28.402  1.00 40.37 ? 164 GLU A OE2   1 
ATOM   2049 N  N     . TYR B 2 165 ? -6.772  23.841 27.484  1.00 39.02 ? 165 TYR A N     1 
ATOM   2050 C  CA    . TYR B 2 165 ? -7.179  24.860 26.521  1.00 37.49 ? 165 TYR A CA    1 
ATOM   2051 C  C     . TYR B 2 165 ? -6.085  25.635 25.802  1.00 37.03 ? 165 TYR A C     1 
ATOM   2052 O  O     . TYR B 2 165 ? -6.351  26.310 24.807  1.00 38.51 ? 165 TYR A O     1 
ATOM   2053 C  CB    . TYR B 2 165 ? -8.156  25.829 27.183  1.00 36.24 ? 165 TYR A CB    1 
ATOM   2054 C  CG    . TYR B 2 165 ? -9.527  25.225 27.331  1.00 36.32 ? 165 TYR A CG    1 
ATOM   2055 C  CD1   . TYR B 2 165 ? -10.034 24.856 28.583  1.00 36.47 ? 165 TYR A CD1   1 
ATOM   2056 C  CD2   . TYR B 2 165 ? -10.304 24.973 26.207  1.00 36.72 ? 165 TYR A CD2   1 
ATOM   2057 C  CE1   . TYR B 2 165 ? -11.288 24.247 28.698  1.00 35.95 ? 165 TYR A CE1   1 
ATOM   2058 C  CE2   . TYR B 2 165 ? -11.541 24.366 26.308  1.00 36.56 ? 165 TYR A CE2   1 
ATOM   2059 C  CZ    . TYR B 2 165 ? -12.025 24.004 27.546  1.00 36.91 ? 165 TYR A CZ    1 
ATOM   2060 O  OH    . TYR B 2 165 ? -13.235 23.364 27.598  1.00 38.99 ? 165 TYR A OH    1 
ATOM   2061 N  N     . LYS B 2 166 ? -4.857  25.547 26.281  1.00 35.47 ? 166 LYS A N     1 
ATOM   2062 C  CA    . LYS B 2 166 ? -3.780  26.250 25.609  1.00 34.28 ? 166 LYS A CA    1 
ATOM   2063 C  C     . LYS B 2 166 ? -3.188  25.336 24.537  1.00 33.53 ? 166 LYS A C     1 
ATOM   2064 O  O     . LYS B 2 166 ? -2.194  25.681 23.902  1.00 33.52 ? 166 LYS A O     1 
ATOM   2065 C  CB    . LYS B 2 166 ? -2.710  26.655 26.621  1.00 34.69 ? 166 LYS A CB    1 
ATOM   2066 C  CG    . LYS B 2 166 ? -1.542  27.411 26.040  1.00 35.44 ? 166 LYS A CG    1 
ATOM   2067 C  CD    . LYS B 2 166 ? -0.461  27.602 27.089  1.00 37.15 ? 166 LYS A CD    1 
ATOM   2068 C  CE    . LYS B 2 166 ? 0.898   27.977 26.475  1.00 37.59 ? 166 LYS A CE    1 
ATOM   2069 N  NZ    . LYS B 2 166 ? 2.006   27.804 27.485  1.00 39.45 ? 166 LYS A NZ    1 
ATOM   2070 N  N     . VAL B 2 167 ? -3.810  24.178 24.323  1.00 32.37 ? 167 VAL A N     1 
ATOM   2071 C  CA    . VAL B 2 167 ? -3.340  23.216 23.361  1.00 31.40 ? 167 VAL A CA    1 
ATOM   2072 C  C     . VAL B 2 167 ? -4.570  22.789 22.577  1.00 32.23 ? 167 VAL A C     1 
ATOM   2073 O  O     . VAL B 2 167 ? -4.692  23.010 21.362  1.00 33.49 ? 167 VAL A O     1 
ATOM   2074 C  CB    . VAL B 2 167 ? -2.506  22.060 24.005  1.00 30.07 ? 167 VAL A CB    1 
ATOM   2075 C  CG1   . VAL B 2 167 ? -2.170  21.002 22.975  1.00 28.96 ? 167 VAL A CG1   1 
ATOM   2076 C  CG2   . VAL B 2 167 ? -1.241  22.588 24.635  1.00 27.69 ? 167 VAL A CG2   1 
ATOM   2077 N  N     . ARG B 2 168 ? -5.503  22.151 23.331  1.00 32.62 ? 168 ARG A N     1 
ATOM   2078 C  CA    . ARG B 2 168 ? -6.631  21.460 22.743  1.00 32.28 ? 168 ARG A CA    1 
ATOM   2079 C  C     . ARG B 2 168 ? -6.094  20.300 21.862  1.00 32.71 ? 168 ARG A C     1 
ATOM   2080 O  O     . ARG B 2 168 ? -6.517  20.121 20.726  1.00 33.75 ? 168 ARG A O     1 
ATOM   2081 C  CB    . ARG B 2 168 ? -7.410  22.417 21.863  1.00 31.48 ? 168 ARG A CB    1 
ATOM   2082 C  CG    . ARG B 2 168 ? -8.221  23.394 22.655  1.00 33.03 ? 168 ARG A CG    1 
ATOM   2083 C  CD    . ARG B 2 168 ? -8.691  24.500 21.725  1.00 35.56 ? 168 ARG A CD    1 
ATOM   2084 N  NE    . ARG B 2 168 ? -9.790  25.279 22.271  1.00 36.34 ? 168 ARG A NE    1 
ATOM   2085 C  CZ    . ARG B 2 168 ? -11.015 24.800 22.452  1.00 37.88 ? 168 ARG A CZ    1 
ATOM   2086 N  NH1   . ARG B 2 168 ? -11.293 23.536 22.128  1.00 37.56 ? 168 ARG A NH1   1 
ATOM   2087 N  NH2   . ARG B 2 168 ? -11.961 25.591 22.955  1.00 37.74 ? 168 ARG A NH2   1 
ATOM   2088 N  N     . GLY B 2 169 ? -5.164  19.526 22.408  1.00 32.34 ? 169 GLY A N     1 
ATOM   2089 C  CA    . GLY B 2 169 ? -4.611  18.405 21.674  1.00 31.47 ? 169 GLY A CA    1 
ATOM   2090 C  C     . GLY B 2 169 ? -5.057  17.085 22.272  1.00 32.38 ? 169 GLY A C     1 
ATOM   2091 O  O     . GLY B 2 169 ? -6.225  16.932 22.626  1.00 32.13 ? 169 GLY A O     1 
ATOM   2092 N  N     . PHE B 2 170 ? -4.114  16.148 22.409  1.00 33.19 ? 170 PHE A N     1 
ATOM   2093 C  CA    . PHE B 2 170 ? -4.367  14.795 22.938  1.00 33.70 ? 170 PHE A CA    1 
ATOM   2094 C  C     . PHE B 2 170 ? -3.963  14.619 24.400  1.00 34.48 ? 170 PHE A C     1 
ATOM   2095 O  O     . PHE B 2 170 ? -2.801  14.815 24.738  1.00 35.51 ? 170 PHE A O     1 
ATOM   2096 C  CB    . PHE B 2 170 ? -3.582  13.758 22.120  1.00 32.45 ? 170 PHE A CB    1 
ATOM   2097 C  CG    . PHE B 2 170 ? -3.977  13.677 20.673  1.00 32.97 ? 170 PHE A CG    1 
ATOM   2098 C  CD1   . PHE B 2 170 ? -4.001  14.813 19.872  1.00 33.69 ? 170 PHE A CD1   1 
ATOM   2099 C  CD2   . PHE B 2 170 ? -4.290  12.455 20.098  1.00 32.95 ? 170 PHE A CD2   1 
ATOM   2100 C  CE1   . PHE B 2 170 ? -4.327  14.732 18.524  1.00 33.69 ? 170 PHE A CE1   1 
ATOM   2101 C  CE2   . PHE B 2 170 ? -4.617  12.363 18.751  1.00 32.80 ? 170 PHE A CE2   1 
ATOM   2102 C  CZ    . PHE B 2 170 ? -4.636  13.505 17.962  1.00 32.96 ? 170 PHE A CZ    1 
ATOM   2103 N  N     . SER B 2 171 ? -4.885  14.230 25.277  1.00 34.24 ? 171 SER A N     1 
ATOM   2104 C  CA    . SER B 2 171 ? -4.465  14.045 26.660  1.00 34.23 ? 171 SER A CA    1 
ATOM   2105 C  C     . SER B 2 171 ? -3.576  12.801 26.740  1.00 35.35 ? 171 SER A C     1 
ATOM   2106 O  O     . SER B 2 171 ? -3.585  11.951 25.840  1.00 35.83 ? 171 SER A O     1 
ATOM   2107 C  CB    . SER B 2 171 ? -5.667  13.928 27.618  1.00 33.31 ? 171 SER A CB    1 
ATOM   2108 O  OG    . SER B 2 171 ? -6.394  12.720 27.486  1.00 33.50 ? 171 SER A OG    1 
ATOM   2109 N  N     . GLY B 2 172 ? -2.780  12.713 27.798  1.00 36.23 ? 172 GLY A N     1 
ATOM   2110 C  CA    . GLY B 2 172 ? -1.910  11.568 27.957  1.00 36.45 ? 172 GLY A CA    1 
ATOM   2111 C  C     . GLY B 2 172 ? -2.749  10.311 28.102  1.00 36.31 ? 172 GLY A C     1 
ATOM   2112 O  O     . GLY B 2 172 ? -2.352  9.237  27.647  1.00 37.20 ? 172 GLY A O     1 
ATOM   2113 N  N     . TYR B 2 173 ? -3.910  10.436 28.739  1.00 34.64 ? 173 TYR A N     1 
ATOM   2114 C  CA    . TYR B 2 173 ? -4.782  9.286  28.911  1.00 34.07 ? 173 TYR A CA    1 
ATOM   2115 C  C     . TYR B 2 173 ? -5.320  8.860  27.551  1.00 33.97 ? 173 TYR A C     1 
ATOM   2116 O  O     . TYR B 2 173 ? -5.443  7.671  27.274  1.00 33.92 ? 173 TYR A O     1 
ATOM   2117 C  CB    . TYR B 2 173 ? -5.926  9.635  29.850  1.00 34.60 ? 173 TYR A CB    1 
ATOM   2118 C  CG    . TYR B 2 173 ? -6.997  8.575  29.969  1.00 35.86 ? 173 TYR A CG    1 
ATOM   2119 C  CD1   . TYR B 2 173 ? -6.682  7.252  30.321  1.00 35.49 ? 173 TYR A CD1   1 
ATOM   2120 C  CD2   . TYR B 2 173 ? -8.339  8.899  29.759  1.00 36.51 ? 173 TYR A CD2   1 
ATOM   2121 C  CE1   . TYR B 2 173 ? -7.690  6.282  30.460  1.00 34.47 ? 173 TYR A CE1   1 
ATOM   2122 C  CE2   . TYR B 2 173 ? -9.348  7.941  29.893  1.00 35.72 ? 173 TYR A CE2   1 
ATOM   2123 C  CZ    . TYR B 2 173 ? -9.018  6.640  30.240  1.00 34.50 ? 173 TYR A CZ    1 
ATOM   2124 O  OH    . TYR B 2 173 ? -10.028 5.718  30.343  1.00 32.81 ? 173 TYR A OH    1 
ATOM   2125 N  N     . LEU B 2 174 ? -5.638  9.826  26.692  1.00 33.06 ? 174 LEU A N     1 
ATOM   2126 C  CA    . LEU B 2 174 ? -6.134  9.485  25.367  1.00 31.37 ? 174 LEU A CA    1 
ATOM   2127 C  C     . LEU B 2 174 ? -5.086  8.624  24.673  1.00 30.78 ? 174 LEU A C     1 
ATOM   2128 O  O     . LEU B 2 174 ? -5.409  7.577  24.104  1.00 29.20 ? 174 LEU A O     1 
ATOM   2129 C  CB    . LEU B 2 174 ? -6.390  10.735 24.529  1.00 30.35 ? 174 LEU A CB    1 
ATOM   2130 C  CG    . LEU B 2 174 ? -6.817  10.349 23.106  1.00 30.03 ? 174 LEU A CG    1 
ATOM   2131 C  CD1   . LEU B 2 174 ? -8.189  9.688  23.150  1.00 29.06 ? 174 LEU A CD1   1 
ATOM   2132 C  CD2   . LEU B 2 174 ? -6.847  11.573 22.213  1.00 29.90 ? 174 LEU A CD2   1 
ATOM   2133 N  N     . CYS B 2 175 ? -3.833  9.074  24.724  1.00 29.72 ? 175 CYS A N     1 
ATOM   2134 C  CA    . CYS B 2 175 ? -2.737  8.333  24.116  1.00 30.49 ? 175 CYS A CA    1 
ATOM   2135 C  C     . CYS B 2 175 ? -2.731  6.871  24.542  1.00 31.52 ? 175 CYS A C     1 
ATOM   2136 O  O     . CYS B 2 175 ? -2.809  5.964  23.707  1.00 32.05 ? 175 CYS A O     1 
ATOM   2137 C  CB    . CYS B 2 175 ? -1.398  8.947  24.496  1.00 30.70 ? 175 CYS A CB    1 
ATOM   2138 S  SG    . CYS B 2 175 ? -0.964  10.381 23.548  1.00 32.51 ? 175 CYS A SG    1 
ATOM   2139 N  N     . GLU B 2 176 ? -2.636  6.639  25.845  1.00 32.15 ? 176 GLU A N     1 
ATOM   2140 C  CA    . GLU B 2 176 ? -2.600  5.277  26.344  1.00 33.09 ? 176 GLU A CA    1 
ATOM   2141 C  C     . GLU B 2 176 ? -3.718  4.445  25.722  1.00 33.04 ? 176 GLU A C     1 
ATOM   2142 O  O     . GLU B 2 176 ? -3.450  3.413  25.111  1.00 33.10 ? 176 GLU A O     1 
ATOM   2143 C  CB    . GLU B 2 176 ? -2.692  5.273  27.873  1.00 34.37 ? 176 GLU A CB    1 
ATOM   2144 C  CG    . GLU B 2 176 ? -1.644  6.158  28.517  1.00 37.96 ? 176 GLU A CG    1 
ATOM   2145 C  CD    . GLU B 2 176 ? -1.718  6.162  30.023  1.00 40.02 ? 176 GLU A CD    1 
ATOM   2146 O  OE1   . GLU B 2 176 ? -1.345  5.133  30.619  1.00 42.26 ? 176 GLU A OE1   1 
ATOM   2147 O  OE2   . GLU B 2 176 ? -2.149  7.187  30.609  1.00 39.95 ? 176 GLU A OE2   1 
ATOM   2148 N  N     . LEU B 2 177 ? -4.961  4.900  25.850  1.00 32.46 ? 177 LEU A N     1 
ATOM   2149 C  CA    . LEU B 2 177 ? -6.081  4.163  25.288  1.00 33.00 ? 177 LEU A CA    1 
ATOM   2150 C  C     . LEU B 2 177 ? -5.825  3.773  23.836  1.00 33.92 ? 177 LEU A C     1 
ATOM   2151 O  O     . LEU B 2 177 ? -6.100  2.639  23.442  1.00 35.66 ? 177 LEU A O     1 
ATOM   2152 C  CB    . LEU B 2 177 ? -7.374  4.980  25.385  1.00 32.30 ? 177 LEU A CB    1 
ATOM   2153 C  CG    . LEU B 2 177 ? -7.904  5.234  26.800  1.00 33.03 ? 177 LEU A CG    1 
ATOM   2154 C  CD1   . LEU B 2 177 ? -8.993  6.292  26.763  1.00 32.18 ? 177 LEU A CD1   1 
ATOM   2155 C  CD2   . LEU B 2 177 ? -8.430  3.930  27.409  1.00 32.91 ? 177 LEU A CD2   1 
ATOM   2156 N  N     . LEU B 2 178 ? -5.293  4.687  23.032  1.00 33.60 ? 178 LEU A N     1 
ATOM   2157 C  CA    . LEU B 2 178 ? -5.041  4.341  21.640  1.00 35.20 ? 178 LEU A CA    1 
ATOM   2158 C  C     . LEU B 2 178 ? -4.029  3.195  21.554  1.00 36.56 ? 178 LEU A C     1 
ATOM   2159 O  O     . LEU B 2 178 ? -4.271  2.214  20.845  1.00 38.10 ? 178 LEU A O     1 
ATOM   2160 C  CB    . LEU B 2 178 ? -4.546  5.559  20.831  1.00 34.56 ? 178 LEU A CB    1 
ATOM   2161 C  CG    . LEU B 2 178 ? -5.499  6.753  20.645  1.00 33.15 ? 178 LEU A CG    1 
ATOM   2162 C  CD1   . LEU B 2 178 ? -4.740  7.918  20.056  1.00 32.40 ? 178 LEU A CD1   1 
ATOM   2163 C  CD2   . LEU B 2 178 ? -6.661  6.376  19.757  1.00 32.66 ? 178 LEU A CD2   1 
ATOM   2164 N  N     . ILE B 2 179 ? -2.910  3.294  22.274  1.00 36.66 ? 179 ILE A N     1 
ATOM   2165 C  CA    . ILE B 2 179 ? -1.904  2.225  22.242  1.00 36.45 ? 179 ILE A CA    1 
ATOM   2166 C  C     . ILE B 2 179 ? -2.526  0.868  22.600  1.00 37.08 ? 179 ILE A C     1 
ATOM   2167 O  O     . ILE B 2 179 ? -2.154  -0.168 22.051  1.00 36.91 ? 179 ILE A O     1 
ATOM   2168 C  CB    . ILE B 2 179 ? -0.747  2.514  23.210  1.00 35.41 ? 179 ILE A CB    1 
ATOM   2169 C  CG1   . ILE B 2 179 ? 0.029   3.737  22.726  1.00 35.00 ? 179 ILE A CG1   1 
ATOM   2170 C  CG2   . ILE B 2 179 ? 0.159   1.309  23.304  1.00 34.65 ? 179 ILE A CG2   1 
ATOM   2171 C  CD1   . ILE B 2 179 ? 0.516   3.616  21.303  1.00 35.32 ? 179 ILE A CD1   1 
ATOM   2172 N  N     . VAL B 2 180 ? -3.478  0.883  23.525  1.00 37.34 ? 180 VAL A N     1 
ATOM   2173 C  CA    . VAL B 2 180 ? -4.159  -0.333 23.929  1.00 37.41 ? 180 VAL A CA    1 
ATOM   2174 C  C     . VAL B 2 180 ? -4.993  -0.869 22.765  1.00 37.89 ? 180 VAL A C     1 
ATOM   2175 O  O     . VAL B 2 180 ? -4.983  -2.063 22.466  1.00 38.08 ? 180 VAL A O     1 
ATOM   2176 C  CB    . VAL B 2 180 ? -5.092  -0.065 25.119  1.00 36.73 ? 180 VAL A CB    1 
ATOM   2177 C  CG1   . VAL B 2 180 ? -6.131  -1.171 25.229  1.00 36.21 ? 180 VAL A CG1   1 
ATOM   2178 C  CG2   . VAL B 2 180 ? -4.284  0.027  26.384  1.00 36.07 ? 180 VAL A CG2   1 
ATOM   2179 N  N     . PHE B 2 181 ? -5.705  0.037  22.113  1.00 37.27 ? 181 PHE A N     1 
ATOM   2180 C  CA    . PHE B 2 181 ? -6.564  -0.294 20.991  1.00 38.38 ? 181 PHE A CA    1 
ATOM   2181 C  C     . PHE B 2 181 ? -5.820  -0.774 19.731  1.00 38.91 ? 181 PHE A C     1 
ATOM   2182 O  O     . PHE B 2 181 ? -6.190  -1.779 19.111  1.00 39.49 ? 181 PHE A O     1 
ATOM   2183 C  CB    . PHE B 2 181 ? -7.404  0.937  20.652  1.00 38.51 ? 181 PHE A CB    1 
ATOM   2184 C  CG    . PHE B 2 181 ? -8.563  0.657  19.743  1.00 38.70 ? 181 PHE A CG    1 
ATOM   2185 C  CD1   . PHE B 2 181 ? -9.767  0.195  20.261  1.00 38.36 ? 181 PHE A CD1   1 
ATOM   2186 C  CD2   . PHE B 2 181 ? -8.456  0.881  18.372  1.00 37.85 ? 181 PHE A CD2   1 
ATOM   2187 C  CE1   . PHE B 2 181 ? -10.842 -0.031 19.432  1.00 39.61 ? 181 PHE A CE1   1 
ATOM   2188 C  CE2   . PHE B 2 181 ? -9.528  0.656  17.532  1.00 37.72 ? 181 PHE A CE2   1 
ATOM   2189 C  CZ    . PHE B 2 181 ? -10.728 0.201  18.059  1.00 39.11 ? 181 PHE A CZ    1 
ATOM   2190 N  N     . TYR B 2 182 ? -4.782  -0.049 19.340  1.00 39.27 ? 182 TYR A N     1 
ATOM   2191 C  CA    . TYR B 2 182 ? -4.027  -0.407 18.145  1.00 39.47 ? 182 TYR A CA    1 
ATOM   2192 C  C     . TYR B 2 182 ? -2.832  -1.319 18.428  1.00 40.31 ? 182 TYR A C     1 
ATOM   2193 O  O     . TYR B 2 182 ? -2.293  -1.945 17.513  1.00 40.03 ? 182 TYR A O     1 
ATOM   2194 C  CB    . TYR B 2 182 ? -3.582  0.870  17.417  1.00 38.01 ? 182 TYR A CB    1 
ATOM   2195 C  CG    . TYR B 2 182 ? -4.737  1.574  16.759  1.00 36.59 ? 182 TYR A CG    1 
ATOM   2196 C  CD1   . TYR B 2 182 ? -5.449  0.952  15.753  1.00 36.33 ? 182 TYR A CD1   1 
ATOM   2197 C  CD2   . TYR B 2 182 ? -5.165  2.825  17.186  1.00 38.13 ? 182 TYR A CD2   1 
ATOM   2198 C  CE1   . TYR B 2 182 ? -6.563  1.540  15.182  1.00 37.73 ? 182 TYR A CE1   1 
ATOM   2199 C  CE2   . TYR B 2 182 ? -6.292  3.435  16.620  1.00 38.19 ? 182 TYR A CE2   1 
ATOM   2200 C  CZ    . TYR B 2 182 ? -6.988  2.777  15.613  1.00 38.51 ? 182 TYR A CZ    1 
ATOM   2201 O  OH    . TYR B 2 182 ? -8.114  3.326  15.030  1.00 39.33 ? 182 TYR A OH    1 
ATOM   2202 N  N     . GLY B 2 183 ? -2.428  -1.395 19.693  1.00 40.56 ? 183 GLY A N     1 
ATOM   2203 C  CA    . GLY B 2 183 ? -1.318  -2.257 20.057  1.00 41.95 ? 183 GLY A CA    1 
ATOM   2204 C  C     . GLY B 2 183 ? 0.083   -1.697 19.877  1.00 42.94 ? 183 GLY A C     1 
ATOM   2205 O  O     . GLY B 2 183 ? 1.032   -2.154 20.524  1.00 43.43 ? 183 GLY A O     1 
ATOM   2206 N  N     . SER B 2 184 ? 0.235   -0.704 19.015  1.00 43.37 ? 184 SER A N     1 
ATOM   2207 C  CA    . SER B 2 184 ? 1.560   -0.141 18.794  1.00 43.76 ? 184 SER A CA    1 
ATOM   2208 C  C     . SER B 2 184 ? 1.490   1.285  18.269  1.00 43.96 ? 184 SER A C     1 
ATOM   2209 O  O     . SER B 2 184 ? 0.442   1.717  17.773  1.00 44.04 ? 184 SER A O     1 
ATOM   2210 C  CB    . SER B 2 184 ? 2.331   -1.013 17.800  1.00 43.54 ? 184 SER A CB    1 
ATOM   2211 O  OG    . SER B 2 184 ? 1.605   -1.179 16.591  1.00 43.95 ? 184 SER A OG    1 
ATOM   2212 N  N     . PHE B 2 185 ? 2.605   2.010  18.378  1.00 43.38 ? 185 PHE A N     1 
ATOM   2213 C  CA    . PHE B 2 185 ? 2.654   3.384  17.894  1.00 42.31 ? 185 PHE A CA    1 
ATOM   2214 C  C     . PHE B 2 185 ? 2.544   3.409  16.388  1.00 41.83 ? 185 PHE A C     1 
ATOM   2215 O  O     . PHE B 2 185 ? 1.890   4.283  15.817  1.00 41.46 ? 185 PHE A O     1 
ATOM   2216 C  CB    . PHE B 2 185 ? 3.950   4.086  18.286  1.00 41.74 ? 185 PHE A CB    1 
ATOM   2217 C  CG    . PHE B 2 185 ? 4.248   5.292  17.437  1.00 41.15 ? 185 PHE A CG    1 
ATOM   2218 C  CD1   . PHE B 2 185 ? 5.119   5.200  16.358  1.00 40.64 ? 185 PHE A CD1   1 
ATOM   2219 C  CD2   . PHE B 2 185 ? 3.598   6.502  17.671  1.00 41.33 ? 185 PHE A CD2   1 
ATOM   2220 C  CE1   . PHE B 2 185 ? 5.336   6.289  15.525  1.00 39.91 ? 185 PHE A CE1   1 
ATOM   2221 C  CE2   . PHE B 2 185 ? 3.807   7.598  16.843  1.00 40.39 ? 185 PHE A CE2   1 
ATOM   2222 C  CZ    . PHE B 2 185 ? 4.679   7.490  15.765  1.00 40.39 ? 185 PHE A CZ    1 
ATOM   2223 N  N     . LEU B 2 186 ? 3.196   2.450  15.743  1.00 41.26 ? 186 LEU A N     1 
ATOM   2224 C  CA    . LEU B 2 186 ? 3.154   2.387  14.294  1.00 40.57 ? 186 LEU A CA    1 
ATOM   2225 C  C     . LEU B 2 186 ? 1.756   2.073  13.787  1.00 39.66 ? 186 LEU A C     1 
ATOM   2226 O  O     . LEU B 2 186 ? 1.290   2.672  12.820  1.00 39.34 ? 186 LEU A O     1 
ATOM   2227 C  CB    . LEU B 2 186 ? 4.157   1.355  13.772  1.00 40.40 ? 186 LEU A CB    1 
ATOM   2228 C  CG    . LEU B 2 186 ? 4.106   1.063  12.271  1.00 39.30 ? 186 LEU A CG    1 
ATOM   2229 C  CD1   . LEU B 2 186 ? 4.043   2.350  11.474  1.00 40.32 ? 186 LEU A CD1   1 
ATOM   2230 C  CD2   . LEU B 2 186 ? 5.321   0.262  11.897  1.00 39.19 ? 186 LEU A CD2   1 
ATOM   2231 N  N     . GLU B 2 187 ? 1.082   1.145  14.452  1.00 39.43 ? 187 GLU A N     1 
ATOM   2232 C  CA    . GLU B 2 187 ? -0.267  0.761  14.057  1.00 40.03 ? 187 GLU A CA    1 
ATOM   2233 C  C     . GLU B 2 187 ? -1.270  1.910  14.125  1.00 40.04 ? 187 GLU A C     1 
ATOM   2234 O  O     . GLU B 2 187 ? -2.129  2.045  13.246  1.00 39.47 ? 187 GLU A O     1 
ATOM   2235 C  CB    . GLU B 2 187 ? -0.748  -0.403 14.921  1.00 40.86 ? 187 GLU A CB    1 
ATOM   2236 C  CG    . GLU B 2 187 ? -0.348  -1.729 14.355  1.00 43.01 ? 187 GLU A CG    1 
ATOM   2237 C  CD    . GLU B 2 187 ? -0.858  -1.915 12.928  1.00 44.88 ? 187 GLU A CD    1 
ATOM   2238 O  OE1   . GLU B 2 187 ? -2.101  -2.042 12.738  1.00 43.30 ? 187 GLU A OE1   1 
ATOM   2239 O  OE2   . GLU B 2 187 ? -0.009  -1.922 12.005  1.00 44.88 ? 187 GLU A OE2   1 
ATOM   2240 N  N     . THR B 2 188 ? -1.152  2.724  15.179  1.00 40.31 ? 188 THR A N     1 
ATOM   2241 C  CA    . THR B 2 188 ? -2.020  3.886  15.404  1.00 39.37 ? 188 THR A CA    1 
ATOM   2242 C  C     . THR B 2 188 ? -1.827  4.902  14.282  1.00 38.59 ? 188 THR A C     1 
ATOM   2243 O  O     . THR B 2 188 ? -2.783  5.342  13.650  1.00 38.23 ? 188 THR A O     1 
ATOM   2244 C  CB    . THR B 2 188 ? -1.685  4.593  16.747  1.00 38.76 ? 188 THR A CB    1 
ATOM   2245 O  OG1   . THR B 2 188 ? -1.816  3.660  17.820  1.00 39.11 ? 188 THR A OG1   1 
ATOM   2246 C  CG2   . THR B 2 188 ? -2.624  5.769  16.998  1.00 37.59 ? 188 THR A CG2   1 
ATOM   2247 N  N     . VAL B 2 189 ? -0.578  5.273  14.046  1.00 37.56 ? 189 VAL A N     1 
ATOM   2248 C  CA    . VAL B 2 189 ? -0.279  6.228  13.007  1.00 37.69 ? 189 VAL A CA    1 
ATOM   2249 C  C     . VAL B 2 189 ? -0.888  5.773  11.694  1.00 38.04 ? 189 VAL A C     1 
ATOM   2250 O  O     . VAL B 2 189 ? -1.581  6.541  11.025  1.00 37.92 ? 189 VAL A O     1 
ATOM   2251 C  CB    . VAL B 2 189 ? 1.231   6.387  12.816  1.00 37.26 ? 189 VAL A CB    1 
ATOM   2252 C  CG1   . VAL B 2 189 ? 1.503   7.159  11.551  1.00 37.17 ? 189 VAL A CG1   1 
ATOM   2253 C  CG2   . VAL B 2 189 ? 1.827   7.117  14.002  1.00 37.51 ? 189 VAL A CG2   1 
ATOM   2254 N  N     . LYS B 2 190 ? -0.631  4.519  11.332  1.00 38.61 ? 190 LYS A N     1 
ATOM   2255 C  CA    . LYS B 2 190 ? -1.146  3.976  10.081  1.00 38.82 ? 190 LYS A CA    1 
ATOM   2256 C  C     . LYS B 2 190 ? -2.646  4.117  9.997   1.00 38.64 ? 190 LYS A C     1 
ATOM   2257 O  O     . LYS B 2 190 ? -3.167  4.629  9.007   1.00 38.80 ? 190 LYS A O     1 
ATOM   2258 C  CB    . LYS B 2 190 ? -0.753  2.504  9.919   1.00 39.30 ? 190 LYS A CB    1 
ATOM   2259 C  CG    . LYS B 2 190 ? 0.654   2.287  9.354   1.00 39.34 ? 190 LYS A CG    1 
ATOM   2260 C  CD    . LYS B 2 190 ? 1.005   0.801  9.268   1.00 40.38 ? 190 LYS A CD    1 
ATOM   2261 C  CE    . LYS B 2 190 ? 2.329   0.582  8.543   1.00 42.75 ? 190 LYS A CE    1 
ATOM   2262 N  NZ    . LYS B 2 190 ? 2.665   -0.857 8.363   1.00 43.70 ? 190 LYS A NZ    1 
ATOM   2263 N  N     . ASN B 2 191 ? -3.338  3.692  11.047  1.00 38.26 ? 191 ASN A N     1 
ATOM   2264 C  CA    . ASN B 2 191 ? -4.791  3.753  11.077  1.00 38.86 ? 191 ASN A CA    1 
ATOM   2265 C  C     . ASN B 2 191 ? -5.416  5.126  11.168  1.00 39.80 ? 191 ASN A C     1 
ATOM   2266 O  O     . ASN B 2 191 ? -6.506  5.344  10.642  1.00 40.86 ? 191 ASN A O     1 
ATOM   2267 C  CB    . ASN B 2 191 ? -5.310  2.909  12.222  1.00 38.91 ? 191 ASN A CB    1 
ATOM   2268 C  CG    . ASN B 2 191 ? -5.234  1.450  11.919  1.00 38.88 ? 191 ASN A CG    1 
ATOM   2269 O  OD1   . ASN B 2 191 ? -5.991  0.950  11.093  1.00 39.05 ? 191 ASN A OD1   1 
ATOM   2270 N  ND2   . ASN B 2 191 ? -4.305  0.752  12.566  1.00 38.44 ? 191 ASN A ND2   1 
ATOM   2271 N  N     . ALA B 2 192 ? -4.748  6.048  11.846  1.00 40.06 ? 192 ALA A N     1 
ATOM   2272 C  CA    . ALA B 2 192 ? -5.274  7.393  11.996  1.00 39.12 ? 192 ALA A CA    1 
ATOM   2273 C  C     . ALA B 2 192 ? -5.339  8.108  10.650  1.00 39.03 ? 192 ALA A C     1 
ATOM   2274 O  O     . ALA B 2 192 ? -6.062  9.099  10.496  1.00 40.06 ? 192 ALA A O     1 
ATOM   2275 C  CB    . ALA B 2 192 ? -4.417  8.172  12.963  1.00 39.02 ? 192 ALA A CB    1 
ATOM   2276 N  N     . ARG B 2 193 ? -4.599  7.607  9.670   1.00 37.66 ? 193 ARG A N     1 
ATOM   2277 C  CA    . ARG B 2 193 ? -4.608  8.234  8.358   1.00 37.70 ? 193 ARG A CA    1 
ATOM   2278 C  C     . ARG B 2 193 ? -5.970  8.133  7.698   1.00 37.44 ? 193 ARG A C     1 
ATOM   2279 O  O     . ARG B 2 193 ? -6.262  8.865  6.759   1.00 37.54 ? 193 ARG A O     1 
ATOM   2280 C  CB    . ARG B 2 193 ? -3.562  7.597  7.460   1.00 37.31 ? 193 ARG A CB    1 
ATOM   2281 C  CG    . ARG B 2 193 ? -2.174  7.674  8.009   1.00 39.16 ? 193 ARG A CG    1 
ATOM   2282 C  CD    . ARG B 2 193 ? -1.270  6.850  7.153   1.00 41.92 ? 193 ARG A CD    1 
ATOM   2283 N  NE    . ARG B 2 193 ? -1.935  5.599  6.809   1.00 43.94 ? 193 ARG A NE    1 
ATOM   2284 C  CZ    . ARG B 2 193 ? -1.392  4.630  6.082   1.00 44.77 ? 193 ARG A CZ    1 
ATOM   2285 N  NH1   . ARG B 2 193 ? -0.155  4.752  5.609   1.00 43.36 ? 193 ARG A NH1   1 
ATOM   2286 N  NH2   . ARG B 2 193 ? -2.101  3.540  5.824   1.00 45.19 ? 193 ARG A NH2   1 
ATOM   2287 N  N     . ARG B 2 194 ? -6.800  7.218  8.185   1.00 38.52 ? 194 ARG A N     1 
ATOM   2288 C  CA    . ARG B 2 194 ? -8.139  7.033  7.636   1.00 39.27 ? 194 ARG A CA    1 
ATOM   2289 C  C     . ARG B 2 194 ? -9.229  7.593  8.576   1.00 38.70 ? 194 ARG A C     1 
ATOM   2290 O  O     . ARG B 2 194 ? -10.425 7.484  8.280   1.00 39.11 ? 194 ARG A O     1 
ATOM   2291 C  CB    . ARG B 2 194 ? -8.395  5.548  7.336   1.00 40.72 ? 194 ARG A CB    1 
ATOM   2292 C  CG    . ARG B 2 194 ? -7.147  4.670  7.328   1.00 46.44 ? 194 ARG A CG    1 
ATOM   2293 C  CD    . ARG B 2 194 ? -6.985  3.836  6.044   1.00 51.66 ? 194 ARG A CD    1 
ATOM   2294 N  NE    . ARG B 2 194 ? -8.159  3.023  5.684   1.00 57.50 ? 194 ARG A NE    1 
ATOM   2295 C  CZ    . ARG B 2 194 ? -8.682  2.030  6.415   1.00 59.71 ? 194 ARG A CZ    1 
ATOM   2296 N  NH1   . ARG B 2 194 ? -8.151  1.687  7.592   1.00 60.28 ? 194 ARG A NH1   1 
ATOM   2297 N  NH2   . ARG B 2 194 ? -9.743  1.363  5.956   1.00 60.06 ? 194 ARG A NH2   1 
ATOM   2298 N  N     . TRP B 2 195 ? -8.817  8.195  9.695   1.00 37.26 ? 195 TRP A N     1 
ATOM   2299 C  CA    . TRP B 2 195 ? -9.755  8.798  10.649  1.00 36.92 ? 195 TRP A CA    1 
ATOM   2300 C  C     . TRP B 2 195 ? -10.482 10.002 10.037  1.00 37.12 ? 195 TRP A C     1 
ATOM   2301 O  O     . TRP B 2 195 ? -9.942  10.703 9.169   1.00 37.58 ? 195 TRP A O     1 
ATOM   2302 C  CB    . TRP B 2 195 ? -9.034  9.341  11.882  1.00 36.92 ? 195 TRP A CB    1 
ATOM   2303 C  CG    . TRP B 2 195 ? -8.560  8.379  12.904  1.00 36.72 ? 195 TRP A CG    1 
ATOM   2304 C  CD1   . TRP B 2 195 ? -8.683  7.025  12.895  1.00 36.62 ? 195 TRP A CD1   1 
ATOM   2305 C  CD2   . TRP B 2 195 ? -7.844  8.712  14.097  1.00 36.59 ? 195 TRP A CD2   1 
ATOM   2306 N  NE1   . TRP B 2 195 ? -8.084  6.488  14.013  1.00 35.44 ? 195 TRP A NE1   1 
ATOM   2307 C  CE2   . TRP B 2 195 ? -7.559  7.506  14.767  1.00 36.32 ? 195 TRP A CE2   1 
ATOM   2308 C  CE3   . TRP B 2 195 ? -7.413  9.921  14.668  1.00 36.04 ? 195 TRP A CE3   1 
ATOM   2309 C  CZ2   . TRP B 2 195 ? -6.857  7.469  15.974  1.00 35.69 ? 195 TRP A CZ2   1 
ATOM   2310 C  CZ3   . TRP B 2 195 ? -6.718  9.884  15.867  1.00 34.51 ? 195 TRP A CZ3   1 
ATOM   2311 C  CH2   . TRP B 2 195 ? -6.447  8.667  16.507  1.00 34.40 ? 195 TRP A CH2   1 
ATOM   2312 N  N     . THR B 2 196 ? -11.688 10.270 10.522  1.00 35.93 ? 196 THR A N     1 
ATOM   2313 C  CA    . THR B 2 196 ? -12.439 11.410 10.032  1.00 36.37 ? 196 THR A CA    1 
ATOM   2314 C  C     . THR B 2 196 ? -12.953 12.200 11.208  1.00 37.14 ? 196 THR A C     1 
ATOM   2315 O  O     . THR B 2 196 ? -12.769 11.816 12.368  1.00 35.27 ? 196 THR A O     1 
ATOM   2316 C  CB    . THR B 2 196 ? -13.671 11.011 9.239   1.00 36.56 ? 196 THR A CB    1 
ATOM   2317 O  OG1   . THR B 2 196 ? -14.704 10.614 10.149  1.00 36.34 ? 196 THR A OG1   1 
ATOM   2318 C  CG2   . THR B 2 196 ? -13.348 9.893  8.296   1.00 36.96 ? 196 THR A CG2   1 
ATOM   2319 N  N     . ARG B 2 197 ? -13.630 13.299 10.891  1.00 38.45 ? 197 ARG A N     1 
ATOM   2320 C  CA    . ARG B 2 197 ? -14.187 14.158 11.913  1.00 39.31 ? 197 ARG A CA    1 
ATOM   2321 C  C     . ARG B 2 197 ? -15.410 13.485 12.501  1.00 40.42 ? 197 ARG A C     1 
ATOM   2322 O  O     . ARG B 2 197 ? -16.001 13.987 13.458  1.00 40.67 ? 197 ARG A O     1 
ATOM   2323 C  CB    . ARG B 2 197 ? -14.555 15.515 11.317  1.00 39.35 ? 197 ARG A CB    1 
ATOM   2324 C  CG    . ARG B 2 197 ? -15.732 15.510 10.371  1.00 39.98 ? 197 ARG A CG    1 
ATOM   2325 C  CD    . ARG B 2 197 ? -15.813 16.842 9.652   1.00 42.03 ? 197 ARG A CD    1 
ATOM   2326 N  NE    . ARG B 2 197 ? -14.723 16.989 8.691   1.00 43.77 ? 197 ARG A NE    1 
ATOM   2327 C  CZ    . ARG B 2 197 ? -14.297 18.148 8.197   1.00 44.76 ? 197 ARG A CZ    1 
ATOM   2328 N  NH1   . ARG B 2 197 ? -14.860 19.289 8.571   1.00 45.22 ? 197 ARG A NH1   1 
ATOM   2329 N  NH2   . ARG B 2 197 ? -13.305 18.166 7.318   1.00 45.67 ? 197 ARG A NH2   1 
ATOM   2330 N  N     . ARG B 2 198 ? -15.783 12.335 11.937  1.00 40.64 ? 198 ARG A N     1 
ATOM   2331 C  CA    . ARG B 2 198 ? -16.945 11.606 12.431  1.00 40.62 ? 198 ARG A CA    1 
ATOM   2332 C  C     . ARG B 2 198 ? -16.598 10.211 12.936  1.00 39.32 ? 198 ARG A C     1 
ATOM   2333 O  O     . ARG B 2 198 ? -17.441 9.314  12.943  1.00 39.93 ? 198 ARG A O     1 
ATOM   2334 C  CB    . ARG B 2 198 ? -18.012 11.529 11.338  1.00 42.26 ? 198 ARG A CB    1 
ATOM   2335 C  CG    . ARG B 2 198 ? -18.400 12.911 10.832  1.00 46.12 ? 198 ARG A CG    1 
ATOM   2336 C  CD    . ARG B 2 198 ? -19.737 12.930 10.113  1.00 50.15 ? 198 ARG A CD    1 
ATOM   2337 N  NE    . ARG B 2 198 ? -19.951 14.191 9.392   1.00 54.51 ? 198 ARG A NE    1 
ATOM   2338 C  CZ    . ARG B 2 198 ? -19.958 15.407 9.948   1.00 55.75 ? 198 ARG A CZ    1 
ATOM   2339 N  NH1   . ARG B 2 198 ? -19.762 15.562 11.257  1.00 55.86 ? 198 ARG A NH1   1 
ATOM   2340 N  NH2   . ARG B 2 198 ? -20.163 16.480 9.186   1.00 55.30 ? 198 ARG A NH2   1 
ATOM   2341 N  N     . THR B 2 199 ? -15.363 10.048 13.397  1.00 36.93 ? 199 THR A N     1 
ATOM   2342 C  CA    . THR B 2 199 ? -14.888 8.763  13.884  1.00 34.67 ? 199 THR A CA    1 
ATOM   2343 C  C     . THR B 2 199 ? -15.047 8.478  15.370  1.00 34.61 ? 199 THR A C     1 
ATOM   2344 O  O     . THR B 2 199 ? -14.582 9.240  16.226  1.00 34.99 ? 199 THR A O     1 
ATOM   2345 C  CB    . THR B 2 199 ? -13.418 8.573  13.500  1.00 33.30 ? 199 THR A CB    1 
ATOM   2346 O  OG1   . THR B 2 199 ? -13.339 8.296  12.094  1.00 33.35 ? 199 THR A OG1   1 
ATOM   2347 C  CG2   . THR B 2 199 ? -12.783 7.443  14.300  1.00 30.59 ? 199 THR A CG2   1 
ATOM   2348 N  N     . VAL B 2 200 ? -15.693 7.351  15.665  1.00 33.87 ? 200 VAL A N     1 
ATOM   2349 C  CA    . VAL B 2 200 ? -15.915 6.922  17.041  1.00 33.01 ? 200 VAL A CA    1 
ATOM   2350 C  C     . VAL B 2 200 ? -15.094 5.677  17.374  1.00 33.14 ? 200 VAL A C     1 
ATOM   2351 O  O     . VAL B 2 200 ? -15.125 4.673  16.660  1.00 32.21 ? 200 VAL A O     1 
ATOM   2352 C  CB    . VAL B 2 200 ? -17.392 6.609  17.313  1.00 32.09 ? 200 VAL A CB    1 
ATOM   2353 C  CG1   . VAL B 2 200 ? -17.587 6.411  18.787  1.00 32.31 ? 200 VAL A CG1   1 
ATOM   2354 C  CG2   . VAL B 2 200 ? -18.273 7.740  16.821  1.00 30.83 ? 200 VAL A CG2   1 
ATOM   2355 N  N     . ILE B 2 201 ? -14.357 5.756  18.476  1.00 33.43 ? 201 ILE A N     1 
ATOM   2356 C  CA    . ILE B 2 201 ? -13.521 4.658  18.910  1.00 33.86 ? 201 ILE A CA    1 
ATOM   2357 C  C     . ILE B 2 201 ? -13.967 4.154  20.275  1.00 36.03 ? 201 ILE A C     1 
ATOM   2358 O  O     . ILE B 2 201 ? -13.846 4.839  21.292  1.00 36.94 ? 201 ILE A O     1 
ATOM   2359 C  CB    . ILE B 2 201 ? -12.052 5.089  18.957  1.00 31.84 ? 201 ILE A CB    1 
ATOM   2360 C  CG1   . ILE B 2 201 ? -11.586 5.415  17.542  1.00 31.12 ? 201 ILE A CG1   1 
ATOM   2361 C  CG2   . ILE B 2 201 ? -11.199 3.997  19.572  1.00 30.62 ? 201 ILE A CG2   1 
ATOM   2362 C  CD1   . ILE B 2 201 ? -10.162 5.893  17.467  1.00 30.93 ? 201 ILE A CD1   1 
ATOM   2363 N  N     . ASP B 2 202 ? -14.495 2.938  20.275  1.00 37.87 ? 202 ASP A N     1 
ATOM   2364 C  CA    . ASP B 2 202 ? -14.977 2.302  21.480  1.00 38.83 ? 202 ASP A CA    1 
ATOM   2365 C  C     . ASP B 2 202 ? -13.997 1.219  21.918  1.00 40.30 ? 202 ASP A C     1 
ATOM   2366 O  O     . ASP B 2 202 ? -14.136 0.040  21.560  1.00 40.31 ? 202 ASP A O     1 
ATOM   2367 C  CB    . ASP B 2 202 ? -16.344 1.699  21.215  1.00 38.32 ? 202 ASP A CB    1 
ATOM   2368 C  CG    . ASP B 2 202 ? -17.194 1.666  22.440  1.00 39.54 ? 202 ASP A CG    1 
ATOM   2369 O  OD1   . ASP B 2 202 ? -16.733 1.127  23.474  1.00 39.55 ? 202 ASP A OD1   1 
ATOM   2370 O  OD2   . ASP B 2 202 ? -18.323 2.191  22.367  1.00 40.73 ? 202 ASP A OD2   1 
ATOM   2371 N  N     . VAL B 2 203 ? -13.003 1.635  22.696  1.00 41.55 ? 203 VAL A N     1 
ATOM   2372 C  CA    . VAL B 2 203 ? -11.971 0.732  23.197  1.00 41.33 ? 203 VAL A CA    1 
ATOM   2373 C  C     . VAL B 2 203 ? -12.568 -0.436 23.979  1.00 41.22 ? 203 VAL A C     1 
ATOM   2374 O  O     . VAL B 2 203 ? -12.098 -1.574 23.884  1.00 42.03 ? 203 VAL A O     1 
ATOM   2375 C  CB    . VAL B 2 203 ? -11.005 1.477  24.119  1.00 40.66 ? 203 VAL A CB    1 
ATOM   2376 C  CG1   . VAL B 2 203 ? -9.665  0.753  24.149  1.00 40.44 ? 203 VAL A CG1   1 
ATOM   2377 C  CG2   . VAL B 2 203 ? -10.857 2.921  23.649  1.00 40.72 ? 203 VAL A CG2   1 
ATOM   2378 N  N     . ALA B 2 204 ? -13.603 -0.144 24.757  1.00 40.61 ? 204 ALA A N     1 
ATOM   2379 C  CA    . ALA B 2 204 ? -14.264 -1.163 25.560  1.00 40.12 ? 204 ALA A CA    1 
ATOM   2380 C  C     . ALA B 2 204 ? -14.942 -2.187 24.676  1.00 40.13 ? 204 ALA A C     1 
ATOM   2381 O  O     . ALA B 2 204 ? -15.179 -3.310 25.096  1.00 40.30 ? 204 ALA A O     1 
ATOM   2382 C  CB    . ALA B 2 204 ? -15.288 -0.524 26.476  1.00 40.62 ? 204 ALA A CB    1 
ATOM   2383 N  N     . LYS B 2 205 ? -15.264 -1.801 23.451  1.00 40.20 ? 205 LYS A N     1 
ATOM   2384 C  CA    . LYS B 2 205 ? -15.920 -2.728 22.553  1.00 40.71 ? 205 LYS A CA    1 
ATOM   2385 C  C     . LYS B 2 205 ? -15.046 -3.085 21.365  1.00 40.24 ? 205 LYS A C     1 
ATOM   2386 O  O     . LYS B 2 205 ? -15.526 -3.693 20.408  1.00 41.30 ? 205 LYS A O     1 
ATOM   2387 C  CB    . LYS B 2 205 ? -17.175 -2.092 21.962  1.00 41.86 ? 205 LYS A CB    1 
ATOM   2388 C  CG    . LYS B 2 205 ? -18.284 -1.864 22.961  1.00 43.24 ? 205 LYS A CG    1 
ATOM   2389 C  CD    . LYS B 2 205 ? -19.547 -1.432 22.237  1.00 45.99 ? 205 LYS A CD    1 
ATOM   2390 C  CE    . LYS B 2 205 ? -20.692 -1.164 23.206  1.00 47.95 ? 205 LYS A CE    1 
ATOM   2391 N  NZ    . LYS B 2 205 ? -21.891 -0.617 22.491  1.00 49.74 ? 205 LYS A NZ    1 
ATOM   2392 N  N     . GLY B 2 206 ? -13.767 -2.721 21.426  1.00 39.28 ? 206 GLY A N     1 
ATOM   2393 C  CA    . GLY B 2 206 ? -12.841 -3.107 20.372  1.00 39.54 ? 206 GLY A CA    1 
ATOM   2394 C  C     . GLY B 2 206 ? -13.352 -2.631 19.017  1.00 39.49 ? 206 GLY A C     1 
ATOM   2395 O  O     . GLY B 2 206 ? -12.877 -3.037 17.948  1.00 36.94 ? 206 GLY A O     1 
ATOM   2396 N  N     . GLU B 2 207 ? -14.313 -1.720 19.079  1.00 40.61 ? 207 GLU A N     1 
ATOM   2397 C  CA    . GLU B 2 207 ? -14.945 -1.195 17.884  1.00 41.68 ? 207 GLU A CA    1 
ATOM   2398 C  C     . GLU B 2 207 ? -14.596 0.231  17.468  1.00 42.05 ? 207 GLU A C     1 
ATOM   2399 O  O     . GLU B 2 207 ? -14.074 1.031  18.243  1.00 42.67 ? 207 GLU A O     1 
ATOM   2400 C  CB    . GLU B 2 207 ? -16.453 -1.295 18.046  1.00 41.92 ? 207 GLU A CB    1 
ATOM   2401 C  CG    . GLU B 2 207 ? -17.199 -0.889 16.821  1.00 44.08 ? 207 GLU A CG    1 
ATOM   2402 C  CD    . GLU B 2 207 ? -18.681 -1.029 16.993  1.00 45.23 ? 207 GLU A CD    1 
ATOM   2403 O  OE1   . GLU B 2 207 ? -19.235 -0.351 17.891  1.00 44.13 ? 207 GLU A OE1   1 
ATOM   2404 O  OE2   . GLU B 2 207 ? -19.279 -1.821 16.224  1.00 46.64 ? 207 GLU A OE2   1 
ATOM   2405 N  N     . VAL B 2 208 ? -14.909 0.527  16.214  1.00 41.29 ? 208 VAL A N     1 
ATOM   2406 C  CA    . VAL B 2 208 ? -14.704 1.837  15.628  1.00 40.94 ? 208 VAL A CA    1 
ATOM   2407 C  C     . VAL B 2 208 ? -15.951 2.031  14.805  1.00 40.63 ? 208 VAL A C     1 
ATOM   2408 O  O     . VAL B 2 208 ? -16.429 1.094  14.200  1.00 40.41 ? 208 VAL A O     1 
ATOM   2409 C  CB    . VAL B 2 208 ? -13.488 1.866  14.679  1.00 40.43 ? 208 VAL A CB    1 
ATOM   2410 C  CG1   . VAL B 2 208 ? -13.596 3.050  13.733  1.00 38.27 ? 208 VAL A CG1   1 
ATOM   2411 C  CG2   . VAL B 2 208 ? -12.199 1.939  15.487  1.00 40.73 ? 208 VAL A CG2   1 
ATOM   2412 N  N     . ARG B 2 209 ? -16.501 3.229  14.793  1.00 42.19 ? 209 ARG A N     1 
ATOM   2413 C  CA    . ARG B 2 209 ? -17.688 3.455  13.996  1.00 44.71 ? 209 ARG A CA    1 
ATOM   2414 C  C     . ARG B 2 209 ? -17.854 4.918  13.622  1.00 46.56 ? 209 ARG A C     1 
ATOM   2415 O  O     . ARG B 2 209 ? -16.998 5.756  13.919  1.00 46.58 ? 209 ARG A O     1 
ATOM   2416 C  CB    . ARG B 2 209 ? -18.941 2.943  14.719  1.00 44.30 ? 209 ARG A CB    1 
ATOM   2417 C  CG    . ARG B 2 209 ? -19.086 3.458  16.125  1.00 43.22 ? 209 ARG A CG    1 
ATOM   2418 C  CD    . ARG B 2 209 ? -20.437 3.140  16.714  1.00 41.49 ? 209 ARG A CD    1 
ATOM   2419 N  NE    . ARG B 2 209 ? -20.508 3.671  18.067  1.00 41.31 ? 209 ARG A NE    1 
ATOM   2420 C  CZ    . ARG B 2 209 ? -19.923 3.105  19.114  1.00 40.35 ? 209 ARG A CZ    1 
ATOM   2421 N  NH1   . ARG B 2 209 ? -19.237 1.984  18.964  1.00 40.75 ? 209 ARG A NH1   1 
ATOM   2422 N  NH2   . ARG B 2 209 ? -20.004 3.669  20.304  1.00 39.97 ? 209 ARG A NH2   1 
ATOM   2423 N  N     . LYS B 2 210 ? -18.959 5.203  12.946  1.00 48.53 ? 210 LYS A N     1 
ATOM   2424 C  CA    . LYS B 2 210 ? -19.278 6.538  12.489  1.00 50.19 ? 210 LYS A CA    1 
ATOM   2425 C  C     . LYS B 2 210 ? -20.241 7.132  13.519  1.00 50.58 ? 210 LYS A C     1 
ATOM   2426 O  O     . LYS B 2 210 ? -21.179 6.464  13.969  1.00 50.76 ? 210 LYS A O     1 
ATOM   2427 C  CB    . LYS B 2 210 ? -19.934 6.436  11.107  1.00 51.88 ? 210 LYS A CB    1 
ATOM   2428 C  CG    . LYS B 2 210 ? -19.604 7.556  10.133  1.00 55.24 ? 210 LYS A CG    1 
ATOM   2429 C  CD    . LYS B 2 210 ? -20.728 8.608  10.040  1.00 57.89 ? 210 LYS A CD    1 
ATOM   2430 C  CE    . LYS B 2 210 ? -20.444 9.616  8.911   1.00 59.69 ? 210 LYS A CE    1 
ATOM   2431 N  NZ    . LYS B 2 210 ? -21.390 10.778 8.853   1.00 61.08 ? 210 LYS A NZ    1 
ATOM   2432 N  N     . GLY B 2 211 ? -19.987 8.374  13.915  1.00 50.36 ? 211 GLY A N     1 
ATOM   2433 C  CA    . GLY B 2 211 ? -20.845 9.027  14.884  1.00 50.71 ? 211 GLY A CA    1 
ATOM   2434 C  C     . GLY B 2 211 ? -21.041 10.450 14.433  1.00 50.86 ? 211 GLY A C     1 
ATOM   2435 O  O     . GLY B 2 211 ? -20.718 10.769 13.292  1.00 51.37 ? 211 GLY A O     1 
ATOM   2436 N  N     . GLU B 2 212 ? -21.562 11.308 15.302  1.00 51.47 ? 212 GLU A N     1 
ATOM   2437 C  CA    . GLU B 2 212 ? -21.764 12.698 14.917  1.00 52.42 ? 212 GLU A CA    1 
ATOM   2438 C  C     . GLU B 2 212 ? -20.429 13.442 14.846  1.00 51.10 ? 212 GLU A C     1 
ATOM   2439 O  O     . GLU B 2 212 ? -20.145 14.123 13.864  1.00 51.25 ? 212 GLU A O     1 
ATOM   2440 C  CB    . GLU B 2 212 ? -22.688 13.412 15.907  1.00 55.39 ? 212 GLU A CB    1 
ATOM   2441 C  CG    . GLU B 2 212 ? -24.098 12.828 16.021  1.00 60.80 ? 212 GLU A CG    1 
ATOM   2442 C  CD    . GLU B 2 212 ? -25.032 13.701 16.878  1.00 63.74 ? 212 GLU A CD    1 
ATOM   2443 O  OE1   . GLU B 2 212 ? -25.546 14.721 16.348  1.00 64.98 ? 212 GLU A OE1   1 
ATOM   2444 O  OE2   . GLU B 2 212 ? -25.235 13.377 18.080  1.00 64.47 ? 212 GLU A OE2   1 
ATOM   2445 N  N     . GLU B 2 213 ? -19.606 13.295 15.882  1.00 49.48 ? 213 GLU A N     1 
ATOM   2446 C  CA    . GLU B 2 213 ? -18.313 13.976 15.947  1.00 47.89 ? 213 GLU A CA    1 
ATOM   2447 C  C     . GLU B 2 213 ? -17.206 13.065 16.476  1.00 45.38 ? 213 GLU A C     1 
ATOM   2448 O  O     . GLU B 2 213 ? -17.501 12.015 17.039  1.00 46.52 ? 213 GLU A O     1 
ATOM   2449 C  CB    . GLU B 2 213 ? -18.450 15.223 16.825  1.00 49.07 ? 213 GLU A CB    1 
ATOM   2450 C  CG    . GLU B 2 213 ? -19.504 15.075 17.908  1.00 50.89 ? 213 GLU A CG    1 
ATOM   2451 C  CD    . GLU B 2 213 ? -18.911 14.970 19.293  1.00 52.45 ? 213 GLU A CD    1 
ATOM   2452 O  OE1   . GLU B 2 213 ? -19.598 14.437 20.196  1.00 52.64 ? 213 GLU A OE1   1 
ATOM   2453 O  OE2   . GLU B 2 213 ? -17.763 15.435 19.481  1.00 53.76 ? 213 GLU A OE2   1 
ATOM   2454 N  N     . PHE B 2 214 ? -15.943 13.455 16.294  1.00 41.38 ? 214 PHE A N     1 
ATOM   2455 C  CA    . PHE B 2 214 ? -14.831 12.627 16.763  1.00 38.70 ? 214 PHE A CA    1 
ATOM   2456 C  C     . PHE B 2 214 ? -15.061 12.249 18.204  1.00 38.41 ? 214 PHE A C     1 
ATOM   2457 O  O     . PHE B 2 214 ? -15.196 13.119 19.072  1.00 37.90 ? 214 PHE A O     1 
ATOM   2458 C  CB    . PHE B 2 214 ? -13.503 13.358 16.677  1.00 36.52 ? 214 PHE A CB    1 
ATOM   2459 C  CG    . PHE B 2 214 ? -12.313 12.453 16.815  1.00 33.07 ? 214 PHE A CG    1 
ATOM   2460 C  CD1   . PHE B 2 214 ? -11.836 11.743 15.721  1.00 31.74 ? 214 PHE A CD1   1 
ATOM   2461 C  CD2   . PHE B 2 214 ? -11.650 12.338 18.024  1.00 32.21 ? 214 PHE A CD2   1 
ATOM   2462 C  CE1   . PHE B 2 214 ? -10.710 10.939 15.826  1.00 29.39 ? 214 PHE A CE1   1 
ATOM   2463 C  CE2   . PHE B 2 214 ? -10.530 11.538 18.134  1.00 30.96 ? 214 PHE A CE2   1 
ATOM   2464 C  CZ    . PHE B 2 214 ? -10.060 10.836 17.025  1.00 29.83 ? 214 PHE A CZ    1 
ATOM   2465 N  N     . PHE B 2 215 ? -15.049 10.948 18.467  1.00 37.68 ? 215 PHE A N     1 
ATOM   2466 C  CA    . PHE B 2 215 ? -15.345 10.477 19.803  1.00 36.75 ? 215 PHE A CA    1 
ATOM   2467 C  C     . PHE B 2 215 ? -14.589 9.212  20.180  1.00 37.14 ? 215 PHE A C     1 
ATOM   2468 O  O     . PHE B 2 215 ? -14.701 8.193  19.503  1.00 37.78 ? 215 PHE A O     1 
ATOM   2469 C  CB    . PHE B 2 215 ? -16.847 10.219 19.857  1.00 35.54 ? 215 PHE A CB    1 
ATOM   2470 C  CG    . PHE B 2 215 ? -17.446 10.323 21.216  1.00 34.23 ? 215 PHE A CG    1 
ATOM   2471 C  CD1   . PHE B 2 215 ? -18.558 11.130 21.424  1.00 32.96 ? 215 PHE A CD1   1 
ATOM   2472 C  CD2   . PHE B 2 215 ? -16.939 9.588  22.282  1.00 33.95 ? 215 PHE A CD2   1 
ATOM   2473 C  CE1   . PHE B 2 215 ? -19.165 11.204 22.674  1.00 32.46 ? 215 PHE A CE1   1 
ATOM   2474 C  CE2   . PHE B 2 215 ? -17.545 9.659  23.543  1.00 34.84 ? 215 PHE A CE2   1 
ATOM   2475 C  CZ    . PHE B 2 215 ? -18.662 10.472 23.736  1.00 32.87 ? 215 PHE A CZ    1 
ATOM   2476 N  N     . VAL B 2 216 ? -13.813 9.286  21.254  1.00 36.92 ? 216 VAL A N     1 
ATOM   2477 C  CA    . VAL B 2 216 ? -13.075 8.131  21.764  1.00 36.46 ? 216 VAL A CA    1 
ATOM   2478 C  C     . VAL B 2 216 ? -13.748 7.806  23.096  1.00 37.11 ? 216 VAL A C     1 
ATOM   2479 O  O     . VAL B 2 216 ? -13.427 8.408  24.132  1.00 37.16 ? 216 VAL A O     1 
ATOM   2480 C  CB    . VAL B 2 216 ? -11.599 8.459  22.026  1.00 35.33 ? 216 VAL A CB    1 
ATOM   2481 C  CG1   . VAL B 2 216 ? -10.984 7.407  22.912  1.00 35.01 ? 216 VAL A CG1   1 
ATOM   2482 C  CG2   . VAL B 2 216 ? -10.852 8.508  20.725  1.00 35.42 ? 216 VAL A CG2   1 
ATOM   2483 N  N     . VAL B 2 217 ? -14.686 6.869  23.074  1.00 36.02 ? 217 VAL A N     1 
ATOM   2484 C  CA    . VAL B 2 217 ? -15.390 6.556  24.294  1.00 36.57 ? 217 VAL A CA    1 
ATOM   2485 C  C     . VAL B 2 217 ? -14.505 5.915  25.362  1.00 38.19 ? 217 VAL A C     1 
ATOM   2486 O  O     . VAL B 2 217 ? -13.705 5.019  25.081  1.00 38.69 ? 217 VAL A O     1 
ATOM   2487 C  CB    . VAL B 2 217 ? -16.653 5.717  24.008  1.00 34.04 ? 217 VAL A CB    1 
ATOM   2488 C  CG1   . VAL B 2 217 ? -16.315 4.580  23.155  1.00 34.92 ? 217 VAL A CG1   1 
ATOM   2489 C  CG2   . VAL B 2 217 ? -17.287 5.266  25.300  1.00 33.31 ? 217 VAL A CG2   1 
ATOM   2490 N  N     . ASP B 2 218 ? -14.668 6.444  26.582  1.00 39.09 ? 218 ASP A N     1 
ATOM   2491 C  CA    . ASP B 2 218 ? -13.962 6.086  27.815  1.00 38.03 ? 218 ASP A CA    1 
ATOM   2492 C  C     . ASP B 2 218 ? -14.300 4.679  28.317  1.00 37.37 ? 218 ASP A C     1 
ATOM   2493 O  O     . ASP B 2 218 ? -15.457 4.370  28.578  1.00 36.88 ? 218 ASP A O     1 
ATOM   2494 C  CB    . ASP B 2 218 ? -14.341 7.112  28.886  1.00 39.87 ? 218 ASP A CB    1 
ATOM   2495 C  CG    . ASP B 2 218 ? -13.390 7.117  30.059  1.00 42.80 ? 218 ASP A CG    1 
ATOM   2496 O  OD1   . ASP B 2 218 ? -12.938 6.025  30.456  1.00 45.77 ? 218 ASP A OD1   1 
ATOM   2497 O  OD2   . ASP B 2 218 ? -13.097 8.210  30.601  1.00 43.47 ? 218 ASP A OD2   1 
ATOM   2498 N  N     . PRO B 2 219 ? -13.285 3.824  28.508  1.00 37.12 ? 219 PRO A N     1 
ATOM   2499 C  CA    . PRO B 2 219 ? -13.544 2.460  28.982  1.00 37.10 ? 219 PRO A CA    1 
ATOM   2500 C  C     . PRO B 2 219 ? -14.424 2.463  30.217  1.00 38.42 ? 219 PRO A C     1 
ATOM   2501 O  O     . PRO B 2 219 ? -15.393 1.710  30.326  1.00 38.53 ? 219 PRO A O     1 
ATOM   2502 C  CB    . PRO B 2 219 ? -12.150 1.934  29.312  1.00 36.19 ? 219 PRO A CB    1 
ATOM   2503 C  CG    . PRO B 2 219 ? -11.227 2.798  28.514  1.00 36.89 ? 219 PRO A CG    1 
ATOM   2504 C  CD    . PRO B 2 219 ? -11.854 4.145  28.619  1.00 37.02 ? 219 PRO A CD    1 
ATOM   2505 N  N     . VAL B 2 220 ? -14.047 3.333  31.142  1.00 39.85 ? 220 VAL A N     1 
ATOM   2506 C  CA    . VAL B 2 220 ? -14.705 3.509  32.421  1.00 41.37 ? 220 VAL A CA    1 
ATOM   2507 C  C     . VAL B 2 220 ? -16.045 4.264  32.404  1.00 43.27 ? 220 VAL A C     1 
ATOM   2508 O  O     . VAL B 2 220 ? -16.853 4.102  33.315  1.00 43.36 ? 220 VAL A O     1 
ATOM   2509 C  CB    . VAL B 2 220 ? -13.755 4.233  33.366  1.00 40.63 ? 220 VAL A CB    1 
ATOM   2510 C  CG1   . VAL B 2 220 ? -14.390 4.387  34.715  1.00 42.34 ? 220 VAL A CG1   1 
ATOM   2511 C  CG2   . VAL B 2 220 ? -12.458 3.476  33.455  1.00 39.32 ? 220 VAL A CG2   1 
ATOM   2512 N  N     . ASP B 2 221 ? -16.282 5.097  31.393  1.00 45.05 ? 221 ASP A N     1 
ATOM   2513 C  CA    . ASP B 2 221 ? -17.542 5.844  31.313  1.00 47.19 ? 221 ASP A CA    1 
ATOM   2514 C  C     . ASP B 2 221 ? -17.976 5.939  29.854  1.00 48.05 ? 221 ASP A C     1 
ATOM   2515 O  O     . ASP B 2 221 ? -17.543 6.832  29.123  1.00 47.87 ? 221 ASP A O     1 
ATOM   2516 C  CB    . ASP B 2 221 ? -17.362 7.250  31.888  1.00 49.75 ? 221 ASP A CB    1 
ATOM   2517 C  CG    . ASP B 2 221 ? -18.690 7.957  32.151  1.00 52.43 ? 221 ASP A CG    1 
ATOM   2518 O  OD1   . ASP B 2 221 ? -19.686 7.666  31.441  1.00 53.31 ? 221 ASP A OD1   1 
ATOM   2519 O  OD2   . ASP B 2 221 ? -18.725 8.820  33.062  1.00 53.37 ? 221 ASP A OD2   1 
ATOM   2520 N  N     . GLU B 2 222 ? -18.839 5.017  29.443  1.00 49.15 ? 222 GLU A N     1 
ATOM   2521 C  CA    . GLU B 2 222 ? -19.307 4.956  28.065  1.00 50.24 ? 222 GLU A CA    1 
ATOM   2522 C  C     . GLU B 2 222 ? -19.858 6.256  27.526  1.00 49.73 ? 222 GLU A C     1 
ATOM   2523 O  O     . GLU B 2 222 ? -20.142 6.363  26.330  1.00 50.02 ? 222 GLU A O     1 
ATOM   2524 C  CB    . GLU B 2 222 ? -20.210 3.739  27.852  1.00 52.15 ? 222 GLU A CB    1 
ATOM   2525 C  CG    . GLU B 2 222 ? -19.531 2.388  28.131  1.00 55.44 ? 222 GLU A CG    1 
ATOM   2526 C  CD    . GLU B 2 222 ? -18.077 2.327  27.659  1.00 57.03 ? 222 GLU A CD    1 
ATOM   2527 O  OE1   . GLU B 2 222 ? -17.181 2.683  28.459  1.00 56.90 ? 222 GLU A OE1   1 
ATOM   2528 O  OE2   . GLU B 2 222 ? -17.833 1.928  26.490  1.00 58.21 ? 222 GLU A OE2   1 
ATOM   2529 N  N     . LYS B 2 223 ? -20.012 7.246  28.398  1.00 48.42 ? 223 LYS A N     1 
ATOM   2530 C  CA    . LYS B 2 223 ? -20.670 8.481  28.006  1.00 47.28 ? 223 LYS A CA    1 
ATOM   2531 C  C     . LYS B 2 223 ? -19.677 9.623  27.838  1.00 45.49 ? 223 LYS A C     1 
ATOM   2532 O  O     . LYS B 2 223 ? -19.993 10.634 27.217  1.00 45.08 ? 223 LYS A O     1 
ATOM   2533 C  CB    . LYS B 2 223 ? -21.770 8.835  29.013  1.00 48.71 ? 223 LYS A CB    1 
ATOM   2534 C  CG    . LYS B 2 223 ? -22.869 7.776  29.072  1.00 50.97 ? 223 LYS A CG    1 
ATOM   2535 C  CD    . LYS B 2 223 ? -23.394 7.441  27.648  1.00 52.48 ? 223 LYS A CD    1 
ATOM   2536 C  CE    . LYS B 2 223 ? -24.050 6.039  27.547  1.00 52.00 ? 223 LYS A CE    1 
ATOM   2537 N  NZ    . LYS B 2 223 ? -24.490 5.667  26.155  1.00 48.80 ? 223 LYS A NZ    1 
ATOM   2538 N  N     . ARG B 2 224 ? -18.467 9.453  28.365  1.00 43.88 ? 224 ARG A N     1 
ATOM   2539 C  CA    . ARG B 2 224 ? -17.448 10.488 28.234  1.00 43.00 ? 224 ARG A CA    1 
ATOM   2540 C  C     . ARG B 2 224 ? -16.711 10.406 26.914  1.00 42.52 ? 224 ARG A C     1 
ATOM   2541 O  O     . ARG B 2 224 ? -16.649 9.349  26.285  1.00 43.46 ? 224 ARG A O     1 
ATOM   2542 C  CB    . ARG B 2 224 ? -16.387 10.378 29.323  1.00 42.66 ? 224 ARG A CB    1 
ATOM   2543 C  CG    . ARG B 2 224 ? -15.368 11.500 29.220  1.00 43.62 ? 224 ARG A CG    1 
ATOM   2544 C  CD    . ARG B 2 224 ? -14.052 11.180 29.887  1.00 45.56 ? 224 ARG A CD    1 
ATOM   2545 N  NE    . ARG B 2 224 ? -13.161 12.339 29.857  1.00 46.97 ? 224 ARG A NE    1 
ATOM   2546 C  CZ    . ARG B 2 224 ? -11.934 12.360 30.370  1.00 47.57 ? 224 ARG A CZ    1 
ATOM   2547 N  NH1   . ARG B 2 224 ? -11.430 11.283 30.954  1.00 47.72 ? 224 ARG A NH1   1 
ATOM   2548 N  NH2   . ARG B 2 224 ? -11.214 13.471 30.320  1.00 48.35 ? 224 ARG A NH2   1 
ATOM   2549 N  N     . ASN B 2 225 ? -16.142 11.529 26.498  1.00 40.46 ? 225 ASN A N     1 
ATOM   2550 C  CA    . ASN B 2 225 ? -15.336 11.535 25.295  1.00 38.65 ? 225 ASN A CA    1 
ATOM   2551 C  C     . ASN B 2 225 ? -13.920 11.920 25.720  1.00 37.84 ? 225 ASN A C     1 
ATOM   2552 O  O     . ASN B 2 225 ? -13.612 13.100 25.885  1.00 37.19 ? 225 ASN A O     1 
ATOM   2553 C  CB    . ASN B 2 225 ? -15.858 12.537 24.281  1.00 38.58 ? 225 ASN A CB    1 
ATOM   2554 C  CG    . ASN B 2 225 ? -15.042 12.536 23.005  1.00 39.73 ? 225 ASN A CG    1 
ATOM   2555 O  OD1   . ASN B 2 225 ? -14.051 11.800 22.886  1.00 39.81 ? 225 ASN A OD1   1 
ATOM   2556 N  ND2   . ASN B 2 225 ? -15.450 13.355 22.041  1.00 39.98 ? 225 ASN A ND2   1 
ATOM   2557 N  N     . VAL B 2 226 ? -13.068 10.922 25.919  1.00 36.68 ? 226 VAL A N     1 
ATOM   2558 C  CA    . VAL B 2 226 ? -11.693 11.174 26.329  1.00 36.41 ? 226 VAL A CA    1 
ATOM   2559 C  C     . VAL B 2 226 ? -11.067 12.299 25.511  1.00 36.20 ? 226 VAL A C     1 
ATOM   2560 O  O     . VAL B 2 226 ? -10.371 13.148 26.063  1.00 36.43 ? 226 VAL A O     1 
ATOM   2561 C  CB    . VAL B 2 226 ? -10.809 9.919  26.150  1.00 37.52 ? 226 VAL A CB    1 
ATOM   2562 C  CG1   . VAL B 2 226 ? -9.374  10.226 26.556  1.00 37.83 ? 226 VAL A CG1   1 
ATOM   2563 C  CG2   . VAL B 2 226 ? -11.365 8.769  26.963  1.00 37.68 ? 226 VAL A CG2   1 
ATOM   2564 N  N     . ALA B 2 227 ? -11.321 12.295 24.199  1.00 34.92 ? 227 ALA A N     1 
ATOM   2565 C  CA    . ALA B 2 227 ? -10.780 13.302 23.278  1.00 33.58 ? 227 ALA A CA    1 
ATOM   2566 C  C     . ALA B 2 227 ? -11.710 14.510 23.020  1.00 32.58 ? 227 ALA A C     1 
ATOM   2567 O  O     . ALA B 2 227 ? -11.583 15.213 22.011  1.00 32.49 ? 227 ALA A O     1 
ATOM   2568 C  CB    . ALA B 2 227 ? -10.413 12.634 21.945  1.00 33.19 ? 227 ALA A CB    1 
ATOM   2569 N  N     . ALA B 2 228 ? -12.628 14.754 23.943  1.00 31.36 ? 228 ALA A N     1 
ATOM   2570 C  CA    . ALA B 2 228 ? -13.562 15.861 23.824  1.00 29.94 ? 228 ALA A CA    1 
ATOM   2571 C  C     . ALA B 2 228 ? -12.917 17.237 23.602  1.00 29.80 ? 228 ALA A C     1 
ATOM   2572 O  O     . ALA B 2 228 ? -13.421 18.018 22.807  1.00 29.73 ? 228 ALA A O     1 
ATOM   2573 C  CB    . ALA B 2 228 ? -14.442 15.905 25.057  1.00 29.60 ? 228 ALA A CB    1 
ATOM   2574 N  N     . ASN B 2 229 ? -11.817 17.543 24.294  1.00 29.65 ? 229 ASN A N     1 
ATOM   2575 C  CA    . ASN B 2 229 ? -11.166 18.854 24.155  1.00 29.22 ? 229 ASN A CA    1 
ATOM   2576 C  C     . ASN B 2 229 ? -10.090 18.898 23.060  1.00 29.03 ? 229 ASN A C     1 
ATOM   2577 O  O     . ASN B 2 229 ? -9.139  19.669 23.143  1.00 29.08 ? 229 ASN A O     1 
ATOM   2578 C  CB    . ASN B 2 229 ? -10.569 19.284 25.510  1.00 29.23 ? 229 ASN A CB    1 
ATOM   2579 C  CG    . ASN B 2 229 ? -10.437 20.816 25.662  1.00 29.59 ? 229 ASN A CG    1 
ATOM   2580 O  OD1   . ASN B 2 229 ? -11.343 21.576 25.323  1.00 28.63 ? 229 ASN A OD1   1 
ATOM   2581 N  ND2   . ASN B 2 229 ? -9.308  21.256 26.202  1.00 29.83 ? 229 ASN A ND2   1 
ATOM   2582 N  N     . LEU B 2 230 ? -10.252 18.076 22.028  1.00 28.94 ? 230 LEU A N     1 
ATOM   2583 C  CA    . LEU B 2 230 ? -9.302  18.025 20.920  1.00 29.01 ? 230 LEU A CA    1 
ATOM   2584 C  C     . LEU B 2 230 ? -9.903  18.761 19.741  1.00 29.05 ? 230 LEU A C     1 
ATOM   2585 O  O     . LEU B 2 230 ? -10.745 18.229 19.028  1.00 28.93 ? 230 LEU A O     1 
ATOM   2586 C  CB    . LEU B 2 230 ? -9.023  16.573 20.521  1.00 29.55 ? 230 LEU A CB    1 
ATOM   2587 C  CG    . LEU B 2 230 ? -8.189  16.332 19.253  1.00 29.30 ? 230 LEU A CG    1 
ATOM   2588 C  CD1   . LEU B 2 230 ? -6.732  16.656 19.519  1.00 28.64 ? 230 LEU A CD1   1 
ATOM   2589 C  CD2   . LEU B 2 230 ? -8.331  14.886 18.817  1.00 27.95 ? 230 LEU A CD2   1 
ATOM   2590 N  N     . SER B 2 231 ? -9.468  19.991 19.536  1.00 30.70 ? 231 SER A N     1 
ATOM   2591 C  CA    . SER B 2 231 ? -9.995  20.795 18.446  1.00 31.56 ? 231 SER A CA    1 
ATOM   2592 C  C     . SER B 2 231 ? -9.936  20.025 17.147  1.00 31.64 ? 231 SER A C     1 
ATOM   2593 O  O     . SER B 2 231 ? -9.010  19.257 16.898  1.00 31.86 ? 231 SER A O     1 
ATOM   2594 C  CB    . SER B 2 231 ? -9.195  22.079 18.273  1.00 32.21 ? 231 SER A CB    1 
ATOM   2595 O  OG    . SER B 2 231 ? -7.982  21.812 17.582  1.00 34.36 ? 231 SER A OG    1 
ATOM   2596 N  N     . LEU B 2 232 ? -10.942 20.256 16.322  1.00 31.64 ? 232 LEU A N     1 
ATOM   2597 C  CA    . LEU B 2 232 ? -11.045 19.638 15.019  1.00 31.18 ? 232 LEU A CA    1 
ATOM   2598 C  C     . LEU B 2 232 ? -9.807  19.910 14.173  1.00 31.28 ? 232 LEU A C     1 
ATOM   2599 O  O     . LEU B 2 232 ? -9.292  19.003 13.528  1.00 31.45 ? 232 LEU A O     1 
ATOM   2600 C  CB    . LEU B 2 232 ? -12.292 20.171 14.314  1.00 29.86 ? 232 LEU A CB    1 
ATOM   2601 C  CG    . LEU B 2 232 ? -12.349 20.094 12.797  1.00 29.36 ? 232 LEU A CG    1 
ATOM   2602 C  CD1   . LEU B 2 232 ? -12.253 18.639 12.350  1.00 29.73 ? 232 LEU A CD1   1 
ATOM   2603 C  CD2   . LEU B 2 232 ? -13.649 20.729 12.321  1.00 28.16 ? 232 LEU A CD2   1 
ATOM   2604 N  N     . ASP B 2 233 ? -9.321  21.147 14.173  1.00 31.85 ? 233 ASP A N     1 
ATOM   2605 C  CA    . ASP B 2 233 ? -8.139  21.476 13.374  1.00 33.48 ? 233 ASP A CA    1 
ATOM   2606 C  C     . ASP B 2 233 ? -6.924  20.654 13.785  1.00 33.07 ? 233 ASP A C     1 
ATOM   2607 O  O     . ASP B 2 233 ? -6.151  20.204 12.937  1.00 31.95 ? 233 ASP A O     1 
ATOM   2608 C  CB    . ASP B 2 233 ? -7.797  22.967 13.471  1.00 35.31 ? 233 ASP A CB    1 
ATOM   2609 C  CG    . ASP B 2 233 ? -8.694  23.840 12.600  1.00 36.81 ? 233 ASP A CG    1 
ATOM   2610 O  OD1   . ASP B 2 233 ? -9.501  23.302 11.806  1.00 35.42 ? 233 ASP A OD1   1 
ATOM   2611 O  OD2   . ASP B 2 233 ? -8.574  25.079 12.710  1.00 38.80 ? 233 ASP A OD2   1 
ATOM   2612 N  N     . ASN B 2 234 ? -6.752  20.466 15.089  1.00 33.42 ? 234 ASN A N     1 
ATOM   2613 C  CA    . ASN B 2 234 ? -5.638  19.674 15.597  1.00 33.13 ? 234 ASN A CA    1 
ATOM   2614 C  C     . ASN B 2 234 ? -5.812  18.203 15.208  1.00 32.89 ? 234 ASN A C     1 
ATOM   2615 O  O     . ASN B 2 234 ? -4.845  17.542 14.827  1.00 32.76 ? 234 ASN A O     1 
ATOM   2616 C  CB    . ASN B 2 234 ? -5.545  19.837 17.107  1.00 32.86 ? 234 ASN A CB    1 
ATOM   2617 C  CG    . ASN B 2 234 ? -4.714  21.034 17.496  1.00 33.66 ? 234 ASN A CG    1 
ATOM   2618 O  OD1   . ASN B 2 234 ? -4.787  21.517 18.629  1.00 35.73 ? 234 ASN A OD1   1 
ATOM   2619 N  ND2   . ASN B 2 234 ? -3.900  21.514 16.562  1.00 31.72 ? 234 ASN A ND2   1 
ATOM   2620 N  N     . LEU B 2 235 ? -7.047  17.706 15.303  1.00 31.54 ? 235 LEU A N     1 
ATOM   2621 C  CA    . LEU B 2 235 ? -7.369  16.340 14.914  1.00 29.93 ? 235 LEU A CA    1 
ATOM   2622 C  C     . LEU B 2 235 ? -6.854  16.175 13.500  1.00 30.61 ? 235 LEU A C     1 
ATOM   2623 O  O     . LEU B 2 235 ? -6.072  15.274 13.209  1.00 32.34 ? 235 LEU A O     1 
ATOM   2624 C  CB    . LEU B 2 235 ? -8.881  16.127 14.911  1.00 28.02 ? 235 LEU A CB    1 
ATOM   2625 C  CG    . LEU B 2 235 ? -9.390  14.938 14.087  1.00 25.98 ? 235 LEU A CG    1 
ATOM   2626 C  CD1   . LEU B 2 235 ? -8.715  13.655 14.564  1.00 24.49 ? 235 LEU A CD1   1 
ATOM   2627 C  CD2   . LEU B 2 235 ? -10.900 14.837 14.206  1.00 22.76 ? 235 LEU A CD2   1 
ATOM   2628 N  N     . ALA B 2 236 ? -7.308  17.060 12.621  1.00 30.44 ? 236 ALA A N     1 
ATOM   2629 C  CA    . ALA B 2 236 ? -6.893  17.048 11.229  1.00 30.37 ? 236 ALA A CA    1 
ATOM   2630 C  C     . ALA B 2 236 ? -5.371  17.160 11.076  1.00 29.80 ? 236 ALA A C     1 
ATOM   2631 O  O     . ALA B 2 236 ? -4.773  16.436 10.286  1.00 28.82 ? 236 ALA A O     1 
ATOM   2632 C  CB    . ALA B 2 236 ? -7.573  18.187 10.485  1.00 30.90 ? 236 ALA A CB    1 
ATOM   2633 N  N     . ARG B 2 237 ? -4.756  18.071 11.827  1.00 30.00 ? 237 ARG A N     1 
ATOM   2634 C  CA    . ARG B 2 237 ? -3.307  18.270 11.752  1.00 31.74 ? 237 ARG A CA    1 
ATOM   2635 C  C     . ARG B 2 237 ? -2.546  16.994 12.077  1.00 31.44 ? 237 ARG A C     1 
ATOM   2636 O  O     . ARG B 2 237 ? -1.445  16.779 11.584  1.00 31.52 ? 237 ARG A O     1 
ATOM   2637 C  CB    . ARG B 2 237 ? -2.846  19.392 12.703  1.00 33.63 ? 237 ARG A CB    1 
ATOM   2638 C  CG    . ARG B 2 237 ? -3.238  20.821 12.270  1.00 36.23 ? 237 ARG A CG    1 
ATOM   2639 C  CD    . ARG B 2 237 ? -2.626  21.913 13.172  1.00 36.58 ? 237 ARG A CD    1 
ATOM   2640 N  NE    . ARG B 2 237 ? -3.158  23.238 12.844  1.00 38.36 ? 237 ARG A NE    1 
ATOM   2641 C  CZ    . ARG B 2 237 ? -4.138  23.852 13.506  1.00 39.37 ? 237 ARG A CZ    1 
ATOM   2642 N  NH1   . ARG B 2 237 ? -4.707  23.271 14.557  1.00 40.83 ? 237 ARG A NH1   1 
ATOM   2643 N  NH2   . ARG B 2 237 ? -4.569  25.042 13.107  1.00 38.22 ? 237 ARG A NH2   1 
ATOM   2644 N  N     . PHE B 2 238 ? -3.140  16.156 12.917  1.00 31.27 ? 238 PHE A N     1 
ATOM   2645 C  CA    . PHE B 2 238 ? -2.528  14.892 13.304  1.00 31.11 ? 238 PHE A CA    1 
ATOM   2646 C  C     . PHE B 2 238 ? -2.696  13.934 12.136  1.00 31.74 ? 238 PHE A C     1 
ATOM   2647 O  O     . PHE B 2 238 ? -1.715  13.461 11.553  1.00 31.10 ? 238 PHE A O     1 
ATOM   2648 C  CB    . PHE B 2 238 ? -3.216  14.335 14.556  1.00 29.67 ? 238 PHE A CB    1 
ATOM   2649 C  CG    . PHE B 2 238 ? -2.757  12.960 14.949  1.00 28.53 ? 238 PHE A CG    1 
ATOM   2650 C  CD1   . PHE B 2 238 ? -1.413  12.708 15.222  1.00 28.01 ? 238 PHE A CD1   1 
ATOM   2651 C  CD2   . PHE B 2 238 ? -3.676  11.917 15.075  1.00 27.30 ? 238 PHE A CD2   1 
ATOM   2652 C  CE1   . PHE B 2 238 ? -0.986  11.425 15.621  1.00 26.84 ? 238 PHE A CE1   1 
ATOM   2653 C  CE2   . PHE B 2 238 ? -3.269  10.648 15.468  1.00 26.02 ? 238 PHE A CE2   1 
ATOM   2654 C  CZ    . PHE B 2 238 ? -1.918  10.398 15.743  1.00 26.64 ? 238 PHE A CZ    1 
ATOM   2655 N  N     . VAL B 2 239 ? -3.949  13.662 11.794  1.00 32.18 ? 239 VAL A N     1 
ATOM   2656 C  CA    . VAL B 2 239 ? -4.253  12.775 10.684  1.00 33.74 ? 239 VAL A CA    1 
ATOM   2657 C  C     . VAL B 2 239 ? -3.253  13.000 9.543   1.00 34.91 ? 239 VAL A C     1 
ATOM   2658 O  O     . VAL B 2 239 ? -2.747  12.047 8.939   1.00 35.30 ? 239 VAL A O     1 
ATOM   2659 C  CB    . VAL B 2 239 ? -5.710  13.007 10.179  1.00 33.17 ? 239 VAL A CB    1 
ATOM   2660 C  CG1   . VAL B 2 239 ? -5.871  12.490 8.761   1.00 31.12 ? 239 VAL A CG1   1 
ATOM   2661 C  CG2   . VAL B 2 239 ? -6.701  12.290 11.110  1.00 31.93 ? 239 VAL A CG2   1 
ATOM   2662 N  N     . HIS B 2 240 ? -2.942  14.264 9.286   1.00 35.55 ? 240 HIS A N     1 
ATOM   2663 C  CA    . HIS B 2 240 ? -2.015  14.623 8.218   1.00 36.36 ? 240 HIS A CA    1 
ATOM   2664 C  C     . HIS B 2 240 ? -0.565  14.258 8.538   1.00 36.24 ? 240 HIS A C     1 
ATOM   2665 O  O     . HIS B 2 240 ? 0.167   13.745 7.690   1.00 35.33 ? 240 HIS A O     1 
ATOM   2666 C  CB    . HIS B 2 240 ? -2.127  16.122 7.925   1.00 36.39 ? 240 HIS A CB    1 
ATOM   2667 C  CG    . HIS B 2 240 ? -1.441  16.545 6.663   1.00 36.97 ? 240 HIS A CG    1 
ATOM   2668 N  ND1   . HIS B 2 240 ? -0.103  16.868 6.613   1.00 37.27 ? 240 HIS A ND1   1 
ATOM   2669 C  CD2   . HIS B 2 240 ? -1.909  16.698 5.403   1.00 36.30 ? 240 HIS A CD2   1 
ATOM   2670 C  CE1   . HIS B 2 240 ? 0.223   17.208 5.380   1.00 35.61 ? 240 HIS A CE1   1 
ATOM   2671 N  NE2   . HIS B 2 240 ? -0.855  17.114 4.627   1.00 36.35 ? 240 HIS A NE2   1 
ATOM   2672 N  N     . LEU B 2 241 ? -0.148  14.527 9.765   1.00 35.95 ? 241 LEU A N     1 
ATOM   2673 C  CA    . LEU B 2 241 ? 1.206   14.208 10.146  1.00 36.30 ? 241 LEU A CA    1 
ATOM   2674 C  C     . LEU B 2 241 ? 1.430   12.721 9.973   1.00 36.42 ? 241 LEU A C     1 
ATOM   2675 O  O     . LEU B 2 241 ? 2.533   12.272 9.658   1.00 36.74 ? 241 LEU A O     1 
ATOM   2676 C  CB    . LEU B 2 241 ? 1.456   14.609 11.598  1.00 36.86 ? 241 LEU A CB    1 
ATOM   2677 C  CG    . LEU B 2 241 ? 1.485   16.113 11.883  1.00 36.74 ? 241 LEU A CG    1 
ATOM   2678 C  CD1   . LEU B 2 241 ? 1.884   16.323 13.339  1.00 36.26 ? 241 LEU A CD1   1 
ATOM   2679 C  CD2   . LEU B 2 241 ? 2.461   16.816 10.932  1.00 35.09 ? 241 LEU A CD2   1 
ATOM   2680 N  N     . CYS B 2 242 ? 0.366   11.952 10.173  1.00 36.30 ? 242 CYS A N     1 
ATOM   2681 C  CA    . CYS B 2 242 ? 0.458   10.515 10.047  1.00 35.14 ? 242 CYS A CA    1 
ATOM   2682 C  C     . CYS B 2 242 ? 0.658   10.099 8.608   1.00 35.09 ? 242 CYS A C     1 
ATOM   2683 O  O     . CYS B 2 242 ? 1.578   9.341  8.297   1.00 34.60 ? 242 CYS A O     1 
ATOM   2684 C  CB    . CYS B 2 242 ? -0.773  9.875  10.649  1.00 34.10 ? 242 CYS A CB    1 
ATOM   2685 S  SG    . CYS B 2 242 ? -0.676  9.955  12.435  1.00 35.88 ? 242 CYS A SG    1 
ATOM   2686 N  N     . ARG B 2 243 ? -0.183  10.598 7.716   1.00 35.11 ? 243 ARG A N     1 
ATOM   2687 C  CA    . ARG B 2 243 ? -0.002  10.249 6.325   1.00 35.22 ? 243 ARG A CA    1 
ATOM   2688 C  C     . ARG B 2 243 ? 1.437   10.579 5.986   1.00 36.10 ? 243 ARG A C     1 
ATOM   2689 O  O     . ARG B 2 243 ? 2.183   9.707  5.555   1.00 37.29 ? 243 ARG A O     1 
ATOM   2690 C  CB    . ARG B 2 243 ? -0.966  11.037 5.445   1.00 33.80 ? 243 ARG A CB    1 
ATOM   2691 C  CG    . ARG B 2 243 ? -2.426  10.701 5.730   1.00 33.70 ? 243 ARG A CG    1 
ATOM   2692 C  CD    . ARG B 2 243 ? -3.384  11.610 4.981   1.00 33.24 ? 243 ARG A CD    1 
ATOM   2693 N  NE    . ARG B 2 243 ? -4.776  11.396 5.374   1.00 33.06 ? 243 ARG A NE    1 
ATOM   2694 C  CZ    . ARG B 2 243 ? -5.792  12.113 4.906   1.00 32.50 ? 243 ARG A CZ    1 
ATOM   2695 N  NH1   . ARG B 2 243 ? -5.562  13.078 4.031   1.00 31.57 ? 243 ARG A NH1   1 
ATOM   2696 N  NH2   . ARG B 2 243 ? -7.031  11.882 5.323   1.00 31.09 ? 243 ARG A NH2   1 
ATOM   2697 N  N     . GLU B 2 244 ? 1.837   11.823 6.232   1.00 37.42 ? 244 GLU A N     1 
ATOM   2698 C  CA    . GLU B 2 244 ? 3.190   12.283 5.934   1.00 39.09 ? 244 GLU A CA    1 
ATOM   2699 C  C     . GLU B 2 244 ? 4.304   11.437 6.505   1.00 40.20 ? 244 GLU A C     1 
ATOM   2700 O  O     . GLU B 2 244 ? 5.255   11.083 5.806   1.00 40.53 ? 244 GLU A O     1 
ATOM   2701 C  CB    . GLU B 2 244 ? 3.391   13.698 6.426   1.00 40.33 ? 244 GLU A CB    1 
ATOM   2702 C  CG    . GLU B 2 244 ? 2.564   14.716 5.702   1.00 43.49 ? 244 GLU A CG    1 
ATOM   2703 C  CD    . GLU B 2 244 ? 3.227   16.068 5.720   1.00 45.90 ? 244 GLU A CD    1 
ATOM   2704 O  OE1   . GLU B 2 244 ? 3.679   16.496 6.811   1.00 46.88 ? 244 GLU A OE1   1 
ATOM   2705 O  OE2   . GLU B 2 244 ? 3.300   16.699 4.642   1.00 46.94 ? 244 GLU A OE2   1 
ATOM   2706 N  N     . PHE B 2 245 ? 4.211   11.129 7.787   1.00 41.47 ? 245 PHE A N     1 
ATOM   2707 C  CA    . PHE B 2 245 ? 5.250   10.322 8.395   1.00 43.09 ? 245 PHE A CA    1 
ATOM   2708 C  C     . PHE B 2 245 ? 5.414   9.007  7.650   1.00 43.95 ? 245 PHE A C     1 
ATOM   2709 O  O     . PHE B 2 245 ? 6.528   8.594  7.338   1.00 43.67 ? 245 PHE A O     1 
ATOM   2710 C  CB    . PHE B 2 245 ? 4.928   10.024 9.853   1.00 43.13 ? 245 PHE A CB    1 
ATOM   2711 C  CG    . PHE B 2 245 ? 5.933   9.132  10.505  1.00 43.16 ? 245 PHE A CG    1 
ATOM   2712 C  CD1   . PHE B 2 245 ? 7.256   9.550  10.653  1.00 43.46 ? 245 PHE A CD1   1 
ATOM   2713 C  CD2   . PHE B 2 245 ? 5.574   7.862  10.941  1.00 42.61 ? 245 PHE A CD2   1 
ATOM   2714 C  CE1   . PHE B 2 245 ? 8.211   8.712  11.228  1.00 43.79 ? 245 PHE A CE1   1 
ATOM   2715 C  CE2   . PHE B 2 245 ? 6.520   7.006  11.521  1.00 42.66 ? 245 PHE A CE2   1 
ATOM   2716 C  CZ    . PHE B 2 245 ? 7.839   7.432  11.664  1.00 43.75 ? 245 PHE A CZ    1 
ATOM   2717 N  N     . MET B 2 246 ? 4.293   8.350  7.379   1.00 45.67 ? 246 MET A N     1 
ATOM   2718 C  CA    . MET B 2 246 ? 4.303   7.074  6.676   1.00 47.85 ? 246 MET A CA    1 
ATOM   2719 C  C     . MET B 2 246 ? 4.942   7.166  5.302   1.00 48.99 ? 246 MET A C     1 
ATOM   2720 O  O     . MET B 2 246 ? 5.748   6.309  4.937   1.00 49.17 ? 246 MET A O     1 
ATOM   2721 C  CB    . MET B 2 246 ? 2.882   6.530  6.546   1.00 48.70 ? 246 MET A CB    1 
ATOM   2722 C  CG    . MET B 2 246 ? 2.333   5.948  7.843   1.00 50.22 ? 246 MET A CG    1 
ATOM   2723 S  SD    . MET B 2 246 ? 3.216   4.447  8.346   1.00 50.31 ? 246 MET A SD    1 
ATOM   2724 C  CE    . MET B 2 246 ? 4.454   5.109  9.443   1.00 50.63 ? 246 MET A CE    1 
ATOM   2725 N  N     . GLU B 2 247 ? 4.603   8.201  4.538   1.00 49.97 ? 247 GLU A N     1 
ATOM   2726 C  CA    . GLU B 2 247 ? 5.174   8.324  3.208   1.00 51.02 ? 247 GLU A CA    1 
ATOM   2727 C  C     . GLU B 2 247 ? 6.672   8.564  3.291   1.00 50.52 ? 247 GLU A C     1 
ATOM   2728 O  O     . GLU B 2 247 ? 7.422   8.190  2.400   1.00 51.39 ? 247 GLU A O     1 
ATOM   2729 C  CB    . GLU B 2 247 ? 4.488   9.439  2.408   1.00 52.57 ? 247 GLU A CB    1 
ATOM   2730 C  CG    . GLU B 2 247 ? 4.782   9.348  0.898   1.00 57.18 ? 247 GLU A CG    1 
ATOM   2731 C  CD    . GLU B 2 247 ? 3.817   10.156 0.020   1.00 59.98 ? 247 GLU A CD    1 
ATOM   2732 O  OE1   . GLU B 2 247 ? 4.025   10.194 -1.223  1.00 59.71 ? 247 GLU A OE1   1 
ATOM   2733 O  OE2   . GLU B 2 247 ? 2.853   10.743 0.574   1.00 61.33 ? 247 GLU A OE2   1 
ATOM   2734 N  N     . ALA B 2 248 ? 7.120   9.171  4.376   1.00 50.45 ? 248 ALA A N     1 
ATOM   2735 C  CA    . ALA B 2 248 ? 8.542   9.427  4.534   1.00 50.06 ? 248 ALA A CA    1 
ATOM   2736 C  C     . ALA B 2 248 ? 8.919   9.417  6.003   1.00 50.35 ? 248 ALA A C     1 
ATOM   2737 O  O     . ALA B 2 248 ? 8.919   10.456 6.649   1.00 50.93 ? 248 ALA A O     1 
ATOM   2738 C  CB    . ALA B 2 248 ? 8.899   10.763 3.917   1.00 49.21 ? 248 ALA A CB    1 
ATOM   2739 N  N     . PRO B 2 249 ? 9.251   8.240  6.553   1.00 50.88 ? 249 PRO A N     1 
ATOM   2740 C  CA    . PRO B 2 249 ? 9.620   8.188  7.973   1.00 51.66 ? 249 PRO A CA    1 
ATOM   2741 C  C     . PRO B 2 249 ? 10.751  9.174  8.263   1.00 52.27 ? 249 PRO A C     1 
ATOM   2742 O  O     . PRO B 2 249 ? 11.543  9.495  7.380   1.00 52.68 ? 249 PRO A O     1 
ATOM   2743 C  CB    . PRO B 2 249 ? 10.073  6.738  8.168   1.00 51.44 ? 249 PRO A CB    1 
ATOM   2744 C  CG    . PRO B 2 249 ? 9.341   5.986  7.075   1.00 51.89 ? 249 PRO A CG    1 
ATOM   2745 C  CD    . PRO B 2 249 ? 9.429   6.929  5.906   1.00 50.87 ? 249 PRO A CD    1 
ATOM   2746 N  N     . SER B 2 250 ? 10.824  9.664  9.494   1.00 52.83 ? 250 SER A N     1 
ATOM   2747 C  CA    . SER B 2 250 ? 11.895  10.581 9.848   1.00 53.04 ? 250 SER A CA    1 
ATOM   2748 C  C     . SER B 2 250 ? 11.953  10.725 11.366  1.00 53.69 ? 250 SER A C     1 
ATOM   2749 O  O     . SER B 2 250 ? 10.934  10.756 12.054  1.00 54.00 ? 250 SER A O     1 
ATOM   2750 C  CB    . SER B 2 250 ? 11.784  11.868 9.036   1.00 52.08 ? 250 SER A CB    1 
ATOM   2751 O  OG    . SER B 2 250 ? 12.877  12.723 9.331   1.00 52.06 ? 250 SER A OG    1 
ATOM   2752 N  N     . LEU B 2 251 ? 13.166  10.817 11.884  1.00 54.28 ? 251 LEU A N     1 
ATOM   2753 C  CA    . LEU B 2 251 ? 13.374  11.131 13.284  1.00 55.00 ? 251 LEU A CA    1 
ATOM   2754 C  C     . LEU B 2 251 ? 12.800  12.525 13.574  1.00 55.38 ? 251 LEU A C     1 
ATOM   2755 O  O     . LEU B 2 251 ? 12.334  12.798 14.680  1.00 55.46 ? 251 LEU A O     1 
ATOM   2756 C  CB    . LEU B 2 251 ? 14.874  11.104 13.587  1.00 53.83 ? 251 LEU A CB    1 
ATOM   2757 C  CG    . LEU B 2 251 ? 15.312  11.024 15.044  1.00 52.38 ? 251 LEU A CG    1 
ATOM   2758 C  CD1   . LEU B 2 251 ? 14.860  9.713  15.667  1.00 51.46 ? 251 LEU A CD1   1 
ATOM   2759 C  CD2   . LEU B 2 251 ? 16.812  11.135 15.085  1.00 52.37 ? 251 LEU A CD2   1 
ATOM   2760 N  N     . GLY B 2 252 ? 12.835  13.390 12.561  1.00 55.68 ? 252 GLY A N     1 
ATOM   2761 C  CA    . GLY B 2 252 ? 12.341  14.752 12.685  1.00 56.20 ? 252 GLY A CA    1 
ATOM   2762 C  C     . GLY B 2 252 ? 11.002  14.947 13.377  1.00 56.95 ? 252 GLY A C     1 
ATOM   2763 O  O     . GLY B 2 252 ? 10.846  15.879 14.165  1.00 57.40 ? 252 GLY A O     1 
ATOM   2764 N  N     . PHE B 2 253 ? 10.029  14.087 13.089  1.00 57.23 ? 253 PHE A N     1 
ATOM   2765 C  CA    . PHE B 2 253 ? 8.708   14.203 13.708  1.00 57.17 ? 253 PHE A CA    1 
ATOM   2766 C  C     . PHE B 2 253 ? 8.788   13.980 15.216  1.00 57.73 ? 253 PHE A C     1 
ATOM   2767 O  O     . PHE B 2 253 ? 7.787   14.096 15.919  1.00 58.21 ? 253 PHE A O     1 
ATOM   2768 C  CB    . PHE B 2 253 ? 7.727   13.179 13.115  1.00 56.50 ? 253 PHE A CB    1 
ATOM   2769 C  CG    . PHE B 2 253 ? 7.472   13.339 11.632  1.00 56.09 ? 253 PHE A CG    1 
ATOM   2770 C  CD1   . PHE B 2 253 ? 8.499   13.150 10.704  1.00 55.42 ? 253 PHE A CD1   1 
ATOM   2771 C  CD2   . PHE B 2 253 ? 6.195   13.622 11.160  1.00 55.26 ? 253 PHE A CD2   1 
ATOM   2772 C  CE1   . PHE B 2 253 ? 8.257   13.235 9.338   1.00 53.64 ? 253 PHE A CE1   1 
ATOM   2773 C  CE2   . PHE B 2 253 ? 5.950   13.708 9.792   1.00 54.67 ? 253 PHE A CE2   1 
ATOM   2774 C  CZ    . PHE B 2 253 ? 6.987   13.511 8.883   1.00 53.34 ? 253 PHE A CZ    1 
ATOM   2775 N  N     . PHE B 2 254 ? 9.974   13.646 15.714  1.00 58.50 ? 254 PHE A N     1 
ATOM   2776 C  CA    . PHE B 2 254 ? 10.144  13.405 17.139  1.00 59.48 ? 254 PHE A CA    1 
ATOM   2777 C  C     . PHE B 2 254 ? 11.011  14.469 17.800  1.00 60.56 ? 254 PHE A C     1 
ATOM   2778 O  O     . PHE B 2 254 ? 11.338  14.370 18.983  1.00 60.56 ? 254 PHE A O     1 
ATOM   2779 C  CB    . PHE B 2 254 ? 10.728  12.005 17.374  1.00 59.05 ? 254 PHE A CB    1 
ATOM   2780 C  CG    . PHE B 2 254 ? 9.785   10.892 17.000  1.00 58.97 ? 254 PHE A CG    1 
ATOM   2781 C  CD1   . PHE B 2 254 ? 9.721   10.418 15.693  1.00 58.99 ? 254 PHE A CD1   1 
ATOM   2782 C  CD2   . PHE B 2 254 ? 8.913   10.354 17.947  1.00 58.43 ? 254 PHE A CD2   1 
ATOM   2783 C  CE1   . PHE B 2 254 ? 8.796   9.423  15.333  1.00 58.25 ? 254 PHE A CE1   1 
ATOM   2784 C  CE2   . PHE B 2 254 ? 7.989   9.366  17.600  1.00 57.55 ? 254 PHE A CE2   1 
ATOM   2785 C  CZ    . PHE B 2 254 ? 7.932   8.900  16.291  1.00 57.83 ? 254 PHE A CZ    1 
ATOM   2786 N  N     . LYS B 2 255 ? 11.369  15.491 17.028  1.00 61.79 ? 255 LYS A N     1 
ATOM   2787 C  CA    . LYS B 2 255 ? 12.183  16.598 17.522  1.00 63.00 ? 255 LYS A CA    1 
ATOM   2788 C  C     . LYS B 2 255 ? 11.396  17.899 17.378  1.00 64.40 ? 255 LYS A C     1 
ATOM   2789 O  O     . LYS B 2 255 ? 10.890  18.212 16.297  1.00 63.96 ? 255 LYS A O     1 
ATOM   2790 C  CB    . LYS B 2 255 ? 13.475  16.726 16.711  1.00 62.73 ? 255 LYS A CB    1 
ATOM   2791 C  CG    . LYS B 2 255 ? 14.417  15.529 16.738  1.00 62.37 ? 255 LYS A CG    1 
ATOM   2792 C  CD    . LYS B 2 255 ? 15.559  15.751 15.735  1.00 62.47 ? 255 LYS A CD    1 
ATOM   2793 C  CE    . LYS B 2 255 ? 16.517  14.568 15.636  1.00 62.17 ? 255 LYS A CE    1 
ATOM   2794 N  NZ    . LYS B 2 255 ? 17.398  14.673 14.427  1.00 61.61 ? 255 LYS A NZ    1 
ATOM   2795 N  N     . PRO B 2 256 ? 11.286  18.680 18.463  1.00 66.39 ? 256 PRO A N     1 
ATOM   2796 C  CA    . PRO B 2 256 ? 10.545  19.941 18.388  1.00 68.06 ? 256 PRO A CA    1 
ATOM   2797 C  C     . PRO B 2 256 ? 11.236  20.855 17.398  1.00 70.04 ? 256 PRO A C     1 
ATOM   2798 O  O     . PRO B 2 256 ? 12.466  20.929 17.360  1.00 70.23 ? 256 PRO A O     1 
ATOM   2799 C  CB    . PRO B 2 256 ? 10.635  20.483 19.808  1.00 67.63 ? 256 PRO A CB    1 
ATOM   2800 C  CG    . PRO B 2 256 ? 10.792  19.255 20.642  1.00 67.34 ? 256 PRO A CG    1 
ATOM   2801 C  CD    . PRO B 2 256 ? 11.775  18.450 19.830  1.00 67.10 ? 256 PRO A CD    1 
ATOM   2802 N  N     . LYS B 2 257 ? 10.446  21.547 16.594  1.00 72.46 ? 257 LYS A N     1 
ATOM   2803 C  CA    . LYS B 2 257 ? 11.003  22.454 15.604  1.00 75.31 ? 257 LYS A CA    1 
ATOM   2804 C  C     . LYS B 2 257 ? 11.484  23.710 16.329  1.00 77.18 ? 257 LYS A C     1 
ATOM   2805 O  O     . LYS B 2 257 ? 10.904  24.114 17.340  1.00 77.54 ? 257 LYS A O     1 
ATOM   2806 C  CB    . LYS B 2 257 ? 9.930   22.805 14.570  1.00 75.40 ? 257 LYS A CB    1 
ATOM   2807 C  CG    . LYS B 2 257 ? 8.871   21.704 14.388  1.00 76.41 ? 257 LYS A CG    1 
ATOM   2808 C  CD    . LYS B 2 257 ? 9.483   20.340 14.019  1.00 75.88 ? 257 LYS A CD    1 
ATOM   2809 C  CE    . LYS B 2 257 ? 8.453   19.220 14.140  1.00 75.06 ? 257 LYS A CE    1 
ATOM   2810 N  NZ    . LYS B 2 257 ? 8.981   17.890 13.727  1.00 74.42 ? 257 LYS A NZ    1 
ATOM   2811 N  N     . HIS B 2 258 ? 12.554  24.319 15.838  1.00 79.13 ? 258 HIS A N     1 
ATOM   2812 C  CA    . HIS B 2 258 ? 13.051  25.524 16.483  1.00 81.04 ? 258 HIS A CA    1 
ATOM   2813 C  C     . HIS B 2 258 ? 12.189  26.722 16.085  1.00 81.58 ? 258 HIS A C     1 
ATOM   2814 O  O     . HIS B 2 258 ? 11.725  26.814 14.946  1.00 81.23 ? 258 HIS A O     1 
ATOM   2815 C  CB    . HIS B 2 258 ? 14.522  25.759 16.127  1.00 82.05 ? 258 HIS A CB    1 
ATOM   2816 C  CG    . HIS B 2 258 ? 15.467  24.858 16.866  1.00 83.46 ? 258 HIS A CG    1 
ATOM   2817 N  ND1   . HIS B 2 258 ? 16.831  25.060 16.883  1.00 84.31 ? 258 HIS A ND1   1 
ATOM   2818 C  CD2   . HIS B 2 258 ? 15.241  23.760 17.626  1.00 83.79 ? 258 HIS A CD2   1 
ATOM   2819 C  CE1   . HIS B 2 258 ? 17.404  24.127 17.624  1.00 84.02 ? 258 HIS A CE1   1 
ATOM   2820 N  NE2   . HIS B 2 258 ? 16.461  23.325 18.086  1.00 84.14 ? 258 HIS A NE2   1 
ATOM   2821 N  N     . PRO B 2 259 ? 11.957  27.650 17.034  1.00 82.00 ? 259 PRO A N     1 
ATOM   2822 C  CA    . PRO B 2 259 ? 11.152  28.866 16.860  1.00 82.21 ? 259 PRO A CA    1 
ATOM   2823 C  C     . PRO B 2 259 ? 11.437  29.790 15.671  1.00 82.40 ? 259 PRO A C     1 
ATOM   2824 O  O     . PRO B 2 259 ? 10.729  30.781 15.482  1.00 82.65 ? 259 PRO A O     1 
ATOM   2825 C  CB    . PRO B 2 259 ? 11.501  29.679 18.102  1.00 81.98 ? 259 PRO A CB    1 
ATOM   2826 C  CG    . PRO B 2 259 ? 11.650  28.614 19.143  1.00 81.74 ? 259 PRO A CG    1 
ATOM   2827 C  CD    . PRO B 2 259 ? 12.476  27.569 18.414  1.00 82.13 ? 259 PRO A CD    1 
ATOM   2828 N  N     . LEU B 2 260 ? 12.449  29.475 14.865  1.00 82.18 ? 260 LEU A N     1 
ATOM   2829 C  CA    . LEU B 2 260 ? 12.690  30.221 13.626  1.00 82.46 ? 260 LEU A CA    1 
ATOM   2830 C  C     . LEU B 2 260 ? 12.851  31.748 13.625  1.00 82.48 ? 260 LEU A C     1 
ATOM   2831 O  O     . LEU B 2 260 ? 12.188  32.462 12.862  1.00 82.59 ? 260 LEU A O     1 
ATOM   2832 C  CB    . LEU B 2 260 ? 11.641  29.861 12.561  1.00 82.23 ? 260 LEU A CB    1 
ATOM   2833 C  CG    . LEU B 2 260 ? 11.500  30.827 11.371  1.00 82.72 ? 260 LEU A CG    1 
ATOM   2834 C  CD1   . LEU B 2 260 ? 12.874  31.103 10.754  1.00 83.01 ? 260 LEU A CD1   1 
ATOM   2835 C  CD2   . LEU B 2 260 ? 10.528  30.258 10.339  1.00 81.86 ? 260 LEU A CD2   1 
ATOM   2836 N  N     . GLU B 2 261 ? 13.738  32.244 14.485  1.00 82.24 ? 261 GLU A N     1 
ATOM   2837 C  CA    . GLU B 2 261 ? 13.817  33.664 14.788  1.00 81.34 ? 261 GLU A CA    1 
ATOM   2838 C  C     . GLU B 2 261 ? 14.054  34.435 13.504  1.00 79.91 ? 261 GLU A C     1 
ATOM   2839 O  O     . GLU B 2 261 ? 15.049  34.220 12.809  1.00 79.35 ? 261 GLU A O     1 
ATOM   2840 C  CB    . GLU B 2 261 ? 14.936  33.945 15.797  1.00 82.69 ? 261 GLU A CB    1 
ATOM   2841 C  CG    . GLU B 2 261 ? 14.498  34.877 16.933  1.00 84.83 ? 261 GLU A CG    1 
ATOM   2842 C  CD    . GLU B 2 261 ? 13.433  34.259 17.854  1.00 85.50 ? 261 GLU A CD    1 
ATOM   2843 O  OE1   . GLU B 2 261 ? 13.785  33.383 18.678  1.00 85.81 ? 261 GLU A OE1   1 
ATOM   2844 O  OE2   . GLU B 2 261 ? 12.245  34.647 17.753  1.00 85.18 ? 261 GLU A OE2   1 
ATOM   2845 N  N     . ILE B 2 262 ? 13.114  35.323 13.195  1.00 78.54 ? 262 ILE A N     1 
ATOM   2846 C  CA    . ILE B 2 262 ? 13.164  36.147 11.992  1.00 76.57 ? 262 ILE A CA    1 
ATOM   2847 C  C     . ILE B 2 262 ? 13.412  37.604 12.398  1.00 75.29 ? 262 ILE A C     1 
ATOM   2848 O  O     . ILE B 2 262 ? 12.933  38.055 13.444  1.00 75.03 ? 262 ILE A O     1 
ATOM   2849 C  CB    . ILE B 2 262 ? 11.824  36.045 11.219  1.00 76.46 ? 262 ILE A CB    1 
ATOM   2850 C  CG1   . ILE B 2 262 ? 11.998  36.528 9.778   1.00 76.01 ? 262 ILE A CG1   1 
ATOM   2851 C  CG2   . ILE B 2 262 ? 10.741  36.861 11.937  1.00 75.70 ? 262 ILE A CG2   1 
ATOM   2852 C  CD1   . ILE B 2 262 ? 10.713  36.495 8.975   1.00 75.26 ? 262 ILE A CD1   1 
ATOM   2853 N  N     . GLU B 2 263 ? 14.162  38.336 11.579  1.00 73.45 ? 263 GLU A N     1 
ATOM   2854 C  CA    . GLU B 2 263 ? 14.449  39.733 11.885  1.00 72.43 ? 263 GLU A CA    1 
ATOM   2855 C  C     . GLU B 2 263 ? 13.304  40.626 11.434  1.00 70.26 ? 263 GLU A C     1 
ATOM   2856 O  O     . GLU B 2 263 ? 12.761  40.458 10.345  1.00 69.97 ? 263 GLU A O     1 
ATOM   2857 C  CB    . GLU B 2 263 ? 15.769  40.193 11.229  1.00 74.58 ? 263 GLU A CB    1 
ATOM   2858 C  CG    . GLU B 2 263 ? 15.739  40.497 9.713   1.00 75.52 ? 263 GLU A CG    1 
ATOM   2859 C  CD    . GLU B 2 263 ? 15.596  39.250 8.835   1.00 76.95 ? 263 GLU A CD    1 
ATOM   2860 O  OE1   . GLU B 2 263 ? 15.883  39.347 7.617   1.00 77.07 ? 263 GLU A OE1   1 
ATOM   2861 O  OE2   . GLU B 2 263 ? 15.191  38.179 9.351   1.00 76.86 ? 263 GLU A OE2   1 
ATOM   2862 N  N     . PRO B 2 264 ? 12.919  41.591 12.274  1.00 68.56 ? 264 PRO A N     1 
ATOM   2863 C  CA    . PRO B 2 264 ? 11.827  42.504 11.938  1.00 67.73 ? 264 PRO A CA    1 
ATOM   2864 C  C     . PRO B 2 264 ? 11.820  43.114 10.525  1.00 66.67 ? 264 PRO A C     1 
ATOM   2865 O  O     . PRO B 2 264 ? 10.746  43.403 9.994   1.00 66.49 ? 264 PRO A O     1 
ATOM   2866 C  CB    . PRO B 2 264 ? 11.901  43.562 13.051  1.00 67.71 ? 264 PRO A CB    1 
ATOM   2867 C  CG    . PRO B 2 264 ? 13.295  43.419 13.603  1.00 67.26 ? 264 PRO A CG    1 
ATOM   2868 C  CD    . PRO B 2 264 ? 13.500  41.940 13.577  1.00 67.57 ? 264 PRO A CD    1 
ATOM   2869 N  N     . GLU B 2 265 ? 12.983  43.305 9.903   1.00 64.97 ? 265 GLU A N     1 
ATOM   2870 C  CA    . GLU B 2 265 ? 12.978  43.887 8.564   1.00 63.39 ? 265 GLU A CA    1 
ATOM   2871 C  C     . GLU B 2 265 ? 12.410  42.913 7.540   1.00 62.37 ? 265 GLU A C     1 
ATOM   2872 O  O     . GLU B 2 265 ? 11.655  43.316 6.656   1.00 61.75 ? 265 GLU A O     1 
ATOM   2873 C  CB    . GLU B 2 265 ? 14.382  44.322 8.133   1.00 63.93 ? 265 GLU A CB    1 
ATOM   2874 C  CG    . GLU B 2 265 ? 14.391  45.279 6.925   1.00 64.46 ? 265 GLU A CG    1 
ATOM   2875 C  CD    . GLU B 2 265 ? 13.698  46.626 7.210   1.00 65.68 ? 265 GLU A CD    1 
ATOM   2876 O  OE1   . GLU B 2 265 ? 12.460  46.655 7.370   1.00 65.81 ? 265 GLU A OE1   1 
ATOM   2877 O  OE2   . GLU B 2 265 ? 14.394  47.665 7.283   1.00 66.02 ? 265 GLU A OE2   1 
ATOM   2878 N  N     . ARG B 2 266 ? 12.765  41.634 7.659   1.00 61.44 ? 266 ARG A N     1 
ATOM   2879 C  CA    . ARG B 2 266 ? 12.260  40.627 6.725   1.00 60.77 ? 266 ARG A CA    1 
ATOM   2880 C  C     . ARG B 2 266 ? 10.747  40.518 6.867   1.00 59.24 ? 266 ARG A C     1 
ATOM   2881 O  O     . ARG B 2 266 ? 10.026  40.347 5.877   1.00 59.13 ? 266 ARG A O     1 
ATOM   2882 C  CB    . ARG B 2 266 ? 12.881  39.252 6.979   1.00 62.18 ? 266 ARG A CB    1 
ATOM   2883 C  CG    . ARG B 2 266 ? 12.461  38.222 5.928   1.00 64.32 ? 266 ARG A CG    1 
ATOM   2884 C  CD    . ARG B 2 266 ? 12.726  36.789 6.374   1.00 67.18 ? 266 ARG A CD    1 
ATOM   2885 N  NE    . ARG B 2 266 ? 12.017  35.806 5.548   1.00 68.82 ? 266 ARG A NE    1 
ATOM   2886 C  CZ    . ARG B 2 266 ? 11.790  34.543 5.912   1.00 69.43 ? 266 ARG A CZ    1 
ATOM   2887 N  NH1   . ARG B 2 266 ? 12.220  34.104 7.097   1.00 69.57 ? 266 ARG A NH1   1 
ATOM   2888 N  NH2   . ARG B 2 266 ? 11.128  33.720 5.101   1.00 68.29 ? 266 ARG A NH2   1 
ATOM   2889 N  N     . LEU B 2 267 ? 10.267  40.606 8.101   1.00 56.80 ? 267 LEU A N     1 
ATOM   2890 C  CA    . LEU B 2 267 ? 8.835   40.548 8.335   1.00 54.72 ? 267 LEU A CA    1 
ATOM   2891 C  C     . LEU B 2 267 ? 8.200   41.775 7.663   1.00 53.99 ? 267 LEU A C     1 
ATOM   2892 O  O     . LEU B 2 267 ? 7.236   41.645 6.906   1.00 54.14 ? 267 LEU A O     1 
ATOM   2893 C  CB    . LEU B 2 267 ? 8.537   40.553 9.838   1.00 53.08 ? 267 LEU A CB    1 
ATOM   2894 C  CG    . LEU B 2 267 ? 7.108   40.193 10.246  1.00 50.86 ? 267 LEU A CG    1 
ATOM   2895 C  CD1   . LEU B 2 267 ? 6.892   38.724 10.007  1.00 50.51 ? 267 LEU A CD1   1 
ATOM   2896 C  CD2   . LEU B 2 267 ? 6.872   40.513 11.703  1.00 50.75 ? 267 LEU A CD2   1 
ATOM   2897 N  N     . ARG B 2 268 ? 8.757   42.956 7.920   1.00 53.01 ? 268 ARG A N     1 
ATOM   2898 C  CA    . ARG B 2 268 ? 8.230   44.185 7.336   1.00 52.47 ? 268 ARG A CA    1 
ATOM   2899 C  C     . ARG B 2 268 ? 8.153   44.076 5.816   1.00 51.42 ? 268 ARG A C     1 
ATOM   2900 O  O     . ARG B 2 268 ? 7.195   44.541 5.206   1.00 51.41 ? 268 ARG A O     1 
ATOM   2901 C  CB    . ARG B 2 268 ? 9.100   45.390 7.718   1.00 53.86 ? 268 ARG A CB    1 
ATOM   2902 C  CG    . ARG B 2 268 ? 8.387   46.741 7.555   1.00 56.47 ? 268 ARG A CG    1 
ATOM   2903 C  CD    . ARG B 2 268 ? 9.339   47.938 7.703   1.00 59.04 ? 268 ARG A CD    1 
ATOM   2904 N  NE    . ARG B 2 268 ? 10.396  47.947 6.685   1.00 61.08 ? 268 ARG A NE    1 
ATOM   2905 C  CZ    . ARG B 2 268 ? 10.205  48.121 5.376   1.00 61.07 ? 268 ARG A CZ    1 
ATOM   2906 N  NH1   . ARG B 2 268 ? 8.984   48.315 4.876   1.00 60.38 ? 268 ARG A NH1   1 
ATOM   2907 N  NH2   . ARG B 2 268 ? 11.246  48.076 4.555   1.00 61.43 ? 268 ARG A NH2   1 
ATOM   2908 N  N     . LYS B 2 269 ? 9.163   43.466 5.209   1.00 50.26 ? 269 LYS A N     1 
ATOM   2909 C  CA    . LYS B 2 269 ? 9.183   43.305 3.762   1.00 49.86 ? 269 LYS A CA    1 
ATOM   2910 C  C     . LYS B 2 269 ? 8.135   42.318 3.270   1.00 48.06 ? 269 LYS A C     1 
ATOM   2911 O  O     . LYS B 2 269 ? 7.680   42.406 2.126   1.00 47.80 ? 269 LYS A O     1 
ATOM   2912 C  CB    . LYS B 2 269 ? 10.558  42.842 3.281   1.00 52.02 ? 269 LYS A CB    1 
ATOM   2913 C  CG    . LYS B 2 269 ? 11.587  43.935 3.237   1.00 55.01 ? 269 LYS A CG    1 
ATOM   2914 C  CD    . LYS B 2 269 ? 12.819  43.486 2.471   1.00 57.49 ? 269 LYS A CD    1 
ATOM   2915 C  CE    . LYS B 2 269 ? 13.937  44.516 2.603   1.00 59.57 ? 269 LYS A CE    1 
ATOM   2916 N  NZ    . LYS B 2 269 ? 14.278  44.788 4.045   1.00 61.56 ? 269 LYS A NZ    1 
ATOM   2917 N  N     . ILE B 2 270 ? 7.773   41.365 4.121   1.00 45.62 ? 270 ILE A N     1 
ATOM   2918 C  CA    . ILE B 2 270 ? 6.764   40.392 3.747   1.00 43.29 ? 270 ILE A CA    1 
ATOM   2919 C  C     . ILE B 2 270 ? 5.393   41.055 3.832   1.00 41.73 ? 270 ILE A C     1 
ATOM   2920 O  O     . ILE B 2 270 ? 4.599   40.982 2.895   1.00 41.82 ? 270 ILE A O     1 
ATOM   2921 C  CB    . ILE B 2 270 ? 6.807   39.159 4.662   1.00 42.78 ? 270 ILE A CB    1 
ATOM   2922 C  CG1   . ILE B 2 270 ? 8.151   38.457 4.495   1.00 42.91 ? 270 ILE A CG1   1 
ATOM   2923 C  CG2   . ILE B 2 270 ? 5.700   38.195 4.292   1.00 43.02 ? 270 ILE A CG2   1 
ATOM   2924 C  CD1   . ILE B 2 270 ? 8.283   37.172 5.265   1.00 41.68 ? 270 ILE A CD1   1 
ATOM   2925 N  N     . VAL B 2 271 ? 5.115   41.715 4.946   1.00 39.87 ? 271 VAL A N     1 
ATOM   2926 C  CA    . VAL B 2 271 ? 3.836   42.385 5.084   1.00 39.46 ? 271 VAL A CA    1 
ATOM   2927 C  C     . VAL B 2 271 ? 3.636   43.370 3.949   1.00 40.12 ? 271 VAL A C     1 
ATOM   2928 O  O     . VAL B 2 271 ? 2.526   43.546 3.465   1.00 41.10 ? 271 VAL A O     1 
ATOM   2929 C  CB    . VAL B 2 271 ? 3.733   43.161 6.399   1.00 38.88 ? 271 VAL A CB    1 
ATOM   2930 C  CG1   . VAL B 2 271 ? 2.515   44.078 6.367   1.00 36.95 ? 271 VAL A CG1   1 
ATOM   2931 C  CG2   . VAL B 2 271 ? 3.641   42.183 7.562   1.00 38.71 ? 271 VAL A CG2   1 
ATOM   2932 N  N     . GLU B 2 272 ? 4.707   44.020 3.519   1.00 40.23 ? 272 GLU A N     1 
ATOM   2933 C  CA    . GLU B 2 272 ? 4.566   44.981 2.449   1.00 40.57 ? 272 GLU A CA    1 
ATOM   2934 C  C     . GLU B 2 272 ? 4.315   44.299 1.125   1.00 39.52 ? 272 GLU A C     1 
ATOM   2935 O  O     . GLU B 2 272 ? 3.573   44.803 0.286   1.00 38.09 ? 272 GLU A O     1 
ATOM   2936 C  CB    . GLU B 2 272 ? 5.795   45.848 2.340   1.00 43.28 ? 272 GLU A CB    1 
ATOM   2937 C  CG    . GLU B 2 272 ? 5.448   47.195 1.793   1.00 48.35 ? 272 GLU A CG    1 
ATOM   2938 C  CD    . GLU B 2 272 ? 6.656   47.958 1.365   1.00 51.74 ? 272 GLU A CD    1 
ATOM   2939 O  OE1   . GLU B 2 272 ? 7.523   48.227 2.239   1.00 53.47 ? 272 GLU A OE1   1 
ATOM   2940 O  OE2   . GLU B 2 272 ? 6.727   48.278 0.153   1.00 53.31 ? 272 GLU A OE2   1 
ATOM   2941 N  N     . GLU B 2 273 ? 4.952   43.155 0.938   1.00 39.86 ? 273 GLU A N     1 
ATOM   2942 C  CA    . GLU B 2 273 ? 4.766   42.378 -0.270  1.00 40.73 ? 273 GLU A CA    1 
ATOM   2943 C  C     . GLU B 2 273 ? 3.339   41.880 -0.273  1.00 39.80 ? 273 GLU A C     1 
ATOM   2944 O  O     . GLU B 2 273 ? 2.763   41.659 -1.328  1.00 41.10 ? 273 GLU A O     1 
ATOM   2945 C  CB    . GLU B 2 273 ? 5.672   41.160 -0.283  1.00 43.91 ? 273 GLU A CB    1 
ATOM   2946 C  CG    . GLU B 2 273 ? 6.984   41.312 -1.003  1.00 49.43 ? 273 GLU A CG    1 
ATOM   2947 C  CD    . GLU B 2 273 ? 7.659   39.958 -1.172  1.00 52.84 ? 273 GLU A CD    1 
ATOM   2948 O  OE1   . GLU B 2 273 ? 6.951   39.016 -1.614  1.00 54.42 ? 273 GLU A OE1   1 
ATOM   2949 O  OE2   . GLU B 2 273 ? 8.874   39.832 -0.865  1.00 53.53 ? 273 GLU A OE2   1 
ATOM   2950 N  N     . ARG B 2 274 ? 2.766   41.674 0.904   1.00 37.39 ? 274 ARG A N     1 
ATOM   2951 C  CA    . ARG B 2 274 ? 1.397   41.190 0.948   1.00 36.51 ? 274 ARG A CA    1 
ATOM   2952 C  C     . ARG B 2 274 ? 0.428   42.341 0.717   1.00 35.20 ? 274 ARG A C     1 
ATOM   2953 O  O     . ARG B 2 274 ? -0.726  42.129 0.336   1.00 36.06 ? 274 ARG A O     1 
ATOM   2954 C  CB    . ARG B 2 274 ? 1.107   40.503 2.288   1.00 37.38 ? 274 ARG A CB    1 
ATOM   2955 C  CG    . ARG B 2 274 ? 2.051   39.327 2.592   1.00 38.45 ? 274 ARG A CG    1 
ATOM   2956 C  CD    . ARG B 2 274 ? 1.685   38.594 3.889   1.00 37.20 ? 274 ARG A CD    1 
ATOM   2957 N  NE    . ARG B 2 274 ? 1.485   37.179 3.607   1.00 37.76 ? 274 ARG A NE    1 
ATOM   2958 C  CZ    . ARG B 2 274 ? 0.469   36.454 4.063   1.00 37.72 ? 274 ARG A CZ    1 
ATOM   2959 N  NH1   . ARG B 2 274 ? -0.454  37.004 4.840   1.00 37.20 ? 274 ARG A NH1   1 
ATOM   2960 N  NH2   . ARG B 2 274 ? 0.360   35.183 3.710   1.00 36.49 ? 274 ARG A NH2   1 
ATOM   2961 N  N     . GLY B 2 275 ? 0.911   43.561 0.922   1.00 33.33 ? 275 GLY A N     1 
ATOM   2962 C  CA    . GLY B 2 275 ? 0.073   44.731 0.742   1.00 30.76 ? 275 GLY A CA    1 
ATOM   2963 C  C     . GLY B 2 275 ? -1.159  44.662 1.615   1.00 29.25 ? 275 GLY A C     1 
ATOM   2964 O  O     . GLY B 2 275 ? -2.173  45.284 1.327   1.00 28.04 ? 275 GLY A O     1 
ATOM   2965 N  N     . THR B 2 276 ? -1.064  43.898 2.694   1.00 29.29 ? 276 THR A N     1 
ATOM   2966 C  CA    . THR B 2 276 ? -2.183  43.733 3.611   1.00 30.15 ? 276 THR A CA    1 
ATOM   2967 C  C     . THR B 2 276 ? -2.122  44.694 4.794   1.00 29.83 ? 276 THR A C     1 
ATOM   2968 O  O     . THR B 2 276 ? -1.157  45.435 4.965   1.00 29.89 ? 276 THR A O     1 
ATOM   2969 C  CB    . THR B 2 276 ? -2.238  42.300 4.180   1.00 29.99 ? 276 THR A CB    1 
ATOM   2970 O  OG1   . THR B 2 276 ? -1.057  42.048 4.953   1.00 29.83 ? 276 THR A OG1   1 
ATOM   2971 C  CG2   . THR B 2 276 ? -2.329  41.289 3.061   1.00 30.36 ? 276 THR A CG2   1 
ATOM   2972 N  N     . ALA B 2 277 ? -3.172  44.674 5.600   1.00 29.01 ? 277 ALA A N     1 
ATOM   2973 C  CA    . ALA B 2 277 ? -3.237  45.499 6.785   1.00 28.74 ? 277 ALA A CA    1 
ATOM   2974 C  C     . ALA B 2 277 ? -3.058  44.556 7.962   1.00 28.51 ? 277 ALA A C     1 
ATOM   2975 O  O     . ALA B 2 277 ? -3.923  43.735 8.242   1.00 28.47 ? 277 ALA A O     1 
ATOM   2976 C  CB    . ALA B 2 277 ? -4.578  46.185 6.873   1.00 29.82 ? 277 ALA A CB    1 
ATOM   2977 N  N     . VAL B 2 278 ? -1.922  44.661 8.633   1.00 29.04 ? 278 VAL A N     1 
ATOM   2978 C  CA    . VAL B 2 278 ? -1.631  43.821 9.787   1.00 29.11 ? 278 VAL A CA    1 
ATOM   2979 C  C     . VAL B 2 278 ? -1.533  44.684 11.040  1.00 29.22 ? 278 VAL A C     1 
ATOM   2980 O  O     . VAL B 2 278 ? -0.726  45.612 11.093  1.00 30.29 ? 278 VAL A O     1 
ATOM   2981 C  CB    . VAL B 2 278 ? -0.282  43.069 9.619   1.00 28.88 ? 278 VAL A CB    1 
ATOM   2982 C  CG1   . VAL B 2 278 ? 0.034   42.309 10.895  1.00 28.52 ? 278 VAL A CG1   1 
ATOM   2983 C  CG2   . VAL B 2 278 ? -0.341  42.120 8.419   1.00 26.99 ? 278 VAL A CG2   1 
ATOM   2984 N  N     . PHE B 2 279 ? -2.348  44.385 12.043  1.00 28.55 ? 279 PHE A N     1 
ATOM   2985 C  CA    . PHE B 2 279 ? -2.300  45.147 13.281  1.00 28.41 ? 279 PHE A CA    1 
ATOM   2986 C  C     . PHE B 2 279 ? -2.574  44.281 14.516  1.00 28.39 ? 279 PHE A C     1 
ATOM   2987 O  O     . PHE B 2 279 ? -2.918  43.106 14.398  1.00 27.90 ? 279 PHE A O     1 
ATOM   2988 C  CB    . PHE B 2 279 ? -3.280  46.306 13.200  1.00 28.36 ? 279 PHE A CB    1 
ATOM   2989 C  CG    . PHE B 2 279 ? -4.700  45.886 12.989  1.00 31.12 ? 279 PHE A CG    1 
ATOM   2990 C  CD1   . PHE B 2 279 ? -5.568  45.752 14.068  1.00 33.27 ? 279 PHE A CD1   1 
ATOM   2991 C  CD2   . PHE B 2 279 ? -5.188  45.661 11.713  1.00 31.61 ? 279 PHE A CD2   1 
ATOM   2992 C  CE1   . PHE B 2 279 ? -6.903  45.408 13.873  1.00 32.17 ? 279 PHE A CE1   1 
ATOM   2993 C  CE2   . PHE B 2 279 ? -6.516  45.316 11.508  1.00 31.66 ? 279 PHE A CE2   1 
ATOM   2994 C  CZ    . PHE B 2 279 ? -7.375  45.191 12.586  1.00 32.40 ? 279 PHE A CZ    1 
ATOM   2995 N  N     . ALA B 2 280 ? -2.402  44.856 15.704  1.00 28.27 ? 280 ALA A N     1 
ATOM   2996 C  CA    . ALA B 2 280 ? -2.634  44.109 16.938  1.00 27.84 ? 280 ALA A CA    1 
ATOM   2997 C  C     . ALA B 2 280 ? -3.316  44.891 18.063  1.00 27.35 ? 280 ALA A C     1 
ATOM   2998 O  O     . ALA B 2 280 ? -3.178  46.110 18.185  1.00 26.43 ? 280 ALA A O     1 
ATOM   2999 C  CB    . ALA B 2 280 ? -1.335  43.530 17.436  1.00 26.23 ? 280 ALA A CB    1 
ATOM   3000 N  N     . VAL B 2 281 ? -4.077  44.160 18.866  1.00 27.53 ? 281 VAL A N     1 
ATOM   3001 C  CA    . VAL B 2 281 ? -4.783  44.731 19.990  1.00 29.11 ? 281 VAL A CA    1 
ATOM   3002 C  C     . VAL B 2 281 ? -4.026  44.290 21.232  1.00 30.83 ? 281 VAL A C     1 
ATOM   3003 O  O     . VAL B 2 281 ? -3.968  43.098 21.532  1.00 31.44 ? 281 VAL A O     1 
ATOM   3004 C  CB    . VAL B 2 281 ? -6.227  44.218 20.045  1.00 29.05 ? 281 VAL A CB    1 
ATOM   3005 C  CG1   . VAL B 2 281 ? -6.849  44.543 21.383  1.00 28.31 ? 281 VAL A CG1   1 
ATOM   3006 C  CG2   . VAL B 2 281 ? -7.033  44.867 18.944  1.00 29.48 ? 281 VAL A CG2   1 
ATOM   3007 N  N     . LYS B 2 282 ? -3.448  45.257 21.945  1.00 32.09 ? 282 LYS A N     1 
ATOM   3008 C  CA    . LYS B 2 282 ? -2.649  44.984 23.130  1.00 32.89 ? 282 LYS A CA    1 
ATOM   3009 C  C     . LYS B 2 282 ? -3.290  45.476 24.412  1.00 33.14 ? 282 LYS A C     1 
ATOM   3010 O  O     . LYS B 2 282 ? -3.764  46.612 24.476  1.00 32.59 ? 282 LYS A O     1 
ATOM   3011 C  CB    . LYS B 2 282 ? -1.279  45.628 22.964  1.00 34.32 ? 282 LYS A CB    1 
ATOM   3012 C  CG    . LYS B 2 282 ? -0.324  45.409 24.109  1.00 36.34 ? 282 LYS A CG    1 
ATOM   3013 C  CD    . LYS B 2 282 ? 0.920   46.235 23.880  1.00 37.85 ? 282 LYS A CD    1 
ATOM   3014 C  CE    . LYS B 2 282 ? 1.872   46.151 25.058  1.00 38.37 ? 282 LYS A CE    1 
ATOM   3015 N  NZ    . LYS B 2 282 ? 3.220   46.684 24.677  1.00 39.85 ? 282 LYS A NZ    1 
ATOM   3016 N  N     . PHE B 2 283 ? -3.277  44.621 25.433  1.00 33.85 ? 283 PHE A N     1 
ATOM   3017 C  CA    . PHE B 2 283 ? -3.866  44.956 26.718  1.00 36.65 ? 283 PHE A CA    1 
ATOM   3018 C  C     . PHE B 2 283 ? -3.260  44.136 27.848  1.00 38.60 ? 283 PHE A C     1 
ATOM   3019 O  O     . PHE B 2 283 ? -2.813  43.013 27.622  1.00 39.27 ? 283 PHE A O     1 
ATOM   3020 C  CB    . PHE B 2 283 ? -5.365  44.705 26.660  1.00 37.55 ? 283 PHE A CB    1 
ATOM   3021 C  CG    . PHE B 2 283 ? -5.724  43.278 26.402  1.00 38.79 ? 283 PHE A CG    1 
ATOM   3022 C  CD1   . PHE B 2 283 ? -6.239  42.481 27.420  1.00 39.65 ? 283 PHE A CD1   1 
ATOM   3023 C  CD2   . PHE B 2 283 ? -5.550  42.721 25.143  1.00 39.68 ? 283 PHE A CD2   1 
ATOM   3024 C  CE1   . PHE B 2 283 ? -6.583  41.140 27.188  1.00 39.51 ? 283 PHE A CE1   1 
ATOM   3025 C  CE2   . PHE B 2 283 ? -5.892  41.382 24.901  1.00 39.52 ? 283 PHE A CE2   1 
ATOM   3026 C  CZ    . PHE B 2 283 ? -6.410  40.595 25.930  1.00 39.01 ? 283 PHE A CZ    1 
ATOM   3027 N  N     . ARG B 2 284 ? -3.259  44.689 29.064  1.00 40.44 ? 284 ARG A N     1 
ATOM   3028 C  CA    . ARG B 2 284 ? -2.708  43.994 30.233  1.00 41.35 ? 284 ARG A CA    1 
ATOM   3029 C  C     . ARG B 2 284 ? -3.332  42.606 30.444  1.00 40.99 ? 284 ARG A C     1 
ATOM   3030 O  O     . ARG B 2 284 ? -4.543  42.458 30.608  1.00 39.52 ? 284 ARG A O     1 
ATOM   3031 C  CB    . ARG B 2 284 ? -2.910  44.829 31.501  1.00 43.38 ? 284 ARG A CB    1 
ATOM   3032 C  CG    . ARG B 2 284 ? -2.107  46.112 31.544  1.00 48.15 ? 284 ARG A CG    1 
ATOM   3033 C  CD    . ARG B 2 284 ? -2.541  47.024 32.715  1.00 52.15 ? 284 ARG A CD    1 
ATOM   3034 N  NE    . ARG B 2 284 ? -2.513  48.453 32.361  1.00 54.83 ? 284 ARG A NE    1 
ATOM   3035 C  CZ    . ARG B 2 284 ? -1.428  49.106 31.941  1.00 56.19 ? 284 ARG A CZ    1 
ATOM   3036 N  NH1   . ARG B 2 284 ? -0.260  48.470 31.817  1.00 56.38 ? 284 ARG A NH1   1 
ATOM   3037 N  NH2   . ARG B 2 284 ? -1.508  50.396 31.633  1.00 55.67 ? 284 ARG A NH2   1 
ATOM   3038 N  N     . LYS B 2 285 ? -2.481  41.588 30.445  1.00 41.17 ? 285 LYS A N     1 
ATOM   3039 C  CA    . LYS B 2 285 ? -2.918  40.209 30.634  1.00 40.96 ? 285 LYS A CA    1 
ATOM   3040 C  C     . LYS B 2 285 ? -3.642  40.045 31.953  1.00 40.18 ? 285 LYS A C     1 
ATOM   3041 O  O     . LYS B 2 285 ? -3.143  40.479 32.986  1.00 40.22 ? 285 LYS A O     1 
ATOM   3042 C  CB    . LYS B 2 285 ? -1.699  39.295 30.609  1.00 41.40 ? 285 LYS A CB    1 
ATOM   3043 C  CG    . LYS B 2 285 ? -1.888  37.954 31.258  1.00 43.63 ? 285 LYS A CG    1 
ATOM   3044 C  CD    . LYS B 2 285 ? -0.542  37.272 31.352  1.00 45.85 ? 285 LYS A CD    1 
ATOM   3045 C  CE    . LYS B 2 285 ? -0.654  35.875 31.902  1.00 48.44 ? 285 LYS A CE    1 
ATOM   3046 N  NZ    . LYS B 2 285 ? 0.665   35.175 31.794  1.00 51.33 ? 285 LYS A NZ    1 
ATOM   3047 N  N     . PRO B 2 286 ? -4.838  39.434 31.941  1.00 39.80 ? 286 PRO A N     1 
ATOM   3048 C  CA    . PRO B 2 286 ? -5.554  39.255 33.206  1.00 40.44 ? 286 PRO A CA    1 
ATOM   3049 C  C     . PRO B 2 286 ? -4.732  38.280 34.042  1.00 42.11 ? 286 PRO A C     1 
ATOM   3050 O  O     . PRO B 2 286 ? -3.877  37.571 33.494  1.00 43.47 ? 286 PRO A O     1 
ATOM   3051 C  CB    . PRO B 2 286 ? -6.884  38.646 32.771  1.00 39.88 ? 286 PRO A CB    1 
ATOM   3052 C  CG    . PRO B 2 286 ? -7.071  39.145 31.389  1.00 38.92 ? 286 PRO A CG    1 
ATOM   3053 C  CD    . PRO B 2 286 ? -5.680  39.022 30.809  1.00 39.58 ? 286 PRO A CD    1 
ATOM   3054 N  N     . ASP B 2 287 ? -4.972  38.244 35.352  1.00 42.96 ? 287 ASP A N     1 
ATOM   3055 C  CA    . ASP B 2 287 ? -4.239  37.328 36.232  1.00 42.77 ? 287 ASP A CA    1 
ATOM   3056 C  C     . ASP B 2 287 ? -5.296  36.259 36.535  1.00 41.79 ? 287 ASP A C     1 
ATOM   3057 O  O     . ASP B 2 287 ? -5.952  36.286 37.574  1.00 41.63 ? 287 ASP A O     1 
ATOM   3058 C  CB    . ASP B 2 287 ? -3.766  38.056 37.502  1.00 43.75 ? 287 ASP A CB    1 
ATOM   3059 C  CG    . ASP B 2 287 ? -2.836  37.198 38.369  1.00 43.63 ? 287 ASP A CG    1 
ATOM   3060 O  OD1   . ASP B 2 287 ? -2.249  36.241 37.826  1.00 44.20 ? 287 ASP A OD1   1 
ATOM   3061 O  OD2   . ASP B 2 287 ? -2.680  37.491 39.580  1.00 42.13 ? 287 ASP A OD2   1 
ATOM   3062 N  N     . ILE B 2 288 ? -5.468  35.336 35.595  1.00 40.32 ? 288 ILE A N     1 
ATOM   3063 C  CA    . ILE B 2 288 ? -6.248  34.124 35.788  1.00 39.54 ? 288 ILE A CA    1 
ATOM   3064 C  C     . ILE B 2 288 ? -5.397  32.991 35.239  1.00 38.70 ? 288 ILE A C     1 
ATOM   3065 O  O     . ILE B 2 288 ? -4.380  33.244 34.608  1.00 38.70 ? 288 ILE A O     1 
ATOM   3066 C  CB    . ILE B 2 288 ? -7.573  34.169 35.007  1.00 39.50 ? 288 ILE A CB    1 
ATOM   3067 C  CG1   . ILE B 2 288 ? -7.318  34.663 33.579  1.00 39.68 ? 288 ILE A CG1   1 
ATOM   3068 C  CG2   . ILE B 2 288 ? -8.577  35.028 35.745  1.00 38.28 ? 288 ILE A CG2   1 
ATOM   3069 C  CD1   . ILE B 2 288 ? -8.564  34.739 32.718  1.00 40.59 ? 288 ILE A CD1   1 
ATOM   3070 N  N     . VAL B 2 289 ? -5.794  31.748 35.472  1.00 38.00 ? 289 VAL A N     1 
ATOM   3071 C  CA    . VAL B 2 289 ? -5.007  30.632 34.956  1.00 37.64 ? 289 VAL A CA    1 
ATOM   3072 C  C     . VAL B 2 289 ? -5.196  30.472 33.439  1.00 38.35 ? 289 VAL A C     1 
ATOM   3073 O  O     . VAL B 2 289 ? -6.127  31.036 32.847  1.00 38.70 ? 289 VAL A O     1 
ATOM   3074 C  CB    . VAL B 2 289 ? -5.370  29.311 35.664  1.00 36.28 ? 289 VAL A CB    1 
ATOM   3075 C  CG1   . VAL B 2 289 ? -5.100  29.431 37.147  1.00 34.55 ? 289 VAL A CG1   1 
ATOM   3076 C  CG2   . VAL B 2 289 ? -6.820  28.966 35.414  1.00 36.11 ? 289 VAL A CG2   1 
ATOM   3077 N  N     . ASP B 2 290 ? -4.306  29.703 32.815  1.00 37.99 ? 290 ASP A N     1 
ATOM   3078 C  CA    . ASP B 2 290 ? -4.363  29.490 31.375  1.00 36.29 ? 290 ASP A CA    1 
ATOM   3079 C  C     . ASP B 2 290 ? -5.666  28.895 30.897  1.00 36.05 ? 290 ASP A C     1 
ATOM   3080 O  O     . ASP B 2 290 ? -6.177  29.314 29.869  1.00 36.78 ? 290 ASP A O     1 
ATOM   3081 C  CB    . ASP B 2 290 ? -3.192  28.626 30.919  1.00 35.32 ? 290 ASP A CB    1 
ATOM   3082 C  CG    . ASP B 2 290 ? -1.890  29.396 30.901  1.00 36.53 ? 290 ASP A CG    1 
ATOM   3083 O  OD1   . ASP B 2 290 ? -1.854  30.487 31.506  1.00 36.44 ? 290 ASP A OD1   1 
ATOM   3084 O  OD2   . ASP B 2 290 ? -0.902  28.922 30.291  1.00 37.87 ? 290 ASP A OD2   1 
ATOM   3085 N  N     . ASP B 2 291 ? -6.228  27.938 31.630  1.00 35.59 ? 291 ASP A N     1 
ATOM   3086 C  CA    . ASP B 2 291 ? -7.479  27.339 31.181  1.00 35.77 ? 291 ASP A CA    1 
ATOM   3087 C  C     . ASP B 2 291 ? -8.634  28.308 31.173  1.00 36.11 ? 291 ASP A C     1 
ATOM   3088 O  O     . ASP B 2 291 ? -9.693  28.032 30.598  1.00 35.29 ? 291 ASP A O     1 
ATOM   3089 C  CB    . ASP B 2 291 ? -7.825  26.137 32.032  1.00 35.71 ? 291 ASP A CB    1 
ATOM   3090 C  CG    . ASP B 2 291 ? -7.120  24.904 31.566  1.00 35.91 ? 291 ASP A CG    1 
ATOM   3091 O  OD1   . ASP B 2 291 ? -6.981  23.971 32.376  1.00 35.91 ? 291 ASP A OD1   1 
ATOM   3092 O  OD2   . ASP B 2 291 ? -6.709  24.871 30.384  1.00 36.45 ? 291 ASP A OD2   1 
ATOM   3093 N  N     . ASN B 2 292 ? -8.430  29.450 31.817  1.00 36.73 ? 292 ASN A N     1 
ATOM   3094 C  CA    . ASN B 2 292 ? -9.457  30.469 31.857  1.00 37.67 ? 292 ASN A CA    1 
ATOM   3095 C  C     . ASN B 2 292 ? -9.093  31.517 30.828  1.00 37.89 ? 292 ASN A C     1 
ATOM   3096 O  O     . ASN B 2 292 ? -9.963  32.021 30.123  1.00 38.45 ? 292 ASN A O     1 
ATOM   3097 C  CB    . ASN B 2 292 ? -9.541  31.102 33.246  1.00 39.31 ? 292 ASN A CB    1 
ATOM   3098 C  CG    . ASN B 2 292 ? -10.386 30.284 34.216  1.00 40.38 ? 292 ASN A CG    1 
ATOM   3099 O  OD1   . ASN B 2 292 ? -11.572 30.026 33.966  1.00 42.04 ? 292 ASN A OD1   1 
ATOM   3100 N  ND2   . ASN B 2 292 ? -9.785  29.882 35.330  1.00 39.12 ? 292 ASN A ND2   1 
ATOM   3101 N  N     . LEU B 2 293 ? -7.802  31.834 30.738  1.00 37.38 ? 293 LEU A N     1 
ATOM   3102 C  CA    . LEU B 2 293 ? -7.314  32.836 29.803  1.00 37.04 ? 293 LEU A CA    1 
ATOM   3103 C  C     . LEU B 2 293 ? -7.413  32.660 28.267  1.00 37.84 ? 293 LEU A C     1 
ATOM   3104 O  O     . LEU B 2 293 ? -8.115  33.406 27.583  1.00 40.31 ? 293 LEU A O     1 
ATOM   3105 C  CB    . LEU B 2 293 ? -5.820  33.076 29.969  1.00 34.74 ? 293 LEU A CB    1 
ATOM   3106 C  CG    . LEU B 2 293 ? -5.090  34.109 29.082  1.00 33.40 ? 293 LEU A CG    1 
ATOM   3107 C  CD1   . LEU B 2 293 ? -5.725  35.479 29.205  1.00 31.90 ? 293 LEU A CD1   1 
ATOM   3108 C  CD2   . LEU B 2 293 ? -3.634  34.198 29.494  1.00 32.75 ? 293 LEU A CD2   1 
ATOM   3109 N  N     . TYR B 2 294 ? -6.688  31.676 27.756  1.00 36.95 ? 294 TYR A N     1 
ATOM   3110 C  CA    . TYR B 2 294 ? -6.871  31.174 26.402  1.00 35.84 ? 294 TYR A CA    1 
ATOM   3111 C  C     . TYR B 2 294 ? -8.294  31.025 25.784  1.00 36.32 ? 294 TYR A C     1 
ATOM   3112 O  O     . TYR B 2 294 ? -8.545  31.510 24.684  1.00 36.94 ? 294 TYR A O     1 
ATOM   3113 C  CB    . TYR B 2 294 ? -6.203  29.811 26.270  1.00 33.07 ? 294 TYR A CB    1 
ATOM   3114 C  CG    . TYR B 2 294 ? -4.727  29.996 26.303  1.00 31.86 ? 294 TYR A CG    1 
ATOM   3115 C  CD1   . TYR B 2 294 ? -4.029  30.076 27.503  1.00 32.11 ? 294 TYR A CD1   1 
ATOM   3116 C  CD2   . TYR B 2 294 ? -4.035  30.242 25.132  1.00 32.79 ? 294 TYR A CD2   1 
ATOM   3117 C  CE1   . TYR B 2 294 ? -2.669  30.407 27.518  1.00 31.30 ? 294 TYR A CE1   1 
ATOM   3118 C  CE2   . TYR B 2 294 ? -2.690  30.573 25.139  1.00 31.18 ? 294 TYR A CE2   1 
ATOM   3119 C  CZ    . TYR B 2 294 ? -2.014  30.657 26.322  1.00 30.69 ? 294 TYR A CZ    1 
ATOM   3120 O  OH    . TYR B 2 294 ? -0.690  31.013 26.266  1.00 31.50 ? 294 TYR A OH    1 
ATOM   3121 N  N     . PRO B 2 295 ? -9.224  30.355 26.479  1.00 36.43 ? 295 PRO A N     1 
ATOM   3122 C  CA    . PRO B 2 295 ? -10.580 30.358 25.925  1.00 37.56 ? 295 PRO A CA    1 
ATOM   3123 C  C     . PRO B 2 295 ? -11.137 31.764 25.671  1.00 37.99 ? 295 PRO A C     1 
ATOM   3124 O  O     . PRO B 2 295 ? -11.880 31.981 24.702  1.00 37.47 ? 295 PRO A O     1 
ATOM   3125 C  CB    . PRO B 2 295 ? -11.364 29.569 26.965  1.00 36.94 ? 295 PRO A CB    1 
ATOM   3126 C  CG    . PRO B 2 295 ? -10.367 28.501 27.313  1.00 36.38 ? 295 PRO A CG    1 
ATOM   3127 C  CD    . PRO B 2 295 ? -9.070  29.279 27.473  1.00 36.30 ? 295 PRO A CD    1 
ATOM   3128 N  N     . GLN B 2 296 ? -10.764 32.711 26.535  1.00 38.22 ? 296 GLN A N     1 
ATOM   3129 C  CA    . GLN B 2 296 ? -11.196 34.105 26.398  1.00 37.76 ? 296 GLN A CA    1 
ATOM   3130 C  C     . GLN B 2 296 ? -10.429 34.796 25.276  1.00 36.10 ? 296 GLN A C     1 
ATOM   3131 O  O     . GLN B 2 296 ? -11.017 35.550 24.503  1.00 35.36 ? 296 GLN A O     1 
ATOM   3132 C  CB    . GLN B 2 296 ? -10.996 34.869 27.704  1.00 38.62 ? 296 GLN A CB    1 
ATOM   3133 C  CG    . GLN B 2 296 ? -12.002 34.506 28.774  1.00 40.79 ? 296 GLN A CG    1 
ATOM   3134 C  CD    . GLN B 2 296 ? -11.727 35.228 30.070  1.00 41.19 ? 296 GLN A CD    1 
ATOM   3135 O  OE1   . GLN B 2 296 ? -11.581 36.448 30.088  1.00 41.73 ? 296 GLN A OE1   1 
ATOM   3136 N  NE2   . GLN B 2 296 ? -11.651 34.480 31.163  1.00 40.98 ? 296 GLN A NE2   1 
ATOM   3137 N  N     . LEU B 2 297 ? -9.123  34.545 25.191  1.00 33.87 ? 297 LEU A N     1 
ATOM   3138 C  CA    . LEU B 2 297 ? -8.331  35.131 24.121  1.00 32.68 ? 297 LEU A CA    1 
ATOM   3139 C  C     . LEU B 2 297 ? -8.879  34.610 22.797  1.00 32.75 ? 297 LEU A C     1 
ATOM   3140 O  O     . LEU B 2 297 ? -8.765  35.267 21.765  1.00 33.28 ? 297 LEU A O     1 
ATOM   3141 C  CB    . LEU B 2 297 ? -6.847  34.766 24.257  1.00 30.13 ? 297 LEU A CB    1 
ATOM   3142 C  CG    . LEU B 2 297 ? -6.103  35.421 25.431  1.00 29.20 ? 297 LEU A CG    1 
ATOM   3143 C  CD1   . LEU B 2 297 ? -4.651  34.954 25.500  1.00 27.73 ? 297 LEU A CD1   1 
ATOM   3144 C  CD2   . LEU B 2 297 ? -6.159  36.916 25.271  1.00 28.11 ? 297 LEU A CD2   1 
ATOM   3145 N  N     . GLU B 2 298 ? -9.490  33.431 22.834  1.00 33.28 ? 298 GLU A N     1 
ATOM   3146 C  CA    . GLU B 2 298 ? -10.063 32.838 21.629  1.00 33.58 ? 298 GLU A CA    1 
ATOM   3147 C  C     . GLU B 2 298 ? -11.339 33.557 21.246  1.00 31.94 ? 298 GLU A C     1 
ATOM   3148 O  O     . GLU B 2 298 ? -11.494 34.023 20.123  1.00 30.88 ? 298 GLU A O     1 
ATOM   3149 C  CB    . GLU B 2 298 ? -10.336 31.348 21.846  1.00 35.18 ? 298 GLU A CB    1 
ATOM   3150 C  CG    . GLU B 2 298 ? -9.215  30.466 21.308  1.00 39.94 ? 298 GLU A CG    1 
ATOM   3151 C  CD    . GLU B 2 298 ? -9.203  29.060 21.897  1.00 42.46 ? 298 GLU A CD    1 
ATOM   3152 O  OE1   . GLU B 2 298 ? -8.309  28.276 21.508  1.00 43.85 ? 298 GLU A OE1   1 
ATOM   3153 O  OE2   . GLU B 2 298 ? -10.066 28.736 22.744  1.00 43.03 ? 298 GLU A OE2   1 
ATOM   3154 N  N     . ARG B 2 299 ? -12.248 33.647 22.200  1.00 31.27 ? 299 ARG A N     1 
ATOM   3155 C  CA    . ARG B 2 299 ? -13.516 34.318 21.995  1.00 30.53 ? 299 ARG A CA    1 
ATOM   3156 C  C     . ARG B 2 299 ? -13.303 35.735 21.444  1.00 30.09 ? 299 ARG A C     1 
ATOM   3157 O  O     . ARG B 2 299 ? -13.835 36.083 20.390  1.00 29.00 ? 299 ARG A O     1 
ATOM   3158 C  CB    . ARG B 2 299 ? -14.283 34.362 23.327  1.00 30.07 ? 299 ARG A CB    1 
ATOM   3159 C  CG    . ARG B 2 299 ? -15.446 35.325 23.318  1.00 30.92 ? 299 ARG A CG    1 
ATOM   3160 C  CD    . ARG B 2 299 ? -16.330 35.175 24.538  1.00 30.66 ? 299 ARG A CD    1 
ATOM   3161 N  NE    . ARG B 2 299 ? -17.721 35.003 24.127  1.00 31.43 ? 299 ARG A NE    1 
ATOM   3162 C  CZ    . ARG B 2 299 ? -18.471 35.959 23.589  1.00 31.99 ? 299 ARG A CZ    1 
ATOM   3163 N  NH1   . ARG B 2 299 ? -17.974 37.170 23.400  1.00 30.96 ? 299 ARG A NH1   1 
ATOM   3164 N  NH2   . ARG B 2 299 ? -19.720 35.698 23.219  1.00 33.53 ? 299 ARG A NH2   1 
ATOM   3165 N  N     . ALA B 2 300 ? -12.517 36.536 22.164  1.00 29.92 ? 300 ALA A N     1 
ATOM   3166 C  CA    . ALA B 2 300 ? -12.224 37.916 21.785  1.00 29.60 ? 300 ALA A CA    1 
ATOM   3167 C  C     . ALA B 2 300 ? -11.626 37.987 20.392  1.00 29.78 ? 300 ALA A C     1 
ATOM   3168 O  O     . ALA B 2 300 ? -12.019 38.817 19.578  1.00 30.38 ? 300 ALA A O     1 
ATOM   3169 C  CB    . ALA B 2 300 ? -11.266 38.541 22.787  1.00 29.12 ? 300 ALA A CB    1 
ATOM   3170 N  N     . SER B 2 301 ? -10.660 37.122 20.132  1.00 29.52 ? 301 SER A N     1 
ATOM   3171 C  CA    . SER B 2 301 ? -10.014 37.055 18.832  1.00 30.15 ? 301 SER A CA    1 
ATOM   3172 C  C     . SER B 2 301 ? -11.115 36.829 17.772  1.00 30.57 ? 301 SER A C     1 
ATOM   3173 O  O     . SER B 2 301 ? -11.132 37.441 16.709  1.00 30.83 ? 301 SER A O     1 
ATOM   3174 C  CB    . SER B 2 301 ? -9.024  35.878 18.857  1.00 30.73 ? 301 SER A CB    1 
ATOM   3175 O  OG    . SER B 2 301 ? -8.121  35.880 17.772  1.00 31.98 ? 301 SER A OG    1 
ATOM   3176 N  N     . ARG B 2 302 ? -12.060 35.961 18.094  1.00 31.70 ? 302 ARG A N     1 
ATOM   3177 C  CA    . ARG B 2 302 ? -13.148 35.625 17.187  1.00 32.95 ? 302 ARG A CA    1 
ATOM   3178 C  C     . ARG B 2 302 ? -14.168 36.745 16.993  1.00 33.93 ? 302 ARG A C     1 
ATOM   3179 O  O     . ARG B 2 302 ? -14.515 37.097 15.859  1.00 34.72 ? 302 ARG A O     1 
ATOM   3180 C  CB    . ARG B 2 302 ? -13.866 34.388 17.713  1.00 33.30 ? 302 ARG A CB    1 
ATOM   3181 C  CG    . ARG B 2 302 ? -14.602 33.587 16.680  1.00 32.78 ? 302 ARG A CG    1 
ATOM   3182 C  CD    . ARG B 2 302 ? -15.599 32.721 17.380  1.00 34.33 ? 302 ARG A CD    1 
ATOM   3183 N  NE    . ARG B 2 302 ? -16.784 33.495 17.727  1.00 36.67 ? 302 ARG A NE    1 
ATOM   3184 C  CZ    . ARG B 2 302 ? -17.404 33.452 18.902  1.00 38.53 ? 302 ARG A CZ    1 
ATOM   3185 N  NH1   . ARG B 2 302 ? -16.959 32.665 19.887  1.00 37.20 ? 302 ARG A NH1   1 
ATOM   3186 N  NH2   . ARG B 2 302 ? -18.486 34.203 19.084  1.00 39.47 ? 302 ARG A NH2   1 
ATOM   3187 N  N     . LYS B 2 303 ? -14.671 37.281 18.101  1.00 33.46 ? 303 LYS A N     1 
ATOM   3188 C  CA    . LYS B 2 303 ? -15.656 38.350 18.046  1.00 32.97 ? 303 LYS A CA    1 
ATOM   3189 C  C     . LYS B 2 303 ? -15.164 39.540 17.233  1.00 32.32 ? 303 LYS A C     1 
ATOM   3190 O  O     . LYS B 2 303 ? -15.936 40.144 16.497  1.00 33.53 ? 303 LYS A O     1 
ATOM   3191 C  CB    . LYS B 2 303 ? -16.004 38.816 19.453  1.00 34.27 ? 303 LYS A CB    1 
ATOM   3192 C  CG    . LYS B 2 303 ? -16.665 37.755 20.316  1.00 36.64 ? 303 LYS A CG    1 
ATOM   3193 C  CD    . LYS B 2 303 ? -18.028 37.350 19.765  1.00 38.06 ? 303 LYS A CD    1 
ATOM   3194 C  CE    . LYS B 2 303 ? -18.917 38.560 19.582  1.00 38.35 ? 303 LYS A CE    1 
ATOM   3195 N  NZ    . LYS B 2 303 ? -20.311 38.183 19.248  1.00 38.98 ? 303 LYS A NZ    1 
ATOM   3196 N  N     . ILE B 2 304 ? -13.890 39.892 17.370  1.00 30.57 ? 304 ILE A N     1 
ATOM   3197 C  CA    . ILE B 2 304 ? -13.365 41.021 16.623  1.00 29.24 ? 304 ILE A CA    1 
ATOM   3198 C  C     . ILE B 2 304 ? -13.267 40.646 15.162  1.00 29.34 ? 304 ILE A C     1 
ATOM   3199 O  O     . ILE B 2 304 ? -13.646 41.431 14.282  1.00 29.25 ? 304 ILE A O     1 
ATOM   3200 C  CB    . ILE B 2 304 ? -11.959 41.450 17.120  1.00 28.93 ? 304 ILE A CB    1 
ATOM   3201 C  CG1   . ILE B 2 304 ? -12.081 42.191 18.452  1.00 27.50 ? 304 ILE A CG1   1 
ATOM   3202 C  CG2   . ILE B 2 304 ? -11.273 42.346 16.076  1.00 27.71 ? 304 ILE A CG2   1 
ATOM   3203 C  CD1   . ILE B 2 304 ? -10.751 42.468 19.121  1.00 27.02 ? 304 ILE A CD1   1 
ATOM   3204 N  N     . PHE B 2 305 ? -12.748 39.444 14.908  1.00 28.35 ? 305 PHE A N     1 
ATOM   3205 C  CA    . PHE B 2 305 ? -12.580 38.945 13.536  1.00 27.19 ? 305 PHE A CA    1 
ATOM   3206 C  C     . PHE B 2 305 ? -13.903 39.062 12.780  1.00 26.83 ? 305 PHE A C     1 
ATOM   3207 O  O     . PHE B 2 305 ? -13.938 39.476 11.635  1.00 25.37 ? 305 PHE A O     1 
ATOM   3208 C  CB    . PHE B 2 305 ? -12.127 37.484 13.570  1.00 25.28 ? 305 PHE A CB    1 
ATOM   3209 C  CG    . PHE B 2 305 ? -11.873 36.896 12.214  1.00 24.55 ? 305 PHE A CG    1 
ATOM   3210 C  CD1   . PHE B 2 305 ? -10.577 36.809 11.708  1.00 23.84 ? 305 PHE A CD1   1 
ATOM   3211 C  CD2   . PHE B 2 305 ? -12.937 36.419 11.432  1.00 23.99 ? 305 PHE A CD2   1 
ATOM   3212 C  CE1   . PHE B 2 305 ? -10.343 36.251 10.438  1.00 23.35 ? 305 PHE A CE1   1 
ATOM   3213 C  CE2   . PHE B 2 305 ? -12.717 35.863 10.164  1.00 21.33 ? 305 PHE A CE2   1 
ATOM   3214 C  CZ    . PHE B 2 305 ? -11.415 35.779 9.669   1.00 22.29 ? 305 PHE A CZ    1 
ATOM   3215 N  N     . GLU B 2 306 ? -14.987 38.693 13.451  1.00 27.94 ? 306 GLU A N     1 
ATOM   3216 C  CA    . GLU B 2 306 ? -16.317 38.750 12.876  1.00 29.06 ? 306 GLU A CA    1 
ATOM   3217 C  C     . GLU B 2 306 ? -16.738 40.188 12.590  1.00 28.49 ? 306 GLU A C     1 
ATOM   3218 O  O     . GLU B 2 306 ? -17.289 40.484 11.526  1.00 28.44 ? 306 GLU A O     1 
ATOM   3219 C  CB    . GLU B 2 306 ? -17.303 38.059 13.821  1.00 31.94 ? 306 GLU A CB    1 
ATOM   3220 C  CG    . GLU B 2 306 ? -17.466 36.569 13.528  1.00 36.04 ? 306 GLU A CG    1 
ATOM   3221 C  CD    . GLU B 2 306 ? -17.823 35.737 14.750  1.00 37.95 ? 306 GLU A CD    1 
ATOM   3222 O  OE1   . GLU B 2 306 ? -18.694 36.169 15.545  1.00 40.59 ? 306 GLU A OE1   1 
ATOM   3223 O  OE2   . GLU B 2 306 ? -17.233 34.643 14.903  1.00 37.85 ? 306 GLU A OE2   1 
ATOM   3224 N  N     . PHE B 2 307 ? -16.491 41.089 13.536  1.00 27.59 ? 307 PHE A N     1 
ATOM   3225 C  CA    . PHE B 2 307 ? -16.825 42.490 13.309  1.00 26.95 ? 307 PHE A CA    1 
ATOM   3226 C  C     . PHE B 2 307 ? -16.097 42.894 12.026  1.00 27.81 ? 307 PHE A C     1 
ATOM   3227 O  O     . PHE B 2 307 ? -16.676 43.528 11.144  1.00 27.70 ? 307 PHE A O     1 
ATOM   3228 C  CB    . PHE B 2 307 ? -16.334 43.361 14.465  1.00 24.43 ? 307 PHE A CB    1 
ATOM   3229 C  CG    . PHE B 2 307 ? -16.099 44.800 14.082  1.00 22.24 ? 307 PHE A CG    1 
ATOM   3230 C  CD1   . PHE B 2 307 ? -17.136 45.717 14.086  1.00 20.42 ? 307 PHE A CD1   1 
ATOM   3231 C  CD2   . PHE B 2 307 ? -14.819 45.239 13.730  1.00 21.99 ? 307 PHE A CD2   1 
ATOM   3232 C  CE1   . PHE B 2 307 ? -16.910 47.042 13.756  1.00 18.24 ? 307 PHE A CE1   1 
ATOM   3233 C  CE2   . PHE B 2 307 ? -14.585 46.564 13.398  1.00 20.10 ? 307 PHE A CE2   1 
ATOM   3234 C  CZ    . PHE B 2 307 ? -15.636 47.466 13.413  1.00 19.91 ? 307 PHE A CZ    1 
ATOM   3235 N  N     . LEU B 2 308 ? -14.824 42.511 11.934  1.00 28.45 ? 308 LEU A N     1 
ATOM   3236 C  CA    . LEU B 2 308 ? -14.013 42.816 10.774  1.00 29.63 ? 308 LEU A CA    1 
ATOM   3237 C  C     . LEU B 2 308 ? -14.608 42.299 9.471   1.00 31.63 ? 308 LEU A C     1 
ATOM   3238 O  O     . LEU B 2 308 ? -14.620 43.028 8.477   1.00 33.65 ? 308 LEU A O     1 
ATOM   3239 C  CB    . LEU B 2 308 ? -12.613 42.239 10.933  1.00 28.08 ? 308 LEU A CB    1 
ATOM   3240 C  CG    . LEU B 2 308 ? -11.673 42.956 11.883  1.00 28.02 ? 308 LEU A CG    1 
ATOM   3241 C  CD1   . LEU B 2 308 ? -10.283 42.340 11.775  1.00 28.03 ? 308 LEU A CD1   1 
ATOM   3242 C  CD2   . LEU B 2 308 ? -11.636 44.427 11.521  1.00 27.34 ? 308 LEU A CD2   1 
ATOM   3243 N  N     . GLU B 2 309 ? -15.102 41.061 9.440   1.00 32.61 ? 309 GLU A N     1 
ATOM   3244 C  CA    . GLU B 2 309 ? -15.646 40.587 8.180   1.00 33.51 ? 309 GLU A CA    1 
ATOM   3245 C  C     . GLU B 2 309 ? -17.010 41.156 7.821   1.00 32.81 ? 309 GLU A C     1 
ATOM   3246 O  O     . GLU B 2 309 ? -17.237 41.487 6.654   1.00 32.55 ? 309 GLU A O     1 
ATOM   3247 C  CB    . GLU B 2 309 ? -15.644 39.058 8.080   1.00 35.56 ? 309 GLU A CB    1 
ATOM   3248 C  CG    . GLU B 2 309 ? -16.330 38.284 9.173   1.00 42.29 ? 309 GLU A CG    1 
ATOM   3249 C  CD    . GLU B 2 309 ? -16.233 36.768 8.936   1.00 45.46 ? 309 GLU A CD    1 
ATOM   3250 O  OE1   . GLU B 2 309 ? -16.569 35.975 9.856   1.00 46.07 ? 309 GLU A OE1   1 
ATOM   3251 O  OE2   . GLU B 2 309 ? -15.820 36.380 7.815   1.00 47.00 ? 309 GLU A OE2   1 
ATOM   3252 N  N     . ARG B 2 310 ? -17.918 41.310 8.782   1.00 31.73 ? 310 ARG A N     1 
ATOM   3253 C  CA    . ARG B 2 310 ? -19.200 41.886 8.392   1.00 32.34 ? 310 ARG A CA    1 
ATOM   3254 C  C     . ARG B 2 310 ? -19.004 43.345 8.013   1.00 32.89 ? 310 ARG A C     1 
ATOM   3255 O  O     . ARG B 2 310 ? -19.771 43.902 7.239   1.00 32.71 ? 310 ARG A O     1 
ATOM   3256 C  CB    . ARG B 2 310 ? -20.268 41.766 9.487   1.00 31.25 ? 310 ARG A CB    1 
ATOM   3257 C  CG    . ARG B 2 310 ? -20.049 42.531 10.763  1.00 31.36 ? 310 ARG A CG    1 
ATOM   3258 C  CD    . ARG B 2 310 ? -21.289 42.385 11.654  1.00 32.90 ? 310 ARG A CD    1 
ATOM   3259 N  NE    . ARG B 2 310 ? -21.033 42.620 13.073  1.00 33.38 ? 310 ARG A NE    1 
ATOM   3260 C  CZ    . ARG B 2 310 ? -20.189 41.897 13.808  1.00 35.61 ? 310 ARG A CZ    1 
ATOM   3261 N  NH1   . ARG B 2 310 ? -19.510 40.894 13.265  1.00 36.50 ? 310 ARG A NH1   1 
ATOM   3262 N  NH2   . ARG B 2 310 ? -20.024 42.163 15.094  1.00 37.58 ? 310 ARG A NH2   1 
ATOM   3263 N  N     . GLU B 2 311 ? -17.949 43.952 8.540   1.00 33.79 ? 311 GLU A N     1 
ATOM   3264 C  CA    . GLU B 2 311 ? -17.666 45.340 8.254   1.00 33.93 ? 311 GLU A CA    1 
ATOM   3265 C  C     . GLU B 2 311 ? -16.850 45.454 6.969   1.00 33.48 ? 311 GLU A C     1 
ATOM   3266 O  O     . GLU B 2 311 ? -16.288 46.504 6.657   1.00 33.52 ? 311 GLU A O     1 
ATOM   3267 C  CB    . GLU B 2 311 ? -16.944 45.978 9.440   1.00 34.95 ? 311 GLU A CB    1 
ATOM   3268 C  CG    . GLU B 2 311 ? -17.338 47.442 9.677   1.00 37.65 ? 311 GLU A CG    1 
ATOM   3269 C  CD    . GLU B 2 311 ? -18.850 47.658 9.877   1.00 38.67 ? 311 GLU A CD    1 
ATOM   3270 O  OE1   . GLU B 2 311 ? -19.429 47.098 10.836  1.00 37.68 ? 311 GLU A OE1   1 
ATOM   3271 O  OE2   . GLU B 2 311 ? -19.458 48.401 9.069   1.00 40.14 ? 311 GLU A OE2   1 
ATOM   3272 N  N     . ASN B 2 312 ? -16.793 44.353 6.231   1.00 32.83 ? 312 ASN A N     1 
ATOM   3273 C  CA    . ASN B 2 312 ? -16.109 44.313 4.943   1.00 32.93 ? 312 ASN A CA    1 
ATOM   3274 C  C     . ASN B 2 312 ? -14.623 44.565 4.845   1.00 32.26 ? 312 ASN A C     1 
ATOM   3275 O  O     . ASN B 2 312 ? -14.145 44.943 3.783   1.00 33.01 ? 312 ASN A O     1 
ATOM   3276 C  CB    . ASN B 2 312 ? -16.782 45.285 3.990   1.00 33.58 ? 312 ASN A CB    1 
ATOM   3277 C  CG    . ASN B 2 312 ? -18.217 44.944 3.750   1.00 33.52 ? 312 ASN A CG    1 
ATOM   3278 O  OD1   . ASN B 2 312 ? -19.107 45.761 4.003   1.00 35.02 ? 312 ASN A OD1   1 
ATOM   3279 N  ND2   . ASN B 2 312 ? -18.464 43.732 3.254   1.00 31.57 ? 312 ASN A ND2   1 
ATOM   3280 N  N     . PHE B 2 313 ? -13.870 44.358 5.907   1.00 31.42 ? 313 PHE A N     1 
ATOM   3281 C  CA    . PHE B 2 313 ? -12.451 44.618 5.790   1.00 30.84 ? 313 PHE A CA    1 
ATOM   3282 C  C     . PHE B 2 313 ? -11.685 43.457 5.205   1.00 31.24 ? 313 PHE A C     1 
ATOM   3283 O  O     . PHE B 2 313 ? -10.542 43.613 4.783   1.00 32.05 ? 313 PHE A O     1 
ATOM   3284 C  CB    . PHE B 2 313 ? -11.901 45.048 7.139   1.00 30.28 ? 313 PHE A CB    1 
ATOM   3285 C  CG    . PHE B 2 313 ? -12.336 46.430 7.524   1.00 29.89 ? 313 PHE A CG    1 
ATOM   3286 C  CD1   . PHE B 2 313 ? -11.672 47.545 7.015   1.00 28.43 ? 313 PHE A CD1   1 
ATOM   3287 C  CD2   . PHE B 2 313 ? -13.459 46.623 8.319   1.00 29.41 ? 313 PHE A CD2   1 
ATOM   3288 C  CE1   . PHE B 2 313 ? -12.118 48.824 7.287   1.00 27.66 ? 313 PHE A CE1   1 
ATOM   3289 C  CE2   . PHE B 2 313 ? -13.914 47.906 8.596   1.00 29.24 ? 313 PHE A CE2   1 
ATOM   3290 C  CZ    . PHE B 2 313 ? -13.244 49.009 8.080   1.00 28.00 ? 313 PHE A CZ    1 
ATOM   3291 N  N     . MET B 2 314 ? -12.339 42.301 5.153   1.00 31.15 ? 314 MET A N     1 
ATOM   3292 C  CA    . MET B 2 314 ? -11.753 41.084 4.600   1.00 31.44 ? 314 MET A CA    1 
ATOM   3293 C  C     . MET B 2 314 ? -10.658 40.287 5.304   1.00 31.16 ? 314 MET A C     1 
ATOM   3294 O  O     . MET B 2 314 ? -9.738  39.756 4.687   1.00 32.31 ? 314 MET A O     1 
ATOM   3295 C  CB    . MET B 2 314 ? -11.417 41.287 3.112   1.00 30.51 ? 314 MET A CB    1 
ATOM   3296 C  CG    . MET B 2 314 ? -12.649 41.445 2.250   1.00 30.07 ? 314 MET A CG    1 
ATOM   3297 S  SD    . MET B 2 314 ? -12.356 41.838 0.498   1.00 33.50 ? 314 MET A SD    1 
ATOM   3298 C  CE    . MET B 2 314 ? -12.053 40.169 -0.190  1.00 33.49 ? 314 MET A CE    1 
ATOM   3299 N  N     . PRO B 2 315 ? -10.767 40.183 6.624   1.00 31.07 ? 315 PRO A N     1 
ATOM   3300 C  CA    . PRO B 2 315 ? -9.688  39.677 7.472   1.00 31.95 ? 315 PRO A CA    1 
ATOM   3301 C  C     . PRO B 2 315 ? -9.206  38.436 6.755   1.00 32.38 ? 315 PRO A C     1 
ATOM   3302 O  O     . PRO B 2 315 ? -9.963  37.884 5.969   1.00 33.54 ? 315 PRO A O     1 
ATOM   3303 C  CB    . PRO B 2 315 ? -10.404 39.298 8.772   1.00 31.39 ? 315 PRO A CB    1 
ATOM   3304 C  CG    . PRO B 2 315 ? -11.766 39.913 8.663   1.00 32.00 ? 315 PRO A CG    1 
ATOM   3305 C  CD    . PRO B 2 315 ? -12.080 39.902 7.215   1.00 31.17 ? 315 PRO A CD    1 
ATOM   3306 N  N     . LEU B 2 316 ? -7.972  38.002 7.005   1.00 32.68 ? 316 LEU A N     1 
ATOM   3307 C  CA    . LEU B 2 316 ? -7.464  36.785 6.382   1.00 33.33 ? 316 LEU A CA    1 
ATOM   3308 C  C     . LEU B 2 316 ? -7.391  35.721 7.467   1.00 35.09 ? 316 LEU A C     1 
ATOM   3309 O  O     . LEU B 2 316 ? -7.825  34.582 7.283   1.00 36.53 ? 316 LEU A O     1 
ATOM   3310 C  CB    . LEU B 2 316 ? -6.077  37.001 5.787   1.00 31.98 ? 316 LEU A CB    1 
ATOM   3311 C  CG    . LEU B 2 316 ? -5.987  37.899 4.557   1.00 32.42 ? 316 LEU A CG    1 
ATOM   3312 C  CD1   . LEU B 2 316 ? -4.532  38.033 4.131   1.00 32.93 ? 316 LEU A CD1   1 
ATOM   3313 C  CD2   . LEU B 2 316 ? -6.816  37.317 3.433   1.00 31.77 ? 316 LEU A CD2   1 
ATOM   3314 N  N     . ARG B 2 317 ? -6.842  36.106 8.609   1.00 35.52 ? 317 ARG A N     1 
ATOM   3315 C  CA    . ARG B 2 317 ? -6.710  35.200 9.740   1.00 36.79 ? 317 ARG A CA    1 
ATOM   3316 C  C     . ARG B 2 317 ? -6.576  36.024 11.002  1.00 38.29 ? 317 ARG A C     1 
ATOM   3317 O  O     . ARG B 2 317 ? -6.602  37.260 10.956  1.00 39.62 ? 317 ARG A O     1 
ATOM   3318 C  CB    . ARG B 2 317 ? -5.463  34.327 9.597   1.00 35.46 ? 317 ARG A CB    1 
ATOM   3319 C  CG    . ARG B 2 317 ? -5.652  33.085 8.752   1.00 34.78 ? 317 ARG A CG    1 
ATOM   3320 C  CD    . ARG B 2 317 ? -4.345  32.318 8.672   1.00 33.80 ? 317 ARG A CD    1 
ATOM   3321 N  NE    . ARG B 2 317 ? -4.383  31.026 9.352   1.00 31.79 ? 317 ARG A NE    1 
ATOM   3322 C  CZ    . ARG B 2 317 ? -3.293  30.338 9.674   1.00 30.92 ? 317 ARG A CZ    1 
ATOM   3323 N  NH1   . ARG B 2 317 ? -2.091  30.828 9.382   1.00 29.42 ? 317 ARG A NH1   1 
ATOM   3324 N  NH2   . ARG B 2 317 ? -3.397  29.161 10.270  1.00 28.65 ? 317 ARG A NH2   1 
ATOM   3325 N  N     . SER B 2 318 ? -6.445  35.340 12.131  1.00 38.10 ? 318 SER A N     1 
ATOM   3326 C  CA    . SER B 2 318 ? -6.249  36.030 13.391  1.00 38.25 ? 318 SER A CA    1 
ATOM   3327 C  C     . SER B 2 318 ? -5.347  35.163 14.251  1.00 38.49 ? 318 SER A C     1 
ATOM   3328 O  O     . SER B 2 318 ? -5.167  33.968 13.984  1.00 39.49 ? 318 SER A O     1 
ATOM   3329 C  CB    . SER B 2 318 ? -7.580  36.280 14.092  1.00 37.82 ? 318 SER A CB    1 
ATOM   3330 O  OG    . SER B 2 318 ? -8.216  35.068 14.412  1.00 39.36 ? 318 SER A OG    1 
ATOM   3331 N  N     . ALA B 2 319 ? -4.749  35.767 15.264  1.00 37.57 ? 319 ALA A N     1 
ATOM   3332 C  CA    . ALA B 2 319 ? -3.885  35.017 16.151  1.00 36.95 ? 319 ALA A CA    1 
ATOM   3333 C  C     . ALA B 2 319 ? -3.877  35.736 17.480  1.00 36.89 ? 319 ALA A C     1 
ATOM   3334 O  O     . ALA B 2 319 ? -4.486  36.790 17.619  1.00 37.40 ? 319 ALA A O     1 
ATOM   3335 C  CB    . ALA B 2 319 ? -2.489  34.939 15.575  1.00 36.60 ? 319 ALA A CB    1 
ATOM   3336 N  N     . PHE B 2 320 ? -3.213  35.156 18.465  1.00 36.91 ? 320 PHE A N     1 
ATOM   3337 C  CA    . PHE B 2 320 ? -3.124  35.781 19.769  1.00 37.57 ? 320 PHE A CA    1 
ATOM   3338 C  C     . PHE B 2 320 ? -1.936  35.256 20.568  1.00 39.62 ? 320 PHE A C     1 
ATOM   3339 O  O     . PHE B 2 320 ? -1.578  34.075 20.509  1.00 40.02 ? 320 PHE A O     1 
ATOM   3340 C  CB    . PHE B 2 320 ? -4.431  35.598 20.531  1.00 34.66 ? 320 PHE A CB    1 
ATOM   3341 C  CG    . PHE B 2 320 ? -4.905  34.179 20.611  1.00 33.36 ? 320 PHE A CG    1 
ATOM   3342 C  CD1   . PHE B 2 320 ? -4.254  33.255 21.419  1.00 32.23 ? 320 PHE A CD1   1 
ATOM   3343 C  CD2   . PHE B 2 320 ? -6.056  33.784 19.942  1.00 33.26 ? 320 PHE A CD2   1 
ATOM   3344 C  CE1   . PHE B 2 320 ? -4.741  31.970 21.571  1.00 31.30 ? 320 PHE A CE1   1 
ATOM   3345 C  CE2   . PHE B 2 320 ? -6.554  32.488 20.089  1.00 33.13 ? 320 PHE A CE2   1 
ATOM   3346 C  CZ    . PHE B 2 320 ? -5.894  31.586 20.907  1.00 32.28 ? 320 PHE A CZ    1 
ATOM   3347 N  N     . LYS B 2 321 ? -1.305  36.155 21.305  1.00 41.53 ? 321 LYS A N     1 
ATOM   3348 C  CA    . LYS B 2 321 ? -0.144  35.787 22.087  1.00 42.68 ? 321 LYS A CA    1 
ATOM   3349 C  C     . LYS B 2 321 ? -0.281  36.341 23.502  1.00 43.24 ? 321 LYS A C     1 
ATOM   3350 O  O     . LYS B 2 321 ? -0.887  37.391 23.710  1.00 43.87 ? 321 LYS A O     1 
ATOM   3351 C  CB    . LYS B 2 321 ? 1.105   36.332 21.392  1.00 42.40 ? 321 LYS A CB    1 
ATOM   3352 C  CG    . LYS B 2 321 ? 2.400   35.725 21.847  1.00 42.71 ? 321 LYS A CG    1 
ATOM   3353 C  CD    . LYS B 2 321 ? 3.011   36.516 22.975  1.00 43.79 ? 321 LYS A CD    1 
ATOM   3354 C  CE    . LYS B 2 321 ? 4.352   35.922 23.312  1.00 44.92 ? 321 LYS A CE    1 
ATOM   3355 N  NZ    . LYS B 2 321 ? 5.037   35.527 22.046  1.00 46.32 ? 321 LYS A NZ    1 
ATOM   3356 N  N     . ALA B 2 322 ? 0.266   35.614 24.471  1.00 43.85 ? 322 ALA A N     1 
ATOM   3357 C  CA    . ALA B 2 322 ? 0.222   36.024 25.870  1.00 43.71 ? 322 ALA A CA    1 
ATOM   3358 C  C     . ALA B 2 322 ? 1.621   35.969 26.456  1.00 44.08 ? 322 ALA A C     1 
ATOM   3359 O  O     . ALA B 2 322 ? 2.278   34.940 26.390  1.00 43.68 ? 322 ALA A O     1 
ATOM   3360 C  CB    . ALA B 2 322 ? -0.689  35.106 26.653  1.00 41.90 ? 322 ALA A CB    1 
ATOM   3361 N  N     . SER B 2 323 ? 2.086   37.086 27.001  1.00 45.74 ? 323 SER A N     1 
ATOM   3362 C  CA    . SER B 2 323 ? 3.389   37.118 27.646  1.00 47.98 ? 323 SER A CA    1 
ATOM   3363 C  C     . SER B 2 323 ? 3.094   37.297 29.130  1.00 49.50 ? 323 SER A C     1 
ATOM   3364 O  O     . SER B 2 323 ? 1.926   37.355 29.522  1.00 50.45 ? 323 SER A O     1 
ATOM   3365 C  CB    . SER B 2 323 ? 4.226   38.273 27.122  1.00 48.34 ? 323 SER A CB    1 
ATOM   3366 O  OG    . SER B 2 323 ? 4.564   38.082 25.760  1.00 52.05 ? 323 SER A OG    1 
ATOM   3367 N  N     . GLU B 2 324 ? 4.120   37.366 29.970  1.00 51.07 ? 324 GLU A N     1 
ATOM   3368 C  CA    . GLU B 2 324 ? 3.858   37.529 31.395  1.00 52.17 ? 324 GLU A CA    1 
ATOM   3369 C  C     . GLU B 2 324 ? 3.106   38.826 31.638  1.00 52.39 ? 324 GLU A C     1 
ATOM   3370 O  O     . GLU B 2 324 ? 2.186   38.872 32.452  1.00 52.79 ? 324 GLU A O     1 
ATOM   3371 C  CB    . GLU B 2 324 ? 5.161   37.521 32.208  1.00 53.83 ? 324 GLU A CB    1 
ATOM   3372 C  CG    . GLU B 2 324 ? 5.694   36.116 32.551  1.00 56.41 ? 324 GLU A CG    1 
ATOM   3373 C  CD    . GLU B 2 324 ? 4.653   35.235 33.261  1.00 58.31 ? 324 GLU A CD    1 
ATOM   3374 O  OE1   . GLU B 2 324 ? 3.805   34.606 32.574  1.00 57.76 ? 324 GLU A OE1   1 
ATOM   3375 O  OE2   . GLU B 2 324 ? 4.678   35.183 34.513  1.00 58.91 ? 324 GLU A OE2   1 
ATOM   3376 N  N     . GLU B 2 325 ? 3.481   39.864 30.893  1.00 52.23 ? 325 GLU A N     1 
ATOM   3377 C  CA    . GLU B 2 325 ? 2.882   41.191 31.019  1.00 51.03 ? 325 GLU A CA    1 
ATOM   3378 C  C     . GLU B 2 325 ? 1.544   41.464 30.295  1.00 48.92 ? 325 GLU A C     1 
ATOM   3379 O  O     . GLU B 2 325 ? 0.526   41.690 30.946  1.00 48.47 ? 325 GLU A O     1 
ATOM   3380 C  CB    . GLU B 2 325 ? 3.931   42.246 30.618  1.00 53.66 ? 325 GLU A CB    1 
ATOM   3381 C  CG    . GLU B 2 325 ? 5.151   41.703 29.821  1.00 56.26 ? 325 GLU A CG    1 
ATOM   3382 C  CD    . GLU B 2 325 ? 4.794   41.257 28.408  1.00 58.63 ? 325 GLU A CD    1 
ATOM   3383 O  OE1   . GLU B 2 325 ? 3.856   40.443 28.271  1.00 59.29 ? 325 GLU A OE1   1 
ATOM   3384 O  OE2   . GLU B 2 325 ? 5.443   41.717 27.437  1.00 58.93 ? 325 GLU A OE2   1 
ATOM   3385 N  N     . PHE B 2 326 ? 1.528   41.449 28.966  1.00 46.84 ? 326 PHE A N     1 
ATOM   3386 C  CA    . PHE B 2 326 ? 0.283   41.727 28.256  1.00 45.26 ? 326 PHE A CA    1 
ATOM   3387 C  C     . PHE B 2 326 ? -0.198  40.633 27.318  1.00 44.64 ? 326 PHE A C     1 
ATOM   3388 O  O     . PHE B 2 326 ? 0.365   39.539 27.233  1.00 44.54 ? 326 PHE A O     1 
ATOM   3389 C  CB    . PHE B 2 326 ? 0.403   42.987 27.403  1.00 45.06 ? 326 PHE A CB    1 
ATOM   3390 C  CG    . PHE B 2 326 ? 1.337   44.024 27.946  1.00 44.16 ? 326 PHE A CG    1 
ATOM   3391 C  CD1   . PHE B 2 326 ? 2.715   43.853 27.856  1.00 42.44 ? 326 PHE A CD1   1 
ATOM   3392 C  CD2   . PHE B 2 326 ? 0.834   45.201 28.508  1.00 42.80 ? 326 PHE A CD2   1 
ATOM   3393 C  CE1   . PHE B 2 326 ? 3.573   44.837 28.312  1.00 41.19 ? 326 PHE A CE1   1 
ATOM   3394 C  CE2   . PHE B 2 326 ? 1.684   46.185 28.963  1.00 39.96 ? 326 PHE A CE2   1 
ATOM   3395 C  CZ    . PHE B 2 326 ? 3.052   46.005 28.865  1.00 40.71 ? 326 PHE A CZ    1 
ATOM   3396 N  N     . CYS B 2 327 ? -1.258  40.969 26.594  1.00 43.72 ? 327 CYS A N     1 
ATOM   3397 C  CA    . CYS B 2 327 ? -1.841  40.078 25.610  1.00 43.12 ? 327 CYS A CA    1 
ATOM   3398 C  C     . CYS B 2 327 ? -1.834  40.761 24.255  1.00 42.29 ? 327 CYS A C     1 
ATOM   3399 O  O     . CYS B 2 327 ? -1.627  41.966 24.152  1.00 42.10 ? 327 CYS A O     1 
ATOM   3400 C  CB    . CYS B 2 327 ? -3.266  39.694 25.994  1.00 42.57 ? 327 CYS A CB    1 
ATOM   3401 S  SG    . CYS B 2 327 ? -3.321  38.270 27.087  1.00 43.22 ? 327 CYS A SG    1 
ATOM   3402 N  N     . TYR B 2 328 ? -2.039  39.974 23.210  1.00 41.42 ? 328 TYR A N     1 
ATOM   3403 C  CA    . TYR B 2 328 ? -2.050  40.508 21.867  1.00 39.83 ? 328 TYR A CA    1 
ATOM   3404 C  C     . TYR B 2 328 ? -3.051  39.757 20.996  1.00 39.55 ? 328 TYR A C     1 
ATOM   3405 O  O     . TYR B 2 328 ? -3.029  38.524 20.938  1.00 39.92 ? 328 TYR A O     1 
ATOM   3406 C  CB    . TYR B 2 328 ? -0.670  40.380 21.242  1.00 39.25 ? 328 TYR A CB    1 
ATOM   3407 C  CG    . TYR B 2 328 ? 0.446   41.049 22.005  1.00 40.12 ? 328 TYR A CG    1 
ATOM   3408 C  CD1   . TYR B 2 328 ? 1.008   40.446 23.129  1.00 39.79 ? 328 TYR A CD1   1 
ATOM   3409 C  CD2   . TYR B 2 328 ? 0.974   42.276 21.572  1.00 40.13 ? 328 TYR A CD2   1 
ATOM   3410 C  CE1   . TYR B 2 328 ? 2.069   41.046 23.799  1.00 40.48 ? 328 TYR A CE1   1 
ATOM   3411 C  CE2   . TYR B 2 328 ? 2.032   42.884 22.234  1.00 38.89 ? 328 TYR A CE2   1 
ATOM   3412 C  CZ    . TYR B 2 328 ? 2.572   42.265 23.342  1.00 39.87 ? 328 TYR A CZ    1 
ATOM   3413 O  OH    . TYR B 2 328 ? 3.613   42.860 24.004  1.00 40.00 ? 328 TYR A OH    1 
ATOM   3414 N  N     . LEU B 2 329 ? -3.935  40.502 20.338  1.00 37.31 ? 329 LEU A N     1 
ATOM   3415 C  CA    . LEU B 2 329 ? -4.904  39.914 19.433  1.00 35.30 ? 329 LEU A CA    1 
ATOM   3416 C  C     . LEU B 2 329 ? -4.484  40.377 18.050  1.00 35.08 ? 329 LEU A C     1 
ATOM   3417 O  O     . LEU B 2 329 ? -4.658  41.533 17.691  1.00 35.85 ? 329 LEU A O     1 
ATOM   3418 C  CB    . LEU B 2 329 ? -6.312  40.393 19.762  1.00 33.71 ? 329 LEU A CB    1 
ATOM   3419 C  CG    . LEU B 2 329 ? -6.720  40.009 21.179  1.00 33.16 ? 329 LEU A CG    1 
ATOM   3420 C  CD1   . LEU B 2 329 ? -8.177  40.375 21.402  1.00 33.35 ? 329 LEU A CD1   1 
ATOM   3421 C  CD2   . LEU B 2 329 ? -6.502  38.522 21.391  1.00 31.28 ? 329 LEU A CD2   1 
ATOM   3422 N  N     . LEU B 2 330 ? -3.913  39.459 17.286  1.00 35.22 ? 330 LEU A N     1 
ATOM   3423 C  CA    . LEU B 2 330 ? -3.417  39.747 15.942  1.00 34.90 ? 330 LEU A CA    1 
ATOM   3424 C  C     . LEU B 2 330 ? -4.464  39.555 14.837  1.00 34.46 ? 330 LEU A C     1 
ATOM   3425 O  O     . LEU B 2 330 ? -5.287  38.642 14.908  1.00 34.40 ? 330 LEU A O     1 
ATOM   3426 C  CB    . LEU B 2 330 ? -2.198  38.857 15.649  1.00 32.36 ? 330 LEU A CB    1 
ATOM   3427 C  CG    . LEU B 2 330 ? -0.987  38.911 16.580  1.00 29.71 ? 330 LEU A CG    1 
ATOM   3428 C  CD1   . LEU B 2 330 ? -1.397  38.791 18.014  1.00 28.59 ? 330 LEU A CD1   1 
ATOM   3429 C  CD2   . LEU B 2 330 ? -0.075  37.773 16.233  1.00 30.59 ? 330 LEU A CD2   1 
ATOM   3430 N  N     . PHE B 2 331 ? -4.409  40.426 13.827  1.00 34.53 ? 331 PHE A N     1 
ATOM   3431 C  CA    . PHE B 2 331 ? -5.302  40.383 12.664  1.00 35.12 ? 331 PHE A CA    1 
ATOM   3432 C  C     . PHE B 2 331 ? -4.568  40.913 11.422  1.00 35.41 ? 331 PHE A C     1 
ATOM   3433 O  O     . PHE B 2 331 ? -3.716  41.808 11.515  1.00 36.35 ? 331 PHE A O     1 
ATOM   3434 C  CB    . PHE B 2 331 ? -6.551  41.252 12.882  1.00 34.98 ? 331 PHE A CB    1 
ATOM   3435 C  CG    . PHE B 2 331 ? -7.359  40.872 14.077  1.00 35.42 ? 331 PHE A CG    1 
ATOM   3436 C  CD1   . PHE B 2 331 ? -8.150  39.731 14.067  1.00 35.43 ? 331 PHE A CD1   1 
ATOM   3437 C  CD2   . PHE B 2 331 ? -7.322  41.651 15.228  1.00 36.37 ? 331 PHE A CD2   1 
ATOM   3438 C  CE1   . PHE B 2 331 ? -8.897  39.366 15.188  1.00 35.18 ? 331 PHE A CE1   1 
ATOM   3439 C  CE2   . PHE B 2 331 ? -8.067  41.294 16.355  1.00 37.05 ? 331 PHE A CE2   1 
ATOM   3440 C  CZ    . PHE B 2 331 ? -8.855  40.150 16.334  1.00 35.61 ? 331 PHE A CZ    1 
ATOM   3441 N  N     . GLU B 2 332 ? -4.905  40.356 10.263  1.00 34.65 ? 332 GLU A N     1 
ATOM   3442 C  CA    . GLU B 2 332 ? -4.323  40.781 8.989   1.00 33.51 ? 332 GLU A CA    1 
ATOM   3443 C  C     . GLU B 2 332 ? -5.477  40.882 8.024   1.00 32.54 ? 332 GLU A C     1 
ATOM   3444 O  O     . GLU B 2 332 ? -6.094  39.876 7.702   1.00 32.81 ? 332 GLU A O     1 
ATOM   3445 C  CB    . GLU B 2 332 ? -3.315  39.755 8.459   1.00 33.30 ? 332 GLU A CB    1 
ATOM   3446 C  CG    . GLU B 2 332 ? -2.831  40.056 7.049   1.00 34.10 ? 332 GLU A CG    1 
ATOM   3447 C  CD    . GLU B 2 332 ? -2.052  38.910 6.438   1.00 35.40 ? 332 GLU A CD    1 
ATOM   3448 O  OE1   . GLU B 2 332 ? -2.557  37.768 6.499   1.00 37.15 ? 332 GLU A OE1   1 
ATOM   3449 O  OE2   . GLU B 2 332 ? -0.950  39.146 5.886   1.00 35.09 ? 332 GLU A OE2   1 
ATOM   3450 N  N     . CYS B 2 333 ? -5.776  42.090 7.565   1.00 32.12 ? 333 CYS A N     1 
ATOM   3451 C  CA    . CYS B 2 333 ? -6.886  42.282 6.644   1.00 32.84 ? 333 CYS A CA    1 
ATOM   3452 C  C     . CYS B 2 333 ? -6.460  42.606 5.233   1.00 33.38 ? 333 CYS A C     1 
ATOM   3453 O  O     . CYS B 2 333 ? -5.360  43.119 5.010   1.00 33.87 ? 333 CYS A O     1 
ATOM   3454 C  CB    . CYS B 2 333 ? -7.794  43.388 7.151   1.00 31.97 ? 333 CYS A CB    1 
ATOM   3455 S  SG    . CYS B 2 333 ? -8.471  42.992 8.734   1.00 32.77 ? 333 CYS A SG    1 
ATOM   3456 N  N     . GLN B 2 334 ? -7.349  42.306 4.284   1.00 33.26 ? 334 GLN A N     1 
ATOM   3457 C  CA    . GLN B 2 334 ? -7.094  42.563 2.875   1.00 30.86 ? 334 GLN A CA    1 
ATOM   3458 C  C     . GLN B 2 334 ? -7.375  44.001 2.535   1.00 29.00 ? 334 GLN A C     1 
ATOM   3459 O  O     . GLN B 2 334 ? -6.861  44.508 1.563   1.00 29.25 ? 334 GLN A O     1 
ATOM   3460 C  CB    . GLN B 2 334 ? -7.966  41.688 1.997   1.00 32.42 ? 334 GLN A CB    1 
ATOM   3461 C  CG    . GLN B 2 334 ? -7.437  40.302 1.752   1.00 34.95 ? 334 GLN A CG    1 
ATOM   3462 C  CD    . GLN B 2 334 ? -8.313  39.537 0.776   1.00 35.98 ? 334 GLN A CD    1 
ATOM   3463 O  OE1   . GLN B 2 334 ? -9.484  39.301 1.050   1.00 37.72 ? 334 GLN A OE1   1 
ATOM   3464 N  NE2   . GLN B 2 334 ? -7.753  39.158 -0.367  1.00 34.32 ? 334 GLN A NE2   1 
ATOM   3465 N  N     . ILE B 2 335 ? -8.208  44.659 3.325   1.00 28.29 ? 335 ILE A N     1 
ATOM   3466 C  CA    . ILE B 2 335 ? -8.518  46.060 3.064   1.00 28.42 ? 335 ILE A CA    1 
ATOM   3467 C  C     . ILE B 2 335 ? -7.820  47.027 4.015   1.00 28.59 ? 335 ILE A C     1 
ATOM   3468 O  O     . ILE B 2 335 ? -8.148  47.080 5.193   1.00 28.38 ? 335 ILE A O     1 
ATOM   3469 C  CB    . ILE B 2 335 ? -10.021 46.340 3.188   1.00 28.90 ? 335 ILE A CB    1 
ATOM   3470 C  CG1   . ILE B 2 335 ? -10.827 45.309 2.379   1.00 28.47 ? 335 ILE A CG1   1 
ATOM   3471 C  CG2   . ILE B 2 335 ? -10.294 47.790 2.796   1.00 26.92 ? 335 ILE A CG2   1 
ATOM   3472 C  CD1   . ILE B 2 335 ? -10.239 44.972 1.020   1.00 28.38 ? 335 ILE A CD1   1 
ATOM   3473 N  N     . LYS B 2 336 ? -6.854  47.789 3.518   1.00 29.13 ? 336 LYS A N     1 
ATOM   3474 C  CA    . LYS B 2 336 ? -6.197  48.760 4.379   1.00 29.87 ? 336 LYS A CA    1 
ATOM   3475 C  C     . LYS B 2 336 ? -7.169  49.930 4.578   1.00 30.29 ? 336 LYS A C     1 
ATOM   3476 O  O     . LYS B 2 336 ? -7.387  50.373 5.697   1.00 30.81 ? 336 LYS A O     1 
ATOM   3477 C  CB    . LYS B 2 336 ? -4.901  49.251 3.746   1.00 30.63 ? 336 LYS A CB    1 
ATOM   3478 C  CG    . LYS B 2 336 ? -3.730  48.279 3.842   1.00 31.76 ? 336 LYS A CG    1 
ATOM   3479 C  CD    . LYS B 2 336 ? -2.539  48.882 3.115   1.00 33.82 ? 336 LYS A CD    1 
ATOM   3480 C  CE    . LYS B 2 336 ? -1.228  48.230 3.485   1.00 36.05 ? 336 LYS A CE    1 
ATOM   3481 N  NZ    . LYS B 2 336 ? -0.069  49.131 3.162   1.00 37.38 ? 336 LYS A NZ    1 
ATOM   3482 N  N     . GLU B 2 337 ? -7.765  50.423 3.497   1.00 29.99 ? 337 GLU A N     1 
ATOM   3483 C  CA    . GLU B 2 337 ? -8.720  51.520 3.605   1.00 30.80 ? 337 GLU A CA    1 
ATOM   3484 C  C     . GLU B 2 337 ? -9.932  51.218 2.738   1.00 30.36 ? 337 GLU A C     1 
ATOM   3485 O  O     . GLU B 2 337 ? -9.818  50.461 1.793   1.00 30.82 ? 337 GLU A O     1 
ATOM   3486 C  CB    . GLU B 2 337 ? -8.079  52.835 3.166   1.00 32.08 ? 337 GLU A CB    1 
ATOM   3487 C  CG    . GLU B 2 337 ? -9.050  54.006 3.136   1.00 35.41 ? 337 GLU A CG    1 
ATOM   3488 C  CD    . GLU B 2 337 ? -8.352  55.352 3.233   1.00 37.68 ? 337 GLU A CD    1 
ATOM   3489 O  OE1   . GLU B 2 337 ? -7.422  55.596 2.439   1.00 38.49 ? 337 GLU A OE1   1 
ATOM   3490 O  OE2   . GLU B 2 337 ? -8.735  56.170 4.105   1.00 38.96 ? 337 GLU A OE2   1 
ATOM   3491 N  N     . ILE B 2 338 ? -11.088 51.796 3.056   1.00 29.68 ? 338 ILE A N     1 
ATOM   3492 C  CA    . ILE B 2 338 ? -12.303 51.550 2.278   1.00 29.77 ? 338 ILE A CA    1 
ATOM   3493 C  C     . ILE B 2 338 ? -13.095 52.832 2.108   1.00 30.82 ? 338 ILE A C     1 
ATOM   3494 O  O     . ILE B 2 338 ? -12.991 53.738 2.919   1.00 31.65 ? 338 ILE A O     1 
ATOM   3495 C  CB    . ILE B 2 338 ? -13.203 50.491 2.945   1.00 28.82 ? 338 ILE A CB    1 
ATOM   3496 C  CG1   . ILE B 2 338 ? -14.324 50.089 1.999   1.00 28.90 ? 338 ILE A CG1   1 
ATOM   3497 C  CG2   . ILE B 2 338 ? -13.827 51.041 4.201   1.00 27.31 ? 338 ILE A CG2   1 
ATOM   3498 C  CD1   . ILE B 2 338 ? -15.221 49.027 2.590   1.00 30.18 ? 338 ILE A CD1   1 
ATOM   3499 N  N     . SER B 2 339 ? -13.888 52.911 1.049   1.00 31.93 ? 339 SER A N     1 
ATOM   3500 C  CA    . SER B 2 339 ? -14.656 54.117 0.775   1.00 32.71 ? 339 SER A CA    1 
ATOM   3501 C  C     . SER B 2 339 ? -15.580 54.427 1.929   1.00 32.48 ? 339 SER A C     1 
ATOM   3502 O  O     . SER B 2 339 ? -15.895 53.544 2.731   1.00 31.36 ? 339 SER A O     1 
ATOM   3503 C  CB    . SER B 2 339 ? -15.468 53.966 -0.518  1.00 33.67 ? 339 SER A CB    1 
ATOM   3504 O  OG    . SER B 2 339 ? -16.501 53.009 -0.378  1.00 35.36 ? 339 SER A OG    1 
ATOM   3505 N  N     . ARG B 2 340 ? -15.994 55.686 2.027   1.00 32.85 ? 340 ARG A N     1 
ATOM   3506 C  CA    . ARG B 2 340 ? -16.886 56.070 3.098   1.00 34.73 ? 340 ARG A CA    1 
ATOM   3507 C  C     . ARG B 2 340 ? -18.335 55.782 2.699   1.00 34.36 ? 340 ARG A C     1 
ATOM   3508 O  O     . ARG B 2 340 ? -19.178 55.490 3.549   1.00 33.37 ? 340 ARG A O     1 
ATOM   3509 C  CB    . ARG B 2 340 ? -16.707 57.545 3.470   1.00 36.62 ? 340 ARG A CB    1 
ATOM   3510 C  CG    . ARG B 2 340 ? -17.809 58.014 4.414   1.00 40.41 ? 340 ARG A CG    1 
ATOM   3511 C  CD    . ARG B 2 340 ? -17.445 59.214 5.258   1.00 42.18 ? 340 ARG A CD    1 
ATOM   3512 N  NE    . ARG B 2 340 ? -16.515 58.868 6.330   1.00 43.90 ? 340 ARG A NE    1 
ATOM   3513 C  CZ    . ARG B 2 340 ? -15.205 58.724 6.163   1.00 44.48 ? 340 ARG A CZ    1 
ATOM   3514 N  NH1   . ARG B 2 340 ? -14.661 58.898 4.956   1.00 44.65 ? 340 ARG A NH1   1 
ATOM   3515 N  NH2   . ARG B 2 340 ? -14.444 58.408 7.204   1.00 43.90 ? 340 ARG A NH2   1 
ATOM   3516 N  N     . VAL B 2 341 ? -18.633 55.856 1.408   1.00 33.88 ? 341 VAL A N     1 
ATOM   3517 C  CA    . VAL B 2 341 ? -19.990 55.558 0.975   1.00 34.19 ? 341 VAL A CA    1 
ATOM   3518 C  C     . VAL B 2 341 ? -20.134 54.057 0.738   1.00 34.16 ? 341 VAL A C     1 
ATOM   3519 O  O     . VAL B 2 341 ? -19.196 53.384 0.311   1.00 33.25 ? 341 VAL A O     1 
ATOM   3520 C  CB    . VAL B 2 341 ? -20.381 56.285 -0.352  1.00 34.41 ? 341 VAL A CB    1 
ATOM   3521 C  CG1   . VAL B 2 341 ? -20.055 57.758 -0.258  1.00 35.03 ? 341 VAL A CG1   1 
ATOM   3522 C  CG2   . VAL B 2 341 ? -19.674 55.646 -1.544  1.00 33.81 ? 341 VAL A CG2   1 
ATOM   3523 N  N     . PHE B 2 342 ? -21.314 53.541 1.044   1.00 34.54 ? 342 PHE A N     1 
ATOM   3524 C  CA    . PHE B 2 342 ? -21.621 52.143 0.817   1.00 35.29 ? 342 PHE A CA    1 
ATOM   3525 C  C     . PHE B 2 342 ? -23.106 52.086 0.500   1.00 36.81 ? 342 PHE A C     1 
ATOM   3526 O  O     . PHE B 2 342 ? -23.841 53.049 0.746   1.00 37.18 ? 342 PHE A O     1 
ATOM   3527 C  CB    . PHE B 2 342 ? -21.272 51.287 2.040   1.00 35.10 ? 342 PHE A CB    1 
ATOM   3528 C  CG    . PHE B 2 342 ? -22.065 51.606 3.277   1.00 35.83 ? 342 PHE A CG    1 
ATOM   3529 C  CD1   . PHE B 2 342 ? -23.333 51.067 3.469   1.00 35.11 ? 342 PHE A CD1   1 
ATOM   3530 C  CD2   . PHE B 2 342 ? -21.527 52.432 4.274   1.00 36.65 ? 342 PHE A CD2   1 
ATOM   3531 C  CE1   . PHE B 2 342 ? -24.058 51.341 4.639   1.00 35.95 ? 342 PHE A CE1   1 
ATOM   3532 C  CE2   . PHE B 2 342 ? -22.241 52.714 5.444   1.00 36.03 ? 342 PHE A CE2   1 
ATOM   3533 C  CZ    . PHE B 2 342 ? -23.513 52.164 5.628   1.00 36.10 ? 342 PHE A CZ    1 
ATOM   3534 N  N     . ARG B 2 343 ? -23.550 50.980 -0.078  1.00 37.46 ? 343 ARG A N     1 
ATOM   3535 C  CA    . ARG B 2 343 ? -24.952 50.860 -0.418  1.00 37.59 ? 343 ARG A CA    1 
ATOM   3536 C  C     . ARG B 2 343 ? -25.658 49.995 0.595   1.00 38.63 ? 343 ARG A C     1 
ATOM   3537 O  O     . ARG B 2 343 ? -25.115 48.994 1.071   1.00 37.97 ? 343 ARG A O     1 
ATOM   3538 C  CB    . ARG B 2 343 ? -25.121 50.255 -1.805  1.00 36.75 ? 343 ARG A CB    1 
ATOM   3539 C  CG    . ARG B 2 343 ? -23.852 50.201 -2.606  1.00 37.08 ? 343 ARG A CG    1 
ATOM   3540 C  CD    . ARG B 2 343 ? -24.188 49.870 -4.021  1.00 38.95 ? 343 ARG A CD    1 
ATOM   3541 N  NE    . ARG B 2 343 ? -25.207 48.830 -4.080  1.00 40.00 ? 343 ARG A NE    1 
ATOM   3542 C  CZ    . ARG B 2 343 ? -26.006 48.628 -5.125  1.00 41.26 ? 343 ARG A CZ    1 
ATOM   3543 N  NH1   . ARG B 2 343 ? -25.908 49.398 -6.209  1.00 39.64 ? 343 ARG A NH1   1 
ATOM   3544 N  NH2   . ARG B 2 343 ? -26.909 47.655 -5.082  1.00 42.22 ? 343 ARG A NH2   1 
ATOM   3545 N  N     . ARG B 2 344 ? -26.874 50.406 0.925   1.00 40.09 ? 344 ARG A N     1 
ATOM   3546 C  CA    . ARG B 2 344 ? -27.712 49.692 1.870   1.00 41.84 ? 344 ARG A CA    1 
ATOM   3547 C  C     . ARG B 2 344 ? -28.973 49.373 1.110   1.00 41.28 ? 344 ARG A C     1 
ATOM   3548 O  O     . ARG B 2 344 ? -29.607 50.263 0.558   1.00 42.30 ? 344 ARG A O     1 
ATOM   3549 C  CB    . ARG B 2 344 ? -28.013 50.581 3.085   1.00 44.63 ? 344 ARG A CB    1 
ATOM   3550 C  CG    . ARG B 2 344 ? -29.268 50.223 3.894   1.00 47.91 ? 344 ARG A CG    1 
ATOM   3551 C  CD    . ARG B 2 344 ? -29.223 50.888 5.268   1.00 49.00 ? 344 ARG A CD    1 
ATOM   3552 N  NE    . ARG B 2 344 ? -28.353 50.151 6.189   1.00 51.79 ? 344 ARG A NE    1 
ATOM   3553 C  CZ    . ARG B 2 344 ? -27.515 50.720 7.056   1.00 53.47 ? 344 ARG A CZ    1 
ATOM   3554 N  NH1   . ARG B 2 344 ? -27.415 52.045 7.120   1.00 54.00 ? 344 ARG A NH1   1 
ATOM   3555 N  NH2   . ARG B 2 344 ? -26.800 49.969 7.893   1.00 53.04 ? 344 ARG A NH2   1 
ATOM   3556 N  N     . MET B 2 345 ? -29.321 48.097 1.058   1.00 40.23 ? 345 MET A N     1 
ATOM   3557 C  CA    . MET B 2 345 ? -30.512 47.668 0.346   1.00 39.20 ? 345 MET A CA    1 
ATOM   3558 C  C     . MET B 2 345 ? -31.787 48.273 0.929   1.00 39.03 ? 345 MET A C     1 
ATOM   3559 O  O     . MET B 2 345 ? -31.873 48.535 2.126   1.00 40.34 ? 345 MET A O     1 
ATOM   3560 C  CB    . MET B 2 345 ? -30.607 46.152 0.391   1.00 39.26 ? 345 MET A CB    1 
ATOM   3561 C  CG    . MET B 2 345 ? -31.808 45.599 -0.305  1.00 39.33 ? 345 MET A CG    1 
ATOM   3562 S  SD    . MET B 2 345 ? -31.910 43.843 -0.073  1.00 39.47 ? 345 MET A SD    1 
ATOM   3563 C  CE    . MET B 2 345 ? -32.759 43.792 1.504   1.00 39.62 ? 345 MET A CE    1 
ATOM   3564 N  N     . GLY B 2 346 ? -32.773 48.495 0.069   1.00 38.22 ? 346 GLY A N     1 
ATOM   3565 C  CA    . GLY B 2 346 ? -34.037 49.049 0.504   1.00 36.99 ? 346 GLY A CA    1 
ATOM   3566 C  C     . GLY B 2 346 ? -35.189 48.142 0.104   1.00 36.78 ? 346 GLY A C     1 
ATOM   3567 O  O     . GLY B 2 346 ? -34.971 47.057 -0.438  1.00 37.72 ? 346 GLY A O     1 
ATOM   3568 N  N     . PRO B 2 347 ? -36.436 48.562 0.345   1.00 35.77 ? 347 PRO A N     1 
ATOM   3569 C  CA    . PRO B 2 347 ? -37.617 47.762 0.000   1.00 35.52 ? 347 PRO A CA    1 
ATOM   3570 C  C     . PRO B 2 347 ? -37.844 47.591 -1.505  1.00 35.94 ? 347 PRO A C     1 
ATOM   3571 O  O     . PRO B 2 347 ? -37.232 48.275 -2.317  1.00 35.49 ? 347 PRO A O     1 
ATOM   3572 C  CB    . PRO B 2 347 ? -38.744 48.543 0.648   1.00 35.91 ? 347 PRO A CB    1 
ATOM   3573 C  CG    . PRO B 2 347 ? -38.266 49.975 0.500   1.00 35.56 ? 347 PRO A CG    1 
ATOM   3574 C  CD    . PRO B 2 347 ? -36.821 49.874 0.897   1.00 34.34 ? 347 PRO A CD    1 
ATOM   3575 N  N     . GLN B 2 348 ? -38.727 46.671 -1.874  1.00 36.39 ? 348 GLN A N     1 
ATOM   3576 C  CA    . GLN B 2 348 ? -39.039 46.463 -3.278  1.00 36.80 ? 348 GLN A CA    1 
ATOM   3577 C  C     . GLN B 2 348 ? -39.923 47.632 -3.693  1.00 36.82 ? 348 GLN A C     1 
ATOM   3578 O  O     . GLN B 2 348 ? -40.765 48.083 -2.914  1.00 36.44 ? 348 GLN A O     1 
ATOM   3579 C  CB    . GLN B 2 348 ? -39.780 45.152 -3.472  1.00 38.46 ? 348 GLN A CB    1 
ATOM   3580 C  CG    . GLN B 2 348 ? -38.896 43.942 -3.631  1.00 40.75 ? 348 GLN A CG    1 
ATOM   3581 C  CD    . GLN B 2 348 ? -39.655 42.783 -4.249  1.00 42.91 ? 348 GLN A CD    1 
ATOM   3582 O  OE1   . GLN B 2 348 ? -40.545 42.201 -3.626  1.00 43.24 ? 348 GLN A OE1   1 
ATOM   3583 N  NE2   . GLN B 2 348 ? -39.323 42.452 -5.494  1.00 44.30 ? 348 GLN A NE2   1 
ATOM   3584 N  N     . PHE B 2 349 ? -39.753 48.108 -4.923  1.00 36.81 ? 349 PHE A N     1 
ATOM   3585 C  CA    . PHE B 2 349 ? -40.500 49.277 -5.403  1.00 36.82 ? 349 PHE A CA    1 
ATOM   3586 C  C     . PHE B 2 349 ? -42.019 49.331 -5.193  1.00 36.75 ? 349 PHE A C     1 
ATOM   3587 O  O     . PHE B 2 349 ? -42.541 50.387 -4.823  1.00 35.81 ? 349 PHE A O     1 
ATOM   3588 C  CB    . PHE B 2 349 ? -40.150 49.557 -6.885  1.00 36.12 ? 349 PHE A CB    1 
ATOM   3589 C  CG    . PHE B 2 349 ? -41.026 48.835 -7.892  1.00 35.06 ? 349 PHE A CG    1 
ATOM   3590 C  CD1   . PHE B 2 349 ? -42.252 49.367 -8.275  1.00 32.62 ? 349 PHE A CD1   1 
ATOM   3591 C  CD2   . PHE B 2 349 ? -40.597 47.646 -8.490  1.00 34.54 ? 349 PHE A CD2   1 
ATOM   3592 C  CE1   . PHE B 2 349 ? -43.033 48.742 -9.230  1.00 32.46 ? 349 PHE A CE1   1 
ATOM   3593 C  CE2   . PHE B 2 349 ? -41.381 47.011 -9.455  1.00 33.72 ? 349 PHE A CE2   1 
ATOM   3594 C  CZ    . PHE B 2 349 ? -42.602 47.564 -9.824  1.00 32.71 ? 349 PHE A CZ    1 
ATOM   3595 N  N     . GLU B 2 350 ? -42.737 48.229 -5.409  1.00 37.15 ? 350 GLU A N     1 
ATOM   3596 C  CA    . GLU B 2 350 ? -44.186 48.291 -5.226  1.00 37.92 ? 350 GLU A CA    1 
ATOM   3597 C  C     . GLU B 2 350 ? -44.650 48.455 -3.798  1.00 38.13 ? 350 GLU A C     1 
ATOM   3598 O  O     . GLU B 2 350 ? -45.765 48.877 -3.574  1.00 38.80 ? 350 GLU A O     1 
ATOM   3599 C  CB    . GLU B 2 350 ? -44.913 47.091 -5.852  1.00 37.65 ? 350 GLU A CB    1 
ATOM   3600 C  CG    . GLU B 2 350 ? -44.190 45.783 -5.848  1.00 38.96 ? 350 GLU A CG    1 
ATOM   3601 C  CD    . GLU B 2 350 ? -43.441 45.545 -7.143  1.00 39.35 ? 350 GLU A CD    1 
ATOM   3602 O  OE1   . GLU B 2 350 ? -42.191 45.574 -7.104  1.00 39.78 ? 350 GLU A OE1   1 
ATOM   3603 O  OE2   . GLU B 2 350 ? -44.099 45.336 -8.189  1.00 37.53 ? 350 GLU A OE2   1 
ATOM   3604 N  N     . ASP B 2 351 ? -43.802 48.141 -2.829  1.00 39.20 ? 351 ASP A N     1 
ATOM   3605 C  CA    . ASP B 2 351 ? -44.189 48.285 -1.433  1.00 39.63 ? 351 ASP A CA    1 
ATOM   3606 C  C     . ASP B 2 351 ? -44.152 49.754 -1.029  1.00 39.94 ? 351 ASP A C     1 
ATOM   3607 O  O     . ASP B 2 351 ? -43.201 50.211 -0.413  1.00 39.96 ? 351 ASP A O     1 
ATOM   3608 C  CB    . ASP B 2 351 ? -43.245 47.473 -0.555  1.00 40.57 ? 351 ASP A CB    1 
ATOM   3609 C  CG    . ASP B 2 351 ? -43.528 47.645 0.917   1.00 41.80 ? 351 ASP A CG    1 
ATOM   3610 O  OD1   . ASP B 2 351 ? -42.836 46.992 1.720   1.00 43.06 ? 351 ASP A OD1   1 
ATOM   3611 O  OD2   . ASP B 2 351 ? -44.432 48.428 1.275   1.00 42.76 ? 351 ASP A OD2   1 
ATOM   3612 N  N     . GLU B 2 352 ? -45.204 50.487 -1.367  1.00 40.79 ? 352 GLU A N     1 
ATOM   3613 C  CA    . GLU B 2 352 ? -45.295 51.913 -1.058  1.00 42.35 ? 352 GLU A CA    1 
ATOM   3614 C  C     . GLU B 2 352 ? -45.028 52.296 0.401   1.00 43.00 ? 352 GLU A C     1 
ATOM   3615 O  O     . GLU B 2 352 ? -44.148 53.106 0.676   1.00 43.23 ? 352 GLU A O     1 
ATOM   3616 C  CB    . GLU B 2 352 ? -46.667 52.431 -1.476  1.00 42.84 ? 352 GLU A CB    1 
ATOM   3617 C  CG    . GLU B 2 352 ? -46.879 53.911 -1.270  1.00 45.24 ? 352 GLU A CG    1 
ATOM   3618 C  CD    . GLU B 2 352 ? -48.218 54.380 -1.837  1.00 48.28 ? 352 GLU A CD    1 
ATOM   3619 O  OE1   . GLU B 2 352 ? -48.440 55.611 -1.922  1.00 50.07 ? 352 GLU A OE1   1 
ATOM   3620 O  OE2   . GLU B 2 352 ? -49.050 53.515 -2.200  1.00 49.95 ? 352 GLU A OE2   1 
ATOM   3621 N  N     . ARG B 2 353 ? -45.785 51.715 1.327   1.00 43.88 ? 353 ARG A N     1 
ATOM   3622 C  CA    . ARG B 2 353 ? -45.640 52.017 2.746   1.00 44.90 ? 353 ARG A CA    1 
ATOM   3623 C  C     . ARG B 2 353 ? -44.184 52.123 3.178   1.00 45.00 ? 353 ARG A C     1 
ATOM   3624 O  O     . ARG B 2 353 ? -43.760 53.129 3.733   1.00 45.35 ? 353 ARG A O     1 
ATOM   3625 C  CB    . ARG B 2 353 ? -46.336 50.945 3.583   1.00 47.38 ? 353 ARG A CB    1 
ATOM   3626 C  CG    . ARG B 2 353 ? -46.448 51.279 5.073   1.00 50.44 ? 353 ARG A CG    1 
ATOM   3627 C  CD    . ARG B 2 353 ? -47.868 51.708 5.454   1.00 54.93 ? 353 ARG A CD    1 
ATOM   3628 N  NE    . ARG B 2 353 ? -48.398 52.748 4.566   1.00 59.03 ? 353 ARG A NE    1 
ATOM   3629 C  CZ    . ARG B 2 353 ? -49.571 53.367 4.724   1.00 60.63 ? 353 ARG A CZ    1 
ATOM   3630 N  NH1   . ARG B 2 353 ? -50.365 53.062 5.747   1.00 61.18 ? 353 ARG A NH1   1 
ATOM   3631 N  NH2   . ARG B 2 353 ? -49.951 54.298 3.854   1.00 60.72 ? 353 ARG A NH2   1 
ATOM   3632 N  N     . ASN B 2 354 ? -43.411 51.078 2.920   1.00 45.05 ? 354 ASN A N     1 
ATOM   3633 C  CA    . ASN B 2 354 ? -42.010 51.074 3.310   1.00 45.05 ? 354 ASN A CA    1 
ATOM   3634 C  C     . ASN B 2 354 ? -41.121 51.998 2.484   1.00 44.88 ? 354 ASN A C     1 
ATOM   3635 O  O     . ASN B 2 354 ? -40.151 52.555 2.996   1.00 45.10 ? 354 ASN A O     1 
ATOM   3636 C  CB    . ASN B 2 354 ? -41.477 49.645 3.269   1.00 45.39 ? 354 ASN A CB    1 
ATOM   3637 C  CG    . ASN B 2 354 ? -42.083 48.786 4.349   1.00 46.43 ? 354 ASN A CG    1 
ATOM   3638 O  OD1   . ASN B 2 354 ? -41.798 48.973 5.540   1.00 46.78 ? 354 ASN A OD1   1 
ATOM   3639 N  ND2   . ASN B 2 354 ? -42.945 47.854 3.951   1.00 45.63 ? 354 ASN A ND2   1 
ATOM   3640 N  N     . VAL B 2 355 ? -41.438 52.166 1.209   1.00 44.13 ? 355 VAL A N     1 
ATOM   3641 C  CA    . VAL B 2 355 ? -40.628 53.041 0.387   1.00 43.90 ? 355 VAL A CA    1 
ATOM   3642 C  C     . VAL B 2 355 ? -40.671 54.422 1.018   1.00 44.27 ? 355 VAL A C     1 
ATOM   3643 O  O     . VAL B 2 355 ? -39.642 55.068 1.199   1.00 43.77 ? 355 VAL A O     1 
ATOM   3644 C  CB    . VAL B 2 355 ? -41.156 53.102 -1.069  1.00 43.34 ? 355 VAL A CB    1 
ATOM   3645 C  CG1   . VAL B 2 355 ? -40.442 54.189 -1.854  1.00 41.99 ? 355 VAL A CG1   1 
ATOM   3646 C  CG2   . VAL B 2 355 ? -40.922 51.769 -1.747  1.00 43.44 ? 355 VAL A CG2   1 
ATOM   3647 N  N     . LYS B 2 356 ? -41.869 54.863 1.377   1.00 44.90 ? 356 LYS A N     1 
ATOM   3648 C  CA    . LYS B 2 356 ? -42.026 56.174 1.978   1.00 45.88 ? 356 LYS A CA    1 
ATOM   3649 C  C     . LYS B 2 356 ? -41.048 56.268 3.122   1.00 46.29 ? 356 LYS A C     1 
ATOM   3650 O  O     . LYS B 2 356 ? -40.115 57.075 3.099   1.00 46.66 ? 356 LYS A O     1 
ATOM   3651 C  CB    . LYS B 2 356 ? -43.452 56.355 2.491   1.00 46.62 ? 356 LYS A CB    1 
ATOM   3652 C  CG    . LYS B 2 356 ? -43.999 57.782 2.351   1.00 47.70 ? 356 LYS A CG    1 
ATOM   3653 C  CD    . LYS B 2 356 ? -45.525 57.776 2.462   1.00 48.08 ? 356 LYS A CD    1 
ATOM   3654 C  CE    . LYS B 2 356 ? -46.106 59.178 2.403   1.00 49.02 ? 356 LYS A CE    1 
ATOM   3655 N  NZ    . LYS B 2 356 ? -47.555 59.174 2.794   1.00 50.40 ? 356 LYS A NZ    1 
ATOM   3656 N  N     . LYS B 2 357 ? -41.251 55.409 4.111   1.00 46.71 ? 357 LYS A N     1 
ATOM   3657 C  CA    . LYS B 2 357 ? -40.392 55.382 5.287   1.00 47.36 ? 357 LYS A CA    1 
ATOM   3658 C  C     . LYS B 2 357 ? -38.890 55.416 4.958   1.00 47.50 ? 357 LYS A C     1 
ATOM   3659 O  O     . LYS B 2 357 ? -38.142 56.205 5.541   1.00 48.53 ? 357 LYS A O     1 
ATOM   3660 C  CB    . LYS B 2 357 ? -40.735 54.155 6.143   1.00 47.14 ? 357 LYS A CB    1 
ATOM   3661 C  CG    . LYS B 2 357 ? -42.168 54.179 6.686   1.00 46.91 ? 357 LYS A CG    1 
ATOM   3662 C  CD    . LYS B 2 357 ? -42.405 53.102 7.735   1.00 47.18 ? 357 LYS A CD    1 
ATOM   3663 C  CE    . LYS B 2 357 ? -41.499 53.281 8.945   1.00 46.80 ? 357 LYS A CE    1 
ATOM   3664 N  NZ    . LYS B 2 357 ? -41.586 52.120 9.863   1.00 46.21 ? 357 LYS A NZ    1 
ATOM   3665 N  N     . PHE B 2 358 ? -38.462 54.574 4.021   1.00 47.23 ? 358 PHE A N     1 
ATOM   3666 C  CA    . PHE B 2 358 ? -37.056 54.498 3.617   1.00 46.58 ? 358 PHE A CA    1 
ATOM   3667 C  C     . PHE B 2 358 ? -36.545 55.811 3.012   1.00 46.41 ? 358 PHE A C     1 
ATOM   3668 O  O     . PHE B 2 358 ? -35.405 56.225 3.255   1.00 46.27 ? 358 PHE A O     1 
ATOM   3669 C  CB    . PHE B 2 358 ? -36.885 53.369 2.601   1.00 46.08 ? 358 PHE A CB    1 
ATOM   3670 C  CG    . PHE B 2 358 ? -35.456 53.073 2.239   1.00 45.09 ? 358 PHE A CG    1 
ATOM   3671 C  CD1   . PHE B 2 358 ? -34.598 52.497 3.161   1.00 43.33 ? 358 PHE A CD1   1 
ATOM   3672 C  CD2   . PHE B 2 358 ? -34.988 53.317 0.947   1.00 45.27 ? 358 PHE A CD2   1 
ATOM   3673 C  CE1   . PHE B 2 358 ? -33.295 52.160 2.803   1.00 43.77 ? 358 PHE A CE1   1 
ATOM   3674 C  CE2   . PHE B 2 358 ? -33.681 52.984 0.577   1.00 43.89 ? 358 PHE A CE2   1 
ATOM   3675 C  CZ    . PHE B 2 358 ? -32.836 52.402 1.506   1.00 44.03 ? 358 PHE A CZ    1 
ATOM   3676 N  N     . LEU B 2 359 ? -37.390 56.469 2.227   1.00 45.77 ? 359 LEU A N     1 
ATOM   3677 C  CA    . LEU B 2 359 ? -36.990 57.713 1.600   1.00 45.41 ? 359 LEU A CA    1 
ATOM   3678 C  C     . LEU B 2 359 ? -37.096 58.919 2.508   1.00 45.96 ? 359 LEU A C     1 
ATOM   3679 O  O     . LEU B 2 359 ? -36.541 59.971 2.185   1.00 46.15 ? 359 LEU A O     1 
ATOM   3680 C  CB    . LEU B 2 359 ? -37.798 57.968 0.331   1.00 44.47 ? 359 LEU A CB    1 
ATOM   3681 C  CG    . LEU B 2 359 ? -37.630 56.936 -0.783  1.00 44.60 ? 359 LEU A CG    1 
ATOM   3682 C  CD1   . LEU B 2 359 ? -38.266 57.455 -2.069  1.00 42.60 ? 359 LEU A CD1   1 
ATOM   3683 C  CD2   . LEU B 2 359 ? -36.149 56.647 -0.992  1.00 43.45 ? 359 LEU A CD2   1 
ATOM   3684 N  N     . SER B 2 360 ? -37.793 58.788 3.634   1.00 46.09 ? 360 SER A N     1 
ATOM   3685 C  CA    . SER B 2 360 ? -37.925 59.925 4.544   1.00 47.05 ? 360 SER A CA    1 
ATOM   3686 C  C     . SER B 2 360 ? -36.613 60.196 5.287   1.00 48.03 ? 360 SER A C     1 
ATOM   3687 O  O     . SER B 2 360 ? -36.313 61.340 5.627   1.00 47.95 ? 360 SER A O     1 
ATOM   3688 C  CB    . SER B 2 360 ? -39.037 59.685 5.552   1.00 46.24 ? 360 SER A CB    1 
ATOM   3689 O  OG    . SER B 2 360 ? -38.642 58.697 6.484   1.00 47.38 ? 360 SER A OG    1 
ATOM   3690 N  N     . ARG B 2 361 ? -35.833 59.145 5.535   1.00 49.35 ? 361 ARG A N     1 
ATOM   3691 C  CA    . ARG B 2 361 ? -34.551 59.292 6.226   1.00 50.93 ? 361 ARG A CA    1 
ATOM   3692 C  C     . ARG B 2 361 ? -33.620 60.105 5.344   1.00 50.94 ? 361 ARG A C     1 
ATOM   3693 O  O     . ARG B 2 361 ? -33.080 59.594 4.364   1.00 51.56 ? 361 ARG A O     1 
ATOM   3694 C  CB    . ARG B 2 361 ? -33.926 57.921 6.495   1.00 52.96 ? 361 ARG A CB    1 
ATOM   3695 C  CG    . ARG B 2 361 ? -34.661 57.084 7.531   1.00 56.60 ? 361 ARG A CG    1 
ATOM   3696 C  CD    . ARG B 2 361 ? -34.464 57.650 8.931   1.00 59.52 ? 361 ARG A CD    1 
ATOM   3697 N  NE    . ARG B 2 361 ? -33.729 56.734 9.804   1.00 62.78 ? 361 ARG A NE    1 
ATOM   3698 C  CZ    . ARG B 2 361 ? -32.547 56.190 9.515   1.00 64.23 ? 361 ARG A CZ    1 
ATOM   3699 N  NH1   . ARG B 2 361 ? -31.941 56.457 8.361   1.00 65.38 ? 361 ARG A NH1   1 
ATOM   3700 N  NH2   . ARG B 2 361 ? -31.961 55.381 10.387  1.00 64.50 ? 361 ARG A NH2   1 
ATOM   3701 N  N     . ASN B 2 362 ? -33.431 61.371 5.690   1.00 50.82 ? 362 ASN A N     1 
ATOM   3702 C  CA    . ASN B 2 362 ? -32.572 62.248 4.901   1.00 51.52 ? 362 ASN A CA    1 
ATOM   3703 C  C     . ASN B 2 362 ? -31.093 61.910 5.023   1.00 49.92 ? 362 ASN A C     1 
ATOM   3704 O  O     . ASN B 2 362 ? -30.537 61.855 6.123   1.00 48.21 ? 362 ASN A O     1 
ATOM   3705 C  CB    . ASN B 2 362 ? -32.796 63.693 5.318   1.00 55.17 ? 362 ASN A CB    1 
ATOM   3706 C  CG    . ASN B 2 362 ? -32.678 63.874 6.811   1.00 58.48 ? 362 ASN A CG    1 
ATOM   3707 O  OD1   . ASN B 2 362 ? -33.204 63.061 7.578   1.00 60.82 ? 362 ASN A OD1   1 
ATOM   3708 N  ND2   . ASN B 2 362 ? -31.991 64.936 7.239   1.00 60.10 ? 362 ASN A ND2   1 
ATOM   3709 N  N     . ARG B 2 363 ? -30.471 61.691 3.867   1.00 48.65 ? 363 ARG A N     1 
ATOM   3710 C  CA    . ARG B 2 363 ? -29.056 61.356 3.781   1.00 46.58 ? 363 ARG A CA    1 
ATOM   3711 C  C     . ARG B 2 363 ? -28.397 62.284 2.780   1.00 45.53 ? 363 ARG A C     1 
ATOM   3712 O  O     . ARG B 2 363 ? -29.068 62.989 2.021   1.00 44.33 ? 363 ARG A O     1 
ATOM   3713 C  CB    . ARG B 2 363 ? -28.877 59.894 3.350   1.00 46.78 ? 363 ARG A CB    1 
ATOM   3714 C  CG    . ARG B 2 363 ? -30.197 59.167 3.086   1.00 45.53 ? 363 ARG A CG    1 
ATOM   3715 C  CD    . ARG B 2 363 ? -30.044 57.659 3.135   1.00 44.97 ? 363 ARG A CD    1 
ATOM   3716 N  NE    . ARG B 2 363 ? -31.348 57.014 3.010   1.00 47.25 ? 363 ARG A NE    1 
ATOM   3717 C  CZ    . ARG B 2 363 ? -31.736 55.945 3.703   1.00 48.02 ? 363 ARG A CZ    1 
ATOM   3718 N  NH1   . ARG B 2 363 ? -30.915 55.377 4.582   1.00 48.41 ? 363 ARG A NH1   1 
ATOM   3719 N  NH2   . ARG B 2 363 ? -32.962 55.458 3.539   1.00 47.15 ? 363 ARG A NH2   1 
ATOM   3720 N  N     . ALA B 2 364 ? -27.076 62.267 2.766   1.00 44.82 ? 364 ALA A N     1 
ATOM   3721 C  CA    . ALA B 2 364 ? -26.330 63.141 1.881   1.00 45.58 ? 364 ALA A CA    1 
ATOM   3722 C  C     . ALA B 2 364 ? -26.435 62.866 0.391   1.00 46.30 ? 364 ALA A C     1 
ATOM   3723 O  O     . ALA B 2 364 ? -26.159 63.757 -0.406  1.00 46.34 ? 364 ALA A O     1 
ATOM   3724 C  CB    . ALA B 2 364 ? -24.870 63.136 2.279   1.00 44.86 ? 364 ALA A CB    1 
ATOM   3725 N  N     . PHE B 2 365 ? -26.858 61.669 -0.008  1.00 47.60 ? 365 PHE A N     1 
ATOM   3726 C  CA    . PHE B 2 365 ? -26.858 61.375 -1.433  1.00 47.99 ? 365 PHE A CA    1 
ATOM   3727 C  C     . PHE B 2 365 ? -28.069 61.054 -2.298  1.00 48.49 ? 365 PHE A C     1 
ATOM   3728 O  O     . PHE B 2 365 ? -27.903 60.864 -3.502  1.00 49.15 ? 365 PHE A O     1 
ATOM   3729 C  CB    . PHE B 2 365 ? -25.793 60.318 -1.698  1.00 47.90 ? 365 PHE A CB    1 
ATOM   3730 C  CG    . PHE B 2 365 ? -24.400 60.833 -1.560  1.00 47.98 ? 365 PHE A CG    1 
ATOM   3731 C  CD1   . PHE B 2 365 ? -23.566 60.361 -0.557  1.00 48.22 ? 365 PHE A CD1   1 
ATOM   3732 C  CD2   . PHE B 2 365 ? -23.913 61.786 -2.451  1.00 47.82 ? 365 PHE A CD2   1 
ATOM   3733 C  CE1   . PHE B 2 365 ? -22.259 60.830 -0.445  1.00 48.76 ? 365 PHE A CE1   1 
ATOM   3734 C  CE2   . PHE B 2 365 ? -22.611 62.263 -2.350  1.00 47.53 ? 365 PHE A CE2   1 
ATOM   3735 C  CZ    . PHE B 2 365 ? -21.781 61.785 -1.348  1.00 48.30 ? 365 PHE A CZ    1 
ATOM   3736 N  N     . ARG B 2 366 ? -29.275 60.972 -1.756  1.00 48.38 ? 366 ARG A N     1 
ATOM   3737 C  CA    . ARG B 2 366 ? -30.405 60.707 -2.659  1.00 48.20 ? 366 ARG A CA    1 
ATOM   3738 C  C     . ARG B 2 366 ? -30.322 59.306 -3.274  1.00 45.94 ? 366 ARG A C     1 
ATOM   3739 O  O     . ARG B 2 366 ? -29.515 59.054 -4.169  1.00 44.77 ? 366 ARG A O     1 
ATOM   3740 C  CB    . ARG B 2 366 ? -30.427 61.759 -3.791  1.00 49.80 ? 366 ARG A CB    1 
ATOM   3741 C  CG    . ARG B 2 366 ? -31.578 61.632 -4.775  1.00 53.32 ? 366 ARG A CG    1 
ATOM   3742 C  CD    . ARG B 2 366 ? -31.542 62.696 -5.891  1.00 56.44 ? 366 ARG A CD    1 
ATOM   3743 N  NE    . ARG B 2 366 ? -31.475 64.076 -5.389  1.00 60.48 ? 366 ARG A NE    1 
ATOM   3744 C  CZ    . ARG B 2 366 ? -31.997 65.138 -6.015  1.00 61.56 ? 366 ARG A CZ    1 
ATOM   3745 N  NH1   . ARG B 2 366 ? -32.639 64.983 -7.172  1.00 61.60 ? 366 ARG A NH1   1 
ATOM   3746 N  NH2   . ARG B 2 366 ? -31.867 66.362 -5.500  1.00 60.04 ? 366 ARG A NH2   1 
ATOM   3747 N  N     . PRO B 2 367 ? -31.165 58.381 -2.790  1.00 44.41 ? 367 PRO A N     1 
ATOM   3748 C  CA    . PRO B 2 367 ? -31.264 56.985 -3.225  1.00 43.17 ? 367 PRO A CA    1 
ATOM   3749 C  C     . PRO B 2 367 ? -31.729 56.745 -4.669  1.00 42.05 ? 367 PRO A C     1 
ATOM   3750 O  O     . PRO B 2 367 ? -32.262 57.637 -5.326  1.00 42.36 ? 367 PRO A O     1 
ATOM   3751 C  CB    . PRO B 2 367 ? -32.205 56.375 -2.192  1.00 42.73 ? 367 PRO A CB    1 
ATOM   3752 C  CG    . PRO B 2 367 ? -33.033 57.538 -1.749  1.00 42.45 ? 367 PRO A CG    1 
ATOM   3753 C  CD    . PRO B 2 367 ? -32.016 58.614 -1.611  1.00 43.47 ? 367 PRO A CD    1 
ATOM   3754 N  N     . PHE B 2 368 ? -31.518 55.521 -5.145  1.00 39.94 ? 368 PHE A N     1 
ATOM   3755 C  CA    . PHE B 2 368 ? -31.860 55.135 -6.506  1.00 37.63 ? 368 PHE A CA    1 
ATOM   3756 C  C     . PHE B 2 368 ? -32.568 53.776 -6.547  1.00 37.49 ? 368 PHE A C     1 
ATOM   3757 O  O     . PHE B 2 368 ? -32.669 53.084 -5.531  1.00 37.71 ? 368 PHE A O     1 
ATOM   3758 C  CB    . PHE B 2 368 ? -30.588 55.066 -7.351  1.00 36.05 ? 368 PHE A CB    1 
ATOM   3759 C  CG    . PHE B 2 368 ? -29.522 54.187 -6.760  1.00 35.95 ? 368 PHE A CG    1 
ATOM   3760 C  CD1   . PHE B 2 368 ? -28.699 54.652 -5.739  1.00 36.73 ? 368 PHE A CD1   1 
ATOM   3761 C  CD2   . PHE B 2 368 ? -29.376 52.877 -7.177  1.00 35.83 ? 368 PHE A CD2   1 
ATOM   3762 C  CE1   . PHE B 2 368 ? -27.749 53.816 -5.143  1.00 36.90 ? 368 PHE A CE1   1 
ATOM   3763 C  CE2   . PHE B 2 368 ? -28.427 52.033 -6.584  1.00 36.15 ? 368 PHE A CE2   1 
ATOM   3764 C  CZ    . PHE B 2 368 ? -27.617 52.504 -5.569  1.00 35.78 ? 368 PHE A CZ    1 
ATOM   3765 N  N     . ILE B 2 369 ? -33.055 53.409 -7.732  1.00 36.41 ? 369 ILE A N     1 
ATOM   3766 C  CA    . ILE B 2 369 ? -33.755 52.150 -7.951  1.00 35.10 ? 369 ILE A CA    1 
ATOM   3767 C  C     . ILE B 2 369 ? -32.920 51.230 -8.832  1.00 36.16 ? 369 ILE A C     1 
ATOM   3768 O  O     . ILE B 2 369 ? -32.389 51.644 -9.852  1.00 36.69 ? 369 ILE A O     1 
ATOM   3769 C  CB    . ILE B 2 369 ? -35.097 52.362 -8.667  1.00 33.50 ? 369 ILE A CB    1 
ATOM   3770 C  CG1   . ILE B 2 369 ? -36.023 53.243 -7.828  1.00 32.61 ? 369 ILE A CG1   1 
ATOM   3771 C  CG2   . ILE B 2 369 ? -35.747 51.026 -8.928  1.00 35.19 ? 369 ILE A CG2   1 
ATOM   3772 C  CD1   . ILE B 2 369 ? -37.323 53.613 -8.528  1.00 29.24 ? 369 ILE A CD1   1 
ATOM   3773 N  N     . GLU B 2 370 ? -32.824 49.970 -8.440  1.00 37.44 ? 370 GLU A N     1 
ATOM   3774 C  CA    . GLU B 2 370 ? -32.061 48.998 -9.193  1.00 38.21 ? 370 GLU A CA    1 
ATOM   3775 C  C     . GLU B 2 370 ? -32.794 47.662 -9.115  1.00 39.30 ? 370 GLU A C     1 
ATOM   3776 O  O     . GLU B 2 370 ? -33.054 47.148 -8.027  1.00 40.01 ? 370 GLU A O     1 
ATOM   3777 C  CB    . GLU B 2 370 ? -30.667 48.900 -8.588  1.00 39.02 ? 370 GLU A CB    1 
ATOM   3778 C  CG    . GLU B 2 370 ? -29.682 48.061 -9.365  1.00 40.64 ? 370 GLU A CG    1 
ATOM   3779 C  CD    . GLU B 2 370 ? -28.280 48.641 -9.287  1.00 42.66 ? 370 GLU A CD    1 
ATOM   3780 O  OE1   . GLU B 2 370 ? -28.023 49.672 -9.970  1.00 42.17 ? 370 GLU A OE1   1 
ATOM   3781 O  OE2   . GLU B 2 370 ? -27.448 48.076 -8.532  1.00 42.50 ? 370 GLU A OE2   1 
ATOM   3782 N  N     . ASN B 2 371 ? -33.148 47.111 -10.269 1.00 39.64 ? 371 ASN A N     1 
ATOM   3783 C  CA    . ASN B 2 371 ? -33.869 45.848 -10.327 1.00 39.87 ? 371 ASN A CA    1 
ATOM   3784 C  C     . ASN B 2 371 ? -35.093 45.818 -9.426  1.00 40.83 ? 371 ASN A C     1 
ATOM   3785 O  O     . ASN B 2 371 ? -35.196 45.014 -8.498  1.00 41.10 ? 371 ASN A O     1 
ATOM   3786 C  CB    . ASN B 2 371 ? -32.944 44.695 -9.980  1.00 39.65 ? 371 ASN A CB    1 
ATOM   3787 C  CG    . ASN B 2 371 ? -31.663 44.751 -10.755 1.00 40.97 ? 371 ASN A CG    1 
ATOM   3788 O  OD1   . ASN B 2 371 ? -31.669 44.984 -11.963 1.00 41.13 ? 371 ASN A OD1   1 
ATOM   3789 N  ND2   . ASN B 2 371 ? -30.547 44.542 -10.070 1.00 42.47 ? 371 ASN A ND2   1 
ATOM   3790 N  N     . GLY B 2 372 ? -36.018 46.727 -9.706  1.00 41.48 ? 372 GLY A N     1 
ATOM   3791 C  CA    . GLY B 2 372 ? -37.264 46.773 -8.973  1.00 41.08 ? 372 GLY A CA    1 
ATOM   3792 C  C     . GLY B 2 372 ? -37.226 47.130 -7.510  1.00 40.91 ? 372 GLY A C     1 
ATOM   3793 O  O     . GLY B 2 372 ? -38.250 47.000 -6.827  1.00 40.31 ? 372 GLY A O     1 
ATOM   3794 N  N     . ARG B 2 373 ? -36.078 47.564 -7.002  1.00 40.36 ? 373 ARG A N     1 
ATOM   3795 C  CA    . ARG B 2 373 ? -36.053 47.943 -5.597  1.00 40.65 ? 373 ARG A CA    1 
ATOM   3796 C  C     . ARG B 2 373 ? -35.117 49.092 -5.301  1.00 40.11 ? 373 ARG A C     1 
ATOM   3797 O  O     . ARG B 2 373 ? -34.139 49.303 -6.010  1.00 40.58 ? 373 ARG A O     1 
ATOM   3798 C  CB    . ARG B 2 373 ? -35.735 46.740 -4.711  1.00 41.24 ? 373 ARG A CB    1 
ATOM   3799 C  CG    . ARG B 2 373 ? -34.286 46.373 -4.572  1.00 42.55 ? 373 ARG A CG    1 
ATOM   3800 C  CD    . ARG B 2 373 ? -34.176 45.024 -3.859  1.00 43.97 ? 373 ARG A CD    1 
ATOM   3801 N  NE    . ARG B 2 373 ? -34.746 45.032 -2.510  1.00 42.75 ? 373 ARG A NE    1 
ATOM   3802 C  CZ    . ARG B 2 373 ? -35.374 43.993 -1.968  1.00 41.51 ? 373 ARG A CZ    1 
ATOM   3803 N  NH1   . ARG B 2 373 ? -35.521 42.873 -2.659  1.00 40.50 ? 373 ARG A NH1   1 
ATOM   3804 N  NH2   . ARG B 2 373 ? -35.828 44.060 -0.729  1.00 41.33 ? 373 ARG A NH2   1 
ATOM   3805 N  N     . TRP B 2 374 ? -35.442 49.846 -4.254  1.00 39.85 ? 374 TRP A N     1 
ATOM   3806 C  CA    . TRP B 2 374 ? -34.645 51.002 -3.864  1.00 39.17 ? 374 TRP A CA    1 
ATOM   3807 C  C     . TRP B 2 374 ? -33.389 50.650 -3.077  1.00 38.20 ? 374 TRP A C     1 
ATOM   3808 O  O     . TRP B 2 374 ? -33.342 49.650 -2.365  1.00 37.54 ? 374 TRP A O     1 
ATOM   3809 C  CB    . TRP B 2 374 ? -35.485 51.975 -3.036  1.00 39.06 ? 374 TRP A CB    1 
ATOM   3810 C  CG    . TRP B 2 374 ? -36.613 52.606 -3.775  1.00 38.22 ? 374 TRP A CG    1 
ATOM   3811 C  CD1   . TRP B 2 374 ? -37.821 52.046 -4.058  1.00 38.47 ? 374 TRP A CD1   1 
ATOM   3812 C  CD2   . TRP B 2 374 ? -36.638 53.923 -4.336  1.00 38.14 ? 374 TRP A CD2   1 
ATOM   3813 N  NE1   . TRP B 2 374 ? -38.606 52.932 -4.764  1.00 38.05 ? 374 TRP A NE1   1 
ATOM   3814 C  CE2   . TRP B 2 374 ? -37.903 54.092 -4.950  1.00 38.19 ? 374 TRP A CE2   1 
ATOM   3815 C  CE3   . TRP B 2 374 ? -35.716 54.979 -4.381  1.00 37.55 ? 374 TRP A CE3   1 
ATOM   3816 C  CZ2   . TRP B 2 374 ? -38.270 55.274 -5.602  1.00 36.83 ? 374 TRP A CZ2   1 
ATOM   3817 C  CZ3   . TRP B 2 374 ? -36.078 56.153 -5.026  1.00 37.29 ? 374 TRP A CZ3   1 
ATOM   3818 C  CH2   . TRP B 2 374 ? -37.349 56.290 -5.628  1.00 38.09 ? 374 TRP A CH2   1 
ATOM   3819 N  N     . TRP B 2 375 ? -32.371 51.487 -3.245  1.00 37.72 ? 375 TRP A N     1 
ATOM   3820 C  CA    . TRP B 2 375 ? -31.086 51.353 -2.559  1.00 37.37 ? 375 TRP A CA    1 
ATOM   3821 C  C     . TRP B 2 375 ? -30.712 52.776 -2.169  1.00 37.08 ? 375 TRP A C     1 
ATOM   3822 O  O     . TRP B 2 375 ? -31.131 53.738 -2.828  1.00 37.07 ? 375 TRP A O     1 
ATOM   3823 C  CB    . TRP B 2 375 ? -29.989 50.799 -3.480  1.00 36.28 ? 375 TRP A CB    1 
ATOM   3824 C  CG    . TRP B 2 375 ? -30.241 49.442 -3.987  1.00 35.92 ? 375 TRP A CG    1 
ATOM   3825 C  CD1   . TRP B 2 375 ? -31.122 49.082 -4.964  1.00 36.79 ? 375 TRP A CD1   1 
ATOM   3826 C  CD2   . TRP B 2 375 ? -29.639 48.237 -3.525  1.00 35.94 ? 375 TRP A CD2   1 
ATOM   3827 N  NE1   . TRP B 2 375 ? -31.107 47.718 -5.138  1.00 37.33 ? 375 TRP A NE1   1 
ATOM   3828 C  CE2   . TRP B 2 375 ? -30.203 47.175 -4.265  1.00 36.63 ? 375 TRP A CE2   1 
ATOM   3829 C  CE3   . TRP B 2 375 ? -28.679 47.947 -2.557  1.00 36.31 ? 375 TRP A CE3   1 
ATOM   3830 C  CZ2   . TRP B 2 375 ? -29.838 45.843 -4.063  1.00 37.23 ? 375 TRP A CZ2   1 
ATOM   3831 C  CZ3   . TRP B 2 375 ? -28.315 46.616 -2.357  1.00 37.48 ? 375 TRP A CZ3   1 
ATOM   3832 C  CH2   . TRP B 2 375 ? -28.895 45.584 -3.107  1.00 36.45 ? 375 TRP A CH2   1 
ATOM   3833 N  N     . ALA B 2 376 ? -29.927 52.911 -1.107  1.00 35.74 ? 376 ALA A N     1 
ATOM   3834 C  CA    . ALA B 2 376 ? -29.518 54.223 -0.651  1.00 34.73 ? 376 ALA A CA    1 
ATOM   3835 C  C     . ALA B 2 376 ? -28.033 54.230 -0.387  1.00 33.76 ? 376 ALA A C     1 
ATOM   3836 O  O     . ALA B 2 376 ? -27.437 53.194 -0.081  1.00 33.07 ? 376 ALA A O     1 
ATOM   3837 C  CB    . ALA B 2 376 ? -30.283 54.605 0.621   1.00 34.61 ? 376 ALA A CB    1 
ATOM   3838 N  N     . PHE B 2 377 ? -27.445 55.411 -0.527  1.00 32.83 ? 377 PHE A N     1 
ATOM   3839 C  CA    . PHE B 2 377 ? -26.029 55.615 -0.280  1.00 32.17 ? 377 PHE A CA    1 
ATOM   3840 C  C     . PHE B 2 377 ? -25.837 56.047 1.178   1.00 32.84 ? 377 PHE A C     1 
ATOM   3841 O  O     . PHE B 2 377 ? -26.403 57.041 1.624   1.00 31.89 ? 377 PHE A O     1 
ATOM   3842 C  CB    . PHE B 2 377 ? -25.494 56.687 -1.227  1.00 28.57 ? 377 PHE A CB    1 
ATOM   3843 C  CG    . PHE B 2 377 ? -25.121 56.166 -2.566  1.00 26.36 ? 377 PHE A CG    1 
ATOM   3844 C  CD1   . PHE B 2 377 ? -25.590 56.776 -3.721  1.00 25.85 ? 377 PHE A CD1   1 
ATOM   3845 C  CD2   . PHE B 2 377 ? -24.280 55.065 -2.683  1.00 26.13 ? 377 PHE A CD2   1 
ATOM   3846 C  CE1   . PHE B 2 377 ? -25.228 56.295 -4.982  1.00 23.15 ? 377 PHE A CE1   1 
ATOM   3847 C  CE2   . PHE B 2 377 ? -23.912 54.580 -3.934  1.00 24.08 ? 377 PHE A CE2   1 
ATOM   3848 C  CZ    . PHE B 2 377 ? -24.389 55.200 -5.082  1.00 23.60 ? 377 PHE A CZ    1 
ATOM   3849 N  N     . GLU B 2 378 ? -25.043 55.296 1.923   1.00 35.04 ? 378 GLU A N     1 
ATOM   3850 C  CA    . GLU B 2 378 ? -24.804 55.638 3.314   1.00 38.16 ? 378 GLU A CA    1 
ATOM   3851 C  C     . GLU B 2 378 ? -23.317 55.879 3.518   1.00 38.46 ? 378 GLU A C     1 
ATOM   3852 O  O     . GLU B 2 378 ? -22.498 55.503 2.677   1.00 37.88 ? 378 GLU A O     1 
ATOM   3853 C  CB    . GLU B 2 378 ? -25.273 54.507 4.231   1.00 40.56 ? 378 GLU A CB    1 
ATOM   3854 C  CG    . GLU B 2 378 ? -26.318 54.907 5.264   1.00 44.25 ? 378 GLU A CG    1 
ATOM   3855 C  CD    . GLU B 2 378 ? -27.722 55.002 4.684   1.00 46.83 ? 378 GLU A CD    1 
ATOM   3856 O  OE1   . GLU B 2 378 ? -27.924 55.802 3.740   1.00 48.05 ? 378 GLU A OE1   1 
ATOM   3857 O  OE2   . GLU B 2 378 ? -28.620 54.274 5.181   1.00 47.88 ? 378 GLU A OE2   1 
ATOM   3858 N  N     . MET B 2 379 ? -22.974 56.499 4.641   1.00 39.08 ? 379 MET A N     1 
ATOM   3859 C  CA    . MET B 2 379 ? -21.580 56.791 4.958   1.00 40.15 ? 379 MET A CA    1 
ATOM   3860 C  C     . MET B 2 379 ? -21.058 56.000 6.163   1.00 40.42 ? 379 MET A C     1 
ATOM   3861 O  O     . MET B 2 379 ? -21.741 55.857 7.180   1.00 40.79 ? 379 MET A O     1 
ATOM   3862 C  CB    . MET B 2 379 ? -21.412 58.287 5.207   1.00 39.84 ? 379 MET A CB    1 
ATOM   3863 C  CG    . MET B 2 379 ? -21.811 59.122 4.020   1.00 39.67 ? 379 MET A CG    1 
ATOM   3864 S  SD    . MET B 2 379 ? -20.734 58.783 2.662   1.00 39.80 ? 379 MET A SD    1 
ATOM   3865 C  CE    . MET B 2 379 ? -19.724 60.288 2.665   1.00 38.91 ? 379 MET A CE    1 
ATOM   3866 N  N     . ARG B 2 380 ? -19.839 55.492 6.044   1.00 39.79 ? 380 ARG A N     1 
ATOM   3867 C  CA    . ARG B 2 380 ? -19.252 54.720 7.117   1.00 39.16 ? 380 ARG A CA    1 
ATOM   3868 C  C     . ARG B 2 380 ? -18.722 55.613 8.224   1.00 39.83 ? 380 ARG A C     1 
ATOM   3869 O  O     . ARG B 2 380 ? -18.240 56.717 7.962   1.00 40.35 ? 380 ARG A O     1 
ATOM   3870 C  CB    . ARG B 2 380 ? -18.113 53.848 6.583   1.00 37.69 ? 380 ARG A CB    1 
ATOM   3871 C  CG    . ARG B 2 380 ? -18.556 52.699 5.729   1.00 34.76 ? 380 ARG A CG    1 
ATOM   3872 C  CD    . ARG B 2 380 ? -17.459 51.679 5.652   1.00 33.34 ? 380 ARG A CD    1 
ATOM   3873 N  NE    . ARG B 2 380 ? -17.856 50.510 4.873   1.00 32.84 ? 380 ARG A NE    1 
ATOM   3874 C  CZ    . ARG B 2 380 ? -18.024 50.511 3.555   1.00 31.67 ? 380 ARG A CZ    1 
ATOM   3875 N  NH1   . ARG B 2 380 ? -17.832 51.618 2.849   1.00 30.98 ? 380 ARG A NH1   1 
ATOM   3876 N  NH2   . ARG B 2 380 ? -18.375 49.396 2.942   1.00 32.37 ? 380 ARG A NH2   1 
ATOM   3877 N  N     . LYS B 2 381 ? -18.810 55.116 9.456   1.00 40.51 ? 381 LYS A N     1 
ATOM   3878 C  CA    . LYS B 2 381 ? -18.322 55.837 10.621  1.00 41.63 ? 381 LYS A CA    1 
ATOM   3879 C  C     . LYS B 2 381 ? -16.805 55.702 10.729  1.00 41.15 ? 381 LYS A C     1 
ATOM   3880 O  O     . LYS B 2 381 ? -16.169 56.411 11.514  1.00 41.95 ? 381 LYS A O     1 
ATOM   3881 C  CB    . LYS B 2 381 ? -18.978 55.289 11.886  1.00 44.27 ? 381 LYS A CB    1 
ATOM   3882 C  CG    . LYS B 2 381 ? -20.320 55.918 12.245  1.00 47.16 ? 381 LYS A CG    1 
ATOM   3883 C  CD    . LYS B 2 381 ? -20.142 57.311 12.870  1.00 49.03 ? 381 LYS A CD    1 
ATOM   3884 C  CE    . LYS B 2 381 ? -21.494 57.920 13.260  1.00 50.21 ? 381 LYS A CE    1 
ATOM   3885 N  NZ    . LYS B 2 381 ? -22.454 57.983 12.101  1.00 50.88 ? 381 LYS A NZ    1 
ATOM   3886 N  N     . PHE B 2 382 ? -16.234 54.779 9.958   1.00 39.45 ? 382 PHE A N     1 
ATOM   3887 C  CA    . PHE B 2 382 ? -14.789 54.556 9.931   1.00 38.58 ? 382 PHE A CA    1 
ATOM   3888 C  C     . PHE B 2 382 ? -14.400 53.974 8.580   1.00 37.12 ? 382 PHE A C     1 
ATOM   3889 O  O     . PHE B 2 382 ? -15.263 53.550 7.814   1.00 37.20 ? 382 PHE A O     1 
ATOM   3890 C  CB    . PHE B 2 382 ? -14.340 53.616 11.065  1.00 39.01 ? 382 PHE A CB    1 
ATOM   3891 C  CG    . PHE B 2 382 ? -15.236 52.430 11.268  1.00 40.09 ? 382 PHE A CG    1 
ATOM   3892 C  CD1   . PHE B 2 382 ? -15.507 51.550 10.225  1.00 41.30 ? 382 PHE A CD1   1 
ATOM   3893 C  CD2   . PHE B 2 382 ? -15.825 52.195 12.508  1.00 40.53 ? 382 PHE A CD2   1 
ATOM   3894 C  CE1   . PHE B 2 382 ? -16.358 50.451 10.418  1.00 41.77 ? 382 PHE A CE1   1 
ATOM   3895 C  CE2   . PHE B 2 382 ? -16.674 51.098 12.708  1.00 40.07 ? 382 PHE A CE2   1 
ATOM   3896 C  CZ    . PHE B 2 382 ? -16.940 50.230 11.663  1.00 40.19 ? 382 PHE A CZ    1 
ATOM   3897 N  N     . THR B 2 383 ? -13.106 53.948 8.279   1.00 35.68 ? 383 THR A N     1 
ATOM   3898 C  CA    . THR B 2 383 ? -12.678 53.431 6.992   1.00 34.45 ? 383 THR A CA    1 
ATOM   3899 C  C     . THR B 2 383 ? -11.433 52.572 6.990   1.00 34.28 ? 383 THR A C     1 
ATOM   3900 O  O     . THR B 2 383 ? -10.955 52.167 5.934   1.00 34.85 ? 383 THR A O     1 
ATOM   3901 C  CB    . THR B 2 383 ? -12.462 54.559 5.995   1.00 33.51 ? 383 THR A CB    1 
ATOM   3902 O  OG1   . THR B 2 383 ? -11.508 55.480 6.527   1.00 34.14 ? 383 THR A OG1   1 
ATOM   3903 C  CG2   . THR B 2 383 ? -13.773 55.270 5.714   1.00 33.36 ? 383 THR A CG2   1 
ATOM   3904 N  N     . THR B 2 384 ? -10.890 52.292 8.158   1.00 33.73 ? 384 THR A N     1 
ATOM   3905 C  CA    . THR B 2 384 ? -9.717  51.443 8.194   1.00 33.46 ? 384 THR A CA    1 
ATOM   3906 C  C     . THR B 2 384 ? -10.030 50.387 9.218   1.00 33.63 ? 384 THR A C     1 
ATOM   3907 O  O     . THR B 2 384 ? -10.867 50.609 10.087  1.00 34.24 ? 384 THR A O     1 
ATOM   3908 C  CB    . THR B 2 384 ? -8.451  52.238 8.593   1.00 31.95 ? 384 THR A CB    1 
ATOM   3909 O  OG1   . THR B 2 384 ? -8.590  52.750 9.922   1.00 28.84 ? 384 THR A OG1   1 
ATOM   3910 C  CG2   . THR B 2 384 ? -8.255  53.401 7.635   1.00 31.38 ? 384 THR A CG2   1 
ATOM   3911 N  N     . PRO B 2 385 ? -9.393  49.210 9.123   1.00 33.08 ? 385 PRO A N     1 
ATOM   3912 C  CA    . PRO B 2 385 ? -9.673  48.159 10.107  1.00 32.86 ? 385 PRO A CA    1 
ATOM   3913 C  C     . PRO B 2 385 ? -9.406  48.660 11.525  1.00 32.94 ? 385 PRO A C     1 
ATOM   3914 O  O     . PRO B 2 385 ? -10.289 48.623 12.386  1.00 33.41 ? 385 PRO A O     1 
ATOM   3915 C  CB    . PRO B 2 385 ? -8.718  47.050 9.703   1.00 32.41 ? 385 PRO A CB    1 
ATOM   3916 C  CG    . PRO B 2 385 ? -8.569  47.259 8.226   1.00 33.09 ? 385 PRO A CG    1 
ATOM   3917 C  CD    . PRO B 2 385 ? -8.430  48.747 8.114   1.00 32.17 ? 385 PRO A CD    1 
ATOM   3918 N  N     . GLU B 2 386 ? -8.190  49.154 11.748  1.00 33.00 ? 386 GLU A N     1 
ATOM   3919 C  CA    . GLU B 2 386 ? -7.783  49.654 13.056  1.00 33.13 ? 386 GLU A CA    1 
ATOM   3920 C  C     . GLU B 2 386 ? -8.778  50.649 13.611  1.00 33.74 ? 386 GLU A C     1 
ATOM   3921 O  O     . GLU B 2 386 ? -9.137  50.595 14.786  1.00 33.92 ? 386 GLU A O     1 
ATOM   3922 C  CB    . GLU B 2 386 ? -6.405  50.291 12.964  1.00 32.26 ? 386 GLU A CB    1 
ATOM   3923 C  CG    . GLU B 2 386 ? -5.358  49.344 12.437  1.00 33.33 ? 386 GLU A CG    1 
ATOM   3924 C  CD    . GLU B 2 386 ? -5.030  49.573 10.972  1.00 34.71 ? 386 GLU A CD    1 
ATOM   3925 O  OE1   . GLU B 2 386 ? -5.958  49.583 10.125  1.00 34.33 ? 386 GLU A OE1   1 
ATOM   3926 O  OE2   . GLU B 2 386 ? -3.823  49.738 10.674  1.00 36.39 ? 386 GLU A OE2   1 
ATOM   3927 N  N     . GLU B 2 387 ? -9.222  51.551 12.747  1.00 33.99 ? 387 GLU A N     1 
ATOM   3928 C  CA    . GLU B 2 387 ? -10.191 52.574 13.101  1.00 35.24 ? 387 GLU A CA    1 
ATOM   3929 C  C     . GLU B 2 387 ? -11.425 51.891 13.673  1.00 35.27 ? 387 GLU A C     1 
ATOM   3930 O  O     . GLU B 2 387 ? -11.831 52.154 14.801  1.00 36.04 ? 387 GLU A O     1 
ATOM   3931 C  CB    . GLU B 2 387 ? -10.570 53.333 11.839  1.00 37.67 ? 387 GLU A CB    1 
ATOM   3932 C  CG    . GLU B 2 387 ? -10.996 54.765 12.021  1.00 41.36 ? 387 GLU A CG    1 
ATOM   3933 C  CD    . GLU B 2 387 ? -10.880 55.543 10.715  1.00 43.03 ? 387 GLU A CD    1 
ATOM   3934 O  OE1   . GLU B 2 387 ? -11.739 55.351 9.825   1.00 43.40 ? 387 GLU A OE1   1 
ATOM   3935 O  OE2   . GLU B 2 387 ? -9.915  56.329 10.576  1.00 42.68 ? 387 GLU A OE2   1 
ATOM   3936 N  N     . GLY B 2 388 ? -12.003 50.998 12.879  1.00 34.85 ? 388 GLY A N     1 
ATOM   3937 C  CA    . GLY B 2 388 ? -13.197 50.277 13.276  1.00 34.36 ? 388 GLY A CA    1 
ATOM   3938 C  C     . GLY B 2 388 ? -13.033 49.415 14.507  1.00 34.21 ? 388 GLY A C     1 
ATOM   3939 O  O     . GLY B 2 388 ? -13.957 49.307 15.315  1.00 35.41 ? 388 GLY A O     1 
ATOM   3940 N  N     . VAL B 2 389 ? -11.873 48.786 14.660  1.00 32.77 ? 389 VAL A N     1 
ATOM   3941 C  CA    . VAL B 2 389 ? -11.650 47.951 15.831  1.00 31.62 ? 389 VAL A CA    1 
ATOM   3942 C  C     . VAL B 2 389 ? -11.558 48.802 17.111  1.00 31.47 ? 389 VAL A C     1 
ATOM   3943 O  O     . VAL B 2 389 ? -12.010 48.377 18.173  1.00 30.36 ? 389 VAL A O     1 
ATOM   3944 C  CB    . VAL B 2 389 ? -10.381 47.106 15.657  1.00 30.93 ? 389 VAL A CB    1 
ATOM   3945 C  CG1   . VAL B 2 389 ? -10.157 46.232 16.879  1.00 29.65 ? 389 VAL A CG1   1 
ATOM   3946 C  CG2   . VAL B 2 389 ? -10.528 46.244 14.436  1.00 30.29 ? 389 VAL A CG2   1 
ATOM   3947 N  N     . ARG B 2 390 ? -10.987 50.003 17.003  1.00 31.13 ? 390 ARG A N     1 
ATOM   3948 C  CA    . ARG B 2 390 ? -10.866 50.900 18.154  1.00 30.73 ? 390 ARG A CA    1 
ATOM   3949 C  C     . ARG B 2 390 ? -12.273 51.256 18.609  1.00 30.45 ? 390 ARG A C     1 
ATOM   3950 O  O     . ARG B 2 390 ? -12.554 51.418 19.796  1.00 30.18 ? 390 ARG A O     1 
ATOM   3951 C  CB    . ARG B 2 390 ? -10.136 52.185 17.765  1.00 30.04 ? 390 ARG A CB    1 
ATOM   3952 C  CG    . ARG B 2 390 ? -9.785  53.057 18.942  1.00 29.53 ? 390 ARG A CG    1 
ATOM   3953 C  CD    . ARG B 2 390 ? -9.890  54.540 18.612  1.00 30.70 ? 390 ARG A CD    1 
ATOM   3954 N  NE    . ARG B 2 390 ? -9.033  54.979 17.511  1.00 34.51 ? 390 ARG A NE    1 
ATOM   3955 C  CZ    . ARG B 2 390 ? -9.473  55.311 16.293  1.00 37.74 ? 390 ARG A CZ    1 
ATOM   3956 N  NH1   . ARG B 2 390 ? -10.775 55.252 16.003  1.00 39.49 ? 390 ARG A NH1   1 
ATOM   3957 N  NH2   . ARG B 2 390 ? -8.618  55.721 15.360  1.00 36.72 ? 390 ARG A NH2   1 
ATOM   3958 N  N     . SER B 2 391 ? -13.158 51.393 17.640  1.00 29.96 ? 391 SER A N     1 
ATOM   3959 C  CA    . SER B 2 391 ? -14.536 51.715 17.934  1.00 31.19 ? 391 SER A CA    1 
ATOM   3960 C  C     . SER B 2 391 ? -15.239 50.523 18.590  1.00 32.07 ? 391 SER A C     1 
ATOM   3961 O  O     . SER B 2 391 ? -15.973 50.687 19.561  1.00 32.86 ? 391 SER A O     1 
ATOM   3962 C  CB    . SER B 2 391 ? -15.269 52.093 16.643  1.00 31.02 ? 391 SER A CB    1 
ATOM   3963 O  OG    . SER B 2 391 ? -16.656 52.204 16.881  1.00 31.89 ? 391 SER A OG    1 
ATOM   3964 N  N     . TYR B 2 392 ? -15.005 49.328 18.048  1.00 31.73 ? 392 TYR A N     1 
ATOM   3965 C  CA    . TYR B 2 392 ? -15.633 48.110 18.547  1.00 31.05 ? 392 TYR A CA    1 
ATOM   3966 C  C     . TYR B 2 392 ? -15.132 47.734 19.941  1.00 31.25 ? 392 TYR A C     1 
ATOM   3967 O  O     . TYR B 2 392 ? -15.917 47.561 20.873  1.00 30.21 ? 392 TYR A O     1 
ATOM   3968 C  CB    . TYR B 2 392 ? -15.380 46.958 17.553  1.00 30.34 ? 392 TYR A CB    1 
ATOM   3969 C  CG    . TYR B 2 392 ? -15.995 45.621 17.944  1.00 30.56 ? 392 TYR A CG    1 
ATOM   3970 C  CD1   . TYR B 2 392 ? -17.384 45.443 17.973  1.00 30.39 ? 392 TYR A CD1   1 
ATOM   3971 C  CD2   . TYR B 2 392 ? -15.188 44.531 18.288  1.00 29.80 ? 392 TYR A CD2   1 
ATOM   3972 C  CE1   . TYR B 2 392 ? -17.953 44.207 18.330  1.00 29.46 ? 392 TYR A CE1   1 
ATOM   3973 C  CE2   . TYR B 2 392 ? -15.744 43.297 18.649  1.00 28.72 ? 392 TYR A CE2   1 
ATOM   3974 C  CZ    . TYR B 2 392 ? -17.122 43.141 18.664  1.00 29.19 ? 392 TYR A CZ    1 
ATOM   3975 O  OH    . TYR B 2 392 ? -17.670 41.917 18.981  1.00 29.13 ? 392 TYR A OH    1 
ATOM   3976 N  N     . ALA B 2 393 ? -13.818 47.607 20.079  1.00 31.97 ? 393 ALA A N     1 
ATOM   3977 C  CA    . ALA B 2 393 ? -13.229 47.241 21.352  1.00 32.35 ? 393 ALA A CA    1 
ATOM   3978 C  C     . ALA B 2 393 ? -13.722 48.202 22.412  1.00 33.80 ? 393 ALA A C     1 
ATOM   3979 O  O     . ALA B 2 393 ? -14.159 47.791 23.489  1.00 34.25 ? 393 ALA A O     1 
ATOM   3980 C  CB    . ALA B 2 393 ? -11.719 47.296 21.264  1.00 30.08 ? 393 ALA A CB    1 
ATOM   3981 N  N     . SER B 2 394 ? -13.678 49.488 22.087  1.00 34.98 ? 394 SER A N     1 
ATOM   3982 C  CA    . SER B 2 394 ? -14.090 50.519 23.027  1.00 35.46 ? 394 SER A CA    1 
ATOM   3983 C  C     . SER B 2 394 ? -15.544 50.426 23.462  1.00 35.79 ? 394 SER A C     1 
ATOM   3984 O  O     . SER B 2 394 ? -15.865 50.788 24.592  1.00 35.75 ? 394 SER A O     1 
ATOM   3985 C  CB    . SER B 2 394 ? -13.806 51.910 22.449  1.00 35.69 ? 394 SER A CB    1 
ATOM   3986 O  OG    . SER B 2 394 ? -12.414 52.116 22.266  1.00 35.18 ? 394 SER A OG    1 
ATOM   3987 N  N     . THR B 2 395 ? -16.428 49.935 22.597  1.00 36.65 ? 395 THR A N     1 
ATOM   3988 C  CA    . THR B 2 395 ? -17.829 49.853 22.989  1.00 38.72 ? 395 THR A CA    1 
ATOM   3989 C  C     . THR B 2 395 ? -18.364 48.438 23.156  1.00 40.68 ? 395 THR A C     1 
ATOM   3990 O  O     . THR B 2 395 ? -19.520 48.255 23.547  1.00 42.05 ? 395 THR A O     1 
ATOM   3991 C  CB    . THR B 2 395 ? -18.767 50.611 21.995  1.00 38.09 ? 395 THR A CB    1 
ATOM   3992 O  OG1   . THR B 2 395 ? -18.957 49.832 20.811  1.00 38.10 ? 395 THR A OG1   1 
ATOM   3993 C  CG2   . THR B 2 395 ? -18.179 51.966 21.618  1.00 39.14 ? 395 THR A CG2   1 
ATOM   3994 N  N     . HIS B 2 396 ? -17.546 47.432 22.868  1.00 42.48 ? 396 HIS A N     1 
ATOM   3995 C  CA    . HIS B 2 396 ? -18.006 46.048 23.005  1.00 43.57 ? 396 HIS A CA    1 
ATOM   3996 C  C     . HIS B 2 396 ? -17.081 45.194 23.873  1.00 43.34 ? 396 HIS A C     1 
ATOM   3997 O  O     . HIS B 2 396 ? -17.058 43.958 23.769  1.00 42.72 ? 396 HIS A O     1 
ATOM   3998 C  CB    . HIS B 2 396 ? -18.192 45.412 21.621  1.00 44.28 ? 396 HIS A CB    1 
ATOM   3999 C  CG    . HIS B 2 396 ? -19.410 45.897 20.893  1.00 45.81 ? 396 HIS A CG    1 
ATOM   4000 N  ND1   . HIS B 2 396 ? -19.562 47.203 20.480  1.00 46.64 ? 396 HIS A ND1   1 
ATOM   4001 C  CD2   . HIS B 2 396 ? -20.544 45.252 20.526  1.00 46.48 ? 396 HIS A CD2   1 
ATOM   4002 C  CE1   . HIS B 2 396 ? -20.737 47.343 19.892  1.00 47.14 ? 396 HIS A CE1   1 
ATOM   4003 N  NE2   . HIS B 2 396 ? -21.353 46.174 19.906  1.00 46.90 ? 396 HIS A NE2   1 
ATOM   4004 N  N     . TRP B 2 397 ? -16.334 45.877 24.739  1.00 42.76 ? 397 TRP A N     1 
ATOM   4005 C  CA    . TRP B 2 397 ? -15.399 45.240 25.654  1.00 41.85 ? 397 TRP A CA    1 
ATOM   4006 C  C     . TRP B 2 397 ? -16.046 44.110 26.476  1.00 41.57 ? 397 TRP A C     1 
ATOM   4007 O  O     . TRP B 2 397 ? -15.413 43.083 26.716  1.00 40.91 ? 397 TRP A O     1 
ATOM   4008 C  CB    . TRP B 2 397 ? -14.804 46.292 26.605  1.00 41.69 ? 397 TRP A CB    1 
ATOM   4009 C  CG    . TRP B 2 397 ? -15.833 46.933 27.488  1.00 40.84 ? 397 TRP A CG    1 
ATOM   4010 C  CD1   . TRP B 2 397 ? -16.605 48.025 27.199  1.00 40.67 ? 397 TRP A CD1   1 
ATOM   4011 C  CD2   . TRP B 2 397 ? -16.306 46.432 28.740  1.00 40.20 ? 397 TRP A CD2   1 
ATOM   4012 N  NE1   . TRP B 2 397 ? -17.538 48.227 28.185  1.00 39.83 ? 397 TRP A NE1   1 
ATOM   4013 C  CE2   . TRP B 2 397 ? -17.378 47.265 29.147  1.00 40.14 ? 397 TRP A CE2   1 
ATOM   4014 C  CE3   . TRP B 2 397 ? -15.933 45.357 29.557  1.00 39.49 ? 397 TRP A CE3   1 
ATOM   4015 C  CZ2   . TRP B 2 397 ? -18.085 47.056 30.337  1.00 39.52 ? 397 TRP A CZ2   1 
ATOM   4016 C  CZ3   . TRP B 2 397 ? -16.638 45.149 30.743  1.00 40.45 ? 397 TRP A CZ3   1 
ATOM   4017 C  CH2   . TRP B 2 397 ? -17.704 45.998 31.119  1.00 39.74 ? 397 TRP A CH2   1 
ATOM   4018 N  N     . HIS B 2 398 ? -17.302 44.289 26.896  1.00 41.40 ? 398 HIS A N     1 
ATOM   4019 C  CA    . HIS B 2 398 ? -17.968 43.267 27.705  1.00 40.80 ? 398 HIS A CA    1 
ATOM   4020 C  C     . HIS B 2 398 ? -18.092 41.901 27.058  1.00 39.07 ? 398 HIS A C     1 
ATOM   4021 O  O     . HIS B 2 398 ? -18.067 40.894 27.750  1.00 39.65 ? 398 HIS A O     1 
ATOM   4022 C  CB    . HIS B 2 398 ? -19.368 43.714 28.152  1.00 42.35 ? 398 HIS A CB    1 
ATOM   4023 C  CG    . HIS B 2 398 ? -20.074 42.708 29.029  1.00 44.56 ? 398 HIS A CG    1 
ATOM   4024 N  ND1   . HIS B 2 398 ? -20.702 41.584 28.528  1.00 45.09 ? 398 HIS A ND1   1 
ATOM   4025 C  CD2   . HIS B 2 398 ? -20.237 42.653 30.377  1.00 43.95 ? 398 HIS A CD2   1 
ATOM   4026 C  CE1   . HIS B 2 398 ? -21.222 40.885 29.527  1.00 43.72 ? 398 HIS A CE1   1 
ATOM   4027 N  NE2   . HIS B 2 398 ? -20.954 41.513 30.657  1.00 43.34 ? 398 HIS A NE2   1 
ATOM   4028 N  N     . THR B 2 399 ? -18.211 41.845 25.741  1.00 37.26 ? 399 THR A N     1 
ATOM   4029 C  CA    . THR B 2 399 ? -18.365 40.552 25.101  1.00 35.51 ? 399 THR A CA    1 
ATOM   4030 C  C     . THR B 2 399 ? -17.088 39.873 24.609  1.00 35.17 ? 399 THR A C     1 
ATOM   4031 O  O     . THR B 2 399 ? -17.125 39.054 23.708  1.00 36.65 ? 399 THR A O     1 
ATOM   4032 C  CB    . THR B 2 399 ? -19.464 40.610 23.993  1.00 34.29 ? 399 THR A CB    1 
ATOM   4033 O  OG1   . THR B 2 399 ? -19.939 39.282 23.717  1.00 32.96 ? 399 THR A OG1   1 
ATOM   4034 C  CG2   . THR B 2 399 ? -18.919 41.252 22.710  1.00 32.16 ? 399 THR A CG2   1 
ATOM   4035 N  N     . LEU B 2 400 ? -15.953 40.191 25.207  1.00 34.02 ? 400 LEU A N     1 
ATOM   4036 C  CA    . LEU B 2 400 ? -14.703 39.638 24.713  1.00 33.67 ? 400 LEU A CA    1 
ATOM   4037 C  C     . LEU B 2 400 ? -14.115 38.739 25.798  1.00 34.33 ? 400 LEU A C     1 
ATOM   4038 O  O     . LEU B 2 400 ? -12.946 38.364 25.763  1.00 34.75 ? 400 LEU A O     1 
ATOM   4039 C  CB    . LEU B 2 400 ? -13.729 40.767 24.350  1.00 33.94 ? 400 LEU A CB    1 
ATOM   4040 C  CG    . LEU B 2 400 ? -14.218 41.930 23.458  1.00 33.95 ? 400 LEU A CG    1 
ATOM   4041 C  CD1   . LEU B 2 400 ? -13.081 42.934 23.278  1.00 32.53 ? 400 LEU A CD1   1 
ATOM   4042 C  CD2   . LEU B 2 400 ? -14.698 41.431 22.108  1.00 33.35 ? 400 LEU A CD2   1 
ATOM   4043 N  N     . GLY B 2 401 ? -14.945 38.379 26.764  1.00 35.20 ? 401 GLY A N     1 
ATOM   4044 C  CA    . GLY B 2 401 ? -14.481 37.532 27.849  1.00 37.33 ? 401 GLY A CA    1 
ATOM   4045 C  C     . GLY B 2 401 ? -14.610 38.249 29.181  1.00 37.83 ? 401 GLY A C     1 
ATOM   4046 O  O     . GLY B 2 401 ? -14.194 39.402 29.305  1.00 38.57 ? 401 GLY A O     1 
ATOM   4047 N  N     . LYS B 2 402 ? -15.174 37.580 30.184  1.00 37.69 ? 402 LYS A N     1 
ATOM   4048 C  CA    . LYS B 2 402 ? -15.347 38.225 31.468  1.00 36.44 ? 402 LYS A CA    1 
ATOM   4049 C  C     . LYS B 2 402 ? -14.070 38.964 31.825  1.00 35.32 ? 402 LYS A C     1 
ATOM   4050 O  O     . LYS B 2 402 ? -14.097 40.157 32.057  1.00 35.54 ? 402 LYS A O     1 
ATOM   4051 C  CB    . LYS B 2 402 ? -15.713 37.201 32.547  1.00 37.63 ? 402 LYS A CB    1 
ATOM   4052 C  CG    . LYS B 2 402 ? -15.669 37.731 34.000  1.00 42.74 ? 402 LYS A CG    1 
ATOM   4053 C  CD    . LYS B 2 402 ? -16.830 38.677 34.364  1.00 44.57 ? 402 LYS A CD    1 
ATOM   4054 C  CE    . LYS B 2 402 ? -18.075 37.895 34.807  1.00 47.40 ? 402 LYS A CE    1 
ATOM   4055 N  NZ    . LYS B 2 402 ? -19.211 38.760 35.282  1.00 46.46 ? 402 LYS A NZ    1 
ATOM   4056 N  N     . ASN B 2 403 ? -12.947 38.266 31.813  1.00 35.26 ? 403 ASN A N     1 
ATOM   4057 C  CA    . ASN B 2 403 ? -11.669 38.862 32.184  1.00 35.67 ? 403 ASN A CA    1 
ATOM   4058 C  C     . ASN B 2 403 ? -10.957 39.649 31.090  1.00 36.95 ? 403 ASN A C     1 
ATOM   4059 O  O     . ASN B 2 403 ? -10.512 40.778 31.321  1.00 37.91 ? 403 ASN A O     1 
ATOM   4060 C  CB    . ASN B 2 403 ? -10.747 37.768 32.721  1.00 35.01 ? 403 ASN A CB    1 
ATOM   4061 C  CG    . ASN B 2 403 ? -11.383 36.998 33.856  1.00 35.87 ? 403 ASN A CG    1 
ATOM   4062 O  OD1   . ASN B 2 403 ? -11.486 37.496 34.971  1.00 34.91 ? 403 ASN A OD1   1 
ATOM   4063 N  ND2   . ASN B 2 403 ? -11.844 35.785 33.568  1.00 36.48 ? 403 ASN A ND2   1 
ATOM   4064 N  N     . VAL B 2 404 ? -10.827 39.066 29.902  1.00 37.36 ? 404 VAL A N     1 
ATOM   4065 C  CA    . VAL B 2 404 ? -10.148 39.773 28.832  1.00 37.07 ? 404 VAL A CA    1 
ATOM   4066 C  C     . VAL B 2 404 ? -10.894 41.068 28.585  1.00 37.29 ? 404 VAL A C     1 
ATOM   4067 O  O     . VAL B 2 404 ? -10.299 42.144 28.589  1.00 37.07 ? 404 VAL A O     1 
ATOM   4068 C  CB    . VAL B 2 404 ? -10.076 38.913 27.558  1.00 37.38 ? 404 VAL A CB    1 
ATOM   4069 C  CG1   . VAL B 2 404 ? -9.827  39.777 26.336  1.00 36.94 ? 404 VAL A CG1   1 
ATOM   4070 C  CG2   . VAL B 2 404 ? -8.944  37.910 27.701  1.00 37.90 ? 404 VAL A CG2   1 
ATOM   4071 N  N     . GLY B 2 405 ? -12.205 40.958 28.404  1.00 37.43 ? 405 GLY A N     1 
ATOM   4072 C  CA    . GLY B 2 405 ? -13.025 42.134 28.174  1.00 38.67 ? 405 GLY A CA    1 
ATOM   4073 C  C     . GLY B 2 405 ? -12.822 43.257 29.183  1.00 39.30 ? 405 GLY A C     1 
ATOM   4074 O  O     . GLY B 2 405 ? -12.830 44.435 28.815  1.00 39.45 ? 405 GLY A O     1 
ATOM   4075 N  N     . GLU B 2 406 ? -12.628 42.907 30.453  1.00 39.18 ? 406 GLU A N     1 
ATOM   4076 C  CA    . GLU B 2 406 ? -12.431 43.918 31.485  1.00 40.09 ? 406 GLU A CA    1 
ATOM   4077 C  C     . GLU B 2 406 ? -11.048 44.573 31.431  1.00 40.03 ? 406 GLU A C     1 
ATOM   4078 O  O     . GLU B 2 406 ? -10.900 45.756 31.759  1.00 40.13 ? 406 GLU A O     1 
ATOM   4079 C  CB    . GLU B 2 406 ? -12.691 43.316 32.868  1.00 40.56 ? 406 GLU A CB    1 
ATOM   4080 C  CG    . GLU B 2 406 ? -14.161 43.007 33.107  1.00 43.11 ? 406 GLU A CG    1 
ATOM   4081 C  CD    . GLU B 2 406 ? -14.411 42.049 34.271  1.00 44.58 ? 406 GLU A CD    1 
ATOM   4082 O  OE1   . GLU B 2 406 ? -15.587 41.637 34.454  1.00 44.81 ? 406 GLU A OE1   1 
ATOM   4083 O  OE2   . GLU B 2 406 ? -13.442 41.709 34.994  1.00 44.92 ? 406 GLU A OE2   1 
ATOM   4084 N  N     . SER B 2 407 ? -10.038 43.821 31.010  1.00 39.13 ? 407 SER A N     1 
ATOM   4085 C  CA    . SER B 2 407 ? -8.701  44.384 30.928  1.00 39.24 ? 407 SER A CA    1 
ATOM   4086 C  C     . SER B 2 407 ? -8.640  45.415 29.819  1.00 40.18 ? 407 SER A C     1 
ATOM   4087 O  O     . SER B 2 407 ? -8.028  46.475 29.965  1.00 39.65 ? 407 SER A O     1 
ATOM   4088 C  CB    . SER B 2 407 ? -7.675  43.304 30.632  1.00 38.59 ? 407 SER A CB    1 
ATOM   4089 O  OG    . SER B 2 407 ? -6.441  43.913 30.301  1.00 39.23 ? 407 SER A OG    1 
ATOM   4090 N  N     . ILE B 2 408 ? -9.264  45.066 28.697  1.00 41.18 ? 408 ILE A N     1 
ATOM   4091 C  CA    . ILE B 2 408 ? -9.308  45.922 27.522  1.00 41.25 ? 408 ILE A CA    1 
ATOM   4092 C  C     . ILE B 2 408 ? -10.064 47.167 27.910  1.00 40.78 ? 408 ILE A C     1 
ATOM   4093 O  O     . ILE B 2 408 ? -9.621  48.275 27.624  1.00 40.29 ? 408 ILE A O     1 
ATOM   4094 C  CB    . ILE B 2 408 ? -10.046 45.230 26.335  1.00 42.39 ? 408 ILE A CB    1 
ATOM   4095 C  CG1   . ILE B 2 408 ? -9.233  44.040 25.818  1.00 41.06 ? 408 ILE A CG1   1 
ATOM   4096 C  CG2   . ILE B 2 408 ? -10.282 46.234 25.196  1.00 42.80 ? 408 ILE A CG2   1 
ATOM   4097 C  CD1   . ILE B 2 408 ? -9.881  43.343 24.644  1.00 39.36 ? 408 ILE A CD1   1 
ATOM   4098 N  N     . ARG B 2 409 ? -11.204 46.966 28.569  1.00 40.52 ? 409 ARG A N     1 
ATOM   4099 C  CA    . ARG B 2 409 ? -12.046 48.067 29.018  1.00 41.43 ? 409 ARG A CA    1 
ATOM   4100 C  C     . ARG B 2 409 ? -11.243 49.063 29.852  1.00 41.73 ? 409 ARG A C     1 
ATOM   4101 O  O     . ARG B 2 409 ? -11.577 50.246 29.904  1.00 42.11 ? 409 ARG A O     1 
ATOM   4102 C  CB    . ARG B 2 409 ? -13.218 47.536 29.848  1.00 42.62 ? 409 ARG A CB    1 
ATOM   4103 C  CG    . ARG B 2 409 ? -14.122 48.606 30.447  1.00 44.51 ? 409 ARG A CG    1 
ATOM   4104 C  CD    . ARG B 2 409 ? -14.867 48.080 31.668  1.00 48.86 ? 409 ARG A CD    1 
ATOM   4105 N  NE    . ARG B 2 409 ? -13.943 47.479 32.643  1.00 53.46 ? 409 ARG A NE    1 
ATOM   4106 C  CZ    . ARG B 2 409 ? -14.286 46.956 33.828  1.00 54.26 ? 409 ARG A CZ    1 
ATOM   4107 N  NH1   . ARG B 2 409 ? -15.555 46.946 34.233  1.00 54.28 ? 409 ARG A NH1   1 
ATOM   4108 N  NH2   . ARG B 2 409 ? -13.347 46.425 34.609  1.00 53.47 ? 409 ARG A NH2   1 
ATOM   4109 N  N     . GLU B 2 410 ? -10.181 48.598 30.503  1.00 41.58 ? 410 GLU A N     1 
ATOM   4110 C  CA    . GLU B 2 410 ? -9.386  49.503 31.324  1.00 41.52 ? 410 GLU A CA    1 
ATOM   4111 C  C     . GLU B 2 410 ? -8.132  49.986 30.620  1.00 40.14 ? 410 GLU A C     1 
ATOM   4112 O  O     . GLU B 2 410 ? -7.385  50.811 31.145  1.00 40.52 ? 410 GLU A O     1 
ATOM   4113 C  CB    . GLU B 2 410 ? -9.042  48.854 32.672  1.00 43.60 ? 410 GLU A CB    1 
ATOM   4114 C  CG    . GLU B 2 410 ? -8.119  47.652 32.618  1.00 46.24 ? 410 GLU A CG    1 
ATOM   4115 C  CD    . GLU B 2 410 ? -7.988  46.975 33.982  1.00 48.20 ? 410 GLU A CD    1 
ATOM   4116 O  OE1   . GLU B 2 410 ? -9.024  46.512 34.513  1.00 48.38 ? 410 GLU A OE1   1 
ATOM   4117 O  OE2   . GLU B 2 410 ? -6.857  46.907 34.521  1.00 49.52 ? 410 GLU A OE2   1 
ATOM   4118 N  N     . TYR B 2 411 ? -7.915  49.472 29.422  1.00 38.80 ? 411 TYR A N     1 
ATOM   4119 C  CA    . TYR B 2 411 ? -6.779  49.862 28.602  1.00 38.09 ? 411 TYR A CA    1 
ATOM   4120 C  C     . TYR B 2 411 ? -6.458  48.856 27.519  1.00 37.83 ? 411 TYR A C     1 
ATOM   4121 O  O     . TYR B 2 411 ? -6.491  47.646 27.732  1.00 38.71 ? 411 TYR A O     1 
ATOM   4122 C  CB    . TYR B 2 411 ? -5.514  50.098 29.429  1.00 37.80 ? 411 TYR A CB    1 
ATOM   4123 C  CG    . TYR B 2 411 ? -4.257  49.973 28.593  1.00 38.75 ? 411 TYR A CG    1 
ATOM   4124 C  CD1   . TYR B 2 411 ? -3.506  48.791 28.600  1.00 38.60 ? 411 TYR A CD1   1 
ATOM   4125 C  CD2   . TYR B 2 411 ? -3.875  50.993 27.714  1.00 38.37 ? 411 TYR A CD2   1 
ATOM   4126 C  CE1   . TYR B 2 411 ? -2.417  48.623 27.750  1.00 39.08 ? 411 TYR A CE1   1 
ATOM   4127 C  CE2   . TYR B 2 411 ? -2.790  50.836 26.851  1.00 39.17 ? 411 TYR A CE2   1 
ATOM   4128 C  CZ    . TYR B 2 411 ? -2.067  49.647 26.871  1.00 40.16 ? 411 TYR A CZ    1 
ATOM   4129 O  OH    . TYR B 2 411 ? -1.021  49.461 25.987  1.00 40.90 ? 411 TYR A OH    1 
ATOM   4130 N  N     . PHE B 2 412 ? -6.129  49.391 26.354  1.00 37.20 ? 412 PHE A N     1 
ATOM   4131 C  CA    . PHE B 2 412 ? -5.773  48.599 25.205  1.00 36.18 ? 412 PHE A CA    1 
ATOM   4132 C  C     . PHE B 2 412 ? -5.291  49.636 24.214  1.00 36.39 ? 412 PHE A C     1 
ATOM   4133 O  O     . PHE B 2 412 ? -5.667  50.797 24.300  1.00 36.16 ? 412 PHE A O     1 
ATOM   4134 C  CB    . PHE B 2 412 ? -6.979  47.775 24.743  1.00 34.99 ? 412 PHE A CB    1 
ATOM   4135 C  CG    . PHE B 2 412 ? -7.915  48.511 23.817  1.00 33.19 ? 412 PHE A CG    1 
ATOM   4136 C  CD1   . PHE B 2 412 ? -7.607  48.657 22.464  1.00 33.40 ? 412 PHE A CD1   1 
ATOM   4137 C  CD2   . PHE B 2 412 ? -9.113  49.026 24.283  1.00 33.28 ? 412 PHE A CD2   1 
ATOM   4138 C  CE1   . PHE B 2 412 ? -8.483  49.303 21.592  1.00 33.52 ? 412 PHE A CE1   1 
ATOM   4139 C  CE2   . PHE B 2 412 ? -10.010 49.679 23.417  1.00 32.83 ? 412 PHE A CE2   1 
ATOM   4140 C  CZ    . PHE B 2 412 ? -9.692  49.816 22.071  1.00 33.30 ? 412 PHE A CZ    1 
ATOM   4141 N  N     . GLU B 2 413 ? -4.446  49.225 23.284  1.00 37.07 ? 413 GLU A N     1 
ATOM   4142 C  CA    . GLU B 2 413 ? -4.054  50.096 22.198  1.00 38.19 ? 413 GLU A CA    1 
ATOM   4143 C  C     . GLU B 2 413 ? -3.852  49.274 20.940  1.00 38.51 ? 413 GLU A C     1 
ATOM   4144 O  O     . GLU B 2 413 ? -3.726  48.051 21.011  1.00 39.58 ? 413 GLU A O     1 
ATOM   4145 C  CB    . GLU B 2 413 ? -2.783  50.859 22.544  1.00 39.15 ? 413 GLU A CB    1 
ATOM   4146 C  CG    . GLU B 2 413 ? -1.575  50.036 22.826  1.00 41.45 ? 413 GLU A CG    1 
ATOM   4147 C  CD    . GLU B 2 413 ? -0.396  50.924 23.168  1.00 44.49 ? 413 GLU A CD    1 
ATOM   4148 O  OE1   . GLU B 2 413 ? 0.137   51.590 22.248  1.00 45.81 ? 413 GLU A OE1   1 
ATOM   4149 O  OE2   . GLU B 2 413 ? -0.018  50.978 24.361  1.00 45.73 ? 413 GLU A OE2   1 
ATOM   4150 N  N     . ILE B 2 414 ? -3.830  49.939 19.789  1.00 37.73 ? 414 ILE A N     1 
ATOM   4151 C  CA    . ILE B 2 414 ? -3.659  49.242 18.525  1.00 36.17 ? 414 ILE A CA    1 
ATOM   4152 C  C     . ILE B 2 414 ? -2.272  49.474 17.936  1.00 38.04 ? 414 ILE A C     1 
ATOM   4153 O  O     . ILE B 2 414 ? -1.905  50.593 17.588  1.00 38.51 ? 414 ILE A O     1 
ATOM   4154 C  CB    . ILE B 2 414 ? -4.749  49.669 17.547  1.00 33.21 ? 414 ILE A CB    1 
ATOM   4155 C  CG1   . ILE B 2 414 ? -6.114  49.426 18.204  1.00 32.04 ? 414 ILE A CG1   1 
ATOM   4156 C  CG2   . ILE B 2 414 ? -4.623  48.888 16.259  1.00 33.44 ? 414 ILE A CG2   1 
ATOM   4157 C  CD1   . ILE B 2 414 ? -7.297  49.722 17.360  1.00 31.05 ? 414 ILE A CD1   1 
ATOM   4158 N  N     . ILE B 2 415 ? -1.502  48.398 17.839  1.00 39.71 ? 415 ILE A N     1 
ATOM   4159 C  CA    . ILE B 2 415 ? -0.140  48.452 17.319  1.00 42.12 ? 415 ILE A CA    1 
ATOM   4160 C  C     . ILE B 2 415 ? -0.094  48.006 15.853  1.00 44.11 ? 415 ILE A C     1 
ATOM   4161 O  O     . ILE B 2 415 ? -0.737  47.024 15.492  1.00 44.57 ? 415 ILE A O     1 
ATOM   4162 C  CB    . ILE B 2 415 ? 0.776   47.507 18.124  1.00 42.25 ? 415 ILE A CB    1 
ATOM   4163 C  CG1   . ILE B 2 415 ? 0.389   47.528 19.607  1.00 40.97 ? 415 ILE A CG1   1 
ATOM   4164 C  CG2   . ILE B 2 415 ? 2.235   47.887 17.904  1.00 41.98 ? 415 ILE A CG2   1 
ATOM   4165 C  CD1   . ILE B 2 415 ? 0.549   48.857 20.263  1.00 41.03 ? 415 ILE A CD1   1 
ATOM   4166 N  N     . SER B 2 416 ? 0.682   48.705 15.020  1.00 46.62 ? 416 SER A N     1 
ATOM   4167 C  CA    . SER B 2 416 ? 0.789   48.353 13.603  1.00 48.49 ? 416 SER A CA    1 
ATOM   4168 C  C     . SER B 2 416 ? 2.079   48.741 12.887  1.00 50.80 ? 416 SER A C     1 
ATOM   4169 O  O     . SER B 2 416 ? 2.610   49.839 13.046  1.00 50.85 ? 416 SER A O     1 
ATOM   4170 C  CB    . SER B 2 416 ? -0.383  48.947 12.831  1.00 47.65 ? 416 SER A CB    1 
ATOM   4171 O  OG    . SER B 2 416 ? -0.420  50.351 12.968  1.00 47.17 ? 416 SER A OG    1 
ATOM   4172 N  N     . GLY B 2 417 ? 2.576   47.820 12.077  1.00 54.00 ? 417 GLY A N     1 
ATOM   4173 C  CA    . GLY B 2 417 ? 3.782   48.083 11.321  1.00 57.95 ? 417 GLY A CA    1 
ATOM   4174 C  C     . GLY B 2 417 ? 5.077   48.244 12.093  1.00 60.38 ? 417 GLY A C     1 
ATOM   4175 O  O     . GLY B 2 417 ? 5.407   47.459 12.987  1.00 60.22 ? 417 GLY A O     1 
ATOM   4176 N  N     . GLU B 2 418 ? 5.816   49.282 11.715  1.00 62.80 ? 418 GLU A N     1 
ATOM   4177 C  CA    . GLU B 2 418 ? 7.115   49.607 12.297  1.00 65.09 ? 418 GLU A CA    1 
ATOM   4178 C  C     . GLU B 2 418 ? 7.185   49.351 13.801  1.00 65.03 ? 418 GLU A C     1 
ATOM   4179 O  O     . GLU B 2 418 ? 8.144   48.766 14.299  1.00 65.34 ? 418 GLU A O     1 
ATOM   4180 C  CB    . GLU B 2 418 ? 7.450   51.078 11.997  1.00 67.67 ? 418 GLU A CB    1 
ATOM   4181 C  CG    . GLU B 2 418 ? 7.038   51.560 10.580  1.00 70.47 ? 418 GLU A CG    1 
ATOM   4182 C  CD    . GLU B 2 418 ? 7.774   50.851 9.420   1.00 72.67 ? 418 GLU A CD    1 
ATOM   4183 O  OE1   . GLU B 2 418 ? 7.369   51.063 8.253   1.00 73.56 ? 418 GLU A OE1   1 
ATOM   4184 O  OE2   . GLU B 2 418 ? 8.749   50.093 9.658   1.00 73.60 ? 418 GLU A OE2   1 
ATOM   4185 N  N     . LYS B 2 419 ? 6.156   49.786 14.516  1.00 64.67 ? 419 LYS A N     1 
ATOM   4186 C  CA    . LYS B 2 419 ? 6.096   49.617 15.959  1.00 63.95 ? 419 LYS A CA    1 
ATOM   4187 C  C     . LYS B 2 419 ? 5.683   48.200 16.372  1.00 62.94 ? 419 LYS A C     1 
ATOM   4188 O  O     . LYS B 2 419 ? 6.130   47.692 17.402  1.00 61.92 ? 419 LYS A O     1 
ATOM   4189 C  CB    . LYS B 2 419 ? 5.116   50.647 16.534  1.00 65.10 ? 419 LYS A CB    1 
ATOM   4190 C  CG    . LYS B 2 419 ? 4.863   50.548 18.037  1.00 67.13 ? 419 LYS A CG    1 
ATOM   4191 C  CD    . LYS B 2 419 ? 3.878   51.632 18.491  1.00 68.32 ? 419 LYS A CD    1 
ATOM   4192 C  CE    . LYS B 2 419 ? 3.578   51.546 19.986  1.00 69.01 ? 419 LYS A CE    1 
ATOM   4193 N  NZ    . LYS B 2 419 ? 2.655   52.635 20.436  1.00 69.68 ? 419 LYS A NZ    1 
ATOM   4194 N  N     . LEU B 2 420 ? 4.840   47.566 15.558  1.00 62.05 ? 420 LEU A N     1 
ATOM   4195 C  CA    . LEU B 2 420 ? 4.336   46.222 15.846  1.00 61.01 ? 420 LEU A CA    1 
ATOM   4196 C  C     . LEU B 2 420 ? 5.381   45.116 15.836  1.00 60.21 ? 420 LEU A C     1 
ATOM   4197 O  O     . LEU B 2 420 ? 5.399   44.272 16.723  1.00 58.71 ? 420 LEU A O     1 
ATOM   4198 C  CB    . LEU B 2 420 ? 3.230   45.844 14.858  1.00 60.79 ? 420 LEU A CB    1 
ATOM   4199 C  CG    . LEU B 2 420 ? 2.540   44.527 15.228  1.00 60.32 ? 420 LEU A CG    1 
ATOM   4200 C  CD1   . LEU B 2 420 ? 1.335   44.857 16.079  1.00 60.33 ? 420 LEU A CD1   1 
ATOM   4201 C  CD2   . LEU B 2 420 ? 2.108   43.758 13.994  1.00 59.88 ? 420 LEU A CD2   1 
ATOM   4202 N  N     . PHE B 2 421 ? 6.237   45.125 14.818  1.00 60.92 ? 421 PHE A N     1 
ATOM   4203 C  CA    . PHE B 2 421 ? 7.289   44.118 14.653  1.00 61.64 ? 421 PHE A CA    1 
ATOM   4204 C  C     . PHE B 2 421 ? 8.258   44.046 15.824  1.00 62.00 ? 421 PHE A C     1 
ATOM   4205 O  O     . PHE B 2 421 ? 9.058   43.110 15.918  1.00 62.94 ? 421 PHE A O     1 
ATOM   4206 C  CB    . PHE B 2 421 ? 8.046   44.391 13.354  1.00 60.51 ? 421 PHE A CB    1 
ATOM   4207 C  CG    . PHE B 2 421 ? 7.145   44.501 12.171  1.00 60.59 ? 421 PHE A CG    1 
ATOM   4208 C  CD1   . PHE B 2 421 ? 7.403   45.412 11.160  1.00 60.68 ? 421 PHE A CD1   1 
ATOM   4209 C  CD2   . PHE B 2 421 ? 5.997   43.716 12.091  1.00 59.88 ? 421 PHE A CD2   1 
ATOM   4210 C  CE1   . PHE B 2 421 ? 6.526   45.540 10.086  1.00 60.65 ? 421 PHE A CE1   1 
ATOM   4211 C  CE2   . PHE B 2 421 ? 5.119   43.834 11.032  1.00 59.25 ? 421 PHE A CE2   1 
ATOM   4212 C  CZ    . PHE B 2 421 ? 5.379   44.747 10.027  1.00 60.00 ? 421 PHE A CZ    1 
ATOM   4213 N  N     . LYS B 2 422 ? 8.178   45.030 16.715  1.00 61.39 ? 422 LYS A N     1 
ATOM   4214 C  CA    . LYS B 2 422 ? 9.035   45.067 17.886  1.00 60.24 ? 422 LYS A CA    1 
ATOM   4215 C  C     . LYS B 2 422 ? 8.408   44.224 18.994  1.00 58.54 ? 422 LYS A C     1 
ATOM   4216 O  O     . LYS B 2 422 ? 9.106   43.536 19.749  1.00 58.89 ? 422 LYS A O     1 
ATOM   4217 C  CB    . LYS B 2 422 ? 9.203   46.504 18.367  1.00 62.36 ? 422 LYS A CB    1 
ATOM   4218 C  CG    . LYS B 2 422 ? 10.642  46.861 18.718  1.00 65.22 ? 422 LYS A CG    1 
ATOM   4219 C  CD    . LYS B 2 422 ? 11.513  46.979 17.464  1.00 66.51 ? 422 LYS A CD    1 
ATOM   4220 C  CE    . LYS B 2 422 ? 10.983  48.070 16.520  1.00 67.97 ? 422 LYS A CE    1 
ATOM   4221 N  NZ    . LYS B 2 422 ? 10.849  49.415 17.180  1.00 67.57 ? 422 LYS A NZ    1 
ATOM   4222 N  N     . GLU B 2 423 ? 7.086   44.278 19.094  1.00 55.80 ? 423 GLU A N     1 
ATOM   4223 C  CA    . GLU B 2 423 ? 6.398   43.504 20.108  1.00 53.54 ? 423 GLU A CA    1 
ATOM   4224 C  C     . GLU B 2 423 ? 6.793   42.037 19.939  1.00 52.30 ? 423 GLU A C     1 
ATOM   4225 O  O     . GLU B 2 423 ? 7.212   41.621 18.858  1.00 51.87 ? 423 GLU A O     1 
ATOM   4226 C  CB    . GLU B 2 423 ? 4.888   43.662 19.957  1.00 53.47 ? 423 GLU A CB    1 
ATOM   4227 C  CG    . GLU B 2 423 ? 4.380   45.068 20.180  1.00 54.36 ? 423 GLU A CG    1 
ATOM   4228 C  CD    . GLU B 2 423 ? 4.719   45.589 21.565  1.00 55.39 ? 423 GLU A CD    1 
ATOM   4229 O  OE1   . GLU B 2 423 ? 4.957   44.749 22.461  1.00 54.98 ? 423 GLU A OE1   1 
ATOM   4230 O  OE2   . GLU B 2 423 ? 4.733   46.831 21.760  1.00 55.44 ? 423 GLU A OE2   1 
ATOM   4231 N  N     . PRO B 2 424 ? 6.674   41.239 21.013  1.00 50.99 ? 424 PRO A N     1 
ATOM   4232 C  CA    . PRO B 2 424 ? 7.012   39.813 20.997  1.00 50.17 ? 424 PRO A CA    1 
ATOM   4233 C  C     . PRO B 2 424 ? 5.901   39.018 20.316  1.00 49.29 ? 424 PRO A C     1 
ATOM   4234 O  O     . PRO B 2 424 ? 5.302   38.121 20.915  1.00 48.66 ? 424 PRO A O     1 
ATOM   4235 C  CB    . PRO B 2 424 ? 7.120   39.485 22.474  1.00 50.18 ? 424 PRO A CB    1 
ATOM   4236 C  CG    . PRO B 2 424 ? 6.007   40.304 23.048  1.00 50.04 ? 424 PRO A CG    1 
ATOM   4237 C  CD    . PRO B 2 424 ? 6.184   41.637 22.345  1.00 50.29 ? 424 PRO A CD    1 
ATOM   4238 N  N     . VAL B 2 425 ? 5.631   39.358 19.060  1.00 48.59 ? 425 VAL A N     1 
ATOM   4239 C  CA    . VAL B 2 425 ? 4.575   38.698 18.307  1.00 47.56 ? 425 VAL A CA    1 
ATOM   4240 C  C     . VAL B 2 425 ? 5.067   38.153 16.972  1.00 47.10 ? 425 VAL A C     1 
ATOM   4241 O  O     . VAL B 2 425 ? 4.311   37.522 16.230  1.00 46.92 ? 425 VAL A O     1 
ATOM   4242 C  CB    . VAL B 2 425 ? 3.429   39.668 18.040  1.00 46.64 ? 425 VAL A CB    1 
ATOM   4243 C  CG1   . VAL B 2 425 ? 2.958   40.289 19.349  1.00 46.20 ? 425 VAL A CG1   1 
ATOM   4244 C  CG2   . VAL B 2 425 ? 3.883   40.727 17.078  1.00 45.60 ? 425 VAL A CG2   1 
ATOM   4245 N  N     . THR B 2 426 ? 6.337   38.396 16.681  1.00 46.18 ? 426 THR A N     1 
ATOM   4246 C  CA    . THR B 2 426 ? 6.944   37.948 15.438  1.00 45.65 ? 426 THR A CA    1 
ATOM   4247 C  C     . THR B 2 426 ? 6.622   36.509 15.057  1.00 43.92 ? 426 THR A C     1 
ATOM   4248 O  O     . THR B 2 426 ? 6.116   36.258 13.975  1.00 43.51 ? 426 THR A O     1 
ATOM   4249 C  CB    . THR B 2 426 ? 8.454   38.121 15.509  1.00 46.74 ? 426 THR A CB    1 
ATOM   4250 O  OG1   . THR B 2 426 ? 8.922   37.631 16.774  1.00 48.96 ? 426 THR A OG1   1 
ATOM   4251 C  CG2   . THR B 2 426 ? 8.815   39.600 15.366  1.00 47.13 ? 426 THR A CG2   1 
ATOM   4252 N  N     . ALA B 2 427 ? 6.906   35.561 15.938  1.00 43.61 ? 427 ALA A N     1 
ATOM   4253 C  CA    . ALA B 2 427 ? 6.638   34.159 15.634  1.00 43.20 ? 427 ALA A CA    1 
ATOM   4254 C  C     . ALA B 2 427 ? 5.175   33.893 15.338  1.00 42.70 ? 427 ALA A C     1 
ATOM   4255 O  O     . ALA B 2 427 ? 4.860   33.200 14.389  1.00 42.86 ? 427 ALA A O     1 
ATOM   4256 C  CB    . ALA B 2 427 ? 7.095   33.270 16.772  1.00 43.93 ? 427 ALA A CB    1 
ATOM   4257 N  N     . GLU B 2 428 ? 4.275   34.427 16.149  1.00 43.25 ? 428 GLU A N     1 
ATOM   4258 C  CA    . GLU B 2 428 ? 2.861   34.206 15.899  1.00 44.79 ? 428 GLU A CA    1 
ATOM   4259 C  C     . GLU B 2 428 ? 2.473   34.794 14.528  1.00 46.11 ? 428 GLU A C     1 
ATOM   4260 O  O     . GLU B 2 428 ? 1.703   34.185 13.775  1.00 46.16 ? 428 GLU A O     1 
ATOM   4261 C  CB    . GLU B 2 428 ? 2.018   34.838 17.007  1.00 44.58 ? 428 GLU A CB    1 
ATOM   4262 C  CG    . GLU B 2 428 ? 2.073   34.129 18.352  1.00 47.45 ? 428 GLU A CG    1 
ATOM   4263 C  CD    . GLU B 2 428 ? 3.445   34.196 19.031  1.00 50.81 ? 428 GLU A CD    1 
ATOM   4264 O  OE1   . GLU B 2 428 ? 4.238   35.128 18.737  1.00 51.14 ? 428 GLU A OE1   1 
ATOM   4265 O  OE2   . GLU B 2 428 ? 3.727   33.319 19.886  1.00 52.43 ? 428 GLU A OE2   1 
ATOM   4266 N  N     . LEU B 2 429 ? 3.013   35.973 14.206  1.00 46.70 ? 429 LEU A N     1 
ATOM   4267 C  CA    . LEU B 2 429 ? 2.736   36.642 12.927  1.00 46.61 ? 429 LEU A CA    1 
ATOM   4268 C  C     . LEU B 2 429 ? 3.234   35.831 11.731  1.00 46.15 ? 429 LEU A C     1 
ATOM   4269 O  O     . LEU B 2 429 ? 2.511   35.665 10.750  1.00 46.00 ? 429 LEU A O     1 
ATOM   4270 C  CB    . LEU B 2 429 ? 3.385   38.032 12.890  1.00 47.41 ? 429 LEU A CB    1 
ATOM   4271 C  CG    . LEU B 2 429 ? 2.762   39.151 13.733  1.00 48.59 ? 429 LEU A CG    1 
ATOM   4272 C  CD1   . LEU B 2 429 ? 3.712   40.332 13.784  1.00 47.93 ? 429 LEU A CD1   1 
ATOM   4273 C  CD2   . LEU B 2 429 ? 1.409   39.566 13.137  1.00 48.52 ? 429 LEU A CD2   1 
ATOM   4274 N  N     . CYS B 2 430 ? 4.472   35.345 11.812  1.00 45.36 ? 430 CYS A N     1 
ATOM   4275 C  CA    . CYS B 2 430 ? 5.053   34.542 10.743  1.00 44.25 ? 430 CYS A CA    1 
ATOM   4276 C  C     . CYS B 2 430 ? 4.178   33.326 10.533  1.00 44.45 ? 430 CYS A C     1 
ATOM   4277 O  O     . CYS B 2 430 ? 3.793   32.993 9.413   1.00 45.52 ? 430 CYS A O     1 
ATOM   4278 C  CB    . CYS B 2 430 ? 6.468   34.096 11.113  1.00 43.10 ? 430 CYS A CB    1 
ATOM   4279 S  SG    . CYS B 2 430 ? 7.740   35.322 10.713  1.00 44.08 ? 430 CYS A SG    1 
ATOM   4280 N  N     . GLU B 2 431 ? 3.865   32.670 11.636  1.00 44.36 ? 431 GLU A N     1 
ATOM   4281 C  CA    . GLU B 2 431 ? 3.028   31.482 11.639  1.00 43.70 ? 431 GLU A CA    1 
ATOM   4282 C  C     . GLU B 2 431 ? 1.680   31.764 10.985  1.00 42.39 ? 431 GLU A C     1 
ATOM   4283 O  O     . GLU B 2 431 ? 1.229   31.003 10.132  1.00 42.25 ? 431 GLU A O     1 
ATOM   4284 C  CB    . GLU B 2 431 ? 2.810   31.039 13.085  1.00 46.09 ? 431 GLU A CB    1 
ATOM   4285 C  CG    . GLU B 2 431 ? 2.129   29.714 13.243  1.00 50.20 ? 431 GLU A CG    1 
ATOM   4286 C  CD    . GLU B 2 431 ? 2.916   28.626 12.569  1.00 54.37 ? 431 GLU A CD    1 
ATOM   4287 O  OE1   . GLU B 2 431 ? 4.170   28.707 12.608  1.00 54.72 ? 431 GLU A OE1   1 
ATOM   4288 O  OE2   . GLU B 2 431 ? 2.287   27.696 12.008  1.00 57.39 ? 431 GLU A OE2   1 
ATOM   4289 N  N     . MET B 2 432 ? 1.052   32.866 11.398  1.00 41.03 ? 432 MET A N     1 
ATOM   4290 C  CA    . MET B 2 432 ? -0.266  33.289 10.917  1.00 39.67 ? 432 MET A CA    1 
ATOM   4291 C  C     . MET B 2 432 ? -0.350  33.543 9.409   1.00 40.35 ? 432 MET A C     1 
ATOM   4292 O  O     . MET B 2 432 ? -1.417  33.354 8.798   1.00 39.30 ? 432 MET A O     1 
ATOM   4293 C  CB    . MET B 2 432 ? -0.681  34.548 11.679  1.00 38.72 ? 432 MET A CB    1 
ATOM   4294 C  CG    . MET B 2 432 ? -2.006  35.152 11.254  1.00 39.65 ? 432 MET A CG    1 
ATOM   4295 S  SD    . MET B 2 432 ? -2.490  36.669 12.167  1.00 39.41 ? 432 MET A SD    1 
ATOM   4296 C  CE    . MET B 2 432 ? -0.892  37.210 12.820  1.00 39.61 ? 432 MET A CE    1 
ATOM   4297 N  N     . MET B 2 433 ? 0.777   33.972 8.824   1.00 40.71 ? 433 MET A N     1 
ATOM   4298 C  CA    . MET B 2 433 ? 0.882   34.283 7.395   1.00 39.57 ? 433 MET A CA    1 
ATOM   4299 C  C     . MET B 2 433 ? 1.546   33.161 6.596   1.00 39.72 ? 433 MET A C     1 
ATOM   4300 O  O     . MET B 2 433 ? 1.784   33.287 5.395   1.00 39.27 ? 433 MET A O     1 
ATOM   4301 C  CB    . MET B 2 433 ? 1.664   35.585 7.190   1.00 38.95 ? 433 MET A CB    1 
ATOM   4302 C  CG    . MET B 2 433 ? 1.102   36.787 7.931   1.00 39.28 ? 433 MET A CG    1 
ATOM   4303 S  SD    . MET B 2 433 ? 1.959   38.356 7.583   1.00 40.75 ? 433 MET A SD    1 
ATOM   4304 C  CE    . MET B 2 433 ? 3.575   38.045 8.278   1.00 38.77 ? 433 MET A CE    1 
ATOM   4305 N  N     . GLY B 2 434 ? 1.843   32.061 7.266   1.00 40.31 ? 434 GLY A N     1 
ATOM   4306 C  CA    . GLY B 2 434 ? 2.447   30.941 6.580   1.00 41.46 ? 434 GLY A CA    1 
ATOM   4307 C  C     . GLY B 2 434 ? 3.826   31.252 6.055   1.00 42.68 ? 434 GLY A C     1 
ATOM   4308 O  O     . GLY B 2 434 ? 4.342   30.534 5.206   1.00 43.43 ? 434 GLY A O     1 
ATOM   4309 N  N     . VAL B 2 435 ? 4.427   32.333 6.533   1.00 44.10 ? 435 VAL A N     1 
ATOM   4310 C  CA    . VAL B 2 435 ? 5.781   32.678 6.103   1.00 45.49 ? 435 VAL A CA    1 
ATOM   4311 C  C     . VAL B 2 435 ? 6.573   31.375 6.223   1.00 46.94 ? 435 VAL A C     1 
ATOM   4312 O  O     . VAL B 2 435 ? 6.362   30.612 7.162   1.00 46.92 ? 435 VAL A O     1 
ATOM   4313 C  CB    . VAL B 2 435 ? 6.400   33.747 7.040   1.00 44.64 ? 435 VAL A CB    1 
ATOM   4314 C  CG1   . VAL B 2 435 ? 7.841   34.011 6.640   1.00 43.80 ? 435 VAL A CG1   1 
ATOM   4315 C  CG2   . VAL B 2 435 ? 5.560   35.026 7.005   1.00 42.54 ? 435 VAL A CG2   1 
ATOM   4316 N  N     . LYS B 2 436 ? 7.475   31.091 5.296   1.00 48.90 ? 436 LYS A N     1 
ATOM   4317 C  CA    . LYS B 2 436 ? 8.195   29.831 5.417   1.00 51.33 ? 436 LYS A CA    1 
ATOM   4318 C  C     . LYS B 2 436 ? 9.724   29.879 5.445   1.00 54.01 ? 436 LYS A C     1 
ATOM   4319 O  O     . LYS B 2 436 ? 10.346  30.615 4.678   1.00 53.31 ? 436 LYS A O     1 
ATOM   4320 C  CB    . LYS B 2 436 ? 7.724   28.860 4.325   1.00 49.44 ? 436 LYS A CB    1 
ATOM   4321 C  CG    . LYS B 2 436 ? 7.856   29.369 2.917   1.00 46.62 ? 436 LYS A CG    1 
ATOM   4322 C  CD    . LYS B 2 436 ? 7.421   28.318 1.909   1.00 45.69 ? 436 LYS A CD    1 
ATOM   4323 C  CE    . LYS B 2 436 ? 7.477   28.876 0.487   1.00 45.77 ? 436 LYS A CE    1 
ATOM   4324 N  NZ    . LYS B 2 436 ? 6.954   27.942 -0.542  1.00 45.49 ? 436 LYS A NZ    1 
ATOM   4325 N  N     . ASP B 2 437 ? 10.297  29.080 6.353   1.00 57.68 ? 437 ASP A N     1 
ATOM   4326 C  CA    . ASP B 2 437 ? 11.750  28.923 6.549   1.00 60.96 ? 437 ASP A CA    1 
ATOM   4327 C  C     . ASP B 2 437 ? 12.131  28.294 7.901   1.00 62.29 ? 437 ASP A C     1 
ATOM   4328 O  O     . ASP B 2 437 ? 11.997  27.054 8.061   1.00 62.95 ? 437 ASP A O     1 
ATOM   4329 C  CB    . ASP B 2 437 ? 12.485  30.265 6.410   1.00 61.51 ? 437 ASP A CB    1 
ATOM   4330 C  CG    . ASP B 2 437 ? 13.034  30.478 5.017   1.00 62.01 ? 437 ASP A CG    1 
ATOM   4331 O  OD1   . ASP B 2 437 ? 13.553  29.501 4.436   1.00 61.81 ? 437 ASP A OD1   1 
ATOM   4332 O  OD2   . ASP B 2 437 ? 12.954  31.615 4.506   1.00 62.92 ? 437 ASP A OD2   1 
ATOM   4333 O  OXT   . ASP B 2 437 ? 12.568  29.056 8.791   1.00 63.62 ? 437 ASP A OXT   1 
HETATM 4334 MG MG    . MG  C 3 .   ? 1.360   14.029 35.079  1.00 60.41 ? 502 MG  A MG    1 
HETATM 4335 S  S     . SO4 D 4 .   ? -21.914 35.038 20.579  1.00 67.57 ? 503 SO4 A S     1 
HETATM 4336 O  O1    . SO4 D 4 .   ? -21.452 33.680 20.946  1.00 67.25 ? 503 SO4 A O1    1 
HETATM 4337 O  O2    . SO4 D 4 .   ? -22.921 34.949 19.499  1.00 66.89 ? 503 SO4 A O2    1 
HETATM 4338 O  O3    . SO4 D 4 .   ? -22.523 35.690 21.756  1.00 67.46 ? 503 SO4 A O3    1 
HETATM 4339 O  O4    . SO4 D 4 .   ? -20.752 35.823 20.124  1.00 66.75 ? 503 SO4 A O4    1 
HETATM 4340 N  N1    . CTP E 5 .   ? -7.102  13.055 32.981  1.00 48.77 ? 501 CTP A N1    1 
HETATM 4341 C  C2    . CTP E 5 .   ? -8.207  12.834 32.154  1.00 49.84 ? 501 CTP A C2    1 
HETATM 4342 N  N3    . CTP E 5 .   ? -8.501  13.741 31.190  1.00 50.63 ? 501 CTP A N3    1 
HETATM 4343 C  C4    . CTP E 5 .   ? -7.738  14.830 31.041  1.00 50.58 ? 501 CTP A C4    1 
HETATM 4344 C  C5    . CTP E 5 .   ? -6.602  15.070 31.863  1.00 50.38 ? 501 CTP A C5    1 
HETATM 4345 C  C6    . CTP E 5 .   ? -6.321  14.166 32.808  1.00 49.67 ? 501 CTP A C6    1 
HETATM 4346 O  O2    . CTP E 5 .   ? -8.891  11.811 32.323  1.00 50.37 ? 501 CTP A O2    1 
HETATM 4347 N  N4    . CTP E 5 .   ? -8.071  15.706 30.086  1.00 50.30 ? 501 CTP A N4    1 
HETATM 4348 C  "C1'" . CTP E 5 .   ? -6.791  12.098 34.048  1.00 47.56 ? 501 CTP A "C1'" 1 
HETATM 4349 C  "C2'" . CTP E 5 .   ? -6.551  10.661 33.576  1.00 47.17 ? 501 CTP A "C2'" 1 
HETATM 4350 O  "O2'" . CTP E 5 .   ? -6.877  9.732  34.589  1.00 49.68 ? 501 CTP A "O2'" 1 
HETATM 4351 C  "C3'" . CTP E 5 .   ? -5.067  10.696 33.266  1.00 46.35 ? 501 CTP A "C3'" 1 
HETATM 4352 C  "C4'" . CTP E 5 .   ? -4.515  11.652 34.297  1.00 46.64 ? 501 CTP A "C4'" 1 
HETATM 4353 O  "O4'" . CTP E 5 .   ? -5.599  12.540 34.658  1.00 45.91 ? 501 CTP A "O4'" 1 
HETATM 4354 O  "O3'" . CTP E 5 .   ? -4.391  9.458  33.411  1.00 44.47 ? 501 CTP A "O3'" 1 
HETATM 4355 C  "C5'" . CTP E 5 .   ? -3.433  12.424 33.630  1.00 48.97 ? 501 CTP A "C5'" 1 
HETATM 4356 O  "O5'" . CTP E 5 .   ? -2.852  13.351 34.502  1.00 49.64 ? 501 CTP A "O5'" 1 
HETATM 4357 P  PA    . CTP E 5 .   ? -1.738  14.331 33.939  1.00 51.00 ? 501 CTP A PA    1 
HETATM 4358 O  O1A   . CTP E 5 .   ? -0.710  14.466 35.012  1.00 51.85 ? 501 CTP A O1A   1 
HETATM 4359 O  O2A   . CTP E 5 .   ? -2.448  15.542 33.447  1.00 49.36 ? 501 CTP A O2A   1 
HETATM 4360 O  O3A   . CTP E 5 .   ? -1.116  13.572 32.657  1.00 49.13 ? 501 CTP A O3A   1 
HETATM 4361 P  PB    . CTP E 5 .   ? -0.574  12.058 32.697  1.00 46.84 ? 501 CTP A PB    1 
HETATM 4362 O  O1B   . CTP E 5 .   ? -1.659  11.143 32.257  1.00 47.94 ? 501 CTP A O1B   1 
HETATM 4363 O  O2B   . CTP E 5 .   ? 0.102   11.811 33.993  1.00 47.39 ? 501 CTP A O2B   1 
HETATM 4364 O  O3B   . CTP E 5 .   ? 0.519   11.980 31.540  1.00 46.46 ? 501 CTP A O3B   1 
HETATM 4365 P  PG    . CTP E 5 .   ? 1.602   13.130 31.355  1.00 46.31 ? 501 CTP A PG    1 
HETATM 4366 O  O1G   . CTP E 5 .   ? 2.775   12.591 30.607  1.00 45.35 ? 501 CTP A O1G   1 
HETATM 4367 O  O2G   . CTP E 5 .   ? 0.907   14.343 30.847  1.00 45.76 ? 501 CTP A O2G   1 
HETATM 4368 O  O3G   . CTP E 5 .   ? 2.086   13.411 32.845  1.00 46.02 ? 501 CTP A O3G   1 
HETATM 4369 O  O     . HOH F 6 .   ? -28.282 37.459 24.043  1.00 32.88 ? 35  HOH B O     1 
HETATM 4370 O  O     . HOH F 6 .   ? -36.331 49.257 17.681  1.00 34.59 ? 36  HOH B O     1 
HETATM 4371 O  O     . HOH F 6 .   ? -34.801 43.508 19.768  1.00 51.76 ? 37  HOH B O     1 
HETATM 4372 O  O     . HOH G 6 .   ? -19.903 45.645 26.745  1.00 40.06 ? 504 HOH A O     1 
HETATM 4373 O  O     . HOH G 6 .   ? -15.052 40.870 4.849   1.00 25.47 ? 505 HOH A O     1 
HETATM 4374 O  O     . HOH G 6 .   ? -13.335 60.274 3.538   1.00 34.55 ? 508 HOH A O     1 
HETATM 4375 O  O     . HOH G 6 .   ? -10.342 32.805 17.706  1.00 29.55 ? 509 HOH A O     1 
HETATM 4376 O  O     . HOH G 6 .   ? 13.491  38.105 15.884  1.00 50.93 ? 511 HOH A O     1 
HETATM 4377 O  O     . HOH G 6 .   ? -7.241  10.479 53.196  1.00 41.54 ? 512 HOH A O     1 
HETATM 4378 O  O     . HOH G 6 .   ? 23.383  9.614  38.016  1.00 42.50 ? 513 HOH A O     1 
HETATM 4379 O  O     . HOH G 6 .   ? 14.285  30.818 8.445   1.00 59.40 ? 514 HOH A O     1 
HETATM 4380 O  O     . HOH G 6 .   ? -14.928 24.365 25.548  1.00 36.33 ? 516 HOH A O     1 
HETATM 4381 O  O     . HOH G 6 .   ? -7.682  24.269 54.813  1.00 48.35 ? 517 HOH A O     1 
HETATM 4382 O  O     . HOH G 6 .   ? 5.069   12.680 29.657  1.00 35.84 ? 518 HOH A O     1 
HETATM 4383 O  O     . HOH G 6 .   ? 5.058   13.902 32.543  1.00 43.17 ? 519 HOH A O     1 
HETATM 4384 O  O     . HOH G 6 .   ? 8.898   -0.256 18.197  1.00 28.59 ? 520 HOH A O     1 
HETATM 4385 O  O     . HOH G 6 .   ? -7.082  27.242 14.564  1.00 38.85 ? 521 HOH A O     1 
HETATM 4386 O  O     . HOH G 6 .   ? -35.693 40.949 -5.355  1.00 36.14 ? 522 HOH A O     1 
HETATM 4387 O  O     . HOH G 6 .   ? -0.355  52.304 19.903  1.00 44.56 ? 523 HOH A O     1 
HETATM 4388 O  O     . HOH G 6 .   ? -4.166  1.299  7.312   1.00 40.35 ? 524 HOH A O     1 
HETATM 4389 O  O     . HOH G 6 .   ? -25.617 49.157 -11.766 1.00 29.88 ? 525 HOH A O     1 
HETATM 4390 O  O     . HOH G 6 .   ? 19.613  9.517  28.632  1.00 48.23 ? 528 HOH A O     1 
HETATM 4391 O  O     . HOH G 6 .   ? 9.729   14.640 21.805  1.00 36.24 ? 529 HOH A O     1 
HETATM 4392 O  O     . HOH G 6 .   ? 2.048   47.037 -0.005  1.00 30.64 ? 531 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  U   33  33  33  U   U   B . n 
B 2 1   MET 1   1   1   MET MET A . n 
B 2 2   LYS 2   2   2   LYS LYS A . n 
B 2 3   VAL 3   3   3   VAL VAL A . n 
B 2 4   GLU 4   4   4   GLU GLU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   ILE 6   6   6   ILE ILE A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  ALA 10  10  10  ALA ALA A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLU 12  12  12  GLU GLU A . n 
B 2 13  LEU 13  13  13  LEU LEU A . n 
B 2 14  VAL 14  14  14  VAL VAL A . n 
B 2 15  ILE 15  15  15  ILE ILE A . n 
B 2 16  PRO 16  16  16  PRO PRO A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  GLU 19  19  19  GLU GLU A . n 
B 2 20  GLU 20  20  20  GLU GLU A . n 
B 2 21  VAL 21  21  21  VAL VAL A . n 
B 2 22  ARG 22  22  22  ARG ARG A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  GLY 24  24  24  GLY GLY A . n 
B 2 25  ARG 25  25  25  ARG ARG A . n 
B 2 26  GLU 26  26  26  GLU GLU A . n 
B 2 27  ALA 27  27  27  ALA ALA A . n 
B 2 28  GLU 28  28  28  GLU GLU A . n 
B 2 29  GLU 29  29  29  GLU GLU A . n 
B 2 30  GLU 30  30  30  GLU GLU A . n 
B 2 31  LEU 31  31  31  LEU LEU A . n 
B 2 32  ARG 32  32  32  ARG ARG A . n 
B 2 33  ARG 33  33  33  ARG ARG A . n 
B 2 34  ARG 34  34  34  ARG ARG A . n 
B 2 35  LEU 35  35  35  LEU LEU A . n 
B 2 36  ASP 36  36  36  ASP ASP A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  LEU 38  38  38  LEU LEU A . n 
B 2 39  GLY 39  39  39  GLY GLY A . n 
B 2 40  VAL 40  40  40  VAL VAL A . n 
B 2 41  GLU 41  41  41  GLU GLU A . n 
B 2 42  TYR 42  42  42  TYR TYR A . n 
B 2 43  VAL 43  43  43  VAL VAL A . n 
B 2 44  PHE 44  44  44  PHE PHE A . n 
B 2 45  VAL 45  45  45  VAL VAL A . n 
B 2 46  GLY 46  46  46  GLY GLY A . n 
B 2 47  SER 47  47  47  SER SER A . n 
B 2 48  TYR 48  48  48  TYR TYR A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ARG 50  50  50  ARG ARG A . n 
B 2 51  ASN 51  51  51  ASN ASN A . n 
B 2 52  THR 52  52  52  THR THR A . n 
B 2 53  TRP 53  53  53  TRP TRP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LYS 55  55  55  LYS LYS A . n 
B 2 56  GLY 56  56  56  GLY GLY A . n 
B 2 57  SER 57  57  57  SER SER A . n 
B 2 58  LEU 58  58  58  LEU LEU A . n 
B 2 59  GLU 59  59  59  GLU GLU A . n 
B 2 60  ILE 60  60  60  ILE ILE A . n 
B 2 61  ASP 61  61  61  ASP ASP A . n 
B 2 62  VAL 62  62  62  VAL VAL A . n 
B 2 63  PHE 63  63  63  PHE PHE A . n 
B 2 64  LEU 64  64  64  LEU LEU A . n 
B 2 65  LEU 65  65  65  LEU LEU A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  PRO 67  67  67  PRO PRO A . n 
B 2 68  GLU 68  68  68  GLU GLU A . n 
B 2 69  GLU 69  69  69  GLU GLU A . n 
B 2 70  PHE 70  70  70  PHE PHE A . n 
B 2 71  SER 71  71  71  SER SER A . n 
B 2 72  LYS 72  72  72  LYS LYS A . n 
B 2 73  GLU 73  73  73  GLU GLU A . n 
B 2 74  GLU 74  74  74  GLU GLU A . n 
B 2 75  LEU 75  75  75  LEU LEU A . n 
B 2 76  ARG 76  76  76  ARG ARG A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  ARG 78  78  78  ARG ARG A . n 
B 2 79  GLY 79  79  79  GLY GLY A . n 
B 2 80  LEU 80  80  80  LEU LEU A . n 
B 2 81  GLU 81  81  81  GLU GLU A . n 
B 2 82  ILE 82  82  82  ILE ILE A . n 
B 2 83  GLY 83  83  83  GLY GLY A . n 
B 2 84  LYS 84  84  84  LYS LYS A . n 
B 2 85  ALA 85  85  85  ALA ALA A . n 
B 2 86  VAL 86  86  86  VAL VAL A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  ASP 88  88  88  ASP ASP A . n 
B 2 89  SER 89  89  89  SER SER A . n 
B 2 90  TYR 90  90  90  TYR TYR A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  ILE 92  92  92  ILE ILE A . n 
B 2 93  ARG 93  93  93  ARG ARG A . n 
B 2 94  TYR 94  94  94  TYR TYR A . n 
B 2 95  ALA 95  95  95  ALA ALA A . n 
B 2 96  GLU 96  96  96  GLU GLU A . n 
B 2 97  HIS 97  97  97  HIS HIS A . n 
B 2 98  PRO 98  98  98  PRO PRO A . n 
B 2 99  TYR 99  99  99  TYR TYR A . n 
B 2 100 VAL 100 100 100 VAL VAL A . n 
B 2 101 HIS 101 101 101 HIS HIS A . n 
B 2 102 GLY 102 102 102 GLY GLY A . n 
B 2 103 VAL 103 103 103 VAL VAL A . n 
B 2 104 VAL 104 104 104 VAL VAL A . n 
B 2 105 LYS 105 105 105 LYS LYS A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 VAL 107 107 107 VAL VAL A . n 
B 2 108 GLU 108 108 108 GLU GLU A . n 
B 2 109 VAL 109 109 109 VAL VAL A . n 
B 2 110 ASP 110 110 110 ASP ASP A . n 
B 2 111 VAL 111 111 111 VAL VAL A . n 
B 2 112 VAL 112 112 112 VAL VAL A . n 
B 2 113 PRO 113 113 113 PRO PRO A . n 
B 2 114 CYS 114 114 114 CYS CYS A . n 
B 2 115 TYR 115 115 115 TYR TYR A . n 
B 2 116 LYS 116 116 116 LYS LYS A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 LYS 118 118 118 LYS LYS A . n 
B 2 119 GLU 119 119 119 GLU GLU A . n 
B 2 120 PRO 120 120 120 PRO PRO A . n 
B 2 121 LYS 121 121 121 LYS LYS A . n 
B 2 122 ASN 122 122 122 ASN ASN A . n 
B 2 123 ILE 123 123 123 ILE ILE A . n 
B 2 124 LYS 124 124 124 LYS LYS A . n 
B 2 125 SER 125 125 125 SER SER A . n 
B 2 126 ALA 126 126 126 ALA ALA A . n 
B 2 127 VAL 127 127 127 VAL VAL A . n 
B 2 128 ASP 128 128 128 ASP ASP A . n 
B 2 129 ARG 129 129 129 ARG ARG A . n 
B 2 130 THR 130 130 130 THR THR A . n 
B 2 131 PRO 131 131 131 PRO PRO A . n 
B 2 132 PHE 132 132 132 PHE PHE A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 LYS 135 135 135 LYS LYS A . n 
B 2 136 TRP 136 136 136 TRP TRP A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 GLU 138 138 138 GLU GLU A . n 
B 2 139 GLY 139 139 139 GLY GLY A . n 
B 2 140 ARG 140 140 140 ARG ARG A . n 
B 2 141 ILE 141 141 141 ILE ILE A . n 
B 2 142 LYS 142 142 142 LYS LYS A . n 
B 2 143 GLY 143 143 143 GLY GLY A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 ASN 146 146 146 ASN ASN A . n 
B 2 147 GLU 147 147 147 GLU GLU A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 ARG 149 149 149 ARG ARG A . n 
B 2 150 LEU 150 150 150 LEU LEU A . n 
B 2 151 LEU 151 151 151 LEU LEU A . n 
B 2 152 LYS 152 152 152 LYS LYS A . n 
B 2 153 GLY 153 153 153 GLY GLY A . n 
B 2 154 PHE 154 154 154 PHE PHE A . n 
B 2 155 LEU 155 155 155 LEU LEU A . n 
B 2 156 LYS 156 156 156 LYS LYS A . n 
B 2 157 ALA 157 157 157 ALA ALA A . n 
B 2 158 ASN 158 158 158 ASN ASN A . n 
B 2 159 GLY 159 159 159 GLY GLY A . n 
B 2 160 ILE 160 160 160 ILE ILE A . n 
B 2 161 TYR 161 161 161 TYR TYR A . n 
B 2 162 GLY 162 162 162 GLY GLY A . n 
B 2 163 ALA 163 163 163 ALA ALA A . n 
B 2 164 GLU 164 164 164 GLU GLU A . n 
B 2 165 TYR 165 165 165 TYR TYR A . n 
B 2 166 LYS 166 166 166 LYS LYS A . n 
B 2 167 VAL 167 167 167 VAL VAL A . n 
B 2 168 ARG 168 168 168 ARG ARG A . n 
B 2 169 GLY 169 169 169 GLY GLY A . n 
B 2 170 PHE 170 170 170 PHE PHE A . n 
B 2 171 SER 171 171 171 SER SER A . n 
B 2 172 GLY 172 172 172 GLY GLY A . n 
B 2 173 TYR 173 173 173 TYR TYR A . n 
B 2 174 LEU 174 174 174 LEU LEU A . n 
B 2 175 CYS 175 175 175 CYS CYS A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 LEU 177 177 177 LEU LEU A . n 
B 2 178 LEU 178 178 178 LEU LEU A . n 
B 2 179 ILE 179 179 179 ILE ILE A . n 
B 2 180 VAL 180 180 180 VAL VAL A . n 
B 2 181 PHE 181 181 181 PHE PHE A . n 
B 2 182 TYR 182 182 182 TYR TYR A . n 
B 2 183 GLY 183 183 183 GLY GLY A . n 
B 2 184 SER 184 184 184 SER SER A . n 
B 2 185 PHE 185 185 185 PHE PHE A . n 
B 2 186 LEU 186 186 186 LEU LEU A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 THR 188 188 188 THR THR A . n 
B 2 189 VAL 189 189 189 VAL VAL A . n 
B 2 190 LYS 190 190 190 LYS LYS A . n 
B 2 191 ASN 191 191 191 ASN ASN A . n 
B 2 192 ALA 192 192 192 ALA ALA A . n 
B 2 193 ARG 193 193 193 ARG ARG A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 TRP 195 195 195 TRP TRP A . n 
B 2 196 THR 196 196 196 THR THR A . n 
B 2 197 ARG 197 197 197 ARG ARG A . n 
B 2 198 ARG 198 198 198 ARG ARG A . n 
B 2 199 THR 199 199 199 THR THR A . n 
B 2 200 VAL 200 200 200 VAL VAL A . n 
B 2 201 ILE 201 201 201 ILE ILE A . n 
B 2 202 ASP 202 202 202 ASP ASP A . n 
B 2 203 VAL 203 203 203 VAL VAL A . n 
B 2 204 ALA 204 204 204 ALA ALA A . n 
B 2 205 LYS 205 205 205 LYS LYS A . n 
B 2 206 GLY 206 206 206 GLY GLY A . n 
B 2 207 GLU 207 207 207 GLU GLU A . n 
B 2 208 VAL 208 208 208 VAL VAL A . n 
B 2 209 ARG 209 209 209 ARG ARG A . n 
B 2 210 LYS 210 210 210 LYS LYS A . n 
B 2 211 GLY 211 211 211 GLY GLY A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 GLU 213 213 213 GLU GLU A . n 
B 2 214 PHE 214 214 214 PHE PHE A . n 
B 2 215 PHE 215 215 215 PHE PHE A . n 
B 2 216 VAL 216 216 216 VAL VAL A . n 
B 2 217 VAL 217 217 217 VAL VAL A . n 
B 2 218 ASP 218 218 218 ASP ASP A . n 
B 2 219 PRO 219 219 219 PRO PRO A . n 
B 2 220 VAL 220 220 220 VAL VAL A . n 
B 2 221 ASP 221 221 221 ASP ASP A . n 
B 2 222 GLU 222 222 222 GLU GLU A . n 
B 2 223 LYS 223 223 223 LYS LYS A . n 
B 2 224 ARG 224 224 224 ARG ARG A . n 
B 2 225 ASN 225 225 225 ASN ASN A . n 
B 2 226 VAL 226 226 226 VAL VAL A . n 
B 2 227 ALA 227 227 227 ALA ALA A . n 
B 2 228 ALA 228 228 228 ALA ALA A . n 
B 2 229 ASN 229 229 229 ASN ASN A . n 
B 2 230 LEU 230 230 230 LEU LEU A . n 
B 2 231 SER 231 231 231 SER SER A . n 
B 2 232 LEU 232 232 232 LEU LEU A . n 
B 2 233 ASP 233 233 233 ASP ASP A . n 
B 2 234 ASN 234 234 234 ASN ASN A . n 
B 2 235 LEU 235 235 235 LEU LEU A . n 
B 2 236 ALA 236 236 236 ALA ALA A . n 
B 2 237 ARG 237 237 237 ARG ARG A . n 
B 2 238 PHE 238 238 238 PHE PHE A . n 
B 2 239 VAL 239 239 239 VAL VAL A . n 
B 2 240 HIS 240 240 240 HIS HIS A . n 
B 2 241 LEU 241 241 241 LEU LEU A . n 
B 2 242 CYS 242 242 242 CYS CYS A . n 
B 2 243 ARG 243 243 243 ARG ARG A . n 
B 2 244 GLU 244 244 244 GLU GLU A . n 
B 2 245 PHE 245 245 245 PHE PHE A . n 
B 2 246 MET 246 246 246 MET MET A . n 
B 2 247 GLU 247 247 247 GLU GLU A . n 
B 2 248 ALA 248 248 248 ALA ALA A . n 
B 2 249 PRO 249 249 249 PRO PRO A . n 
B 2 250 SER 250 250 250 SER SER A . n 
B 2 251 LEU 251 251 251 LEU LEU A . n 
B 2 252 GLY 252 252 252 GLY GLY A . n 
B 2 253 PHE 253 253 253 PHE PHE A . n 
B 2 254 PHE 254 254 254 PHE PHE A . n 
B 2 255 LYS 255 255 255 LYS LYS A . n 
B 2 256 PRO 256 256 256 PRO PRO A . n 
B 2 257 LYS 257 257 257 LYS LYS A . n 
B 2 258 HIS 258 258 258 HIS HIS A . n 
B 2 259 PRO 259 259 259 PRO PRO A . n 
B 2 260 LEU 260 260 260 LEU LEU A . n 
B 2 261 GLU 261 261 261 GLU GLU A . n 
B 2 262 ILE 262 262 262 ILE ILE A . n 
B 2 263 GLU 263 263 263 GLU GLU A . n 
B 2 264 PRO 264 264 264 PRO PRO A . n 
B 2 265 GLU 265 265 265 GLU GLU A . n 
B 2 266 ARG 266 266 266 ARG ARG A . n 
B 2 267 LEU 267 267 267 LEU LEU A . n 
B 2 268 ARG 268 268 268 ARG ARG A . n 
B 2 269 LYS 269 269 269 LYS LYS A . n 
B 2 270 ILE 270 270 270 ILE ILE A . n 
B 2 271 VAL 271 271 271 VAL VAL A . n 
B 2 272 GLU 272 272 272 GLU GLU A . n 
B 2 273 GLU 273 273 273 GLU GLU A . n 
B 2 274 ARG 274 274 274 ARG ARG A . n 
B 2 275 GLY 275 275 275 GLY GLY A . n 
B 2 276 THR 276 276 276 THR THR A . n 
B 2 277 ALA 277 277 277 ALA ALA A . n 
B 2 278 VAL 278 278 278 VAL VAL A . n 
B 2 279 PHE 279 279 279 PHE PHE A . n 
B 2 280 ALA 280 280 280 ALA ALA A . n 
B 2 281 VAL 281 281 281 VAL VAL A . n 
B 2 282 LYS 282 282 282 LYS LYS A . n 
B 2 283 PHE 283 283 283 PHE PHE A . n 
B 2 284 ARG 284 284 284 ARG ARG A . n 
B 2 285 LYS 285 285 285 LYS LYS A . n 
B 2 286 PRO 286 286 286 PRO PRO A . n 
B 2 287 ASP 287 287 287 ASP ASP A . n 
B 2 288 ILE 288 288 288 ILE ILE A . n 
B 2 289 VAL 289 289 289 VAL VAL A . n 
B 2 290 ASP 290 290 290 ASP ASP A . n 
B 2 291 ASP 291 291 291 ASP ASP A . n 
B 2 292 ASN 292 292 292 ASN ASN A . n 
B 2 293 LEU 293 293 293 LEU LEU A . n 
B 2 294 TYR 294 294 294 TYR TYR A . n 
B 2 295 PRO 295 295 295 PRO PRO A . n 
B 2 296 GLN 296 296 296 GLN GLN A . n 
B 2 297 LEU 297 297 297 LEU LEU A . n 
B 2 298 GLU 298 298 298 GLU GLU A . n 
B 2 299 ARG 299 299 299 ARG ARG A . n 
B 2 300 ALA 300 300 300 ALA ALA A . n 
B 2 301 SER 301 301 301 SER SER A . n 
B 2 302 ARG 302 302 302 ARG ARG A . n 
B 2 303 LYS 303 303 303 LYS LYS A . n 
B 2 304 ILE 304 304 304 ILE ILE A . n 
B 2 305 PHE 305 305 305 PHE PHE A . n 
B 2 306 GLU 306 306 306 GLU GLU A . n 
B 2 307 PHE 307 307 307 PHE PHE A . n 
B 2 308 LEU 308 308 308 LEU LEU A . n 
B 2 309 GLU 309 309 309 GLU GLU A . n 
B 2 310 ARG 310 310 310 ARG ARG A . n 
B 2 311 GLU 311 311 311 GLU GLU A . n 
B 2 312 ASN 312 312 312 ASN ASN A . n 
B 2 313 PHE 313 313 313 PHE PHE A . n 
B 2 314 MET 314 314 314 MET MET A . n 
B 2 315 PRO 315 315 315 PRO PRO A . n 
B 2 316 LEU 316 316 316 LEU LEU A . n 
B 2 317 ARG 317 317 317 ARG ARG A . n 
B 2 318 SER 318 318 318 SER SER A . n 
B 2 319 ALA 319 319 319 ALA ALA A . n 
B 2 320 PHE 320 320 320 PHE PHE A . n 
B 2 321 LYS 321 321 321 LYS LYS A . n 
B 2 322 ALA 322 322 322 ALA ALA A . n 
B 2 323 SER 323 323 323 SER SER A . n 
B 2 324 GLU 324 324 324 GLU GLU A . n 
B 2 325 GLU 325 325 325 GLU GLU A . n 
B 2 326 PHE 326 326 326 PHE PHE A . n 
B 2 327 CYS 327 327 327 CYS CYS A . n 
B 2 328 TYR 328 328 328 TYR TYR A . n 
B 2 329 LEU 329 329 329 LEU LEU A . n 
B 2 330 LEU 330 330 330 LEU LEU A . n 
B 2 331 PHE 331 331 331 PHE PHE A . n 
B 2 332 GLU 332 332 332 GLU GLU A . n 
B 2 333 CYS 333 333 333 CYS CYS A . n 
B 2 334 GLN 334 334 334 GLN GLN A . n 
B 2 335 ILE 335 335 335 ILE ILE A . n 
B 2 336 LYS 336 336 336 LYS LYS A . n 
B 2 337 GLU 337 337 337 GLU GLU A . n 
B 2 338 ILE 338 338 338 ILE ILE A . n 
B 2 339 SER 339 339 339 SER SER A . n 
B 2 340 ARG 340 340 340 ARG ARG A . n 
B 2 341 VAL 341 341 341 VAL VAL A . n 
B 2 342 PHE 342 342 342 PHE PHE A . n 
B 2 343 ARG 343 343 343 ARG ARG A . n 
B 2 344 ARG 344 344 344 ARG ARG A . n 
B 2 345 MET 345 345 345 MET MET A . n 
B 2 346 GLY 346 346 346 GLY GLY A . n 
B 2 347 PRO 347 347 347 PRO PRO A . n 
B 2 348 GLN 348 348 348 GLN GLN A . n 
B 2 349 PHE 349 349 349 PHE PHE A . n 
B 2 350 GLU 350 350 350 GLU GLU A . n 
B 2 351 ASP 351 351 351 ASP ASP A . n 
B 2 352 GLU 352 352 352 GLU GLU A . n 
B 2 353 ARG 353 353 353 ARG ARG A . n 
B 2 354 ASN 354 354 354 ASN ASN A . n 
B 2 355 VAL 355 355 355 VAL VAL A . n 
B 2 356 LYS 356 356 356 LYS LYS A . n 
B 2 357 LYS 357 357 357 LYS LYS A . n 
B 2 358 PHE 358 358 358 PHE PHE A . n 
B 2 359 LEU 359 359 359 LEU LEU A . n 
B 2 360 SER 360 360 360 SER SER A . n 
B 2 361 ARG 361 361 361 ARG ARG A . n 
B 2 362 ASN 362 362 362 ASN ASN A . n 
B 2 363 ARG 363 363 363 ARG ARG A . n 
B 2 364 ALA 364 364 364 ALA ALA A . n 
B 2 365 PHE 365 365 365 PHE PHE A . n 
B 2 366 ARG 366 366 366 ARG ARG A . n 
B 2 367 PRO 367 367 367 PRO PRO A . n 
B 2 368 PHE 368 368 368 PHE PHE A . n 
B 2 369 ILE 369 369 369 ILE ILE A . n 
B 2 370 GLU 370 370 370 GLU GLU A . n 
B 2 371 ASN 371 371 371 ASN ASN A . n 
B 2 372 GLY 372 372 372 GLY GLY A . n 
B 2 373 ARG 373 373 373 ARG ARG A . n 
B 2 374 TRP 374 374 374 TRP TRP A . n 
B 2 375 TRP 375 375 375 TRP TRP A . n 
B 2 376 ALA 376 376 376 ALA ALA A . n 
B 2 377 PHE 377 377 377 PHE PHE A . n 
B 2 378 GLU 378 378 378 GLU GLU A . n 
B 2 379 MET 379 379 379 MET MET A . n 
B 2 380 ARG 380 380 380 ARG ARG A . n 
B 2 381 LYS 381 381 381 LYS LYS A . n 
B 2 382 PHE 382 382 382 PHE PHE A . n 
B 2 383 THR 383 383 383 THR THR A . n 
B 2 384 THR 384 384 384 THR THR A . n 
B 2 385 PRO 385 385 385 PRO PRO A . n 
B 2 386 GLU 386 386 386 GLU GLU A . n 
B 2 387 GLU 387 387 387 GLU GLU A . n 
B 2 388 GLY 388 388 388 GLY GLY A . n 
B 2 389 VAL 389 389 389 VAL VAL A . n 
B 2 390 ARG 390 390 390 ARG ARG A . n 
B 2 391 SER 391 391 391 SER SER A . n 
B 2 392 TYR 392 392 392 TYR TYR A . n 
B 2 393 ALA 393 393 393 ALA ALA A . n 
B 2 394 SER 394 394 394 SER SER A . n 
B 2 395 THR 395 395 395 THR THR A . n 
B 2 396 HIS 396 396 396 HIS HIS A . n 
B 2 397 TRP 397 397 397 TRP TRP A . n 
B 2 398 HIS 398 398 398 HIS HIS A . n 
B 2 399 THR 399 399 399 THR THR A . n 
B 2 400 LEU 400 400 400 LEU LEU A . n 
B 2 401 GLY 401 401 401 GLY GLY A . n 
B 2 402 LYS 402 402 402 LYS LYS A . n 
B 2 403 ASN 403 403 403 ASN ASN A . n 
B 2 404 VAL 404 404 404 VAL VAL A . n 
B 2 405 GLY 405 405 405 GLY GLY A . n 
B 2 406 GLU 406 406 406 GLU GLU A . n 
B 2 407 SER 407 407 407 SER SER A . n 
B 2 408 ILE 408 408 408 ILE ILE A . n 
B 2 409 ARG 409 409 409 ARG ARG A . n 
B 2 410 GLU 410 410 410 GLU GLU A . n 
B 2 411 TYR 411 411 411 TYR TYR A . n 
B 2 412 PHE 412 412 412 PHE PHE A . n 
B 2 413 GLU 413 413 413 GLU GLU A . n 
B 2 414 ILE 414 414 414 ILE ILE A . n 
B 2 415 ILE 415 415 415 ILE ILE A . n 
B 2 416 SER 416 416 416 SER SER A . n 
B 2 417 GLY 417 417 417 GLY GLY A . n 
B 2 418 GLU 418 418 418 GLU GLU A . n 
B 2 419 LYS 419 419 419 LYS LYS A . n 
B 2 420 LEU 420 420 420 LEU LEU A . n 
B 2 421 PHE 421 421 421 PHE PHE A . n 
B 2 422 LYS 422 422 422 LYS LYS A . n 
B 2 423 GLU 423 423 423 GLU GLU A . n 
B 2 424 PRO 424 424 424 PRO PRO A . n 
B 2 425 VAL 425 425 425 VAL VAL A . n 
B 2 426 THR 426 426 426 THR THR A . n 
B 2 427 ALA 427 427 427 ALA ALA A . n 
B 2 428 GLU 428 428 428 GLU GLU A . n 
B 2 429 LEU 429 429 429 LEU LEU A . n 
B 2 430 CYS 430 430 430 CYS CYS A . n 
B 2 431 GLU 431 431 431 GLU GLU A . n 
B 2 432 MET 432 432 432 MET MET A . n 
B 2 433 MET 433 433 433 MET MET A . n 
B 2 434 GLY 434 434 434 GLY GLY A . n 
B 2 435 VAL 435 435 435 VAL VAL A . n 
B 2 436 LYS 436 436 436 LYS LYS A . n 
B 2 437 ASP 437 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MG  1  502 502 MG  MG  A . 
D 4 SO4 1  503 503 SO4 SO4 A . 
E 5 CTP 1  501 501 CTP CTP A . 
F 6 HOH 1  35  35  HOH HOH B . 
F 6 HOH 2  36  36  HOH HOH B . 
F 6 HOH 3  37  37  HOH HOH B . 
G 6 HOH 1  504 504 HOH HOH A . 
G 6 HOH 2  505 505 HOH HOH A . 
G 6 HOH 3  508 508 HOH HOH A . 
G 6 HOH 4  509 509 HOH HOH A . 
G 6 HOH 5  511 511 HOH HOH A . 
G 6 HOH 6  512 512 HOH HOH A . 
G 6 HOH 7  513 513 HOH HOH A . 
G 6 HOH 8  514 514 HOH HOH A . 
G 6 HOH 9  516 516 HOH HOH A . 
G 6 HOH 10 517 517 HOH HOH A . 
G 6 HOH 11 518 518 HOH HOH A . 
G 6 HOH 12 519 519 HOH HOH A . 
G 6 HOH 13 520 520 HOH HOH A . 
G 6 HOH 14 521 521 HOH HOH A . 
G 6 HOH 15 522 522 HOH HOH A . 
G 6 HOH 16 523 523 HOH HOH A . 
G 6 HOH 17 524 524 HOH HOH A . 
G 6 HOH 18 525 525 HOH HOH A . 
G 6 HOH 19 528 528 HOH HOH A . 
G 6 HOH 20 529 529 HOH HOH A . 
G 6 HOH 21 531 531 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3740  ? 
1 MORE         -48   ? 
1 'SSA (A^2)'  26570 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O3G 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   CTP 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    CTP 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     501 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    MG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     502 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O1A 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   CTP 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    CTP 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     501 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 108.4 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 299 ? ? O A THR 399 ? ? 2.09 
2 1 O   A GLU 119 ? ? N A LYS 121 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A ALA 95  ? ? CA A ALA 95  ? ? C A ALA 95  ? ? 89.51 111.00 -21.49 2.70 N 
2 1 CB A GLU 119 ? ? CA A GLU 119 ? ? C A GLU 119 ? ? 95.27 110.40 -15.13 2.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 3   ? ? -6.40   -73.75  
2  1 GLU A 37  ? ? -72.20  36.36   
3  1 LEU A 38  ? ? -143.81 -39.18  
4  1 GLU A 59  ? ? -167.39 118.99  
5  1 PHE A 70  ? ? -46.55  157.50  
6  1 GLU A 91  ? ? -170.41 126.36  
7  1 ALA A 95  ? ? 160.81  -150.00 
8  1 GLU A 96  ? ? -34.42  -94.27  
9  1 GLU A 119 ? ? 66.30   106.11  
10 1 PRO A 120 ? ? -28.67  -25.44  
11 1 ASN A 122 ? ? 87.08   7.24    
12 1 LYS A 124 ? ? -90.51  -72.37  
13 1 VAL A 167 ? ? -133.65 -63.84  
14 1 GLU A 222 ? ? -52.19  -8.21   
15 1 PRO A 259 ? ? -50.92  -2.59   
16 1 MET A 314 ? ? 72.22   38.72   
17 1 PRO A 315 ? ? -46.04  157.58  
18 1 ARG A 366 ? ? 66.68   105.29  
19 1 TYR A 411 ? ? 160.58  139.49  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    U 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     14 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.070 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZHA 'double helix'         
2ZHA 'a-form double helix'  
2ZHA 'hairpin loop'         
2ZHA 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 0.309  -0.196 1.259  11.323  -5.928  -7.123  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.231 -0.174 0.476  9.401   -14.327 3.163   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.452  0.023  -0.132 8.602   -18.535 3.375   3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 0.107  0.076  0.682  -4.364  7.409   9.259   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 0.152  0.179  -0.291 8.258   -12.480 12.657  5  B_C5:G27_B  B 5  ? B 27 ? ?  1 
1 A G 6  1_555 A U 26 1_555 -1.605 -0.315 -0.383 -5.752  -11.679 11.632  6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 0.510  -0.308 -0.566 -6.427  -7.586  -9.336  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.598  -0.284 0.005  -6.941  -10.591 1.680   8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.112 -0.275 -0.431 -13.586 -16.643 -1.368  9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 -0.819 -0.132 -0.062 -0.121  -11.971 -11.232 10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 0.070  0.059  0.597  5.037   -8.395  4.299   11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 0.710  -0.183 -0.087 -7.155  -23.604 -5.496  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.275  -2.667 -0.423 -8.099  8.670   -86.302 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.185  -1.662 3.145 6.127   10.440 32.916 -4.167 0.517  2.512 17.696 -10.385 
35.014 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 0.344  -1.615 3.156 3.577   2.108  35.925 -2.887 -0.072 3.079 3.403  -5.776  
36.157 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.412 -2.066 3.391 -11.619 12.893 28.438 -5.637 -1.103 2.270 23.665 21.326  
33.222 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 -0.224 -2.136 2.562 8.591   3.401  29.224 -4.542 1.678  2.154 6.537  -16.514 
30.619 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 0.834  -2.491 3.611 -0.138  14.421 23.620 -8.364 -1.777 1.810 31.721 0.303   
27.621 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.523 -1.984 3.462 -1.983  -0.637 32.725 -3.396 2.330  3.582 -1.129 3.514   
32.790 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.539  -1.719 3.345 -2.766  8.472  36.542 -3.728 -1.183 2.843 13.270 4.332   
37.577 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.270  -2.101 3.381 8.012   8.357  22.108 -7.215 1.625  2.394 20.116 -19.285 
24.922 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.235  -2.230 2.960 -2.012  4.509  25.633 -5.977 -0.985 2.511 10.043 4.482   
26.096 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.112 -2.251 2.998 -5.006  0.955  30.817 -4.347 -0.656 2.910 1.782  9.339   
31.226 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.086  -1.520 3.508 7.681   6.236  41.195 -2.771 0.700  3.219 8.713  -10.731 
42.316 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.530 -1.879 3.297 6.468   -1.757 77.228 -1.451 1.406  3.217 -1.405 -5.173  
77.473 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'            MG  
4 'SULFATE ION'              SO4 
5 "CYTIDINE-5'-TRIPHOSPHATE" CTP 
6 water                      HOH 
#