data_2ZLB
# 
_entry.id   2ZLB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZLB         
RCSB  RCSB028115   
WWPDB D_1000028115 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1VID 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF CATECHOL O-METHYLTRANSFERASE COMPLEXED WITH INHIBITOR.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZLB 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-04 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Tsuji, E.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase' 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_volume            165 
_citation.page_first                133 
_citation.page_last                 139 
_citation.year                      2009 
_citation.journal_id_ASTM           JSBIEM 
_citation.country                   US 
_citation.journal_id_ISSN           1047-8477 
_citation.journal_id_CSD            0803 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19111934 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2008.11.012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tsuji, E.'   1 
primary 'Okazaki, K.' 2 
primary 'Isaji, M.'   3 
primary 'Takeda, K.'  4 
# 
_cell.entry_id           2ZLB 
_cell.length_a           56.262 
_cell.length_b           56.262 
_cell.length_c           117.483 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZLB 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Catechol O-methyltransferase' 24916.531 1   2.1.1.6 ? ? ? 
2 non-polymer syn 'SULFATE ION'                  96.063    1   ?       ? ? ? 
3 water       nat water                          18.015    149 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMAR
LLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCG
LLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMAR
LLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCG
LLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   GLY n 
1 5   ASP n 
1 6   THR n 
1 7   LYS n 
1 8   GLU n 
1 9   GLN n 
1 10  ARG n 
1 11  ILE n 
1 12  LEU n 
1 13  ARG n 
1 14  TYR n 
1 15  VAL n 
1 16  GLN n 
1 17  GLN n 
1 18  ASN n 
1 19  ALA n 
1 20  LYS n 
1 21  PRO n 
1 22  GLY n 
1 23  ASP n 
1 24  PRO n 
1 25  GLN n 
1 26  SER n 
1 27  VAL n 
1 28  LEU n 
1 29  GLU n 
1 30  ALA n 
1 31  ILE n 
1 32  ASP n 
1 33  THR n 
1 34  TYR n 
1 35  CYS n 
1 36  THR n 
1 37  GLN n 
1 38  LYS n 
1 39  GLU n 
1 40  TRP n 
1 41  ALA n 
1 42  MET n 
1 43  ASN n 
1 44  VAL n 
1 45  GLY n 
1 46  ASP n 
1 47  ALA n 
1 48  LYS n 
1 49  GLY n 
1 50  GLN n 
1 51  ILE n 
1 52  MET n 
1 53  ASP n 
1 54  ALA n 
1 55  VAL n 
1 56  ILE n 
1 57  ARG n 
1 58  GLU n 
1 59  TYR n 
1 60  SER n 
1 61  PRO n 
1 62  SER n 
1 63  LEU n 
1 64  VAL n 
1 65  LEU n 
1 66  GLU n 
1 67  LEU n 
1 68  GLY n 
1 69  ALA n 
1 70  TYR n 
1 71  CYS n 
1 72  GLY n 
1 73  TYR n 
1 74  SER n 
1 75  ALA n 
1 76  VAL n 
1 77  ARG n 
1 78  MET n 
1 79  ALA n 
1 80  ARG n 
1 81  LEU n 
1 82  LEU n 
1 83  GLN n 
1 84  PRO n 
1 85  GLY n 
1 86  ALA n 
1 87  ARG n 
1 88  LEU n 
1 89  LEU n 
1 90  THR n 
1 91  MET n 
1 92  GLU n 
1 93  MET n 
1 94  ASN n 
1 95  PRO n 
1 96  ASP n 
1 97  TYR n 
1 98  ALA n 
1 99  ALA n 
1 100 ILE n 
1 101 THR n 
1 102 GLN n 
1 103 GLN n 
1 104 MET n 
1 105 LEU n 
1 106 ASN n 
1 107 PHE n 
1 108 ALA n 
1 109 GLY n 
1 110 LEU n 
1 111 GLN n 
1 112 ASP n 
1 113 LYS n 
1 114 VAL n 
1 115 THR n 
1 116 ILE n 
1 117 LEU n 
1 118 ASN n 
1 119 GLY n 
1 120 ALA n 
1 121 SER n 
1 122 GLN n 
1 123 ASP n 
1 124 LEU n 
1 125 ILE n 
1 126 PRO n 
1 127 GLN n 
1 128 LEU n 
1 129 LYS n 
1 130 LYS n 
1 131 LYS n 
1 132 TYR n 
1 133 ASP n 
1 134 VAL n 
1 135 ASP n 
1 136 THR n 
1 137 LEU n 
1 138 ASP n 
1 139 MET n 
1 140 VAL n 
1 141 PHE n 
1 142 LEU n 
1 143 ASP n 
1 144 HIS n 
1 145 TRP n 
1 146 LYS n 
1 147 ASP n 
1 148 ARG n 
1 149 TYR n 
1 150 LEU n 
1 151 PRO n 
1 152 ASP n 
1 153 THR n 
1 154 LEU n 
1 155 LEU n 
1 156 LEU n 
1 157 GLU n 
1 158 LYS n 
1 159 CYS n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 ARG n 
1 164 LYS n 
1 165 GLY n 
1 166 THR n 
1 167 VAL n 
1 168 LEU n 
1 169 LEU n 
1 170 ALA n 
1 171 ASP n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 PRO n 
1 177 GLY n 
1 178 THR n 
1 179 PRO n 
1 180 ASP n 
1 181 PHE n 
1 182 LEU n 
1 183 ALA n 
1 184 TYR n 
1 185 VAL n 
1 186 ARG n 
1 187 GLY n 
1 188 SER n 
1 189 SER n 
1 190 SER n 
1 191 PHE n 
1 192 GLU n 
1 193 CYS n 
1 194 THR n 
1 195 HIS n 
1 196 TYR n 
1 197 SER n 
1 198 SER n 
1 199 TYR n 
1 200 LEU n 
1 201 GLU n 
1 202 TYR n 
1 203 MET n 
1 204 LYS n 
1 205 VAL n 
1 206 VAL n 
1 207 ASP n 
1 208 GLY n 
1 209 LEU n 
1 210 GLU n 
1 211 LYS n 
1 212 ALA n 
1 213 ILE n 
1 214 TYR n 
1 215 GLN n 
1 216 GLY n 
1 217 PRO n 
1 218 SER n 
1 219 SER n 
1 220 PRO n 
1 221 ASP n 
1 222 LYS n 
1 223 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Rat 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   liver 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Codon Plus(DE3)RP' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COMT_RAT 
_struct_ref.pdbx_db_accession          P22734 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLL
QPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLL
RKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
;
_struct_ref.pdbx_align_begin           44 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ZLB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 223 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P22734 
_struct_ref_seq.db_align_beg                  44 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  264 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       221 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ZLB GLY A 1 ? UNP P22734 ? ? 'EXPRESSION TAG' -1 1 
1 2ZLB SER A 2 ? UNP P22734 ? ? 'EXPRESSION TAG' 0  2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ZLB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '0.2M (NH4)2SO4, 30% PEG 8000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU JUPITER 210' 
_diffrn_detector.pdbx_collection_date   2003-07-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL32B2' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL32B2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2ZLB 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             39.16 
_reflns.number_all                   ? 
_reflns.number_obs                   11356 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.0 
_reflns.B_iso_Wilson_estimate        34.11 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           0.241 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.5 
_reflns_shell.pdbx_redundancy        7.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1565 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZLB 
_refine.ls_number_reflns_obs                     10735 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    98.57 
_refine.ls_R_factor_obs                          0.18159 
_refine.ls_R_factor_all                          0.198 
_refine.ls_R_factor_R_work                       0.17877 
_refine.ls_R_factor_R_free                       0.23747 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  535 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               25.767 
_refine.aniso_B[1][1]                            -0.66 
_refine.aniso_B[2][2]                            -0.66 
_refine.aniso_B[3][3]                            0.99 
_refine.aniso_B[1][2]                            -0.33 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1VID' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.293 
_refine.pdbx_overall_ESU_R_Free                  0.220 
_refine.overall_SU_ML                            0.142 
_refine.overall_SU_B                             5.477 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1672 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             149 
_refine_hist.number_atoms_total               1826 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.020  0.022  ? 1708 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.144  1.989  ? 2315 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       10.114 5.000  ? 211  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.751 24.868 ? 76   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.761 15.000 ? 305  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.708 15.000 ? 9    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.159  0.200  ? 260  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 1277 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.252  0.200  ? 849  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.320  0.200  ? 1120 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.280  0.200  ? 134  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.187  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.187  0.200  ? 24   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.292  1.500  ? 1101 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.052  2.000  ? 1699 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.800  3.000  ? 719  'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.309  4.500  ? 616  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.256 
_refine_ls_shell.number_reflns_R_work             747 
_refine_ls_shell.R_factor_R_work                  0.177 
_refine_ls_shell.percent_reflns_obs               93.88 
_refine_ls_shell.R_factor_R_free                  0.361 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             36 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZLB 
_struct.title                     'Crystal structure of APO form of rat catechol-O-methyltransferase' 
_struct.pdbx_descriptor           'Catechol O-methyltransferase (E.C.2.1.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZLB 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, METHYLTRANSFERASE, NEUROTRANSMITTER DEGRADATION, Alternative initiation, Catecholamine metabolism, Cytoplasm, Magnesium, Membrane, Metal-binding, Phosphoprotein, S-adenosyl-L-methionine, Signal-anchor, Transmembrane, TRANSFERASE (METHYLTRANSFERASE)
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 6   ? ALA A 19  ? THR A 4   ALA A 17  1 ? 14 
HELX_P HELX_P2  2  ASP A 23  ? LYS A 38  ? ASP A 21  LYS A 36  1 ? 16 
HELX_P HELX_P3  3  ASN A 43  ? SER A 60  ? ASN A 41  SER A 58  1 ? 18 
HELX_P HELX_P4  4  GLY A 72  ? ARG A 80  ? GLY A 70  ARG A 78  1 ? 9  
HELX_P HELX_P5  5  ASN A 94  ? ALA A 108 ? ASN A 92  ALA A 106 1 ? 15 
HELX_P HELX_P6  6  LEU A 110 ? ASP A 112 ? LEU A 108 ASP A 110 5 ? 3  
HELX_P HELX_P7  7  ALA A 120 ? ILE A 125 ? ALA A 118 ILE A 123 1 ? 6  
HELX_P HELX_P8  8  GLN A 127 ? TYR A 132 ? GLN A 125 TYR A 130 1 ? 6  
HELX_P HELX_P9  9  TRP A 145 ? ASP A 147 ? TRP A 143 ASP A 145 5 ? 3  
HELX_P HELX_P10 10 ARG A 148 ? CYS A 159 ? ARG A 146 CYS A 157 1 ? 12 
HELX_P HELX_P11 11 THR A 178 ? SER A 188 ? THR A 176 SER A 186 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           175 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            173 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    176 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     174 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       19.92 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 114 ? LEU A 117 ? VAL A 112 LEU A 115 
A 2 ARG A 87  ? MET A 91  ? ARG A 85  MET A 89  
A 3 LEU A 63  ? LEU A 67  ? LEU A 61  LEU A 65  
A 4 LEU A 137 ? LEU A 142 ? LEU A 135 LEU A 140 
A 5 LEU A 162 ? ALA A 170 ? LEU A 160 ALA A 168 
A 6 ASP A 207 ? TYR A 214 ? ASP A 205 TYR A 212 
A 7 PHE A 191 ? SER A 198 ? PHE A 189 SER A 196 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 117 ? O LEU A 115 N THR A 90  ? N THR A 88  
A 2 3 O LEU A 89  ? O LEU A 87  N GLU A 66  ? N GLU A 64  
A 3 4 N LEU A 67  ? N LEU A 65  O PHE A 141 ? O PHE A 139 
A 4 5 N VAL A 140 ? N VAL A 138 O VAL A 167 ? O VAL A 165 
A 5 6 N GLY A 165 ? N GLY A 163 O TYR A 214 ? O TYR A 212 
A 6 7 O LYS A 211 ? O LYS A 209 N THR A 194 ? N THR A 192 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 TYR A 70  ? TYR A 68  . ? 1_555 ? 
2 AC1 9 CYS A 71  ? CYS A 69  . ? 1_555 ? 
3 AC1 9 GLY A 72  ? GLY A 70  . ? 1_555 ? 
4 AC1 9 TYR A 73  ? TYR A 71  . ? 1_555 ? 
5 AC1 9 SER A 74  ? SER A 72  . ? 1_555 ? 
6 AC1 9 ASP A 143 ? ASP A 141 . ? 1_555 ? 
7 AC1 9 HOH C .   ? HOH A 304 . ? 1_555 ? 
8 AC1 9 HOH C .   ? HOH A 322 . ? 1_555 ? 
9 AC1 9 HOH C .   ? HOH A 359 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZLB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZLB 
_atom_sites.fract_transf_matrix[1][1]   0.017774 
_atom_sites.fract_transf_matrix[1][2]   0.010262 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020524 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008512 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 5   ? 48.595 34.490 27.291 1.00 64.90 ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 5   ? 49.365 35.322 28.269 1.00 64.63 ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 5   ? 50.297 34.408 29.063 1.00 63.72 ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 5   ? 51.493 34.327 28.785 1.00 63.50 ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 5   ? 48.409 36.080 29.207 1.00 65.36 ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 5   ? 47.372 36.916 28.449 1.00 66.76 ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 5   ? 47.444 36.967 27.196 1.00 67.66 ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 5   ? 46.487 37.522 29.109 1.00 68.19 ? 3   ASP A OD2 1 
ATOM   9    N N   . THR A 1 6   ? 49.734 33.718 30.049 1.00 62.43 ? 4   THR A N   1 
ATOM   10   C CA  . THR A 1 6   ? 50.448 32.647 30.721 1.00 60.91 ? 4   THR A CA  1 
ATOM   11   C C   . THR A 1 6   ? 49.893 31.317 30.203 1.00 59.67 ? 4   THR A C   1 
ATOM   12   O O   . THR A 1 6   ? 48.777 31.285 29.677 1.00 59.26 ? 4   THR A O   1 
ATOM   13   C CB  . THR A 1 6   ? 50.424 32.799 32.263 1.00 60.97 ? 4   THR A CB  1 
ATOM   14   O OG1 . THR A 1 6   ? 51.642 32.272 32.797 1.00 61.92 ? 4   THR A OG1 1 
ATOM   15   C CG2 . THR A 1 6   ? 49.202 32.136 32.904 1.00 59.99 ? 4   THR A CG2 1 
ATOM   16   N N   . LYS A 1 7   ? 50.689 30.250 30.312 1.00 58.28 ? 5   LYS A N   1 
ATOM   17   C CA  . LYS A 1 7   ? 50.427 28.995 29.591 1.00 56.83 ? 5   LYS A CA  1 
ATOM   18   C C   . LYS A 1 7   ? 49.251 28.286 30.206 1.00 55.55 ? 5   LYS A C   1 
ATOM   19   O O   . LYS A 1 7   ? 48.471 27.645 29.505 1.00 54.73 ? 5   LYS A O   1 
ATOM   20   C CB  . LYS A 1 7   ? 51.660 28.074 29.552 1.00 57.07 ? 5   LYS A CB  1 
ATOM   21   C CG  . LYS A 1 7   ? 53.024 28.761 29.240 1.00 57.56 ? 5   LYS A CG  1 
ATOM   22   C CD  . LYS A 1 7   ? 52.913 30.169 28.563 1.00 58.42 ? 5   LYS A CD  1 
ATOM   23   C CE  . LYS A 1 7   ? 54.263 30.684 28.034 1.00 58.15 ? 5   LYS A CE  1 
ATOM   24   N NZ  . LYS A 1 7   ? 55.401 30.552 29.017 1.00 57.64 ? 5   LYS A NZ  1 
ATOM   25   N N   . GLU A 1 8   ? 49.139 28.428 31.527 1.00 54.39 ? 6   GLU A N   1 
ATOM   26   C CA  . GLU A 1 8   ? 47.980 27.972 32.311 1.00 53.55 ? 6   GLU A CA  1 
ATOM   27   C C   . GLU A 1 8   ? 46.672 28.715 31.932 1.00 52.68 ? 6   GLU A C   1 
ATOM   28   O O   . GLU A 1 8   ? 45.604 28.085 31.838 1.00 52.50 ? 6   GLU A O   1 
ATOM   29   C CB  . GLU A 1 8   ? 48.288 28.056 33.816 1.00 53.98 ? 6   GLU A CB  1 
ATOM   30   C CG  . GLU A 1 8   ? 49.675 28.693 34.111 1.00 53.99 ? 6   GLU A CG  1 
ATOM   31   C CD  . GLU A 1 8   ? 49.609 29.778 35.147 1.00 55.62 ? 6   GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 8   ? 48.521 29.920 35.758 1.00 58.91 ? 6   GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 8   ? 50.624 30.498 35.357 1.00 53.37 ? 6   GLU A OE2 1 
ATOM   34   N N   . GLN A 1 9   ? 46.768 30.025 31.674 1.00 51.34 ? 7   GLN A N   1 
ATOM   35   C CA  . GLN A 1 9   ? 45.655 30.800 31.099 1.00 50.35 ? 7   GLN A CA  1 
ATOM   36   C C   . GLN A 1 9   ? 45.414 30.565 29.590 1.00 49.59 ? 7   GLN A C   1 
ATOM   37   O O   . GLN A 1 9   ? 44.304 30.764 29.104 1.00 49.51 ? 7   GLN A O   1 
ATOM   38   C CB  . GLN A 1 9   ? 45.783 32.297 31.426 1.00 50.81 ? 7   GLN A CB  1 
ATOM   39   C CG  . GLN A 1 9   ? 44.661 32.825 32.373 1.00 51.68 ? 7   GLN A CG  1 
ATOM   40   C CD  . GLN A 1 9   ? 43.394 33.311 31.608 1.00 52.69 ? 7   GLN A CD  1 
ATOM   41   O OE1 . GLN A 1 9   ? 43.008 32.742 30.585 1.00 51.67 ? 7   GLN A OE1 1 
ATOM   42   N NE2 . GLN A 1 9   ? 42.765 34.379 32.111 1.00 53.49 ? 7   GLN A NE2 1 
ATOM   43   N N   . ARG A 1 10  ? 46.446 30.140 28.858 1.00 48.41 ? 8   ARG A N   1 
ATOM   44   C CA  . ARG A 1 10  ? 46.281 29.679 27.473 1.00 47.30 ? 8   ARG A CA  1 
ATOM   45   C C   . ARG A 1 10  ? 45.494 28.382 27.430 1.00 45.54 ? 8   ARG A C   1 
ATOM   46   O O   . ARG A 1 10  ? 44.624 28.223 26.584 1.00 46.06 ? 8   ARG A O   1 
ATOM   47   C CB  . ARG A 1 10  ? 47.641 29.522 26.768 1.00 47.86 ? 8   ARG A CB  1 
ATOM   48   C CG  . ARG A 1 10  ? 48.009 30.714 25.886 1.00 50.73 ? 8   ARG A CG  1 
ATOM   49   C CD  . ARG A 1 10  ? 49.423 31.213 26.118 1.00 54.46 ? 8   ARG A CD  1 
ATOM   50   N NE  . ARG A 1 10  ? 50.418 30.202 25.764 1.00 57.66 ? 8   ARG A NE  1 
ATOM   51   C CZ  . ARG A 1 10  ? 51.692 30.459 25.486 1.00 59.51 ? 8   ARG A CZ  1 
ATOM   52   N NH1 . ARG A 1 10  ? 52.159 31.714 25.506 1.00 60.88 ? 8   ARG A NH1 1 
ATOM   53   N NH2 . ARG A 1 10  ? 52.501 29.454 25.180 1.00 58.10 ? 8   ARG A NH2 1 
ATOM   54   N N   . ILE A 1 11  ? 45.778 27.457 28.344 1.00 43.96 ? 9   ILE A N   1 
ATOM   55   C CA  . ILE A 1 11  ? 44.973 26.233 28.448 1.00 42.81 ? 9   ILE A CA  1 
ATOM   56   C C   . ILE A 1 11  ? 43.503 26.650 28.604 1.00 42.12 ? 9   ILE A C   1 
ATOM   57   O O   . ILE A 1 11  ? 42.634 26.116 27.913 1.00 42.25 ? 9   ILE A O   1 
ATOM   58   C CB  . ILE A 1 11  ? 45.470 25.242 29.578 1.00 42.62 ? 9   ILE A CB  1 
ATOM   59   C CG1 . ILE A 1 11  ? 46.938 24.846 29.347 1.00 42.80 ? 9   ILE A CG1 1 
ATOM   60   C CG2 . ILE A 1 11  ? 44.631 23.973 29.604 1.00 40.90 ? 9   ILE A CG2 1 
ATOM   61   C CD1 . ILE A 1 11  ? 47.628 24.086 30.501 1.00 42.96 ? 9   ILE A CD1 1 
ATOM   62   N N   . LEU A 1 12  ? 43.254 27.651 29.454 1.00 41.78 ? 10  LEU A N   1 
ATOM   63   C CA  . LEU A 1 12  ? 41.901 28.247 29.641 1.00 40.58 ? 10  LEU A CA  1 
ATOM   64   C C   . LEU A 1 12  ? 41.159 28.741 28.379 1.00 39.88 ? 10  LEU A C   1 
ATOM   65   O O   . LEU A 1 12  ? 40.113 28.166 28.057 1.00 40.25 ? 10  LEU A O   1 
ATOM   66   C CB  . LEU A 1 12  ? 41.912 29.329 30.746 1.00 40.85 ? 10  LEU A CB  1 
ATOM   67   C CG  . LEU A 1 12  ? 40.625 29.567 31.561 1.00 40.90 ? 10  LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 12  ? 40.084 28.254 32.118 1.00 39.79 ? 10  LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 12  ? 40.838 30.592 32.691 1.00 40.28 ? 10  LEU A CD2 1 
ATOM   70   N N   . ARG A 1 13  ? 41.651 29.774 27.669 1.00 39.48 ? 11  ARG A N   1 
ATOM   71   C CA  . ARG A 1 13  ? 40.984 30.239 26.400 1.00 38.78 ? 11  ARG A CA  1 
ATOM   72   C C   . ARG A 1 13  ? 40.808 29.114 25.371 1.00 36.09 ? 11  ARG A C   1 
ATOM   73   O O   . ARG A 1 13  ? 39.776 29.043 24.692 1.00 35.09 ? 11  ARG A O   1 
ATOM   74   C CB  . ARG A 1 13  ? 41.662 31.474 25.750 1.00 39.69 ? 11  ARG A CB  1 
ATOM   75   C CG  . ARG A 1 13  ? 41.103 31.836 24.326 1.00 40.49 ? 11  ARG A CG  1 
ATOM   76   C CD  . ARG A 1 13  ? 41.111 33.365 23.965 1.00 42.26 ? 11  ARG A CD  1 
ATOM   77   N NE  . ARG A 1 13  ? 41.714 33.598 22.645 1.00 47.15 ? 11  ARG A NE  1 
ATOM   78   C CZ  . ARG A 1 13  ? 42.014 34.793 22.100 1.00 50.11 ? 11  ARG A CZ  1 
ATOM   79   N NH1 . ARG A 1 13  ? 41.752 35.939 22.735 1.00 48.49 ? 11  ARG A NH1 1 
ATOM   80   N NH2 . ARG A 1 13  ? 42.577 34.841 20.885 1.00 48.92 ? 11  ARG A NH2 1 
ATOM   81   N N   . TYR A 1 14  ? 41.793 28.210 25.306 1.00 33.86 ? 12  TYR A N   1 
ATOM   82   C CA  . TYR A 1 14  ? 41.698 27.042 24.458 1.00 31.34 ? 12  TYR A CA  1 
ATOM   83   C C   . TYR A 1 14  ? 40.499 26.183 24.847 1.00 30.82 ? 12  TYR A C   1 
ATOM   84   O O   . TYR A 1 14  ? 39.691 25.789 23.992 1.00 29.74 ? 12  TYR A O   1 
ATOM   85   C CB  . TYR A 1 14  ? 42.985 26.225 24.501 1.00 31.49 ? 12  TYR A CB  1 
ATOM   86   C CG  . TYR A 1 14  ? 42.943 25.088 23.530 1.00 31.31 ? 12  TYR A CG  1 
ATOM   87   C CD1 . TYR A 1 14  ? 43.320 25.280 22.184 1.00 32.06 ? 12  TYR A CD1 1 
ATOM   88   C CD2 . TYR A 1 14  ? 42.480 23.824 23.924 1.00 27.41 ? 12  TYR A CD2 1 
ATOM   89   C CE1 . TYR A 1 14  ? 43.256 24.216 21.280 1.00 30.59 ? 12  TYR A CE1 1 
ATOM   90   C CE2 . TYR A 1 14  ? 42.389 22.792 23.042 1.00 27.36 ? 12  TYR A CE2 1 
ATOM   91   C CZ  . TYR A 1 14  ? 42.788 22.979 21.709 1.00 30.21 ? 12  TYR A CZ  1 
ATOM   92   O OH  . TYR A 1 14  ? 42.713 21.917 20.818 1.00 29.33 ? 12  TYR A OH  1 
ATOM   93   N N   . VAL A 1 15  ? 40.360 25.893 26.141 1.00 29.40 ? 13  VAL A N   1 
ATOM   94   C CA  . VAL A 1 15  ? 39.203 25.100 26.554 1.00 27.79 ? 13  VAL A CA  1 
ATOM   95   C C   . VAL A 1 15  ? 37.944 25.879 26.228 1.00 28.14 ? 13  VAL A C   1 
ATOM   96   O O   . VAL A 1 15  ? 36.963 25.311 25.742 1.00 27.44 ? 13  VAL A O   1 
ATOM   97   C CB  . VAL A 1 15  ? 39.245 24.716 28.068 1.00 27.16 ? 13  VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 15  ? 37.923 24.097 28.515 1.00 25.07 ? 13  VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 15  ? 40.351 23.752 28.299 1.00 24.64 ? 13  VAL A CG2 1 
ATOM   100  N N   . GLN A 1 16  ? 38.007 27.184 26.495 1.00 29.66 ? 14  GLN A N   1 
ATOM   101  C CA  . GLN A 1 16  ? 36.898 28.104 26.268 1.00 31.83 ? 14  GLN A CA  1 
ATOM   102  C C   . GLN A 1 16  ? 36.445 28.093 24.812 1.00 32.83 ? 14  GLN A C   1 
ATOM   103  O O   . GLN A 1 16  ? 35.266 28.145 24.550 1.00 33.92 ? 14  GLN A O   1 
ATOM   104  C CB  . GLN A 1 16  ? 37.224 29.498 26.839 1.00 31.37 ? 14  GLN A CB  1 
ATOM   105  C CG  . GLN A 1 16  ? 36.914 29.559 28.348 1.00 30.99 ? 14  GLN A CG  1 
ATOM   106  C CD  . GLN A 1 16  ? 37.635 30.654 29.143 1.00 32.83 ? 14  GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 16  ? 38.332 31.514 28.592 1.00 35.53 ? 14  GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 16  ? 37.465 30.615 30.460 1.00 33.27 ? 14  GLN A NE2 1 
ATOM   109  N N   . GLN A 1 17  ? 37.371 27.903 23.873 1.00 34.23 ? 15  GLN A N   1 
ATOM   110  C CA  . GLN A 1 17  ? 37.044 27.851 22.441 1.00 34.80 ? 15  GLN A CA  1 
ATOM   111  C C   . GLN A 1 17  ? 36.679 26.484 21.867 1.00 35.67 ? 15  GLN A C   1 
ATOM   112  O O   . GLN A 1 17  ? 36.131 26.397 20.761 1.00 36.49 ? 15  GLN A O   1 
ATOM   113  C CB  . GLN A 1 17  ? 38.207 28.399 21.657 1.00 35.54 ? 15  GLN A CB  1 
ATOM   114  C CG  . GLN A 1 17  ? 38.581 29.808 22.087 1.00 38.62 ? 15  GLN A CG  1 
ATOM   115  C CD  . GLN A 1 17  ? 39.719 30.325 21.276 1.00 44.26 ? 15  GLN A CD  1 
ATOM   116  O OE1 . GLN A 1 17  ? 39.554 31.238 20.439 1.00 45.62 ? 15  GLN A OE1 1 
ATOM   117  N NE2 . GLN A 1 17  ? 40.891 29.719 21.470 1.00 44.61 ? 15  GLN A NE2 1 
ATOM   118  N N   . ASN A 1 18  ? 36.952 25.404 22.595 1.00 34.62 ? 16  ASN A N   1 
ATOM   119  C CA  . ASN A 1 18  ? 36.844 24.111 21.977 1.00 33.44 ? 16  ASN A CA  1 
ATOM   120  C C   . ASN A 1 18  ? 35.909 23.172 22.694 1.00 32.54 ? 16  ASN A C   1 
ATOM   121  O O   . ASN A 1 18  ? 35.267 22.313 22.074 1.00 31.10 ? 16  ASN A O   1 
ATOM   122  C CB  . ASN A 1 18  ? 38.269 23.554 21.841 1.00 34.55 ? 16  ASN A CB  1 
ATOM   123  C CG  . ASN A 1 18  ? 39.076 24.315 20.781 1.00 34.72 ? 16  ASN A CG  1 
ATOM   124  O OD1 . ASN A 1 18  ? 39.901 25.194 21.074 1.00 35.25 ? 16  ASN A OD1 1 
ATOM   125  N ND2 . ASN A 1 18  ? 38.768 24.020 19.531 1.00 35.86 ? 16  ASN A ND2 1 
ATOM   126  N N   . ALA A 1 19  ? 35.810 23.350 24.010 1.00 30.86 ? 17  ALA A N   1 
ATOM   127  C CA  . ALA A 1 19  ? 35.021 22.431 24.803 1.00 29.41 ? 17  ALA A CA  1 
ATOM   128  C C   . ALA A 1 19  ? 33.546 22.829 24.777 1.00 28.70 ? 17  ALA A C   1 
ATOM   129  O O   . ALA A 1 19  ? 33.223 23.946 24.428 1.00 29.05 ? 17  ALA A O   1 
ATOM   130  C CB  . ALA A 1 19  ? 35.587 22.362 26.227 1.00 28.68 ? 17  ALA A CB  1 
ATOM   131  N N   . LYS A 1 20  ? 32.648 21.900 25.080 1.00 29.02 ? 18  LYS A N   1 
ATOM   132  C CA  . LYS A 1 20  ? 31.271 22.261 25.345 1.00 28.98 ? 18  LYS A CA  1 
ATOM   133  C C   . LYS A 1 20  ? 31.061 22.523 26.835 1.00 27.41 ? 18  LYS A C   1 
ATOM   134  O O   . LYS A 1 20  ? 31.355 21.652 27.689 1.00 25.76 ? 18  LYS A O   1 
ATOM   135  C CB  . LYS A 1 20  ? 30.233 21.252 24.815 1.00 29.50 ? 18  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 20  ? 30.225 21.019 23.277 1.00 34.44 ? 18  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 20  ? 30.631 22.271 22.402 1.00 41.15 ? 18  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 20  ? 29.433 23.163 21.932 1.00 40.82 ? 18  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 20  ? 28.631 23.770 23.046 1.00 43.36 ? 18  LYS A NZ  1 
ATOM   140  N N   . PRO A 1 21  ? 30.532 23.739 27.151 1.00 26.94 ? 19  PRO A N   1 
ATOM   141  C CA  . PRO A 1 21  ? 30.317 24.105 28.552 1.00 25.12 ? 19  PRO A CA  1 
ATOM   142  C C   . PRO A 1 21  ? 29.423 23.075 29.177 1.00 23.45 ? 19  PRO A C   1 
ATOM   143  O O   . PRO A 1 21  ? 28.478 22.620 28.532 1.00 24.05 ? 19  PRO A O   1 
ATOM   144  C CB  . PRO A 1 21  ? 29.630 25.488 28.459 1.00 25.83 ? 19  PRO A CB  1 
ATOM   145  C CG  . PRO A 1 21  ? 30.083 26.074 27.114 1.00 25.81 ? 19  PRO A CG  1 
ATOM   146  C CD  . PRO A 1 21  ? 30.153 24.837 26.216 1.00 26.81 ? 19  PRO A CD  1 
ATOM   147  N N   . GLY A 1 22  ? 29.719 22.667 30.402 1.00 21.30 ? 20  GLY A N   1 
ATOM   148  C CA  . GLY A 1 22  ? 28.902 21.668 31.068 1.00 19.02 ? 20  GLY A CA  1 
ATOM   149  C C   . GLY A 1 22  ? 29.156 20.247 30.649 1.00 19.46 ? 20  GLY A C   1 
ATOM   150  O O   . GLY A 1 22  ? 28.396 19.319 31.022 1.00 19.98 ? 20  GLY A O   1 
ATOM   151  N N   . ASP A 1 23  ? 30.223 20.039 29.884 1.00 19.71 ? 21  ASP A N   1 
ATOM   152  C CA  . ASP A 1 23  ? 30.586 18.697 29.437 1.00 20.07 ? 21  ASP A CA  1 
ATOM   153  C C   . ASP A 1 23  ? 32.017 18.407 29.899 1.00 18.37 ? 21  ASP A C   1 
ATOM   154  O O   . ASP A 1 23  ? 32.942 18.782 29.203 1.00 18.09 ? 21  ASP A O   1 
ATOM   155  C CB  . ASP A 1 23  ? 30.557 18.666 27.891 1.00 21.50 ? 21  ASP A CB  1 
ATOM   156  C CG  . ASP A 1 23  ? 30.866 17.267 27.311 1.00 25.06 ? 21  ASP A CG  1 
ATOM   157  O OD1 . ASP A 1 23  ? 31.152 16.312 28.095 1.00 27.77 ? 21  ASP A OD1 1 
ATOM   158  O OD2 . ASP A 1 23  ? 30.815 17.142 26.068 1.00 31.53 ? 21  ASP A OD2 1 
ATOM   159  N N   . PRO A 1 24  ? 32.207 17.763 31.071 1.00 17.38 ? 22  PRO A N   1 
ATOM   160  C CA  . PRO A 1 24  ? 33.589 17.614 31.556 1.00 16.58 ? 22  PRO A CA  1 
ATOM   161  C C   . PRO A 1 24  ? 34.497 16.758 30.635 1.00 17.22 ? 22  PRO A C   1 
ATOM   162  O O   . PRO A 1 24  ? 35.666 17.061 30.541 1.00 17.20 ? 22  PRO A O   1 
ATOM   163  C CB  . PRO A 1 24  ? 33.414 16.902 32.908 1.00 16.34 ? 22  PRO A CB  1 
ATOM   164  C CG  . PRO A 1 24  ? 32.028 17.150 33.350 1.00 15.41 ? 22  PRO A CG  1 
ATOM   165  C CD  . PRO A 1 24  ? 31.249 17.154 32.018 1.00 17.71 ? 22  PRO A CD  1 
ATOM   166  N N   . GLN A 1 25  ? 33.969 15.707 29.988 1.00 17.09 ? 23  GLN A N   1 
ATOM   167  C CA  . GLN A 1 25  ? 34.720 14.931 28.996 1.00 18.94 ? 23  GLN A CA  1 
ATOM   168  C C   . GLN A 1 25  ? 35.286 15.795 27.881 1.00 18.77 ? 23  GLN A C   1 
ATOM   169  O O   . GLN A 1 25  ? 36.456 15.712 27.561 1.00 18.57 ? 23  GLN A O   1 
ATOM   170  C CB  . GLN A 1 25  ? 33.885 13.777 28.472 1.00 19.38 ? 23  GLN A CB  1 
ATOM   171  C CG  . GLN A 1 25  ? 34.605 12.902 27.454 1.00 26.36 ? 23  GLN A CG  1 
ATOM   172  C CD  . GLN A 1 25  ? 35.737 12.067 28.070 1.00 33.84 ? 23  GLN A CD  1 
ATOM   173  O OE1 . GLN A 1 25  ? 35.667 11.635 29.253 1.00 33.26 ? 23  GLN A OE1 1 
ATOM   174  N NE2 . GLN A 1 25  ? 36.791 11.826 27.258 1.00 33.50 ? 23  GLN A NE2 1 
ATOM   175  N N   . SER A 1 26  ? 34.478 16.709 27.352 1.00 19.92 ? 24  SER A N   1 
ATOM   176  C CA  . SER A 1 26  ? 34.982 17.675 26.387 1.00 20.12 ? 24  SER A CA  1 
ATOM   177  C C   . SER A 1 26  ? 36.087 18.602 26.919 1.00 19.87 ? 24  SER A C   1 
ATOM   178  O O   . SER A 1 26  ? 37.027 18.964 26.195 1.00 19.02 ? 24  SER A O   1 
ATOM   179  C CB  . SER A 1 26  ? 33.831 18.511 25.859 1.00 21.20 ? 24  SER A CB  1 
ATOM   180  O OG  . SER A 1 26  ? 34.383 19.400 24.933 1.00 25.55 ? 24  SER A OG  1 
ATOM   181  N N   . VAL A 1 27  ? 35.961 19.026 28.175 1.00 19.05 ? 25  VAL A N   1 
ATOM   182  C CA  . VAL A 1 27  ? 36.963 19.910 28.773 1.00 17.40 ? 25  VAL A CA  1 
ATOM   183  C C   . VAL A 1 27  ? 38.264 19.135 28.981 1.00 18.12 ? 25  VAL A C   1 
ATOM   184  O O   . VAL A 1 27  ? 39.358 19.671 28.721 1.00 16.64 ? 25  VAL A O   1 
ATOM   185  C CB  . VAL A 1 27  ? 36.502 20.456 30.178 1.00 17.81 ? 25  VAL A CB  1 
ATOM   186  C CG1 . VAL A 1 27  ? 37.702 21.058 30.927 1.00 14.66 ? 25  VAL A CG1 1 
ATOM   187  C CG2 . VAL A 1 27  ? 35.276 21.498 30.039 1.00 14.75 ? 25  VAL A CG2 1 
ATOM   188  N N   . LEU A 1 28  ? 38.143 17.885 29.469 1.00 16.98 ? 26  LEU A N   1 
ATOM   189  C CA  . LEU A 1 28  ? 39.341 17.064 29.684 1.00 18.52 ? 26  LEU A CA  1 
ATOM   190  C C   . LEU A 1 28  ? 40.031 16.816 28.360 1.00 19.14 ? 26  LEU A C   1 
ATOM   191  O O   . LEU A 1 28  ? 41.252 16.946 28.293 1.00 17.38 ? 26  LEU A O   1 
ATOM   192  C CB  . LEU A 1 28  ? 39.055 15.709 30.387 1.00 17.41 ? 26  LEU A CB  1 
ATOM   193  C CG  . LEU A 1 28  ? 38.517 15.780 31.826 1.00 18.17 ? 26  LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 28  ? 37.889 14.479 32.092 1.00 20.71 ? 26  LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 28  ? 39.581 16.124 32.897 1.00 14.96 ? 26  LEU A CD2 1 
ATOM   196  N N   . GLU A 1 29  ? 39.247 16.497 27.315 1.00 20.95 ? 27  GLU A N   1 
ATOM   197  C CA  . GLU A 1 29  ? 39.849 16.223 25.993 1.00 23.85 ? 27  GLU A CA  1 
ATOM   198  C C   . GLU A 1 29  ? 40.532 17.455 25.507 1.00 23.58 ? 27  GLU A C   1 
ATOM   199  O O   . GLU A 1 29  ? 41.649 17.371 25.041 1.00 24.79 ? 27  GLU A O   1 
ATOM   200  C CB  . GLU A 1 29  ? 38.827 15.734 24.971 1.00 24.36 ? 27  GLU A CB  1 
ATOM   201  C CG  . GLU A 1 29  ? 38.379 14.314 25.203 1.00 30.02 ? 27  GLU A CG  1 
ATOM   202  C CD  . GLU A 1 29  ? 37.109 13.968 24.401 1.00 38.02 ? 27  GLU A CD  1 
ATOM   203  O OE1 . GLU A 1 29  ? 36.744 14.760 23.474 1.00 42.91 ? 27  GLU A OE1 1 
ATOM   204  O OE2 . GLU A 1 29  ? 36.478 12.919 24.705 1.00 38.43 ? 27  GLU A OE2 1 
ATOM   205  N N   . ALA A 1 30  ? 39.901 18.624 25.694 1.00 23.83 ? 28  ALA A N   1 
ATOM   206  C CA  . ALA A 1 30  ? 40.523 19.891 25.273 1.00 23.17 ? 28  ALA A CA  1 
ATOM   207  C C   . ALA A 1 30  ? 41.827 20.208 25.990 1.00 23.28 ? 28  ALA A C   1 
ATOM   208  O O   . ALA A 1 30  ? 42.809 20.669 25.336 1.00 22.61 ? 28  ALA A O   1 
ATOM   209  C CB  . ALA A 1 30  ? 39.537 21.080 25.390 1.00 22.46 ? 28  ALA A CB  1 
ATOM   210  N N   . ILE A 1 31  ? 41.825 20.044 27.328 1.00 22.89 ? 29  ILE A N   1 
ATOM   211  C CA  . ILE A 1 31  ? 43.030 20.286 28.137 1.00 22.94 ? 29  ILE A CA  1 
ATOM   212  C C   . ILE A 1 31  ? 44.155 19.322 27.678 1.00 23.86 ? 29  ILE A C   1 
ATOM   213  O O   . ILE A 1 31  ? 45.288 19.724 27.464 1.00 21.93 ? 29  ILE A O   1 
ATOM   214  C CB  . ILE A 1 31  ? 42.822 20.094 29.687 1.00 23.84 ? 29  ILE A CB  1 
ATOM   215  C CG1 . ILE A 1 31  ? 41.949 21.198 30.290 1.00 21.71 ? 29  ILE A CG1 1 
ATOM   216  C CG2 . ILE A 1 31  ? 44.185 20.176 30.397 1.00 22.25 ? 29  ILE A CG2 1 
ATOM   217  C CD1 . ILE A 1 31  ? 41.563 20.948 31.729 1.00 21.50 ? 29  ILE A CD1 1 
ATOM   218  N N   . ASP A 1 32  ? 43.786 18.061 27.508 1.00 24.88 ? 30  ASP A N   1 
ATOM   219  C CA  . ASP A 1 32  ? 44.710 17.007 27.109 1.00 27.58 ? 30  ASP A CA  1 
ATOM   220  C C   . ASP A 1 32  ? 45.371 17.338 25.742 1.00 28.75 ? 30  ASP A C   1 
ATOM   221  O O   . ASP A 1 32  ? 46.596 17.456 25.643 1.00 27.57 ? 30  ASP A O   1 
ATOM   222  C CB  . ASP A 1 32  ? 43.922 15.689 27.067 1.00 26.86 ? 30  ASP A CB  1 
ATOM   223  C CG  . ASP A 1 32  ? 44.799 14.463 26.901 1.00 32.89 ? 30  ASP A CG  1 
ATOM   224  O OD1 . ASP A 1 32  ? 46.021 14.579 26.671 1.00 35.61 ? 30  ASP A OD1 1 
ATOM   225  O OD2 . ASP A 1 32  ? 44.248 13.348 27.017 1.00 38.20 ? 30  ASP A OD2 1 
ATOM   226  N N   . THR A 1 33  ? 44.537 17.507 24.706 1.00 30.75 ? 31  THR A N   1 
ATOM   227  C CA  . THR A 1 33  ? 44.993 17.888 23.359 1.00 32.30 ? 31  THR A CA  1 
ATOM   228  C C   . THR A 1 33  ? 45.951 19.080 23.333 1.00 33.74 ? 31  THR A C   1 
ATOM   229  O O   . THR A 1 33  ? 46.951 19.041 22.630 1.00 33.81 ? 31  THR A O   1 
ATOM   230  C CB  . THR A 1 33  ? 43.809 18.186 22.465 1.00 32.31 ? 31  THR A CB  1 
ATOM   231  O OG1 . THR A 1 33  ? 43.022 17.009 22.342 1.00 30.88 ? 31  THR A OG1 1 
ATOM   232  C CG2 . THR A 1 33  ? 44.270 18.619 21.064 1.00 34.80 ? 31  THR A CG2 1 
ATOM   233  N N   . TYR A 1 34  ? 45.651 20.117 24.115 1.00 35.75 ? 32  TYR A N   1 
ATOM   234  C CA  . TYR A 1 34  ? 46.473 21.312 24.186 1.00 37.76 ? 32  TYR A CA  1 
ATOM   235  C C   . TYR A 1 34  ? 47.827 21.015 24.804 1.00 39.59 ? 32  TYR A C   1 
ATOM   236  O O   . TYR A 1 34  ? 48.860 21.339 24.218 1.00 38.99 ? 32  TYR A O   1 
ATOM   237  C CB  . TYR A 1 34  ? 45.795 22.451 24.985 1.00 38.34 ? 32  TYR A CB  1 
ATOM   238  C CG  . TYR A 1 34  ? 46.591 23.740 24.924 1.00 37.80 ? 32  TYR A CG  1 
ATOM   239  C CD1 . TYR A 1 34  ? 46.534 24.561 23.799 1.00 39.59 ? 32  TYR A CD1 1 
ATOM   240  C CD2 . TYR A 1 34  ? 47.443 24.104 25.953 1.00 39.87 ? 32  TYR A CD2 1 
ATOM   241  C CE1 . TYR A 1 34  ? 47.275 25.719 23.711 1.00 40.35 ? 32  TYR A CE1 1 
ATOM   242  C CE2 . TYR A 1 34  ? 48.208 25.281 25.884 1.00 41.26 ? 32  TYR A CE2 1 
ATOM   243  C CZ  . TYR A 1 34  ? 48.117 26.084 24.747 1.00 42.03 ? 32  TYR A CZ  1 
ATOM   244  O OH  . TYR A 1 34  ? 48.874 27.252 24.647 1.00 41.22 ? 32  TYR A OH  1 
ATOM   245  N N   . CYS A 1 35  ? 47.810 20.464 26.023 1.00 41.49 ? 33  CYS A N   1 
ATOM   246  C CA  . CYS A 1 35  ? 49.046 20.159 26.743 1.00 43.20 ? 33  CYS A CA  1 
ATOM   247  C C   . CYS A 1 35  ? 49.904 19.129 25.978 1.00 44.88 ? 33  CYS A C   1 
ATOM   248  O O   . CYS A 1 35  ? 51.120 19.255 25.951 1.00 44.50 ? 33  CYS A O   1 
ATOM   249  C CB  . CYS A 1 35  ? 48.738 19.677 28.159 1.00 43.14 ? 33  CYS A CB  1 
ATOM   250  S SG  . CYS A 1 35  ? 47.985 20.866 29.280 1.00 42.12 ? 33  CYS A SG  1 
ATOM   251  N N   . THR A 1 36  ? 49.268 18.122 25.361 1.00 47.22 ? 34  THR A N   1 
ATOM   252  C CA  . THR A 1 36  ? 49.977 17.176 24.470 1.00 49.59 ? 34  THR A CA  1 
ATOM   253  C C   . THR A 1 36  ? 50.566 17.824 23.188 1.00 52.05 ? 34  THR A C   1 
ATOM   254  O O   . THR A 1 36  ? 51.666 17.446 22.768 1.00 52.42 ? 34  THR A O   1 
ATOM   255  C CB  . THR A 1 36  ? 49.126 15.929 24.088 1.00 49.33 ? 34  THR A CB  1 
ATOM   256  O OG1 . THR A 1 36  ? 48.708 15.235 25.275 1.00 48.03 ? 34  THR A OG1 1 
ATOM   257  C CG2 . THR A 1 36  ? 49.935 14.963 23.213 1.00 48.99 ? 34  THR A CG2 1 
ATOM   258  N N   . GLN A 1 37  ? 49.845 18.781 22.578 1.00 54.73 ? 35  GLN A N   1 
ATOM   259  C CA  . GLN A 1 37  ? 50.350 19.579 21.429 1.00 56.45 ? 35  GLN A CA  1 
ATOM   260  C C   . GLN A 1 37  ? 51.775 20.059 21.722 1.00 57.39 ? 35  GLN A C   1 
ATOM   261  O O   . GLN A 1 37  ? 52.606 20.109 20.817 1.00 57.48 ? 35  GLN A O   1 
ATOM   262  C CB  . GLN A 1 37  ? 49.411 20.770 21.105 1.00 56.32 ? 35  GLN A CB  1 
ATOM   263  C CG  . GLN A 1 37  ? 49.662 21.583 19.788 1.00 55.72 ? 35  GLN A CG  1 
ATOM   264  C CD  . GLN A 1 37  ? 48.546 22.656 19.502 1.00 57.63 ? 35  GLN A CD  1 
ATOM   265  O OE1 . GLN A 1 37  ? 48.281 23.541 20.330 1.00 59.47 ? 35  GLN A OE1 1 
ATOM   266  N NE2 . GLN A 1 37  ? 47.910 22.573 18.329 1.00 58.36 ? 35  GLN A NE2 1 
ATOM   267  N N   . LYS A 1 38  ? 52.049 20.335 23.002 1.00 58.77 ? 36  LYS A N   1 
ATOM   268  C CA  . LYS A 1 38  ? 53.331 20.873 23.477 1.00 60.09 ? 36  LYS A CA  1 
ATOM   269  C C   . LYS A 1 38  ? 53.926 20.262 24.794 1.00 60.69 ? 36  LYS A C   1 
ATOM   270  O O   . LYS A 1 38  ? 54.792 19.381 24.736 1.00 60.55 ? 36  LYS A O   1 
ATOM   271  C CB  . LYS A 1 38  ? 53.200 22.398 23.591 1.00 60.54 ? 36  LYS A CB  1 
ATOM   272  C CG  . LYS A 1 38  ? 51.748 22.945 23.469 1.00 60.84 ? 36  LYS A CG  1 
ATOM   273  C CD  . LYS A 1 38  ? 51.409 23.913 24.580 1.00 61.89 ? 36  LYS A CD  1 
ATOM   274  C CE  . LYS A 1 38  ? 51.022 23.149 25.878 1.00 64.27 ? 36  LYS A CE  1 
ATOM   275  N NZ  . LYS A 1 38  ? 50.812 23.988 27.137 1.00 61.89 ? 36  LYS A NZ  1 
ATOM   276  N N   . GLU A 1 39  ? 53.410 20.710 25.957 1.00 61.54 ? 37  GLU A N   1 
ATOM   277  C CA  . GLU A 1 39  ? 54.071 20.676 27.301 1.00 61.30 ? 37  GLU A CA  1 
ATOM   278  C C   . GLU A 1 39  ? 54.349 19.377 28.032 1.00 61.11 ? 37  GLU A C   1 
ATOM   279  O O   . GLU A 1 39  ? 55.497 19.135 28.449 1.00 61.13 ? 37  GLU A O   1 
ATOM   280  C CB  . GLU A 1 39  ? 53.351 21.621 28.277 1.00 62.04 ? 37  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 39  ? 53.970 23.024 28.349 1.00 64.01 ? 37  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 39  ? 53.930 23.757 27.006 1.00 65.40 ? 37  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 39  ? 53.454 24.916 26.966 1.00 65.38 ? 37  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 39  ? 54.348 23.165 25.987 1.00 65.93 ? 37  GLU A OE2 1 
ATOM   285  N N   . TRP A 1 40  ? 53.312 18.572 28.259 1.00 60.42 ? 38  TRP A N   1 
ATOM   286  C CA  . TRP A 1 40  ? 53.508 17.238 28.827 1.00 59.72 ? 38  TRP A CA  1 
ATOM   287  C C   . TRP A 1 40  ? 54.556 16.499 27.992 1.00 59.40 ? 38  TRP A C   1 
ATOM   288  O O   . TRP A 1 40  ? 54.518 16.603 26.758 1.00 59.00 ? 38  TRP A O   1 
ATOM   289  C CB  . TRP A 1 40  ? 52.197 16.459 28.800 1.00 59.54 ? 38  TRP A CB  1 
ATOM   290  C CG  . TRP A 1 40  ? 51.201 16.909 29.808 1.00 59.58 ? 38  TRP A CG  1 
ATOM   291  C CD1 . TRP A 1 40  ? 51.453 17.516 31.018 1.00 59.95 ? 38  TRP A CD1 1 
ATOM   292  C CD2 . TRP A 1 40  ? 49.780 16.754 29.725 1.00 60.29 ? 38  TRP A CD2 1 
ATOM   293  N NE1 . TRP A 1 40  ? 50.270 17.764 31.681 1.00 60.31 ? 38  TRP A NE1 1 
ATOM   294  C CE2 . TRP A 1 40  ? 49.227 17.303 30.913 1.00 60.43 ? 38  TRP A CE2 1 
ATOM   295  C CE3 . TRP A 1 40  ? 48.912 16.206 28.759 1.00 59.82 ? 38  TRP A CE3 1 
ATOM   296  C CZ2 . TRP A 1 40  ? 47.845 17.318 31.159 1.00 59.59 ? 38  TRP A CZ2 1 
ATOM   297  C CZ3 . TRP A 1 40  ? 47.535 16.226 29.007 1.00 59.61 ? 38  TRP A CZ3 1 
ATOM   298  C CH2 . TRP A 1 40  ? 47.020 16.779 30.195 1.00 59.37 ? 38  TRP A CH2 1 
ATOM   299  N N   . ALA A 1 41  ? 55.481 15.769 28.641 1.00 59.02 ? 39  ALA A N   1 
ATOM   300  C CA  . ALA A 1 41  ? 56.584 15.094 27.908 1.00 58.32 ? 39  ALA A CA  1 
ATOM   301  C C   . ALA A 1 41  ? 56.052 14.108 26.843 1.00 57.49 ? 39  ALA A C   1 
ATOM   302  O O   . ALA A 1 41  ? 56.482 14.163 25.667 1.00 58.13 ? 39  ALA A O   1 
ATOM   303  C CB  . ALA A 1 41  ? 57.605 14.433 28.864 1.00 58.67 ? 39  ALA A CB  1 
ATOM   304  N N   . MET A 1 42  ? 55.118 13.239 27.256 1.00 55.33 ? 40  MET A N   1 
ATOM   305  C CA  . MET A 1 42  ? 54.175 12.573 26.332 1.00 53.22 ? 40  MET A CA  1 
ATOM   306  C C   . MET A 1 42  ? 52.713 12.857 26.744 1.00 51.22 ? 40  MET A C   1 
ATOM   307  O O   . MET A 1 42  ? 52.378 13.956 27.212 1.00 50.65 ? 40  MET A O   1 
ATOM   308  C CB  . MET A 1 42  ? 54.446 11.063 26.249 1.00 53.95 ? 40  MET A CB  1 
ATOM   309  C CG  . MET A 1 42  ? 55.594 10.676 25.320 1.00 55.20 ? 40  MET A CG  1 
ATOM   310  S SD  . MET A 1 42  ? 56.883 9.768  26.210 1.00 57.92 ? 40  MET A SD  1 
ATOM   311  C CE  . MET A 1 42  ? 58.020 9.332  24.868 1.00 55.85 ? 40  MET A CE  1 
ATOM   312  N N   . ASN A 1 43  ? 51.830 11.887 26.561 1.00 48.78 ? 41  ASN A N   1 
ATOM   313  C CA  . ASN A 1 43  ? 50.436 12.108 26.955 1.00 46.83 ? 41  ASN A CA  1 
ATOM   314  C C   . ASN A 1 43  ? 50.140 11.818 28.438 1.00 44.74 ? 41  ASN A C   1 
ATOM   315  O O   . ASN A 1 43  ? 49.371 10.901 28.758 1.00 43.93 ? 41  ASN A O   1 
ATOM   316  C CB  . ASN A 1 43  ? 49.462 11.366 26.026 1.00 46.91 ? 41  ASN A CB  1 
ATOM   317  C CG  . ASN A 1 43  ? 48.109 11.994 26.019 1.00 47.17 ? 41  ASN A CG  1 
ATOM   318  O OD1 . ASN A 1 43  ? 47.490 12.150 27.065 1.00 48.42 ? 41  ASN A OD1 1 
ATOM   319  N ND2 . ASN A 1 43  ? 47.635 12.381 24.839 1.00 48.30 ? 41  ASN A ND2 1 
ATOM   320  N N   . VAL A 1 44  ? 50.706 12.633 29.337 1.00 42.93 ? 42  VAL A N   1 
ATOM   321  C CA  . VAL A 1 44  ? 50.466 12.431 30.773 1.00 41.46 ? 42  VAL A CA  1 
ATOM   322  C C   . VAL A 1 44  ? 48.961 12.429 31.179 1.00 39.99 ? 42  VAL A C   1 
ATOM   323  O O   . VAL A 1 44  ? 48.601 11.701 32.103 1.00 39.79 ? 42  VAL A O   1 
ATOM   324  C CB  . VAL A 1 44  ? 51.401 13.270 31.757 1.00 41.86 ? 42  VAL A CB  1 
ATOM   325  C CG1 . VAL A 1 44  ? 52.656 13.804 31.060 1.00 41.86 ? 42  VAL A CG1 1 
ATOM   326  C CG2 . VAL A 1 44  ? 50.641 14.355 32.491 1.00 42.62 ? 42  VAL A CG2 1 
ATOM   327  N N   . GLY A 1 45  ? 48.106 13.186 30.466 1.00 37.78 ? 43  GLY A N   1 
ATOM   328  C CA  . GLY A 1 45  ? 46.680 13.248 30.731 1.00 36.10 ? 43  GLY A CA  1 
ATOM   329  C C   . GLY A 1 45  ? 46.037 11.878 30.829 1.00 34.69 ? 43  GLY A C   1 
ATOM   330  O O   . GLY A 1 45  ? 45.700 11.423 31.918 1.00 33.50 ? 43  GLY A O   1 
ATOM   331  N N   . ASP A 1 46  ? 45.890 11.216 29.686 1.00 35.26 ? 44  ASP A N   1 
ATOM   332  C CA  . ASP A 1 46  ? 45.462 9.778  29.604 1.00 34.53 ? 44  ASP A CA  1 
ATOM   333  C C   . ASP A 1 46  ? 46.187 8.810  30.606 1.00 33.86 ? 44  ASP A C   1 
ATOM   334  O O   . ASP A 1 46  ? 45.517 8.063  31.305 1.00 35.29 ? 44  ASP A O   1 
ATOM   335  C CB  . ASP A 1 46  ? 45.583 9.288  28.135 1.00 36.89 ? 44  ASP A CB  1 
ATOM   336  C CG  . ASP A 1 46  ? 45.593 7.729  28.004 1.00 41.18 ? 44  ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 46  ? 45.467 7.055  29.074 1.00 44.00 ? 44  ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 46  ? 45.730 7.196  26.840 1.00 42.30 ? 44  ASP A OD2 1 
ATOM   339  N N   . ALA A 1 47  ? 47.529 8.835  30.628 1.00 31.07 ? 45  ALA A N   1 
ATOM   340  C CA  . ALA A 1 47  ? 48.428 8.202  31.630 1.00 29.02 ? 45  ALA A CA  1 
ATOM   341  C C   . ALA A 1 47  ? 48.055 8.397  33.136 1.00 26.18 ? 45  ALA A C   1 
ATOM   342  O O   . ALA A 1 47  ? 48.102 7.456  33.908 1.00 26.24 ? 45  ALA A O   1 
ATOM   343  C CB  . ALA A 1 47  ? 49.880 8.671  31.386 1.00 26.87 ? 45  ALA A CB  1 
ATOM   344  N N   . LYS A 1 48  ? 47.691 9.597  33.559 1.00 23.81 ? 46  LYS A N   1 
ATOM   345  C CA  . LYS A 1 48  ? 47.207 9.756  34.931 1.00 21.78 ? 46  LYS A CA  1 
ATOM   346  C C   . LYS A 1 48  ? 45.698 9.583  35.135 1.00 20.81 ? 46  LYS A C   1 
ATOM   347  O O   . LYS A 1 48  ? 45.284 8.993  36.123 1.00 18.97 ? 46  LYS A O   1 
ATOM   348  C CB  . LYS A 1 48  ? 47.714 11.061 35.593 1.00 22.73 ? 46  LYS A CB  1 
ATOM   349  C CG  . LYS A 1 48  ? 47.151 12.360 35.145 1.00 21.59 ? 46  LYS A CG  1 
ATOM   350  C CD  . LYS A 1 48  ? 48.025 13.556 35.663 1.00 20.95 ? 46  LYS A CD  1 
ATOM   351  C CE  . LYS A 1 48  ? 47.492 14.149 36.982 1.00 22.09 ? 46  LYS A CE  1 
ATOM   352  N NZ  . LYS A 1 48  ? 48.368 15.217 37.551 1.00 20.64 ? 46  LYS A NZ  1 
ATOM   353  N N   . GLY A 1 49  ? 44.893 10.106 34.214 1.00 19.52 ? 47  GLY A N   1 
ATOM   354  C CA  . GLY A 1 49  ? 43.434 10.114 34.377 1.00 19.14 ? 47  GLY A CA  1 
ATOM   355  C C   . GLY A 1 49  ? 42.808 8.744  34.583 1.00 18.90 ? 47  GLY A C   1 
ATOM   356  O O   . GLY A 1 49  ? 41.970 8.588  35.458 1.00 19.28 ? 47  GLY A O   1 
ATOM   357  N N   . GLN A 1 50  ? 43.235 7.751  33.814 1.00 18.58 ? 48  GLN A N   1 
ATOM   358  C CA  . GLN A 1 50  ? 42.639 6.424  33.920 1.00 20.86 ? 48  GLN A CA  1 
ATOM   359  C C   . GLN A 1 50  ? 42.959 5.730  35.236 1.00 18.88 ? 48  GLN A C   1 
ATOM   360  O O   . GLN A 1 50  ? 42.129 5.034  35.759 1.00 19.08 ? 48  GLN A O   1 
ATOM   361  C CB  . GLN A 1 50  ? 43.004 5.544  32.732 1.00 21.36 ? 48  GLN A CB  1 
ATOM   362  C CG  . GLN A 1 50  ? 42.544 6.149  31.373 1.00 30.98 ? 48  GLN A CG  1 
ATOM   363  C CD  . GLN A 1 50  ? 41.045 5.964  31.031 1.00 41.46 ? 48  GLN A CD  1 
ATOM   364  O OE1 . GLN A 1 50  ? 40.240 6.914  31.122 1.00 46.85 ? 48  GLN A OE1 1 
ATOM   365  N NE2 . GLN A 1 50  ? 40.683 4.757  30.580 1.00 43.89 ? 48  GLN A NE2 1 
ATOM   366  N N   . ILE A 1 51  ? 44.146 5.965  35.786 1.00 19.20 ? 49  ILE A N   1 
ATOM   367  C CA  . ILE A 1 51  ? 44.466 5.505  37.171 1.00 18.21 ? 49  ILE A CA  1 
ATOM   368  C C   . ILE A 1 51  ? 43.584 6.228  38.171 1.00 16.44 ? 49  ILE A C   1 
ATOM   369  O O   . ILE A 1 51  ? 43.041 5.630  39.074 1.00 17.06 ? 49  ILE A O   1 
ATOM   370  C CB  . ILE A 1 51  ? 45.999 5.782  37.569 1.00 18.15 ? 49  ILE A CB  1 
ATOM   371  C CG1 . ILE A 1 51  ? 47.007 5.182  36.563 1.00 19.02 ? 49  ILE A CG1 1 
ATOM   372  C CG2 . ILE A 1 51  ? 46.290 5.356  39.033 1.00 18.43 ? 49  ILE A CG2 1 
ATOM   373  C CD1 . ILE A 1 51  ? 46.784 3.774  36.262 1.00 22.41 ? 49  ILE A CD1 1 
ATOM   374  N N   . MET A 1 52  ? 43.458 7.547  38.005 1.00 16.34 ? 50  MET A N   1 
ATOM   375  C CA  . MET A 1 52  ? 42.679 8.386  38.900 1.00 14.28 ? 50  MET A CA  1 
ATOM   376  C C   . MET A 1 52  ? 41.255 7.906  38.912 1.00 15.33 ? 50  MET A C   1 
ATOM   377  O O   . MET A 1 52  ? 40.680 7.773  39.976 1.00 15.58 ? 50  MET A O   1 
ATOM   378  C CB  . MET A 1 52  ? 42.742 9.840  38.433 1.00 15.00 ? 50  MET A CB  1 
ATOM   379  C CG  . MET A 1 52  ? 44.063 10.497 38.736 1.00 13.27 ? 50  MET A CG  1 
ATOM   380  S SD  . MET A 1 52  ? 44.241 12.137 38.066 1.00 15.22 ? 50  MET A SD  1 
ATOM   381  C CE  . MET A 1 52  ? 42.853 12.932 38.852 1.00 7.95  ? 50  MET A CE  1 
ATOM   382  N N   . ASP A 1 53  ? 40.690 7.665  37.721 1.00 15.25 ? 51  ASP A N   1 
ATOM   383  C CA  . ASP A 1 53  ? 39.332 7.136  37.547 1.00 17.09 ? 51  ASP A CA  1 
ATOM   384  C C   . ASP A 1 53  ? 39.117 5.808  38.259 1.00 16.44 ? 51  ASP A C   1 
ATOM   385  O O   . ASP A 1 53  ? 38.161 5.687  38.993 1.00 16.00 ? 51  ASP A O   1 
ATOM   386  C CB  . ASP A 1 53  ? 38.996 6.918  36.051 1.00 17.22 ? 51  ASP A CB  1 
ATOM   387  C CG  . ASP A 1 53  ? 38.825 8.214  35.281 1.00 19.98 ? 51  ASP A CG  1 
ATOM   388  O OD1 . ASP A 1 53  ? 39.113 9.295  35.835 1.00 18.03 ? 51  ASP A OD1 1 
ATOM   389  O OD2 . ASP A 1 53  ? 38.415 8.131  34.091 1.00 21.23 ? 51  ASP A OD2 1 
ATOM   390  N N   . ALA A 1 54  ? 40.035 4.857  38.069 1.00 16.71 ? 52  ALA A N   1 
ATOM   391  C CA  . ALA A 1 54  ? 39.938 3.498  38.768 1.00 17.41 ? 52  ALA A CA  1 
ATOM   392  C C   . ALA A 1 54  ? 39.993 3.616  40.256 1.00 16.71 ? 52  ALA A C   1 
ATOM   393  O O   . ALA A 1 54  ? 39.289 2.920  40.973 1.00 18.34 ? 52  ALA A O   1 
ATOM   394  C CB  . ALA A 1 54  ? 41.045 2.534  38.306 1.00 15.37 ? 52  ALA A CB  1 
ATOM   395  N N   . VAL A 1 55  ? 40.832 4.514  40.750 1.00 17.21 ? 53  VAL A N   1 
ATOM   396  C CA  . VAL A 1 55  ? 40.922 4.685  42.199 1.00 16.32 ? 53  VAL A CA  1 
ATOM   397  C C   . VAL A 1 55  ? 39.632 5.315  42.771 1.00 17.31 ? 53  VAL A C   1 
ATOM   398  O O   . VAL A 1 55  ? 39.066 4.811  43.749 1.00 17.81 ? 53  VAL A O   1 
ATOM   399  C CB  . VAL A 1 55  ? 42.233 5.455  42.587 1.00 16.35 ? 53  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 55  ? 42.295 5.676  44.050 1.00 12.52 ? 53  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 55  ? 43.545 4.629  42.131 1.00 16.01 ? 53  VAL A CG2 1 
ATOM   402  N N   . ILE A 1 56  ? 39.158 6.400  42.166 1.00 18.35 ? 54  ILE A N   1 
ATOM   403  C CA  . ILE A 1 56  ? 37.894 7.024  42.629 1.00 20.36 ? 54  ILE A CA  1 
ATOM   404  C C   . ILE A 1 56  ? 36.761 6.001  42.604 1.00 20.92 ? 54  ILE A C   1 
ATOM   405  O O   . ILE A 1 56  ? 36.024 5.852  43.592 1.00 21.23 ? 54  ILE A O   1 
ATOM   406  C CB  . ILE A 1 56  ? 37.526 8.276  41.786 1.00 20.37 ? 54  ILE A CB  1 
ATOM   407  C CG1 . ILE A 1 56  ? 38.222 9.501  42.344 1.00 24.05 ? 54  ILE A CG1 1 
ATOM   408  C CG2 . ILE A 1 56  ? 36.021 8.562  41.780 1.00 20.35 ? 54  ILE A CG2 1 
ATOM   409  C CD1 . ILE A 1 56  ? 39.384 9.925  41.519 1.00 27.20 ? 54  ILE A CD1 1 
ATOM   410  N N   . ARG A 1 57  ? 36.634 5.294  41.471 1.00 22.09 ? 55  ARG A N   1 
ATOM   411  C CA  . ARG A 1 57  ? 35.607 4.251  41.293 1.00 22.31 ? 55  ARG A CA  1 
ATOM   412  C C   . ARG A 1 57  ? 35.764 3.086  42.283 1.00 23.07 ? 55  ARG A C   1 
ATOM   413  O O   . ARG A 1 57  ? 34.781 2.588  42.815 1.00 24.24 ? 55  ARG A O   1 
ATOM   414  C CB  . ARG A 1 57  ? 35.589 3.753  39.847 1.00 21.63 ? 55  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 57  ? 34.736 4.632  38.916 1.00 22.18 ? 55  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 57  ? 35.077 4.371  37.436 1.00 23.76 ? 55  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 57  ? 34.353 5.238  36.489 1.00 23.66 ? 55  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 57  ? 34.821 5.656  35.304 1.00 28.65 ? 55  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 57  ? 36.062 5.335  34.890 1.00 27.85 ? 55  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 57  ? 34.058 6.435  34.515 1.00 26.29 ? 55  ARG A NH2 1 
ATOM   421  N N   . GLU A 1 58  ? 36.986 2.643  42.570 1.00 23.24 ? 56  GLU A N   1 
ATOM   422  C CA  . GLU A 1 58  ? 37.131 1.586  43.583 1.00 23.00 ? 56  GLU A CA  1 
ATOM   423  C C   . GLU A 1 58  ? 36.662 2.030  44.981 1.00 23.33 ? 56  GLU A C   1 
ATOM   424  O O   . GLU A 1 58  ? 36.001 1.255  45.701 1.00 24.65 ? 56  GLU A O   1 
ATOM   425  C CB  . GLU A 1 58  ? 38.569 1.066  43.603 1.00 22.95 ? 56  GLU A CB  1 
ATOM   426  C CG  . GLU A 1 58  ? 38.940 0.143  44.800 1.00 24.69 ? 56  GLU A CG  1 
ATOM   427  C CD  . GLU A 1 58  ? 40.256 -0.544 44.559 1.00 23.70 ? 56  GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 58  ? 40.889 -0.240 43.551 1.00 25.30 ? 56  GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 58  ? 40.670 -1.404 45.348 1.00 30.72 ? 56  GLU A OE2 1 
ATOM   430  N N   . TYR A 1 59  ? 36.985 3.261  45.395 1.00 22.06 ? 57  TYR A N   1 
ATOM   431  C CA  . TYR A 1 59  ? 36.806 3.617  46.815 1.00 20.89 ? 57  TYR A CA  1 
ATOM   432  C C   . TYR A 1 59  ? 35.628 4.493  47.059 1.00 20.76 ? 57  TYR A C   1 
ATOM   433  O O   . TYR A 1 59  ? 35.300 4.739  48.210 1.00 20.25 ? 57  TYR A O   1 
ATOM   434  C CB  . TYR A 1 59  ? 38.055 4.281  47.445 1.00 20.49 ? 57  TYR A CB  1 
ATOM   435  C CG  . TYR A 1 59  ? 39.219 3.347  47.452 1.00 19.80 ? 57  TYR A CG  1 
ATOM   436  C CD1 . TYR A 1 59  ? 39.444 2.471  48.509 1.00 22.28 ? 57  TYR A CD1 1 
ATOM   437  C CD2 . TYR A 1 59  ? 40.096 3.325  46.381 1.00 19.54 ? 57  TYR A CD2 1 
ATOM   438  C CE1 . TYR A 1 59  ? 40.526 1.582  48.476 1.00 22.18 ? 57  TYR A CE1 1 
ATOM   439  C CE2 . TYR A 1 59  ? 41.139 2.442  46.319 1.00 18.20 ? 57  TYR A CE2 1 
ATOM   440  C CZ  . TYR A 1 59  ? 41.368 1.578  47.359 1.00 19.91 ? 57  TYR A CZ  1 
ATOM   441  O OH  . TYR A 1 59  ? 42.454 0.715  47.248 1.00 19.41 ? 57  TYR A OH  1 
ATOM   442  N N   . SER A 1 60  ? 35.024 5.026  46.002 1.00 20.65 ? 58  SER A N   1 
ATOM   443  C CA  . SER A 1 60  ? 33.802 5.795  46.182 1.00 21.95 ? 58  SER A CA  1 
ATOM   444  C C   . SER A 1 60  ? 33.892 6.892  47.237 1.00 21.16 ? 58  SER A C   1 
ATOM   445  O O   . SER A 1 60  ? 33.005 6.996  48.089 1.00 21.83 ? 58  SER A O   1 
ATOM   446  C CB  . SER A 1 60  ? 32.643 4.837  46.519 1.00 22.34 ? 58  SER A CB  1 
ATOM   447  O OG  . SER A 1 60  ? 32.073 4.411  45.306 1.00 26.67 ? 58  SER A OG  1 
ATOM   448  N N   . PRO A 1 61  ? 34.948 7.728  47.187 1.00 20.78 ? 59  PRO A N   1 
ATOM   449  C CA  . PRO A 1 61  ? 35.085 8.703  48.288 1.00 20.26 ? 59  PRO A CA  1 
ATOM   450  C C   . PRO A 1 61  ? 33.955 9.759  48.321 1.00 21.06 ? 59  PRO A C   1 
ATOM   451  O O   . PRO A 1 61  ? 33.471 10.185 47.259 1.00 20.99 ? 59  PRO A O   1 
ATOM   452  C CB  . PRO A 1 61  ? 36.430 9.378  47.983 1.00 18.70 ? 59  PRO A CB  1 
ATOM   453  C CG  . PRO A 1 61  ? 36.562 9.257  46.452 1.00 20.27 ? 59  PRO A CG  1 
ATOM   454  C CD  . PRO A 1 61  ? 36.029 7.869  46.185 1.00 19.86 ? 59  PRO A CD  1 
ATOM   455  N N   . SER A 1 62  ? 33.568 10.197 49.523 1.00 20.83 ? 60  SER A N   1 
ATOM   456  C CA  . SER A 1 62  ? 32.520 11.210 49.655 1.00 22.19 ? 60  SER A CA  1 
ATOM   457  C C   . SER A 1 62  ? 33.177 12.563 49.852 1.00 22.10 ? 60  SER A C   1 
ATOM   458  O O   . SER A 1 62  ? 32.592 13.580 49.550 1.00 21.33 ? 60  SER A O   1 
ATOM   459  C CB  . SER A 1 62  ? 31.607 10.917 50.859 1.00 22.58 ? 60  SER A CB  1 
ATOM   460  O OG  . SER A 1 62  ? 30.810 9.770  50.557 1.00 25.83 ? 60  SER A OG  1 
ATOM   461  N N   . LEU A 1 63  ? 34.387 12.553 50.406 1.00 21.89 ? 61  LEU A N   1 
ATOM   462  C CA  . LEU A 1 63  ? 35.138 13.778 50.594 1.00 20.96 ? 61  LEU A CA  1 
ATOM   463  C C   . LEU A 1 63  ? 36.565 13.511 50.128 1.00 19.21 ? 61  LEU A C   1 
ATOM   464  O O   . LEU A 1 63  ? 37.233 12.625 50.675 1.00 17.93 ? 61  LEU A O   1 
ATOM   465  C CB  . LEU A 1 63  ? 35.127 14.186 52.061 1.00 21.69 ? 61  LEU A CB  1 
ATOM   466  C CG  . LEU A 1 63  ? 35.129 15.654 52.510 1.00 24.62 ? 61  LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 63  ? 36.044 15.776 53.725 1.00 24.43 ? 61  LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 63  ? 35.431 16.704 51.448 1.00 24.68 ? 61  LEU A CD2 1 
ATOM   469  N N   . VAL A 1 64  ? 36.972 14.265 49.100 1.00 17.07 ? 62  VAL A N   1 
ATOM   470  C CA  . VAL A 1 64  ? 38.283 14.224 48.513 1.00 16.12 ? 62  VAL A CA  1 
ATOM   471  C C   . VAL A 1 64  ? 38.926 15.587 48.765 1.00 16.31 ? 62  VAL A C   1 
ATOM   472  O O   . VAL A 1 64  ? 38.307 16.651 48.573 1.00 14.98 ? 62  VAL A O   1 
ATOM   473  C CB  . VAL A 1 64  ? 38.300 13.985 46.992 1.00 15.27 ? 62  VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 64  ? 39.763 13.819 46.471 1.00 15.19 ? 62  VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 64  ? 37.435 12.764 46.594 1.00 16.91 ? 62  VAL A CG2 1 
ATOM   476  N N   . LEU A 1 65  ? 40.175 15.529 49.217 1.00 14.57 ? 63  LEU A N   1 
ATOM   477  C CA  . LEU A 1 65  ? 41.005 16.702 49.304 1.00 14.18 ? 63  LEU A CA  1 
ATOM   478  C C   . LEU A 1 65  ? 42.076 16.608 48.200 1.00 13.96 ? 63  LEU A C   1 
ATOM   479  O O   . LEU A 1 65  ? 42.816 15.617 48.142 1.00 14.81 ? 63  LEU A O   1 
ATOM   480  C CB  . LEU A 1 65  ? 41.653 16.733 50.682 1.00 12.58 ? 63  LEU A CB  1 
ATOM   481  C CG  . LEU A 1 65  ? 42.754 17.793 50.898 1.00 13.47 ? 63  LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 65  ? 42.136 19.249 50.772 1.00 7.81  ? 63  LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 65  ? 43.500 17.603 52.190 1.00 13.14 ? 63  LEU A CD2 1 
ATOM   484  N N   . GLU A 1 66  ? 42.157 17.608 47.334 1.00 14.07 ? 64  GLU A N   1 
ATOM   485  C CA  . GLU A 1 66  ? 43.283 17.736 46.403 1.00 13.74 ? 64  GLU A CA  1 
ATOM   486  C C   . GLU A 1 66  ? 44.277 18.746 46.931 1.00 13.71 ? 64  GLU A C   1 
ATOM   487  O O   . GLU A 1 66  ? 43.912 19.889 47.264 1.00 13.31 ? 64  GLU A O   1 
ATOM   488  C CB  . GLU A 1 66  ? 42.817 18.228 45.023 1.00 14.97 ? 64  GLU A CB  1 
ATOM   489  C CG  . GLU A 1 66  ? 43.965 18.531 44.025 1.00 13.94 ? 64  GLU A CG  1 
ATOM   490  C CD  . GLU A 1 66  ? 43.422 18.990 42.637 1.00 15.23 ? 64  GLU A CD  1 
ATOM   491  O OE1 . GLU A 1 66  ? 42.214 18.884 42.385 1.00 18.79 ? 64  GLU A OE1 1 
ATOM   492  O OE2 . GLU A 1 66  ? 44.187 19.485 41.806 1.00 11.81 ? 64  GLU A OE2 1 
ATOM   493  N N   . LEU A 1 67  ? 45.544 18.331 46.965 1.00 13.52 ? 65  LEU A N   1 
ATOM   494  C CA  . LEU A 1 67  ? 46.642 19.158 47.448 1.00 13.70 ? 65  LEU A CA  1 
ATOM   495  C C   . LEU A 1 67  ? 47.521 19.500 46.256 1.00 13.32 ? 65  LEU A C   1 
ATOM   496  O O   . LEU A 1 67  ? 48.292 18.641 45.754 1.00 13.96 ? 65  LEU A O   1 
ATOM   497  C CB  . LEU A 1 67  ? 47.441 18.415 48.528 1.00 12.31 ? 65  LEU A CB  1 
ATOM   498  C CG  . LEU A 1 67  ? 46.683 18.236 49.842 1.00 13.28 ? 65  LEU A CG  1 
ATOM   499  C CD1 . LEU A 1 67  ? 47.461 17.482 50.898 1.00 14.78 ? 65  LEU A CD1 1 
ATOM   500  C CD2 . LEU A 1 67  ? 46.296 19.546 50.390 1.00 17.49 ? 65  LEU A CD2 1 
ATOM   501  N N   . GLY A 1 68  ? 47.405 20.739 45.787 1.00 13.07 ? 66  GLY A N   1 
ATOM   502  C CA  . GLY A 1 68  ? 48.078 21.143 44.567 1.00 14.44 ? 66  GLY A CA  1 
ATOM   503  C C   . GLY A 1 68  ? 47.173 21.089 43.348 1.00 15.59 ? 66  GLY A C   1 
ATOM   504  O O   . GLY A 1 68  ? 46.367 20.175 43.160 1.00 14.19 ? 66  GLY A O   1 
ATOM   505  N N   . ALA A 1 69  ? 47.381 22.074 42.487 1.00 16.74 ? 67  ALA A N   1 
ATOM   506  C CA  . ALA A 1 69  ? 46.626 22.225 41.263 1.00 18.14 ? 67  ALA A CA  1 
ATOM   507  C C   . ALA A 1 69  ? 47.395 23.219 40.391 1.00 18.89 ? 67  ALA A C   1 
ATOM   508  O O   . ALA A 1 69  ? 48.101 24.107 40.871 1.00 19.15 ? 67  ALA A O   1 
ATOM   509  C CB  . ALA A 1 69  ? 45.190 22.750 41.569 1.00 15.08 ? 67  ALA A CB  1 
ATOM   510  N N   . TYR A 1 70  ? 47.236 23.054 39.087 1.00 20.80 ? 68  TYR A N   1 
ATOM   511  C CA  . TYR A 1 70  ? 47.984 23.792 38.108 1.00 20.76 ? 68  TYR A CA  1 
ATOM   512  C C   . TYR A 1 70  ? 46.962 24.323 37.085 1.00 20.80 ? 68  TYR A C   1 
ATOM   513  O O   . TYR A 1 70  ? 46.587 25.482 37.141 1.00 20.13 ? 68  TYR A O   1 
ATOM   514  C CB  . TYR A 1 70  ? 48.999 22.845 37.476 1.00 21.49 ? 68  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 70  ? 49.837 23.461 36.398 1.00 24.58 ? 68  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 70  ? 50.182 24.811 36.437 1.00 27.49 ? 68  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 70  ? 50.325 22.697 35.357 1.00 28.13 ? 68  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 70  ? 50.969 25.389 35.457 1.00 28.50 ? 68  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 70  ? 51.121 23.271 34.372 1.00 32.26 ? 68  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 70  ? 51.445 24.636 34.433 1.00 29.16 ? 68  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 70  ? 52.270 25.233 33.461 1.00 27.85 ? 68  TYR A OH  1 
ATOM   522  N N   . CYS A 1 71  ? 46.483 23.488 36.172 1.00 20.96 ? 69  CYS A N   1 
ATOM   523  C CA  . CYS A 1 71  ? 45.483 23.992 35.231 1.00 22.11 ? 69  CYS A CA  1 
ATOM   524  C C   . CYS A 1 71  ? 44.112 23.358 35.336 1.00 21.75 ? 69  CYS A C   1 
ATOM   525  O O   . CYS A 1 71  ? 43.285 23.536 34.424 1.00 23.27 ? 69  CYS A O   1 
ATOM   526  C CB  . CYS A 1 71  ? 45.989 23.931 33.797 1.00 22.65 ? 69  CYS A CB  1 
ATOM   527  S SG  . CYS A 1 71  ? 46.122 22.298 33.187 1.00 28.87 ? 69  CYS A SG  1 
ATOM   528  N N   . GLY A 1 72  ? 43.851 22.663 36.446 1.00 19.47 ? 70  GLY A N   1 
ATOM   529  C CA  . GLY A 1 72  ? 42.552 22.077 36.742 1.00 18.69 ? 70  GLY A CA  1 
ATOM   530  C C   . GLY A 1 72  ? 42.164 20.759 36.114 1.00 17.83 ? 70  GLY A C   1 
ATOM   531  O O   . GLY A 1 72  ? 41.103 20.240 36.414 1.00 19.02 ? 70  GLY A O   1 
ATOM   532  N N   . TYR A 1 73  ? 43.011 20.201 35.253 1.00 17.70 ? 71  TYR A N   1 
ATOM   533  C CA  . TYR A 1 73  ? 42.770 18.868 34.715 1.00 17.19 ? 71  TYR A CA  1 
ATOM   534  C C   . TYR A 1 73  ? 42.340 17.848 35.799 1.00 16.29 ? 71  TYR A C   1 
ATOM   535  O O   . TYR A 1 73  ? 41.285 17.219 35.668 1.00 14.58 ? 71  TYR A O   1 
ATOM   536  C CB  . TYR A 1 73  ? 43.981 18.333 33.962 1.00 18.20 ? 71  TYR A CB  1 
ATOM   537  C CG  . TYR A 1 73  ? 43.696 17.009 33.227 1.00 22.30 ? 71  TYR A CG  1 
ATOM   538  C CD1 . TYR A 1 73  ? 43.862 15.764 33.880 1.00 22.82 ? 71  TYR A CD1 1 
ATOM   539  C CD2 . TYR A 1 73  ? 43.251 17.004 31.891 1.00 20.06 ? 71  TYR A CD2 1 
ATOM   540  C CE1 . TYR A 1 73  ? 43.591 14.542 33.213 1.00 24.30 ? 71  TYR A CE1 1 
ATOM   541  C CE2 . TYR A 1 73  ? 42.978 15.797 31.233 1.00 24.92 ? 71  TYR A CE2 1 
ATOM   542  C CZ  . TYR A 1 73  ? 43.149 14.567 31.893 1.00 22.52 ? 71  TYR A CZ  1 
ATOM   543  O OH  . TYR A 1 73  ? 42.868 13.383 31.229 1.00 20.36 ? 71  TYR A OH  1 
ATOM   544  N N   . SER A 1 74  ? 43.183 17.677 36.837 1.00 16.00 ? 72  SER A N   1 
ATOM   545  C CA  . SER A 1 74  ? 42.964 16.674 37.908 1.00 15.22 ? 72  SER A CA  1 
ATOM   546  C C   . SER A 1 74  ? 41.676 16.885 38.666 1.00 14.49 ? 72  SER A C   1 
ATOM   547  O O   . SER A 1 74  ? 41.005 15.933 38.957 1.00 13.84 ? 72  SER A O   1 
ATOM   548  C CB  . SER A 1 74  ? 44.126 16.696 38.909 1.00 14.79 ? 72  SER A CB  1 
ATOM   549  O OG  . SER A 1 74  ? 45.297 16.402 38.206 1.00 13.13 ? 72  SER A OG  1 
ATOM   550  N N   . ALA A 1 75  ? 41.342 18.141 38.971 1.00 14.11 ? 73  ALA A N   1 
ATOM   551  C CA  . ALA A 1 75  ? 40.103 18.485 39.671 1.00 14.51 ? 73  ALA A CA  1 
ATOM   552  C C   . ALA A 1 75  ? 38.893 18.181 38.822 1.00 14.80 ? 73  ALA A C   1 
ATOM   553  O O   . ALA A 1 75  ? 37.903 17.670 39.344 1.00 16.02 ? 73  ALA A O   1 
ATOM   554  C CB  . ALA A 1 75  ? 40.091 19.996 40.018 1.00 15.34 ? 73  ALA A CB  1 
ATOM   555  N N   . VAL A 1 76  ? 38.952 18.505 37.521 1.00 13.85 ? 74  VAL A N   1 
ATOM   556  C CA  . VAL A 1 76  ? 37.804 18.191 36.616 1.00 13.92 ? 74  VAL A CA  1 
ATOM   557  C C   . VAL A 1 76  ? 37.648 16.683 36.578 1.00 14.37 ? 74  VAL A C   1 
ATOM   558  O O   . VAL A 1 76  ? 36.512 16.143 36.704 1.00 12.70 ? 74  VAL A O   1 
ATOM   559  C CB  . VAL A 1 76  ? 37.982 18.810 35.156 1.00 14.13 ? 74  VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 76  ? 36.934 18.250 34.136 1.00 13.15 ? 74  VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 76  ? 37.903 20.365 35.201 1.00 11.77 ? 74  VAL A CG2 1 
ATOM   562  N N   . ARG A 1 77  ? 38.819 16.030 36.437 1.00 14.37 ? 75  ARG A N   1 
ATOM   563  C CA  . ARG A 1 77  ? 38.917 14.566 36.355 1.00 15.70 ? 75  ARG A CA  1 
ATOM   564  C C   . ARG A 1 77  ? 38.250 13.840 37.534 1.00 15.73 ? 75  ARG A C   1 
ATOM   565  O O   . ARG A 1 77  ? 37.419 12.916 37.359 1.00 16.07 ? 75  ARG A O   1 
ATOM   566  C CB  . ARG A 1 77  ? 40.402 14.128 36.181 1.00 14.48 ? 75  ARG A CB  1 
ATOM   567  C CG  . ARG A 1 77  ? 40.583 12.657 35.814 1.00 16.38 ? 75  ARG A CG  1 
ATOM   568  C CD  . ARG A 1 77  ? 40.595 12.419 34.294 1.00 16.56 ? 75  ARG A CD  1 
ATOM   569  N NE  . ARG A 1 77  ? 40.274 11.037 33.926 1.00 17.63 ? 75  ARG A NE  1 
ATOM   570  C CZ  . ARG A 1 77  ? 40.526 10.506 32.725 1.00 20.30 ? 75  ARG A CZ  1 
ATOM   571  N NH1 . ARG A 1 77  ? 41.151 11.214 31.810 1.00 17.57 ? 75  ARG A NH1 1 
ATOM   572  N NH2 . ARG A 1 77  ? 40.223 9.243  32.468 1.00 22.05 ? 75  ARG A NH2 1 
ATOM   573  N N   . MET A 1 78  ? 38.572 14.275 38.740 1.00 15.76 ? 76  MET A N   1 
ATOM   574  C CA  . MET A 1 78  ? 37.925 13.690 39.904 1.00 16.69 ? 76  MET A CA  1 
ATOM   575  C C   . MET A 1 78  ? 36.446 14.097 40.065 1.00 17.64 ? 76  MET A C   1 
ATOM   576  O O   . MET A 1 78  ? 35.561 13.240 40.294 1.00 17.72 ? 76  MET A O   1 
ATOM   577  C CB  . MET A 1 78  ? 38.724 14.068 41.154 1.00 15.80 ? 76  MET A CB  1 
ATOM   578  C CG  . MET A 1 78  ? 40.154 13.522 41.096 1.00 17.13 ? 76  MET A CG  1 
ATOM   579  S SD  . MET A 1 78  ? 41.038 13.616 42.646 1.00 17.88 ? 76  MET A SD  1 
ATOM   580  C CE  . MET A 1 78  ? 41.523 15.333 42.611 1.00 19.18 ? 76  MET A CE  1 
ATOM   581  N N   . ALA A 1 79  ? 36.201 15.412 40.013 1.00 17.35 ? 77  ALA A N   1 
ATOM   582  C CA  . ALA A 1 79  ? 34.900 15.980 40.289 1.00 17.78 ? 77  ALA A CA  1 
ATOM   583  C C   . ALA A 1 79  ? 33.810 15.409 39.351 1.00 17.89 ? 77  ALA A C   1 
ATOM   584  O O   . ALA A 1 79  ? 32.712 15.076 39.774 1.00 18.36 ? 77  ALA A O   1 
ATOM   585  C CB  . ALA A 1 79  ? 34.994 17.502 40.188 1.00 18.34 ? 77  ALA A CB  1 
ATOM   586  N N   . ARG A 1 80  ? 34.144 15.207 38.088 1.00 19.13 ? 78  ARG A N   1 
ATOM   587  C CA  . ARG A 1 80  ? 33.175 14.607 37.169 1.00 19.80 ? 78  ARG A CA  1 
ATOM   588  C C   . ARG A 1 80  ? 32.615 13.278 37.681 1.00 20.93 ? 78  ARG A C   1 
ATOM   589  O O   . ARG A 1 80  ? 31.485 12.931 37.348 1.00 20.88 ? 78  ARG A O   1 
ATOM   590  C CB  . ARG A 1 80  ? 33.762 14.498 35.760 1.00 19.31 ? 78  ARG A CB  1 
ATOM   591  C CG  . ARG A 1 80  ? 34.432 13.189 35.461 1.00 19.02 ? 78  ARG A CG  1 
ATOM   592  C CD  . ARG A 1 80  ? 35.175 13.336 34.175 1.00 20.52 ? 78  ARG A CD  1 
ATOM   593  N NE  . ARG A 1 80  ? 35.428 12.043 33.569 1.00 25.61 ? 78  ARG A NE  1 
ATOM   594  C CZ  . ARG A 1 80  ? 36.362 11.173 33.983 1.00 25.24 ? 78  ARG A CZ  1 
ATOM   595  N NH1 . ARG A 1 80  ? 37.129 11.433 35.053 1.00 20.63 ? 78  ARG A NH1 1 
ATOM   596  N NH2 . ARG A 1 80  ? 36.512 10.026 33.337 1.00 17.90 ? 78  ARG A NH2 1 
ATOM   597  N N   . LEU A 1 81  ? 33.383 12.572 38.532 1.00 21.58 ? 79  LEU A N   1 
ATOM   598  C CA  . LEU A 1 81  ? 33.082 11.201 38.943 1.00 21.62 ? 79  LEU A CA  1 
ATOM   599  C C   . LEU A 1 81  ? 32.483 11.119 40.309 1.00 22.83 ? 79  LEU A C   1 
ATOM   600  O O   . LEU A 1 81  ? 32.086 10.046 40.742 1.00 23.32 ? 79  LEU A O   1 
ATOM   601  C CB  . LEU A 1 81  ? 34.348 10.310 38.924 1.00 21.25 ? 79  LEU A CB  1 
ATOM   602  C CG  . LEU A 1 81  ? 34.988 10.047 37.552 1.00 21.96 ? 79  LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 81  ? 36.152 9.078  37.610 1.00 22.45 ? 79  LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 81  ? 33.937 9.645  36.497 1.00 20.17 ? 79  LEU A CD2 1 
ATOM   605  N N   . LEU A 1 82  ? 32.436 12.235 41.025 1.00 23.78 ? 80  LEU A N   1 
ATOM   606  C CA  . LEU A 1 82  ? 31.973 12.172 42.405 1.00 24.57 ? 80  LEU A CA  1 
ATOM   607  C C   . LEU A 1 82  ? 30.497 11.791 42.464 1.00 25.79 ? 80  LEU A C   1 
ATOM   608  O O   . LEU A 1 82  ? 29.716 12.317 41.679 1.00 24.82 ? 80  LEU A O   1 
ATOM   609  C CB  . LEU A 1 82  ? 32.247 13.480 43.116 1.00 23.63 ? 80  LEU A CB  1 
ATOM   610  C CG  . LEU A 1 82  ? 33.757 13.659 43.373 1.00 23.54 ? 80  LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 82  ? 34.047 15.093 43.823 1.00 22.14 ? 80  LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 82  ? 34.390 12.597 44.325 1.00 20.34 ? 80  LEU A CD2 1 
ATOM   613  N N   . GLN A 1 83  ? 30.136 10.851 43.354 1.00 27.30 ? 81  GLN A N   1 
ATOM   614  C CA  . GLN A 1 83  ? 28.721 10.519 43.554 1.00 29.66 ? 81  GLN A CA  1 
ATOM   615  C C   . GLN A 1 83  ? 27.900 11.701 44.087 1.00 30.76 ? 81  GLN A C   1 
ATOM   616  O O   . GLN A 1 83  ? 28.443 12.655 44.676 1.00 29.21 ? 81  GLN A O   1 
ATOM   617  C CB  . GLN A 1 83  ? 28.448 9.216  44.351 1.00 29.95 ? 81  GLN A CB  1 
ATOM   618  C CG  . GLN A 1 83  ? 29.562 8.576  45.073 1.00 33.74 ? 81  GLN A CG  1 
ATOM   619  C CD  . GLN A 1 83  ? 29.357 8.583  46.568 1.00 40.37 ? 81  GLN A CD  1 
ATOM   620  O OE1 . GLN A 1 83  ? 28.425 9.214  47.067 1.00 46.99 ? 81  GLN A OE1 1 
ATOM   621  N NE2 . GLN A 1 83  ? 30.213 7.872  47.298 1.00 39.73 ? 81  GLN A NE2 1 
ATOM   622  N N   . PRO A 1 84  ? 26.579 11.660 43.865 1.00 31.94 ? 82  PRO A N   1 
ATOM   623  C CA  . PRO A 1 84  ? 25.805 12.786 44.377 1.00 31.96 ? 82  PRO A CA  1 
ATOM   624  C C   . PRO A 1 84  ? 26.088 12.968 45.870 1.00 31.25 ? 82  PRO A C   1 
ATOM   625  O O   . PRO A 1 84  ? 26.228 11.979 46.611 1.00 31.87 ? 82  PRO A O   1 
ATOM   626  C CB  . PRO A 1 84  ? 24.342 12.342 44.148 1.00 32.31 ? 82  PRO A CB  1 
ATOM   627  C CG  . PRO A 1 84  ? 24.401 10.834 43.962 1.00 33.58 ? 82  PRO A CG  1 
ATOM   628  C CD  . PRO A 1 84  ? 25.721 10.633 43.225 1.00 32.94 ? 82  PRO A CD  1 
ATOM   629  N N   . GLY A 1 85  ? 26.228 14.210 46.305 1.00 30.72 ? 83  GLY A N   1 
ATOM   630  C CA  . GLY A 1 85  ? 26.550 14.489 47.711 1.00 29.99 ? 83  GLY A CA  1 
ATOM   631  C C   . GLY A 1 85  ? 28.034 14.524 48.091 1.00 30.14 ? 83  GLY A C   1 
ATOM   632  O O   . GLY A 1 85  ? 28.403 15.175 49.096 1.00 31.65 ? 83  GLY A O   1 
ATOM   633  N N   . ALA A 1 86  ? 28.882 13.828 47.317 1.00 28.04 ? 84  ALA A N   1 
ATOM   634  C CA  . ALA A 1 86  ? 30.346 13.852 47.455 1.00 25.97 ? 84  ALA A CA  1 
ATOM   635  C C   . ALA A 1 86  ? 30.921 15.247 47.129 1.00 25.92 ? 84  ALA A C   1 
ATOM   636  O O   . ALA A 1 86  ? 30.429 15.953 46.233 1.00 25.86 ? 84  ALA A O   1 
ATOM   637  C CB  . ALA A 1 86  ? 30.960 12.826 46.542 1.00 24.42 ? 84  ALA A CB  1 
ATOM   638  N N   . ARG A 1 87  ? 31.959 15.645 47.850 1.00 24.83 ? 85  ARG A N   1 
ATOM   639  C CA  . ARG A 1 87  ? 32.649 16.886 47.519 1.00 25.21 ? 85  ARG A CA  1 
ATOM   640  C C   . ARG A 1 87  ? 34.170 16.793 47.356 1.00 22.91 ? 85  ARG A C   1 
ATOM   641  O O   . ARG A 1 87  ? 34.850 15.920 47.941 1.00 22.55 ? 85  ARG A O   1 
ATOM   642  C CB  . ARG A 1 87  ? 32.202 18.067 48.434 1.00 25.70 ? 85  ARG A CB  1 
ATOM   643  C CG  . ARG A 1 87  ? 32.483 17.926 49.875 1.00 29.98 ? 85  ARG A CG  1 
ATOM   644  C CD  . ARG A 1 87  ? 31.504 18.774 50.705 1.00 36.75 ? 85  ARG A CD  1 
ATOM   645  N NE  . ARG A 1 87  ? 32.175 19.308 51.895 1.00 41.22 ? 85  ARG A NE  1 
ATOM   646  C CZ  . ARG A 1 87  ? 32.345 18.628 53.030 1.00 43.17 ? 85  ARG A CZ  1 
ATOM   647  N NH1 . ARG A 1 87  ? 31.884 17.384 53.132 1.00 45.27 ? 85  ARG A NH1 1 
ATOM   648  N NH2 . ARG A 1 87  ? 32.981 19.182 54.057 1.00 41.60 ? 85  ARG A NH2 1 
ATOM   649  N N   . LEU A 1 88  ? 34.668 17.681 46.501 1.00 20.87 ? 86  LEU A N   1 
ATOM   650  C CA  . LEU A 1 88  ? 36.101 17.913 46.309 1.00 18.43 ? 86  LEU A CA  1 
ATOM   651  C C   . LEU A 1 88  ? 36.482 19.218 46.947 1.00 18.80 ? 86  LEU A C   1 
ATOM   652  O O   . LEU A 1 88  ? 35.849 20.237 46.714 1.00 18.73 ? 86  LEU A O   1 
ATOM   653  C CB  . LEU A 1 88  ? 36.481 17.955 44.833 1.00 18.47 ? 86  LEU A CB  1 
ATOM   654  C CG  . LEU A 1 88  ? 37.965 18.212 44.482 1.00 19.35 ? 86  LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 88  ? 38.989 17.184 45.102 1.00 12.00 ? 86  LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 88  ? 38.130 18.325 42.979 1.00 13.56 ? 86  LEU A CD2 1 
ATOM   657  N N   . LEU A 1 89  ? 37.522 19.181 47.767 1.00 18.46 ? 87  LEU A N   1 
ATOM   658  C CA  . LEU A 1 89  ? 38.142 20.397 48.255 1.00 18.65 ? 87  LEU A CA  1 
ATOM   659  C C   . LEU A 1 89  ? 39.504 20.434 47.630 1.00 17.49 ? 87  LEU A C   1 
ATOM   660  O O   . LEU A 1 89  ? 40.273 19.473 47.786 1.00 17.22 ? 87  LEU A O   1 
ATOM   661  C CB  . LEU A 1 89  ? 38.330 20.374 49.789 1.00 17.77 ? 87  LEU A CB  1 
ATOM   662  C CG  . LEU A 1 89  ? 37.191 19.995 50.710 1.00 19.82 ? 87  LEU A CG  1 
ATOM   663  C CD1 . LEU A 1 89  ? 37.718 20.103 52.148 1.00 21.22 ? 87  LEU A CD1 1 
ATOM   664  C CD2 . LEU A 1 89  ? 36.112 21.012 50.548 1.00 25.51 ? 87  LEU A CD2 1 
ATOM   665  N N   . THR A 1 90  ? 39.834 21.527 46.958 1.00 17.63 ? 88  THR A N   1 
ATOM   666  C CA  . THR A 1 90  ? 41.196 21.660 46.435 1.00 18.97 ? 88  THR A CA  1 
ATOM   667  C C   . THR A 1 90  ? 41.954 22.857 46.958 1.00 19.03 ? 88  THR A C   1 
ATOM   668  O O   . THR A 1 90  ? 41.435 23.944 47.039 1.00 20.24 ? 88  THR A O   1 
ATOM   669  C CB  . THR A 1 90  ? 41.346 21.460 44.913 1.00 19.37 ? 88  THR A CB  1 
ATOM   670  O OG1 . THR A 1 90  ? 41.908 22.621 44.278 1.00 24.74 ? 88  THR A OG1 1 
ATOM   671  C CG2 . THR A 1 90  ? 40.107 21.010 44.284 1.00 16.19 ? 88  THR A CG2 1 
ATOM   672  N N   . MET A 1 91  ? 43.159 22.600 47.424 1.00 19.08 ? 89  MET A N   1 
ATOM   673  C CA  . MET A 1 91  ? 44.030 23.626 47.954 1.00 18.95 ? 89  MET A CA  1 
ATOM   674  C C   . MET A 1 91  ? 45.130 23.855 46.961 1.00 17.47 ? 89  MET A C   1 
ATOM   675  O O   . MET A 1 91  ? 45.765 22.894 46.476 1.00 14.73 ? 89  MET A O   1 
ATOM   676  C CB  . MET A 1 91  ? 44.719 23.189 49.255 1.00 17.24 ? 89  MET A CB  1 
ATOM   677  C CG  . MET A 1 91  ? 43.890 23.203 50.399 1.00 19.73 ? 89  MET A CG  1 
ATOM   678  S SD  . MET A 1 91  ? 44.761 22.590 51.885 1.00 21.72 ? 89  MET A SD  1 
ATOM   679  C CE  . MET A 1 91  ? 43.332 22.283 52.844 1.00 17.88 ? 89  MET A CE  1 
ATOM   680  N N   . GLU A 1 92  ? 45.365 25.134 46.699 1.00 16.21 ? 90  GLU A N   1 
ATOM   681  C CA  . GLU A 1 92  ? 46.473 25.521 45.855 1.00 17.27 ? 90  GLU A CA  1 
ATOM   682  C C   . GLU A 1 92  ? 46.929 26.911 46.275 1.00 19.14 ? 90  GLU A C   1 
ATOM   683  O O   . GLU A 1 92  ? 46.127 27.843 46.298 1.00 18.27 ? 90  GLU A O   1 
ATOM   684  C CB  . GLU A 1 92  ? 46.095 25.456 44.374 1.00 15.03 ? 90  GLU A CB  1 
ATOM   685  C CG  . GLU A 1 92  ? 47.128 26.008 43.378 1.00 14.29 ? 90  GLU A CG  1 
ATOM   686  C CD  . GLU A 1 92  ? 48.582 25.530 43.633 1.00 13.73 ? 90  GLU A CD  1 
ATOM   687  O OE1 . GLU A 1 92  ? 48.852 24.350 43.837 1.00 15.02 ? 90  GLU A OE1 1 
ATOM   688  O OE2 . GLU A 1 92  ? 49.500 26.345 43.579 1.00 20.80 ? 90  GLU A OE2 1 
ATOM   689  N N   . MET A 1 93  ? 48.239 27.022 46.519 1.00 22.04 ? 91  MET A N   1 
ATOM   690  C CA  . MET A 1 93  ? 48.914 28.263 46.923 1.00 25.05 ? 91  MET A CA  1 
ATOM   691  C C   . MET A 1 93  ? 49.008 29.372 45.850 1.00 24.71 ? 91  MET A C   1 
ATOM   692  O O   . MET A 1 93  ? 48.658 30.512 46.144 1.00 27.37 ? 91  MET A O   1 
ATOM   693  C CB  . MET A 1 93  ? 50.286 27.927 47.509 1.00 24.96 ? 91  MET A CB  1 
ATOM   694  C CG  . MET A 1 93  ? 50.982 29.070 48.236 1.00 26.52 ? 91  MET A CG  1 
ATOM   695  S SD  . MET A 1 93  ? 52.362 28.402 49.152 1.00 30.48 ? 91  MET A SD  1 
ATOM   696  C CE  . MET A 1 93  ? 53.536 28.438 47.832 1.00 22.14 ? 91  MET A CE  1 
ATOM   697  N N   . ASN A 1 94  ? 49.443 29.053 44.629 1.00 25.22 ? 92  ASN A N   1 
ATOM   698  C CA  . ASN A 1 94  ? 49.564 30.004 43.517 1.00 23.78 ? 92  ASN A CA  1 
ATOM   699  C C   . ASN A 1 94  ? 48.157 30.503 43.136 1.00 24.27 ? 92  ASN A C   1 
ATOM   700  O O   . ASN A 1 94  ? 47.333 29.724 42.673 1.00 23.60 ? 92  ASN A O   1 
ATOM   701  C CB  . ASN A 1 94  ? 50.250 29.276 42.383 1.00 24.35 ? 92  ASN A CB  1 
ATOM   702  C CG  . ASN A 1 94  ? 50.609 30.164 41.180 1.00 26.11 ? 92  ASN A CG  1 
ATOM   703  O OD1 . ASN A 1 94  ? 51.712 30.051 40.649 1.00 26.26 ? 92  ASN A OD1 1 
ATOM   704  N ND2 . ASN A 1 94  ? 49.667 30.943 40.687 1.00 25.54 ? 92  ASN A ND2 1 
ATOM   705  N N   . PRO A 1 95  ? 47.859 31.819 43.381 1.00 24.99 ? 93  PRO A N   1 
ATOM   706  C CA  . PRO A 1 95  ? 46.531 32.360 43.088 1.00 23.94 ? 93  PRO A CA  1 
ATOM   707  C C   . PRO A 1 95  ? 46.071 32.217 41.614 1.00 23.09 ? 93  PRO A C   1 
ATOM   708  O O   . PRO A 1 95  ? 44.887 32.046 41.384 1.00 22.59 ? 93  PRO A O   1 
ATOM   709  C CB  . PRO A 1 95  ? 46.630 33.808 43.575 1.00 24.73 ? 93  PRO A CB  1 
ATOM   710  C CG  . PRO A 1 95  ? 48.131 34.137 43.550 1.00 24.65 ? 93  PRO A CG  1 
ATOM   711  C CD  . PRO A 1 95  ? 48.759 32.860 43.951 1.00 24.62 ? 93  PRO A CD  1 
ATOM   712  N N   . ASP A 1 96  ? 46.983 32.213 40.649 1.00 22.45 ? 94  ASP A N   1 
ATOM   713  C CA  . ASP A 1 96  ? 46.632 32.013 39.234 1.00 22.70 ? 94  ASP A CA  1 
ATOM   714  C C   . ASP A 1 96  ? 46.266 30.568 38.868 1.00 21.76 ? 94  ASP A C   1 
ATOM   715  O O   . ASP A 1 96  ? 45.347 30.324 38.110 1.00 20.70 ? 94  ASP A O   1 
ATOM   716  C CB  . ASP A 1 96  ? 47.799 32.486 38.372 1.00 24.93 ? 94  ASP A CB  1 
ATOM   717  C CG  . ASP A 1 96  ? 48.324 33.863 38.821 1.00 30.24 ? 94  ASP A CG  1 
ATOM   718  O OD1 . ASP A 1 96  ? 47.531 34.848 38.818 1.00 34.38 ? 94  ASP A OD1 1 
ATOM   719  O OD2 . ASP A 1 96  ? 49.501 33.953 39.233 1.00 34.53 ? 94  ASP A OD2 1 
ATOM   720  N N   . TYR A 1 97  ? 46.995 29.605 39.416 1.00 21.42 ? 95  TYR A N   1 
ATOM   721  C CA  . TYR A 1 97  ? 46.628 28.201 39.316 1.00 21.43 ? 95  TYR A CA  1 
ATOM   722  C C   . TYR A 1 97  ? 45.243 27.943 39.946 1.00 19.78 ? 95  TYR A C   1 
ATOM   723  O O   . TYR A 1 97  ? 44.406 27.309 39.345 1.00 21.08 ? 95  TYR A O   1 
ATOM   724  C CB  . TYR A 1 97  ? 47.725 27.360 39.987 1.00 21.64 ? 95  TYR A CB  1 
ATOM   725  C CG  . TYR A 1 97  ? 49.074 27.373 39.281 1.00 22.98 ? 95  TYR A CG  1 
ATOM   726  C CD1 . TYR A 1 97  ? 49.348 28.253 38.205 1.00 25.09 ? 95  TYR A CD1 1 
ATOM   727  C CD2 . TYR A 1 97  ? 50.095 26.530 39.710 1.00 26.09 ? 95  TYR A CD2 1 
ATOM   728  C CE1 . TYR A 1 97  ? 50.606 28.259 37.569 1.00 23.55 ? 95  TYR A CE1 1 
ATOM   729  C CE2 . TYR A 1 97  ? 51.335 26.519 39.082 1.00 28.50 ? 95  TYR A CE2 1 
ATOM   730  C CZ  . TYR A 1 97  ? 51.584 27.391 38.005 1.00 26.66 ? 95  TYR A CZ  1 
ATOM   731  O OH  . TYR A 1 97  ? 52.830 27.346 37.400 1.00 25.95 ? 95  TYR A OH  1 
ATOM   732  N N   . ALA A 1 98  ? 45.012 28.449 41.146 1.00 18.89 ? 96  ALA A N   1 
ATOM   733  C CA  . ALA A 1 98  ? 43.701 28.344 41.805 1.00 18.15 ? 96  ALA A CA  1 
ATOM   734  C C   . ALA A 1 98  ? 42.574 28.937 40.956 1.00 17.97 ? 96  ALA A C   1 
ATOM   735  O O   . ALA A 1 98  ? 41.527 28.337 40.833 1.00 17.87 ? 96  ALA A O   1 
ATOM   736  C CB  . ALA A 1 98  ? 43.729 29.005 43.182 1.00 16.56 ? 96  ALA A CB  1 
ATOM   737  N N   . ALA A 1 99  ? 42.817 30.110 40.371 1.00 18.52 ? 97  ALA A N   1 
ATOM   738  C CA  . ALA A 1 99  ? 41.881 30.825 39.503 1.00 18.84 ? 97  ALA A CA  1 
ATOM   739  C C   . ALA A 1 99  ? 41.547 30.048 38.240 1.00 19.19 ? 97  ALA A C   1 
ATOM   740  O O   . ALA A 1 99  ? 40.368 29.905 37.891 1.00 21.82 ? 97  ALA A O   1 
ATOM   741  C CB  . ALA A 1 99  ? 42.482 32.236 39.130 1.00 17.90 ? 97  ALA A CB  1 
ATOM   742  N N   . ILE A 1 100 ? 42.571 29.557 37.547 1.00 18.62 ? 98  ILE A N   1 
ATOM   743  C CA  . ILE A 1 100 ? 42.389 28.713 36.375 1.00 18.57 ? 98  ILE A CA  1 
ATOM   744  C C   . ILE A 1 100 ? 41.689 27.394 36.662 1.00 17.34 ? 98  ILE A C   1 
ATOM   745  O O   . ILE A 1 100 ? 40.848 26.966 35.891 1.00 16.74 ? 98  ILE A O   1 
ATOM   746  C CB  . ILE A 1 100 ? 43.738 28.390 35.663 1.00 18.81 ? 98  ILE A CB  1 
ATOM   747  C CG1 . ILE A 1 100 ? 44.313 29.674 35.067 1.00 22.51 ? 98  ILE A CG1 1 
ATOM   748  C CG2 . ILE A 1 100 ? 43.452 27.397 34.562 1.00 19.95 ? 98  ILE A CG2 1 
ATOM   749  C CD1 . ILE A 1 100 ? 45.821 29.800 35.254 1.00 29.19 ? 98  ILE A CD1 1 
ATOM   750  N N   . THR A 1 101 ? 42.081 26.737 37.752 1.00 15.57 ? 99  THR A N   1 
ATOM   751  C CA  . THR A 1 101 ? 41.398 25.540 38.197 1.00 14.48 ? 99  THR A CA  1 
ATOM   752  C C   . THR A 1 101 ? 39.901 25.813 38.442 1.00 14.42 ? 99  THR A C   1 
ATOM   753  O O   . THR A 1 101 ? 39.061 25.047 37.978 1.00 14.06 ? 99  THR A O   1 
ATOM   754  C CB  . THR A 1 101 ? 42.104 24.961 39.464 1.00 14.07 ? 99  THR A CB  1 
ATOM   755  O OG1 . THR A 1 101 ? 43.437 24.526 39.104 1.00 15.40 ? 99  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 101 ? 41.313 23.810 40.059 1.00 12.34 ? 99  THR A CG2 1 
ATOM   757  N N   . GLN A 1 102 ? 39.580 26.880 39.181 1.00 14.21 ? 100 GLN A N   1 
ATOM   758  C CA  . GLN A 1 102 ? 38.176 27.328 39.349 1.00 16.11 ? 100 GLN A CA  1 
ATOM   759  C C   . GLN A 1 102 ? 37.440 27.556 38.002 1.00 16.73 ? 100 GLN A C   1 
ATOM   760  O O   . GLN A 1 102 ? 36.280 27.083 37.775 1.00 17.09 ? 100 GLN A O   1 
ATOM   761  C CB  . GLN A 1 102 ? 38.087 28.587 40.229 1.00 15.01 ? 100 GLN A CB  1 
ATOM   762  C CG  . GLN A 1 102 ? 36.618 29.006 40.467 1.00 14.31 ? 100 GLN A CG  1 
ATOM   763  C CD  . GLN A 1 102 ? 35.914 28.126 41.494 1.00 15.00 ? 100 GLN A CD  1 
ATOM   764  O OE1 . GLN A 1 102 ? 36.192 28.229 42.684 1.00 14.08 ? 100 GLN A OE1 1 
ATOM   765  N NE2 . GLN A 1 102 ? 34.964 27.303 41.045 1.00 11.64 ? 100 GLN A NE2 1 
ATOM   766  N N   . GLN A 1 103 ? 38.124 28.238 37.091 1.00 17.28 ? 101 GLN A N   1 
ATOM   767  C CA  . GLN A 1 103 ? 37.467 28.602 35.838 1.00 19.05 ? 101 GLN A CA  1 
ATOM   768  C C   . GLN A 1 103 ? 37.190 27.365 35.022 1.00 18.79 ? 101 GLN A C   1 
ATOM   769  O O   . GLN A 1 103 ? 36.184 27.289 34.336 1.00 19.63 ? 101 GLN A O   1 
ATOM   770  C CB  . GLN A 1 103 ? 38.275 29.631 35.056 1.00 18.86 ? 101 GLN A CB  1 
ATOM   771  C CG  . GLN A 1 103 ? 38.126 31.095 35.583 1.00 22.90 ? 101 GLN A CG  1 
ATOM   772  C CD  . GLN A 1 103 ? 36.655 31.499 35.723 1.00 33.32 ? 101 GLN A CD  1 
ATOM   773  O OE1 . GLN A 1 103 ? 35.840 31.312 34.789 1.00 37.53 ? 101 GLN A OE1 1 
ATOM   774  N NE2 . GLN A 1 103 ? 36.279 31.994 36.910 1.00 36.86 ? 101 GLN A NE2 1 
ATOM   775  N N   . MET A 1 104 ? 38.073 26.380 35.140 1.00 18.65 ? 102 MET A N   1 
ATOM   776  C CA  . MET A 1 104 ? 37.978 25.159 34.393 1.00 18.52 ? 102 MET A CA  1 
ATOM   777  C C   . MET A 1 104 ? 36.840 24.289 34.923 1.00 18.25 ? 102 MET A C   1 
ATOM   778  O O   . MET A 1 104 ? 36.063 23.685 34.166 1.00 18.19 ? 102 MET A O   1 
ATOM   779  C CB  . MET A 1 104 ? 39.326 24.447 34.527 1.00 19.26 ? 102 MET A CB  1 
ATOM   780  C CG  . MET A 1 104 ? 39.639 23.545 33.350 1.00 22.67 ? 102 MET A CG  1 
ATOM   781  S SD  . MET A 1 104 ? 40.077 24.489 31.869 1.00 21.63 ? 102 MET A SD  1 
ATOM   782  C CE  . MET A 1 104 ? 41.852 24.649 32.051 1.00 24.88 ? 102 MET A CE  1 
ATOM   783  N N   . LEU A 1 105 ? 36.721 24.251 36.245 1.00 18.12 ? 103 LEU A N   1 
ATOM   784  C CA  . LEU A 1 105 ? 35.595 23.572 36.889 1.00 17.47 ? 103 LEU A CA  1 
ATOM   785  C C   . LEU A 1 105 ? 34.270 24.239 36.542 1.00 17.43 ? 103 LEU A C   1 
ATOM   786  O O   . LEU A 1 105 ? 33.283 23.527 36.323 1.00 18.74 ? 103 LEU A O   1 
ATOM   787  C CB  . LEU A 1 105 ? 35.793 23.485 38.416 1.00 16.09 ? 103 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 105 ? 36.902 22.516 38.824 1.00 15.65 ? 103 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 105 ? 37.327 22.826 40.261 1.00 18.19 ? 103 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 105 ? 36.404 21.071 38.739 1.00 13.65 ? 103 LEU A CD2 1 
ATOM   791  N N   . ASN A 1 106 ? 34.228 25.578 36.508 1.00 17.39 ? 104 ASN A N   1 
ATOM   792  C CA  . ASN A 1 106 ? 32.971 26.321 36.091 1.00 17.09 ? 104 ASN A CA  1 
ATOM   793  C C   . ASN A 1 106 ? 32.557 25.935 34.696 1.00 17.23 ? 104 ASN A C   1 
ATOM   794  O O   . ASN A 1 106 ? 31.431 25.491 34.474 1.00 17.99 ? 104 ASN A O   1 
ATOM   795  C CB  . ASN A 1 106 ? 33.159 27.839 36.141 1.00 15.87 ? 104 ASN A CB  1 
ATOM   796  C CG  . ASN A 1 106 ? 33.429 28.333 37.550 1.00 18.01 ? 104 ASN A CG  1 
ATOM   797  O OD1 . ASN A 1 106 ? 33.302 27.583 38.518 1.00 18.22 ? 104 ASN A OD1 1 
ATOM   798  N ND2 . ASN A 1 106 ? 33.843 29.571 37.672 1.00 19.12 ? 104 ASN A ND2 1 
ATOM   799  N N   . PHE A 1 107 ? 33.508 26.050 33.763 1.00 17.64 ? 105 PHE A N   1 
ATOM   800  C CA  . PHE A 1 107 ? 33.294 25.681 32.380 1.00 17.12 ? 105 PHE A CA  1 
ATOM   801  C C   . PHE A 1 107 ? 32.684 24.303 32.254 1.00 16.86 ? 105 PHE A C   1 
ATOM   802  O O   . PHE A 1 107 ? 31.659 24.119 31.587 1.00 18.17 ? 105 PHE A O   1 
ATOM   803  C CB  . PHE A 1 107 ? 34.593 25.827 31.557 1.00 17.77 ? 105 PHE A CB  1 
ATOM   804  C CG  . PHE A 1 107 ? 34.324 25.972 30.065 1.00 18.64 ? 105 PHE A CG  1 
ATOM   805  C CD1 . PHE A 1 107 ? 34.217 24.841 29.248 1.00 17.11 ? 105 PHE A CD1 1 
ATOM   806  C CD2 . PHE A 1 107 ? 34.091 27.228 29.502 1.00 16.99 ? 105 PHE A CD2 1 
ATOM   807  C CE1 . PHE A 1 107 ? 33.917 24.978 27.904 1.00 19.39 ? 105 PHE A CE1 1 
ATOM   808  C CE2 . PHE A 1 107 ? 33.750 27.358 28.154 1.00 17.55 ? 105 PHE A CE2 1 
ATOM   809  C CZ  . PHE A 1 107 ? 33.686 26.227 27.360 1.00 19.01 ? 105 PHE A CZ  1 
ATOM   810  N N   . ALA A 1 108 ? 33.283 23.340 32.940 1.00 16.58 ? 106 ALA A N   1 
ATOM   811  C CA  . ALA A 1 108 ? 32.848 21.940 32.886 1.00 16.02 ? 106 ALA A CA  1 
ATOM   812  C C   . ALA A 1 108 ? 31.512 21.740 33.581 1.00 16.16 ? 106 ALA A C   1 
ATOM   813  O O   . ALA A 1 108 ? 30.969 20.634 33.573 1.00 16.67 ? 106 ALA A O   1 
ATOM   814  C CB  . ALA A 1 108 ? 33.889 21.062 33.557 1.00 15.23 ? 106 ALA A CB  1 
ATOM   815  N N   . GLY A 1 109 ? 31.010 22.770 34.263 1.00 15.54 ? 107 GLY A N   1 
ATOM   816  C CA  . GLY A 1 109 ? 29.768 22.610 34.966 1.00 16.03 ? 107 GLY A CA  1 
ATOM   817  C C   . GLY A 1 109 ? 29.832 21.886 36.292 1.00 16.92 ? 107 GLY A C   1 
ATOM   818  O O   . GLY A 1 109 ? 28.793 21.366 36.760 1.00 15.38 ? 107 GLY A O   1 
ATOM   819  N N   . LEU A 1 110 ? 31.020 21.891 36.930 1.00 17.05 ? 108 LEU A N   1 
ATOM   820  C CA  . LEU A 1 110 ? 31.245 21.113 38.193 1.00 18.59 ? 108 LEU A CA  1 
ATOM   821  C C   . LEU A 1 110 ? 31.531 21.987 39.396 1.00 19.23 ? 108 LEU A C   1 
ATOM   822  O O   . LEU A 1 110 ? 31.940 21.509 40.431 1.00 19.06 ? 108 LEU A O   1 
ATOM   823  C CB  . LEU A 1 110 ? 32.443 20.162 38.060 1.00 17.67 ? 108 LEU A CB  1 
ATOM   824  C CG  . LEU A 1 110 ? 32.336 19.135 36.933 1.00 17.35 ? 108 LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 110 ? 33.754 18.593 36.613 1.00 12.34 ? 108 LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 110 ? 31.327 18.052 37.333 1.00 17.45 ? 108 LEU A CD2 1 
ATOM   827  N N   . GLN A 1 111 ? 31.276 23.271 39.275 1.00 20.14 ? 109 GLN A N   1 
ATOM   828  C CA  . GLN A 1 111 ? 31.638 24.162 40.353 1.00 20.38 ? 109 GLN A CA  1 
ATOM   829  C C   . GLN A 1 111 ? 30.839 23.909 41.624 1.00 20.18 ? 109 GLN A C   1 
ATOM   830  O O   . GLN A 1 111 ? 31.282 24.320 42.714 1.00 20.43 ? 109 GLN A O   1 
ATOM   831  C CB  . GLN A 1 111 ? 31.476 25.624 39.921 1.00 20.03 ? 109 GLN A CB  1 
ATOM   832  C CG  . GLN A 1 111 ? 30.077 26.119 39.997 1.00 21.49 ? 109 GLN A CG  1 
ATOM   833  C CD  . GLN A 1 111 ? 29.403 26.147 38.641 1.00 27.71 ? 109 GLN A CD  1 
ATOM   834  O OE1 . GLN A 1 111 ? 28.506 26.984 38.420 1.00 27.13 ? 109 GLN A OE1 1 
ATOM   835  N NE2 . GLN A 1 111 ? 29.866 25.272 37.694 1.00 26.95 ? 109 GLN A NE2 1 
ATOM   836  N N   . ASP A 1 112 ? 29.681 23.269 41.499 1.00 19.90 ? 110 ASP A N   1 
ATOM   837  C CA  . ASP A 1 112 ? 28.825 22.996 42.703 1.00 21.08 ? 110 ASP A CA  1 
ATOM   838  C C   . ASP A 1 112 ? 29.364 21.842 43.589 1.00 20.60 ? 110 ASP A C   1 
ATOM   839  O O   . ASP A 1 112 ? 28.879 21.592 44.688 1.00 20.43 ? 110 ASP A O   1 
ATOM   840  C CB  . ASP A 1 112 ? 27.356 22.711 42.311 1.00 20.39 ? 110 ASP A CB  1 
ATOM   841  C CG  . ASP A 1 112 ? 26.667 23.938 41.696 1.00 21.99 ? 110 ASP A CG  1 
ATOM   842  O OD1 . ASP A 1 112 ? 26.840 24.993 42.295 1.00 15.83 ? 110 ASP A OD1 1 
ATOM   843  O OD2 . ASP A 1 112 ? 25.992 23.831 40.621 1.00 20.53 ? 110 ASP A OD2 1 
ATOM   844  N N   . LYS A 1 113 ? 30.370 21.148 43.102 1.00 21.42 ? 111 LYS A N   1 
ATOM   845  C CA  . LYS A 1 113 ? 30.868 19.949 43.785 1.00 21.92 ? 111 LYS A CA  1 
ATOM   846  C C   . LYS A 1 113 ? 32.231 20.241 44.413 1.00 20.69 ? 111 LYS A C   1 
ATOM   847  O O   . LYS A 1 113 ? 32.774 19.395 45.159 1.00 21.46 ? 111 LYS A O   1 
ATOM   848  C CB  . LYS A 1 113 ? 30.999 18.823 42.747 1.00 23.36 ? 111 LYS A CB  1 
ATOM   849  C CG  . LYS A 1 113 ? 29.666 18.098 42.450 1.00 27.79 ? 111 LYS A CG  1 
ATOM   850  C CD  . LYS A 1 113 ? 29.604 17.748 40.992 1.00 34.19 ? 111 LYS A CD  1 
ATOM   851  C CE  . LYS A 1 113 ? 28.521 16.683 40.666 1.00 36.85 ? 111 LYS A CE  1 
ATOM   852  N NZ  . LYS A 1 113 ? 27.474 16.454 41.732 1.00 41.32 ? 111 LYS A NZ  1 
ATOM   853  N N   . VAL A 1 114 ? 32.778 21.429 44.131 1.00 18.73 ? 112 VAL A N   1 
ATOM   854  C CA  . VAL A 1 114 ? 34.144 21.753 44.492 1.00 17.05 ? 112 VAL A CA  1 
ATOM   855  C C   . VAL A 1 114 ? 34.259 23.058 45.262 1.00 17.90 ? 112 VAL A C   1 
ATOM   856  O O   . VAL A 1 114 ? 33.527 24.034 45.030 1.00 16.40 ? 112 VAL A O   1 
ATOM   857  C CB  . VAL A 1 114 ? 35.077 21.809 43.258 1.00 17.54 ? 112 VAL A CB  1 
ATOM   858  C CG1 . VAL A 1 114 ? 36.578 21.883 43.688 1.00 19.31 ? 112 VAL A CG1 1 
ATOM   859  C CG2 . VAL A 1 114 ? 34.821 20.627 42.252 1.00 15.90 ? 112 VAL A CG2 1 
ATOM   860  N N   . THR A 1 115 ? 35.208 23.056 46.190 1.00 18.26 ? 113 THR A N   1 
ATOM   861  C CA  . THR A 1 115 ? 35.672 24.243 46.862 1.00 19.15 ? 113 THR A CA  1 
ATOM   862  C C   . THR A 1 115 ? 37.189 24.402 46.645 1.00 20.11 ? 113 THR A C   1 
ATOM   863  O O   . THR A 1 115 ? 37.990 23.542 47.043 1.00 18.12 ? 113 THR A O   1 
ATOM   864  C CB  . THR A 1 115 ? 35.339 24.154 48.338 1.00 19.55 ? 113 THR A CB  1 
ATOM   865  O OG1 . THR A 1 115 ? 33.980 23.754 48.442 1.00 20.38 ? 113 THR A OG1 1 
ATOM   866  C CG2 . THR A 1 115 ? 35.491 25.502 49.039 1.00 17.50 ? 113 THR A CG2 1 
ATOM   867  N N   . ILE A 1 116 ? 37.546 25.515 45.998 1.00 20.73 ? 114 ILE A N   1 
ATOM   868  C CA  . ILE A 1 116 ? 38.914 25.886 45.803 1.00 23.16 ? 114 ILE A CA  1 
ATOM   869  C C   . ILE A 1 116 ? 39.350 26.765 46.962 1.00 25.30 ? 114 ILE A C   1 
ATOM   870  O O   . ILE A 1 116 ? 38.716 27.767 47.251 1.00 26.25 ? 114 ILE A O   1 
ATOM   871  C CB  . ILE A 1 116 ? 39.127 26.630 44.499 1.00 22.74 ? 114 ILE A CB  1 
ATOM   872  C CG1 . ILE A 1 116 ? 39.047 25.661 43.331 1.00 23.14 ? 114 ILE A CG1 1 
ATOM   873  C CG2 . ILE A 1 116 ? 40.531 27.235 44.462 1.00 23.26 ? 114 ILE A CG2 1 
ATOM   874  C CD1 . ILE A 1 116 ? 37.720 25.530 42.770 1.00 26.56 ? 114 ILE A CD1 1 
ATOM   875  N N   . LEU A 1 117 ? 40.427 26.359 47.625 1.00 26.86 ? 115 LEU A N   1 
ATOM   876  C CA  . LEU A 1 117 ? 41.040 27.121 48.703 1.00 27.74 ? 115 LEU A CA  1 
ATOM   877  C C   . LEU A 1 117 ? 42.352 27.630 48.201 1.00 28.59 ? 115 LEU A C   1 
ATOM   878  O O   . LEU A 1 117 ? 43.253 26.853 47.888 1.00 28.71 ? 115 LEU A O   1 
ATOM   879  C CB  . LEU A 1 117 ? 41.283 26.232 49.922 1.00 28.20 ? 115 LEU A CB  1 
ATOM   880  C CG  . LEU A 1 117 ? 40.032 25.534 50.468 1.00 28.13 ? 115 LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 117 ? 40.279 24.958 51.823 1.00 28.48 ? 115 LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 117 ? 38.874 26.532 50.543 1.00 31.01 ? 115 LEU A CD2 1 
ATOM   883  N N   . ASN A 1 118 ? 42.458 28.940 48.062 1.00 29.42 ? 116 ASN A N   1 
ATOM   884  C CA  . ASN A 1 118 ? 43.732 29.495 47.678 1.00 31.05 ? 116 ASN A CA  1 
ATOM   885  C C   . ASN A 1 118 ? 44.520 29.917 48.913 1.00 31.58 ? 116 ASN A C   1 
ATOM   886  O O   . ASN A 1 118 ? 44.225 30.914 49.531 1.00 32.21 ? 116 ASN A O   1 
ATOM   887  C CB  . ASN A 1 118 ? 43.580 30.621 46.646 1.00 30.70 ? 116 ASN A CB  1 
ATOM   888  C CG  . ASN A 1 118 ? 44.889 31.355 46.404 1.00 31.66 ? 116 ASN A CG  1 
ATOM   889  O OD1 . ASN A 1 118 ? 44.898 32.557 46.233 1.00 29.88 ? 116 ASN A OD1 1 
ATOM   890  N ND2 . ASN A 1 118 ? 46.010 30.627 46.422 1.00 31.55 ? 116 ASN A ND2 1 
ATOM   891  N N   . GLY A 1 119 ? 45.504 29.107 49.269 1.00 32.79 ? 117 GLY A N   1 
ATOM   892  C CA  . GLY A 1 119 ? 46.356 29.328 50.421 1.00 33.26 ? 117 GLY A CA  1 
ATOM   893  C C   . GLY A 1 119 ? 47.474 28.282 50.490 1.00 34.21 ? 117 GLY A C   1 
ATOM   894  O O   . GLY A 1 119 ? 47.518 27.326 49.682 1.00 33.68 ? 117 GLY A O   1 
ATOM   895  N N   . ALA A 1 120 ? 48.381 28.472 51.450 1.00 34.10 ? 118 ALA A N   1 
ATOM   896  C CA  . ALA A 1 120 ? 49.437 27.497 51.739 1.00 35.35 ? 118 ALA A CA  1 
ATOM   897  C C   . ALA A 1 120 ? 48.829 26.241 52.372 1.00 35.15 ? 118 ALA A C   1 
ATOM   898  O O   . ALA A 1 120 ? 48.001 26.321 53.252 1.00 35.21 ? 118 ALA A O   1 
ATOM   899  C CB  . ALA A 1 120 ? 50.489 28.121 52.679 1.00 35.22 ? 118 ALA A CB  1 
ATOM   900  N N   . SER A 1 121 ? 49.230 25.074 51.924 1.00 36.25 ? 119 SER A N   1 
ATOM   901  C CA  . SER A 1 121 ? 48.741 23.839 52.565 1.00 37.32 ? 119 SER A CA  1 
ATOM   902  C C   . SER A 1 121 ? 48.944 23.861 54.091 1.00 36.55 ? 119 SER A C   1 
ATOM   903  O O   . SER A 1 121 ? 48.067 23.453 54.852 1.00 35.70 ? 119 SER A O   1 
ATOM   904  C CB  . SER A 1 121 ? 49.449 22.630 51.957 1.00 37.74 ? 119 SER A CB  1 
ATOM   905  O OG  . SER A 1 121 ? 50.861 22.799 52.034 1.00 40.65 ? 119 SER A OG  1 
ATOM   906  N N   . GLN A 1 122 ? 50.091 24.381 54.527 1.00 36.99 ? 120 GLN A N   1 
ATOM   907  C CA  . GLN A 1 122 ? 50.427 24.389 55.948 1.00 37.26 ? 120 GLN A CA  1 
ATOM   908  C C   . GLN A 1 122 ? 49.535 25.251 56.799 1.00 36.32 ? 120 GLN A C   1 
ATOM   909  O O   . GLN A 1 122 ? 49.398 24.933 57.951 1.00 36.40 ? 120 GLN A O   1 
ATOM   910  C CB  . GLN A 1 122 ? 51.891 24.721 56.201 1.00 37.74 ? 120 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 122 ? 52.787 24.474 54.997 1.00 41.99 ? 120 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 122 ? 53.312 25.764 54.356 1.00 45.62 ? 120 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 122 ? 53.941 25.721 53.296 1.00 47.09 ? 120 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 122 ? 53.074 26.911 55.011 1.00 46.49 ? 120 GLN A NE2 1 
ATOM   915  N N   . ASP A 1 123 ? 48.941 26.330 56.253 1.00 35.46 ? 121 ASP A N   1 
ATOM   916  C CA  . ASP A 1 123 ? 48.008 27.156 57.035 1.00 34.54 ? 121 ASP A CA  1 
ATOM   917  C C   . ASP A 1 123 ? 46.605 26.580 56.965 1.00 33.41 ? 121 ASP A C   1 
ATOM   918  O O   . ASP A 1 123 ? 45.826 26.685 57.916 1.00 32.87 ? 121 ASP A O   1 
ATOM   919  C CB  . ASP A 1 123 ? 47.891 28.635 56.585 1.00 35.74 ? 121 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 123 ? 49.207 29.271 56.093 1.00 38.94 ? 121 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 123 ? 50.334 28.965 56.576 1.00 41.12 ? 121 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 123 ? 49.070 30.151 55.211 1.00 41.56 ? 121 ASP A OD2 1 
ATOM   923  N N   . LEU A 1 124 ? 46.273 26.023 55.800 1.00 31.46 ? 122 LEU A N   1 
ATOM   924  C CA  . LEU A 1 124 ? 44.911 25.579 55.520 1.00 29.75 ? 122 LEU A CA  1 
ATOM   925  C C   . LEU A 1 124 ? 44.500 24.207 56.074 1.00 28.59 ? 122 LEU A C   1 
ATOM   926  O O   . LEU A 1 124 ? 43.339 24.029 56.436 1.00 28.34 ? 122 LEU A O   1 
ATOM   927  C CB  . LEU A 1 124 ? 44.651 25.635 54.022 1.00 29.42 ? 122 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 124 ? 44.670 26.980 53.313 1.00 29.79 ? 122 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 124 ? 44.573 26.615 51.886 1.00 31.50 ? 122 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 124 ? 43.502 27.906 53.742 1.00 27.41 ? 122 LEU A CD2 1 
ATOM   931  N N   . ILE A 1 125 ? 45.430 23.249 56.101 1.00 27.42 ? 123 ILE A N   1 
ATOM   932  C CA  . ILE A 1 125 ? 45.158 21.924 56.621 1.00 26.00 ? 123 ILE A CA  1 
ATOM   933  C C   . ILE A 1 125 ? 44.701 21.971 58.085 1.00 27.94 ? 123 ILE A C   1 
ATOM   934  O O   . ILE A 1 125 ? 43.728 21.311 58.400 1.00 26.92 ? 123 ILE A O   1 
ATOM   935  C CB  . ILE A 1 125 ? 46.343 20.899 56.370 1.00 26.45 ? 123 ILE A CB  1 
ATOM   936  C CG1 . ILE A 1 125 ? 46.382 20.440 54.889 1.00 26.36 ? 123 ILE A CG1 1 
ATOM   937  C CG2 . ILE A 1 125 ? 46.253 19.655 57.296 1.00 24.03 ? 123 ILE A CG2 1 
ATOM   938  C CD1 . ILE A 1 125 ? 47.718 19.845 54.440 1.00 22.93 ? 123 ILE A CD1 1 
ATOM   939  N N   . PRO A 1 126 ? 45.406 22.735 58.989 1.00 29.66 ? 124 PRO A N   1 
ATOM   940  C CA  . PRO A 1 126 ? 44.927 22.859 60.376 1.00 31.01 ? 124 PRO A CA  1 
ATOM   941  C C   . PRO A 1 126 ? 43.507 23.449 60.506 1.00 32.64 ? 124 PRO A C   1 
ATOM   942  O O   . PRO A 1 126 ? 42.817 23.166 61.479 1.00 32.91 ? 124 PRO A O   1 
ATOM   943  C CB  . PRO A 1 126 ? 45.963 23.809 60.999 1.00 31.37 ? 124 PRO A CB  1 
ATOM   944  C CG  . PRO A 1 126 ? 47.229 23.561 60.211 1.00 29.44 ? 124 PRO A CG  1 
ATOM   945  C CD  . PRO A 1 126 ? 46.687 23.471 58.818 1.00 29.52 ? 124 PRO A CD  1 
ATOM   946  N N   . GLN A 1 127 ? 43.091 24.250 59.532 1.00 33.66 ? 125 GLN A N   1 
ATOM   947  C CA  . GLN A 1 127 ? 41.786 24.905 59.540 1.00 36.14 ? 125 GLN A CA  1 
ATOM   948  C C   . GLN A 1 127 ? 40.664 24.017 59.074 1.00 35.69 ? 125 GLN A C   1 
ATOM   949  O O   . GLN A 1 127 ? 39.507 24.419 59.136 1.00 35.71 ? 125 GLN A O   1 
ATOM   950  C CB  . GLN A 1 127 ? 41.757 26.090 58.575 1.00 35.45 ? 125 GLN A CB  1 
ATOM   951  C CG  . GLN A 1 127 ? 42.671 27.251 58.854 1.00 39.00 ? 125 GLN A CG  1 
ATOM   952  C CD  . GLN A 1 127 ? 42.359 28.447 57.905 1.00 39.57 ? 125 GLN A CD  1 
ATOM   953  O OE1 . GLN A 1 127 ? 43.269 29.086 57.370 1.00 42.23 ? 125 GLN A OE1 1 
ATOM   954  N NE2 . GLN A 1 127 ? 41.054 28.730 57.691 1.00 43.18 ? 125 GLN A NE2 1 
ATOM   955  N N   . LEU A 1 128 ? 40.996 22.853 58.531 1.00 36.04 ? 126 LEU A N   1 
ATOM   956  C CA  . LEU A 1 128 ? 40.019 22.028 57.812 1.00 35.96 ? 126 LEU A CA  1 
ATOM   957  C C   . LEU A 1 128 ? 38.843 21.566 58.676 1.00 36.68 ? 126 LEU A C   1 
ATOM   958  O O   . LEU A 1 128 ? 37.703 21.588 58.222 1.00 36.05 ? 126 LEU A O   1 
ATOM   959  C CB  . LEU A 1 128 ? 40.731 20.819 57.179 1.00 35.31 ? 126 LEU A CB  1 
ATOM   960  C CG  . LEU A 1 128 ? 40.576 20.522 55.697 1.00 33.26 ? 126 LEU A CG  1 
ATOM   961  C CD1 . LEU A 1 128 ? 40.258 21.740 54.836 1.00 31.25 ? 126 LEU A CD1 1 
ATOM   962  C CD2 . LEU A 1 128 ? 41.851 19.864 55.274 1.00 31.82 ? 126 LEU A CD2 1 
ATOM   963  N N   . LYS A 1 129 ? 39.118 21.152 59.910 1.00 38.40 ? 127 LYS A N   1 
ATOM   964  C CA  . LYS A 1 129 ? 38.060 20.658 60.798 1.00 41.13 ? 127 LYS A CA  1 
ATOM   965  C C   . LYS A 1 129 ? 37.038 21.744 61.239 1.00 42.74 ? 127 LYS A C   1 
ATOM   966  O O   . LYS A 1 129 ? 35.820 21.597 61.047 1.00 42.25 ? 127 LYS A O   1 
ATOM   967  C CB  . LYS A 1 129 ? 38.658 19.924 62.001 1.00 41.28 ? 127 LYS A CB  1 
ATOM   968  C CG  . LYS A 1 129 ? 39.274 18.593 61.645 1.00 41.38 ? 127 LYS A CG  1 
ATOM   969  C CD  . LYS A 1 129 ? 39.250 17.598 62.813 1.00 42.34 ? 127 LYS A CD  1 
ATOM   970  C CE  . LYS A 1 129 ? 40.159 16.414 62.493 1.00 41.22 ? 127 LYS A CE  1 
ATOM   971  N NZ  . LYS A 1 129 ? 39.801 15.195 63.238 1.00 41.79 ? 127 LYS A NZ  1 
ATOM   972  N N   . LYS A 1 130 ? 37.531 22.848 61.790 1.00 44.83 ? 128 LYS A N   1 
ATOM   973  C CA  . LYS A 1 130 ? 36.625 23.909 62.265 1.00 47.29 ? 128 LYS A CA  1 
ATOM   974  C C   . LYS A 1 130 ? 35.915 24.669 61.135 1.00 47.81 ? 128 LYS A C   1 
ATOM   975  O O   . LYS A 1 130 ? 34.691 24.772 61.140 1.00 48.14 ? 128 LYS A O   1 
ATOM   976  C CB  . LYS A 1 130 ? 37.366 24.884 63.186 1.00 47.57 ? 128 LYS A CB  1 
ATOM   977  C CG  . LYS A 1 130 ? 37.892 24.255 64.487 1.00 49.31 ? 128 LYS A CG  1 
ATOM   978  C CD  . LYS A 1 130 ? 38.916 25.166 65.177 1.00 48.99 ? 128 LYS A CD  1 
ATOM   979  C CE  . LYS A 1 130 ? 39.178 24.729 66.622 1.00 52.00 ? 128 LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 130 ? 39.957 23.463 66.679 1.00 51.52 ? 128 LYS A NZ  1 
ATOM   981  N N   . LYS A 1 131 ? 36.694 25.165 60.172 1.00 48.68 ? 129 LYS A N   1 
ATOM   982  C CA  . LYS A 1 131 ? 36.238 26.104 59.144 1.00 49.81 ? 129 LYS A CA  1 
ATOM   983  C C   . LYS A 1 131 ? 35.565 25.465 57.904 1.00 50.17 ? 129 LYS A C   1 
ATOM   984  O O   . LYS A 1 131 ? 34.872 26.164 57.137 1.00 50.65 ? 129 LYS A O   1 
ATOM   985  C CB  . LYS A 1 131 ? 37.406 27.022 58.749 1.00 49.67 ? 129 LYS A CB  1 
ATOM   986  C CG  . LYS A 1 131 ? 37.094 28.072 57.670 1.00 51.16 ? 129 LYS A CG  1 
ATOM   987  C CD  . LYS A 1 131 ? 38.016 29.312 57.786 1.00 51.11 ? 129 LYS A CD  1 
ATOM   988  C CE  . LYS A 1 131 ? 37.936 30.226 56.546 1.00 51.84 ? 129 LYS A CE  1 
ATOM   989  N NZ  . LYS A 1 131 ? 38.965 29.845 55.505 1.00 54.38 ? 129 LYS A NZ  1 
ATOM   990  N N   . TYR A 1 132 ? 35.771 24.159 57.704 1.00 50.23 ? 130 TYR A N   1 
ATOM   991  C CA  . TYR A 1 132 ? 35.005 23.340 56.727 1.00 50.62 ? 130 TYR A CA  1 
ATOM   992  C C   . TYR A 1 132 ? 34.479 22.135 57.510 1.00 50.81 ? 130 TYR A C   1 
ATOM   993  O O   . TYR A 1 132 ? 34.920 21.919 58.641 1.00 52.03 ? 130 TYR A O   1 
ATOM   994  C CB  . TYR A 1 132 ? 35.885 22.999 55.517 1.00 50.95 ? 130 TYR A CB  1 
ATOM   995  C CG  . TYR A 1 132 ? 36.609 24.253 55.023 1.00 51.27 ? 130 TYR A CG  1 
ATOM   996  C CD1 . TYR A 1 132 ? 36.013 25.117 54.090 1.00 51.50 ? 130 TYR A CD1 1 
ATOM   997  C CD2 . TYR A 1 132 ? 37.861 24.613 55.542 1.00 51.86 ? 130 TYR A CD2 1 
ATOM   998  C CE1 . TYR A 1 132 ? 36.662 26.298 53.674 1.00 50.99 ? 130 TYR A CE1 1 
ATOM   999  C CE2 . TYR A 1 132 ? 38.514 25.779 55.125 1.00 51.37 ? 130 TYR A CE2 1 
ATOM   1000 C CZ  . TYR A 1 132 ? 37.908 26.614 54.199 1.00 51.30 ? 130 TYR A CZ  1 
ATOM   1001 O OH  . TYR A 1 132 ? 38.565 27.759 53.796 1.00 52.29 ? 130 TYR A OH  1 
ATOM   1002 N N   . ASP A 1 133 ? 33.503 21.374 57.039 1.00 50.50 ? 131 ASP A N   1 
ATOM   1003 C CA  . ASP A 1 133 ? 32.873 20.483 58.063 1.00 50.11 ? 131 ASP A CA  1 
ATOM   1004 C C   . ASP A 1 133 ? 33.626 19.170 58.418 1.00 47.98 ? 131 ASP A C   1 
ATOM   1005 O O   . ASP A 1 133 ? 33.067 18.264 59.066 1.00 48.85 ? 131 ASP A O   1 
ATOM   1006 C CB  . ASP A 1 133 ? 31.315 20.348 57.934 1.00 51.27 ? 131 ASP A CB  1 
ATOM   1007 C CG  . ASP A 1 133 ? 30.860 19.455 56.755 1.00 54.93 ? 131 ASP A CG  1 
ATOM   1008 O OD1 . ASP A 1 133 ? 31.604 18.514 56.353 1.00 59.56 ? 131 ASP A OD1 1 
ATOM   1009 O OD2 . ASP A 1 133 ? 29.732 19.692 56.243 1.00 55.98 ? 131 ASP A OD2 1 
ATOM   1010 N N   . VAL A 1 134 ? 34.916 19.134 58.095 1.00 44.84 ? 132 VAL A N   1 
ATOM   1011 C CA  . VAL A 1 134 ? 35.682 17.890 57.979 1.00 41.58 ? 132 VAL A CA  1 
ATOM   1012 C C   . VAL A 1 134 ? 35.971 17.144 59.284 1.00 40.55 ? 132 VAL A C   1 
ATOM   1013 O O   . VAL A 1 134 ? 36.510 17.690 60.253 1.00 40.80 ? 132 VAL A O   1 
ATOM   1014 C CB  . VAL A 1 134 ? 36.997 18.111 57.171 1.00 40.92 ? 132 VAL A CB  1 
ATOM   1015 C CG1 . VAL A 1 134 ? 37.718 16.789 56.923 1.00 39.52 ? 132 VAL A CG1 1 
ATOM   1016 C CG2 . VAL A 1 134 ? 36.699 18.804 55.851 1.00 39.47 ? 132 VAL A CG2 1 
ATOM   1017 N N   . ASP A 1 135 ? 35.614 15.872 59.286 1.00 38.52 ? 133 ASP A N   1 
ATOM   1018 C CA  . ASP A 1 135 ? 36.060 14.964 60.322 1.00 36.31 ? 133 ASP A CA  1 
ATOM   1019 C C   . ASP A 1 135 ? 37.359 14.279 59.824 1.00 34.22 ? 133 ASP A C   1 
ATOM   1020 O O   . ASP A 1 135 ? 38.471 14.692 60.209 1.00 34.49 ? 133 ASP A O   1 
ATOM   1021 C CB  . ASP A 1 135 ? 34.919 14.003 60.677 1.00 36.93 ? 133 ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 135 ? 35.341 12.881 61.614 1.00 38.87 ? 133 ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 135 ? 36.347 13.001 62.332 1.00 39.49 ? 133 ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 135 ? 34.640 11.850 61.620 1.00 43.14 ? 133 ASP A OD2 1 
ATOM   1025 N N   . THR A 1 136 ? 37.237 13.246 58.996 1.00 30.97 ? 134 THR A N   1 
ATOM   1026 C CA  . THR A 1 136 ? 38.409 12.615 58.367 1.00 27.63 ? 134 THR A CA  1 
ATOM   1027 C C   . THR A 1 136 ? 38.179 12.616 56.861 1.00 24.92 ? 134 THR A C   1 
ATOM   1028 O O   . THR A 1 136 ? 37.044 12.702 56.431 1.00 24.71 ? 134 THR A O   1 
ATOM   1029 C CB  . THR A 1 136 ? 38.592 11.123 58.799 1.00 27.49 ? 134 THR A CB  1 
ATOM   1030 O OG1 . THR A 1 136 ? 37.375 10.403 58.576 1.00 27.75 ? 134 THR A OG1 1 
ATOM   1031 C CG2 . THR A 1 136 ? 39.015 10.966 60.257 1.00 27.23 ? 134 THR A CG2 1 
ATOM   1032 N N   . LEU A 1 137 ? 39.239 12.496 56.061 1.00 22.69 ? 135 LEU A N   1 
ATOM   1033 C CA  . LEU A 1 137 ? 39.128 12.466 54.585 1.00 19.82 ? 135 LEU A CA  1 
ATOM   1034 C C   . LEU A 1 137 ? 39.000 11.045 54.049 1.00 18.71 ? 135 LEU A C   1 
ATOM   1035 O O   . LEU A 1 137 ? 39.530 10.094 54.642 1.00 19.82 ? 135 LEU A O   1 
ATOM   1036 C CB  . LEU A 1 137 ? 40.333 13.159 53.966 1.00 19.53 ? 135 LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 137 ? 40.602 14.541 54.600 1.00 20.25 ? 135 LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 137 ? 42.062 14.933 54.461 1.00 17.42 ? 135 LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 137 ? 39.715 15.543 53.946 1.00 19.03 ? 135 LEU A CD2 1 
ATOM   1040 N N   . ASP A 1 138 ? 38.284 10.887 52.941 1.00 16.99 ? 136 ASP A N   1 
ATOM   1041 C CA  . ASP A 1 138 ? 38.215 9.578  52.296 1.00 15.95 ? 136 ASP A CA  1 
ATOM   1042 C C   . ASP A 1 138 ? 39.355 9.363  51.369 1.00 15.49 ? 136 ASP A C   1 
ATOM   1043 O O   . ASP A 1 138 ? 39.853 8.262  51.270 1.00 13.72 ? 136 ASP A O   1 
ATOM   1044 C CB  . ASP A 1 138 ? 36.908 9.365  51.583 1.00 15.79 ? 136 ASP A CB  1 
ATOM   1045 C CG  . ASP A 1 138 ? 35.721 9.616  52.513 1.00 19.09 ? 136 ASP A CG  1 
ATOM   1046 O OD1 . ASP A 1 138 ? 35.745 9.096  53.647 1.00 18.20 ? 136 ASP A OD1 1 
ATOM   1047 O OD2 . ASP A 1 138 ? 34.812 10.357 52.113 1.00 21.64 ? 136 ASP A OD2 1 
ATOM   1048 N N   . MET A 1 139 ? 39.759 10.436 50.697 1.00 15.12 ? 137 MET A N   1 
ATOM   1049 C CA  . MET A 1 139 ? 40.831 10.362 49.718 1.00 15.22 ? 137 MET A CA  1 
ATOM   1050 C C   . MET A 1 139 ? 41.585 11.703 49.669 1.00 14.59 ? 137 MET A C   1 
ATOM   1051 O O   . MET A 1 139 ? 41.008 12.768 49.865 1.00 15.05 ? 137 MET A O   1 
ATOM   1052 C CB  . MET A 1 139 ? 40.252 9.969  48.359 1.00 13.71 ? 137 MET A CB  1 
ATOM   1053 C CG  . MET A 1 139 ? 41.251 9.990  47.218 1.00 13.44 ? 137 MET A CG  1 
ATOM   1054 S SD  . MET A 1 139 ? 40.474 9.243  45.803 1.00 16.73 ? 137 MET A SD  1 
ATOM   1055 C CE  . MET A 1 139 ? 41.595 9.777  44.439 1.00 15.31 ? 137 MET A CE  1 
ATOM   1056 N N   . VAL A 1 140 ? 42.877 11.610 49.436 1.00 13.82 ? 138 VAL A N   1 
ATOM   1057 C CA  . VAL A 1 140 ? 43.746 12.750 49.291 1.00 13.58 ? 138 VAL A CA  1 
ATOM   1058 C C   . VAL A 1 140 ? 44.411 12.532 47.956 1.00 12.93 ? 138 VAL A C   1 
ATOM   1059 O O   . VAL A 1 140 ? 45.038 11.515 47.736 1.00 14.45 ? 138 VAL A O   1 
ATOM   1060 C CB  . VAL A 1 140 ? 44.776 12.851 50.476 1.00 12.93 ? 138 VAL A CB  1 
ATOM   1061 C CG1 . VAL A 1 140 ? 45.656 14.096 50.367 1.00 14.56 ? 138 VAL A CG1 1 
ATOM   1062 C CG2 . VAL A 1 140 ? 44.040 12.924 51.803 1.00 14.20 ? 138 VAL A CG2 1 
ATOM   1063 N N   . PHE A 1 141 ? 44.235 13.473 47.036 1.00 13.36 ? 139 PHE A N   1 
ATOM   1064 C CA  . PHE A 1 141 ? 45.070 13.572 45.843 1.00 12.64 ? 139 PHE A CA  1 
ATOM   1065 C C   . PHE A 1 141 ? 46.177 14.640 45.919 1.00 13.36 ? 139 PHE A C   1 
ATOM   1066 O O   . PHE A 1 141 ? 45.898 15.838 45.984 1.00 12.78 ? 139 PHE A O   1 
ATOM   1067 C CB  . PHE A 1 141 ? 44.206 13.825 44.598 1.00 11.82 ? 139 PHE A CB  1 
ATOM   1068 C CG  . PHE A 1 141 ? 44.965 13.672 43.297 1.00 10.12 ? 139 PHE A CG  1 
ATOM   1069 C CD1 . PHE A 1 141 ? 45.309 12.393 42.827 1.00 9.04  ? 139 PHE A CD1 1 
ATOM   1070 C CD2 . PHE A 1 141 ? 45.256 14.782 42.504 1.00 9.15  ? 139 PHE A CD2 1 
ATOM   1071 C CE1 . PHE A 1 141 ? 46.008 12.246 41.666 1.00 10.42 ? 139 PHE A CE1 1 
ATOM   1072 C CE2 . PHE A 1 141 ? 45.936 14.638 41.310 1.00 6.26  ? 139 PHE A CE2 1 
ATOM   1073 C CZ  . PHE A 1 141 ? 46.315 13.355 40.897 1.00 11.01 ? 139 PHE A CZ  1 
ATOM   1074 N N   . LEU A 1 142 ? 47.425 14.183 45.867 1.00 13.43 ? 140 LEU A N   1 
ATOM   1075 C CA  . LEU A 1 142 ? 48.608 15.019 45.966 1.00 13.94 ? 140 LEU A CA  1 
ATOM   1076 C C   . LEU A 1 142 ? 49.161 15.211 44.556 1.00 13.99 ? 140 LEU A C   1 
ATOM   1077 O O   . LEU A 1 142 ? 49.495 14.216 43.857 1.00 12.46 ? 140 LEU A O   1 
ATOM   1078 C CB  . LEU A 1 142 ? 49.696 14.354 46.818 1.00 12.63 ? 140 LEU A CB  1 
ATOM   1079 C CG  . LEU A 1 142 ? 49.273 13.873 48.229 1.00 15.69 ? 140 LEU A CG  1 
ATOM   1080 C CD1 . LEU A 1 142 ? 50.167 12.766 48.743 1.00 16.39 ? 140 LEU A CD1 1 
ATOM   1081 C CD2 . LEU A 1 142 ? 49.361 14.992 49.259 1.00 17.75 ? 140 LEU A CD2 1 
ATOM   1082 N N   . ASP A 1 143 ? 49.289 16.475 44.138 1.00 14.50 ? 141 ASP A N   1 
ATOM   1083 C CA  . ASP A 1 143 ? 49.339 16.688 42.673 1.00 16.55 ? 141 ASP A CA  1 
ATOM   1084 C C   . ASP A 1 143 ? 50.571 17.281 41.954 1.00 16.64 ? 141 ASP A C   1 
ATOM   1085 O O   . ASP A 1 143 ? 51.232 16.654 41.138 1.00 23.00 ? 141 ASP A O   1 
ATOM   1086 C CB  . ASP A 1 143 ? 48.013 17.313 42.175 1.00 15.51 ? 141 ASP A CB  1 
ATOM   1087 C CG  . ASP A 1 143 ? 48.083 17.689 40.730 1.00 16.77 ? 141 ASP A CG  1 
ATOM   1088 O OD1 . ASP A 1 143 ? 48.568 16.862 39.937 1.00 15.72 ? 141 ASP A OD1 1 
ATOM   1089 O OD2 . ASP A 1 143 ? 47.725 18.824 40.387 1.00 17.18 ? 141 ASP A OD2 1 
ATOM   1090 N N   . HIS A 1 144 ? 50.933 18.485 42.178 1.00 15.99 ? 142 HIS A N   1 
ATOM   1091 C CA  . HIS A 1 144 ? 51.850 19.076 41.201 1.00 14.65 ? 142 HIS A CA  1 
ATOM   1092 C C   . HIS A 1 144 ? 53.238 19.306 41.796 1.00 14.78 ? 142 HIS A C   1 
ATOM   1093 O O   . HIS A 1 144 ? 54.253 19.414 41.088 1.00 14.98 ? 142 HIS A O   1 
ATOM   1094 C CB  . HIS A 1 144 ? 51.212 20.416 40.819 1.00 14.57 ? 142 HIS A CB  1 
ATOM   1095 C CG  . HIS A 1 144 ? 51.943 21.143 39.757 1.00 16.05 ? 142 HIS A CG  1 
ATOM   1096 N ND1 . HIS A 1 144 ? 51.950 20.717 38.444 1.00 16.08 ? 142 HIS A ND1 1 
ATOM   1097 C CD2 . HIS A 1 144 ? 52.711 22.257 39.809 1.00 16.87 ? 142 HIS A CD2 1 
ATOM   1098 C CE1 . HIS A 1 144 ? 52.666 21.573 37.727 1.00 19.51 ? 142 HIS A CE1 1 
ATOM   1099 N NE2 . HIS A 1 144 ? 53.156 22.501 38.534 1.00 16.44 ? 142 HIS A NE2 1 
ATOM   1100 N N   . TRP A 1 145 ? 53.268 19.380 43.125 1.00 13.93 ? 143 TRP A N   1 
ATOM   1101 C CA  . TRP A 1 145 ? 54.441 19.833 43.861 1.00 14.13 ? 143 TRP A CA  1 
ATOM   1102 C C   . TRP A 1 145 ? 55.039 18.697 44.696 1.00 14.51 ? 143 TRP A C   1 
ATOM   1103 O O   . TRP A 1 145 ? 54.673 18.543 45.852 1.00 12.88 ? 143 TRP A O   1 
ATOM   1104 C CB  . TRP A 1 145 ? 53.997 20.952 44.815 1.00 13.43 ? 143 TRP A CB  1 
ATOM   1105 C CG  . TRP A 1 145 ? 53.148 21.965 44.169 1.00 12.33 ? 143 TRP A CG  1 
ATOM   1106 C CD1 . TRP A 1 145 ? 51.800 22.175 44.369 1.00 14.27 ? 143 TRP A CD1 1 
ATOM   1107 C CD2 . TRP A 1 145 ? 53.577 22.954 43.220 1.00 15.22 ? 143 TRP A CD2 1 
ATOM   1108 N NE1 . TRP A 1 145 ? 51.361 23.234 43.613 1.00 15.97 ? 143 TRP A NE1 1 
ATOM   1109 C CE2 . TRP A 1 145 ? 52.428 23.738 42.889 1.00 14.87 ? 143 TRP A CE2 1 
ATOM   1110 C CE3 . TRP A 1 145 ? 54.835 23.295 42.655 1.00 13.27 ? 143 TRP A CE3 1 
ATOM   1111 C CZ2 . TRP A 1 145 ? 52.490 24.830 41.996 1.00 14.66 ? 143 TRP A CZ2 1 
ATOM   1112 C CZ3 . TRP A 1 145 ? 54.892 24.379 41.728 1.00 15.00 ? 143 TRP A CZ3 1 
ATOM   1113 C CH2 . TRP A 1 145 ? 53.729 25.150 41.434 1.00 15.59 ? 143 TRP A CH2 1 
ATOM   1114 N N   . LYS A 1 146 ? 55.949 17.916 44.104 1.00 14.67 ? 144 LYS A N   1 
ATOM   1115 C CA  . LYS A 1 146 ? 56.464 16.748 44.751 1.00 16.36 ? 144 LYS A CA  1 
ATOM   1116 C C   . LYS A 1 146 ? 57.084 16.986 46.160 1.00 15.95 ? 144 LYS A C   1 
ATOM   1117 O O   . LYS A 1 146 ? 56.940 16.141 47.051 1.00 14.91 ? 144 LYS A O   1 
ATOM   1118 C CB  . LYS A 1 146 ? 57.420 16.048 43.823 1.00 15.89 ? 144 LYS A CB  1 
ATOM   1119 C CG  . LYS A 1 146 ? 56.730 15.574 42.530 1.00 20.70 ? 144 LYS A CG  1 
ATOM   1120 C CD  . LYS A 1 146 ? 57.629 14.647 41.677 1.00 21.51 ? 144 LYS A CD  1 
ATOM   1121 C CE  . LYS A 1 146 ? 58.927 15.378 41.196 1.00 29.40 ? 144 LYS A CE  1 
ATOM   1122 N NZ  . LYS A 1 146 ? 59.361 15.036 39.778 1.00 32.55 ? 144 LYS A NZ  1 
ATOM   1123 N N   . ASP A 1 147 ? 57.777 18.114 46.367 1.00 15.15 ? 145 ASP A N   1 
ATOM   1124 C CA  . ASP A 1 147 ? 58.419 18.343 47.666 1.00 14.86 ? 145 ASP A CA  1 
ATOM   1125 C C   . ASP A 1 147 ? 57.401 18.632 48.743 1.00 13.87 ? 145 ASP A C   1 
ATOM   1126 O O   . ASP A 1 147 ? 57.752 18.674 49.880 1.00 15.26 ? 145 ASP A O   1 
ATOM   1127 C CB  . ASP A 1 147 ? 59.446 19.483 47.605 1.00 15.81 ? 145 ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 147 ? 60.445 19.284 46.535 1.00 17.82 ? 145 ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 147 ? 61.298 18.468 46.805 1.00 22.24 ? 145 ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 147 ? 60.348 19.864 45.416 1.00 20.53 ? 145 ASP A OD2 1 
ATOM   1131 N N   . ARG A 1 148 ? 56.144 18.821 48.405 1.00 13.66 ? 146 ARG A N   1 
ATOM   1132 C CA  . ARG A 1 148 ? 55.108 19.021 49.458 1.00 13.88 ? 146 ARG A CA  1 
ATOM   1133 C C   . ARG A 1 148 ? 54.416 17.765 49.880 1.00 13.70 ? 146 ARG A C   1 
ATOM   1134 O O   . ARG A 1 148 ? 53.759 17.758 50.896 1.00 14.41 ? 146 ARG A O   1 
ATOM   1135 C CB  . ARG A 1 148 ? 54.078 20.077 49.002 1.00 14.16 ? 146 ARG A CB  1 
ATOM   1136 C CG  . ARG A 1 148 ? 54.819 21.320 48.471 1.00 13.22 ? 146 ARG A CG  1 
ATOM   1137 C CD  . ARG A 1 148 ? 53.969 22.523 48.085 1.00 17.12 ? 146 ARG A CD  1 
ATOM   1138 N NE  . ARG A 1 148 ? 54.751 23.362 47.131 1.00 19.31 ? 146 ARG A NE  1 
ATOM   1139 C CZ  . ARG A 1 148 ? 54.253 24.394 46.460 1.00 19.86 ? 146 ARG A CZ  1 
ATOM   1140 N NH1 . ARG A 1 148 ? 52.973 24.738 46.620 1.00 21.21 ? 146 ARG A NH1 1 
ATOM   1141 N NH2 . ARG A 1 148 ? 55.025 25.065 45.618 1.00 19.36 ? 146 ARG A NH2 1 
ATOM   1142 N N   . TYR A 1 149 ? 54.544 16.668 49.112 1.00 14.06 ? 147 TYR A N   1 
ATOM   1143 C CA  . TYR A 1 149 ? 53.778 15.430 49.421 1.00 12.58 ? 147 TYR A CA  1 
ATOM   1144 C C   . TYR A 1 149 ? 54.043 14.899 50.837 1.00 13.29 ? 147 TYR A C   1 
ATOM   1145 O O   . TYR A 1 149 ? 53.108 14.641 51.584 1.00 13.36 ? 147 TYR A O   1 
ATOM   1146 C CB  . TYR A 1 149 ? 54.154 14.356 48.405 1.00 12.63 ? 147 TYR A CB  1 
ATOM   1147 C CG  . TYR A 1 149 ? 53.733 14.597 46.957 1.00 12.33 ? 147 TYR A CG  1 
ATOM   1148 C CD1 . TYR A 1 149 ? 53.074 15.769 46.544 1.00 9.61  ? 147 TYR A CD1 1 
ATOM   1149 C CD2 . TYR A 1 149 ? 54.009 13.631 45.995 1.00 14.53 ? 147 TYR A CD2 1 
ATOM   1150 C CE1 . TYR A 1 149 ? 52.692 15.962 45.154 1.00 10.89 ? 147 TYR A CE1 1 
ATOM   1151 C CE2 . TYR A 1 149 ? 53.632 13.790 44.666 1.00 14.24 ? 147 TYR A CE2 1 
ATOM   1152 C CZ  . TYR A 1 149 ? 52.983 14.951 44.239 1.00 14.01 ? 147 TYR A CZ  1 
ATOM   1153 O OH  . TYR A 1 149 ? 52.654 15.047 42.895 1.00 12.70 ? 147 TYR A OH  1 
ATOM   1154 N N   . LEU A 1 150 ? 55.315 14.716 51.226 1.00 14.50 ? 148 LEU A N   1 
ATOM   1155 C CA  . LEU A 1 150 ? 55.620 14.256 52.588 1.00 16.02 ? 148 LEU A CA  1 
ATOM   1156 C C   . LEU A 1 150 ? 55.169 15.258 53.652 1.00 17.13 ? 148 LEU A C   1 
ATOM   1157 O O   . LEU A 1 150 ? 54.332 14.931 54.497 1.00 17.86 ? 148 LEU A O   1 
ATOM   1158 C CB  . LEU A 1 150 ? 57.104 14.021 52.747 1.00 16.85 ? 148 LEU A CB  1 
ATOM   1159 C CG  . LEU A 1 150 ? 57.602 12.837 53.578 1.00 19.56 ? 148 LEU A CG  1 
ATOM   1160 C CD1 . LEU A 1 150 ? 58.975 13.197 54.180 1.00 17.50 ? 148 LEU A CD1 1 
ATOM   1161 C CD2 . LEU A 1 150 ? 56.637 12.259 54.598 1.00 14.31 ? 148 LEU A CD2 1 
ATOM   1162 N N   . PRO A 1 151 ? 55.713 16.497 53.634 1.00 17.45 ? 149 PRO A N   1 
ATOM   1163 C CA  . PRO A 1 151 ? 55.210 17.343 54.714 1.00 18.22 ? 149 PRO A CA  1 
ATOM   1164 C C   . PRO A 1 151 ? 53.676 17.471 54.771 1.00 19.20 ? 149 PRO A C   1 
ATOM   1165 O O   . PRO A 1 151 ? 53.152 17.696 55.846 1.00 20.69 ? 149 PRO A O   1 
ATOM   1166 C CB  . PRO A 1 151 ? 55.822 18.727 54.405 1.00 18.20 ? 149 PRO A CB  1 
ATOM   1167 C CG  . PRO A 1 151 ? 56.499 18.590 53.069 1.00 17.86 ? 149 PRO A CG  1 
ATOM   1168 C CD  . PRO A 1 151 ? 56.727 17.164 52.808 1.00 15.94 ? 149 PRO A CD  1 
ATOM   1169 N N   . ASP A 1 152 ? 52.945 17.407 53.641 1.00 19.67 ? 150 ASP A N   1 
ATOM   1170 C CA  . ASP A 1 152 ? 51.474 17.546 53.722 1.00 18.53 ? 150 ASP A CA  1 
ATOM   1171 C C   . ASP A 1 152 ? 50.887 16.301 54.374 1.00 17.59 ? 150 ASP A C   1 
ATOM   1172 O O   . ASP A 1 152 ? 49.938 16.384 55.156 1.00 18.83 ? 150 ASP A O   1 
ATOM   1173 C CB  . ASP A 1 152 ? 50.843 17.711 52.335 1.00 20.09 ? 150 ASP A CB  1 
ATOM   1174 C CG  . ASP A 1 152 ? 50.990 19.119 51.759 1.00 21.70 ? 150 ASP A CG  1 
ATOM   1175 O OD1 . ASP A 1 152 ? 51.288 20.071 52.486 1.00 24.34 ? 150 ASP A OD1 1 
ATOM   1176 O OD2 . ASP A 1 152 ? 50.775 19.272 50.557 1.00 24.67 ? 150 ASP A OD2 1 
ATOM   1177 N N   . THR A 1 153 ? 51.482 15.151 54.072 1.00 15.80 ? 151 THR A N   1 
ATOM   1178 C CA  . THR A 1 153 ? 51.030 13.856 54.597 1.00 14.93 ? 151 THR A CA  1 
ATOM   1179 C C   . THR A 1 153 ? 51.168 13.855 56.109 1.00 14.81 ? 151 THR A C   1 
ATOM   1180 O O   . THR A 1 153 ? 50.228 13.504 56.805 1.00 14.86 ? 151 THR A O   1 
ATOM   1181 C CB  . THR A 1 153 ? 51.799 12.694 53.921 1.00 14.15 ? 151 THR A CB  1 
ATOM   1182 O OG1 . THR A 1 153 ? 51.453 12.676 52.544 1.00 11.84 ? 151 THR A OG1 1 
ATOM   1183 C CG2 . THR A 1 153 ? 51.459 11.354 54.495 1.00 13.62 ? 151 THR A CG2 1 
ATOM   1184 N N   . LEU A 1 154 ? 52.325 14.322 56.581 1.00 16.35 ? 152 LEU A N   1 
ATOM   1185 C CA  . LEU A 1 154 ? 52.694 14.354 58.003 1.00 17.18 ? 152 LEU A CA  1 
ATOM   1186 C C   . LEU A 1 154 ? 51.781 15.258 58.753 1.00 17.52 ? 152 LEU A C   1 
ATOM   1187 O O   . LEU A 1 154 ? 51.325 14.912 59.815 1.00 19.51 ? 152 LEU A O   1 
ATOM   1188 C CB  . LEU A 1 154 ? 54.165 14.783 58.168 1.00 17.02 ? 152 LEU A CB  1 
ATOM   1189 C CG  . LEU A 1 154 ? 55.233 13.787 57.730 1.00 18.02 ? 152 LEU A CG  1 
ATOM   1190 C CD1 . LEU A 1 154 ? 56.681 14.299 58.014 1.00 15.86 ? 152 LEU A CD1 1 
ATOM   1191 C CD2 . LEU A 1 154 ? 55.007 12.412 58.364 1.00 18.45 ? 152 LEU A CD2 1 
ATOM   1192 N N   . LEU A 1 155 ? 51.469 16.403 58.150 1.00 19.06 ? 153 LEU A N   1 
ATOM   1193 C CA  . LEU A 1 155 ? 50.548 17.361 58.721 1.00 19.40 ? 153 LEU A CA  1 
ATOM   1194 C C   . LEU A 1 155 ? 49.095 16.880 58.726 1.00 20.26 ? 153 LEU A C   1 
ATOM   1195 O O   . LEU A 1 155 ? 48.353 17.211 59.640 1.00 21.76 ? 153 LEU A O   1 
ATOM   1196 C CB  . LEU A 1 155 ? 50.681 18.723 57.993 1.00 18.45 ? 153 LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 155 ? 49.948 19.866 58.740 1.00 20.85 ? 153 LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 155 ? 50.544 20.096 60.202 1.00 16.60 ? 153 LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 155 ? 49.928 21.181 57.971 1.00 19.66 ? 153 LEU A CD2 1 
ATOM   1200 N N   . LEU A 1 156 ? 48.653 16.129 57.708 1.00 20.50 ? 154 LEU A N   1 
ATOM   1201 C CA  . LEU A 1 156 ? 47.291 15.530 57.752 1.00 20.79 ? 154 LEU A CA  1 
ATOM   1202 C C   . LEU A 1 156 ? 47.158 14.507 58.890 1.00 21.62 ? 154 LEU A C   1 
ATOM   1203 O O   . LEU A 1 156 ? 46.153 14.469 59.559 1.00 21.78 ? 154 LEU A O   1 
ATOM   1204 C CB  . LEU A 1 156 ? 46.902 14.886 56.423 1.00 19.63 ? 154 LEU A CB  1 
ATOM   1205 C CG  . LEU A 1 156 ? 46.706 15.841 55.235 1.00 18.98 ? 154 LEU A CG  1 
ATOM   1206 C CD1 . LEU A 1 156 ? 46.752 15.023 53.938 1.00 18.75 ? 154 LEU A CD1 1 
ATOM   1207 C CD2 . LEU A 1 156 ? 45.410 16.664 55.325 1.00 15.25 ? 154 LEU A CD2 1 
ATOM   1208 N N   . GLU A 1 157 ? 48.198 13.700 59.100 1.00 22.02 ? 155 GLU A N   1 
ATOM   1209 C CA  . GLU A 1 157 ? 48.251 12.783 60.218 1.00 23.88 ? 155 GLU A CA  1 
ATOM   1210 C C   . GLU A 1 157 ? 48.213 13.586 61.508 1.00 24.34 ? 155 GLU A C   1 
ATOM   1211 O O   . GLU A 1 157 ? 47.352 13.377 62.310 1.00 25.18 ? 155 GLU A O   1 
ATOM   1212 C CB  . GLU A 1 157 ? 49.518 11.952 60.181 1.00 22.65 ? 155 GLU A CB  1 
ATOM   1213 C CG  . GLU A 1 157 ? 49.540 10.965 59.097 1.00 25.47 ? 155 GLU A CG  1 
ATOM   1214 C CD  . GLU A 1 157 ? 50.668 9.987  59.251 1.00 29.83 ? 155 GLU A CD  1 
ATOM   1215 O OE1 . GLU A 1 157 ? 50.723 9.228  60.252 1.00 33.75 ? 155 GLU A OE1 1 
ATOM   1216 O OE2 . GLU A 1 157 ? 51.516 9.971  58.371 1.00 30.66 ? 155 GLU A OE2 1 
ATOM   1217 N N   . LYS A 1 158 ? 49.141 14.521 61.678 1.00 26.49 ? 156 LYS A N   1 
ATOM   1218 C CA  . LYS A 1 158 ? 49.220 15.331 62.897 1.00 27.55 ? 156 LYS A CA  1 
ATOM   1219 C C   . LYS A 1 158 ? 47.845 15.849 63.303 1.00 26.58 ? 156 LYS A C   1 
ATOM   1220 O O   . LYS A 1 158 ? 47.434 15.714 64.438 1.00 26.75 ? 156 LYS A O   1 
ATOM   1221 C CB  . LYS A 1 158 ? 50.187 16.499 62.673 1.00 27.82 ? 156 LYS A CB  1 
ATOM   1222 C CG  . LYS A 1 158 ? 50.722 17.102 64.015 1.00 30.47 ? 156 LYS A CG  1 
ATOM   1223 C CD  . LYS A 1 158 ? 51.537 18.365 63.786 1.00 29.35 ? 156 LYS A CD  1 
ATOM   1224 C CE  . LYS A 1 158 ? 51.116 19.482 64.734 1.00 34.94 ? 156 LYS A CE  1 
ATOM   1225 N NZ  . LYS A 1 158 ? 49.730 20.010 64.400 1.00 36.61 ? 156 LYS A NZ  1 
ATOM   1226 N N   . CYS A 1 159 ? 47.134 16.381 62.316 1.00 26.07 ? 157 CYS A N   1 
ATOM   1227 C CA  . CYS A 1 159 ? 45.853 17.033 62.455 1.00 24.49 ? 157 CYS A CA  1 
ATOM   1228 C C   . CYS A 1 159 ? 44.671 16.072 62.587 1.00 24.47 ? 157 CYS A C   1 
ATOM   1229 O O   . CYS A 1 159 ? 43.517 16.526 62.655 1.00 24.11 ? 157 CYS A O   1 
ATOM   1230 C CB  . CYS A 1 159 ? 45.654 17.975 61.260 1.00 24.09 ? 157 CYS A CB  1 
ATOM   1231 S SG  . CYS A 1 159 ? 46.611 19.505 61.382 1.00 26.28 ? 157 CYS A SG  1 
ATOM   1232 N N   . GLY A 1 160 ? 44.954 14.762 62.623 1.00 23.48 ? 158 GLY A N   1 
ATOM   1233 C CA  . GLY A 1 160 ? 43.929 13.710 62.726 1.00 23.05 ? 158 GLY A CA  1 
ATOM   1234 C C   . GLY A 1 160 ? 42.927 13.624 61.577 1.00 22.91 ? 158 GLY A C   1 
ATOM   1235 O O   . GLY A 1 160 ? 41.744 13.254 61.756 1.00 21.75 ? 158 GLY A O   1 
ATOM   1236 N N   . LEU A 1 161 ? 43.404 13.970 60.382 1.00 23.25 ? 159 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 161 ? 42.548 13.979 59.168 1.00 22.22 ? 159 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 161 ? 42.495 12.656 58.412 1.00 21.49 ? 159 LEU A C   1 
ATOM   1239 O O   . LEU A 1 161 ? 41.685 12.516 57.520 1.00 22.38 ? 159 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 161 ? 42.933 15.150 58.239 1.00 22.05 ? 159 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 161 ? 42.418 16.505 58.725 1.00 21.66 ? 159 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 161 ? 43.275 17.683 58.284 1.00 19.66 ? 159 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 161 ? 40.933 16.674 58.303 1.00 20.62 ? 159 LEU A CD2 1 
ATOM   1244 N N   . LEU A 1 162 ? 43.328 11.677 58.758 1.00 19.91 ? 160 LEU A N   1 
ATOM   1245 C CA  . LEU A 1 162 ? 43.282 10.416 58.046 1.00 18.01 ? 160 LEU A CA  1 
ATOM   1246 C C   . LEU A 1 162 ? 42.698 9.380  58.983 1.00 19.45 ? 160 LEU A C   1 
ATOM   1247 O O   . LEU A 1 162 ? 43.024 9.341  60.182 1.00 16.62 ? 160 LEU A O   1 
ATOM   1248 C CB  . LEU A 1 162 ? 44.691 9.929  57.601 1.00 17.27 ? 160 LEU A CB  1 
ATOM   1249 C CG  . LEU A 1 162 ? 45.691 10.914 56.961 1.00 17.49 ? 160 LEU A CG  1 
ATOM   1250 C CD1 . LEU A 1 162 ? 47.063 10.218 56.596 1.00 15.56 ? 160 LEU A CD1 1 
ATOM   1251 C CD2 . LEU A 1 162 ? 45.036 11.675 55.752 1.00 14.71 ? 160 LEU A CD2 1 
ATOM   1252 N N   . ARG A 1 163 ? 41.909 8.478  58.404 1.00 20.10 ? 161 ARG A N   1 
ATOM   1253 C CA  . ARG A 1 163 ? 41.389 7.368  59.193 1.00 21.80 ? 161 ARG A CA  1 
ATOM   1254 C C   . ARG A 1 163 ? 41.836 6.103  58.479 1.00 22.12 ? 161 ARG A C   1 
ATOM   1255 O O   . ARG A 1 163 ? 42.421 6.163  57.346 1.00 21.43 ? 161 ARG A O   1 
ATOM   1256 C CB  . ARG A 1 163 ? 39.862 7.512  59.398 1.00 21.17 ? 161 ARG A CB  1 
ATOM   1257 C CG  . ARG A 1 163 ? 38.848 6.792  58.452 1.00 24.86 ? 161 ARG A CG  1 
ATOM   1258 C CD  . ARG A 1 163 ? 39.021 7.119  57.056 1.00 23.27 ? 161 ARG A CD  1 
ATOM   1259 N NE  . ARG A 1 163 ? 37.856 7.160  56.153 1.00 23.17 ? 161 ARG A NE  1 
ATOM   1260 C CZ  . ARG A 1 163 ? 37.573 6.279  55.186 1.00 20.83 ? 161 ARG A CZ  1 
ATOM   1261 N NH1 . ARG A 1 163 ? 38.212 5.121  55.058 1.00 19.83 ? 161 ARG A NH1 1 
ATOM   1262 N NH2 . ARG A 1 163 ? 36.571 6.531  54.376 1.00 18.92 ? 161 ARG A NH2 1 
ATOM   1263 N N   . LYS A 1 164 ? 41.569 4.970  59.116 1.00 21.15 ? 162 LYS A N   1 
ATOM   1264 C CA  . LYS A 1 164 ? 41.930 3.707  58.544 1.00 20.02 ? 162 LYS A CA  1 
ATOM   1265 C C   . LYS A 1 164 ? 41.207 3.536  57.179 1.00 19.57 ? 162 LYS A C   1 
ATOM   1266 O O   . LYS A 1 164 ? 39.973 3.646  57.083 1.00 18.87 ? 162 LYS A O   1 
ATOM   1267 C CB  . LYS A 1 164 ? 41.593 2.604  59.547 1.00 20.40 ? 162 LYS A CB  1 
ATOM   1268 C CG  . LYS A 1 164 ? 41.905 1.260  59.024 1.00 24.46 ? 162 LYS A CG  1 
ATOM   1269 C CD  . LYS A 1 164 ? 41.371 0.185  59.970 1.00 32.51 ? 162 LYS A CD  1 
ATOM   1270 C CE  . LYS A 1 164 ? 41.667 -1.200 59.404 1.00 36.55 ? 162 LYS A CE  1 
ATOM   1271 N NZ  . LYS A 1 164 ? 42.039 -2.126 60.514 1.00 38.62 ? 162 LYS A NZ  1 
ATOM   1272 N N   . GLY A 1 165 ? 41.963 3.279  56.117 1.00 17.33 ? 163 GLY A N   1 
ATOM   1273 C CA  . GLY A 1 165 ? 41.324 3.191  54.820 1.00 17.48 ? 163 GLY A CA  1 
ATOM   1274 C C   . GLY A 1 165 ? 41.275 4.499  54.000 1.00 16.32 ? 163 GLY A C   1 
ATOM   1275 O O   . GLY A 1 165 ? 40.882 4.476  52.845 1.00 15.95 ? 163 GLY A O   1 
ATOM   1276 N N   . THR A 1 166 ? 41.657 5.631  54.585 1.00 15.49 ? 164 THR A N   1 
ATOM   1277 C CA  . THR A 1 166 ? 41.925 6.819  53.733 1.00 15.03 ? 164 THR A CA  1 
ATOM   1278 C C   . THR A 1 166 ? 42.943 6.564  52.630 1.00 14.47 ? 164 THR A C   1 
ATOM   1279 O O   . THR A 1 166 ? 44.086 6.149  52.905 1.00 14.97 ? 164 THR A O   1 
ATOM   1280 C CB  . THR A 1 166 ? 42.425 7.987  54.566 1.00 14.92 ? 164 THR A CB  1 
ATOM   1281 O OG1 . THR A 1 166 ? 41.393 8.324  55.513 1.00 14.50 ? 164 THR A OG1 1 
ATOM   1282 C CG2 . THR A 1 166 ? 42.754 9.201  53.631 1.00 13.33 ? 164 THR A CG2 1 
ATOM   1283 N N   . VAL A 1 167 ? 42.564 6.856  51.387 1.00 15.05 ? 165 VAL A N   1 
ATOM   1284 C CA  . VAL A 1 167 ? 43.442 6.682  50.246 1.00 14.18 ? 165 VAL A CA  1 
ATOM   1285 C C   . VAL A 1 167 ? 44.230 7.941  49.936 1.00 14.61 ? 165 VAL A C   1 
ATOM   1286 O O   . VAL A 1 167 ? 43.671 9.006  49.682 1.00 14.94 ? 165 VAL A O   1 
ATOM   1287 C CB  . VAL A 1 167 ? 42.615 6.268  49.005 1.00 16.50 ? 165 VAL A CB  1 
ATOM   1288 C CG1 . VAL A 1 167 ? 43.502 5.795  47.883 1.00 13.82 ? 165 VAL A CG1 1 
ATOM   1289 C CG2 . VAL A 1 167 ? 41.600 5.146  49.413 1.00 15.55 ? 165 VAL A CG2 1 
ATOM   1290 N N   . LEU A 1 168 ? 45.550 7.824  49.906 1.00 13.31 ? 166 LEU A N   1 
ATOM   1291 C CA  . LEU A 1 168 ? 46.339 8.912  49.361 1.00 13.38 ? 166 LEU A CA  1 
ATOM   1292 C C   . LEU A 1 168 ? 46.722 8.441  47.967 1.00 13.55 ? 166 LEU A C   1 
ATOM   1293 O O   . LEU A 1 168 ? 47.147 7.284  47.801 1.00 14.30 ? 166 LEU A O   1 
ATOM   1294 C CB  . LEU A 1 168 ? 47.627 9.233  50.203 1.00 13.42 ? 166 LEU A CB  1 
ATOM   1295 C CG  . LEU A 1 168 ? 47.632 9.215  51.740 1.00 12.94 ? 166 LEU A CG  1 
ATOM   1296 C CD1 . LEU A 1 168 ? 48.988 9.753  52.366 1.00 12.14 ? 166 LEU A CD1 1 
ATOM   1297 C CD2 . LEU A 1 168 ? 46.510 9.941  52.279 1.00 15.66 ? 166 LEU A CD2 1 
ATOM   1298 N N   . LEU A 1 169 ? 46.578 9.318  46.988 1.00 11.25 ? 167 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 169 ? 47.036 9.021  45.668 1.00 11.45 ? 167 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 169 ? 47.914 10.176 45.249 1.00 11.01 ? 167 LEU A C   1 
ATOM   1301 O O   . LEU A 1 169 ? 47.429 11.322 45.224 1.00 11.75 ? 167 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 169 ? 45.837 8.812  44.689 1.00 11.88 ? 167 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 169 ? 46.218 8.478  43.230 1.00 11.29 ? 167 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 169 ? 46.883 7.059  43.100 1.00 10.41 ? 167 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 169 ? 44.945 8.572  42.343 1.00 11.76 ? 167 LEU A CD2 1 
ATOM   1306 N N   . ALA A 1 170 ? 49.182 9.890  44.907 1.00 10.84 ? 168 ALA A N   1 
ATOM   1307 C CA  . ALA A 1 170 ? 50.187 10.916 44.608 1.00 11.04 ? 168 ALA A CA  1 
ATOM   1308 C C   . ALA A 1 170 ? 50.571 10.805 43.154 1.00 12.14 ? 168 ALA A C   1 
ATOM   1309 O O   . ALA A 1 170 ? 50.966 9.760  42.681 1.00 13.29 ? 168 ALA A O   1 
ATOM   1310 C CB  . ALA A 1 170 ? 51.441 10.836 45.517 1.00 8.66  ? 168 ALA A CB  1 
ATOM   1311 N N   . ASP A 1 171 ? 50.451 11.916 42.446 1.00 12.69 ? 169 ASP A N   1 
ATOM   1312 C CA  . ASP A 1 171 ? 50.821 11.975 41.047 1.00 12.17 ? 169 ASP A CA  1 
ATOM   1313 C C   . ASP A 1 171 ? 52.330 12.259 40.818 1.00 12.77 ? 169 ASP A C   1 
ATOM   1314 O O   . ASP A 1 171 ? 53.030 12.884 41.637 1.00 9.77  ? 169 ASP A O   1 
ATOM   1315 C CB  . ASP A 1 171 ? 50.005 13.031 40.331 1.00 11.54 ? 169 ASP A CB  1 
ATOM   1316 C CG  . ASP A 1 171 ? 50.195 12.959 38.820 1.00 12.76 ? 169 ASP A CG  1 
ATOM   1317 O OD1 . ASP A 1 171 ? 50.047 11.867 38.258 1.00 14.62 ? 169 ASP A OD1 1 
ATOM   1318 O OD2 . ASP A 1 171 ? 50.551 13.974 38.218 1.00 13.02 ? 169 ASP A OD2 1 
ATOM   1319 N N   . ASN A 1 172 ? 52.828 11.777 39.694 1.00 14.52 ? 170 ASN A N   1 
ATOM   1320 C CA  . ASN A 1 172 ? 54.192 12.103 39.265 1.00 17.26 ? 170 ASN A CA  1 
ATOM   1321 C C   . ASN A 1 172 ? 55.297 11.697 40.262 1.00 19.01 ? 170 ASN A C   1 
ATOM   1322 O O   . ASN A 1 172 ? 56.161 12.499 40.622 1.00 18.68 ? 170 ASN A O   1 
ATOM   1323 C CB  . ASN A 1 172 ? 54.296 13.590 38.890 1.00 16.59 ? 170 ASN A CB  1 
ATOM   1324 C CG  . ASN A 1 172 ? 55.497 13.875 37.983 1.00 19.81 ? 170 ASN A CG  1 
ATOM   1325 O OD1 . ASN A 1 172 ? 56.001 12.975 37.325 1.00 22.55 ? 170 ASN A OD1 1 
ATOM   1326 N ND2 . ASN A 1 172 ? 55.962 15.121 37.963 1.00 21.07 ? 170 ASN A ND2 1 
ATOM   1327 N N   . VAL A 1 173 ? 55.166 10.495 40.775 1.00 21.94 ? 171 VAL A N   1 
ATOM   1328 C CA  . VAL A 1 173 ? 56.218 9.887  41.530 1.00 25.27 ? 171 VAL A CA  1 
ATOM   1329 C C   . VAL A 1 173 ? 56.853 8.837  40.644 1.00 27.48 ? 171 VAL A C   1 
ATOM   1330 O O   . VAL A 1 173 ? 56.391 7.706  40.546 1.00 28.28 ? 171 VAL A O   1 
ATOM   1331 C CB  . VAL A 1 173 ? 55.742 9.414  42.905 1.00 24.53 ? 171 VAL A CB  1 
ATOM   1332 C CG1 . VAL A 1 173 ? 54.259 9.416  42.977 1.00 24.41 ? 171 VAL A CG1 1 
ATOM   1333 C CG2 . VAL A 1 173 ? 56.331 8.098  43.293 1.00 24.95 ? 171 VAL A CG2 1 
ATOM   1334 N N   . ILE A 1 174 ? 57.878 9.296  39.939 1.00 30.10 ? 172 ILE A N   1 
ATOM   1335 C CA  . ILE A 1 174 ? 58.770 8.466  39.155 1.00 32.25 ? 172 ILE A CA  1 
ATOM   1336 C C   . ILE A 1 174 ? 60.185 8.466  39.741 1.00 34.01 ? 172 ILE A C   1 
ATOM   1337 O O   . ILE A 1 174 ? 60.798 9.496  39.946 1.00 34.14 ? 172 ILE A O   1 
ATOM   1338 C CB  . ILE A 1 174 ? 58.773 8.936  37.701 1.00 31.27 ? 172 ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 174 ? 57.351 8.968  37.156 1.00 31.03 ? 172 ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 174 ? 59.616 8.050  36.857 1.00 30.35 ? 172 ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 174 ? 57.114 10.005 36.125 1.00 29.53 ? 172 ILE A CD1 1 
ATOM   1342 N N   . VAL A 1 175 ? 60.677 7.277  40.020 1.00 37.40 ? 173 VAL A N   1 
ATOM   1343 C CA  . VAL A 1 175 ? 62.037 7.073  40.614 1.00 40.41 ? 173 VAL A CA  1 
ATOM   1344 C C   . VAL A 1 175 ? 63.187 7.473  39.620 1.00 41.95 ? 173 VAL A C   1 
ATOM   1345 O O   . VAL A 1 175 ? 63.186 7.052  38.432 1.00 41.79 ? 173 VAL A O   1 
ATOM   1346 C CB  . VAL A 1 175 ? 62.212 5.664  41.335 1.00 40.17 ? 173 VAL A CB  1 
ATOM   1347 C CG1 . VAL A 1 175 ? 61.028 4.754  41.126 1.00 41.17 ? 173 VAL A CG1 1 
ATOM   1348 C CG2 . VAL A 1 175 ? 63.540 4.945  40.969 1.00 41.76 ? 173 VAL A CG2 1 
ATOM   1349 N N   . PRO A 1 176 ? 64.177 8.280  40.094 1.00 43.34 ? 174 PRO A N   1 
ATOM   1350 C CA  . PRO A 1 176 ? 64.621 8.579  41.471 1.00 43.88 ? 174 PRO A CA  1 
ATOM   1351 C C   . PRO A 1 176 ? 63.796 9.648  42.231 1.00 44.21 ? 174 PRO A C   1 
ATOM   1352 O O   . PRO A 1 176 ? 64.185 10.049 43.342 1.00 44.59 ? 174 PRO A O   1 
ATOM   1353 C CB  . PRO A 1 176 ? 66.050 9.104  41.230 1.00 43.72 ? 174 PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 176 ? 65.885 9.915  39.971 1.00 43.11 ? 174 PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 176 ? 64.962 9.070  39.111 1.00 43.40 ? 174 PRO A CD  1 
ATOM   1356 N N   . GLY A 1 177 ? 62.683 10.095 41.637 1.00 44.43 ? 175 GLY A N   1 
ATOM   1357 C CA  . GLY A 1 177 ? 61.907 11.236 42.148 1.00 44.46 ? 175 GLY A CA  1 
ATOM   1358 C C   . GLY A 1 177 ? 61.248 10.996 43.500 1.00 44.60 ? 175 GLY A C   1 
ATOM   1359 O O   . GLY A 1 177 ? 61.091 9.834  43.925 1.00 44.73 ? 175 GLY A O   1 
ATOM   1360 N N   . THR A 1 178 ? 60.857 12.096 44.168 1.00 44.02 ? 176 THR A N   1 
ATOM   1361 C CA  . THR A 1 178 ? 60.230 12.052 45.515 1.00 43.43 ? 176 THR A CA  1 
ATOM   1362 C C   . THR A 1 178 ? 60.817 10.917 46.385 1.00 41.83 ? 176 THR A C   1 
ATOM   1363 O O   . THR A 1 178 ? 60.074 9.997  46.782 1.00 41.84 ? 176 THR A O   1 
ATOM   1364 C CB  . THR A 1 178 ? 58.684 11.854 45.475 1.00 43.78 ? 176 THR A CB  1 
ATOM   1365 O OG1 . THR A 1 178 ? 58.355 10.894 44.458 1.00 45.44 ? 176 THR A OG1 1 
ATOM   1366 C CG2 . THR A 1 178 ? 57.956 13.170 45.228 1.00 44.78 ? 176 THR A CG2 1 
ATOM   1367 N N   . PRO A 1 179 ? 62.135 11.008 46.709 1.00 39.38 ? 177 PRO A N   1 
ATOM   1368 C CA  . PRO A 1 179 ? 62.737 9.890  47.433 1.00 37.51 ? 177 PRO A CA  1 
ATOM   1369 C C   . PRO A 1 179 ? 62.144 9.792  48.882 1.00 34.42 ? 177 PRO A C   1 
ATOM   1370 O O   . PRO A 1 179 ? 61.981 8.700  49.405 1.00 33.03 ? 177 PRO A O   1 
ATOM   1371 C CB  . PRO A 1 179 ? 64.248 10.243 47.435 1.00 37.78 ? 177 PRO A CB  1 
ATOM   1372 C CG  . PRO A 1 179 ? 64.281 11.765 47.321 1.00 38.15 ? 177 PRO A CG  1 
ATOM   1373 C CD  . PRO A 1 179 ? 63.073 12.145 46.509 1.00 39.10 ? 177 PRO A CD  1 
ATOM   1374 N N   . ASP A 1 180 ? 61.805 10.944 49.463 1.00 31.29 ? 178 ASP A N   1 
ATOM   1375 C CA  . ASP A 1 180 ? 61.412 11.057 50.851 1.00 28.83 ? 178 ASP A CA  1 
ATOM   1376 C C   . ASP A 1 180 ? 59.968 10.612 51.066 1.00 25.55 ? 178 ASP A C   1 
ATOM   1377 O O   . ASP A 1 180 ? 59.721 9.854  51.994 1.00 23.60 ? 178 ASP A O   1 
ATOM   1378 C CB  . ASP A 1 180 ? 61.672 12.474 51.403 1.00 29.70 ? 178 ASP A CB  1 
ATOM   1379 C CG  . ASP A 1 180 ? 63.133 12.661 51.896 1.00 35.62 ? 178 ASP A CG  1 
ATOM   1380 O OD1 . ASP A 1 180 ? 64.081 12.271 51.166 1.00 40.80 ? 178 ASP A OD1 1 
ATOM   1381 O OD2 . ASP A 1 180 ? 63.351 13.197 53.020 1.00 40.23 ? 178 ASP A OD2 1 
ATOM   1382 N N   . PHE A 1 181 ? 59.038 11.062 50.207 1.00 22.32 ? 179 PHE A N   1 
ATOM   1383 C CA  . PHE A 1 181 ? 57.641 10.637 50.293 1.00 19.96 ? 179 PHE A CA  1 
ATOM   1384 C C   . PHE A 1 181 ? 57.513 9.123  50.185 1.00 18.84 ? 179 PHE A C   1 
ATOM   1385 O O   . PHE A 1 181 ? 56.817 8.502  50.968 1.00 16.21 ? 179 PHE A O   1 
ATOM   1386 C CB  . PHE A 1 181 ? 56.770 11.287 49.207 1.00 20.25 ? 179 PHE A CB  1 
ATOM   1387 C CG  . PHE A 1 181 ? 55.366 10.772 49.181 1.00 17.45 ? 179 PHE A CG  1 
ATOM   1388 C CD1 . PHE A 1 181 ? 54.463 11.138 50.174 1.00 16.43 ? 179 PHE A CD1 1 
ATOM   1389 C CD2 . PHE A 1 181 ? 54.951 9.882  48.180 1.00 16.71 ? 179 PHE A CD2 1 
ATOM   1390 C CE1 . PHE A 1 181 ? 53.142 10.640 50.165 1.00 15.02 ? 179 PHE A CE1 1 
ATOM   1391 C CE2 . PHE A 1 181 ? 53.660 9.388  48.176 1.00 15.41 ? 179 PHE A CE2 1 
ATOM   1392 C CZ  . PHE A 1 181 ? 52.753 9.776  49.147 1.00 16.05 ? 179 PHE A CZ  1 
ATOM   1393 N N   . LEU A 1 182 ? 58.217 8.540  49.209 1.00 18.77 ? 180 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 182 ? 58.125 7.113  48.930 1.00 18.76 ? 180 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 182 ? 58.714 6.314  50.048 1.00 17.69 ? 180 LEU A C   1 
ATOM   1396 O O   . LEU A 1 182 ? 58.138 5.309  50.472 1.00 19.06 ? 180 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 182 ? 58.848 6.719  47.650 1.00 18.89 ? 180 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 182 ? 58.017 6.844  46.403 1.00 19.60 ? 180 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 182 ? 58.853 6.319  45.152 1.00 19.41 ? 180 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 182 ? 56.676 6.148  46.569 1.00 16.95 ? 180 LEU A CD2 1 
ATOM   1401 N N   . ALA A 1 183 ? 59.861 6.770  50.509 1.00 16.15 ? 181 ALA A N   1 
ATOM   1402 C CA  . ALA A 1 183 ? 60.572 6.114  51.548 1.00 16.48 ? 181 ALA A CA  1 
ATOM   1403 C C   . ALA A 1 183 ? 59.690 6.116  52.821 1.00 15.37 ? 181 ALA A C   1 
ATOM   1404 O O   . ALA A 1 183 ? 59.623 5.133  53.528 1.00 17.72 ? 181 ALA A O   1 
ATOM   1405 C CB  . ALA A 1 183 ? 62.045 6.783  51.770 1.00 15.59 ? 181 ALA A CB  1 
ATOM   1406 N N   . TYR A 1 184 ? 58.988 7.192  53.065 1.00 14.00 ? 182 TYR A N   1 
ATOM   1407 C CA  . TYR A 1 184 ? 58.069 7.261  54.176 1.00 14.16 ? 182 TYR A CA  1 
ATOM   1408 C C   . TYR A 1 184 ? 56.853 6.271  54.127 1.00 14.22 ? 182 TYR A C   1 
ATOM   1409 O O   . TYR A 1 184 ? 56.653 5.436  55.042 1.00 14.35 ? 182 TYR A O   1 
ATOM   1410 C CB  . TYR A 1 184 ? 57.607 8.726  54.379 1.00 14.01 ? 182 TYR A CB  1 
ATOM   1411 C CG  . TYR A 1 184 ? 56.552 8.786  55.473 1.00 14.27 ? 182 TYR A CG  1 
ATOM   1412 C CD1 . TYR A 1 184 ? 56.888 8.477  56.786 1.00 12.07 ? 182 TYR A CD1 1 
ATOM   1413 C CD2 . TYR A 1 184 ? 55.218 9.062  55.178 1.00 14.28 ? 182 TYR A CD2 1 
ATOM   1414 C CE1 . TYR A 1 184 ? 55.909 8.428  57.800 1.00 12.23 ? 182 TYR A CE1 1 
ATOM   1415 C CE2 . TYR A 1 184 ? 54.233 9.028  56.193 1.00 15.59 ? 182 TYR A CE2 1 
ATOM   1416 C CZ  . TYR A 1 184 ? 54.610 8.715  57.506 1.00 13.21 ? 182 TYR A CZ  1 
ATOM   1417 O OH  . TYR A 1 184 ? 53.660 8.657  58.527 1.00 15.16 ? 182 TYR A OH  1 
ATOM   1418 N N   . VAL A 1 185 ? 56.032 6.364  53.080 1.00 12.17 ? 183 VAL A N   1 
ATOM   1419 C CA  . VAL A 1 185 ? 54.822 5.550  53.020 1.00 11.09 ? 183 VAL A CA  1 
ATOM   1420 C C   . VAL A 1 185 ? 55.171 4.066  52.815 1.00 11.45 ? 183 VAL A C   1 
ATOM   1421 O O   . VAL A 1 185 ? 54.500 3.188  53.386 1.00 11.50 ? 183 VAL A O   1 
ATOM   1422 C CB  . VAL A 1 185 ? 53.786 6.060  51.960 1.00 9.72  ? 183 VAL A CB  1 
ATOM   1423 C CG1 . VAL A 1 185 ? 53.410 7.464  52.257 1.00 9.73  ? 183 VAL A CG1 1 
ATOM   1424 C CG2 . VAL A 1 185 ? 54.384 6.006  50.566 1.00 5.54  ? 183 VAL A CG2 1 
ATOM   1425 N N   . ARG A 1 186 ? 56.234 3.783  52.064 1.00 10.51 ? 184 ARG A N   1 
ATOM   1426 C CA  . ARG A 1 186 ? 56.697 2.375  51.903 1.00 11.47 ? 184 ARG A CA  1 
ATOM   1427 C C   . ARG A 1 186 ? 57.255 1.766  53.175 1.00 12.81 ? 184 ARG A C   1 
ATOM   1428 O O   . ARG A 1 186 ? 56.777 0.702  53.614 1.00 13.77 ? 184 ARG A O   1 
ATOM   1429 C CB  . ARG A 1 186 ? 57.688 2.255  50.780 1.00 11.68 ? 184 ARG A CB  1 
ATOM   1430 C CG  . ARG A 1 186 ? 57.081 2.815  49.428 1.00 13.49 ? 184 ARG A CG  1 
ATOM   1431 C CD  . ARG A 1 186 ? 56.790 1.672  48.466 1.00 13.36 ? 184 ARG A CD  1 
ATOM   1432 N NE  . ARG A 1 186 ? 56.389 2.196  47.157 1.00 13.24 ? 184 ARG A NE  1 
ATOM   1433 C CZ  . ARG A 1 186 ? 57.194 2.312  46.119 1.00 12.59 ? 184 ARG A CZ  1 
ATOM   1434 N NH1 . ARG A 1 186 ? 58.449 1.920  46.202 1.00 12.86 ? 184 ARG A NH1 1 
ATOM   1435 N NH2 . ARG A 1 186 ? 56.725 2.791  44.992 1.00 12.03 ? 184 ARG A NH2 1 
ATOM   1436 N N   . GLY A 1 187 ? 58.249 2.415  53.775 1.00 11.90 ? 185 GLY A N   1 
ATOM   1437 C CA  . GLY A 1 187 ? 58.817 1.873  55.017 1.00 13.00 ? 185 GLY A CA  1 
ATOM   1438 C C   . GLY A 1 187 ? 57.873 1.902  56.210 1.00 13.15 ? 185 GLY A C   1 
ATOM   1439 O O   . GLY A 1 187 ? 58.142 1.256  57.221 1.00 14.92 ? 185 GLY A O   1 
ATOM   1440 N N   . SER A 1 188 ? 56.771 2.652  56.114 1.00 13.31 ? 186 SER A N   1 
ATOM   1441 C CA  . SER A 1 188 ? 55.800 2.722  57.196 1.00 12.83 ? 186 SER A CA  1 
ATOM   1442 C C   . SER A 1 188 ? 54.803 1.602  57.266 1.00 13.72 ? 186 SER A C   1 
ATOM   1443 O O   . SER A 1 188 ? 54.106 1.314  56.278 1.00 11.98 ? 186 SER A O   1 
ATOM   1444 C CB  . SER A 1 188 ? 55.058 4.037  57.166 1.00 13.88 ? 186 SER A CB  1 
ATOM   1445 O OG  . SER A 1 188 ? 53.922 3.973  57.974 1.00 15.39 ? 186 SER A OG  1 
ATOM   1446 N N   . SER A 1 189 ? 54.722 0.979  58.468 1.00 13.43 ? 187 SER A N   1 
ATOM   1447 C CA  . SER A 1 189 ? 53.735 -0.062 58.720 1.00 15.01 ? 187 SER A CA  1 
ATOM   1448 C C   . SER A 1 189 ? 52.300 0.505  58.820 1.00 15.46 ? 187 SER A C   1 
ATOM   1449 O O   . SER A 1 189 ? 51.352 -0.257 58.910 1.00 17.05 ? 187 SER A O   1 
ATOM   1450 C CB  . SER A 1 189 ? 54.100 -0.858 59.978 1.00 14.35 ? 187 SER A CB  1 
ATOM   1451 O OG  . SER A 1 189 ? 53.962 -0.039 61.105 1.00 14.24 ? 187 SER A OG  1 
ATOM   1452 N N   . SER A 1 190 ? 52.144 1.827  58.786 1.00 14.55 ? 188 SER A N   1 
ATOM   1453 C CA  . SER A 1 190 ? 50.802 2.476  58.750 1.00 14.93 ? 188 SER A CA  1 
ATOM   1454 C C   . SER A 1 190 ? 50.204 2.786  57.325 1.00 14.26 ? 188 SER A C   1 
ATOM   1455 O O   . SER A 1 190 ? 49.104 3.363  57.231 1.00 14.16 ? 188 SER A O   1 
ATOM   1456 C CB  . SER A 1 190 ? 50.837 3.786  59.546 1.00 14.37 ? 188 SER A CB  1 
ATOM   1457 O OG  . SER A 1 190 ? 50.939 3.497  60.936 1.00 17.25 ? 188 SER A OG  1 
ATOM   1458 N N   . PHE A 1 191 ? 50.914 2.397  56.275 1.00 11.76 ? 189 PHE A N   1 
ATOM   1459 C CA  . PHE A 1 191 ? 50.501 2.573  54.877 1.00 11.58 ? 189 PHE A CA  1 
ATOM   1460 C C   . PHE A 1 191 ? 50.779 1.303  54.039 1.00 11.81 ? 189 PHE A C   1 
ATOM   1461 O O   . PHE A 1 191 ? 51.918 0.807  53.968 1.00 12.76 ? 189 PHE A O   1 
ATOM   1462 C CB  . PHE A 1 191 ? 51.312 3.706  54.231 1.00 11.48 ? 189 PHE A CB  1 
ATOM   1463 C CG  . PHE A 1 191 ? 50.997 5.092  54.770 1.00 12.08 ? 189 PHE A CG  1 
ATOM   1464 C CD1 . PHE A 1 191 ? 49.919 5.819  54.251 1.00 15.47 ? 189 PHE A CD1 1 
ATOM   1465 C CD2 . PHE A 1 191 ? 51.757 5.650  55.791 1.00 9.95  ? 189 PHE A CD2 1 
ATOM   1466 C CE1 . PHE A 1 191 ? 49.610 7.079  54.712 1.00 12.50 ? 189 PHE A CE1 1 
ATOM   1467 C CE2 . PHE A 1 191 ? 51.445 6.903  56.290 1.00 16.52 ? 189 PHE A CE2 1 
ATOM   1468 C CZ  . PHE A 1 191 ? 50.378 7.655  55.731 1.00 13.27 ? 189 PHE A CZ  1 
ATOM   1469 N N   . GLU A 1 192 ? 49.767 0.820  53.363 1.00 11.11 ? 190 GLU A N   1 
ATOM   1470 C CA  . GLU A 1 192 ? 49.918 -0.205 52.353 1.00 13.03 ? 190 GLU A CA  1 
ATOM   1471 C C   . GLU A 1 192 ? 49.953 0.466  50.965 1.00 11.70 ? 190 GLU A C   1 
ATOM   1472 O O   . GLU A 1 192 ? 49.078 1.287  50.636 1.00 10.54 ? 190 GLU A O   1 
ATOM   1473 C CB  . GLU A 1 192 ? 48.727 -1.153 52.429 1.00 13.65 ? 190 GLU A CB  1 
ATOM   1474 C CG  . GLU A 1 192 ? 48.748 -1.923 53.777 1.00 21.32 ? 190 GLU A CG  1 
ATOM   1475 C CD  . GLU A 1 192 ? 48.034 -3.244 53.702 1.00 28.84 ? 190 GLU A CD  1 
ATOM   1476 O OE1 . GLU A 1 192 ? 47.511 -3.591 52.611 1.00 30.84 ? 190 GLU A OE1 1 
ATOM   1477 O OE2 . GLU A 1 192 ? 48.021 -3.935 54.738 1.00 33.55 ? 190 GLU A OE2 1 
ATOM   1478 N N   . CYS A 1 193 ? 50.959 0.108  50.201 1.00 10.33 ? 191 CYS A N   1 
ATOM   1479 C CA  . CYS A 1 193 ? 51.335 0.898  49.009 1.00 12.07 ? 191 CYS A CA  1 
ATOM   1480 C C   . CYS A 1 193 ? 51.205 0.064  47.747 1.00 10.98 ? 191 CYS A C   1 
ATOM   1481 O O   . CYS A 1 193 ? 51.435 -1.146 47.770 1.00 13.78 ? 191 CYS A O   1 
ATOM   1482 C CB  . CYS A 1 193 ? 52.760 1.436  49.132 1.00 9.27  ? 191 CYS A CB  1 
ATOM   1483 S SG  . CYS A 1 193 ? 52.820 2.648  50.551 1.00 11.67 ? 191 CYS A SG  1 
ATOM   1484 N N   . THR A 1 194 ? 50.800 0.734  46.697 1.00 10.82 ? 192 THR A N   1 
ATOM   1485 C CA  . THR A 1 194 ? 50.719 0.192  45.357 1.00 11.48 ? 192 THR A CA  1 
ATOM   1486 C C   . THR A 1 194 ? 51.250 1.319  44.417 1.00 11.80 ? 192 THR A C   1 
ATOM   1487 O O   . THR A 1 194 ? 50.824 2.495  44.489 1.00 11.53 ? 192 THR A O   1 
ATOM   1488 C CB  . THR A 1 194 ? 49.293 -0.119 44.921 1.00 8.64  ? 192 THR A CB  1 
ATOM   1489 O OG1 . THR A 1 194 ? 48.704 -0.989 45.899 1.00 10.32 ? 192 THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 194 ? 49.305 -0.827 43.506 1.00 7.23  ? 192 THR A CG2 1 
ATOM   1491 N N   . HIS A 1 195 ? 52.194 0.913  43.586 1.00 11.55 ? 193 HIS A N   1 
ATOM   1492 C CA  . HIS A 1 195 ? 52.785 1.788  42.604 1.00 12.19 ? 193 HIS A CA  1 
ATOM   1493 C C   . HIS A 1 195 ? 52.250 1.471  41.231 1.00 11.96 ? 193 HIS A C   1 
ATOM   1494 O O   . HIS A 1 195 ? 52.156 0.300  40.873 1.00 12.95 ? 193 HIS A O   1 
ATOM   1495 C CB  . HIS A 1 195 ? 54.311 1.758  42.584 1.00 11.37 ? 193 HIS A CB  1 
ATOM   1496 C CG  . HIS A 1 195 ? 54.882 2.946  41.854 1.00 12.65 ? 193 HIS A CG  1 
ATOM   1497 N ND1 . HIS A 1 195 ? 54.756 4.246  42.334 1.00 10.97 ? 193 HIS A ND1 1 
ATOM   1498 C CD2 . HIS A 1 195 ? 55.457 3.048  40.627 1.00 10.17 ? 193 HIS A CD2 1 
ATOM   1499 C CE1 . HIS A 1 195 ? 55.268 5.087  41.449 1.00 9.90  ? 193 HIS A CE1 1 
ATOM   1500 N NE2 . HIS A 1 195 ? 55.678 4.392  40.397 1.00 8.69  ? 193 HIS A NE2 1 
ATOM   1501 N N   . TYR A 1 196 ? 51.817 2.514  40.521 1.00 12.64 ? 194 TYR A N   1 
ATOM   1502 C CA  . TYR A 1 196 ? 51.326 2.393  39.130 1.00 13.84 ? 194 TYR A CA  1 
ATOM   1503 C C   . TYR A 1 196 ? 52.297 3.146  38.225 1.00 13.60 ? 194 TYR A C   1 
ATOM   1504 O O   . TYR A 1 196 ? 52.502 4.349  38.434 1.00 13.92 ? 194 TYR A O   1 
ATOM   1505 C CB  . TYR A 1 196 ? 49.964 3.094  38.972 1.00 14.81 ? 194 TYR A CB  1 
ATOM   1506 C CG  . TYR A 1 196 ? 48.941 2.630  39.926 1.00 14.82 ? 194 TYR A CG  1 
ATOM   1507 C CD1 . TYR A 1 196 ? 48.885 3.134  41.215 1.00 14.87 ? 194 TYR A CD1 1 
ATOM   1508 C CD2 . TYR A 1 196 ? 48.025 1.663  39.544 1.00 16.01 ? 194 TYR A CD2 1 
ATOM   1509 C CE1 . TYR A 1 196 ? 47.927 2.692  42.121 1.00 15.27 ? 194 TYR A CE1 1 
ATOM   1510 C CE2 . TYR A 1 196 ? 47.073 1.212  40.418 1.00 19.03 ? 194 TYR A CE2 1 
ATOM   1511 C CZ  . TYR A 1 196 ? 47.041 1.721  41.727 1.00 19.85 ? 194 TYR A CZ  1 
ATOM   1512 O OH  . TYR A 1 196 ? 46.081 1.257  42.581 1.00 19.96 ? 194 TYR A OH  1 
ATOM   1513 N N   . SER A 1 197 ? 52.869 2.455  37.230 1.00 13.02 ? 195 SER A N   1 
ATOM   1514 C CA  . SER A 1 197 ? 53.631 3.120  36.143 1.00 12.18 ? 195 SER A CA  1 
ATOM   1515 C C   . SER A 1 197 ? 52.922 2.957  34.811 1.00 12.14 ? 195 SER A C   1 
ATOM   1516 O O   . SER A 1 197 ? 52.764 1.826  34.317 1.00 11.10 ? 195 SER A O   1 
ATOM   1517 C CB  . SER A 1 197 ? 55.013 2.536  36.007 1.00 10.77 ? 195 SER A CB  1 
ATOM   1518 O OG  . SER A 1 197 ? 55.648 2.484  37.251 1.00 14.61 ? 195 SER A OG  1 
ATOM   1519 N N   . SER A 1 198 ? 52.472 4.090  34.266 1.00 12.23 ? 196 SER A N   1 
ATOM   1520 C CA  . SER A 1 198 ? 51.807 4.144  33.004 1.00 13.77 ? 196 SER A CA  1 
ATOM   1521 C C   . SER A 1 198 ? 52.879 4.407  31.942 1.00 13.54 ? 196 SER A C   1 
ATOM   1522 O O   . SER A 1 198 ? 53.592 5.423  31.968 1.00 13.13 ? 196 SER A O   1 
ATOM   1523 C CB  . SER A 1 198 ? 50.875 5.341  32.963 1.00 14.44 ? 196 SER A CB  1 
ATOM   1524 O OG  . SER A 1 198 ? 49.754 5.134  33.726 1.00 19.82 ? 196 SER A OG  1 
ATOM   1525 N N   . TYR A 1 199 ? 53.015 3.469  31.039 1.00 13.69 ? 197 TYR A N   1 
ATOM   1526 C CA  . TYR A 1 199 ? 53.860 3.667  29.884 1.00 14.51 ? 197 TYR A CA  1 
ATOM   1527 C C   . TYR A 1 199 ? 52.720 3.943  28.907 1.00 16.55 ? 197 TYR A C   1 
ATOM   1528 O O   . TYR A 1 199 ? 51.517 3.911  29.199 1.00 20.57 ? 197 TYR A O   1 
ATOM   1529 C CB  . TYR A 1 199 ? 54.620 2.366  29.588 1.00 13.84 ? 197 TYR A CB  1 
ATOM   1530 C CG  . TYR A 1 199 ? 55.541 1.912  30.719 1.00 12.96 ? 197 TYR A CG  1 
ATOM   1531 C CD1 . TYR A 1 199 ? 55.029 1.233  31.843 1.00 17.39 ? 197 TYR A CD1 1 
ATOM   1532 C CD2 . TYR A 1 199 ? 56.907 2.182  30.677 1.00 15.16 ? 197 TYR A CD2 1 
ATOM   1533 C CE1 . TYR A 1 199 ? 55.866 0.810  32.927 1.00 14.13 ? 197 TYR A CE1 1 
ATOM   1534 C CE2 . TYR A 1 199 ? 57.744 1.778  31.716 1.00 16.90 ? 197 TYR A CE2 1 
ATOM   1535 C CZ  . TYR A 1 199 ? 57.191 1.098  32.853 1.00 14.37 ? 197 TYR A CZ  1 
ATOM   1536 O OH  . TYR A 1 199 ? 58.018 0.711  33.869 1.00 16.23 ? 197 TYR A OH  1 
ATOM   1537 N N   . LEU A 1 200 ? 52.915 4.263  27.706 1.00 18.08 ? 198 LEU A N   1 
ATOM   1538 C CA  . LEU A 1 200 ? 51.591 4.261  27.057 1.00 16.24 ? 198 LEU A CA  1 
ATOM   1539 C C   . LEU A 1 200 ? 52.017 3.121  26.176 1.00 15.66 ? 198 LEU A C   1 
ATOM   1540 O O   . LEU A 1 200 ? 52.189 1.997  26.704 1.00 15.42 ? 198 LEU A O   1 
ATOM   1541 C CB  . LEU A 1 200 ? 51.326 5.636  26.456 1.00 15.58 ? 198 LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 200 ? 50.827 6.702  27.461 1.00 15.78 ? 198 LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 200 ? 51.004 8.122  26.994 1.00 15.15 ? 198 LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 200 ? 49.328 6.477  27.815 1.00 15.88 ? 198 LEU A CD2 1 
ATOM   1545 N N   . GLU A 1 201 ? 52.420 3.402  24.953 1.00 14.97 ? 199 GLU A N   1 
ATOM   1546 C CA  . GLU A 1 201 ? 53.042 2.351  24.127 1.00 16.29 ? 199 GLU A CA  1 
ATOM   1547 C C   . GLU A 1 201 ? 54.556 2.366  24.291 1.00 15.59 ? 199 GLU A C   1 
ATOM   1548 O O   . GLU A 1 201 ? 55.248 1.620  23.661 1.00 18.27 ? 199 GLU A O   1 
ATOM   1549 C CB  . GLU A 1 201 ? 52.691 2.562  22.671 1.00 17.45 ? 199 GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 201 ? 53.081 3.951  22.257 1.00 19.70 ? 199 GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 201 ? 51.912 4.897  22.282 1.00 31.33 ? 199 GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 201 ? 51.331 5.269  23.397 1.00 22.76 ? 199 GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 201 ? 51.583 5.264  21.097 1.00 36.69 ? 199 GLU A OE2 1 
ATOM   1554 N N   . TYR A 1 202 ? 55.078 3.220  25.142 1.00 14.56 ? 200 TYR A N   1 
ATOM   1555 C CA  . TYR A 1 202 ? 56.512 3.375  25.259 1.00 14.86 ? 200 TYR A CA  1 
ATOM   1556 C C   . TYR A 1 202 ? 57.180 2.457  26.263 1.00 15.70 ? 200 TYR A C   1 
ATOM   1557 O O   . TYR A 1 202 ? 56.490 1.727  27.039 1.00 12.64 ? 200 TYR A O   1 
ATOM   1558 C CB  . TYR A 1 202 ? 56.849 4.833  25.596 1.00 14.59 ? 200 TYR A CB  1 
ATOM   1559 C CG  . TYR A 1 202 ? 56.101 5.778  24.668 1.00 16.19 ? 200 TYR A CG  1 
ATOM   1560 C CD1 . TYR A 1 202 ? 56.483 5.902  23.311 1.00 15.95 ? 200 TYR A CD1 1 
ATOM   1561 C CD2 . TYR A 1 202 ? 55.022 6.514  25.132 1.00 14.93 ? 200 TYR A CD2 1 
ATOM   1562 C CE1 . TYR A 1 202 ? 55.805 6.757  22.432 1.00 16.73 ? 200 TYR A CE1 1 
ATOM   1563 C CE2 . TYR A 1 202 ? 54.326 7.376  24.265 1.00 19.34 ? 200 TYR A CE2 1 
ATOM   1564 C CZ  . TYR A 1 202 ? 54.736 7.474  22.929 1.00 17.48 ? 200 TYR A CZ  1 
ATOM   1565 O OH  . TYR A 1 202 ? 54.052 8.294  22.108 1.00 20.74 ? 200 TYR A OH  1 
ATOM   1566 N N   . MET A 1 203 ? 58.517 2.515  26.237 1.00 15.68 ? 201 MET A N   1 
ATOM   1567 C CA  . MET A 1 203 ? 59.378 1.690  27.154 1.00 19.76 ? 201 MET A CA  1 
ATOM   1568 C C   . MET A 1 203 ? 59.741 2.501  28.422 1.00 17.43 ? 201 MET A C   1 
ATOM   1569 O O   . MET A 1 203 ? 60.213 1.930  29.410 1.00 15.92 ? 201 MET A O   1 
ATOM   1570 C CB  . MET A 1 203 ? 60.701 1.286  26.474 1.00 18.20 ? 201 MET A CB  1 
ATOM   1571 C CG  . MET A 1 203 ? 60.771 -0.029 25.699 1.00 22.59 ? 201 MET A CG  1 
ATOM   1572 S SD  . MET A 1 203 ? 62.432 -0.018 24.882 1.00 26.49 ? 201 MET A SD  1 
ATOM   1573 C CE  . MET A 1 203 ? 63.447 0.872  26.057 1.00 26.56 ? 201 MET A CE  1 
ATOM   1574 N N   . LYS A 1 204 ? 59.539 3.812  28.352 1.00 17.15 ? 202 LYS A N   1 
ATOM   1575 C CA  . LYS A 1 204 ? 59.798 4.729  29.494 1.00 19.42 ? 202 LYS A CA  1 
ATOM   1576 C C   . LYS A 1 204 ? 58.473 5.197  30.113 1.00 18.14 ? 202 LYS A C   1 
ATOM   1577 O O   . LYS A 1 204 ? 57.508 5.461  29.385 1.00 17.60 ? 202 LYS A O   1 
ATOM   1578 C CB  . LYS A 1 204 ? 60.580 5.943  28.987 1.00 20.09 ? 202 LYS A CB  1 
ATOM   1579 C CG  . LYS A 1 204 ? 61.238 6.786  30.069 1.00 24.86 ? 202 LYS A CG  1 
ATOM   1580 C CD  . LYS A 1 204 ? 61.894 8.055  29.456 1.00 25.06 ? 202 LYS A CD  1 
ATOM   1581 C CE  . LYS A 1 204 ? 62.541 8.953  30.551 1.00 29.43 ? 202 LYS A CE  1 
ATOM   1582 N NZ  . LYS A 1 204 ? 62.558 10.380 30.081 1.00 31.94 ? 202 LYS A NZ  1 
ATOM   1583 N N   . VAL A 1 205 ? 58.432 5.258  31.450 1.00 17.83 ? 203 VAL A N   1 
ATOM   1584 C CA  . VAL A 1 205 ? 57.257 5.650  32.232 1.00 16.48 ? 203 VAL A CA  1 
ATOM   1585 C C   . VAL A 1 205 ? 56.833 7.061  31.802 1.00 17.46 ? 203 VAL A C   1 
ATOM   1586 O O   . VAL A 1 205 ? 57.660 7.984  31.787 1.00 16.57 ? 203 VAL A O   1 
ATOM   1587 C CB  . VAL A 1 205 ? 57.624 5.707  33.741 1.00 16.89 ? 203 VAL A CB  1 
ATOM   1588 C CG1 . VAL A 1 205 ? 56.563 6.421  34.554 1.00 13.68 ? 203 VAL A CG1 1 
ATOM   1589 C CG2 . VAL A 1 205 ? 57.958 4.277  34.302 1.00 13.39 ? 203 VAL A CG2 1 
ATOM   1590 N N   . VAL A 1 206 ? 55.556 7.217  31.469 1.00 16.09 ? 204 VAL A N   1 
ATOM   1591 C CA  . VAL A 1 206 ? 54.994 8.529  31.150 1.00 15.94 ? 204 VAL A CA  1 
ATOM   1592 C C   . VAL A 1 206 ? 54.497 9.241  32.441 1.00 16.35 ? 204 VAL A C   1 
ATOM   1593 O O   . VAL A 1 206 ? 54.718 10.425 32.649 1.00 16.94 ? 204 VAL A O   1 
ATOM   1594 C CB  . VAL A 1 206 ? 53.830 8.380  30.141 1.00 15.25 ? 204 VAL A CB  1 
ATOM   1595 C CG1 . VAL A 1 206 ? 53.188 9.718  29.906 1.00 15.01 ? 204 VAL A CG1 1 
ATOM   1596 C CG2 . VAL A 1 206 ? 54.399 7.812  28.834 1.00 11.78 ? 204 VAL A CG2 1 
ATOM   1597 N N   . ASP A 1 207 ? 53.792 8.510  33.281 1.00 15.03 ? 205 ASP A N   1 
ATOM   1598 C CA  . ASP A 1 207 ? 53.455 8.991  34.611 1.00 13.80 ? 205 ASP A CA  1 
ATOM   1599 C C   . ASP A 1 207 ? 53.522 7.782  35.564 1.00 12.24 ? 205 ASP A C   1 
ATOM   1600 O O   . ASP A 1 207 ? 53.210 6.666  35.181 1.00 11.29 ? 205 ASP A O   1 
ATOM   1601 C CB  . ASP A 1 207 ? 52.059 9.675  34.656 1.00 12.71 ? 205 ASP A CB  1 
ATOM   1602 C CG  . ASP A 1 207 ? 51.882 10.550 35.924 1.00 14.55 ? 205 ASP A CG  1 
ATOM   1603 O OD1 . ASP A 1 207 ? 52.850 10.662 36.734 1.00 16.90 ? 205 ASP A OD1 1 
ATOM   1604 O OD2 . ASP A 1 207 ? 50.771 11.060 36.154 1.00 13.86 ? 205 ASP A OD2 1 
ATOM   1605 N N   . GLY A 1 208 ? 53.945 8.037  36.785 1.00 11.61 ? 206 GLY A N   1 
ATOM   1606 C CA  . GLY A 1 208 ? 53.911 7.037  37.863 1.00 10.86 ? 206 GLY A CA  1 
ATOM   1607 C C   . GLY A 1 208 ? 53.123 7.601  39.043 1.00 11.41 ? 206 GLY A C   1 
ATOM   1608 O O   . GLY A 1 208 ? 53.223 8.799  39.427 1.00 9.33  ? 206 GLY A O   1 
ATOM   1609 N N   . LEU A 1 209 ? 52.284 6.757  39.608 1.00 10.58 ? 207 LEU A N   1 
ATOM   1610 C CA  . LEU A 1 209 ? 51.482 7.216  40.733 1.00 10.85 ? 207 LEU A CA  1 
ATOM   1611 C C   . LEU A 1 209 ? 51.642 6.272  41.947 1.00 10.59 ? 207 LEU A C   1 
ATOM   1612 O O   . LEU A 1 209 ? 51.866 5.075  41.779 1.00 10.46 ? 207 LEU A O   1 
ATOM   1613 C CB  . LEU A 1 209 ? 49.995 7.373  40.315 1.00 11.01 ? 207 LEU A CB  1 
ATOM   1614 C CG  . LEU A 1 209 ? 49.589 8.402  39.233 1.00 10.79 ? 207 LEU A CG  1 
ATOM   1615 C CD1 . LEU A 1 209 ? 49.701 7.761  37.756 1.00 10.13 ? 207 LEU A CD1 1 
ATOM   1616 C CD2 . LEU A 1 209 ? 48.190 8.958  39.536 1.00 8.04  ? 207 LEU A CD2 1 
ATOM   1617 N N   . GLU A 1 210 ? 51.489 6.806  43.158 1.00 10.67 ? 208 GLU A N   1 
ATOM   1618 C CA  . GLU A 1 210 ? 51.566 5.979  44.343 1.00 10.84 ? 208 GLU A CA  1 
ATOM   1619 C C   . GLU A 1 210 ? 50.254 6.026  45.051 1.00 10.41 ? 208 GLU A C   1 
ATOM   1620 O O   . GLU A 1 210 ? 49.788 7.077  45.399 1.00 9.88  ? 208 GLU A O   1 
ATOM   1621 C CB  . GLU A 1 210 ? 52.671 6.487  45.296 1.00 11.52 ? 208 GLU A CB  1 
ATOM   1622 C CG  . GLU A 1 210 ? 52.985 5.527  46.455 1.00 9.69  ? 208 GLU A CG  1 
ATOM   1623 C CD  . GLU A 1 210 ? 53.730 4.256  46.048 1.00 9.82  ? 208 GLU A CD  1 
ATOM   1624 O OE1 . GLU A 1 210 ? 54.169 4.116  44.906 1.00 13.76 ? 208 GLU A OE1 1 
ATOM   1625 O OE2 . GLU A 1 210 ? 53.937 3.361  46.888 1.00 14.12 ? 208 GLU A OE2 1 
ATOM   1626 N N   . LYS A 1 211 ? 49.652 4.870  45.275 1.00 12.04 ? 209 LYS A N   1 
ATOM   1627 C CA  . LYS A 1 211 ? 48.507 4.741  46.230 1.00 10.55 ? 209 LYS A CA  1 
ATOM   1628 C C   . LYS A 1 211 ? 49.057 4.234  47.554 1.00 11.52 ? 209 LYS A C   1 
ATOM   1629 O O   . LYS A 1 211 ? 49.781 3.239  47.593 1.00 11.52 ? 209 LYS A O   1 
ATOM   1630 C CB  . LYS A 1 211 ? 47.435 3.814  45.666 1.00 10.83 ? 209 LYS A CB  1 
ATOM   1631 C CG  . LYS A 1 211 ? 46.167 3.728  46.484 1.00 8.89  ? 209 LYS A CG  1 
ATOM   1632 C CD  . LYS A 1 211 ? 45.108 2.820  45.878 1.00 10.59 ? 209 LYS A CD  1 
ATOM   1633 C CE  . LYS A 1 211 ? 45.640 1.361  45.761 1.00 12.59 ? 209 LYS A CE  1 
ATOM   1634 N NZ  . LYS A 1 211 ? 44.541 0.417  45.402 1.00 11.80 ? 209 LYS A NZ  1 
ATOM   1635 N N   . ALA A 1 212 ? 48.706 4.937  48.626 1.00 12.53 ? 210 ALA A N   1 
ATOM   1636 C CA  . ALA A 1 212 ? 49.152 4.615  50.008 1.00 12.80 ? 210 ALA A CA  1 
ATOM   1637 C C   . ALA A 1 212 ? 47.901 4.622  50.811 1.00 13.42 ? 210 ALA A C   1 
ATOM   1638 O O   . ALA A 1 212 ? 47.264 5.668  50.940 1.00 12.88 ? 210 ALA A O   1 
ATOM   1639 C CB  . ALA A 1 212 ? 50.083 5.706  50.553 1.00 12.75 ? 210 ALA A CB  1 
ATOM   1640 N N   . ILE A 1 213 ? 47.507 3.466  51.324 1.00 13.89 ? 211 ILE A N   1 
ATOM   1641 C CA  . ILE A 1 213 ? 46.247 3.439  52.117 1.00 14.44 ? 211 ILE A CA  1 
ATOM   1642 C C   . ILE A 1 213 ? 46.638 3.507  53.581 1.00 13.31 ? 211 ILE A C   1 
ATOM   1643 O O   . ILE A 1 213 ? 47.412 2.699  54.058 1.00 10.45 ? 211 ILE A O   1 
ATOM   1644 C CB  . ILE A 1 213 ? 45.315 2.206  51.712 1.00 14.73 ? 211 ILE A CB  1 
ATOM   1645 C CG1 . ILE A 1 213 ? 44.926 2.412  50.246 1.00 15.23 ? 211 ILE A CG1 1 
ATOM   1646 C CG2 . ILE A 1 213 ? 44.021 2.145  52.609 1.00 14.63 ? 211 ILE A CG2 1 
ATOM   1647 C CD1 . ILE A 1 213 ? 44.671 1.170  49.521 1.00 23.37 ? 211 ILE A CD1 1 
ATOM   1648 N N   . TYR A 1 214 ? 46.201 4.542  54.259 1.00 15.53 ? 212 TYR A N   1 
ATOM   1649 C CA  . TYR A 1 214 ? 46.487 4.669  55.688 1.00 16.78 ? 212 TYR A CA  1 
ATOM   1650 C C   . TYR A 1 214 ? 45.813 3.550  56.533 1.00 18.12 ? 212 TYR A C   1 
ATOM   1651 O O   . TYR A 1 214 ? 44.629 3.220  56.343 1.00 17.62 ? 212 TYR A O   1 
ATOM   1652 C CB  . TYR A 1 214 ? 46.113 6.078  56.157 1.00 17.94 ? 212 TYR A CB  1 
ATOM   1653 C CG  . TYR A 1 214 ? 46.490 6.364  57.577 1.00 17.33 ? 212 TYR A CG  1 
ATOM   1654 C CD1 . TYR A 1 214 ? 47.827 6.399  57.986 1.00 14.52 ? 212 TYR A CD1 1 
ATOM   1655 C CD2 . TYR A 1 214 ? 45.512 6.602  58.505 1.00 19.83 ? 212 TYR A CD2 1 
ATOM   1656 C CE1 . TYR A 1 214 ? 48.159 6.650  59.286 1.00 14.37 ? 212 TYR A CE1 1 
ATOM   1657 C CE2 . TYR A 1 214 ? 45.826 6.904  59.796 1.00 20.58 ? 212 TYR A CE2 1 
ATOM   1658 C CZ  . TYR A 1 214 ? 47.134 6.907  60.189 1.00 20.49 ? 212 TYR A CZ  1 
ATOM   1659 O OH  . TYR A 1 214 ? 47.372 7.196  61.508 1.00 23.45 ? 212 TYR A OH  1 
ATOM   1660 N N   . GLN A 1 215 ? 46.572 2.962  57.456 1.00 20.61 ? 213 GLN A N   1 
ATOM   1661 C CA  . GLN A 1 215 ? 46.054 1.837  58.254 1.00 23.86 ? 213 GLN A CA  1 
ATOM   1662 C C   . GLN A 1 215 ? 45.462 2.168  59.634 1.00 25.24 ? 213 GLN A C   1 
ATOM   1663 O O   . GLN A 1 215 ? 45.161 1.271  60.388 1.00 25.39 ? 213 GLN A O   1 
ATOM   1664 C CB  . GLN A 1 215 ? 47.085 0.699  58.388 1.00 23.44 ? 213 GLN A CB  1 
ATOM   1665 C CG  . GLN A 1 215 ? 47.462 0.047  57.066 1.00 25.16 ? 213 GLN A CG  1 
ATOM   1666 C CD  . GLN A 1 215 ? 46.253 -0.322 56.233 1.00 30.00 ? 213 GLN A CD  1 
ATOM   1667 O OE1 . GLN A 1 215 ? 46.045 0.210  55.154 1.00 31.18 ? 213 GLN A OE1 1 
ATOM   1668 N NE2 . GLN A 1 215 ? 45.437 -1.214 56.743 1.00 31.99 ? 213 GLN A NE2 1 
ATOM   1669 N N   . GLY A 1 216 ? 45.305 3.449  59.955 1.00 28.16 ? 214 GLY A N   1 
ATOM   1670 C CA  . GLY A 1 216 ? 44.927 3.875  61.309 1.00 30.19 ? 214 GLY A CA  1 
ATOM   1671 C C   . GLY A 1 216 ? 46.157 3.955  62.201 1.00 32.19 ? 214 GLY A C   1 
ATOM   1672 O O   . GLY A 1 216 ? 47.188 3.306  61.927 1.00 33.62 ? 214 GLY A O   1 
HETATM 1673 S S   . SO4 B 2 .   ? 46.619 19.751 37.124 1.00 17.20 ? 300 SO4 A S   1 
HETATM 1674 O O1  . SO4 B 2 .   ? 46.986 20.475 35.879 1.00 17.27 ? 300 SO4 A O1  1 
HETATM 1675 O O2  . SO4 B 2 .   ? 47.823 19.508 37.922 1.00 19.00 ? 300 SO4 A O2  1 
HETATM 1676 O O3  . SO4 B 2 .   ? 45.961 18.497 36.826 1.00 16.79 ? 300 SO4 A O3  1 
HETATM 1677 O O4  . SO4 B 2 .   ? 45.754 20.642 37.887 1.00 13.26 ? 300 SO4 A O4  1 
HETATM 1678 O O   . HOH C 3 .   ? 54.481 0.834  54.180 1.00 2.00  ? 301 HOH A O   1 
HETATM 1679 O O   . HOH C 3 .   ? 54.813 0.000  39.162 0.50 13.60 ? 302 HOH A O   1 
HETATM 1680 O O   . HOH C 3 .   ? 60.210 -0.606 30.064 1.00 16.86 ? 303 HOH A O   1 
HETATM 1681 O O   . HOH C 3 .   ? 43.476 20.231 39.227 1.00 11.55 ? 304 HOH A O   1 
HETATM 1682 O O   . HOH C 3 .   ? 58.348 2.990  42.731 1.00 15.70 ? 305 HOH A O   1 
HETATM 1683 O O   . HOH C 3 .   ? 57.755 -0.222 36.916 1.00 22.11 ? 306 HOH A O   1 
HETATM 1684 O O   . HOH C 3 .   ? 51.036 19.444 46.428 1.00 21.76 ? 307 HOH A O   1 
HETATM 1685 O O   . HOH C 3 .   ? 54.319 -0.274 51.975 1.00 9.62  ? 308 HOH A O   1 
HETATM 1686 O O   . HOH C 3 .   ? 47.757 0.291  48.307 1.00 11.39 ? 309 HOH A O   1 
HETATM 1687 O O   . HOH C 3 .   ? 29.154 25.635 32.264 1.00 23.35 ? 310 HOH A O   1 
HETATM 1688 O O   . HOH C 3 .   ? 51.538 16.196 39.178 1.00 9.23  ? 311 HOH A O   1 
HETATM 1689 O O   . HOH C 3 .   ? 53.291 4.989  20.326 0.50 10.86 ? 312 HOH A O   1 
HETATM 1690 O O   . HOH C 3 .   ? 37.227 18.994 23.695 1.00 26.58 ? 313 HOH A O   1 
HETATM 1691 O O   . HOH C 3 .   ? 60.152 -1.003 55.920 1.00 20.49 ? 314 HOH A O   1 
HETATM 1692 O O   . HOH C 3 .   ? 49.780 3.242  30.157 1.00 6.14  ? 315 HOH A O   1 
HETATM 1693 O O   . HOH C 3 .   ? 56.679 5.077  38.103 1.00 14.42 ? 316 HOH A O   1 
HETATM 1694 O O   . HOH C 3 .   ? 51.994 26.792 44.581 1.00 25.80 ? 317 HOH A O   1 
HETATM 1695 O O   . HOH C 3 .   ? 45.061 11.030 61.048 1.00 19.06 ? 318 HOH A O   1 
HETATM 1696 O O   . HOH C 3 .   ? 50.396 20.918 48.197 1.00 31.66 ? 319 HOH A O   1 
HETATM 1697 O O   . HOH C 3 .   ? 63.516 19.223 45.601 1.00 23.34 ? 320 HOH A O   1 
HETATM 1698 O O   . HOH C 3 .   ? 44.499 -0.745 41.938 1.00 36.86 ? 321 HOH A O   1 
HETATM 1699 O O   . HOH C 3 .   ? 47.396 16.978 35.065 1.00 24.47 ? 322 HOH A O   1 
HETATM 1700 O O   . HOH C 3 .   ? 45.976 12.966 65.282 1.00 38.13 ? 323 HOH A O   1 
HETATM 1701 O O   . HOH C 3 .   ? 42.245 13.521 28.783 1.00 28.72 ? 324 HOH A O   1 
HETATM 1702 O O   . HOH C 3 .   ? 54.848 5.036  60.256 1.00 12.82 ? 325 HOH A O   1 
HETATM 1703 O O   . HOH C 3 .   ? 59.818 15.619 51.144 1.00 40.35 ? 326 HOH A O   1 
HETATM 1704 O O   . HOH C 3 .   ? 58.213 21.598 54.875 1.00 26.73 ? 327 HOH A O   1 
HETATM 1705 O O   . HOH C 3 .   ? 29.447 27.963 33.455 1.00 20.34 ? 328 HOH A O   1 
HETATM 1706 O O   . HOH C 3 .   ? 52.754 13.380 61.530 1.00 22.66 ? 329 HOH A O   1 
HETATM 1707 O O   . HOH C 3 .   ? 48.020 24.776 49.074 1.00 24.84 ? 330 HOH A O   1 
HETATM 1708 O O   . HOH C 3 .   ? 38.340 8.779  29.473 1.00 35.53 ? 331 HOH A O   1 
HETATM 1709 O O   . HOH C 3 .   ? 42.767 2.512  32.120 1.00 32.91 ? 332 HOH A O   1 
HETATM 1710 O O   . HOH C 3 .   ? 57.485 15.019 49.534 1.00 17.11 ? 333 HOH A O   1 
HETATM 1711 O O   . HOH C 3 .   ? 58.410 5.287  57.352 1.00 24.35 ? 334 HOH A O   1 
HETATM 1712 O O   . HOH C 3 .   ? 37.473 25.823 17.937 1.00 28.88 ? 335 HOH A O   1 
HETATM 1713 O O   . HOH C 3 .   ? 65.242 6.088  26.186 1.00 23.01 ? 336 HOH A O   1 
HETATM 1714 O O   . HOH C 3 .   ? 27.656 27.811 41.707 1.00 33.30 ? 337 HOH A O   1 
HETATM 1715 O O   . HOH C 3 .   ? 50.994 7.877  20.765 1.00 37.62 ? 338 HOH A O   1 
HETATM 1716 O O   . HOH C 3 .   ? 43.498 0.158  39.916 0.50 8.93  ? 339 HOH A O   1 
HETATM 1717 O O   . HOH C 3 .   ? 43.026 32.741 43.042 1.00 35.64 ? 340 HOH A O   1 
HETATM 1718 O O   . HOH C 3 .   ? 57.364 6.825  18.867 1.00 38.72 ? 341 HOH A O   1 
HETATM 1719 O O   . HOH C 3 .   ? 60.889 1.585  33.883 1.00 30.55 ? 342 HOH A O   1 
HETATM 1720 O O   . HOH C 3 .   ? 32.650 8.163  43.260 1.00 29.29 ? 343 HOH A O   1 
HETATM 1721 O O   . HOH C 3 .   ? 52.337 21.311 54.601 1.00 33.15 ? 344 HOH A O   1 
HETATM 1722 O O   . HOH C 3 .   ? 38.569 32.158 39.174 1.00 22.39 ? 345 HOH A O   1 
HETATM 1723 O O   . HOH C 3 .   ? 32.064 29.573 40.641 1.00 30.61 ? 346 HOH A O   1 
HETATM 1724 O O   . HOH C 3 .   ? 32.022 15.184 24.744 1.00 31.97 ? 347 HOH A O   1 
HETATM 1725 O O   . HOH C 3 .   ? 24.355 17.152 33.262 1.00 47.72 ? 348 HOH A O   1 
HETATM 1726 O O   . HOH C 3 .   ? 33.335 21.012 48.184 1.00 45.10 ? 349 HOH A O   1 
HETATM 1727 O O   . HOH C 3 .   ? 33.311 26.069 43.190 1.00 23.36 ? 350 HOH A O   1 
HETATM 1728 O O   . HOH C 3 .   ? 54.084 13.055 34.391 1.00 32.64 ? 351 HOH A O   1 
HETATM 1729 O O   . HOH C 3 .   ? 40.628 22.976 62.654 1.00 29.04 ? 352 HOH A O   1 
HETATM 1730 O O   . HOH C 3 .   ? 56.350 26.870 39.095 1.00 21.74 ? 353 HOH A O   1 
HETATM 1731 O O   . HOH C 3 .   ? 54.491 11.112 61.528 1.00 30.68 ? 354 HOH A O   1 
HETATM 1732 O O   . HOH C 3 .   ? 35.463 27.084 44.917 1.00 14.48 ? 355 HOH A O   1 
HETATM 1733 O O   . HOH C 3 .   ? 31.898 28.495 43.081 1.00 30.01 ? 356 HOH A O   1 
HETATM 1734 O O   . HOH C 3 .   ? 31.852 28.137 24.682 1.00 35.71 ? 357 HOH A O   1 
HETATM 1735 O O   . HOH C 3 .   ? 28.535 18.918 34.636 1.00 34.60 ? 358 HOH A O   1 
HETATM 1736 O O   . HOH C 3 .   ? 50.558 18.496 37.620 1.00 14.61 ? 359 HOH A O   1 
HETATM 1737 O O   . HOH C 3 .   ? 39.935 1.996  51.710 1.00 34.88 ? 360 HOH A O   1 
HETATM 1738 O O   . HOH C 3 .   ? 39.050 10.561 38.580 1.00 38.00 ? 361 HOH A O   1 
HETATM 1739 O O   . HOH C 3 .   ? 38.535 5.715  51.374 1.00 22.39 ? 362 HOH A O   1 
HETATM 1740 O O   . HOH C 3 .   ? 54.577 18.598 57.907 1.00 22.96 ? 363 HOH A O   1 
HETATM 1741 O O   . HOH C 3 .   ? 40.661 30.789 50.519 1.00 37.94 ? 364 HOH A O   1 
HETATM 1742 O O   . HOH C 3 .   ? 38.509 -1.731 47.584 1.00 33.95 ? 365 HOH A O   1 
HETATM 1743 O O   . HOH C 3 .   ? 30.943 7.952  39.475 1.00 38.10 ? 366 HOH A O   1 
HETATM 1744 O O   . HOH C 3 .   ? 45.524 30.890 53.875 1.00 35.07 ? 367 HOH A O   1 
HETATM 1745 O O   . HOH C 3 .   ? 61.777 4.254  45.564 1.00 31.19 ? 368 HOH A O   1 
HETATM 1746 O O   . HOH C 3 .   ? 47.780 30.760 53.146 1.00 31.42 ? 369 HOH A O   1 
HETATM 1747 O O   . HOH C 3 .   ? 49.854 24.567 46.646 1.00 22.04 ? 370 HOH A O   1 
HETATM 1748 O O   . HOH C 3 .   ? 32.974 22.835 51.077 1.00 30.57 ? 371 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? 39.960 -3.924 43.667 1.00 20.82 ? 372 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? 57.530 5.753  59.844 1.00 27.01 ? 373 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? 53.700 7.133  60.595 1.00 28.60 ? 374 HOH A O   1 
HETATM 1752 O O   . HOH C 3 .   ? 60.455 2.237  44.113 1.00 22.48 ? 375 HOH A O   1 
HETATM 1753 O O   . HOH C 3 .   ? 52.205 14.355 35.791 1.00 23.86 ? 376 HOH A O   1 
HETATM 1754 O O   . HOH C 3 .   ? 37.231 1.697  37.018 1.00 25.14 ? 377 HOH A O   1 
HETATM 1755 O O   . HOH C 3 .   ? 61.087 4.251  32.895 1.00 20.50 ? 378 HOH A O   1 
HETATM 1756 O O   . HOH C 3 .   ? 53.521 17.874 60.448 1.00 32.15 ? 379 HOH A O   1 
HETATM 1757 O O   . HOH C 3 .   ? 55.399 29.142 38.432 1.00 29.38 ? 380 HOH A O   1 
HETATM 1758 O O   . HOH C 3 .   ? 61.165 9.900  54.350 1.00 29.11 ? 381 HOH A O   1 
HETATM 1759 O O   . HOH C 3 .   ? 38.955 31.920 41.509 1.00 26.46 ? 382 HOH A O   1 
HETATM 1760 O O   . HOH C 3 .   ? 60.100 8.892  32.938 1.00 27.54 ? 383 HOH A O   1 
HETATM 1761 O O   . HOH C 3 .   ? 56.411 11.866 30.643 1.00 31.07 ? 384 HOH A O   1 
HETATM 1762 O O   . HOH C 3 .   ? 50.944 18.008 48.417 1.00 33.76 ? 385 HOH A O   1 
HETATM 1763 O O   . HOH C 3 .   ? 30.024 14.688 39.514 1.00 31.84 ? 386 HOH A O   1 
HETATM 1764 O O   . HOH C 3 .   ? 58.855 11.592 41.865 1.00 30.10 ? 387 HOH A O   1 
HETATM 1765 O O   . HOH C 3 .   ? 40.359 5.201  61.876 1.00 25.79 ? 388 HOH A O   1 
HETATM 1766 O O   . HOH C 3 .   ? 60.297 13.281 48.658 1.00 43.05 ? 389 HOH A O   1 
HETATM 1767 O O   . HOH C 3 .   ? 26.921 18.951 33.184 1.00 36.62 ? 390 HOH A O   1 
HETATM 1768 O O   . HOH C 3 .   ? 34.057 26.673 23.608 1.00 22.84 ? 391 HOH A O   1 
HETATM 1769 O O   . HOH C 3 .   ? 36.555 9.392  56.124 1.00 36.46 ? 392 HOH A O   1 
HETATM 1770 O O   . HOH C 3 .   ? 59.805 -3.838 54.273 1.00 22.18 ? 393 HOH A O   1 
HETATM 1771 O O   . HOH C 3 .   ? 51.882 10.514 24.034 1.00 43.67 ? 394 HOH A O   1 
HETATM 1772 O O   . HOH C 3 .   ? 50.496 18.793 43.665 1.00 11.83 ? 395 HOH A O   1 
HETATM 1773 O O   . HOH C 3 .   ? 48.065 31.941 49.141 1.00 37.36 ? 396 HOH A O   1 
HETATM 1774 O O   . HOH C 3 .   ? 32.169 6.073  42.617 1.00 38.97 ? 397 HOH A O   1 
HETATM 1775 O O   . HOH C 3 .   ? 46.193 -2.532 45.258 1.00 40.68 ? 398 HOH A O   1 
HETATM 1776 O O   . HOH C 3 .   ? 54.341 4.423  27.734 1.00 9.17  ? 399 HOH A O   1 
HETATM 1777 O O   . HOH C 3 .   ? 62.460 7.270  44.389 1.00 43.45 ? 400 HOH A O   1 
HETATM 1778 O O   . HOH C 3 .   ? 49.838 5.146  31.172 1.00 27.97 ? 401 HOH A O   1 
HETATM 1779 O O   . HOH C 3 .   ? 34.072 11.446 31.084 1.00 35.60 ? 402 HOH A O   1 
HETATM 1780 O O   . HOH C 3 .   ? 31.546 13.581 32.000 1.00 30.17 ? 403 HOH A O   1 
HETATM 1781 O O   . HOH C 3 .   ? 54.407 8.476  19.576 1.00 23.68 ? 404 HOH A O   1 
HETATM 1782 O O   . HOH C 3 .   ? 32.204 9.538  45.022 1.00 23.95 ? 405 HOH A O   1 
HETATM 1783 O O   . HOH C 3 .   ? 55.900 22.258 54.262 1.00 34.81 ? 406 HOH A O   1 
HETATM 1784 O O   . HOH C 3 .   ? 30.787 24.321 45.684 1.00 20.39 ? 407 HOH A O   1 
HETATM 1785 O O   . HOH C 3 .   ? 36.030 6.109  50.321 1.00 26.62 ? 408 HOH A O   1 
HETATM 1786 O O   . HOH C 3 .   ? 42.995 1.103  43.050 1.00 32.39 ? 409 HOH A O   1 
HETATM 1787 O O   . HOH C 3 .   ? 53.681 21.498 56.661 1.00 37.82 ? 410 HOH A O   1 
HETATM 1788 O O   . HOH C 3 .   ? 48.960 3.717  65.143 1.00 31.20 ? 411 HOH A O   1 
HETATM 1789 O O   . HOH C 3 .   ? 33.945 1.926  49.566 1.00 38.81 ? 412 HOH A O   1 
HETATM 1790 O O   . HOH C 3 .   ? 40.129 12.280 63.959 1.00 34.16 ? 413 HOH A O   1 
HETATM 1791 O O   . HOH C 3 .   ? 54.162 21.689 52.109 1.00 33.95 ? 414 HOH A O   1 
HETATM 1792 O O   . HOH C 3 .   ? 33.893 7.275  51.373 1.00 35.55 ? 415 HOH A O   1 
HETATM 1793 O O   . HOH C 3 .   ? 32.921 30.918 44.604 1.00 44.22 ? 416 HOH A O   1 
HETATM 1794 O O   . HOH C 3 .   ? 51.272 12.815 63.891 1.00 36.34 ? 417 HOH A O   1 
HETATM 1795 O O   . HOH C 3 .   ? 34.009 14.101 57.225 1.00 40.06 ? 418 HOH A O   1 
HETATM 1796 O O   . HOH C 3 .   ? 54.925 16.192 61.900 1.00 35.70 ? 419 HOH A O   1 
HETATM 1797 O O   . HOH C 3 .   ? 43.967 6.285  63.456 1.00 49.12 ? 420 HOH A O   1 
HETATM 1798 O O   . HOH C 3 .   ? 60.281 7.845  60.376 1.00 38.15 ? 421 HOH A O   1 
HETATM 1799 O O   . HOH C 3 .   ? 58.507 16.265 55.726 1.00 28.90 ? 422 HOH A O   1 
HETATM 1800 O O   . HOH C 3 .   ? 59.081 4.571  38.178 1.00 43.10 ? 423 HOH A O   1 
HETATM 1801 O O   . HOH C 3 .   ? 57.967 16.652 64.394 1.00 42.79 ? 424 HOH A O   1 
HETATM 1802 O O   . HOH C 3 .   ? 61.352 -3.298 29.793 1.00 38.29 ? 425 HOH A O   1 
HETATM 1803 O O   . HOH C 3 .   ? 25.952 30.311 41.431 1.00 37.22 ? 426 HOH A O   1 
HETATM 1804 O O   . HOH C 3 .   ? 33.702 31.390 40.202 1.00 34.31 ? 427 HOH A O   1 
HETATM 1805 O O   . HOH C 3 .   ? 36.383 29.000 48.962 1.00 42.27 ? 428 HOH A O   1 
HETATM 1806 O O   . HOH C 3 .   ? 64.794 16.233 53.740 1.00 37.80 ? 429 HOH A O   1 
HETATM 1807 O O   . HOH C 3 .   ? 28.671 14.382 37.054 1.00 37.85 ? 430 HOH A O   1 
HETATM 1808 O O   . HOH C 3 .   ? 62.323 11.459 60.136 1.00 39.66 ? 431 HOH A O   1 
HETATM 1809 O O   . HOH C 3 .   ? 47.870 30.112 22.600 1.00 37.39 ? 432 HOH A O   1 
HETATM 1810 O O   . HOH C 3 .   ? 29.206 27.286 35.445 1.00 37.75 ? 433 HOH A O   1 
HETATM 1811 O O   . HOH C 3 .   ? 53.344 20.393 62.222 1.00 37.77 ? 434 HOH A O   1 
HETATM 1812 O O   . HOH C 3 .   ? 57.688 7.882  27.811 1.00 27.45 ? 435 HOH A O   1 
HETATM 1813 O O   . HOH C 3 .   ? 31.916 30.053 26.998 1.00 33.55 ? 436 HOH A O   1 
HETATM 1814 O O   . HOH C 3 .   ? 31.052 10.402 34.043 1.00 41.09 ? 437 HOH A O   1 
HETATM 1815 O O   . HOH C 3 .   ? 38.623 -5.570 45.618 1.00 32.36 ? 438 HOH A O   1 
HETATM 1816 O O   . HOH C 3 .   ? 34.358 28.064 51.127 1.00 40.43 ? 439 HOH A O   1 
HETATM 1817 O O   . HOH C 3 .   ? 56.456 25.027 25.058 1.00 41.16 ? 440 HOH A O   1 
HETATM 1818 O O   . HOH C 3 .   ? 27.894 15.502 24.353 1.00 38.40 ? 441 HOH A O   1 
HETATM 1819 O O   . HOH C 3 .   ? 26.818 17.342 22.077 1.00 41.84 ? 442 HOH A O   1 
HETATM 1820 O O   . HOH C 3 .   ? 67.669 6.258  29.927 1.00 37.64 ? 443 HOH A O   1 
HETATM 1821 O O   . HOH C 3 .   ? 43.285 4.633  29.725 1.00 37.91 ? 444 HOH A O   1 
HETATM 1822 O O   . HOH C 3 .   ? 42.392 8.584  28.951 1.00 51.13 ? 445 HOH A O   1 
HETATM 1823 O O   . HOH C 3 .   ? 26.481 21.330 34.360 1.00 31.73 ? 446 HOH A O   1 
HETATM 1824 O O   . HOH C 3 .   ? 37.558 2.312  54.167 1.00 35.69 ? 447 HOH A O   1 
HETATM 1825 O O   . HOH C 3 .   ? 44.634 15.336 66.156 1.00 42.57 ? 448 HOH A O   1 
HETATM 1826 O O   . HOH C 3 .   ? 30.140 15.049 35.139 1.00 44.52 ? 449 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   SER 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLY 4   2   ?   ?   ?   A . n 
A 1 5   ASP 5   3   3   ASP ASP A . n 
A 1 6   THR 6   4   4   THR THR A . n 
A 1 7   LYS 7   5   5   LYS LYS A . n 
A 1 8   GLU 8   6   6   GLU GLU A . n 
A 1 9   GLN 9   7   7   GLN GLN A . n 
A 1 10  ARG 10  8   8   ARG ARG A . n 
A 1 11  ILE 11  9   9   ILE ILE A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  ARG 13  11  11  ARG ARG A . n 
A 1 14  TYR 14  12  12  TYR TYR A . n 
A 1 15  VAL 15  13  13  VAL VAL A . n 
A 1 16  GLN 16  14  14  GLN GLN A . n 
A 1 17  GLN 17  15  15  GLN GLN A . n 
A 1 18  ASN 18  16  16  ASN ASN A . n 
A 1 19  ALA 19  17  17  ALA ALA A . n 
A 1 20  LYS 20  18  18  LYS LYS A . n 
A 1 21  PRO 21  19  19  PRO PRO A . n 
A 1 22  GLY 22  20  20  GLY GLY A . n 
A 1 23  ASP 23  21  21  ASP ASP A . n 
A 1 24  PRO 24  22  22  PRO PRO A . n 
A 1 25  GLN 25  23  23  GLN GLN A . n 
A 1 26  SER 26  24  24  SER SER A . n 
A 1 27  VAL 27  25  25  VAL VAL A . n 
A 1 28  LEU 28  26  26  LEU LEU A . n 
A 1 29  GLU 29  27  27  GLU GLU A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  ILE 31  29  29  ILE ILE A . n 
A 1 32  ASP 32  30  30  ASP ASP A . n 
A 1 33  THR 33  31  31  THR THR A . n 
A 1 34  TYR 34  32  32  TYR TYR A . n 
A 1 35  CYS 35  33  33  CYS CYS A . n 
A 1 36  THR 36  34  34  THR THR A . n 
A 1 37  GLN 37  35  35  GLN GLN A . n 
A 1 38  LYS 38  36  36  LYS LYS A . n 
A 1 39  GLU 39  37  37  GLU GLU A . n 
A 1 40  TRP 40  38  38  TRP TRP A . n 
A 1 41  ALA 41  39  39  ALA ALA A . n 
A 1 42  MET 42  40  40  MET MET A . n 
A 1 43  ASN 43  41  41  ASN ASN A . n 
A 1 44  VAL 44  42  42  VAL VAL A . n 
A 1 45  GLY 45  43  43  GLY GLY A . n 
A 1 46  ASP 46  44  44  ASP ASP A . n 
A 1 47  ALA 47  45  45  ALA ALA A . n 
A 1 48  LYS 48  46  46  LYS LYS A . n 
A 1 49  GLY 49  47  47  GLY GLY A . n 
A 1 50  GLN 50  48  48  GLN GLN A . n 
A 1 51  ILE 51  49  49  ILE ILE A . n 
A 1 52  MET 52  50  50  MET MET A . n 
A 1 53  ASP 53  51  51  ASP ASP A . n 
A 1 54  ALA 54  52  52  ALA ALA A . n 
A 1 55  VAL 55  53  53  VAL VAL A . n 
A 1 56  ILE 56  54  54  ILE ILE A . n 
A 1 57  ARG 57  55  55  ARG ARG A . n 
A 1 58  GLU 58  56  56  GLU GLU A . n 
A 1 59  TYR 59  57  57  TYR TYR A . n 
A 1 60  SER 60  58  58  SER SER A . n 
A 1 61  PRO 61  59  59  PRO PRO A . n 
A 1 62  SER 62  60  60  SER SER A . n 
A 1 63  LEU 63  61  61  LEU LEU A . n 
A 1 64  VAL 64  62  62  VAL VAL A . n 
A 1 65  LEU 65  63  63  LEU LEU A . n 
A 1 66  GLU 66  64  64  GLU GLU A . n 
A 1 67  LEU 67  65  65  LEU LEU A . n 
A 1 68  GLY 68  66  66  GLY GLY A . n 
A 1 69  ALA 69  67  67  ALA ALA A . n 
A 1 70  TYR 70  68  68  TYR TYR A . n 
A 1 71  CYS 71  69  69  CYS CYS A . n 
A 1 72  GLY 72  70  70  GLY GLY A . n 
A 1 73  TYR 73  71  71  TYR TYR A . n 
A 1 74  SER 74  72  72  SER SER A . n 
A 1 75  ALA 75  73  73  ALA ALA A . n 
A 1 76  VAL 76  74  74  VAL VAL A . n 
A 1 77  ARG 77  75  75  ARG ARG A . n 
A 1 78  MET 78  76  76  MET MET A . n 
A 1 79  ALA 79  77  77  ALA ALA A . n 
A 1 80  ARG 80  78  78  ARG ARG A . n 
A 1 81  LEU 81  79  79  LEU LEU A . n 
A 1 82  LEU 82  80  80  LEU LEU A . n 
A 1 83  GLN 83  81  81  GLN GLN A . n 
A 1 84  PRO 84  82  82  PRO PRO A . n 
A 1 85  GLY 85  83  83  GLY GLY A . n 
A 1 86  ALA 86  84  84  ALA ALA A . n 
A 1 87  ARG 87  85  85  ARG ARG A . n 
A 1 88  LEU 88  86  86  LEU LEU A . n 
A 1 89  LEU 89  87  87  LEU LEU A . n 
A 1 90  THR 90  88  88  THR THR A . n 
A 1 91  MET 91  89  89  MET MET A . n 
A 1 92  GLU 92  90  90  GLU GLU A . n 
A 1 93  MET 93  91  91  MET MET A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  PRO 95  93  93  PRO PRO A . n 
A 1 96  ASP 96  94  94  ASP ASP A . n 
A 1 97  TYR 97  95  95  TYR TYR A . n 
A 1 98  ALA 98  96  96  ALA ALA A . n 
A 1 99  ALA 99  97  97  ALA ALA A . n 
A 1 100 ILE 100 98  98  ILE ILE A . n 
A 1 101 THR 101 99  99  THR THR A . n 
A 1 102 GLN 102 100 100 GLN GLN A . n 
A 1 103 GLN 103 101 101 GLN GLN A . n 
A 1 104 MET 104 102 102 MET MET A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 ASN 106 104 104 ASN ASN A . n 
A 1 107 PHE 107 105 105 PHE PHE A . n 
A 1 108 ALA 108 106 106 ALA ALA A . n 
A 1 109 GLY 109 107 107 GLY GLY A . n 
A 1 110 LEU 110 108 108 LEU LEU A . n 
A 1 111 GLN 111 109 109 GLN GLN A . n 
A 1 112 ASP 112 110 110 ASP ASP A . n 
A 1 113 LYS 113 111 111 LYS LYS A . n 
A 1 114 VAL 114 112 112 VAL VAL A . n 
A 1 115 THR 115 113 113 THR THR A . n 
A 1 116 ILE 116 114 114 ILE ILE A . n 
A 1 117 LEU 117 115 115 LEU LEU A . n 
A 1 118 ASN 118 116 116 ASN ASN A . n 
A 1 119 GLY 119 117 117 GLY GLY A . n 
A 1 120 ALA 120 118 118 ALA ALA A . n 
A 1 121 SER 121 119 119 SER SER A . n 
A 1 122 GLN 122 120 120 GLN GLN A . n 
A 1 123 ASP 123 121 121 ASP ASP A . n 
A 1 124 LEU 124 122 122 LEU LEU A . n 
A 1 125 ILE 125 123 123 ILE ILE A . n 
A 1 126 PRO 126 124 124 PRO PRO A . n 
A 1 127 GLN 127 125 125 GLN GLN A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 LYS 129 127 127 LYS LYS A . n 
A 1 130 LYS 130 128 128 LYS LYS A . n 
A 1 131 LYS 131 129 129 LYS LYS A . n 
A 1 132 TYR 132 130 130 TYR TYR A . n 
A 1 133 ASP 133 131 131 ASP ASP A . n 
A 1 134 VAL 134 132 132 VAL VAL A . n 
A 1 135 ASP 135 133 133 ASP ASP A . n 
A 1 136 THR 136 134 134 THR THR A . n 
A 1 137 LEU 137 135 135 LEU LEU A . n 
A 1 138 ASP 138 136 136 ASP ASP A . n 
A 1 139 MET 139 137 137 MET MET A . n 
A 1 140 VAL 140 138 138 VAL VAL A . n 
A 1 141 PHE 141 139 139 PHE PHE A . n 
A 1 142 LEU 142 140 140 LEU LEU A . n 
A 1 143 ASP 143 141 141 ASP ASP A . n 
A 1 144 HIS 144 142 142 HIS HIS A . n 
A 1 145 TRP 145 143 143 TRP TRP A . n 
A 1 146 LYS 146 144 144 LYS LYS A . n 
A 1 147 ASP 147 145 145 ASP ASP A . n 
A 1 148 ARG 148 146 146 ARG ARG A . n 
A 1 149 TYR 149 147 147 TYR TYR A . n 
A 1 150 LEU 150 148 148 LEU LEU A . n 
A 1 151 PRO 151 149 149 PRO PRO A . n 
A 1 152 ASP 152 150 150 ASP ASP A . n 
A 1 153 THR 153 151 151 THR THR A . n 
A 1 154 LEU 154 152 152 LEU LEU A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 LEU 156 154 154 LEU LEU A . n 
A 1 157 GLU 157 155 155 GLU GLU A . n 
A 1 158 LYS 158 156 156 LYS LYS A . n 
A 1 159 CYS 159 157 157 CYS CYS A . n 
A 1 160 GLY 160 158 158 GLY GLY A . n 
A 1 161 LEU 161 159 159 LEU LEU A . n 
A 1 162 LEU 162 160 160 LEU LEU A . n 
A 1 163 ARG 163 161 161 ARG ARG A . n 
A 1 164 LYS 164 162 162 LYS LYS A . n 
A 1 165 GLY 165 163 163 GLY GLY A . n 
A 1 166 THR 166 164 164 THR THR A . n 
A 1 167 VAL 167 165 165 VAL VAL A . n 
A 1 168 LEU 168 166 166 LEU LEU A . n 
A 1 169 LEU 169 167 167 LEU LEU A . n 
A 1 170 ALA 170 168 168 ALA ALA A . n 
A 1 171 ASP 171 169 169 ASP ASP A . n 
A 1 172 ASN 172 170 170 ASN ASN A . n 
A 1 173 VAL 173 171 171 VAL VAL A . n 
A 1 174 ILE 174 172 172 ILE ILE A . n 
A 1 175 VAL 175 173 173 VAL VAL A . n 
A 1 176 PRO 176 174 174 PRO PRO A . n 
A 1 177 GLY 177 175 175 GLY GLY A . n 
A 1 178 THR 178 176 176 THR THR A . n 
A 1 179 PRO 179 177 177 PRO PRO A . n 
A 1 180 ASP 180 178 178 ASP ASP A . n 
A 1 181 PHE 181 179 179 PHE PHE A . n 
A 1 182 LEU 182 180 180 LEU LEU A . n 
A 1 183 ALA 183 181 181 ALA ALA A . n 
A 1 184 TYR 184 182 182 TYR TYR A . n 
A 1 185 VAL 185 183 183 VAL VAL A . n 
A 1 186 ARG 186 184 184 ARG ARG A . n 
A 1 187 GLY 187 185 185 GLY GLY A . n 
A 1 188 SER 188 186 186 SER SER A . n 
A 1 189 SER 189 187 187 SER SER A . n 
A 1 190 SER 190 188 188 SER SER A . n 
A 1 191 PHE 191 189 189 PHE PHE A . n 
A 1 192 GLU 192 190 190 GLU GLU A . n 
A 1 193 CYS 193 191 191 CYS CYS A . n 
A 1 194 THR 194 192 192 THR THR A . n 
A 1 195 HIS 195 193 193 HIS HIS A . n 
A 1 196 TYR 196 194 194 TYR TYR A . n 
A 1 197 SER 197 195 195 SER SER A . n 
A 1 198 SER 198 196 196 SER SER A . n 
A 1 199 TYR 199 197 197 TYR TYR A . n 
A 1 200 LEU 200 198 198 LEU LEU A . n 
A 1 201 GLU 201 199 199 GLU GLU A . n 
A 1 202 TYR 202 200 200 TYR TYR A . n 
A 1 203 MET 203 201 201 MET MET A . n 
A 1 204 LYS 204 202 202 LYS LYS A . n 
A 1 205 VAL 205 203 203 VAL VAL A . n 
A 1 206 VAL 206 204 204 VAL VAL A . n 
A 1 207 ASP 207 205 205 ASP ASP A . n 
A 1 208 GLY 208 206 206 GLY GLY A . n 
A 1 209 LEU 209 207 207 LEU LEU A . n 
A 1 210 GLU 210 208 208 GLU GLU A . n 
A 1 211 LYS 211 209 209 LYS LYS A . n 
A 1 212 ALA 212 210 210 ALA ALA A . n 
A 1 213 ILE 213 211 211 ILE ILE A . n 
A 1 214 TYR 214 212 212 TYR TYR A . n 
A 1 215 GLN 215 213 213 GLN GLN A . n 
A 1 216 GLY 216 214 214 GLY GLY A . n 
A 1 217 PRO 217 215 ?   ?   ?   A . n 
A 1 218 SER 218 216 ?   ?   ?   A . n 
A 1 219 SER 219 217 ?   ?   ?   A . n 
A 1 220 PRO 220 218 ?   ?   ?   A . n 
A 1 221 ASP 221 219 ?   ?   ?   A . n 
A 1 222 LYS 222 220 ?   ?   ?   A . n 
A 1 223 SER 223 221 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   300 300 SO4 SO4 A . 
C 3 HOH 1   301 301 HOH HOH A . 
C 3 HOH 2   302 302 HOH HOH A . 
C 3 HOH 3   303 303 HOH HOH A . 
C 3 HOH 4   304 304 HOH HOH A . 
C 3 HOH 5   305 305 HOH HOH A . 
C 3 HOH 6   306 306 HOH HOH A . 
C 3 HOH 7   307 307 HOH HOH A . 
C 3 HOH 8   308 308 HOH HOH A . 
C 3 HOH 9   309 309 HOH HOH A . 
C 3 HOH 10  310 310 HOH HOH A . 
C 3 HOH 11  311 311 HOH HOH A . 
C 3 HOH 12  312 312 HOH HOH A . 
C 3 HOH 13  313 313 HOH HOH A . 
C 3 HOH 14  314 314 HOH HOH A . 
C 3 HOH 15  315 315 HOH HOH A . 
C 3 HOH 16  316 316 HOH HOH A . 
C 3 HOH 17  317 317 HOH HOH A . 
C 3 HOH 18  318 318 HOH HOH A . 
C 3 HOH 19  319 319 HOH HOH A . 
C 3 HOH 20  320 320 HOH HOH A . 
C 3 HOH 21  321 321 HOH HOH A . 
C 3 HOH 22  322 322 HOH HOH A . 
C 3 HOH 23  323 323 HOH HOH A . 
C 3 HOH 24  324 324 HOH HOH A . 
C 3 HOH 25  325 325 HOH HOH A . 
C 3 HOH 26  326 326 HOH HOH A . 
C 3 HOH 27  327 327 HOH HOH A . 
C 3 HOH 28  328 328 HOH HOH A . 
C 3 HOH 29  329 329 HOH HOH A . 
C 3 HOH 30  330 330 HOH HOH A . 
C 3 HOH 31  331 331 HOH HOH A . 
C 3 HOH 32  332 332 HOH HOH A . 
C 3 HOH 33  333 333 HOH HOH A . 
C 3 HOH 34  334 334 HOH HOH A . 
C 3 HOH 35  335 335 HOH HOH A . 
C 3 HOH 36  336 336 HOH HOH A . 
C 3 HOH 37  337 337 HOH HOH A . 
C 3 HOH 38  338 338 HOH HOH A . 
C 3 HOH 39  339 339 HOH HOH A . 
C 3 HOH 40  340 340 HOH HOH A . 
C 3 HOH 41  341 341 HOH HOH A . 
C 3 HOH 42  342 342 HOH HOH A . 
C 3 HOH 43  343 343 HOH HOH A . 
C 3 HOH 44  344 344 HOH HOH A . 
C 3 HOH 45  345 345 HOH HOH A . 
C 3 HOH 46  346 346 HOH HOH A . 
C 3 HOH 47  347 347 HOH HOH A . 
C 3 HOH 48  348 348 HOH HOH A . 
C 3 HOH 49  349 349 HOH HOH A . 
C 3 HOH 50  350 350 HOH HOH A . 
C 3 HOH 51  351 351 HOH HOH A . 
C 3 HOH 52  352 352 HOH HOH A . 
C 3 HOH 53  353 353 HOH HOH A . 
C 3 HOH 54  354 354 HOH HOH A . 
C 3 HOH 55  355 355 HOH HOH A . 
C 3 HOH 56  356 356 HOH HOH A . 
C 3 HOH 57  357 357 HOH HOH A . 
C 3 HOH 58  358 358 HOH HOH A . 
C 3 HOH 59  359 359 HOH HOH A . 
C 3 HOH 60  360 360 HOH HOH A . 
C 3 HOH 61  361 361 HOH HOH A . 
C 3 HOH 62  362 362 HOH HOH A . 
C 3 HOH 63  363 363 HOH HOH A . 
C 3 HOH 64  364 364 HOH HOH A . 
C 3 HOH 65  365 365 HOH HOH A . 
C 3 HOH 66  366 366 HOH HOH A . 
C 3 HOH 67  367 367 HOH HOH A . 
C 3 HOH 68  368 368 HOH HOH A . 
C 3 HOH 69  369 369 HOH HOH A . 
C 3 HOH 70  370 370 HOH HOH A . 
C 3 HOH 71  371 371 HOH HOH A . 
C 3 HOH 72  372 372 HOH HOH A . 
C 3 HOH 73  373 373 HOH HOH A . 
C 3 HOH 74  374 374 HOH HOH A . 
C 3 HOH 75  375 375 HOH HOH A . 
C 3 HOH 76  376 376 HOH HOH A . 
C 3 HOH 77  377 377 HOH HOH A . 
C 3 HOH 78  378 378 HOH HOH A . 
C 3 HOH 79  379 379 HOH HOH A . 
C 3 HOH 80  380 380 HOH HOH A . 
C 3 HOH 81  381 381 HOH HOH A . 
C 3 HOH 82  382 382 HOH HOH A . 
C 3 HOH 83  383 383 HOH HOH A . 
C 3 HOH 84  384 384 HOH HOH A . 
C 3 HOH 85  385 385 HOH HOH A . 
C 3 HOH 86  386 386 HOH HOH A . 
C 3 HOH 87  387 387 HOH HOH A . 
C 3 HOH 88  388 388 HOH HOH A . 
C 3 HOH 89  389 389 HOH HOH A . 
C 3 HOH 90  390 390 HOH HOH A . 
C 3 HOH 91  391 391 HOH HOH A . 
C 3 HOH 92  392 392 HOH HOH A . 
C 3 HOH 93  393 393 HOH HOH A . 
C 3 HOH 94  394 394 HOH HOH A . 
C 3 HOH 95  395 395 HOH HOH A . 
C 3 HOH 96  396 396 HOH HOH A . 
C 3 HOH 97  397 397 HOH HOH A . 
C 3 HOH 98  398 398 HOH HOH A . 
C 3 HOH 99  399 399 HOH HOH A . 
C 3 HOH 100 400 400 HOH HOH A . 
C 3 HOH 101 401 401 HOH HOH A . 
C 3 HOH 102 402 402 HOH HOH A . 
C 3 HOH 103 403 403 HOH HOH A . 
C 3 HOH 104 404 404 HOH HOH A . 
C 3 HOH 105 405 405 HOH HOH A . 
C 3 HOH 106 406 406 HOH HOH A . 
C 3 HOH 107 407 407 HOH HOH A . 
C 3 HOH 108 408 408 HOH HOH A . 
C 3 HOH 109 409 409 HOH HOH A . 
C 3 HOH 110 410 410 HOH HOH A . 
C 3 HOH 111 411 411 HOH HOH A . 
C 3 HOH 112 412 412 HOH HOH A . 
C 3 HOH 113 413 413 HOH HOH A . 
C 3 HOH 114 414 414 HOH HOH A . 
C 3 HOH 115 415 415 HOH HOH A . 
C 3 HOH 116 416 416 HOH HOH A . 
C 3 HOH 117 417 417 HOH HOH A . 
C 3 HOH 118 418 418 HOH HOH A . 
C 3 HOH 119 419 419 HOH HOH A . 
C 3 HOH 120 420 420 HOH HOH A . 
C 3 HOH 121 421 421 HOH HOH A . 
C 3 HOH 122 422 422 HOH HOH A . 
C 3 HOH 123 423 423 HOH HOH A . 
C 3 HOH 124 424 424 HOH HOH A . 
C 3 HOH 125 425 425 HOH HOH A . 
C 3 HOH 126 426 426 HOH HOH A . 
C 3 HOH 127 427 427 HOH HOH A . 
C 3 HOH 128 428 428 HOH HOH A . 
C 3 HOH 129 429 429 HOH HOH A . 
C 3 HOH 130 430 430 HOH HOH A . 
C 3 HOH 131 431 431 HOH HOH A . 
C 3 HOH 132 432 432 HOH HOH A . 
C 3 HOH 133 433 433 HOH HOH A . 
C 3 HOH 134 434 434 HOH HOH A . 
C 3 HOH 135 435 435 HOH HOH A . 
C 3 HOH 136 436 436 HOH HOH A . 
C 3 HOH 137 437 437 HOH HOH A . 
C 3 HOH 138 438 438 HOH HOH A . 
C 3 HOH 139 439 439 HOH HOH A . 
C 3 HOH 140 440 440 HOH HOH A . 
C 3 HOH 141 441 441 HOH HOH A . 
C 3 HOH 142 442 442 HOH HOH A . 
C 3 HOH 143 443 443 HOH HOH A . 
C 3 HOH 144 444 444 HOH HOH A . 
C 3 HOH 145 445 445 HOH HOH A . 
C 3 HOH 146 446 446 HOH HOH A . 
C 3 HOH 147 447 447 HOH HOH A . 
C 3 HOH 148 448 448 HOH HOH A . 
C 3 HOH 149 449 449 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     302 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-07 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0005    ? 1 
BSS    'data collection' 'at BL32B2' ? 2 
MOSFLM 'data reduction'  .           ? 3 
SCALA  'data scaling'    .           ? 4 
AMoRE  phasing           .           ? 5 
# 
_pdbx_entry_details.entry_id             2ZLB 
_pdbx_entry_details.sequence_details     
;THE SEQUENCE OF THIS ENTITY WAS BASED ON ISOFORM 2 OF UNIPROTKB/SWISS-PROT P22734 (COMT_RAT). UNP-RESIDUES 1-43 WERE MISSING IN ISOFORM-2.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 N  A LEU 198 ? ? O A HOH 399 ? ? 1.44 
2  1 N  A HIS 142 ? ? O A HOH 395 ? ? 1.58 
3  1 O  A ASP 141 ? ? O A HOH 311 ? ? 2.04 
4  1 C  A TYR 197 ? ? O A HOH 399 ? ? 2.06 
5  1 CB A SER 196 ? ? O A HOH 401 ? ? 2.08 
6  1 O  A TYR 197 ? ? O A HOH 315 ? ? 2.09 
7  1 O  A HOH 328 ? ? O A HOH 433 ? ? 2.12 
8  1 O  A GLN 14  ? ? O A HOH 391 ? ? 2.13 
9  1 O  A HOH 315 ? ? O A HOH 401 ? ? 2.16 
10 1 O  A HOH 358 ? ? O A HOH 390 ? ? 2.17 
11 1 O  A SER 186 ? ? O A HOH 301 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O A TYR 197 ? ? C  A TYR 197 ? ? N  A LEU 198 ? ? 112.47 122.70 -10.23 1.60 Y 
2 1 C A TYR 197 ? ? N  A LEU 198 ? ? CA A LEU 198 ? ? 106.30 121.70 -15.40 2.50 Y 
3 1 N A LEU 198 ? ? CA A LEU 198 ? ? C  A LEU 198 ? ? 90.26  111.00 -20.74 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 36  ? ? -137.56 -79.84  
2 1 MET A 40  ? ? -123.18 -144.79 
3 1 TYR A 68  ? ? -131.80 -77.74  
4 1 ASP A 133 ? ? -92.77  -81.19  
5 1 THR A 176 ? ? 35.10   63.98   
6 1 LEU A 198 ? ? -115.25 -98.56  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A SER 0   ? A SER 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A GLY 2   ? A GLY 4   
5  1 Y 1 A PRO 215 ? A PRO 217 
6  1 Y 1 A SER 216 ? A SER 218 
7  1 Y 1 A SER 217 ? A SER 219 
8  1 Y 1 A PRO 218 ? A PRO 220 
9  1 Y 1 A ASP 219 ? A ASP 221 
10 1 Y 1 A LYS 220 ? A LYS 222 
11 1 Y 1 A SER 221 ? A SER 223 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#