data_2ZHB
# 
_entry.id   2ZHB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZHB         
NDB   PR0328       
RCSB  RCSB027971   
WWPDB D_1000027971 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZH1 . unspecified 
PDB 2ZH2 . unspecified 
PDB 2ZH3 . unspecified 
PDB 2ZH4 . unspecified 
PDB 2ZH5 . unspecified 
PDB 2ZH6 . unspecified 
PDB 2ZH7 . unspecified 
PDB 2ZH8 . unspecified 
PDB 2ZH9 . unspecified 
PDB 2ZHA . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZHB 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toh, Y.'    1 
'Tomita, K.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1944 
_citation.page_last                 1952 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18583961 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toh, Y.'       1 
primary 'Numata, T.'    2 
primary 'Watanabe, K.'  3 
primary 'Takeshita, D.' 4 
primary 'Nureki, O.'    5 
primary 'Tomita, K.'    6 
# 
_cell.entry_id           2ZHB 
_cell.length_a           58.139 
_cell.length_b           58.139 
_cell.length_c           443.483 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZHB 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (34-MER)'     10905.486 1  ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme' 51337.941 1  '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'       96.063    2  ?                    ? ? ? 
4 water       nat water               18.015    20 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAUC GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAUC B ? 
2 'polypeptide(L)'   no no 
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  U   n 
1 34  C   n 
2 1   LYS n 
2 2   VAL n 
2 3   GLU n 
2 4   GLU n 
2 5   ILE n 
2 6   LEU n 
2 7   GLU n 
2 8   LYS n 
2 9   ALA n 
2 10  LEU n 
2 11  GLU n 
2 12  LEU n 
2 13  VAL n 
2 14  ILE n 
2 15  PRO n 
2 16  ASP n 
2 17  GLU n 
2 18  GLU n 
2 19  GLU n 
2 20  VAL n 
2 21  ARG n 
2 22  LYS n 
2 23  GLY n 
2 24  ARG n 
2 25  GLU n 
2 26  ALA n 
2 27  GLU n 
2 28  GLU n 
2 29  GLU n 
2 30  LEU n 
2 31  ARG n 
2 32  ARG n 
2 33  ARG n 
2 34  LEU n 
2 35  ASP n 
2 36  GLU n 
2 37  LEU n 
2 38  GLY n 
2 39  VAL n 
2 40  GLU n 
2 41  TYR n 
2 42  VAL n 
2 43  PHE n 
2 44  VAL n 
2 45  GLY n 
2 46  SER n 
2 47  TYR n 
2 48  ALA n 
2 49  ARG n 
2 50  ASN n 
2 51  THR n 
2 52  TRP n 
2 53  LEU n 
2 54  LYS n 
2 55  GLY n 
2 56  SER n 
2 57  LEU n 
2 58  GLU n 
2 59  ILE n 
2 60  ASP n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  LEU n 
2 65  PHE n 
2 66  PRO n 
2 67  GLU n 
2 68  GLU n 
2 69  PHE n 
2 70  SER n 
2 71  LYS n 
2 72  GLU n 
2 73  GLU n 
2 74  LEU n 
2 75  ARG n 
2 76  GLU n 
2 77  ARG n 
2 78  GLY n 
2 79  LEU n 
2 80  GLU n 
2 81  ILE n 
2 82  GLY n 
2 83  LYS n 
2 84  ALA n 
2 85  VAL n 
2 86  LEU n 
2 87  ASP n 
2 88  SER n 
2 89  TYR n 
2 90  GLU n 
2 91  ILE n 
2 92  ARG n 
2 93  TYR n 
2 94  ALA n 
2 95  GLU n 
2 96  HIS n 
2 97  PRO n 
2 98  TYR n 
2 99  VAL n 
2 100 HIS n 
2 101 GLY n 
2 102 VAL n 
2 103 VAL n 
2 104 LYS n 
2 105 GLY n 
2 106 VAL n 
2 107 GLU n 
2 108 VAL n 
2 109 ASP n 
2 110 VAL n 
2 111 VAL n 
2 112 PRO n 
2 113 CYS n 
2 114 TYR n 
2 115 LYS n 
2 116 LEU n 
2 117 LYS n 
2 118 GLU n 
2 119 PRO n 
2 120 LYS n 
2 121 ASN n 
2 122 ILE n 
2 123 LYS n 
2 124 SER n 
2 125 ALA n 
2 126 VAL n 
2 127 ASP n 
2 128 ARG n 
2 129 THR n 
2 130 PRO n 
2 131 PHE n 
2 132 HIS n 
2 133 HIS n 
2 134 LYS n 
2 135 TRP n 
2 136 LEU n 
2 137 GLU n 
2 138 GLY n 
2 139 ARG n 
2 140 ILE n 
2 141 LYS n 
2 142 GLY n 
2 143 LYS n 
2 144 GLU n 
2 145 ASN n 
2 146 GLU n 
2 147 VAL n 
2 148 ARG n 
2 149 LEU n 
2 150 LEU n 
2 151 LYS n 
2 152 GLY n 
2 153 PHE n 
2 154 LEU n 
2 155 LYS n 
2 156 ALA n 
2 157 ASN n 
2 158 GLY n 
2 159 ILE n 
2 160 TYR n 
2 161 GLY n 
2 162 ALA n 
2 163 GLU n 
2 164 TYR n 
2 165 LYS n 
2 166 VAL n 
2 167 ARG n 
2 168 GLY n 
2 169 PHE n 
2 170 SER n 
2 171 GLY n 
2 172 TYR n 
2 173 LEU n 
2 174 CYS n 
2 175 GLU n 
2 176 LEU n 
2 177 LEU n 
2 178 ILE n 
2 179 VAL n 
2 180 PHE n 
2 181 TYR n 
2 182 GLY n 
2 183 SER n 
2 184 PHE n 
2 185 LEU n 
2 186 GLU n 
2 187 THR n 
2 188 VAL n 
2 189 LYS n 
2 190 ASN n 
2 191 ALA n 
2 192 ARG n 
2 193 ARG n 
2 194 TRP n 
2 195 THR n 
2 196 ARG n 
2 197 ARG n 
2 198 THR n 
2 199 VAL n 
2 200 ILE n 
2 201 ASP n 
2 202 VAL n 
2 203 ALA n 
2 204 LYS n 
2 205 GLY n 
2 206 GLU n 
2 207 VAL n 
2 208 ARG n 
2 209 LYS n 
2 210 GLY n 
2 211 GLU n 
2 212 GLU n 
2 213 PHE n 
2 214 PHE n 
2 215 VAL n 
2 216 VAL n 
2 217 ASP n 
2 218 PRO n 
2 219 VAL n 
2 220 ASP n 
2 221 GLU n 
2 222 LYS n 
2 223 ARG n 
2 224 ASN n 
2 225 VAL n 
2 226 ALA n 
2 227 ALA n 
2 228 ASN n 
2 229 LEU n 
2 230 SER n 
2 231 LEU n 
2 232 ASP n 
2 233 ASN n 
2 234 LEU n 
2 235 ALA n 
2 236 ARG n 
2 237 PHE n 
2 238 VAL n 
2 239 HIS n 
2 240 LEU n 
2 241 CYS n 
2 242 ARG n 
2 243 GLU n 
2 244 PHE n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 PRO n 
2 249 SER n 
2 250 LEU n 
2 251 GLY n 
2 252 PHE n 
2 253 PHE n 
2 254 LYS n 
2 255 PRO n 
2 256 LYS n 
2 257 HIS n 
2 258 PRO n 
2 259 LEU n 
2 260 GLU n 
2 261 ILE n 
2 262 GLU n 
2 263 PRO n 
2 264 GLU n 
2 265 ARG n 
2 266 LEU n 
2 267 ARG n 
2 268 LYS n 
2 269 ILE n 
2 270 VAL n 
2 271 GLU n 
2 272 GLU n 
2 273 ARG n 
2 274 GLY n 
2 275 THR n 
2 276 ALA n 
2 277 VAL n 
2 278 PHE n 
2 279 ALA n 
2 280 VAL n 
2 281 LYS n 
2 282 PHE n 
2 283 ARG n 
2 284 LYS n 
2 285 PRO n 
2 286 ASP n 
2 287 ILE n 
2 288 VAL n 
2 289 ASP n 
2 290 ASP n 
2 291 ASN n 
2 292 LEU n 
2 293 TYR n 
2 294 PRO n 
2 295 GLN n 
2 296 LEU n 
2 297 GLU n 
2 298 ARG n 
2 299 ALA n 
2 300 SER n 
2 301 ARG n 
2 302 LYS n 
2 303 ILE n 
2 304 PHE n 
2 305 GLU n 
2 306 PHE n 
2 307 LEU n 
2 308 GLU n 
2 309 ARG n 
2 310 GLU n 
2 311 ASN n 
2 312 PHE n 
2 313 MET n 
2 314 PRO n 
2 315 LEU n 
2 316 ARG n 
2 317 SER n 
2 318 ALA n 
2 319 PHE n 
2 320 LYS n 
2 321 ALA n 
2 322 SER n 
2 323 GLU n 
2 324 GLU n 
2 325 PHE n 
2 326 CYS n 
2 327 TYR n 
2 328 LEU n 
2 329 LEU n 
2 330 PHE n 
2 331 GLU n 
2 332 CYS n 
2 333 GLN n 
2 334 ILE n 
2 335 LYS n 
2 336 GLU n 
2 337 ILE n 
2 338 SER n 
2 339 ARG n 
2 340 VAL n 
2 341 PHE n 
2 342 ARG n 
2 343 ARG n 
2 344 MET n 
2 345 GLY n 
2 346 PRO n 
2 347 GLN n 
2 348 PHE n 
2 349 GLU n 
2 350 ASP n 
2 351 GLU n 
2 352 ARG n 
2 353 ASN n 
2 354 VAL n 
2 355 LYS n 
2 356 LYS n 
2 357 PHE n 
2 358 LEU n 
2 359 SER n 
2 360 ARG n 
2 361 ASN n 
2 362 ARG n 
2 363 ALA n 
2 364 PHE n 
2 365 ARG n 
2 366 PRO n 
2 367 PHE n 
2 368 ILE n 
2 369 GLU n 
2 370 ASN n 
2 371 GLY n 
2 372 ARG n 
2 373 TRP n 
2 374 TRP n 
2 375 ALA n 
2 376 PHE n 
2 377 GLU n 
2 378 MET n 
2 379 ARG n 
2 380 LYS n 
2 381 PHE n 
2 382 THR n 
2 383 THR n 
2 384 PRO n 
2 385 GLU n 
2 386 GLU n 
2 387 GLY n 
2 388 VAL n 
2 389 ARG n 
2 390 SER n 
2 391 TYR n 
2 392 ALA n 
2 393 SER n 
2 394 THR n 
2 395 HIS n 
2 396 TRP n 
2 397 HIS n 
2 398 THR n 
2 399 LEU n 
2 400 GLY n 
2 401 LYS n 
2 402 ASN n 
2 403 VAL n 
2 404 GLY n 
2 405 GLU n 
2 406 SER n 
2 407 ILE n 
2 408 ARG n 
2 409 GLU n 
2 410 TYR n 
2 411 PHE n 
2 412 GLU n 
2 413 ILE n 
2 414 ILE n 
2 415 SER n 
2 416 GLY n 
2 417 GLU n 
2 418 LYS n 
2 419 LEU n 
2 420 PHE n 
2 421 LYS n 
2 422 GLU n 
2 423 PRO n 
2 424 VAL n 
2 425 THR n 
2 426 ALA n 
2 427 GLU n 
2 428 LEU n 
2 429 CYS n 
2 430 GLU n 
2 431 MET n 
2 432 MET n 
2 433 GLY n 
2 434 VAL n 
2 435 LYS n 
2 436 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU O28126 2 
;KVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLE
IGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIY
GAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHL
CREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFK
ASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLG
KNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
2 ? 
2 PDB 2ZHB      2ZHB   1 GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAUC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZHB A 1 ? 436 ? O28126 2 ? 437 ? 2 437 
2 2 2ZHB B 1 ? 34  ? 2ZHB   1 ? 34  ? 1 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ZHB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_percent_sol   59.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-lithium citrate, 80mM NH4SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 NH4SO4                ? ? ? 
1 5  1 HOH                   ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 NH4SO4                ? ? ? 
1 10 2 HOH                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2ZHB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.05 
_reflns.number_obs                   15750 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.110 
_reflns.pdbx_netI_over_sigmaI        41.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.335 
_reflns_shell.meanI_over_sigI_obs    10.9 
_reflns_shell.pdbx_redundancy        14.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1509 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZHB 
_refine.ls_number_reflns_obs                     15645 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1961756.01 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.55 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.265 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  797 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               42.1 
_refine.aniso_B[1][1]                            -3.72 
_refine.aniso_B[2][2]                            -3.72 
_refine.aniso_B[3][3]                            7.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.330982 
_refine.solvent_model_param_bsol                 13.1587 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZHB 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.62 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3622 
_refine_hist.pdbx_number_atoms_nucleic_acid   723 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             20 
_refine_hist.number_atoms_total               4375 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        38.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.09  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.99  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.74  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.30  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.14  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.05 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             466 
_refine_ls_shell.R_factor_R_work                  0.336 
_refine_ls_shell.percent_reflns_obs               16.8 
_refine_ls_shell.R_factor_R_free                  0.396 
_refine_ls_shell.R_factor_R_free_error            0.079 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             25 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param   water.top        'X-RAY DIFFRACTION' 
4 ion.param         carbohydrate.top 'X-RAY DIFFRACTION' 
5 SO4.param         ion.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZHB 
_struct.title                     'Complex structure of AFCCA with tRNAminiDUC' 
_struct.pdbx_descriptor           'CCA-adding enzyme(E.C.2.7.7.25, 2.7.7.21)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZHB 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
;TRANSFERASE/RNA, ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Nucleotidyltransferase, RNA repair, RNA-binding, tRNA processing, TRANSFERASE-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS B 1   ? ILE B 14  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP B 16  ? GLU B 36  ? ASP A 17  GLU A 37  1 ? 21 
HELX_P HELX_P3  3  GLY B 45  ? ARG B 49  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 70  ? LEU B 86  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  SER B 124 ? GLY B 138 ? SER A 125 GLY A 139 1 ? 15 
HELX_P HELX_P6  6  LYS B 143 ? ASN B 157 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER B 170 ? GLY B 182 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER B 183 ? ARG B 192 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  ALA B 203 ? GLY B 205 ? ALA A 204 GLY A 206 5 ? 3  
HELX_P HELX_P10 10 SER B 230 ? ALA B 247 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P11 11 SER B 249 ? PHE B 253 ? SER A 250 PHE A 254 5 ? 5  
HELX_P HELX_P12 12 GLU B 262 ? GLY B 274 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P13 13 VAL B 288 ? GLU B 310 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P14 14 ASP B 350 ? ARG B 360 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P15 15 THR B 383 ? HIS B 395 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P16 16 TRP B 396 ? LEU B 399 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P17 17 ASN B 402 ? ARG B 408 ? ASN A 403 ARG A 409 1 ? 7  
HELX_P HELX_P18 18 GLY B 416 ? LYS B 421 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P19 19 VAL B 424 ? MET B 432 ? VAL A 425 MET A 433 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 31 N3 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 31 O2 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 31 N4 ? ? B G 1  B C 31 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 30 N3 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 30 O2 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 30 N4 ? ? B G 2  B C 30 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? A C 3  N3 ? ? ? 1_555 A G 29 N1 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8  hydrog ? ? A C 3  N4 ? ? ? 1_555 A G 29 O6 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? A C 3  O2 ? ? ? 1_555 A G 29 N2 ? ? B C 3  B G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? A C 4  O2 ? ? ? 1_555 A G 28 N2 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog11 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 27 N1 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 27 O6 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 27 N2 ? ? B C 5  B G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? A G 6  N1 ? ? ? 1_555 A U 26 O2 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog15 hydrog ? ? A G 6  O6 ? ? ? 1_555 A U 26 N3 ? ? B G 6  B U 26 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog16 hydrog ? ? A G 7  N1 ? ? ? 1_555 A C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog17 hydrog ? ? A G 7  N2 ? ? ? 1_555 A C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog18 hydrog ? ? A G 7  O6 ? ? ? 1_555 A C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 24 O2 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 24 N4 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? A G 9  N1 ? ? ? 1_555 A C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? A G 9  N2 ? ? ? 1_555 A C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog24 hydrog ? ? A G 9  O6 ? ? ? 1_555 A C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog25 hydrog ? ? A C 10 N3 ? ? ? 1_555 A G 22 N1 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog26 hydrog ? ? A C 10 N4 ? ? ? 1_555 A G 22 O6 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog27 hydrog ? ? A C 10 O2 ? ? ? 1_555 A G 22 N2 ? ? B C 10 B G 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? A G 11 N1 ? ? ? 1_555 A C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? A G 11 N2 ? ? ? 1_555 A C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? A G 11 O6 ? ? ? 1_555 A C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? A G 12 N1 ? ? ? 1_555 A C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? A G 12 N2 ? ? ? 1_555 A C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? A G 12 O6 ? ? ? 1_555 A C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? A U 13 N3 ? ? ? 1_555 A A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog35 hydrog ? ? A U 13 O2 ? ? ? 1_555 A A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 41  ? VAL B 44  ? TYR A 42  VAL A 45  
A 2 GLU B 58  ? PHE B 65  ? GLU A 59  PHE A 66  
A 3 VAL B 106 ? TYR B 114 ? VAL A 107 TYR A 115 
A 4 TYR B 98  ? VAL B 103 ? TYR A 99  VAL A 104 
A 5 ILE B 91  ? ARG B 92  ? ILE A 92  ARG A 93  
B 1 GLU B 206 ? LYS B 209 ? GLU A 207 LYS A 210 
B 2 THR B 198 ? ASP B 201 ? THR A 199 ASP A 202 
B 3 PHE B 214 ? VAL B 216 ? PHE A 215 VAL A 217 
C 1 PRO B 314 ? ALA B 321 ? PRO A 315 ALA A 322 
C 2 PHE B 325 ? CYS B 332 ? PHE A 326 CYS A 333 
C 3 ALA B 276 ? ARG B 283 ? ALA A 277 ARG A 284 
C 4 PHE B 411 ? SER B 415 ? PHE A 412 SER A 416 
D 1 VAL B 340 ? GLN B 347 ? VAL A 341 GLN A 348 
D 2 ARG B 372 ? MET B 378 ? ARG A 373 MET A 379 
D 3 PHE B 367 ? GLU B 369 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 44  ? N VAL A 45  O ASP B 60  ? O ASP A 61  
A 2 3 N LEU B 63  ? N LEU A 64  O VAL B 111 ? O VAL A 112 
A 3 4 O VAL B 110 ? O VAL A 111 N VAL B 99  ? N VAL A 100 
A 4 5 O TYR B 98  ? O TYR A 99  N ARG B 92  ? N ARG A 93  
B 1 2 O ARG B 208 ? O ARG A 209 N VAL B 199 ? N VAL A 200 
B 2 3 N ILE B 200 ? N ILE A 201 O PHE B 214 ? O PHE A 215 
C 1 2 N ALA B 318 ? N ALA A 319 O LEU B 329 ? O LEU A 330 
C 2 3 O CYS B 326 ? O CYS A 327 N PHE B 282 ? N PHE A 283 
C 3 4 N LYS B 281 ? N LYS A 282 O GLU B 412 ? O GLU A 413 
D 1 2 N ARG B 343 ? N ARG A 344 O ALA B 375 ? O ALA A 376 
D 2 3 O TRP B 374 ? O TRP A 375 N PHE B 367 ? N PHE A 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1'   
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 438' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 SER B 46  ? SER A 47  . ? 1_555 ? 
2  AC1 7 THR B 51  ? THR A 52  . ? 1_555 ? 
3  AC1 7 TRP B 52  ? TRP A 53  . ? 1_555 ? 
4  AC1 7 LEU B 53  ? LEU A 54  . ? 1_555 ? 
5  AC1 7 SER B 56  ? SER A 57  . ? 1_555 ? 
6  AC1 7 LYS B 151 ? LYS A 152 . ? 1_555 ? 
7  AC1 7 TYR B 160 ? TYR A 161 . ? 1_555 ? 
8  AC2 3 ARG B 298 ? ARG A 299 . ? 1_555 ? 
9  AC2 3 ARG B 301 ? ARG A 302 . ? 1_555 ? 
10 AC2 3 LYS B 302 ? LYS A 303 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZHB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZHB 
_atom_sites.fract_transf_matrix[1][1]   0.017200 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017200 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002255 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . G   A 1 1   ? -14.966 36.005 36.494  1.00 41.94 ? 1   G   B P     1 
ATOM   2    O OP1   . G   A 1 1   ? -15.302 34.865 37.457  1.00 43.25 ? 1   G   B OP1   1 
ATOM   3    O OP2   . G   A 1 1   ? -13.660 36.702 36.869  1.00 41.75 ? 1   G   B OP2   1 
ATOM   4    O "O5'" . G   A 1 1   ? -14.696 35.295 35.048  1.00 41.97 ? 1   G   B "O5'" 1 
ATOM   5    C "C5'" . G   A 1 1   ? -14.233 36.055 33.920  1.00 38.50 ? 1   G   B "C5'" 1 
ATOM   6    C "C4'" . G   A 1 1   ? -13.119 35.321 33.200  1.00 37.83 ? 1   G   B "C4'" 1 
ATOM   7    O "O4'" . G   A 1 1   ? -12.669 34.164 33.953  1.00 37.61 ? 1   G   B "O4'" 1 
ATOM   8    C "C3'" . G   A 1 1   ? -13.491 34.754 31.847  1.00 37.25 ? 1   G   B "C3'" 1 
ATOM   9    O "O3'" . G   A 1 1   ? -13.416 35.769 30.870  1.00 36.30 ? 1   G   B "O3'" 1 
ATOM   10   C "C2'" . G   A 1 1   ? -12.442 33.669 31.637  1.00 37.01 ? 1   G   B "C2'" 1 
ATOM   11   O "O2'" . G   A 1 1   ? -11.196 34.156 31.181  1.00 35.69 ? 1   G   B "O2'" 1 
ATOM   12   C "C1'" . G   A 1 1   ? -12.295 33.123 33.058  1.00 37.36 ? 1   G   B "C1'" 1 
ATOM   13   N N9    . G   A 1 1   ? -13.156 31.973 33.312  1.00 37.38 ? 1   G   B N9    1 
ATOM   14   C C8    . G   A 1 1   ? -14.205 31.911 34.196  1.00 38.22 ? 1   G   B C8    1 
ATOM   15   N N7    . G   A 1 1   ? -14.800 30.749 34.205  1.00 38.38 ? 1   G   B N7    1 
ATOM   16   C C5    . G   A 1 1   ? -14.101 29.996 33.269  1.00 36.99 ? 1   G   B C5    1 
ATOM   17   C C6    . G   A 1 1   ? -14.290 28.660 32.841  1.00 36.13 ? 1   G   B C6    1 
ATOM   18   O O6    . G   A 1 1   ? -15.153 27.856 33.192  1.00 37.11 ? 1   G   B O6    1 
ATOM   19   N N1    . G   A 1 1   ? -13.345 28.288 31.897  1.00 36.00 ? 1   G   B N1    1 
ATOM   20   C C2    . G   A 1 1   ? -12.354 29.092 31.422  1.00 36.47 ? 1   G   B C2    1 
ATOM   21   N N2    . G   A 1 1   ? -11.510 28.527 30.561  1.00 35.93 ? 1   G   B N2    1 
ATOM   22   N N3    . G   A 1 1   ? -12.187 30.352 31.779  1.00 37.68 ? 1   G   B N3    1 
ATOM   23   C C4    . G   A 1 1   ? -13.083 30.734 32.710  1.00 37.41 ? 1   G   B C4    1 
ATOM   24   P P     . G   A 1 2   ? -14.542 35.846 29.744  1.00 34.04 ? 2   G   B P     1 
ATOM   25   O OP1   . G   A 1 2   ? -14.283 37.055 28.912  1.00 34.13 ? 2   G   B OP1   1 
ATOM   26   O OP2   . G   A 1 2   ? -15.860 35.682 30.402  1.00 36.05 ? 2   G   B OP2   1 
ATOM   27   O "O5'" . G   A 1 2   ? -14.237 34.552 28.880  1.00 36.55 ? 2   G   B "O5'" 1 
ATOM   28   C "C5'" . G   A 1 2   ? -13.099 34.519 28.023  1.00 37.28 ? 2   G   B "C5'" 1 
ATOM   29   C "C4'" . G   A 1 2   ? -13.072 33.230 27.245  1.00 36.79 ? 2   G   B "C4'" 1 
ATOM   30   O "O4'" . G   A 1 2   ? -12.834 32.132 28.165  1.00 37.33 ? 2   G   B "O4'" 1 
ATOM   31   C "C3'" . G   A 1 2   ? -14.368 32.851 26.546  1.00 36.13 ? 2   G   B "C3'" 1 
ATOM   32   O "O3'" . G   A 1 2   ? -14.486 33.501 25.282  1.00 33.83 ? 2   G   B "O3'" 1 
ATOM   33   C "C2'" . G   A 1 2   ? -14.180 31.353 26.388  1.00 37.27 ? 2   G   B "C2'" 1 
ATOM   34   O "O2'" . G   A 1 2   ? -13.244 31.078 25.360  1.00 39.28 ? 2   G   B "O2'" 1 
ATOM   35   C "C1'" . G   A 1 2   ? -13.553 30.990 27.736  1.00 37.56 ? 2   G   B "C1'" 1 
ATOM   36   N N9    . G   A 1 2   ? -14.521 30.639 28.774  1.00 38.44 ? 2   G   B N9    1 
ATOM   37   C C8    . G   A 1 2   ? -15.027 31.465 29.750  1.00 39.09 ? 2   G   B C8    1 
ATOM   38   N N7    . G   A 1 2   ? -15.877 30.866 30.541  1.00 39.64 ? 2   G   B N7    1 
ATOM   39   C C5    . G   A 1 2   ? -15.935 29.564 30.061  1.00 39.28 ? 2   G   B C5    1 
ATOM   40   C C6    . G   A 1 2   ? -16.687 28.443 30.520  1.00 39.01 ? 2   G   B C6    1 
ATOM   41   O O6    . G   A 1 2   ? -17.461 28.371 31.484  1.00 38.66 ? 2   G   B O6    1 
ATOM   42   N N1    . G   A 1 2   ? -16.459 27.321 29.734  1.00 39.11 ? 2   G   B N1    1 
ATOM   43   C C2    . G   A 1 2   ? -15.611 27.272 28.659  1.00 39.69 ? 2   G   B C2    1 
ATOM   44   N N2    . G   A 1 2   ? -15.545 26.101 28.032  1.00 39.65 ? 2   G   B N2    1 
ATOM   45   N N3    . G   A 1 2   ? -14.888 28.297 28.231  1.00 39.54 ? 2   G   B N3    1 
ATOM   46   C C4    . G   A 1 2   ? -15.104 29.406 28.970  1.00 39.18 ? 2   G   B C4    1 
ATOM   47   P P     . C   A 1 3   ? -15.913 33.538 24.523  1.00 32.91 ? 3   C   B P     1 
ATOM   48   O OP1   . C   A 1 3   ? -15.723 34.221 23.209  1.00 33.05 ? 3   C   B OP1   1 
ATOM   49   O OP2   . C   A 1 3   ? -16.942 34.038 25.465  1.00 32.77 ? 3   C   B OP2   1 
ATOM   50   O "O5'" . C   A 1 3   ? -16.237 32.004 24.212  1.00 33.84 ? 3   C   B "O5'" 1 
ATOM   51   C "C5'" . C   A 1 3   ? -15.621 31.344 23.100  1.00 34.49 ? 3   C   B "C5'" 1 
ATOM   52   C "C4'" . C   A 1 3   ? -16.079 29.908 23.004  1.00 34.45 ? 3   C   B "C4'" 1 
ATOM   53   O "O4'" . C   A 1 3   ? -15.786 29.227 24.250  1.00 35.01 ? 3   C   B "O4'" 1 
ATOM   54   C "C3'" . C   A 1 3   ? -17.568 29.677 22.806  1.00 34.98 ? 3   C   B "C3'" 1 
ATOM   55   O "O3'" . C   A 1 3   ? -17.921 29.780 21.435  1.00 35.81 ? 3   C   B "O3'" 1 
ATOM   56   C "C2'" . C   A 1 3   ? -17.728 28.249 23.301  1.00 35.61 ? 3   C   B "C2'" 1 
ATOM   57   O "O2'" . C   A 1 3   ? -17.298 27.298 22.345  1.00 36.03 ? 3   C   B "O2'" 1 
ATOM   58   C "C1'" . C   A 1 3   ? -16.788 28.255 24.510  1.00 36.45 ? 3   C   B "C1'" 1 
ATOM   59   N N1    . C   A 1 3   ? -17.478 28.641 25.750  1.00 36.64 ? 3   C   B N1    1 
ATOM   60   C C2    . C   A 1 3   ? -18.310 27.712 26.373  1.00 36.80 ? 3   C   B C2    1 
ATOM   61   O O2    . C   A 1 3   ? -18.408 26.581 25.883  1.00 37.54 ? 3   C   B O2    1 
ATOM   62   N N3    . C   A 1 3   ? -18.986 28.072 27.494  1.00 37.42 ? 3   C   B N3    1 
ATOM   63   C C4    . C   A 1 3   ? -18.843 29.306 27.991  1.00 36.69 ? 3   C   B C4    1 
ATOM   64   N N4    . C   A 1 3   ? -19.544 29.635 29.073  1.00 34.90 ? 3   C   B N4    1 
ATOM   65   C C5    . C   A 1 3   ? -17.978 30.262 27.391  1.00 37.27 ? 3   C   B C5    1 
ATOM   66   C C6    . C   A 1 3   ? -17.321 29.892 26.279  1.00 37.66 ? 3   C   B C6    1 
ATOM   67   P P     . C   A 1 4   ? -19.429 30.149 21.025  1.00 45.55 ? 4   C   B P     1 
ATOM   68   O OP1   . C   A 1 4   ? -19.426 30.286 19.541  1.00 45.87 ? 4   C   B OP1   1 
ATOM   69   O OP2   . C   A 1 4   ? -19.900 31.272 21.871  1.00 45.11 ? 4   C   B OP2   1 
ATOM   70   O "O5'" . C   A 1 4   ? -20.266 28.862 21.445  1.00 45.74 ? 4   C   B "O5'" 1 
ATOM   71   C "C5'" . C   A 1 4   ? -20.181 27.677 20.671  1.00 47.67 ? 4   C   B "C5'" 1 
ATOM   72   C "C4'" . C   A 1 4   ? -21.175 26.664 21.158  1.00 47.96 ? 4   C   B "C4'" 1 
ATOM   73   O "O4'" . C   A 1 4   ? -20.776 26.204 22.472  1.00 49.04 ? 4   C   B "O4'" 1 
ATOM   74   C "C3'" . C   A 1 4   ? -22.591 27.172 21.348  1.00 48.21 ? 4   C   B "C3'" 1 
ATOM   75   O "O3'" . C   A 1 4   ? -23.292 27.186 20.105  1.00 49.31 ? 4   C   B "O3'" 1 
ATOM   76   C "C2'" . C   A 1 4   ? -23.131 26.145 22.336  1.00 49.08 ? 4   C   B "C2'" 1 
ATOM   77   O "O2'" . C   A 1 4   ? -23.383 24.890 21.738  1.00 48.14 ? 4   C   B "O2'" 1 
ATOM   78   C "C1'" . C   A 1 4   ? -21.927 25.977 23.260  1.00 49.95 ? 4   C   B "C1'" 1 
ATOM   79   N N1    . C   A 1 4   ? -21.927 26.956 24.352  1.00 52.00 ? 4   C   B N1    1 
ATOM   80   C C2    . C   A 1 4   ? -22.837 26.791 25.397  1.00 52.81 ? 4   C   B C2    1 
ATOM   81   O O2    . C   A 1 4   ? -23.624 25.831 25.354  1.00 54.78 ? 4   C   B O2    1 
ATOM   82   N N3    . C   A 1 4   ? -22.842 27.684 26.422  1.00 52.02 ? 4   C   B N3    1 
ATOM   83   C C4    . C   A 1 4   ? -21.988 28.709 26.416  1.00 51.56 ? 4   C   B C4    1 
ATOM   84   N N4    . C   A 1 4   ? -22.020 29.557 27.445  1.00 51.08 ? 4   C   B N4    1 
ATOM   85   C C5    . C   A 1 4   ? -21.059 28.906 25.354  1.00 52.29 ? 4   C   B C5    1 
ATOM   86   C C6    . C   A 1 4   ? -21.060 28.012 24.353  1.00 52.14 ? 4   C   B C6    1 
ATOM   87   P P     . C   A 1 5   ? -24.544 28.184 19.893  1.00 57.80 ? 5   C   B P     1 
ATOM   88   O OP1   . C   A 1 5   ? -25.049 28.001 18.510  1.00 57.98 ? 5   C   B OP1   1 
ATOM   89   O OP2   . C   A 1 5   ? -24.159 29.536 20.350  1.00 56.88 ? 5   C   B OP2   1 
ATOM   90   O "O5'" . C   A 1 5   ? -25.652 27.625 20.895  1.00 58.16 ? 5   C   B "O5'" 1 
ATOM   91   C "C5'" . C   A 1 5   ? -26.212 26.321 20.710  1.00 57.98 ? 5   C   B "C5'" 1 
ATOM   92   C "C4'" . C   A 1 5   ? -27.209 26.007 21.804  1.00 58.06 ? 5   C   B "C4'" 1 
ATOM   93   O "O4'" . C   A 1 5   ? -26.535 25.850 23.083  1.00 58.48 ? 5   C   B "O4'" 1 
ATOM   94   C "C3'" . C   A 1 5   ? -28.232 27.087 22.086  1.00 57.95 ? 5   C   B "C3'" 1 
ATOM   95   O "O3'" . C   A 1 5   ? -29.295 27.071 21.151  1.00 58.33 ? 5   C   B "O3'" 1 
ATOM   96   C "C2'" . C   A 1 5   ? -28.710 26.716 23.481  1.00 58.45 ? 5   C   B "C2'" 1 
ATOM   97   O "O2'" . C   A 1 5   ? -29.680 25.687 23.500  1.00 58.41 ? 5   C   B "O2'" 1 
ATOM   98   C "C1'" . C   A 1 5   ? -27.410 26.249 24.130  1.00 58.24 ? 5   C   B "C1'" 1 
ATOM   99   N N1    . C   A 1 5   ? -26.790 27.355 24.863  1.00 58.02 ? 5   C   B N1    1 
ATOM   100  C C2    . C   A 1 5   ? -27.265 27.655 26.146  1.00 58.38 ? 5   C   B C2    1 
ATOM   101  O O2    . C   A 1 5   ? -28.183 26.966 26.623  1.00 58.24 ? 5   C   B O2    1 
ATOM   102  N N3    . C   A 1 5   ? -26.715 28.684 26.832  1.00 58.56 ? 5   C   B N3    1 
ATOM   103  C C4    . C   A 1 5   ? -25.727 29.397 26.284  1.00 59.00 ? 5   C   B C4    1 
ATOM   104  N N4    . C   A 1 5   ? -25.206 30.401 27.001  1.00 58.44 ? 5   C   B N4    1 
ATOM   105  C C5    . C   A 1 5   ? -25.224 29.111 24.977  1.00 58.95 ? 5   C   B C5    1 
ATOM   106  C C6    . C   A 1 5   ? -25.779 28.091 24.309  1.00 57.89 ? 5   C   B C6    1 
ATOM   107  P P     . G   A 1 6   ? -30.146 28.413 20.911  1.00 72.12 ? 6   G   B P     1 
ATOM   108  O OP1   . G   A 1 6   ? -31.258 28.069 19.991  1.00 73.08 ? 6   G   B OP1   1 
ATOM   109  O OP2   . G   A 1 6   ? -29.179 29.476 20.526  1.00 72.14 ? 6   G   B OP2   1 
ATOM   110  O "O5'" . G   A 1 6   ? -30.759 28.744 22.352  1.00 69.97 ? 6   G   B "O5'" 1 
ATOM   111  C "C5'" . G   A 1 6   ? -31.551 27.773 23.024  1.00 68.73 ? 6   G   B "C5'" 1 
ATOM   112  C "C4'" . G   A 1 6   ? -32.087 28.295 24.341  1.00 69.01 ? 6   G   B "C4'" 1 
ATOM   113  O "O4'" . G   A 1 6   ? -31.067 28.415 25.364  1.00 68.80 ? 6   G   B "O4'" 1 
ATOM   114  C "C3'" . G   A 1 6   ? -32.742 29.656 24.400  1.00 68.78 ? 6   G   B "C3'" 1 
ATOM   115  O "O3'" . G   A 1 6   ? -34.002 29.650 23.748  1.00 69.90 ? 6   G   B "O3'" 1 
ATOM   116  C "C2'" . G   A 1 6   ? -32.879 29.853 25.913  1.00 68.27 ? 6   G   B "C2'" 1 
ATOM   117  O "O2'" . G   A 1 6   ? -33.983 29.188 26.495  1.00 66.42 ? 6   G   B "O2'" 1 
ATOM   118  C "C1'" . G   A 1 6   ? -31.593 29.201 26.425  1.00 68.19 ? 6   G   B "C1'" 1 
ATOM   119  N N9    . G   A 1 6   ? -30.616 30.198 26.844  1.00 68.68 ? 6   G   B N9    1 
ATOM   120  C C8    . G   A 1 6   ? -29.490 30.624 26.183  1.00 68.51 ? 6   G   B C8    1 
ATOM   121  N N7    . G   A 1 6   ? -28.837 31.550 26.835  1.00 68.66 ? 6   G   B N7    1 
ATOM   122  C C5    . G   A 1 6   ? -29.577 31.742 27.994  1.00 68.26 ? 6   G   B C5    1 
ATOM   123  C C6    . G   A 1 6   ? -29.365 32.622 29.098  1.00 68.06 ? 6   G   B C6    1 
ATOM   124  O O6    . G   A 1 6   ? -28.443 33.431 29.283  1.00 68.24 ? 6   G   B O6    1 
ATOM   125  N N1    . G   A 1 6   ? -30.364 32.489 30.054  1.00 68.25 ? 6   G   B N1    1 
ATOM   126  C C2    . G   A 1 6   ? -31.428 31.623 29.974  1.00 68.74 ? 6   G   B C2    1 
ATOM   127  N N2    . G   A 1 6   ? -32.294 31.644 31.006  1.00 68.09 ? 6   G   B N2    1 
ATOM   128  N N3    . G   A 1 6   ? -31.633 30.797 28.959  1.00 68.74 ? 6   G   B N3    1 
ATOM   129  C C4    . G   A 1 6   ? -30.676 30.912 28.013  1.00 68.59 ? 6   G   B C4    1 
ATOM   130  P P     . G   A 1 7   ? -34.860 31.005 23.669  1.00 75.43 ? 7   G   B P     1 
ATOM   131  O OP1   . G   A 1 7   ? -35.948 30.809 22.673  1.00 74.78 ? 7   G   B OP1   1 
ATOM   132  O OP2   . G   A 1 7   ? -33.923 32.148 23.519  1.00 74.34 ? 7   G   B OP2   1 
ATOM   133  O "O5'" . G   A 1 7   ? -35.512 31.083 25.118  1.00 75.15 ? 7   G   B "O5'" 1 
ATOM   134  C "C5'" . G   A 1 7   ? -36.022 32.302 25.617  1.00 74.67 ? 7   G   B "C5'" 1 
ATOM   135  C "C4'" . G   A 1 7   ? -36.202 32.224 27.112  1.00 74.22 ? 7   G   B "C4'" 1 
ATOM   136  O "O4'" . G   A 1 7   ? -34.964 31.812 27.751  1.00 73.85 ? 7   G   B "O4'" 1 
ATOM   137  C "C3'" . G   A 1 7   ? -36.516 33.578 27.714  1.00 74.41 ? 7   G   B "C3'" 1 
ATOM   138  O "O3'" . G   A 1 7   ? -37.905 33.844 27.613  1.00 73.87 ? 7   G   B "O3'" 1 
ATOM   139  C "C2'" . G   A 1 7   ? -35.991 33.430 29.131  1.00 74.18 ? 7   G   B "C2'" 1 
ATOM   140  O "O2'" . G   A 1 7   ? -36.854 32.664 29.944  1.00 75.14 ? 7   G   B "O2'" 1 
ATOM   141  C "C1'" . G   A 1 7   ? -34.705 32.644 28.873  1.00 73.85 ? 7   G   B "C1'" 1 
ATOM   142  N N9    . G   A 1 7   ? -33.555 33.479 28.535  1.00 72.69 ? 7   G   B N9    1 
ATOM   143  C C8    . G   A 1 7   ? -32.794 33.375 27.395  1.00 72.26 ? 7   G   B C8    1 
ATOM   144  N N7    . G   A 1 7   ? -31.803 34.223 27.358  1.00 72.33 ? 7   G   B N7    1 
ATOM   145  C C5    . G   A 1 7   ? -31.917 34.944 28.540  1.00 71.94 ? 7   G   B C5    1 
ATOM   146  C C6    . G   A 1 7   ? -31.115 36.002 29.054  1.00 71.57 ? 7   G   B C6    1 
ATOM   147  O O6    . G   A 1 7   ? -30.107 36.522 28.557  1.00 71.00 ? 7   G   B O6    1 
ATOM   148  N N1    . G   A 1 7   ? -31.586 36.451 30.279  1.00 71.22 ? 7   G   B N1    1 
ATOM   149  C C2    . G   A 1 7   ? -32.678 35.951 30.937  1.00 71.16 ? 7   G   B C2    1 
ATOM   150  N N2    . G   A 1 7   ? -32.962 36.535 32.114  1.00 70.49 ? 7   G   B N2    1 
ATOM   151  N N3    . G   A 1 7   ? -33.435 34.958 30.478  1.00 71.05 ? 7   G   B N3    1 
ATOM   152  C C4    . G   A 1 7   ? -32.999 34.506 29.280  1.00 71.83 ? 7   G   B C4    1 
ATOM   153  P P     . G   A 1 8   ? -38.398 35.130 26.789  1.00 71.82 ? 8   G   B P     1 
ATOM   154  O OP1   . G   A 1 8   ? -39.864 34.993 26.592  1.00 72.76 ? 8   G   B OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? -37.515 35.289 25.603  1.00 70.21 ? 8   G   B OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? -38.108 36.318 27.808  1.00 69.64 ? 8   G   B "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? -38.627 36.253 29.130  1.00 67.84 ? 8   G   B "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? -38.158 37.428 29.954  1.00 66.89 ? 8   G   B "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? -36.835 37.192 30.508  1.00 66.32 ? 8   G   B "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? -38.009 38.752 29.234  1.00 66.17 ? 8   G   B "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? -39.253 39.385 28.985  1.00 67.91 ? 8   G   B "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? -37.144 39.519 30.220  1.00 65.45 ? 8   G   B "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? -37.861 39.968 31.350  1.00 64.30 ? 8   G   B "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? -36.147 38.430 30.621  1.00 65.03 ? 8   G   B "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? -35.040 38.424 29.672  1.00 63.91 ? 8   G   B N9    1 
ATOM   166  C C8    . G   A 1 8   ? -34.939 37.700 28.505  1.00 63.77 ? 8   G   B C8    1 
ATOM   167  N N7    . G   A 1 8   ? -33.853 37.966 27.832  1.00 63.38 ? 8   G   B N7    1 
ATOM   168  C C5    . G   A 1 8   ? -33.191 38.909 28.607  1.00 62.55 ? 8   G   B C5    1 
ATOM   169  C C6    . G   A 1 8   ? -31.963 39.583 28.385  1.00 61.61 ? 8   G   B C6    1 
ATOM   170  O O6    . G   A 1 8   ? -31.190 39.483 27.428  1.00 60.83 ? 8   G   B O6    1 
ATOM   171  N N1    . G   A 1 8   ? -31.663 40.455 29.425  1.00 62.10 ? 8   G   B N1    1 
ATOM   172  C C2    . G   A 1 8   ? -32.445 40.658 30.541  1.00 62.97 ? 8   G   B C2    1 
ATOM   173  N N2    . G   A 1 8   ? -31.987 41.542 31.448  1.00 62.76 ? 8   G   B N2    1 
ATOM   174  N N3    . G   A 1 8   ? -33.595 40.040 30.755  1.00 63.26 ? 8   G   B N3    1 
ATOM   175  C C4    . G   A 1 8   ? -33.904 39.187 29.754  1.00 63.26 ? 8   G   B C4    1 
ATOM   176  P P     . G   A 1 9   ? -39.327 40.591 27.922  1.00 72.26 ? 9   G   B P     1 
ATOM   177  O OP1   . G   A 1 9   ? -40.646 40.537 27.232  1.00 71.78 ? 9   G   B OP1   1 
ATOM   178  O OP2   . G   A 1 9   ? -38.076 40.562 27.115  1.00 71.84 ? 9   G   B OP2   1 
ATOM   179  O "O5'" . G   A 1 9   ? -39.294 41.881 28.856  1.00 70.69 ? 9   G   B "O5'" 1 
ATOM   180  C "C5'" . G   A 1 9   ? -38.628 43.064 28.450  1.00 69.53 ? 9   G   B "C5'" 1 
ATOM   181  C "C4'" . G   A 1 9   ? -37.719 43.547 29.552  1.00 68.42 ? 9   G   B "C4'" 1 
ATOM   182  O "O4'" . G   A 1 9   ? -36.688 42.555 29.798  1.00 67.70 ? 9   G   B "O4'" 1 
ATOM   183  C "C3'" . G   A 1 9   ? -36.956 44.810 29.205  1.00 68.50 ? 9   G   B "C3'" 1 
ATOM   184  O "O3'" . G   A 1 9   ? -37.736 45.965 29.481  1.00 68.88 ? 9   G   B "O3'" 1 
ATOM   185  C "C2'" . G   A 1 9   ? -35.717 44.702 30.081  1.00 68.14 ? 9   G   B "C2'" 1 
ATOM   186  O "O2'" . G   A 1 9   ? -35.935 45.110 31.418  1.00 69.49 ? 9   G   B "O2'" 1 
ATOM   187  C "C1'" . G   A 1 9   ? -35.439 43.200 30.009  1.00 67.42 ? 9   G   B "C1'" 1 
ATOM   188  N N9    . G   A 1 9   ? -34.558 42.861 28.896  1.00 66.15 ? 9   G   B N9    1 
ATOM   189  C C8    . G   A 1 9   ? -34.805 41.972 27.877  1.00 65.36 ? 9   G   B C8    1 
ATOM   190  N N7    . G   A 1 9   ? -33.818 41.879 27.029  1.00 64.49 ? 9   G   B N7    1 
ATOM   191  C C5    . G   A 1 9   ? -32.863 42.763 27.514  1.00 64.29 ? 9   G   B C5    1 
ATOM   192  C C6    . G   A 1 9   ? -31.574 43.098 27.013  1.00 63.54 ? 9   G   B C6    1 
ATOM   193  O O6    . G   A 1 9   ? -30.995 42.664 26.006  1.00 62.80 ? 9   G   B O6    1 
ATOM   194  N N1    . G   A 1 9   ? -30.947 44.044 27.814  1.00 63.13 ? 9   G   B N1    1 
ATOM   195  C C2    . G   A 1 9   ? -31.482 44.600 28.948  1.00 63.58 ? 9   G   B C2    1 
ATOM   196  N N2    . G   A 1 9   ? -30.722 45.503 29.582  1.00 63.54 ? 9   G   B N2    1 
ATOM   197  N N3    . G   A 1 9   ? -32.676 44.297 29.426  1.00 64.61 ? 9   G   B N3    1 
ATOM   198  C C4    . G   A 1 9   ? -33.307 43.378 28.665  1.00 65.21 ? 9   G   B C4    1 
ATOM   199  P P     . C   A 1 10  ? -38.139 46.932 28.271  1.00 69.30 ? 10  C   B P     1 
ATOM   200  O OP1   . C   A 1 10  ? -38.204 48.336 28.777  1.00 68.68 ? 10  C   B OP1   1 
ATOM   201  O OP2   . C   A 1 10  ? -39.317 46.334 27.586  1.00 68.90 ? 10  C   B OP2   1 
ATOM   202  O "O5'" . C   A 1 10  ? -36.909 46.761 27.275  1.00 67.35 ? 10  C   B "O5'" 1 
ATOM   203  C "C5'" . C   A 1 10  ? -36.361 47.868 26.590  1.00 63.95 ? 10  C   B "C5'" 1 
ATOM   204  C "C4'" . C   A 1 10  ? -35.071 48.288 27.243  1.00 61.08 ? 10  C   B "C4'" 1 
ATOM   205  O "O4'" . C   A 1 10  ? -34.265 47.124 27.568  1.00 58.50 ? 10  C   B "O4'" 1 
ATOM   206  C "C3'" . C   A 1 10  ? -34.188 49.110 26.330  1.00 60.84 ? 10  C   B "C3'" 1 
ATOM   207  O "O3'" . C   A 1 10  ? -34.576 50.467 26.308  1.00 61.14 ? 10  C   B "O3'" 1 
ATOM   208  C "C2'" . C   A 1 10  ? -32.808 48.868 26.910  1.00 59.73 ? 10  C   B "C2'" 1 
ATOM   209  O "O2'" . C   A 1 10  ? -32.585 49.628 28.080  1.00 60.05 ? 10  C   B "O2'" 1 
ATOM   210  C "C1'" . C   A 1 10  ? -32.905 47.377 27.235  1.00 58.21 ? 10  C   B "C1'" 1 
ATOM   211  N N1    . C   A 1 10  ? -32.560 46.507 26.091  1.00 56.79 ? 10  C   B N1    1 
ATOM   212  C C2    . C   A 1 10  ? -31.271 46.579 25.530  1.00 55.60 ? 10  C   B C2    1 
ATOM   213  O O2    . C   A 1 10  ? -30.458 47.402 25.981  1.00 54.53 ? 10  C   B O2    1 
ATOM   214  N N3    . C   A 1 10  ? -30.950 45.752 24.510  1.00 54.40 ? 10  C   B N3    1 
ATOM   215  C C4    . C   A 1 10  ? -31.852 44.887 24.043  1.00 54.59 ? 10  C   B C4    1 
ATOM   216  N N4    . C   A 1 10  ? -31.487 44.083 23.050  1.00 54.99 ? 10  C   B N4    1 
ATOM   217  C C5    . C   A 1 10  ? -33.169 44.807 24.579  1.00 55.55 ? 10  C   B C5    1 
ATOM   218  C C6    . C   A 1 10  ? -33.479 45.628 25.589  1.00 56.19 ? 10  C   B C6    1 
ATOM   219  P P     . G   A 1 11  ? -34.666 51.216 24.899  1.00 55.39 ? 11  G   B P     1 
ATOM   220  O OP1   . G   A 1 11  ? -35.405 52.485 25.087  1.00 57.28 ? 11  G   B OP1   1 
ATOM   221  O OP2   . G   A 1 11  ? -35.162 50.209 23.923  1.00 55.15 ? 11  G   B OP2   1 
ATOM   222  O "O5'" . G   A 1 11  ? -33.142 51.565 24.592  1.00 53.90 ? 11  G   B "O5'" 1 
ATOM   223  C "C5'" . G   A 1 11  ? -32.419 52.416 25.473  1.00 51.19 ? 11  G   B "C5'" 1 
ATOM   224  C "C4'" . G   A 1 11  ? -30.962 52.475 25.087  1.00 49.61 ? 11  G   B "C4'" 1 
ATOM   225  O "O4'" . G   A 1 11  ? -30.337 51.179 25.303  1.00 47.43 ? 11  G   B "O4'" 1 
ATOM   226  C "C3'" . G   A 1 11  ? -30.659 52.775 23.625  1.00 50.13 ? 11  G   B "C3'" 1 
ATOM   227  O "O3'" . G   A 1 11  ? -30.800 54.157 23.293  1.00 51.29 ? 11  G   B "O3'" 1 
ATOM   228  C "C2'" . G   A 1 11  ? -29.227 52.263 23.515  1.00 48.53 ? 11  G   B "C2'" 1 
ATOM   229  O "O2'" . G   A 1 11  ? -28.267 53.105 24.136  1.00 48.45 ? 11  G   B "O2'" 1 
ATOM   230  C "C1'" . G   A 1 11  ? -29.345 50.962 24.306  1.00 46.65 ? 11  G   B "C1'" 1 
ATOM   231  N N9    . G   A 1 11  ? -29.803 49.891 23.434  1.00 43.97 ? 11  G   B N9    1 
ATOM   232  C C8    . G   A 1 11  ? -31.049 49.310 23.403  1.00 43.36 ? 11  G   B C8    1 
ATOM   233  N N7    . G   A 1 11  ? -31.152 48.368 22.505  1.00 42.62 ? 11  G   B N7    1 
ATOM   234  C C5    . G   A 1 11  ? -29.896 48.326 21.908  1.00 41.89 ? 11  G   B C5    1 
ATOM   235  C C6    . G   A 1 11  ? -29.388 47.488 20.867  1.00 40.47 ? 11  G   B C6    1 
ATOM   236  O O6    . G   A 1 11  ? -29.960 46.568 20.260  1.00 39.34 ? 11  G   B O6    1 
ATOM   237  N N1    . G   A 1 11  ? -28.068 47.803 20.558  1.00 39.36 ? 11  G   B N1    1 
ATOM   238  C C2    . G   A 1 11  ? -27.327 48.781 21.168  1.00 40.66 ? 11  G   B C2    1 
ATOM   239  N N2    . G   A 1 11  ? -26.088 48.951 20.702  1.00 39.90 ? 11  G   B N2    1 
ATOM   240  N N3    . G   A 1 11  ? -27.773 49.544 22.154  1.00 41.81 ? 11  G   B N3    1 
ATOM   241  C C4    . G   A 1 11  ? -29.058 49.267 22.467  1.00 42.59 ? 11  G   B C4    1 
ATOM   242  P P     . G   A 1 12  ? -31.263 54.576 21.805  1.00 53.40 ? 12  G   B P     1 
ATOM   243  O OP1   . G   A 1 12  ? -31.550 56.035 21.826  1.00 54.08 ? 12  G   B OP1   1 
ATOM   244  O OP2   . G   A 1 12  ? -32.309 53.621 21.325  1.00 53.11 ? 12  G   B OP2   1 
ATOM   245  O "O5'" . G   A 1 12  ? -29.960 54.342 20.921  1.00 51.92 ? 12  G   B "O5'" 1 
ATOM   246  C "C5'" . G   A 1 12  ? -28.774 55.090 21.157  1.00 50.77 ? 12  G   B "C5'" 1 
ATOM   247  C "C4'" . G   A 1 12  ? -27.669 54.584 20.273  1.00 51.33 ? 12  G   B "C4'" 1 
ATOM   248  O "O4'" . G   A 1 12  ? -27.384 53.199 20.618  1.00 51.76 ? 12  G   B "O4'" 1 
ATOM   249  C "C3'" . G   A 1 12  ? -28.020 54.527 18.798  1.00 51.88 ? 12  G   B "C3'" 1 
ATOM   250  O "O3'" . G   A 1 12  ? -27.823 55.784 18.170  1.00 52.39 ? 12  G   B "O3'" 1 
ATOM   251  C "C2'" . G   A 1 12  ? -27.041 53.478 18.299  1.00 51.91 ? 12  G   B "C2'" 1 
ATOM   252  O "O2'" . G   A 1 12  ? -25.730 54.002 18.180  1.00 52.77 ? 12  G   B "O2'" 1 
ATOM   253  C "C1'" . G   A 1 12  ? -27.111 52.457 19.439  1.00 50.67 ? 12  G   B "C1'" 1 
ATOM   254  N N9    . G   A 1 12  ? -28.210 51.520 19.232  1.00 49.16 ? 12  G   B N9    1 
ATOM   255  C C8    . G   A 1 12  ? -29.467 51.576 19.784  1.00 48.49 ? 12  G   B C8    1 
ATOM   256  N N7    . G   A 1 12  ? -30.255 50.624 19.363  1.00 47.51 ? 12  G   B N7    1 
ATOM   257  C C5    . G   A 1 12  ? -29.468 49.888 18.490  1.00 48.77 ? 12  G   B C5    1 
ATOM   258  C C6    . G   A 1 12  ? -29.781 48.735 17.704  1.00 49.72 ? 12  G   B C6    1 
ATOM   259  O O6    . G   A 1 12  ? -30.856 48.114 17.625  1.00 50.67 ? 12  G   B O6    1 
ATOM   260  N N1    . G   A 1 12  ? -28.690 48.321 16.951  1.00 49.74 ? 12  G   B N1    1 
ATOM   261  C C2    . G   A 1 12  ? -27.460 48.929 16.944  1.00 49.71 ? 12  G   B C2    1 
ATOM   262  N N2    . G   A 1 12  ? -26.539 48.387 16.139  1.00 48.80 ? 12  G   B N2    1 
ATOM   263  N N3    . G   A 1 12  ? -27.153 49.995 17.669  1.00 49.44 ? 12  G   B N3    1 
ATOM   264  C C4    . G   A 1 12  ? -28.198 50.420 18.410  1.00 49.10 ? 12  G   B C4    1 
ATOM   265  P P     . U   A 1 13  ? -28.651 56.145 16.842  1.00 45.67 ? 13  U   B P     1 
ATOM   266  O OP1   . U   A 1 13  ? -28.131 57.439 16.351  1.00 46.47 ? 13  U   B OP1   1 
ATOM   267  O OP2   . U   A 1 13  ? -30.111 55.984 17.084  1.00 44.79 ? 13  U   B OP2   1 
ATOM   268  O "O5'" . U   A 1 13  ? -28.200 55.024 15.811  1.00 43.78 ? 13  U   B "O5'" 1 
ATOM   269  C "C5'" . U   A 1 13  ? -26.848 54.933 15.395  1.00 42.67 ? 13  U   B "C5'" 1 
ATOM   270  C "C4'" . U   A 1 13  ? -26.689 53.781 14.444  1.00 41.65 ? 13  U   B "C4'" 1 
ATOM   271  O "O4'" . U   A 1 13  ? -27.002 52.546 15.137  1.00 42.23 ? 13  U   B "O4'" 1 
ATOM   272  C "C3'" . U   A 1 13  ? -27.674 53.778 13.292  1.00 41.30 ? 13  U   B "C3'" 1 
ATOM   273  O "O3'" . U   A 1 13  ? -27.276 54.660 12.260  1.00 39.92 ? 13  U   B "O3'" 1 
ATOM   274  C "C2'" . U   A 1 13  ? -27.643 52.323 12.860  1.00 41.61 ? 13  U   B "C2'" 1 
ATOM   275  O "O2'" . U   A 1 13  ? -26.502 52.016 12.082  1.00 40.53 ? 13  U   B "O2'" 1 
ATOM   276  C "C1'" . U   A 1 13  ? -27.576 51.626 14.222  1.00 42.10 ? 13  U   B "C1'" 1 
ATOM   277  N N1    . U   A 1 13  ? -28.910 51.246 14.706  1.00 41.65 ? 13  U   B N1    1 
ATOM   278  C C2    . U   A 1 13  ? -29.442 50.105 14.174  1.00 42.45 ? 13  U   B C2    1 
ATOM   279  O O2    . U   A 1 13  ? -28.846 49.446 13.342  1.00 45.13 ? 13  U   B O2    1 
ATOM   280  N N3    . U   A 1 13  ? -30.696 49.770 14.631  1.00 41.89 ? 13  U   B N3    1 
ATOM   281  C C4    . U   A 1 13  ? -31.462 50.468 15.539  1.00 41.98 ? 13  U   B C4    1 
ATOM   282  O O4    . U   A 1 13  ? -32.607 50.080 15.789  1.00 42.03 ? 13  U   B O4    1 
ATOM   283  C C5    . U   A 1 13  ? -30.840 51.654 16.055  1.00 42.07 ? 13  U   B C5    1 
ATOM   284  C C6    . U   A 1 13  ? -29.609 51.992 15.634  1.00 41.87 ? 13  U   B C6    1 
ATOM   285  P P     . U   A 1 14  ? -28.390 55.526 11.501  1.00 51.40 ? 14  U   B P     1 
ATOM   286  O OP1   . U   A 1 14  ? -27.693 56.468 10.596  1.00 51.28 ? 14  U   B OP1   1 
ATOM   287  O OP2   . U   A 1 14  ? -29.348 56.054 12.512  1.00 50.67 ? 14  U   B OP2   1 
ATOM   288  O "O5'" . U   A 1 14  ? -29.154 54.437 10.622  1.00 51.19 ? 14  U   B "O5'" 1 
ATOM   289  C "C5'" . U   A 1 14  ? -28.445 53.634 9.683   1.00 49.07 ? 14  U   B "C5'" 1 
ATOM   290  C "C4'" . U   A 1 14  ? -29.341 52.558 9.115   1.00 48.45 ? 14  U   B "C4'" 1 
ATOM   291  O "O4'" . U   A 1 14  ? -29.624 51.547 10.117  1.00 48.18 ? 14  U   B "O4'" 1 
ATOM   292  C "C3'" . U   A 1 14  ? -30.718 52.999 8.663   1.00 48.23 ? 14  U   B "C3'" 1 
ATOM   293  O "O3'" . U   A 1 14  ? -30.675 53.634 7.396   1.00 48.58 ? 14  U   B "O3'" 1 
ATOM   294  C "C2'" . U   A 1 14  ? -31.466 51.673 8.631   1.00 47.77 ? 14  U   B "C2'" 1 
ATOM   295  O "O2'" . U   A 1 14  ? -31.142 50.894 7.497   1.00 48.67 ? 14  U   B "O2'" 1 
ATOM   296  C "C1'" . U   A 1 14  ? -30.921 51.006 9.893   1.00 47.63 ? 14  U   B "C1'" 1 
ATOM   297  N N1    . U   A 1 14  ? -31.759 51.341 11.049  1.00 46.59 ? 14  U   B N1    1 
ATOM   298  C C2    . U   A 1 14  ? -32.812 50.506 11.341  1.00 46.45 ? 14  U   B C2    1 
ATOM   299  O O2    . U   A 1 14  ? -33.038 49.487 10.718  1.00 47.49 ? 14  U   B O2    1 
ATOM   300  N N3    . U   A 1 14  ? -33.590 50.907 12.396  1.00 46.08 ? 14  U   B N3    1 
ATOM   301  C C4    . U   A 1 14  ? -33.415 52.027 13.180  1.00 45.55 ? 14  U   B C4    1 
ATOM   302  O O4    . U   A 1 14  ? -34.239 52.281 14.059  1.00 45.96 ? 14  U   B O4    1 
ATOM   303  C C5    . U   A 1 14  ? -32.281 52.825 12.834  1.00 45.58 ? 14  U   B C5    1 
ATOM   304  C C6    . U   A 1 14  ? -31.512 52.465 11.805  1.00 46.26 ? 14  U   B C6    1 
ATOM   305  P P     . C   A 1 15  ? -31.566 54.946 7.145   1.00 43.29 ? 15  C   B P     1 
ATOM   306  O OP1   . C   A 1 15  ? -31.066 55.567 5.887   1.00 44.71 ? 15  C   B OP1   1 
ATOM   307  O OP2   . C   A 1 15  ? -31.560 55.741 8.409   1.00 40.82 ? 15  C   B OP2   1 
ATOM   308  O "O5'" . C   A 1 15  ? -33.031 54.357 6.905   1.00 43.34 ? 15  C   B "O5'" 1 
ATOM   309  C "C5'" . C   A 1 15  ? -34.110 55.189 6.465   1.00 43.37 ? 15  C   B "C5'" 1 
ATOM   310  C "C4'" . C   A 1 15  ? -35.358 54.355 6.218   1.00 43.84 ? 15  C   B "C4'" 1 
ATOM   311  O "O4'" . C   A 1 15  ? -35.346 53.698 4.912   1.00 44.48 ? 15  C   B "O4'" 1 
ATOM   312  C "C3'" . C   A 1 15  ? -35.594 53.226 7.211   1.00 43.60 ? 15  C   B "C3'" 1 
ATOM   313  O "O3'" . C   A 1 15  ? -36.192 53.729 8.399   1.00 44.00 ? 15  C   B "O3'" 1 
ATOM   314  C "C2'" . C   A 1 15  ? -36.543 52.300 6.451   1.00 43.04 ? 15  C   B "C2'" 1 
ATOM   315  O "O2'" . C   A 1 15  ? -37.881 52.736 6.530   1.00 44.33 ? 15  C   B "O2'" 1 
ATOM   316  C "C1'" . C   A 1 15  ? -36.085 52.489 5.004   1.00 42.67 ? 15  C   B "C1'" 1 
ATOM   317  N N1    . C   A 1 15  ? -35.342 51.383 4.363   1.00 41.32 ? 15  C   B N1    1 
ATOM   318  C C2    . C   A 1 15  ? -33.942 51.391 4.377   1.00 40.90 ? 15  C   B C2    1 
ATOM   319  O O2    . C   A 1 15  ? -33.355 52.357 4.879   1.00 40.55 ? 15  C   B O2    1 
ATOM   320  N N3    . C   A 1 15  ? -33.262 50.354 3.828   1.00 40.43 ? 15  C   B N3    1 
ATOM   321  C C4    . C   A 1 15  ? -33.929 49.347 3.269   1.00 41.52 ? 15  C   B C4    1 
ATOM   322  N N4    . C   A 1 15  ? -33.215 48.348 2.734   1.00 41.59 ? 15  C   B N4    1 
ATOM   323  C C5    . C   A 1 15  ? -35.357 49.317 3.229   1.00 42.05 ? 15  C   B C5    1 
ATOM   324  C C6    . C   A 1 15  ? -36.015 50.347 3.781   1.00 41.11 ? 15  C   B C6    1 
ATOM   325  P P     . G   A 1 16  ? -35.858 53.036 9.805   1.00 41.10 ? 16  G   B P     1 
ATOM   326  O OP1   . G   A 1 16  ? -36.750 53.597 10.849  1.00 41.12 ? 16  G   B OP1   1 
ATOM   327  O OP2   . G   A 1 16  ? -34.385 53.119 9.978   1.00 40.08 ? 16  G   B OP2   1 
ATOM   328  O "O5'" . G   A 1 16  ? -36.298 51.522 9.575   1.00 40.19 ? 16  G   B "O5'" 1 
ATOM   329  C "C5'" . G   A 1 16  ? -37.677 51.186 9.426   1.00 40.21 ? 16  G   B "C5'" 1 
ATOM   330  C "C4'" . G   A 1 16  ? -37.833 49.716 9.114   1.00 39.21 ? 16  G   B "C4'" 1 
ATOM   331  O "O4'" . G   A 1 16  ? -37.338 49.433 7.782   1.00 39.29 ? 16  G   B "O4'" 1 
ATOM   332  C "C3'" . G   A 1 16  ? -37.053 48.800 10.037  1.00 39.86 ? 16  G   B "C3'" 1 
ATOM   333  O "O3'" . G   A 1 16  ? -37.845 48.528 11.192  1.00 42.06 ? 16  G   B "O3'" 1 
ATOM   334  C "C2'" . G   A 1 16  ? -36.842 47.562 9.170   1.00 38.94 ? 16  G   B "C2'" 1 
ATOM   335  O "O2'" . G   A 1 16  ? -37.947 46.686 9.200   1.00 38.87 ? 16  G   B "O2'" 1 
ATOM   336  C "C1'" . G   A 1 16  ? -36.687 48.173 7.771   1.00 38.46 ? 16  G   B "C1'" 1 
ATOM   337  N N9    . G   A 1 16  ? -35.295 48.380 7.368   1.00 36.89 ? 16  G   B N9    1 
ATOM   338  C C8    . G   A 1 16  ? -34.494 49.447 7.708   1.00 36.11 ? 16  G   B C8    1 
ATOM   339  N N7    . G   A 1 16  ? -33.280 49.347 7.239   1.00 35.74 ? 16  G   B N7    1 
ATOM   340  C C5    . G   A 1 16  ? -33.277 48.146 6.534   1.00 35.41 ? 16  G   B C5    1 
ATOM   341  C C6    . G   A 1 16  ? -32.225 47.496 5.815   1.00 35.26 ? 16  G   B C6    1 
ATOM   342  O O6    . G   A 1 16  ? -31.051 47.855 5.662   1.00 35.08 ? 16  G   B O6    1 
ATOM   343  N N1    . G   A 1 16  ? -32.654 46.301 5.254   1.00 35.41 ? 16  G   B N1    1 
ATOM   344  C C2    . G   A 1 16  ? -33.916 45.778 5.374   1.00 35.07 ? 16  G   B C2    1 
ATOM   345  N N2    . G   A 1 16  ? -34.108 44.588 4.771   1.00 34.35 ? 16  G   B N2    1 
ATOM   346  N N3    . G   A 1 16  ? -34.907 46.370 6.040   1.00 34.26 ? 16  G   B N3    1 
ATOM   347  C C4    . G   A 1 16  ? -34.517 47.541 6.592   1.00 35.23 ? 16  G   B C4    1 
ATOM   348  P P     . A   A 1 17  ? -37.172 48.530 12.654  1.00 46.51 ? 17  A   B P     1 
ATOM   349  O OP1   . A   A 1 17  ? -38.258 48.480 13.658  1.00 45.87 ? 17  A   B OP1   1 
ATOM   350  O OP2   . A   A 1 17  ? -36.176 49.630 12.714  1.00 46.36 ? 17  A   B OP2   1 
ATOM   351  O "O5'" . A   A 1 17  ? -36.403 47.143 12.701  1.00 45.55 ? 17  A   B "O5'" 1 
ATOM   352  C "C5'" . A   A 1 17  ? -37.123 45.926 12.785  1.00 46.64 ? 17  A   B "C5'" 1 
ATOM   353  C "C4'" . A   A 1 17  ? -36.278 44.891 13.466  1.00 49.10 ? 17  A   B "C4'" 1 
ATOM   354  O "O4'" . A   A 1 17  ? -35.057 44.768 12.695  1.00 49.88 ? 17  A   B "O4'" 1 
ATOM   355  C "C3'" . A   A 1 17  ? -35.793 45.255 14.864  1.00 51.17 ? 17  A   B "C3'" 1 
ATOM   356  O "O3'" . A   A 1 17  ? -36.761 45.043 15.914  1.00 52.87 ? 17  A   B "O3'" 1 
ATOM   357  C "C2'" . A   A 1 17  ? -34.496 44.476 14.998  1.00 51.87 ? 17  A   B "C2'" 1 
ATOM   358  O "O2'" . A   A 1 17  ? -34.685 43.138 15.395  1.00 56.17 ? 17  A   B "O2'" 1 
ATOM   359  C "C1'" . A   A 1 17  ? -33.975 44.489 13.561  1.00 50.73 ? 17  A   B "C1'" 1 
ATOM   360  N N9    . A   A 1 17  ? -32.875 45.417 13.294  1.00 48.83 ? 17  A   B N9    1 
ATOM   361  C C8    . A   A 1 17  ? -32.682 46.701 13.741  1.00 48.15 ? 17  A   B C8    1 
ATOM   362  N N7    . A   A 1 17  ? -31.553 47.239 13.337  1.00 47.27 ? 17  A   B N7    1 
ATOM   363  C C5    . A   A 1 17  ? -30.968 46.246 12.564  1.00 47.48 ? 17  A   B C5    1 
ATOM   364  C C6    . A   A 1 17  ? -29.751 46.188 11.844  1.00 46.99 ? 17  A   B C6    1 
ATOM   365  N N6    . A   A 1 17  ? -28.864 47.184 11.797  1.00 45.54 ? 17  A   B N6    1 
ATOM   366  N N1    . A   A 1 17  ? -29.473 45.047 11.166  1.00 47.14 ? 17  A   B N1    1 
ATOM   367  C C2    . A   A 1 17  ? -30.358 44.034 11.221  1.00 47.08 ? 17  A   B C2    1 
ATOM   368  N N3    . A   A 1 17  ? -31.525 43.966 11.868  1.00 47.65 ? 17  A   B N3    1 
ATOM   369  C C4    . A   A 1 17  ? -31.774 45.119 12.524  1.00 48.12 ? 17  A   B C4    1 
ATOM   370  P P     . U   A 1 18  ? -37.572 43.638 16.053  1.00 71.94 ? 18  U   B P     1 
ATOM   371  O OP1   . U   A 1 18  ? -38.122 43.231 14.721  1.00 72.58 ? 18  U   B OP1   1 
ATOM   372  O OP2   . U   A 1 18  ? -38.500 43.827 17.197  1.00 71.88 ? 18  U   B OP2   1 
ATOM   373  O "O5'" . U   A 1 18  ? -36.499 42.547 16.501  1.00 72.66 ? 18  U   B "O5'" 1 
ATOM   374  C "C5'" . U   A 1 18  ? -36.427 42.070 17.846  1.00 73.87 ? 18  U   B "C5'" 1 
ATOM   375  C "C4'" . U   A 1 18  ? -35.778 40.702 17.877  1.00 75.03 ? 18  U   B "C4'" 1 
ATOM   376  O "O4'" . U   A 1 18  ? -36.700 39.713 17.352  1.00 75.42 ? 18  U   B "O4'" 1 
ATOM   377  C "C3'" . U   A 1 18  ? -34.520 40.557 17.023  1.00 76.06 ? 18  U   B "C3'" 1 
ATOM   378  O "O3'" . U   A 1 18  ? -33.351 40.997 17.732  1.00 76.91 ? 18  U   B "O3'" 1 
ATOM   379  C "C2'" . U   A 1 18  ? -34.487 39.058 16.708  1.00 76.11 ? 18  U   B "C2'" 1 
ATOM   380  O "O2'" . U   A 1 18  ? -33.851 38.255 17.683  1.00 76.07 ? 18  U   B "O2'" 1 
ATOM   381  C "C1'" . U   A 1 18  ? -35.978 38.706 16.656  1.00 76.24 ? 18  U   B "C1'" 1 
ATOM   382  N N1    . U   A 1 18  ? -36.518 38.577 15.292  1.00 77.26 ? 18  U   B N1    1 
ATOM   383  C C2    . U   A 1 18  ? -36.036 37.536 14.504  1.00 77.36 ? 18  U   B C2    1 
ATOM   384  O O2    . U   A 1 18  ? -35.189 36.743 14.887  1.00 77.27 ? 18  U   B O2    1 
ATOM   385  N N3    . U   A 1 18  ? -36.582 37.460 13.247  1.00 77.66 ? 18  U   B N3    1 
ATOM   386  C C4    . U   A 1 18  ? -37.538 38.294 12.702  1.00 78.14 ? 18  U   B C4    1 
ATOM   387  O O4    . U   A 1 18  ? -37.918 38.094 11.545  1.00 77.97 ? 18  U   B O4    1 
ATOM   388  C C5    . U   A 1 18  ? -37.987 39.348 13.573  1.00 78.08 ? 18  U   B C5    1 
ATOM   389  C C6    . U   A 1 18  ? -37.473 39.450 14.806  1.00 77.92 ? 18  U   B C6    1 
ATOM   390  P P     . U   A 1 19  ? -32.089 41.593 16.921  1.00 66.81 ? 19  U   B P     1 
ATOM   391  O OP1   . U   A 1 19  ? -30.887 41.411 17.778  1.00 68.50 ? 19  U   B OP1   1 
ATOM   392  O OP2   . U   A 1 19  ? -32.446 42.960 16.462  1.00 66.36 ? 19  U   B OP2   1 
ATOM   393  O "O5'" . U   A 1 19  ? -31.950 40.626 15.657  1.00 66.38 ? 19  U   B "O5'" 1 
ATOM   394  C "C5'" . U   A 1 19  ? -31.172 39.429 15.729  1.00 65.59 ? 19  U   B "C5'" 1 
ATOM   395  C "C4'" . U   A 1 19  ? -30.845 38.954 14.340  1.00 66.06 ? 19  U   B "C4'" 1 
ATOM   396  O "O4'" . U   A 1 19  ? -32.065 38.516 13.705  1.00 66.13 ? 19  U   B "O4'" 1 
ATOM   397  C "C3'" . U   A 1 19  ? -30.290 40.058 13.457  1.00 67.21 ? 19  U   B "C3'" 1 
ATOM   398  O "O3'" . U   A 1 19  ? -28.868 40.196 13.621  1.00 68.69 ? 19  U   B "O3'" 1 
ATOM   399  C "C2'" . U   A 1 19  ? -30.841 39.773 12.057  1.00 67.33 ? 19  U   B "C2'" 1 
ATOM   400  O "O2'" . U   A 1 19  ? -30.000 39.074 11.162  1.00 68.43 ? 19  U   B "O2'" 1 
ATOM   401  C "C1'" . U   A 1 19  ? -32.114 38.975 12.364  1.00 66.92 ? 19  U   B "C1'" 1 
ATOM   402  N N1    . U   A 1 19  ? -33.378 39.701 12.182  1.00 66.58 ? 19  U   B N1    1 
ATOM   403  C C2    . U   A 1 19  ? -34.030 39.564 10.971  1.00 66.46 ? 19  U   B C2    1 
ATOM   404  O O2    . U   A 1 19  ? -33.579 38.905 10.050  1.00 65.99 ? 19  U   B O2    1 
ATOM   405  N N3    . U   A 1 19  ? -35.229 40.230 10.881  1.00 66.70 ? 19  U   B N3    1 
ATOM   406  C C4    . U   A 1 19  ? -35.824 41.014 11.860  1.00 66.86 ? 19  U   B C4    1 
ATOM   407  O O4    . U   A 1 19  ? -36.941 41.507 11.654  1.00 66.80 ? 19  U   B O4    1 
ATOM   408  C C5    . U   A 1 19  ? -35.071 41.123 13.075  1.00 66.19 ? 19  U   B C5    1 
ATOM   409  C C6    . U   A 1 19  ? -33.904 40.479 13.191  1.00 66.19 ? 19  U   B C6    1 
ATOM   410  P P     . C   A 1 20  ? -27.857 38.992 13.221  1.00 49.15 ? 20  C   B P     1 
ATOM   411  O OP1   . C   A 1 20  ? -28.489 37.948 12.375  1.00 49.81 ? 20  C   B OP1   1 
ATOM   412  O OP2   . C   A 1 20  ? -27.180 38.598 14.488  1.00 48.05 ? 20  C   B OP2   1 
ATOM   413  O "O5'" . C   A 1 20  ? -26.759 39.722 12.336  1.00 48.28 ? 20  C   B "O5'" 1 
ATOM   414  C "C5'" . C   A 1 20  ? -25.709 40.403 12.981  1.00 46.28 ? 20  C   B "C5'" 1 
ATOM   415  C "C4'" . C   A 1 20  ? -25.449 41.750 12.353  1.00 43.45 ? 20  C   B "C4'" 1 
ATOM   416  O "O4'" . C   A 1 20  ? -26.668 42.483 12.063  1.00 41.96 ? 20  C   B "O4'" 1 
ATOM   417  C "C3'" . C   A 1 20  ? -24.734 42.622 13.352  1.00 42.47 ? 20  C   B "C3'" 1 
ATOM   418  O "O3'" . C   A 1 20  ? -23.386 42.215 13.445  1.00 42.06 ? 20  C   B "O3'" 1 
ATOM   419  C "C2'" . C   A 1 20  ? -25.043 44.026 12.863  1.00 41.57 ? 20  C   B "C2'" 1 
ATOM   420  O "O2'" . C   A 1 20  ? -24.228 44.462 11.791  1.00 41.59 ? 20  C   B "O2'" 1 
ATOM   421  C "C1'" . C   A 1 20  ? -26.496 43.847 12.415  1.00 41.26 ? 20  C   B "C1'" 1 
ATOM   422  N N1    . C   A 1 20  ? -27.487 44.165 13.456  1.00 41.64 ? 20  C   B N1    1 
ATOM   423  C C2    . C   A 1 20  ? -27.438 45.421 14.084  1.00 42.63 ? 20  C   B C2    1 
ATOM   424  O O2    . C   A 1 20  ? -26.529 46.211 13.780  1.00 43.48 ? 20  C   B O2    1 
ATOM   425  N N3    . C   A 1 20  ? -28.381 45.735 15.007  1.00 42.60 ? 20  C   B N3    1 
ATOM   426  C C4    . C   A 1 20  ? -29.336 44.852 15.313  1.00 42.34 ? 20  C   B C4    1 
ATOM   427  N N4    . C   A 1 20  ? -30.245 45.213 16.216  1.00 43.66 ? 20  C   B N4    1 
ATOM   428  C C5    . C   A 1 20  ? -29.397 43.561 14.702  1.00 41.07 ? 20  C   B C5    1 
ATOM   429  C C6    . C   A 1 20  ? -28.458 43.262 13.795  1.00 41.36 ? 20  C   B C6    1 
ATOM   430  P P     . C   A 1 21  ? -22.878 41.548 14.813  1.00 42.74 ? 21  C   B P     1 
ATOM   431  O OP1   . C   A 1 21  ? -21.716 40.663 14.546  1.00 42.69 ? 21  C   B OP1   1 
ATOM   432  O OP2   . C   A 1 21  ? -24.066 41.003 15.530  1.00 43.31 ? 21  C   B OP2   1 
ATOM   433  O "O5'" . C   A 1 21  ? -22.382 42.827 15.617  1.00 43.95 ? 21  C   B "O5'" 1 
ATOM   434  C "C5'" . C   A 1 21  ? -21.687 43.871 14.938  1.00 42.83 ? 21  C   B "C5'" 1 
ATOM   435  C "C4'" . C   A 1 21  ? -21.696 45.125 15.767  1.00 41.51 ? 21  C   B "C4'" 1 
ATOM   436  O "O4'" . C   A 1 21  ? -22.996 45.760 15.696  1.00 41.67 ? 21  C   B "O4'" 1 
ATOM   437  C "C3'" . C   A 1 21  ? -21.483 44.914 17.253  1.00 40.22 ? 21  C   B "C3'" 1 
ATOM   438  O "O3'" . C   A 1 21  ? -20.107 44.711 17.528  1.00 39.71 ? 21  C   B "O3'" 1 
ATOM   439  C "C2'" . C   A 1 21  ? -22.037 46.215 17.814  1.00 40.88 ? 21  C   B "C2'" 1 
ATOM   440  O "O2'" . C   A 1 21  ? -21.167 47.304 17.585  1.00 38.90 ? 21  C   B "O2'" 1 
ATOM   441  C "C1'" . C   A 1 21  ? -23.266 46.413 16.927  1.00 41.04 ? 21  C   B "C1'" 1 
ATOM   442  N N1    . C   A 1 21  ? -24.540 45.886 17.452  1.00 41.40 ? 21  C   B N1    1 
ATOM   443  C C2    . C   A 1 21  ? -25.273 46.661 18.372  1.00 40.89 ? 21  C   B C2    1 
ATOM   444  O O2    . C   A 1 21  ? -24.772 47.707 18.815  1.00 38.61 ? 21  C   B O2    1 
ATOM   445  N N3    . C   A 1 21  ? -26.505 46.241 18.753  1.00 40.90 ? 21  C   B N3    1 
ATOM   446  C C4    . C   A 1 21  ? -26.998 45.093 18.271  1.00 40.70 ? 21  C   B C4    1 
ATOM   447  N N4    . C   A 1 21  ? -28.243 44.744 18.623  1.00 41.39 ? 21  C   B N4    1 
ATOM   448  C C5    . C   A 1 21  ? -26.243 44.255 17.391  1.00 40.36 ? 21  C   B C5    1 
ATOM   449  C C6    . C   A 1 21  ? -25.029 44.685 17.015  1.00 40.47 ? 21  C   B C6    1 
ATOM   450  P P     . G   A 1 22  ? -19.667 43.656 18.655  1.00 34.82 ? 22  G   B P     1 
ATOM   451  O OP1   . G   A 1 22  ? -18.208 43.390 18.495  1.00 33.18 ? 22  G   B OP1   1 
ATOM   452  O OP2   . G   A 1 22  ? -20.619 42.517 18.612  1.00 35.02 ? 22  G   B OP2   1 
ATOM   453  O "O5'" . G   A 1 22  ? -19.915 44.484 19.999  1.00 36.10 ? 22  G   B "O5'" 1 
ATOM   454  C "C5'" . G   A 1 22  ? -20.745 43.987 21.046  1.00 35.73 ? 22  G   B "C5'" 1 
ATOM   455  C "C4'" . G   A 1 22  ? -21.290 45.136 21.864  1.00 36.40 ? 22  G   B "C4'" 1 
ATOM   456  O "O4'" . G   A 1 22  ? -22.393 45.768 21.158  1.00 35.13 ? 22  G   B "O4'" 1 
ATOM   457  C "C3'" . G   A 1 22  ? -21.905 44.760 23.204  1.00 37.37 ? 22  G   B "C3'" 1 
ATOM   458  O "O3'" . G   A 1 22  ? -20.895 44.663 24.191  1.00 38.84 ? 22  G   B "O3'" 1 
ATOM   459  C "C2'" . G   A 1 22  ? -22.796 45.956 23.490  1.00 36.84 ? 22  G   B "C2'" 1 
ATOM   460  O "O2'" . G   A 1 22  ? -22.063 47.068 23.966  1.00 37.31 ? 22  G   B "O2'" 1 
ATOM   461  C "C1'" . G   A 1 22  ? -23.354 46.240 22.096  1.00 36.59 ? 22  G   B "C1'" 1 
ATOM   462  N N9    . G   A 1 22  ? -24.597 45.507 21.888  1.00 37.42 ? 22  G   B N9    1 
ATOM   463  C C8    . G   A 1 22  ? -24.795 44.439 21.049  1.00 37.90 ? 22  G   B C8    1 
ATOM   464  N N7    . G   A 1 22  ? -26.016 43.975 21.089  1.00 38.16 ? 22  G   B N7    1 
ATOM   465  C C5    . G   A 1 22  ? -26.666 44.790 22.007  1.00 38.08 ? 22  G   B C5    1 
ATOM   466  C C6    . G   A 1 22  ? -28.022 44.771 22.469  1.00 37.64 ? 22  G   B C6    1 
ATOM   467  O O6    . G   A 1 22  ? -28.938 43.997 22.150  1.00 36.07 ? 22  G   B O6    1 
ATOM   468  N N1    . G   A 1 22  ? -28.262 45.784 23.398  1.00 38.12 ? 22  G   B N1    1 
ATOM   469  C C2    . G   A 1 22  ? -27.329 46.696 23.831  1.00 37.58 ? 22  G   B C2    1 
ATOM   470  N N2    . G   A 1 22  ? -27.767 47.598 24.724  1.00 37.33 ? 22  G   B N2    1 
ATOM   471  N N3    . G   A 1 22  ? -26.062 46.721 23.416  1.00 37.54 ? 22  G   B N3    1 
ATOM   472  C C4    . G   A 1 22  ? -25.805 45.746 22.509  1.00 38.04 ? 22  G   B C4    1 
ATOM   473  P P     . C   A 1 23  ? -21.183 43.847 25.539  1.00 50.73 ? 23  C   B P     1 
ATOM   474  O OP1   . C   A 1 23  ? -19.941 43.896 26.347  1.00 49.49 ? 23  C   B OP1   1 
ATOM   475  O OP2   . C   A 1 23  ? -21.785 42.535 25.185  1.00 50.24 ? 23  C   B OP2   1 
ATOM   476  O "O5'" . C   A 1 23  ? -22.286 44.717 26.276  1.00 50.28 ? 23  C   B "O5'" 1 
ATOM   477  C "C5'" . C   A 1 23  ? -21.974 46.005 26.776  1.00 51.66 ? 23  C   B "C5'" 1 
ATOM   478  C "C4'" . C   A 1 23  ? -23.070 46.466 27.697  1.00 52.81 ? 23  C   B "C4'" 1 
ATOM   479  O "O4'" . C   A 1 23  ? -24.282 46.732 26.943  1.00 53.08 ? 23  C   B "O4'" 1 
ATOM   480  C "C3'" . C   A 1 23  ? -23.508 45.426 28.709  1.00 53.73 ? 23  C   B "C3'" 1 
ATOM   481  O "O3'" . C   A 1 23  ? -22.607 45.377 29.803  1.00 56.39 ? 23  C   B "O3'" 1 
ATOM   482  C "C2'" . C   A 1 23  ? -24.900 45.921 29.081  1.00 53.68 ? 23  C   B "C2'" 1 
ATOM   483  O "O2'" . C   A 1 23  ? -24.890 47.028 29.962  1.00 54.23 ? 23  C   B "O2'" 1 
ATOM   484  C "C1'" . C   A 1 23  ? -25.414 46.385 27.721  1.00 52.72 ? 23  C   B "C1'" 1 
ATOM   485  N N1    . C   A 1 23  ? -26.146 45.342 27.001  1.00 51.84 ? 23  C   B N1    1 
ATOM   486  C C2    . C   A 1 23  ? -27.537 45.332 27.075  1.00 51.85 ? 23  C   B C2    1 
ATOM   487  O O2    . C   A 1 23  ? -28.102 46.166 27.804  1.00 51.93 ? 23  C   B O2    1 
ATOM   488  N N3    . C   A 1 23  ? -28.230 44.416 26.355  1.00 51.40 ? 23  C   B N3    1 
ATOM   489  C C4    . C   A 1 23  ? -27.576 43.532 25.591  1.00 50.58 ? 23  C   B C4    1 
ATOM   490  N N4    . C   A 1 23  ? -28.297 42.680 24.853  1.00 50.15 ? 23  C   B N4    1 
ATOM   491  C C5    . C   A 1 23  ? -26.153 43.493 25.538  1.00 50.74 ? 23  C   B C5    1 
ATOM   492  C C6    . C   A 1 23  ? -25.484 44.409 26.252  1.00 51.71 ? 23  C   B C6    1 
ATOM   493  P P     . C   A 1 24  ? -22.824 44.291 30.957  1.00 53.67 ? 24  C   B P     1 
ATOM   494  O OP1   . C   A 1 24  ? -21.564 44.154 31.723  1.00 54.00 ? 24  C   B OP1   1 
ATOM   495  O OP2   . C   A 1 24  ? -23.461 43.087 30.370  1.00 53.86 ? 24  C   B OP2   1 
ATOM   496  O "O5'" . C   A 1 24  ? -23.895 44.993 31.892  1.00 53.78 ? 24  C   B "O5'" 1 
ATOM   497  C "C5'" . C   A 1 24  ? -24.545 44.247 32.886  1.00 54.57 ? 24  C   B "C5'" 1 
ATOM   498  C "C4'" . C   A 1 24  ? -25.894 44.825 33.183  1.00 54.30 ? 24  C   B "C4'" 1 
ATOM   499  O "O4'" . C   A 1 24  ? -26.590 45.147 31.954  1.00 53.79 ? 24  C   B "O4'" 1 
ATOM   500  C "C3'" . C   A 1 24  ? -26.763 43.796 33.867  1.00 55.41 ? 24  C   B "C3'" 1 
ATOM   501  O "O3'" . C   A 1 24  ? -26.472 43.796 35.256  1.00 57.29 ? 24  C   B "O3'" 1 
ATOM   502  C "C2'" . C   A 1 24  ? -28.165 44.245 33.484  1.00 54.93 ? 24  C   B "C2'" 1 
ATOM   503  O "O2'" . C   A 1 24  ? -28.650 45.325 34.262  1.00 55.97 ? 24  C   B "O2'" 1 
ATOM   504  C "C1'" . C   A 1 24  ? -27.934 44.704 32.041  1.00 53.89 ? 24  C   B "C1'" 1 
ATOM   505  N N1    . C   A 1 24  ? -28.121 43.653 31.027  1.00 52.24 ? 24  C   B N1    1 
ATOM   506  C C2    . C   A 1 24  ? -29.319 42.940 30.998  1.00 51.47 ? 24  C   B C2    1 
ATOM   507  O O2    . C   A 1 24  ? -30.177 43.176 31.860  1.00 50.80 ? 24  C   B O2    1 
ATOM   508  N N3    . C   A 1 24  ? -29.508 42.008 30.036  1.00 51.45 ? 24  C   B N3    1 
ATOM   509  C C4    . C   A 1 24  ? -28.548 41.773 29.134  1.00 51.54 ? 24  C   B C4    1 
ATOM   510  N N4    . C   A 1 24  ? -28.781 40.852 28.196  1.00 50.84 ? 24  C   B N4    1 
ATOM   511  C C5    . C   A 1 24  ? -27.309 42.472 29.155  1.00 51.38 ? 24  C   B C5    1 
ATOM   512  C C6    . C   A 1 24  ? -27.138 43.392 30.111  1.00 52.01 ? 24  C   B C6    1 
ATOM   513  P P     . C   A 1 25  ? -25.460 42.689 35.850  1.00 63.43 ? 25  C   B P     1 
ATOM   514  O OP1   . C   A 1 25  ? -24.291 43.381 36.459  1.00 61.15 ? 25  C   B OP1   1 
ATOM   515  O OP2   . C   A 1 25  ? -25.238 41.634 34.813  1.00 60.36 ? 25  C   B OP2   1 
ATOM   516  O "O5'" . C   A 1 25  ? -26.322 42.037 37.014  1.00 64.24 ? 25  C   B "O5'" 1 
ATOM   517  C "C5'" . C   A 1 25  ? -26.893 40.753 36.845  1.00 65.41 ? 25  C   B "C5'" 1 
ATOM   518  C "C4'" . C   A 1 25  ? -28.397 40.826 36.920  1.00 65.19 ? 25  C   B "C4'" 1 
ATOM   519  O "O4'" . C   A 1 25  ? -28.947 41.512 35.758  1.00 64.56 ? 25  C   B "O4'" 1 
ATOM   520  C "C3'" . C   A 1 25  ? -29.006 39.445 36.847  1.00 66.02 ? 25  C   B "C3'" 1 
ATOM   521  O "O3'" . C   A 1 25  ? -28.946 38.842 38.122  1.00 66.79 ? 25  C   B "O3'" 1 
ATOM   522  C "C2'" . C   A 1 25  ? -30.394 39.726 36.306  1.00 65.20 ? 25  C   B "C2'" 1 
ATOM   523  O "O2'" . C   A 1 25  ? -31.271 40.268 37.273  1.00 66.60 ? 25  C   B "O2'" 1 
ATOM   524  C "C1'" . C   A 1 25  ? -30.058 40.779 35.252  1.00 64.55 ? 25  C   B "C1'" 1 
ATOM   525  N N1    . C   A 1 25  ? -29.652 40.182 33.966  1.00 64.40 ? 25  C   B N1    1 
ATOM   526  C C2    . C   A 1 25  ? -30.512 39.278 33.331  1.00 64.21 ? 25  C   B C2    1 
ATOM   527  O O2    . C   A 1 25  ? -31.577 38.969 33.883  1.00 63.54 ? 25  C   B O2    1 
ATOM   528  N N3    . C   A 1 25  ? -30.152 38.756 32.133  1.00 64.09 ? 25  C   B N3    1 
ATOM   529  C C4    . C   A 1 25  ? -28.985 39.092 31.580  1.00 63.68 ? 25  C   B C4    1 
ATOM   530  N N4    . C   A 1 25  ? -28.674 38.554 30.401  1.00 62.59 ? 25  C   B N4    1 
ATOM   531  C C5    . C   A 1 25  ? -28.086 39.994 32.211  1.00 63.87 ? 25  C   B C5    1 
ATOM   532  C C6    . C   A 1 25  ? -28.454 40.512 33.392  1.00 64.78 ? 25  C   B C6    1 
ATOM   533  P P     . U   A 1 26  ? -27.995 37.569 38.329  1.00 75.51 ? 26  U   B P     1 
ATOM   534  O OP1   . U   A 1 26  ? -27.982 37.217 39.779  1.00 76.48 ? 26  U   B OP1   1 
ATOM   535  O OP2   . U   A 1 26  ? -26.709 37.867 37.632  1.00 74.72 ? 26  U   B OP2   1 
ATOM   536  O "O5'" . U   A 1 26  ? -28.774 36.442 37.518  1.00 74.14 ? 26  U   B "O5'" 1 
ATOM   537  C "C5'" . U   A 1 26  ? -30.184 36.323 37.653  1.00 73.36 ? 26  U   B "C5'" 1 
ATOM   538  C "C4'" . U   A 1 26  ? -30.763 35.505 36.525  1.00 73.53 ? 26  U   B "C4'" 1 
ATOM   539  O "O4'" . U   A 1 26  ? -30.686 36.237 35.273  1.00 72.99 ? 26  U   B "O4'" 1 
ATOM   540  C "C3'" . U   A 1 26  ? -30.069 34.194 36.193  1.00 73.79 ? 26  U   B "C3'" 1 
ATOM   541  O "O3'" . U   A 1 26  ? -30.406 33.153 37.104  1.00 74.99 ? 26  U   B "O3'" 1 
ATOM   542  C "C2'" . U   A 1 26  ? -30.633 33.907 34.809  1.00 73.27 ? 26  U   B "C2'" 1 
ATOM   543  O "O2'" . U   A 1 26  ? -31.953 33.399 34.874  1.00 73.41 ? 26  U   B "O2'" 1 
ATOM   544  C "C1'" . U   A 1 26  ? -30.641 35.310 34.196  1.00 72.59 ? 26  U   B "C1'" 1 
ATOM   545  N N1    . U   A 1 26  ? -29.423 35.548 33.412  1.00 72.20 ? 26  U   B N1    1 
ATOM   546  C C2    . U   A 1 26  ? -29.371 34.996 32.140  1.00 72.38 ? 26  U   B C2    1 
ATOM   547  O O2    . U   A 1 26  ? -30.289 34.351 31.661  1.00 72.44 ? 26  U   B O2    1 
ATOM   548  N N3    . U   A 1 26  ? -28.204 35.224 31.453  1.00 72.42 ? 26  U   B N3    1 
ATOM   549  C C4    . U   A 1 26  ? -27.107 35.935 31.898  1.00 72.95 ? 26  U   B C4    1 
ATOM   550  O O4    . U   A 1 26  ? -26.122 36.042 31.165  1.00 72.80 ? 26  U   B O4    1 
ATOM   551  C C5    . U   A 1 26  ? -27.239 36.481 33.222  1.00 72.74 ? 26  U   B C5    1 
ATOM   552  C C6    . U   A 1 26  ? -28.369 36.274 33.916  1.00 72.33 ? 26  U   B C6    1 
ATOM   553  P P     . G   A 1 27  ? -29.339 31.990 37.413  1.00 67.72 ? 27  G   B P     1 
ATOM   554  O OP1   . G   A 1 27  ? -29.431 31.678 38.865  1.00 66.53 ? 27  G   B OP1   1 
ATOM   555  O OP2   . G   A 1 27  ? -28.038 32.424 36.835  1.00 67.36 ? 27  G   B OP2   1 
ATOM   556  O "O5'" . G   A 1 27  ? -29.864 30.747 36.560  1.00 67.18 ? 27  G   B "O5'" 1 
ATOM   557  C "C5'" . G   A 1 27  ? -31.121 30.142 36.845  1.00 67.85 ? 27  G   B "C5'" 1 
ATOM   558  C "C4'" . G   A 1 27  ? -31.468 29.111 35.792  1.00 69.11 ? 27  G   B "C4'" 1 
ATOM   559  O "O4'" . G   A 1 27  ? -31.761 29.763 34.519  1.00 69.12 ? 27  G   B "O4'" 1 
ATOM   560  C "C3'" . G   A 1 27  ? -30.367 28.136 35.415  1.00 69.87 ? 27  G   B "C3'" 1 
ATOM   561  O "O3'" . G   A 1 27  ? -30.135 27.107 36.369  1.00 70.40 ? 27  G   B "O3'" 1 
ATOM   562  C "C2'" . G   A 1 27  ? -30.881 27.613 34.080  1.00 69.48 ? 27  G   B "C2'" 1 
ATOM   563  O "O2'" . G   A 1 27  ? -31.965 26.710 34.209  1.00 69.62 ? 27  G   B "O2'" 1 
ATOM   564  C "C1'" . G   A 1 27  ? -31.361 28.915 33.444  1.00 68.92 ? 27  G   B "C1'" 1 
ATOM   565  N N9    . G   A 1 27  ? -30.248 29.547 32.740  1.00 68.61 ? 27  G   B N9    1 
ATOM   566  C C8    . G   A 1 27  ? -29.496 30.624 33.154  1.00 68.30 ? 27  G   B C8    1 
ATOM   567  N N7    . G   A 1 27  ? -28.549 30.943 32.312  1.00 67.67 ? 27  G   B N7    1 
ATOM   568  C C5    . G   A 1 27  ? -28.683 30.024 31.280  1.00 68.44 ? 27  G   B C5    1 
ATOM   569  C C6    . G   A 1 27  ? -27.935 29.871 30.079  1.00 68.86 ? 27  G   B C6    1 
ATOM   570  O O6    . G   A 1 27  ? -26.973 30.536 29.679  1.00 69.74 ? 27  G   B O6    1 
ATOM   571  N N1    . G   A 1 27  ? -28.410 28.813 29.310  1.00 69.01 ? 27  G   B N1    1 
ATOM   572  C C2    . G   A 1 27  ? -29.466 28.000 29.649  1.00 68.89 ? 27  G   B C2    1 
ATOM   573  N N2    . G   A 1 27  ? -29.766 27.024 28.777  1.00 69.13 ? 27  G   B N2    1 
ATOM   574  N N3    . G   A 1 27  ? -30.173 28.132 30.764  1.00 68.78 ? 27  G   B N3    1 
ATOM   575  C C4    . G   A 1 27  ? -29.729 29.158 31.527  1.00 68.69 ? 27  G   B C4    1 
ATOM   576  P P     . G   A 1 28  ? -28.633 26.565 36.581  1.00 69.82 ? 28  G   B P     1 
ATOM   577  O OP1   . G   A 1 28  ? -28.548 25.812 37.862  1.00 70.35 ? 28  G   B OP1   1 
ATOM   578  O OP2   . G   A 1 28  ? -27.741 27.735 36.359  1.00 69.71 ? 28  G   B OP2   1 
ATOM   579  O "O5'" . G   A 1 28  ? -28.405 25.557 35.364  1.00 67.31 ? 28  G   B "O5'" 1 
ATOM   580  C "C5'" . G   A 1 28  ? -29.248 24.425 35.177  1.00 65.23 ? 28  G   B "C5'" 1 
ATOM   581  C "C4'" . G   A 1 28  ? -29.002 23.804 33.818  1.00 64.12 ? 28  G   B "C4'" 1 
ATOM   582  O "O4'" . G   A 1 28  ? -29.267 24.794 32.782  1.00 63.63 ? 28  G   B "O4'" 1 
ATOM   583  C "C3'" . G   A 1 28  ? -27.573 23.388 33.522  1.00 63.95 ? 28  G   B "C3'" 1 
ATOM   584  O "O3'" . G   A 1 28  ? -27.204 22.157 34.116  1.00 63.54 ? 28  G   B "O3'" 1 
ATOM   585  C "C2'" . G   A 1 28  ? -27.578 23.341 32.000  1.00 63.44 ? 28  G   B "C2'" 1 
ATOM   586  O "O2'" . G   A 1 28  ? -28.226 22.208 31.440  1.00 63.05 ? 28  G   B "O2'" 1 
ATOM   587  C "C1'" . G   A 1 28  ? -28.365 24.611 31.696  1.00 62.65 ? 28  G   B "C1'" 1 
ATOM   588  N N9    . G   A 1 28  ? -27.451 25.747 31.670  1.00 60.81 ? 28  G   B N9    1 
ATOM   589  C C8    . G   A 1 28  ? -27.219 26.658 32.675  1.00 61.06 ? 28  G   B C8    1 
ATOM   590  N N7    . G   A 1 28  ? -26.313 27.543 32.363  1.00 59.63 ? 28  G   B N7    1 
ATOM   591  C C5    . G   A 1 28  ? -25.930 27.200 31.075  1.00 59.00 ? 28  G   B C5    1 
ATOM   592  C C6    . G   A 1 28  ? -24.983 27.794 30.220  1.00 58.66 ? 28  G   B C6    1 
ATOM   593  O O6    . G   A 1 28  ? -24.271 28.784 30.429  1.00 58.48 ? 28  G   B O6    1 
ATOM   594  N N1    . G   A 1 28  ? -24.897 27.122 29.006  1.00 57.76 ? 28  G   B N1    1 
ATOM   595  C C2    . G   A 1 28  ? -25.633 26.019 28.661  1.00 56.85 ? 28  G   B C2    1 
ATOM   596  N N2    . G   A 1 28  ? -25.396 25.500 27.457  1.00 55.25 ? 28  G   B N2    1 
ATOM   597  N N3    . G   A 1 28  ? -26.533 25.461 29.447  1.00 57.84 ? 28  G   B N3    1 
ATOM   598  C C4    . G   A 1 28  ? -26.627 26.097 30.632  1.00 59.13 ? 28  G   B C4    1 
ATOM   599  P P     . G   A 1 29  ? -25.664 21.904 34.490  1.00 71.86 ? 29  G   B P     1 
ATOM   600  O OP1   . G   A 1 29  ? -25.586 20.727 35.403  1.00 71.94 ? 29  G   B OP1   1 
ATOM   601  O OP2   . G   A 1 29  ? -25.112 23.215 34.934  1.00 71.00 ? 29  G   B OP2   1 
ATOM   602  O "O5'" . G   A 1 29  ? -25.003 21.536 33.085  1.00 69.62 ? 29  G   B "O5'" 1 
ATOM   603  C "C5'" . G   A 1 29  ? -25.634 20.606 32.204  1.00 68.34 ? 29  G   B "C5'" 1 
ATOM   604  C "C4'" . G   A 1 29  ? -24.960 20.614 30.847  1.00 68.07 ? 29  G   B "C4'" 1 
ATOM   605  O "O4'" . G   A 1 29  ? -25.293 21.824 30.104  1.00 68.25 ? 29  G   B "O4'" 1 
ATOM   606  C "C3'" . G   A 1 29  ? -23.441 20.608 30.864  1.00 67.24 ? 29  G   B "C3'" 1 
ATOM   607  O "O3'" . G   A 1 29  ? -22.907 19.319 31.101  1.00 66.41 ? 29  G   B "O3'" 1 
ATOM   608  C "C2'" . G   A 1 29  ? -23.118 21.125 29.469  1.00 66.84 ? 29  G   B "C2'" 1 
ATOM   609  O "O2'" . G   A 1 29  ? -23.271 20.153 28.451  1.00 66.05 ? 29  G   B "O2'" 1 
ATOM   610  C "C1'" . G   A 1 29  ? -24.169 22.228 29.328  1.00 66.63 ? 29  G   B "C1'" 1 
ATOM   611  N N9    . G   A 1 29  ? -23.632 23.457 29.900  1.00 65.26 ? 29  G   B N9    1 
ATOM   612  C C8    . G   A 1 29  ? -23.949 24.029 31.108  1.00 64.31 ? 29  G   B C8    1 
ATOM   613  N N7    . G   A 1 29  ? -23.249 25.098 31.365  1.00 63.99 ? 29  G   B N7    1 
ATOM   614  C C5    . G   A 1 29  ? -22.429 25.247 30.256  1.00 64.17 ? 29  G   B C5    1 
ATOM   615  C C6    . G   A 1 29  ? -21.437 26.226 29.965  1.00 64.31 ? 29  G   B C6    1 
ATOM   616  O O6    . G   A 1 29  ? -21.071 27.187 30.656  1.00 65.19 ? 29  G   B O6    1 
ATOM   617  N N1    . G   A 1 29  ? -20.846 26.003 28.724  1.00 63.77 ? 29  G   B N1    1 
ATOM   618  C C2    . G   A 1 29  ? -21.163 24.976 27.872  1.00 63.59 ? 29  G   B C2    1 
ATOM   619  N N2    . G   A 1 29  ? -20.495 24.932 26.716  1.00 62.42 ? 29  G   B N2    1 
ATOM   620  N N3    . G   A 1 29  ? -22.076 24.057 28.133  1.00 64.71 ? 29  G   B N3    1 
ATOM   621  C C4    . G   A 1 29  ? -22.665 24.252 29.336  1.00 64.63 ? 29  G   B C4    1 
ATOM   622  P P     . C   A 1 30  ? -21.569 19.174 31.973  1.00 56.00 ? 30  C   B P     1 
ATOM   623  O OP1   . C   A 1 30  ? -21.443 17.743 32.365  1.00 56.44 ? 30  C   B OP1   1 
ATOM   624  O OP2   . C   A 1 30  ? -21.599 20.232 33.027  1.00 55.65 ? 30  C   B OP2   1 
ATOM   625  O "O5'" . C   A 1 30  ? -20.397 19.535 30.951  1.00 52.90 ? 30  C   B "O5'" 1 
ATOM   626  C "C5'" . C   A 1 30  ? -20.312 18.896 29.680  1.00 48.75 ? 30  C   B "C5'" 1 
ATOM   627  C "C4'" . C   A 1 30  ? -19.349 19.632 28.774  1.00 46.72 ? 30  C   B "C4'" 1 
ATOM   628  O "O4'" . C   A 1 30  ? -19.866 20.959 28.478  1.00 45.96 ? 30  C   B "O4'" 1 
ATOM   629  C "C3'" . C   A 1 30  ? -17.954 19.909 29.312  1.00 45.44 ? 30  C   B "C3'" 1 
ATOM   630  O "O3'" . C   A 1 30  ? -17.102 18.774 29.208  1.00 45.00 ? 30  C   B "O3'" 1 
ATOM   631  C "C2'" . C   A 1 30  ? -17.504 21.038 28.392  1.00 45.01 ? 30  C   B "C2'" 1 
ATOM   632  O "O2'" . C   A 1 30  ? -17.145 20.598 27.100  1.00 44.52 ? 30  C   B "O2'" 1 
ATOM   633  C "C1'" . C   A 1 30  ? -18.785 21.865 28.295  1.00 44.32 ? 30  C   B "C1'" 1 
ATOM   634  N N1    . C   A 1 30  ? -18.824 22.884 29.358  1.00 42.56 ? 30  C   B N1    1 
ATOM   635  C C2    . C   A 1 30  ? -18.001 23.995 29.234  1.00 41.85 ? 30  C   B C2    1 
ATOM   636  O O2    . C   A 1 30  ? -17.309 24.111 28.218  1.00 42.42 ? 30  C   B O2    1 
ATOM   637  N N3    . C   A 1 30  ? -17.978 24.918 30.221  1.00 41.70 ? 30  C   B N3    1 
ATOM   638  C C4    . C   A 1 30  ? -18.749 24.762 31.295  1.00 41.73 ? 30  C   B C4    1 
ATOM   639  N N4    . C   A 1 30  ? -18.685 25.692 32.248  1.00 40.76 ? 30  C   B N4    1 
ATOM   640  C C5    . C   A 1 30  ? -19.620 23.647 31.440  1.00 41.75 ? 30  C   B C5    1 
ATOM   641  C C6    . C   A 1 30  ? -19.628 22.741 30.454  1.00 42.60 ? 30  C   B C6    1 
ATOM   642  P P     . C   A 1 31  ? -15.728 18.723 30.044  1.00 39.98 ? 31  C   B P     1 
ATOM   643  O OP1   . C   A 1 31  ? -15.059 17.435 29.717  1.00 40.87 ? 31  C   B OP1   1 
ATOM   644  O OP2   . C   A 1 31  ? -15.996 19.074 31.465  1.00 40.80 ? 31  C   B OP2   1 
ATOM   645  O "O5'" . C   A 1 31  ? -14.843 19.897 29.438  1.00 39.67 ? 31  C   B "O5'" 1 
ATOM   646  C "C5'" . C   A 1 31  ? -14.368 19.839 28.098  1.00 40.95 ? 31  C   B "C5'" 1 
ATOM   647  C "C4'" . C   A 1 31  ? -13.366 20.941 27.863  1.00 40.69 ? 31  C   B "C4'" 1 
ATOM   648  O "O4'" . C   A 1 31  ? -14.027 22.234 27.937  1.00 40.47 ? 31  C   B "O4'" 1 
ATOM   649  C "C3'" . C   A 1 31  ? -12.264 21.007 28.904  1.00 40.21 ? 31  C   B "C3'" 1 
ATOM   650  O "O3'" . C   A 1 31  ? -11.208 20.148 28.517  1.00 38.18 ? 31  C   B "O3'" 1 
ATOM   651  C "C2'" . C   A 1 31  ? -11.858 22.474 28.861  1.00 40.20 ? 31  C   B "C2'" 1 
ATOM   652  O "O2'" . C   A 1 31  ? -10.994 22.757 27.778  1.00 40.62 ? 31  C   B "O2'" 1 
ATOM   653  C "C1'" . C   A 1 31  ? -13.211 23.152 28.635  1.00 39.52 ? 31  C   B "C1'" 1 
ATOM   654  N N1    . C   A 1 31  ? -13.931 23.508 29.854  1.00 38.86 ? 31  C   B N1    1 
ATOM   655  C C2    . C   A 1 31  ? -13.637 24.705 30.505  1.00 39.87 ? 31  C   B C2    1 
ATOM   656  O O2    . C   A 1 31  ? -12.740 25.425 30.057  1.00 40.99 ? 31  C   B O2    1 
ATOM   657  N N3    . C   A 1 31  ? -14.342 25.050 31.604  1.00 39.98 ? 31  C   B N3    1 
ATOM   658  C C4    . C   A 1 31  ? -15.311 24.249 32.049  1.00 39.66 ? 31  C   B C4    1 
ATOM   659  N N4    . C   A 1 31  ? -16.015 24.640 33.104  1.00 39.52 ? 31  C   B N4    1 
ATOM   660  C C5    . C   A 1 31  ? -15.611 23.012 31.419  1.00 40.11 ? 31  C   B C5    1 
ATOM   661  C C6    . C   A 1 31  ? -14.900 22.682 30.336  1.00 39.15 ? 31  C   B C6    1 
ATOM   662  P P     . A   A 1 32  ? -10.216 19.572 29.629  1.00 45.20 ? 32  A   B P     1 
ATOM   663  O OP1   . A   A 1 32  ? -9.298  18.600 28.977  1.00 45.72 ? 32  A   B OP1   1 
ATOM   664  O OP2   . A   A 1 32  ? -11.048 19.144 30.775  1.00 46.03 ? 32  A   B OP2   1 
ATOM   665  O "O5'" . A   A 1 32  ? -9.365  20.836 30.092  1.00 46.24 ? 32  A   B "O5'" 1 
ATOM   666  C "C5'" . A   A 1 32  ? -8.284  21.306 29.301  1.00 45.79 ? 32  A   B "C5'" 1 
ATOM   667  C "C4'" . A   A 1 32  ? -7.658  22.511 29.944  1.00 45.11 ? 32  A   B "C4'" 1 
ATOM   668  O "O4'" . A   A 1 32  ? -8.688  23.504 30.132  1.00 45.50 ? 32  A   B "O4'" 1 
ATOM   669  C "C3'" . A   A 1 32  ? -7.098  22.305 31.342  1.00 45.40 ? 32  A   B "C3'" 1 
ATOM   670  O "O3'" . A   A 1 32  ? -5.761  21.822 31.251  1.00 46.56 ? 32  A   B "O3'" 1 
ATOM   671  C "C2'" . A   A 1 32  ? -7.109  23.724 31.902  1.00 45.80 ? 32  A   B "C2'" 1 
ATOM   672  O "O2'" . A   A 1 32  ? -5.993  24.470 31.458  1.00 45.90 ? 32  A   B "O2'" 1 
ATOM   673  C "C1'" . A   A 1 32  ? -8.373  24.299 31.260  1.00 46.30 ? 32  A   B "C1'" 1 
ATOM   674  N N9    . A   A 1 32  ? -9.547  24.354 32.126  1.00 45.94 ? 32  A   B N9    1 
ATOM   675  C C8    . A   A 1 32  ? -10.422 23.348 32.456  1.00 46.14 ? 32  A   B C8    1 
ATOM   676  N N7    . A   A 1 32  ? -11.406 23.737 33.233  1.00 46.10 ? 32  A   B N7    1 
ATOM   677  C C5    . A   A 1 32  ? -11.160 25.089 33.428  1.00 46.15 ? 32  A   B C5    1 
ATOM   678  C C6    . A   A 1 32  ? -11.854 26.083 34.135  1.00 45.69 ? 32  A   B C6    1 
ATOM   679  N N6    . A   A 1 32  ? -12.999 25.866 34.778  1.00 46.34 ? 32  A   B N6    1 
ATOM   680  N N1    . A   A 1 32  ? -11.333 27.331 34.144  1.00 45.16 ? 32  A   B N1    1 
ATOM   681  C C2    . A   A 1 32  ? -10.199 27.559 33.463  1.00 45.82 ? 32  A   B C2    1 
ATOM   682  N N3    . A   A 1 32  ? -9.464  26.710 32.741  1.00 46.11 ? 32  A   B N3    1 
ATOM   683  C C4    . A   A 1 32  ? -10.007 25.478 32.766  1.00 46.06 ? 32  A   B C4    1 
ATOM   684  P P     . U   A 1 33  ? -5.199  20.791 32.349  1.00 65.42 ? 33  U   B P     1 
ATOM   685  O OP1   . U   A 1 33  ? -3.815  20.422 31.946  1.00 65.88 ? 33  U   B OP1   1 
ATOM   686  O OP2   . U   A 1 33  ? -6.227  19.732 32.495  1.00 64.13 ? 33  U   B OP2   1 
ATOM   687  O "O5'" . U   A 1 33  ? -5.131  21.644 33.705  1.00 68.55 ? 33  U   B "O5'" 1 
ATOM   688  C "C5'" . U   A 1 33  ? -4.127  22.660 33.908  1.00 70.20 ? 33  U   B "C5'" 1 
ATOM   689  C "C4'" . U   A 1 33  ? -4.319  23.374 35.252  1.00 71.33 ? 33  U   B "C4'" 1 
ATOM   690  O "O4'" . U   A 1 33  ? -5.602  24.053 35.261  1.00 71.88 ? 33  U   B "O4'" 1 
ATOM   691  C "C3'" . U   A 1 33  ? -4.319  22.514 36.515  1.00 71.37 ? 33  U   B "C3'" 1 
ATOM   692  O "O3'" . U   A 1 33  ? -2.996  22.373 37.043  1.00 71.44 ? 33  U   B "O3'" 1 
ATOM   693  C "C2'" . U   A 1 33  ? -5.144  23.350 37.502  1.00 71.44 ? 33  U   B "C2'" 1 
ATOM   694  O "O2'" . U   A 1 33  ? -4.351  24.287 38.214  1.00 70.88 ? 33  U   B "O2'" 1 
ATOM   695  C "C1'" . U   A 1 33  ? -6.136  24.067 36.576  1.00 71.96 ? 33  U   B "C1'" 1 
ATOM   696  N N1    . U   A 1 33  ? -7.470  23.449 36.529  1.00 72.94 ? 33  U   B N1    1 
ATOM   697  C C2    . U   A 1 33  ? -8.535  24.166 37.055  1.00 73.00 ? 33  U   B C2    1 
ATOM   698  O O2    . U   A 1 33  ? -8.412  25.273 37.550  1.00 71.87 ? 33  U   B O2    1 
ATOM   699  N N3    . U   A 1 33  ? -9.753  23.531 36.979  1.00 73.14 ? 33  U   B N3    1 
ATOM   700  C C4    . U   A 1 33  ? -10.010 22.277 36.450  1.00 73.32 ? 33  U   B C4    1 
ATOM   701  O O4    . U   A 1 33  ? -11.152 21.819 36.501  1.00 73.08 ? 33  U   B O4    1 
ATOM   702  C C5    . U   A 1 33  ? -8.862  21.603 35.927  1.00 73.43 ? 33  U   B C5    1 
ATOM   703  C C6    . U   A 1 33  ? -7.661  22.195 35.982  1.00 73.38 ? 33  U   B C6    1 
ATOM   704  P P     . C   A 1 34  ? -1.875  21.567 36.216  1.00 97.87 ? 34  C   B P     1 
ATOM   705  O OP1   . C   A 1 34  ? -0.876  22.573 35.765  1.00 97.02 ? 34  C   B OP1   1 
ATOM   706  O OP2   . C   A 1 34  ? -2.525  20.672 35.221  1.00 97.43 ? 34  C   B OP2   1 
ATOM   707  O "O5'" . C   A 1 34  ? -1.166  20.641 37.302  1.00 97.82 ? 34  C   B "O5'" 1 
ATOM   708  C "C5'" . C   A 1 34  ? -1.545  20.671 38.677  1.00 97.52 ? 34  C   B "C5'" 1 
ATOM   709  C "C4'" . C   A 1 34  ? -2.065  19.314 39.096  1.00 96.84 ? 34  C   B "C4'" 1 
ATOM   710  O "O4'" . C   A 1 34  ? -3.488  19.205 38.841  1.00 96.20 ? 34  C   B "O4'" 1 
ATOM   711  C "C3'" . C   A 1 34  ? -1.477  18.135 38.340  1.00 96.81 ? 34  C   B "C3'" 1 
ATOM   712  O "O3'" . C   A 1 34  ? -0.113  17.836 38.673  1.00 96.46 ? 34  C   B "O3'" 1 
ATOM   713  C "C2'" . C   A 1 34  ? -2.506  17.040 38.604  1.00 96.67 ? 34  C   B "C2'" 1 
ATOM   714  O "O2'" . C   A 1 34  ? -2.309  16.392 39.843  1.00 97.62 ? 34  C   B "O2'" 1 
ATOM   715  C "C1'" . C   A 1 34  ? -3.819  17.838 38.636  1.00 96.68 ? 34  C   B "C1'" 1 
ATOM   716  N N1    . C   A 1 34  ? -4.612  17.715 37.397  1.00 96.80 ? 34  C   B N1    1 
ATOM   717  C C2    . C   A 1 34  ? -5.855  17.063 37.458  1.00 96.25 ? 34  C   B C2    1 
ATOM   718  O O2    . C   A 1 34  ? -6.246  16.613 38.549  1.00 94.93 ? 34  C   B O2    1 
ATOM   719  N N3    . C   A 1 34  ? -6.596  16.938 36.328  1.00 96.60 ? 34  C   B N3    1 
ATOM   720  C C4    . C   A 1 34  ? -6.140  17.427 35.171  1.00 96.60 ? 34  C   B C4    1 
ATOM   721  N N4    . C   A 1 34  ? -6.906  17.280 34.084  1.00 95.84 ? 34  C   B N4    1 
ATOM   722  C C5    . C   A 1 34  ? -4.878  18.090 35.077  1.00 96.75 ? 34  C   B C5    1 
ATOM   723  C C6    . C   A 1 34  ? -4.154  18.213 36.204  1.00 97.18 ? 34  C   B C6    1 
ATOM   724  N N     . LYS B 2 1   ? 16.267  5.746  8.252   1.00 56.31 ? 2   LYS A N     1 
ATOM   725  C CA    . LYS B 2 1   ? 14.883  5.293  8.121   1.00 56.10 ? 2   LYS A CA    1 
ATOM   726  C C     . LYS B 2 1   ? 14.200  5.409  9.485   1.00 56.12 ? 2   LYS A C     1 
ATOM   727  O O     . LYS B 2 1   ? 14.869  5.407  10.527  1.00 56.17 ? 2   LYS A O     1 
ATOM   728  C CB    . LYS B 2 1   ? 14.855  3.842  7.628   1.00 55.33 ? 2   LYS A CB    1 
ATOM   729  C CG    . LYS B 2 1   ? 13.551  3.410  6.984   1.00 54.53 ? 2   LYS A CG    1 
ATOM   730  C CD    . LYS B 2 1   ? 13.668  2.003  6.401   1.00 53.98 ? 2   LYS A CD    1 
ATOM   731  C CE    . LYS B 2 1   ? 13.749  0.913  7.482   1.00 52.42 ? 2   LYS A CE    1 
ATOM   732  N NZ    . LYS B 2 1   ? 14.930  1.000  8.380   1.00 50.29 ? 2   LYS A NZ    1 
ATOM   733  N N     . VAL B 2 2   ? 12.874  5.524  9.465   1.00 55.57 ? 3   VAL A N     1 
ATOM   734  C CA    . VAL B 2 2   ? 12.073  5.661  10.679  1.00 55.26 ? 3   VAL A CA    1 
ATOM   735  C C     . VAL B 2 2   ? 12.720  5.020  11.908  1.00 55.40 ? 3   VAL A C     1 
ATOM   736  O O     . VAL B 2 2   ? 13.067  5.704  12.868  1.00 54.80 ? 3   VAL A O     1 
ATOM   737  C CB    . VAL B 2 2   ? 10.685  5.034  10.486  1.00 55.24 ? 3   VAL A CB    1 
ATOM   738  C CG1   . VAL B 2 2   ? 9.617   5.975  11.028  1.00 54.71 ? 3   VAL A CG1   1 
ATOM   739  C CG2   . VAL B 2 2   ? 10.458  4.711  9.002   1.00 54.87 ? 3   VAL A CG2   1 
ATOM   740  N N     . GLU B 2 3   ? 12.874  3.701  11.864  1.00 56.18 ? 4   GLU A N     1 
ATOM   741  C CA    . GLU B 2 3   ? 13.472  2.941  12.956  1.00 56.90 ? 4   GLU A CA    1 
ATOM   742  C C     . GLU B 2 3   ? 14.784  3.556  13.451  1.00 56.95 ? 4   GLU A C     1 
ATOM   743  O O     . GLU B 2 3   ? 14.918  3.868  14.636  1.00 56.41 ? 4   GLU A O     1 
ATOM   744  C CB    . GLU B 2 3   ? 13.708  1.495  12.505  1.00 57.46 ? 4   GLU A CB    1 
ATOM   745  C CG    . GLU B 2 3   ? 12.430  0.732  12.159  1.00 58.07 ? 4   GLU A CG    1 
ATOM   746  C CD    . GLU B 2 3   ? 12.670  -0.405 11.169  1.00 58.57 ? 4   GLU A CD    1 
ATOM   747  O OE1   . GLU B 2 3   ? 13.045  -0.122 10.007  1.00 58.87 ? 4   GLU A OE1   1 
ATOM   748  O OE2   . GLU B 2 3   ? 12.482  -1.582 11.552  1.00 58.21 ? 4   GLU A OE2   1 
ATOM   749  N N     . GLU B 2 4   ? 15.753  3.722  12.554  1.00 57.46 ? 5   GLU A N     1 
ATOM   750  C CA    . GLU B 2 4   ? 17.033  4.308  12.947  1.00 58.53 ? 5   GLU A CA    1 
ATOM   751  C C     . GLU B 2 4   ? 16.791  5.666  13.592  1.00 57.65 ? 5   GLU A C     1 
ATOM   752  O O     . GLU B 2 4   ? 17.451  6.028  14.573  1.00 57.30 ? 5   GLU A O     1 
ATOM   753  C CB    . GLU B 2 4   ? 17.960  4.493  11.740  1.00 60.44 ? 5   GLU A CB    1 
ATOM   754  C CG    . GLU B 2 4   ? 17.333  4.165  10.395  1.00 64.91 ? 5   GLU A CG    1 
ATOM   755  C CD    . GLU B 2 4   ? 17.247  2.669  10.120  1.00 67.19 ? 5   GLU A CD    1 
ATOM   756  O OE1   . GLU B 2 4   ? 16.626  1.944  10.939  1.00 68.44 ? 5   GLU A OE1   1 
ATOM   757  O OE2   . GLU B 2 4   ? 17.801  2.230  9.078   1.00 68.06 ? 5   GLU A OE2   1 
ATOM   758  N N     . ILE B 2 5   ? 15.839  6.410  13.033  1.00 56.22 ? 6   ILE A N     1 
ATOM   759  C CA    . ILE B 2 5   ? 15.502  7.730  13.543  1.00 54.52 ? 6   ILE A CA    1 
ATOM   760  C C     . ILE B 2 5   ? 14.885  7.651  14.933  1.00 53.77 ? 6   ILE A C     1 
ATOM   761  O O     . ILE B 2 5   ? 15.321  8.345  15.849  1.00 53.85 ? 6   ILE A O     1 
ATOM   762  C CB    . ILE B 2 5   ? 14.526  8.452  12.606  1.00 54.10 ? 6   ILE A CB    1 
ATOM   763  C CG1   . ILE B 2 5   ? 15.183  8.667  11.239  1.00 54.16 ? 6   ILE A CG1   1 
ATOM   764  C CG2   . ILE B 2 5   ? 14.099  9.771  13.228  1.00 53.78 ? 6   ILE A CG2   1 
ATOM   765  C CD1   . ILE B 2 5   ? 16.496  9.440  11.290  1.00 53.66 ? 6   ILE A CD1   1 
ATOM   766  N N     . LEU B 2 6   ? 13.869  6.806  15.086  1.00 53.11 ? 7   LEU A N     1 
ATOM   767  C CA    . LEU B 2 6   ? 13.203  6.640  16.377  1.00 52.16 ? 7   LEU A CA    1 
ATOM   768  C C     . LEU B 2 6   ? 14.228  6.194  17.424  1.00 52.99 ? 7   LEU A C     1 
ATOM   769  O O     . LEU B 2 6   ? 14.075  6.478  18.612  1.00 53.61 ? 7   LEU A O     1 
ATOM   770  C CB    . LEU B 2 6   ? 12.059  5.617  16.269  1.00 49.51 ? 7   LEU A CB    1 
ATOM   771  C CG    . LEU B 2 6   ? 10.967  5.922  15.235  1.00 47.39 ? 7   LEU A CG    1 
ATOM   772  C CD1   . LEU B 2 6   ? 9.911   4.838  15.253  1.00 46.71 ? 7   LEU A CD1   1 
ATOM   773  C CD2   . LEU B 2 6   ? 10.338  7.261  15.534  1.00 47.25 ? 7   LEU A CD2   1 
ATOM   774  N N     . GLU B 2 7   ? 15.277  5.505  16.975  1.00 53.50 ? 8   GLU A N     1 
ATOM   775  C CA    . GLU B 2 7   ? 16.331  5.044  17.872  1.00 53.48 ? 8   GLU A CA    1 
ATOM   776  C C     . GLU B 2 7   ? 17.065  6.239  18.447  1.00 51.67 ? 8   GLU A C     1 
ATOM   777  O O     . GLU B 2 7   ? 17.109  6.455  19.655  1.00 51.36 ? 8   GLU A O     1 
ATOM   778  C CB    . GLU B 2 7   ? 17.321  4.165  17.116  1.00 56.57 ? 8   GLU A CB    1 
ATOM   779  C CG    . GLU B 2 7   ? 16.823  2.754  16.846  1.00 61.87 ? 8   GLU A CG    1 
ATOM   780  C CD    . GLU B 2 7   ? 16.582  1.955  18.132  1.00 65.31 ? 8   GLU A CD    1 
ATOM   781  O OE1   . GLU B 2 7   ? 16.270  0.738  18.017  1.00 66.81 ? 8   GLU A OE1   1 
ATOM   782  O OE2   . GLU B 2 7   ? 16.702  2.542  19.247  1.00 65.91 ? 8   GLU A OE2   1 
ATOM   783  N N     . LYS B 2 8   ? 17.644  7.023  17.559  1.00 50.20 ? 9   LYS A N     1 
ATOM   784  C CA    . LYS B 2 8   ? 18.377  8.202  17.968  1.00 48.92 ? 9   LYS A CA    1 
ATOM   785  C C     . LYS B 2 8   ? 17.457  9.115  18.783  1.00 47.56 ? 9   LYS A C     1 
ATOM   786  O O     . LYS B 2 8   ? 17.924  9.909  19.599  1.00 47.86 ? 9   LYS A O     1 
ATOM   787  C CB    . LYS B 2 8   ? 18.899  8.928  16.716  1.00 49.97 ? 9   LYS A CB    1 
ATOM   788  C CG    . LYS B 2 8   ? 19.528  7.978  15.679  1.00 50.95 ? 9   LYS A CG    1 
ATOM   789  C CD    . LYS B 2 8   ? 19.895  8.671  14.363  1.00 52.10 ? 9   LYS A CD    1 
ATOM   790  C CE    . LYS B 2 8   ? 20.261  7.645  13.281  1.00 52.48 ? 9   LYS A CE    1 
ATOM   791  N NZ    . LYS B 2 8   ? 20.596  8.270  11.961  1.00 51.84 ? 9   LYS A NZ    1 
ATOM   792  N N     . ALA B 2 9   ? 16.148  8.980  18.574  1.00 45.89 ? 10  ALA A N     1 
ATOM   793  C CA    . ALA B 2 9   ? 15.162  9.814  19.264  1.00 43.97 ? 10  ALA A CA    1 
ATOM   794  C C     . ALA B 2 9   ? 14.938  9.471  20.733  1.00 43.00 ? 10  ALA A C     1 
ATOM   795  O O     . ALA B 2 9   ? 14.812  10.368 21.569  1.00 42.07 ? 10  ALA A O     1 
ATOM   796  C CB    . ALA B 2 9   ? 13.834  9.769  18.518  1.00 43.04 ? 10  ALA A CB    1 
ATOM   797  N N     . LEU B 2 10  ? 14.871  8.181  21.047  1.00 41.95 ? 11  LEU A N     1 
ATOM   798  C CA    . LEU B 2 10  ? 14.657  7.764  22.422  1.00 42.18 ? 11  LEU A CA    1 
ATOM   799  C C     . LEU B 2 10  ? 15.597  8.553  23.307  1.00 42.94 ? 11  LEU A C     1 
ATOM   800  O O     . LEU B 2 10  ? 15.305  8.834  24.468  1.00 42.61 ? 11  LEU A O     1 
ATOM   801  C CB    . LEU B 2 10  ? 14.957  6.281  22.586  1.00 41.50 ? 11  LEU A CB    1 
ATOM   802  C CG    . LEU B 2 10  ? 14.014  5.280  21.930  1.00 42.85 ? 11  LEU A CG    1 
ATOM   803  C CD1   . LEU B 2 10  ? 14.410  3.870  22.369  1.00 43.55 ? 11  LEU A CD1   1 
ATOM   804  C CD2   . LEU B 2 10  ? 12.579  5.571  22.332  1.00 42.48 ? 11  LEU A CD2   1 
ATOM   805  N N     . GLU B 2 11  ? 16.729  8.916  22.723  1.00 44.10 ? 12  GLU A N     1 
ATOM   806  C CA    . GLU B 2 11  ? 17.777  9.655  23.403  1.00 45.14 ? 12  GLU A CA    1 
ATOM   807  C C     . GLU B 2 11  ? 17.354  11.036 23.878  1.00 45.48 ? 12  GLU A C     1 
ATOM   808  O O     . GLU B 2 11  ? 17.885  11.543 24.864  1.00 45.38 ? 12  GLU A O     1 
ATOM   809  C CB    . GLU B 2 11  ? 18.965  9.788  22.464  1.00 46.50 ? 12  GLU A CB    1 
ATOM   810  C CG    . GLU B 2 11  ? 20.294  9.620  23.131  1.00 49.17 ? 12  GLU A CG    1 
ATOM   811  C CD    . GLU B 2 11  ? 21.385  9.372  22.121  1.00 51.46 ? 12  GLU A CD    1 
ATOM   812  O OE1   . GLU B 2 11  ? 21.192  8.494  21.242  1.00 52.28 ? 12  GLU A OE1   1 
ATOM   813  O OE2   . GLU B 2 11  ? 22.434  10.050 22.212  1.00 53.31 ? 12  GLU A OE2   1 
ATOM   814  N N     . LEU B 2 12  ? 16.408  11.651 23.172  1.00 46.36 ? 13  LEU A N     1 
ATOM   815  C CA    . LEU B 2 12  ? 15.934  12.986 23.535  1.00 46.14 ? 13  LEU A CA    1 
ATOM   816  C C     . LEU B 2 12  ? 14.693  12.936 24.415  1.00 45.94 ? 13  LEU A C     1 
ATOM   817  O O     . LEU B 2 12  ? 14.389  13.891 25.121  1.00 46.28 ? 13  LEU A O     1 
ATOM   818  C CB    . LEU B 2 12  ? 15.625  13.798 22.276  1.00 45.97 ? 13  LEU A CB    1 
ATOM   819  C CG    . LEU B 2 12  ? 16.750  13.862 21.242  1.00 46.13 ? 13  LEU A CG    1 
ATOM   820  C CD1   . LEU B 2 12  ? 16.278  14.620 20.006  1.00 46.36 ? 13  LEU A CD1   1 
ATOM   821  C CD2   . LEU B 2 12  ? 17.968  14.530 21.860  1.00 46.26 ? 13  LEU A CD2   1 
ATOM   822  N N     . VAL B 2 13  ? 13.987  11.812 24.386  1.00 46.03 ? 14  VAL A N     1 
ATOM   823  C CA    . VAL B 2 13  ? 12.769  11.665 25.168  1.00 45.65 ? 14  VAL A CA    1 
ATOM   824  C C     . VAL B 2 13  ? 12.913  10.904 26.490  1.00 45.74 ? 14  VAL A C     1 
ATOM   825  O O     . VAL B 2 13  ? 12.302  11.274 27.490  1.00 45.88 ? 14  VAL A O     1 
ATOM   826  C CB    . VAL B 2 13  ? 11.662  11.001 24.308  1.00 44.91 ? 14  VAL A CB    1 
ATOM   827  C CG1   . VAL B 2 13  ? 11.355  11.882 23.111  1.00 44.01 ? 14  VAL A CG1   1 
ATOM   828  C CG2   . VAL B 2 13  ? 12.109  9.619  23.841  1.00 44.30 ? 14  VAL A CG2   1 
ATOM   829  N N     . ILE B 2 14  ? 13.720  9.854  26.510  1.00 45.97 ? 15  ILE A N     1 
ATOM   830  C CA    . ILE B 2 14  ? 13.870  9.079  27.734  1.00 46.80 ? 15  ILE A CA    1 
ATOM   831  C C     . ILE B 2 14  ? 14.817  9.716  28.747  1.00 47.37 ? 15  ILE A C     1 
ATOM   832  O O     . ILE B 2 14  ? 15.951  10.053 28.423  1.00 47.33 ? 15  ILE A O     1 
ATOM   833  C CB    . ILE B 2 14  ? 14.372  7.655  27.440  1.00 46.58 ? 15  ILE A CB    1 
ATOM   834  C CG1   . ILE B 2 14  ? 13.574  7.042  26.286  1.00 47.29 ? 15  ILE A CG1   1 
ATOM   835  C CG2   . ILE B 2 14  ? 14.201  6.792  28.677  1.00 45.92 ? 15  ILE A CG2   1 
ATOM   836  C CD1   . ILE B 2 14  ? 14.166  5.758  25.753  1.00 47.29 ? 15  ILE A CD1   1 
ATOM   837  N N     . PRO B 2 15  ? 14.355  9.877  29.995  1.00 48.52 ? 16  PRO A N     1 
ATOM   838  C CA    . PRO B 2 15  ? 15.108  10.465 31.108  1.00 49.67 ? 16  PRO A CA    1 
ATOM   839  C C     . PRO B 2 15  ? 16.356  9.641  31.353  1.00 51.30 ? 16  PRO A C     1 
ATOM   840  O O     . PRO B 2 15  ? 16.258  8.422  31.468  1.00 51.03 ? 16  PRO A O     1 
ATOM   841  C CB    . PRO B 2 15  ? 14.141  10.346 32.281  1.00 49.45 ? 16  PRO A CB    1 
ATOM   842  C CG    . PRO B 2 15  ? 12.784  10.348 31.617  1.00 48.89 ? 16  PRO A CG    1 
ATOM   843  C CD    . PRO B 2 15  ? 13.012  9.462  30.435  1.00 48.63 ? 16  PRO A CD    1 
ATOM   844  N N     . ASP B 2 16  ? 17.521  10.282 31.443  1.00 53.82 ? 17  ASP A N     1 
ATOM   845  C CA    . ASP B 2 16  ? 18.753  9.525  31.670  1.00 56.39 ? 17  ASP A CA    1 
ATOM   846  C C     . ASP B 2 16  ? 18.800  8.939  33.077  1.00 58.12 ? 17  ASP A C     1 
ATOM   847  O O     . ASP B 2 16  ? 18.015  9.318  33.959  1.00 58.32 ? 17  ASP A O     1 
ATOM   848  C CB    . ASP B 2 16  ? 20.002  10.383 31.402  1.00 57.18 ? 17  ASP A CB    1 
ATOM   849  C CG    . ASP B 2 16  ? 20.166  11.535 32.398  1.00 58.91 ? 17  ASP A CG    1 
ATOM   850  O OD1   . ASP B 2 16  ? 21.060  12.391 32.168  1.00 59.21 ? 17  ASP A OD1   1 
ATOM   851  O OD2   . ASP B 2 16  ? 19.418  11.587 33.408  1.00 58.84 ? 17  ASP A OD2   1 
ATOM   852  N N     . GLU B 2 17  ? 19.728  8.005  33.273  1.00 60.05 ? 18  GLU A N     1 
ATOM   853  C CA    . GLU B 2 17  ? 19.895  7.301  34.547  1.00 61.30 ? 18  GLU A CA    1 
ATOM   854  C C     . GLU B 2 17  ? 19.901  8.176  35.808  1.00 61.48 ? 18  GLU A C     1 
ATOM   855  O O     . GLU B 2 17  ? 19.360  7.765  36.846  1.00 61.04 ? 18  GLU A O     1 
ATOM   856  C CB    . GLU B 2 17  ? 21.162  6.439  34.476  1.00 62.16 ? 18  GLU A CB    1 
ATOM   857  C CG    . GLU B 2 17  ? 21.040  5.278  33.477  1.00 63.81 ? 18  GLU A CG    1 
ATOM   858  C CD    . GLU B 2 17  ? 22.295  5.071  32.621  1.00 64.12 ? 18  GLU A CD    1 
ATOM   859  O OE1   . GLU B 2 17  ? 22.530  5.867  31.675  1.00 63.90 ? 18  GLU A OE1   1 
ATOM   860  O OE2   . GLU B 2 17  ? 23.048  4.110  32.905  1.00 64.08 ? 18  GLU A OE2   1 
ATOM   861  N N     . GLU B 2 18  ? 20.496  9.372  35.716  1.00 61.42 ? 19  GLU A N     1 
ATOM   862  C CA    . GLU B 2 18  ? 20.554  10.295 36.852  1.00 60.49 ? 19  GLU A CA    1 
ATOM   863  C C     . GLU B 2 18  ? 19.239  11.028 37.091  1.00 58.98 ? 19  GLU A C     1 
ATOM   864  O O     . GLU B 2 18  ? 18.890  11.303 38.243  1.00 58.68 ? 19  GLU A O     1 
ATOM   865  C CB    . GLU B 2 18  ? 21.691  11.321 36.694  1.00 61.87 ? 19  GLU A CB    1 
ATOM   866  C CG    . GLU B 2 18  ? 22.008  11.740 35.268  1.00 65.96 ? 19  GLU A CG    1 
ATOM   867  C CD    . GLU B 2 18  ? 23.114  10.891 34.614  1.00 68.34 ? 19  GLU A CD    1 
ATOM   868  O OE1   . GLU B 2 18  ? 23.406  11.116 33.416  1.00 69.43 ? 19  GLU A OE1   1 
ATOM   869  O OE2   . GLU B 2 18  ? 23.700  10.007 35.291  1.00 69.64 ? 19  GLU A OE2   1 
ATOM   870  N N     . GLU B 2 19  ? 18.510  11.351 36.020  1.00 57.36 ? 20  GLU A N     1 
ATOM   871  C CA    . GLU B 2 19  ? 17.233  12.040 36.183  1.00 55.75 ? 20  GLU A CA    1 
ATOM   872  C C     . GLU B 2 19  ? 16.231  11.045 36.746  1.00 54.67 ? 20  GLU A C     1 
ATOM   873  O O     . GLU B 2 19  ? 15.288  11.418 37.447  1.00 54.06 ? 20  GLU A O     1 
ATOM   874  C CB    . GLU B 2 19  ? 16.726  12.612 34.852  1.00 56.14 ? 20  GLU A CB    1 
ATOM   875  C CG    . GLU B 2 19  ? 15.264  13.068 34.920  1.00 57.83 ? 20  GLU A CG    1 
ATOM   876  C CD    . GLU B 2 19  ? 14.880  14.096 33.861  1.00 58.68 ? 20  GLU A CD    1 
ATOM   877  O OE1   . GLU B 2 19  ? 15.226  13.903 32.669  1.00 60.11 ? 20  GLU A OE1   1 
ATOM   878  O OE2   . GLU B 2 19  ? 14.215  15.093 34.229  1.00 58.13 ? 20  GLU A OE2   1 
ATOM   879  N N     . VAL B 2 20  ? 16.449  9.770  36.443  1.00 54.01 ? 21  VAL A N     1 
ATOM   880  C CA    . VAL B 2 20  ? 15.579  8.716  36.947  1.00 52.72 ? 21  VAL A CA    1 
ATOM   881  C C     . VAL B 2 20  ? 15.902  8.497  38.421  1.00 51.98 ? 21  VAL A C     1 
ATOM   882  O O     . VAL B 2 20  ? 15.026  8.580  39.283  1.00 51.16 ? 21  VAL A O     1 
ATOM   883  C CB    . VAL B 2 20  ? 15.804  7.395  36.191  1.00 52.28 ? 21  VAL A CB    1 
ATOM   884  C CG1   . VAL B 2 20  ? 14.895  6.308  36.752  1.00 51.63 ? 21  VAL A CG1   1 
ATOM   885  C CG2   . VAL B 2 20  ? 15.538  7.603  34.715  1.00 52.43 ? 21  VAL A CG2   1 
ATOM   886  N N     . ARG B 2 21  ? 17.175  8.223  38.693  1.00 52.06 ? 22  ARG A N     1 
ATOM   887  C CA    . ARG B 2 21  ? 17.660  7.988  40.052  1.00 52.81 ? 22  ARG A CA    1 
ATOM   888  C C     . ARG B 2 21  ? 17.174  9.073  41.007  1.00 51.39 ? 22  ARG A C     1 
ATOM   889  O O     . ARG B 2 21  ? 16.689  8.788  42.106  1.00 50.97 ? 22  ARG A O     1 
ATOM   890  C CB    . ARG B 2 21  ? 19.190  7.943  40.048  1.00 55.17 ? 22  ARG A CB    1 
ATOM   891  C CG    . ARG B 2 21  ? 19.831  8.021  41.427  1.00 57.79 ? 22  ARG A CG    1 
ATOM   892  C CD    . ARG B 2 21  ? 21.354  7.939  41.321  1.00 60.50 ? 22  ARG A CD    1 
ATOM   893  N NE    . ARG B 2 21  ? 21.913  8.852  40.314  1.00 62.05 ? 22  ARG A NE    1 
ATOM   894  C CZ    . ARG B 2 21  ? 21.915  10.186 40.397  1.00 62.70 ? 22  ARG A CZ    1 
ATOM   895  N NH1   . ARG B 2 21  ? 21.387  10.805 41.447  1.00 62.40 ? 22  ARG A NH1   1 
ATOM   896  N NH2   . ARG B 2 21  ? 22.447  10.908 39.418  1.00 63.18 ? 22  ARG A NH2   1 
ATOM   897  N N     . LYS B 2 22  ? 17.323  10.316 40.571  1.00 50.14 ? 23  LYS A N     1 
ATOM   898  C CA    . LYS B 2 22  ? 16.899  11.474 41.339  1.00 49.17 ? 23  LYS A CA    1 
ATOM   899  C C     . LYS B 2 22  ? 15.436  11.307 41.683  1.00 48.60 ? 23  LYS A C     1 
ATOM   900  O O     . LYS B 2 22  ? 15.008  11.617 42.792  1.00 49.04 ? 23  LYS A O     1 
ATOM   901  C CB    . LYS B 2 22  ? 17.087  12.739 40.497  1.00 48.90 ? 23  LYS A CB    1 
ATOM   902  C CG    . LYS B 2 22  ? 16.777  14.043 41.205  1.00 49.39 ? 23  LYS A CG    1 
ATOM   903  C CD    . LYS B 2 22  ? 17.343  15.187 40.388  1.00 50.71 ? 23  LYS A CD    1 
ATOM   904  C CE    . LYS B 2 22  ? 17.277  16.526 41.109  1.00 51.09 ? 23  LYS A CE    1 
ATOM   905  N NZ    . LYS B 2 22  ? 17.940  17.593 40.282  1.00 50.59 ? 23  LYS A NZ    1 
ATOM   906  N N     . GLY B 2 23  ? 14.680  10.796 40.714  1.00 48.34 ? 24  GLY A N     1 
ATOM   907  C CA    . GLY B 2 23  ? 13.252  10.599 40.889  1.00 48.46 ? 24  GLY A CA    1 
ATOM   908  C C     . GLY B 2 23  ? 12.910  9.568  41.934  1.00 48.95 ? 24  GLY A C     1 
ATOM   909  O O     . GLY B 2 23  ? 12.139  9.848  42.853  1.00 48.46 ? 24  GLY A O     1 
ATOM   910  N N     . ARG B 2 24  ? 13.482  8.377  41.773  1.00 50.19 ? 25  ARG A N     1 
ATOM   911  C CA    . ARG B 2 24  ? 13.284  7.252  42.688  1.00 51.08 ? 25  ARG A CA    1 
ATOM   912  C C     . ARG B 2 24  ? 13.521  7.682  44.126  1.00 51.08 ? 25  ARG A C     1 
ATOM   913  O O     . ARG B 2 24  ? 12.636  7.575  44.977  1.00 51.11 ? 25  ARG A O     1 
ATOM   914  C CB    . ARG B 2 24  ? 14.267  6.129  42.354  1.00 53.04 ? 25  ARG A CB    1 
ATOM   915  C CG    . ARG B 2 24  ? 14.094  5.522  40.969  1.00 56.86 ? 25  ARG A CG    1 
ATOM   916  C CD    . ARG B 2 24  ? 12.890  4.588  40.928  1.00 59.43 ? 25  ARG A CD    1 
ATOM   917  N NE    . ARG B 2 24  ? 12.538  4.197  39.567  1.00 61.50 ? 25  ARG A NE    1 
ATOM   918  C CZ    . ARG B 2 24  ? 12.128  5.046  38.629  1.00 62.76 ? 25  ARG A CZ    1 
ATOM   919  N NH1   . ARG B 2 24  ? 12.020  6.344  38.902  1.00 63.16 ? 25  ARG A NH1   1 
ATOM   920  N NH2   . ARG B 2 24  ? 11.804  4.595  37.421  1.00 63.51 ? 25  ARG A NH2   1 
ATOM   921  N N     . GLU B 2 25  ? 14.730  8.169  44.386  1.00 50.75 ? 26  GLU A N     1 
ATOM   922  C CA    . GLU B 2 25  ? 15.113  8.608  45.722  1.00 50.57 ? 26  GLU A CA    1 
ATOM   923  C C     . GLU B 2 25  ? 14.244  9.721  46.293  1.00 49.87 ? 26  GLU A C     1 
ATOM   924  O O     . GLU B 2 25  ? 14.174  9.898  47.515  1.00 50.01 ? 26  GLU A O     1 
ATOM   925  C CB    . GLU B 2 25  ? 16.578  9.031  45.719  1.00 51.14 ? 26  GLU A CB    1 
ATOM   926  C CG    . GLU B 2 25  ? 17.536  7.860  45.679  1.00 51.91 ? 26  GLU A CG    1 
ATOM   927  C CD    . GLU B 2 25  ? 18.944  8.298  45.377  1.00 53.41 ? 26  GLU A CD    1 
ATOM   928  O OE1   . GLU B 2 25  ? 19.419  9.241  46.054  1.00 54.16 ? 26  GLU A OE1   1 
ATOM   929  O OE2   . GLU B 2 25  ? 19.570  7.704  44.466  1.00 53.84 ? 26  GLU A OE2   1 
ATOM   930  N N     . ALA B 2 26  ? 13.589  10.474 45.418  1.00 49.35 ? 27  ALA A N     1 
ATOM   931  C CA    . ALA B 2 26  ? 12.712  11.546 45.867  1.00 49.17 ? 27  ALA A CA    1 
ATOM   932  C C     . ALA B 2 26  ? 11.389  10.898 46.236  1.00 49.11 ? 27  ALA A C     1 
ATOM   933  O O     . ALA B 2 26  ? 10.727  11.297 47.193  1.00 47.14 ? 27  ALA A O     1 
ATOM   934  C CB    . ALA B 2 26  ? 12.514  12.556 44.759  1.00 49.44 ? 27  ALA A CB    1 
ATOM   935  N N     . GLU B 2 27  ? 11.008  9.892  45.454  1.00 50.81 ? 28  GLU A N     1 
ATOM   936  C CA    . GLU B 2 27  ? 9.772   9.161  45.700  1.00 52.67 ? 28  GLU A CA    1 
ATOM   937  C C     . GLU B 2 27  ? 9.981   8.286  46.925  1.00 53.31 ? 28  GLU A C     1 
ATOM   938  O O     . GLU B 2 27  ? 9.050   8.032  47.695  1.00 52.30 ? 28  GLU A O     1 
ATOM   939  C CB    . GLU B 2 27  ? 9.417   8.263  44.517  1.00 53.36 ? 28  GLU A CB    1 
ATOM   940  C CG    . GLU B 2 27  ? 8.421   7.169  44.901  1.00 55.88 ? 28  GLU A CG    1 
ATOM   941  C CD    . GLU B 2 27  ? 8.342   6.053  43.877  1.00 56.63 ? 28  GLU A CD    1 
ATOM   942  O OE1   . GLU B 2 27  ? 9.413   5.521  43.503  1.00 56.84 ? 28  GLU A OE1   1 
ATOM   943  O OE2   . GLU B 2 27  ? 7.211   5.707  43.457  1.00 56.97 ? 28  GLU A OE2   1 
ATOM   944  N N     . GLU B 2 28  ? 11.212  7.809  47.078  1.00 54.73 ? 29  GLU A N     1 
ATOM   945  C CA    . GLU B 2 28  ? 11.576  6.968  48.209  1.00 56.46 ? 29  GLU A CA    1 
ATOM   946  C C     . GLU B 2 28  ? 11.283  7.763  49.486  1.00 56.22 ? 29  GLU A C     1 
ATOM   947  O O     . GLU B 2 28  ? 10.468  7.351  50.321  1.00 56.01 ? 29  GLU A O     1 
ATOM   948  C CB    . GLU B 2 28  ? 13.068  6.613  48.135  1.00 58.80 ? 29  GLU A CB    1 
ATOM   949  C CG    . GLU B 2 28  ? 13.608  5.800  49.330  1.00 62.53 ? 29  GLU A CG    1 
ATOM   950  C CD    . GLU B 2 28  ? 13.310  4.288  49.255  1.00 64.72 ? 29  GLU A CD    1 
ATOM   951  O OE1   . GLU B 2 28  ? 13.742  3.557  50.190  1.00 65.04 ? 29  GLU A OE1   1 
ATOM   952  O OE2   . GLU B 2 28  ? 12.656  3.840  48.268  1.00 66.11 ? 29  GLU A OE2   1 
ATOM   953  N N     . GLU B 2 29  ? 11.946  8.911  49.617  1.00 55.43 ? 30  GLU A N     1 
ATOM   954  C CA    . GLU B 2 29  ? 11.762  9.767  50.776  1.00 54.33 ? 30  GLU A CA    1 
ATOM   955  C C     . GLU B 2 29  ? 10.300  10.166 50.900  1.00 53.91 ? 30  GLU A C     1 
ATOM   956  O O     . GLU B 2 29  ? 9.675   9.967  51.944  1.00 53.67 ? 30  GLU A O     1 
ATOM   957  C CB    . GLU B 2 29  ? 12.623  11.025 50.658  1.00 53.89 ? 30  GLU A CB    1 
ATOM   958  C CG    . GLU B 2 29  ? 12.469  11.964 51.848  1.00 53.21 ? 30  GLU A CG    1 
ATOM   959  C CD    . GLU B 2 29  ? 12.979  11.357 53.151  1.00 52.54 ? 30  GLU A CD    1 
ATOM   960  O OE1   . GLU B 2 29  ? 12.647  11.910 54.221  1.00 51.98 ? 30  GLU A OE1   1 
ATOM   961  O OE2   . GLU B 2 29  ? 13.713  10.341 53.104  1.00 51.22 ? 30  GLU A OE2   1 
ATOM   962  N N     . LEU B 2 30  ? 9.758   10.727 49.824  1.00 53.51 ? 31  LEU A N     1 
ATOM   963  C CA    . LEU B 2 30  ? 8.370   11.164 49.817  1.00 52.58 ? 31  LEU A CA    1 
ATOM   964  C C     . LEU B 2 30  ? 7.462   10.083 50.406  1.00 52.56 ? 31  LEU A C     1 
ATOM   965  O O     . LEU B 2 30  ? 6.460   10.382 51.067  1.00 52.42 ? 31  LEU A O     1 
ATOM   966  C CB    . LEU B 2 30  ? 7.946   11.513 48.386  1.00 51.80 ? 31  LEU A CB    1 
ATOM   967  C CG    . LEU B 2 30  ? 6.512   12.023 48.210  1.00 51.36 ? 31  LEU A CG    1 
ATOM   968  C CD1   . LEU B 2 30  ? 6.173   13.014 49.316  1.00 50.69 ? 31  LEU A CD1   1 
ATOM   969  C CD2   . LEU B 2 30  ? 6.361   12.666 46.831  1.00 51.20 ? 31  LEU A CD2   1 
ATOM   970  N N     . ARG B 2 31  ? 7.835   8.827  50.169  1.00 52.34 ? 32  ARG A N     1 
ATOM   971  C CA    . ARG B 2 31  ? 7.085   7.674  50.669  1.00 51.98 ? 32  ARG A CA    1 
ATOM   972  C C     . ARG B 2 31  ? 7.229   7.536  52.177  1.00 50.58 ? 32  ARG A C     1 
ATOM   973  O O     . ARG B 2 31  ? 6.235   7.411  52.891  1.00 50.30 ? 32  ARG A O     1 
ATOM   974  C CB    . ARG B 2 31  ? 7.573   6.388  49.994  1.00 53.54 ? 32  ARG A CB    1 
ATOM   975  C CG    . ARG B 2 31  ? 6.945   6.112  48.629  1.00 54.59 ? 32  ARG A CG    1 
ATOM   976  C CD    . ARG B 2 31  ? 5.587   5.416  48.765  1.00 55.09 ? 32  ARG A CD    1 
ATOM   977  N NE    . ARG B 2 31  ? 4.924   5.211  47.476  1.00 54.41 ? 32  ARG A NE    1 
ATOM   978  C CZ    . ARG B 2 31  ? 5.487   4.621  46.425  1.00 54.43 ? 32  ARG A CZ    1 
ATOM   979  N NH1   . ARG B 2 31  ? 6.734   4.170  46.494  1.00 54.34 ? 32  ARG A NH1   1 
ATOM   980  N NH2   . ARG B 2 31  ? 4.798   4.474  45.302  1.00 55.01 ? 32  ARG A NH2   1 
ATOM   981  N N     . ARG B 2 32  ? 8.467   7.557  52.658  1.00 48.91 ? 33  ARG A N     1 
ATOM   982  C CA    . ARG B 2 32  ? 8.718   7.439  54.087  1.00 47.45 ? 33  ARG A CA    1 
ATOM   983  C C     . ARG B 2 32  ? 7.937   8.495  54.841  1.00 46.90 ? 33  ARG A C     1 
ATOM   984  O O     . ARG B 2 32  ? 7.093   8.171  55.680  1.00 47.66 ? 33  ARG A O     1 
ATOM   985  C CB    . ARG B 2 32  ? 10.199  7.623  54.391  1.00 46.26 ? 33  ARG A CB    1 
ATOM   986  C CG    . ARG B 2 32  ? 11.105  6.570  53.800  1.00 45.26 ? 33  ARG A CG    1 
ATOM   987  C CD    . ARG B 2 32  ? 12.536  6.923  54.113  1.00 45.09 ? 33  ARG A CD    1 
ATOM   988  N NE    . ARG B 2 32  ? 13.487  5.979  53.548  1.00 43.98 ? 33  ARG A NE    1 
ATOM   989  C CZ    . ARG B 2 32  ? 14.415  6.303  52.657  1.00 43.96 ? 33  ARG A CZ    1 
ATOM   990  N NH1   . ARG B 2 32  ? 14.523  7.557  52.215  1.00 43.59 ? 33  ARG A NH1   1 
ATOM   991  N NH2   . ARG B 2 32  ? 15.246  5.369  52.218  1.00 44.36 ? 33  ARG A NH2   1 
ATOM   992  N N     . ARG B 2 33  ? 8.225   9.757  54.534  1.00 45.60 ? 34  ARG A N     1 
ATOM   993  C CA    . ARG B 2 33  ? 7.564   10.879 55.186  1.00 44.53 ? 34  ARG A CA    1 
ATOM   994  C C     . ARG B 2 33  ? 6.064   10.623 55.304  1.00 45.27 ? 34  ARG A C     1 
ATOM   995  O O     . ARG B 2 33  ? 5.497   10.634 56.406  1.00 44.66 ? 34  ARG A O     1 
ATOM   996  C CB    . ARG B 2 33  ? 7.822   12.166 54.398  1.00 42.94 ? 34  ARG A CB    1 
ATOM   997  C CG    . ARG B 2 33  ? 9.304   12.463 54.184  1.00 41.13 ? 34  ARG A CG    1 
ATOM   998  C CD    . ARG B 2 33  ? 9.536   13.865 53.649  1.00 39.92 ? 34  ARG A CD    1 
ATOM   999  N NE    . ARG B 2 33  ? 10.958  14.158 53.488  1.00 39.08 ? 34  ARG A NE    1 
ATOM   1000 C CZ    . ARG B 2 33  ? 11.447  15.320 53.057  1.00 38.36 ? 34  ARG A CZ    1 
ATOM   1001 N NH1   . ARG B 2 33  ? 10.632  16.319 52.737  1.00 36.68 ? 34  ARG A NH1   1 
ATOM   1002 N NH2   . ARG B 2 33  ? 12.758  15.481 52.950  1.00 37.07 ? 34  ARG A NH2   1 
ATOM   1003 N N     . LEU B 2 34  ? 5.435   10.360 54.165  1.00 45.76 ? 35  LEU A N     1 
ATOM   1004 C CA    . LEU B 2 34  ? 4.003   10.106 54.120  1.00 46.46 ? 35  LEU A CA    1 
ATOM   1005 C C     . LEU B 2 34  ? 3.505   8.956  55.010  1.00 46.85 ? 35  LEU A C     1 
ATOM   1006 O O     . LEU B 2 34  ? 2.359   8.973  55.489  1.00 45.51 ? 35  LEU A O     1 
ATOM   1007 C CB    . LEU B 2 34  ? 3.586   9.863  52.674  1.00 45.82 ? 35  LEU A CB    1 
ATOM   1008 C CG    . LEU B 2 34  ? 2.848   11.028 52.024  1.00 45.34 ? 35  LEU A CG    1 
ATOM   1009 C CD1   . LEU B 2 34  ? 2.513   10.655 50.594  1.00 46.45 ? 35  LEU A CD1   1 
ATOM   1010 C CD2   . LEU B 2 34  ? 1.581   11.348 52.804  1.00 44.94 ? 35  LEU A CD2   1 
ATOM   1011 N N     . ASP B 2 35  ? 4.356   7.957  55.220  1.00 48.00 ? 36  ASP A N     1 
ATOM   1012 C CA    . ASP B 2 35  ? 3.992   6.816  56.054  1.00 49.46 ? 36  ASP A CA    1 
ATOM   1013 C C     . ASP B 2 35  ? 4.228   7.114  57.531  1.00 50.09 ? 36  ASP A C     1 
ATOM   1014 O O     . ASP B 2 35  ? 3.469   6.667  58.392  1.00 49.74 ? 36  ASP A O     1 
ATOM   1015 C CB    . ASP B 2 35  ? 4.781   5.575  55.631  1.00 50.46 ? 36  ASP A CB    1 
ATOM   1016 C CG    . ASP B 2 35  ? 4.368   5.071  54.257  1.00 51.94 ? 36  ASP A CG    1 
ATOM   1017 O OD1   . ASP B 2 35  ? 3.147   5.055  53.977  1.00 51.21 ? 36  ASP A OD1   1 
ATOM   1018 O OD2   . ASP B 2 35  ? 5.253   4.685  53.460  1.00 52.67 ? 36  ASP A OD2   1 
ATOM   1019 N N     . GLU B 2 36  ? 5.279   7.881  57.816  1.00 50.85 ? 37  GLU A N     1 
ATOM   1020 C CA    . GLU B 2 36  ? 5.603   8.260  59.182  1.00 50.71 ? 37  GLU A CA    1 
ATOM   1021 C C     . GLU B 2 36  ? 4.515   9.225  59.649  1.00 49.78 ? 37  GLU A C     1 
ATOM   1022 O O     . GLU B 2 36  ? 4.719   10.017 60.564  1.00 50.43 ? 37  GLU A O     1 
ATOM   1023 C CB    . GLU B 2 36  ? 6.982   8.925  59.228  1.00 52.53 ? 37  GLU A CB    1 
ATOM   1024 C CG    . GLU B 2 36  ? 7.452   9.383  60.616  1.00 56.93 ? 37  GLU A CG    1 
ATOM   1025 C CD    . GLU B 2 36  ? 7.571   8.242  61.634  1.00 59.46 ? 37  GLU A CD    1 
ATOM   1026 O OE1   . GLU B 2 36  ? 8.234   7.221  61.316  1.00 60.40 ? 37  GLU A OE1   1 
ATOM   1027 O OE2   . GLU B 2 36  ? 7.010   8.375  62.756  1.00 59.47 ? 37  GLU A OE2   1 
ATOM   1028 N N     . LEU B 2 37  ? 3.359   9.141  58.997  1.00 48.32 ? 38  LEU A N     1 
ATOM   1029 C CA    . LEU B 2 37  ? 2.196   9.959  59.310  1.00 47.46 ? 38  LEU A CA    1 
ATOM   1030 C C     . LEU B 2 37  ? 0.961   9.117  59.043  1.00 47.67 ? 38  LEU A C     1 
ATOM   1031 O O     . LEU B 2 37  ? -0.170  9.535  59.316  1.00 46.96 ? 38  LEU A O     1 
ATOM   1032 C CB    . LEU B 2 37  ? 2.155   11.208 58.430  1.00 47.32 ? 38  LEU A CB    1 
ATOM   1033 C CG    . LEU B 2 37  ? 2.971   12.416 58.892  1.00 47.64 ? 38  LEU A CG    1 
ATOM   1034 C CD1   . LEU B 2 37  ? 2.883   13.523 57.839  1.00 48.02 ? 38  LEU A CD1   1 
ATOM   1035 C CD2   . LEU B 2 37  ? 2.440   12.906 60.242  1.00 47.01 ? 38  LEU A CD2   1 
ATOM   1036 N N     . GLY B 2 38  ? 1.196   7.933  58.484  1.00 48.15 ? 39  GLY A N     1 
ATOM   1037 C CA    . GLY B 2 38  ? 0.116   7.015  58.176  1.00 49.01 ? 39  GLY A CA    1 
ATOM   1038 C C     . GLY B 2 38  ? -0.989  7.610  57.322  1.00 50.01 ? 39  GLY A C     1 
ATOM   1039 O O     . GLY B 2 38  ? -2.173  7.387  57.583  1.00 51.22 ? 39  GLY A O     1 
ATOM   1040 N N     . VAL B 2 39  ? -0.621  8.370  56.297  1.00 50.55 ? 40  VAL A N     1 
ATOM   1041 C CA    . VAL B 2 39  ? -1.631  8.966  55.429  1.00 50.14 ? 40  VAL A CA    1 
ATOM   1042 C C     . VAL B 2 39  ? -1.950  8.002  54.285  1.00 50.38 ? 40  VAL A C     1 
ATOM   1043 O O     . VAL B 2 39  ? -1.073  7.270  53.805  1.00 49.95 ? 40  VAL A O     1 
ATOM   1044 C CB    . VAL B 2 39  ? -1.135  10.290 54.833  1.00 49.70 ? 40  VAL A CB    1 
ATOM   1045 C CG1   . VAL B 2 39  ? -2.318  11.142 54.398  1.00 48.83 ? 40  VAL A CG1   1 
ATOM   1046 C CG2   . VAL B 2 39  ? -0.269  11.011 55.846  1.00 49.86 ? 40  VAL A CG2   1 
ATOM   1047 N N     . GLU B 2 40  ? -3.207  7.991  53.855  1.00 50.19 ? 41  GLU A N     1 
ATOM   1048 C CA    . GLU B 2 40  ? -3.608  7.125  52.754  1.00 50.20 ? 41  GLU A CA    1 
ATOM   1049 C C     . GLU B 2 40  ? -3.399  7.871  51.426  1.00 49.46 ? 41  GLU A C     1 
ATOM   1050 O O     . GLU B 2 40  ? -4.130  8.816  51.097  1.00 49.37 ? 41  GLU A O     1 
ATOM   1051 C CB    . GLU B 2 40  ? -5.072  6.703  52.920  1.00 51.56 ? 41  GLU A CB    1 
ATOM   1052 C CG    . GLU B 2 40  ? -5.529  5.739  51.843  1.00 54.59 ? 41  GLU A CG    1 
ATOM   1053 C CD    . GLU B 2 40  ? -6.944  5.227  52.050  1.00 56.13 ? 41  GLU A CD    1 
ATOM   1054 O OE1   . GLU B 2 40  ? -7.868  6.058  52.224  1.00 57.00 ? 41  GLU A OE1   1 
ATOM   1055 O OE2   . GLU B 2 40  ? -7.129  3.986  52.027  1.00 57.77 ? 41  GLU A OE2   1 
ATOM   1056 N N     . TYR B 2 41  ? -2.405  7.434  50.659  1.00 48.05 ? 42  TYR A N     1 
ATOM   1057 C CA    . TYR B 2 41  ? -2.092  8.091  49.397  1.00 46.90 ? 42  TYR A CA    1 
ATOM   1058 C C     . TYR B 2 41  ? -1.896  7.161  48.199  1.00 46.44 ? 42  TYR A C     1 
ATOM   1059 O O     . TYR B 2 41  ? -1.954  5.939  48.328  1.00 46.94 ? 42  TYR A O     1 
ATOM   1060 C CB    . TYR B 2 41  ? -0.840  8.932  49.583  1.00 45.68 ? 42  TYR A CB    1 
ATOM   1061 C CG    . TYR B 2 41  ? 0.369   8.106  49.949  1.00 44.59 ? 42  TYR A CG    1 
ATOM   1062 C CD1   . TYR B 2 41  ? 1.116   7.461  48.972  1.00 43.49 ? 42  TYR A CD1   1 
ATOM   1063 C CD2   . TYR B 2 41  ? 0.771   7.986  51.272  1.00 44.25 ? 42  TYR A CD2   1 
ATOM   1064 C CE1   . TYR B 2 41  ? 2.238   6.725  49.303  1.00 43.01 ? 42  TYR A CE1   1 
ATOM   1065 C CE2   . TYR B 2 41  ? 1.888   7.252  51.612  1.00 43.94 ? 42  TYR A CE2   1 
ATOM   1066 C CZ    . TYR B 2 41  ? 2.619   6.627  50.623  1.00 43.71 ? 42  TYR A CZ    1 
ATOM   1067 O OH    . TYR B 2 41  ? 3.749   5.920  50.962  1.00 45.40 ? 42  TYR A OH    1 
ATOM   1068 N N     . VAL B 2 42  ? -1.652  7.766  47.036  1.00 45.85 ? 43  VAL A N     1 
ATOM   1069 C CA    . VAL B 2 42  ? -1.440  7.038  45.785  1.00 44.74 ? 43  VAL A CA    1 
ATOM   1070 C C     . VAL B 2 42  ? -0.815  7.929  44.701  1.00 44.40 ? 43  VAL A C     1 
ATOM   1071 O O     . VAL B 2 42  ? -1.381  8.964  44.319  1.00 44.21 ? 43  VAL A O     1 
ATOM   1072 C CB    . VAL B 2 42  ? -2.767  6.465  45.221  1.00 43.96 ? 43  VAL A CB    1 
ATOM   1073 C CG1   . VAL B 2 42  ? -3.702  7.595  44.797  1.00 42.12 ? 43  VAL A CG1   1 
ATOM   1074 C CG2   . VAL B 2 42  ? -2.468  5.555  44.047  1.00 43.52 ? 43  VAL A CG2   1 
ATOM   1075 N N     . PHE B 2 43  ? 0.352   7.517  44.210  1.00 43.37 ? 44  PHE A N     1 
ATOM   1076 C CA    . PHE B 2 43  ? 1.051   8.257  43.165  1.00 42.36 ? 44  PHE A CA    1 
ATOM   1077 C C     . PHE B 2 43  ? 0.368   8.008  41.826  1.00 42.12 ? 44  PHE A C     1 
ATOM   1078 O O     . PHE B 2 43  ? 0.094   6.865  41.454  1.00 41.89 ? 44  PHE A O     1 
ATOM   1079 C CB    . PHE B 2 43  ? 2.506   7.806  43.063  1.00 41.61 ? 44  PHE A CB    1 
ATOM   1080 C CG    . PHE B 2 43  ? 3.335   8.122  44.271  1.00 41.49 ? 44  PHE A CG    1 
ATOM   1081 C CD1   . PHE B 2 43  ? 2.836   7.930  45.549  1.00 41.72 ? 44  PHE A CD1   1 
ATOM   1082 C CD2   . PHE B 2 43  ? 4.645   8.565  44.125  1.00 41.51 ? 44  PHE A CD2   1 
ATOM   1083 C CE1   . PHE B 2 43  ? 3.630   8.172  46.661  1.00 41.64 ? 44  PHE A CE1   1 
ATOM   1084 C CE2   . PHE B 2 43  ? 5.448   8.810  45.232  1.00 40.34 ? 44  PHE A CE2   1 
ATOM   1085 C CZ    . PHE B 2 43  ? 4.940   8.613  46.500  1.00 41.50 ? 44  PHE A CZ    1 
ATOM   1086 N N     . VAL B 2 44  ? 0.100   9.082  41.100  1.00 41.42 ? 45  VAL A N     1 
ATOM   1087 C CA    . VAL B 2 44  ? -0.549  8.978  39.806  1.00 40.81 ? 45  VAL A CA    1 
ATOM   1088 C C     . VAL B 2 44  ? 0.249   9.773  38.766  1.00 41.25 ? 45  VAL A C     1 
ATOM   1089 O O     . VAL B 2 44  ? 1.336   10.283 39.057  1.00 41.60 ? 45  VAL A O     1 
ATOM   1090 C CB    . VAL B 2 44  ? -2.005  9.514  39.886  1.00 40.04 ? 45  VAL A CB    1 
ATOM   1091 C CG1   . VAL B 2 44  ? -2.797  8.714  40.888  1.00 39.87 ? 45  VAL A CG1   1 
ATOM   1092 C CG2   . VAL B 2 44  ? -2.006  10.969 40.302  1.00 40.12 ? 45  VAL A CG2   1 
ATOM   1093 N N     . GLY B 2 45  ? -0.279  9.864  37.551  1.00 41.52 ? 46  GLY A N     1 
ATOM   1094 C CA    . GLY B 2 45  ? 0.406   10.629 36.527  1.00 40.99 ? 46  GLY A CA    1 
ATOM   1095 C C     . GLY B 2 45  ? 1.666   9.997  35.982  1.00 39.77 ? 46  GLY A C     1 
ATOM   1096 O O     . GLY B 2 45  ? 2.192   9.037  36.543  1.00 39.97 ? 46  GLY A O     1 
ATOM   1097 N N     . SER B 2 46  ? 2.152   10.578 34.892  1.00 38.66 ? 47  SER A N     1 
ATOM   1098 C CA    . SER B 2 46  ? 3.331   10.107 34.180  1.00 38.64 ? 47  SER A CA    1 
ATOM   1099 C C     . SER B 2 46  ? 4.544   9.679  35.004  1.00 39.12 ? 47  SER A C     1 
ATOM   1100 O O     . SER B 2 46  ? 5.429   8.992  34.479  1.00 39.11 ? 47  SER A O     1 
ATOM   1101 C CB    . SER B 2 46  ? 3.771   11.153 33.148  1.00 38.57 ? 47  SER A CB    1 
ATOM   1102 O OG    . SER B 2 46  ? 4.193   12.357 33.768  1.00 40.09 ? 47  SER A OG    1 
ATOM   1103 N N     . TYR B 2 47  ? 4.634   10.079 36.268  1.00 38.79 ? 48  TYR A N     1 
ATOM   1104 C CA    . TYR B 2 47  ? 5.789   9.621  37.015  1.00 38.24 ? 48  TYR A CA    1 
ATOM   1105 C C     . TYR B 2 47  ? 5.528   8.190  37.454  1.00 38.07 ? 48  TYR A C     1 
ATOM   1106 O O     . TYR B 2 47  ? 6.378   7.314  37.297  1.00 38.93 ? 48  TYR A O     1 
ATOM   1107 C CB    . TYR B 2 47  ? 6.067   10.459 38.256  1.00 38.65 ? 48  TYR A CB    1 
ATOM   1108 C CG    . TYR B 2 47  ? 7.235   9.874  39.019  1.00 39.49 ? 48  TYR A CG    1 
ATOM   1109 C CD1   . TYR B 2 47  ? 8.539   10.036 38.556  1.00 39.83 ? 48  TYR A CD1   1 
ATOM   1110 C CD2   . TYR B 2 47  ? 7.028   9.050  40.130  1.00 39.86 ? 48  TYR A CD2   1 
ATOM   1111 C CE1   . TYR B 2 47  ? 9.606   9.388  39.170  1.00 41.61 ? 48  TYR A CE1   1 
ATOM   1112 C CE2   . TYR B 2 47  ? 8.087   8.393  40.752  1.00 40.23 ? 48  TYR A CE2   1 
ATOM   1113 C CZ    . TYR B 2 47  ? 9.375   8.564  40.266  1.00 42.22 ? 48  TYR A CZ    1 
ATOM   1114 O OH    . TYR B 2 47  ? 10.434  7.901  40.858  1.00 44.57 ? 48  TYR A OH    1 
ATOM   1115 N N     . ALA B 2 48  ? 4.340   7.958  38.000  1.00 36.44 ? 49  ALA A N     1 
ATOM   1116 C CA    . ALA B 2 48  ? 3.969   6.639  38.482  1.00 35.06 ? 49  ALA A CA    1 
ATOM   1117 C C     . ALA B 2 48  ? 3.872   5.585  37.382  1.00 35.35 ? 49  ALA A C     1 
ATOM   1118 O O     . ALA B 2 48  ? 3.714   4.397  37.675  1.00 37.05 ? 49  ALA A O     1 
ATOM   1119 C CB    . ALA B 2 48  ? 2.654   6.724  39.235  1.00 34.76 ? 49  ALA A CB    1 
ATOM   1120 N N     . ARG B 2 49  ? 3.959   6.007  36.122  1.00 34.11 ? 50  ARG A N     1 
ATOM   1121 C CA    . ARG B 2 49  ? 3.871   5.068  35.006  1.00 33.17 ? 50  ARG A CA    1 
ATOM   1122 C C     . ARG B 2 49  ? 5.071   5.155  34.072  1.00 34.10 ? 50  ARG A C     1 
ATOM   1123 O O     . ARG B 2 49  ? 5.055   4.607  32.973  1.00 33.77 ? 50  ARG A O     1 
ATOM   1124 C CB    . ARG B 2 49  ? 2.587   5.304  34.212  1.00 31.81 ? 50  ARG A CB    1 
ATOM   1125 C CG    . ARG B 2 49  ? 1.317   5.131  35.018  1.00 30.64 ? 50  ARG A CG    1 
ATOM   1126 C CD    . ARG B 2 49  ? 0.101   5.040  34.113  1.00 30.55 ? 50  ARG A CD    1 
ATOM   1127 N NE    . ARG B 2 49  ? -0.835  6.140  34.312  1.00 30.70 ? 50  ARG A NE    1 
ATOM   1128 C CZ    . ARG B 2 49  ? -0.696  7.353  33.792  1.00 30.33 ? 50  ARG A CZ    1 
ATOM   1129 N NH1   . ARG B 2 49  ? 0.347   7.638  33.031  1.00 29.60 ? 50  ARG A NH1   1 
ATOM   1130 N NH2   . ARG B 2 49  ? -1.604  8.282  34.035  1.00 32.02 ? 50  ARG A NH2   1 
ATOM   1131 N N     . ASN B 2 50  ? 6.110   5.844  34.521  1.00 35.52 ? 51  ASN A N     1 
ATOM   1132 C CA    . ASN B 2 50  ? 7.323   6.005  33.738  1.00 36.99 ? 51  ASN A CA    1 
ATOM   1133 C C     . ASN B 2 50  ? 7.042   6.472  32.325  1.00 36.66 ? 51  ASN A C     1 
ATOM   1134 O O     . ASN B 2 50  ? 7.733   6.090  31.386  1.00 37.32 ? 51  ASN A O     1 
ATOM   1135 C CB    . ASN B 2 50  ? 8.090   4.695  33.710  1.00 39.08 ? 51  ASN A CB    1 
ATOM   1136 C CG    . ASN B 2 50  ? 8.414   4.201  35.094  1.00 42.94 ? 51  ASN A CG    1 
ATOM   1137 O OD1   . ASN B 2 50  ? 9.048   4.915  35.887  1.00 44.96 ? 51  ASN A OD1   1 
ATOM   1138 N ND2   . ASN B 2 50  ? 7.979   2.976  35.408  1.00 43.32 ? 51  ASN A ND2   1 
ATOM   1139 N N     . THR B 2 51  ? 6.027   7.312  32.187  1.00 35.53 ? 52  THR A N     1 
ATOM   1140 C CA    . THR B 2 51  ? 5.642   7.854  30.902  1.00 35.42 ? 52  THR A CA    1 
ATOM   1141 C C     . THR B 2 51  ? 6.024   9.325  30.834  1.00 36.78 ? 52  THR A C     1 
ATOM   1142 O O     . THR B 2 51  ? 5.655   10.034 29.898  1.00 37.61 ? 52  THR A O     1 
ATOM   1143 C CB    . THR B 2 51  ? 4.141   7.732  30.711  1.00 34.67 ? 52  THR A CB    1 
ATOM   1144 O OG1   . THR B 2 51  ? 3.474   8.253  31.865  1.00 35.63 ? 52  THR A OG1   1 
ATOM   1145 C CG2   . THR B 2 51  ? 3.753   6.284  30.534  1.00 35.32 ? 52  THR A CG2   1 
ATOM   1146 N N     . TRP B 2 52  ? 6.777   9.780  31.831  1.00 37.91 ? 53  TRP A N     1 
ATOM   1147 C CA    . TRP B 2 52  ? 7.183   11.175 31.892  1.00 37.27 ? 53  TRP A CA    1 
ATOM   1148 C C     . TRP B 2 52  ? 8.306   11.502 30.916  1.00 36.35 ? 53  TRP A C     1 
ATOM   1149 O O     . TRP B 2 52  ? 9.266   10.751 30.756  1.00 35.35 ? 53  TRP A O     1 
ATOM   1150 C CB    . TRP B 2 52  ? 7.553   11.554 33.342  1.00 38.69 ? 53  TRP A CB    1 
ATOM   1151 C CG    . TRP B 2 52  ? 9.002   11.408 33.741  1.00 40.19 ? 53  TRP A CG    1 
ATOM   1152 C CD1   . TRP B 2 52  ? 10.001  12.331 33.576  1.00 40.66 ? 53  TRP A CD1   1 
ATOM   1153 C CD2   . TRP B 2 52  ? 9.600   10.288 34.397  1.00 40.60 ? 53  TRP A CD2   1 
ATOM   1154 N NE1   . TRP B 2 52  ? 11.181  11.853 34.093  1.00 40.58 ? 53  TRP A NE1   1 
ATOM   1155 C CE2   . TRP B 2 52  ? 10.964  10.601 34.602  1.00 40.70 ? 53  TRP A CE2   1 
ATOM   1156 C CE3   . TRP B 2 52  ? 9.116   9.050  34.834  1.00 41.56 ? 53  TRP A CE3   1 
ATOM   1157 C CZ2   . TRP B 2 52  ? 11.853  9.721  35.226  1.00 41.38 ? 53  TRP A CZ2   1 
ATOM   1158 C CZ3   . TRP B 2 52  ? 10.003  8.168  35.459  1.00 42.84 ? 53  TRP A CZ3   1 
ATOM   1159 C CH2   . TRP B 2 52  ? 11.358  8.512  35.648  1.00 42.16 ? 53  TRP A CH2   1 
ATOM   1160 N N     . LEU B 2 53  ? 8.164   12.638 30.253  1.00 36.06 ? 54  LEU A N     1 
ATOM   1161 C CA    . LEU B 2 53  ? 9.140   13.068 29.278  1.00 37.12 ? 54  LEU A CA    1 
ATOM   1162 C C     . LEU B 2 53  ? 10.420  13.560 29.931  1.00 38.32 ? 54  LEU A C     1 
ATOM   1163 O O     . LEU B 2 53  ? 10.402  14.144 31.017  1.00 38.81 ? 54  LEU A O     1 
ATOM   1164 C CB    . LEU B 2 53  ? 8.539   14.170 28.416  1.00 36.09 ? 54  LEU A CB    1 
ATOM   1165 C CG    . LEU B 2 53  ? 9.247   14.462 27.103  1.00 34.85 ? 54  LEU A CG    1 
ATOM   1166 C CD1   . LEU B 2 53  ? 9.438   13.170 26.325  1.00 34.31 ? 54  LEU A CD1   1 
ATOM   1167 C CD2   . LEU B 2 53  ? 8.417   15.463 26.314  1.00 33.90 ? 54  LEU A CD2   1 
ATOM   1168 N N     . LYS B 2 54  ? 11.539  13.322 29.261  1.00 39.57 ? 55  LYS A N     1 
ATOM   1169 C CA    . LYS B 2 54  ? 12.838  13.744 29.771  1.00 40.25 ? 55  LYS A CA    1 
ATOM   1170 C C     . LYS B 2 54  ? 12.815  15.232 30.108  1.00 40.52 ? 55  LYS A C     1 
ATOM   1171 O O     . LYS B 2 54  ? 12.302  16.056 29.343  1.00 41.19 ? 55  LYS A O     1 
ATOM   1172 C CB    . LYS B 2 54  ? 13.910  13.460 28.723  1.00 40.81 ? 55  LYS A CB    1 
ATOM   1173 C CG    . LYS B 2 54  ? 15.317  13.792 29.140  1.00 42.31 ? 55  LYS A CG    1 
ATOM   1174 C CD    . LYS B 2 54  ? 16.289  13.245 28.107  1.00 44.02 ? 55  LYS A CD    1 
ATOM   1175 C CE    . LYS B 2 54  ? 17.720  13.534 28.493  1.00 44.89 ? 55  LYS A CE    1 
ATOM   1176 N NZ    . LYS B 2 54  ? 17.936  15.003 28.634  1.00 46.23 ? 55  LYS A NZ    1 
ATOM   1177 N N     . GLY B 2 55  ? 13.355  15.571 31.270  1.00 40.20 ? 56  GLY A N     1 
ATOM   1178 C CA    . GLY B 2 55  ? 13.386  16.962 31.672  1.00 40.12 ? 56  GLY A CA    1 
ATOM   1179 C C     . GLY B 2 55  ? 12.123  17.444 32.354  1.00 40.15 ? 56  GLY A C     1 
ATOM   1180 O O     . GLY B 2 55  ? 12.108  18.533 32.927  1.00 40.68 ? 56  GLY A O     1 
ATOM   1181 N N     . SER B 2 56  ? 11.060  16.647 32.308  1.00 40.13 ? 57  SER A N     1 
ATOM   1182 C CA    . SER B 2 56  ? 9.806   17.047 32.941  1.00 40.32 ? 57  SER A CA    1 
ATOM   1183 C C     . SER B 2 56  ? 9.472   16.171 34.138  1.00 40.00 ? 57  SER A C     1 
ATOM   1184 O O     . SER B 2 56  ? 8.368   15.636 34.232  1.00 40.69 ? 57  SER A O     1 
ATOM   1185 C CB    . SER B 2 56  ? 8.662   16.983 31.932  1.00 40.47 ? 57  SER A CB    1 
ATOM   1186 O OG    . SER B 2 56  ? 8.992   17.695 30.755  1.00 41.52 ? 57  SER A OG    1 
ATOM   1187 N N     . LEU B 2 57  ? 10.426  16.026 35.053  1.00 39.40 ? 58  LEU A N     1 
ATOM   1188 C CA    . LEU B 2 57  ? 10.208  15.210 36.238  1.00 39.38 ? 58  LEU A CA    1 
ATOM   1189 C C     . LEU B 2 57  ? 9.389   15.955 37.274  1.00 40.03 ? 58  LEU A C     1 
ATOM   1190 O O     . LEU B 2 57  ? 9.774   17.026 37.728  1.00 40.66 ? 58  LEU A O     1 
ATOM   1191 C CB    . LEU B 2 57  ? 11.543  14.776 36.856  1.00 38.12 ? 58  LEU A CB    1 
ATOM   1192 C CG    . LEU B 2 57  ? 11.450  13.950 38.151  1.00 36.32 ? 58  LEU A CG    1 
ATOM   1193 C CD1   . LEU B 2 57  ? 10.549  12.743 37.933  1.00 35.54 ? 58  LEU A CD1   1 
ATOM   1194 C CD2   . LEU B 2 57  ? 12.833  13.500 38.584  1.00 35.94 ? 58  LEU A CD2   1 
ATOM   1195 N N     . GLU B 2 58  ? 8.253   15.374 37.637  1.00 40.84 ? 59  GLU A N     1 
ATOM   1196 C CA    . GLU B 2 58  ? 7.351   15.942 38.635  1.00 41.90 ? 59  GLU A CA    1 
ATOM   1197 C C     . GLU B 2 58  ? 6.619   14.725 39.187  1.00 41.87 ? 59  GLU A C     1 
ATOM   1198 O O     . GLU B 2 58  ? 6.418   13.753 38.457  1.00 42.87 ? 59  GLU A O     1 
ATOM   1199 C CB    . GLU B 2 58  ? 6.354   16.912 37.976  1.00 43.99 ? 59  GLU A CB    1 
ATOM   1200 C CG    . GLU B 2 58  ? 5.505   17.746 38.958  1.00 47.98 ? 59  GLU A CG    1 
ATOM   1201 C CD    . GLU B 2 58  ? 4.392   18.561 38.267  1.00 50.10 ? 59  GLU A CD    1 
ATOM   1202 O OE1   . GLU B 2 58  ? 3.456   17.949 37.697  1.00 52.23 ? 59  GLU A OE1   1 
ATOM   1203 O OE2   . GLU B 2 58  ? 4.450   19.814 38.297  1.00 50.16 ? 59  GLU A OE2   1 
ATOM   1204 N N     . ILE B 2 59  ? 6.235   14.761 40.461  1.00 40.69 ? 60  ILE A N     1 
ATOM   1205 C CA    . ILE B 2 59  ? 5.531   13.637 41.082  1.00 39.29 ? 60  ILE A CA    1 
ATOM   1206 C C     . ILE B 2 59  ? 4.133   14.053 41.494  1.00 39.89 ? 60  ILE A C     1 
ATOM   1207 O O     . ILE B 2 59  ? 3.937   15.175 41.935  1.00 40.65 ? 60  ILE A O     1 
ATOM   1208 C CB    . ILE B 2 59  ? 6.282   13.141 42.327  1.00 37.99 ? 60  ILE A CB    1 
ATOM   1209 C CG1   . ILE B 2 59  ? 7.666   12.627 41.918  1.00 37.50 ? 60  ILE A CG1   1 
ATOM   1210 C CG2   . ILE B 2 59  ? 5.453   12.086 43.045  1.00 36.31 ? 60  ILE A CG2   1 
ATOM   1211 C CD1   . ILE B 2 59  ? 8.492   12.078 43.061  1.00 37.79 ? 60  ILE A CD1   1 
ATOM   1212 N N     . ASP B 2 60  ? 3.161   13.157 41.358  1.00 41.27 ? 61  ASP A N     1 
ATOM   1213 C CA    . ASP B 2 60  ? 1.784   13.490 41.731  1.00 42.97 ? 61  ASP A CA    1 
ATOM   1214 C C     . ASP B 2 60  ? 1.183   12.619 42.824  1.00 42.65 ? 61  ASP A C     1 
ATOM   1215 O O     . ASP B 2 60  ? 0.555   11.600 42.547  1.00 42.60 ? 61  ASP A O     1 
ATOM   1216 C CB    . ASP B 2 60  ? 0.858   13.456 40.506  1.00 45.56 ? 61  ASP A CB    1 
ATOM   1217 C CG    . ASP B 2 60  ? 1.186   14.542 39.495  1.00 47.50 ? 61  ASP A CG    1 
ATOM   1218 O OD1   . ASP B 2 60  ? 1.935   14.253 38.527  1.00 48.43 ? 61  ASP A OD1   1 
ATOM   1219 O OD2   . ASP B 2 60  ? 0.703   15.685 39.683  1.00 48.08 ? 61  ASP A OD2   1 
ATOM   1220 N N     . VAL B 2 61  ? 1.359   13.048 44.067  1.00 42.41 ? 62  VAL A N     1 
ATOM   1221 C CA    . VAL B 2 61  ? 0.839   12.329 45.222  1.00 41.76 ? 62  VAL A CA    1 
ATOM   1222 C C     . VAL B 2 61  ? -0.607  12.727 45.537  1.00 40.79 ? 62  VAL A C     1 
ATOM   1223 O O     . VAL B 2 61  ? -0.859  13.818 46.048  1.00 40.22 ? 62  VAL A O     1 
ATOM   1224 C CB    . VAL B 2 61  ? 1.743   12.592 46.455  1.00 41.77 ? 62  VAL A CB    1 
ATOM   1225 C CG1   . VAL B 2 61  ? 1.094   12.071 47.731  1.00 41.73 ? 62  VAL A CG1   1 
ATOM   1226 C CG2   . VAL B 2 61  ? 3.090   11.925 46.236  1.00 41.85 ? 62  VAL A CG2   1 
ATOM   1227 N N     . PHE B 2 62  ? -1.552  11.843 45.224  1.00 40.05 ? 63  PHE A N     1 
ATOM   1228 C CA    . PHE B 2 62  ? -2.968  12.108 45.492  1.00 40.08 ? 63  PHE A CA    1 
ATOM   1229 C C     . PHE B 2 62  ? -3.414  11.569 46.863  1.00 41.03 ? 63  PHE A C     1 
ATOM   1230 O O     . PHE B 2 62  ? -3.211  10.388 47.187  1.00 41.00 ? 63  PHE A O     1 
ATOM   1231 C CB    . PHE B 2 62  ? -3.842  11.512 44.383  1.00 37.98 ? 63  PHE A CB    1 
ATOM   1232 C CG    . PHE B 2 62  ? -4.174  12.484 43.287  1.00 36.13 ? 63  PHE A CG    1 
ATOM   1233 C CD1   . PHE B 2 62  ? -3.173  13.194 42.641  1.00 36.05 ? 63  PHE A CD1   1 
ATOM   1234 C CD2   . PHE B 2 62  ? -5.493  12.700 42.911  1.00 35.82 ? 63  PHE A CD2   1 
ATOM   1235 C CE1   . PHE B 2 62  ? -3.482  14.104 41.642  1.00 34.91 ? 63  PHE A CE1   1 
ATOM   1236 C CE2   . PHE B 2 62  ? -5.813  13.611 41.911  1.00 34.63 ? 63  PHE A CE2   1 
ATOM   1237 C CZ    . PHE B 2 62  ? -4.807  14.313 41.277  1.00 33.88 ? 63  PHE A CZ    1 
ATOM   1238 N N     . LEU B 2 63  ? -4.019  12.444 47.667  1.00 41.12 ? 64  LEU A N     1 
ATOM   1239 C CA    . LEU B 2 63  ? -4.462  12.059 48.996  1.00 40.54 ? 64  LEU A CA    1 
ATOM   1240 C C     . LEU B 2 63  ? -5.919  11.649 49.005  1.00 41.68 ? 64  LEU A C     1 
ATOM   1241 O O     . LEU B 2 63  ? -6.813  12.446 48.703  1.00 41.14 ? 64  LEU A O     1 
ATOM   1242 C CB    . LEU B 2 63  ? -4.232  13.204 49.982  1.00 39.44 ? 64  LEU A CB    1 
ATOM   1243 C CG    . LEU B 2 63  ? -2.776  13.667 50.079  1.00 39.66 ? 64  LEU A CG    1 
ATOM   1244 C CD1   . LEU B 2 63  ? -2.630  14.641 51.242  1.00 39.27 ? 64  LEU A CD1   1 
ATOM   1245 C CD2   . LEU B 2 63  ? -1.849  12.461 50.263  1.00 39.61 ? 64  LEU A CD2   1 
ATOM   1246 N N     . LEU B 2 64  ? -6.147  10.389 49.356  1.00 43.00 ? 65  LEU A N     1 
ATOM   1247 C CA    . LEU B 2 64  ? -7.489  9.840  49.405  1.00 44.78 ? 65  LEU A CA    1 
ATOM   1248 C C     . LEU B 2 64  ? -8.218  10.172 50.710  1.00 45.98 ? 65  LEU A C     1 
ATOM   1249 O O     . LEU B 2 64  ? -7.676  9.994  51.810  1.00 47.23 ? 65  LEU A O     1 
ATOM   1250 C CB    . LEU B 2 64  ? -7.419  8.326  49.195  1.00 44.42 ? 65  LEU A CB    1 
ATOM   1251 C CG    . LEU B 2 64  ? -7.309  7.800  47.756  1.00 43.04 ? 65  LEU A CG    1 
ATOM   1252 C CD1   . LEU B 2 64  ? -6.379  8.652  46.917  1.00 42.81 ? 65  LEU A CD1   1 
ATOM   1253 C CD2   . LEU B 2 64  ? -6.821  6.361  47.811  1.00 43.15 ? 65  LEU A CD2   1 
ATOM   1254 N N     . PHE B 2 65  ? -9.450  10.665 50.575  1.00 46.25 ? 66  PHE A N     1 
ATOM   1255 C CA    . PHE B 2 65  ? -10.286 11.036 51.716  1.00 46.49 ? 66  PHE A CA    1 
ATOM   1256 C C     . PHE B 2 65  ? -11.668 10.422 51.578  1.00 47.02 ? 66  PHE A C     1 
ATOM   1257 O O     . PHE B 2 65  ? -12.202 10.315 50.473  1.00 47.71 ? 66  PHE A O     1 
ATOM   1258 C CB    . PHE B 2 65  ? -10.441 12.552 51.791  1.00 46.93 ? 66  PHE A CB    1 
ATOM   1259 C CG    . PHE B 2 65  ? -9.216  13.265 52.280  1.00 48.11 ? 66  PHE A CG    1 
ATOM   1260 C CD1   . PHE B 2 65  ? -8.889  13.269 53.636  1.00 47.57 ? 66  PHE A CD1   1 
ATOM   1261 C CD2   . PHE B 2 65  ? -8.390  13.946 51.389  1.00 47.59 ? 66  PHE A CD2   1 
ATOM   1262 C CE1   . PHE B 2 65  ? -7.761  13.945 54.095  1.00 47.09 ? 66  PHE A CE1   1 
ATOM   1263 C CE2   . PHE B 2 65  ? -7.264  14.621 51.838  1.00 47.06 ? 66  PHE A CE2   1 
ATOM   1264 C CZ    . PHE B 2 65  ? -6.948  14.623 53.192  1.00 47.29 ? 66  PHE A CZ    1 
ATOM   1265 N N     . PRO B 2 66  ? -12.271 10.011 52.703  1.00 47.36 ? 67  PRO A N     1 
ATOM   1266 C CA    . PRO B 2 66  ? -13.608 9.409  52.686  1.00 47.60 ? 67  PRO A CA    1 
ATOM   1267 C C     . PRO B 2 66  ? -14.596 10.263 51.894  1.00 47.99 ? 67  PRO A C     1 
ATOM   1268 O O     . PRO B 2 66  ? -14.404 11.467 51.736  1.00 47.07 ? 67  PRO A O     1 
ATOM   1269 C CB    . PRO B 2 66  ? -13.971 9.342  54.166  1.00 47.47 ? 67  PRO A CB    1 
ATOM   1270 C CG    . PRO B 2 66  ? -12.637 9.107  54.815  1.00 47.34 ? 67  PRO A CG    1 
ATOM   1271 C CD    . PRO B 2 66  ? -11.721 10.049 54.070  1.00 47.30 ? 67  PRO A CD    1 
ATOM   1272 N N     . GLU B 2 67  ? -15.652 9.635  51.396  1.00 49.57 ? 68  GLU A N     1 
ATOM   1273 C CA    . GLU B 2 67  ? -16.663 10.361 50.639  1.00 51.81 ? 68  GLU A CA    1 
ATOM   1274 C C     . GLU B 2 67  ? -17.303 11.430 51.514  1.00 51.93 ? 68  GLU A C     1 
ATOM   1275 O O     . GLU B 2 67  ? -17.369 12.602 51.144  1.00 52.61 ? 68  GLU A O     1 
ATOM   1276 C CB    . GLU B 2 67  ? -17.774 9.425  50.171  1.00 53.33 ? 68  GLU A CB    1 
ATOM   1277 C CG    . GLU B 2 67  ? -17.369 8.344  49.202  1.00 56.98 ? 68  GLU A CG    1 
ATOM   1278 C CD    . GLU B 2 67  ? -18.541 7.442  48.871  1.00 60.05 ? 68  GLU A CD    1 
ATOM   1279 O OE1   . GLU B 2 67  ? -19.044 6.769  49.802  1.00 60.42 ? 68  GLU A OE1   1 
ATOM   1280 O OE2   . GLU B 2 67  ? -18.966 7.421  47.689  1.00 62.35 ? 68  GLU A OE2   1 
ATOM   1281 N N     . GLU B 2 68  ? -17.780 11.008 52.678  1.00 51.81 ? 69  GLU A N     1 
ATOM   1282 C CA    . GLU B 2 68  ? -18.457 11.900 53.602  1.00 51.57 ? 69  GLU A CA    1 
ATOM   1283 C C     . GLU B 2 68  ? -17.706 13.168 53.980  1.00 51.34 ? 69  GLU A C     1 
ATOM   1284 O O     . GLU B 2 68  ? -18.333 14.160 54.367  1.00 52.33 ? 69  GLU A O     1 
ATOM   1285 C CB    . GLU B 2 68  ? -18.844 11.142 54.864  1.00 51.01 ? 69  GLU A CB    1 
ATOM   1286 C CG    . GLU B 2 68  ? -19.581 9.853  54.569  1.00 51.27 ? 69  GLU A CG    1 
ATOM   1287 C CD    . GLU B 2 68  ? -18.653 8.751  54.085  1.00 51.30 ? 69  GLU A CD    1 
ATOM   1288 O OE1   . GLU B 2 68  ? -19.173 7.706  53.633  1.00 51.42 ? 69  GLU A OE1   1 
ATOM   1289 O OE2   . GLU B 2 68  ? -17.412 8.927  54.167  1.00 50.54 ? 69  GLU A OE2   1 
ATOM   1290 N N     . PHE B 2 69  ? -16.381 13.158 53.877  1.00 49.87 ? 70  PHE A N     1 
ATOM   1291 C CA    . PHE B 2 69  ? -15.631 14.355 54.226  1.00 49.02 ? 70  PHE A CA    1 
ATOM   1292 C C     . PHE B 2 69  ? -16.118 15.567 53.443  1.00 49.22 ? 70  PHE A C     1 
ATOM   1293 O O     . PHE B 2 69  ? -16.518 15.462 52.287  1.00 48.96 ? 70  PHE A O     1 
ATOM   1294 C CB    . PHE B 2 69  ? -14.143 14.146 53.987  1.00 48.12 ? 70  PHE A CB    1 
ATOM   1295 C CG    . PHE B 2 69  ? -13.433 13.508 55.142  1.00 47.34 ? 70  PHE A CG    1 
ATOM   1296 C CD1   . PHE B 2 69  ? -13.995 12.427 55.808  1.00 46.96 ? 70  PHE A CD1   1 
ATOM   1297 C CD2   . PHE B 2 69  ? -12.177 13.956 55.532  1.00 47.20 ? 70  PHE A CD2   1 
ATOM   1298 C CE1   . PHE B 2 69  ? -13.319 11.801 56.843  1.00 47.18 ? 70  PHE A CE1   1 
ATOM   1299 C CE2   . PHE B 2 69  ? -11.492 13.337 56.566  1.00 47.63 ? 70  PHE A CE2   1 
ATOM   1300 C CZ    . PHE B 2 69  ? -12.064 12.253 57.222  1.00 47.77 ? 70  PHE A CZ    1 
ATOM   1301 N N     . SER B 2 70  ? -16.098 16.716 54.103  1.00 49.98 ? 71  SER A N     1 
ATOM   1302 C CA    . SER B 2 70  ? -16.523 17.973 53.513  1.00 50.82 ? 71  SER A CA    1 
ATOM   1303 C C     . SER B 2 70  ? -15.425 18.469 52.583  1.00 52.63 ? 71  SER A C     1 
ATOM   1304 O O     . SER B 2 70  ? -14.274 18.027 52.685  1.00 53.85 ? 71  SER A O     1 
ATOM   1305 C CB    . SER B 2 70  ? -16.714 18.995 54.616  1.00 50.22 ? 71  SER A CB    1 
ATOM   1306 O OG    . SER B 2 70  ? -15.459 19.270 55.227  1.00 48.59 ? 71  SER A OG    1 
ATOM   1307 N N     . LYS B 2 71  ? -15.771 19.393 51.691  1.00 53.31 ? 72  LYS A N     1 
ATOM   1308 C CA    . LYS B 2 71  ? -14.789 19.957 50.766  1.00 54.31 ? 72  LYS A CA    1 
ATOM   1309 C C     . LYS B 2 71  ? -13.654 20.633 51.552  1.00 54.56 ? 72  LYS A C     1 
ATOM   1310 O O     . LYS B 2 71  ? -12.464 20.369 51.324  1.00 54.72 ? 72  LYS A O     1 
ATOM   1311 C CB    . LYS B 2 71  ? -15.477 20.975 49.848  1.00 55.32 ? 72  LYS A CB    1 
ATOM   1312 C CG    . LYS B 2 71  ? -14.711 22.280 49.632  1.00 57.32 ? 72  LYS A CG    1 
ATOM   1313 C CD    . LYS B 2 71  ? -15.469 23.215 48.689  1.00 59.26 ? 72  LYS A CD    1 
ATOM   1314 C CE    . LYS B 2 71  ? -14.779 24.581 48.560  1.00 60.28 ? 72  LYS A CE    1 
ATOM   1315 N NZ    . LYS B 2 71  ? -14.988 25.470 49.748  1.00 59.99 ? 72  LYS A NZ    1 
ATOM   1316 N N     . GLU B 2 72  ? -14.051 21.496 52.485  1.00 54.62 ? 73  GLU A N     1 
ATOM   1317 C CA    . GLU B 2 72  ? -13.147 22.258 53.348  1.00 53.39 ? 73  GLU A CA    1 
ATOM   1318 C C     . GLU B 2 72  ? -12.159 21.362 54.091  1.00 52.67 ? 73  GLU A C     1 
ATOM   1319 O O     . GLU B 2 72  ? -10.963 21.664 54.139  1.00 52.13 ? 73  GLU A O     1 
ATOM   1320 C CB    . GLU B 2 72  ? -13.959 23.057 54.370  1.00 53.25 ? 73  GLU A CB    1 
ATOM   1321 C CG    . GLU B 2 72  ? -15.253 23.658 53.822  1.00 53.61 ? 73  GLU A CG    1 
ATOM   1322 C CD    . GLU B 2 72  ? -16.189 22.604 53.235  1.00 54.09 ? 73  GLU A CD    1 
ATOM   1323 O OE1   . GLU B 2 72  ? -16.181 21.464 53.745  1.00 54.47 ? 73  GLU A OE1   1 
ATOM   1324 O OE2   . GLU B 2 72  ? -16.933 22.912 52.273  1.00 55.32 ? 73  GLU A OE2   1 
ATOM   1325 N N     . GLU B 2 73  ? -12.659 20.273 54.681  1.00 51.55 ? 74  GLU A N     1 
ATOM   1326 C CA    . GLU B 2 73  ? -11.792 19.349 55.411  1.00 51.50 ? 74  GLU A CA    1 
ATOM   1327 C C     . GLU B 2 73  ? -10.671 18.869 54.506  1.00 51.28 ? 74  GLU A C     1 
ATOM   1328 O O     . GLU B 2 73  ? -9.490  18.964 54.859  1.00 50.10 ? 74  GLU A O     1 
ATOM   1329 C CB    . GLU B 2 73  ? -12.577 18.137 55.920  1.00 52.15 ? 74  GLU A CB    1 
ATOM   1330 C CG    . GLU B 2 73  ? -12.734 18.073 57.447  1.00 52.62 ? 74  GLU A CG    1 
ATOM   1331 C CD    . GLU B 2 73  ? -11.404 18.052 58.211  1.00 52.89 ? 74  GLU A CD    1 
ATOM   1332 O OE1   . GLU B 2 73  ? -10.620 17.083 58.050  1.00 51.90 ? 74  GLU A OE1   1 
ATOM   1333 O OE2   . GLU B 2 73  ? -11.152 19.010 58.980  1.00 52.66 ? 74  GLU A OE2   1 
ATOM   1334 N N     . LEU B 2 74  ? -11.054 18.365 53.333  1.00 51.56 ? 75  LEU A N     1 
ATOM   1335 C CA    . LEU B 2 74  ? -10.093 17.859 52.360  1.00 51.87 ? 75  LEU A CA    1 
ATOM   1336 C C     . LEU B 2 74  ? -8.902  18.777 52.214  1.00 52.03 ? 75  LEU A C     1 
ATOM   1337 O O     . LEU B 2 74  ? -7.773  18.367 52.465  1.00 51.92 ? 75  LEU A O     1 
ATOM   1338 C CB    . LEU B 2 74  ? -10.751 17.668 50.995  1.00 51.97 ? 75  LEU A CB    1 
ATOM   1339 C CG    . LEU B 2 74  ? -11.046 16.221 50.591  1.00 52.03 ? 75  LEU A CG    1 
ATOM   1340 C CD1   . LEU B 2 74  ? -11.866 15.531 51.671  1.00 52.08 ? 75  LEU A CD1   1 
ATOM   1341 C CD2   . LEU B 2 74  ? -11.790 16.213 49.266  1.00 52.32 ? 75  LEU A CD2   1 
ATOM   1342 N N     . ARG B 2 75  ? -9.153  20.024 51.830  1.00 52.77 ? 76  ARG A N     1 
ATOM   1343 C CA    . ARG B 2 75  ? -8.068  20.985 51.641  1.00 53.41 ? 76  ARG A CA    1 
ATOM   1344 C C     . ARG B 2 75  ? -7.265  21.352 52.905  1.00 51.99 ? 76  ARG A C     1 
ATOM   1345 O O     . ARG B 2 75  ? -6.047  21.551 52.827  1.00 50.81 ? 76  ARG A O     1 
ATOM   1346 C CB    . ARG B 2 75  ? -8.614  22.239 50.937  1.00 55.34 ? 76  ARG A CB    1 
ATOM   1347 C CG    . ARG B 2 75  ? -9.795  22.904 51.617  1.00 58.11 ? 76  ARG A CG    1 
ATOM   1348 C CD    . ARG B 2 75  ? -9.308  24.048 52.489  1.00 61.85 ? 76  ARG A CD    1 
ATOM   1349 N NE    . ARG B 2 75  ? -8.496  24.983 51.717  1.00 64.22 ? 76  ARG A NE    1 
ATOM   1350 C CZ    . ARG B 2 75  ? -7.503  25.701 52.233  1.00 65.63 ? 76  ARG A CZ    1 
ATOM   1351 N NH1   . ARG B 2 75  ? -7.204  25.591 53.530  1.00 65.61 ? 76  ARG A NH1   1 
ATOM   1352 N NH2   . ARG B 2 75  ? -6.795  26.511 51.447  1.00 66.04 ? 76  ARG A NH2   1 
ATOM   1353 N N     . GLU B 2 76  ? -7.934  21.421 54.057  1.00 51.15 ? 77  GLU A N     1 
ATOM   1354 C CA    . GLU B 2 76  ? -7.263  21.743 55.323  1.00 50.31 ? 77  GLU A CA    1 
ATOM   1355 C C     . GLU B 2 76  ? -6.275  20.636 55.685  1.00 49.52 ? 77  GLU A C     1 
ATOM   1356 O O     . GLU B 2 76  ? -5.115  20.901 56.001  1.00 48.16 ? 77  GLU A O     1 
ATOM   1357 C CB    . GLU B 2 76  ? -8.278  21.875 56.462  1.00 51.31 ? 77  GLU A CB    1 
ATOM   1358 C CG    . GLU B 2 76  ? -9.238  23.056 56.372  1.00 51.81 ? 77  GLU A CG    1 
ATOM   1359 C CD    . GLU B 2 76  ? -10.329 22.985 57.440  1.00 52.49 ? 77  GLU A CD    1 
ATOM   1360 O OE1   . GLU B 2 76  ? -10.989 24.018 57.689  1.00 53.19 ? 77  GLU A OE1   1 
ATOM   1361 O OE2   . GLU B 2 76  ? -10.528 21.892 58.024  1.00 51.18 ? 77  GLU A OE2   1 
ATOM   1362 N N     . ARG B 2 77  ? -6.756  19.397 55.651  1.00 49.52 ? 78  ARG A N     1 
ATOM   1363 C CA    . ARG B 2 77  ? -5.927  18.235 55.958  1.00 50.60 ? 78  ARG A CA    1 
ATOM   1364 C C     . ARG B 2 77  ? -4.868  18.071 54.882  1.00 50.54 ? 78  ARG A C     1 
ATOM   1365 O O     . ARG B 2 77  ? -3.762  17.595 55.146  1.00 49.75 ? 78  ARG A O     1 
ATOM   1366 C CB    . ARG B 2 77  ? -6.786  16.973 56.025  1.00 51.76 ? 78  ARG A CB    1 
ATOM   1367 C CG    . ARG B 2 77  ? -7.572  16.815 57.321  1.00 54.76 ? 78  ARG A CG    1 
ATOM   1368 C CD    . ARG B 2 77  ? -6.713  16.203 58.417  1.00 57.80 ? 78  ARG A CD    1 
ATOM   1369 N NE    . ARG B 2 77  ? -5.559  17.033 58.773  1.00 60.66 ? 78  ARG A NE    1 
ATOM   1370 C CZ    . ARG B 2 77  ? -4.303  16.587 58.838  1.00 62.02 ? 78  ARG A CZ    1 
ATOM   1371 N NH1   . ARG B 2 77  ? -4.028  15.316 58.562  1.00 61.76 ? 78  ARG A NH1   1 
ATOM   1372 N NH2   . ARG B 2 77  ? -3.319  17.406 59.204  1.00 62.61 ? 78  ARG A NH2   1 
ATOM   1373 N N     . GLY B 2 78  ? -5.230  18.469 53.663  1.00 50.87 ? 79  GLY A N     1 
ATOM   1374 C CA    . GLY B 2 78  ? -4.317  18.377 52.541  1.00 50.67 ? 79  GLY A CA    1 
ATOM   1375 C C     . GLY B 2 78  ? -3.220  19.402 52.705  1.00 51.06 ? 79  GLY A C     1 
ATOM   1376 O O     . GLY B 2 78  ? -2.043  19.110 52.481  1.00 51.28 ? 79  GLY A O     1 
ATOM   1377 N N     . LEU B 2 79  ? -3.609  20.607 53.110  1.00 50.86 ? 80  LEU A N     1 
ATOM   1378 C CA    . LEU B 2 79  ? -2.646  21.681 53.317  1.00 50.98 ? 80  LEU A CA    1 
ATOM   1379 C C     . LEU B 2 79  ? -1.655  21.290 54.412  1.00 51.05 ? 80  LEU A C     1 
ATOM   1380 O O     . LEU B 2 79  ? -0.441  21.491 54.281  1.00 50.52 ? 80  LEU A O     1 
ATOM   1381 C CB    . LEU B 2 79  ? -3.375  22.974 53.693  1.00 50.92 ? 80  LEU A CB    1 
ATOM   1382 C CG    . LEU B 2 79  ? -2.535  24.135 54.231  1.00 50.86 ? 80  LEU A CG    1 
ATOM   1383 C CD1   . LEU B 2 79  ? -1.305  24.380 53.365  1.00 50.29 ? 80  LEU A CD1   1 
ATOM   1384 C CD2   . LEU B 2 79  ? -3.417  25.367 54.293  1.00 50.34 ? 80  LEU A CD2   1 
ATOM   1385 N N     . GLU B 2 80  ? -2.187  20.716 55.484  1.00 51.49 ? 81  GLU A N     1 
ATOM   1386 C CA    . GLU B 2 80  ? -1.376  20.281 56.611  1.00 52.24 ? 81  GLU A CA    1 
ATOM   1387 C C     . GLU B 2 80  ? -0.392  19.183 56.197  1.00 51.84 ? 81  GLU A C     1 
ATOM   1388 O O     . GLU B 2 80  ? 0.826   19.319 56.378  1.00 51.39 ? 81  GLU A O     1 
ATOM   1389 C CB    . GLU B 2 80  ? -2.295  19.769 57.724  1.00 54.50 ? 81  GLU A CB    1 
ATOM   1390 C CG    . GLU B 2 80  ? -2.249  20.574 59.023  1.00 57.46 ? 81  GLU A CG    1 
ATOM   1391 C CD    . GLU B 2 80  ? -2.088  22.067 58.778  1.00 59.57 ? 81  GLU A CD    1 
ATOM   1392 O OE1   . GLU B 2 80  ? -1.002  22.594 59.106  1.00 60.01 ? 81  GLU A OE1   1 
ATOM   1393 O OE2   . GLU B 2 80  ? -3.032  22.709 58.251  1.00 60.69 ? 81  GLU A OE2   1 
ATOM   1394 N N     . ILE B 2 81  ? -0.927  18.096 55.641  1.00 51.15 ? 82  ILE A N     1 
ATOM   1395 C CA    . ILE B 2 81  ? -0.102  16.968 55.214  1.00 50.58 ? 82  ILE A CA    1 
ATOM   1396 C C     . ILE B 2 81  ? 0.994   17.420 54.262  1.00 50.90 ? 82  ILE A C     1 
ATOM   1397 O O     . ILE B 2 81  ? 2.162   17.072 54.432  1.00 51.10 ? 82  ILE A O     1 
ATOM   1398 C CB    . ILE B 2 81  ? -0.936  15.894 54.493  1.00 50.02 ? 82  ILE A CB    1 
ATOM   1399 C CG1   . ILE B 2 81  ? -2.072  15.403 55.395  1.00 49.53 ? 82  ILE A CG1   1 
ATOM   1400 C CG2   . ILE B 2 81  ? -0.038  14.739 54.103  1.00 49.60 ? 82  ILE A CG2   1 
ATOM   1401 C CD1   . ILE B 2 81  ? -3.010  14.415 54.726  1.00 48.53 ? 82  ILE A CD1   1 
ATOM   1402 N N     . GLY B 2 82  ? 0.603   18.200 53.258  1.00 50.88 ? 83  GLY A N     1 
ATOM   1403 C CA    . GLY B 2 82  ? 1.561   18.686 52.284  1.00 51.18 ? 83  GLY A CA    1 
ATOM   1404 C C     . GLY B 2 82  ? 2.652   19.492 52.953  1.00 51.83 ? 83  GLY A C     1 
ATOM   1405 O O     . GLY B 2 82  ? 3.843   19.283 52.702  1.00 51.38 ? 83  GLY A O     1 
ATOM   1406 N N     . LYS B 2 83  ? 2.240   20.410 53.822  1.00 52.33 ? 84  LYS A N     1 
ATOM   1407 C CA    . LYS B 2 83  ? 3.181   21.267 54.532  1.00 53.03 ? 84  LYS A CA    1 
ATOM   1408 C C     . LYS B 2 83  ? 4.225   20.468 55.328  1.00 53.02 ? 84  LYS A C     1 
ATOM   1409 O O     . LYS B 2 83  ? 5.434   20.717 55.227  1.00 52.57 ? 84  LYS A O     1 
ATOM   1410 C CB    . LYS B 2 83  ? 2.410   22.213 55.464  1.00 53.54 ? 84  LYS A CB    1 
ATOM   1411 C CG    . LYS B 2 83  ? 3.303   23.128 56.274  1.00 54.78 ? 84  LYS A CG    1 
ATOM   1412 C CD    . LYS B 2 83  ? 2.507   24.146 57.078  1.00 55.55 ? 84  LYS A CD    1 
ATOM   1413 C CE    . LYS B 2 83  ? 1.759   25.128 56.170  1.00 55.56 ? 84  LYS A CE    1 
ATOM   1414 N NZ    . LYS B 2 83  ? 1.470   26.435 56.855  1.00 55.37 ? 84  LYS A NZ    1 
ATOM   1415 N N     . ALA B 2 84  ? 3.750   19.500 56.105  1.00 52.58 ? 85  ALA A N     1 
ATOM   1416 C CA    . ALA B 2 84  ? 4.618   18.673 56.936  1.00 52.10 ? 85  ALA A CA    1 
ATOM   1417 C C     . ALA B 2 84  ? 5.601   17.804 56.153  1.00 52.24 ? 85  ALA A C     1 
ATOM   1418 O O     . ALA B 2 84  ? 6.735   17.564 56.589  1.00 52.53 ? 85  ALA A O     1 
ATOM   1419 C CB    . ALA B 2 84  ? 3.762   17.790 57.828  1.00 51.95 ? 85  ALA A CB    1 
ATOM   1420 N N     . VAL B 2 85  ? 5.174   17.339 54.988  1.00 51.90 ? 86  VAL A N     1 
ATOM   1421 C CA    . VAL B 2 85  ? 6.014   16.458 54.200  1.00 51.22 ? 86  VAL A CA    1 
ATOM   1422 C C     . VAL B 2 85  ? 6.981   17.118 53.219  1.00 50.44 ? 86  VAL A C     1 
ATOM   1423 O O     . VAL B 2 85  ? 8.080   16.603 52.988  1.00 49.71 ? 86  VAL A O     1 
ATOM   1424 C CB    . VAL B 2 85  ? 5.134   15.457 53.449  1.00 50.97 ? 86  VAL A CB    1 
ATOM   1425 C CG1   . VAL B 2 85  ? 4.195   16.198 52.532  1.00 52.15 ? 86  VAL A CG1   1 
ATOM   1426 C CG2   . VAL B 2 85  ? 5.990   14.492 52.679  1.00 51.63 ? 86  VAL A CG2   1 
ATOM   1427 N N     . LEU B 2 86  ? 6.584   18.255 52.655  1.00 49.94 ? 87  LEU A N     1 
ATOM   1428 C CA    . LEU B 2 86  ? 7.419   18.959 51.678  1.00 50.37 ? 87  LEU A CA    1 
ATOM   1429 C C     . LEU B 2 86  ? 8.530   19.785 52.300  1.00 50.01 ? 87  LEU A C     1 
ATOM   1430 O O     . LEU B 2 86  ? 8.314   20.469 53.296  1.00 49.95 ? 87  LEU A O     1 
ATOM   1431 C CB    . LEU B 2 86  ? 6.553   19.877 50.820  1.00 50.50 ? 87  LEU A CB    1 
ATOM   1432 C CG    . LEU B 2 86  ? 5.350   19.158 50.219  1.00 51.05 ? 87  LEU A CG    1 
ATOM   1433 C CD1   . LEU B 2 86  ? 4.344   20.170 49.696  1.00 51.88 ? 87  LEU A CD1   1 
ATOM   1434 C CD2   . LEU B 2 86  ? 5.832   18.207 49.126  1.00 51.79 ? 87  LEU A CD2   1 
ATOM   1435 N N     . ASP B 2 87  ? 9.717   19.713 51.705  1.00 49.90 ? 88  ASP A N     1 
ATOM   1436 C CA    . ASP B 2 87  ? 10.864  20.479 52.173  1.00 50.51 ? 88  ASP A CA    1 
ATOM   1437 C C     . ASP B 2 87  ? 10.441  21.943 52.206  1.00 51.53 ? 88  ASP A C     1 
ATOM   1438 O O     . ASP B 2 87  ? 10.563  22.628 53.234  1.00 52.03 ? 88  ASP A O     1 
ATOM   1439 C CB    . ASP B 2 87  ? 12.029  20.337 51.194  1.00 50.43 ? 88  ASP A CB    1 
ATOM   1440 C CG    . ASP B 2 87  ? 12.689  18.981 51.259  1.00 50.87 ? 88  ASP A CG    1 
ATOM   1441 O OD1   . ASP B 2 87  ? 11.964  17.959 51.273  1.00 51.97 ? 88  ASP A OD1   1 
ATOM   1442 O OD2   . ASP B 2 87  ? 13.937  18.937 51.288  1.00 50.86 ? 88  ASP A OD2   1 
ATOM   1443 N N     . SER B 2 88  ? 9.941   22.403 51.058  1.00 51.61 ? 89  SER A N     1 
ATOM   1444 C CA    . SER B 2 88  ? 9.480   23.776 50.857  1.00 51.01 ? 89  SER A CA    1 
ATOM   1445 C C     . SER B 2 88  ? 8.181   23.697 50.081  1.00 50.63 ? 89  SER A C     1 
ATOM   1446 O O     . SER B 2 88  ? 8.144   23.100 49.008  1.00 51.51 ? 89  SER A O     1 
ATOM   1447 C CB    . SER B 2 88  ? 10.507  24.542 50.036  1.00 51.23 ? 89  SER A CB    1 
ATOM   1448 O OG    . SER B 2 88  ? 10.908  23.775 48.917  1.00 51.68 ? 89  SER A OG    1 
ATOM   1449 N N     . TYR B 2 89  ? 7.119   24.300 50.602  1.00 50.51 ? 90  TYR A N     1 
ATOM   1450 C CA    . TYR B 2 89  ? 5.839   24.230 49.915  1.00 50.94 ? 90  TYR A CA    1 
ATOM   1451 C C     . TYR B 2 89  ? 5.379   25.515 49.242  1.00 51.50 ? 90  TYR A C     1 
ATOM   1452 O O     . TYR B 2 89  ? 6.100   26.517 49.208  1.00 52.23 ? 90  TYR A O     1 
ATOM   1453 C CB    . TYR B 2 89  ? 4.756   23.744 50.878  1.00 51.71 ? 90  TYR A CB    1 
ATOM   1454 C CG    . TYR B 2 89  ? 4.351   24.743 51.931  1.00 53.11 ? 90  TYR A CG    1 
ATOM   1455 C CD1   . TYR B 2 89  ? 3.013   25.094 52.101  1.00 53.83 ? 90  TYR A CD1   1 
ATOM   1456 C CD2   . TYR B 2 89  ? 5.294   25.308 52.786  1.00 53.63 ? 90  TYR A CD2   1 
ATOM   1457 C CE1   . TYR B 2 89  ? 2.621   25.979 53.098  1.00 54.82 ? 90  TYR A CE1   1 
ATOM   1458 C CE2   . TYR B 2 89  ? 4.918   26.196 53.791  1.00 54.30 ? 90  TYR A CE2   1 
ATOM   1459 C CZ    . TYR B 2 89  ? 3.580   26.527 53.943  1.00 55.24 ? 90  TYR A CZ    1 
ATOM   1460 O OH    . TYR B 2 89  ? 3.203   27.401 54.945  1.00 56.44 ? 90  TYR A OH    1 
ATOM   1461 N N     . GLU B 2 90  ? 4.167   25.459 48.695  1.00 51.43 ? 91  GLU A N     1 
ATOM   1462 C CA    . GLU B 2 90  ? 3.538   26.582 48.005  1.00 51.56 ? 91  GLU A CA    1 
ATOM   1463 C C     . GLU B 2 90  ? 2.109   26.226 47.611  1.00 51.11 ? 91  GLU A C     1 
ATOM   1464 O O     . GLU B 2 90  ? 1.884   25.450 46.683  1.00 52.11 ? 91  GLU A O     1 
ATOM   1465 C CB    . GLU B 2 90  ? 4.323   26.960 46.745  1.00 52.73 ? 91  GLU A CB    1 
ATOM   1466 C CG    . GLU B 2 90  ? 3.590   27.926 45.797  1.00 54.58 ? 91  GLU A CG    1 
ATOM   1467 C CD    . GLU B 2 90  ? 4.366   28.176 44.505  1.00 56.43 ? 91  GLU A CD    1 
ATOM   1468 O OE1   . GLU B 2 90  ? 5.468   28.773 44.576  1.00 57.38 ? 91  GLU A OE1   1 
ATOM   1469 O OE2   . GLU B 2 90  ? 3.881   27.773 43.420  1.00 56.59 ? 91  GLU A OE2   1 
ATOM   1470 N N     . ILE B 2 91  ? 1.149   26.794 48.333  1.00 49.81 ? 92  ILE A N     1 
ATOM   1471 C CA    . ILE B 2 91  ? -0.266  26.575 48.070  1.00 48.41 ? 92  ILE A CA    1 
ATOM   1472 C C     . ILE B 2 91  ? -0.607  27.031 46.647  1.00 48.63 ? 92  ILE A C     1 
ATOM   1473 O O     . ILE B 2 91  ? -0.570  28.223 46.346  1.00 48.71 ? 92  ILE A O     1 
ATOM   1474 C CB    . ILE B 2 91  ? -1.113  27.375 49.081  1.00 47.55 ? 92  ILE A CB    1 
ATOM   1475 C CG1   . ILE B 2 91  ? -0.886  26.813 50.490  1.00 46.63 ? 92  ILE A CG1   1 
ATOM   1476 C CG2   . ILE B 2 91  ? -2.583  27.371 48.667  1.00 46.61 ? 92  ILE A CG2   1 
ATOM   1477 C CD1   . ILE B 2 91  ? -1.587  27.586 51.583  1.00 46.45 ? 92  ILE A CD1   1 
ATOM   1478 N N     . ARG B 2 92  ? -0.932  26.082 45.774  1.00 49.16 ? 93  ARG A N     1 
ATOM   1479 C CA    . ARG B 2 92  ? -1.284  26.398 44.388  1.00 49.37 ? 93  ARG A CA    1 
ATOM   1480 C C     . ARG B 2 92  ? -2.803  26.377 44.240  1.00 49.96 ? 93  ARG A C     1 
ATOM   1481 O O     . ARG B 2 92  ? -3.523  26.208 45.220  1.00 49.87 ? 93  ARG A O     1 
ATOM   1482 C CB    . ARG B 2 92  ? -0.667  25.375 43.429  1.00 48.64 ? 93  ARG A CB    1 
ATOM   1483 C CG    . ARG B 2 92  ? 0.049   25.987 42.238  1.00 48.77 ? 93  ARG A CG    1 
ATOM   1484 C CD    . ARG B 2 92  ? 1.467   26.434 42.595  1.00 49.55 ? 93  ARG A CD    1 
ATOM   1485 N NE    . ARG B 2 92  ? 2.469   25.425 42.248  1.00 51.04 ? 93  ARG A NE    1 
ATOM   1486 C CZ    . ARG B 2 92  ? 2.705   24.996 41.008  1.00 51.30 ? 93  ARG A CZ    1 
ATOM   1487 N NH1   . ARG B 2 92  ? 2.011   25.486 39.984  1.00 52.39 ? 93  ARG A NH1   1 
ATOM   1488 N NH2   . ARG B 2 92  ? 3.631   24.075 40.785  1.00 50.45 ? 93  ARG A NH2   1 
ATOM   1489 N N     . TYR B 2 93  ? -3.299  26.545 43.021  1.00 51.72 ? 94  TYR A N     1 
ATOM   1490 C CA    . TYR B 2 93  ? -4.746  26.541 42.819  1.00 53.21 ? 94  TYR A CA    1 
ATOM   1491 C C     . TYR B 2 93  ? -5.253  25.934 41.507  1.00 54.53 ? 94  TYR A C     1 
ATOM   1492 O O     . TYR B 2 93  ? -4.547  25.900 40.485  1.00 53.99 ? 94  TYR A O     1 
ATOM   1493 C CB    . TYR B 2 93  ? -5.313  27.961 42.955  1.00 53.16 ? 94  TYR A CB    1 
ATOM   1494 C CG    . TYR B 2 93  ? -5.253  28.530 44.352  1.00 53.44 ? 94  TYR A CG    1 
ATOM   1495 C CD1   . TYR B 2 93  ? -4.100  29.157 44.829  1.00 53.29 ? 94  TYR A CD1   1 
ATOM   1496 C CD2   . TYR B 2 93  ? -6.351  28.422 45.210  1.00 54.66 ? 94  TYR A CD2   1 
ATOM   1497 C CE1   . TYR B 2 93  ? -4.040  29.666 46.139  1.00 54.39 ? 94  TYR A CE1   1 
ATOM   1498 C CE2   . TYR B 2 93  ? -6.308  28.923 46.519  1.00 54.66 ? 94  TYR A CE2   1 
ATOM   1499 C CZ    . TYR B 2 93  ? -5.151  29.541 46.979  1.00 55.01 ? 94  TYR A CZ    1 
ATOM   1500 O OH    . TYR B 2 93  ? -5.102  30.004 48.276  1.00 55.97 ? 94  TYR A OH    1 
ATOM   1501 N N     . ALA B 2 94  ? -6.503  25.470 41.581  1.00 55.87 ? 95  ALA A N     1 
ATOM   1502 C CA    . ALA B 2 94  ? -7.248  24.845 40.487  1.00 56.59 ? 95  ALA A CA    1 
ATOM   1503 C C     . ALA B 2 94  ? -8.723  24.815 40.922  1.00 57.31 ? 95  ALA A C     1 
ATOM   1504 O O     . ALA B 2 94  ? -9.190  25.710 41.644  1.00 57.34 ? 95  ALA A O     1 
ATOM   1505 C CB    . ALA B 2 94  ? -6.746  23.427 40.254  1.00 55.82 ? 95  ALA A CB    1 
ATOM   1506 N N     . GLU B 2 95  ? -9.447  23.778 40.501  1.00 58.02 ? 96  GLU A N     1 
ATOM   1507 C CA    . GLU B 2 95  ? -10.863 23.636 40.858  1.00 58.58 ? 96  GLU A CA    1 
ATOM   1508 C C     . GLU B 2 95  ? -10.964 23.877 42.360  1.00 57.84 ? 96  GLU A C     1 
ATOM   1509 O O     . GLU B 2 95  ? -11.940 24.451 42.858  1.00 57.79 ? 96  GLU A O     1 
ATOM   1510 C CB    . GLU B 2 95  ? -11.375 22.223 40.499  1.00 60.33 ? 96  GLU A CB    1 
ATOM   1511 C CG    . GLU B 2 95  ? -12.898 22.131 40.279  1.00 62.44 ? 96  GLU A CG    1 
ATOM   1512 C CD    . GLU B 2 95  ? -13.321 20.880 39.496  1.00 63.93 ? 96  GLU A CD    1 
ATOM   1513 O OE1   . GLU B 2 95  ? -12.729 20.617 38.425  1.00 64.53 ? 96  GLU A OE1   1 
ATOM   1514 O OE2   . GLU B 2 95  ? -14.253 20.167 39.941  1.00 64.60 ? 96  GLU A OE2   1 
ATOM   1515 N N     . HIS B 2 96  ? -9.924  23.439 43.062  1.00 56.92 ? 97  HIS A N     1 
ATOM   1516 C CA    . HIS B 2 96  ? -9.808  23.584 44.504  1.00 55.03 ? 97  HIS A CA    1 
ATOM   1517 C C     . HIS B 2 96  ? -8.322  23.748 44.749  1.00 53.25 ? 97  HIS A C     1 
ATOM   1518 O O     . HIS B 2 96  ? -7.502  23.348 43.923  1.00 53.65 ? 97  HIS A O     1 
ATOM   1519 C CB    . HIS B 2 96  ? -10.345 22.335 45.194  1.00 55.68 ? 97  HIS A CB    1 
ATOM   1520 C CG    . HIS B 2 96  ? -11.748 22.004 44.795  1.00 57.11 ? 97  HIS A CG    1 
ATOM   1521 N ND1   . HIS B 2 96  ? -12.842 22.663 45.315  1.00 57.69 ? 97  HIS A ND1   1 
ATOM   1522 C CD2   . HIS B 2 96  ? -12.230 21.153 43.856  1.00 57.32 ? 97  HIS A CD2   1 
ATOM   1523 C CE1   . HIS B 2 96  ? -13.938 22.236 44.710  1.00 58.17 ? 97  HIS A CE1   1 
ATOM   1524 N NE2   . HIS B 2 96  ? -13.594 21.320 43.820  1.00 57.57 ? 97  HIS A NE2   1 
ATOM   1525 N N     . PRO B 2 97  ? -7.946  24.341 45.880  1.00 51.51 ? 98  PRO A N     1 
ATOM   1526 C CA    . PRO B 2 97  ? -6.509  24.502 46.100  1.00 50.08 ? 98  PRO A CA    1 
ATOM   1527 C C     . PRO B 2 97  ? -5.788  23.188 46.385  1.00 48.20 ? 98  PRO A C     1 
ATOM   1528 O O     . PRO B 2 97  ? -6.408  22.203 46.779  1.00 49.04 ? 98  PRO A O     1 
ATOM   1529 C CB    . PRO B 2 97  ? -6.454  25.481 47.278  1.00 50.21 ? 98  PRO A CB    1 
ATOM   1530 C CG    . PRO B 2 97  ? -7.685  25.111 48.078  1.00 50.08 ? 98  PRO A CG    1 
ATOM   1531 C CD    . PRO B 2 97  ? -8.736  24.897 46.998  1.00 51.01 ? 98  PRO A CD    1 
ATOM   1532 N N     . TYR B 2 98  ? -4.481  23.180 46.156  1.00 45.60 ? 99  TYR A N     1 
ATOM   1533 C CA    . TYR B 2 98  ? -3.653  22.017 46.426  1.00 44.23 ? 99  TYR A CA    1 
ATOM   1534 C C     . TYR B 2 98  ? -2.267  22.545 46.788  1.00 44.23 ? 99  TYR A C     1 
ATOM   1535 O O     . TYR B 2 98  ? -2.038  23.751 46.747  1.00 44.60 ? 99  TYR A O     1 
ATOM   1536 C CB    . TYR B 2 98  ? -3.615  21.081 45.212  1.00 43.00 ? 99  TYR A CB    1 
ATOM   1537 C CG    . TYR B 2 98  ? -2.925  21.617 43.980  1.00 41.61 ? 99  TYR A CG    1 
ATOM   1538 C CD1   . TYR B 2 98  ? -1.565  21.398 43.774  1.00 40.88 ? 99  TYR A CD1   1 
ATOM   1539 C CD2   . TYR B 2 98  ? -3.639  22.320 43.004  1.00 41.03 ? 99  TYR A CD2   1 
ATOM   1540 C CE1   . TYR B 2 98  ? -0.932  21.860 42.625  1.00 41.54 ? 99  TYR A CE1   1 
ATOM   1541 C CE2   . TYR B 2 98  ? -3.014  22.790 41.847  1.00 40.73 ? 99  TYR A CE2   1 
ATOM   1542 C CZ    . TYR B 2 98  ? -1.658  22.555 41.667  1.00 41.08 ? 99  TYR A CZ    1 
ATOM   1543 O OH    . TYR B 2 98  ? -1.019  23.017 40.540  1.00 40.20 ? 99  TYR A OH    1 
ATOM   1544 N N     . VAL B 2 99  ? -1.342  21.669 47.154  1.00 43.72 ? 100 VAL A N     1 
ATOM   1545 C CA    . VAL B 2 99  ? -0.022  22.142 47.549  1.00 43.90 ? 100 VAL A CA    1 
ATOM   1546 C C     . VAL B 2 99  ? 1.088   21.664 46.640  1.00 44.39 ? 100 VAL A C     1 
ATOM   1547 O O     . VAL B 2 99  ? 1.130   20.499 46.267  1.00 45.34 ? 100 VAL A O     1 
ATOM   1548 C CB    . VAL B 2 99  ? 0.318   21.693 48.976  1.00 43.48 ? 100 VAL A CB    1 
ATOM   1549 C CG1   . VAL B 2 99  ? 1.663   22.257 49.390  1.00 42.54 ? 100 VAL A CG1   1 
ATOM   1550 C CG2   . VAL B 2 99  ? -0.772  22.130 49.928  1.00 43.34 ? 100 VAL A CG2   1 
ATOM   1551 N N     . HIS B 2 100 ? 1.993   22.569 46.293  1.00 44.36 ? 101 HIS A N     1 
ATOM   1552 C CA    . HIS B 2 100 ? 3.114   22.217 45.440  1.00 43.79 ? 101 HIS A CA    1 
ATOM   1553 C C     . HIS B 2 100 ? 4.417   22.425 46.197  1.00 43.24 ? 101 HIS A C     1 
ATOM   1554 O O     . HIS B 2 100 ? 4.577   23.431 46.894  1.00 43.67 ? 101 HIS A O     1 
ATOM   1555 C CB    . HIS B 2 100 ? 3.134   23.083 44.191  1.00 44.61 ? 101 HIS A CB    1 
ATOM   1556 C CG    . HIS B 2 100 ? 4.234   22.721 43.251  1.00 46.60 ? 101 HIS A CG    1 
ATOM   1557 N ND1   . HIS B 2 100 ? 4.146   21.652 42.386  1.00 47.00 ? 101 HIS A ND1   1 
ATOM   1558 C CD2   . HIS B 2 100 ? 5.487   23.217 43.113  1.00 47.44 ? 101 HIS A CD2   1 
ATOM   1559 C CE1   . HIS B 2 100 ? 5.300   21.500 41.759  1.00 47.73 ? 101 HIS A CE1   1 
ATOM   1560 N NE2   . HIS B 2 100 ? 6.130   22.437 42.184  1.00 47.76 ? 101 HIS A NE2   1 
ATOM   1561 N N     . GLY B 2 101 ? 5.353   21.492 46.055  1.00 41.62 ? 102 GLY A N     1 
ATOM   1562 C CA    . GLY B 2 101 ? 6.612   21.633 46.760  1.00 40.64 ? 102 GLY A CA    1 
ATOM   1563 C C     . GLY B 2 101 ? 7.774   20.904 46.118  1.00 40.80 ? 102 GLY A C     1 
ATOM   1564 O O     . GLY B 2 101 ? 7.725   20.531 44.943  1.00 41.09 ? 102 GLY A O     1 
ATOM   1565 N N     . VAL B 2 102 ? 8.827   20.702 46.901  1.00 40.50 ? 103 VAL A N     1 
ATOM   1566 C CA    . VAL B 2 102 ? 10.018  20.017 46.429  1.00 40.68 ? 103 VAL A CA    1 
ATOM   1567 C C     . VAL B 2 102 ? 10.514  19.044 47.496  1.00 42.30 ? 103 VAL A C     1 
ATOM   1568 O O     . VAL B 2 102 ? 10.509  19.356 48.690  1.00 44.02 ? 103 VAL A O     1 
ATOM   1569 C CB    . VAL B 2 102 ? 11.129  21.021 46.126  1.00 39.61 ? 103 VAL A CB    1 
ATOM   1570 C CG1   . VAL B 2 102 ? 12.385  20.292 45.690  1.00 38.80 ? 103 VAL A CG1   1 
ATOM   1571 C CG2   . VAL B 2 102 ? 10.661  21.986 45.059  1.00 40.30 ? 103 VAL A CG2   1 
ATOM   1572 N N     . VAL B 2 103 ? 10.938  17.862 47.068  1.00 41.79 ? 104 VAL A N     1 
ATOM   1573 C CA    . VAL B 2 103 ? 11.440  16.859 47.998  1.00 40.82 ? 104 VAL A CA    1 
ATOM   1574 C C     . VAL B 2 103 ? 12.699  16.234 47.402  1.00 40.91 ? 104 VAL A C     1 
ATOM   1575 O O     . VAL B 2 103 ? 12.657  15.630 46.330  1.00 41.09 ? 104 VAL A O     1 
ATOM   1576 C CB    . VAL B 2 103 ? 10.369  15.772 48.264  1.00 40.21 ? 104 VAL A CB    1 
ATOM   1577 C CG1   . VAL B 2 103 ? 10.854  14.811 49.331  1.00 40.61 ? 104 VAL A CG1   1 
ATOM   1578 C CG2   . VAL B 2 103 ? 9.067   16.423 48.703  1.00 38.94 ? 104 VAL A CG2   1 
ATOM   1579 N N     . LYS B 2 104 ? 13.820  16.385 48.101  1.00 41.00 ? 105 LYS A N     1 
ATOM   1580 C CA    . LYS B 2 104 ? 15.094  15.866 47.624  1.00 41.67 ? 105 LYS A CA    1 
ATOM   1581 C C     . LYS B 2 104 ? 15.355  16.361 46.217  1.00 42.15 ? 105 LYS A C     1 
ATOM   1582 O O     . LYS B 2 104 ? 15.827  15.612 45.368  1.00 42.78 ? 105 LYS A O     1 
ATOM   1583 C CB    . LYS B 2 104 ? 15.122  14.332 47.625  1.00 42.51 ? 105 LYS A CB    1 
ATOM   1584 C CG    . LYS B 2 104 ? 15.180  13.688 49.012  1.00 42.73 ? 105 LYS A CG    1 
ATOM   1585 C CD    . LYS B 2 104 ? 15.775  12.280 48.956  1.00 40.47 ? 105 LYS A CD    1 
ATOM   1586 C CE    . LYS B 2 104 ? 17.248  12.311 48.575  1.00 38.23 ? 105 LYS A CE    1 
ATOM   1587 N NZ    . LYS B 2 104 ? 17.850  10.950 48.641  1.00 38.73 ? 105 LYS A NZ    1 
ATOM   1588 N N     . GLY B 2 105 ? 15.014  17.619 45.964  1.00 42.67 ? 106 GLY A N     1 
ATOM   1589 C CA    . GLY B 2 105 ? 15.256  18.200 44.656  1.00 43.56 ? 106 GLY A CA    1 
ATOM   1590 C C     . GLY B 2 105 ? 14.180  18.123 43.582  1.00 44.04 ? 106 GLY A C     1 
ATOM   1591 O O     . GLY B 2 105 ? 14.199  18.934 42.652  1.00 44.27 ? 106 GLY A O     1 
ATOM   1592 N N     . VAL B 2 106 ? 13.244  17.183 43.679  1.00 43.90 ? 107 VAL A N     1 
ATOM   1593 C CA    . VAL B 2 106 ? 12.224  17.083 42.643  1.00 43.84 ? 107 VAL A CA    1 
ATOM   1594 C C     . VAL B 2 106 ? 10.884  17.728 42.990  1.00 44.11 ? 107 VAL A C     1 
ATOM   1595 O O     . VAL B 2 106 ? 10.534  17.907 44.163  1.00 44.41 ? 107 VAL A O     1 
ATOM   1596 C CB    . VAL B 2 106 ? 11.986  15.610 42.226  1.00 44.05 ? 107 VAL A CB    1 
ATOM   1597 C CG1   . VAL B 2 106 ? 13.315  14.870 42.160  1.00 43.92 ? 107 VAL A CG1   1 
ATOM   1598 C CG2   . VAL B 2 106 ? 11.025  14.939 43.179  1.00 44.54 ? 107 VAL A CG2   1 
ATOM   1599 N N     . GLU B 2 107 ? 10.148  18.075 41.935  1.00 44.51 ? 108 GLU A N     1 
ATOM   1600 C CA    . GLU B 2 107 ? 8.838   18.713 42.027  1.00 45.68 ? 108 GLU A CA    1 
ATOM   1601 C C     . GLU B 2 107 ? 7.777   17.762 42.538  1.00 45.38 ? 108 GLU A C     1 
ATOM   1602 O O     . GLU B 2 107 ? 7.792   16.576 42.217  1.00 46.49 ? 108 GLU A O     1 
ATOM   1603 C CB    . GLU B 2 107 ? 8.406   19.216 40.651  1.00 48.17 ? 108 GLU A CB    1 
ATOM   1604 C CG    . GLU B 2 107 ? 9.275   20.317 40.097  1.00 51.87 ? 108 GLU A CG    1 
ATOM   1605 C CD    . GLU B 2 107 ? 9.292   21.517 41.010  1.00 54.42 ? 108 GLU A CD    1 
ATOM   1606 O OE1   . GLU B 2 107 ? 8.199   22.066 41.275  1.00 55.03 ? 108 GLU A OE1   1 
ATOM   1607 O OE2   . GLU B 2 107 ? 10.395  21.904 41.466  1.00 56.43 ? 108 GLU A OE2   1 
ATOM   1608 N N     . VAL B 2 108 ? 6.841   18.288 43.316  1.00 44.23 ? 109 VAL A N     1 
ATOM   1609 C CA    . VAL B 2 108 ? 5.776   17.461 43.853  1.00 43.46 ? 109 VAL A CA    1 
ATOM   1610 C C     . VAL B 2 108 ? 4.454   18.204 43.915  1.00 43.62 ? 109 VAL A C     1 
ATOM   1611 O O     . VAL B 2 108 ? 4.411   19.385 44.272  1.00 44.48 ? 109 VAL A O     1 
ATOM   1612 C CB    . VAL B 2 108 ? 6.115   16.968 45.264  1.00 43.28 ? 109 VAL A CB    1 
ATOM   1613 C CG1   . VAL B 2 108 ? 4.943   16.202 45.839  1.00 43.93 ? 109 VAL A CG1   1 
ATOM   1614 C CG2   . VAL B 2 108 ? 7.346   16.087 45.222  1.00 43.62 ? 109 VAL A CG2   1 
ATOM   1615 N N     . ASP B 2 109 ? 3.384   17.499 43.559  1.00 42.58 ? 110 ASP A N     1 
ATOM   1616 C CA    . ASP B 2 109 ? 2.032   18.038 43.580  1.00 42.27 ? 110 ASP A CA    1 
ATOM   1617 C C     . ASP B 2 109 ? 1.281   17.184 44.575  1.00 41.71 ? 110 ASP A C     1 
ATOM   1618 O O     . ASP B 2 109 ? 1.183   15.978 44.402  1.00 41.85 ? 110 ASP A O     1 
ATOM   1619 C CB    . ASP B 2 109 ? 1.369   17.912 42.207  1.00 43.78 ? 110 ASP A CB    1 
ATOM   1620 C CG    . ASP B 2 109 ? 1.718   19.062 41.274  1.00 45.70 ? 110 ASP A CG    1 
ATOM   1621 O OD1   . ASP B 2 109 ? 1.222   20.186 41.513  1.00 46.30 ? 110 ASP A OD1   1 
ATOM   1622 O OD2   . ASP B 2 109 ? 2.484   18.845 40.303  1.00 46.04 ? 110 ASP A OD2   1 
ATOM   1623 N N     . VAL B 2 110 ? 0.767   17.807 45.626  1.00 41.42 ? 111 VAL A N     1 
ATOM   1624 C CA    . VAL B 2 110 ? 0.030   17.087 46.647  1.00 40.64 ? 111 VAL A CA    1 
ATOM   1625 C C     . VAL B 2 110 ? -1.430  17.481 46.571  1.00 42.27 ? 111 VAL A C     1 
ATOM   1626 O O     . VAL B 2 110 ? -1.873  18.390 47.265  1.00 43.09 ? 111 VAL A O     1 
ATOM   1627 C CB    . VAL B 2 110 ? 0.561   17.416 48.024  1.00 38.86 ? 111 VAL A CB    1 
ATOM   1628 C CG1   . VAL B 2 110 ? -0.222  16.664 49.066  1.00 37.68 ? 111 VAL A CG1   1 
ATOM   1629 C CG2   . VAL B 2 110 ? 2.033   17.065 48.093  1.00 37.93 ? 111 VAL A CG2   1 
ATOM   1630 N N     . VAL B 2 111 ? -2.175  16.783 45.720  1.00 43.80 ? 112 VAL A N     1 
ATOM   1631 C CA    . VAL B 2 111 ? -3.589  17.057 45.517  1.00 44.51 ? 112 VAL A CA    1 
ATOM   1632 C C     . VAL B 2 111 ? -4.537  16.275 46.421  1.00 45.83 ? 112 VAL A C     1 
ATOM   1633 O O     . VAL B 2 111 ? -4.361  15.077 46.655  1.00 46.40 ? 112 VAL A O     1 
ATOM   1634 C CB    . VAL B 2 111 ? -3.983  16.769 44.065  1.00 43.65 ? 112 VAL A CB    1 
ATOM   1635 C CG1   . VAL B 2 111 ? -5.462  17.043 43.863  1.00 44.75 ? 112 VAL A CG1   1 
ATOM   1636 C CG2   . VAL B 2 111 ? -3.138  17.608 43.129  1.00 43.86 ? 112 VAL A CG2   1 
ATOM   1637 N N     . PRO B 2 112 ? -5.543  16.963 46.973  1.00 46.98 ? 113 PRO A N     1 
ATOM   1638 C CA    . PRO B 2 112 ? -6.523  16.308 47.848  1.00 47.24 ? 113 PRO A CA    1 
ATOM   1639 C C     . PRO B 2 112 ? -7.710  15.822 47.012  1.00 46.92 ? 113 PRO A C     1 
ATOM   1640 O O     . PRO B 2 112 ? -8.201  16.556 46.155  1.00 46.37 ? 113 PRO A O     1 
ATOM   1641 C CB    . PRO B 2 112 ? -6.929  17.425 48.818  1.00 46.76 ? 113 PRO A CB    1 
ATOM   1642 C CG    . PRO B 2 112 ? -5.753  18.366 48.793  1.00 47.30 ? 113 PRO A CG    1 
ATOM   1643 C CD    . PRO B 2 112 ? -5.426  18.389 47.321  1.00 47.31 ? 113 PRO A CD    1 
ATOM   1644 N N     . CYS B 2 113 ? -8.160  14.591 47.255  1.00 47.39 ? 114 CYS A N     1 
ATOM   1645 C CA    . CYS B 2 113 ? -9.300  14.036 46.521  1.00 47.89 ? 114 CYS A CA    1 
ATOM   1646 C C     . CYS B 2 113 ? -10.078 12.996 47.326  1.00 48.30 ? 114 CYS A C     1 
ATOM   1647 O O     . CYS B 2 113 ? -9.599  12.489 48.341  1.00 48.14 ? 114 CYS A O     1 
ATOM   1648 C CB    . CYS B 2 113 ? -8.836  13.405 45.203  1.00 46.89 ? 114 CYS A CB    1 
ATOM   1649 S SG    . CYS B 2 113 ? -7.879  11.889 45.400  1.00 46.90 ? 114 CYS A SG    1 
ATOM   1650 N N     . TYR B 2 114 ? -11.279 12.684 46.847  1.00 49.19 ? 115 TYR A N     1 
ATOM   1651 C CA    . TYR B 2 114 ? -12.166 11.701 47.474  1.00 50.83 ? 115 TYR A CA    1 
ATOM   1652 C C     . TYR B 2 114 ? -11.927 10.260 47.011  1.00 51.70 ? 115 TYR A C     1 
ATOM   1653 O O     . TYR B 2 114 ? -12.021 9.958  45.809  1.00 52.03 ? 115 TYR A O     1 
ATOM   1654 C CB    . TYR B 2 114 ? -13.623 12.034 47.161  1.00 51.11 ? 115 TYR A CB    1 
ATOM   1655 C CG    . TYR B 2 114 ? -14.194 13.209 47.902  1.00 51.89 ? 115 TYR A CG    1 
ATOM   1656 C CD1   . TYR B 2 114 ? -15.102 14.060 47.283  1.00 52.32 ? 115 TYR A CD1   1 
ATOM   1657 C CD2   . TYR B 2 114 ? -13.872 13.445 49.231  1.00 51.77 ? 115 TYR A CD2   1 
ATOM   1658 C CE1   . TYR B 2 114 ? -15.674 15.113 47.967  1.00 52.37 ? 115 TYR A CE1   1 
ATOM   1659 C CE2   . TYR B 2 114 ? -14.444 14.497 49.923  1.00 52.07 ? 115 TYR A CE2   1 
ATOM   1660 C CZ    . TYR B 2 114 ? -15.343 15.325 49.284  1.00 52.40 ? 115 TYR A CZ    1 
ATOM   1661 O OH    . TYR B 2 114 ? -15.926 16.364 49.967  1.00 53.87 ? 115 TYR A OH    1 
ATOM   1662 N N     . LYS B 2 115 ? -11.636 9.371  47.958  1.00 52.42 ? 116 LYS A N     1 
ATOM   1663 C CA    . LYS B 2 115 ? -11.442 7.965  47.615  1.00 53.21 ? 116 LYS A CA    1 
ATOM   1664 C C     . LYS B 2 115 ? -12.824 7.511  47.148  1.00 53.96 ? 116 LYS A C     1 
ATOM   1665 O O     . LYS B 2 115 ? -13.784 7.560  47.914  1.00 54.72 ? 116 LYS A O     1 
ATOM   1666 C CB    . LYS B 2 115 ? -11.000 7.152  48.842  1.00 52.28 ? 116 LYS A CB    1 
ATOM   1667 C CG    . LYS B 2 115 ? -10.676 5.685  48.542  1.00 52.32 ? 116 LYS A CG    1 
ATOM   1668 C CD    . LYS B 2 115 ? -10.133 4.954  49.773  1.00 52.55 ? 116 LYS A CD    1 
ATOM   1669 C CE    . LYS B 2 115 ? -9.867  3.474  49.488  1.00 53.10 ? 116 LYS A CE    1 
ATOM   1670 N NZ    . LYS B 2 115 ? -9.727  2.650  50.730  1.00 51.86 ? 116 LYS A NZ    1 
ATOM   1671 N N     . LEU B 2 116 ? -12.938 7.089  45.894  1.00 54.21 ? 117 LEU A N     1 
ATOM   1672 C CA    . LEU B 2 116 ? -14.236 6.673  45.391  1.00 54.67 ? 117 LEU A CA    1 
ATOM   1673 C C     . LEU B 2 116 ? -14.239 5.299  44.761  1.00 56.16 ? 117 LEU A C     1 
ATOM   1674 O O     . LEU B 2 116 ? -13.187 4.760  44.425  1.00 56.85 ? 117 LEU A O     1 
ATOM   1675 C CB    . LEU B 2 116 ? -14.726 7.685  44.368  1.00 52.11 ? 117 LEU A CB    1 
ATOM   1676 C CG    . LEU B 2 116 ? -14.981 9.074  44.922  1.00 50.26 ? 117 LEU A CG    1 
ATOM   1677 C CD1   . LEU B 2 116 ? -15.400 9.990  43.785  1.00 50.08 ? 117 LEU A CD1   1 
ATOM   1678 C CD2   . LEU B 2 116 ? -16.057 8.997  45.989  1.00 49.82 ? 117 LEU A CD2   1 
ATOM   1679 N N     . LYS B 2 117 ? -15.430 4.728  44.620  1.00 58.15 ? 118 LYS A N     1 
ATOM   1680 C CA    . LYS B 2 117 ? -15.562 3.434  43.965  1.00 60.87 ? 118 LYS A CA    1 
ATOM   1681 C C     . LYS B 2 117 ? -16.542 3.592  42.798  1.00 61.61 ? 118 LYS A C     1 
ATOM   1682 O O     . LYS B 2 117 ? -17.690 4.019  42.975  1.00 62.22 ? 118 LYS A O     1 
ATOM   1683 C CB    . LYS B 2 117 ? -16.051 2.352  44.938  1.00 62.02 ? 118 LYS A CB    1 
ATOM   1684 C CG    . LYS B 2 117 ? -16.155 0.943  44.294  1.00 63.26 ? 118 LYS A CG    1 
ATOM   1685 C CD    . LYS B 2 117 ? -14.813 0.446  43.730  1.00 63.49 ? 118 LYS A CD    1 
ATOM   1686 C CE    . LYS B 2 117 ? -14.948 -0.921 43.022  1.00 64.00 ? 118 LYS A CE    1 
ATOM   1687 N NZ    . LYS B 2 117 ? -13.635 -1.622 42.739  1.00 62.69 ? 118 LYS A NZ    1 
ATOM   1688 N N     . GLU B 2 118 ? -16.068 3.254  41.606  1.00 62.45 ? 119 GLU A N     1 
ATOM   1689 C CA    . GLU B 2 118 ? -16.853 3.368  40.383  1.00 64.09 ? 119 GLU A CA    1 
ATOM   1690 C C     . GLU B 2 118 ? -17.039 4.828  39.952  1.00 63.62 ? 119 GLU A C     1 
ATOM   1691 O O     . GLU B 2 118 ? -17.612 5.640  40.685  1.00 63.15 ? 119 GLU A O     1 
ATOM   1692 C CB    . GLU B 2 118 ? -18.208 2.657  40.532  1.00 66.30 ? 119 GLU A CB    1 
ATOM   1693 C CG    . GLU B 2 118 ? -18.093 1.114  40.613  1.00 69.32 ? 119 GLU A CG    1 
ATOM   1694 C CD    . GLU B 2 118 ? -17.122 0.510  39.569  1.00 71.07 ? 119 GLU A CD    1 
ATOM   1695 O OE1   . GLU B 2 118 ? -15.880 0.658  39.740  1.00 71.95 ? 119 GLU A OE1   1 
ATOM   1696 O OE2   . GLU B 2 118 ? -17.599 -0.106 38.580  1.00 71.47 ? 119 GLU A OE2   1 
ATOM   1697 N N     . PRO B 2 119 ? -16.543 5.164  38.741  1.00 63.26 ? 120 PRO A N     1 
ATOM   1698 C CA    . PRO B 2 119 ? -16.540 6.452  38.036  1.00 62.83 ? 120 PRO A CA    1 
ATOM   1699 C C     . PRO B 2 119 ? -17.597 7.481  38.397  1.00 62.50 ? 120 PRO A C     1 
ATOM   1700 O O     . PRO B 2 119 ? -17.287 8.673  38.453  1.00 62.28 ? 120 PRO A O     1 
ATOM   1701 C CB    . PRO B 2 119 ? -16.591 6.030  36.579  1.00 63.13 ? 120 PRO A CB    1 
ATOM   1702 C CG    . PRO B 2 119 ? -15.620 4.873  36.592  1.00 63.51 ? 120 PRO A CG    1 
ATOM   1703 C CD    . PRO B 2 119 ? -16.063 4.097  37.836  1.00 63.26 ? 120 PRO A CD    1 
ATOM   1704 N N     . LYS B 2 120 ? -18.833 7.036  38.623  1.00 62.79 ? 121 LYS A N     1 
ATOM   1705 C CA    . LYS B 2 120 ? -19.907 7.951  39.017  1.00 63.42 ? 121 LYS A CA    1 
ATOM   1706 C C     . LYS B 2 120 ? -19.548 8.384  40.450  1.00 65.08 ? 121 LYS A C     1 
ATOM   1707 O O     . LYS B 2 120 ? -18.663 7.778  41.071  1.00 65.42 ? 121 LYS A O     1 
ATOM   1708 C CB    . LYS B 2 120 ? -21.262 7.238  39.018  1.00 62.21 ? 121 LYS A CB    1 
ATOM   1709 C CG    . LYS B 2 120 ? -21.372 6.050  38.073  1.00 62.14 ? 121 LYS A CG    1 
ATOM   1710 C CD    . LYS B 2 120 ? -21.124 6.408  36.604  1.00 63.00 ? 121 LYS A CD    1 
ATOM   1711 C CE    . LYS B 2 120 ? -21.287 5.162  35.705  1.00 63.21 ? 121 LYS A CE    1 
ATOM   1712 N NZ    . LYS B 2 120 ? -20.880 5.369  34.282  1.00 61.56 ? 121 LYS A NZ    1 
ATOM   1713 N N     . ASN B 2 121 ? -20.237 9.402  40.975  1.00 66.29 ? 122 ASN A N     1 
ATOM   1714 C CA    . ASN B 2 121 ? -19.972 9.939  42.325  1.00 67.18 ? 122 ASN A CA    1 
ATOM   1715 C C     . ASN B 2 121 ? -18.870 10.980 42.170  1.00 68.08 ? 122 ASN A C     1 
ATOM   1716 O O     . ASN B 2 121 ? -18.640 11.808 43.062  1.00 68.67 ? 122 ASN A O     1 
ATOM   1717 C CB    . ASN B 2 121 ? -19.488 8.851  43.309  1.00 66.77 ? 122 ASN A CB    1 
ATOM   1718 C CG    . ASN B 2 121 ? -20.631 8.069  43.946  1.00 66.10 ? 122 ASN A CG    1 
ATOM   1719 O OD1   . ASN B 2 121 ? -21.450 8.630  44.676  1.00 65.63 ? 122 ASN A OD1   1 
ATOM   1720 N ND2   . ASN B 2 121 ? -20.685 6.764  43.674  1.00 65.47 ? 122 ASN A ND2   1 
ATOM   1721 N N     . ILE B 2 122 ? -18.195 10.910 41.022  1.00 68.88 ? 123 ILE A N     1 
ATOM   1722 C CA    . ILE B 2 122 ? -17.103 11.810 40.655  1.00 69.18 ? 123 ILE A CA    1 
ATOM   1723 C C     . ILE B 2 122 ? -17.458 13.262 41.024  1.00 69.35 ? 123 ILE A C     1 
ATOM   1724 O O     . ILE B 2 122 ? -18.372 13.864 40.446  1.00 69.18 ? 123 ILE A O     1 
ATOM   1725 C CB    . ILE B 2 122 ? -16.808 11.683 39.120  1.00 69.25 ? 123 ILE A CB    1 
ATOM   1726 C CG1   . ILE B 2 122 ? -15.442 12.287 38.803  1.00 69.50 ? 123 ILE A CG1   1 
ATOM   1727 C CG2   . ILE B 2 122 ? -17.934 12.312 38.295  1.00 69.13 ? 123 ILE A CG2   1 
ATOM   1728 C CD1   . ILE B 2 122 ? -14.288 11.420 39.288  1.00 69.60 ? 123 ILE A CD1   1 
ATOM   1729 N N     . LYS B 2 123 ? -16.736 13.828 41.988  1.00 69.66 ? 124 LYS A N     1 
ATOM   1730 C CA    . LYS B 2 123 ? -17.038 15.192 42.422  1.00 70.19 ? 124 LYS A CA    1 
ATOM   1731 C C     . LYS B 2 123 ? -16.183 16.312 41.804  1.00 70.02 ? 124 LYS A C     1 
ATOM   1732 O O     . LYS B 2 123 ? -16.544 17.492 41.895  1.00 69.93 ? 124 LYS A O     1 
ATOM   1733 C CB    . LYS B 2 123 ? -17.012 15.251 43.961  1.00 69.98 ? 124 LYS A CB    1 
ATOM   1734 C CG    . LYS B 2 123 ? -18.155 14.422 44.591  1.00 70.26 ? 124 LYS A CG    1 
ATOM   1735 C CD    . LYS B 2 123 ? -18.041 14.259 46.108  1.00 70.05 ? 124 LYS A CD    1 
ATOM   1736 C CE    . LYS B 2 123 ? -19.062 13.247 46.661  1.00 69.64 ? 124 LYS A CE    1 
ATOM   1737 N NZ    . LYS B 2 123 ? -18.808 12.874 48.097  1.00 68.36 ? 124 LYS A NZ    1 
ATOM   1738 N N     . SER B 2 124 ? -15.073 15.946 41.158  1.00 69.42 ? 125 SER A N     1 
ATOM   1739 C CA    . SER B 2 124 ? -14.180 16.924 40.514  1.00 68.13 ? 125 SER A CA    1 
ATOM   1740 C C     . SER B 2 124 ? -13.220 16.246 39.539  1.00 66.47 ? 125 SER A C     1 
ATOM   1741 O O     . SER B 2 124 ? -12.897 15.065 39.697  1.00 66.12 ? 125 SER A O     1 
ATOM   1742 C CB    . SER B 2 124 ? -13.371 17.706 41.563  1.00 68.75 ? 125 SER A CB    1 
ATOM   1743 O OG    . SER B 2 124 ? -14.122 18.783 42.113  1.00 69.20 ? 125 SER A OG    1 
ATOM   1744 N N     . ALA B 2 125 ? -12.768 16.990 38.530  1.00 64.81 ? 126 ALA A N     1 
ATOM   1745 C CA    . ALA B 2 125 ? -11.852 16.428 37.542  1.00 62.99 ? 126 ALA A CA    1 
ATOM   1746 C C     . ALA B 2 125 ? -10.787 15.602 38.265  1.00 62.12 ? 126 ALA A C     1 
ATOM   1747 O O     . ALA B 2 125 ? -10.506 14.471 37.879  1.00 62.51 ? 126 ALA A O     1 
ATOM   1748 C CB    . ALA B 2 125 ? -11.200 17.543 36.712  1.00 62.32 ? 126 ALA A CB    1 
ATOM   1749 N N     . VAL B 2 126 ? -10.221 16.150 39.336  1.00 60.69 ? 127 VAL A N     1 
ATOM   1750 C CA    . VAL B 2 126 ? -9.191  15.434 40.080  1.00 60.10 ? 127 VAL A CA    1 
ATOM   1751 C C     . VAL B 2 126 ? -9.634  14.065 40.631  1.00 58.79 ? 127 VAL A C     1 
ATOM   1752 O O     . VAL B 2 126 ? -8.816  13.145 40.720  1.00 58.50 ? 127 VAL A O     1 
ATOM   1753 C CB    . VAL B 2 126 ? -8.623  16.300 41.248  1.00 60.87 ? 127 VAL A CB    1 
ATOM   1754 C CG1   . VAL B 2 126 ? -7.974  17.560 40.684  1.00 61.12 ? 127 VAL A CG1   1 
ATOM   1755 C CG2   . VAL B 2 126 ? -9.735  16.660 42.250  1.00 60.69 ? 127 VAL A CG2   1 
ATOM   1756 N N     . ASP B 2 127 ? -10.905 13.920 41.006  1.00 56.98 ? 128 ASP A N     1 
ATOM   1757 C CA    . ASP B 2 127 ? -11.385 12.625 41.512  1.00 55.15 ? 128 ASP A CA    1 
ATOM   1758 C C     . ASP B 2 127 ? -11.224 11.547 40.436  1.00 53.45 ? 128 ASP A C     1 
ATOM   1759 O O     . ASP B 2 127 ? -10.981 10.368 40.731  1.00 52.91 ? 128 ASP A O     1 
ATOM   1760 C CB    . ASP B 2 127 ? -12.873 12.683 41.894  1.00 55.78 ? 128 ASP A CB    1 
ATOM   1761 C CG    . ASP B 2 127 ? -13.104 13.190 43.301  1.00 55.89 ? 128 ASP A CG    1 
ATOM   1762 O OD1   . ASP B 2 127 ? -12.288 12.863 44.194  1.00 56.25 ? 128 ASP A OD1   1 
ATOM   1763 O OD2   . ASP B 2 127 ? -14.118 13.899 43.510  1.00 55.77 ? 128 ASP A OD2   1 
ATOM   1764 N N     . ARG B 2 128 ? -11.372 11.977 39.186  1.00 51.05 ? 129 ARG A N     1 
ATOM   1765 C CA    . ARG B 2 128 ? -11.289 11.101 38.021  1.00 48.45 ? 129 ARG A CA    1 
ATOM   1766 C C     . ARG B 2 128 ? -9.886  10.565 37.736  1.00 46.36 ? 129 ARG A C     1 
ATOM   1767 O O     . ARG B 2 128 ? -9.726  9.464  37.201  1.00 45.40 ? 129 ARG A O     1 
ATOM   1768 C CB    . ARG B 2 128 ? -11.825 11.855 36.800  1.00 48.74 ? 129 ARG A CB    1 
ATOM   1769 C CG    . ARG B 2 128 ? -11.705 11.124 35.493  1.00 49.49 ? 129 ARG A CG    1 
ATOM   1770 C CD    . ARG B 2 128 ? -12.201 11.988 34.326  1.00 51.18 ? 129 ARG A CD    1 
ATOM   1771 N NE    . ARG B 2 128 ? -13.645 12.234 34.376  1.00 52.46 ? 129 ARG A NE    1 
ATOM   1772 C CZ    . ARG B 2 128 ? -14.221 13.238 35.033  1.00 53.29 ? 129 ARG A CZ    1 
ATOM   1773 N NH1   . ARG B 2 128 ? -13.473 14.116 35.703  1.00 54.19 ? 129 ARG A NH1   1 
ATOM   1774 N NH2   . ARG B 2 128 ? -15.548 13.349 35.039  1.00 52.23 ? 129 ARG A NH2   1 
ATOM   1775 N N     . THR B 2 129 ? -8.873  11.333 38.108  1.00 44.62 ? 130 THR A N     1 
ATOM   1776 C CA    . THR B 2 129 ? -7.504  10.920 37.857  1.00 43.49 ? 130 THR A CA    1 
ATOM   1777 C C     . THR B 2 129 ? -7.188  9.538  38.417  1.00 42.92 ? 130 THR A C     1 
ATOM   1778 O O     . THR B 2 129 ? -6.625  8.701  37.717  1.00 43.22 ? 130 THR A O     1 
ATOM   1779 C CB    . THR B 2 129 ? -6.532  11.950 38.418  1.00 42.79 ? 130 THR A CB    1 
ATOM   1780 O OG1   . THR B 2 129 ? -6.955  13.249 38.000  1.00 44.43 ? 130 THR A OG1   1 
ATOM   1781 C CG2   . THR B 2 129 ? -5.128  11.710 37.895  1.00 42.68 ? 130 THR A CG2   1 
ATOM   1782 N N     . PRO B 2 130 ? -7.548  9.273  39.685  1.00 42.27 ? 131 PRO A N     1 
ATOM   1783 C CA    . PRO B 2 130 ? -7.248  7.946  40.230  1.00 41.07 ? 131 PRO A CA    1 
ATOM   1784 C C     . PRO B 2 130 ? -7.727  6.806  39.320  1.00 40.04 ? 131 PRO A C     1 
ATOM   1785 O O     . PRO B 2 130 ? -6.985  5.855  39.082  1.00 40.35 ? 131 PRO A O     1 
ATOM   1786 C CB    . PRO B 2 130 ? -7.955  7.970  41.586  1.00 40.59 ? 131 PRO A CB    1 
ATOM   1787 C CG    . PRO B 2 130 ? -7.823  9.389  41.991  1.00 39.57 ? 131 PRO A CG    1 
ATOM   1788 C CD    . PRO B 2 130 ? -8.163  10.129 40.717  1.00 41.14 ? 131 PRO A CD    1 
ATOM   1789 N N     . PHE B 2 131 ? -8.958  6.916  38.812  1.00 38.54 ? 132 PHE A N     1 
ATOM   1790 C CA    . PHE B 2 131 ? -9.532  5.906  37.920  1.00 37.97 ? 132 PHE A CA    1 
ATOM   1791 C C     . PHE B 2 131 ? -8.718  5.831  36.623  1.00 37.40 ? 132 PHE A C     1 
ATOM   1792 O O     . PHE B 2 131 ? -8.419  4.745  36.121  1.00 37.93 ? 132 PHE A O     1 
ATOM   1793 C CB    . PHE B 2 131 ? -10.994 6.236  37.569  1.00 38.82 ? 132 PHE A CB    1 
ATOM   1794 C CG    . PHE B 2 131 ? -11.939 6.209  38.743  1.00 39.62 ? 132 PHE A CG    1 
ATOM   1795 C CD1   . PHE B 2 131 ? -11.931 7.230  39.692  1.00 41.32 ? 132 PHE A CD1   1 
ATOM   1796 C CD2   . PHE B 2 131 ? -12.847 5.174  38.895  1.00 39.85 ? 132 PHE A CD2   1 
ATOM   1797 C CE1   . PHE B 2 131 ? -12.818 7.220  40.774  1.00 41.88 ? 132 PHE A CE1   1 
ATOM   1798 C CE2   . PHE B 2 131 ? -13.734 5.157  39.974  1.00 41.89 ? 132 PHE A CE2   1 
ATOM   1799 C CZ    . PHE B 2 131 ? -13.719 6.181  40.914  1.00 41.76 ? 132 PHE A CZ    1 
ATOM   1800 N N     . HIS B 2 132 ? -8.381  6.993  36.074  1.00 35.78 ? 133 HIS A N     1 
ATOM   1801 C CA    . HIS B 2 132 ? -7.595  7.055  34.857  1.00 35.06 ? 133 HIS A CA    1 
ATOM   1802 C C     . HIS B 2 132 ? -6.293  6.308  35.082  1.00 35.28 ? 133 HIS A C     1 
ATOM   1803 O O     . HIS B 2 132 ? -5.757  5.686  34.176  1.00 37.14 ? 133 HIS A O     1 
ATOM   1804 C CB    . HIS B 2 132 ? -7.260  8.503  34.506  1.00 35.54 ? 133 HIS A CB    1 
ATOM   1805 C CG    . HIS B 2 132 ? -8.390  9.270  33.898  1.00 35.34 ? 133 HIS A CG    1 
ATOM   1806 N ND1   . HIS B 2 132 ? -8.278  10.597 33.551  1.00 35.01 ? 133 HIS A ND1   1 
ATOM   1807 C CD2   . HIS B 2 132 ? -9.643  8.897  33.551  1.00 36.23 ? 133 HIS A CD2   1 
ATOM   1808 C CE1   . HIS B 2 132 ? -9.413  11.008 33.014  1.00 35.57 ? 133 HIS A CE1   1 
ATOM   1809 N NE2   . HIS B 2 132 ? -10.257 9.995  33.002  1.00 35.42 ? 133 HIS A NE2   1 
ATOM   1810 N N     . HIS B 2 133 ? -5.768  6.372  36.292  1.00 34.54 ? 134 HIS A N     1 
ATOM   1811 C CA    . HIS B 2 133 ? -4.518  5.702  36.553  1.00 35.45 ? 134 HIS A CA    1 
ATOM   1812 C C     . HIS B 2 133 ? -4.663  4.190  36.647  1.00 36.72 ? 134 HIS A C     1 
ATOM   1813 O O     . HIS B 2 133 ? -3.877  3.451  36.050  1.00 37.87 ? 134 HIS A O     1 
ATOM   1814 C CB    . HIS B 2 133 ? -3.888  6.234  37.831  1.00 35.92 ? 134 HIS A CB    1 
ATOM   1815 C CG    . HIS B 2 133 ? -2.579  5.591  38.159  1.00 35.89 ? 134 HIS A CG    1 
ATOM   1816 N ND1   . HIS B 2 133 ? -1.473  5.699  37.343  1.00 35.98 ? 134 HIS A ND1   1 
ATOM   1817 C CD2   . HIS B 2 133 ? -2.207  4.810  39.199  1.00 34.87 ? 134 HIS A CD2   1 
ATOM   1818 C CE1   . HIS B 2 133 ? -0.476  5.011  37.867  1.00 36.60 ? 134 HIS A CE1   1 
ATOM   1819 N NE2   . HIS B 2 133 ? -0.895  4.461  38.993  1.00 36.20 ? 134 HIS A NE2   1 
ATOM   1820 N N     . LYS B 2 134 ? -5.656  3.722  37.397  1.00 37.05 ? 135 LYS A N     1 
ATOM   1821 C CA    . LYS B 2 134 ? -5.857  2.287  37.547  1.00 38.56 ? 135 LYS A CA    1 
ATOM   1822 C C     . LYS B 2 134 ? -6.132  1.618  36.215  1.00 38.43 ? 135 LYS A C     1 
ATOM   1823 O O     . LYS B 2 134 ? -5.741  0.466  35.995  1.00 39.40 ? 135 LYS A O     1 
ATOM   1824 C CB    . LYS B 2 134 ? -7.012  1.991  38.502  1.00 40.54 ? 135 LYS A CB    1 
ATOM   1825 C CG    . LYS B 2 134 ? -6.723  2.329  39.954  1.00 44.11 ? 135 LYS A CG    1 
ATOM   1826 C CD    . LYS B 2 134 ? -5.412  1.719  40.424  1.00 44.89 ? 135 LYS A CD    1 
ATOM   1827 C CE    . LYS B 2 134 ? -5.252  1.835  41.934  1.00 46.49 ? 135 LYS A CE    1 
ATOM   1828 N NZ    . LYS B 2 134 ? -6.265  1.012  42.667  1.00 47.41 ? 135 LYS A NZ    1 
ATOM   1829 N N     . TRP B 2 135 ? -6.812  2.339  35.329  1.00 37.02 ? 136 TRP A N     1 
ATOM   1830 C CA    . TRP B 2 135 ? -7.146  1.811  34.014  1.00 36.79 ? 136 TRP A CA    1 
ATOM   1831 C C     . TRP B 2 135 ? -5.929  1.847  33.108  1.00 36.10 ? 136 TRP A C     1 
ATOM   1832 O O     . TRP B 2 135 ? -5.785  1.029  32.207  1.00 36.25 ? 136 TRP A O     1 
ATOM   1833 C CB    . TRP B 2 135 ? -8.254  2.648  33.369  1.00 37.21 ? 136 TRP A CB    1 
ATOM   1834 C CG    . TRP B 2 135 ? -8.802  2.049  32.097  1.00 37.57 ? 136 TRP A CG    1 
ATOM   1835 C CD1   . TRP B 2 135 ? -9.890  1.229  31.976  1.00 38.11 ? 136 TRP A CD1   1 
ATOM   1836 C CD2   . TRP B 2 135 ? -8.256  2.184  30.779  1.00 37.34 ? 136 TRP A CD2   1 
ATOM   1837 N NE1   . TRP B 2 135 ? -10.054 0.846  30.664  1.00 38.23 ? 136 TRP A NE1   1 
ATOM   1838 C CE2   . TRP B 2 135 ? -9.065  1.421  29.908  1.00 37.63 ? 136 TRP A CE2   1 
ATOM   1839 C CE3   . TRP B 2 135 ? -7.163  2.876  30.248  1.00 37.13 ? 136 TRP A CE3   1 
ATOM   1840 C CZ2   . TRP B 2 135 ? -8.811  1.325  28.542  1.00 38.07 ? 136 TRP A CZ2   1 
ATOM   1841 C CZ3   . TRP B 2 135 ? -6.911  2.779  28.887  1.00 38.14 ? 136 TRP A CZ3   1 
ATOM   1842 C CH2   . TRP B 2 135 ? -7.734  2.011  28.050  1.00 38.18 ? 136 TRP A CH2   1 
ATOM   1843 N N     . LEU B 2 136 ? -5.037  2.786  33.373  1.00 35.09 ? 137 LEU A N     1 
ATOM   1844 C CA    . LEU B 2 136 ? -3.867  2.967  32.537  1.00 35.07 ? 137 LEU A CA    1 
ATOM   1845 C C     . LEU B 2 136 ? -2.609  2.210  32.938  1.00 35.42 ? 137 LEU A C     1 
ATOM   1846 O O     . LEU B 2 136 ? -1.795  1.874  32.080  1.00 34.42 ? 137 LEU A O     1 
ATOM   1847 C CB    . LEU B 2 136 ? -3.572  4.467  32.455  1.00 33.94 ? 137 LEU A CB    1 
ATOM   1848 C CG    . LEU B 2 136 ? -2.863  5.032  31.231  1.00 33.72 ? 137 LEU A CG    1 
ATOM   1849 C CD1   . LEU B 2 136 ? -3.466  4.455  29.963  1.00 33.19 ? 137 LEU A CD1   1 
ATOM   1850 C CD2   . LEU B 2 136 ? -2.988  6.551  31.256  1.00 32.16 ? 137 LEU A CD2   1 
ATOM   1851 N N     . GLU B 2 137 ? -2.447  1.929  34.229  1.00 36.10 ? 138 GLU A N     1 
ATOM   1852 C CA    . GLU B 2 137 ? -1.239  1.250  34.694  1.00 35.84 ? 138 GLU A CA    1 
ATOM   1853 C C     . GLU B 2 137 ? -1.002  -0.159 34.168  1.00 35.19 ? 138 GLU A C     1 
ATOM   1854 O O     . GLU B 2 137 ? 0.121   -0.503 33.821  1.00 36.12 ? 138 GLU A O     1 
ATOM   1855 C CB    . GLU B 2 137 ? -1.170  1.264  36.228  1.00 35.85 ? 138 GLU A CB    1 
ATOM   1856 C CG    . GLU B 2 137 ? -2.135  0.362  36.980  1.00 38.07 ? 138 GLU A CG    1 
ATOM   1857 C CD    . GLU B 2 137 ? -1.968  0.522  38.491  1.00 40.37 ? 138 GLU A CD    1 
ATOM   1858 O OE1   . GLU B 2 137 ? -0.827  0.790  38.929  1.00 40.75 ? 138 GLU A OE1   1 
ATOM   1859 O OE2   . GLU B 2 137 ? -2.957  0.379  39.245  1.00 40.95 ? 138 GLU A OE2   1 
ATOM   1860 N N     . GLY B 2 138 ? -2.048  -0.969 34.091  1.00 34.03 ? 139 GLY A N     1 
ATOM   1861 C CA    . GLY B 2 138 ? -1.869  -2.321 33.603  1.00 33.44 ? 139 GLY A CA    1 
ATOM   1862 C C     . GLY B 2 138 ? -1.686  -2.450 32.097  1.00 34.19 ? 139 GLY A C     1 
ATOM   1863 O O     . GLY B 2 138 ? -0.978  -3.349 31.625  1.00 35.43 ? 139 GLY A O     1 
ATOM   1864 N N     . ARG B 2 139 ? -2.300  -1.544 31.340  1.00 33.46 ? 140 ARG A N     1 
ATOM   1865 C CA    . ARG B 2 139 ? -2.243  -1.585 29.886  1.00 32.04 ? 140 ARG A CA    1 
ATOM   1866 C C     . ARG B 2 139 ? -1.092  -0.856 29.205  1.00 33.77 ? 140 ARG A C     1 
ATOM   1867 O O     . ARG B 2 139 ? -0.721  -1.199 28.086  1.00 35.51 ? 140 ARG A O     1 
ATOM   1868 C CB    . ARG B 2 139 ? -3.554  -1.059 29.318  1.00 30.05 ? 140 ARG A CB    1 
ATOM   1869 C CG    . ARG B 2 139 ? -4.781  -1.732 29.876  1.00 28.00 ? 140 ARG A CG    1 
ATOM   1870 C CD    . ARG B 2 139 ? -6.014  -0.993 29.426  1.00 27.33 ? 140 ARG A CD    1 
ATOM   1871 N NE    . ARG B 2 139 ? -7.040  -0.988 30.457  1.00 27.17 ? 140 ARG A NE    1 
ATOM   1872 C CZ    . ARG B 2 139 ? -8.029  -1.862 30.533  1.00 27.46 ? 140 ARG A CZ    1 
ATOM   1873 N NH1   . ARG B 2 139 ? -8.134  -2.820 29.630  1.00 27.56 ? 140 ARG A NH1   1 
ATOM   1874 N NH2   . ARG B 2 139 ? -8.913  -1.775 31.512  1.00 28.05 ? 140 ARG A NH2   1 
ATOM   1875 N N     . ILE B 2 140 ? -0.526  0.149  29.858  1.00 35.07 ? 141 ILE A N     1 
ATOM   1876 C CA    . ILE B 2 140 ? 0.562   0.905  29.243  1.00 36.08 ? 141 ILE A CA    1 
ATOM   1877 C C     . ILE B 2 140 ? 1.927   0.337  29.595  1.00 37.34 ? 141 ILE A C     1 
ATOM   1878 O O     . ILE B 2 140 ? 2.951   0.783  29.072  1.00 38.16 ? 141 ILE A O     1 
ATOM   1879 C CB    . ILE B 2 140 ? 0.520   2.395  29.659  1.00 35.99 ? 141 ILE A CB    1 
ATOM   1880 C CG1   . ILE B 2 140 ? 1.332   3.233  28.675  1.00 35.78 ? 141 ILE A CG1   1 
ATOM   1881 C CG2   . ILE B 2 140 ? 1.061   2.564  31.058  1.00 35.91 ? 141 ILE A CG2   1 
ATOM   1882 C CD1   . ILE B 2 140 ? 0.755   3.248  27.264  1.00 35.58 ? 141 ILE A CD1   1 
ATOM   1883 N N     . LYS B 2 141 ? 1.938   -0.651 30.483  1.00 38.42 ? 142 LYS A N     1 
ATOM   1884 C CA    . LYS B 2 141 ? 3.183   -1.270 30.900  1.00 38.74 ? 142 LYS A CA    1 
ATOM   1885 C C     . LYS B 2 141 ? 3.887   -1.805 29.654  1.00 38.65 ? 142 LYS A C     1 
ATOM   1886 O O     . LYS B 2 141 ? 3.253   -2.388 28.770  1.00 38.53 ? 142 LYS A O     1 
ATOM   1887 C CB    . LYS B 2 141 ? 2.907   -2.408 31.883  1.00 39.25 ? 142 LYS A CB    1 
ATOM   1888 C CG    . LYS B 2 141 ? 4.096   -2.760 32.767  1.00 42.34 ? 142 LYS A CG    1 
ATOM   1889 C CD    . LYS B 2 141 ? 4.080   -1.977 34.083  1.00 44.54 ? 142 LYS A CD    1 
ATOM   1890 C CE    . LYS B 2 141 ? 5.445   -2.001 34.793  1.00 44.87 ? 142 LYS A CE    1 
ATOM   1891 N NZ    . LYS B 2 141 ? 6.012   -3.375 34.940  1.00 45.96 ? 142 LYS A NZ    1 
ATOM   1892 N N     . GLY B 2 142 ? 5.192   -1.567 29.577  1.00 38.53 ? 143 GLY A N     1 
ATOM   1893 C CA    . GLY B 2 142 ? 5.977   -2.039 28.451  1.00 39.04 ? 143 GLY A CA    1 
ATOM   1894 C C     . GLY B 2 142 ? 5.960   -1.207 27.178  1.00 39.49 ? 143 GLY A C     1 
ATOM   1895 O O     . GLY B 2 142 ? 6.522   -1.630 26.167  1.00 39.56 ? 143 GLY A O     1 
ATOM   1896 N N     . LYS B 2 143 ? 5.329   -0.035 27.208  1.00 39.38 ? 144 LYS A N     1 
ATOM   1897 C CA    . LYS B 2 143 ? 5.274   0.812  26.022  1.00 39.41 ? 144 LYS A CA    1 
ATOM   1898 C C     . LYS B 2 143 ? 5.584   2.262  26.355  1.00 39.27 ? 144 LYS A C     1 
ATOM   1899 O O     . LYS B 2 143 ? 5.503   3.140  25.497  1.00 39.00 ? 144 LYS A O     1 
ATOM   1900 C CB    . LYS B 2 143 ? 3.894   0.727  25.375  1.00 40.89 ? 144 LYS A CB    1 
ATOM   1901 C CG    . LYS B 2 143 ? 3.394   -0.685 25.159  1.00 42.72 ? 144 LYS A CG    1 
ATOM   1902 C CD    . LYS B 2 143 ? 2.641   -0.793 23.846  1.00 43.78 ? 144 LYS A CD    1 
ATOM   1903 C CE    . LYS B 2 143 ? 1.756   -2.017 23.830  1.00 45.31 ? 144 LYS A CE    1 
ATOM   1904 N NZ    . LYS B 2 143 ? 0.750   -1.917 24.927  1.00 46.59 ? 144 LYS A NZ    1 
ATOM   1905 N N     . GLU B 2 144 ? 5.931   2.502  27.613  1.00 39.32 ? 145 GLU A N     1 
ATOM   1906 C CA    . GLU B 2 144 ? 6.266   3.839  28.099  1.00 39.19 ? 145 GLU A CA    1 
ATOM   1907 C C     . GLU B 2 144 ? 7.100   4.662  27.116  1.00 38.35 ? 145 GLU A C     1 
ATOM   1908 O O     . GLU B 2 144 ? 6.833   5.839  26.900  1.00 38.69 ? 145 GLU A O     1 
ATOM   1909 C CB    . GLU B 2 144 ? 7.020   3.722  29.419  1.00 39.78 ? 145 GLU A CB    1 
ATOM   1910 C CG    . GLU B 2 144 ? 8.002   2.563  29.434  1.00 41.98 ? 145 GLU A CG    1 
ATOM   1911 C CD    . GLU B 2 144 ? 7.329   1.248  29.769  1.00 41.90 ? 145 GLU A CD    1 
ATOM   1912 O OE1   . GLU B 2 144 ? 7.882   0.188  29.407  1.00 42.33 ? 145 GLU A OE1   1 
ATOM   1913 O OE2   . GLU B 2 144 ? 6.251   1.279  30.407  1.00 41.06 ? 145 GLU A OE2   1 
ATOM   1914 N N     . ASN B 2 145 ? 8.114   4.043  26.524  1.00 37.48 ? 146 ASN A N     1 
ATOM   1915 C CA    . ASN B 2 145 ? 8.973   4.747  25.582  1.00 36.00 ? 146 ASN A CA    1 
ATOM   1916 C C     . ASN B 2 145 ? 8.264   5.105  24.294  1.00 34.38 ? 146 ASN A C     1 
ATOM   1917 O O     . ASN B 2 145 ? 8.758   5.906  23.500  1.00 33.68 ? 146 ASN A O     1 
ATOM   1918 C CB    . ASN B 2 145 ? 10.218  3.916  25.299  1.00 36.46 ? 146 ASN A CB    1 
ATOM   1919 C CG    . ASN B 2 145 ? 11.131  3.842  26.500  1.00 37.28 ? 146 ASN A CG    1 
ATOM   1920 O OD1   . ASN B 2 145 ? 11.595  4.868  26.999  1.00 38.08 ? 146 ASN A OD1   1 
ATOM   1921 N ND2   . ASN B 2 145 ? 11.380  2.634  26.984  1.00 38.13 ? 146 ASN A ND2   1 
ATOM   1922 N N     . GLU B 2 146 ? 7.103   4.502  24.084  1.00 32.51 ? 147 GLU A N     1 
ATOM   1923 C CA    . GLU B 2 146 ? 6.325   4.815  22.906  1.00 31.82 ? 147 GLU A CA    1 
ATOM   1924 C C     . GLU B 2 146 ? 5.578   6.081  23.276  1.00 30.57 ? 147 GLU A C     1 
ATOM   1925 O O     . GLU B 2 146 ? 5.470   7.015  22.484  1.00 31.18 ? 147 GLU A O     1 
ATOM   1926 C CB    . GLU B 2 146 ? 5.353   3.683  22.574  1.00 32.51 ? 147 GLU A CB    1 
ATOM   1927 C CG    . GLU B 2 146 ? 6.025   2.451  22.001  1.00 33.41 ? 147 GLU A CG    1 
ATOM   1928 C CD    . GLU B 2 146 ? 6.943   2.789  20.848  1.00 34.94 ? 147 GLU A CD    1 
ATOM   1929 O OE1   . GLU B 2 146 ? 6.549   3.631  20.013  1.00 35.91 ? 147 GLU A OE1   1 
ATOM   1930 O OE2   . GLU B 2 146 ? 8.051   2.215  20.768  1.00 35.50 ? 147 GLU A OE2   1 
ATOM   1931 N N     . VAL B 2 147 ? 5.083   6.117  24.504  1.00 29.07 ? 148 VAL A N     1 
ATOM   1932 C CA    . VAL B 2 147 ? 4.366   7.285  24.982  1.00 28.10 ? 148 VAL A CA    1 
ATOM   1933 C C     . VAL B 2 147 ? 5.284   8.490  24.911  1.00 28.10 ? 148 VAL A C     1 
ATOM   1934 O O     . VAL B 2 147 ? 4.917   9.528  24.361  1.00 27.87 ? 148 VAL A O     1 
ATOM   1935 C CB    . VAL B 2 147 ? 3.893   7.091  26.430  1.00 27.10 ? 148 VAL A CB    1 
ATOM   1936 C CG1   . VAL B 2 147 ? 3.541   8.431  27.049  1.00 26.01 ? 148 VAL A CG1   1 
ATOM   1937 C CG2   . VAL B 2 147 ? 2.679   6.167  26.452  1.00 26.64 ? 148 VAL A CG2   1 
ATOM   1938 N N     . ARG B 2 148 ? 6.486   8.335  25.457  1.00 28.73 ? 149 ARG A N     1 
ATOM   1939 C CA    . ARG B 2 148 ? 7.481   9.400  25.466  1.00 29.72 ? 149 ARG A CA    1 
ATOM   1940 C C     . ARG B 2 148 ? 7.793   9.909  24.066  1.00 28.77 ? 149 ARG A C     1 
ATOM   1941 O O     . ARG B 2 148 ? 7.818   11.117 23.830  1.00 28.29 ? 149 ARG A O     1 
ATOM   1942 C CB    . ARG B 2 148 ? 8.758   8.916  26.165  1.00 30.61 ? 149 ARG A CB    1 
ATOM   1943 C CG    . ARG B 2 148 ? 8.662   8.975  27.683  1.00 31.57 ? 149 ARG A CG    1 
ATOM   1944 C CD    . ARG B 2 148 ? 9.779   8.209  28.372  1.00 34.45 ? 149 ARG A CD    1 
ATOM   1945 N NE    . ARG B 2 148 ? 9.676   8.305  29.831  1.00 34.87 ? 149 ARG A NE    1 
ATOM   1946 C CZ    . ARG B 2 148 ? 10.044  7.349  30.679  1.00 33.60 ? 149 ARG A CZ    1 
ATOM   1947 N NH1   . ARG B 2 148 ? 10.544  6.203  30.231  1.00 31.61 ? 149 ARG A NH1   1 
ATOM   1948 N NH2   . ARG B 2 148 ? 9.903   7.539  31.980  1.00 32.86 ? 149 ARG A NH2   1 
ATOM   1949 N N     . LEU B 2 149 ? 8.032   8.990  23.138  1.00 28.20 ? 150 LEU A N     1 
ATOM   1950 C CA    . LEU B 2 149 ? 8.316   9.382  21.762  1.00 27.73 ? 150 LEU A CA    1 
ATOM   1951 C C     . LEU B 2 149 ? 7.200   10.283 21.253  1.00 27.59 ? 150 LEU A C     1 
ATOM   1952 O O     . LEU B 2 149 ? 7.465   11.315 20.641  1.00 27.85 ? 150 LEU A O     1 
ATOM   1953 C CB    . LEU B 2 149 ? 8.413   8.155  20.853  1.00 28.17 ? 150 LEU A CB    1 
ATOM   1954 C CG    . LEU B 2 149 ? 9.747   7.428  20.707  1.00 27.95 ? 150 LEU A CG    1 
ATOM   1955 C CD1   . LEU B 2 149 ? 9.536   6.160  19.885  1.00 28.50 ? 150 LEU A CD1   1 
ATOM   1956 C CD2   . LEU B 2 149 ? 10.756  8.342  20.032  1.00 27.09 ? 150 LEU A CD2   1 
ATOM   1957 N N     . LEU B 2 150 ? 5.957   9.883  21.519  1.00 26.21 ? 151 LEU A N     1 
ATOM   1958 C CA    . LEU B 2 150 ? 4.787   10.626 21.077  1.00 25.68 ? 151 LEU A CA    1 
ATOM   1959 C C     . LEU B 2 150 ? 4.648   11.999 21.717  1.00 27.26 ? 151 LEU A C     1 
ATOM   1960 O O     . LEU B 2 150 ? 3.984   12.871 21.167  1.00 27.61 ? 151 LEU A O     1 
ATOM   1961 C CB    . LEU B 2 150 ? 3.516   9.816  21.334  1.00 23.69 ? 151 LEU A CB    1 
ATOM   1962 C CG    . LEU B 2 150 ? 2.203   10.458 20.881  1.00 22.08 ? 151 LEU A CG    1 
ATOM   1963 C CD1   . LEU B 2 150 ? 2.285   10.797 19.420  1.00 19.79 ? 151 LEU A CD1   1 
ATOM   1964 C CD2   . LEU B 2 150 ? 1.057   9.515  21.118  1.00 22.16 ? 151 LEU A CD2   1 
ATOM   1965 N N     . LYS B 2 151 ? 5.256   12.197 22.881  1.00 28.71 ? 152 LYS A N     1 
ATOM   1966 C CA    . LYS B 2 151 ? 5.176   13.496 23.543  1.00 29.92 ? 152 LYS A CA    1 
ATOM   1967 C C     . LYS B 2 151 ? 6.288   14.401 23.023  1.00 29.91 ? 152 LYS A C     1 
ATOM   1968 O O     . LYS B 2 151 ? 6.056   15.564 22.703  1.00 29.83 ? 152 LYS A O     1 
ATOM   1969 C CB    . LYS B 2 151 ? 5.311   13.345 25.059  1.00 30.94 ? 152 LYS A CB    1 
ATOM   1970 C CG    . LYS B 2 151 ? 4.185   12.573 25.716  1.00 31.99 ? 152 LYS A CG    1 
ATOM   1971 C CD    . LYS B 2 151 ? 4.436   12.413 27.210  1.00 32.79 ? 152 LYS A CD    1 
ATOM   1972 C CE    . LYS B 2 151 ? 3.282   11.690 27.887  1.00 34.29 ? 152 LYS A CE    1 
ATOM   1973 N NZ    . LYS B 2 151 ? 3.516   11.499 29.345  1.00 35.90 ? 152 LYS A NZ    1 
ATOM   1974 N N     . GLY B 2 152 ? 7.499   13.860 22.947  1.00 29.63 ? 153 GLY A N     1 
ATOM   1975 C CA    . GLY B 2 152 ? 8.619   14.640 22.453  1.00 29.97 ? 153 GLY A CA    1 
ATOM   1976 C C     . GLY B 2 152 ? 8.346   15.124 21.043  1.00 29.81 ? 153 GLY A C     1 
ATOM   1977 O O     . GLY B 2 152 ? 8.823   16.175 20.628  1.00 29.83 ? 153 GLY A O     1 
ATOM   1978 N N     . PHE B 2 153 ? 7.575   14.337 20.306  1.00 28.68 ? 154 PHE A N     1 
ATOM   1979 C CA    . PHE B 2 153 ? 7.198   14.661 18.940  1.00 28.00 ? 154 PHE A CA    1 
ATOM   1980 C C     . PHE B 2 153 ? 6.179   15.802 18.981  1.00 28.05 ? 154 PHE A C     1 
ATOM   1981 O O     . PHE B 2 153 ? 6.308   16.790 18.262  1.00 28.16 ? 154 PHE A O     1 
ATOM   1982 C CB    . PHE B 2 153 ? 6.573   13.430 18.285  1.00 28.34 ? 154 PHE A CB    1 
ATOM   1983 C CG    . PHE B 2 153 ? 6.175   13.628 16.857  1.00 27.85 ? 154 PHE A CG    1 
ATOM   1984 C CD1   . PHE B 2 153 ? 7.117   13.551 15.843  1.00 28.24 ? 154 PHE A CD1   1 
ATOM   1985 C CD2   . PHE B 2 153 ? 4.857   13.890 16.525  1.00 27.92 ? 154 PHE A CD2   1 
ATOM   1986 C CE1   . PHE B 2 153 ? 6.750   13.726 14.523  1.00 28.35 ? 154 PHE A CE1   1 
ATOM   1987 C CE2   . PHE B 2 153 ? 4.482   14.068 15.205  1.00 29.38 ? 154 PHE A CE2   1 
ATOM   1988 C CZ    . PHE B 2 153 ? 5.429   13.988 14.204  1.00 29.08 ? 154 PHE A CZ    1 
ATOM   1989 N N     . LEU B 2 154 ? 5.168   15.662 19.833  1.00 27.37 ? 155 LEU A N     1 
ATOM   1990 C CA    . LEU B 2 154 ? 4.132   16.681 19.964  1.00 26.64 ? 155 LEU A CA    1 
ATOM   1991 C C     . LEU B 2 154 ? 4.671   17.930 20.654  1.00 27.15 ? 155 LEU A C     1 
ATOM   1992 O O     . LEU B 2 154 ? 4.332   19.053 20.286  1.00 26.47 ? 155 LEU A O     1 
ATOM   1993 C CB    . LEU B 2 154 ? 2.950   16.132 20.765  1.00 24.24 ? 155 LEU A CB    1 
ATOM   1994 C CG    . LEU B 2 154 ? 2.128   15.008 20.149  1.00 20.80 ? 155 LEU A CG    1 
ATOM   1995 C CD1   . LEU B 2 154 ? 1.342   14.284 21.224  1.00 20.27 ? 155 LEU A CD1   1 
ATOM   1996 C CD2   . LEU B 2 154 ? 1.214   15.592 19.117  1.00 19.79 ? 155 LEU A CD2   1 
ATOM   1997 N N     . LYS B 2 155 ? 5.510   17.731 21.660  1.00 28.41 ? 156 LYS A N     1 
ATOM   1998 C CA    . LYS B 2 155 ? 6.079   18.855 22.386  1.00 29.81 ? 156 LYS A CA    1 
ATOM   1999 C C     . LYS B 2 155 ? 7.013   19.636 21.473  1.00 30.22 ? 156 LYS A C     1 
ATOM   2000 O O     . LYS B 2 155 ? 6.950   20.861 21.412  1.00 30.94 ? 156 LYS A O     1 
ATOM   2001 C CB    . LYS B 2 155 ? 6.825   18.360 23.633  1.00 28.87 ? 156 LYS A CB    1 
ATOM   2002 C CG    . LYS B 2 155 ? 7.333   19.463 24.555  1.00 29.16 ? 156 LYS A CG    1 
ATOM   2003 C CD    . LYS B 2 155 ? 7.428   18.964 25.999  1.00 30.74 ? 156 LYS A CD    1 
ATOM   2004 C CE    . LYS B 2 155 ? 8.195   19.921 26.913  1.00 30.26 ? 156 LYS A CE    1 
ATOM   2005 N NZ    . LYS B 2 155 ? 9.667   19.811 26.725  1.00 30.34 ? 156 LYS A NZ    1 
ATOM   2006 N N     . ALA B 2 156 ? 7.862   18.919 20.746  1.00 29.62 ? 157 ALA A N     1 
ATOM   2007 C CA    . ALA B 2 156 ? 8.809   19.550 19.841  1.00 29.21 ? 157 ALA A CA    1 
ATOM   2008 C C     . ALA B 2 156 ? 8.131   20.439 18.814  1.00 28.95 ? 157 ALA A C     1 
ATOM   2009 O O     . ALA B 2 156 ? 8.685   21.463 18.414  1.00 29.47 ? 157 ALA A O     1 
ATOM   2010 C CB    . ALA B 2 156 ? 9.627   18.494 19.137  1.00 29.35 ? 157 ALA A CB    1 
ATOM   2011 N N     . ASN B 2 157 ? 6.932   20.052 18.388  1.00 28.19 ? 158 ASN A N     1 
ATOM   2012 C CA    . ASN B 2 157 ? 6.213   20.827 17.388  1.00 27.75 ? 158 ASN A CA    1 
ATOM   2013 C C     . ASN B 2 157 ? 5.199   21.833 17.927  1.00 27.71 ? 158 ASN A C     1 
ATOM   2014 O O     . ASN B 2 157 ? 4.351   22.309 17.194  1.00 28.37 ? 158 ASN A O     1 
ATOM   2015 C CB    . ASN B 2 157 ? 5.558   19.881 16.390  1.00 27.49 ? 158 ASN A CB    1 
ATOM   2016 C CG    . ASN B 2 157 ? 6.581   19.088 15.582  1.00 28.90 ? 158 ASN A CG    1 
ATOM   2017 O OD1   . ASN B 2 157 ? 7.342   19.648 14.797  1.00 30.17 ? 158 ASN A OD1   1 
ATOM   2018 N ND2   . ASN B 2 157 ? 6.601   17.779 15.778  1.00 30.39 ? 158 ASN A ND2   1 
ATOM   2019 N N     . GLY B 2 158 ? 5.288   22.142 19.215  1.00 27.46 ? 159 GLY A N     1 
ATOM   2020 C CA    . GLY B 2 158 ? 4.417   23.137 19.824  1.00 26.22 ? 159 GLY A CA    1 
ATOM   2021 C C     . GLY B 2 158 ? 2.988   22.794 20.165  1.00 26.05 ? 159 GLY A C     1 
ATOM   2022 O O     . GLY B 2 158 ? 2.195   23.677 20.479  1.00 25.33 ? 159 GLY A O     1 
ATOM   2023 N N     . ILE B 2 159 ? 2.648   21.518 20.123  1.00 27.13 ? 160 ILE A N     1 
ATOM   2024 C CA    . ILE B 2 159 ? 1.285   21.112 20.424  1.00 27.77 ? 160 ILE A CA    1 
ATOM   2025 C C     . ILE B 2 159 ? 1.200   20.032 21.503  1.00 29.34 ? 160 ILE A C     1 
ATOM   2026 O O     . ILE B 2 159 ? 0.422   19.094 21.377  1.00 28.86 ? 160 ILE A O     1 
ATOM   2027 C CB    . ILE B 2 159 ? 0.592   20.607 19.145  1.00 25.97 ? 160 ILE A CB    1 
ATOM   2028 C CG1   . ILE B 2 159 ? 1.510   19.631 18.416  1.00 24.22 ? 160 ILE A CG1   1 
ATOM   2029 C CG2   . ILE B 2 159 ? 0.254   21.766 18.241  1.00 24.08 ? 160 ILE A CG2   1 
ATOM   2030 C CD1   . ILE B 2 159 ? 0.904   19.055 17.176  1.00 24.75 ? 160 ILE A CD1   1 
ATOM   2031 N N     . TYR B 2 160 ? 1.976   20.164 22.575  1.00 31.52 ? 161 TYR A N     1 
ATOM   2032 C CA    . TYR B 2 160 ? 1.937   19.144 23.614  1.00 32.19 ? 161 TYR A CA    1 
ATOM   2033 C C     . TYR B 2 160 ? 1.056   19.435 24.816  1.00 32.09 ? 161 TYR A C     1 
ATOM   2034 O O     . TYR B 2 160 ? 0.668   18.518 25.531  1.00 33.26 ? 161 TYR A O     1 
ATOM   2035 C CB    . TYR B 2 160 ? 3.339   18.802 24.110  1.00 32.86 ? 161 TYR A CB    1 
ATOM   2036 C CG    . TYR B 2 160 ? 3.312   17.805 25.244  1.00 33.90 ? 161 TYR A CG    1 
ATOM   2037 C CD1   . TYR B 2 160 ? 2.665   16.577 25.101  1.00 34.15 ? 161 TYR A CD1   1 
ATOM   2038 C CD2   . TYR B 2 160 ? 3.870   18.115 26.486  1.00 34.81 ? 161 TYR A CD2   1 
ATOM   2039 C CE1   . TYR B 2 160 ? 2.570   15.691 26.163  1.00 34.24 ? 161 TYR A CE1   1 
ATOM   2040 C CE2   . TYR B 2 160 ? 3.780   17.232 27.555  1.00 34.55 ? 161 TYR A CE2   1 
ATOM   2041 C CZ    . TYR B 2 160 ? 3.129   16.025 27.387  1.00 34.03 ? 161 TYR A CZ    1 
ATOM   2042 O OH    . TYR B 2 160 ? 3.043   15.154 28.447  1.00 34.10 ? 161 TYR A OH    1 
ATOM   2043 N N     . GLY B 2 161 ? 0.729   20.691 25.058  1.00 31.91 ? 162 GLY A N     1 
ATOM   2044 C CA    . GLY B 2 161 ? -0.119  20.970 26.203  1.00 31.89 ? 162 GLY A CA    1 
ATOM   2045 C C     . GLY B 2 161 ? -1.609  20.864 25.935  1.00 31.16 ? 162 GLY A C     1 
ATOM   2046 O O     . GLY B 2 161 ? -2.061  20.917 24.800  1.00 30.88 ? 162 GLY A O     1 
ATOM   2047 N N     . ALA B 2 162 ? -2.381  20.708 26.997  1.00 31.78 ? 163 ALA A N     1 
ATOM   2048 C CA    . ALA B 2 162 ? -3.832  20.632 26.877  1.00 31.71 ? 163 ALA A CA    1 
ATOM   2049 C C     . ALA B 2 162 ? -4.419  21.923 27.439  1.00 31.47 ? 163 ALA A C     1 
ATOM   2050 O O     . ALA B 2 162 ? -5.628  22.135 27.401  1.00 31.13 ? 163 ALA A O     1 
ATOM   2051 C CB    . ALA B 2 162 ? -4.365  19.439 27.652  1.00 32.61 ? 163 ALA A CB    1 
ATOM   2052 N N     . GLU B 2 163 ? -3.548  22.781 27.963  1.00 31.59 ? 164 GLU A N     1 
ATOM   2053 C CA    . GLU B 2 163 ? -3.973  24.050 28.531  1.00 31.08 ? 164 GLU A CA    1 
ATOM   2054 C C     . GLU B 2 163 ? -4.203  25.062 27.428  1.00 30.50 ? 164 GLU A C     1 
ATOM   2055 O O     . GLU B 2 163 ? -3.660  24.939 26.336  1.00 30.49 ? 164 GLU A O     1 
ATOM   2056 C CB    . GLU B 2 163 ? -2.931  24.596 29.510  1.00 31.31 ? 164 GLU A CB    1 
ATOM   2057 C CG    . GLU B 2 163 ? -1.638  25.080 28.881  1.00 31.60 ? 164 GLU A CG    1 
ATOM   2058 C CD    . GLU B 2 163 ? -0.591  23.995 28.780  1.00 32.39 ? 164 GLU A CD    1 
ATOM   2059 O OE1   . GLU B 2 163 ? 0.612   24.337 28.759  1.00 33.11 ? 164 GLU A OE1   1 
ATOM   2060 O OE2   . GLU B 2 163 ? -0.962  22.806 28.717  1.00 31.89 ? 164 GLU A OE2   1 
ATOM   2061 N N     . TYR B 2 164 ? -4.996  26.079 27.742  1.00 29.15 ? 165 TYR A N     1 
ATOM   2062 C CA    . TYR B 2 164 ? -5.350  27.115 26.792  1.00 27.14 ? 165 TYR A CA    1 
ATOM   2063 C C     . TYR B 2 164 ? -4.239  27.858 26.090  1.00 27.17 ? 165 TYR A C     1 
ATOM   2064 O O     . TYR B 2 164 ? -4.510  28.647 25.191  1.00 28.03 ? 165 TYR A O     1 
ATOM   2065 C CB    . TYR B 2 164 ? -6.295  28.108 27.449  1.00 27.23 ? 165 TYR A CB    1 
ATOM   2066 C CG    . TYR B 2 164 ? -7.689  27.565 27.543  1.00 27.53 ? 165 TYR A CG    1 
ATOM   2067 C CD1   . TYR B 2 164 ? -8.239  27.204 28.764  1.00 28.19 ? 165 TYR A CD1   1 
ATOM   2068 C CD2   . TYR B 2 164 ? -8.459  27.397 26.399  1.00 27.81 ? 165 TYR A CD2   1 
ATOM   2069 C CE1   . TYR B 2 164 ? -9.529  26.691 28.841  1.00 27.77 ? 165 TYR A CE1   1 
ATOM   2070 C CE2   . TYR B 2 164 ? -9.744  26.886 26.464  1.00 27.07 ? 165 TYR A CE2   1 
ATOM   2071 C CZ    . TYR B 2 164 ? -10.275 26.538 27.685  1.00 27.05 ? 165 TYR A CZ    1 
ATOM   2072 O OH    . TYR B 2 164 ? -11.563 26.062 27.753  1.00 28.58 ? 165 TYR A OH    1 
ATOM   2073 N N     . LYS B 2 165 ? -2.992  27.632 26.476  1.00 26.37 ? 166 LYS A N     1 
ATOM   2074 C CA    . LYS B 2 165 ? -1.919  28.314 25.771  1.00 25.90 ? 166 LYS A CA    1 
ATOM   2075 C C     . LYS B 2 165 ? -1.409  27.399 24.658  1.00 24.81 ? 166 LYS A C     1 
ATOM   2076 O O     . LYS B 2 165 ? -0.626  27.806 23.804  1.00 24.42 ? 166 LYS A O     1 
ATOM   2077 C CB    . LYS B 2 165 ? -0.776  28.683 26.716  1.00 26.54 ? 166 LYS A CB    1 
ATOM   2078 C CG    . LYS B 2 165 ? 0.353   29.418 26.008  1.00 28.68 ? 166 LYS A CG    1 
ATOM   2079 C CD    . LYS B 2 165 ? 1.457   29.849 26.959  1.00 31.20 ? 166 LYS A CD    1 
ATOM   2080 C CE    . LYS B 2 165 ? 2.600   30.531 26.202  1.00 33.34 ? 166 LYS A CE    1 
ATOM   2081 N NZ    . LYS B 2 165 ? 3.746   30.936 27.077  1.00 35.19 ? 166 LYS A NZ    1 
ATOM   2082 N N     . VAL B 2 166 ? -1.886  26.161 24.661  1.00 24.19 ? 167 VAL A N     1 
ATOM   2083 C CA    . VAL B 2 166 ? -1.471  25.187 23.670  1.00 23.07 ? 167 VAL A CA    1 
ATOM   2084 C C     . VAL B 2 166 ? -2.631  24.599 22.895  1.00 24.69 ? 167 VAL A C     1 
ATOM   2085 O O     . VAL B 2 166 ? -2.578  24.508 21.679  1.00 25.92 ? 167 VAL A O     1 
ATOM   2086 C CB    . VAL B 2 166 ? -0.721  24.036 24.323  1.00 20.97 ? 167 VAL A CB    1 
ATOM   2087 C CG1   . VAL B 2 166 ? -0.185  23.103 23.260  1.00 20.10 ? 167 VAL A CG1   1 
ATOM   2088 C CG2   . VAL B 2 166 ? 0.392   24.579 25.183  1.00 20.06 ? 167 VAL A CG2   1 
ATOM   2089 N N     . ARG B 2 167 ? -3.680  24.187 23.593  1.00 26.90 ? 168 ARG A N     1 
ATOM   2090 C CA    . ARG B 2 167 ? -4.825  23.590 22.922  1.00 28.15 ? 168 ARG A CA    1 
ATOM   2091 C C     . ARG B 2 167 ? -4.355  22.404 22.083  1.00 27.50 ? 168 ARG A C     1 
ATOM   2092 O O     . ARG B 2 167 ? -4.750  22.252 20.928  1.00 27.07 ? 168 ARG A O     1 
ATOM   2093 C CB    . ARG B 2 167 ? -5.497  24.620 22.021  1.00 30.00 ? 168 ARG A CB    1 
ATOM   2094 C CG    . ARG B 2 167 ? -6.366  25.610 22.752  1.00 32.16 ? 168 ARG A CG    1 
ATOM   2095 C CD    . ARG B 2 167 ? -6.970  26.611 21.781  1.00 36.19 ? 168 ARG A CD    1 
ATOM   2096 N NE    . ARG B 2 167 ? -8.117  27.288 22.374  1.00 40.11 ? 168 ARG A NE    1 
ATOM   2097 C CZ    . ARG B 2 167 ? -9.285  26.694 22.602  1.00 43.42 ? 168 ARG A CZ    1 
ATOM   2098 N NH1   . ARG B 2 167 ? -9.457  25.412 22.272  1.00 42.93 ? 168 ARG A NH1   1 
ATOM   2099 N NH2   . ARG B 2 167 ? -10.275 27.374 23.179  1.00 43.86 ? 168 ARG A NH2   1 
ATOM   2100 N N     . GLY B 2 168 ? -3.514  21.563 22.673  1.00 26.84 ? 169 GLY A N     1 
ATOM   2101 C CA    . GLY B 2 168 ? -2.998  20.420 21.952  1.00 27.27 ? 169 GLY A CA    1 
ATOM   2102 C C     . GLY B 2 168 ? -3.368  19.089 22.562  1.00 28.53 ? 169 GLY A C     1 
ATOM   2103 O O     . GLY B 2 168 ? -4.498  18.890 22.997  1.00 29.39 ? 169 GLY A O     1 
ATOM   2104 N N     . PHE B 2 169 ? -2.405  18.172 22.596  1.00 28.17 ? 170 PHE A N     1 
ATOM   2105 C CA    . PHE B 2 169 ? -2.621  16.837 23.136  1.00 27.98 ? 170 PHE A CA    1 
ATOM   2106 C C     . PHE B 2 169 ? -2.242  16.767 24.601  1.00 26.95 ? 170 PHE A C     1 
ATOM   2107 O O     . PHE B 2 169 ? -1.177  17.225 24.977  1.00 26.86 ? 170 PHE A O     1 
ATOM   2108 C CB    . PHE B 2 169 ? -1.786  15.806 22.366  1.00 29.44 ? 170 PHE A CB    1 
ATOM   2109 C CG    . PHE B 2 169 ? -2.122  15.703 20.906  1.00 30.68 ? 170 PHE A CG    1 
ATOM   2110 C CD1   . PHE B 2 169 ? -1.912  16.773 20.050  1.00 31.26 ? 170 PHE A CD1   1 
ATOM   2111 C CD2   . PHE B 2 169 ? -2.647  14.533 20.389  1.00 32.20 ? 170 PHE A CD2   1 
ATOM   2112 C CE1   . PHE B 2 169 ? -2.205  16.676 18.702  1.00 31.22 ? 170 PHE A CE1   1 
ATOM   2113 C CE2   . PHE B 2 169 ? -2.944  14.426 19.038  1.00 32.70 ? 170 PHE A CE2   1 
ATOM   2114 C CZ    . PHE B 2 169 ? -2.726  15.503 18.199  1.00 32.18 ? 170 PHE A CZ    1 
ATOM   2115 N N     . SER B 2 170 ? -3.111  16.186 25.425  1.00 26.26 ? 171 SER A N     1 
ATOM   2116 C CA    . SER B 2 170 ? -2.823  16.045 26.850  1.00 25.92 ? 171 SER A CA    1 
ATOM   2117 C C     . SER B 2 170 ? -2.066  14.739 27.042  1.00 27.01 ? 171 SER A C     1 
ATOM   2118 O O     . SER B 2 170 ? -2.301  13.775 26.316  1.00 27.78 ? 171 SER A O     1 
ATOM   2119 C CB    . SER B 2 170 ? -4.118  16.013 27.679  1.00 26.08 ? 171 SER A CB    1 
ATOM   2120 O OG    . SER B 2 170 ? -4.779  14.759 27.612  1.00 23.51 ? 171 SER A OG    1 
ATOM   2121 N N     . GLY B 2 171 ? -1.154  14.711 28.007  1.00 27.49 ? 172 GLY A N     1 
ATOM   2122 C CA    . GLY B 2 171 ? -0.390  13.504 28.254  1.00 27.98 ? 172 GLY A CA    1 
ATOM   2123 C C     . GLY B 2 171 ? -1.270  12.271 28.364  1.00 28.75 ? 172 GLY A C     1 
ATOM   2124 O O     . GLY B 2 171 ? -0.873  11.178 27.968  1.00 29.16 ? 172 GLY A O     1 
ATOM   2125 N N     . TYR B 2 172 ? -2.471  12.441 28.908  1.00 28.79 ? 173 TYR A N     1 
ATOM   2126 C CA    . TYR B 2 172 ? -3.402  11.329 29.067  1.00 28.87 ? 173 TYR A CA    1 
ATOM   2127 C C     . TYR B 2 172 ? -3.822  10.833 27.694  1.00 28.98 ? 173 TYR A C     1 
ATOM   2128 O O     . TYR B 2 172 ? -3.812  9.637  27.426  1.00 29.94 ? 173 TYR A O     1 
ATOM   2129 C CB    . TYR B 2 172 ? -4.624  11.781 29.870  1.00 29.67 ? 173 TYR A CB    1 
ATOM   2130 C CG    . TYR B 2 172 ? -5.694  10.732 30.063  1.00 30.17 ? 173 TYR A CG    1 
ATOM   2131 C CD1   . TYR B 2 172 ? -5.368  9.433  30.444  1.00 30.71 ? 173 TYR A CD1   1 
ATOM   2132 C CD2   . TYR B 2 172 ? -7.040  11.053 29.903  1.00 30.81 ? 173 TYR A CD2   1 
ATOM   2133 C CE1   . TYR B 2 172 ? -6.361  8.476  30.661  1.00 32.05 ? 173 TYR A CE1   1 
ATOM   2134 C CE2   . TYR B 2 172 ? -8.040  10.107 30.118  1.00 31.71 ? 173 TYR A CE2   1 
ATOM   2135 C CZ    . TYR B 2 172 ? -7.696  8.819  30.494  1.00 32.48 ? 173 TYR A CZ    1 
ATOM   2136 O OH    . TYR B 2 172 ? -8.682  7.873  30.678  1.00 32.67 ? 173 TYR A OH    1 
ATOM   2137 N N     . LEU B 2 173 ? -4.184  11.765 26.826  1.00 27.80 ? 174 LEU A N     1 
ATOM   2138 C CA    . LEU B 2 173 ? -4.586  11.428 25.477  1.00 26.83 ? 174 LEU A CA    1 
ATOM   2139 C C     . LEU B 2 173 ? -3.461  10.650 24.828  1.00 27.32 ? 174 LEU A C     1 
ATOM   2140 O O     . LEU B 2 173 ? -3.689  9.706  24.077  1.00 26.24 ? 174 LEU A O     1 
ATOM   2141 C CB    . LEU B 2 173 ? -4.848  12.702 24.681  1.00 26.36 ? 174 LEU A CB    1 
ATOM   2142 C CG    . LEU B 2 173 ? -5.282  12.544 23.227  1.00 26.33 ? 174 LEU A CG    1 
ATOM   2143 C CD1   . LEU B 2 173 ? -6.451  11.578 23.122  1.00 25.99 ? 174 LEU A CD1   1 
ATOM   2144 C CD2   . LEU B 2 173 ? -5.663  13.900 22.691  1.00 26.24 ? 174 LEU A CD2   1 
ATOM   2145 N N     . CYS B 2 174 ? -2.236  11.047 25.144  1.00 28.17 ? 175 CYS A N     1 
ATOM   2146 C CA    . CYS B 2 174 ? -1.063  10.407 24.577  1.00 30.16 ? 175 CYS A CA    1 
ATOM   2147 C C     . CYS B 2 174 ? -0.936  8.936  24.908  1.00 30.50 ? 175 CYS A C     1 
ATOM   2148 O O     . CYS B 2 174 ? -0.615  8.127  24.040  1.00 32.00 ? 175 CYS A O     1 
ATOM   2149 C CB    . CYS B 2 174 ? 0.192   11.148 25.015  1.00 30.89 ? 175 CYS A CB    1 
ATOM   2150 S SG    . CYS B 2 174 ? 0.273   12.802 24.330  1.00 35.00 ? 175 CYS A SG    1 
ATOM   2151 N N     . GLU B 2 175 ? -1.183  8.578  26.158  1.00 29.16 ? 176 GLU A N     1 
ATOM   2152 C CA    . GLU B 2 175 ? -1.082  7.189  26.532  1.00 28.19 ? 176 GLU A CA    1 
ATOM   2153 C C     . GLU B 2 175 ? -2.262  6.421  25.973  1.00 27.95 ? 176 GLU A C     1 
ATOM   2154 O O     . GLU B 2 175 ? -2.103  5.309  25.470  1.00 28.30 ? 176 GLU A O     1 
ATOM   2155 C CB    . GLU B 2 175 ? -0.984  7.078  28.043  1.00 29.09 ? 176 GLU A CB    1 
ATOM   2156 C CG    . GLU B 2 175 ? 0.310   7.702  28.542  1.00 32.40 ? 176 GLU A CG    1 
ATOM   2157 C CD    . GLU B 2 175 ? 0.537   7.540  30.030  1.00 32.76 ? 176 GLU A CD    1 
ATOM   2158 O OE1   . GLU B 2 175 ? 0.495   6.391  30.515  1.00 34.33 ? 176 GLU A OE1   1 
ATOM   2159 O OE2   . GLU B 2 175 ? 0.773   8.564  30.708  1.00 32.70 ? 176 GLU A OE2   1 
ATOM   2160 N N     . LEU B 2 176 ? -3.446  7.013  26.029  1.00 27.32 ? 177 LEU A N     1 
ATOM   2161 C CA    . LEU B 2 176 ? -4.608  6.339  25.480  1.00 26.99 ? 177 LEU A CA    1 
ATOM   2162 C C     . LEU B 2 176 ? -4.344  6.011  24.020  1.00 27.60 ? 177 LEU A C     1 
ATOM   2163 O O     . LEU B 2 176 ? -4.701  4.934  23.555  1.00 27.74 ? 177 LEU A O     1 
ATOM   2164 C CB    . LEU B 2 176 ? -5.855  7.212  25.583  1.00 26.87 ? 177 LEU A CB    1 
ATOM   2165 C CG    . LEU B 2 176 ? -6.416  7.458  26.979  1.00 28.64 ? 177 LEU A CG    1 
ATOM   2166 C CD1   . LEU B 2 176 ? -7.791  8.070  26.860  1.00 28.34 ? 177 LEU A CD1   1 
ATOM   2167 C CD2   . LEU B 2 176 ? -6.498  6.149  27.731  1.00 29.42 ? 177 LEU A CD2   1 
ATOM   2168 N N     . LEU B 2 177 ? -3.714  6.935  23.297  1.00 28.27 ? 178 LEU A N     1 
ATOM   2169 C CA    . LEU B 2 177 ? -3.408  6.712  21.879  1.00 29.09 ? 178 LEU A CA    1 
ATOM   2170 C C     . LEU B 2 177 ? -2.441  5.548  21.688  1.00 29.47 ? 178 LEU A C     1 
ATOM   2171 O O     . LEU B 2 177 ? -2.655  4.702  20.827  1.00 30.61 ? 178 LEU A O     1 
ATOM   2172 C CB    . LEU B 2 177 ? -2.808  7.972  21.240  1.00 29.13 ? 178 LEU A CB    1 
ATOM   2173 C CG    . LEU B 2 177 ? -3.733  9.150  20.924  1.00 29.38 ? 178 LEU A CG    1 
ATOM   2174 C CD1   . LEU B 2 177 ? -2.911  10.392 20.610  1.00 28.54 ? 178 LEU A CD1   1 
ATOM   2175 C CD2   . LEU B 2 177 ? -4.635  8.787  19.758  1.00 28.98 ? 178 LEU A CD2   1 
ATOM   2176 N N     . ILE B 2 178 ? -1.378  5.513  22.489  1.00 27.88 ? 179 ILE A N     1 
ATOM   2177 C CA    . ILE B 2 178 ? -0.391  4.449  22.398  1.00 26.25 ? 179 ILE A CA    1 
ATOM   2178 C C     . ILE B 2 178 ? -1.053  3.130  22.757  1.00 26.61 ? 179 ILE A C     1 
ATOM   2179 O O     . ILE B 2 178 ? -0.803  2.105  22.125  1.00 27.42 ? 179 ILE A O     1 
ATOM   2180 C CB    . ILE B 2 178 ? 0.797   4.700  23.349  1.00 26.38 ? 179 ILE A CB    1 
ATOM   2181 C CG1   . ILE B 2 178 ? 1.476   6.011  22.991  1.00 24.89 ? 179 ILE A CG1   1 
ATOM   2182 C CG2   . ILE B 2 178 ? 1.808   3.578  23.239  1.00 25.15 ? 179 ILE A CG2   1 
ATOM   2183 C CD1   . ILE B 2 178 ? 1.995   6.040  21.589  1.00 25.89 ? 179 ILE A CD1   1 
ATOM   2184 N N     . VAL B 2 179 ? -1.903  3.149  23.772  1.00 25.96 ? 180 VAL A N     1 
ATOM   2185 C CA    . VAL B 2 179 ? -2.591  1.932  24.177  1.00 26.24 ? 180 VAL A CA    1 
ATOM   2186 C C     . VAL B 2 179 ? -3.513  1.425  23.063  1.00 27.16 ? 180 VAL A C     1 
ATOM   2187 O O     . VAL B 2 179 ? -3.815  0.240  22.986  1.00 26.70 ? 180 VAL A O     1 
ATOM   2188 C CB    . VAL B 2 179 ? -3.413  2.171  25.477  1.00 25.31 ? 180 VAL A CB    1 
ATOM   2189 C CG1   . VAL B 2 179 ? -4.344  1.001  25.742  1.00 24.04 ? 180 VAL A CG1   1 
ATOM   2190 C CG2   . VAL B 2 179 ? -2.470  2.357  26.656  1.00 24.48 ? 180 VAL A CG2   1 
ATOM   2191 N N     . PHE B 2 180 ? -3.934  2.328  22.186  1.00 27.98 ? 181 PHE A N     1 
ATOM   2192 C CA    . PHE B 2 180 ? -4.843  1.978  21.100  1.00 28.96 ? 181 PHE A CA    1 
ATOM   2193 C C     . PHE B 2 180 ? -4.155  1.488  19.837  1.00 29.66 ? 181 PHE A C     1 
ATOM   2194 O O     . PHE B 2 180 ? -4.569  0.494  19.244  1.00 32.97 ? 181 PHE A O     1 
ATOM   2195 C CB    . PHE B 2 180 ? -5.707  3.184  20.741  1.00 28.85 ? 181 PHE A CB    1 
ATOM   2196 C CG    . PHE B 2 180 ? -6.842  2.868  19.807  1.00 29.64 ? 181 PHE A CG    1 
ATOM   2197 C CD1   . PHE B 2 180 ? -8.122  2.639  20.300  1.00 30.49 ? 181 PHE A CD1   1 
ATOM   2198 C CD2   . PHE B 2 180 ? -6.643  2.843  18.429  1.00 30.67 ? 181 PHE A CD2   1 
ATOM   2199 C CE1   . PHE B 2 180 ? -9.191  2.399  19.429  1.00 31.15 ? 181 PHE A CE1   1 
ATOM   2200 C CE2   . PHE B 2 180 ? -7.704  2.604  17.551  1.00 30.51 ? 181 PHE A CE2   1 
ATOM   2201 C CZ    . PHE B 2 180 ? -8.980  2.384  18.052  1.00 29.69 ? 181 PHE A CZ    1 
ATOM   2202 N N     . TYR B 2 181 ? -3.118  2.200  19.416  1.00 29.04 ? 182 TYR A N     1 
ATOM   2203 C CA    . TYR B 2 181 ? -2.394  1.853  18.205  1.00 27.40 ? 182 TYR A CA    1 
ATOM   2204 C C     . TYR B 2 181 ? -1.209  0.934  18.457  1.00 26.89 ? 182 TYR A C     1 
ATOM   2205 O O     . TYR B 2 181 ? -0.699  0.289  17.539  1.00 25.93 ? 182 TYR A O     1 
ATOM   2206 C CB    . TYR B 2 181 ? -1.976  3.141  17.498  1.00 27.22 ? 182 TYR A CB    1 
ATOM   2207 C CG    . TYR B 2 181 ? -3.159  3.846  16.870  1.00 26.87 ? 182 TYR A CG    1 
ATOM   2208 C CD1   . TYR B 2 181 ? -3.943  3.194  15.920  1.00 27.70 ? 182 TYR A CD1   1 
ATOM   2209 C CD2   . TYR B 2 181 ? -3.497  5.157  17.213  1.00 26.12 ? 182 TYR A CD2   1 
ATOM   2210 C CE1   . TYR B 2 181 ? -5.035  3.826  15.319  1.00 27.34 ? 182 TYR A CE1   1 
ATOM   2211 C CE2   . TYR B 2 181 ? -4.594  5.800  16.615  1.00 26.33 ? 182 TYR A CE2   1 
ATOM   2212 C CZ    . TYR B 2 181 ? -5.354  5.124  15.665  1.00 26.97 ? 182 TYR A CZ    1 
ATOM   2213 O OH    . TYR B 2 181 ? -6.418  5.724  15.038  1.00 25.12 ? 182 TYR A OH    1 
ATOM   2214 N N     . GLY B 2 182 ? -0.782  0.877  19.714  1.00 27.36 ? 183 GLY A N     1 
ATOM   2215 C CA    . GLY B 2 182 ? 0.317   0.009  20.099  1.00 28.99 ? 183 GLY A CA    1 
ATOM   2216 C C     . GLY B 2 182 ? 1.702   0.613  20.187  1.00 29.55 ? 183 GLY A C     1 
ATOM   2217 O O     . GLY B 2 182 ? 2.559   0.098  20.905  1.00 30.91 ? 183 GLY A O     1 
ATOM   2218 N N     . SER B 2 183 ? 1.934   1.698  19.464  1.00 30.05 ? 184 SER A N     1 
ATOM   2219 C CA    . SER B 2 183 ? 3.245   2.318  19.475  1.00 31.35 ? 184 SER A CA    1 
ATOM   2220 C C     . SER B 2 183 ? 3.201   3.678  18.814  1.00 32.12 ? 184 SER A C     1 
ATOM   2221 O O     . SER B 2 183 ? 2.206   4.038  18.186  1.00 33.01 ? 184 SER A O     1 
ATOM   2222 C CB    . SER B 2 183 ? 4.231   1.438  18.722  1.00 31.59 ? 184 SER A CB    1 
ATOM   2223 O OG    . SER B 2 183 ? 3.872   1.366  17.356  1.00 32.12 ? 184 SER A OG    1 
ATOM   2224 N N     . PHE B 2 184 ? 4.292   4.427  18.944  1.00 32.29 ? 185 PHE A N     1 
ATOM   2225 C CA    . PHE B 2 184 ? 4.379   5.750  18.346  1.00 32.70 ? 185 PHE A CA    1 
ATOM   2226 C C     . PHE B 2 184 ? 4.090   5.669  16.856  1.00 33.50 ? 185 PHE A C     1 
ATOM   2227 O O     . PHE B 2 184 ? 3.090   6.204  16.382  1.00 33.74 ? 185 PHE A O     1 
ATOM   2228 C CB    . PHE B 2 184 ? 5.767   6.341  18.566  1.00 31.74 ? 185 PHE A CB    1 
ATOM   2229 C CG    . PHE B 2 184 ? 6.014   7.599  17.792  1.00 31.29 ? 185 PHE A CG    1 
ATOM   2230 C CD1   . PHE B 2 184 ? 6.975   7.632  16.788  1.00 31.54 ? 185 PHE A CD1   1 
ATOM   2231 C CD2   . PHE B 2 184 ? 5.289   8.747  18.061  1.00 30.66 ? 185 PHE A CD2   1 
ATOM   2232 C CE1   . PHE B 2 184 ? 7.215   8.793  16.062  1.00 31.29 ? 185 PHE A CE1   1 
ATOM   2233 C CE2   . PHE B 2 184 ? 5.518   9.909  17.342  1.00 31.39 ? 185 PHE A CE2   1 
ATOM   2234 C CZ    . PHE B 2 184 ? 6.487   9.931  16.337  1.00 31.93 ? 185 PHE A CZ    1 
ATOM   2235 N N     . LEU B 2 185 ? 4.966   4.980  16.128  1.00 33.77 ? 186 LEU A N     1 
ATOM   2236 C CA    . LEU B 2 185 ? 4.827   4.810  14.682  1.00 33.86 ? 186 LEU A CA    1 
ATOM   2237 C C     . LEU B 2 185 ? 3.406   4.452  14.224  1.00 33.51 ? 186 LEU A C     1 
ATOM   2238 O O     . LEU B 2 185 ? 2.854   5.099  13.343  1.00 34.06 ? 186 LEU A O     1 
ATOM   2239 C CB    . LEU B 2 185 ? 5.795   3.736  14.192  1.00 34.01 ? 186 LEU A CB    1 
ATOM   2240 C CG    . LEU B 2 185 ? 5.852   3.614  12.674  1.00 34.22 ? 186 LEU A CG    1 
ATOM   2241 C CD1   . LEU B 2 185 ? 6.569   4.824  12.113  1.00 35.30 ? 186 LEU A CD1   1 
ATOM   2242 C CD2   . LEU B 2 185 ? 6.575   2.350  12.270  1.00 35.08 ? 186 LEU A CD2   1 
ATOM   2243 N N     . GLU B 2 186 ? 2.814   3.423  14.812  1.00 32.48 ? 187 GLU A N     1 
ATOM   2244 C CA    . GLU B 2 186 ? 1.466   3.035  14.427  1.00 32.41 ? 187 GLU A CA    1 
ATOM   2245 C C     . GLU B 2 186 ? 0.484   4.178  14.625  1.00 31.93 ? 187 GLU A C     1 
ATOM   2246 O O     . GLU B 2 186 ? -0.492  4.306  13.894  1.00 31.59 ? 187 GLU A O     1 
ATOM   2247 C CB    . GLU B 2 186 ? 1.010   1.813  15.229  1.00 33.72 ? 187 GLU A CB    1 
ATOM   2248 C CG    . GLU B 2 186 ? 1.529   0.504  14.674  1.00 34.39 ? 187 GLU A CG    1 
ATOM   2249 C CD    . GLU B 2 186 ? 1.156   0.311  13.206  1.00 35.55 ? 187 GLU A CD    1 
ATOM   2250 O OE1   . GLU B 2 186 ? -0.057  0.182  12.908  1.00 34.85 ? 187 GLU A OE1   1 
ATOM   2251 O OE2   . GLU B 2 186 ? 2.080   0.297  12.354  1.00 36.44 ? 187 GLU A OE2   1 
ATOM   2252 N N     . THR B 2 187 ? 0.747   5.009  15.623  1.00 31.80 ? 188 THR A N     1 
ATOM   2253 C CA    . THR B 2 187 ? -0.115  6.141  15.899  1.00 32.30 ? 188 THR A CA    1 
ATOM   2254 C C     . THR B 2 187 ? 0.093   7.168  14.809  1.00 32.71 ? 188 THR A C     1 
ATOM   2255 O O     . THR B 2 187 ? -0.860  7.726  14.282  1.00 33.34 ? 188 THR A O     1 
ATOM   2256 C CB    . THR B 2 187 ? 0.237   6.770  17.229  1.00 32.63 ? 188 THR A CB    1 
ATOM   2257 O OG1   . THR B 2 187 ? 0.442   5.731  18.188  1.00 36.05 ? 188 THR A OG1   1 
ATOM   2258 C CG2   . THR B 2 187 ? -0.887  7.670  17.706  1.00 32.04 ? 188 THR A CG2   1 
ATOM   2259 N N     . VAL B 2 188 ? 1.354   7.414  14.477  1.00 33.06 ? 189 VAL A N     1 
ATOM   2260 C CA    . VAL B 2 188 ? 1.699   8.366  13.435  1.00 33.19 ? 189 VAL A CA    1 
ATOM   2261 C C     . VAL B 2 188 ? 1.075   7.929  12.111  1.00 34.10 ? 189 VAL A C     1 
ATOM   2262 O O     . VAL B 2 188 ? 0.395   8.710  11.450  1.00 35.07 ? 189 VAL A O     1 
ATOM   2263 C CB    . VAL B 2 188 ? 3.232   8.485  13.295  1.00 33.16 ? 189 VAL A CB    1 
ATOM   2264 C CG1   . VAL B 2 188 ? 3.607   8.989  11.914  1.00 34.05 ? 189 VAL A CG1   1 
ATOM   2265 C CG2   . VAL B 2 188 ? 3.755   9.439  14.335  1.00 31.87 ? 189 VAL A CG2   1 
ATOM   2266 N N     . LYS B 2 189 ? 1.297   6.676  11.733  1.00 33.81 ? 190 LYS A N     1 
ATOM   2267 C CA    . LYS B 2 189 ? 0.737   6.149  10.497  1.00 34.04 ? 190 LYS A CA    1 
ATOM   2268 C C     . LYS B 2 189 ? -0.777  6.344  10.377  1.00 33.50 ? 190 LYS A C     1 
ATOM   2269 O O     . LYS B 2 189 ? -1.265  6.885  9.387   1.00 34.14 ? 190 LYS A O     1 
ATOM   2270 C CB    . LYS B 2 189 ? 1.057   4.663  10.372  1.00 35.30 ? 190 LYS A CB    1 
ATOM   2271 C CG    . LYS B 2 189 ? 2.495   4.372  10.016  1.00 36.95 ? 190 LYS A CG    1 
ATOM   2272 C CD    . LYS B 2 189 ? 2.727   2.875  9.837   1.00 38.88 ? 190 LYS A CD    1 
ATOM   2273 C CE    . LYS B 2 189 ? 4.147   2.605  9.364   1.00 41.56 ? 190 LYS A CE    1 
ATOM   2274 N NZ    . LYS B 2 189 ? 4.451   1.153  9.225   1.00 43.22 ? 190 LYS A NZ    1 
ATOM   2275 N N     . ASN B 2 190 ? -1.520  5.904  11.384  1.00 31.97 ? 191 ASN A N     1 
ATOM   2276 C CA    . ASN B 2 190 ? -2.972  6.013  11.368  1.00 31.39 ? 191 ASN A CA    1 
ATOM   2277 C C     . ASN B 2 190 ? -3.528  7.418  11.454  1.00 31.22 ? 191 ASN A C     1 
ATOM   2278 O O     . ASN B 2 190 ? -4.562  7.715  10.861  1.00 31.02 ? 191 ASN A O     1 
ATOM   2279 C CB    . ASN B 2 190 ? -3.546  5.185  12.498  1.00 32.54 ? 191 ASN A CB    1 
ATOM   2280 C CG    . ASN B 2 190 ? -3.306  3.725  12.302  1.00 33.49 ? 191 ASN A CG    1 
ATOM   2281 O OD1   . ASN B 2 190 ? -4.001  3.069  11.531  1.00 32.36 ? 191 ASN A OD1   1 
ATOM   2282 N ND2   . ASN B 2 190 ? -2.300  3.200  12.980  1.00 36.38 ? 191 ASN A ND2   1 
ATOM   2283 N N     . ALA B 2 191 ? -2.853  8.275  12.207  1.00 31.24 ? 192 ALA A N     1 
ATOM   2284 C CA    . ALA B 2 191 ? -3.289  9.651  12.376  1.00 31.23 ? 192 ALA A CA    1 
ATOM   2285 C C     . ALA B 2 191 ? -3.468  10.368 11.044  1.00 31.83 ? 192 ALA A C     1 
ATOM   2286 O O     . ALA B 2 191 ? -4.277  11.289 10.928  1.00 31.38 ? 192 ALA A O     1 
ATOM   2287 C CB    . ALA B 2 191 ? -2.298  10.392 13.233  1.00 31.55 ? 192 ALA A CB    1 
ATOM   2288 N N     . ARG B 2 192 ? -2.708  9.943  10.040  1.00 31.73 ? 193 ARG A N     1 
ATOM   2289 C CA    . ARG B 2 192 ? -2.784  10.541 8.713   1.00 32.19 ? 193 ARG A CA    1 
ATOM   2290 C C     . ARG B 2 192 ? -4.172  10.427 8.090   1.00 33.39 ? 193 ARG A C     1 
ATOM   2291 O O     . ARG B 2 192 ? -4.544  11.228 7.235   1.00 33.34 ? 193 ARG A O     1 
ATOM   2292 C CB    . ARG B 2 192 ? -1.767  9.884  7.795   1.00 32.03 ? 193 ARG A CB    1 
ATOM   2293 C CG    . ARG B 2 192 ? -0.346  10.055 8.256   1.00 33.82 ? 193 ARG A CG    1 
ATOM   2294 C CD    . ARG B 2 192 ? 0.629   9.589  7.200   1.00 35.08 ? 193 ARG A CD    1 
ATOM   2295 N NE    . ARG B 2 192 ? 0.736   8.138  7.128   1.00 36.97 ? 193 ARG A NE    1 
ATOM   2296 C CZ    . ARG B 2 192 ? 1.518   7.499  6.264   1.00 37.91 ? 193 ARG A CZ    1 
ATOM   2297 N NH1   . ARG B 2 192 ? 2.251   8.193  5.396   1.00 38.15 ? 193 ARG A NH1   1 
ATOM   2298 N NH2   . ARG B 2 192 ? 1.584   6.173  6.277   1.00 37.05 ? 193 ARG A NH2   1 
ATOM   2299 N N     . ARG B 2 193 ? -4.939  9.431  8.520   1.00 34.89 ? 194 ARG A N     1 
ATOM   2300 C CA    . ARG B 2 193 ? -6.281  9.223  7.995   1.00 35.78 ? 194 ARG A CA    1 
ATOM   2301 C C     . ARG B 2 193 ? -7.312  9.916  8.872   1.00 35.55 ? 194 ARG A C     1 
ATOM   2302 O O     . ARG B 2 193 ? -8.497  9.907  8.556   1.00 37.25 ? 194 ARG A O     1 
ATOM   2303 C CB    . ARG B 2 193 ? -6.612  7.733  7.938   1.00 37.79 ? 194 ARG A CB    1 
ATOM   2304 C CG    . ARG B 2 193 ? -5.419  6.845  7.692   1.00 43.47 ? 194 ARG A CG    1 
ATOM   2305 C CD    . ARG B 2 193 ? -5.009  6.778  6.224   1.00 47.52 ? 194 ARG A CD    1 
ATOM   2306 N NE    . ARG B 2 193 ? -5.757  5.772  5.466   1.00 50.89 ? 194 ARG A NE    1 
ATOM   2307 C CZ    . ARG B 2 193 ? -6.057  4.550  5.910   1.00 52.05 ? 194 ARG A CZ    1 
ATOM   2308 N NH1   . ARG B 2 193 ? -5.685  4.157  7.132   1.00 52.41 ? 194 ARG A NH1   1 
ATOM   2309 N NH2   . ARG B 2 193 ? -6.721  3.708  5.119   1.00 52.36 ? 194 ARG A NH2   1 
ATOM   2310 N N     . TRP B 2 194 ? -6.870  10.500 9.981   1.00 33.72 ? 195 TRP A N     1 
ATOM   2311 C CA    . TRP B 2 194 ? -7.793  11.198 10.868  1.00 32.85 ? 195 TRP A CA    1 
ATOM   2312 C C     . TRP B 2 194 ? -8.458  12.381 10.159  1.00 33.66 ? 195 TRP A C     1 
ATOM   2313 O O     . TRP B 2 194 ? -7.851  13.044 9.317   1.00 34.67 ? 195 TRP A O     1 
ATOM   2314 C CB    . TRP B 2 194 ? -7.067  11.714 12.118  1.00 31.71 ? 195 TRP A CB    1 
ATOM   2315 C CG    . TRP B 2 194 ? -6.677  10.661 13.138  1.00 30.11 ? 195 TRP A CG    1 
ATOM   2316 C CD1   . TRP B 2 194 ? -7.001  9.339  13.119  1.00 30.32 ? 195 TRP A CD1   1 
ATOM   2317 C CD2   . TRP B 2 194 ? -5.891  10.860 14.322  1.00 27.57 ? 195 TRP A CD2   1 
ATOM   2318 N NE1   . TRP B 2 194 ? -6.466  8.703  14.210  1.00 27.93 ? 195 TRP A NE1   1 
ATOM   2319 C CE2   . TRP B 2 194 ? -5.779  9.614  14.961  1.00 28.24 ? 195 TRP A CE2   1 
ATOM   2320 C CE3   . TRP B 2 194 ? -5.269  11.972 14.895  1.00 26.63 ? 195 TRP A CE3   1 
ATOM   2321 C CZ2   . TRP B 2 194 ? -5.070  9.445  16.150  1.00 28.34 ? 195 TRP A CZ2   1 
ATOM   2322 C CZ3   . TRP B 2 194 ? -4.564  11.802 16.075  1.00 27.11 ? 195 TRP A CZ3   1 
ATOM   2323 C CH2   . TRP B 2 194 ? -4.469  10.547 16.688  1.00 26.92 ? 195 TRP A CH2   1 
ATOM   2324 N N     . THR B 2 195 ? -9.713  12.639 10.501  1.00 33.01 ? 196 THR A N     1 
ATOM   2325 C CA    . THR B 2 195 ? -10.458 13.745 9.917   1.00 32.84 ? 196 THR A CA    1 
ATOM   2326 C C     . THR B 2 195 ? -11.058 14.503 11.086  1.00 33.87 ? 196 THR A C     1 
ATOM   2327 O O     . THR B 2 195 ? -10.881 14.096 12.235  1.00 34.55 ? 196 THR A O     1 
ATOM   2328 C CB    . THR B 2 195 ? -11.606 13.255 9.051   1.00 32.08 ? 196 THR A CB    1 
ATOM   2329 O OG1   . THR B 2 195 ? -12.655 12.782 9.899   1.00 32.53 ? 196 THR A OG1   1 
ATOM   2330 C CG2   . THR B 2 195 ? -11.150 12.135 8.144   1.00 31.45 ? 196 THR A CG2   1 
ATOM   2331 N N     . ARG B 2 196 ? -11.781 15.584 10.811  1.00 33.91 ? 197 ARG A N     1 
ATOM   2332 C CA    . ARG B 2 196 ? -12.379 16.344 11.900  1.00 34.25 ? 197 ARG A CA    1 
ATOM   2333 C C     . ARG B 2 196 ? -13.615 15.646 12.461  1.00 34.24 ? 197 ARG A C     1 
ATOM   2334 O O     . ARG B 2 196 ? -14.221 16.109 13.423  1.00 33.30 ? 197 ARG A O     1 
ATOM   2335 C CB    . ARG B 2 196 ? -12.732 17.758 11.435  1.00 34.90 ? 197 ARG A CB    1 
ATOM   2336 C CG    . ARG B 2 196 ? -13.814 17.846 10.386  1.00 35.16 ? 197 ARG A CG    1 
ATOM   2337 C CD    . ARG B 2 196 ? -13.787 19.208 9.729   1.00 35.89 ? 197 ARG A CD    1 
ATOM   2338 N NE    . ARG B 2 196 ? -12.633 19.314 8.846   1.00 37.37 ? 197 ARG A NE    1 
ATOM   2339 C CZ    . ARG B 2 196 ? -12.183 20.447 8.324   1.00 36.65 ? 197 ARG A CZ    1 
ATOM   2340 N NH1   . ARG B 2 196 ? -12.791 21.590 8.603   1.00 37.27 ? 197 ARG A NH1   1 
ATOM   2341 N NH2   . ARG B 2 196 ? -11.129 20.434 7.518   1.00 35.08 ? 197 ARG A NH2   1 
ATOM   2342 N N     . ARG B 2 197 ? -13.980 14.521 11.860  1.00 35.00 ? 198 ARG A N     1 
ATOM   2343 C CA    . ARG B 2 197 ? -15.142 13.761 12.308  1.00 36.37 ? 198 ARG A CA    1 
ATOM   2344 C C     . ARG B 2 197 ? -14.751 12.411 12.906  1.00 35.90 ? 198 ARG A C     1 
ATOM   2345 O O     . ARG B 2 197 ? -15.625 11.607 13.240  1.00 35.69 ? 198 ARG A O     1 
ATOM   2346 C CB    . ARG B 2 197 ? -16.099 13.517 11.141  1.00 37.66 ? 198 ARG A CB    1 
ATOM   2347 C CG    . ARG B 2 197 ? -16.832 14.738 10.644  1.00 41.55 ? 198 ARG A CG    1 
ATOM   2348 C CD    . ARG B 2 197 ? -17.765 15.302 11.714  1.00 45.47 ? 198 ARG A CD    1 
ATOM   2349 N NE    . ARG B 2 197 ? -18.636 16.358 11.196  1.00 48.08 ? 198 ARG A NE    1 
ATOM   2350 C CZ    . ARG B 2 197 ? -18.213 17.404 10.485  1.00 48.62 ? 198 ARG A CZ    1 
ATOM   2351 N NH1   . ARG B 2 197 ? -16.927 17.551 10.190  1.00 48.69 ? 198 ARG A NH1   1 
ATOM   2352 N NH2   . ARG B 2 197 ? -19.080 18.317 10.067  1.00 49.55 ? 198 ARG A NH2   1 
ATOM   2353 N N     . THR B 2 198 ? -13.445 12.166 13.032  1.00 34.02 ? 199 THR A N     1 
ATOM   2354 C CA    . THR B 2 198 ? -12.946 10.906 13.575  1.00 31.01 ? 199 THR A CA    1 
ATOM   2355 C C     . THR B 2 198 ? -13.166 10.760 15.080  1.00 29.24 ? 199 THR A C     1 
ATOM   2356 O O     . THR B 2 198 ? -12.939 11.692 15.852  1.00 27.83 ? 199 THR A O     1 
ATOM   2357 C CB    . THR B 2 198 ? -11.443 10.723 13.248  1.00 30.45 ? 199 THR A CB    1 
ATOM   2358 O OG1   . THR B 2 198 ? -11.280 10.557 11.833  1.00 30.66 ? 199 THR A OG1   1 
ATOM   2359 C CG2   . THR B 2 198 ? -10.876 9.502  13.959  1.00 29.32 ? 199 THR A CG2   1 
ATOM   2360 N N     . VAL B 2 199 ? -13.626 9.575  15.472  1.00 28.42 ? 200 VAL A N     1 
ATOM   2361 C CA    . VAL B 2 199 ? -13.898 9.242  16.867  1.00 29.08 ? 200 VAL A CA    1 
ATOM   2362 C C     . VAL B 2 199 ? -13.131 7.972  17.226  1.00 29.22 ? 200 VAL A C     1 
ATOM   2363 O O     . VAL B 2 199 ? -13.158 7.000  16.480  1.00 29.56 ? 200 VAL A O     1 
ATOM   2364 C CB    . VAL B 2 199 ? -15.406 8.991  17.102  1.00 28.43 ? 200 VAL A CB    1 
ATOM   2365 C CG1   . VAL B 2 199 ? -15.671 8.722  18.566  1.00 26.25 ? 200 VAL A CG1   1 
ATOM   2366 C CG2   . VAL B 2 199 ? -16.213 10.187 16.632  1.00 29.90 ? 200 VAL A CG2   1 
ATOM   2367 N N     . ILE B 2 200 ? -12.452 7.987  18.369  1.00 29.15 ? 201 ILE A N     1 
ATOM   2368 C CA    . ILE B 2 200 ? -11.659 6.847  18.827  1.00 29.04 ? 201 ILE A CA    1 
ATOM   2369 C C     . ILE B 2 200 ? -12.122 6.330  20.196  1.00 29.34 ? 201 ILE A C     1 
ATOM   2370 O O     . ILE B 2 200 ? -11.867 6.943  21.230  1.00 29.66 ? 201 ILE A O     1 
ATOM   2371 C CB    . ILE B 2 200 ? -10.165 7.237  18.896  1.00 28.43 ? 201 ILE A CB    1 
ATOM   2372 C CG1   . ILE B 2 200 ? -9.663  7.592  17.498  1.00 26.49 ? 201 ILE A CG1   1 
ATOM   2373 C CG2   . ILE B 2 200 ? -9.348  6.107  19.494  1.00 28.21 ? 201 ILE A CG2   1 
ATOM   2374 C CD1   . ILE B 2 200 ? -8.230  8.041  17.465  1.00 26.58 ? 201 ILE A CD1   1 
ATOM   2375 N N     . ASP B 2 201 ? -12.806 5.193  20.189  1.00 30.07 ? 202 ASP A N     1 
ATOM   2376 C CA    . ASP B 2 201 ? -13.318 4.594  21.414  1.00 31.86 ? 202 ASP A CA    1 
ATOM   2377 C C     . ASP B 2 201 ? -12.330 3.543  21.913  1.00 33.27 ? 202 ASP A C     1 
ATOM   2378 O O     . ASP B 2 201 ? -12.399 2.375  21.537  1.00 34.49 ? 202 ASP A O     1 
ATOM   2379 C CB    . ASP B 2 201 ? -14.684 3.957  21.148  1.00 31.12 ? 202 ASP A CB    1 
ATOM   2380 C CG    . ASP B 2 201 ? -15.498 3.782  22.403  1.00 32.45 ? 202 ASP A CG    1 
ATOM   2381 O OD1   . ASP B 2 201 ? -14.988 3.187  23.367  1.00 35.43 ? 202 ASP A OD1   1 
ATOM   2382 O OD2   . ASP B 2 201 ? -16.656 4.231  22.428  1.00 33.23 ? 202 ASP A OD2   1 
ATOM   2383 N N     . VAL B 2 202 ? -11.411 3.966  22.770  1.00 34.71 ? 203 VAL A N     1 
ATOM   2384 C CA    . VAL B 2 202 ? -10.391 3.071  23.302  1.00 34.96 ? 203 VAL A CA    1 
ATOM   2385 C C     . VAL B 2 202 ? -10.971 1.812  23.923  1.00 34.71 ? 203 VAL A C     1 
ATOM   2386 O O     . VAL B 2 202 ? -10.447 0.719  23.727  1.00 35.59 ? 203 VAL A O     1 
ATOM   2387 C CB    . VAL B 2 202 ? -9.544  3.771  24.378  1.00 35.10 ? 203 VAL A CB    1 
ATOM   2388 C CG1   . VAL B 2 202 ? -8.276  2.976  24.615  1.00 34.28 ? 203 VAL A CG1   1 
ATOM   2389 C CG2   . VAL B 2 202 ? -9.242  5.213  23.963  1.00 34.36 ? 203 VAL A CG2   1 
ATOM   2390 N N     . ALA B 2 203 ? -12.051 1.971  24.674  1.00 34.19 ? 204 ALA A N     1 
ATOM   2391 C CA    . ALA B 2 203 ? -12.677 0.844  25.341  1.00 34.07 ? 204 ALA A CA    1 
ATOM   2392 C C     . ALA B 2 203 ? -13.274 -0.149 24.362  1.00 34.12 ? 204 ALA A C     1 
ATOM   2393 O O     . ALA B 2 203 ? -13.400 -1.335 24.672  1.00 34.38 ? 204 ALA A O     1 
ATOM   2394 C CB    . ALA B 2 203 ? -13.739 1.338  26.295  1.00 34.88 ? 204 ALA A CB    1 
ATOM   2395 N N     . LYS B 2 204 ? -13.639 0.331  23.181  1.00 33.83 ? 205 LYS A N     1 
ATOM   2396 C CA    . LYS B 2 204 ? -14.227 -0.530 22.162  1.00 34.20 ? 205 LYS A CA    1 
ATOM   2397 C C     . LYS B 2 204 ? -13.248 -0.880 21.040  1.00 34.68 ? 205 LYS A C     1 
ATOM   2398 O O     . LYS B 2 204 ? -13.632 -1.506 20.057  1.00 35.05 ? 205 LYS A O     1 
ATOM   2399 C CB    . LYS B 2 204 ? -15.465 0.140  21.563  1.00 34.01 ? 205 LYS A CB    1 
ATOM   2400 C CG    . LYS B 2 204 ? -16.652 0.244  22.509  1.00 35.23 ? 205 LYS A CG    1 
ATOM   2401 C CD    . LYS B 2 204 ? -17.826 0.964  21.847  1.00 37.10 ? 205 LYS A CD    1 
ATOM   2402 C CE    . LYS B 2 204 ? -19.053 1.017  22.762  1.00 38.32 ? 205 LYS A CE    1 
ATOM   2403 N NZ    . LYS B 2 204 ? -20.171 1.847  22.194  1.00 40.33 ? 205 LYS A NZ    1 
ATOM   2404 N N     . GLY B 2 205 ? -11.987 -0.483 21.190  1.00 34.96 ? 206 GLY A N     1 
ATOM   2405 C CA    . GLY B 2 205 ? -10.990 -0.768 20.169  1.00 35.83 ? 206 GLY A CA    1 
ATOM   2406 C C     . GLY B 2 205 ? -11.520 -0.452 18.783  1.00 35.84 ? 206 GLY A C     1 
ATOM   2407 O O     . GLY B 2 205 ? -11.048 -0.982 17.773  1.00 36.07 ? 206 GLY A O     1 
ATOM   2408 N N     . GLU B 2 206 ? -12.501 0.441  18.745  1.00 35.89 ? 207 GLU A N     1 
ATOM   2409 C CA    . GLU B 2 206 ? -13.163 0.838  17.508  1.00 37.06 ? 207 GLU A CA    1 
ATOM   2410 C C     . GLU B 2 206 ? -12.931 2.293  17.108  1.00 36.82 ? 207 GLU A C     1 
ATOM   2411 O O     . GLU B 2 206 ? -12.628 3.140  17.941  1.00 37.67 ? 207 GLU A O     1 
ATOM   2412 C CB    . GLU B 2 206 ? -14.666 0.585  17.663  1.00 38.43 ? 207 GLU A CB    1 
ATOM   2413 C CG    . GLU B 2 206 ? -15.536 1.153  16.567  1.00 39.87 ? 207 GLU A CG    1 
ATOM   2414 C CD    . GLU B 2 206 ? -17.012 1.179  16.946  1.00 41.44 ? 207 GLU A CD    1 
ATOM   2415 O OE1   . GLU B 2 206 ? -17.357 1.765  18.000  1.00 41.04 ? 207 GLU A OE1   1 
ATOM   2416 O OE2   . GLU B 2 206 ? -17.829 0.619  16.184  1.00 43.35 ? 207 GLU A OE2   1 
ATOM   2417 N N     . VAL B 2 207 ? -13.067 2.568  15.817  1.00 36.60 ? 208 VAL A N     1 
ATOM   2418 C CA    . VAL B 2 207 ? -12.920 3.919  15.284  1.00 35.89 ? 208 VAL A CA    1 
ATOM   2419 C C     . VAL B 2 207 ? -14.174 4.199  14.477  1.00 35.74 ? 208 VAL A C     1 
ATOM   2420 O O     . VAL B 2 207 ? -14.607 3.374  13.676  1.00 35.17 ? 208 VAL A O     1 
ATOM   2421 C CB    . VAL B 2 207 ? -11.705 4.058  14.346  1.00 35.47 ? 208 VAL A CB    1 
ATOM   2422 C CG1   . VAL B 2 207 ? -11.531 5.513  13.938  1.00 33.95 ? 208 VAL A CG1   1 
ATOM   2423 C CG2   . VAL B 2 207 ? -10.461 3.546  15.030  1.00 37.14 ? 208 VAL A CG2   1 
ATOM   2424 N N     . ARG B 2 208 ? -14.771 5.358  14.693  1.00 36.20 ? 209 ARG A N     1 
ATOM   2425 C CA    . ARG B 2 208 ? -15.972 5.685  13.959  1.00 38.43 ? 209 ARG A CA    1 
ATOM   2426 C C     . ARG B 2 208 ? -16.070 7.159  13.576  1.00 39.35 ? 209 ARG A C     1 
ATOM   2427 O O     . ARG B 2 208 ? -15.266 7.986  13.998  1.00 39.15 ? 209 ARG A O     1 
ATOM   2428 C CB    . ARG B 2 208 ? -17.211 5.236  14.754  1.00 38.08 ? 209 ARG A CB    1 
ATOM   2429 C CG    . ARG B 2 208 ? -17.233 5.686  16.194  1.00 39.28 ? 209 ARG A CG    1 
ATOM   2430 C CD    . ARG B 2 208 ? -18.531 5.318  16.867  1.00 39.32 ? 209 ARG A CD    1 
ATOM   2431 N NE    . ARG B 2 208 ? -18.613 5.864  18.223  1.00 41.91 ? 209 ARG A NE    1 
ATOM   2432 C CZ    . ARG B 2 208 ? -18.396 5.174  19.341  1.00 41.58 ? 209 ARG A CZ    1 
ATOM   2433 N NH1   . ARG B 2 208 ? -18.076 3.887  19.293  1.00 41.77 ? 209 ARG A NH1   1 
ATOM   2434 N NH2   . ARG B 2 208 ? -18.522 5.773  20.516  1.00 43.21 ? 209 ARG A NH2   1 
ATOM   2435 N N     . LYS B 2 209 ? -17.055 7.457  12.743  1.00 40.24 ? 210 LYS A N     1 
ATOM   2436 C CA    . LYS B 2 209 ? -17.305 8.800  12.270  1.00 41.42 ? 210 LYS A CA    1 
ATOM   2437 C C     . LYS B 2 209 ? -18.241 9.427  13.300  1.00 41.95 ? 210 LYS A C     1 
ATOM   2438 O O     . LYS B 2 209 ? -19.198 8.790  13.733  1.00 42.89 ? 210 LYS A O     1 
ATOM   2439 C CB    . LYS B 2 209 ? -17.980 8.715  10.897  1.00 41.89 ? 210 LYS A CB    1 
ATOM   2440 C CG    . LYS B 2 209 ? -17.717 9.872  9.944   1.00 43.65 ? 210 LYS A CG    1 
ATOM   2441 C CD    . LYS B 2 209 ? -18.503 11.133 10.302  1.00 44.95 ? 210 LYS A CD    1 
ATOM   2442 C CE    . LYS B 2 209 ? -18.362 12.196 9.206   1.00 44.68 ? 210 LYS A CE    1 
ATOM   2443 N NZ    . LYS B 2 209 ? -19.115 13.444 9.504   1.00 43.67 ? 210 LYS A NZ    1 
ATOM   2444 N N     . GLY B 2 210 ? -17.946 10.655 13.716  1.00 42.79 ? 211 GLY A N     1 
ATOM   2445 C CA    . GLY B 2 210 ? -18.789 11.341 14.682  1.00 42.54 ? 211 GLY A CA    1 
ATOM   2446 C C     . GLY B 2 210 ? -19.104 12.726 14.154  1.00 43.25 ? 211 GLY A C     1 
ATOM   2447 O O     . GLY B 2 210 ? -19.168 12.941 12.945  1.00 43.10 ? 211 GLY A O     1 
ATOM   2448 N N     . GLU B 2 211 ? -19.311 13.681 15.043  1.00 44.52 ? 212 GLU A N     1 
ATOM   2449 C CA    . GLU B 2 211 ? -19.588 15.031 14.590  1.00 46.50 ? 212 GLU A CA    1 
ATOM   2450 C C     . GLU B 2 211 ? -18.400 15.938 14.875  1.00 46.71 ? 212 GLU A C     1 
ATOM   2451 O O     . GLU B 2 211 ? -18.387 17.096 14.465  1.00 47.06 ? 212 GLU A O     1 
ATOM   2452 C CB    . GLU B 2 211 ? -20.806 15.593 15.301  1.00 48.67 ? 212 GLU A CB    1 
ATOM   2453 C CG    . GLU B 2 211 ? -22.044 14.743 15.189  1.00 53.66 ? 212 GLU A CG    1 
ATOM   2454 C CD    . GLU B 2 211 ? -23.284 15.534 15.552  1.00 56.23 ? 212 GLU A CD    1 
ATOM   2455 O OE1   . GLU B 2 211 ? -23.633 16.450 14.766  1.00 56.97 ? 212 GLU A OE1   1 
ATOM   2456 O OE2   . GLU B 2 211 ? -23.890 15.251 16.621  1.00 58.24 ? 212 GLU A OE2   1 
ATOM   2457 N N     . GLU B 2 212 ? -17.407 15.395 15.577  1.00 46.84 ? 213 GLU A N     1 
ATOM   2458 C CA    . GLU B 2 212 ? -16.205 16.130 15.965  1.00 45.32 ? 213 GLU A CA    1 
ATOM   2459 C C     . GLU B 2 212 ? -15.149 15.136 16.425  1.00 43.43 ? 213 GLU A C     1 
ATOM   2460 O O     . GLU B 2 212 ? -15.484 14.031 16.853  1.00 44.19 ? 213 GLU A O     1 
ATOM   2461 C CB    . GLU B 2 212 ? -16.533 17.043 17.130  1.00 46.66 ? 213 GLU A CB    1 
ATOM   2462 C CG    . GLU B 2 212 ? -17.298 16.297 18.210  1.00 50.09 ? 213 GLU A CG    1 
ATOM   2463 C CD    . GLU B 2 212 ? -17.274 16.999 19.550  1.00 52.14 ? 213 GLU A CD    1 
ATOM   2464 O OE1   . GLU B 2 212 ? -17.935 16.502 20.492  1.00 52.01 ? 213 GLU A OE1   1 
ATOM   2465 O OE2   . GLU B 2 212 ? -16.589 18.042 19.662  1.00 53.75 ? 213 GLU A OE2   1 
ATOM   2466 N N     . PHE B 2 213 ? -13.881 15.526 16.345  1.00 40.25 ? 214 PHE A N     1 
ATOM   2467 C CA    . PHE B 2 213 ? -12.799 14.653 16.785  1.00 37.37 ? 214 PHE A CA    1 
ATOM   2468 C C     . PHE B 2 213 ? -13.114 14.321 18.237  1.00 36.89 ? 214 PHE A C     1 
ATOM   2469 O O     . PHE B 2 213 ? -13.143 15.212 19.088  1.00 36.77 ? 214 PHE A O     1 
ATOM   2470 C CB    . PHE B 2 213 ? -11.457 15.376 16.709  1.00 35.63 ? 214 PHE A CB    1 
ATOM   2471 C CG    . PHE B 2 213 ? -10.279 14.459 16.798  1.00 33.73 ? 214 PHE A CG    1 
ATOM   2472 C CD1   . PHE B 2 213 ? -9.881  13.712 15.694  1.00 33.00 ? 214 PHE A CD1   1 
ATOM   2473 C CD2   . PHE B 2 213 ? -9.574  14.329 17.983  1.00 32.49 ? 214 PHE A CD2   1 
ATOM   2474 C CE1   . PHE B 2 213 ? -8.814  12.846 15.774  1.00 32.40 ? 214 PHE A CE1   1 
ATOM   2475 C CE2   . PHE B 2 213 ? -8.502  13.459 18.070  1.00 31.81 ? 214 PHE A CE2   1 
ATOM   2476 C CZ    . PHE B 2 213 ? -8.119  12.721 16.960  1.00 32.46 ? 214 PHE A CZ    1 
ATOM   2477 N N     . PHE B 2 214 ? -13.351 13.044 18.516  1.00 35.99 ? 215 PHE A N     1 
ATOM   2478 C CA    . PHE B 2 214 ? -13.713 12.618 19.860  1.00 34.48 ? 215 PHE A CA    1 
ATOM   2479 C C     . PHE B 2 214 ? -12.953 11.353 20.245  1.00 34.21 ? 215 PHE A C     1 
ATOM   2480 O O     . PHE B 2 214 ? -13.020 10.346 19.548  1.00 34.88 ? 215 PHE A O     1 
ATOM   2481 C CB    . PHE B 2 214 ? -15.222 12.350 19.894  1.00 34.43 ? 215 PHE A CB    1 
ATOM   2482 C CG    . PHE B 2 214 ? -15.858 12.509 21.254  1.00 34.90 ? 215 PHE A CG    1 
ATOM   2483 C CD1   . PHE B 2 214 ? -16.821 13.496 21.471  1.00 33.98 ? 215 PHE A CD1   1 
ATOM   2484 C CD2   . PHE B 2 214 ? -15.513 11.672 22.311  1.00 35.57 ? 215 PHE A CD2   1 
ATOM   2485 C CE1   . PHE B 2 214 ? -17.426 13.645 22.713  1.00 33.16 ? 215 PHE A CE1   1 
ATOM   2486 C CE2   . PHE B 2 214 ? -16.117 11.817 23.561  1.00 35.65 ? 215 PHE A CE2   1 
ATOM   2487 C CZ    . PHE B 2 214 ? -17.075 12.806 23.760  1.00 34.01 ? 215 PHE A CZ    1 
ATOM   2488 N N     . VAL B 2 215 ? -12.212 11.416 21.346  1.00 32.35 ? 216 VAL A N     1 
ATOM   2489 C CA    . VAL B 2 215 ? -11.468 10.263 21.846  1.00 30.76 ? 216 VAL A CA    1 
ATOM   2490 C C     . VAL B 2 215 ? -12.149 9.957  23.175  1.00 31.27 ? 216 VAL A C     1 
ATOM   2491 O O     . VAL B 2 215 ? -11.793 10.517 24.205  1.00 31.32 ? 216 VAL A O     1 
ATOM   2492 C CB    . VAL B 2 215 ? -9.970  10.604 22.071  1.00 28.83 ? 216 VAL A CB    1 
ATOM   2493 C CG1   . VAL B 2 215 ? -9.244  9.435  22.695  1.00 27.18 ? 216 VAL A CG1   1 
ATOM   2494 C CG2   . VAL B 2 215 ? -9.322  10.941 20.760  1.00 28.16 ? 216 VAL A CG2   1 
ATOM   2495 N N     . VAL B 2 216 ? -13.151 9.086  23.144  1.00 30.98 ? 217 VAL A N     1 
ATOM   2496 C CA    . VAL B 2 216 ? -13.892 8.768  24.355  1.00 30.18 ? 217 VAL A CA    1 
ATOM   2497 C C     . VAL B 2 216 ? -13.071 8.123  25.456  1.00 30.23 ? 217 VAL A C     1 
ATOM   2498 O O     . VAL B 2 216 ? -12.410 7.105  25.266  1.00 31.14 ? 217 VAL A O     1 
ATOM   2499 C CB    . VAL B 2 216 ? -15.146 7.912  24.047  1.00 29.46 ? 217 VAL A CB    1 
ATOM   2500 C CG1   . VAL B 2 216 ? -14.884 7.014  22.876  1.00 29.59 ? 217 VAL A CG1   1 
ATOM   2501 C CG2   . VAL B 2 216 ? -15.539 7.106  25.260  1.00 27.36 ? 217 VAL A CG2   1 
ATOM   2502 N N     . ASP B 2 217 ? -13.135 8.767  26.615  1.00 29.92 ? 218 ASP A N     1 
ATOM   2503 C CA    . ASP B 2 217 ? -12.443 8.378  27.830  1.00 30.01 ? 218 ASP A CA    1 
ATOM   2504 C C     . ASP B 2 217 ? -12.866 6.982  28.282  1.00 30.67 ? 218 ASP A C     1 
ATOM   2505 O O     . ASP B 2 217 ? -14.053 6.715  28.436  1.00 32.12 ? 218 ASP A O     1 
ATOM   2506 C CB    . ASP B 2 217 ? -12.781 9.412  28.910  1.00 30.31 ? 218 ASP A CB    1 
ATOM   2507 C CG    . ASP B 2 217 ? -12.039 9.183  30.209  1.00 31.59 ? 218 ASP A CG    1 
ATOM   2508 O OD1   . ASP B 2 217 ? -11.191 8.266  30.283  1.00 32.13 ? 218 ASP A OD1   1 
ATOM   2509 O OD2   . ASP B 2 217 ? -12.306 9.940  31.164  1.00 31.79 ? 218 ASP A OD2   1 
ATOM   2510 N N     . PRO B 2 218 ? -11.901 6.068  28.497  1.00 30.66 ? 219 PRO A N     1 
ATOM   2511 C CA    . PRO B 2 218 ? -12.229 4.707  28.938  1.00 30.43 ? 219 PRO A CA    1 
ATOM   2512 C C     . PRO B 2 218 ? -13.049 4.715  30.224  1.00 30.82 ? 219 PRO A C     1 
ATOM   2513 O O     . PRO B 2 218 ? -13.952 3.908  30.415  1.00 30.45 ? 219 PRO A O     1 
ATOM   2514 C CB    . PRO B 2 218 ? -10.860 4.083  29.155  1.00 29.24 ? 219 PRO A CB    1 
ATOM   2515 C CG    . PRO B 2 218 ? -10.038 4.749  28.126  1.00 29.60 ? 219 PRO A CG    1 
ATOM   2516 C CD    . PRO B 2 218 ? -10.458 6.190  28.234  1.00 30.02 ? 219 PRO A CD    1 
ATOM   2517 N N     . VAL B 2 219 ? -12.719 5.655  31.097  1.00 31.75 ? 220 VAL A N     1 
ATOM   2518 C CA    . VAL B 2 219 ? -13.372 5.795  32.385  1.00 32.35 ? 220 VAL A CA    1 
ATOM   2519 C C     . VAL B 2 219 ? -14.764 6.414  32.319  1.00 33.73 ? 220 VAL A C     1 
ATOM   2520 O O     . VAL B 2 219 ? -15.622 6.086  33.126  1.00 35.30 ? 220 VAL A O     1 
ATOM   2521 C CB    . VAL B 2 219 ? -12.496 6.626  33.326  1.00 31.63 ? 220 VAL A CB    1 
ATOM   2522 C CG1   . VAL B 2 219 ? -13.000 6.503  34.738  1.00 31.62 ? 220 VAL A CG1   1 
ATOM   2523 C CG2   . VAL B 2 219 ? -11.061 6.155  33.235  1.00 31.29 ? 220 VAL A CG2   1 
ATOM   2524 N N     . ASP B 2 220 ? -14.987 7.306  31.361  1.00 34.91 ? 221 ASP A N     1 
ATOM   2525 C CA    . ASP B 2 220 ? -16.287 7.958  31.208  1.00 36.56 ? 221 ASP A CA    1 
ATOM   2526 C C     . ASP B 2 220 ? -16.631 8.115  29.728  1.00 37.72 ? 221 ASP A C     1 
ATOM   2527 O O     . ASP B 2 220 ? -16.115 9.000  29.052  1.00 37.25 ? 221 ASP A O     1 
ATOM   2528 C CB    . ASP B 2 220 ? -16.259 9.333  31.865  1.00 36.83 ? 221 ASP A CB    1 
ATOM   2529 C CG    . ASP B 2 220 ? -17.647 9.875  32.137  1.00 38.19 ? 221 ASP A CG    1 
ATOM   2530 O OD1   . ASP B 2 220 ? -18.528 9.779  31.249  1.00 38.49 ? 221 ASP A OD1   1 
ATOM   2531 O OD2   . ASP B 2 220 ? -17.854 10.405 33.250  1.00 40.34 ? 221 ASP A OD2   1 
ATOM   2532 N N     . GLU B 2 221 ? -17.518 7.263  29.231  1.00 39.94 ? 222 GLU A N     1 
ATOM   2533 C CA    . GLU B 2 221 ? -17.901 7.290  27.823  1.00 41.93 ? 222 GLU A CA    1 
ATOM   2534 C C     . GLU B 2 221 ? -18.470 8.601  27.312  1.00 40.34 ? 222 GLU A C     1 
ATOM   2535 O O     . GLU B 2 221 ? -18.644 8.769  26.111  1.00 40.15 ? 222 GLU A O     1 
ATOM   2536 C CB    . GLU B 2 221 ? -18.894 6.162  27.527  1.00 45.70 ? 222 GLU A CB    1 
ATOM   2537 C CG    . GLU B 2 221 ? -18.364 4.748  27.857  1.00 51.46 ? 222 GLU A CG    1 
ATOM   2538 C CD    . GLU B 2 221 ? -16.960 4.465  27.297  1.00 54.24 ? 222 GLU A CD    1 
ATOM   2539 O OE1   . GLU B 2 221 ? -15.968 4.833  27.966  1.00 55.35 ? 222 GLU A OE1   1 
ATOM   2540 O OE2   . GLU B 2 221 ? -16.850 3.878  26.187  1.00 55.10 ? 222 GLU A OE2   1 
ATOM   2541 N N     . LYS B 2 222 ? -18.768 9.527  28.213  1.00 39.39 ? 223 LYS A N     1 
ATOM   2542 C CA    . LYS B 2 222 ? -19.321 10.818 27.809  1.00 39.56 ? 223 LYS A CA    1 
ATOM   2543 C C     . LYS B 2 222 ? -18.235 11.892 27.658  1.00 39.09 ? 223 LYS A C     1 
ATOM   2544 O O     . LYS B 2 222 ? -18.403 12.878 26.938  1.00 38.84 ? 223 LYS A O     1 
ATOM   2545 C CB    . LYS B 2 222 ? -20.363 11.278 28.831  1.00 39.91 ? 223 LYS A CB    1 
ATOM   2546 C CG    . LYS B 2 222 ? -21.639 10.475 28.800  1.00 41.84 ? 223 LYS A CG    1 
ATOM   2547 C CD    . LYS B 2 222 ? -22.329 10.635 27.463  1.00 44.17 ? 223 LYS A CD    1 
ATOM   2548 C CE    . LYS B 2 222 ? -23.486 9.649  27.311  1.00 46.11 ? 223 LYS A CE    1 
ATOM   2549 N NZ    . LYS B 2 222 ? -23.049 8.217  27.265  1.00 46.70 ? 223 LYS A NZ    1 
ATOM   2550 N N     . ARG B 2 223 ? -17.116 11.667 28.331  1.00 38.50 ? 224 ARG A N     1 
ATOM   2551 C CA    . ARG B 2 223 ? -15.993 12.587 28.337  1.00 37.84 ? 224 ARG A CA    1 
ATOM   2552 C C     . ARG B 2 223 ? -15.053 12.464 27.125  1.00 36.07 ? 224 ARG A C     1 
ATOM   2553 O O     . ARG B 2 223 ? -14.583 11.382 26.777  1.00 36.60 ? 224 ARG A O     1 
ATOM   2554 C CB    . ARG B 2 223 ? -15.216 12.366 29.633  1.00 40.72 ? 224 ARG A CB    1 
ATOM   2555 C CG    . ARG B 2 223 ? -14.500 13.575 30.178  1.00 45.18 ? 224 ARG A CG    1 
ATOM   2556 C CD    . ARG B 2 223 ? -14.267 13.389 31.677  1.00 48.88 ? 224 ARG A CD    1 
ATOM   2557 N NE    . ARG B 2 223 ? -13.190 14.233 32.178  1.00 52.41 ? 224 ARG A NE    1 
ATOM   2558 C CZ    . ARG B 2 223 ? -11.977 14.292 31.629  1.00 54.49 ? 224 ARG A CZ    1 
ATOM   2559 N NH1   . ARG B 2 223 ? -11.691 13.551 30.555  1.00 54.67 ? 224 ARG A NH1   1 
ATOM   2560 N NH2   . ARG B 2 223 ? -11.048 15.095 32.147  1.00 55.09 ? 224 ARG A NH2   1 
ATOM   2561 N N     . ASN B 2 224 ? -14.781 13.594 26.488  1.00 32.58 ? 225 ASN A N     1 
ATOM   2562 C CA    . ASN B 2 224 ? -13.892 13.632 25.345  1.00 28.27 ? 225 ASN A CA    1 
ATOM   2563 C C     . ASN B 2 224 ? -12.513 13.933 25.890  1.00 27.71 ? 225 ASN A C     1 
ATOM   2564 O O     . ASN B 2 224 ? -12.290 15.018 26.417  1.00 26.56 ? 225 ASN A O     1 
ATOM   2565 C CB    . ASN B 2 224 ? -14.306 14.755 24.407  1.00 27.12 ? 225 ASN A CB    1 
ATOM   2566 C CG    . ASN B 2 224 ? -13.430 14.845 23.192  1.00 26.93 ? 225 ASN A CG    1 
ATOM   2567 O OD1   . ASN B 2 224 ? -12.253 14.517 23.240  1.00 29.14 ? 225 ASN A OD1   1 
ATOM   2568 N ND2   . ASN B 2 224 ? -13.995 15.304 22.093  1.00 25.52 ? 225 ASN A ND2   1 
ATOM   2569 N N     . VAL B 2 225 ? -11.590 12.984 25.770  1.00 26.83 ? 226 VAL A N     1 
ATOM   2570 C CA    . VAL B 2 225 ? -10.232 13.188 26.266  1.00 25.56 ? 226 VAL A CA    1 
ATOM   2571 C C     . VAL B 2 225 ? -9.524  14.292 25.497  1.00 25.49 ? 226 VAL A C     1 
ATOM   2572 O O     . VAL B 2 225 ? -8.791  15.083 26.080  1.00 25.45 ? 226 VAL A O     1 
ATOM   2573 C CB    . VAL B 2 225 ? -9.401  11.880 26.193  1.00 25.52 ? 226 VAL A CB    1 
ATOM   2574 C CG1   . VAL B 2 225 ? -7.931  12.169 26.374  1.00 25.80 ? 226 VAL A CG1   1 
ATOM   2575 C CG2   . VAL B 2 225 ? -9.849  10.935 27.284  1.00 26.07 ? 226 VAL A CG2   1 
ATOM   2576 N N     . ALA B 2 226 ? -9.758  14.351 24.191  1.00 25.20 ? 227 ALA A N     1 
ATOM   2577 C CA    . ALA B 2 226 ? -9.145  15.367 23.341  1.00 25.52 ? 227 ALA A CA    1 
ATOM   2578 C C     . ALA B 2 226 ? -10.064 16.588 23.176  1.00 25.57 ? 227 ALA A C     1 
ATOM   2579 O O     . ALA B 2 226 ? -10.018 17.293 22.172  1.00 25.80 ? 227 ALA A O     1 
ATOM   2580 C CB    . ALA B 2 226 ? -8.826  14.763 21.985  1.00 24.18 ? 227 ALA A CB    1 
ATOM   2581 N N     . ALA B 2 227 ? -10.888 16.837 24.182  1.00 25.07 ? 228 ALA A N     1 
ATOM   2582 C CA    . ALA B 2 227 ? -11.829 17.938 24.155  1.00 24.97 ? 228 ALA A CA    1 
ATOM   2583 C C     . ALA B 2 227 ? -11.239 19.277 23.767  1.00 26.22 ? 228 ALA A C     1 
ATOM   2584 O O     . ALA B 2 227 ? -11.744 19.934 22.863  1.00 28.19 ? 228 ALA A O     1 
ATOM   2585 C CB    . ALA B 2 227 ? -12.512 18.060 25.501  1.00 24.45 ? 228 ALA A CB    1 
ATOM   2586 N N     . ASN B 2 228 ? -10.176 19.695 24.443  1.00 27.07 ? 229 ASN A N     1 
ATOM   2587 C CA    . ASN B 2 228 ? -9.584  20.998 24.155  1.00 27.55 ? 229 ASN A CA    1 
ATOM   2588 C C     . ASN B 2 228 ? -8.475  20.984 23.111  1.00 27.36 ? 229 ASN A C     1 
ATOM   2589 O O     . ASN B 2 228 ? -7.516  21.741 23.213  1.00 27.75 ? 229 ASN A O     1 
ATOM   2590 C CB    . ASN B 2 228 ? -9.078  21.638 25.459  1.00 28.32 ? 229 ASN A CB    1 
ATOM   2591 C CG    . ASN B 2 228 ? -8.951  23.152 25.359  1.00 30.32 ? 229 ASN A CG    1 
ATOM   2592 O OD1   . ASN B 2 228 ? -9.909  23.844 25.018  1.00 30.92 ? 229 ASN A OD1   1 
ATOM   2593 N ND2   . ASN B 2 228 ? -7.768  23.669 25.661  1.00 31.97 ? 229 ASN A ND2   1 
ATOM   2594 N N     . LEU B 2 229 ? -8.604  20.115 22.113  1.00 27.45 ? 230 LEU A N     1 
ATOM   2595 C CA    . LEU B 2 229 ? -7.626  20.036 21.030  1.00 27.18 ? 230 LEU A CA    1 
ATOM   2596 C C     . LEU B 2 229 ? -8.192  20.891 19.914  1.00 27.22 ? 230 LEU A C     1 
ATOM   2597 O O     . LEU B 2 229 ? -9.284  20.619 19.419  1.00 26.34 ? 230 LEU A O     1 
ATOM   2598 C CB    . LEU B 2 229 ? -7.463  18.600 20.545  1.00 26.78 ? 230 LEU A CB    1 
ATOM   2599 C CG    . LEU B 2 229 ? -6.606  18.407 19.295  1.00 26.21 ? 230 LEU A CG    1 
ATOM   2600 C CD1   . LEU B 2 229 ? -5.290  19.120 19.450  1.00 27.84 ? 230 LEU A CD1   1 
ATOM   2601 C CD2   . LEU B 2 229 ? -6.378  16.945 19.068  1.00 26.55 ? 230 LEU A CD2   1 
ATOM   2602 N N     . SER B 2 230 ? -7.460  21.925 19.515  1.00 27.76 ? 231 SER A N     1 
ATOM   2603 C CA    . SER B 2 230 ? -7.969  22.825 18.491  1.00 29.18 ? 231 SER A CA    1 
ATOM   2604 C C     . SER B 2 230 ? -8.003  22.216 17.106  1.00 29.02 ? 231 SER A C     1 
ATOM   2605 O O     . SER B 2 230 ? -7.101  21.480 16.711  1.00 30.32 ? 231 SER A O     1 
ATOM   2606 C CB    . SER B 2 230 ? -7.163  24.117 18.463  1.00 29.91 ? 231 SER A CB    1 
ATOM   2607 O OG    . SER B 2 230 ? -5.873  23.898 17.942  1.00 33.76 ? 231 SER A OG    1 
ATOM   2608 N N     . LEU B 2 231 ? -9.061  22.533 16.369  1.00 27.91 ? 232 LEU A N     1 
ATOM   2609 C CA    . LEU B 2 231 ? -9.235  22.019 15.021  1.00 27.01 ? 232 LEU A CA    1 
ATOM   2610 C C     . LEU B 2 231 ? -7.999  22.252 14.158  1.00 27.69 ? 232 LEU A C     1 
ATOM   2611 O O     . LEU B 2 231 ? -7.716  21.480 13.242  1.00 28.44 ? 232 LEU A O     1 
ATOM   2612 C CB    . LEU B 2 231 ? -10.454 22.671 14.370  1.00 24.23 ? 232 LEU A CB    1 
ATOM   2613 C CG    . LEU B 2 231 ? -10.697 22.302 12.912  1.00 23.73 ? 232 LEU A CG    1 
ATOM   2614 C CD1   . LEU B 2 231 ? -10.951 20.816 12.796  1.00 22.50 ? 232 LEU A CD1   1 
ATOM   2615 C CD2   . LEU B 2 231 ? -11.872 23.093 12.380  1.00 24.72 ? 232 LEU A CD2   1 
ATOM   2616 N N     . ASP B 2 232 ? -7.253  23.310 14.445  1.00 27.86 ? 233 ASP A N     1 
ATOM   2617 C CA    . ASP B 2 232 ? -6.072  23.588 13.650  1.00 27.99 ? 233 ASP A CA    1 
ATOM   2618 C C     . ASP B 2 232 ? -4.890  22.781 14.135  1.00 27.90 ? 233 ASP A C     1 
ATOM   2619 O O     . ASP B 2 232 ? -4.044  22.383 13.340  1.00 27.89 ? 233 ASP A O     1 
ATOM   2620 C CB    . ASP B 2 232 ? -5.757  25.083 13.658  1.00 29.79 ? 233 ASP A CB    1 
ATOM   2621 C CG    . ASP B 2 232 ? -6.888  25.920 13.064  1.00 31.54 ? 233 ASP A CG    1 
ATOM   2622 O OD1   . ASP B 2 232 ? -7.321  25.637 11.927  1.00 32.08 ? 233 ASP A OD1   1 
ATOM   2623 O OD2   . ASP B 2 232 ? -7.349  26.865 13.733  1.00 33.13 ? 233 ASP A OD2   1 
ATOM   2624 N N     . ASN B 2 233 ? -4.835  22.527 15.437  1.00 27.59 ? 234 ASN A N     1 
ATOM   2625 C CA    . ASN B 2 233 ? -3.754  21.725 15.994  1.00 27.54 ? 234 ASN A CA    1 
ATOM   2626 C C     . ASN B 2 233 ? -3.892  20.281 15.530  1.00 27.65 ? 234 ASN A C     1 
ATOM   2627 O O     . ASN B 2 233 ? -2.902  19.579 15.340  1.00 27.19 ? 234 ASN A O     1 
ATOM   2628 C CB    . ASN B 2 233 ? -3.772  21.790 17.518  1.00 28.56 ? 234 ASN A CB    1 
ATOM   2629 C CG    . ASN B 2 233 ? -2.957  22.944 18.055  1.00 30.57 ? 234 ASN A CG    1 
ATOM   2630 O OD1   . ASN B 2 233 ? -2.942  23.206 19.254  1.00 31.39 ? 234 ASN A OD1   1 
ATOM   2631 N ND2   . ASN B 2 233 ? -2.267  23.638 17.163  1.00 30.15 ? 234 ASN A ND2   1 
ATOM   2632 N N     . LEU B 2 234 ? -5.131  19.840 15.356  1.00 28.10 ? 235 LEU A N     1 
ATOM   2633 C CA    . LEU B 2 234 ? -5.395  18.491 14.881  1.00 27.95 ? 235 LEU A CA    1 
ATOM   2634 C C     . LEU B 2 234 ? -4.910  18.429 13.443  1.00 28.48 ? 235 LEU A C     1 
ATOM   2635 O O     . LEU B 2 234 ? -4.271  17.466 13.025  1.00 29.07 ? 235 LEU A O     1 
ATOM   2636 C CB    . LEU B 2 234 ? -6.890  18.195 14.914  1.00 26.89 ? 235 LEU A CB    1 
ATOM   2637 C CG    . LEU B 2 234 ? -7.269  16.889 14.222  1.00 27.13 ? 235 LEU A CG    1 
ATOM   2638 C CD1   . LEU B 2 234 ? -6.848  15.720 15.091  1.00 24.33 ? 235 LEU A CD1   1 
ATOM   2639 C CD2   . LEU B 2 234 ? -8.768  16.857 13.947  1.00 27.98 ? 235 LEU A CD2   1 
ATOM   2640 N N     . ALA B 2 235 ? -5.226  19.471 12.685  1.00 28.65 ? 236 ALA A N     1 
ATOM   2641 C CA    . ALA B 2 235 ? -4.821  19.543 11.296  1.00 28.60 ? 236 ALA A CA    1 
ATOM   2642 C C     . ALA B 2 235 ? -3.302  19.512 11.188  1.00 28.96 ? 236 ALA A C     1 
ATOM   2643 O O     . ALA B 2 235 ? -2.747  18.802 10.349  1.00 29.34 ? 236 ALA A O     1 
ATOM   2644 C CB    . ALA B 2 235 ? -5.364  20.810 10.670  1.00 28.69 ? 236 ALA A CB    1 
ATOM   2645 N N     . ARG B 2 236 ? -2.636  20.277 12.051  1.00 28.79 ? 237 ARG A N     1 
ATOM   2646 C CA    . ARG B 2 236 ? -1.178  20.353 12.054  1.00 28.81 ? 237 ARG A CA    1 
ATOM   2647 C C     . ARG B 2 236 ? -0.505  19.028 12.402  1.00 28.14 ? 237 ARG A C     1 
ATOM   2648 O O     . ARG B 2 236 ? 0.619   18.766 11.970  1.00 27.93 ? 237 ARG A O     1 
ATOM   2649 C CB    . ARG B 2 236 ? -0.698  21.430 13.031  1.00 30.53 ? 237 ARG A CB    1 
ATOM   2650 C CG    . ARG B 2 236 ? -1.210  22.815 12.716  1.00 33.00 ? 237 ARG A CG    1 
ATOM   2651 C CD    . ARG B 2 236 ? -0.451  23.889 13.481  1.00 37.23 ? 237 ARG A CD    1 
ATOM   2652 N NE    . ARG B 2 236 ? -0.986  25.227 13.214  1.00 40.43 ? 237 ARG A NE    1 
ATOM   2653 C CZ    . ARG B 2 236 ? -1.966  25.806 13.913  1.00 42.05 ? 237 ARG A CZ    1 
ATOM   2654 N NH1   . ARG B 2 236 ? -2.527  25.174 14.941  1.00 42.22 ? 237 ARG A NH1   1 
ATOM   2655 N NH2   . ARG B 2 236 ? -2.404  27.013 13.571  1.00 41.55 ? 237 ARG A NH2   1 
ATOM   2656 N N     . PHE B 2 237 ? -1.185  18.199 13.187  1.00 27.51 ? 238 PHE A N     1 
ATOM   2657 C CA    . PHE B 2 237 ? -0.637  16.905 13.580  1.00 26.65 ? 238 PHE A CA    1 
ATOM   2658 C C     . PHE B 2 237 ? -0.831  15.922 12.438  1.00 25.86 ? 238 PHE A C     1 
ATOM   2659 O O     . PHE B 2 237 ? 0.079   15.174 12.087  1.00 24.98 ? 238 PHE A O     1 
ATOM   2660 C CB    . PHE B 2 237 ? -1.342  16.384 14.835  1.00 25.53 ? 238 PHE A CB    1 
ATOM   2661 C CG    . PHE B 2 237 ? -0.834  15.045 15.312  1.00 26.65 ? 238 PHE A CG    1 
ATOM   2662 C CD1   . PHE B 2 237 ? 0.418   14.927 15.900  1.00 26.70 ? 238 PHE A CD1   1 
ATOM   2663 C CD2   . PHE B 2 237 ? -1.624  13.899 15.191  1.00 27.76 ? 238 PHE A CD2   1 
ATOM   2664 C CE1   . PHE B 2 237 ? 0.874   13.695 16.364  1.00 26.32 ? 238 PHE A CE1   1 
ATOM   2665 C CE2   . PHE B 2 237 ? -1.172  12.659 15.654  1.00 26.42 ? 238 PHE A CE2   1 
ATOM   2666 C CZ    . PHE B 2 237 ? 0.074   12.561 16.240  1.00 26.79 ? 238 PHE A CZ    1 
ATOM   2667 N N     . VAL B 2 238 ? -2.026  15.928 11.861  1.00 25.64 ? 239 VAL A N     1 
ATOM   2668 C CA    . VAL B 2 238 ? -2.327  15.034 10.756  1.00 26.66 ? 239 VAL A CA    1 
ATOM   2669 C C     . VAL B 2 238 ? -1.309  15.274 9.642   1.00 26.87 ? 239 VAL A C     1 
ATOM   2670 O O     . VAL B 2 238 ? -0.810  14.332 9.022   1.00 27.08 ? 239 VAL A O     1 
ATOM   2671 C CB    . VAL B 2 238 ? -3.778  15.256 10.244  1.00 26.56 ? 239 VAL A CB    1 
ATOM   2672 C CG1   . VAL B 2 238 ? -4.031  14.460 8.975   1.00 26.02 ? 239 VAL A CG1   1 
ATOM   2673 C CG2   . VAL B 2 238 ? -4.765  14.824 11.319  1.00 25.08 ? 239 VAL A CG2   1 
ATOM   2674 N N     . HIS B 2 239 ? -0.978  16.536 9.410   1.00 27.17 ? 240 HIS A N     1 
ATOM   2675 C CA    . HIS B 2 239 ? -0.006  16.870 8.382   1.00 27.80 ? 240 HIS A CA    1 
ATOM   2676 C C     . HIS B 2 239 ? 1.385   16.452 8.831   1.00 28.12 ? 240 HIS A C     1 
ATOM   2677 O O     . HIS B 2 239 ? 2.144   15.858 8.076   1.00 27.22 ? 240 HIS A O     1 
ATOM   2678 C CB    . HIS B 2 239 ? -0.016  18.372 8.110   1.00 28.77 ? 240 HIS A CB    1 
ATOM   2679 C CG    . HIS B 2 239 ? 0.782   18.774 6.909   1.00 30.58 ? 240 HIS A CG    1 
ATOM   2680 N ND1   . HIS B 2 239 ? 1.771   19.733 6.959   1.00 30.12 ? 240 HIS A ND1   1 
ATOM   2681 C CD2   . HIS B 2 239 ? 0.723   18.361 5.621   1.00 30.63 ? 240 HIS A CD2   1 
ATOM   2682 C CE1   . HIS B 2 239 ? 2.287   19.894 5.755   1.00 30.84 ? 240 HIS A CE1   1 
ATOM   2683 N NE2   . HIS B 2 239 ? 1.669   19.074 4.925   1.00 31.17 ? 240 HIS A NE2   1 
ATOM   2684 N N     . LEU B 2 240 ? 1.713   16.770 10.074  1.00 28.72 ? 241 LEU A N     1 
ATOM   2685 C CA    . LEU B 2 240 ? 3.021   16.441 10.616  1.00 29.59 ? 241 LEU A CA    1 
ATOM   2686 C C     . LEU B 2 240 ? 3.307   14.947 10.567  1.00 30.17 ? 241 LEU A C     1 
ATOM   2687 O O     . LEU B 2 240 ? 4.457   14.528 10.444  1.00 30.17 ? 241 LEU A O     1 
ATOM   2688 C CB    . LEU B 2 240 ? 3.136   16.964 12.050  1.00 30.11 ? 241 LEU A CB    1 
ATOM   2689 C CG    . LEU B 2 240 ? 4.061   18.174 12.222  1.00 29.96 ? 241 LEU A CG    1 
ATOM   2690 C CD1   . LEU B 2 240 ? 3.788   18.860 13.546  1.00 30.33 ? 241 LEU A CD1   1 
ATOM   2691 C CD2   . LEU B 2 240 ? 5.510   17.718 12.139  1.00 30.50 ? 241 LEU A CD2   1 
ATOM   2692 N N     . CYS B 2 241 ? 2.261   14.138 10.658  1.00 30.29 ? 242 CYS A N     1 
ATOM   2693 C CA    . CYS B 2 241 ? 2.443   12.700 10.612  1.00 30.26 ? 242 CYS A CA    1 
ATOM   2694 C C     . CYS B 2 241 ? 2.676   12.295 9.173   1.00 30.31 ? 242 CYS A C     1 
ATOM   2695 O O     . CYS B 2 241 ? 3.540   11.470 8.881   1.00 30.50 ? 242 CYS A O     1 
ATOM   2696 C CB    . CYS B 2 241 ? 1.217   11.995 11.178  1.00 30.74 ? 242 CYS A CB    1 
ATOM   2697 S SG    . CYS B 2 241 ? 0.991   12.286 12.942  1.00 31.98 ? 242 CYS A SG    1 
ATOM   2698 N N     . ARG B 2 242 ? 1.913   12.898 8.270   1.00 30.17 ? 243 ARG A N     1 
ATOM   2699 C CA    . ARG B 2 242 ? 2.047   12.600 6.850   1.00 30.43 ? 243 ARG A CA    1 
ATOM   2700 C C     . ARG B 2 242 ? 3.453   12.897 6.327   1.00 31.28 ? 243 ARG A C     1 
ATOM   2701 O O     . ARG B 2 242 ? 3.971   12.177 5.471   1.00 31.01 ? 243 ARG A O     1 
ATOM   2702 C CB    . ARG B 2 242 ? 1.024   13.393 6.048   1.00 27.06 ? 243 ARG A CB    1 
ATOM   2703 C CG    . ARG B 2 242 ? -0.400  13.014 6.348   1.00 25.80 ? 243 ARG A CG    1 
ATOM   2704 C CD    . ARG B 2 242 ? -1.331  13.776 5.442   1.00 26.19 ? 243 ARG A CD    1 
ATOM   2705 N NE    . ARG B 2 242 ? -2.721  13.418 5.669   1.00 25.82 ? 243 ARG A NE    1 
ATOM   2706 C CZ    . ARG B 2 242 ? -3.747  14.093 5.176   1.00 25.59 ? 243 ARG A CZ    1 
ATOM   2707 N NH1   . ARG B 2 242 ? -3.545  15.161 4.425   1.00 25.63 ? 243 ARG A NH1   1 
ATOM   2708 N NH2   . ARG B 2 242 ? -4.976  13.704 5.448   1.00 26.29 ? 243 ARG A NH2   1 
ATOM   2709 N N     . GLU B 2 243 ? 4.062   13.957 6.846   1.00 32.51 ? 244 GLU A N     1 
ATOM   2710 C CA    . GLU B 2 243 ? 5.402   14.347 6.436   1.00 34.63 ? 244 GLU A CA    1 
ATOM   2711 C C     . GLU B 2 243 ? 6.456   13.484 7.087   1.00 35.96 ? 244 GLU A C     1 
ATOM   2712 O O     . GLU B 2 243 ? 7.448   13.128 6.455   1.00 37.00 ? 244 GLU A O     1 
ATOM   2713 C CB    . GLU B 2 243 ? 5.673   15.792 6.809   1.00 34.93 ? 244 GLU A CB    1 
ATOM   2714 C CG    . GLU B 2 243 ? 4.720   16.767 6.188   1.00 37.89 ? 244 GLU A CG    1 
ATOM   2715 C CD    . GLU B 2 243 ? 5.165   18.186 6.423   1.00 40.22 ? 244 GLU A CD    1 
ATOM   2716 O OE1   . GLU B 2 243 ? 5.328   18.553 7.610   1.00 40.49 ? 244 GLU A OE1   1 
ATOM   2717 O OE2   . GLU B 2 243 ? 5.360   18.924 5.425   1.00 41.12 ? 244 GLU A OE2   1 
ATOM   2718 N N     . PHE B 2 244 ? 6.253   13.148 8.355   1.00 36.94 ? 245 PHE A N     1 
ATOM   2719 C CA    . PHE B 2 244 ? 7.237   12.331 9.044   1.00 36.86 ? 245 PHE A CA    1 
ATOM   2720 C C     . PHE B 2 244 ? 7.393   11.020 8.307   1.00 36.97 ? 245 PHE A C     1 
ATOM   2721 O O     . PHE B 2 244 ? 8.505   10.585 8.007   1.00 35.95 ? 245 PHE A O     1 
ATOM   2722 C CB    . PHE B 2 244 ? 6.823   12.034 10.482  1.00 35.89 ? 245 PHE A CB    1 
ATOM   2723 C CG    . PHE B 2 244 ? 7.847   11.238 11.237  1.00 35.48 ? 245 PHE A CG    1 
ATOM   2724 C CD1   . PHE B 2 244 ? 8.974   11.858 11.769  1.00 34.77 ? 245 PHE A CD1   1 
ATOM   2725 C CD2   . PHE B 2 244 ? 7.715   9.859  11.374  1.00 35.39 ? 245 PHE A CD2   1 
ATOM   2726 C CE1   . PHE B 2 244 ? 9.949   11.115 12.421  1.00 35.25 ? 245 PHE A CE1   1 
ATOM   2727 C CE2   . PHE B 2 244 ? 8.689   9.108  12.026  1.00 35.20 ? 245 PHE A CE2   1 
ATOM   2728 C CZ    . PHE B 2 244 ? 9.802   9.735  12.549  1.00 35.30 ? 245 PHE A CZ    1 
ATOM   2729 N N     . MET B 2 245 ? 6.264   10.390 8.019   1.00 37.39 ? 246 MET A N     1 
ATOM   2730 C CA    . MET B 2 245 ? 6.285   9.124  7.321   1.00 38.16 ? 246 MET A CA    1 
ATOM   2731 C C     . MET B 2 245 ? 6.867   9.277  5.925   1.00 38.26 ? 246 MET A C     1 
ATOM   2732 O O     . MET B 2 245 ? 7.441   8.339  5.390   1.00 38.41 ? 246 MET A O     1 
ATOM   2733 C CB    . MET B 2 245 ? 4.874   8.552  7.253   1.00 38.73 ? 246 MET A CB    1 
ATOM   2734 C CG    . MET B 2 245 ? 4.323   8.119  8.609   1.00 39.85 ? 246 MET A CG    1 
ATOM   2735 S SD    . MET B 2 245 ? 4.940   6.508  9.153   1.00 41.77 ? 246 MET A SD    1 
ATOM   2736 C CE    . MET B 2 245 ? 6.564   6.942  9.751   1.00 40.60 ? 246 MET A CE    1 
ATOM   2737 N N     . GLU B 2 246 ? 6.735   10.457 5.334   1.00 39.24 ? 247 GLU A N     1 
ATOM   2738 C CA    . GLU B 2 246 ? 7.268   10.666 3.996   1.00 40.15 ? 247 GLU A CA    1 
ATOM   2739 C C     . GLU B 2 246 ? 8.774   10.847 4.050   1.00 39.68 ? 247 GLU A C     1 
ATOM   2740 O O     . GLU B 2 246 ? 9.503   10.333 3.200   1.00 39.84 ? 247 GLU A O     1 
ATOM   2741 C CB    . GLU B 2 246 ? 6.629   11.886 3.338   1.00 42.01 ? 247 GLU A CB    1 
ATOM   2742 C CG    . GLU B 2 246 ? 6.910   11.968 1.837   1.00 45.61 ? 247 GLU A CG    1 
ATOM   2743 C CD    . GLU B 2 246 ? 6.157   13.101 1.144   1.00 47.58 ? 247 GLU A CD    1 
ATOM   2744 O OE1   . GLU B 2 246 ? 6.326   13.243 -0.094  1.00 48.52 ? 247 GLU A OE1   1 
ATOM   2745 O OE2   . GLU B 2 246 ? 5.403   13.842 1.833   1.00 47.78 ? 247 GLU A OE2   1 
ATOM   2746 N N     . ALA B 2 247 ? 9.234   11.577 5.060   1.00 39.38 ? 248 ALA A N     1 
ATOM   2747 C CA    . ALA B 2 247 ? 10.659  11.830 5.250   1.00 38.41 ? 248 ALA A CA    1 
ATOM   2748 C C     . ALA B 2 247 ? 11.016  11.799 6.739   1.00 37.99 ? 248 ALA A C     1 
ATOM   2749 O O     . ALA B 2 247 ? 11.113  12.837 7.388   1.00 37.55 ? 248 ALA A O     1 
ATOM   2750 C CB    . ALA B 2 247 ? 11.026  13.176 4.654   1.00 37.62 ? 248 ALA A CB    1 
ATOM   2751 N N     . PRO B 2 248 ? 11.213  10.598 7.299   1.00 38.38 ? 249 PRO A N     1 
ATOM   2752 C CA    . PRO B 2 248 ? 11.557  10.511 8.720   1.00 39.01 ? 249 PRO A CA    1 
ATOM   2753 C C     . PRO B 2 248 ? 12.790  11.362 8.973   1.00 39.40 ? 249 PRO A C     1 
ATOM   2754 O O     . PRO B 2 248 ? 13.641  11.494 8.101   1.00 40.30 ? 249 PRO A O     1 
ATOM   2755 C CB    . PRO B 2 248 ? 11.829  9.024  8.919   1.00 40.08 ? 249 PRO A CB    1 
ATOM   2756 C CG    . PRO B 2 248 ? 10.959  8.373  7.870   1.00 40.09 ? 249 PRO A CG    1 
ATOM   2757 C CD    . PRO B 2 248 ? 11.184  9.263  6.679   1.00 38.54 ? 249 PRO A CD    1 
ATOM   2758 N N     . SER B 2 249 ? 12.884  11.941 10.160  1.00 39.46 ? 250 SER A N     1 
ATOM   2759 C CA    . SER B 2 249 ? 14.017  12.788 10.493  1.00 38.65 ? 250 SER A CA    1 
ATOM   2760 C C     . SER B 2 249 ? 14.035  13.094 11.967  1.00 38.34 ? 250 SER A C     1 
ATOM   2761 O O     . SER B 2 249 ? 12.998  13.361 12.556  1.00 38.73 ? 250 SER A O     1 
ATOM   2762 C CB    . SER B 2 249 ? 13.932  14.102 9.731   1.00 38.41 ? 250 SER A CB    1 
ATOM   2763 O OG    . SER B 2 249 ? 14.850  15.035 10.266  1.00 39.94 ? 250 SER A OG    1 
ATOM   2764 N N     . LEU B 2 250 ? 15.218  13.081 12.561  1.00 37.99 ? 251 LEU A N     1 
ATOM   2765 C CA    . LEU B 2 250 ? 15.340  13.363 13.981  1.00 38.31 ? 251 LEU A CA    1 
ATOM   2766 C C     . LEU B 2 250 ? 14.965  14.813 14.292  1.00 38.53 ? 251 LEU A C     1 
ATOM   2767 O O     . LEU B 2 250 ? 14.830  15.192 15.449  1.00 38.79 ? 251 LEU A O     1 
ATOM   2768 C CB    . LEU B 2 250 ? 16.771  13.093 14.450  1.00 38.93 ? 251 LEU A CB    1 
ATOM   2769 C CG    . LEU B 2 250 ? 16.958  13.134 15.964  1.00 39.12 ? 251 LEU A CG    1 
ATOM   2770 C CD1   . LEU B 2 250 ? 16.130  12.015 16.580  1.00 40.33 ? 251 LEU A CD1   1 
ATOM   2771 C CD2   . LEU B 2 250 ? 18.426  12.983 16.329  1.00 38.39 ? 251 LEU A CD2   1 
ATOM   2772 N N     . GLY B 2 251 ? 14.792  15.622 13.255  1.00 38.71 ? 252 GLY A N     1 
ATOM   2773 C CA    . GLY B 2 251 ? 14.442  17.017 13.467  1.00 39.11 ? 252 GLY A CA    1 
ATOM   2774 C C     . GLY B 2 251 ? 13.042  17.240 14.016  1.00 39.23 ? 252 GLY A C     1 
ATOM   2775 O O     . GLY B 2 251 ? 12.736  18.316 14.551  1.00 39.36 ? 252 GLY A O     1 
ATOM   2776 N N     . PHE B 2 252 ? 12.189  16.230 13.878  1.00 38.18 ? 253 PHE A N     1 
ATOM   2777 C CA    . PHE B 2 252 ? 10.823  16.314 14.363  1.00 37.74 ? 253 PHE A CA    1 
ATOM   2778 C C     . PHE B 2 252 ? 10.755  16.259 15.880  1.00 37.92 ? 253 PHE A C     1 
ATOM   2779 O O     . PHE B 2 252 ? 9.765   16.655 16.480  1.00 38.89 ? 253 PHE A O     1 
ATOM   2780 C CB    . PHE B 2 252 ? 9.984   15.183 13.777  1.00 37.89 ? 253 PHE A CB    1 
ATOM   2781 C CG    . PHE B 2 252 ? 9.706   15.338 12.313  1.00 39.26 ? 253 PHE A CG    1 
ATOM   2782 C CD1   . PHE B 2 252 ? 10.735  15.264 11.386  1.00 39.04 ? 253 PHE A CD1   1 
ATOM   2783 C CD2   . PHE B 2 252 ? 8.414   15.583 11.860  1.00 39.92 ? 253 PHE A CD2   1 
ATOM   2784 C CE1   . PHE B 2 252 ? 10.477  15.433 10.031  1.00 39.23 ? 253 PHE A CE1   1 
ATOM   2785 C CE2   . PHE B 2 252 ? 8.151   15.753 10.515  1.00 39.51 ? 253 PHE A CE2   1 
ATOM   2786 C CZ    . PHE B 2 252 ? 9.181   15.680 9.598   1.00 39.40 ? 253 PHE A CZ    1 
ATOM   2787 N N     . PHE B 2 253 ? 11.805  15.769 16.511  1.00 37.74 ? 254 PHE A N     1 
ATOM   2788 C CA    . PHE B 2 253 ? 11.790  15.693 17.958  1.00 39.44 ? 254 PHE A CA    1 
ATOM   2789 C C     . PHE B 2 253 ? 12.599  16.830 18.585  1.00 41.09 ? 254 PHE A C     1 
ATOM   2790 O O     . PHE B 2 253 ? 12.559  17.038 19.797  1.00 41.47 ? 254 PHE A O     1 
ATOM   2791 C CB    . PHE B 2 253 ? 12.316  14.323 18.403  1.00 38.66 ? 254 PHE A CB    1 
ATOM   2792 C CG    . PHE B 2 253 ? 11.503  13.170 17.878  1.00 38.15 ? 254 PHE A CG    1 
ATOM   2793 C CD1   . PHE B 2 253 ? 11.576  12.800 16.538  1.00 37.51 ? 254 PHE A CD1   1 
ATOM   2794 C CD2   . PHE B 2 253 ? 10.621  12.487 18.711  1.00 38.12 ? 254 PHE A CD2   1 
ATOM   2795 C CE1   . PHE B 2 253 ? 10.780  11.771 16.034  1.00 36.85 ? 254 PHE A CE1   1 
ATOM   2796 C CE2   . PHE B 2 253 ? 9.821   11.459 18.216  1.00 38.28 ? 254 PHE A CE2   1 
ATOM   2797 C CZ    . PHE B 2 253 ? 9.902   11.100 16.872  1.00 37.35 ? 254 PHE A CZ    1 
ATOM   2798 N N     . LYS B 2 254 ? 13.318  17.570 17.743  1.00 42.69 ? 255 LYS A N     1 
ATOM   2799 C CA    . LYS B 2 254 ? 14.145  18.685 18.182  1.00 42.98 ? 255 LYS A CA    1 
ATOM   2800 C C     . LYS B 2 254 ? 13.390  19.989 18.135  1.00 45.15 ? 255 LYS A C     1 
ATOM   2801 O O     . LYS B 2 254 ? 12.986  20.440 17.061  1.00 44.62 ? 255 LYS A O     1 
ATOM   2802 C CB    . LYS B 2 254 ? 15.370  18.830 17.294  1.00 41.33 ? 255 LYS A CB    1 
ATOM   2803 C CG    . LYS B 2 254 ? 16.406  17.769 17.480  1.00 41.54 ? 255 LYS A CG    1 
ATOM   2804 C CD    . LYS B 2 254 ? 17.552  18.036 16.540  1.00 44.15 ? 255 LYS A CD    1 
ATOM   2805 C CE    . LYS B 2 254 ? 18.695  17.078 16.781  1.00 46.50 ? 255 LYS A CE    1 
ATOM   2806 N NZ    . LYS B 2 254 ? 19.829  17.349 15.852  1.00 49.59 ? 255 LYS A NZ    1 
ATOM   2807 N N     . PRO B 2 255 ? 13.196  20.622 19.301  1.00 47.24 ? 256 PRO A N     1 
ATOM   2808 C CA    . PRO B 2 255 ? 12.485  21.894 19.377  1.00 49.86 ? 256 PRO A CA    1 
ATOM   2809 C C     . PRO B 2 255 ? 13.060  22.842 18.346  1.00 53.01 ? 256 PRO A C     1 
ATOM   2810 O O     . PRO B 2 255 ? 14.263  23.105 18.337  1.00 53.61 ? 256 PRO A O     1 
ATOM   2811 C CB    . PRO B 2 255 ? 12.762  22.354 20.797  1.00 48.62 ? 256 PRO A CB    1 
ATOM   2812 C CG    . PRO B 2 255 ? 12.785  21.073 21.544  1.00 48.35 ? 256 PRO A CG    1 
ATOM   2813 C CD    . PRO B 2 255 ? 13.623  20.190 20.642  1.00 48.19 ? 256 PRO A CD    1 
ATOM   2814 N N     . LYS B 2 256 ? 12.195  23.336 17.469  1.00 56.79 ? 257 LYS A N     1 
ATOM   2815 C CA    . LYS B 2 256 ? 12.605  24.250 16.417  1.00 60.71 ? 257 LYS A CA    1 
ATOM   2816 C C     . LYS B 2 256 ? 13.327  25.470 17.003  1.00 63.15 ? 257 LYS A C     1 
ATOM   2817 O O     . LYS B 2 256 ? 13.008  25.923 18.118  1.00 63.25 ? 257 LYS A O     1 
ATOM   2818 C CB    . LYS B 2 256 ? 11.372  24.683 15.619  1.00 61.70 ? 257 LYS A CB    1 
ATOM   2819 C CG    . LYS B 2 256 ? 10.352  23.548 15.362  1.00 63.33 ? 257 LYS A CG    1 
ATOM   2820 C CD    . LYS B 2 256 ? 10.979  22.327 14.663  1.00 63.81 ? 257 LYS A CD    1 
ATOM   2821 C CE    . LYS B 2 256 ? 9.967   21.187 14.470  1.00 63.24 ? 257 LYS A CE    1 
ATOM   2822 N NZ    . LYS B 2 256 ? 10.601  19.929 13.955  1.00 62.19 ? 257 LYS A NZ    1 
ATOM   2823 N N     . HIS B 2 257 ? 14.308  25.986 16.256  1.00 65.87 ? 258 HIS A N     1 
ATOM   2824 C CA    . HIS B 2 257 ? 15.091  27.151 16.690  1.00 68.37 ? 258 HIS A CA    1 
ATOM   2825 C C     . HIS B 2 257 ? 14.302  28.463 16.638  1.00 68.90 ? 258 HIS A C     1 
ATOM   2826 O O     . HIS B 2 257 ? 13.525  28.692 15.703  1.00 68.82 ? 258 HIS A O     1 
ATOM   2827 C CB    . HIS B 2 257 ? 16.357  27.290 15.835  1.00 69.77 ? 258 HIS A CB    1 
ATOM   2828 C CG    . HIS B 2 257 ? 17.599  26.764 16.494  1.00 71.63 ? 258 HIS A CG    1 
ATOM   2829 N ND1   . HIS B 2 257 ? 18.806  26.660 15.829  1.00 72.30 ? 258 HIS A ND1   1 
ATOM   2830 C CD2   . HIS B 2 257 ? 17.827  26.334 17.760  1.00 71.99 ? 258 HIS A CD2   1 
ATOM   2831 C CE1   . HIS B 2 257 ? 19.723  26.188 16.659  1.00 72.52 ? 258 HIS A CE1   1 
ATOM   2832 N NE2   . HIS B 2 257 ? 19.155  25.982 17.836  1.00 72.44 ? 258 HIS A NE2   1 
ATOM   2833 N N     . PRO B 2 258 ? 14.500  29.341 17.647  1.00 69.59 ? 259 PRO A N     1 
ATOM   2834 C CA    . PRO B 2 258 ? 13.825  30.647 17.755  1.00 70.21 ? 259 PRO A CA    1 
ATOM   2835 C C     . PRO B 2 258 ? 13.874  31.459 16.446  1.00 70.94 ? 259 PRO A C     1 
ATOM   2836 O O     . PRO B 2 258 ? 12.873  32.063 16.034  1.00 70.45 ? 259 PRO A O     1 
ATOM   2837 C CB    . PRO B 2 258 ? 14.584  31.329 18.898  1.00 69.47 ? 259 PRO A CB    1 
ATOM   2838 C CG    . PRO B 2 258 ? 14.954  30.166 19.784  1.00 69.09 ? 259 PRO A CG    1 
ATOM   2839 C CD    . PRO B 2 258 ? 15.439  29.145 18.771  1.00 69.31 ? 259 PRO A CD    1 
ATOM   2840 N N     . LEU B 2 259 ? 15.044  31.453 15.804  1.00 71.82 ? 260 LEU A N     1 
ATOM   2841 C CA    . LEU B 2 259 ? 15.273  32.164 14.543  1.00 72.20 ? 260 LEU A CA    1 
ATOM   2842 C C     . LEU B 2 259 ? 14.849  33.632 14.570  1.00 72.35 ? 260 LEU A C     1 
ATOM   2843 O O     . LEU B 2 259 ? 13.804  34.001 14.007  1.00 72.37 ? 260 LEU A O     1 
ATOM   2844 C CB    . LEU B 2 259 ? 14.561  31.456 13.381  1.00 71.85 ? 260 LEU A CB    1 
ATOM   2845 C CG    . LEU B 2 259 ? 14.595  32.237 12.059  1.00 71.95 ? 260 LEU A CG    1 
ATOM   2846 C CD1   . LEU B 2 259 ? 16.047  32.585 11.676  1.00 71.03 ? 260 LEU A CD1   1 
ATOM   2847 C CD2   . LEU B 2 259 ? 13.912  31.418 10.978  1.00 71.73 ? 260 LEU A CD2   1 
ATOM   2848 N N     . GLU B 2 260 ? 15.669  34.461 15.223  1.00 72.62 ? 261 GLU A N     1 
ATOM   2849 C CA    . GLU B 2 260 ? 15.411  35.900 15.320  1.00 72.62 ? 261 GLU A CA    1 
ATOM   2850 C C     . GLU B 2 260 ? 15.533  36.533 13.939  1.00 71.73 ? 261 GLU A C     1 
ATOM   2851 O O     . GLU B 2 260 ? 16.108  35.935 13.015  1.00 71.66 ? 261 GLU A O     1 
ATOM   2852 C CB    . GLU B 2 260 ? 16.404  36.580 16.273  1.00 73.80 ? 261 GLU A CB    1 
ATOM   2853 C CG    . GLU B 2 260 ? 16.038  36.507 17.769  1.00 75.33 ? 261 GLU A CG    1 
ATOM   2854 C CD    . GLU B 2 260 ? 16.407  35.184 18.427  1.00 75.77 ? 261 GLU A CD    1 
ATOM   2855 O OE1   . GLU B 2 260 ? 17.607  34.828 18.415  1.00 75.73 ? 261 GLU A OE1   1 
ATOM   2856 O OE2   . GLU B 2 260 ? 15.496  34.509 18.962  1.00 76.87 ? 261 GLU A OE2   1 
ATOM   2857 N N     . ILE B 2 261 ? 14.986  37.736 13.800  1.00 70.35 ? 262 ILE A N     1 
ATOM   2858 C CA    . ILE B 2 261 ? 15.038  38.451 12.525  1.00 69.33 ? 262 ILE A CA    1 
ATOM   2859 C C     . ILE B 2 261 ? 15.444  39.890 12.825  1.00 68.14 ? 262 ILE A C     1 
ATOM   2860 O O     . ILE B 2 261 ? 15.130  40.410 13.903  1.00 68.41 ? 262 ILE A O     1 
ATOM   2861 C CB    . ILE B 2 261 ? 13.633  38.434 11.815  1.00 69.32 ? 262 ILE A CB    1 
ATOM   2862 C CG1   . ILE B 2 261 ? 13.748  38.939 10.359  1.00 68.22 ? 262 ILE A CG1   1 
ATOM   2863 C CG2   . ILE B 2 261 ? 12.627  39.278 12.629  1.00 69.42 ? 262 ILE A CG2   1 
ATOM   2864 C CD1   . ILE B 2 261 ? 12.433  38.862 9.545   1.00 65.91 ? 262 ILE A CD1   1 
ATOM   2865 N N     . GLU B 2 262 ? 16.162  40.529 11.908  1.00 66.08 ? 263 GLU A N     1 
ATOM   2866 C CA    . GLU B 2 262 ? 16.530  41.914 12.159  1.00 64.29 ? 263 GLU A CA    1 
ATOM   2867 C C     . GLU B 2 262 ? 15.287  42.734 11.832  1.00 61.74 ? 263 GLU A C     1 
ATOM   2868 O O     . GLU B 2 262 ? 14.630  42.522 10.797  1.00 60.85 ? 263 GLU A O     1 
ATOM   2869 C CB    . GLU B 2 262 ? 17.748  42.367 11.319  1.00 65.80 ? 263 GLU A CB    1 
ATOM   2870 C CG    . GLU B 2 262 ? 17.574  42.417 9.788   1.00 68.03 ? 263 GLU A CG    1 
ATOM   2871 C CD    . GLU B 2 262 ? 17.581  41.039 9.118   1.00 69.01 ? 263 GLU A CD    1 
ATOM   2872 O OE1   . GLU B 2 262 ? 17.782  40.969 7.883   1.00 68.76 ? 263 GLU A OE1   1 
ATOM   2873 O OE2   . GLU B 2 262 ? 17.376  40.025 9.820   1.00 69.57 ? 263 GLU A OE2   1 
ATOM   2874 N N     . PRO B 2 263 ? 14.927  43.662 12.726  1.00 59.31 ? 264 PRO A N     1 
ATOM   2875 C CA    . PRO B 2 263 ? 13.743  44.475 12.473  1.00 58.46 ? 264 PRO A CA    1 
ATOM   2876 C C     . PRO B 2 263 ? 13.758  45.099 11.079  1.00 57.85 ? 264 PRO A C     1 
ATOM   2877 O O     . PRO B 2 263 ? 12.711  45.236 10.447  1.00 58.11 ? 264 PRO A O     1 
ATOM   2878 C CB    . PRO B 2 263 ? 13.790  45.502 13.598  1.00 57.53 ? 264 PRO A CB    1 
ATOM   2879 C CG    . PRO B 2 263 ? 15.254  45.635 13.853  1.00 57.87 ? 264 PRO A CG    1 
ATOM   2880 C CD    . PRO B 2 263 ? 15.716  44.215 13.835  1.00 58.26 ? 264 PRO A CD    1 
ATOM   2881 N N     . GLU B 2 264 ? 14.944  45.451 10.589  1.00 57.00 ? 265 GLU A N     1 
ATOM   2882 C CA    . GLU B 2 264 ? 15.047  46.070 9.275   1.00 56.15 ? 265 GLU A CA    1 
ATOM   2883 C C     . GLU B 2 264 ? 14.420  45.219 8.174   1.00 55.16 ? 265 GLU A C     1 
ATOM   2884 O O     . GLU B 2 264 ? 13.624  45.719 7.368   1.00 56.07 ? 265 GLU A O     1 
ATOM   2885 C CB    . GLU B 2 264 ? 16.508  46.370 8.920   1.00 57.42 ? 265 GLU A CB    1 
ATOM   2886 C CG    . GLU B 2 264 ? 16.667  47.135 7.598   1.00 59.73 ? 265 GLU A CG    1 
ATOM   2887 C CD    . GLU B 2 264 ? 15.889  48.464 7.584   1.00 61.30 ? 265 GLU A CD    1 
ATOM   2888 O OE1   . GLU B 2 264 ? 14.647  48.440 7.780   1.00 62.06 ? 265 GLU A OE1   1 
ATOM   2889 O OE2   . GLU B 2 264 ? 16.523  49.529 7.376   1.00 61.61 ? 265 GLU A OE2   1 
ATOM   2890 N N     . ARG B 2 265 ? 14.774  43.937 8.140   1.00 52.89 ? 266 ARG A N     1 
ATOM   2891 C CA    . ARG B 2 265 ? 14.238  43.034 7.134   1.00 50.51 ? 266 ARG A CA    1 
ATOM   2892 C C     . ARG B 2 265 ? 12.730  42.932 7.265   1.00 49.19 ? 266 ARG A C     1 
ATOM   2893 O O     . ARG B 2 265 ? 12.025  42.754 6.274   1.00 48.83 ? 266 ARG A O     1 
ATOM   2894 C CB    . ARG B 2 265 ? 14.837  41.645 7.296   1.00 51.35 ? 266 ARG A CB    1 
ATOM   2895 C CG    . ARG B 2 265 ? 14.371  40.631 6.257   1.00 51.92 ? 266 ARG A CG    1 
ATOM   2896 C CD    . ARG B 2 265 ? 14.502  39.236 6.837   1.00 52.65 ? 266 ARG A CD    1 
ATOM   2897 N NE    . ARG B 2 265 ? 14.243  38.156 5.890   1.00 52.05 ? 266 ARG A NE    1 
ATOM   2898 C CZ    . ARG B 2 265 ? 14.026  36.898 6.263   1.00 52.41 ? 266 ARG A CZ    1 
ATOM   2899 N NH1   . ARG B 2 265 ? 14.032  36.580 7.555   1.00 52.12 ? 266 ARG A NH1   1 
ATOM   2900 N NH2   . ARG B 2 265 ? 13.817  35.957 5.356   1.00 52.21 ? 266 ARG A NH2   1 
ATOM   2901 N N     . LEU B 2 266 ? 12.227  43.036 8.491   1.00 47.75 ? 267 LEU A N     1 
ATOM   2902 C CA    . LEU B 2 266 ? 10.788  42.947 8.687   1.00 45.54 ? 267 LEU A CA    1 
ATOM   2903 C C     . LEU B 2 266 ? 10.139  44.134 8.014   1.00 44.83 ? 267 LEU A C     1 
ATOM   2904 O O     . LEU B 2 266 ? 9.115   43.986 7.356   1.00 45.12 ? 267 LEU A O     1 
ATOM   2905 C CB    . LEU B 2 266 ? 10.425  42.940 10.173  1.00 44.78 ? 267 LEU A CB    1 
ATOM   2906 C CG    . LEU B 2 266 ? 9.013   42.412 10.456  1.00 43.82 ? 267 LEU A CG    1 
ATOM   2907 C CD1   . LEU B 2 266 ? 8.931   40.963 9.985   1.00 43.66 ? 267 LEU A CD1   1 
ATOM   2908 C CD2   . LEU B 2 266 ? 8.691   42.505 11.937  1.00 43.11 ? 267 LEU A CD2   1 
ATOM   2909 N N     . ARG B 2 267 ? 10.742  45.310 8.175   1.00 44.31 ? 268 ARG A N     1 
ATOM   2910 C CA    . ARG B 2 267 ? 10.211  46.525 7.566   1.00 44.11 ? 268 ARG A CA    1 
ATOM   2911 C C     . ARG B 2 267 ? 10.093  46.308 6.068   1.00 42.67 ? 268 ARG A C     1 
ATOM   2912 O O     . ARG B 2 267 ? 9.017   46.479 5.488   1.00 42.26 ? 268 ARG A O     1 
ATOM   2913 C CB    . ARG B 2 267 ? 11.127  47.727 7.829   1.00 46.29 ? 268 ARG A CB    1 
ATOM   2914 C CG    . ARG B 2 267 ? 10.537  49.065 7.341   1.00 49.90 ? 268 ARG A CG    1 
ATOM   2915 C CD    . ARG B 2 267 ? 11.509  50.239 7.491   1.00 53.39 ? 268 ARG A CD    1 
ATOM   2916 N NE    . ARG B 2 267 ? 12.731  50.073 6.699   1.00 55.73 ? 268 ARG A NE    1 
ATOM   2917 C CZ    . ARG B 2 267 ? 12.776  50.053 5.367   1.00 55.58 ? 268 ARG A CZ    1 
ATOM   2918 N NH1   . ARG B 2 267 ? 11.661  50.198 4.654   1.00 54.88 ? 268 ARG A NH1   1 
ATOM   2919 N NH2   . ARG B 2 267 ? 13.937  49.863 4.748   1.00 55.95 ? 268 ARG A NH2   1 
ATOM   2920 N N     . LYS B 2 268 ? 11.207  45.924 5.447   1.00 40.80 ? 269 LYS A N     1 
ATOM   2921 C CA    . LYS B 2 268 ? 11.231  45.681 4.008   1.00 39.05 ? 269 LYS A CA    1 
ATOM   2922 C C     . LYS B 2 268 ? 10.067  44.807 3.550   1.00 37.43 ? 269 LYS A C     1 
ATOM   2923 O O     . LYS B 2 268 ? 9.332   45.167 2.629   1.00 38.07 ? 269 LYS A O     1 
ATOM   2924 C CB    . LYS B 2 268 ? 12.553  45.026 3.584   1.00 38.57 ? 269 LYS A CB    1 
ATOM   2925 C CG    . LYS B 2 268 ? 13.747  45.952 3.653   1.00 40.76 ? 269 LYS A CG    1 
ATOM   2926 C CD    . LYS B 2 268 ? 14.877  45.462 2.755   1.00 42.92 ? 269 LYS A CD    1 
ATOM   2927 C CE    . LYS B 2 268 ? 16.116  46.345 2.870   1.00 43.49 ? 269 LYS A CE    1 
ATOM   2928 N NZ    . LYS B 2 268 ? 16.692  46.312 4.251   1.00 45.20 ? 269 LYS A NZ    1 
ATOM   2929 N N     . ILE B 2 269 ? 9.898   43.662 4.199   1.00 34.44 ? 270 ILE A N     1 
ATOM   2930 C CA    . ILE B 2 269 ? 8.840   42.739 3.838   1.00 31.09 ? 270 ILE A CA    1 
ATOM   2931 C C     . ILE B 2 269 ? 7.446   43.344 3.882   1.00 31.03 ? 270 ILE A C     1 
ATOM   2932 O O     . ILE B 2 269 ? 6.695   43.202 2.927   1.00 31.33 ? 270 ILE A O     1 
ATOM   2933 C CB    . ILE B 2 269 ? 8.901   41.499 4.723   1.00 29.98 ? 270 ILE A CB    1 
ATOM   2934 C CG1   . ILE B 2 269 ? 10.183  40.725 4.401   1.00 29.41 ? 270 ILE A CG1   1 
ATOM   2935 C CG2   . ILE B 2 269 ? 7.657   40.653 4.523   1.00 29.33 ? 270 ILE A CG2   1 
ATOM   2936 C CD1   . ILE B 2 269 ? 10.486  39.591 5.339   1.00 26.98 ? 270 ILE A CD1   1 
ATOM   2937 N N     . VAL B 2 270 ? 7.098   44.018 4.974   1.00 30.55 ? 271 VAL A N     1 
ATOM   2938 C CA    . VAL B 2 270 ? 5.778   44.637 5.098   1.00 30.25 ? 271 VAL A CA    1 
ATOM   2939 C C     . VAL B 2 270 ? 5.574   45.621 3.963   1.00 31.40 ? 271 VAL A C     1 
ATOM   2940 O O     . VAL B 2 270 ? 4.459   45.903 3.547   1.00 30.71 ? 271 VAL A O     1 
ATOM   2941 C CB    . VAL B 2 270 ? 5.638   45.415 6.406   1.00 28.66 ? 271 VAL A CB    1 
ATOM   2942 C CG1   . VAL B 2 270 ? 4.224   45.935 6.547   1.00 27.91 ? 271 VAL A CG1   1 
ATOM   2943 C CG2   . VAL B 2 270 ? 6.010   44.538 7.562   1.00 28.31 ? 271 VAL A CG2   1 
ATOM   2944 N N     . GLU B 2 271 ? 6.676   46.162 3.479   1.00 34.04 ? 272 GLU A N     1 
ATOM   2945 C CA    . GLU B 2 271 ? 6.629   47.109 2.387   1.00 36.72 ? 272 GLU A CA    1 
ATOM   2946 C C     . GLU B 2 271 ? 6.345   46.310 1.125   1.00 36.16 ? 272 GLU A C     1 
ATOM   2947 O O     . GLU B 2 271 ? 5.502   46.683 0.316   1.00 36.88 ? 272 GLU A O     1 
ATOM   2948 C CB    . GLU B 2 271 ? 7.969   47.815 2.285   1.00 40.53 ? 272 GLU A CB    1 
ATOM   2949 C CG    . GLU B 2 271 ? 7.936   49.118 1.543   1.00 47.08 ? 272 GLU A CG    1 
ATOM   2950 C CD    . GLU B 2 271 ? 9.120   49.979 1.919   1.00 51.27 ? 272 GLU A CD    1 
ATOM   2951 O OE1   . GLU B 2 271 ? 9.196   50.370 3.113   1.00 53.10 ? 272 GLU A OE1   1 
ATOM   2952 O OE2   . GLU B 2 271 ? 9.972   50.249 1.032   1.00 53.20 ? 272 GLU A OE2   1 
ATOM   2953 N N     . GLU B 2 272 ? 7.061   45.200 0.977   1.00 35.12 ? 273 GLU A N     1 
ATOM   2954 C CA    . GLU B 2 272 ? 6.896   44.309 -0.157  1.00 35.15 ? 273 GLU A CA    1 
ATOM   2955 C C     . GLU B 2 272 ? 5.433   43.841 -0.219  1.00 33.50 ? 273 GLU A C     1 
ATOM   2956 O O     . GLU B 2 272 ? 4.905   43.540 -1.294  1.00 32.54 ? 273 GLU A O     1 
ATOM   2957 C CB    . GLU B 2 272 ? 7.836   43.110 0.002   1.00 39.25 ? 273 GLU A CB    1 
ATOM   2958 C CG    . GLU B 2 272 ? 9.339   43.465 -0.018  1.00 45.93 ? 273 GLU A CG    1 
ATOM   2959 C CD    . GLU B 2 272 ? 10.263  42.286 0.348   1.00 49.14 ? 273 GLU A CD    1 
ATOM   2960 O OE1   . GLU B 2 272 ? 10.093  41.175 -0.211  1.00 51.77 ? 273 GLU A OE1   1 
ATOM   2961 O OE2   . GLU B 2 272 ? 11.169  42.479 1.193   1.00 50.00 ? 273 GLU A OE2   1 
ATOM   2962 N N     . ARG B 2 273 ? 4.785   43.792 0.945   1.00 31.14 ? 274 ARG A N     1 
ATOM   2963 C CA    . ARG B 2 273 ? 3.391   43.375 1.056   1.00 28.88 ? 274 ARG A CA    1 
ATOM   2964 C C     . ARG B 2 273 ? 2.465   44.568 0.891   1.00 27.96 ? 274 ARG A C     1 
ATOM   2965 O O     . ARG B 2 273 ? 1.329   44.426 0.436   1.00 29.11 ? 274 ARG A O     1 
ATOM   2966 C CB    . ARG B 2 273 ? 3.119   42.764 2.424   1.00 29.13 ? 274 ARG A CB    1 
ATOM   2967 C CG    . ARG B 2 273 ? 3.805   41.459 2.693   1.00 27.95 ? 274 ARG A CG    1 
ATOM   2968 C CD    . ARG B 2 273 ? 3.340   40.903 4.032   1.00 26.51 ? 274 ARG A CD    1 
ATOM   2969 N NE    . ARG B 2 273 ? 3.367   39.448 4.008   1.00 24.47 ? 274 ARG A NE    1 
ATOM   2970 C CZ    . ARG B 2 273 ? 2.390   38.687 4.472   1.00 23.55 ? 274 ARG A CZ    1 
ATOM   2971 N NH1   . ARG B 2 273 ? 1.313   39.240 4.999   1.00 22.57 ? 274 ARG A NH1   1 
ATOM   2972 N NH2   . ARG B 2 273 ? 2.483   37.375 4.388   1.00 24.37 ? 274 ARG A NH2   1 
ATOM   2973 N N     . GLY B 2 274 ? 2.951   45.739 1.289   1.00 26.06 ? 275 GLY A N     1 
ATOM   2974 C CA    . GLY B 2 274 ? 2.158   46.948 1.186   1.00 24.49 ? 275 GLY A CA    1 
ATOM   2975 C C     . GLY B 2 274 ? 0.851   46.855 1.941   1.00 23.30 ? 275 GLY A C     1 
ATOM   2976 O O     . GLY B 2 274 ? -0.165  47.345 1.469   1.00 23.20 ? 275 GLY A O     1 
ATOM   2977 N N     . THR B 2 275 ? 0.887   46.233 3.119   1.00 22.67 ? 276 THR A N     1 
ATOM   2978 C CA    . THR B 2 275 ? -0.294  46.061 3.970   1.00 22.63 ? 276 THR A CA    1 
ATOM   2979 C C     . THR B 2 275 ? -0.246  46.961 5.203   1.00 22.44 ? 276 THR A C     1 
ATOM   2980 O O     . THR B 2 275 ? 0.757   47.632 5.460   1.00 22.20 ? 276 THR A O     1 
ATOM   2981 C CB    . THR B 2 275 ? -0.415  44.612 4.472   1.00 23.36 ? 276 THR A CB    1 
ATOM   2982 O OG1   . THR B 2 275 ? 0.688   44.314 5.330   1.00 24.18 ? 276 THR A OG1   1 
ATOM   2983 C CG2   . THR B 2 275 ? -0.405  43.643 3.314   1.00 24.16 ? 276 THR A CG2   1 
ATOM   2984 N N     . ALA B 2 276 ? -1.339  46.977 5.960   1.00 21.08 ? 277 ALA A N     1 
ATOM   2985 C CA    . ALA B 2 276 ? -1.405  47.769 7.182   1.00 21.02 ? 277 ALA A CA    1 
ATOM   2986 C C     . ALA B 2 276 ? -1.076  46.830 8.331   1.00 21.16 ? 277 ALA A C     1 
ATOM   2987 O O     . ALA B 2 276 ? -1.809  45.887 8.572   1.00 23.13 ? 277 ALA A O     1 
ATOM   2988 C CB    . ALA B 2 276 ? -2.801  48.353 7.369   1.00 18.91 ? 277 ALA A CB    1 
ATOM   2989 N N     . VAL B 2 277 ? 0.037   47.067 9.018   1.00 21.24 ? 278 VAL A N     1 
ATOM   2990 C CA    . VAL B 2 277 ? 0.427   46.224 10.144  1.00 20.01 ? 278 VAL A CA    1 
ATOM   2991 C C     . VAL B 2 277 ? 0.457   47.059 11.411  1.00 21.32 ? 278 VAL A C     1 
ATOM   2992 O O     . VAL B 2 277 ? 1.265   47.972 11.541  1.00 22.74 ? 278 VAL A O     1 
ATOM   2993 C CB    . VAL B 2 277 ? 1.820   45.615 9.945   1.00 17.62 ? 278 VAL A CB    1 
ATOM   2994 C CG1   . VAL B 2 277 ? 2.223   44.854 11.182  1.00 17.79 ? 278 VAL A CG1   1 
ATOM   2995 C CG2   . VAL B 2 277 ? 1.821   44.705 8.747   1.00 17.42 ? 278 VAL A CG2   1 
ATOM   2996 N N     . PHE B 2 278 ? -0.427  46.753 12.348  1.00 21.59 ? 279 PHE A N     1 
ATOM   2997 C CA    . PHE B 2 278 ? -0.466  47.507 13.580  1.00 23.02 ? 279 PHE A CA    1 
ATOM   2998 C C     . PHE B 2 278 ? -0.717  46.625 14.778  1.00 24.62 ? 279 PHE A C     1 
ATOM   2999 O O     . PHE B 2 278 ? -1.066  45.454 14.648  1.00 25.58 ? 279 PHE A O     1 
ATOM   3000 C CB    . PHE B 2 278 ? -1.530  48.597 13.491  1.00 24.26 ? 279 PHE A CB    1 
ATOM   3001 C CG    . PHE B 2 278 ? -2.889  48.092 13.127  1.00 25.37 ? 279 PHE A CG    1 
ATOM   3002 C CD1   . PHE B 2 278 ? -3.807  47.758 14.112  1.00 27.29 ? 279 PHE A CD1   1 
ATOM   3003 C CD2   . PHE B 2 278 ? -3.260  47.958 11.800  1.00 26.33 ? 279 PHE A CD2   1 
ATOM   3004 C CE1   . PHE B 2 278 ? -5.077  47.301 13.780  1.00 27.42 ? 279 PHE A CE1   1 
ATOM   3005 C CE2   . PHE B 2 278 ? -4.522  47.502 11.458  1.00 27.28 ? 279 PHE A CE2   1 
ATOM   3006 C CZ    . PHE B 2 278 ? -5.432  47.175 12.447  1.00 27.88 ? 279 PHE A CZ    1 
ATOM   3007 N N     . ALA B 2 279 ? -0.536  47.196 15.958  1.00 25.36 ? 280 ALA A N     1 
ATOM   3008 C CA    . ALA B 2 279 ? -0.725  46.447 17.183  1.00 26.03 ? 280 ALA A CA    1 
ATOM   3009 C C     . ALA B 2 279 ? -1.557  47.224 18.171  1.00 26.74 ? 280 ALA A C     1 
ATOM   3010 O O     . ALA B 2 279 ? -1.618  48.446 18.108  1.00 27.82 ? 280 ALA A O     1 
ATOM   3011 C CB    . ALA B 2 279 ? 0.619   46.124 17.797  1.00 27.75 ? 280 ALA A CB    1 
ATOM   3012 N N     . VAL B 2 280 ? -2.208  46.500 19.074  1.00 26.66 ? 281 VAL A N     1 
ATOM   3013 C CA    . VAL B 2 280 ? -3.020  47.105 20.118  1.00 27.49 ? 281 VAL A CA    1 
ATOM   3014 C C     . VAL B 2 280 ? -2.340  46.681 21.409  1.00 28.34 ? 281 VAL A C     1 
ATOM   3015 O O     . VAL B 2 280 ? -2.404  45.521 21.804  1.00 27.85 ? 281 VAL A O     1 
ATOM   3016 C CB    . VAL B 2 280 ? -4.472  46.586 20.095  1.00 27.66 ? 281 VAL A CB    1 
ATOM   3017 C CG1   . VAL B 2 280 ? -5.283  47.274 21.176  1.00 26.14 ? 281 VAL A CG1   1 
ATOM   3018 C CG2   . VAL B 2 280 ? -5.098  46.853 18.733  1.00 29.59 ? 281 VAL A CG2   1 
ATOM   3019 N N     . LYS B 2 281 ? -1.664  47.630 22.042  1.00 29.37 ? 282 LYS A N     1 
ATOM   3020 C CA    . LYS B 2 281 ? -0.935  47.365 23.265  1.00 30.18 ? 282 LYS A CA    1 
ATOM   3021 C C     . LYS B 2 281 ? -1.659  47.885 24.492  1.00 31.59 ? 282 LYS A C     1 
ATOM   3022 O O     . LYS B 2 281 ? -2.189  48.990 24.493  1.00 32.20 ? 282 LYS A O     1 
ATOM   3023 C CB    . LYS B 2 281 ? 0.452   47.988 23.162  1.00 30.06 ? 282 LYS A CB    1 
ATOM   3024 C CG    . LYS B 2 281 ? 1.345   47.726 24.346  1.00 32.26 ? 282 LYS A CG    1 
ATOM   3025 C CD    . LYS B 2 281 ? 2.721   48.288 24.086  1.00 32.70 ? 282 LYS A CD    1 
ATOM   3026 C CE    . LYS B 2 281 ? 3.560   48.260 25.331  1.00 33.05 ? 282 LYS A CE    1 
ATOM   3027 N NZ    . LYS B 2 281 ? 4.968   48.598 25.031  1.00 34.81 ? 282 LYS A NZ    1 
ATOM   3028 N N     . PHE B 2 282 ? -1.672  47.071 25.537  1.00 33.26 ? 283 PHE A N     1 
ATOM   3029 C CA    . PHE B 2 282 ? -2.329  47.413 26.791  1.00 34.90 ? 283 PHE A CA    1 
ATOM   3030 C C     . PHE B 2 282 ? -1.622  46.601 27.864  1.00 35.70 ? 283 PHE A C     1 
ATOM   3031 O O     . PHE B 2 282 ? -0.956  45.624 27.543  1.00 36.41 ? 283 PHE A O     1 
ATOM   3032 C CB    . PHE B 2 282 ? -3.816  47.051 26.713  1.00 35.50 ? 283 PHE A CB    1 
ATOM   3033 C CG    . PHE B 2 282 ? -4.077  45.633 26.280  1.00 36.24 ? 283 PHE A CG    1 
ATOM   3034 C CD1   . PHE B 2 282 ? -4.439  44.665 27.202  1.00 37.34 ? 283 PHE A CD1   1 
ATOM   3035 C CD2   . PHE B 2 282 ? -3.915  45.258 24.955  1.00 36.01 ? 283 PHE A CD2   1 
ATOM   3036 C CE1   . PHE B 2 282 ? -4.630  43.347 26.805  1.00 38.35 ? 283 PHE A CE1   1 
ATOM   3037 C CE2   . PHE B 2 282 ? -4.104  43.946 24.556  1.00 36.71 ? 283 PHE A CE2   1 
ATOM   3038 C CZ    . PHE B 2 282 ? -4.459  42.991 25.479  1.00 37.28 ? 283 PHE A CZ    1 
ATOM   3039 N N     . ARG B 2 283 ? -1.752  46.997 29.126  1.00 37.34 ? 284 ARG A N     1 
ATOM   3040 C CA    . ARG B 2 283 ? -1.083  46.283 30.216  1.00 38.49 ? 284 ARG A CA    1 
ATOM   3041 C C     . ARG B 2 283 ? -1.631  44.878 30.418  1.00 38.19 ? 284 ARG A C     1 
ATOM   3042 O O     . ARG B 2 283 ? -2.837  44.658 30.336  1.00 38.07 ? 284 ARG A O     1 
ATOM   3043 C CB    . ARG B 2 283 ? -1.170  47.104 31.516  1.00 40.74 ? 284 ARG A CB    1 
ATOM   3044 C CG    . ARG B 2 283 ? -0.259  48.362 31.483  1.00 44.65 ? 284 ARG A CG    1 
ATOM   3045 C CD    . ARG B 2 283 ? -0.620  49.422 32.532  1.00 48.86 ? 284 ARG A CD    1 
ATOM   3046 N NE    . ARG B 2 283 ? -0.421  50.786 32.020  1.00 52.77 ? 284 ARG A NE    1 
ATOM   3047 C CZ    . ARG B 2 283 ? 0.768   51.367 31.822  1.00 55.17 ? 284 ARG A CZ    1 
ATOM   3048 N NH1   . ARG B 2 283 ? 1.893   50.710 32.105  1.00 55.65 ? 284 ARG A NH1   1 
ATOM   3049 N NH2   . ARG B 2 283 ? 0.836   52.601 31.314  1.00 54.48 ? 284 ARG A NH2   1 
ATOM   3050 N N     . LYS B 2 284 ? -0.737  43.921 30.654  1.00 37.62 ? 285 LYS A N     1 
ATOM   3051 C CA    . LYS B 2 284 ? -1.150  42.537 30.855  1.00 37.46 ? 285 LYS A CA    1 
ATOM   3052 C C     . LYS B 2 284 ? -1.883  42.327 32.169  1.00 37.35 ? 285 LYS A C     1 
ATOM   3053 O O     . LYS B 2 284 ? -1.308  42.478 33.243  1.00 36.18 ? 285 LYS A O     1 
ATOM   3054 C CB    . LYS B 2 284 ? 0.053   41.596 30.827  1.00 38.26 ? 285 LYS A CB    1 
ATOM   3055 C CG    . LYS B 2 284 ? -0.318  40.169 31.207  1.00 39.46 ? 285 LYS A CG    1 
ATOM   3056 C CD    . LYS B 2 284 ? 0.887   39.331 31.587  1.00 41.78 ? 285 LYS A CD    1 
ATOM   3057 C CE    . LYS B 2 284 ? 0.427   37.998 32.166  1.00 44.20 ? 285 LYS A CE    1 
ATOM   3058 N NZ    . LYS B 2 284 ? 1.535   37.184 32.740  1.00 45.84 ? 285 LYS A NZ    1 
ATOM   3059 N N     . PRO B 2 285 ? -3.170  41.971 32.105  1.00 38.08 ? 286 PRO A N     1 
ATOM   3060 C CA    . PRO B 2 285 ? -3.883  41.760 33.361  1.00 38.83 ? 286 PRO A CA    1 
ATOM   3061 C C     . PRO B 2 285 ? -3.100  40.719 34.147  1.00 40.12 ? 286 PRO A C     1 
ATOM   3062 O O     . PRO B 2 285 ? -2.516  39.813 33.555  1.00 41.11 ? 286 PRO A O     1 
ATOM   3063 C CB    . PRO B 2 285 ? -5.240  41.229 32.901  1.00 37.81 ? 286 PRO A CB    1 
ATOM   3064 C CG    . PRO B 2 285 ? -5.431  41.888 31.591  1.00 38.38 ? 286 PRO A CG    1 
ATOM   3065 C CD    . PRO B 2 285 ? -4.061  41.756 30.954  1.00 38.56 ? 286 PRO A CD    1 
ATOM   3066 N N     . ASP B 2 286 ? -3.062  40.855 35.468  1.00 40.71 ? 287 ASP A N     1 
ATOM   3067 C CA    . ASP B 2 286 ? -2.351  39.885 36.286  1.00 40.91 ? 287 ASP A CA    1 
ATOM   3068 C C     . ASP B 2 286 ? -3.280  38.717 36.580  1.00 40.18 ? 287 ASP A C     1 
ATOM   3069 O O     . ASP B 2 286 ? -4.001  38.716 37.575  1.00 39.75 ? 287 ASP A O     1 
ATOM   3070 C CB    . ASP B 2 286 ? -1.872  40.520 37.593  1.00 42.17 ? 287 ASP A CB    1 
ATOM   3071 C CG    . ASP B 2 286 ? -1.144  39.528 38.484  1.00 43.67 ? 287 ASP A CG    1 
ATOM   3072 O OD1   . ASP B 2 286 ? -0.543  38.581 37.930  1.00 44.05 ? 287 ASP A OD1   1 
ATOM   3073 O OD2   . ASP B 2 286 ? -1.164  39.699 39.727  1.00 44.15 ? 287 ASP A OD2   1 
ATOM   3074 N N     . ILE B 2 287 ? -3.267  37.733 35.687  1.00 39.15 ? 288 ILE A N     1 
ATOM   3075 C CA    . ILE B 2 287 ? -4.097  36.548 35.820  1.00 37.33 ? 288 ILE A CA    1 
ATOM   3076 C C     . ILE B 2 287 ? -3.374  35.365 35.217  1.00 36.41 ? 288 ILE A C     1 
ATOM   3077 O O     . ILE B 2 287 ? -2.512  35.524 34.352  1.00 36.24 ? 288 ILE A O     1 
ATOM   3078 C CB    . ILE B 2 287 ? -5.442  36.704 35.082  1.00 37.85 ? 288 ILE A CB    1 
ATOM   3079 C CG1   . ILE B 2 287 ? -5.184  37.092 33.619  1.00 37.72 ? 288 ILE A CG1   1 
ATOM   3080 C CG2   . ILE B 2 287 ? -6.317  37.724 35.799  1.00 36.97 ? 288 ILE A CG2   1 
ATOM   3081 C CD1   . ILE B 2 287 ? -6.423  37.050 32.718  1.00 37.92 ? 288 ILE A CD1   1 
ATOM   3082 N N     . VAL B 2 288 ? -3.738  34.173 35.673  1.00 36.53 ? 289 VAL A N     1 
ATOM   3083 C CA    . VAL B 2 288 ? -3.125  32.952 35.175  1.00 36.02 ? 289 VAL A CA    1 
ATOM   3084 C C     . VAL B 2 288 ? -3.316  32.899 33.663  1.00 35.99 ? 289 VAL A C     1 
ATOM   3085 O O     . VAL B 2 288 ? -4.228  33.518 33.116  1.00 35.86 ? 289 VAL A O     1 
ATOM   3086 C CB    . VAL B 2 288 ? -3.766  31.702 35.824  1.00 35.07 ? 289 VAL A CB    1 
ATOM   3087 C CG1   . VAL B 2 288 ? -4.424  32.083 37.133  1.00 33.09 ? 289 VAL A CG1   1 
ATOM   3088 C CG2   . VAL B 2 288 ? -4.767  31.073 34.892  1.00 35.89 ? 289 VAL A CG2   1 
ATOM   3089 N N     . ASP B 2 289 ? -2.454  32.158 32.985  1.00 36.29 ? 290 ASP A N     1 
ATOM   3090 C CA    . ASP B 2 289 ? -2.549  32.048 31.541  1.00 36.04 ? 290 ASP A CA    1 
ATOM   3091 C C     . ASP B 2 289 ? -3.820  31.348 31.074  1.00 35.94 ? 290 ASP A C     1 
ATOM   3092 O O     . ASP B 2 289 ? -4.270  31.578 29.962  1.00 37.16 ? 290 ASP A O     1 
ATOM   3093 C CB    . ASP B 2 289 ? -1.320  31.322 30.998  1.00 36.47 ? 290 ASP A CB    1 
ATOM   3094 C CG    . ASP B 2 289 ? -0.050  32.150 31.123  1.00 38.40 ? 290 ASP A CG    1 
ATOM   3095 O OD1   . ASP B 2 289 ? -0.032  33.100 31.940  1.00 39.80 ? 290 ASP A OD1   1 
ATOM   3096 O OD2   . ASP B 2 289 ? 0.934   31.843 30.411  1.00 39.16 ? 290 ASP A OD2   1 
ATOM   3097 N N     . ASP B 2 290 ? -4.410  30.506 31.915  1.00 35.70 ? 291 ASP A N     1 
ATOM   3098 C CA    . ASP B 2 290 ? -5.622  29.795 31.517  1.00 35.07 ? 291 ASP A CA    1 
ATOM   3099 C C     . ASP B 2 290 ? -6.830  30.703 31.367  1.00 33.81 ? 291 ASP A C     1 
ATOM   3100 O O     . ASP B 2 290 ? -7.863  30.291 30.838  1.00 33.81 ? 291 ASP A O     1 
ATOM   3101 C CB    . ASP B 2 290 ? -5.949  28.682 32.514  1.00 37.12 ? 291 ASP A CB    1 
ATOM   3102 C CG    . ASP B 2 290 ? -5.222  27.387 32.209  1.00 38.83 ? 291 ASP A CG    1 
ATOM   3103 O OD1   . ASP B 2 290 ? -5.307  26.458 33.041  1.00 40.61 ? 291 ASP A OD1   1 
ATOM   3104 O OD2   . ASP B 2 290 ? -4.573  27.287 31.142  1.00 40.28 ? 291 ASP A OD2   1 
ATOM   3105 N N     . ASN B 2 291 ? -6.712  31.935 31.843  1.00 32.35 ? 292 ASN A N     1 
ATOM   3106 C CA    . ASN B 2 291 ? -7.813  32.879 31.737  1.00 32.38 ? 292 ASN A CA    1 
ATOM   3107 C C     . ASN B 2 291 ? -7.428  33.974 30.757  1.00 31.04 ? 292 ASN A C     1 
ATOM   3108 O O     . ASN B 2 291 ? -8.280  34.507 30.052  1.00 30.30 ? 292 ASN A O     1 
ATOM   3109 C CB    . ASN B 2 291 ? -8.125  33.503 33.102  1.00 33.97 ? 292 ASN A CB    1 
ATOM   3110 C CG    . ASN B 2 291 ? -8.508  32.469 34.156  1.00 35.57 ? 292 ASN A CG    1 
ATOM   3111 O OD1   . ASN B 2 291 ? -9.600  31.899 34.135  1.00 36.77 ? 292 ASN A OD1   1 
ATOM   3112 N ND2   . ASN B 2 291 ? -7.598  32.222 35.086  1.00 36.64 ? 292 ASN A ND2   1 
ATOM   3113 N N     . LEU B 2 292 ? -6.132  34.284 30.712  1.00 29.76 ? 293 LEU A N     1 
ATOM   3114 C CA    . LEU B 2 292 ? -5.593  35.329 29.845  1.00 27.95 ? 293 LEU A CA    1 
ATOM   3115 C C     . LEU B 2 292 ? -5.667  35.058 28.346  1.00 28.49 ? 293 LEU A C     1 
ATOM   3116 O O     . LEU B 2 292 ? -6.158  35.891 27.578  1.00 28.41 ? 293 LEU A O     1 
ATOM   3117 C CB    . LEU B 2 292 ? -4.142  35.611 30.204  1.00 25.45 ? 293 LEU A CB    1 
ATOM   3118 C CG    . LEU B 2 292 ? -3.541  36.727 29.349  1.00 25.56 ? 293 LEU A CG    1 
ATOM   3119 C CD1   . LEU B 2 292 ? -4.150  38.055 29.772  1.00 25.29 ? 293 LEU A CD1   1 
ATOM   3120 C CD2   . LEU B 2 292 ? -2.031  36.765 29.496  1.00 25.91 ? 293 LEU A CD2   1 
ATOM   3121 N N     . TYR B 2 293 ? -5.169  33.904 27.923  1.00 28.23 ? 294 TYR A N     1 
ATOM   3122 C CA    . TYR B 2 293 ? -5.177  33.578 26.504  1.00 27.94 ? 294 TYR A CA    1 
ATOM   3123 C C     . TYR B 2 293 ? -6.562  33.352 25.897  1.00 28.50 ? 294 TYR A C     1 
ATOM   3124 O O     . TYR B 2 293 ? -6.808  33.730 24.754  1.00 29.09 ? 294 TYR A O     1 
ATOM   3125 C CB    . TYR B 2 293 ? -4.266  32.384 26.227  1.00 26.52 ? 294 TYR A CB    1 
ATOM   3126 C CG    . TYR B 2 293 ? -2.795  32.703 26.407  1.00 26.67 ? 294 TYR A CG    1 
ATOM   3127 C CD1   . TYR B 2 293 ? -2.239  32.842 27.675  1.00 25.84 ? 294 TYR A CD1   1 
ATOM   3128 C CD2   . TYR B 2 293 ? -1.964  32.886 25.306  1.00 26.11 ? 294 TYR A CD2   1 
ATOM   3129 C CE1   . TYR B 2 293 ? -0.897  33.153 27.845  1.00 25.43 ? 294 TYR A CE1   1 
ATOM   3130 C CE2   . TYR B 2 293 ? -0.619  33.199 25.466  1.00 26.04 ? 294 TYR A CE2   1 
ATOM   3131 C CZ    . TYR B 2 293 ? -0.094  33.330 26.739  1.00 26.71 ? 294 TYR A CZ    1 
ATOM   3132 O OH    . TYR B 2 293 ? 1.236   33.636 26.903  1.00 28.38 ? 294 TYR A OH    1 
ATOM   3133 N N     . PRO B 2 294 ? -7.485  32.718 26.632  1.00 28.43 ? 295 PRO A N     1 
ATOM   3134 C CA    . PRO B 2 294 ? -8.790  32.547 25.991  1.00 28.53 ? 295 PRO A CA    1 
ATOM   3135 C C     . PRO B 2 294 ? -9.396  33.924 25.742  1.00 30.03 ? 295 PRO A C     1 
ATOM   3136 O O     . PRO B 2 294 ? -10.249 34.097 24.861  1.00 31.13 ? 295 PRO A O     1 
ATOM   3137 C CB    . PRO B 2 294 ? -9.567  31.737 27.018  1.00 26.85 ? 295 PRO A CB    1 
ATOM   3138 C CG    . PRO B 2 294 ? -8.515  30.874 27.587  1.00 26.80 ? 295 PRO A CG    1 
ATOM   3139 C CD    . PRO B 2 294 ? -7.373  31.845 27.809  1.00 28.54 ? 295 PRO A CD    1 
ATOM   3140 N N     . GLN B 2 295 ? -8.932  34.896 26.529  1.00 30.11 ? 296 GLN A N     1 
ATOM   3141 C CA    . GLN B 2 295 ? -9.379  36.281 26.424  1.00 29.32 ? 296 GLN A CA    1 
ATOM   3142 C C     . GLN B 2 295 ? -8.667  36.942 25.275  1.00 28.12 ? 296 GLN A C     1 
ATOM   3143 O O     . GLN B 2 295 ? -9.298  37.579 24.442  1.00 28.70 ? 296 GLN A O     1 
ATOM   3144 C CB    . GLN B 2 295 ? -9.079  37.050 27.704  1.00 29.76 ? 296 GLN A CB    1 
ATOM   3145 C CG    . GLN B 2 295 ? -9.958  36.656 28.864  1.00 31.13 ? 296 GLN A CG    1 
ATOM   3146 C CD    . GLN B 2 295 ? -9.837  37.618 30.016  1.00 32.05 ? 296 GLN A CD    1 
ATOM   3147 O OE1   . GLN B 2 295 ? -9.980  38.826 29.840  1.00 33.04 ? 296 GLN A OE1   1 
ATOM   3148 N NE2   . GLN B 2 295 ? -9.574  37.092 31.207  1.00 33.68 ? 296 GLN A NE2   1 
ATOM   3149 N N     . LEU B 2 296 ? -7.349  36.786 25.226  1.00 26.83 ? 297 LEU A N     1 
ATOM   3150 C CA    . LEU B 2 296 ? -6.577  37.364 24.137  1.00 26.25 ? 297 LEU A CA    1 
ATOM   3151 C C     . LEU B 2 296 ? -7.148  36.943 22.787  1.00 27.38 ? 297 LEU A C     1 
ATOM   3152 O O     . LEU B 2 296 ? -7.146  37.730 21.849  1.00 29.37 ? 297 LEU A O     1 
ATOM   3153 C CB    . LEU B 2 296 ? -5.107  36.946 24.217  1.00 22.95 ? 297 LEU A CB    1 
ATOM   3154 C CG    . LEU B 2 296 ? -4.285  37.469 25.389  1.00 20.75 ? 297 LEU A CG    1 
ATOM   3155 C CD1   . LEU B 2 296 ? -2.820  37.215 25.113  1.00 19.17 ? 297 LEU A CD1   1 
ATOM   3156 C CD2   . LEU B 2 296 ? -4.528  38.960 25.579  1.00 20.14 ? 297 LEU A CD2   1 
ATOM   3157 N N     . GLU B 2 297 ? -7.636  35.707 22.688  1.00 28.61 ? 298 GLU A N     1 
ATOM   3158 C CA    . GLU B 2 297 ? -8.208  35.201 21.441  1.00 29.32 ? 298 GLU A CA    1 
ATOM   3159 C C     . GLU B 2 297 ? -9.501  35.910 21.129  1.00 28.23 ? 298 GLU A C     1 
ATOM   3160 O O     . GLU B 2 297 ? -9.725  36.351 20.011  1.00 28.42 ? 298 GLU A O     1 
ATOM   3161 C CB    . GLU B 2 297 ? -8.512  33.719 21.537  1.00 31.33 ? 298 GLU A CB    1 
ATOM   3162 C CG    . GLU B 2 297 ? -7.354  32.845 21.886  1.00 35.75 ? 298 GLU A CG    1 
ATOM   3163 C CD    . GLU B 2 297 ? -7.747  31.384 21.853  1.00 39.17 ? 298 GLU A CD    1 
ATOM   3164 O OE1   . GLU B 2 297 ? -6.983  30.540 22.365  1.00 42.11 ? 298 GLU A OE1   1 
ATOM   3165 O OE2   . GLU B 2 297 ? -8.830  31.073 21.312  1.00 40.91 ? 298 GLU A OE2   1 
ATOM   3166 N N     . ARG B 2 298 ? -10.366 35.992 22.125  1.00 26.94 ? 299 ARG A N     1 
ATOM   3167 C CA    . ARG B 2 298 ? -11.637 36.655 21.951  1.00 27.59 ? 299 ARG A CA    1 
ATOM   3168 C C     . ARG B 2 298 ? -11.406 38.081 21.504  1.00 27.13 ? 299 ARG A C     1 
ATOM   3169 O O     . ARG B 2 298 ? -11.905 38.502 20.468  1.00 26.81 ? 299 ARG A O     1 
ATOM   3170 C CB    . ARG B 2 298 ? -12.418 36.629 23.262  1.00 28.27 ? 299 ARG A CB    1 
ATOM   3171 C CG    . ARG B 2 298 ? -13.364 37.798 23.467  1.00 28.85 ? 299 ARG A CG    1 
ATOM   3172 C CD    . ARG B 2 298 ? -14.292 37.553 24.641  1.00 29.86 ? 299 ARG A CD    1 
ATOM   3173 N NE    . ARG B 2 298 ? -15.545 36.970 24.190  1.00 32.68 ? 299 ARG A NE    1 
ATOM   3174 C CZ    . ARG B 2 298 ? -16.554 37.677 23.695  1.00 34.08 ? 299 ARG A CZ    1 
ATOM   3175 N NH1   . ARG B 2 298 ? -16.454 38.994 23.601  1.00 35.03 ? 299 ARG A NH1   1 
ATOM   3176 N NH2   . ARG B 2 298 ? -17.656 37.068 23.278  1.00 35.44 ? 299 ARG A NH2   1 
ATOM   3177 N N     . ALA B 2 299 ? -10.643 38.824 22.290  1.00 26.76 ? 300 ALA A N     1 
ATOM   3178 C CA    . ALA B 2 299 ? -10.353 40.212 21.967  1.00 26.79 ? 300 ALA A CA    1 
ATOM   3179 C C     . ALA B 2 299 ? -9.828  40.314 20.540  1.00 26.72 ? 300 ALA A C     1 
ATOM   3180 O O     . ALA B 2 299 ? -10.331 41.095 19.736  1.00 26.06 ? 300 ALA A O     1 
ATOM   3181 C CB    . ALA B 2 299 ? -9.331  40.772 22.950  1.00 26.91 ? 300 ALA A CB    1 
ATOM   3182 N N     . SER B 2 300 ? -8.820  39.511 20.233  1.00 26.18 ? 301 SER A N     1 
ATOM   3183 C CA    . SER B 2 300 ? -8.229  39.505 18.912  1.00 26.03 ? 301 SER A CA    1 
ATOM   3184 C C     . SER B 2 300 ? -9.264  39.168 17.845  1.00 25.65 ? 301 SER A C     1 
ATOM   3185 O O     . SER B 2 300 ? -9.215  39.686 16.737  1.00 26.39 ? 301 SER A O     1 
ATOM   3186 C CB    . SER B 2 300 ? -7.091  38.496 18.869  1.00 26.22 ? 301 SER A CB    1 
ATOM   3187 O OG    . SER B 2 300 ? -6.540  38.427 17.571  1.00 30.66 ? 301 SER A OG    1 
ATOM   3188 N N     . ARG B 2 301 ? -10.209 38.304 18.186  1.00 25.68 ? 302 ARG A N     1 
ATOM   3189 C CA    . ARG B 2 301 ? -11.247 37.897 17.246  1.00 25.52 ? 302 ARG A CA    1 
ATOM   3190 C C     . ARG B 2 301 ? -12.290 38.986 17.057  1.00 24.21 ? 302 ARG A C     1 
ATOM   3191 O O     . ARG B 2 301 ? -12.728 39.245 15.947  1.00 23.26 ? 302 ARG A O     1 
ATOM   3192 C CB    . ARG B 2 301 ? -11.935 36.635 17.749  1.00 26.72 ? 302 ARG A CB    1 
ATOM   3193 C CG    . ARG B 2 301 ? -12.832 35.970 16.739  1.00 30.37 ? 302 ARG A CG    1 
ATOM   3194 C CD    . ARG B 2 301 ? -13.561 34.788 17.366  1.00 34.80 ? 302 ARG A CD    1 
ATOM   3195 N NE    . ARG B 2 301 ? -14.732 35.206 18.139  1.00 39.42 ? 302 ARG A NE    1 
ATOM   3196 C CZ    . ARG B 2 301 ? -14.862 35.069 19.459  1.00 42.05 ? 302 ARG A CZ    1 
ATOM   3197 N NH1   . ARG B 2 301 ? -13.889 34.516 20.188  1.00 42.48 ? 302 ARG A NH1   1 
ATOM   3198 N NH2   . ARG B 2 301 ? -15.973 35.486 20.057  1.00 42.80 ? 302 ARG A NH2   1 
ATOM   3199 N N     . LYS B 2 302 ? -12.689 39.622 18.149  1.00 24.24 ? 303 LYS A N     1 
ATOM   3200 C CA    . LYS B 2 302 ? -13.690 40.671 18.084  1.00 23.90 ? 303 LYS A CA    1 
ATOM   3201 C C     . LYS B 2 302 ? -13.220 41.826 17.209  1.00 24.07 ? 303 LYS A C     1 
ATOM   3202 O O     . LYS B 2 302 ? -14.016 42.457 16.527  1.00 24.41 ? 303 LYS A O     1 
ATOM   3203 C CB    . LYS B 2 302 ? -14.009 41.186 19.494  1.00 23.48 ? 303 LYS A CB    1 
ATOM   3204 C CG    . LYS B 2 302 ? -14.583 40.141 20.437  1.00 24.05 ? 303 LYS A CG    1 
ATOM   3205 C CD    . LYS B 2 302 ? -15.823 39.459 19.858  1.00 25.59 ? 303 LYS A CD    1 
ATOM   3206 C CE    . LYS B 2 302 ? -17.001 40.408 19.757  1.00 25.83 ? 303 LYS A CE    1 
ATOM   3207 N NZ    . LYS B 2 302 ? -18.104 39.833 18.952  1.00 27.43 ? 303 LYS A NZ    1 
ATOM   3208 N N     . ILE B 2 303 ? -11.922 42.098 17.231  1.00 23.93 ? 304 ILE A N     1 
ATOM   3209 C CA    . ILE B 2 303 ? -11.364 43.193 16.449  1.00 22.72 ? 304 ILE A CA    1 
ATOM   3210 C C     . ILE B 2 303 ? -11.183 42.818 14.989  1.00 22.58 ? 304 ILE A C     1 
ATOM   3211 O O     . ILE B 2 303 ? -11.311 43.654 14.105  1.00 22.93 ? 304 ILE A O     1 
ATOM   3212 C CB    . ILE B 2 303 ? -10.011 43.651 17.024  1.00 22.40 ? 304 ILE A CB    1 
ATOM   3213 C CG1   . ILE B 2 303 ? -10.218 44.260 18.412  1.00 21.90 ? 304 ILE A CG1   1 
ATOM   3214 C CG2   . ILE B 2 303 ? -9.366  44.657 16.095  1.00 23.24 ? 304 ILE A CG2   1 
ATOM   3215 C CD1   . ILE B 2 303 ? -8.964  44.806 19.031  1.00 23.24 ? 304 ILE A CD1   1 
ATOM   3216 N N     . PHE B 2 304 ? -10.873 41.553 14.745  1.00 22.47 ? 305 PHE A N     1 
ATOM   3217 C CA    . PHE B 2 304 ? -10.698 41.048 13.390  1.00 22.00 ? 305 PHE A CA    1 
ATOM   3218 C C     . PHE B 2 304 ? -12.053 41.200 12.707  1.00 22.63 ? 305 PHE A C     1 
ATOM   3219 O O     . PHE B 2 304 ? -12.162 41.686 11.584  1.00 22.12 ? 305 PHE A O     1 
ATOM   3220 C CB    . PHE B 2 304 ? -10.311 39.570 13.445  1.00 21.93 ? 305 PHE A CB    1 
ATOM   3221 C CG    . PHE B 2 304 ? -9.970  38.977 12.115  1.00 22.76 ? 305 PHE A CG    1 
ATOM   3222 C CD1   . PHE B 2 304 ? -8.679  39.073 11.603  1.00 23.21 ? 305 PHE A CD1   1 
ATOM   3223 C CD2   . PHE B 2 304 ? -10.941 38.323 11.364  1.00 23.00 ? 305 PHE A CD2   1 
ATOM   3224 C CE1   . PHE B 2 304 ? -8.359  38.525 10.364  1.00 22.61 ? 305 PHE A CE1   1 
ATOM   3225 C CE2   . PHE B 2 304 ? -10.627 37.776 10.126  1.00 23.37 ? 305 PHE A CE2   1 
ATOM   3226 C CZ    . PHE B 2 304 ? -9.330  37.880 9.627   1.00 23.17 ? 305 PHE A CZ    1 
ATOM   3227 N N     . GLU B 2 305 ? -13.090 40.783 13.420  1.00 24.08 ? 306 GLU A N     1 
ATOM   3228 C CA    . GLU B 2 305 ? -14.445 40.852 12.916  1.00 25.32 ? 306 GLU A CA    1 
ATOM   3229 C C     . GLU B 2 305 ? -14.902 42.280 12.697  1.00 25.59 ? 306 GLU A C     1 
ATOM   3230 O O     . GLU B 2 305 ? -15.727 42.536 11.829  1.00 27.10 ? 306 GLU A O     1 
ATOM   3231 C CB    . GLU B 2 305 ? -15.376 40.126 13.872  1.00 25.62 ? 306 GLU A CB    1 
ATOM   3232 C CG    . GLU B 2 305 ? -14.919 38.710 14.140  1.00 29.42 ? 306 GLU A CG    1 
ATOM   3233 C CD    . GLU B 2 305 ? -15.891 37.944 14.994  1.00 32.74 ? 306 GLU A CD    1 
ATOM   3234 O OE1   . GLU B 2 305 ? -16.571 38.581 15.825  1.00 35.18 ? 306 GLU A OE1   1 
ATOM   3235 O OE2   . GLU B 2 305 ? -15.972 36.708 14.849  1.00 33.58 ? 306 GLU A OE2   1 
ATOM   3236 N N     . PHE B 2 306 ? -14.375 43.211 13.485  1.00 24.52 ? 307 PHE A N     1 
ATOM   3237 C CA    . PHE B 2 306 ? -14.722 44.613 13.314  1.00 23.75 ? 307 PHE A CA    1 
ATOM   3238 C C     . PHE B 2 306 ? -14.053 45.062 12.019  1.00 24.80 ? 307 PHE A C     1 
ATOM   3239 O O     . PHE B 2 306 ? -14.673 45.701 11.170  1.00 25.34 ? 307 PHE A O     1 
ATOM   3240 C CB    . PHE B 2 306 ? -14.195 45.449 14.481  1.00 22.49 ? 307 PHE A CB    1 
ATOM   3241 C CG    . PHE B 2 306 ? -14.159 46.927 14.202  1.00 20.96 ? 307 PHE A CG    1 
ATOM   3242 C CD1   . PHE B 2 306 ? -15.329 47.664 14.117  1.00 21.19 ? 307 PHE A CD1   1 
ATOM   3243 C CD2   . PHE B 2 306 ? -12.948 47.577 13.998  1.00 22.76 ? 307 PHE A CD2   1 
ATOM   3244 C CE1   . PHE B 2 306 ? -15.300 49.019 13.820  1.00 21.00 ? 307 PHE A CE1   1 
ATOM   3245 C CE2   . PHE B 2 306 ? -12.908 48.934 13.699  1.00 23.68 ? 307 PHE A CE2   1 
ATOM   3246 C CZ    . PHE B 2 306 ? -14.090 49.657 13.614  1.00 22.58 ? 307 PHE A CZ    1 
ATOM   3247 N N     . LEU B 2 307 ? -12.784 44.699 11.865  1.00 25.09 ? 308 LEU A N     1 
ATOM   3248 C CA    . LEU B 2 307 ? -12.032 45.075 10.686  1.00 26.24 ? 308 LEU A CA    1 
ATOM   3249 C C     . LEU B 2 307 ? -12.604 44.563 9.384   1.00 28.32 ? 308 LEU A C     1 
ATOM   3250 O O     . LEU B 2 307 ? -12.535 45.260 8.384   1.00 29.70 ? 308 LEU A O     1 
ATOM   3251 C CB    . LEU B 2 307 ? -10.587 44.613 10.791  1.00 25.29 ? 308 LEU A CB    1 
ATOM   3252 C CG    . LEU B 2 307 ? -9.661  45.306 11.787  1.00 27.45 ? 308 LEU A CG    1 
ATOM   3253 C CD1   . LEU B 2 307 ? -8.258  44.747 11.625  1.00 28.47 ? 308 LEU A CD1   1 
ATOM   3254 C CD2   . LEU B 2 307 ? -9.652  46.800 11.544  1.00 28.50 ? 308 LEU A CD2   1 
ATOM   3255 N N     . GLU B 2 308 ? -13.154 43.354 9.356   1.00 30.13 ? 309 GLU A N     1 
ATOM   3256 C CA    . GLU B 2 308 ? -13.692 42.880 8.090   1.00 31.89 ? 309 GLU A CA    1 
ATOM   3257 C C     . GLU B 2 308 ? -15.085 43.405 7.776   1.00 31.56 ? 309 GLU A C     1 
ATOM   3258 O O     . GLU B 2 308 ? -15.391 43.695 6.619   1.00 32.12 ? 309 GLU A O     1 
ATOM   3259 C CB    . GLU B 2 308 ? -13.644 41.348 7.978   1.00 33.14 ? 309 GLU A CB    1 
ATOM   3260 C CG    . GLU B 2 308 ? -14.180 40.540 9.138   1.00 37.01 ? 309 GLU A CG    1 
ATOM   3261 C CD    . GLU B 2 308 ? -14.136 39.034 8.835   1.00 39.81 ? 309 GLU A CD    1 
ATOM   3262 O OE1   . GLU B 2 308 ? -14.387 38.204 9.746   1.00 40.06 ? 309 GLU A OE1   1 
ATOM   3263 O OE2   . GLU B 2 308 ? -13.851 38.680 7.666   1.00 41.08 ? 309 GLU A OE2   1 
ATOM   3264 N N     . ARG B 2 309 ? -15.939 43.555 8.776   1.00 30.71 ? 310 ARG A N     1 
ATOM   3265 C CA    . ARG B 2 309 ? -17.241 44.079 8.443   1.00 31.52 ? 310 ARG A CA    1 
ATOM   3266 C C     . ARG B 2 309 ? -17.050 45.545 8.103   1.00 32.34 ? 310 ARG A C     1 
ATOM   3267 O O     . ARG B 2 309 ? -17.931 46.189 7.545   1.00 33.84 ? 310 ARG A O     1 
ATOM   3268 C CB    . ARG B 2 309 ? -18.240 43.919 9.592   1.00 31.68 ? 310 ARG A CB    1 
ATOM   3269 C CG    . ARG B 2 309 ? -18.031 44.784 10.811  1.00 33.79 ? 310 ARG A CG    1 
ATOM   3270 C CD    . ARG B 2 309 ? -19.294 44.737 11.692  1.00 36.80 ? 310 ARG A CD    1 
ATOM   3271 N NE    . ARG B 2 309 ? -19.004 45.004 13.099  1.00 39.57 ? 310 ARG A NE    1 
ATOM   3272 C CZ    . ARG B 2 309 ? -18.431 44.132 13.924  1.00 40.35 ? 310 ARG A CZ    1 
ATOM   3273 N NH1   . ARG B 2 309 ? -18.093 42.925 13.495  1.00 41.45 ? 310 ARG A NH1   1 
ATOM   3274 N NH2   . ARG B 2 309 ? -18.159 44.479 15.173  1.00 40.41 ? 310 ARG A NH2   1 
ATOM   3275 N N     . GLU B 2 310 ? -15.876 46.074 8.415   1.00 31.50 ? 311 GLU A N     1 
ATOM   3276 C CA    . GLU B 2 310 ? -15.618 47.469 8.137   1.00 29.28 ? 311 GLU A CA    1 
ATOM   3277 C C     . GLU B 2 310 ? -14.860 47.649 6.837   1.00 28.02 ? 311 GLU A C     1 
ATOM   3278 O O     . GLU B 2 310 ? -14.378 48.731 6.535   1.00 28.54 ? 311 GLU A O     1 
ATOM   3279 C CB    . GLU B 2 310 ? -14.856 48.097 9.292   1.00 30.16 ? 311 GLU A CB    1 
ATOM   3280 C CG    . GLU B 2 310 ? -15.291 49.511 9.557   1.00 34.25 ? 311 GLU A CG    1 
ATOM   3281 C CD    . GLU B 2 310 ? -16.747 49.596 9.963   1.00 36.31 ? 311 GLU A CD    1 
ATOM   3282 O OE1   . GLU B 2 310 ? -17.083 49.048 11.032  1.00 38.35 ? 311 GLU A OE1   1 
ATOM   3283 O OE2   . GLU B 2 310 ? -17.557 50.202 9.223   1.00 38.12 ? 311 GLU A OE2   1 
ATOM   3284 N N     . ASN B 2 311 ? -14.758 46.575 6.069   1.00 27.22 ? 312 ASN A N     1 
ATOM   3285 C CA    . ASN B 2 311 ? -14.092 46.605 4.771   1.00 27.45 ? 312 ASN A CA    1 
ATOM   3286 C C     . ASN B 2 311 ? -12.606 46.927 4.748   1.00 27.02 ? 312 ASN A C     1 
ATOM   3287 O O     . ASN B 2 311 ? -12.132 47.585 3.826   1.00 27.39 ? 312 ASN A O     1 
ATOM   3288 C CB    . ASN B 2 311 ? -14.811 47.584 3.841   1.00 27.68 ? 312 ASN A CB    1 
ATOM   3289 C CG    . ASN B 2 311 ? -16.268 47.252 3.663   1.00 27.57 ? 312 ASN A CG    1 
ATOM   3290 O OD1   . ASN B 2 311 ? -17.120 48.136 3.713   1.00 29.36 ? 312 ASN A OD1   1 
ATOM   3291 N ND2   . ASN B 2 311 ? -16.566 45.976 3.444   1.00 26.31 ? 312 ASN A ND2   1 
ATOM   3292 N N     . PHE B 2 312 ? -11.859 46.478 5.745   1.00 27.02 ? 313 PHE A N     1 
ATOM   3293 C CA    . PHE B 2 312 ? -10.425 46.731 5.734   1.00 27.34 ? 313 PHE A CA    1 
ATOM   3294 C C     . PHE B 2 312 ? -9.690  45.478 5.269   1.00 28.09 ? 313 PHE A C     1 
ATOM   3295 O O     . PHE B 2 312 ? -8.477  45.469 5.134   1.00 29.26 ? 313 PHE A O     1 
ATOM   3296 C CB    . PHE B 2 312 ? -9.940  47.186 7.113   1.00 26.05 ? 313 PHE A CB    1 
ATOM   3297 C CG    . PHE B 2 312 ? -10.328 48.599 7.446   1.00 26.22 ? 313 PHE A CG    1 
ATOM   3298 C CD1   . PHE B 2 312 ? -9.869  49.659 6.674   1.00 26.51 ? 313 PHE A CD1   1 
ATOM   3299 C CD2   . PHE B 2 312 ? -11.167 48.875 8.513   1.00 26.30 ? 313 PHE A CD2   1 
ATOM   3300 C CE1   . PHE B 2 312 ? -10.250 50.972 6.959   1.00 25.62 ? 313 PHE A CE1   1 
ATOM   3301 C CE2   . PHE B 2 312 ? -11.551 50.183 8.803   1.00 25.66 ? 313 PHE A CE2   1 
ATOM   3302 C CZ    . PHE B 2 312 ? -11.089 51.230 8.025   1.00 26.38 ? 313 PHE A CZ    1 
ATOM   3303 N N     . MET B 2 313 ? -10.452 44.424 5.010   1.00 28.03 ? 314 MET A N     1 
ATOM   3304 C CA    . MET B 2 313 ? -9.905  43.166 4.531   1.00 27.60 ? 314 MET A CA    1 
ATOM   3305 C C     . MET B 2 313 ? -8.742  42.642 5.345   1.00 26.98 ? 314 MET A C     1 
ATOM   3306 O O     . MET B 2 313 ? -7.606  42.694 4.902   1.00 28.34 ? 314 MET A O     1 
ATOM   3307 C CB    . MET B 2 313 ? -9.470  43.314 3.076   1.00 26.78 ? 314 MET A CB    1 
ATOM   3308 C CG    . MET B 2 313 ? -10.613 43.603 2.115   1.00 27.51 ? 314 MET A CG    1 
ATOM   3309 S SD    . MET B 2 313 ? -10.056 43.762 0.408   1.00 29.13 ? 314 MET A SD    1 
ATOM   3310 C CE    . MET B 2 313 ? -9.742  42.015 0.020   1.00 29.41 ? 314 MET A CE    1 
ATOM   3311 N N     . PRO B 2 314 ? -9.013  42.118 6.548   1.00 26.80 ? 315 PRO A N     1 
ATOM   3312 C CA    . PRO B 2 314 ? -7.957  41.585 7.405   1.00 27.13 ? 315 PRO A CA    1 
ATOM   3313 C C     . PRO B 2 314 ? -7.417  40.293 6.818   1.00 27.25 ? 315 PRO A C     1 
ATOM   3314 O O     . PRO B 2 314 ? -8.151  39.548 6.173   1.00 27.89 ? 315 PRO A O     1 
ATOM   3315 C CB    . PRO B 2 314 ? -8.675  41.326 8.727   1.00 26.54 ? 315 PRO A CB    1 
ATOM   3316 C CG    . PRO B 2 314 ? -9.848  42.211 8.678   1.00 26.63 ? 315 PRO A CG    1 
ATOM   3317 C CD    . PRO B 2 314 ? -10.297 42.094 7.258   1.00 26.79 ? 315 PRO A CD    1 
ATOM   3318 N N     . LEU B 2 315 ? -6.136  40.030 7.033   1.00 25.98 ? 316 LEU A N     1 
ATOM   3319 C CA    . LEU B 2 315 ? -5.543  38.807 6.539   1.00 25.99 ? 316 LEU A CA    1 
ATOM   3320 C C     . LEU B 2 315 ? -5.511  37.844 7.703   1.00 27.13 ? 316 LEU A C     1 
ATOM   3321 O O     . LEU B 2 315 ? -6.250  36.860 7.715   1.00 28.23 ? 316 LEU A O     1 
ATOM   3322 C CB    . LEU B 2 315 ? -4.139  39.062 6.003   1.00 25.07 ? 316 LEU A CB    1 
ATOM   3323 C CG    . LEU B 2 315 ? -4.083  39.978 4.778   1.00 24.25 ? 316 LEU A CG    1 
ATOM   3324 C CD1   . LEU B 2 315 ? -2.671  39.985 4.236   1.00 23.10 ? 316 LEU A CD1   1 
ATOM   3325 C CD2   . LEU B 2 315 ? -5.052  39.499 3.707   1.00 23.05 ? 316 LEU A CD2   1 
ATOM   3326 N N     . ARG B 2 316 ? -4.672  38.133 8.692   1.00 27.92 ? 317 ARG A N     1 
ATOM   3327 C CA    . ARG B 2 316 ? -4.595  37.287 9.878   1.00 29.28 ? 317 ARG A CA    1 
ATOM   3328 C C     . ARG B 2 316 ? -4.386  38.094 11.147  1.00 29.82 ? 317 ARG A C     1 
ATOM   3329 O O     . ARG B 2 316 ? -3.836  39.194 11.108  1.00 30.61 ? 317 ARG A O     1 
ATOM   3330 C CB    . ARG B 2 316 ? -3.456  36.278 9.758   1.00 30.00 ? 317 ARG A CB    1 
ATOM   3331 C CG    . ARG B 2 316 ? -3.554  35.336 8.584   1.00 32.02 ? 317 ARG A CG    1 
ATOM   3332 C CD    . ARG B 2 316 ? -2.401  34.362 8.626   1.00 32.91 ? 317 ARG A CD    1 
ATOM   3333 N NE    . ARG B 2 316 ? -2.550  33.385 9.697   1.00 32.66 ? 317 ARG A NE    1 
ATOM   3334 C CZ    . ARG B 2 316 ? -1.593  32.541 10.072  1.00 33.38 ? 317 ARG A CZ    1 
ATOM   3335 N NH1   . ARG B 2 316 ? -0.407  32.555 9.471   1.00 32.89 ? 317 ARG A NH1   1 
ATOM   3336 N NH2   . ARG B 2 316 ? -1.827  31.668 11.041  1.00 35.07 ? 317 ARG A NH2   1 
ATOM   3337 N N     . SER B 2 317 ? -4.836  37.534 12.269  1.00 30.13 ? 318 SER A N     1 
ATOM   3338 C CA    . SER B 2 317 ? -4.673  38.166 13.573  1.00 29.61 ? 318 SER A CA    1 
ATOM   3339 C C     . SER B 2 317 ? -3.687  37.317 14.367  1.00 29.53 ? 318 SER A C     1 
ATOM   3340 O O     . SER B 2 317 ? -3.348  36.200 13.969  1.00 29.33 ? 318 SER A O     1 
ATOM   3341 C CB    . SER B 2 317 ? -6.008  38.252 14.319  1.00 29.59 ? 318 SER A CB    1 
ATOM   3342 O OG    . SER B 2 317 ? -6.483  36.974 14.686  1.00 29.99 ? 318 SER A OG    1 
ATOM   3343 N N     . ALA B 2 318 ? -3.219  37.859 15.483  1.00 29.31 ? 319 ALA A N     1 
ATOM   3344 C CA    . ALA B 2 318 ? -2.264  37.163 16.335  1.00 28.75 ? 319 ALA A CA    1 
ATOM   3345 C C     . ALA B 2 318 ? -2.137  37.924 17.638  1.00 27.90 ? 319 ALA A C     1 
ATOM   3346 O O     . ALA B 2 318 ? -2.649  39.025 17.761  1.00 28.23 ? 319 ALA A O     1 
ATOM   3347 C CB    . ALA B 2 318 ? -0.914  37.081 15.647  1.00 27.41 ? 319 ALA A CB    1 
ATOM   3348 N N     . PHE B 2 319 ? -1.449  37.339 18.607  1.00 28.17 ? 320 PHE A N     1 
ATOM   3349 C CA    . PHE B 2 319 ? -1.271  37.986 19.898  1.00 29.14 ? 320 PHE A CA    1 
ATOM   3350 C C     . PHE B 2 319 ? -0.070  37.452 20.680  1.00 30.38 ? 320 PHE A C     1 
ATOM   3351 O O     . PHE B 2 319 ? 0.299   36.283 20.563  1.00 31.37 ? 320 PHE A O     1 
ATOM   3352 C CB    . PHE B 2 319 ? -2.547  37.846 20.724  1.00 27.32 ? 320 PHE A CB    1 
ATOM   3353 C CG    . PHE B 2 319 ? -2.986  36.432 20.919  1.00 26.86 ? 320 PHE A CG    1 
ATOM   3354 C CD1   . PHE B 2 319 ? -2.257  35.568 21.720  1.00 24.87 ? 320 PHE A CD1   1 
ATOM   3355 C CD2   . PHE B 2 319 ? -4.140  35.960 20.307  1.00 27.62 ? 320 PHE A CD2   1 
ATOM   3356 C CE1   . PHE B 2 319 ? -2.671  34.259 21.909  1.00 24.82 ? 320 PHE A CE1   1 
ATOM   3357 C CE2   . PHE B 2 319 ? -4.559  34.645 20.493  1.00 24.76 ? 320 PHE A CE2   1 
ATOM   3358 C CZ    . PHE B 2 319 ? -3.825  33.800 21.294  1.00 23.85 ? 320 PHE A CZ    1 
ATOM   3359 N N     . LYS B 2 320 ? 0.536   38.324 21.479  1.00 30.85 ? 321 LYS A N     1 
ATOM   3360 C CA    . LYS B 2 320 ? 1.697   37.963 22.275  1.00 31.92 ? 321 LYS A CA    1 
ATOM   3361 C C     . LYS B 2 320 ? 1.526   38.512 23.688  1.00 33.68 ? 321 LYS A C     1 
ATOM   3362 O O     . LYS B 2 320 ? 0.898   39.548 23.884  1.00 34.16 ? 321 LYS A O     1 
ATOM   3363 C CB    . LYS B 2 320 ? 2.956   38.534 21.618  1.00 30.97 ? 321 LYS A CB    1 
ATOM   3364 C CG    . LYS B 2 320 ? 4.249   37.880 22.048  1.00 30.02 ? 321 LYS A CG    1 
ATOM   3365 C CD    . LYS B 2 320 ? 4.686   38.362 23.408  1.00 31.19 ? 321 LYS A CD    1 
ATOM   3366 C CE    . LYS B 2 320 ? 5.855   37.548 23.910  1.00 32.52 ? 321 LYS A CE    1 
ATOM   3367 N NZ    . LYS B 2 320 ? 6.886   37.400 22.845  1.00 34.97 ? 321 LYS A NZ    1 
ATOM   3368 N N     . ALA B 2 321 ? 2.075   37.814 24.676  1.00 35.72 ? 322 ALA A N     1 
ATOM   3369 C CA    . ALA B 2 321 ? 1.962   38.259 26.060  1.00 37.33 ? 322 ALA A CA    1 
ATOM   3370 C C     . ALA B 2 321 ? 3.324   38.332 26.732  1.00 38.81 ? 322 ALA A C     1 
ATOM   3371 O O     . ALA B 2 321 ? 4.204   37.529 26.443  1.00 38.65 ? 322 ALA A O     1 
ATOM   3372 C CB    . ALA B 2 321 ? 1.050   37.327 26.830  1.00 37.14 ? 322 ALA A CB    1 
ATOM   3373 N N     . SER B 2 322 ? 3.485   39.306 27.625  1.00 41.86 ? 323 SER A N     1 
ATOM   3374 C CA    . SER B 2 322 ? 4.738   39.512 28.359  1.00 44.23 ? 323 SER A CA    1 
ATOM   3375 C C     . SER B 2 322 ? 4.509   39.723 29.856  1.00 46.57 ? 323 SER A C     1 
ATOM   3376 O O     . SER B 2 322 ? 3.366   39.754 30.341  1.00 46.56 ? 323 SER A O     1 
ATOM   3377 C CB    . SER B 2 322 ? 5.482   40.730 27.813  1.00 42.87 ? 323 SER A CB    1 
ATOM   3378 O OG    . SER B 2 322 ? 5.786   40.559 26.447  1.00 43.84 ? 323 SER A OG    1 
ATOM   3379 N N     . GLU B 2 323 ? 5.611   39.851 30.590  1.00 48.99 ? 324 GLU A N     1 
ATOM   3380 C CA    . GLU B 2 323 ? 5.533   40.091 32.026  1.00 51.08 ? 324 GLU A CA    1 
ATOM   3381 C C     . GLU B 2 323 ? 4.937   41.481 32.124  1.00 50.84 ? 324 GLU A C     1 
ATOM   3382 O O     . GLU B 2 323 ? 4.132   41.792 33.009  1.00 51.07 ? 324 GLU A O     1 
ATOM   3383 C CB    . GLU B 2 323 ? 6.939   40.071 32.646  1.00 53.29 ? 324 GLU A CB    1 
ATOM   3384 C CG    . GLU B 2 323 ? 7.552   38.675 32.725  1.00 57.81 ? 324 GLU A CG    1 
ATOM   3385 C CD    . GLU B 2 323 ? 6.831   37.784 33.733  1.00 60.50 ? 324 GLU A CD    1 
ATOM   3386 O OE1   . GLU B 2 323 ? 5.573   37.797 33.754  1.00 61.16 ? 324 GLU A OE1   1 
ATOM   3387 O OE2   . GLU B 2 323 ? 7.523   37.069 34.501  1.00 62.30 ? 324 GLU A OE2   1 
ATOM   3388 N N     . GLU B 2 324 ? 5.328   42.294 31.154  1.00 50.29 ? 325 GLU A N     1 
ATOM   3389 C CA    . GLU B 2 324 ? 4.904   43.670 31.054  1.00 49.74 ? 325 GLU A CA    1 
ATOM   3390 C C     . GLU B 2 324 ? 3.551   43.883 30.358  1.00 48.12 ? 325 GLU A C     1 
ATOM   3391 O O     . GLU B 2 324 ? 2.538   44.108 31.027  1.00 47.92 ? 325 GLU A O     1 
ATOM   3392 C CB    . GLU B 2 324 ? 6.014   44.459 30.342  1.00 52.09 ? 325 GLU A CB    1 
ATOM   3393 C CG    . GLU B 2 324 ? 6.997   43.578 29.516  1.00 53.82 ? 325 GLU A CG    1 
ATOM   3394 C CD    . GLU B 2 324 ? 7.007   43.898 28.007  1.00 55.14 ? 325 GLU A CD    1 
ATOM   3395 O OE1   . GLU B 2 324 ? 5.938   43.804 27.349  1.00 54.21 ? 325 GLU A OE1   1 
ATOM   3396 O OE2   . GLU B 2 324 ? 8.089   44.236 27.475  1.00 55.28 ? 325 GLU A OE2   1 
ATOM   3397 N N     . PHE B 2 325 ? 3.536   43.793 29.025  1.00 46.23 ? 326 PHE A N     1 
ATOM   3398 C CA    . PHE B 2 325 ? 2.321   44.035 28.244  1.00 44.17 ? 326 PHE A CA    1 
ATOM   3399 C C     . PHE B 2 325 ? 1.839   42.909 27.336  1.00 43.34 ? 326 PHE A C     1 
ATOM   3400 O O     . PHE B 2 325 ? 2.502   41.884 27.184  1.00 44.08 ? 326 PHE A O     1 
ATOM   3401 C CB    . PHE B 2 325 ? 2.502   45.263 27.346  1.00 43.35 ? 326 PHE A CB    1 
ATOM   3402 C CG    . PHE B 2 325 ? 3.028   46.476 28.051  1.00 41.56 ? 326 PHE A CG    1 
ATOM   3403 C CD1   . PHE B 2 325 ? 4.394   46.694 28.157  1.00 39.67 ? 326 PHE A CD1   1 
ATOM   3404 C CD2   . PHE B 2 325 ? 2.153   47.427 28.566  1.00 41.24 ? 326 PHE A CD2   1 
ATOM   3405 C CE1   . PHE B 2 325 ? 4.881   47.842 28.759  1.00 38.19 ? 326 PHE A CE1   1 
ATOM   3406 C CE2   . PHE B 2 325 ? 2.634   48.578 29.171  1.00 39.53 ? 326 PHE A CE2   1 
ATOM   3407 C CZ    . PHE B 2 325 ? 4.001   48.785 29.265  1.00 39.09 ? 326 PHE A CZ    1 
ATOM   3408 N N     . CYS B 2 326 ? 0.682   43.156 26.714  1.00 41.90 ? 327 CYS A N     1 
ATOM   3409 C CA    . CYS B 2 326 ? 0.018   42.254 25.765  1.00 40.10 ? 327 CYS A CA    1 
ATOM   3410 C C     . CYS B 2 326 ? -0.123  42.978 24.442  1.00 38.18 ? 327 CYS A C     1 
ATOM   3411 O O     . CYS B 2 326 ? -0.305  44.189 24.430  1.00 38.42 ? 327 CYS A O     1 
ATOM   3412 C CB    . CYS B 2 326 ? -1.381  41.903 26.243  1.00 40.25 ? 327 CYS A CB    1 
ATOM   3413 S SG    . CYS B 2 326 ? -1.377  40.765 27.587  1.00 42.61 ? 327 CYS A SG    1 
ATOM   3414 N N     . TYR B 2 327 ? -0.065  42.249 23.333  1.00 36.03 ? 328 TYR A N     1 
ATOM   3415 C CA    . TYR B 2 327 ? -0.199  42.875 22.024  1.00 34.52 ? 328 TYR A CA    1 
ATOM   3416 C C     . TYR B 2 327 ? -1.166  42.139 21.123  1.00 32.47 ? 328 TYR A C     1 
ATOM   3417 O O     . TYR B 2 327 ? -1.116  40.926 21.014  1.00 32.49 ? 328 TYR A O     1 
ATOM   3418 C CB    . TYR B 2 327 ? 1.141   42.920 21.305  1.00 36.54 ? 328 TYR A CB    1 
ATOM   3419 C CG    . TYR B 2 327 ? 2.278   43.493 22.105  1.00 40.79 ? 328 TYR A CG    1 
ATOM   3420 C CD1   . TYR B 2 327 ? 2.769   42.830 23.230  1.00 41.94 ? 328 TYR A CD1   1 
ATOM   3421 C CD2   . TYR B 2 327 ? 2.908   44.677 21.706  1.00 42.11 ? 328 TYR A CD2   1 
ATOM   3422 C CE1   . TYR B 2 327 ? 3.864   43.324 23.936  1.00 43.66 ? 328 TYR A CE1   1 
ATOM   3423 C CE2   . TYR B 2 327 ? 4.005   45.182 22.402  1.00 43.62 ? 328 TYR A CE2   1 
ATOM   3424 C CZ    . TYR B 2 327 ? 4.482   44.499 23.514  1.00 44.35 ? 328 TYR A CZ    1 
ATOM   3425 O OH    . TYR B 2 327 ? 5.592   44.967 24.187  1.00 45.78 ? 328 TYR A OH    1 
ATOM   3426 N N     . LEU B 2 328 ? -2.059  42.874 20.482  1.00 29.91 ? 329 LEU A N     1 
ATOM   3427 C CA    . LEU B 2 328 ? -2.977  42.265 19.542  1.00 27.38 ? 329 LEU A CA    1 
ATOM   3428 C C     . LEU B 2 328 ? -2.392  42.708 18.215  1.00 27.94 ? 329 LEU A C     1 
ATOM   3429 O O     . LEU B 2 328 ? -2.260  43.898 17.963  1.00 29.21 ? 329 LEU A O     1 
ATOM   3430 C CB    . LEU B 2 328 ? -4.395  42.808 19.717  1.00 25.78 ? 329 LEU A CB    1 
ATOM   3431 C CG    . LEU B 2 328 ? -5.090  42.502 21.048  1.00 25.60 ? 329 LEU A CG    1 
ATOM   3432 C CD1   . LEU B 2 328 ? -6.521  42.969 20.968  1.00 24.96 ? 329 LEU A CD1   1 
ATOM   3433 C CD2   . LEU B 2 328 ? -5.040  41.018 21.352  1.00 25.11 ? 329 LEU A CD2   1 
ATOM   3434 N N     . LEU B 2 329 ? -2.011  41.754 17.379  1.00 27.75 ? 330 LEU A N     1 
ATOM   3435 C CA    . LEU B 2 329 ? -1.410  42.074 16.093  1.00 26.67 ? 330 LEU A CA    1 
ATOM   3436 C C     . LEU B 2 329 ? -2.339  41.823 14.927  1.00 26.16 ? 330 LEU A C     1 
ATOM   3437 O O     . LEU B 2 329 ? -3.011  40.800 14.871  1.00 26.28 ? 330 LEU A O     1 
ATOM   3438 C CB    . LEU B 2 329 ? -0.145  41.255 15.916  1.00 26.33 ? 330 LEU A CB    1 
ATOM   3439 C CG    . LEU B 2 329 ? 0.759   41.381 17.131  1.00 26.33 ? 330 LEU A CG    1 
ATOM   3440 C CD1   . LEU B 2 329 ? 1.171   40.006 17.591  1.00 28.12 ? 330 LEU A CD1   1 
ATOM   3441 C CD2   . LEU B 2 329 ? 1.948   42.234 16.789  1.00 26.97 ? 330 LEU A CD2   1 
ATOM   3442 N N     . PHE B 2 330 ? -2.367  42.768 13.993  1.00 26.09 ? 331 PHE A N     1 
ATOM   3443 C CA    . PHE B 2 330 ? -3.213  42.653 12.812  1.00 25.69 ? 331 PHE A CA    1 
ATOM   3444 C C     . PHE B 2 330 ? -2.493  43.089 11.550  1.00 25.47 ? 331 PHE A C     1 
ATOM   3445 O O     . PHE B 2 330 ? -1.557  43.885 11.598  1.00 25.51 ? 331 PHE A O     1 
ATOM   3446 C CB    . PHE B 2 330 ? -4.463  43.514 12.971  1.00 24.52 ? 331 PHE A CB    1 
ATOM   3447 C CG    . PHE B 2 330 ? -5.255  43.204 14.195  1.00 25.25 ? 331 PHE A CG    1 
ATOM   3448 C CD1   . PHE B 2 330 ? -5.969  42.025 14.294  1.00 26.35 ? 331 PHE A CD1   1 
ATOM   3449 C CD2   . PHE B 2 330 ? -5.277  44.088 15.262  1.00 25.18 ? 331 PHE A CD2   1 
ATOM   3450 C CE1   . PHE B 2 330 ? -6.690  41.730 15.435  1.00 25.70 ? 331 PHE A CE1   1 
ATOM   3451 C CE2   . PHE B 2 330 ? -5.997  43.795 16.407  1.00 24.28 ? 331 PHE A CE2   1 
ATOM   3452 C CZ    . PHE B 2 330 ? -6.703  42.617 16.490  1.00 25.03 ? 331 PHE A CZ    1 
ATOM   3453 N N     . GLU B 2 331 ? -2.936  42.543 10.424  1.00 25.02 ? 332 GLU A N     1 
ATOM   3454 C CA    . GLU B 2 331 ? -2.406  42.894 9.114   1.00 24.99 ? 332 GLU A CA    1 
ATOM   3455 C C     . GLU B 2 331 ? -3.635  43.004 8.223   1.00 24.82 ? 332 GLU A C     1 
ATOM   3456 O O     . GLU B 2 331 ? -4.527  42.164 8.292   1.00 26.08 ? 332 GLU A O     1 
ATOM   3457 C CB    . GLU B 2 331 ? -1.457  41.818 8.582   1.00 24.42 ? 332 GLU A CB    1 
ATOM   3458 C CG    . GLU B 2 331 ? -0.888  42.158 7.216   1.00 26.64 ? 332 GLU A CG    1 
ATOM   3459 C CD    . GLU B 2 331 ? 0.064   41.102 6.689   1.00 28.75 ? 332 GLU A CD    1 
ATOM   3460 O OE1   . GLU B 2 331 ? -0.258  39.905 6.822   1.00 30.83 ? 332 GLU A OE1   1 
ATOM   3461 O OE2   . GLU B 2 331 ? 1.128   41.463 6.133   1.00 28.60 ? 332 GLU A OE2   1 
ATOM   3462 N N     . CYS B 2 332 ? -3.694  44.048 7.407   1.00 24.43 ? 333 CYS A N     1 
ATOM   3463 C CA    . CYS B 2 332 ? -4.835  44.261 6.524   1.00 24.45 ? 333 CYS A CA    1 
ATOM   3464 C C     . CYS B 2 332 ? -4.396  44.589 5.103   1.00 23.95 ? 333 CYS A C     1 
ATOM   3465 O O     . CYS B 2 332 ? -3.266  45.014 4.878   1.00 24.88 ? 333 CYS A O     1 
ATOM   3466 C CB    . CYS B 2 332 ? -5.695  45.411 7.052   1.00 24.74 ? 333 CYS A CB    1 
ATOM   3467 S SG    . CYS B 2 332 ? -6.349  45.206 8.713   1.00 27.47 ? 333 CYS A SG    1 
ATOM   3468 N N     . GLN B 2 333 ? -5.299  44.401 4.148   1.00 23.40 ? 334 GLN A N     1 
ATOM   3469 C CA    . GLN B 2 333 ? -5.003  44.701 2.752   1.00 23.83 ? 334 GLN A CA    1 
ATOM   3470 C C     . GLN B 2 333 ? -5.284  46.168 2.434   1.00 22.44 ? 334 GLN A C     1 
ATOM   3471 O O     . GLN B 2 333 ? -4.799  46.696 1.439   1.00 22.81 ? 334 GLN A O     1 
ATOM   3472 C CB    . GLN B 2 333 ? -5.853  43.836 1.818   1.00 25.16 ? 334 GLN A CB    1 
ATOM   3473 C CG    . GLN B 2 333 ? -5.840  42.365 2.109   1.00 27.60 ? 334 GLN A CG    1 
ATOM   3474 C CD    . GLN B 2 333 ? -6.226  41.546 0.893   1.00 30.88 ? 334 GLN A CD    1 
ATOM   3475 O OE1   . GLN B 2 333 ? -6.616  40.379 1.006   1.00 33.29 ? 334 GLN A OE1   1 
ATOM   3476 N NE2   . GLN B 2 333 ? -6.108  42.150 -0.284  1.00 30.54 ? 334 GLN A NE2   1 
ATOM   3477 N N     . ILE B 2 334 ? -6.067  46.816 3.287   1.00 20.54 ? 335 ILE A N     1 
ATOM   3478 C CA    . ILE B 2 334 ? -6.448  48.209 3.088   1.00 21.24 ? 335 ILE A CA    1 
ATOM   3479 C C     . ILE B 2 334 ? -5.800  49.168 4.080   1.00 21.45 ? 335 ILE A C     1 
ATOM   3480 O O     . ILE B 2 334 ? -6.150  49.166 5.249   1.00 20.82 ? 335 ILE A O     1 
ATOM   3481 C CB    . ILE B 2 334 ? -7.980  48.381 3.231   1.00 21.69 ? 335 ILE A CB    1 
ATOM   3482 C CG1   . ILE B 2 334 ? -8.724  47.344 2.384   1.00 20.96 ? 335 ILE A CG1   1 
ATOM   3483 C CG2   . ILE B 2 334 ? -8.375  49.797 2.863   1.00 21.09 ? 335 ILE A CG2   1 
ATOM   3484 C CD1   . ILE B 2 334 ? -8.426  47.395 0.917   1.00 19.09 ? 335 ILE A CD1   1 
ATOM   3485 N N     . LYS B 2 335 ? -4.868  49.996 3.623   1.00 22.52 ? 336 LYS A N     1 
ATOM   3486 C CA    . LYS B 2 335 ? -4.234  50.961 4.521   1.00 23.46 ? 336 LYS A CA    1 
ATOM   3487 C C     . LYS B 2 335 ? -5.173  52.150 4.701   1.00 24.79 ? 336 LYS A C     1 
ATOM   3488 O O     . LYS B 2 335 ? -5.151  52.825 5.731   1.00 24.95 ? 336 LYS A O     1 
ATOM   3489 C CB    . LYS B 2 335 ? -2.907  51.474 3.956   1.00 23.14 ? 336 LYS A CB    1 
ATOM   3490 C CG    . LYS B 2 335 ? -1.812  50.449 3.852   1.00 24.37 ? 336 LYS A CG    1 
ATOM   3491 C CD    . LYS B 2 335 ? -0.500  51.082 3.442   1.00 25.25 ? 336 LYS A CD    1 
ATOM   3492 C CE    . LYS B 2 335 ? 0.559   50.015 3.261   1.00 28.83 ? 336 LYS A CE    1 
ATOM   3493 N NZ    . LYS B 2 335 ? 1.943   50.547 3.062   1.00 32.01 ? 336 LYS A NZ    1 
ATOM   3494 N N     . GLU B 2 336 ? -5.990  52.397 3.680   1.00 25.91 ? 337 GLU A N     1 
ATOM   3495 C CA    . GLU B 2 336 ? -6.944  53.494 3.687   1.00 26.98 ? 337 GLU A CA    1 
ATOM   3496 C C     . GLU B 2 336 ? -8.077  53.189 2.729   1.00 27.16 ? 337 GLU A C     1 
ATOM   3497 O O     . GLU B 2 336 ? -7.900  52.446 1.776   1.00 28.58 ? 337 GLU A O     1 
ATOM   3498 C CB    . GLU B 2 336 ? -6.257  54.790 3.269   1.00 28.51 ? 337 GLU A CB    1 
ATOM   3499 C CG    . GLU B 2 336 ? -7.186  55.985 3.194   1.00 33.26 ? 337 GLU A CG    1 
ATOM   3500 C CD    . GLU B 2 336 ? -6.435  57.300 3.230   1.00 36.87 ? 337 GLU A CD    1 
ATOM   3501 O OE1   . GLU B 2 336 ? -5.504  57.466 2.412   1.00 36.93 ? 337 GLU A OE1   1 
ATOM   3502 O OE2   . GLU B 2 336 ? -6.775  58.164 4.076   1.00 38.38 ? 337 GLU A OE2   1 
ATOM   3503 N N     . ILE B 2 337 ? -9.240  53.773 2.986   1.00 27.48 ? 338 ILE A N     1 
ATOM   3504 C CA    . ILE B 2 337 ? -10.415 53.564 2.154   1.00 27.57 ? 338 ILE A CA    1 
ATOM   3505 C C     . ILE B 2 337 ? -11.107 54.912 1.967   1.00 29.17 ? 338 ILE A C     1 
ATOM   3506 O O     . ILE B 2 337 ? -10.873 55.844 2.739   1.00 30.15 ? 338 ILE A O     1 
ATOM   3507 C CB    . ILE B 2 337 ? -11.379 52.581 2.831   1.00 27.77 ? 338 ILE A CB    1 
ATOM   3508 C CG1   . ILE B 2 337 ? -12.473 52.169 1.861   1.00 29.21 ? 338 ILE A CG1   1 
ATOM   3509 C CG2   . ILE B 2 337 ? -12.009 53.226 4.061   1.00 27.84 ? 338 ILE A CG2   1 
ATOM   3510 C CD1   . ILE B 2 337 ? -13.408 51.154 2.438   1.00 30.04 ? 338 ILE A CD1   1 
ATOM   3511 N N     . SER B 2 338 ? -11.955 55.030 0.952   1.00 29.58 ? 339 SER A N     1 
ATOM   3512 C CA    . SER B 2 338 ? -12.629 56.299 0.720   1.00 29.61 ? 339 SER A CA    1 
ATOM   3513 C C     . SER B 2 338 ? -13.558 56.628 1.873   1.00 29.98 ? 339 SER A C     1 
ATOM   3514 O O     . SER B 2 338 ? -13.865 55.777 2.709   1.00 29.58 ? 339 SER A O     1 
ATOM   3515 C CB    . SER B 2 338 ? -13.433 56.260 -0.572  1.00 30.45 ? 339 SER A CB    1 
ATOM   3516 O OG    . SER B 2 338 ? -14.545 55.400 -0.443  1.00 32.89 ? 339 SER A OG    1 
ATOM   3517 N N     . ARG B 2 339 ? -14.002 57.877 1.907   1.00 29.81 ? 340 ARG A N     1 
ATOM   3518 C CA    . ARG B 2 339 ? -14.901 58.340 2.942   1.00 29.44 ? 340 ARG A CA    1 
ATOM   3519 C C     . ARG B 2 339 ? -16.278 57.852 2.556   1.00 29.08 ? 340 ARG A C     1 
ATOM   3520 O O     . ARG B 2 339 ? -16.994 57.283 3.360   1.00 29.81 ? 340 ARG A O     1 
ATOM   3521 C CB    . ARG B 2 339 ? -14.902 59.858 2.986   1.00 30.11 ? 340 ARG A CB    1 
ATOM   3522 C CG    . ARG B 2 339 ? -15.317 60.426 4.313   1.00 32.23 ? 340 ARG A CG    1 
ATOM   3523 C CD    . ARG B 2 339 ? -14.090 60.772 5.100   1.00 34.28 ? 340 ARG A CD    1 
ATOM   3524 N NE    . ARG B 2 339 ? -14.326 60.752 6.537   1.00 35.91 ? 340 ARG A NE    1 
ATOM   3525 C CZ    . ARG B 2 339 ? -13.356 60.858 7.440   1.00 37.63 ? 340 ARG A CZ    1 
ATOM   3526 N NH1   . ARG B 2 339 ? -12.093 60.998 7.040   1.00 36.97 ? 340 ARG A NH1   1 
ATOM   3527 N NH2   . ARG B 2 339 ? -13.643 60.800 8.737   1.00 39.08 ? 340 ARG A NH2   1 
ATOM   3528 N N     . VAL B 2 340 ? -16.647 58.081 1.306   1.00 28.09 ? 341 VAL A N     1 
ATOM   3529 C CA    . VAL B 2 340 ? -17.946 57.653 0.822   1.00 27.02 ? 341 VAL A CA    1 
ATOM   3530 C C     . VAL B 2 340 ? -18.031 56.145 0.607   1.00 26.69 ? 341 VAL A C     1 
ATOM   3531 O O     . VAL B 2 340 ? -17.068 55.490 0.209   1.00 25.36 ? 341 VAL A O     1 
ATOM   3532 C CB    . VAL B 2 340 ? -18.324 58.353 -0.513  1.00 25.68 ? 341 VAL A CB    1 
ATOM   3533 C CG1   . VAL B 2 340 ? -18.563 59.817 -0.281  1.00 26.34 ? 341 VAL A CG1   1 
ATOM   3534 C CG2   . VAL B 2 340 ? -17.224 58.166 -1.534  1.00 26.73 ? 341 VAL A CG2   1 
ATOM   3535 N N     . PHE B 2 341 ? -19.210 55.610 0.888   1.00 27.06 ? 342 PHE A N     1 
ATOM   3536 C CA    . PHE B 2 341 ? -19.501 54.199 0.708   1.00 27.52 ? 342 PHE A CA    1 
ATOM   3537 C C     . PHE B 2 341 ? -20.987 54.170 0.366   1.00 27.86 ? 342 PHE A C     1 
ATOM   3538 O O     . PHE B 2 341 ? -21.708 55.133 0.647   1.00 26.28 ? 342 PHE A O     1 
ATOM   3539 C CB    . PHE B 2 341 ? -19.185 53.406 1.986   1.00 26.60 ? 342 PHE A CB    1 
ATOM   3540 C CG    . PHE B 2 341 ? -20.092 53.708 3.136   1.00 26.17 ? 342 PHE A CG    1 
ATOM   3541 C CD1   . PHE B 2 341 ? -21.244 52.968 3.337   1.00 25.38 ? 342 PHE A CD1   1 
ATOM   3542 C CD2   . PHE B 2 341 ? -19.800 54.741 4.021   1.00 26.73 ? 342 PHE A CD2   1 
ATOM   3543 C CE1   . PHE B 2 341 ? -22.093 53.250 4.404   1.00 25.21 ? 342 PHE A CE1   1 
ATOM   3544 C CE2   . PHE B 2 341 ? -20.645 55.029 5.092   1.00 26.11 ? 342 PHE A CE2   1 
ATOM   3545 C CZ    . PHE B 2 341 ? -21.792 54.282 5.280   1.00 25.41 ? 342 PHE A CZ    1 
ATOM   3546 N N     . ARG B 2 342 ? -21.447 53.088 -0.250  1.00 29.48 ? 343 ARG A N     1 
ATOM   3547 C CA    . ARG B 2 342 ? -22.846 53.005 -0.649  1.00 30.80 ? 343 ARG A CA    1 
ATOM   3548 C C     . ARG B 2 342 ? -23.764 52.242 0.303   1.00 31.20 ? 343 ARG A C     1 
ATOM   3549 O O     . ARG B 2 342 ? -23.496 51.099 0.673   1.00 32.23 ? 343 ARG A O     1 
ATOM   3550 C CB    . ARG B 2 342 ? -22.936 52.427 -2.065  1.00 30.10 ? 343 ARG A CB    1 
ATOM   3551 C CG    . ARG B 2 342 ? -22.082 51.196 -2.281  1.00 32.03 ? 343 ARG A CG    1 
ATOM   3552 C CD    . ARG B 2 342 ? -22.147 50.764 -3.718  1.00 31.43 ? 343 ARG A CD    1 
ATOM   3553 N NE    . ARG B 2 342 ? -23.528 50.568 -4.128  1.00 33.17 ? 343 ARG A NE    1 
ATOM   3554 C CZ    . ARG B 2 342 ? -23.915 50.397 -5.384  1.00 33.74 ? 343 ARG A CZ    1 
ATOM   3555 N NH1   . ARG B 2 342 ? -23.021 50.402 -6.361  1.00 34.93 ? 343 ARG A NH1   1 
ATOM   3556 N NH2   . ARG B 2 342 ? -25.195 50.212 -5.661  1.00 33.59 ? 343 ARG A NH2   1 
ATOM   3557 N N     . ARG B 2 343 ? -24.849 52.901 0.698   1.00 31.26 ? 344 ARG A N     1 
ATOM   3558 C CA    . ARG B 2 343 ? -25.840 52.327 1.600   1.00 31.72 ? 344 ARG A CA    1 
ATOM   3559 C C     . ARG B 2 343 ? -27.046 51.870 0.779   1.00 31.04 ? 344 ARG A C     1 
ATOM   3560 O O     . ARG B 2 343 ? -27.533 52.606 -0.072  1.00 30.43 ? 344 ARG A O     1 
ATOM   3561 C CB    . ARG B 2 343 ? -26.233 53.374 2.657   1.00 33.14 ? 344 ARG A CB    1 
ATOM   3562 C CG    . ARG B 2 343 ? -27.504 53.084 3.459   1.00 35.89 ? 344 ARG A CG    1 
ATOM   3563 C CD    . ARG B 2 343 ? -27.504 53.769 4.842   1.00 37.21 ? 344 ARG A CD    1 
ATOM   3564 N NE    . ARG B 2 343 ? -26.704 53.010 5.806   1.00 39.70 ? 344 ARG A NE    1 
ATOM   3565 C CZ    . ARG B 2 343 ? -25.651 53.488 6.469   1.00 42.29 ? 344 ARG A CZ    1 
ATOM   3566 N NH1   . ARG B 2 343 ? -25.251 54.742 6.288   1.00 43.61 ? 344 ARG A NH1   1 
ATOM   3567 N NH2   . ARG B 2 343 ? -24.978 52.706 7.306   1.00 42.89 ? 344 ARG A NH2   1 
ATOM   3568 N N     . MET B 2 344 ? -27.503 50.644 1.028   1.00 30.82 ? 345 MET A N     1 
ATOM   3569 C CA    . MET B 2 344 ? -28.626 50.058 0.300   1.00 31.17 ? 345 MET A CA    1 
ATOM   3570 C C     . MET B 2 344 ? -29.984 50.482 0.847   1.00 31.39 ? 345 MET A C     1 
ATOM   3571 O O     . MET B 2 344 ? -30.285 50.277 2.021   1.00 31.57 ? 345 MET A O     1 
ATOM   3572 C CB    . MET B 2 344 ? -28.522 48.526 0.318   1.00 31.35 ? 345 MET A CB    1 
ATOM   3573 C CG    . MET B 2 344 ? -29.567 47.815 -0.544  1.00 32.55 ? 345 MET A CG    1 
ATOM   3574 S SD    . MET B 2 344 ? -29.407 46.004 -0.670  1.00 34.01 ? 345 MET A SD    1 
ATOM   3575 C CE    . MET B 2 344 ? -30.665 45.475 0.459   1.00 34.44 ? 345 MET A CE    1 
ATOM   3576 N N     . GLY B 2 345 ? -30.802 51.070 -0.022  1.00 30.95 ? 346 GLY A N     1 
ATOM   3577 C CA    . GLY B 2 345 ? -32.124 51.520 0.373   1.00 30.66 ? 346 GLY A CA    1 
ATOM   3578 C C     . GLY B 2 345 ? -33.231 50.610 -0.127  1.00 30.43 ? 346 GLY A C     1 
ATOM   3579 O O     . GLY B 2 345 ? -32.957 49.604 -0.781  1.00 30.99 ? 346 GLY A O     1 
ATOM   3580 N N     . PRO B 2 346 ? -34.500 50.941 0.157   1.00 29.56 ? 347 PRO A N     1 
ATOM   3581 C CA    . PRO B 2 346 ? -35.662 50.146 -0.266  1.00 29.59 ? 347 PRO A CA    1 
ATOM   3582 C C     . PRO B 2 346 ? -35.859 50.035 -1.784  1.00 29.87 ? 347 PRO A C     1 
ATOM   3583 O O     . PRO B 2 346 ? -35.193 50.720 -2.558  1.00 30.88 ? 347 PRO A O     1 
ATOM   3584 C CB    . PRO B 2 346 ? -36.823 50.867 0.409   1.00 29.67 ? 347 PRO A CB    1 
ATOM   3585 C CG    . PRO B 2 346 ? -36.355 52.295 0.447   1.00 28.38 ? 347 PRO A CG    1 
ATOM   3586 C CD    . PRO B 2 346 ? -34.927 52.157 0.874   1.00 28.08 ? 347 PRO A CD    1 
ATOM   3587 N N     . GLN B 2 347 ? -36.765 49.161 -2.210  1.00 29.85 ? 348 GLN A N     1 
ATOM   3588 C CA    . GLN B 2 347 ? -37.043 49.016 -3.632  1.00 30.50 ? 348 GLN A CA    1 
ATOM   3589 C C     . GLN B 2 347 ? -37.909 50.201 -4.069  1.00 30.85 ? 348 GLN A C     1 
ATOM   3590 O O     . GLN B 2 347 ? -38.625 50.778 -3.252  1.00 31.53 ? 348 GLN A O     1 
ATOM   3591 C CB    . GLN B 2 347 ? -37.747 47.693 -3.897  1.00 30.71 ? 348 GLN A CB    1 
ATOM   3592 C CG    . GLN B 2 347 ? -36.896 46.503 -3.526  1.00 31.48 ? 348 GLN A CG    1 
ATOM   3593 C CD    . GLN B 2 347 ? -37.266 45.260 -4.297  1.00 32.90 ? 348 GLN A CD    1 
ATOM   3594 O OE1   . GLN B 2 347 ? -38.375 44.745 -4.177  1.00 32.74 ? 348 GLN A OE1   1 
ATOM   3595 N NE2   . GLN B 2 347 ? -36.334 44.773 -5.103  1.00 36.14 ? 348 GLN A NE2   1 
ATOM   3596 N N     . PHE B 2 348 ? -37.855 50.572 -5.345  1.00 30.71 ? 349 PHE A N     1 
ATOM   3597 C CA    . PHE B 2 348 ? -38.605 51.738 -5.807  1.00 30.35 ? 349 PHE A CA    1 
ATOM   3598 C C     . PHE B 2 348 ? -40.108 51.754 -5.545  1.00 31.50 ? 349 PHE A C     1 
ATOM   3599 O O     . PHE B 2 348 ? -40.677 52.823 -5.340  1.00 30.65 ? 349 PHE A O     1 
ATOM   3600 C CB    . PHE B 2 348 ? -38.321 52.003 -7.298  1.00 29.12 ? 349 PHE A CB    1 
ATOM   3601 C CG    . PHE B 2 348 ? -39.069 51.107 -8.248  1.00 28.19 ? 349 PHE A CG    1 
ATOM   3602 C CD1   . PHE B 2 348 ? -40.337 51.454 -8.699  1.00 27.11 ? 349 PHE A CD1   1 
ATOM   3603 C CD2   . PHE B 2 348 ? -38.497 49.922 -8.707  1.00 28.85 ? 349 PHE A CD2   1 
ATOM   3604 C CE1   . PHE B 2 348 ? -41.020 50.642 -9.592  1.00 26.94 ? 349 PHE A CE1   1 
ATOM   3605 C CE2   . PHE B 2 348 ? -39.174 49.100 -9.601  1.00 28.07 ? 349 PHE A CE2   1 
ATOM   3606 C CZ    . PHE B 2 348 ? -40.437 49.461 -10.044 1.00 27.87 ? 349 PHE A CZ    1 
ATOM   3607 N N     . GLU B 2 349 ? -40.761 50.597 -5.527  1.00 32.72 ? 350 GLU A N     1 
ATOM   3608 C CA    . GLU B 2 349 ? -42.200 50.602 -5.304  1.00 34.88 ? 350 GLU A CA    1 
ATOM   3609 C C     . GLU B 2 349 ? -42.684 50.659 -3.858  1.00 36.02 ? 350 GLU A C     1 
ATOM   3610 O O     . GLU B 2 349 ? -43.874 50.799 -3.601  1.00 36.86 ? 350 GLU A O     1 
ATOM   3611 C CB    . GLU B 2 349 ? -42.871 49.433 -6.038  1.00 34.46 ? 350 GLU A CB    1 
ATOM   3612 C CG    . GLU B 2 349 ? -42.205 48.090 -5.921  1.00 36.05 ? 350 GLU A CG    1 
ATOM   3613 C CD    . GLU B 2 349 ? -41.122 47.887 -6.951  1.00 37.41 ? 350 GLU A CD    1 
ATOM   3614 O OE1   . GLU B 2 349 ? -40.006 48.395 -6.732  1.00 39.87 ? 350 GLU A OE1   1 
ATOM   3615 O OE2   . GLU B 2 349 ? -41.385 47.226 -7.987  1.00 37.30 ? 350 GLU A OE2   1 
ATOM   3616 N N     . ASP B 2 350 ? -41.769 50.574 -2.907  1.00 38.11 ? 351 ASP A N     1 
ATOM   3617 C CA    . ASP B 2 350 ? -42.158 50.635 -1.503  1.00 39.79 ? 351 ASP A CA    1 
ATOM   3618 C C     . ASP B 2 350 ? -42.232 52.104 -1.064  1.00 40.26 ? 351 ASP A C     1 
ATOM   3619 O O     . ASP B 2 350 ? -41.419 52.578 -0.270  1.00 40.20 ? 351 ASP A O     1 
ATOM   3620 C CB    . ASP B 2 350 ? -41.147 49.853 -0.655  1.00 41.20 ? 351 ASP A CB    1 
ATOM   3621 C CG    . ASP B 2 350 ? -41.643 49.587 0.756   1.00 43.29 ? 351 ASP A CG    1 
ATOM   3622 O OD1   . ASP B 2 350 ? -41.023 48.741 1.441   1.00 43.77 ? 351 ASP A OD1   1 
ATOM   3623 O OD2   . ASP B 2 350 ? -42.645 50.217 1.180   1.00 44.83 ? 351 ASP A OD2   1 
ATOM   3624 N N     . GLU B 2 351 ? -43.223 52.813 -1.594  1.00 40.42 ? 352 GLU A N     1 
ATOM   3625 C CA    . GLU B 2 351 ? -43.427 54.231 -1.304  1.00 40.99 ? 352 GLU A CA    1 
ATOM   3626 C C     . GLU B 2 351 ? -43.183 54.654 0.144   1.00 40.61 ? 352 GLU A C     1 
ATOM   3627 O O     . GLU B 2 351 ? -42.604 55.712 0.399   1.00 40.20 ? 352 GLU A O     1 
ATOM   3628 C CB    . GLU B 2 351 ? -44.843 54.638 -1.727  1.00 43.61 ? 352 GLU A CB    1 
ATOM   3629 C CG    . GLU B 2 351 ? -45.215 56.102 -1.479  1.00 46.41 ? 352 GLU A CG    1 
ATOM   3630 C CD    . GLU B 2 351 ? -46.663 56.407 -1.872  1.00 48.19 ? 352 GLU A CD    1 
ATOM   3631 O OE1   . GLU B 2 351 ? -46.914 56.843 -3.026  1.00 46.44 ? 352 GLU A OE1   1 
ATOM   3632 O OE2   . GLU B 2 351 ? -47.554 56.187 -1.017  1.00 49.58 ? 352 GLU A OE2   1 
ATOM   3633 N N     . ARG B 2 352 ? -43.621 53.837 1.094   1.00 41.16 ? 353 ARG A N     1 
ATOM   3634 C CA    . ARG B 2 352 ? -43.446 54.174 2.502   1.00 42.23 ? 353 ARG A CA    1 
ATOM   3635 C C     . ARG B 2 352 ? -41.972 54.320 2.887   1.00 41.68 ? 353 ARG A C     1 
ATOM   3636 O O     . ARG B 2 352 ? -41.500 55.415 3.217   1.00 40.71 ? 353 ARG A O     1 
ATOM   3637 C CB    . ARG B 2 352 ? -44.111 53.112 3.385   1.00 44.61 ? 353 ARG A CB    1 
ATOM   3638 C CG    . ARG B 2 352 ? -44.047 53.417 4.891   1.00 47.91 ? 353 ARG A CG    1 
ATOM   3639 C CD    . ARG B 2 352 ? -45.425 53.722 5.472   1.00 50.21 ? 353 ARG A CD    1 
ATOM   3640 N NE    . ARG B 2 352 ? -46.140 54.723 4.681   1.00 52.22 ? 353 ARG A NE    1 
ATOM   3641 C CZ    . ARG B 2 352 ? -47.370 55.154 4.948   1.00 53.60 ? 353 ARG A CZ    1 
ATOM   3642 N NH1   . ARG B 2 352 ? -48.028 54.671 5.998   1.00 54.45 ? 353 ARG A NH1   1 
ATOM   3643 N NH2   . ARG B 2 352 ? -47.946 56.058 4.157   1.00 53.85 ? 353 ARG A NH2   1 
ATOM   3644 N N     . ASN B 2 353 ? -41.246 53.209 2.839   1.00 41.44 ? 354 ASN A N     1 
ATOM   3645 C CA    . ASN B 2 353 ? -39.837 53.209 3.195   1.00 41.57 ? 354 ASN A CA    1 
ATOM   3646 C C     . ASN B 2 353 ? -39.006 54.111 2.308   1.00 40.80 ? 354 ASN A C     1 
ATOM   3647 O O     . ASN B 2 353 ? -38.070 54.754 2.774   1.00 41.30 ? 354 ASN A O     1 
ATOM   3648 C CB    . ASN B 2 353 ? -39.308 51.787 3.152   1.00 41.85 ? 354 ASN A CB    1 
ATOM   3649 C CG    . ASN B 2 353 ? -40.052 50.888 4.097   1.00 43.20 ? 354 ASN A CG    1 
ATOM   3650 O OD1   . ASN B 2 353 ? -39.915 50.991 5.321   1.00 42.95 ? 354 ASN A OD1   1 
ATOM   3651 N ND2   . ASN B 2 353 ? -40.877 50.015 3.540   1.00 44.79 ? 354 ASN A ND2   1 
ATOM   3652 N N     . VAL B 2 354 ? -39.344 54.162 1.028   1.00 39.90 ? 355 VAL A N     1 
ATOM   3653 C CA    . VAL B 2 354 ? -38.614 55.020 0.111   1.00 39.06 ? 355 VAL A CA    1 
ATOM   3654 C C     . VAL B 2 354 ? -38.632 56.441 0.666   1.00 39.63 ? 355 VAL A C     1 
ATOM   3655 O O     . VAL B 2 354 ? -37.584 57.069 0.827   1.00 38.48 ? 355 VAL A O     1 
ATOM   3656 C CB    . VAL B 2 354 ? -39.250 55.010 -1.291  1.00 37.10 ? 355 VAL A CB    1 
ATOM   3657 C CG1   . VAL B 2 354 ? -38.623 56.082 -2.159  1.00 35.88 ? 355 VAL A CG1   1 
ATOM   3658 C CG2   . VAL B 2 354 ? -39.063 53.648 -1.922  1.00 35.54 ? 355 VAL A CG2   1 
ATOM   3659 N N     . LYS B 2 355 ? -39.824 56.937 0.981   1.00 41.13 ? 356 LYS A N     1 
ATOM   3660 C CA    . LYS B 2 355 ? -39.929 58.281 1.513   1.00 42.76 ? 356 LYS A CA    1 
ATOM   3661 C C     . LYS B 2 355 ? -38.999 58.419 2.714   1.00 42.42 ? 356 LYS A C     1 
ATOM   3662 O O     . LYS B 2 355 ? -38.175 59.332 2.756   1.00 43.55 ? 356 LYS A O     1 
ATOM   3663 C CB    . LYS B 2 355 ? -41.374 58.613 1.915   1.00 44.55 ? 356 LYS A CB    1 
ATOM   3664 C CG    . LYS B 2 355 ? -41.604 60.115 2.171   1.00 47.73 ? 356 LYS A CG    1 
ATOM   3665 C CD    . LYS B 2 355 ? -43.045 60.441 2.576   1.00 50.88 ? 356 LYS A CD    1 
ATOM   3666 C CE    . LYS B 2 355 ? -43.225 61.944 2.879   1.00 52.56 ? 356 LYS A CE    1 
ATOM   3667 N NZ    . LYS B 2 355 ? -44.561 62.279 3.507   1.00 53.56 ? 356 LYS A NZ    1 
ATOM   3668 N N     . LYS B 2 356 ? -39.110 57.515 3.682   1.00 41.75 ? 357 LYS A N     1 
ATOM   3669 C CA    . LYS B 2 356 ? -38.248 57.594 4.852   1.00 41.58 ? 357 LYS A CA    1 
ATOM   3670 C C     . LYS B 2 356 ? -36.773 57.663 4.443   1.00 40.92 ? 357 LYS A C     1 
ATOM   3671 O O     . LYS B 2 356 ? -36.065 58.609 4.799   1.00 40.96 ? 357 LYS A O     1 
ATOM   3672 C CB    . LYS B 2 356 ? -38.493 56.400 5.773   1.00 42.97 ? 357 LYS A CB    1 
ATOM   3673 C CG    . LYS B 2 356 ? -39.920 56.341 6.304   1.00 45.30 ? 357 LYS A CG    1 
ATOM   3674 C CD    . LYS B 2 356 ? -40.096 55.262 7.365   1.00 47.30 ? 357 LYS A CD    1 
ATOM   3675 C CE    . LYS B 2 356 ? -39.260 55.560 8.597   1.00 48.80 ? 357 LYS A CE    1 
ATOM   3676 N NZ    . LYS B 2 356 ? -39.454 54.535 9.666   1.00 50.14 ? 357 LYS A NZ    1 
ATOM   3677 N N     . PHE B 2 357 ? -36.314 56.674 3.682   1.00 39.70 ? 358 PHE A N     1 
ATOM   3678 C CA    . PHE B 2 357 ? -34.925 56.643 3.226   1.00 37.87 ? 358 PHE A CA    1 
ATOM   3679 C C     . PHE B 2 357 ? -34.526 57.985 2.621   1.00 37.80 ? 358 PHE A C     1 
ATOM   3680 O O     . PHE B 2 357 ? -33.428 58.478 2.852   1.00 37.51 ? 358 PHE A O     1 
ATOM   3681 C CB    . PHE B 2 357 ? -34.732 55.548 2.179   1.00 35.85 ? 358 PHE A CB    1 
ATOM   3682 C CG    . PHE B 2 357 ? -33.290 55.273 1.838   1.00 33.64 ? 358 PHE A CG    1 
ATOM   3683 C CD1   . PHE B 2 357 ? -32.438 54.693 2.767   1.00 31.26 ? 358 PHE A CD1   1 
ATOM   3684 C CD2   . PHE B 2 357 ? -32.797 55.537 0.562   1.00 32.49 ? 358 PHE A CD2   1 
ATOM   3685 C CE1   . PHE B 2 357 ? -31.124 54.377 2.429   1.00 29.50 ? 358 PHE A CE1   1 
ATOM   3686 C CE2   . PHE B 2 357 ? -31.481 55.222 0.218   1.00 30.07 ? 358 PHE A CE2   1 
ATOM   3687 C CZ    . PHE B 2 357 ? -30.649 54.639 1.153   1.00 29.90 ? 358 PHE A CZ    1 
ATOM   3688 N N     . LEU B 2 358 ? -35.420 58.579 1.844   1.00 37.98 ? 359 LEU A N     1 
ATOM   3689 C CA    . LEU B 2 358 ? -35.111 59.854 1.224   1.00 39.05 ? 359 LEU A CA    1 
ATOM   3690 C C     . LEU B 2 358 ? -35.251 61.024 2.188   1.00 40.98 ? 359 LEU A C     1 
ATOM   3691 O O     . LEU B 2 358 ? -34.779 62.124 1.887   1.00 41.43 ? 359 LEU A O     1 
ATOM   3692 C CB    . LEU B 2 358 ? -36.003 60.082 -0.004  1.00 37.01 ? 359 LEU A CB    1 
ATOM   3693 C CG    . LEU B 2 358 ? -35.807 59.131 -1.196  1.00 36.53 ? 359 LEU A CG    1 
ATOM   3694 C CD1   . LEU B 2 358 ? -36.642 59.602 -2.375  1.00 35.83 ? 359 LEU A CD1   1 
ATOM   3695 C CD2   . LEU B 2 358 ? -34.347 59.082 -1.601  1.00 34.10 ? 359 LEU A CD2   1 
ATOM   3696 N N     . SER B 2 359 ? -35.868 60.789 3.352   1.00 43.04 ? 360 SER A N     1 
ATOM   3697 C CA    . SER B 2 359 ? -36.086 61.859 4.333   1.00 44.64 ? 360 SER A CA    1 
ATOM   3698 C C     . SER B 2 359 ? -34.842 62.271 5.119   1.00 45.54 ? 360 SER A C     1 
ATOM   3699 O O     . SER B 2 359 ? -34.846 63.291 5.809   1.00 45.80 ? 360 SER A O     1 
ATOM   3700 C CB    . SER B 2 359 ? -37.207 61.478 5.308   1.00 44.43 ? 360 SER A CB    1 
ATOM   3701 O OG    . SER B 2 359 ? -36.759 60.561 6.290   1.00 46.89 ? 360 SER A OG    1 
ATOM   3702 N N     . ARG B 2 360 ? -33.786 61.472 5.020   1.00 47.09 ? 361 ARG A N     1 
ATOM   3703 C CA    . ARG B 2 360 ? -32.523 61.763 5.696   1.00 48.64 ? 361 ARG A CA    1 
ATOM   3704 C C     . ARG B 2 360 ? -31.779 62.838 4.924   1.00 49.10 ? 361 ARG A C     1 
ATOM   3705 O O     . ARG B 2 360 ? -31.758 62.829 3.686   1.00 50.71 ? 361 ARG A O     1 
ATOM   3706 C CB    . ARG B 2 360 ? -31.649 60.520 5.744   1.00 49.94 ? 361 ARG A CB    1 
ATOM   3707 C CG    . ARG B 2 360 ? -32.030 59.548 6.805   1.00 52.73 ? 361 ARG A CG    1 
ATOM   3708 C CD    . ARG B 2 360 ? -31.549 60.033 8.148   1.00 55.29 ? 361 ARG A CD    1 
ATOM   3709 N NE    . ARG B 2 360 ? -31.088 58.900 8.939   1.00 58.06 ? 361 ARG A NE    1 
ATOM   3710 C CZ    . ARG B 2 360 ? -30.391 59.008 10.060  1.00 58.95 ? 361 ARG A CZ    1 
ATOM   3711 N NH1   . ARG B 2 360 ? -30.073 60.210 10.526  1.00 60.07 ? 361 ARG A NH1   1 
ATOM   3712 N NH2   . ARG B 2 360 ? -30.001 57.917 10.701  1.00 58.32 ? 361 ARG A NH2   1 
ATOM   3713 N N     . ASN B 2 361 ? -31.154 63.759 5.643   1.00 48.68 ? 362 ASN A N     1 
ATOM   3714 C CA    . ASN B 2 361 ? -30.431 64.817 4.971   1.00 48.60 ? 362 ASN A CA    1 
ATOM   3715 C C     . ASN B 2 361 ? -28.978 64.415 4.797   1.00 46.76 ? 362 ASN A C     1 
ATOM   3716 O O     . ASN B 2 361 ? -28.157 64.604 5.683   1.00 46.88 ? 362 ASN A O     1 
ATOM   3717 C CB    . ASN B 2 361 ? -30.557 66.133 5.752   1.00 51.61 ? 362 ASN A CB    1 
ATOM   3718 C CG    . ASN B 2 361 ? -29.876 66.086 7.111   1.00 54.56 ? 362 ASN A CG    1 
ATOM   3719 O OD1   . ASN B 2 361 ? -30.256 65.300 7.991   1.00 56.78 ? 362 ASN A OD1   1 
ATOM   3720 N ND2   . ASN B 2 361 ? -28.859 66.935 7.292   1.00 55.62 ? 362 ASN A ND2   1 
ATOM   3721 N N     . ARG B 2 362 ? -28.667 63.834 3.648   1.00 44.72 ? 363 ARG A N     1 
ATOM   3722 C CA    . ARG B 2 362 ? -27.303 63.425 3.370   1.00 42.48 ? 363 ARG A CA    1 
ATOM   3723 C C     . ARG B 2 362 ? -26.647 64.497 2.506   1.00 41.88 ? 363 ARG A C     1 
ATOM   3724 O O     . ARG B 2 362 ? -27.301 65.458 2.079   1.00 41.93 ? 363 ARG A O     1 
ATOM   3725 C CB    . ARG B 2 362 ? -27.295 62.082 2.650   1.00 42.96 ? 363 ARG A CB    1 
ATOM   3726 C CG    . ARG B 2 362 ? -28.152 61.019 3.312   1.00 42.54 ? 363 ARG A CG    1 
ATOM   3727 C CD    . ARG B 2 362 ? -28.069 59.715 2.542   1.00 43.17 ? 363 ARG A CD    1 
ATOM   3728 N NE    . ARG B 2 362 ? -29.348 59.016 2.494   1.00 44.32 ? 363 ARG A NE    1 
ATOM   3729 C CZ    . ARG B 2 362 ? -29.863 58.313 3.494   1.00 45.01 ? 363 ARG A CZ    1 
ATOM   3730 N NH1   . ARG B 2 362 ? -29.207 58.201 4.641   1.00 46.25 ? 363 ARG A NH1   1 
ATOM   3731 N NH2   . ARG B 2 362 ? -31.041 57.722 3.347   1.00 45.24 ? 363 ARG A NH2   1 
ATOM   3732 N N     . ALA B 2 363 ? -25.358 64.325 2.237   1.00 40.75 ? 364 ALA A N     1 
ATOM   3733 C CA    . ALA B 2 363 ? -24.617 65.299 1.454   1.00 39.78 ? 364 ALA A CA    1 
ATOM   3734 C C     . ALA B 2 363 ? -24.579 65.032 -0.037  1.00 40.32 ? 364 ALA A C     1 
ATOM   3735 O O     . ALA B 2 363 ? -24.301 65.945 -0.809  1.00 40.83 ? 364 ALA A O     1 
ATOM   3736 C CB    . ALA B 2 363 ? -23.200 65.393 1.974   1.00 38.59 ? 364 ALA A CB    1 
ATOM   3737 N N     . PHE B 2 364 ? -24.873 63.807 -0.464  1.00 40.25 ? 365 PHE A N     1 
ATOM   3738 C CA    . PHE B 2 364 ? -24.772 63.518 -1.883  1.00 39.59 ? 365 PHE A CA    1 
ATOM   3739 C C     . PHE B 2 364 ? -25.965 63.136 -2.744  1.00 40.66 ? 365 PHE A C     1 
ATOM   3740 O O     . PHE B 2 364 ? -25.769 62.729 -3.889  1.00 43.10 ? 365 PHE A O     1 
ATOM   3741 C CB    . PHE B 2 364 ? -23.670 62.491 -2.113  1.00 38.55 ? 365 PHE A CB    1 
ATOM   3742 C CG    . PHE B 2 364 ? -22.289 63.060 -2.037  1.00 36.51 ? 365 PHE A CG    1 
ATOM   3743 C CD1   . PHE B 2 364 ? -21.448 62.747 -0.976  1.00 36.26 ? 365 PHE A CD1   1 
ATOM   3744 C CD2   . PHE B 2 364 ? -21.827 63.908 -3.023  1.00 35.37 ? 365 PHE A CD2   1 
ATOM   3745 C CE1   . PHE B 2 364 ? -20.166 63.266 -0.906  1.00 34.65 ? 365 PHE A CE1   1 
ATOM   3746 C CE2   . PHE B 2 364 ? -20.546 64.431 -2.958  1.00 35.21 ? 365 PHE A CE2   1 
ATOM   3747 C CZ    . PHE B 2 364 ? -19.715 64.111 -1.895  1.00 34.20 ? 365 PHE A CZ    1 
ATOM   3748 N N     . ARG B 2 365 ? -27.190 63.239 -2.248  1.00 40.20 ? 366 ARG A N     1 
ATOM   3749 C CA    . ARG B 2 365 ? -28.328 62.920 -3.121  1.00 40.01 ? 366 ARG A CA    1 
ATOM   3750 C C     . ARG B 2 365 ? -28.342 61.469 -3.625  1.00 38.01 ? 366 ARG A C     1 
ATOM   3751 O O     . ARG B 2 365 ? -27.632 61.119 -4.571  1.00 37.08 ? 366 ARG A O     1 
ATOM   3752 C CB    . ARG B 2 365 ? -28.318 63.878 -4.322  1.00 40.57 ? 366 ARG A CB    1 
ATOM   3753 C CG    . ARG B 2 365 ? -29.443 63.676 -5.297  1.00 45.24 ? 366 ARG A CG    1 
ATOM   3754 C CD    . ARG B 2 365 ? -29.214 64.471 -6.571  1.00 50.82 ? 366 ARG A CD    1 
ATOM   3755 N NE    . ARG B 2 365 ? -29.093 65.912 -6.336  1.00 55.88 ? 366 ARG A NE    1 
ATOM   3756 C CZ    . ARG B 2 365 ? -30.105 66.720 -6.007  1.00 58.35 ? 366 ARG A CZ    1 
ATOM   3757 N NH1   . ARG B 2 365 ? -31.343 66.231 -5.867  1.00 59.69 ? 366 ARG A NH1   1 
ATOM   3758 N NH2   . ARG B 2 365 ? -29.884 68.025 -5.828  1.00 57.56 ? 366 ARG A NH2   1 
ATOM   3759 N N     . PRO B 2 366 ? -29.177 60.613 -3.007  1.00 37.39 ? 367 PRO A N     1 
ATOM   3760 C CA    . PRO B 2 366 ? -29.308 59.194 -3.365  1.00 36.66 ? 367 PRO A CA    1 
ATOM   3761 C C     . PRO B 2 366 ? -29.745 58.953 -4.808  1.00 36.12 ? 367 PRO A C     1 
ATOM   3762 O O     . PRO B 2 366 ? -30.250 59.860 -5.472  1.00 36.93 ? 367 PRO A O     1 
ATOM   3763 C CB    . PRO B 2 366 ? -30.320 58.672 -2.343  1.00 36.45 ? 367 PRO A CB    1 
ATOM   3764 C CG    . PRO B 2 366 ? -31.153 59.875 -2.053  1.00 36.88 ? 367 PRO A CG    1 
ATOM   3765 C CD    . PRO B 2 366 ? -30.126 60.968 -1.935  1.00 37.41 ? 367 PRO A CD    1 
ATOM   3766 N N     . PHE B 2 367 ? -29.549 57.722 -5.280  1.00 34.33 ? 368 PHE A N     1 
ATOM   3767 C CA    . PHE B 2 367 ? -29.892 57.350 -6.648  1.00 32.00 ? 368 PHE A CA    1 
ATOM   3768 C C     . PHE B 2 367 ? -30.528 55.970 -6.720  1.00 31.67 ? 368 PHE A C     1 
ATOM   3769 O O     . PHE B 2 367 ? -30.496 55.216 -5.749  1.00 32.19 ? 368 PHE A O     1 
ATOM   3770 C CB    . PHE B 2 367 ? -28.635 57.358 -7.525  1.00 30.84 ? 368 PHE A CB    1 
ATOM   3771 C CG    . PHE B 2 367 ? -27.552 56.449 -7.027  1.00 27.54 ? 368 PHE A CG    1 
ATOM   3772 C CD1   . PHE B 2 367 ? -26.762 56.813 -5.946  1.00 28.05 ? 368 PHE A CD1   1 
ATOM   3773 C CD2   . PHE B 2 367 ? -27.361 55.208 -7.594  1.00 25.28 ? 368 PHE A CD2   1 
ATOM   3774 C CE1   . PHE B 2 367 ? -25.816 55.946 -5.434  1.00 26.51 ? 368 PHE A CE1   1 
ATOM   3775 C CE2   . PHE B 2 367 ? -26.420 54.344 -7.085  1.00 24.40 ? 368 PHE A CE2   1 
ATOM   3776 C CZ    . PHE B 2 367 ? -25.647 54.714 -6.006  1.00 24.83 ? 368 PHE A CZ    1 
ATOM   3777 N N     . ILE B 2 368 ? -31.090 55.661 -7.891  1.00 30.71 ? 369 ILE A N     1 
ATOM   3778 C CA    . ILE B 2 368 ? -31.747 54.385 -8.189  1.00 28.66 ? 369 ILE A CA    1 
ATOM   3779 C C     . ILE B 2 368 ? -30.848 53.496 -9.038  1.00 28.88 ? 369 ILE A C     1 
ATOM   3780 O O     . ILE B 2 368 ? -30.301 53.935 -10.046 1.00 29.16 ? 369 ILE A O     1 
ATOM   3781 C CB    . ILE B 2 368 ? -33.046 54.592 -8.995  1.00 27.39 ? 369 ILE A CB    1 
ATOM   3782 C CG1   . ILE B 2 368 ? -34.109 55.241 -8.121  1.00 27.31 ? 369 ILE A CG1   1 
ATOM   3783 C CG2   . ILE B 2 368 ? -33.550 53.268 -9.532  1.00 26.25 ? 369 ILE A CG2   1 
ATOM   3784 C CD1   . ILE B 2 368 ? -35.400 55.487 -8.850  1.00 27.35 ? 369 ILE A CD1   1 
ATOM   3785 N N     . GLU B 2 369 ? -30.716 52.241 -8.634  1.00 29.99 ? 370 GLU A N     1 
ATOM   3786 C CA    . GLU B 2 369 ? -29.903 51.292 -9.373  1.00 32.20 ? 370 GLU A CA    1 
ATOM   3787 C C     . GLU B 2 369 ? -30.545 49.916 -9.335  1.00 33.31 ? 370 GLU A C     1 
ATOM   3788 O O     . GLU B 2 369 ? -30.797 49.362 -8.266  1.00 34.00 ? 370 GLU A O     1 
ATOM   3789 C CB    . GLU B 2 369 ? -28.505 51.226 -8.780  1.00 33.34 ? 370 GLU A CB    1 
ATOM   3790 C CG    . GLU B 2 369 ? -27.586 50.247 -9.476  1.00 33.33 ? 370 GLU A CG    1 
ATOM   3791 C CD    . GLU B 2 369 ? -26.182 50.279 -8.907  1.00 34.35 ? 370 GLU A CD    1 
ATOM   3792 O OE1   . GLU B 2 369 ? -25.422 51.219 -9.236  1.00 34.02 ? 370 GLU A OE1   1 
ATOM   3793 O OE2   . GLU B 2 369 ? -25.848 49.365 -8.123  1.00 33.10 ? 370 GLU A OE2   1 
ATOM   3794 N N     . ASN B 2 370 ? -30.820 49.376 -10.512 1.00 34.20 ? 371 ASN A N     1 
ATOM   3795 C CA    . ASN B 2 370 ? -31.440 48.069 -10.630 1.00 35.66 ? 371 ASN A CA    1 
ATOM   3796 C C     . ASN B 2 370 ? -32.627 47.871 -9.702  1.00 36.59 ? 371 ASN A C     1 
ATOM   3797 O O     . ASN B 2 370 ? -32.628 46.985 -8.845  1.00 37.82 ? 371 ASN A O     1 
ATOM   3798 C CB    . ASN B 2 370 ? -30.398 46.978 -10.398 1.00 36.52 ? 371 ASN A CB    1 
ATOM   3799 C CG    . ASN B 2 370 ? -29.281 47.037 -11.419 1.00 39.63 ? 371 ASN A CG    1 
ATOM   3800 O OD1   . ASN B 2 370 ? -29.536 46.974 -12.626 1.00 41.25 ? 371 ASN A OD1   1 
ATOM   3801 N ND2   . ASN B 2 370 ? -28.036 47.168 -10.949 1.00 40.49 ? 371 ASN A ND2   1 
ATOM   3802 N N     . GLY B 2 371 ? -33.636 48.717 -9.870  1.00 36.75 ? 372 GLY A N     1 
ATOM   3803 C CA    . GLY B 2 371 ? -34.838 48.589 -9.076  1.00 37.51 ? 372 GLY A CA    1 
ATOM   3804 C C     . GLY B 2 371 ? -34.878 49.162 -7.675  1.00 37.95 ? 372 GLY A C     1 
ATOM   3805 O O     . GLY B 2 371 ? -35.970 49.461 -7.187  1.00 38.71 ? 372 GLY A O     1 
ATOM   3806 N N     . ARG B 2 372 ? -33.741 49.297 -6.998  1.00 36.87 ? 373 ARG A N     1 
ATOM   3807 C CA    . ARG B 2 372 ? -33.797 49.864 -5.657  1.00 36.30 ? 373 ARG A CA    1 
ATOM   3808 C C     . ARG B 2 372 ? -32.975 51.121 -5.456  1.00 36.09 ? 373 ARG A C     1 
ATOM   3809 O O     . ARG B 2 372 ? -32.090 51.440 -6.249  1.00 37.12 ? 373 ARG A O     1 
ATOM   3810 C CB    . ARG B 2 372 ? -33.453 48.814 -4.595  1.00 36.68 ? 373 ARG A CB    1 
ATOM   3811 C CG    . ARG B 2 372 ? -32.114 48.125 -4.704  1.00 38.49 ? 373 ARG A CG    1 
ATOM   3812 C CD    . ARG B 2 372 ? -32.195 46.775 -3.962  1.00 39.77 ? 373 ARG A CD    1 
ATOM   3813 N NE    . ARG B 2 372 ? -32.776 46.914 -2.619  1.00 39.50 ? 373 ARG A NE    1 
ATOM   3814 C CZ    . ARG B 2 372 ? -33.458 45.962 -1.984  1.00 39.12 ? 373 ARG A CZ    1 
ATOM   3815 N NH1   . ARG B 2 372 ? -33.660 44.788 -2.561  1.00 37.89 ? 373 ARG A NH1   1 
ATOM   3816 N NH2   . ARG B 2 372 ? -33.934 46.185 -0.766  1.00 39.65 ? 373 ARG A NH2   1 
ATOM   3817 N N     . TRP B 2 373 ? -33.308 51.850 -4.397  1.00 35.06 ? 374 TRP A N     1 
ATOM   3818 C CA    . TRP B 2 373 ? -32.633 53.094 -4.058  1.00 33.28 ? 374 TRP A CA    1 
ATOM   3819 C C     . TRP B 2 373 ? -31.310 52.900 -3.332  1.00 32.62 ? 374 TRP A C     1 
ATOM   3820 O O     . TRP B 2 373 ? -31.125 51.942 -2.584  1.00 33.02 ? 374 TRP A O     1 
ATOM   3821 C CB    . TRP B 2 373 ? -33.540 53.965 -3.190  1.00 32.85 ? 374 TRP A CB    1 
ATOM   3822 C CG    . TRP B 2 373 ? -34.586 54.698 -3.949  1.00 31.96 ? 374 TRP A CG    1 
ATOM   3823 C CD1   . TRP B 2 373 ? -35.855 54.284 -4.214  1.00 31.42 ? 374 TRP A CD1   1 
ATOM   3824 C CD2   . TRP B 2 373 ? -34.445 55.986 -4.555  1.00 31.08 ? 374 TRP A CD2   1 
ATOM   3825 N NE1   . TRP B 2 373 ? -36.521 55.240 -4.945  1.00 31.96 ? 374 TRP A NE1   1 
ATOM   3826 C CE2   . TRP B 2 373 ? -35.679 56.296 -5.162  1.00 30.85 ? 374 TRP A CE2   1 
ATOM   3827 C CE3   . TRP B 2 373 ? -33.396 56.911 -4.632  1.00 30.18 ? 374 TRP A CE3   1 
ATOM   3828 C CZ2   . TRP B 2 373 ? -35.889 57.491 -5.848  1.00 30.52 ? 374 TRP A CZ2   1 
ATOM   3829 C CZ3   . TRP B 2 373 ? -33.606 58.096 -5.313  1.00 29.81 ? 374 TRP A CZ3   1 
ATOM   3830 C CH2   . TRP B 2 373 ? -34.845 58.379 -5.907  1.00 30.38 ? 374 TRP A CH2   1 
ATOM   3831 N N     . TRP B 2 374 ? -30.389 53.826 -3.558  1.00 31.50 ? 375 TRP A N     1 
ATOM   3832 C CA    . TRP B 2 374 ? -29.095 53.772 -2.907  1.00 31.68 ? 375 TRP A CA    1 
ATOM   3833 C C     . TRP B 2 374 ? -28.681 55.164 -2.460  1.00 32.75 ? 375 TRP A C     1 
ATOM   3834 O O     . TRP B 2 374 ? -29.206 56.168 -2.955  1.00 33.00 ? 375 TRP A O     1 
ATOM   3835 C CB    . TRP B 2 374 ? -28.038 53.216 -3.851  1.00 29.79 ? 375 TRP A CB    1 
ATOM   3836 C CG    . TRP B 2 374 ? -28.307 51.831 -4.302  1.00 28.08 ? 375 TRP A CG    1 
ATOM   3837 C CD1   . TRP B 2 374 ? -29.211 51.435 -5.238  1.00 27.40 ? 375 TRP A CD1   1 
ATOM   3838 C CD2   . TRP B 2 374 ? -27.647 50.646 -3.854  1.00 27.20 ? 375 TRP A CD2   1 
ATOM   3839 N NE1   . TRP B 2 374 ? -29.159 50.075 -5.401  1.00 27.71 ? 375 TRP A NE1   1 
ATOM   3840 C CE2   . TRP B 2 374 ? -28.210 49.564 -4.553  1.00 27.41 ? 375 TRP A CE2   1 
ATOM   3841 C CE3   . TRP B 2 374 ? -26.646 50.393 -2.911  1.00 26.19 ? 375 TRP A CE3   1 
ATOM   3842 C CZ2   . TRP B 2 374 ? -27.789 48.250 -4.363  1.00 27.05 ? 375 TRP A CZ2   1 
ATOM   3843 C CZ3   . TRP B 2 374 ? -26.229 49.089 -2.721  1.00 25.56 ? 375 TRP A CZ3   1 
ATOM   3844 C CH2   . TRP B 2 374 ? -26.806 48.033 -3.435  1.00 25.82 ? 375 TRP A CH2   1 
ATOM   3845 N N     . ALA B 2 375 ? -27.730 55.213 -1.529  1.00 32.26 ? 376 ALA A N     1 
ATOM   3846 C CA    . ALA B 2 375 ? -27.235 56.474 -1.006  1.00 31.09 ? 376 ALA A CA    1 
ATOM   3847 C C     . ALA B 2 375 ? -25.735 56.441 -0.746  1.00 30.59 ? 376 ALA A C     1 
ATOM   3848 O O     . ALA B 2 375 ? -25.160 55.397 -0.451  1.00 29.70 ? 376 ALA A O     1 
ATOM   3849 C CB    . ALA B 2 375 ? -27.968 56.821 0.275   1.00 31.30 ? 376 ALA A CB    1 
ATOM   3850 N N     . PHE B 2 376 ? -25.107 57.600 -0.875  1.00 30.26 ? 377 PHE A N     1 
ATOM   3851 C CA    . PHE B 2 376 ? -23.687 57.728 -0.622  1.00 30.24 ? 377 PHE A CA    1 
ATOM   3852 C C     . PHE B 2 376 ? -23.603 58.293 0.777   1.00 31.98 ? 377 PHE A C     1 
ATOM   3853 O O     . PHE B 2 376 ? -24.155 59.362 1.052   1.00 32.74 ? 377 PHE A O     1 
ATOM   3854 C CB    . PHE B 2 376 ? -23.048 58.705 -1.599  1.00 29.44 ? 377 PHE A CB    1 
ATOM   3855 C CG    . PHE B 2 376 ? -22.793 58.130 -2.959  1.00 29.65 ? 377 PHE A CG    1 
ATOM   3856 C CD1   . PHE B 2 376 ? -23.255 58.780 -4.100  1.00 29.29 ? 377 PHE A CD1   1 
ATOM   3857 C CD2   . PHE B 2 376 ? -22.059 56.959 -3.105  1.00 29.34 ? 377 PHE A CD2   1 
ATOM   3858 C CE1   . PHE B 2 376 ? -22.992 58.274 -5.364  1.00 28.99 ? 377 PHE A CE1   1 
ATOM   3859 C CE2   . PHE B 2 376 ? -21.788 56.442 -4.365  1.00 30.25 ? 377 PHE A CE2   1 
ATOM   3860 C CZ    . PHE B 2 376 ? -22.256 57.104 -5.501  1.00 30.43 ? 377 PHE A CZ    1 
ATOM   3861 N N     . GLU B 2 377 ? -22.937 57.563 1.665   1.00 33.64 ? 378 GLU A N     1 
ATOM   3862 C CA    . GLU B 2 377 ? -22.776 57.989 3.050   1.00 34.46 ? 378 GLU A CA    1 
ATOM   3863 C C     . GLU B 2 377 ? -21.283 58.186 3.269   1.00 34.30 ? 378 GLU A C     1 
ATOM   3864 O O     . GLU B 2 377 ? -20.478 57.733 2.457   1.00 34.61 ? 378 GLU A O     1 
ATOM   3865 C CB    . GLU B 2 377 ? -23.306 56.912 4.006   1.00 36.78 ? 378 GLU A CB    1 
ATOM   3866 C CG    . GLU B 2 377 ? -24.409 57.372 4.972   1.00 39.77 ? 378 GLU A CG    1 
ATOM   3867 C CD    . GLU B 2 377 ? -25.796 57.357 4.347   1.00 41.78 ? 378 GLU A CD    1 
ATOM   3868 O OE1   . GLU B 2 377 ? -25.963 57.959 3.269   1.00 44.45 ? 378 GLU A OE1   1 
ATOM   3869 O OE2   . GLU B 2 377 ? -26.721 56.749 4.933   1.00 42.86 ? 378 GLU A OE2   1 
ATOM   3870 N N     . MET B 2 378 ? -20.919 58.867 4.354   1.00 34.22 ? 379 MET A N     1 
ATOM   3871 C CA    . MET B 2 378 ? -19.517 59.122 4.678   1.00 34.11 ? 379 MET A CA    1 
ATOM   3872 C C     . MET B 2 378 ? -19.115 58.235 5.845   1.00 33.97 ? 379 MET A C     1 
ATOM   3873 O O     . MET B 2 378 ? -19.932 57.949 6.711   1.00 34.92 ? 379 MET A O     1 
ATOM   3874 C CB    . MET B 2 378 ? -19.319 60.583 5.077   1.00 34.64 ? 379 MET A CB    1 
ATOM   3875 C CG    . MET B 2 378 ? -19.861 61.600 4.100   1.00 35.88 ? 379 MET A CG    1 
ATOM   3876 S SD    . MET B 2 378 ? -19.212 61.365 2.433   1.00 40.51 ? 379 MET A SD    1 
ATOM   3877 C CE    . MET B 2 378 ? -17.588 62.142 2.540   1.00 38.02 ? 379 MET A CE    1 
ATOM   3878 N N     . ARG B 2 379 ? -17.861 57.799 5.874   1.00 33.28 ? 380 ARG A N     1 
ATOM   3879 C CA    . ARG B 2 379 ? -17.382 56.950 6.962   1.00 32.11 ? 380 ARG A CA    1 
ATOM   3880 C C     . ARG B 2 379 ? -16.867 57.786 8.114   1.00 33.09 ? 380 ARG A C     1 
ATOM   3881 O O     . ARG B 2 379 ? -16.476 58.941 7.938   1.00 32.93 ? 380 ARG A O     1 
ATOM   3882 C CB    . ARG B 2 379 ? -16.249 56.031 6.500   1.00 30.00 ? 380 ARG A CB    1 
ATOM   3883 C CG    . ARG B 2 379 ? -16.673 54.874 5.629   1.00 28.23 ? 380 ARG A CG    1 
ATOM   3884 C CD    . ARG B 2 379 ? -15.488 53.970 5.362   1.00 27.86 ? 380 ARG A CD    1 
ATOM   3885 N NE    . ARG B 2 379 ? -15.867 52.763 4.636   1.00 28.39 ? 380 ARG A NE    1 
ATOM   3886 C CZ    . ARG B 2 379 ? -16.070 52.709 3.325   1.00 28.71 ? 380 ARG A CZ    1 
ATOM   3887 N NH1   . ARG B 2 379 ? -15.926 53.792 2.586   1.00 30.26 ? 380 ARG A NH1   1 
ATOM   3888 N NH2   . ARG B 2 379 ? -16.430 51.573 2.756   1.00 28.85 ? 380 ARG A NH2   1 
ATOM   3889 N N     . LYS B 2 380 ? -16.864 57.186 9.299   1.00 34.15 ? 381 LYS A N     1 
ATOM   3890 C CA    . LYS B 2 380 ? -16.381 57.866 10.487  1.00 34.21 ? 381 LYS A CA    1 
ATOM   3891 C C     . LYS B 2 380 ? -14.851 57.831 10.537  1.00 33.49 ? 381 LYS A C     1 
ATOM   3892 O O     . LYS B 2 380 ? -14.225 58.731 11.096  1.00 33.90 ? 381 LYS A O     1 
ATOM   3893 C CB    . LYS B 2 380 ? -16.976 57.221 11.741  1.00 35.92 ? 381 LYS A CB    1 
ATOM   3894 C CG    . LYS B 2 380 ? -18.283 57.862 12.246  1.00 37.81 ? 381 LYS A CG    1 
ATOM   3895 C CD    . LYS B 2 380 ? -18.086 59.335 12.638  1.00 37.88 ? 381 LYS A CD    1 
ATOM   3896 C CE    . LYS B 2 380 ? -18.959 59.745 13.829  1.00 38.96 ? 381 LYS A CE    1 
ATOM   3897 N NZ    . LYS B 2 380 ? -20.392 59.379 13.692  1.00 40.33 ? 381 LYS A NZ    1 
ATOM   3898 N N     . PHE B 2 381 ? -14.265 56.794 9.942   1.00 31.95 ? 382 PHE A N     1 
ATOM   3899 C CA    . PHE B 2 381 ? -12.811 56.615 9.887   1.00 30.08 ? 382 PHE A CA    1 
ATOM   3900 C C     . PHE B 2 381 ? -12.435 56.052 8.522   1.00 28.38 ? 382 PHE A C     1 
ATOM   3901 O O     . PHE B 2 381 ? -13.294 55.529 7.813   1.00 28.43 ? 382 PHE A O     1 
ATOM   3902 C CB    . PHE B 2 381 ? -12.350 55.670 10.997  1.00 30.10 ? 382 PHE A CB    1 
ATOM   3903 C CG    . PHE B 2 381 ? -13.300 54.533 11.259  1.00 29.96 ? 382 PHE A CG    1 
ATOM   3904 C CD1   . PHE B 2 381 ? -13.555 53.577 10.280  1.00 29.52 ? 382 PHE A CD1   1 
ATOM   3905 C CD2   . PHE B 2 381 ? -13.948 54.421 12.488  1.00 29.32 ? 382 PHE A CD2   1 
ATOM   3906 C CE1   . PHE B 2 381 ? -14.439 52.528 10.521  1.00 28.19 ? 382 PHE A CE1   1 
ATOM   3907 C CE2   . PHE B 2 381 ? -14.832 53.375 12.737  1.00 28.63 ? 382 PHE A CE2   1 
ATOM   3908 C CZ    . PHE B 2 381 ? -15.076 52.428 11.751  1.00 27.65 ? 382 PHE A CZ    1 
ATOM   3909 N N     . THR B 2 382 ? -11.164 56.149 8.147   1.00 26.47 ? 383 THR A N     1 
ATOM   3910 C CA    . THR B 2 382 ? -10.751 55.660 6.838   1.00 24.88 ? 383 THR A CA    1 
ATOM   3911 C C     . THR B 2 382 ? -9.525  54.763 6.813   1.00 25.02 ? 383 THR A C     1 
ATOM   3912 O O     . THR B 2 382 ? -9.082  54.350 5.747   1.00 25.00 ? 383 THR A O     1 
ATOM   3913 C CB    . THR B 2 382 ? -10.485 56.816 5.892   1.00 23.18 ? 383 THR A CB    1 
ATOM   3914 O OG1   . THR B 2 382 ? -9.305  57.506 6.316   1.00 23.84 ? 383 THR A OG1   1 
ATOM   3915 C CG2   . THR B 2 382 ? -11.666 57.764 5.886   1.00 20.37 ? 383 THR A CG2   1 
ATOM   3916 N N     . THR B 2 383 ? -8.971  54.469 7.980   1.00 24.45 ? 384 THR A N     1 
ATOM   3917 C CA    . THR B 2 383 ? -7.805  53.604 8.061   1.00 24.18 ? 384 THR A CA    1 
ATOM   3918 C C     . THR B 2 383 ? -8.092  52.611 9.170   1.00 24.33 ? 384 THR A C     1 
ATOM   3919 O O     . THR B 2 383 ? -8.813  52.933 10.105  1.00 24.64 ? 384 THR A O     1 
ATOM   3920 C CB    . THR B 2 383 ? -6.546  54.397 8.418   1.00 24.47 ? 384 THR A CB    1 
ATOM   3921 O OG1   . THR B 2 383 ? -6.644  54.859 9.766   1.00 25.78 ? 384 THR A OG1   1 
ATOM   3922 C CG2   . THR B 2 383 ? -6.398  55.592 7.501   1.00 25.56 ? 384 THR A CG2   1 
ATOM   3923 N N     . PRO B 2 384 ? -7.531  51.397 9.089   1.00 24.44 ? 385 PRO A N     1 
ATOM   3924 C CA    . PRO B 2 384 ? -7.745  50.361 10.103  1.00 25.34 ? 385 PRO A CA    1 
ATOM   3925 C C     . PRO B 2 384 ? -7.475  50.881 11.508  1.00 27.01 ? 385 PRO A C     1 
ATOM   3926 O O     . PRO B 2 384 ? -8.321  50.802 12.402  1.00 27.02 ? 385 PRO A O     1 
ATOM   3927 C CB    . PRO B 2 384 ? -6.748  49.286 9.708   1.00 24.36 ? 385 PRO A CB    1 
ATOM   3928 C CG    . PRO B 2 384 ? -6.601  49.479 8.257   1.00 24.70 ? 385 PRO A CG    1 
ATOM   3929 C CD    . PRO B 2 384 ? -6.516  50.960 8.126   1.00 24.66 ? 385 PRO A CD    1 
ATOM   3930 N N     . GLU B 2 385 ? -6.276  51.412 11.695  1.00 27.66 ? 386 GLU A N     1 
ATOM   3931 C CA    . GLU B 2 385 ? -5.888  51.941 12.977  1.00 28.74 ? 386 GLU A CA    1 
ATOM   3932 C C     . GLU B 2 385 ? -6.936  52.928 13.477  1.00 28.93 ? 386 GLU A C     1 
ATOM   3933 O O     . GLU B 2 385 ? -7.450  52.792 14.585  1.00 29.90 ? 386 GLU A O     1 
ATOM   3934 C CB    . GLU B 2 385 ? -4.517  52.604 12.853  1.00 29.41 ? 386 GLU A CB    1 
ATOM   3935 C CG    . GLU B 2 385 ? -3.409  51.628 12.445  1.00 30.02 ? 386 GLU A CG    1 
ATOM   3936 C CD    . GLU B 2 385 ? -2.980  51.768 10.985  1.00 31.40 ? 386 GLU A CD    1 
ATOM   3937 O OE1   . GLU B 2 385 ? -3.849  52.074 10.132  1.00 30.95 ? 386 GLU A OE1   1 
ATOM   3938 O OE2   . GLU B 2 385 ? -1.774  51.559 10.698  1.00 31.46 ? 386 GLU A OE2   1 
ATOM   3939 N N     . GLU B 2 386 ? -7.263  53.911 12.648  1.00 29.41 ? 387 GLU A N     1 
ATOM   3940 C CA    . GLU B 2 386 ? -8.252  54.927 12.997  1.00 30.65 ? 387 GLU A CA    1 
ATOM   3941 C C     . GLU B 2 386 ? -9.541  54.275 13.491  1.00 30.65 ? 387 GLU A C     1 
ATOM   3942 O O     . GLU B 2 386 ? -10.200 54.774 14.397  1.00 30.79 ? 387 GLU A O     1 
ATOM   3943 C CB    . GLU B 2 386 ? -8.536  55.787 11.770  1.00 32.22 ? 387 GLU A CB    1 
ATOM   3944 C CG    . GLU B 2 386 ? -9.129  57.158 12.032  1.00 35.94 ? 387 GLU A CG    1 
ATOM   3945 C CD    . GLU B 2 386 ? -8.803  58.148 10.905  1.00 38.71 ? 387 GLU A CD    1 
ATOM   3946 O OE1   . GLU B 2 386 ? -9.400  59.243 10.868  1.00 40.09 ? 387 GLU A OE1   1 
ATOM   3947 O OE2   . GLU B 2 386 ? -7.938  57.840 10.055  1.00 40.12 ? 387 GLU A OE2   1 
ATOM   3948 N N     . GLY B 2 387 ? -9.889  53.142 12.898  1.00 29.73 ? 388 GLY A N     1 
ATOM   3949 C CA    . GLY B 2 387 ? -11.094 52.450 13.296  1.00 29.70 ? 388 GLY A CA    1 
ATOM   3950 C C     . GLY B 2 387 ? -10.944 51.718 14.611  1.00 30.58 ? 388 GLY A C     1 
ATOM   3951 O O     . GLY B 2 387 ? -11.792 51.851 15.497  1.00 32.52 ? 388 GLY A O     1 
ATOM   3952 N N     . VAL B 2 388 ? -9.873  50.943 14.751  1.00 29.87 ? 389 VAL A N     1 
ATOM   3953 C CA    . VAL B 2 388 ? -9.653  50.196 15.984  1.00 28.46 ? 389 VAL A CA    1 
ATOM   3954 C C     . VAL B 2 388 ? -9.511  51.123 17.186  1.00 27.91 ? 389 VAL A C     1 
ATOM   3955 O O     . VAL B 2 388 ? -9.836  50.742 18.305  1.00 27.39 ? 389 VAL A O     1 
ATOM   3956 C CB    . VAL B 2 388 ? -8.401  49.296 15.888  1.00 28.67 ? 389 VAL A CB    1 
ATOM   3957 C CG1   . VAL B 2 388 ? -8.129  48.627 17.235  1.00 28.26 ? 389 VAL A CG1   1 
ATOM   3958 C CG2   . VAL B 2 388 ? -8.607  48.231 14.815  1.00 29.74 ? 389 VAL A CG2   1 
ATOM   3959 N N     . ARG B 2 389 ? -9.026  52.339 16.964  1.00 27.24 ? 390 ARG A N     1 
ATOM   3960 C CA    . ARG B 2 389 ? -8.879  53.264 18.073  1.00 27.09 ? 390 ARG A CA    1 
ATOM   3961 C C     . ARG B 2 389 ? -10.264 53.584 18.572  1.00 26.89 ? 390 ARG A C     1 
ATOM   3962 O O     . ARG B 2 389 ? -10.469 53.867 19.743  1.00 26.33 ? 390 ARG A O     1 
ATOM   3963 C CB    . ARG B 2 389 ? -8.213  54.564 17.638  1.00 27.18 ? 390 ARG A CB    1 
ATOM   3964 C CG    . ARG B 2 389 ? -7.837  55.445 18.819  1.00 27.39 ? 390 ARG A CG    1 
ATOM   3965 C CD    . ARG B 2 389 ? -7.920  56.928 18.517  1.00 27.63 ? 390 ARG A CD    1 
ATOM   3966 N NE    . ARG B 2 389 ? -7.066  57.348 17.410  1.00 29.97 ? 390 ARG A NE    1 
ATOM   3967 C CZ    . ARG B 2 389 ? -7.528  57.789 16.241  1.00 30.28 ? 390 ARG A CZ    1 
ATOM   3968 N NH1   . ARG B 2 389 ? -8.838  57.867 16.021  1.00 29.34 ? 390 ARG A NH1   1 
ATOM   3969 N NH2   . ARG B 2 389 ? -6.682  58.161 15.291  1.00 30.35 ? 390 ARG A NH2   1 
ATOM   3970 N N     . SER B 2 390 ? -11.220 53.543 17.659  1.00 27.09 ? 391 SER A N     1 
ATOM   3971 C CA    . SER B 2 390 ? -12.596 53.845 17.999  1.00 28.28 ? 391 SER A CA    1 
ATOM   3972 C C     . SER B 2 390 ? -13.256 52.622 18.595  1.00 29.46 ? 391 SER A C     1 
ATOM   3973 O O     . SER B 2 390 ? -13.968 52.720 19.595  1.00 31.16 ? 391 SER A O     1 
ATOM   3974 C CB    . SER B 2 390 ? -13.362 54.293 16.755  1.00 27.46 ? 391 SER A CB    1 
ATOM   3975 O OG    . SER B 2 390 ? -14.711 54.572 17.065  1.00 27.04 ? 391 SER A OG    1 
ATOM   3976 N N     . TYR B 2 391 ? -13.010 51.468 17.983  1.00 28.74 ? 392 TYR A N     1 
ATOM   3977 C CA    . TYR B 2 391 ? -13.595 50.219 18.450  1.00 28.80 ? 392 TYR A CA    1 
ATOM   3978 C C     . TYR B 2 391 ? -13.173 49.829 19.871  1.00 29.45 ? 392 TYR A C     1 
ATOM   3979 O O     . TYR B 2 391 ? -14.011 49.495 20.708  1.00 29.67 ? 392 TYR A O     1 
ATOM   3980 C CB    . TYR B 2 391 ? -13.244 49.081 17.494  1.00 28.24 ? 392 TYR A CB    1 
ATOM   3981 C CG    . TYR B 2 391 ? -13.898 47.779 17.884  1.00 28.44 ? 392 TYR A CG    1 
ATOM   3982 C CD1   . TYR B 2 391 ? -15.285 47.625 17.809  1.00 28.41 ? 392 TYR A CD1   1 
ATOM   3983 C CD2   . TYR B 2 391 ? -13.147 46.726 18.397  1.00 29.01 ? 392 TYR A CD2   1 
ATOM   3984 C CE1   . TYR B 2 391 ? -15.905 46.463 18.241  1.00 28.77 ? 392 TYR A CE1   1 
ATOM   3985 C CE2   . TYR B 2 391 ? -13.759 45.554 18.833  1.00 29.63 ? 392 TYR A CE2   1 
ATOM   3986 C CZ    . TYR B 2 391 ? -15.135 45.435 18.755  1.00 29.83 ? 392 TYR A CZ    1 
ATOM   3987 O OH    . TYR B 2 391 ? -15.741 44.297 19.215  1.00 32.22 ? 392 TYR A OH    1 
ATOM   3988 N N     . ALA B 2 392 ? -11.871 49.871 20.134  1.00 29.58 ? 393 ALA A N     1 
ATOM   3989 C CA    . ALA B 2 392 ? -11.328 49.512 21.433  1.00 29.74 ? 393 ALA A CA    1 
ATOM   3990 C C     . ALA B 2 392 ? -11.749 50.457 22.544  1.00 30.71 ? 393 ALA A C     1 
ATOM   3991 O O     . ALA B 2 392 ? -11.841 50.054 23.699  1.00 31.83 ? 393 ALA A O     1 
ATOM   3992 C CB    . ALA B 2 392 ? -9.820  49.462 21.352  1.00 28.48 ? 393 ALA A CB    1 
ATOM   3993 N N     . SER B 2 393 ? -12.006 51.713 22.194  1.00 31.27 ? 394 SER A N     1 
ATOM   3994 C CA    . SER B 2 393 ? -12.398 52.728 23.174  1.00 30.97 ? 394 SER A CA    1 
ATOM   3995 C C     . SER B 2 393 ? -13.861 52.634 23.602  1.00 30.91 ? 394 SER A C     1 
ATOM   3996 O O     . SER B 2 393 ? -14.219 52.998 24.723  1.00 30.88 ? 394 SER A O     1 
ATOM   3997 C CB    . SER B 2 393 ? -12.129 54.132 22.620  1.00 30.71 ? 394 SER A CB    1 
ATOM   3998 O OG    . SER B 2 393 ? -10.755 54.318 22.331  1.00 30.96 ? 394 SER A OG    1 
ATOM   3999 N N     . THR B 2 394 ? -14.707 52.143 22.712  1.00 30.54 ? 395 THR A N     1 
ATOM   4000 C CA    . THR B 2 394 ? -16.120 52.041 23.018  1.00 30.89 ? 395 THR A CA    1 
ATOM   4001 C C     . THR B 2 394 ? -16.579 50.613 23.273  1.00 30.67 ? 395 THR A C     1 
ATOM   4002 O O     . THR B 2 394 ? -17.513 50.379 24.038  1.00 30.07 ? 395 THR A O     1 
ATOM   4003 C CB    . THR B 2 394 ? -16.961 52.640 21.874  1.00 31.62 ? 395 THR A CB    1 
ATOM   4004 O OG1   . THR B 2 394 ? -16.698 51.926 20.660  1.00 33.77 ? 395 THR A OG1   1 
ATOM   4005 C CG2   . THR B 2 394 ? -16.610 54.103 21.669  1.00 31.78 ? 395 THR A CG2   1 
ATOM   4006 N N     . HIS B 2 395 ? -15.918 49.654 22.646  1.00 30.86 ? 396 HIS A N     1 
ATOM   4007 C CA    . HIS B 2 395 ? -16.313 48.269 22.818  1.00 30.76 ? 396 HIS A CA    1 
ATOM   4008 C C     . HIS B 2 395 ? -15.394 47.460 23.731  1.00 30.77 ? 396 HIS A C     1 
ATOM   4009 O O     . HIS B 2 395 ? -15.397 46.234 23.692  1.00 30.57 ? 396 HIS A O     1 
ATOM   4010 C CB    . HIS B 2 395 ? -16.430 47.614 21.440  1.00 30.76 ? 396 HIS A CB    1 
ATOM   4011 C CG    . HIS B 2 395 ? -17.556 48.159 20.614  1.00 32.34 ? 396 HIS A CG    1 
ATOM   4012 N ND1   . HIS B 2 395 ? -17.744 49.510 20.409  1.00 32.70 ? 396 HIS A ND1   1 
ATOM   4013 C CD2   . HIS B 2 395 ? -18.560 47.537 19.949  1.00 32.63 ? 396 HIS A CD2   1 
ATOM   4014 C CE1   . HIS B 2 395 ? -18.813 49.696 19.655  1.00 33.58 ? 396 HIS A CE1   1 
ATOM   4015 N NE2   . HIS B 2 395 ? -19.327 48.515 19.361  1.00 33.52 ? 396 HIS A NE2   1 
ATOM   4016 N N     . TRP B 2 396 ? -14.634 48.149 24.575  1.00 30.55 ? 397 TRP A N     1 
ATOM   4017 C CA    . TRP B 2 396 ? -13.707 47.481 25.483  1.00 30.50 ? 397 TRP A CA    1 
ATOM   4018 C C     . TRP B 2 396 ? -14.332 46.340 26.294  1.00 30.99 ? 397 TRP A C     1 
ATOM   4019 O O     . TRP B 2 396 ? -13.730 45.280 26.480  1.00 31.25 ? 397 TRP A O     1 
ATOM   4020 C CB    . TRP B 2 396 ? -13.096 48.497 26.450  1.00 29.18 ? 397 TRP A CB    1 
ATOM   4021 C CG    . TRP B 2 396 ? -14.093 49.149 27.327  1.00 28.19 ? 397 TRP A CG    1 
ATOM   4022 C CD1   . TRP B 2 396 ? -14.835 50.241 27.034  1.00 28.52 ? 397 TRP A CD1   1 
ATOM   4023 C CD2   . TRP B 2 396 ? -14.506 48.716 28.627  1.00 28.33 ? 397 TRP A CD2   1 
ATOM   4024 N NE1   . TRP B 2 396 ? -15.692 50.522 28.065  1.00 28.79 ? 397 TRP A NE1   1 
ATOM   4025 C CE2   . TRP B 2 396 ? -15.512 49.598 29.058  1.00 28.16 ? 397 TRP A CE2   1 
ATOM   4026 C CE3   . TRP B 2 396 ? -14.128 47.661 29.467  1.00 29.40 ? 397 TRP A CE3   1 
ATOM   4027 C CZ2   . TRP B 2 396 ? -16.145 49.467 30.298  1.00 28.60 ? 397 TRP A CZ2   1 
ATOM   4028 C CZ3   . TRP B 2 396 ? -14.761 47.530 30.707  1.00 29.68 ? 397 TRP A CZ3   1 
ATOM   4029 C CH2   . TRP B 2 396 ? -15.758 48.428 31.104  1.00 29.27 ? 397 TRP A CH2   1 
ATOM   4030 N N     . HIS B 2 397 ? -15.546 46.560 26.775  1.00 31.25 ? 398 HIS A N     1 
ATOM   4031 C CA    . HIS B 2 397 ? -16.223 45.570 27.588  1.00 31.51 ? 398 HIS A CA    1 
ATOM   4032 C C     . HIS B 2 397 ? -16.479 44.234 26.896  1.00 31.44 ? 398 HIS A C     1 
ATOM   4033 O O     . HIS B 2 397 ? -16.811 43.250 27.555  1.00 32.17 ? 398 HIS A O     1 
ATOM   4034 C CB    . HIS B 2 397 ? -17.532 46.161 28.110  1.00 31.77 ? 398 HIS A CB    1 
ATOM   4035 C CG    . HIS B 2 397 ? -18.266 45.260 29.050  1.00 33.06 ? 398 HIS A CG    1 
ATOM   4036 N ND1   . HIS B 2 397 ? -19.178 44.321 28.618  1.00 33.36 ? 398 HIS A ND1   1 
ATOM   4037 C CD2   . HIS B 2 397 ? -18.199 45.129 30.395  1.00 33.04 ? 398 HIS A CD2   1 
ATOM   4038 C CE1   . HIS B 2 397 ? -19.640 43.650 29.658  1.00 33.27 ? 398 HIS A CE1   1 
ATOM   4039 N NE2   . HIS B 2 397 ? -19.061 44.120 30.748  1.00 33.51 ? 398 HIS A NE2   1 
ATOM   4040 N N     . THR B 2 398 ? -16.305 44.181 25.580  1.00 30.84 ? 399 THR A N     1 
ATOM   4041 C CA    . THR B 2 398 ? -16.554 42.938 24.860  1.00 30.11 ? 399 THR A CA    1 
ATOM   4042 C C     . THR B 2 398 ? -15.290 42.188 24.496  1.00 27.93 ? 399 THR A C     1 
ATOM   4043 O O     . THR B 2 398 ? -15.355 41.196 23.794  1.00 27.35 ? 399 THR A O     1 
ATOM   4044 C CB    . THR B 2 398 ? -17.368 43.178 23.557  1.00 31.93 ? 399 THR A CB    1 
ATOM   4045 O OG1   . THR B 2 398 ? -17.914 41.934 23.104  1.00 34.03 ? 399 THR A OG1   1 
ATOM   4046 C CG2   . THR B 2 398 ? -16.482 43.747 22.456  1.00 31.69 ? 399 THR A CG2   1 
ATOM   4047 N N     . LEU B 2 399 ? -14.143 42.647 24.978  1.00 27.38 ? 400 LEU A N     1 
ATOM   4048 C CA    . LEU B 2 399 ? -12.888 41.986 24.652  1.00 27.82 ? 400 LEU A CA    1 
ATOM   4049 C C     . LEU B 2 399 ? -12.425 41.029 25.746  1.00 28.81 ? 400 LEU A C     1 
ATOM   4050 O O     . LEU B 2 399 ? -11.261 40.648 25.807  1.00 30.33 ? 400 LEU A O     1 
ATOM   4051 C CB    . LEU B 2 399 ? -11.814 43.036 24.383  1.00 27.99 ? 400 LEU A CB    1 
ATOM   4052 C CG    . LEU B 2 399 ? -12.248 44.146 23.418  1.00 28.79 ? 400 LEU A CG    1 
ATOM   4053 C CD1   . LEU B 2 399 ? -11.087 45.096 23.142  1.00 28.13 ? 400 LEU A CD1   1 
ATOM   4054 C CD2   . LEU B 2 399 ? -12.759 43.526 22.130  1.00 28.94 ? 400 LEU A CD2   1 
ATOM   4055 N N     . GLY B 2 400 ? -13.353 40.622 26.599  1.00 29.66 ? 401 GLY A N     1 
ATOM   4056 C CA    . GLY B 2 400 ? -13.017 39.724 27.684  1.00 29.63 ? 401 GLY A CA    1 
ATOM   4057 C C     . GLY B 2 400 ? -13.189 40.488 28.975  1.00 30.67 ? 401 GLY A C     1 
ATOM   4058 O O     . GLY B 2 400 ? -13.148 41.715 28.967  1.00 31.94 ? 401 GLY A O     1 
ATOM   4059 N N     . LYS B 2 401 ? -13.381 39.770 30.078  1.00 31.14 ? 402 LYS A N     1 
ATOM   4060 C CA    . LYS B 2 401 ? -13.575 40.387 31.389  1.00 32.01 ? 402 LYS A CA    1 
ATOM   4061 C C     . LYS B 2 401 ? -12.344 41.173 31.816  1.00 31.20 ? 402 LYS A C     1 
ATOM   4062 O O     . LYS B 2 401 ? -12.438 42.347 32.151  1.00 31.47 ? 402 LYS A O     1 
ATOM   4063 C CB    . LYS B 2 401 ? -13.852 39.310 32.429  1.00 34.77 ? 402 LYS A CB    1 
ATOM   4064 C CG    . LYS B 2 401 ? -14.914 39.629 33.498  1.00 38.60 ? 402 LYS A CG    1 
ATOM   4065 C CD    . LYS B 2 401 ? -14.439 40.547 34.627  1.00 39.34 ? 402 LYS A CD    1 
ATOM   4066 C CE    . LYS B 2 401 ? -15.390 40.435 35.833  1.00 41.39 ? 402 LYS A CE    1 
ATOM   4067 N NZ    . LYS B 2 401 ? -16.851 40.501 35.459  1.00 42.46 ? 402 LYS A NZ    1 
ATOM   4068 N N     . ASN B 2 402 ? -11.189 40.517 31.799  1.00 30.22 ? 403 ASN A N     1 
ATOM   4069 C CA    . ASN B 2 402 ? -9.942  41.135 32.220  1.00 29.93 ? 403 ASN A CA    1 
ATOM   4070 C C     . ASN B 2 402 ? -9.284  41.960 31.135  1.00 30.67 ? 403 ASN A C     1 
ATOM   4071 O O     . ASN B 2 402 ? -9.082  43.162 31.305  1.00 31.54 ? 403 ASN A O     1 
ATOM   4072 C CB    . ASN B 2 402 ? -8.982  40.061 32.730  1.00 28.75 ? 403 ASN A CB    1 
ATOM   4073 C CG    . ASN B 2 402 ? -9.553  39.290 33.906  1.00 27.57 ? 403 ASN A CG    1 
ATOM   4074 O OD1   . ASN B 2 402 ? -9.985  39.881 34.893  1.00 26.12 ? 403 ASN A OD1   1 
ATOM   4075 N ND2   . ASN B 2 402 ? -9.562  37.965 33.803  1.00 26.62 ? 403 ASN A ND2   1 
ATOM   4076 N N     . VAL B 2 403 ? -8.939  41.329 30.022  1.00 31.55 ? 404 VAL A N     1 
ATOM   4077 C CA    . VAL B 2 403 ? -8.319  42.053 28.924  1.00 32.13 ? 404 VAL A CA    1 
ATOM   4078 C C     . VAL B 2 403 ? -9.144  43.303 28.658  1.00 32.80 ? 404 VAL A C     1 
ATOM   4079 O O     . VAL B 2 403 ? -8.612  44.409 28.572  1.00 32.32 ? 404 VAL A O     1 
ATOM   4080 C CB    . VAL B 2 403 ? -8.277  41.195 27.646  1.00 32.17 ? 404 VAL A CB    1 
ATOM   4081 C CG1   . VAL B 2 403 ? -7.897  42.051 26.462  1.00 31.77 ? 404 VAL A CG1   1 
ATOM   4082 C CG2   . VAL B 2 403 ? -7.271  40.078 27.808  1.00 33.30 ? 404 VAL A CG2   1 
ATOM   4083 N N     . GLY B 2 404 ? -10.453 43.118 28.544  1.00 33.70 ? 405 GLY A N     1 
ATOM   4084 C CA    . GLY B 2 404 ? -11.333 44.240 28.283  1.00 34.95 ? 405 GLY A CA    1 
ATOM   4085 C C     . GLY B 2 404 ? -11.215 45.334 29.324  1.00 35.65 ? 405 GLY A C     1 
ATOM   4086 O O     . GLY B 2 404 ? -11.406 46.508 29.018  1.00 37.47 ? 405 GLY A O     1 
ATOM   4087 N N     . GLU B 2 405 ? -10.894 44.960 30.557  1.00 34.83 ? 406 GLU A N     1 
ATOM   4088 C CA    . GLU B 2 405 ? -10.770 45.944 31.620  1.00 33.73 ? 406 GLU A CA    1 
ATOM   4089 C C     . GLU B 2 405 ? -9.444  46.687 31.655  1.00 33.76 ? 406 GLU A C     1 
ATOM   4090 O O     . GLU B 2 405 ? -9.374  47.783 32.206  1.00 35.08 ? 406 GLU A O     1 
ATOM   4091 C CB    . GLU B 2 405 ? -11.062 45.296 32.975  1.00 33.72 ? 406 GLU A CB    1 
ATOM   4092 C CG    . GLU B 2 405 ? -12.566 45.133 33.218  1.00 35.17 ? 406 GLU A CG    1 
ATOM   4093 C CD    . GLU B 2 405 ? -12.896 44.324 34.456  1.00 35.16 ? 406 GLU A CD    1 
ATOM   4094 O OE1   . GLU B 2 405 ? -14.087 43.979 34.632  1.00 34.16 ? 406 GLU A OE1   1 
ATOM   4095 O OE2   . GLU B 2 405 ? -11.970 44.032 35.247  1.00 36.00 ? 406 GLU A OE2   1 
ATOM   4096 N N     . SER B 2 406 ? -8.399  46.111 31.065  1.00 33.31 ? 407 SER A N     1 
ATOM   4097 C CA    . SER B 2 406 ? -7.102  46.772 31.039  1.00 33.50 ? 407 SER A CA    1 
ATOM   4098 C C     . SER B 2 406 ? -7.035  47.674 29.828  1.00 34.14 ? 407 SER A C     1 
ATOM   4099 O O     . SER B 2 406 ? -6.229  48.604 29.768  1.00 34.77 ? 407 SER A O     1 
ATOM   4100 C CB    . SER B 2 406 ? -5.969  45.760 30.955  1.00 33.62 ? 407 SER A CB    1 
ATOM   4101 O OG    . SER B 2 406 ? -4.725  46.433 30.828  1.00 35.93 ? 407 SER A OG    1 
ATOM   4102 N N     . ILE B 2 407 ? -7.882  47.380 28.850  1.00 34.81 ? 408 ILE A N     1 
ATOM   4103 C CA    . ILE B 2 407 ? -7.933  48.165 27.631  1.00 35.20 ? 408 ILE A CA    1 
ATOM   4104 C C     . ILE B 2 407 ? -8.778  49.391 27.904  1.00 35.49 ? 408 ILE A C     1 
ATOM   4105 O O     . ILE B 2 407 ? -8.548  50.454 27.350  1.00 37.11 ? 408 ILE A O     1 
ATOM   4106 C CB    . ILE B 2 407 ? -8.532  47.344 26.475  1.00 35.74 ? 408 ILE A CB    1 
ATOM   4107 C CG1   . ILE B 2 407 ? -7.584  46.192 26.137  1.00 37.17 ? 408 ILE A CG1   1 
ATOM   4108 C CG2   . ILE B 2 407 ? -8.743  48.220 25.249  1.00 34.65 ? 408 ILE A CG2   1 
ATOM   4109 C CD1   . ILE B 2 407 ? -8.069  45.302 25.021  1.00 37.82 ? 408 ILE A CD1   1 
ATOM   4110 N N     . ARG B 2 408 ? -9.754  49.246 28.780  1.00 35.44 ? 409 ARG A N     1 
ATOM   4111 C CA    . ARG B 2 408 ? -10.600 50.368 29.118  1.00 36.18 ? 409 ARG A CA    1 
ATOM   4112 C C     . ARG B 2 408 ? -9.813  51.454 29.849  1.00 36.12 ? 409 ARG A C     1 
ATOM   4113 O O     . ARG B 2 408 ? -10.181 52.624 29.804  1.00 36.08 ? 409 ARG A O     1 
ATOM   4114 C CB    . ARG B 2 408 ? -11.752 49.899 29.997  1.00 36.93 ? 409 ARG A CB    1 
ATOM   4115 C CG    . ARG B 2 408 ? -12.523 51.017 30.679  1.00 40.37 ? 409 ARG A CG    1 
ATOM   4116 C CD    . ARG B 2 408 ? -12.947 50.567 32.079  1.00 44.88 ? 409 ARG A CD    1 
ATOM   4117 N NE    . ARG B 2 408 ? -11.808 49.992 32.810  1.00 47.11 ? 409 ARG A NE    1 
ATOM   4118 C CZ    . ARG B 2 408 ? -11.903 49.099 33.795  1.00 47.11 ? 409 ARG A CZ    1 
ATOM   4119 N NH1   . ARG B 2 408 ? -13.095 48.657 34.197  1.00 46.67 ? 409 ARG A NH1   1 
ATOM   4120 N NH2   . ARG B 2 408 ? -10.799 48.629 34.366  1.00 46.55 ? 409 ARG A NH2   1 
ATOM   4121 N N     . GLU B 2 409 ? -8.727  51.077 30.516  1.00 35.77 ? 410 GLU A N     1 
ATOM   4122 C CA    . GLU B 2 409 ? -7.947  52.047 31.274  1.00 36.17 ? 410 GLU A CA    1 
ATOM   4123 C C     . GLU B 2 409 ? -6.680  52.504 30.567  1.00 35.26 ? 410 GLU A C     1 
ATOM   4124 O O     . GLU B 2 409 ? -6.092  53.524 30.926  1.00 36.42 ? 410 GLU A O     1 
ATOM   4125 C CB    . GLU B 2 409 ? -7.604  51.475 32.646  1.00 36.49 ? 410 GLU A CB    1 
ATOM   4126 C CG    . GLU B 2 409 ? -6.910  50.141 32.558  1.00 39.97 ? 410 GLU A CG    1 
ATOM   4127 C CD    . GLU B 2 409 ? -6.618  49.526 33.916  1.00 43.03 ? 410 GLU A CD    1 
ATOM   4128 O OE1   . GLU B 2 409 ? -7.562  49.408 34.737  1.00 45.04 ? 410 GLU A OE1   1 
ATOM   4129 O OE2   . GLU B 2 409 ? -5.446  49.151 34.154  1.00 44.18 ? 410 GLU A OE2   1 
ATOM   4130 N N     . TYR B 2 410 ? -6.245  51.750 29.570  1.00 33.13 ? 411 TYR A N     1 
ATOM   4131 C CA    . TYR B 2 410 ? -5.067  52.137 28.815  1.00 31.89 ? 411 TYR A CA    1 
ATOM   4132 C C     . TYR B 2 410 ? -4.768  51.187 27.696  1.00 33.30 ? 411 TYR A C     1 
ATOM   4133 O O     . TYR B 2 410 ? -4.632  49.981 27.913  1.00 34.91 ? 411 TYR A O     1 
ATOM   4134 C CB    . TYR B 2 410 ? -3.818  52.229 29.684  1.00 30.22 ? 411 TYR A CB    1 
ATOM   4135 C CG    . TYR B 2 410 ? -2.560  52.097 28.852  1.00 29.85 ? 411 TYR A CG    1 
ATOM   4136 C CD1   . TYR B 2 410 ? -2.001  50.847 28.590  1.00 30.03 ? 411 TYR A CD1   1 
ATOM   4137 C CD2   . TYR B 2 410 ? -1.995  53.205 28.237  1.00 31.02 ? 411 TYR A CD2   1 
ATOM   4138 C CE1   . TYR B 2 410 ? -0.924  50.705 27.733  1.00 30.04 ? 411 TYR A CE1   1 
ATOM   4139 C CE2   . TYR B 2 410 ? -0.916  53.076 27.378  1.00 32.28 ? 411 TYR A CE2   1 
ATOM   4140 C CZ    . TYR B 2 410 ? -0.386  51.822 27.126  1.00 31.88 ? 411 TYR A CZ    1 
ATOM   4141 O OH    . TYR B 2 410 ? 0.663   51.690 26.244  1.00 33.12 ? 411 TYR A OH    1 
ATOM   4142 N N     . PHE B 2 411 ? -4.640  51.751 26.501  1.00 33.19 ? 412 PHE A N     1 
ATOM   4143 C CA    . PHE B 2 411 ? -4.314  50.991 25.308  1.00 32.33 ? 412 PHE A CA    1 
ATOM   4144 C C     . PHE B 2 411 ? -3.775  51.988 24.292  1.00 33.03 ? 412 PHE A C     1 
ATOM   4145 O O     . PHE B 2 411 ? -4.179  53.147 24.286  1.00 33.42 ? 412 PHE A O     1 
ATOM   4146 C CB    . PHE B 2 411 ? -5.562  50.278 24.765  1.00 29.76 ? 412 PHE A CB    1 
ATOM   4147 C CG    . PHE B 2 411 ? -6.303  51.048 23.720  1.00 28.53 ? 412 PHE A CG    1 
ATOM   4148 C CD1   . PHE B 2 411 ? -5.839  51.097 22.413  1.00 29.83 ? 412 PHE A CD1   1 
ATOM   4149 C CD2   . PHE B 2 411 ? -7.450  51.747 24.042  1.00 29.15 ? 412 PHE A CD2   1 
ATOM   4150 C CE1   . PHE B 2 411 ? -6.516  51.831 21.440  1.00 30.30 ? 412 PHE A CE1   1 
ATOM   4151 C CE2   . PHE B 2 411 ? -8.136  52.484 23.078  1.00 29.63 ? 412 PHE A CE2   1 
ATOM   4152 C CZ    . PHE B 2 411 ? -7.668  52.529 21.779  1.00 29.67 ? 412 PHE A CZ    1 
ATOM   4153 N N     . GLU B 2 412 ? -2.838  51.550 23.461  1.00 34.05 ? 413 GLU A N     1 
ATOM   4154 C CA    . GLU B 2 412 ? -2.292  52.409 22.420  1.00 35.76 ? 413 GLU A CA    1 
ATOM   4155 C C     . GLU B 2 412 ? -2.139  51.579 21.151  1.00 35.31 ? 413 GLU A C     1 
ATOM   4156 O O     . GLU B 2 412 ? -2.006  50.360 21.218  1.00 35.64 ? 413 GLU A O     1 
ATOM   4157 C CB    . GLU B 2 412 ? -0.937  52.994 22.830  1.00 36.95 ? 413 GLU A CB    1 
ATOM   4158 C CG    . GLU B 2 412 ? 0.207   51.992 22.852  1.00 40.81 ? 413 GLU A CG    1 
ATOM   4159 C CD    . GLU B 2 412 ? 1.562   52.633 23.174  1.00 43.95 ? 413 GLU A CD    1 
ATOM   4160 O OE1   . GLU B 2 412 ? 2.065   53.443 22.355  1.00 44.71 ? 413 GLU A OE1   1 
ATOM   4161 O OE2   . GLU B 2 412 ? 2.125   52.324 24.252  1.00 45.43 ? 413 GLU A OE2   1 
ATOM   4162 N N     . ILE B 2 413 ? -2.179  52.237 19.998  1.00 34.17 ? 414 ILE A N     1 
ATOM   4163 C CA    . ILE B 2 413 ? -2.030  51.539 18.733  1.00 33.47 ? 414 ILE A CA    1 
ATOM   4164 C C     . ILE B 2 413 ? -0.671  51.896 18.153  1.00 33.44 ? 414 ILE A C     1 
ATOM   4165 O O     . ILE B 2 413 ? -0.388  53.056 17.902  1.00 34.63 ? 414 ILE A O     1 
ATOM   4166 C CB    . ILE B 2 413 ? -3.136  51.940 17.742  1.00 32.95 ? 414 ILE A CB    1 
ATOM   4167 C CG1   . ILE B 2 413 ? -4.511  51.687 18.359  1.00 32.59 ? 414 ILE A CG1   1 
ATOM   4168 C CG2   . ILE B 2 413 ? -3.003  51.135 16.468  1.00 33.48 ? 414 ILE A CG2   1 
ATOM   4169 C CD1   . ILE B 2 413 ? -5.661  52.046 17.455  1.00 32.04 ? 414 ILE A CD1   1 
ATOM   4170 N N     . ILE B 2 414 ? 0.173   50.893 17.955  1.00 33.92 ? 415 ILE A N     1 
ATOM   4171 C CA    . ILE B 2 414 ? 1.514   51.104 17.422  1.00 34.46 ? 415 ILE A CA    1 
ATOM   4172 C C     . ILE B 2 414 ? 1.542   50.632 15.982  1.00 35.00 ? 415 ILE A C     1 
ATOM   4173 O O     . ILE B 2 414 ? 0.674   49.877 15.566  1.00 35.62 ? 415 ILE A O     1 
ATOM   4174 C CB    . ILE B 2 414 ? 2.574   50.285 18.206  1.00 34.30 ? 415 ILE A CB    1 
ATOM   4175 C CG1   . ILE B 2 414 ? 2.214   50.225 19.690  1.00 33.89 ? 415 ILE A CG1   1 
ATOM   4176 C CG2   . ILE B 2 414 ? 3.940   50.921 18.053  1.00 33.92 ? 415 ILE A CG2   1 
ATOM   4177 C CD1   . ILE B 2 414 ? 2.136   51.567 20.337  1.00 34.85 ? 415 ILE A CD1   1 
ATOM   4178 N N     . SER B 2 415 ? 2.544   51.081 15.231  1.00 36.54 ? 416 SER A N     1 
ATOM   4179 C CA    . SER B 2 415 ? 2.723   50.699 13.827  1.00 38.31 ? 416 SER A CA    1 
ATOM   4180 C C     . SER B 2 415 ? 4.115   51.124 13.369  1.00 39.94 ? 416 SER A C     1 
ATOM   4181 O O     . SER B 2 415 ? 4.928   51.571 14.172  1.00 41.59 ? 416 SER A O     1 
ATOM   4182 C CB    . SER B 2 415 ? 1.692   51.382 12.939  1.00 36.71 ? 416 SER A CB    1 
ATOM   4183 O OG    . SER B 2 415 ? 2.187   52.627 12.497  1.00 38.36 ? 416 SER A OG    1 
ATOM   4184 N N     . GLY B 2 416 ? 4.390   50.990 12.079  1.00 41.50 ? 417 GLY A N     1 
ATOM   4185 C CA    . GLY B 2 416 ? 5.692   51.385 11.567  1.00 44.35 ? 417 GLY A CA    1 
ATOM   4186 C C     . GLY B 2 416 ? 6.860   50.912 12.414  1.00 46.29 ? 417 GLY A C     1 
ATOM   4187 O O     . GLY B 2 416 ? 6.711   49.990 13.225  1.00 46.65 ? 417 GLY A O     1 
ATOM   4188 N N     . GLU B 2 417 ? 8.020   51.547 12.234  1.00 48.22 ? 418 GLU A N     1 
ATOM   4189 C CA    . GLU B 2 417 ? 9.224   51.181 12.982  1.00 51.08 ? 418 GLU A CA    1 
ATOM   4190 C C     . GLU B 2 417 ? 8.900   50.983 14.466  1.00 51.66 ? 418 GLU A C     1 
ATOM   4191 O O     . GLU B 2 417 ? 9.278   49.968 15.056  1.00 51.81 ? 418 GLU A O     1 
ATOM   4192 C CB    . GLU B 2 417 ? 10.310  52.261 12.840  1.00 52.46 ? 418 GLU A CB    1 
ATOM   4193 C CG    . GLU B 2 417 ? 10.424  52.886 11.440  1.00 56.35 ? 418 GLU A CG    1 
ATOM   4194 C CD    . GLU B 2 417 ? 10.957  51.927 10.369  1.00 57.70 ? 418 GLU A CD    1 
ATOM   4195 O OE1   . GLU B 2 417 ? 10.406  51.920 9.239   1.00 57.39 ? 418 GLU A OE1   1 
ATOM   4196 O OE2   . GLU B 2 417 ? 11.935  51.196 10.655  1.00 57.90 ? 418 GLU A OE2   1 
ATOM   4197 N N     . LYS B 2 418 ? 8.185   51.939 15.060  1.00 52.31 ? 419 LYS A N     1 
ATOM   4198 C CA    . LYS B 2 418 ? 7.849   51.846 16.473  1.00 53.35 ? 419 LYS A CA    1 
ATOM   4199 C C     . LYS B 2 418 ? 7.339   50.468 16.835  1.00 53.18 ? 419 LYS A C     1 
ATOM   4200 O O     . LYS B 2 418 ? 7.611   49.974 17.934  1.00 54.14 ? 419 LYS A O     1 
ATOM   4201 C CB    . LYS B 2 418 ? 6.801   52.891 16.876  1.00 54.67 ? 419 LYS A CB    1 
ATOM   4202 C CG    . LYS B 2 418 ? 6.607   52.995 18.411  1.00 56.75 ? 419 LYS A CG    1 
ATOM   4203 C CD    . LYS B 2 418 ? 5.947   54.320 18.813  1.00 58.67 ? 419 LYS A CD    1 
ATOM   4204 C CE    . LYS B 2 418 ? 6.354   54.780 20.222  1.00 58.76 ? 419 LYS A CE    1 
ATOM   4205 N NZ    . LYS B 2 418 ? 5.844   56.162 20.528  1.00 58.64 ? 419 LYS A NZ    1 
ATOM   4206 N N     . LEU B 2 419 ? 6.614   49.844 15.912  1.00 52.12 ? 420 LEU A N     1 
ATOM   4207 C CA    . LEU B 2 419 ? 6.058   48.521 16.157  1.00 51.69 ? 420 LEU A CA    1 
ATOM   4208 C C     . LEU B 2 419 ? 7.093   47.414 16.117  1.00 52.08 ? 420 LEU A C     1 
ATOM   4209 O O     . LEU B 2 419 ? 7.056   46.509 16.950  1.00 51.71 ? 420 LEU A O     1 
ATOM   4210 C CB    . LEU B 2 419 ? 4.957   48.206 15.152  1.00 51.24 ? 420 LEU A CB    1 
ATOM   4211 C CG    . LEU B 2 419 ? 4.339   46.821 15.351  1.00 50.52 ? 420 LEU A CG    1 
ATOM   4212 C CD1   . LEU B 2 419 ? 3.790   46.704 16.769  1.00 50.63 ? 420 LEU A CD1   1 
ATOM   4213 C CD2   . LEU B 2 419 ? 3.241   46.595 14.326  1.00 50.98 ? 420 LEU A CD2   1 
ATOM   4214 N N     . PHE B 2 420 ? 8.003   47.477 15.145  1.00 52.94 ? 421 PHE A N     1 
ATOM   4215 C CA    . PHE B 2 420 ? 9.065   46.470 15.011  1.00 53.88 ? 421 PHE A CA    1 
ATOM   4216 C C     . PHE B 2 420 ? 10.013  46.519 16.215  1.00 53.60 ? 421 PHE A C     1 
ATOM   4217 O O     . PHE B 2 420 ? 10.779  45.582 16.469  1.00 53.18 ? 421 PHE A O     1 
ATOM   4218 C CB    . PHE B 2 420 ? 9.870   46.702 13.729  1.00 55.37 ? 421 PHE A CB    1 
ATOM   4219 C CG    . PHE B 2 420 ? 9.019   46.840 12.500  1.00 57.19 ? 421 PHE A CG    1 
ATOM   4220 C CD1   . PHE B 2 420 ? 8.962   48.054 11.809  1.00 57.24 ? 421 PHE A CD1   1 
ATOM   4221 C CD2   . PHE B 2 420 ? 8.254   45.764 12.041  1.00 57.06 ? 421 PHE A CD2   1 
ATOM   4222 C CE1   . PHE B 2 420 ? 8.157   48.198 10.679  1.00 57.06 ? 421 PHE A CE1   1 
ATOM   4223 C CE2   . PHE B 2 420 ? 7.442   45.895 10.907  1.00 57.17 ? 421 PHE A CE2   1 
ATOM   4224 C CZ    . PHE B 2 420 ? 7.394   47.119 10.226  1.00 57.41 ? 421 PHE A CZ    1 
ATOM   4225 N N     . LYS B 2 421 ? 9.956   47.622 16.950  1.00 53.66 ? 422 LYS A N     1 
ATOM   4226 C CA    . LYS B 2 421 ? 10.790  47.802 18.124  1.00 53.51 ? 422 LYS A CA    1 
ATOM   4227 C C     . LYS B 2 421 ? 10.125  47.204 19.376  1.00 52.02 ? 422 LYS A C     1 
ATOM   4228 O O     . LYS B 2 421 ? 10.742  47.129 20.446  1.00 52.50 ? 422 LYS A O     1 
ATOM   4229 C CB    . LYS B 2 421 ? 11.103  49.298 18.299  1.00 55.70 ? 422 LYS A CB    1 
ATOM   4230 C CG    . LYS B 2 421 ? 12.099  49.833 17.247  1.00 58.04 ? 422 LYS A CG    1 
ATOM   4231 C CD    . LYS B 2 421 ? 11.889  51.324 16.927  1.00 60.09 ? 422 LYS A CD    1 
ATOM   4232 C CE    . LYS B 2 421 ? 12.061  52.226 18.152  1.00 60.48 ? 422 LYS A CE    1 
ATOM   4233 N NZ    . LYS B 2 421 ? 13.460  52.241 18.704  1.00 61.43 ? 422 LYS A NZ    1 
ATOM   4234 N N     . GLU B 2 422 ? 8.866   46.786 19.244  1.00 49.26 ? 423 GLU A N     1 
ATOM   4235 C CA    . GLU B 2 422 ? 8.166   46.153 20.360  1.00 45.89 ? 423 GLU A CA    1 
ATOM   4236 C C     . GLU B 2 422 ? 8.559   44.678 20.252  1.00 43.59 ? 423 GLU A C     1 
ATOM   4237 O O     . GLU B 2 422 ? 8.843   44.184 19.162  1.00 43.17 ? 423 GLU A O     1 
ATOM   4238 C CB    . GLU B 2 422 ? 6.641   46.292 20.231  1.00 46.37 ? 423 GLU A CB    1 
ATOM   4239 C CG    . GLU B 2 422 ? 6.076   47.709 20.292  1.00 46.17 ? 423 GLU A CG    1 
ATOM   4240 C CD    . GLU B 2 422 ? 6.497   48.459 21.538  1.00 47.39 ? 423 GLU A CD    1 
ATOM   4241 O OE1   . GLU B 2 422 ? 6.563   47.823 22.615  1.00 47.47 ? 423 GLU A OE1   1 
ATOM   4242 O OE2   . GLU B 2 422 ? 6.750   49.686 21.440  1.00 48.08 ? 423 GLU A OE2   1 
ATOM   4243 N N     . PRO B 2 423 ? 8.565   43.956 21.378  1.00 41.97 ? 424 PRO A N     1 
ATOM   4244 C CA    . PRO B 2 423 ? 8.929   42.537 21.423  1.00 40.54 ? 424 PRO A CA    1 
ATOM   4245 C C     . PRO B 2 423 ? 7.908   41.621 20.769  1.00 39.36 ? 424 PRO A C     1 
ATOM   4246 O O     . PRO B 2 423 ? 7.396   40.702 21.404  1.00 39.01 ? 424 PRO A O     1 
ATOM   4247 C CB    . PRO B 2 423 ? 9.040   42.275 22.912  1.00 41.62 ? 424 PRO A CB    1 
ATOM   4248 C CG    . PRO B 2 423 ? 7.906   43.123 23.459  1.00 41.82 ? 424 PRO A CG    1 
ATOM   4249 C CD    . PRO B 2 423 ? 8.074   44.418 22.690  1.00 42.30 ? 424 PRO A CD    1 
ATOM   4250 N N     . VAL B 2 424 ? 7.618   41.855 19.497  1.00 38.01 ? 425 VAL A N     1 
ATOM   4251 C CA    . VAL B 2 424 ? 6.629   41.039 18.807  1.00 36.75 ? 425 VAL A CA    1 
ATOM   4252 C C     . VAL B 2 424 ? 7.062   40.621 17.400  1.00 37.99 ? 425 VAL A C     1 
ATOM   4253 O O     . VAL B 2 424 ? 6.273   40.062 16.647  1.00 38.14 ? 425 VAL A O     1 
ATOM   4254 C CB    . VAL B 2 424 ? 5.287   41.796 18.714  1.00 33.65 ? 425 VAL A CB    1 
ATOM   4255 C CG1   . VAL B 2 424 ? 4.843   42.247 20.093  1.00 32.70 ? 425 VAL A CG1   1 
ATOM   4256 C CG2   . VAL B 2 424 ? 5.435   42.989 17.811  1.00 32.83 ? 425 VAL A CG2   1 
ATOM   4257 N N     . THR B 2 425 ? 8.318   40.882 17.051  1.00 38.86 ? 426 THR A N     1 
ATOM   4258 C CA    . THR B 2 425 ? 8.837   40.549 15.724  1.00 38.98 ? 426 THR A CA    1 
ATOM   4259 C C     . THR B 2 425 ? 8.650   39.093 15.303  1.00 38.28 ? 426 THR A C     1 
ATOM   4260 O O     . THR B 2 425 ? 8.310   38.810 14.156  1.00 38.05 ? 426 THR A O     1 
ATOM   4261 C CB    . THR B 2 425 ? 10.332  40.905 15.619  1.00 39.57 ? 426 THR A CB    1 
ATOM   4262 O OG1   . THR B 2 425 ? 10.930  40.819 16.919  1.00 42.45 ? 426 THR A OG1   1 
ATOM   4263 C CG2   . THR B 2 425 ? 10.511  42.312 15.067  1.00 39.89 ? 426 THR A CG2   1 
ATOM   4264 N N     . ALA B 2 426 ? 8.878   38.170 16.227  1.00 38.00 ? 427 ALA A N     1 
ATOM   4265 C CA    . ALA B 2 426 ? 8.730   36.752 15.924  1.00 37.61 ? 427 ALA A CA    1 
ATOM   4266 C C     . ALA B 2 426 ? 7.302   36.423 15.488  1.00 37.31 ? 427 ALA A C     1 
ATOM   4267 O O     . ALA B 2 426 ? 7.077   35.892 14.401  1.00 37.49 ? 427 ALA A O     1 
ATOM   4268 C CB    . ALA B 2 426 ? 9.110   35.921 17.145  1.00 37.30 ? 427 ALA A CB    1 
ATOM   4269 N N     . GLU B 2 427 ? 6.344   36.739 16.352  1.00 37.13 ? 428 GLU A N     1 
ATOM   4270 C CA    . GLU B 2 427 ? 4.937   36.488 16.083  1.00 36.89 ? 428 GLU A CA    1 
ATOM   4271 C C     . GLU B 2 427 ? 4.523   36.979 14.698  1.00 36.47 ? 428 GLU A C     1 
ATOM   4272 O O     . GLU B 2 427 ? 3.875   36.251 13.948  1.00 37.58 ? 428 GLU A O     1 
ATOM   4273 C CB    . GLU B 2 427 ? 4.076   37.172 17.142  1.00 37.96 ? 428 GLU A CB    1 
ATOM   4274 C CG    . GLU B 2 427 ? 4.238   36.635 18.550  1.00 41.55 ? 428 GLU A CG    1 
ATOM   4275 C CD    . GLU B 2 427 ? 5.647   36.802 19.110  1.00 44.15 ? 428 GLU A CD    1 
ATOM   4276 O OE1   . GLU B 2 427 ? 6.387   37.703 18.658  1.00 45.17 ? 428 GLU A OE1   1 
ATOM   4277 O OE2   . GLU B 2 427 ? 6.009   36.037 20.030  1.00 45.49 ? 428 GLU A OE2   1 
ATOM   4278 N N     . LEU B 2 428 ? 4.893   38.213 14.363  1.00 35.41 ? 429 LEU A N     1 
ATOM   4279 C CA    . LEU B 2 428 ? 4.559   38.787 13.063  1.00 34.96 ? 429 LEU A CA    1 
ATOM   4280 C C     . LEU B 2 428 ? 5.045   37.915 11.911  1.00 35.16 ? 429 LEU A C     1 
ATOM   4281 O O     . LEU B 2 428 ? 4.293   37.616 10.994  1.00 35.75 ? 429 LEU A O     1 
ATOM   4282 C CB    . LEU B 2 428 ? 5.151   40.190 12.934  1.00 34.03 ? 429 LEU A CB    1 
ATOM   4283 C CG    . LEU B 2 428 ? 4.503   41.284 13.780  1.00 33.97 ? 429 LEU A CG    1 
ATOM   4284 C CD1   . LEU B 2 428 ? 5.365   42.518 13.737  1.00 33.50 ? 429 LEU A CD1   1 
ATOM   4285 C CD2   . LEU B 2 428 ? 3.102   41.588 13.267  1.00 33.89 ? 429 LEU A CD2   1 
ATOM   4286 N N     . CYS B 2 429 ? 6.305   37.507 11.963  1.00 35.06 ? 430 CYS A N     1 
ATOM   4287 C CA    . CYS B 2 429 ? 6.865   36.657 10.930  1.00 35.51 ? 430 CYS A CA    1 
ATOM   4288 C C     . CYS B 2 429 ? 6.065   35.368 10.774  1.00 36.95 ? 430 CYS A C     1 
ATOM   4289 O O     . CYS B 2 429 ? 5.880   34.885 9.659   1.00 37.40 ? 430 CYS A O     1 
ATOM   4290 C CB    . CYS B 2 429 ? 8.319   36.336 11.255  1.00 35.12 ? 430 CYS A CB    1 
ATOM   4291 S SG    . CYS B 2 429 ? 9.411   37.758 11.036  1.00 39.60 ? 430 CYS A SG    1 
ATOM   4292 N N     . GLU B 2 430 ? 5.596   34.809 11.887  1.00 37.63 ? 431 GLU A N     1 
ATOM   4293 C CA    . GLU B 2 430 ? 4.795   33.585 11.855  1.00 38.12 ? 431 GLU A CA    1 
ATOM   4294 C C     . GLU B 2 430 ? 3.426   33.903 11.256  1.00 37.70 ? 431 GLU A C     1 
ATOM   4295 O O     . GLU B 2 430 ? 2.820   33.088 10.555  1.00 38.61 ? 431 GLU A O     1 
ATOM   4296 C CB    . GLU B 2 430 ? 4.630   33.038 13.273  1.00 40.62 ? 431 GLU A CB    1 
ATOM   4297 C CG    . GLU B 2 430 ? 3.463   32.060 13.488  1.00 46.59 ? 431 GLU A CG    1 
ATOM   4298 C CD    . GLU B 2 430 ? 3.620   30.731 12.747  1.00 49.66 ? 431 GLU A CD    1 
ATOM   4299 O OE1   . GLU B 2 430 ? 4.737   30.160 12.791  1.00 50.85 ? 431 GLU A OE1   1 
ATOM   4300 O OE2   . GLU B 2 430 ? 2.617   30.254 12.137  1.00 50.83 ? 431 GLU A OE2   1 
ATOM   4301 N N     . MET B 2 431 ? 2.947   35.106 11.534  1.00 35.61 ? 432 MET A N     1 
ATOM   4302 C CA    . MET B 2 431 ? 1.660   35.540 11.029  1.00 33.46 ? 432 MET A CA    1 
ATOM   4303 C C     . MET B 2 431 ? 1.683   35.828 9.523   1.00 33.30 ? 432 MET A C     1 
ATOM   4304 O O     . MET B 2 431 ? 0.705   35.551 8.820   1.00 32.97 ? 432 MET A O     1 
ATOM   4305 C CB    . MET B 2 431 ? 1.222   36.779 11.789  1.00 31.73 ? 432 MET A CB    1 
ATOM   4306 C CG    . MET B 2 431 ? -0.093  37.325 11.341  1.00 31.69 ? 432 MET A CG    1 
ATOM   4307 S SD    . MET B 2 431 ? -0.558  38.658 12.409  1.00 33.24 ? 432 MET A SD    1 
ATOM   4308 C CE    . MET B 2 431 ? 0.380   40.039 11.693  1.00 34.14 ? 432 MET A CE    1 
ATOM   4309 N N     . MET B 2 432 ? 2.798   36.377 9.034   1.00 31.99 ? 433 MET A N     1 
ATOM   4310 C CA    . MET B 2 432 ? 2.949   36.716 7.620   1.00 30.84 ? 433 MET A CA    1 
ATOM   4311 C C     . MET B 2 432 ? 3.525   35.587 6.782   1.00 31.42 ? 433 MET A C     1 
ATOM   4312 O O     . MET B 2 432 ? 3.714   35.725 5.576   1.00 30.66 ? 433 MET A O     1 
ATOM   4313 C CB    . MET B 2 432 ? 3.826   37.953 7.464   1.00 29.08 ? 433 MET A CB    1 
ATOM   4314 C CG    . MET B 2 432 ? 3.273   39.170 8.149   1.00 29.74 ? 433 MET A CG    1 
ATOM   4315 S SD    . MET B 2 432 ? 4.132   40.686 7.729   1.00 32.02 ? 433 MET A SD    1 
ATOM   4316 C CE    . MET B 2 432 ? 5.439   40.679 8.938   1.00 31.20 ? 433 MET A CE    1 
ATOM   4317 N N     . GLY B 2 433 ? 3.802   34.463 7.423   1.00 33.00 ? 434 GLY A N     1 
ATOM   4318 C CA    . GLY B 2 433 ? 4.356   33.340 6.695   1.00 34.31 ? 434 GLY A CA    1 
ATOM   4319 C C     . GLY B 2 433 ? 5.774   33.629 6.249   1.00 35.37 ? 434 GLY A C     1 
ATOM   4320 O O     . GLY B 2 433 ? 6.343   32.894 5.451   1.00 34.94 ? 434 GLY A O     1 
ATOM   4321 N N     . VAL B 2 434 ? 6.352   34.710 6.756   1.00 37.04 ? 435 VAL A N     1 
ATOM   4322 C CA    . VAL B 2 434 ? 7.717   35.043 6.390   1.00 38.52 ? 435 VAL A CA    1 
ATOM   4323 C C     . VAL B 2 434 ? 8.495   33.742 6.525   1.00 40.74 ? 435 VAL A C     1 
ATOM   4324 O O     . VAL B 2 434 ? 8.419   33.081 7.559   1.00 40.27 ? 435 VAL A O     1 
ATOM   4325 C CB    . VAL B 2 434 ? 8.334   36.091 7.345   1.00 37.12 ? 435 VAL A CB    1 
ATOM   4326 C CG1   . VAL B 2 434 ? 9.704   36.512 6.839   1.00 36.03 ? 435 VAL A CG1   1 
ATOM   4327 C CG2   . VAL B 2 434 ? 7.421   37.285 7.474   1.00 36.17 ? 435 VAL A CG2   1 
ATOM   4328 N N     . LYS B 2 435 ? 9.218   33.359 5.480   1.00 43.40 ? 436 LYS A N     1 
ATOM   4329 C CA    . LYS B 2 435 ? 9.984   32.124 5.541   1.00 46.72 ? 436 LYS A CA    1 
ATOM   4330 C C     . LYS B 2 435 ? 11.486  32.363 5.565   1.00 49.03 ? 436 LYS A C     1 
ATOM   4331 O O     . LYS B 2 435 ? 11.975  33.349 5.009   1.00 49.22 ? 436 LYS A O     1 
ATOM   4332 C CB    . LYS B 2 435 ? 9.615   31.198 4.368   1.00 47.28 ? 436 LYS A CB    1 
ATOM   4333 C CG    . LYS B 2 435 ? 10.017  31.671 2.980   1.00 47.32 ? 436 LYS A CG    1 
ATOM   4334 C CD    . LYS B 2 435 ? 9.590   30.640 1.934   1.00 47.68 ? 436 LYS A CD    1 
ATOM   4335 C CE    . LYS B 2 435 ? 10.216  30.910 0.569   1.00 48.33 ? 436 LYS A CE    1 
ATOM   4336 N NZ    . LYS B 2 435 ? 9.669   30.016 -0.489  1.00 47.70 ? 436 LYS A NZ    1 
ATOM   4337 N N     . ASP B 2 436 ? 12.199  31.456 6.235   1.00 52.05 ? 437 ASP A N     1 
ATOM   4338 C CA    . ASP B 2 436 ? 13.660  31.492 6.364   1.00 54.20 ? 437 ASP A CA    1 
ATOM   4339 C C     . ASP B 2 436 ? 14.076  30.780 7.652   1.00 54.87 ? 437 ASP A C     1 
ATOM   4340 O O     . ASP B 2 436 ? 13.232  30.028 8.189   1.00 55.34 ? 437 ASP A O     1 
ATOM   4341 C CB    . ASP B 2 436 ? 14.188  32.934 6.376   1.00 55.30 ? 437 ASP A CB    1 
ATOM   4342 C CG    . ASP B 2 436 ? 15.679  33.012 6.072   1.00 56.12 ? 437 ASP A CG    1 
ATOM   4343 O OD1   . ASP B 2 436 ? 16.124  32.332 5.112   1.00 56.05 ? 437 ASP A OD1   1 
ATOM   4344 O OD2   . ASP B 2 436 ? 16.392  33.757 6.790   1.00 55.76 ? 437 ASP A OD2   1 
ATOM   4345 O OXT   . ASP B 2 436 ? 15.235  30.964 8.099   1.00 56.15 ? 437 ASP A OXT   1 
HETATM 4346 S S     . SO4 C 3 .   ? 4.726   14.726 31.389  1.00 54.39 ? 1   SO4 A S     1 
HETATM 4347 O O1    . SO4 C 3 .   ? 5.377   14.649 32.785  1.00 54.21 ? 1   SO4 A O1    1 
HETATM 4348 O O2    . SO4 C 3 .   ? 5.155   13.486 30.605  1.00 55.71 ? 1   SO4 A O2    1 
HETATM 4349 O O3    . SO4 C 3 .   ? 3.307   14.639 31.566  1.00 53.31 ? 1   SO4 A O3    1 
HETATM 4350 O O4    . SO4 C 3 .   ? 5.398   15.797 30.742  1.00 55.17 ? 1   SO4 A O4    1 
HETATM 4351 S S     . SO4 D 3 .   ? -19.828 37.292 20.486  1.00 63.41 ? 438 SO4 A S     1 
HETATM 4352 O O1    . SO4 D 3 .   ? -19.818 35.790 20.844  1.00 64.34 ? 438 SO4 A O1    1 
HETATM 4353 O O2    . SO4 D 3 .   ? -21.256 37.642 20.035  1.00 62.84 ? 438 SO4 A O2    1 
HETATM 4354 O O3    . SO4 D 3 .   ? -19.593 38.020 21.690  1.00 62.30 ? 438 SO4 A O3    1 
HETATM 4355 O O4    . SO4 D 3 .   ? -19.011 37.381 19.303  1.00 63.30 ? 438 SO4 A O4    1 
HETATM 4356 O O     . HOH E 4 .   ? -13.595 27.247 24.722  1.00 36.08 ? 36  HOH B O     1 
HETATM 4357 O O     . HOH E 4 .   ? -33.736 51.152 20.775  1.00 24.84 ? 37  HOH B O     1 
HETATM 4358 O O     . HOH E 4 .   ? -18.967 48.456 15.599  1.00 34.57 ? 38  HOH B O     1 
HETATM 4359 O O     . HOH F 4 .   ? -10.905 24.228 17.312  1.00 13.69 ? 439 HOH A O     1 
HETATM 4360 O O     . HOH F 4 .   ? -31.719 58.191 -10.030 1.00 13.82 ? 440 HOH A O     1 
HETATM 4361 O O     . HOH F 4 .   ? -3.798  10.506 34.658  1.00 18.38 ? 441 HOH A O     1 
HETATM 4362 O O     . HOH F 4 .   ? -17.699 38.058 37.090  1.00 43.31 ? 443 HOH A O     1 
HETATM 4363 O O     . HOH F 4 .   ? -2.585  52.737 7.500   1.00 17.73 ? 444 HOH A O     1 
HETATM 4364 O O     . HOH F 4 .   ? 10.687  1.570  18.728  1.00 41.42 ? 445 HOH A O     1 
HETATM 4365 O O     . HOH F 4 .   ? -5.831  -2.149 22.456  1.00 23.36 ? 446 HOH A O     1 
HETATM 4366 O O     . HOH F 4 .   ? -6.631  34.627 37.584  1.00 28.82 ? 448 HOH A O     1 
HETATM 4367 O O     . HOH F 4 .   ? -8.798  39.218 2.943   1.00 28.36 ? 449 HOH A O     1 
HETATM 4368 O O     . HOH F 4 .   ? -9.977  -1.609 34.095  1.00 38.19 ? 450 HOH A O     1 
HETATM 4369 O O     . HOH F 4 .   ? -8.460  37.862 -0.339  1.00 34.84 ? 452 HOH A O     1 
HETATM 4370 O O     . HOH F 4 .   ? -31.492 63.482 9.905   1.00 17.99 ? 453 HOH A O     1 
HETATM 4371 O O     . HOH F 4 .   ? -11.236 38.334 5.905   1.00 26.87 ? 454 HOH A O     1 
HETATM 4372 O O     . HOH F 4 .   ? -7.037  34.927 11.785  1.00 41.42 ? 455 HOH A O     1 
HETATM 4373 O O     . HOH F 4 .   ? -12.658 -0.350 29.686  1.00 26.30 ? 456 HOH A O     1 
HETATM 4374 O O     . HOH F 4 .   ? -9.963  43.188 35.831  1.00 41.48 ? 457 HOH A O     1 
HETATM 4375 O O     . HOH F 4 .   ? 0.172   30.354 47.766  1.00 37.23 ? 459 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   C   3   3   3   C   C   B . n 
A 1 4   C   4   4   4   C   C   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   G   7   7   7   G   G   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  C   10  10  10  C   C   B . n 
A 1 11  G   11  11  11  G   G   B . n 
A 1 12  G   12  12  12  G   G   B . n 
A 1 13  U   13  13  13  U   U   B . n 
A 1 14  U   14  14  14  U   U   B . n 
A 1 15  C   15  15  15  C   C   B . n 
A 1 16  G   16  16  16  G   G   B . n 
A 1 17  A   17  17  17  A   A   B . n 
A 1 18  U   18  18  18  U   U   B . n 
A 1 19  U   19  19  19  U   U   B . n 
A 1 20  C   20  20  20  C   C   B . n 
A 1 21  C   21  21  21  C   C   B . n 
A 1 22  G   22  22  22  G   G   B . n 
A 1 23  C   23  23  23  C   C   B . n 
A 1 24  C   24  24  24  C   C   B . n 
A 1 25  C   25  25  25  C   C   B . n 
A 1 26  U   26  26  26  U   U   B . n 
A 1 27  G   27  27  27  G   G   B . n 
A 1 28  G   28  28  28  G   G   B . n 
A 1 29  G   29  29  29  G   G   B . n 
A 1 30  C   30  30  30  C   C   B . n 
A 1 31  C   31  31  31  C   C   B . n 
A 1 32  A   32  32  32  A   A   B . n 
A 1 33  U   33  33  33  U   U   B . n 
A 1 34  C   34  34  34  C   C   B . n 
B 2 1   LYS 1   2   2   LYS LYS A . n 
B 2 2   VAL 2   3   3   VAL VAL A . n 
B 2 3   GLU 3   4   4   GLU GLU A . n 
B 2 4   GLU 4   5   5   GLU GLU A . n 
B 2 5   ILE 5   6   6   ILE ILE A . n 
B 2 6   LEU 6   7   7   LEU LEU A . n 
B 2 7   GLU 7   8   8   GLU GLU A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ALA 9   10  10  ALA ALA A . n 
B 2 10  LEU 10  11  11  LEU LEU A . n 
B 2 11  GLU 11  12  12  GLU GLU A . n 
B 2 12  LEU 12  13  13  LEU LEU A . n 
B 2 13  VAL 13  14  14  VAL VAL A . n 
B 2 14  ILE 14  15  15  ILE ILE A . n 
B 2 15  PRO 15  16  16  PRO PRO A . n 
B 2 16  ASP 16  17  17  ASP ASP A . n 
B 2 17  GLU 17  18  18  GLU GLU A . n 
B 2 18  GLU 18  19  19  GLU GLU A . n 
B 2 19  GLU 19  20  20  GLU GLU A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ARG 21  22  22  ARG ARG A . n 
B 2 22  LYS 22  23  23  LYS LYS A . n 
B 2 23  GLY 23  24  24  GLY GLY A . n 
B 2 24  ARG 24  25  25  ARG ARG A . n 
B 2 25  GLU 25  26  26  GLU GLU A . n 
B 2 26  ALA 26  27  27  ALA ALA A . n 
B 2 27  GLU 27  28  28  GLU GLU A . n 
B 2 28  GLU 28  29  29  GLU GLU A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  LEU 30  31  31  LEU LEU A . n 
B 2 31  ARG 31  32  32  ARG ARG A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ARG 33  34  34  ARG ARG A . n 
B 2 34  LEU 34  35  35  LEU LEU A . n 
B 2 35  ASP 35  36  36  ASP ASP A . n 
B 2 36  GLU 36  37  37  GLU GLU A . n 
B 2 37  LEU 37  38  38  LEU LEU A . n 
B 2 38  GLY 38  39  39  GLY GLY A . n 
B 2 39  VAL 39  40  40  VAL VAL A . n 
B 2 40  GLU 40  41  41  GLU GLU A . n 
B 2 41  TYR 41  42  42  TYR TYR A . n 
B 2 42  VAL 42  43  43  VAL VAL A . n 
B 2 43  PHE 43  44  44  PHE PHE A . n 
B 2 44  VAL 44  45  45  VAL VAL A . n 
B 2 45  GLY 45  46  46  GLY GLY A . n 
B 2 46  SER 46  47  47  SER SER A . n 
B 2 47  TYR 47  48  48  TYR TYR A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  ARG 49  50  50  ARG ARG A . n 
B 2 50  ASN 50  51  51  ASN ASN A . n 
B 2 51  THR 51  52  52  THR THR A . n 
B 2 52  TRP 52  53  53  TRP TRP A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  LYS 54  55  55  LYS LYS A . n 
B 2 55  GLY 55  56  56  GLY GLY A . n 
B 2 56  SER 56  57  57  SER SER A . n 
B 2 57  LEU 57  58  58  LEU LEU A . n 
B 2 58  GLU 58  59  59  GLU GLU A . n 
B 2 59  ILE 59  60  60  ILE ILE A . n 
B 2 60  ASP 60  61  61  ASP ASP A . n 
B 2 61  VAL 61  62  62  VAL VAL A . n 
B 2 62  PHE 62  63  63  PHE PHE A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  PHE 65  66  66  PHE PHE A . n 
B 2 66  PRO 66  67  67  PRO PRO A . n 
B 2 67  GLU 67  68  68  GLU GLU A . n 
B 2 68  GLU 68  69  69  GLU GLU A . n 
B 2 69  PHE 69  70  70  PHE PHE A . n 
B 2 70  SER 70  71  71  SER SER A . n 
B 2 71  LYS 71  72  72  LYS LYS A . n 
B 2 72  GLU 72  73  73  GLU GLU A . n 
B 2 73  GLU 73  74  74  GLU GLU A . n 
B 2 74  LEU 74  75  75  LEU LEU A . n 
B 2 75  ARG 75  76  76  ARG ARG A . n 
B 2 76  GLU 76  77  77  GLU GLU A . n 
B 2 77  ARG 77  78  78  ARG ARG A . n 
B 2 78  GLY 78  79  79  GLY GLY A . n 
B 2 79  LEU 79  80  80  LEU LEU A . n 
B 2 80  GLU 80  81  81  GLU GLU A . n 
B 2 81  ILE 81  82  82  ILE ILE A . n 
B 2 82  GLY 82  83  83  GLY GLY A . n 
B 2 83  LYS 83  84  84  LYS LYS A . n 
B 2 84  ALA 84  85  85  ALA ALA A . n 
B 2 85  VAL 85  86  86  VAL VAL A . n 
B 2 86  LEU 86  87  87  LEU LEU A . n 
B 2 87  ASP 87  88  88  ASP ASP A . n 
B 2 88  SER 88  89  89  SER SER A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  GLU 90  91  91  GLU GLU A . n 
B 2 91  ILE 91  92  92  ILE ILE A . n 
B 2 92  ARG 92  93  93  ARG ARG A . n 
B 2 93  TYR 93  94  94  TYR TYR A . n 
B 2 94  ALA 94  95  95  ALA ALA A . n 
B 2 95  GLU 95  96  96  GLU GLU A . n 
B 2 96  HIS 96  97  97  HIS HIS A . n 
B 2 97  PRO 97  98  98  PRO PRO A . n 
B 2 98  TYR 98  99  99  TYR TYR A . n 
B 2 99  VAL 99  100 100 VAL VAL A . n 
B 2 100 HIS 100 101 101 HIS HIS A . n 
B 2 101 GLY 101 102 102 GLY GLY A . n 
B 2 102 VAL 102 103 103 VAL VAL A . n 
B 2 103 VAL 103 104 104 VAL VAL A . n 
B 2 104 LYS 104 105 105 LYS LYS A . n 
B 2 105 GLY 105 106 106 GLY GLY A . n 
B 2 106 VAL 106 107 107 VAL VAL A . n 
B 2 107 GLU 107 108 108 GLU GLU A . n 
B 2 108 VAL 108 109 109 VAL VAL A . n 
B 2 109 ASP 109 110 110 ASP ASP A . n 
B 2 110 VAL 110 111 111 VAL VAL A . n 
B 2 111 VAL 111 112 112 VAL VAL A . n 
B 2 112 PRO 112 113 113 PRO PRO A . n 
B 2 113 CYS 113 114 114 CYS CYS A . n 
B 2 114 TYR 114 115 115 TYR TYR A . n 
B 2 115 LYS 115 116 116 LYS LYS A . n 
B 2 116 LEU 116 117 117 LEU LEU A . n 
B 2 117 LYS 117 118 118 LYS LYS A . n 
B 2 118 GLU 118 119 119 GLU GLU A . n 
B 2 119 PRO 119 120 120 PRO PRO A . n 
B 2 120 LYS 120 121 121 LYS LYS A . n 
B 2 121 ASN 121 122 122 ASN ASN A . n 
B 2 122 ILE 122 123 123 ILE ILE A . n 
B 2 123 LYS 123 124 124 LYS LYS A . n 
B 2 124 SER 124 125 125 SER SER A . n 
B 2 125 ALA 125 126 126 ALA ALA A . n 
B 2 126 VAL 126 127 127 VAL VAL A . n 
B 2 127 ASP 127 128 128 ASP ASP A . n 
B 2 128 ARG 128 129 129 ARG ARG A . n 
B 2 129 THR 129 130 130 THR THR A . n 
B 2 130 PRO 130 131 131 PRO PRO A . n 
B 2 131 PHE 131 132 132 PHE PHE A . n 
B 2 132 HIS 132 133 133 HIS HIS A . n 
B 2 133 HIS 133 134 134 HIS HIS A . n 
B 2 134 LYS 134 135 135 LYS LYS A . n 
B 2 135 TRP 135 136 136 TRP TRP A . n 
B 2 136 LEU 136 137 137 LEU LEU A . n 
B 2 137 GLU 137 138 138 GLU GLU A . n 
B 2 138 GLY 138 139 139 GLY GLY A . n 
B 2 139 ARG 139 140 140 ARG ARG A . n 
B 2 140 ILE 140 141 141 ILE ILE A . n 
B 2 141 LYS 141 142 142 LYS LYS A . n 
B 2 142 GLY 142 143 143 GLY GLY A . n 
B 2 143 LYS 143 144 144 LYS LYS A . n 
B 2 144 GLU 144 145 145 GLU GLU A . n 
B 2 145 ASN 145 146 146 ASN ASN A . n 
B 2 146 GLU 146 147 147 GLU GLU A . n 
B 2 147 VAL 147 148 148 VAL VAL A . n 
B 2 148 ARG 148 149 149 ARG ARG A . n 
B 2 149 LEU 149 150 150 LEU LEU A . n 
B 2 150 LEU 150 151 151 LEU LEU A . n 
B 2 151 LYS 151 152 152 LYS LYS A . n 
B 2 152 GLY 152 153 153 GLY GLY A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 LEU 154 155 155 LEU LEU A . n 
B 2 155 LYS 155 156 156 LYS LYS A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 ASN 157 158 158 ASN ASN A . n 
B 2 158 GLY 158 159 159 GLY GLY A . n 
B 2 159 ILE 159 160 160 ILE ILE A . n 
B 2 160 TYR 160 161 161 TYR TYR A . n 
B 2 161 GLY 161 162 162 GLY GLY A . n 
B 2 162 ALA 162 163 163 ALA ALA A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 TYR 164 165 165 TYR TYR A . n 
B 2 165 LYS 165 166 166 LYS LYS A . n 
B 2 166 VAL 166 167 167 VAL VAL A . n 
B 2 167 ARG 167 168 168 ARG ARG A . n 
B 2 168 GLY 168 169 169 GLY GLY A . n 
B 2 169 PHE 169 170 170 PHE PHE A . n 
B 2 170 SER 170 171 171 SER SER A . n 
B 2 171 GLY 171 172 172 GLY GLY A . n 
B 2 172 TYR 172 173 173 TYR TYR A . n 
B 2 173 LEU 173 174 174 LEU LEU A . n 
B 2 174 CYS 174 175 175 CYS CYS A . n 
B 2 175 GLU 175 176 176 GLU GLU A . n 
B 2 176 LEU 176 177 177 LEU LEU A . n 
B 2 177 LEU 177 178 178 LEU LEU A . n 
B 2 178 ILE 178 179 179 ILE ILE A . n 
B 2 179 VAL 179 180 180 VAL VAL A . n 
B 2 180 PHE 180 181 181 PHE PHE A . n 
B 2 181 TYR 181 182 182 TYR TYR A . n 
B 2 182 GLY 182 183 183 GLY GLY A . n 
B 2 183 SER 183 184 184 SER SER A . n 
B 2 184 PHE 184 185 185 PHE PHE A . n 
B 2 185 LEU 185 186 186 LEU LEU A . n 
B 2 186 GLU 186 187 187 GLU GLU A . n 
B 2 187 THR 187 188 188 THR THR A . n 
B 2 188 VAL 188 189 189 VAL VAL A . n 
B 2 189 LYS 189 190 190 LYS LYS A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 ALA 191 192 192 ALA ALA A . n 
B 2 192 ARG 192 193 193 ARG ARG A . n 
B 2 193 ARG 193 194 194 ARG ARG A . n 
B 2 194 TRP 194 195 195 TRP TRP A . n 
B 2 195 THR 195 196 196 THR THR A . n 
B 2 196 ARG 196 197 197 ARG ARG A . n 
B 2 197 ARG 197 198 198 ARG ARG A . n 
B 2 198 THR 198 199 199 THR THR A . n 
B 2 199 VAL 199 200 200 VAL VAL A . n 
B 2 200 ILE 200 201 201 ILE ILE A . n 
B 2 201 ASP 201 202 202 ASP ASP A . n 
B 2 202 VAL 202 203 203 VAL VAL A . n 
B 2 203 ALA 203 204 204 ALA ALA A . n 
B 2 204 LYS 204 205 205 LYS LYS A . n 
B 2 205 GLY 205 206 206 GLY GLY A . n 
B 2 206 GLU 206 207 207 GLU GLU A . n 
B 2 207 VAL 207 208 208 VAL VAL A . n 
B 2 208 ARG 208 209 209 ARG ARG A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 GLY 210 211 211 GLY GLY A . n 
B 2 211 GLU 211 212 212 GLU GLU A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 PHE 213 214 214 PHE PHE A . n 
B 2 214 PHE 214 215 215 PHE PHE A . n 
B 2 215 VAL 215 216 216 VAL VAL A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 ASP 217 218 218 ASP ASP A . n 
B 2 218 PRO 218 219 219 PRO PRO A . n 
B 2 219 VAL 219 220 220 VAL VAL A . n 
B 2 220 ASP 220 221 221 ASP ASP A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 LYS 222 223 223 LYS LYS A . n 
B 2 223 ARG 223 224 224 ARG ARG A . n 
B 2 224 ASN 224 225 225 ASN ASN A . n 
B 2 225 VAL 225 226 226 VAL VAL A . n 
B 2 226 ALA 226 227 227 ALA ALA A . n 
B 2 227 ALA 227 228 228 ALA ALA A . n 
B 2 228 ASN 228 229 229 ASN ASN A . n 
B 2 229 LEU 229 230 230 LEU LEU A . n 
B 2 230 SER 230 231 231 SER SER A . n 
B 2 231 LEU 231 232 232 LEU LEU A . n 
B 2 232 ASP 232 233 233 ASP ASP A . n 
B 2 233 ASN 233 234 234 ASN ASN A . n 
B 2 234 LEU 234 235 235 LEU LEU A . n 
B 2 235 ALA 235 236 236 ALA ALA A . n 
B 2 236 ARG 236 237 237 ARG ARG A . n 
B 2 237 PHE 237 238 238 PHE PHE A . n 
B 2 238 VAL 238 239 239 VAL VAL A . n 
B 2 239 HIS 239 240 240 HIS HIS A . n 
B 2 240 LEU 240 241 241 LEU LEU A . n 
B 2 241 CYS 241 242 242 CYS CYS A . n 
B 2 242 ARG 242 243 243 ARG ARG A . n 
B 2 243 GLU 243 244 244 GLU GLU A . n 
B 2 244 PHE 244 245 245 PHE PHE A . n 
B 2 245 MET 245 246 246 MET MET A . n 
B 2 246 GLU 246 247 247 GLU GLU A . n 
B 2 247 ALA 247 248 248 ALA ALA A . n 
B 2 248 PRO 248 249 249 PRO PRO A . n 
B 2 249 SER 249 250 250 SER SER A . n 
B 2 250 LEU 250 251 251 LEU LEU A . n 
B 2 251 GLY 251 252 252 GLY GLY A . n 
B 2 252 PHE 252 253 253 PHE PHE A . n 
B 2 253 PHE 253 254 254 PHE PHE A . n 
B 2 254 LYS 254 255 255 LYS LYS A . n 
B 2 255 PRO 255 256 256 PRO PRO A . n 
B 2 256 LYS 256 257 257 LYS LYS A . n 
B 2 257 HIS 257 258 258 HIS HIS A . n 
B 2 258 PRO 258 259 259 PRO PRO A . n 
B 2 259 LEU 259 260 260 LEU LEU A . n 
B 2 260 GLU 260 261 261 GLU GLU A . n 
B 2 261 ILE 261 262 262 ILE ILE A . n 
B 2 262 GLU 262 263 263 GLU GLU A . n 
B 2 263 PRO 263 264 264 PRO PRO A . n 
B 2 264 GLU 264 265 265 GLU GLU A . n 
B 2 265 ARG 265 266 266 ARG ARG A . n 
B 2 266 LEU 266 267 267 LEU LEU A . n 
B 2 267 ARG 267 268 268 ARG ARG A . n 
B 2 268 LYS 268 269 269 LYS LYS A . n 
B 2 269 ILE 269 270 270 ILE ILE A . n 
B 2 270 VAL 270 271 271 VAL VAL A . n 
B 2 271 GLU 271 272 272 GLU GLU A . n 
B 2 272 GLU 272 273 273 GLU GLU A . n 
B 2 273 ARG 273 274 274 ARG ARG A . n 
B 2 274 GLY 274 275 275 GLY GLY A . n 
B 2 275 THR 275 276 276 THR THR A . n 
B 2 276 ALA 276 277 277 ALA ALA A . n 
B 2 277 VAL 277 278 278 VAL VAL A . n 
B 2 278 PHE 278 279 279 PHE PHE A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 VAL 280 281 281 VAL VAL A . n 
B 2 281 LYS 281 282 282 LYS LYS A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 ARG 283 284 284 ARG ARG A . n 
B 2 284 LYS 284 285 285 LYS LYS A . n 
B 2 285 PRO 285 286 286 PRO PRO A . n 
B 2 286 ASP 286 287 287 ASP ASP A . n 
B 2 287 ILE 287 288 288 ILE ILE A . n 
B 2 288 VAL 288 289 289 VAL VAL A . n 
B 2 289 ASP 289 290 290 ASP ASP A . n 
B 2 290 ASP 290 291 291 ASP ASP A . n 
B 2 291 ASN 291 292 292 ASN ASN A . n 
B 2 292 LEU 292 293 293 LEU LEU A . n 
B 2 293 TYR 293 294 294 TYR TYR A . n 
B 2 294 PRO 294 295 295 PRO PRO A . n 
B 2 295 GLN 295 296 296 GLN GLN A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLU 297 298 298 GLU GLU A . n 
B 2 298 ARG 298 299 299 ARG ARG A . n 
B 2 299 ALA 299 300 300 ALA ALA A . n 
B 2 300 SER 300 301 301 SER SER A . n 
B 2 301 ARG 301 302 302 ARG ARG A . n 
B 2 302 LYS 302 303 303 LYS LYS A . n 
B 2 303 ILE 303 304 304 ILE ILE A . n 
B 2 304 PHE 304 305 305 PHE PHE A . n 
B 2 305 GLU 305 306 306 GLU GLU A . n 
B 2 306 PHE 306 307 307 PHE PHE A . n 
B 2 307 LEU 307 308 308 LEU LEU A . n 
B 2 308 GLU 308 309 309 GLU GLU A . n 
B 2 309 ARG 309 310 310 ARG ARG A . n 
B 2 310 GLU 310 311 311 GLU GLU A . n 
B 2 311 ASN 311 312 312 ASN ASN A . n 
B 2 312 PHE 312 313 313 PHE PHE A . n 
B 2 313 MET 313 314 314 MET MET A . n 
B 2 314 PRO 314 315 315 PRO PRO A . n 
B 2 315 LEU 315 316 316 LEU LEU A . n 
B 2 316 ARG 316 317 317 ARG ARG A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ALA 318 319 319 ALA ALA A . n 
B 2 319 PHE 319 320 320 PHE PHE A . n 
B 2 320 LYS 320 321 321 LYS LYS A . n 
B 2 321 ALA 321 322 322 ALA ALA A . n 
B 2 322 SER 322 323 323 SER SER A . n 
B 2 323 GLU 323 324 324 GLU GLU A . n 
B 2 324 GLU 324 325 325 GLU GLU A . n 
B 2 325 PHE 325 326 326 PHE PHE A . n 
B 2 326 CYS 326 327 327 CYS CYS A . n 
B 2 327 TYR 327 328 328 TYR TYR A . n 
B 2 328 LEU 328 329 329 LEU LEU A . n 
B 2 329 LEU 329 330 330 LEU LEU A . n 
B 2 330 PHE 330 331 331 PHE PHE A . n 
B 2 331 GLU 331 332 332 GLU GLU A . n 
B 2 332 CYS 332 333 333 CYS CYS A . n 
B 2 333 GLN 333 334 334 GLN GLN A . n 
B 2 334 ILE 334 335 335 ILE ILE A . n 
B 2 335 LYS 335 336 336 LYS LYS A . n 
B 2 336 GLU 336 337 337 GLU GLU A . n 
B 2 337 ILE 337 338 338 ILE ILE A . n 
B 2 338 SER 338 339 339 SER SER A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 VAL 340 341 341 VAL VAL A . n 
B 2 341 PHE 341 342 342 PHE PHE A . n 
B 2 342 ARG 342 343 343 ARG ARG A . n 
B 2 343 ARG 343 344 344 ARG ARG A . n 
B 2 344 MET 344 345 345 MET MET A . n 
B 2 345 GLY 345 346 346 GLY GLY A . n 
B 2 346 PRO 346 347 347 PRO PRO A . n 
B 2 347 GLN 347 348 348 GLN GLN A . n 
B 2 348 PHE 348 349 349 PHE PHE A . n 
B 2 349 GLU 349 350 350 GLU GLU A . n 
B 2 350 ASP 350 351 351 ASP ASP A . n 
B 2 351 GLU 351 352 352 GLU GLU A . n 
B 2 352 ARG 352 353 353 ARG ARG A . n 
B 2 353 ASN 353 354 354 ASN ASN A . n 
B 2 354 VAL 354 355 355 VAL VAL A . n 
B 2 355 LYS 355 356 356 LYS LYS A . n 
B 2 356 LYS 356 357 357 LYS LYS A . n 
B 2 357 PHE 357 358 358 PHE PHE A . n 
B 2 358 LEU 358 359 359 LEU LEU A . n 
B 2 359 SER 359 360 360 SER SER A . n 
B 2 360 ARG 360 361 361 ARG ARG A . n 
B 2 361 ASN 361 362 362 ASN ASN A . n 
B 2 362 ARG 362 363 363 ARG ARG A . n 
B 2 363 ALA 363 364 364 ALA ALA A . n 
B 2 364 PHE 364 365 365 PHE PHE A . n 
B 2 365 ARG 365 366 366 ARG ARG A . n 
B 2 366 PRO 366 367 367 PRO PRO A . n 
B 2 367 PHE 367 368 368 PHE PHE A . n 
B 2 368 ILE 368 369 369 ILE ILE A . n 
B 2 369 GLU 369 370 370 GLU GLU A . n 
B 2 370 ASN 370 371 371 ASN ASN A . n 
B 2 371 GLY 371 372 372 GLY GLY A . n 
B 2 372 ARG 372 373 373 ARG ARG A . n 
B 2 373 TRP 373 374 374 TRP TRP A . n 
B 2 374 TRP 374 375 375 TRP TRP A . n 
B 2 375 ALA 375 376 376 ALA ALA A . n 
B 2 376 PHE 376 377 377 PHE PHE A . n 
B 2 377 GLU 377 378 378 GLU GLU A . n 
B 2 378 MET 378 379 379 MET MET A . n 
B 2 379 ARG 379 380 380 ARG ARG A . n 
B 2 380 LYS 380 381 381 LYS LYS A . n 
B 2 381 PHE 381 382 382 PHE PHE A . n 
B 2 382 THR 382 383 383 THR THR A . n 
B 2 383 THR 383 384 384 THR THR A . n 
B 2 384 PRO 384 385 385 PRO PRO A . n 
B 2 385 GLU 385 386 386 GLU GLU A . n 
B 2 386 GLU 386 387 387 GLU GLU A . n 
B 2 387 GLY 387 388 388 GLY GLY A . n 
B 2 388 VAL 388 389 389 VAL VAL A . n 
B 2 389 ARG 389 390 390 ARG ARG A . n 
B 2 390 SER 390 391 391 SER SER A . n 
B 2 391 TYR 391 392 392 TYR TYR A . n 
B 2 392 ALA 392 393 393 ALA ALA A . n 
B 2 393 SER 393 394 394 SER SER A . n 
B 2 394 THR 394 395 395 THR THR A . n 
B 2 395 HIS 395 396 396 HIS HIS A . n 
B 2 396 TRP 396 397 397 TRP TRP A . n 
B 2 397 HIS 397 398 398 HIS HIS A . n 
B 2 398 THR 398 399 399 THR THR A . n 
B 2 399 LEU 399 400 400 LEU LEU A . n 
B 2 400 GLY 400 401 401 GLY GLY A . n 
B 2 401 LYS 401 402 402 LYS LYS A . n 
B 2 402 ASN 402 403 403 ASN ASN A . n 
B 2 403 VAL 403 404 404 VAL VAL A . n 
B 2 404 GLY 404 405 405 GLY GLY A . n 
B 2 405 GLU 405 406 406 GLU GLU A . n 
B 2 406 SER 406 407 407 SER SER A . n 
B 2 407 ILE 407 408 408 ILE ILE A . n 
B 2 408 ARG 408 409 409 ARG ARG A . n 
B 2 409 GLU 409 410 410 GLU GLU A . n 
B 2 410 TYR 410 411 411 TYR TYR A . n 
B 2 411 PHE 411 412 412 PHE PHE A . n 
B 2 412 GLU 412 413 413 GLU GLU A . n 
B 2 413 ILE 413 414 414 ILE ILE A . n 
B 2 414 ILE 414 415 415 ILE ILE A . n 
B 2 415 SER 415 416 416 SER SER A . n 
B 2 416 GLY 416 417 417 GLY GLY A . n 
B 2 417 GLU 417 418 418 GLU GLU A . n 
B 2 418 LYS 418 419 419 LYS LYS A . n 
B 2 419 LEU 419 420 420 LEU LEU A . n 
B 2 420 PHE 420 421 421 PHE PHE A . n 
B 2 421 LYS 421 422 422 LYS LYS A . n 
B 2 422 GLU 422 423 423 GLU GLU A . n 
B 2 423 PRO 423 424 424 PRO PRO A . n 
B 2 424 VAL 424 425 425 VAL VAL A . n 
B 2 425 THR 425 426 426 THR THR A . n 
B 2 426 ALA 426 427 427 ALA ALA A . n 
B 2 427 GLU 427 428 428 GLU GLU A . n 
B 2 428 LEU 428 429 429 LEU LEU A . n 
B 2 429 CYS 429 430 430 CYS CYS A . n 
B 2 430 GLU 430 431 431 GLU GLU A . n 
B 2 431 MET 431 432 432 MET MET A . n 
B 2 432 MET 432 433 433 MET MET A . n 
B 2 433 GLY 433 434 434 GLY GLY A . n 
B 2 434 VAL 434 435 435 VAL VAL A . n 
B 2 435 LYS 435 436 436 LYS LYS A . n 
B 2 436 ASP 436 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  1   1   SO4 SO4 A . 
D 3 SO4 1  438 438 SO4 SO4 A . 
E 4 HOH 1  36  36  HOH HOH B . 
E 4 HOH 2  37  37  HOH HOH B . 
E 4 HOH 3  38  38  HOH HOH B . 
F 4 HOH 1  439 439 HOH HOH A . 
F 4 HOH 2  440 440 HOH HOH A . 
F 4 HOH 3  441 441 HOH HOH A . 
F 4 HOH 4  443 443 HOH HOH A . 
F 4 HOH 5  444 444 HOH HOH A . 
F 4 HOH 6  445 445 HOH HOH A . 
F 4 HOH 7  446 446 HOH HOH A . 
F 4 HOH 8  448 448 HOH HOH A . 
F 4 HOH 9  449 449 HOH HOH A . 
F 4 HOH 10 450 450 HOH HOH A . 
F 4 HOH 11 452 452 HOH HOH A . 
F 4 HOH 12 453 453 HOH HOH A . 
F 4 HOH 13 454 454 HOH HOH A . 
F 4 HOH 14 455 455 HOH HOH A . 
F 4 HOH 15 456 456 HOH HOH A . 
F 4 HOH 16 457 457 HOH HOH A . 
F 4 HOH 17 459 459 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3160  ? 
1 MORE         -49   ? 
1 'SSA (A^2)'  27080 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1     ? 1 
ADSC     'data collection' Quantum ? 2 
HKL-2000 'data reduction'  .       ? 3 
HKL-2000 'data scaling'    .       ? 4 
AMoRE    phasing           .       ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              119 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              120 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              120 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.49 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.19 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 3   ? ? -27.51  -64.29  
2  1 GLU A 37  ? ? -69.30  22.70   
3  1 LEU A 38  ? ? -146.45 -6.24   
4  1 SER A 47  ? ? -42.98  -18.16  
5  1 SER A 57  ? ? -112.42 51.77   
6  1 GLU A 91  ? ? -174.85 105.95  
7  1 ALA A 95  ? ? -165.53 -146.77 
8  1 GLU A 119 ? ? 72.31   119.35  
9  1 PRO A 120 ? ? -23.80  -40.14  
10 1 ASN A 122 ? ? 86.62   -16.66  
11 1 TYR A 165 ? ? -54.58  -7.11   
12 1 ASN A 229 ? ? -91.30  34.83   
13 1 LEU A 260 ? ? 51.08   75.89   
14 1 MET A 314 ? ? 50.21   73.89   
15 1 LEU A 316 ? ? -98.86  -69.03  
16 1 GLU A 325 ? ? -84.32  -76.92  
17 1 ARG A 366 ? ? 61.62   101.36  
18 1 TYR A 411 ? ? -177.68 126.51  
19 1 PRO A 424 ? ? -69.98  57.53   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ZHB 'double helix'         
2ZHB 'a-form double helix'  
2ZHB 'hairpin loop'         
2ZHB 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 -1.239 -0.037 0.639  11.873  -4.208  -3.046  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.115 -0.083 0.345  12.343  -10.800 3.104   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.163  0.073  0.221  7.046   -14.580 4.061   3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 0.021  0.483  0.160  -6.325  -3.893  11.667  4  B_C4:G28_B  B 4  ? B 28 ? ?  1 
1 A C 5  1_555 A G 27 1_555 0.874  -0.129 -0.161 4.682   -1.668  5.347   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.753 -0.728 -0.505 -6.398  -10.523 9.579   6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 0.464  0.266  -0.096 -7.584  -6.673  -4.781  7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.559  -0.253 0.204  -2.312  -8.816  3.065   8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.823 -0.147 -0.813 -20.418 -16.366 -3.226  9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 0.080  -0.147 0.090  -5.497  -4.310  -5.277  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 0.014  -0.105 0.195  -5.305  -12.649 2.810   11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 0.506  0.270  -0.013 -8.245  -19.009 -0.286  12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.413  -2.522 0.135  -6.464  9.171   -89.066 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 0.307  -1.548 3.129 0.216  8.865  42.091 -2.914  -0.399 2.764 12.181 -0.296  
42.973 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.278 -1.771 3.365 -2.547 3.345  32.460 -3.723  0.051  3.183 5.953  4.532   
32.723 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.061 -1.933 3.322 -1.704 8.509  31.911 -4.756  -0.165 2.729 15.131 3.030   
33.040 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 -0.568 -1.856 2.967 -0.883 3.535  30.833 -4.064  0.913  2.758 6.619  1.654   
31.043 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.530  -2.843 3.443 1.532  13.599 13.697 -13.359 -4.002 0.575 44.896 -5.056  
19.339 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -1.192 -1.913 3.352 -4.590 -2.259 41.669 -2.423  1.159  3.552 -3.162 6.424   
41.968 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 0.311  -1.820 3.117 1.697  5.979  33.959 -3.909  -0.285 2.778 10.132 -2.875  
34.506 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.336  -2.017 3.755 10.665 10.120 20.568 -7.695  2.477  2.409 24.678 -26.008 
25.236 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.941  -2.320 2.939 -3.473 3.025  31.673 -4.673  -2.241 2.597 5.506  6.321   
31.997 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.538 -2.019 3.085 -0.854 6.373  27.977 -5.335  0.917  2.586 12.966 1.737   
28.693 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.115  -1.658 3.256 2.681  6.747  38.873 -3.210  0.131  2.940 10.031 -3.986  
39.520 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.781 -2.287 3.237 1.844  -2.089 78.662 -1.747  1.454  3.252 -1.647 -1.454  
78.704 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#