data_2ZOT
# 
_entry.id   2ZOT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZOT         
RCSB  RCSB028237   
WWPDB D_1000028237 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2ZOU 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZOT 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagae, M.'  1 
'Nogi, T.'   2 
'Takagi, J.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            64 
_citation.page_first                1138 
_citation.page_last                 1145 
_citation.year                      2008 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19020352 
_citation.pdbx_database_id_DOI      10.1107/S0907444908028308 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagae, M.'     1 
primary 'Nishikawa, K.' 2 
primary 'Yasui, N.'     3 
primary 'Yamasaki, M.'  4 
primary 'Nogi, T.'      5 
primary 'Takagi, J.'    6 
# 
_cell.entry_id           2ZOT 
_cell.length_a           57.579 
_cell.length_b           57.579 
_cell.length_c           190.857 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZOT 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Spondin-1 
_entity.formula_weight             19412.717 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'reeler domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'F-spondin, Vascular smooth muscle cell growth-promoting factor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSFSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDK
EEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDS
TFDGVTDKPILD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSFSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDK
EEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDS
TFDGVTDKPILD
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PHE n 
1 4   SER n 
1 5   ASP n 
1 6   GLU n 
1 7   THR n 
1 8   LEU n 
1 9   ASP n 
1 10  LYS n 
1 11  VAL n 
1 12  PRO n 
1 13  LYS n 
1 14  SER n 
1 15  GLU n 
1 16  GLY n 
1 17  TYR n 
1 18  CYS n 
1 19  SER n 
1 20  ARG n 
1 21  ILE n 
1 22  LEU n 
1 23  ARG n 
1 24  ALA n 
1 25  GLN n 
1 26  GLY n 
1 27  THR n 
1 28  ARG n 
1 29  ARG n 
1 30  GLU n 
1 31  GLY n 
1 32  TYR n 
1 33  THR n 
1 34  GLU n 
1 35  PHE n 
1 36  SER n 
1 37  LEU n 
1 38  ARG n 
1 39  VAL n 
1 40  GLU n 
1 41  GLY n 
1 42  ASP n 
1 43  PRO n 
1 44  ASP n 
1 45  PHE n 
1 46  TYR n 
1 47  LYS n 
1 48  PRO n 
1 49  GLY n 
1 50  THR n 
1 51  SER n 
1 52  TYR n 
1 53  ARG n 
1 54  VAL n 
1 55  THR n 
1 56  LEU n 
1 57  SER n 
1 58  ALA n 
1 59  ALA n 
1 60  PRO n 
1 61  PRO n 
1 62  SER n 
1 63  TYR n 
1 64  PHE n 
1 65  ARG n 
1 66  GLY n 
1 67  PHE n 
1 68  THR n 
1 69  LEU n 
1 70  ILE n 
1 71  ALA n 
1 72  LEU n 
1 73  ARG n 
1 74  GLU n 
1 75  ASN n 
1 76  ARG n 
1 77  GLU n 
1 78  GLY n 
1 79  ASP n 
1 80  LYS n 
1 81  GLU n 
1 82  GLU n 
1 83  ASP n 
1 84  HIS n 
1 85  ALA n 
1 86  GLY n 
1 87  THR n 
1 88  PHE n 
1 89  GLN n 
1 90  ILE n 
1 91  ILE n 
1 92  ASP n 
1 93  GLU n 
1 94  GLU n 
1 95  GLU n 
1 96  THR n 
1 97  GLN n 
1 98  PHE n 
1 99  MET n 
1 100 SER n 
1 101 ASN n 
1 102 CYS n 
1 103 PRO n 
1 104 VAL n 
1 105 ALA n 
1 106 VAL n 
1 107 THR n 
1 108 GLU n 
1 109 SER n 
1 110 THR n 
1 111 PRO n 
1 112 ARG n 
1 113 ARG n 
1 114 ARG n 
1 115 THR n 
1 116 ARG n 
1 117 ILE n 
1 118 GLN n 
1 119 VAL n 
1 120 PHE n 
1 121 TRP n 
1 122 ILE n 
1 123 ALA n 
1 124 PRO n 
1 125 PRO n 
1 126 ALA n 
1 127 GLY n 
1 128 THR n 
1 129 GLY n 
1 130 CYS n 
1 131 VAL n 
1 132 ILE n 
1 133 LEU n 
1 134 LYS n 
1 135 ALA n 
1 136 SER n 
1 137 ILE n 
1 138 VAL n 
1 139 GLN n 
1 140 LYS n 
1 141 ARG n 
1 142 ILE n 
1 143 ILE n 
1 144 TYR n 
1 145 PHE n 
1 146 GLN n 
1 147 ASP n 
1 148 GLU n 
1 149 GLY n 
1 150 SER n 
1 151 LEU n 
1 152 THR n 
1 153 LYS n 
1 154 LYS n 
1 155 LEU n 
1 156 CYS n 
1 157 GLU n 
1 158 GLN n 
1 159 ASP n 
1 160 SER n 
1 161 THR n 
1 162 PHE n 
1 163 ASP n 
1 164 GLY n 
1 165 VAL n 
1 166 THR n 
1 167 ASP n 
1 168 LYS n 
1 169 PRO n 
1 170 ILE n 
1 171 LEU n 
1 172 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SPON1, KIAA0762, VSGP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK293T cell' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pcDNA3.1/Myc-His(+) vector' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPON1_HUMAN 
_struct_ref.pdbx_db_accession          Q9HCB6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEE
DHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTF
DGVTDKPILD
;
_struct_ref.pdbx_align_begin           29 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZOT A 3 ? 172 ? Q9HCB6 29 ? 198 ? 29 198 
2 1 2ZOT B 3 ? 172 ? Q9HCB6 29 ? 198 ? 29 198 
3 1 2ZOT C 3 ? 172 ? Q9HCB6 29 ? 198 ? 29 198 
4 1 2ZOT D 3 ? 172 ? Q9HCB6 29 ? 198 ? 29 198 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ZOT GLY A 1 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 27 1 
1 2ZOT SER A 2 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 28 2 
2 2ZOT GLY B 1 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 27 3 
2 2ZOT SER B 2 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 28 4 
3 2ZOT GLY C 1 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 27 5 
3 2ZOT SER C 2 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 28 6 
4 2ZOT GLY D 1 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 27 7 
4 2ZOT SER D 2 ? UNP Q9HCB6 ? ? 'EXPRESSION TAG' 28 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ZOT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_percent_sol   40.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.2M bis-tris(pH 5.5), 0.4M ammonium acetate, 25% polyethylene glycol(PEG) 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   90 ? 1 
2   90 ? 1 
1,2 ?  ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 210' 2006-12-20 ? 
2 CCD 'ADSC QUANTUM 270' 2007-02-21 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0000  1.0 
2 1.07225 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'PHOTON FACTORY BEAMLINE AR-NW12A' 'Photon Factory' AR-NW12A ? 1.0000  
2 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-17A'   'Photon Factory' BL-17A   ? 1.07225 
# 
_reflns.entry_id                     2ZOT 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.70 
_reflns.d_resolution_low             100 
_reflns.number_all                   17075 
_reflns.number_obs                   16670 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.08300 
_reflns.pdbx_netI_over_sigmaI        9.0000 
_reflns.pdbx_netI_over_av_sigmaI     7.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.48800 
_reflns_shell.meanI_over_sigI_obs    2.038 
_reflns_shell.pdbx_redundancy        3.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1724 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 2ZOT 
_refine.ls_number_reflns_obs                     15792 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             57.54 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    97.74 
_refine.ls_R_factor_obs                          0.24563 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24203 
_refine.ls_R_factor_R_free                       0.31251 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  848 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.903 
_refine.correlation_coeff_Fo_to_Fc_free          0.835 
_refine.B_iso_mean                               39.394 
_refine.aniso_B[1][1]                            -0.96 
_refine.aniso_B[2][2]                            -0.96 
_refine.aniso_B[3][3]                            1.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.457 
_refine.overall_SU_ML                            0.398 
_refine.overall_SU_B                             43.470 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4409 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4409 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        57.54 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 4511 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.163  1.961  ? 6099 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.623  5.000  ? 553  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.507 22.190 ? 210  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.305 15.000 ? 754  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.637 15.000 ? 52   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 667  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 3440 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.208  0.200  ? 1853 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 3068 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.155  0.200  ? 129  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.209  0.200  ? 132  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.160  0.200  ? 24   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.314  1.500  ? 2860 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.561  2.000  ? 4507 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.760  3.000  ? 1842 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.282  4.500  ? 1592 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             1198 
_refine_ls_shell.R_factor_R_work                  0.303 
_refine_ls_shell.percent_reflns_obs               99.68 
_refine_ls_shell.R_factor_R_free                  0.418 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZOT 
_struct.title                     'Crystal structure of human F-spondin reeler domain (fragment 1)' 
_struct.pdbx_descriptor           Spondin-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZOT 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
'beta-sandwich, extracellular protein, Cell adhesion, Extracellular matrix, Glycoprotein, Secreted' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 18  SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 44  A CYS 128 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf2 disulf ? ? A CYS 130 SG ? ? ? 1_555 A CYS 156 SG ? ? A CYS 156 A CYS 182 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf3 disulf ? ? B CYS 18  SG ? ? ? 1_555 B CYS 102 SG ? ? B CYS 44  B CYS 128 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4 disulf ? ? B CYS 130 SG ? ? ? 1_555 B CYS 156 SG ? ? B CYS 156 B CYS 182 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5 disulf ? ? C CYS 18  SG ? ? ? 1_555 C CYS 102 SG ? ? C CYS 44  C CYS 128 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf6 disulf ? ? C CYS 130 SG ? ? ? 1_555 C CYS 156 SG ? ? C CYS 156 C CYS 182 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf7 disulf ? ? D CYS 18  SG ? ? ? 1_555 D CYS 102 SG ? ? D CYS 44  D CYS 128 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf8 disulf ? ? D CYS 130 SG ? ? ? 1_555 D CYS 156 SG ? ? D CYS 156 D CYS 182 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 5 ? 
G ? 6 ? 
H ? 4 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 26  ? ARG A 28  ? GLY A 52  ARG A 54  
A 2 ILE A 143 ? PHE A 145 ? ILE A 169 PHE A 171 
A 3 VAL A 131 ? VAL A 138 ? VAL A 157 VAL A 164 
A 4 GLY A 66  ? ARG A 73  ? GLY A 92  ARG A 99  
A 5 VAL A 106 ? GLU A 108 ? VAL A 132 GLU A 134 
A 6 THR A 96  ? PHE A 98  ? THR A 122 PHE A 124 
B 1 GLY A 26  ? ARG A 28  ? GLY A 52  ARG A 54  
B 2 ILE A 143 ? PHE A 145 ? ILE A 169 PHE A 171 
B 3 VAL A 131 ? VAL A 138 ? VAL A 157 VAL A 164 
B 4 THR A 152 ? LEU A 155 ? THR A 178 LEU A 181 
C 1 PHE A 35  ? VAL A 39  ? PHE A 61  VAL A 65  
C 2 SER A 51  ? ALA A 58  ? SER A 77  ALA A 84  
C 3 ARG A 116 ? ILE A 122 ? ARG A 142 ILE A 148 
C 4 THR A 87  ? GLN A 89  ? THR A 113 GLN A 115 
D 1 ILE B 21  ? LEU B 22  ? ILE B 47  LEU B 48  
D 2 ILE B 143 ? TYR B 144 ? ILE B 169 TYR B 170 
E 1 PHE B 35  ? VAL B 39  ? PHE B 61  VAL B 65  
E 2 SER B 51  ? ALA B 58  ? SER B 77  ALA B 84  
E 3 ARG B 116 ? ILE B 122 ? ARG B 142 ILE B 148 
E 4 THR B 87  ? ILE B 90  ? THR B 113 ILE B 116 
F 1 THR B 96  ? PHE B 98  ? THR B 122 PHE B 124 
F 2 VAL B 106 ? GLU B 108 ? VAL B 132 GLU B 134 
F 3 THR B 68  ? ARG B 73  ? THR B 94  ARG B 99  
F 4 VAL B 131 ? SER B 136 ? VAL B 157 SER B 162 
F 5 THR B 152 ? LEU B 155 ? THR B 178 LEU B 181 
G 1 THR C 27  ? ARG C 28  ? THR C 53  ARG C 54  
G 2 ILE C 142 ? PHE C 145 ? ILE C 168 PHE C 171 
G 3 CYS C 130 ? GLN C 139 ? CYS C 156 GLN C 165 
G 4 GLY C 66  ? ARG C 73  ? GLY C 92  ARG C 99  
G 5 VAL C 106 ? GLU C 108 ? VAL C 132 GLU C 134 
G 6 THR C 96  ? PHE C 98  ? THR C 122 PHE C 124 
H 1 THR C 27  ? ARG C 28  ? THR C 53  ARG C 54  
H 2 ILE C 142 ? PHE C 145 ? ILE C 168 PHE C 171 
H 3 CYS C 130 ? GLN C 139 ? CYS C 156 GLN C 165 
H 4 THR C 152 ? CYS C 156 ? THR C 178 CYS C 182 
I 1 PHE C 35  ? VAL C 39  ? PHE C 61  VAL C 65  
I 2 SER C 51  ? ALA C 58  ? SER C 77  ALA C 84  
I 3 ARG C 116 ? ILE C 122 ? ARG C 142 ILE C 148 
I 4 THR C 87  ? GLN C 89  ? THR C 113 GLN C 115 
J 1 ILE D 21  ? ARG D 23  ? ILE D 47  ARG D 49  
J 2 ILE D 143 ? PHE D 145 ? ILE D 169 PHE D 171 
K 1 PHE D 35  ? VAL D 39  ? PHE D 61  VAL D 65  
K 2 SER D 51  ? ALA D 58  ? SER D 77  ALA D 84  
K 3 ARG D 116 ? ILE D 122 ? ARG D 142 ILE D 148 
K 4 THR D 87  ? ILE D 90  ? THR D 113 ILE D 116 
L 1 THR D 96  ? MET D 99  ? THR D 122 MET D 125 
L 2 CYS D 102 ? GLU D 108 ? CYS D 128 GLU D 134 
L 3 THR D 68  ? LEU D 72  ? THR D 94  LEU D 98  
L 4 VAL D 131 ? SER D 136 ? VAL D 157 SER D 162 
L 5 THR D 152 ? LEU D 155 ? THR D 178 LEU D 181 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 27  ? N THR A 53  O ILE A 143 ? O ILE A 169 
A 2 3 O TYR A 144 ? O TYR A 170 N ILE A 137 ? N ILE A 163 
A 3 4 O ILE A 132 ? O ILE A 158 N LEU A 72  ? N LEU A 98  
A 4 5 N LEU A 69  ? N LEU A 95  O VAL A 106 ? O VAL A 132 
A 5 6 O THR A 107 ? O THR A 133 N GLN A 97  ? N GLN A 123 
B 1 2 N THR A 27  ? N THR A 53  O ILE A 143 ? O ILE A 169 
B 2 3 O TYR A 144 ? O TYR A 170 N ILE A 137 ? N ILE A 163 
B 3 4 N VAL A 131 ? N VAL A 157 O LEU A 155 ? O LEU A 181 
C 1 2 N SER A 36  ? N SER A 62  O SER A 57  ? O SER A 83  
C 2 3 N VAL A 54  ? N VAL A 80  O VAL A 119 ? O VAL A 145 
C 3 4 O ILE A 122 ? O ILE A 148 N THR A 87  ? N THR A 113 
D 1 2 N LEU B 22  ? N LEU B 48  O ILE B 143 ? O ILE B 169 
E 1 2 N ARG B 38  ? N ARG B 64  O THR B 55  ? O THR B 81  
E 2 3 N VAL B 54  ? N VAL B 80  O VAL B 119 ? O VAL B 145 
E 3 4 O ILE B 122 ? O ILE B 148 N THR B 87  ? N THR B 113 
F 1 2 N GLN B 97  ? N GLN B 123 O THR B 107 ? O THR B 133 
F 2 3 O VAL B 106 ? O VAL B 132 N LEU B 69  ? N LEU B 95  
F 3 4 N LEU B 72  ? N LEU B 98  O ILE B 132 ? O ILE B 158 
F 4 5 N VAL B 131 ? N VAL B 157 O LEU B 155 ? O LEU B 181 
G 1 2 N THR C 27  ? N THR C 53  O ILE C 143 ? O ILE C 169 
G 2 3 O TYR C 144 ? O TYR C 170 N ILE C 137 ? N ILE C 163 
G 3 4 O ILE C 132 ? O ILE C 158 N LEU C 72  ? N LEU C 98  
G 4 5 N LEU C 69  ? N LEU C 95  O VAL C 106 ? O VAL C 132 
G 5 6 O THR C 107 ? O THR C 133 N GLN C 97  ? N GLN C 123 
H 1 2 N THR C 27  ? N THR C 53  O ILE C 143 ? O ILE C 169 
H 2 3 O TYR C 144 ? O TYR C 170 N ILE C 137 ? N ILE C 163 
H 3 4 N VAL C 131 ? N VAL C 157 O LEU C 155 ? O LEU C 181 
I 1 2 N ARG C 38  ? N ARG C 64  O THR C 55  ? O THR C 81  
I 2 3 N VAL C 54  ? N VAL C 80  O VAL C 119 ? O VAL C 145 
I 3 4 O ILE C 122 ? O ILE C 148 N THR C 87  ? N THR C 113 
J 1 2 N LEU D 22  ? N LEU D 48  O ILE D 143 ? O ILE D 169 
K 1 2 N SER D 36  ? N SER D 62  O SER D 57  ? O SER D 83  
K 2 3 N VAL D 54  ? N VAL D 80  O VAL D 119 ? O VAL D 145 
K 3 4 O ILE D 122 ? O ILE D 148 N THR D 87  ? N THR D 113 
L 1 2 N GLN D 97  ? N GLN D 123 O THR D 107 ? O THR D 133 
L 2 3 O VAL D 106 ? O VAL D 132 N LEU D 69  ? N LEU D 95  
L 3 4 N ILE D 70  ? N ILE D 96  O LYS D 134 ? O LYS D 160 
L 4 5 N LEU D 133 ? N LEU D 159 O LYS D 153 ? O LYS D 179 
# 
_database_PDB_matrix.entry_id          2ZOT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZOT 
_atom_sites.fract_transf_matrix[1][1]   0.017367 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017367 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005240 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . CYS A 1 18  ? -15.757 -9.519  -15.063 1.00 46.56 ? 44  CYS A N   1 
ATOM 2    C CA  . CYS A 1 18  ? -15.443 -8.075  -14.853 1.00 46.54 ? 44  CYS A CA  1 
ATOM 3    C C   . CYS A 1 18  ? -13.935 -7.810  -14.900 1.00 46.72 ? 44  CYS A C   1 
ATOM 4    O O   . CYS A 1 18  ? -13.290 -8.119  -15.907 1.00 46.64 ? 44  CYS A O   1 
ATOM 5    C CB  . CYS A 1 18  ? -16.060 -7.571  -13.547 1.00 46.24 ? 44  CYS A CB  1 
ATOM 6    S SG  . CYS A 1 18  ? -15.972 -8.750  -12.165 1.00 46.35 ? 44  CYS A SG  1 
ATOM 7    N N   . SER A 1 19  ? -13.375 -7.258  -13.816 1.00 46.98 ? 45  SER A N   1 
ATOM 8    C CA  . SER A 1 19  ? -11.979 -6.814  -13.821 1.00 47.10 ? 45  SER A CA  1 
ATOM 9    C C   . SER A 1 19  ? -11.348 -6.498  -12.457 1.00 47.27 ? 45  SER A C   1 
ATOM 10   O O   . SER A 1 19  ? -12.027 -6.096  -11.510 1.00 47.22 ? 45  SER A O   1 
ATOM 11   C CB  . SER A 1 19  ? -11.843 -5.575  -14.712 1.00 47.05 ? 45  SER A CB  1 
ATOM 12   O OG  . SER A 1 19  ? -12.646 -4.516  -14.221 1.00 46.83 ? 45  SER A OG  1 
ATOM 13   N N   . ARG A 1 20  ? -10.033 -6.707  -12.393 1.00 47.43 ? 46  ARG A N   1 
ATOM 14   C CA  . ARG A 1 20  ? -9.142  -6.032  -11.449 1.00 47.37 ? 46  ARG A CA  1 
ATOM 15   C C   . ARG A 1 20  ? -8.530  -4.805  -12.148 1.00 47.31 ? 46  ARG A C   1 
ATOM 16   O O   . ARG A 1 20  ? -7.843  -3.986  -11.529 1.00 47.20 ? 46  ARG A O   1 
ATOM 17   C CB  . ARG A 1 20  ? -8.037  -6.979  -10.968 1.00 47.43 ? 46  ARG A CB  1 
ATOM 18   C CG  . ARG A 1 20  ? -8.420  -7.827  -9.770  1.00 47.66 ? 46  ARG A CG  1 
ATOM 19   C CD  . ARG A 1 20  ? -8.639  -6.960  -8.526  1.00 48.53 ? 46  ARG A CD  1 
ATOM 20   N NE  . ARG A 1 20  ? -7.406  -6.702  -7.778  1.00 48.32 ? 46  ARG A NE  1 
ATOM 21   C CZ  . ARG A 1 20  ? -7.312  -5.861  -6.750  1.00 47.89 ? 46  ARG A CZ  1 
ATOM 22   N NH1 . ARG A 1 20  ? -6.154  -5.697  -6.124  1.00 47.65 ? 46  ARG A NH1 1 
ATOM 23   N NH2 . ARG A 1 20  ? -8.374  -5.180  -6.344  1.00 48.17 ? 46  ARG A NH2 1 
ATOM 24   N N   . ILE A 1 21  ? -8.780  -4.708  -13.454 1.00 47.24 ? 47  ILE A N   1 
ATOM 25   C CA  . ILE A 1 21  ? -8.497  -3.507  -14.237 1.00 47.13 ? 47  ILE A CA  1 
ATOM 26   C C   . ILE A 1 21  ? -9.514  -2.429  -13.826 1.00 46.90 ? 47  ILE A C   1 
ATOM 27   O O   . ILE A 1 21  ? -9.464  -1.286  -14.289 1.00 46.80 ? 47  ILE A O   1 
ATOM 28   C CB  . ILE A 1 21  ? -8.539  -3.797  -15.767 1.00 47.27 ? 47  ILE A CB  1 
ATOM 29   C CG1 . ILE A 1 21  ? -7.671  -5.013  -16.123 1.00 47.51 ? 47  ILE A CG1 1 
ATOM 30   C CG2 . ILE A 1 21  ? -8.074  -2.580  -16.580 1.00 47.49 ? 47  ILE A CG2 1 
ATOM 31   C CD1 . ILE A 1 21  ? -8.433  -6.320  -16.257 1.00 47.83 ? 47  ILE A CD1 1 
ATOM 32   N N   . LEU A 1 22  ? -10.433 -2.826  -12.944 1.00 46.57 ? 48  LEU A N   1 
ATOM 33   C CA  . LEU A 1 22  ? -11.308 -1.930  -12.192 1.00 46.27 ? 48  LEU A CA  1 
ATOM 34   C C   . LEU A 1 22  ? -10.503 -0.742  -11.662 1.00 45.94 ? 48  LEU A C   1 
ATOM 35   O O   . LEU A 1 22  ? -11.046 0.347   -11.431 1.00 45.88 ? 48  LEU A O   1 
ATOM 36   C CB  . LEU A 1 22  ? -11.900 -2.709  -11.017 1.00 46.36 ? 48  LEU A CB  1 
ATOM 37   C CG  . LEU A 1 22  ? -13.405 -2.707  -10.735 1.00 46.70 ? 48  LEU A CG  1 
ATOM 38   C CD1 . LEU A 1 22  ? -14.226 -3.197  -11.942 1.00 46.97 ? 48  LEU A CD1 1 
ATOM 39   C CD2 . LEU A 1 22  ? -13.699 -3.559  -9.503  1.00 46.41 ? 48  LEU A CD2 1 
ATOM 40   N N   . ARG A 1 23  ? -9.209  -0.987  -11.451 1.00 45.37 ? 49  ARG A N   1 
ATOM 41   C CA  . ARG A 1 23  ? -8.227  0.050   -11.189 1.00 44.71 ? 49  ARG A CA  1 
ATOM 42   C C   . ARG A 1 23  ? -7.866  0.725   -12.500 1.00 44.18 ? 49  ARG A C   1 
ATOM 43   O O   . ARG A 1 23  ? -7.540  0.052   -13.481 1.00 44.69 ? 49  ARG A O   1 
ATOM 44   C CB  . ARG A 1 23  ? -6.955  -0.554  -10.601 1.00 44.66 ? 49  ARG A CB  1 
ATOM 45   C CG  . ARG A 1 23  ? -5.849  0.478   -10.411 1.00 45.44 ? 49  ARG A CG  1 
ATOM 46   C CD  . ARG A 1 23  ? -4.549  0.093   -11.109 1.00 46.08 ? 49  ARG A CD  1 
ATOM 47   N NE  . ARG A 1 23  ? -4.636  0.164   -12.567 1.00 46.53 ? 49  ARG A NE  1 
ATOM 48   C CZ  . ARG A 1 23  ? -4.403  1.258   -13.290 1.00 47.52 ? 49  ARG A CZ  1 
ATOM 49   N NH1 . ARG A 1 23  ? -4.512  1.209   -14.609 1.00 46.94 ? 49  ARG A NH1 1 
ATOM 50   N NH2 . ARG A 1 23  ? -4.072  2.406   -12.705 1.00 48.19 ? 49  ARG A NH2 1 
ATOM 51   N N   . ALA A 1 24  ? -7.921  2.050   -12.520 1.00 43.21 ? 50  ALA A N   1 
ATOM 52   C CA  . ALA A 1 24  ? -7.386  2.834   -13.640 1.00 42.16 ? 50  ALA A CA  1 
ATOM 53   C C   . ALA A 1 24  ? -6.894  4.153   -13.069 1.00 41.26 ? 50  ALA A C   1 
ATOM 54   O O   . ALA A 1 24  ? -6.286  4.973   -13.763 1.00 41.01 ? 50  ALA A O   1 
ATOM 55   C CB  . ALA A 1 24  ? -8.445  3.051   -14.724 1.00 42.18 ? 50  ALA A CB  1 
ATOM 56   N N   . GLN A 1 25  ? -7.154  4.309   -11.773 1.00 40.26 ? 51  GLN A N   1 
ATOM 57   C CA  . GLN A 1 25  ? -6.872  5.518   -11.020 1.00 39.19 ? 51  GLN A CA  1 
ATOM 58   C C   . GLN A 1 25  ? -6.108  5.157   -9.749  1.00 38.27 ? 51  GLN A C   1 
ATOM 59   O O   . GLN A 1 25  ? -6.177  5.882   -8.758  1.00 38.44 ? 51  GLN A O   1 
ATOM 60   C CB  . GLN A 1 25  ? -8.189  6.198   -10.618 1.00 39.46 ? 51  GLN A CB  1 
ATOM 61   C CG  . GLN A 1 25  ? -9.426  5.824   -11.453 1.00 39.25 ? 51  GLN A CG  1 
ATOM 62   C CD  . GLN A 1 25  ? -10.682 6.546   -10.989 1.00 39.15 ? 51  GLN A CD  1 
ATOM 63   O OE1 . GLN A 1 25  ? -10.793 7.764   -11.111 1.00 38.83 ? 51  GLN A OE1 1 
ATOM 64   N NE2 . GLN A 1 25  ? -11.633 5.792   -10.452 1.00 39.25 ? 51  GLN A NE2 1 
ATOM 65   N N   . GLY A 1 26  ? -5.392  4.039   -9.765  1.00 37.10 ? 52  GLY A N   1 
ATOM 66   C CA  . GLY A 1 26  ? -4.748  3.545   -8.551  1.00 35.75 ? 52  GLY A CA  1 
ATOM 67   C C   . GLY A 1 26  ? -3.322  4.012   -8.316  1.00 34.70 ? 52  GLY A C   1 
ATOM 68   O O   . GLY A 1 26  ? -2.558  4.213   -9.252  1.00 34.54 ? 52  GLY A O   1 
ATOM 69   N N   . THR A 1 27  ? -2.981  4.203   -7.049  1.00 33.89 ? 53  THR A N   1 
ATOM 70   C CA  . THR A 1 27  ? -1.590  4.318   -6.616  1.00 33.22 ? 53  THR A CA  1 
ATOM 71   C C   . THR A 1 27  ? -1.207  3.038   -5.887  1.00 32.37 ? 53  THR A C   1 
ATOM 72   O O   . THR A 1 27  ? -1.835  2.648   -4.903  1.00 32.17 ? 53  THR A O   1 
ATOM 73   C CB  . THR A 1 27  ? -1.373  5.507   -5.681  1.00 33.28 ? 53  THR A CB  1 
ATOM 74   O OG1 . THR A 1 27  ? -2.396  5.494   -4.681  1.00 34.71 ? 53  THR A OG1 1 
ATOM 75   C CG2 . THR A 1 27  ? -1.458  6.810   -6.445  1.00 32.76 ? 53  THR A CG2 1 
ATOM 76   N N   . ARG A 1 28  ? -0.194  2.363   -6.401  1.00 31.73 ? 54  ARG A N   1 
ATOM 77   C CA  . ARG A 1 28  ? 0.292   1.142   -5.794  1.00 31.27 ? 54  ARG A CA  1 
ATOM 78   C C   . ARG A 1 28  ? 1.014   1.517   -4.504  1.00 30.81 ? 54  ARG A C   1 
ATOM 79   O O   . ARG A 1 28  ? 1.830   2.430   -4.488  1.00 31.03 ? 54  ARG A O   1 
ATOM 80   C CB  . ARG A 1 28  ? 1.218   0.436   -6.785  1.00 31.22 ? 54  ARG A CB  1 
ATOM 81   C CG  . ARG A 1 28  ? 2.054   -0.695  -6.228  1.00 31.54 ? 54  ARG A CG  1 
ATOM 82   C CD  . ARG A 1 28  ? 2.905   -1.335  -7.328  1.00 31.68 ? 54  ARG A CD  1 
ATOM 83   N NE  . ARG A 1 28  ? 2.087   -2.069  -8.291  1.00 32.80 ? 54  ARG A NE  1 
ATOM 84   C CZ  . ARG A 1 28  ? 1.576   -3.281  -8.081  1.00 33.34 ? 54  ARG A CZ  1 
ATOM 85   N NH1 . ARG A 1 28  ? 0.839   -3.853  -9.022  1.00 34.15 ? 54  ARG A NH1 1 
ATOM 86   N NH2 . ARG A 1 28  ? 1.793   -3.923  -6.938  1.00 33.41 ? 54  ARG A NH2 1 
ATOM 87   N N   . ARG A 1 29  ? 0.687   0.843   -3.413  1.00 30.34 ? 55  ARG A N   1 
ATOM 88   C CA  . ARG A 1 29  ? 1.391   1.064   -2.161  1.00 30.05 ? 55  ARG A CA  1 
ATOM 89   C C   . ARG A 1 29  ? 1.630   -0.274  -1.463  1.00 30.04 ? 55  ARG A C   1 
ATOM 90   O O   . ARG A 1 29  ? 0.771   -0.788  -0.741  1.00 30.74 ? 55  ARG A O   1 
ATOM 91   C CB  . ARG A 1 29  ? 0.635   2.057   -1.268  1.00 29.94 ? 55  ARG A CB  1 
ATOM 92   C CG  . ARG A 1 29  ? 1.462   2.599   -0.120  1.00 29.13 ? 55  ARG A CG  1 
ATOM 93   C CD  . ARG A 1 29  ? 0.643   3.473   0.807   1.00 29.44 ? 55  ARG A CD  1 
ATOM 94   N NE  . ARG A 1 29  ? 1.513   4.248   1.692   1.00 30.87 ? 55  ARG A NE  1 
ATOM 95   C CZ  . ARG A 1 29  ? 1.118   4.900   2.783   1.00 30.88 ? 55  ARG A CZ  1 
ATOM 96   N NH1 . ARG A 1 29  ? -0.151  4.880   3.154   1.00 31.57 ? 55  ARG A NH1 1 
ATOM 97   N NH2 . ARG A 1 29  ? 2.001   5.568   3.512   1.00 31.14 ? 55  ARG A NH2 1 
ATOM 98   N N   . GLU A 1 30  ? 2.797   -0.845  -1.709  1.00 29.71 ? 56  GLU A N   1 
ATOM 99   C CA  . GLU A 1 30  ? 3.148   -2.144  -1.174  1.00 29.46 ? 56  GLU A CA  1 
ATOM 100  C C   . GLU A 1 30  ? 3.560   -1.983  0.282   1.00 29.48 ? 56  GLU A C   1 
ATOM 101  O O   . GLU A 1 30  ? 4.035   -0.927  0.679   1.00 29.38 ? 56  GLU A O   1 
ATOM 102  C CB  . GLU A 1 30  ? 4.297   -2.726  -1.992  1.00 29.31 ? 56  GLU A CB  1 
ATOM 103  C CG  . GLU A 1 30  ? 4.141   -4.185  -2.367  1.00 29.69 ? 56  GLU A CG  1 
ATOM 104  C CD  . GLU A 1 30  ? 3.085   -4.433  -3.440  1.00 30.25 ? 56  GLU A CD  1 
ATOM 105  O OE1 . GLU A 1 30  ? 2.667   -3.480  -4.136  1.00 30.61 ? 56  GLU A OE1 1 
ATOM 106  O OE2 . GLU A 1 30  ? 2.676   -5.601  -3.595  1.00 30.57 ? 56  GLU A OE2 1 
ATOM 107  N N   . GLY A 1 31  ? 3.362   -3.027  1.079   1.00 29.69 ? 57  GLY A N   1 
ATOM 108  C CA  . GLY A 1 31  ? 3.823   -3.029  2.460   1.00 30.04 ? 57  GLY A CA  1 
ATOM 109  C C   . GLY A 1 31  ? 2.766   -2.723  3.502   1.00 30.49 ? 57  GLY A C   1 
ATOM 110  O O   . GLY A 1 31  ? 1.587   -2.570  3.192   1.00 30.62 ? 57  GLY A O   1 
ATOM 111  N N   . TYR A 1 32  ? 3.194   -2.660  4.756   1.00 31.10 ? 58  TYR A N   1 
ATOM 112  C CA  . TYR A 1 32  ? 2.288   -2.392  5.855   1.00 31.57 ? 58  TYR A CA  1 
ATOM 113  C C   . TYR A 1 32  ? 1.973   -0.910  5.893   1.00 31.60 ? 58  TYR A C   1 
ATOM 114  O O   . TYR A 1 32  ? 2.876   -0.071  5.911   1.00 31.65 ? 58  TYR A O   1 
ATOM 115  C CB  . TYR A 1 32  ? 2.901   -2.813  7.191   1.00 32.02 ? 58  TYR A CB  1 
ATOM 116  C CG  . TYR A 1 32  ? 3.398   -4.234  7.259   1.00 32.57 ? 58  TYR A CG  1 
ATOM 117  C CD1 . TYR A 1 32  ? 4.718   -4.502  7.649   1.00 33.55 ? 58  TYR A CD1 1 
ATOM 118  C CD2 . TYR A 1 32  ? 2.560   -5.313  6.962   1.00 31.99 ? 58  TYR A CD2 1 
ATOM 119  C CE1 . TYR A 1 32  ? 5.197   -5.806  7.735   1.00 33.34 ? 58  TYR A CE1 1 
ATOM 120  C CE2 . TYR A 1 32  ? 3.028   -6.627  7.041   1.00 32.42 ? 58  TYR A CE2 1 
ATOM 121  C CZ  . TYR A 1 32  ? 4.347   -6.860  7.428   1.00 33.54 ? 58  TYR A CZ  1 
ATOM 122  O OH  . TYR A 1 32  ? 4.834   -8.142  7.516   1.00 34.69 ? 58  TYR A OH  1 
ATOM 123  N N   . THR A 1 33  ? 0.688   -0.596  5.915   1.00 31.70 ? 59  THR A N   1 
ATOM 124  C CA  . THR A 1 33  ? 0.237   0.785   5.896   1.00 32.03 ? 59  THR A CA  1 
ATOM 125  C C   . THR A 1 33  ? -0.629  1.059   7.126   1.00 32.19 ? 59  THR A C   1 
ATOM 126  O O   . THR A 1 33  ? -0.698  0.218   8.017   1.00 32.39 ? 59  THR A O   1 
ATOM 127  C CB  . THR A 1 33  ? -0.480  1.112   4.566   1.00 31.80 ? 59  THR A CB  1 
ATOM 128  O OG1 . THR A 1 33  ? -0.750  2.506   4.517   1.00 33.49 ? 59  THR A OG1 1 
ATOM 129  C CG2 . THR A 1 33  ? -1.785  0.374   4.425   1.00 31.55 ? 59  THR A CG2 1 
ATOM 130  N N   . GLU A 1 34  ? -1.270  2.222   7.198   1.00 32.35 ? 60  GLU A N   1 
ATOM 131  C CA  . GLU A 1 34  ? -2.134  2.521   8.336   1.00 32.87 ? 60  GLU A CA  1 
ATOM 132  C C   . GLU A 1 34  ? -3.512  1.885   8.186   1.00 32.89 ? 60  GLU A C   1 
ATOM 133  O O   . GLU A 1 34  ? -4.385  2.078   9.029   1.00 33.03 ? 60  GLU A O   1 
ATOM 134  C CB  . GLU A 1 34  ? -2.255  4.030   8.559   1.00 33.20 ? 60  GLU A CB  1 
ATOM 135  C CG  . GLU A 1 34  ? -3.151  4.766   7.555   1.00 35.21 ? 60  GLU A CG  1 
ATOM 136  C CD  . GLU A 1 34  ? -2.426  5.163   6.281   1.00 37.77 ? 60  GLU A CD  1 
ATOM 137  O OE1 . GLU A 1 34  ? -2.908  6.095   5.591   1.00 39.35 ? 60  GLU A OE1 1 
ATOM 138  O OE2 . GLU A 1 34  ? -1.370  4.562   5.976   1.00 38.25 ? 60  GLU A OE2 1 
ATOM 139  N N   . PHE A 1 35  ? -3.690  1.131   7.103   1.00 33.17 ? 61  PHE A N   1 
ATOM 140  C CA  . PHE A 1 35  ? -4.920  0.400   6.800   1.00 33.05 ? 61  PHE A CA  1 
ATOM 141  C C   . PHE A 1 35  ? -4.651  -1.092  6.861   1.00 33.31 ? 61  PHE A C   1 
ATOM 142  O O   . PHE A 1 35  ? -3.611  -1.546  6.390   1.00 33.73 ? 61  PHE A O   1 
ATOM 143  C CB  . PHE A 1 35  ? -5.415  0.778   5.410   1.00 32.75 ? 61  PHE A CB  1 
ATOM 144  C CG  . PHE A 1 35  ? -5.881  2.194   5.313   1.00 33.17 ? 61  PHE A CG  1 
ATOM 145  C CD1 . PHE A 1 35  ? -5.137  3.135   4.611   1.00 33.20 ? 61  PHE A CD1 1 
ATOM 146  C CD2 . PHE A 1 35  ? -7.053  2.602   5.951   1.00 32.35 ? 61  PHE A CD2 1 
ATOM 147  C CE1 . PHE A 1 35  ? -5.561  4.456   4.525   1.00 32.59 ? 61  PHE A CE1 1 
ATOM 148  C CE2 . PHE A 1 35  ? -7.478  3.915   5.877   1.00 31.99 ? 61  PHE A CE2 1 
ATOM 149  C CZ  . PHE A 1 35  ? -6.725  4.846   5.159   1.00 32.77 ? 61  PHE A CZ  1 
ATOM 150  N N   . SER A 1 36  ? -5.574  -1.860  7.438   1.00 33.48 ? 62  SER A N   1 
ATOM 151  C CA  . SER A 1 36  ? -5.327  -3.288  7.650   1.00 33.56 ? 62  SER A CA  1 
ATOM 152  C C   . SER A 1 36  ? -6.510  -4.198  7.356   1.00 33.73 ? 62  SER A C   1 
ATOM 153  O O   . SER A 1 36  ? -7.646  -3.941  7.759   1.00 33.70 ? 62  SER A O   1 
ATOM 154  C CB  . SER A 1 36  ? -4.817  -3.529  9.064   1.00 33.53 ? 62  SER A CB  1 
ATOM 155  O OG  . SER A 1 36  ? -3.797  -2.588  9.374   1.00 34.33 ? 62  SER A OG  1 
ATOM 156  N N   . LEU A 1 37  ? -6.217  -5.268  6.637   1.00 34.06 ? 63  LEU A N   1 
ATOM 157  C CA  . LEU A 1 37  ? -7.180  -6.303  6.365   1.00 34.80 ? 63  LEU A CA  1 
ATOM 158  C C   . LEU A 1 37  ? -6.758  -7.508  7.183   1.00 35.33 ? 63  LEU A C   1 
ATOM 159  O O   . LEU A 1 37  ? -5.639  -8.000  7.032   1.00 35.66 ? 63  LEU A O   1 
ATOM 160  C CB  . LEU A 1 37  ? -7.175  -6.643  4.870   1.00 34.84 ? 63  LEU A CB  1 
ATOM 161  C CG  . LEU A 1 37  ? -8.166  -7.690  4.349   1.00 35.32 ? 63  LEU A CG  1 
ATOM 162  C CD1 . LEU A 1 37  ? -9.596  -7.154  4.382   1.00 35.55 ? 63  LEU A CD1 1 
ATOM 163  C CD2 . LEU A 1 37  ? -7.788  -8.085  2.949   1.00 34.68 ? 63  LEU A CD2 1 
ATOM 164  N N   . ARG A 1 38  ? -7.630  -7.966  8.075   1.00 35.72 ? 64  ARG A N   1 
ATOM 165  C CA  . ARG A 1 38  ? -7.341  -9.179  8.837   1.00 36.22 ? 64  ARG A CA  1 
ATOM 166  C C   . ARG A 1 38  ? -8.609  -9.962  9.149   1.00 35.91 ? 64  ARG A C   1 
ATOM 167  O O   . ARG A 1 38  ? -9.708  -9.527  8.825   1.00 36.67 ? 64  ARG A O   1 
ATOM 168  C CB  . ARG A 1 38  ? -6.491  -8.889  10.094  1.00 36.59 ? 64  ARG A CB  1 
ATOM 169  C CG  . ARG A 1 38  ? -7.025  -7.791  11.002  1.00 37.89 ? 64  ARG A CG  1 
ATOM 170  C CD  . ARG A 1 38  ? -5.907  -7.184  11.848  1.00 39.35 ? 64  ARG A CD  1 
ATOM 171  N NE  . ARG A 1 38  ? -6.243  -5.824  12.281  1.00 40.88 ? 64  ARG A NE  1 
ATOM 172  C CZ  . ARG A 1 38  ? -5.370  -4.824  12.431  1.00 41.73 ? 64  ARG A CZ  1 
ATOM 173  N NH1 . ARG A 1 38  ? -4.070  -5.000  12.182  1.00 41.86 ? 64  ARG A NH1 1 
ATOM 174  N NH2 . ARG A 1 38  ? -5.803  -3.633  12.832  1.00 41.68 ? 64  ARG A NH2 1 
ATOM 175  N N   . VAL A 1 39  ? -8.449  -11.138 9.738   1.00 35.49 ? 65  VAL A N   1 
ATOM 176  C CA  . VAL A 1 39  ? -9.578  -11.996 10.027  1.00 34.81 ? 65  VAL A CA  1 
ATOM 177  C C   . VAL A 1 39  ? -9.688  -12.103 11.527  1.00 34.77 ? 65  VAL A C   1 
ATOM 178  O O   . VAL A 1 39  ? -8.683  -12.307 12.214  1.00 34.24 ? 65  VAL A O   1 
ATOM 179  C CB  . VAL A 1 39  ? -9.421  -13.404 9.401   1.00 34.80 ? 65  VAL A CB  1 
ATOM 180  C CG1 . VAL A 1 39  ? -10.673 -14.246 9.648   1.00 34.14 ? 65  VAL A CG1 1 
ATOM 181  C CG2 . VAL A 1 39  ? -9.134  -13.299 7.909   1.00 34.21 ? 65  VAL A CG2 1 
ATOM 182  N N   . GLU A 1 40  ? -10.914 -11.947 12.029  1.00 34.79 ? 66  GLU A N   1 
ATOM 183  C CA  . GLU A 1 40  ? -11.174 -12.042 13.453  1.00 34.83 ? 66  GLU A CA  1 
ATOM 184  C C   . GLU A 1 40  ? -10.826 -13.427 13.963  1.00 35.18 ? 66  GLU A C   1 
ATOM 185  O O   . GLU A 1 40  ? -11.201 -14.426 13.357  1.00 35.37 ? 66  GLU A O   1 
ATOM 186  C CB  . GLU A 1 40  ? -12.619 -11.700 13.751  1.00 34.61 ? 66  GLU A CB  1 
ATOM 187  C CG  . GLU A 1 40  ? -12.894 -10.219 13.683  1.00 34.05 ? 66  GLU A CG  1 
ATOM 188  C CD  . GLU A 1 40  ? -14.195 -9.823  14.350  1.00 33.20 ? 66  GLU A CD  1 
ATOM 189  O OE1 . GLU A 1 40  ? -15.002 -10.710 14.709  1.00 32.00 ? 66  GLU A OE1 1 
ATOM 190  O OE2 . GLU A 1 40  ? -14.406 -8.604  14.511  1.00 34.07 ? 66  GLU A OE2 1 
ATOM 191  N N   . GLY A 1 41  ? -10.082 -13.484 15.059  1.00 35.76 ? 67  GLY A N   1 
ATOM 192  C CA  . GLY A 1 41  ? -9.594  -14.760 15.581  1.00 36.50 ? 67  GLY A CA  1 
ATOM 193  C C   . GLY A 1 41  ? -8.223  -15.100 15.034  1.00 36.97 ? 67  GLY A C   1 
ATOM 194  O O   . GLY A 1 41  ? -7.506  -15.908 15.617  1.00 37.10 ? 67  GLY A O   1 
ATOM 195  N N   . ASP A 1 42  ? -7.866  -14.469 13.915  1.00 37.55 ? 68  ASP A N   1 
ATOM 196  C CA  . ASP A 1 42  ? -6.556  -14.621 13.254  1.00 38.25 ? 68  ASP A CA  1 
ATOM 197  C C   . ASP A 1 42  ? -6.156  -16.074 12.980  1.00 38.36 ? 68  ASP A C   1 
ATOM 198  O O   . ASP A 1 42  ? -5.144  -16.559 13.503  1.00 38.50 ? 68  ASP A O   1 
ATOM 199  C CB  . ASP A 1 42  ? -5.445  -13.883 14.019  1.00 38.38 ? 68  ASP A CB  1 
ATOM 200  C CG  . ASP A 1 42  ? -4.135  -13.817 13.233  1.00 39.73 ? 68  ASP A CG  1 
ATOM 201  O OD1 . ASP A 1 42  ? -3.064  -13.781 13.885  1.00 40.54 ? 68  ASP A OD1 1 
ATOM 202  O OD2 . ASP A 1 42  ? -4.172  -13.814 11.971  1.00 40.22 ? 68  ASP A OD2 1 
ATOM 203  N N   . PRO A 1 43  ? -6.947  -16.777 12.150  1.00 38.35 ? 69  PRO A N   1 
ATOM 204  C CA  . PRO A 1 43  ? -6.631  -18.176 11.875  1.00 38.22 ? 69  PRO A CA  1 
ATOM 205  C C   . PRO A 1 43  ? -5.340  -18.310 11.068  1.00 38.10 ? 69  PRO A C   1 
ATOM 206  O O   . PRO A 1 43  ? -5.120  -17.543 10.122  1.00 38.36 ? 69  PRO A O   1 
ATOM 207  C CB  . PRO A 1 43  ? -7.835  -18.645 11.052  1.00 38.22 ? 69  PRO A CB  1 
ATOM 208  C CG  . PRO A 1 43  ? -8.355  -17.402 10.416  1.00 38.39 ? 69  PRO A CG  1 
ATOM 209  C CD  . PRO A 1 43  ? -8.150  -16.330 11.429  1.00 38.15 ? 69  PRO A CD  1 
ATOM 210  N N   . ASP A 1 44  ? -4.494  -19.262 11.455  1.00 37.72 ? 70  ASP A N   1 
ATOM 211  C CA  . ASP A 1 44  ? -3.270  -19.569 10.709  1.00 37.40 ? 70  ASP A CA  1 
ATOM 212  C C   . ASP A 1 44  ? -3.632  -20.290 9.419   1.00 36.96 ? 70  ASP A C   1 
ATOM 213  O O   . ASP A 1 44  ? -2.925  -20.199 8.413   1.00 36.92 ? 70  ASP A O   1 
ATOM 214  C CB  . ASP A 1 44  ? -2.335  -20.462 11.531  1.00 37.43 ? 70  ASP A CB  1 
ATOM 215  C CG  . ASP A 1 44  ? -2.366  -20.139 13.013  1.00 37.78 ? 70  ASP A CG  1 
ATOM 216  O OD1 . ASP A 1 44  ? -1.812  -19.091 13.415  1.00 37.83 ? 70  ASP A OD1 1 
ATOM 217  O OD2 . ASP A 1 44  ? -2.947  -20.943 13.775  1.00 38.07 ? 70  ASP A OD2 1 
ATOM 218  N N   . PHE A 1 45  ? -4.749  -21.005 9.469   1.00 36.44 ? 71  PHE A N   1 
ATOM 219  C CA  . PHE A 1 45  ? -5.201  -21.839 8.369   1.00 35.84 ? 71  PHE A CA  1 
ATOM 220  C C   . PHE A 1 45  ? -6.716  -21.756 8.275   1.00 35.12 ? 71  PHE A C   1 
ATOM 221  O O   . PHE A 1 45  ? -7.378  -21.450 9.260   1.00 35.01 ? 71  PHE A O   1 
ATOM 222  C CB  . PHE A 1 45  ? -4.734  -23.296 8.571   1.00 35.83 ? 71  PHE A CB  1 
ATOM 223  C CG  . PHE A 1 45  ? -5.250  -23.950 9.843   1.00 36.24 ? 71  PHE A CG  1 
ATOM 224  C CD1 . PHE A 1 45  ? -6.434  -24.697 9.836   1.00 36.46 ? 71  PHE A CD1 1 
ATOM 225  C CD2 . PHE A 1 45  ? -4.540  -23.844 11.042  1.00 36.15 ? 71  PHE A CD2 1 
ATOM 226  C CE1 . PHE A 1 45  ? -6.910  -25.314 11.006  1.00 35.73 ? 71  PHE A CE1 1 
ATOM 227  C CE2 . PHE A 1 45  ? -5.007  -24.459 12.217  1.00 35.68 ? 71  PHE A CE2 1 
ATOM 228  C CZ  . PHE A 1 45  ? -6.193  -25.195 12.193  1.00 35.63 ? 71  PHE A CZ  1 
ATOM 229  N N   . TYR A 1 46  ? -7.260  -22.010 7.090   1.00 34.37 ? 72  TYR A N   1 
ATOM 230  C CA  . TYR A 1 46  ? -8.703  -22.046 6.920   1.00 33.61 ? 72  TYR A CA  1 
ATOM 231  C C   . TYR A 1 46  ? -9.237  -23.478 6.915   1.00 33.28 ? 72  TYR A C   1 
ATOM 232  O O   . TYR A 1 46  ? -8.476  -24.437 6.753   1.00 33.28 ? 72  TYR A O   1 
ATOM 233  C CB  . TYR A 1 46  ? -9.135  -21.296 5.658   1.00 33.56 ? 72  TYR A CB  1 
ATOM 234  C CG  . TYR A 1 46  ? -8.880  -22.018 4.350   1.00 33.69 ? 72  TYR A CG  1 
ATOM 235  C CD1 . TYR A 1 46  ? -7.900  -21.567 3.466   1.00 33.55 ? 72  TYR A CD1 1 
ATOM 236  C CD2 . TYR A 1 46  ? -9.638  -23.137 3.981   1.00 33.03 ? 72  TYR A CD2 1 
ATOM 237  C CE1 . TYR A 1 46  ? -7.674  -22.217 2.258   1.00 33.76 ? 72  TYR A CE1 1 
ATOM 238  C CE2 . TYR A 1 46  ? -9.418  -23.795 2.780   1.00 32.76 ? 72  TYR A CE2 1 
ATOM 239  C CZ  . TYR A 1 46  ? -8.437  -23.334 1.923   1.00 33.53 ? 72  TYR A CZ  1 
ATOM 240  O OH  . TYR A 1 46  ? -8.219  -23.988 0.728   1.00 33.71 ? 72  TYR A OH  1 
ATOM 241  N N   . LYS A 1 47  ? -10.550 -23.603 7.100   1.00 32.71 ? 73  LYS A N   1 
ATOM 242  C CA  . LYS A 1 47  ? -11.242 -24.889 7.096   1.00 32.04 ? 73  LYS A CA  1 
ATOM 243  C C   . LYS A 1 47  ? -12.443 -24.839 6.155   1.00 31.68 ? 73  LYS A C   1 
ATOM 244  O O   . LYS A 1 47  ? -13.412 -24.142 6.434   1.00 31.64 ? 73  LYS A O   1 
ATOM 245  C CB  . LYS A 1 47  ? -11.682 -25.274 8.511   1.00 31.96 ? 73  LYS A CB  1 
ATOM 246  C CG  . LYS A 1 47  ? -10.525 -25.416 9.485   1.00 31.69 ? 73  LYS A CG  1 
ATOM 247  C CD  . LYS A 1 47  ? -10.874 -26.287 10.663  1.00 31.03 ? 73  LYS A CD  1 
ATOM 248  C CE  . LYS A 1 47  ? -11.454 -25.487 11.797  1.00 30.70 ? 73  LYS A CE  1 
ATOM 249  N NZ  . LYS A 1 47  ? -11.247 -26.221 13.081  1.00 31.30 ? 73  LYS A NZ  1 
ATOM 250  N N   . PRO A 1 48  ? -12.385 -25.592 5.041   1.00 31.40 ? 74  PRO A N   1 
ATOM 251  C CA  . PRO A 1 48  ? -13.395 -25.539 3.987   1.00 31.22 ? 74  PRO A CA  1 
ATOM 252  C C   . PRO A 1 48  ? -14.825 -25.449 4.523   1.00 31.13 ? 74  PRO A C   1 
ATOM 253  O O   . PRO A 1 48  ? -15.203 -26.212 5.412   1.00 31.21 ? 74  PRO A O   1 
ATOM 254  C CB  . PRO A 1 48  ? -13.181 -26.862 3.255   1.00 31.19 ? 74  PRO A CB  1 
ATOM 255  C CG  . PRO A 1 48  ? -11.736 -27.109 3.396   1.00 31.03 ? 74  PRO A CG  1 
ATOM 256  C CD  . PRO A 1 48  ? -11.339 -26.587 4.738   1.00 31.23 ? 74  PRO A CD  1 
ATOM 257  N N   . GLY A 1 49  ? -15.600 -24.510 3.992   1.00 30.94 ? 75  GLY A N   1 
ATOM 258  C CA  . GLY A 1 49  ? -16.991 -24.340 4.401   1.00 30.74 ? 75  GLY A CA  1 
ATOM 259  C C   . GLY A 1 49  ? -17.199 -23.612 5.720   1.00 30.62 ? 75  GLY A C   1 
ATOM 260  O O   . GLY A 1 49  ? -18.317 -23.550 6.223   1.00 30.68 ? 75  GLY A O   1 
ATOM 261  N N   . THR A 1 50  ? -16.128 -23.060 6.283   1.00 30.53 ? 76  THR A N   1 
ATOM 262  C CA  . THR A 1 50  ? -16.220 -22.277 7.513   1.00 30.39 ? 76  THR A CA  1 
ATOM 263  C C   . THR A 1 50  ? -16.295 -20.788 7.191   1.00 30.39 ? 76  THR A C   1 
ATOM 264  O O   . THR A 1 50  ? -15.580 -20.285 6.314   1.00 30.33 ? 76  THR A O   1 
ATOM 265  C CB  . THR A 1 50  ? -15.035 -22.553 8.456   1.00 30.25 ? 76  THR A CB  1 
ATOM 266  O OG1 . THR A 1 50  ? -14.934 -23.959 8.687   1.00 30.66 ? 76  THR A OG1 1 
ATOM 267  C CG2 . THR A 1 50  ? -15.222 -21.852 9.789   1.00 30.78 ? 76  THR A CG2 1 
ATOM 268  N N   . SER A 1 51  ? -17.169 -20.093 7.911   1.00 30.29 ? 77  SER A N   1 
ATOM 269  C CA  . SER A 1 51  ? -17.402 -18.676 7.688   1.00 30.21 ? 77  SER A CA  1 
ATOM 270  C C   . SER A 1 51  ? -16.586 -17.823 8.651   1.00 30.12 ? 77  SER A C   1 
ATOM 271  O O   . SER A 1 51  ? -16.827 -17.813 9.866   1.00 30.26 ? 77  SER A O   1 
ATOM 272  C CB  . SER A 1 51  ? -18.889 -18.358 7.796   1.00 30.04 ? 77  SER A CB  1 
ATOM 273  O OG  . SER A 1 51  ? -19.473 -19.125 8.830   1.00 30.75 ? 77  SER A OG  1 
ATOM 274  N N   . TYR A 1 52  ? -15.616 -17.115 8.078   1.00 29.74 ? 78  TYR A N   1 
ATOM 275  C CA  . TYR A 1 52  ? -14.717 -16.240 8.806   1.00 29.20 ? 78  TYR A CA  1 
ATOM 276  C C   . TYR A 1 52  ? -15.180 -14.803 8.643   1.00 29.24 ? 78  TYR A C   1 
ATOM 277  O O   . TYR A 1 52  ? -15.703 -14.436 7.589   1.00 29.19 ? 78  TYR A O   1 
ATOM 278  C CB  . TYR A 1 52  ? -13.299 -16.399 8.253   1.00 28.90 ? 78  TYR A CB  1 
ATOM 279  C CG  . TYR A 1 52  ? -12.730 -17.772 8.487   1.00 28.51 ? 78  TYR A CG  1 
ATOM 280  C CD1 . TYR A 1 52  ? -12.931 -18.805 7.567   1.00 27.24 ? 78  TYR A CD1 1 
ATOM 281  C CD2 . TYR A 1 52  ? -12.011 -18.048 9.641   1.00 28.80 ? 78  TYR A CD2 1 
ATOM 282  C CE1 . TYR A 1 52  ? -12.423 -20.070 7.797   1.00 26.94 ? 78  TYR A CE1 1 
ATOM 283  C CE2 . TYR A 1 52  ? -11.502 -19.312 9.881   1.00 28.69 ? 78  TYR A CE2 1 
ATOM 284  C CZ  . TYR A 1 52  ? -11.712 -20.317 8.960   1.00 27.99 ? 78  TYR A CZ  1 
ATOM 285  O OH  . TYR A 1 52  ? -11.192 -21.561 9.222   1.00 28.52 ? 78  TYR A OH  1 
ATOM 286  N N   . ARG A 1 53  ? -14.988 -13.998 9.686   1.00 29.24 ? 79  ARG A N   1 
ATOM 287  C CA  . ARG A 1 53  ? -15.327 -12.582 9.636   1.00 29.75 ? 79  ARG A CA  1 
ATOM 288  C C   . ARG A 1 53  ? -14.115 -11.778 9.178   1.00 29.91 ? 79  ARG A C   1 
ATOM 289  O O   . ARG A 1 53  ? -13.076 -11.786 9.845   1.00 30.36 ? 79  ARG A O   1 
ATOM 290  C CB  . ARG A 1 53  ? -15.803 -12.094 11.002  1.00 29.73 ? 79  ARG A CB  1 
ATOM 291  C CG  . ARG A 1 53  ? -16.778 -10.924 10.963  1.00 30.42 ? 79  ARG A CG  1 
ATOM 292  C CD  . ARG A 1 53  ? -17.458 -10.802 12.315  1.00 32.03 ? 79  ARG A CD  1 
ATOM 293  N NE  . ARG A 1 53  ? -18.620 -9.915  12.316  1.00 32.80 ? 79  ARG A NE  1 
ATOM 294  C CZ  . ARG A 1 53  ? -19.858 -10.272 12.653  1.00 32.53 ? 79  ARG A CZ  1 
ATOM 295  N NH1 . ARG A 1 53  ? -20.138 -11.512 13.026  1.00 32.17 ? 79  ARG A NH1 1 
ATOM 296  N NH2 . ARG A 1 53  ? -20.826 -9.369  12.631  1.00 34.26 ? 79  ARG A NH2 1 
ATOM 297  N N   . VAL A 1 54  ? -14.247 -11.108 8.032   1.00 29.70 ? 80  VAL A N   1 
ATOM 298  C CA  . VAL A 1 54  ? -13.171 -10.283 7.485   1.00 29.74 ? 80  VAL A CA  1 
ATOM 299  C C   . VAL A 1 54  ? -13.431 -8.813  7.838   1.00 30.01 ? 80  VAL A C   1 
ATOM 300  O O   . VAL A 1 54  ? -14.564 -8.326  7.709   1.00 29.80 ? 80  VAL A O   1 
ATOM 301  C CB  . VAL A 1 54  ? -13.031 -10.447 5.938   1.00 29.50 ? 80  VAL A CB  1 
ATOM 302  C CG1 . VAL A 1 54  ? -11.911 -9.583  5.411   1.00 29.01 ? 80  VAL A CG1 1 
ATOM 303  C CG2 . VAL A 1 54  ? -12.774 -11.893 5.557   1.00 29.28 ? 80  VAL A CG2 1 
ATOM 304  N N   . THR A 1 55  ? -12.387 -8.114  8.286   1.00 29.87 ? 81  THR A N   1 
ATOM 305  C CA  . THR A 1 55  ? -12.520 -6.703  8.644   1.00 29.70 ? 81  THR A CA  1 
ATOM 306  C C   . THR A 1 55  ? -11.441 -5.823  8.023   1.00 29.47 ? 81  THR A C   1 
ATOM 307  O O   . THR A 1 55  ? -10.269 -6.202  7.968   1.00 29.75 ? 81  THR A O   1 
ATOM 308  C CB  . THR A 1 55  ? -12.456 -6.479  10.154  1.00 29.64 ? 81  THR A CB  1 
ATOM 309  O OG1 . THR A 1 55  ? -11.110 -6.683  10.584  1.00 30.56 ? 81  THR A OG1 1 
ATOM 310  C CG2 . THR A 1 55  ? -13.409 -7.418  10.914  1.00 29.37 ? 81  THR A CG2 1 
ATOM 311  N N   . LEU A 1 56  ? -11.855 -4.638  7.582   1.00 28.96 ? 82  LEU A N   1 
ATOM 312  C CA  . LEU A 1 56  ? -10.960 -3.649  7.030   1.00 28.59 ? 82  LEU A CA  1 
ATOM 313  C C   . LEU A 1 56  ? -10.925 -2.438  7.957   1.00 28.61 ? 82  LEU A C   1 
ATOM 314  O O   . LEU A 1 56  ? -11.945 -1.778  8.166   1.00 28.68 ? 82  LEU A O   1 
ATOM 315  C CB  . LEU A 1 56  ? -11.437 -3.266  5.632   1.00 28.75 ? 82  LEU A CB  1 
ATOM 316  C CG  . LEU A 1 56  ? -10.524 -2.511  4.670   1.00 28.13 ? 82  LEU A CG  1 
ATOM 317  C CD1 . LEU A 1 56  ? -9.108  -3.093  4.640   1.00 28.46 ? 82  LEU A CD1 1 
ATOM 318  C CD2 . LEU A 1 56  ? -11.155 -2.577  3.305   1.00 27.64 ? 82  LEU A CD2 1 
ATOM 319  N N   . SER A 1 57  ? -9.747  -2.163  8.513   1.00 28.64 ? 83  SER A N   1 
ATOM 320  C CA  . SER A 1 57  ? -9.588  -1.198  9.599   1.00 28.77 ? 83  SER A CA  1 
ATOM 321  C C   . SER A 1 57  ? -8.600  -0.089  9.288   1.00 29.31 ? 83  SER A C   1 
ATOM 322  O O   . SER A 1 57  ? -7.648  -0.275  8.524   1.00 29.18 ? 83  SER A O   1 
ATOM 323  C CB  . SER A 1 57  ? -9.111  -1.900  10.864  1.00 28.57 ? 83  SER A CB  1 
ATOM 324  O OG  . SER A 1 57  ? -10.178 -2.521  11.525  1.00 28.44 ? 83  SER A OG  1 
ATOM 325  N N   . ALA A 1 58  ? -8.820  1.050   9.939   1.00 29.84 ? 84  ALA A N   1 
ATOM 326  C CA  . ALA A 1 58  ? -8.017  2.242   9.760   1.00 30.25 ? 84  ALA A CA  1 
ATOM 327  C C   . ALA A 1 58  ? -7.556  2.706   11.118  1.00 30.68 ? 84  ALA A C   1 
ATOM 328  O O   . ALA A 1 58  ? -8.365  3.124   11.936  1.00 30.85 ? 84  ALA A O   1 
ATOM 329  C CB  . ALA A 1 58  ? -8.843  3.321   9.100   1.00 30.13 ? 84  ALA A CB  1 
ATOM 330  N N   . ALA A 1 59  ? -6.251  2.645   11.346  1.00 31.48 ? 85  ALA A N   1 
ATOM 331  C CA  . ALA A 1 59  ? -5.655  2.958   12.643  1.00 32.36 ? 85  ALA A CA  1 
ATOM 332  C C   . ALA A 1 59  ? -5.884  4.418   13.077  1.00 33.06 ? 85  ALA A C   1 
ATOM 333  O O   . ALA A 1 59  ? -6.293  5.240   12.262  1.00 33.00 ? 85  ALA A O   1 
ATOM 334  C CB  . ALA A 1 59  ? -4.157  2.633   12.601  1.00 32.33 ? 85  ALA A CB  1 
ATOM 335  N N   . PRO A 1 60  ? -5.624  4.736   14.365  1.00 33.92 ? 86  PRO A N   1 
ATOM 336  C CA  . PRO A 1 60  ? -5.547  6.073   14.955  1.00 34.50 ? 86  PRO A CA  1 
ATOM 337  C C   . PRO A 1 60  ? -5.478  7.261   13.984  1.00 35.06 ? 86  PRO A C   1 
ATOM 338  O O   . PRO A 1 60  ? -4.835  7.164   12.935  1.00 35.65 ? 86  PRO A O   1 
ATOM 339  C CB  . PRO A 1 60  ? -4.277  5.960   15.800  1.00 34.63 ? 86  PRO A CB  1 
ATOM 340  C CG  . PRO A 1 60  ? -4.364  4.483   16.342  1.00 34.54 ? 86  PRO A CG  1 
ATOM 341  C CD  . PRO A 1 60  ? -5.346  3.736   15.414  1.00 34.14 ? 86  PRO A CD  1 
ATOM 342  N N   . PRO A 1 61  ? -6.066  8.409   14.375  1.00 35.29 ? 87  PRO A N   1 
ATOM 343  C CA  . PRO A 1 61  ? -6.660  9.444   13.534  1.00 35.30 ? 87  PRO A CA  1 
ATOM 344  C C   . PRO A 1 61  ? -6.541  9.272   12.014  1.00 35.32 ? 87  PRO A C   1 
ATOM 345  O O   . PRO A 1 61  ? -6.068  10.178  11.320  1.00 35.92 ? 87  PRO A O   1 
ATOM 346  C CB  . PRO A 1 61  ? -5.954  10.700  14.037  1.00 35.33 ? 87  PRO A CB  1 
ATOM 347  C CG  . PRO A 1 61  ? -5.750  10.393  15.581  1.00 35.70 ? 87  PRO A CG  1 
ATOM 348  C CD  . PRO A 1 61  ? -6.028  8.891   15.766  1.00 35.41 ? 87  PRO A CD  1 
ATOM 349  N N   . SER A 1 62  ? -6.985  8.124   11.507  1.00 34.93 ? 88  SER A N   1 
ATOM 350  C CA  . SER A 1 62  ? -7.034  7.883   10.070  1.00 34.62 ? 88  SER A CA  1 
ATOM 351  C C   . SER A 1 62  ? -8.315  7.140   9.702   1.00 34.25 ? 88  SER A C   1 
ATOM 352  O O   . SER A 1 62  ? -8.813  6.322   10.468  1.00 34.17 ? 88  SER A O   1 
ATOM 353  C CB  . SER A 1 62  ? -5.807  7.105   9.606   1.00 34.80 ? 88  SER A CB  1 
ATOM 354  O OG  . SER A 1 62  ? -5.773  7.030   8.190   1.00 35.21 ? 88  SER A OG  1 
ATOM 355  N N   . TYR A 1 63  ? -8.843  7.439   8.525   1.00 33.99 ? 89  TYR A N   1 
ATOM 356  C CA  . TYR A 1 63  ? -10.167 6.980   8.124   1.00 33.82 ? 89  TYR A CA  1 
ATOM 357  C C   . TYR A 1 63  ? -10.151 6.637   6.639   1.00 33.81 ? 89  TYR A C   1 
ATOM 358  O O   . TYR A 1 63  ? -9.262  7.085   5.916   1.00 33.74 ? 89  TYR A O   1 
ATOM 359  C CB  . TYR A 1 63  ? -11.206 8.083   8.410   1.00 33.65 ? 89  TYR A CB  1 
ATOM 360  C CG  . TYR A 1 63  ? -10.988 9.364   7.618   1.00 33.84 ? 89  TYR A CG  1 
ATOM 361  C CD1 . TYR A 1 63  ? -10.172 10.394  8.108   1.00 33.68 ? 89  TYR A CD1 1 
ATOM 362  C CD2 . TYR A 1 63  ? -11.587 9.541   6.367   1.00 33.98 ? 89  TYR A CD2 1 
ATOM 363  C CE1 . TYR A 1 63  ? -9.963  11.567  7.371   1.00 33.02 ? 89  TYR A CE1 1 
ATOM 364  C CE2 . TYR A 1 63  ? -11.382 10.702  5.623   1.00 33.93 ? 89  TYR A CE2 1 
ATOM 365  C CZ  . TYR A 1 63  ? -10.574 11.710  6.127   1.00 33.77 ? 89  TYR A CZ  1 
ATOM 366  O OH  . TYR A 1 63  ? -10.394 12.853  5.370   1.00 33.56 ? 89  TYR A OH  1 
ATOM 367  N N   . PHE A 1 64  ? -11.128 5.850   6.187   1.00 33.85 ? 90  PHE A N   1 
ATOM 368  C CA  . PHE A 1 64  ? -11.342 5.640   4.742   1.00 33.57 ? 90  PHE A CA  1 
ATOM 369  C C   . PHE A 1 64  ? -12.792 5.927   4.311   1.00 33.32 ? 90  PHE A C   1 
ATOM 370  O O   . PHE A 1 64  ? -13.721 5.856   5.123   1.00 32.98 ? 90  PHE A O   1 
ATOM 371  C CB  . PHE A 1 64  ? -10.833 4.264   4.258   1.00 33.52 ? 90  PHE A CB  1 
ATOM 372  C CG  . PHE A 1 64  ? -11.487 3.073   4.931   1.00 33.48 ? 90  PHE A CG  1 
ATOM 373  C CD1 . PHE A 1 64  ? -12.575 2.432   4.341   1.00 33.56 ? 90  PHE A CD1 1 
ATOM 374  C CD2 . PHE A 1 64  ? -10.985 2.568   6.129   1.00 33.27 ? 90  PHE A CD2 1 
ATOM 375  C CE1 . PHE A 1 64  ? -13.179 1.324   4.949   1.00 33.29 ? 90  PHE A CE1 1 
ATOM 376  C CE2 . PHE A 1 64  ? -11.572 1.464   6.747   1.00 34.01 ? 90  PHE A CE2 1 
ATOM 377  C CZ  . PHE A 1 64  ? -12.677 0.837   6.154   1.00 33.81 ? 90  PHE A CZ  1 
ATOM 378  N N   . ARG A 1 65  ? -12.963 6.271   3.035   1.00 33.03 ? 91  ARG A N   1 
ATOM 379  C CA  . ARG A 1 65  ? -14.271 6.626   2.506   1.00 32.81 ? 91  ARG A CA  1 
ATOM 380  C C   . ARG A 1 65  ? -14.824 5.574   1.557   1.00 32.67 ? 91  ARG A C   1 
ATOM 381  O O   . ARG A 1 65  ? -16.029 5.491   1.349   1.00 32.48 ? 91  ARG A O   1 
ATOM 382  C CB  . ARG A 1 65  ? -14.225 7.985   1.809   1.00 32.84 ? 91  ARG A CB  1 
ATOM 383  C CG  . ARG A 1 65  ? -14.282 9.169   2.745   1.00 33.17 ? 91  ARG A CG  1 
ATOM 384  C CD  . ARG A 1 65  ? -14.504 10.464  1.979   1.00 35.20 ? 91  ARG A CD  1 
ATOM 385  N NE  . ARG A 1 65  ? -14.308 11.644  2.820   1.00 36.99 ? 91  ARG A NE  1 
ATOM 386  C CZ  . ARG A 1 65  ? -15.243 12.169  3.612   1.00 37.83 ? 91  ARG A CZ  1 
ATOM 387  N NH1 . ARG A 1 65  ? -14.968 13.241  4.345   1.00 38.09 ? 91  ARG A NH1 1 
ATOM 388  N NH2 . ARG A 1 65  ? -16.453 11.625  3.679   1.00 38.19 ? 91  ARG A NH2 1 
ATOM 389  N N   . GLY A 1 66  ? -13.937 4.779   0.978   1.00 32.81 ? 92  GLY A N   1 
ATOM 390  C CA  . GLY A 1 66  ? -14.338 3.714   0.077   1.00 33.19 ? 92  GLY A CA  1 
ATOM 391  C C   . GLY A 1 66  ? -13.286 2.631   0.022   1.00 33.69 ? 92  GLY A C   1 
ATOM 392  O O   . GLY A 1 66  ? -12.143 2.848   0.440   1.00 33.77 ? 92  GLY A O   1 
ATOM 393  N N   . PHE A 1 67  ? -13.679 1.466   -0.492  1.00 34.07 ? 93  PHE A N   1 
ATOM 394  C CA  . PHE A 1 67  ? -12.797 0.303   -0.588  1.00 34.36 ? 93  PHE A CA  1 
ATOM 395  C C   . PHE A 1 67  ? -13.361 -0.708  -1.581  1.00 34.67 ? 93  PHE A C   1 
ATOM 396  O O   . PHE A 1 67  ? -14.503 -0.565  -2.038  1.00 34.86 ? 93  PHE A O   1 
ATOM 397  C CB  . PHE A 1 67  ? -12.670 -0.369  0.781   1.00 34.33 ? 93  PHE A CB  1 
ATOM 398  C CG  . PHE A 1 67  ? -13.817 -1.296  1.112   1.00 34.86 ? 93  PHE A CG  1 
ATOM 399  C CD1 . PHE A 1 67  ? -13.713 -2.667  0.881   1.00 34.51 ? 93  PHE A CD1 1 
ATOM 400  C CD2 . PHE A 1 67  ? -15.006 -0.795  1.632   1.00 34.42 ? 93  PHE A CD2 1 
ATOM 401  C CE1 . PHE A 1 67  ? -14.765 -3.518  1.181   1.00 34.94 ? 93  PHE A CE1 1 
ATOM 402  C CE2 . PHE A 1 67  ? -16.063 -1.644  1.934   1.00 34.19 ? 93  PHE A CE2 1 
ATOM 403  C CZ  . PHE A 1 67  ? -15.942 -3.006  1.710   1.00 34.36 ? 93  PHE A CZ  1 
ATOM 404  N N   . THR A 1 68  ? -12.559 -1.724  -1.905  1.00 34.86 ? 94  THR A N   1 
ATOM 405  C CA  . THR A 1 68  ? -13.032 -2.930  -2.602  1.00 35.22 ? 94  THR A CA  1 
ATOM 406  C C   . THR A 1 68  ? -12.398 -4.142  -1.928  1.00 35.63 ? 94  THR A C   1 
ATOM 407  O O   . THR A 1 68  ? -11.464 -3.989  -1.138  1.00 35.80 ? 94  THR A O   1 
ATOM 408  C CB  . THR A 1 68  ? -12.677 -2.958  -4.110  1.00 35.00 ? 94  THR A CB  1 
ATOM 409  O OG1 . THR A 1 68  ? -11.281 -3.257  -4.283  1.00 35.02 ? 94  THR A OG1 1 
ATOM 410  C CG2 . THR A 1 68  ? -13.017 -1.638  -4.788  1.00 34.81 ? 94  THR A CG2 1 
ATOM 411  N N   . LEU A 1 69  ? -12.884 -5.340  -2.251  1.00 36.00 ? 95  LEU A N   1 
ATOM 412  C CA  . LEU A 1 69  ? -12.395 -6.560  -1.607  1.00 36.38 ? 95  LEU A CA  1 
ATOM 413  C C   . LEU A 1 69  ? -12.709 -7.812  -2.421  1.00 36.91 ? 95  LEU A C   1 
ATOM 414  O O   . LEU A 1 69  ? -13.845 -8.028  -2.835  1.00 36.76 ? 95  LEU A O   1 
ATOM 415  C CB  . LEU A 1 69  ? -12.985 -6.671  -0.197  1.00 36.42 ? 95  LEU A CB  1 
ATOM 416  C CG  . LEU A 1 69  ? -12.624 -7.805  0.755   1.00 36.24 ? 95  LEU A CG  1 
ATOM 417  C CD1 . LEU A 1 69  ? -11.139 -7.832  1.033   1.00 36.70 ? 95  LEU A CD1 1 
ATOM 418  C CD2 . LEU A 1 69  ? -13.408 -7.631  2.047   1.00 36.15 ? 95  LEU A CD2 1 
ATOM 419  N N   . ILE A 1 70  ? -11.687 -8.635  -2.634  1.00 37.68 ? 96  ILE A N   1 
ATOM 420  C CA  . ILE A 1 70  ? -11.813 -9.889  -3.382  1.00 38.40 ? 96  ILE A CA  1 
ATOM 421  C C   . ILE A 1 70  ? -11.057 -11.037 -2.698  1.00 38.85 ? 96  ILE A C   1 
ATOM 422  O O   . ILE A 1 70  ? -10.293 -10.814 -1.745  1.00 39.23 ? 96  ILE A O   1 
ATOM 423  C CB  . ILE A 1 70  ? -11.268 -9.737  -4.820  1.00 38.31 ? 96  ILE A CB  1 
ATOM 424  C CG1 . ILE A 1 70  ? -9.944  -8.964  -4.819  1.00 38.77 ? 96  ILE A CG1 1 
ATOM 425  C CG2 . ILE A 1 70  ? -12.286 -9.048  -5.714  1.00 38.82 ? 96  ILE A CG2 1 
ATOM 426  C CD1 . ILE A 1 70  ? -9.068  -9.236  -6.036  1.00 39.09 ? 96  ILE A CD1 1 
ATOM 427  N N   . ALA A 1 71  ? -11.266 -12.256 -3.189  1.00 39.12 ? 97  ALA A N   1 
ATOM 428  C CA  . ALA A 1 71  ? -10.439 -13.395 -2.799  1.00 39.62 ? 97  ALA A CA  1 
ATOM 429  C C   . ALA A 1 71  ? -9.893  -14.093 -4.036  1.00 40.05 ? 97  ALA A C   1 
ATOM 430  O O   . ALA A 1 71  ? -10.575 -14.180 -5.052  1.00 40.16 ? 97  ALA A O   1 
ATOM 431  C CB  . ALA A 1 71  ? -11.225 -14.361 -1.958  1.00 39.60 ? 97  ALA A CB  1 
ATOM 432  N N   . LEU A 1 72  ? -8.659  -14.583 -3.947  1.00 40.58 ? 98  LEU A N   1 
ATOM 433  C CA  . LEU A 1 72  ? -7.998  -15.239 -5.077  1.00 41.09 ? 98  LEU A CA  1 
ATOM 434  C C   . LEU A 1 72  ? -7.144  -16.409 -4.621  1.00 41.49 ? 98  LEU A C   1 
ATOM 435  O O   . LEU A 1 72  ? -6.563  -16.363 -3.538  1.00 41.69 ? 98  LEU A O   1 
ATOM 436  C CB  . LEU A 1 72  ? -7.108  -14.242 -5.814  1.00 41.04 ? 98  LEU A CB  1 
ATOM 437  C CG  . LEU A 1 72  ? -7.789  -13.190 -6.682  1.00 41.03 ? 98  LEU A CG  1 
ATOM 438  C CD1 . LEU A 1 72  ? -6.867  -12.010 -6.868  1.00 40.73 ? 98  LEU A CD1 1 
ATOM 439  C CD2 . LEU A 1 72  ? -8.183  -13.789 -8.018  1.00 40.79 ? 98  LEU A CD2 1 
ATOM 440  N N   . ARG A 1 73  ? -7.066  -17.450 -5.448  1.00 41.97 ? 99  ARG A N   1 
ATOM 441  C CA  . ARG A 1 73  ? -6.160  -18.570 -5.186  1.00 42.51 ? 99  ARG A CA  1 
ATOM 442  C C   . ARG A 1 73  ? -4.737  -18.110 -5.470  1.00 42.76 ? 99  ARG A C   1 
ATOM 443  O O   . ARG A 1 73  ? -4.498  -17.394 -6.445  1.00 42.79 ? 99  ARG A O   1 
ATOM 444  C CB  . ARG A 1 73  ? -6.477  -19.783 -6.069  1.00 42.52 ? 99  ARG A CB  1 
ATOM 445  C CG  . ARG A 1 73  ? -7.931  -19.947 -6.476  1.00 43.06 ? 99  ARG A CG  1 
ATOM 446  C CD  . ARG A 1 73  ? -8.050  -20.894 -7.667  1.00 43.80 ? 99  ARG A CD  1 
ATOM 447  N NE  . ARG A 1 73  ? -8.103  -22.293 -7.252  1.00 44.57 ? 99  ARG A NE  1 
ATOM 448  C CZ  . ARG A 1 73  ? -7.882  -23.333 -8.052  1.00 45.42 ? 99  ARG A CZ  1 
ATOM 449  N NH1 . ARG A 1 73  ? -7.965  -24.567 -7.567  1.00 45.56 ? 99  ARG A NH1 1 
ATOM 450  N NH2 . ARG A 1 73  ? -7.571  -23.150 -9.333  1.00 46.06 ? 99  ARG A NH2 1 
ATOM 451  N N   . GLU A 1 74  ? -3.798  -18.525 -4.623  1.00 43.13 ? 100 GLU A N   1 
ATOM 452  C CA  . GLU A 1 74  ? -2.395  -18.147 -4.773  1.00 43.56 ? 100 GLU A CA  1 
ATOM 453  C C   . GLU A 1 74  ? -1.851  -18.519 -6.151  1.00 43.75 ? 100 GLU A C   1 
ATOM 454  O O   . GLU A 1 74  ? -2.233  -19.546 -6.723  1.00 43.77 ? 100 GLU A O   1 
ATOM 455  C CB  . GLU A 1 74  ? -1.543  -18.765 -3.659  1.00 43.56 ? 100 GLU A CB  1 
ATOM 456  C CG  . GLU A 1 74  ? -0.225  -18.033 -3.403  1.00 43.81 ? 100 GLU A CG  1 
ATOM 457  C CD  . GLU A 1 74  ? 0.412   -18.388 -2.067  1.00 43.93 ? 100 GLU A CD  1 
ATOM 458  O OE1 . GLU A 1 74  ? 0.496   -19.592 -1.732  1.00 44.16 ? 100 GLU A OE1 1 
ATOM 459  O OE2 . GLU A 1 74  ? 0.838   -17.453 -1.354  1.00 44.29 ? 100 GLU A OE2 1 
ATOM 460  N N   . ASN A 1 75  ? -0.973  -17.657 -6.670  1.00 44.00 ? 101 ASN A N   1 
ATOM 461  C CA  . ASN A 1 75  ? -0.383  -17.769 -8.011  1.00 44.26 ? 101 ASN A CA  1 
ATOM 462  C C   . ASN A 1 75  ? -1.307  -17.338 -9.161  1.00 44.37 ? 101 ASN A C   1 
ATOM 463  O O   . ASN A 1 75  ? -0.827  -16.862 -10.195 1.00 44.44 ? 101 ASN A O   1 
ATOM 464  C CB  . ASN A 1 75  ? 0.217   -19.163 -8.264  1.00 44.39 ? 101 ASN A CB  1 
ATOM 465  C CG  . ASN A 1 75  ? 1.459   -19.433 -7.422  1.00 44.62 ? 101 ASN A CG  1 
ATOM 466  O OD1 . ASN A 1 75  ? 2.436   -18.678 -7.463  1.00 44.95 ? 101 ASN A OD1 1 
ATOM 467  N ND2 . ASN A 1 75  ? 1.431   -20.526 -6.667  1.00 44.34 ? 101 ASN A ND2 1 
ATOM 468  N N   . ARG A 1 76  ? -2.617  -17.510 -8.980  1.00 44.43 ? 102 ARG A N   1 
ATOM 469  C CA  . ARG A 1 76  ? -3.603  -17.141 -10.000 1.00 44.56 ? 102 ARG A CA  1 
ATOM 470  C C   . ARG A 1 76  ? -3.836  -15.632 -10.006 1.00 44.59 ? 102 ARG A C   1 
ATOM 471  O O   . ARG A 1 76  ? -3.970  -15.015 -8.947  1.00 44.57 ? 102 ARG A O   1 
ATOM 472  C CB  . ARG A 1 76  ? -4.935  -17.874 -9.780  1.00 44.61 ? 102 ARG A CB  1 
ATOM 473  C CG  . ARG A 1 76  ? -4.831  -19.367 -9.453  1.00 44.88 ? 102 ARG A CG  1 
ATOM 474  C CD  . ARG A 1 76  ? -4.270  -20.200 -10.600 1.00 45.48 ? 102 ARG A CD  1 
ATOM 475  N NE  . ARG A 1 76  ? -5.183  -20.295 -11.738 1.00 46.09 ? 102 ARG A NE  1 
ATOM 476  C CZ  . ARG A 1 76  ? -5.178  -21.291 -12.625 1.00 46.61 ? 102 ARG A CZ  1 
ATOM 477  N NH1 . ARG A 1 76  ? -4.317  -22.296 -12.506 1.00 46.75 ? 102 ARG A NH1 1 
ATOM 478  N NH2 . ARG A 1 76  ? -6.042  -21.291 -13.633 1.00 46.68 ? 102 ARG A NH2 1 
ATOM 479  N N   . GLU A 1 77  ? -3.884  -15.044 -11.202 1.00 44.69 ? 103 GLU A N   1 
ATOM 480  C CA  . GLU A 1 77  ? -4.066  -13.597 -11.346 1.00 44.71 ? 103 GLU A CA  1 
ATOM 481  C C   . GLU A 1 77  ? -5.478  -13.254 -11.824 1.00 44.67 ? 103 GLU A C   1 
ATOM 482  O O   . GLU A 1 77  ? -6.357  -12.934 -11.023 1.00 44.33 ? 103 GLU A O   1 
ATOM 483  C CB  . GLU A 1 77  ? -3.015  -13.013 -12.300 1.00 44.70 ? 103 GLU A CB  1 
ATOM 484  C CG  . GLU A 1 77  ? -2.774  -11.509 -12.123 1.00 44.76 ? 103 GLU A CG  1 
ATOM 485  C CD  . GLU A 1 77  ? -1.603  -10.979 -12.950 1.00 44.71 ? 103 GLU A CD  1 
ATOM 486  O OE1 . GLU A 1 77  ? -0.955  -11.772 -13.667 1.00 44.79 ? 103 GLU A OE1 1 
ATOM 487  O OE2 . GLU A 1 77  ? -1.330  -9.761  -12.880 1.00 44.36 ? 103 GLU A OE2 1 
ATOM 488  N N   . GLU A 1 81  ? -9.650  -14.629 -14.290 1.00 36.34 ? 107 GLU A N   1 
ATOM 489  C CA  . GLU A 1 81  ? -11.027 -14.900 -14.690 1.00 36.48 ? 107 GLU A CA  1 
ATOM 490  C C   . GLU A 1 81  ? -11.886 -15.410 -13.523 1.00 36.57 ? 107 GLU A C   1 
ATOM 491  O O   . GLU A 1 81  ? -12.254 -14.639 -12.632 1.00 36.51 ? 107 GLU A O   1 
ATOM 492  C CB  . GLU A 1 81  ? -11.059 -15.877 -15.870 1.00 36.44 ? 107 GLU A CB  1 
ATOM 493  N N   . GLU A 1 82  ? -12.205 -16.703 -13.531 1.00 36.76 ? 108 GLU A N   1 
ATOM 494  C CA  . GLU A 1 82  ? -13.068 -17.303 -12.504 1.00 36.87 ? 108 GLU A CA  1 
ATOM 495  C C   . GLU A 1 82  ? -12.247 -18.088 -11.473 1.00 36.85 ? 108 GLU A C   1 
ATOM 496  O O   . GLU A 1 82  ? -12.584 -19.222 -11.119 1.00 36.79 ? 108 GLU A O   1 
ATOM 497  C CB  . GLU A 1 82  ? -14.148 -18.184 -13.159 1.00 36.79 ? 108 GLU A CB  1 
ATOM 498  C CG  . GLU A 1 82  ? -15.241 -17.395 -13.895 1.00 36.71 ? 108 GLU A CG  1 
ATOM 499  C CD  . GLU A 1 82  ? -15.650 -18.008 -15.242 1.00 36.94 ? 108 GLU A CD  1 
ATOM 500  O OE1 . GLU A 1 82  ? -15.411 -19.216 -15.472 1.00 36.41 ? 108 GLU A OE1 1 
ATOM 501  O OE2 . GLU A 1 82  ? -16.220 -17.272 -16.078 1.00 36.66 ? 108 GLU A OE2 1 
ATOM 502  N N   . ASP A 1 83  ? -11.165 -17.468 -11.003 1.00 36.86 ? 109 ASP A N   1 
ATOM 503  C CA  . ASP A 1 83  ? -10.235 -18.105 -10.069 1.00 36.89 ? 109 ASP A CA  1 
ATOM 504  C C   . ASP A 1 83  ? -10.267 -17.432 -8.698  1.00 36.84 ? 109 ASP A C   1 
ATOM 505  O O   . ASP A 1 83  ? -9.231  -17.026 -8.157  1.00 36.88 ? 109 ASP A O   1 
ATOM 506  C CB  . ASP A 1 83  ? -8.810  -18.148 -10.648 1.00 36.91 ? 109 ASP A CB  1 
ATOM 507  C CG  . ASP A 1 83  ? -8.419  -16.860 -11.351 1.00 37.13 ? 109 ASP A CG  1 
ATOM 508  O OD1 . ASP A 1 83  ? -8.480  -15.784 -10.716 1.00 37.43 ? 109 ASP A OD1 1 
ATOM 509  O OD2 . ASP A 1 83  ? -8.039  -16.928 -12.542 1.00 36.71 ? 109 ASP A OD2 1 
ATOM 510  N N   . HIS A 1 84  ? -11.477 -17.337 -8.148  1.00 36.68 ? 110 HIS A N   1 
ATOM 511  C CA  . HIS A 1 84  ? -11.736 -16.670 -6.880  1.00 36.39 ? 110 HIS A CA  1 
ATOM 512  C C   . HIS A 1 84  ? -12.233 -17.673 -5.846  1.00 36.24 ? 110 HIS A C   1 
ATOM 513  O O   . HIS A 1 84  ? -13.226 -18.376 -6.069  1.00 36.32 ? 110 HIS A O   1 
ATOM 514  C CB  . HIS A 1 84  ? -12.763 -15.556 -7.075  1.00 36.46 ? 110 HIS A CB  1 
ATOM 515  C CG  . HIS A 1 84  ? -12.337 -14.512 -8.058  1.00 36.84 ? 110 HIS A CG  1 
ATOM 516  N ND1 . HIS A 1 84  ? -11.760 -13.320 -7.674  1.00 37.19 ? 110 HIS A ND1 1 
ATOM 517  C CD2 . HIS A 1 84  ? -12.390 -14.487 -9.411  1.00 37.42 ? 110 HIS A CD2 1 
ATOM 518  C CE1 . HIS A 1 84  ? -11.483 -12.603 -8.750  1.00 37.79 ? 110 HIS A CE1 1 
ATOM 519  N NE2 . HIS A 1 84  ? -11.854 -13.289 -9.817  1.00 37.63 ? 110 HIS A NE2 1 
ATOM 520  N N   . ALA A 1 85  ? -11.538 -17.733 -4.716  1.00 35.84 ? 111 ALA A N   1 
ATOM 521  C CA  . ALA A 1 85  ? -11.782 -18.774 -3.728  1.00 35.57 ? 111 ALA A CA  1 
ATOM 522  C C   . ALA A 1 85  ? -12.835 -18.375 -2.701  1.00 35.36 ? 111 ALA A C   1 
ATOM 523  O O   . ALA A 1 85  ? -12.796 -17.282 -2.143  1.00 35.49 ? 111 ALA A O   1 
ATOM 524  C CB  . ALA A 1 85  ? -10.483 -19.168 -3.048  1.00 35.52 ? 111 ALA A CB  1 
ATOM 525  N N   . GLY A 1 86  ? -13.785 -19.271 -2.464  1.00 35.18 ? 112 GLY A N   1 
ATOM 526  C CA  . GLY A 1 86  ? -14.848 -19.020 -1.502  1.00 34.73 ? 112 GLY A CA  1 
ATOM 527  C C   . GLY A 1 86  ? -15.813 -17.934 -1.935  1.00 34.35 ? 112 GLY A C   1 
ATOM 528  O O   . GLY A 1 86  ? -15.742 -17.433 -3.060  1.00 34.40 ? 112 GLY A O   1 
ATOM 529  N N   . THR A 1 87  ? -16.710 -17.572 -1.021  1.00 33.95 ? 113 THR A N   1 
ATOM 530  C CA  . THR A 1 87  ? -17.809 -16.651 -1.303  1.00 33.49 ? 113 THR A CA  1 
ATOM 531  C C   . THR A 1 87  ? -17.973 -15.683 -0.146  1.00 33.23 ? 113 THR A C   1 
ATOM 532  O O   . THR A 1 87  ? -17.817 -16.069 1.022   1.00 33.38 ? 113 THR A O   1 
ATOM 533  C CB  . THR A 1 87  ? -19.169 -17.403 -1.513  1.00 33.62 ? 113 THR A CB  1 
ATOM 534  O OG1 . THR A 1 87  ? -19.379 -18.345 -0.452  1.00 33.03 ? 113 THR A OG1 1 
ATOM 535  C CG2 . THR A 1 87  ? -19.211 -18.138 -2.864  1.00 33.62 ? 113 THR A CG2 1 
ATOM 536  N N   . PHE A 1 88  ? -18.297 -14.433 -0.465  1.00 32.65 ? 114 PHE A N   1 
ATOM 537  C CA  . PHE A 1 88  ? -18.559 -13.434 0.564   1.00 32.26 ? 114 PHE A CA  1 
ATOM 538  C C   . PHE A 1 88  ? -20.038 -13.363 0.928   1.00 32.04 ? 114 PHE A C   1 
ATOM 539  O O   . PHE A 1 88  ? -20.903 -13.656 0.105   1.00 31.74 ? 114 PHE A O   1 
ATOM 540  C CB  . PHE A 1 88  ? -18.053 -12.055 0.138   1.00 32.37 ? 114 PHE A CB  1 
ATOM 541  C CG  . PHE A 1 88  ? -16.559 -11.930 0.143   1.00 32.22 ? 114 PHE A CG  1 
ATOM 542  C CD1 . PHE A 1 88  ? -15.867 -11.739 1.341   1.00 32.93 ? 114 PHE A CD1 1 
ATOM 543  C CD2 . PHE A 1 88  ? -15.841 -11.995 -1.049  1.00 31.76 ? 114 PHE A CD2 1 
ATOM 544  C CE1 . PHE A 1 88  ? -14.479 -11.620 1.356   1.00 32.84 ? 114 PHE A CE1 1 
ATOM 545  C CE2 . PHE A 1 88  ? -14.459 -11.883 -1.055  1.00 32.51 ? 114 PHE A CE2 1 
ATOM 546  C CZ  . PHE A 1 88  ? -13.770 -11.694 0.150   1.00 33.51 ? 114 PHE A CZ  1 
ATOM 547  N N   . GLN A 1 89  ? -20.307 -12.983 2.175   1.00 31.76 ? 115 GLN A N   1 
ATOM 548  C CA  . GLN A 1 89  ? -21.662 -12.758 2.661   1.00 31.51 ? 115 GLN A CA  1 
ATOM 549  C C   . GLN A 1 89  ? -21.722 -11.401 3.339   1.00 31.26 ? 115 GLN A C   1 
ATOM 550  O O   . GLN A 1 89  ? -20.951 -11.134 4.259   1.00 31.24 ? 115 GLN A O   1 
ATOM 551  C CB  . GLN A 1 89  ? -22.037 -13.808 3.697   1.00 31.59 ? 115 GLN A CB  1 
ATOM 552  C CG  . GLN A 1 89  ? -22.693 -15.065 3.198   1.00 31.70 ? 115 GLN A CG  1 
ATOM 553  C CD  . GLN A 1 89  ? -23.425 -15.771 4.329   1.00 32.17 ? 115 GLN A CD  1 
ATOM 554  O OE1 . GLN A 1 89  ? -24.413 -15.257 4.849   1.00 32.45 ? 115 GLN A OE1 1 
ATOM 555  N NE2 . GLN A 1 89  ? -22.933 -16.939 4.729   1.00 31.62 ? 115 GLN A NE2 1 
ATOM 556  N N   . ILE A 1 90  ? -22.656 -10.563 2.903   1.00 30.98 ? 116 ILE A N   1 
ATOM 557  C CA  . ILE A 1 90  ? -22.825 -9.215  3.441   1.00 30.73 ? 116 ILE A CA  1 
ATOM 558  C C   . ILE A 1 90  ? -23.375 -9.256  4.861   1.00 30.73 ? 116 ILE A C   1 
ATOM 559  O O   . ILE A 1 90  ? -24.360 -9.943  5.124   1.00 30.79 ? 116 ILE A O   1 
ATOM 560  C CB  . ILE A 1 90  ? -23.788 -8.397  2.565   1.00 30.61 ? 116 ILE A CB  1 
ATOM 561  C CG1 . ILE A 1 90  ? -23.345 -8.430  1.100   1.00 30.88 ? 116 ILE A CG1 1 
ATOM 562  C CG2 . ILE A 1 90  ? -23.922 -6.970  3.077   1.00 30.15 ? 116 ILE A CG2 1 
ATOM 563  C CD1 . ILE A 1 90  ? -24.548 -8.533  0.125   1.00 32.60 ? 116 ILE A CD1 1 
ATOM 564  N N   . ILE A 1 91  ? -22.736 -8.516  5.769   1.00 30.76 ? 117 ILE A N   1 
ATOM 565  C CA  . ILE A 1 91  ? -23.222 -8.370  7.146   1.00 30.61 ? 117 ILE A CA  1 
ATOM 566  C C   . ILE A 1 91  ? -23.956 -7.046  7.353   1.00 30.97 ? 117 ILE A C   1 
ATOM 567  O O   . ILE A 1 91  ? -25.083 -7.030  7.844   1.00 30.83 ? 117 ILE A O   1 
ATOM 568  C CB  . ILE A 1 91  ? -22.081 -8.482  8.176   1.00 30.47 ? 117 ILE A CB  1 
ATOM 569  C CG1 . ILE A 1 91  ? -21.315 -9.798  7.979   1.00 30.06 ? 117 ILE A CG1 1 
ATOM 570  C CG2 . ILE A 1 91  ? -22.629 -8.321  9.608   1.00 30.01 ? 117 ILE A CG2 1 
ATOM 571  C CD1 . ILE A 1 91  ? -20.050 -9.906  8.771   1.00 29.24 ? 117 ILE A CD1 1 
ATOM 572  N N   . ASP A 1 92  ? -23.300 -5.946  6.989   1.00 31.59 ? 118 ASP A N   1 
ATOM 573  C CA  . ASP A 1 92  ? -23.867 -4.608  7.120   1.00 32.20 ? 118 ASP A CA  1 
ATOM 574  C C   . ASP A 1 92  ? -24.250 -4.049  5.756   1.00 32.45 ? 118 ASP A C   1 
ATOM 575  O O   . ASP A 1 92  ? -23.389 -3.627  4.967   1.00 32.63 ? 118 ASP A O   1 
ATOM 576  C CB  . ASP A 1 92  ? -22.877 -3.663  7.806   1.00 32.35 ? 118 ASP A CB  1 
ATOM 577  C CG  . ASP A 1 92  ? -22.574 -4.063  9.234   1.00 33.31 ? 118 ASP A CG  1 
ATOM 578  O OD1 . ASP A 1 92  ? -23.313 -4.906  9.803   1.00 34.62 ? 118 ASP A OD1 1 
ATOM 579  O OD2 . ASP A 1 92  ? -21.591 -3.525  9.792   1.00 33.52 ? 118 ASP A OD2 1 
ATOM 580  N N   . GLU A 1 93  ? -25.549 -4.041  5.488   1.00 32.49 ? 119 GLU A N   1 
ATOM 581  C CA  . GLU A 1 93  ? -26.062 -3.541  4.218   1.00 32.71 ? 119 GLU A CA  1 
ATOM 582  C C   . GLU A 1 93  ? -26.047 -2.014  4.143   1.00 32.45 ? 119 GLU A C   1 
ATOM 583  O O   . GLU A 1 93  ? -26.175 -1.446  3.063   1.00 32.42 ? 119 GLU A O   1 
ATOM 584  C CB  . GLU A 1 93  ? -27.456 -4.108  3.952   1.00 32.81 ? 119 GLU A CB  1 
ATOM 585  C CG  . GLU A 1 93  ? -27.523 -5.618  4.176   1.00 33.70 ? 119 GLU A CG  1 
ATOM 586  C CD  . GLU A 1 93  ? -28.527 -6.311  3.279   1.00 35.47 ? 119 GLU A CD  1 
ATOM 587  O OE1 . GLU A 1 93  ? -28.794 -5.801  2.165   1.00 36.05 ? 119 GLU A OE1 1 
ATOM 588  O OE2 . GLU A 1 93  ? -29.045 -7.375  3.690   1.00 36.13 ? 119 GLU A OE2 1 
ATOM 589  N N   . GLU A 1 94  ? -25.864 -1.366  5.293   1.00 32.36 ? 120 GLU A N   1 
ATOM 590  C CA  . GLU A 1 94  ? -25.707 0.089   5.363   1.00 32.24 ? 120 GLU A CA  1 
ATOM 591  C C   . GLU A 1 94  ? -24.274 0.546   5.071   1.00 32.26 ? 120 GLU A C   1 
ATOM 592  O O   . GLU A 1 94  ? -24.010 1.742   4.968   1.00 32.04 ? 120 GLU A O   1 
ATOM 593  C CB  . GLU A 1 94  ? -26.135 0.617   6.733   1.00 32.04 ? 120 GLU A CB  1 
ATOM 594  C CG  . GLU A 1 94  ? -27.492 0.125   7.205   1.00 32.46 ? 120 GLU A CG  1 
ATOM 595  C CD  . GLU A 1 94  ? -27.396 -1.053  8.166   1.00 32.70 ? 120 GLU A CD  1 
ATOM 596  O OE1 . GLU A 1 94  ? -28.382 -1.292  8.900   1.00 32.36 ? 120 GLU A OE1 1 
ATOM 597  O OE2 . GLU A 1 94  ? -26.343 -1.729  8.196   1.00 32.21 ? 120 GLU A OE2 1 
ATOM 598  N N   . GLU A 1 95  ? -23.349 -0.403  4.957   1.00 32.44 ? 121 GLU A N   1 
ATOM 599  C CA  . GLU A 1 95  ? -21.949 -0.073  4.724   1.00 32.77 ? 121 GLU A CA  1 
ATOM 600  C C   . GLU A 1 95  ? -21.437 -0.719  3.446   1.00 32.79 ? 121 GLU A C   1 
ATOM 601  O O   . GLU A 1 95  ? -20.707 -0.090  2.676   1.00 32.70 ? 121 GLU A O   1 
ATOM 602  C CB  . GLU A 1 95  ? -21.056 -0.495  5.907   1.00 32.73 ? 121 GLU A CB  1 
ATOM 603  C CG  . GLU A 1 95  ? -21.556 -0.125  7.313   1.00 34.23 ? 121 GLU A CG  1 
ATOM 604  C CD  . GLU A 1 95  ? -21.813 1.368   7.525   1.00 36.47 ? 121 GLU A CD  1 
ATOM 605  O OE1 . GLU A 1 95  ? -21.248 2.205   6.787   1.00 38.01 ? 121 GLU A OE1 1 
ATOM 606  O OE2 . GLU A 1 95  ? -22.584 1.712   8.450   1.00 37.14 ? 121 GLU A OE2 1 
ATOM 607  N N   . THR A 1 96  ? -21.838 -1.969  3.224   1.00 32.79 ? 122 THR A N   1 
ATOM 608  C CA  . THR A 1 96  ? -21.250 -2.796  2.173   1.00 32.76 ? 122 THR A CA  1 
ATOM 609  C C   . THR A 1 96  ? -22.287 -3.267  1.177   1.00 32.87 ? 122 THR A C   1 
ATOM 610  O O   . THR A 1 96  ? -23.476 -3.301  1.479   1.00 32.93 ? 122 THR A O   1 
ATOM 611  C CB  . THR A 1 96  ? -20.577 -4.062  2.757   1.00 32.70 ? 122 THR A CB  1 
ATOM 612  O OG1 . THR A 1 96  ? -21.546 -4.810  3.501   1.00 32.23 ? 122 THR A OG1 1 
ATOM 613  C CG2 . THR A 1 96  ? -19.396 -3.701  3.664   1.00 32.35 ? 122 THR A CG2 1 
ATOM 614  N N   . GLN A 1 97  ? -21.809 -3.637  -0.007  1.00 33.01 ? 123 GLN A N   1 
ATOM 615  C CA  . GLN A 1 97  ? -22.622 -4.243  -1.051  1.00 33.37 ? 123 GLN A CA  1 
ATOM 616  C C   . GLN A 1 97  ? -21.700 -5.005  -1.990  1.00 33.50 ? 123 GLN A C   1 
ATOM 617  O O   . GLN A 1 97  ? -20.487 -4.770  -2.000  1.00 33.48 ? 123 GLN A O   1 
ATOM 618  C CB  . GLN A 1 97  ? -23.423 -3.179  -1.826  1.00 33.14 ? 123 GLN A CB  1 
ATOM 619  C CG  . GLN A 1 97  ? -22.600 -2.231  -2.702  1.00 33.40 ? 123 GLN A CG  1 
ATOM 620  C CD  . GLN A 1 97  ? -23.452 -1.180  -3.404  1.00 33.98 ? 123 GLN A CD  1 
ATOM 621  O OE1 . GLN A 1 97  ? -23.610 -1.204  -4.626  1.00 35.07 ? 123 GLN A OE1 1 
ATOM 622  N NE2 . GLN A 1 97  ? -24.011 -0.256  -2.632  1.00 34.76 ? 123 GLN A NE2 1 
ATOM 623  N N   . PHE A 1 98  ? -22.265 -5.935  -2.755  1.00 33.85 ? 124 PHE A N   1 
ATOM 624  C CA  . PHE A 1 98  ? -21.544 -6.520  -3.876  1.00 34.12 ? 124 PHE A CA  1 
ATOM 625  C C   . PHE A 1 98  ? -21.525 -5.473  -4.968  1.00 34.36 ? 124 PHE A C   1 
ATOM 626  O O   . PHE A 1 98  ? -22.516 -4.771  -5.177  1.00 34.24 ? 124 PHE A O   1 
ATOM 627  C CB  . PHE A 1 98  ? -22.220 -7.796  -4.382  1.00 34.22 ? 124 PHE A CB  1 
ATOM 628  C CG  . PHE A 1 98  ? -21.927 -9.017  -3.553  1.00 34.38 ? 124 PHE A CG  1 
ATOM 629  C CD1 . PHE A 1 98  ? -22.946 -9.657  -2.857  1.00 34.44 ? 124 PHE A CD1 1 
ATOM 630  C CD2 . PHE A 1 98  ? -20.637 -9.536  -3.478  1.00 34.67 ? 124 PHE A CD2 1 
ATOM 631  C CE1 . PHE A 1 98  ? -22.686 -10.793 -2.090  1.00 34.34 ? 124 PHE A CE1 1 
ATOM 632  C CE2 . PHE A 1 98  ? -20.366 -10.669 -2.715  1.00 35.14 ? 124 PHE A CE2 1 
ATOM 633  C CZ  . PHE A 1 98  ? -21.397 -11.297 -2.018  1.00 34.77 ? 124 PHE A CZ  1 
ATOM 634  N N   . MET A 1 99  ? -20.392 -5.350  -5.648  1.00 34.84 ? 125 MET A N   1 
ATOM 635  C CA  . MET A 1 99  ? -20.253 -4.365  -6.709  1.00 35.44 ? 125 MET A CA  1 
ATOM 636  C C   . MET A 1 99  ? -20.985 -4.829  -7.967  1.00 35.71 ? 125 MET A C   1 
ATOM 637  O O   . MET A 1 99  ? -20.682 -5.889  -8.513  1.00 35.61 ? 125 MET A O   1 
ATOM 638  C CB  . MET A 1 99  ? -18.779 -4.112  -7.006  1.00 35.16 ? 125 MET A CB  1 
ATOM 639  C CG  . MET A 1 99  ? -18.541 -2.840  -7.786  1.00 35.45 ? 125 MET A CG  1 
ATOM 640  S SD  . MET A 1 99  ? -16.813 -2.600  -8.231  1.00 36.10 ? 125 MET A SD  1 
ATOM 641  C CE  . MET A 1 99  ? -16.147 -1.960  -6.699  1.00 35.18 ? 125 MET A CE  1 
ATOM 642  N N   . SER A 1 100 ? -21.956 -4.041  -8.421  1.00 36.31 ? 126 SER A N   1 
ATOM 643  C CA  . SER A 1 100 ? -22.683 -4.381  -9.652  1.00 37.05 ? 126 SER A CA  1 
ATOM 644  C C   . SER A 1 100 ? -21.766 -4.295  -10.871 1.00 37.47 ? 126 SER A C   1 
ATOM 645  O O   . SER A 1 100 ? -22.081 -4.822  -11.942 1.00 37.50 ? 126 SER A O   1 
ATOM 646  C CB  . SER A 1 100 ? -23.924 -3.503  -9.833  1.00 37.01 ? 126 SER A CB  1 
ATOM 647  O OG  . SER A 1 100 ? -23.621 -2.138  -9.630  1.00 37.46 ? 126 SER A OG  1 
ATOM 648  N N   . ASN A 1 101 ? -20.626 -3.632  -10.683 1.00 38.05 ? 127 ASN A N   1 
ATOM 649  C CA  . ASN A 1 101 ? -19.587 -3.523  -11.700 1.00 38.62 ? 127 ASN A CA  1 
ATOM 650  C C   . ASN A 1 101 ? -18.710 -4.784  -11.753 1.00 38.87 ? 127 ASN A C   1 
ATOM 651  O O   . ASN A 1 101 ? -18.236 -5.172  -12.823 1.00 38.99 ? 127 ASN A O   1 
ATOM 652  C CB  . ASN A 1 101 ? -18.728 -2.275  -11.448 1.00 38.74 ? 127 ASN A CB  1 
ATOM 653  C CG  . ASN A 1 101 ? -19.565 -1.021  -11.180 1.00 38.73 ? 127 ASN A CG  1 
ATOM 654  O OD1 . ASN A 1 101 ? -19.807 -0.654  -10.022 1.00 37.99 ? 127 ASN A OD1 1 
ATOM 655  N ND2 . ASN A 1 101 ? -20.008 -0.362  -12.252 1.00 37.66 ? 127 ASN A ND2 1 
ATOM 656  N N   . CYS A 1 102 ? -18.505 -5.405  -10.590 1.00 39.29 ? 128 CYS A N   1 
ATOM 657  C CA  . CYS A 1 102 ? -17.761 -6.666  -10.457 1.00 39.41 ? 128 CYS A CA  1 
ATOM 658  C C   . CYS A 1 102 ? -18.380 -7.469  -9.316  1.00 39.28 ? 128 CYS A C   1 
ATOM 659  O O   . CYS A 1 102 ? -18.066 -7.218  -8.151  1.00 39.43 ? 128 CYS A O   1 
ATOM 660  C CB  . CYS A 1 102 ? -16.273 -6.402  -10.178 1.00 39.58 ? 128 CYS A CB  1 
ATOM 661  S SG  . CYS A 1 102 ? -15.083 -7.720  -10.634 1.00 39.98 ? 128 CYS A SG  1 
ATOM 662  N N   . PRO A 1 103 ? -19.268 -8.429  -9.645  1.00 39.11 ? 129 PRO A N   1 
ATOM 663  C CA  . PRO A 1 103 ? -20.092 -9.131  -8.644  1.00 39.04 ? 129 PRO A CA  1 
ATOM 664  C C   . PRO A 1 103 ? -19.294 -9.940  -7.618  1.00 38.92 ? 129 PRO A C   1 
ATOM 665  O O   . PRO A 1 103 ? -19.769 -10.170 -6.506  1.00 39.01 ? 129 PRO A O   1 
ATOM 666  C CB  . PRO A 1 103 ? -20.978 -10.054 -9.493  1.00 39.10 ? 129 PRO A CB  1 
ATOM 667  C CG  . PRO A 1 103 ? -20.258 -10.202 -10.789 1.00 39.15 ? 129 PRO A CG  1 
ATOM 668  C CD  . PRO A 1 103 ? -19.534 -8.910  -11.013 1.00 39.14 ? 129 PRO A CD  1 
ATOM 669  N N   . VAL A 1 104 ? -18.088 -10.352 -7.992  1.00 38.73 ? 130 VAL A N   1 
ATOM 670  C CA  . VAL A 1 104 ? -17.221 -11.146 -7.125  1.00 38.45 ? 130 VAL A CA  1 
ATOM 671  C C   . VAL A 1 104 ? -16.506 -10.280 -6.063  1.00 38.18 ? 130 VAL A C   1 
ATOM 672  O O   . VAL A 1 104 ? -15.803 -10.794 -5.179  1.00 38.14 ? 130 VAL A O   1 
ATOM 673  C CB  . VAL A 1 104 ? -16.206 -11.954 -7.981  1.00 38.58 ? 130 VAL A CB  1 
ATOM 674  C CG1 . VAL A 1 104 ? -15.069 -11.055 -8.484  1.00 38.56 ? 130 VAL A CG1 1 
ATOM 675  C CG2 . VAL A 1 104 ? -15.677 -13.163 -7.213  1.00 38.75 ? 130 VAL A CG2 1 
ATOM 676  N N   . ALA A 1 105 ? -16.695 -8.967  -6.155  1.00 37.67 ? 131 ALA A N   1 
ATOM 677  C CA  . ALA A 1 105 ? -16.070 -8.035  -5.227  1.00 37.21 ? 131 ALA A CA  1 
ATOM 678  C C   . ALA A 1 105 ? -17.076 -7.437  -4.256  1.00 36.95 ? 131 ALA A C   1 
ATOM 679  O O   . ALA A 1 105 ? -18.238 -7.218  -4.596  1.00 37.16 ? 131 ALA A O   1 
ATOM 680  C CB  . ALA A 1 105 ? -15.352 -6.935  -5.980  1.00 36.96 ? 131 ALA A CB  1 
ATOM 681  N N   . VAL A 1 106 ? -16.615 -7.191  -3.039  1.00 36.63 ? 132 VAL A N   1 
ATOM 682  C CA  . VAL A 1 106 ? -17.381 -6.460  -2.048  1.00 36.42 ? 132 VAL A CA  1 
ATOM 683  C C   . VAL A 1 106 ? -16.823 -5.043  -1.983  1.00 36.30 ? 132 VAL A C   1 
ATOM 684  O O   . VAL A 1 106 ? -15.617 -4.844  -1.970  1.00 36.22 ? 132 VAL A O   1 
ATOM 685  C CB  . VAL A 1 106 ? -17.330 -7.159  -0.657  1.00 36.43 ? 132 VAL A CB  1 
ATOM 686  C CG1 . VAL A 1 106 ? -17.641 -6.184  0.479   1.00 36.25 ? 132 VAL A CG1 1 
ATOM 687  C CG2 . VAL A 1 106 ? -18.289 -8.338  -0.626  1.00 35.85 ? 132 VAL A CG2 1 
ATOM 688  N N   . THR A 1 107 ? -17.716 -4.064  -1.953  1.00 36.29 ? 133 THR A N   1 
ATOM 689  C CA  . THR A 1 107 ? -17.326 -2.671  -1.908  1.00 36.38 ? 133 THR A CA  1 
ATOM 690  C C   . THR A 1 107 ? -18.283 -1.869  -1.017  1.00 36.62 ? 133 THR A C   1 
ATOM 691  O O   . THR A 1 107 ? -19.352 -2.359  -0.629  1.00 36.61 ? 133 THR A O   1 
ATOM 692  C CB  . THR A 1 107 ? -17.268 -2.082  -3.337  1.00 36.40 ? 133 THR A CB  1 
ATOM 693  O OG1 . THR A 1 107 ? -16.711 -0.762  -3.302  1.00 36.58 ? 133 THR A OG1 1 
ATOM 694  C CG2 . THR A 1 107 ? -18.661 -2.045  -3.974  1.00 36.25 ? 133 THR A CG2 1 
ATOM 695  N N   . GLU A 1 108 ? -17.871 -0.649  -0.688  1.00 36.85 ? 134 GLU A N   1 
ATOM 696  C CA  . GLU A 1 108 ? -18.669 0.320   0.059   1.00 37.46 ? 134 GLU A CA  1 
ATOM 697  C C   . GLU A 1 108 ? -20.018 0.611   -0.603  1.00 37.88 ? 134 GLU A C   1 
ATOM 698  O O   . GLU A 1 108 ? -20.140 0.541   -1.827  1.00 37.92 ? 134 GLU A O   1 
ATOM 699  C CB  . GLU A 1 108 ? -17.894 1.627   0.148   1.00 37.69 ? 134 GLU A CB  1 
ATOM 700  C CG  . GLU A 1 108 ? -17.074 1.931   -1.137  1.00 38.53 ? 134 GLU A CG  1 
ATOM 701  C CD  . GLU A 1 108 ? -17.374 3.288   -1.728  1.00 38.97 ? 134 GLU A CD  1 
ATOM 702  O OE1 . GLU A 1 108 ? -17.328 4.299   -0.996  1.00 38.83 ? 134 GLU A OE1 1 
ATOM 703  O OE2 . GLU A 1 108 ? -17.659 3.345   -2.942  1.00 40.85 ? 134 GLU A OE2 1 
ATOM 704  N N   . SER A 1 109 ? -21.021 0.953   0.204   1.00 38.19 ? 135 SER A N   1 
ATOM 705  C CA  . SER A 1 109 ? -22.330 1.333   -0.325  1.00 38.77 ? 135 SER A CA  1 
ATOM 706  C C   . SER A 1 109 ? -22.574 2.847   -0.265  1.00 39.14 ? 135 SER A C   1 
ATOM 707  O O   . SER A 1 109 ? -23.507 3.356   -0.889  1.00 39.12 ? 135 SER A O   1 
ATOM 708  C CB  . SER A 1 109 ? -23.461 0.548   0.357   1.00 38.70 ? 135 SER A CB  1 
ATOM 709  O OG  . SER A 1 109 ? -23.496 0.765   1.754   1.00 38.88 ? 135 SER A OG  1 
ATOM 710  N N   . THR A 1 110 ? -21.719 3.552   0.477   1.00 39.57 ? 136 THR A N   1 
ATOM 711  C CA  . THR A 1 110 ? -21.753 5.016   0.584   1.00 39.82 ? 136 THR A CA  1 
ATOM 712  C C   . THR A 1 110 ? -20.309 5.505   0.685   1.00 39.86 ? 136 THR A C   1 
ATOM 713  O O   . THR A 1 110 ? -19.479 4.821   1.292   1.00 39.99 ? 136 THR A O   1 
ATOM 714  C CB  . THR A 1 110 ? -22.517 5.466   1.851   1.00 39.86 ? 136 THR A CB  1 
ATOM 715  O OG1 . THR A 1 110 ? -23.765 4.769   1.929   1.00 40.72 ? 136 THR A OG1 1 
ATOM 716  C CG2 . THR A 1 110 ? -22.782 6.973   1.854   1.00 39.50 ? 136 THR A CG2 1 
ATOM 717  N N   . PRO A 1 111 ? -19.989 6.668   0.076   1.00 39.80 ? 137 PRO A N   1 
ATOM 718  C CA  . PRO A 1 111 ? -18.653 7.243   0.277   1.00 39.92 ? 137 PRO A CA  1 
ATOM 719  C C   . PRO A 1 111 ? -18.450 7.989   1.610   1.00 39.90 ? 137 PRO A C   1 
ATOM 720  O O   . PRO A 1 111 ? -17.533 8.797   1.720   1.00 40.20 ? 137 PRO A O   1 
ATOM 721  C CB  . PRO A 1 111 ? -18.503 8.198   -0.916  1.00 39.76 ? 137 PRO A CB  1 
ATOM 722  C CG  . PRO A 1 111 ? -19.886 8.607   -1.237  1.00 39.89 ? 137 PRO A CG  1 
ATOM 723  C CD  . PRO A 1 111 ? -20.795 7.468   -0.864  1.00 39.72 ? 137 PRO A CD  1 
ATOM 724  N N   . ARG A 1 112 ? -19.278 7.708   2.610   1.00 39.97 ? 138 ARG A N   1 
ATOM 725  C CA  . ARG A 1 112 ? -19.153 8.339   3.926   1.00 40.30 ? 138 ARG A CA  1 
ATOM 726  C C   . ARG A 1 112 ? -17.983 7.754   4.724   1.00 40.09 ? 138 ARG A C   1 
ATOM 727  O O   . ARG A 1 112 ? -17.670 6.573   4.584   1.00 40.24 ? 138 ARG A O   1 
ATOM 728  C CB  . ARG A 1 112 ? -20.463 8.169   4.696   1.00 40.60 ? 138 ARG A CB  1 
ATOM 729  C CG  . ARG A 1 112 ? -20.431 8.652   6.136   1.00 42.17 ? 138 ARG A CG  1 
ATOM 730  C CD  . ARG A 1 112 ? -21.533 7.994   6.957   1.00 43.80 ? 138 ARG A CD  1 
ATOM 731  N NE  . ARG A 1 112 ? -21.413 8.329   8.373   1.00 44.89 ? 138 ARG A NE  1 
ATOM 732  C CZ  . ARG A 1 112 ? -20.912 7.522   9.304   1.00 45.64 ? 138 ARG A CZ  1 
ATOM 733  N NH1 . ARG A 1 112 ? -20.853 7.931   10.565  1.00 46.21 ? 138 ARG A NH1 1 
ATOM 734  N NH2 . ARG A 1 112 ? -20.480 6.307   8.986   1.00 46.06 ? 138 ARG A NH2 1 
ATOM 735  N N   . ARG A 1 113 ? -17.351 8.587   5.555   1.00 39.91 ? 139 ARG A N   1 
ATOM 736  C CA  . ARG A 1 113 ? -16.225 8.180   6.415   1.00 39.74 ? 139 ARG A CA  1 
ATOM 737  C C   . ARG A 1 113 ? -16.495 6.913   7.234   1.00 39.77 ? 139 ARG A C   1 
ATOM 738  O O   . ARG A 1 113 ? -17.589 6.746   7.800   1.00 39.68 ? 139 ARG A O   1 
ATOM 739  C CB  . ARG A 1 113 ? -15.875 9.289   7.407   1.00 39.72 ? 139 ARG A CB  1 
ATOM 740  C CG  . ARG A 1 113 ? -15.236 10.529  6.848   1.00 39.84 ? 139 ARG A CG  1 
ATOM 741  C CD  . ARG A 1 113 ? -15.166 11.576  7.950   1.00 40.74 ? 139 ARG A CD  1 
ATOM 742  N NE  . ARG A 1 113 ? -14.837 12.909  7.447   1.00 41.67 ? 139 ARG A NE  1 
ATOM 743  C CZ  . ARG A 1 113 ? -14.882 14.022  8.175   1.00 41.62 ? 139 ARG A CZ  1 
ATOM 744  N NH1 . ARG A 1 113 ? -15.248 13.977  9.452   1.00 41.32 ? 139 ARG A NH1 1 
ATOM 745  N NH2 . ARG A 1 113 ? -14.562 15.186  7.623   1.00 41.55 ? 139 ARG A NH2 1 
ATOM 746  N N   . ARG A 1 114 ? -15.485 6.039   7.293   1.00 39.40 ? 140 ARG A N   1 
ATOM 747  C CA  . ARG A 1 114 ? -15.489 4.847   8.150   1.00 39.04 ? 140 ARG A CA  1 
ATOM 748  C C   . ARG A 1 114 ? -14.108 4.637   8.770   1.00 38.45 ? 140 ARG A C   1 
ATOM 749  O O   . ARG A 1 114 ? -13.096 5.101   8.239   1.00 38.74 ? 140 ARG A O   1 
ATOM 750  C CB  . ARG A 1 114 ? -15.861 3.579   7.368   1.00 39.27 ? 140 ARG A CB  1 
ATOM 751  C CG  . ARG A 1 114 ? -16.808 3.761   6.211   1.00 40.81 ? 140 ARG A CG  1 
ATOM 752  C CD  . ARG A 1 114 ? -17.824 2.626   6.132   1.00 44.13 ? 140 ARG A CD  1 
ATOM 753  N NE  . ARG A 1 114 ? -18.674 2.751   4.943   1.00 46.97 ? 140 ARG A NE  1 
ATOM 754  C CZ  . ARG A 1 114 ? -19.753 3.531   4.854   1.00 49.01 ? 140 ARG A CZ  1 
ATOM 755  N NH1 . ARG A 1 114 ? -20.151 4.273   5.888   1.00 49.01 ? 140 ARG A NH1 1 
ATOM 756  N NH2 . ARG A 1 114 ? -20.452 3.562   3.723   1.00 50.39 ? 140 ARG A NH2 1 
ATOM 757  N N   . THR A 1 115 ? -14.066 3.933   9.892   1.00 37.67 ? 141 THR A N   1 
ATOM 758  C CA  . THR A 1 115 ? -12.800 3.483   10.460  1.00 37.10 ? 141 THR A CA  1 
ATOM 759  C C   . THR A 1 115 ? -12.767 1.959   10.466  1.00 36.85 ? 141 THR A C   1 
ATOM 760  O O   . THR A 1 115 ? -11.710 1.349   10.657  1.00 36.57 ? 141 THR A O   1 
ATOM 761  C CB  . THR A 1 115 ? -12.575 4.002   11.898  1.00 37.07 ? 141 THR A CB  1 
ATOM 762  O OG1 . THR A 1 115 ? -13.481 3.350   12.793  1.00 36.65 ? 141 THR A OG1 1 
ATOM 763  C CG2 . THR A 1 115 ? -12.776 5.508   11.977  1.00 36.78 ? 141 THR A CG2 1 
ATOM 764  N N   . ARG A 1 116 ? -13.940 1.357   10.262  1.00 36.58 ? 142 ARG A N   1 
ATOM 765  C CA  . ARG A 1 116 ? -14.082 -0.094  10.212  1.00 36.35 ? 142 ARG A CA  1 
ATOM 766  C C   . ARG A 1 116 ? -15.145 -0.569  9.208   1.00 35.52 ? 142 ARG A C   1 
ATOM 767  O O   . ARG A 1 116 ? -16.134 0.112   8.944   1.00 35.13 ? 142 ARG A O   1 
ATOM 768  C CB  . ARG A 1 116 ? -14.349 -0.670  11.612  1.00 36.30 ? 142 ARG A CB  1 
ATOM 769  C CG  . ARG A 1 116 ? -14.010 -2.154  11.724  1.00 37.26 ? 142 ARG A CG  1 
ATOM 770  C CD  . ARG A 1 116 ? -14.056 -2.668  13.147  1.00 37.67 ? 142 ARG A CD  1 
ATOM 771  N NE  . ARG A 1 116 ? -14.296 -4.112  13.159  1.00 40.50 ? 142 ARG A NE  1 
ATOM 772  C CZ  . ARG A 1 116 ? -15.498 -4.676  13.259  1.00 40.86 ? 142 ARG A CZ  1 
ATOM 773  N NH1 . ARG A 1 116 ? -15.613 -6.000  13.255  1.00 41.06 ? 142 ARG A NH1 1 
ATOM 774  N NH2 . ARG A 1 116 ? -16.588 -3.923  13.372  1.00 41.31 ? 142 ARG A NH2 1 
ATOM 775  N N   . ILE A 1 117 ? -14.896 -1.749  8.652   1.00 34.85 ? 143 ILE A N   1 
ATOM 776  C CA  . ILE A 1 117 ? -15.775 -2.420  7.716   1.00 34.08 ? 143 ILE A CA  1 
ATOM 777  C C   . ILE A 1 117 ? -15.629 -3.901  8.021   1.00 33.60 ? 143 ILE A C   1 
ATOM 778  O O   . ILE A 1 117 ? -14.547 -4.341  8.402   1.00 33.20 ? 143 ILE A O   1 
ATOM 779  C CB  . ILE A 1 117 ? -15.348 -2.118  6.265   1.00 34.34 ? 143 ILE A CB  1 
ATOM 780  C CG1 . ILE A 1 117 ? -16.068 -0.872  5.746   1.00 34.21 ? 143 ILE A CG1 1 
ATOM 781  C CG2 . ILE A 1 117 ? -15.533 -3.330  5.328   1.00 34.53 ? 143 ILE A CG2 1 
ATOM 782  C CD1 . ILE A 1 117 ? -17.530 -1.054  5.557   1.00 35.53 ? 143 ILE A CD1 1 
ATOM 783  N N   . GLN A 1 118 ? -16.720 -4.655  7.878   1.00 33.02 ? 144 GLN A N   1 
ATOM 784  C CA  . GLN A 1 118 ? -16.715 -6.084  8.148   1.00 32.30 ? 144 GLN A CA  1 
ATOM 785  C C   . GLN A 1 118 ? -17.586 -6.852  7.157   1.00 32.55 ? 144 GLN A C   1 
ATOM 786  O O   . GLN A 1 118 ? -18.643 -6.377  6.742   1.00 32.61 ? 144 GLN A O   1 
ATOM 787  C CB  . GLN A 1 118 ? -17.148 -6.367  9.581   1.00 31.99 ? 144 GLN A CB  1 
ATOM 788  C CG  . GLN A 1 118 ? -18.600 -6.036  9.868   1.00 31.84 ? 144 GLN A CG  1 
ATOM 789  C CD  . GLN A 1 118 ? -19.011 -6.323  11.301  1.00 31.27 ? 144 GLN A CD  1 
ATOM 790  O OE1 . GLN A 1 118 ? -18.440 -7.181  11.974  1.00 29.84 ? 144 GLN A OE1 1 
ATOM 791  N NE2 . GLN A 1 118 ? -20.011 -5.600  11.771  1.00 29.57 ? 144 GLN A NE2 1 
ATOM 792  N N   . VAL A 1 119 ? -17.123 -8.037  6.776   1.00 32.57 ? 145 VAL A N   1 
ATOM 793  C CA  . VAL A 1 119 ? -17.846 -8.886  5.844   1.00 32.83 ? 145 VAL A CA  1 
ATOM 794  C C   . VAL A 1 119 ? -17.540 -10.348 6.181   1.00 32.98 ? 145 VAL A C   1 
ATOM 795  O O   . VAL A 1 119 ? -16.446 -10.656 6.676   1.00 33.27 ? 145 VAL A O   1 
ATOM 796  C CB  . VAL A 1 119 ? -17.478 -8.532  4.357   1.00 32.92 ? 145 VAL A CB  1 
ATOM 797  C CG1 . VAL A 1 119 ? -16.131 -9.133  3.957   1.00 33.13 ? 145 VAL A CG1 1 
ATOM 798  C CG2 . VAL A 1 119 ? -18.578 -8.954  3.387   1.00 32.10 ? 145 VAL A CG2 1 
ATOM 799  N N   . PHE A 1 120 ? -18.508 -11.233 5.953   1.00 32.69 ? 146 PHE A N   1 
ATOM 800  C CA  . PHE A 1 120 ? -18.255 -12.666 6.063   1.00 32.78 ? 146 PHE A CA  1 
ATOM 801  C C   . PHE A 1 120 ? -17.599 -13.185 4.785   1.00 32.90 ? 146 PHE A C   1 
ATOM 802  O O   . PHE A 1 120 ? -17.831 -12.662 3.697   1.00 33.15 ? 146 PHE A O   1 
ATOM 803  C CB  . PHE A 1 120 ? -19.544 -13.456 6.326   1.00 32.65 ? 146 PHE A CB  1 
ATOM 804  C CG  . PHE A 1 120 ? -19.914 -13.590 7.792   1.00 32.77 ? 146 PHE A CG  1 
ATOM 805  C CD1 . PHE A 1 120 ? -21.247 -13.475 8.195   1.00 32.01 ? 146 PHE A CD1 1 
ATOM 806  C CD2 . PHE A 1 120 ? -18.945 -13.850 8.765   1.00 32.54 ? 146 PHE A CD2 1 
ATOM 807  C CE1 . PHE A 1 120 ? -21.612 -13.612 9.540   1.00 31.18 ? 146 PHE A CE1 1 
ATOM 808  C CE2 . PHE A 1 120 ? -19.302 -13.982 10.112  1.00 31.93 ? 146 PHE A CE2 1 
ATOM 809  C CZ  . PHE A 1 120 ? -20.643 -13.864 10.495  1.00 31.86 ? 146 PHE A CZ  1 
ATOM 810  N N   . TRP A 1 121 ? -16.764 -14.206 4.944   1.00 32.87 ? 147 TRP A N   1 
ATOM 811  C CA  . TRP A 1 121 ? -16.165 -14.933 3.840   1.00 32.70 ? 147 TRP A CA  1 
ATOM 812  C C   . TRP A 1 121 ? -16.176 -16.408 4.208   1.00 32.82 ? 147 TRP A C   1 
ATOM 813  O O   . TRP A 1 121 ? -15.770 -16.779 5.310   1.00 32.92 ? 147 TRP A O   1 
ATOM 814  C CB  . TRP A 1 121 ? -14.733 -14.470 3.606   1.00 32.56 ? 147 TRP A CB  1 
ATOM 815  C CG  . TRP A 1 121 ? -13.985 -15.273 2.556   1.00 32.50 ? 147 TRP A CG  1 
ATOM 816  C CD1 . TRP A 1 121 ? -14.096 -15.161 1.187   1.00 32.19 ? 147 TRP A CD1 1 
ATOM 817  C CD2 . TRP A 1 121 ? -13.005 -16.286 2.793   1.00 31.89 ? 147 TRP A CD2 1 
ATOM 818  N NE1 . TRP A 1 121 ? -13.246 -16.046 0.567   1.00 31.51 ? 147 TRP A NE1 1 
ATOM 819  C CE2 . TRP A 1 121 ? -12.564 -16.749 1.525   1.00 31.84 ? 147 TRP A CE2 1 
ATOM 820  C CE3 . TRP A 1 121 ? -12.457 -16.854 3.952   1.00 31.60 ? 147 TRP A CE3 1 
ATOM 821  C CZ2 . TRP A 1 121 ? -11.603 -17.756 1.387   1.00 31.81 ? 147 TRP A CZ2 1 
ATOM 822  C CZ3 . TRP A 1 121 ? -11.495 -17.853 3.814   1.00 32.07 ? 147 TRP A CZ3 1 
ATOM 823  C CH2 . TRP A 1 121 ? -11.081 -18.295 2.537   1.00 32.29 ? 147 TRP A CH2 1 
ATOM 824  N N   . ILE A 1 122 ? -16.645 -17.237 3.282   1.00 32.84 ? 148 ILE A N   1 
ATOM 825  C CA  . ILE A 1 122 ? -16.789 -18.671 3.508   1.00 32.69 ? 148 ILE A CA  1 
ATOM 826  C C   . ILE A 1 122 ? -15.679 -19.422 2.775   1.00 32.65 ? 148 ILE A C   1 
ATOM 827  O O   . ILE A 1 122 ? -15.411 -19.165 1.598   1.00 32.32 ? 148 ILE A O   1 
ATOM 828  C CB  . ILE A 1 122 ? -18.182 -19.163 3.055   1.00 32.84 ? 148 ILE A CB  1 
ATOM 829  C CG1 . ILE A 1 122 ? -19.278 -18.259 3.635   1.00 32.81 ? 148 ILE A CG1 1 
ATOM 830  C CG2 . ILE A 1 122 ? -18.407 -20.626 3.458   1.00 32.89 ? 148 ILE A CG2 1 
ATOM 831  C CD1 . ILE A 1 122 ? -20.559 -18.246 2.829   1.00 32.70 ? 148 ILE A CD1 1 
ATOM 832  N N   . ALA A 1 123 ? -15.040 -20.347 3.487   1.00 32.78 ? 149 ALA A N   1 
ATOM 833  C CA  . ALA A 1 123 ? -13.854 -21.052 2.991   1.00 32.90 ? 149 ALA A CA  1 
ATOM 834  C C   . ALA A 1 123 ? -14.179 -22.031 1.857   1.00 32.92 ? 149 ALA A C   1 
ATOM 835  O O   . ALA A 1 123 ? -15.203 -22.711 1.912   1.00 32.98 ? 149 ALA A O   1 
ATOM 836  C CB  . ALA A 1 123 ? -13.159 -21.766 4.135   1.00 32.83 ? 149 ALA A CB  1 
ATOM 837  N N   . PRO A 1 124 ? -13.298 -22.107 0.834   1.00 32.92 ? 150 PRO A N   1 
ATOM 838  C CA  . PRO A 1 124 ? -13.515 -22.910 -0.369  1.00 32.85 ? 150 PRO A CA  1 
ATOM 839  C C   . PRO A 1 124 ? -13.317 -24.400 -0.086  1.00 32.87 ? 150 PRO A C   1 
ATOM 840  O O   . PRO A 1 124 ? -12.688 -24.735 0.915   1.00 32.89 ? 150 PRO A O   1 
ATOM 841  C CB  . PRO A 1 124 ? -12.430 -22.398 -1.319  1.00 32.95 ? 150 PRO A CB  1 
ATOM 842  C CG  . PRO A 1 124 ? -11.334 -21.964 -0.434  1.00 32.84 ? 150 PRO A CG  1 
ATOM 843  C CD  . PRO A 1 124 ? -11.992 -21.416 0.795   1.00 33.03 ? 150 PRO A CD  1 
ATOM 844  N N   . PRO A 1 125 ? -13.839 -25.289 -0.963  1.00 32.88 ? 151 PRO A N   1 
ATOM 845  C CA  . PRO A 1 125 ? -13.807 -26.748 -0.748  1.00 32.88 ? 151 PRO A CA  1 
ATOM 846  C C   . PRO A 1 125 ? -12.423 -27.327 -0.426  1.00 32.96 ? 151 PRO A C   1 
ATOM 847  O O   . PRO A 1 125 ? -11.404 -26.739 -0.781  1.00 32.98 ? 151 PRO A O   1 
ATOM 848  C CB  . PRO A 1 125 ? -14.314 -27.304 -2.082  1.00 32.83 ? 151 PRO A CB  1 
ATOM 849  C CG  . PRO A 1 125 ? -15.184 -26.237 -2.617  1.00 32.75 ? 151 PRO A CG  1 
ATOM 850  C CD  . PRO A 1 125 ? -14.508 -24.952 -2.234  1.00 32.85 ? 151 PRO A CD  1 
ATOM 851  N N   . ALA A 1 126 ? -12.409 -28.482 0.236   1.00 33.14 ? 152 ALA A N   1 
ATOM 852  C CA  . ALA A 1 126 ? -11.174 -29.130 0.694   1.00 33.23 ? 152 ALA A CA  1 
ATOM 853  C C   . ALA A 1 126 ? -10.152 -29.379 -0.417  1.00 33.27 ? 152 ALA A C   1 
ATOM 854  O O   . ALA A 1 126 ? -10.418 -30.115 -1.372  1.00 33.31 ? 152 ALA A O   1 
ATOM 855  C CB  . ALA A 1 126 ? -11.498 -30.429 1.432   1.00 33.25 ? 152 ALA A CB  1 
ATOM 856  N N   . GLY A 1 127 ? -8.987  -28.750 -0.276  1.00 33.33 ? 153 GLY A N   1 
ATOM 857  C CA  . GLY A 1 127 ? -7.901  -28.873 -1.241  1.00 33.20 ? 153 GLY A CA  1 
ATOM 858  C C   . GLY A 1 127 ? -7.899  -27.793 -2.309  1.00 33.21 ? 153 GLY A C   1 
ATOM 859  O O   . GLY A 1 127 ? -7.561  -28.064 -3.463  1.00 33.15 ? 153 GLY A O   1 
ATOM 860  N N   . THR A 1 128 ? -8.274  -26.572 -1.929  1.00 33.21 ? 154 THR A N   1 
ATOM 861  C CA  . THR A 1 128 ? -8.243  -25.429 -2.852  1.00 33.36 ? 154 THR A CA  1 
ATOM 862  C C   . THR A 1 128 ? -6.915  -24.662 -2.748  1.00 33.38 ? 154 THR A C   1 
ATOM 863  O O   . THR A 1 128 ? -6.691  -23.691 -3.474  1.00 33.37 ? 154 THR A O   1 
ATOM 864  C CB  . THR A 1 128 ? -9.462  -24.477 -2.651  1.00 33.37 ? 154 THR A CB  1 
ATOM 865  O OG1 . THR A 1 128 ? -10.667 -25.246 -2.584  1.00 33.36 ? 154 THR A OG1 1 
ATOM 866  C CG2 . THR A 1 128 ? -9.592  -23.483 -3.808  1.00 33.33 ? 154 THR A CG2 1 
ATOM 867  N N   . GLY A 1 129 ? -6.038  -25.111 -1.851  1.00 33.38 ? 155 GLY A N   1 
ATOM 868  C CA  . GLY A 1 129 ? -4.725  -24.491 -1.666  1.00 33.47 ? 155 GLY A CA  1 
ATOM 869  C C   . GLY A 1 129 ? -4.780  -23.199 -0.869  1.00 33.48 ? 155 GLY A C   1 
ATOM 870  O O   . GLY A 1 129 ? -5.629  -23.047 0.006   1.00 33.40 ? 155 GLY A O   1 
ATOM 871  N N   . CYS A 1 130 ? -3.872  -22.270 -1.174  1.00 33.52 ? 156 CYS A N   1 
ATOM 872  C CA  . CYS A 1 130 ? -3.788  -21.000 -0.453  1.00 33.68 ? 156 CYS A CA  1 
ATOM 873  C C   . CYS A 1 130 ? -4.658  -19.924 -1.087  1.00 33.58 ? 156 CYS A C   1 
ATOM 874  O O   . CYS A 1 130 ? -4.816  -19.878 -2.310  1.00 33.48 ? 156 CYS A O   1 
ATOM 875  C CB  . CYS A 1 130 ? -2.340  -20.514 -0.337  1.00 33.79 ? 156 CYS A CB  1 
ATOM 876  S SG  . CYS A 1 130 ? -1.260  -21.584 0.655   1.00 34.65 ? 156 CYS A SG  1 
ATOM 877  N N   . VAL A 1 131 ? -5.214  -19.064 -0.234  1.00 33.46 ? 157 VAL A N   1 
ATOM 878  C CA  . VAL A 1 131 ? -6.157  -18.031 -0.646  1.00 33.40 ? 157 VAL A CA  1 
ATOM 879  C C   . VAL A 1 131 ? -5.672  -16.664 -0.184  1.00 33.48 ? 157 VAL A C   1 
ATOM 880  O O   . VAL A 1 131 ? -5.339  -16.489 0.987   1.00 33.53 ? 157 VAL A O   1 
ATOM 881  C CB  . VAL A 1 131 ? -7.563  -18.273 -0.048  1.00 33.31 ? 157 VAL A CB  1 
ATOM 882  C CG1 . VAL A 1 131 ? -8.530  -17.199 -0.507  1.00 33.45 ? 157 VAL A CG1 1 
ATOM 883  C CG2 . VAL A 1 131 ? -8.090  -19.647 -0.419  1.00 33.19 ? 157 VAL A CG2 1 
ATOM 884  N N   . ILE A 1 132 ? -5.638  -15.699 -1.100  1.00 33.49 ? 158 ILE A N   1 
ATOM 885  C CA  . ILE A 1 132 ? -5.312  -14.325 -0.736  1.00 33.73 ? 158 ILE A CA  1 
ATOM 886  C C   . ILE A 1 132 ? -6.542  -13.432 -0.811  1.00 33.68 ? 158 ILE A C   1 
ATOM 887  O O   . ILE A 1 132 ? -7.248  -13.414 -1.820  1.00 33.57 ? 158 ILE A O   1 
ATOM 888  C CB  . ILE A 1 132 ? -4.183  -13.715 -1.611  1.00 33.87 ? 158 ILE A CB  1 
ATOM 889  C CG1 . ILE A 1 132 ? -2.957  -14.622 -1.640  1.00 33.91 ? 158 ILE A CG1 1 
ATOM 890  C CG2 . ILE A 1 132 ? -3.789  -12.337 -1.109  1.00 33.69 ? 158 ILE A CG2 1 
ATOM 891  C CD1 . ILE A 1 132 ? -2.783  -15.309 -2.949  1.00 34.61 ? 158 ILE A CD1 1 
ATOM 892  N N   . LEU A 1 133 ? -6.789  -12.706 0.273   1.00 33.77 ? 159 LEU A N   1 
ATOM 893  C CA  . LEU A 1 133 ? -7.806  -11.664 0.299   1.00 34.01 ? 159 LEU A CA  1 
ATOM 894  C C   . LEU A 1 133 ? -7.100  -10.319 0.164   1.00 34.19 ? 159 LEU A C   1 
ATOM 895  O O   . LEU A 1 133 ? -6.178  -10.020 0.918   1.00 34.47 ? 159 LEU A O   1 
ATOM 896  C CB  . LEU A 1 133 ? -8.598  -11.733 1.598   1.00 33.90 ? 159 LEU A CB  1 
ATOM 897  C CG  . LEU A 1 133 ? -9.323  -13.055 1.868   1.00 34.06 ? 159 LEU A CG  1 
ATOM 898  C CD1 . LEU A 1 133 ? -9.361  -13.386 3.353   1.00 34.00 ? 159 LEU A CD1 1 
ATOM 899  C CD2 . LEU A 1 133 ? -10.720 -13.013 1.294   1.00 34.91 ? 159 LEU A CD2 1 
ATOM 900  N N   . LYS A 1 134 ? -7.511  -9.530  -0.821  1.00 34.31 ? 160 LYS A N   1 
ATOM 901  C CA  . LYS A 1 134 ? -6.860  -8.256  -1.116  1.00 34.35 ? 160 LYS A CA  1 
ATOM 902  C C   . LYS A 1 134 ? -7.878  -7.142  -1.006  1.00 34.50 ? 160 LYS A C   1 
ATOM 903  O O   . LYS A 1 134 ? -9.026  -7.295  -1.437  1.00 34.74 ? 160 LYS A O   1 
ATOM 904  C CB  . LYS A 1 134 ? -6.285  -8.248  -2.540  1.00 34.39 ? 160 LYS A CB  1 
ATOM 905  C CG  . LYS A 1 134 ? -5.422  -9.438  -2.901  1.00 34.06 ? 160 LYS A CG  1 
ATOM 906  C CD  . LYS A 1 134 ? -5.320  -9.618  -4.410  1.00 33.51 ? 160 LYS A CD  1 
ATOM 907  C CE  . LYS A 1 134 ? -4.105  -8.928  -5.006  1.00 33.25 ? 160 LYS A CE  1 
ATOM 908  N NZ  . LYS A 1 134 ? -3.844  -9.394  -6.411  1.00 33.21 ? 160 LYS A NZ  1 
ATOM 909  N N   . ALA A 1 135 ? -7.463  -6.018  -0.442  1.00 34.54 ? 161 ALA A N   1 
ATOM 910  C CA  . ALA A 1 135 ? -8.343  -4.868  -0.364  1.00 35.14 ? 161 ALA A CA  1 
ATOM 911  C C   . ALA A 1 135 ? -7.705  -3.659  -1.022  1.00 35.61 ? 161 ALA A C   1 
ATOM 912  O O   . ALA A 1 135 ? -6.481  -3.585  -1.139  1.00 35.88 ? 161 ALA A O   1 
ATOM 913  C CB  . ALA A 1 135 ? -8.694  -4.570  1.069   1.00 35.06 ? 161 ALA A CB  1 
ATOM 914  N N   . SER A 1 136 ? -8.538  -2.729  -1.480  1.00 36.15 ? 162 SER A N   1 
ATOM 915  C CA  . SER A 1 136 ? -8.055  -1.427  -1.930  1.00 36.74 ? 162 SER A CA  1 
ATOM 916  C C   . SER A 1 136 ? -8.749  -0.378  -1.077  1.00 37.20 ? 162 SER A C   1 
ATOM 917  O O   . SER A 1 136 ? -9.795  -0.647  -0.499  1.00 37.40 ? 162 SER A O   1 
ATOM 918  C CB  . SER A 1 136 ? -8.347  -1.203  -3.410  1.00 36.70 ? 162 SER A CB  1 
ATOM 919  O OG  . SER A 1 136 ? -9.566  -0.503  -3.593  1.00 36.75 ? 162 SER A OG  1 
ATOM 920  N N   . ILE A 1 137 ? -8.173  0.815   -1.009  1.00 37.72 ? 163 ILE A N   1 
ATOM 921  C CA  . ILE A 1 137 ? -8.600  1.832   -0.053  1.00 38.05 ? 163 ILE A CA  1 
ATOM 922  C C   . ILE A 1 137 ? -8.592  3.212   -0.716  1.00 38.25 ? 163 ILE A C   1 
ATOM 923  O O   . ILE A 1 137 ? -7.586  3.623   -1.323  1.00 37.98 ? 163 ILE A O   1 
ATOM 924  C CB  . ILE A 1 137 ? -7.653  1.813   1.207   1.00 38.12 ? 163 ILE A CB  1 
ATOM 925  C CG1 . ILE A 1 137 ? -8.065  0.721   2.201   1.00 38.01 ? 163 ILE A CG1 1 
ATOM 926  C CG2 . ILE A 1 137 ? -7.577  3.169   1.902   1.00 38.64 ? 163 ILE A CG2 1 
ATOM 927  C CD1 . ILE A 1 137 ? -9.165  1.106   3.166   1.00 38.03 ? 163 ILE A CD1 1 
ATOM 928  N N   . VAL A 1 138 ? -9.718  3.916   -0.618  1.00 38.38 ? 164 VAL A N   1 
ATOM 929  C CA  . VAL A 1 138 ? -9.728  5.336   -0.954  1.00 38.63 ? 164 VAL A CA  1 
ATOM 930  C C   . VAL A 1 138 ? -10.041 6.182   0.275   1.00 38.94 ? 164 VAL A C   1 
ATOM 931  O O   . VAL A 1 138 ? -11.065 6.001   0.938   1.00 38.55 ? 164 VAL A O   1 
ATOM 932  C CB  . VAL A 1 138 ? -10.625 5.695   -2.186  1.00 38.57 ? 164 VAL A CB  1 
ATOM 933  C CG1 . VAL A 1 138 ? -12.081 5.310   -1.970  1.00 38.09 ? 164 VAL A CG1 1 
ATOM 934  C CG2 . VAL A 1 138 ? -10.496 7.180   -2.532  1.00 38.43 ? 164 VAL A CG2 1 
ATOM 935  N N   . GLN A 1 139 ? -9.125  7.096   0.576   1.00 39.53 ? 165 GLN A N   1 
ATOM 936  C CA  . GLN A 1 139 ? -9.272  7.962   1.730   1.00 40.27 ? 165 GLN A CA  1 
ATOM 937  C C   . GLN A 1 139 ? -9.898  9.286   1.301   1.00 39.99 ? 165 GLN A C   1 
ATOM 938  O O   . GLN A 1 139 ? -11.034 9.601   1.674   1.00 40.00 ? 165 GLN A O   1 
ATOM 939  C CB  . GLN A 1 139 ? -7.920  8.170   2.419   1.00 40.11 ? 165 GLN A CB  1 
ATOM 940  C CG  . GLN A 1 139 ? -8.043  8.524   3.886   1.00 41.01 ? 165 GLN A CG  1 
ATOM 941  C CD  . GLN A 1 139 ? -6.713  8.871   4.536   1.00 41.71 ? 165 GLN A CD  1 
ATOM 942  O OE1 . GLN A 1 139 ? -5.656  8.785   3.901   1.00 44.44 ? 165 GLN A OE1 1 
ATOM 943  N NE2 . GLN A 1 139 ? -6.758  9.275   5.810   1.00 42.58 ? 165 GLN A NE2 1 
ATOM 944  N N   . LYS A 1 140 ? -9.159  10.061  0.516   1.00 39.88 ? 166 LYS A N   1 
ATOM 945  C CA  . LYS A 1 140 ? -9.707  11.291  -0.050  1.00 39.72 ? 166 LYS A CA  1 
ATOM 946  C C   . LYS A 1 140 ? -9.916  11.089  -1.558  1.00 39.22 ? 166 LYS A C   1 
ATOM 947  O O   . LYS A 1 140 ? -10.942 10.536  -1.949  1.00 39.48 ? 166 LYS A O   1 
ATOM 948  C CB  . LYS A 1 140 ? -8.837  12.512  0.306   1.00 39.90 ? 166 LYS A CB  1 
ATOM 949  C CG  . LYS A 1 140 ? -9.406  13.879  -0.116  1.00 40.77 ? 166 LYS A CG  1 
ATOM 950  C CD  . LYS A 1 140 ? -10.785 14.166  0.480   1.00 41.12 ? 166 LYS A CD  1 
ATOM 951  C CE  . LYS A 1 140 ? -11.444 15.352  -0.210  1.00 41.67 ? 166 LYS A CE  1 
ATOM 952  N NZ  . LYS A 1 140 ? -12.936 15.308  -0.098  1.00 42.10 ? 166 LYS A NZ  1 
ATOM 953  N N   . ARG A 1 141 ? -8.957  11.493  -2.392  1.00 38.44 ? 167 ARG A N   1 
ATOM 954  C CA  . ARG A 1 141 ? -9.061  11.264  -3.835  1.00 37.91 ? 167 ARG A CA  1 
ATOM 955  C C   . ARG A 1 141 ? -8.376  9.968   -4.245  1.00 37.71 ? 167 ARG A C   1 
ATOM 956  O O   . ARG A 1 141 ? -8.824  9.285   -5.163  1.00 38.06 ? 167 ARG A O   1 
ATOM 957  C CB  . ARG A 1 141 ? -8.449  12.416  -4.638  1.00 37.70 ? 167 ARG A CB  1 
ATOM 958  C CG  . ARG A 1 141 ? -9.121  13.756  -4.460  1.00 37.22 ? 167 ARG A CG  1 
ATOM 959  C CD  . ARG A 1 141 ? -8.701  14.715  -5.565  1.00 36.19 ? 167 ARG A CD  1 
ATOM 960  N NE  . ARG A 1 141 ? -9.578  14.612  -6.733  1.00 34.89 ? 167 ARG A NE  1 
ATOM 961  C CZ  . ARG A 1 141 ? -9.267  15.029  -7.955  1.00 33.88 ? 167 ARG A CZ  1 
ATOM 962  N NH1 . ARG A 1 141 ? -10.136 14.885  -8.946  1.00 33.52 ? 167 ARG A NH1 1 
ATOM 963  N NH2 . ARG A 1 141 ? -8.088  15.585  -8.190  1.00 33.69 ? 167 ARG A NH2 1 
ATOM 964  N N   . ILE A 1 142 ? -7.292  9.638   -3.555  1.00 37.25 ? 168 ILE A N   1 
ATOM 965  C CA  . ILE A 1 142 ? -6.383  8.585   -3.983  1.00 37.07 ? 168 ILE A CA  1 
ATOM 966  C C   . ILE A 1 142 ? -6.905  7.170   -3.694  1.00 36.70 ? 168 ILE A C   1 
ATOM 967  O O   . ILE A 1 142 ? -7.392  6.905   -2.597  1.00 36.79 ? 168 ILE A O   1 
ATOM 968  C CB  . ILE A 1 142 ? -4.990  8.775   -3.306  1.00 37.49 ? 168 ILE A CB  1 
ATOM 969  C CG1 . ILE A 1 142 ? -4.599  10.267  -3.196  1.00 36.98 ? 168 ILE A CG1 1 
ATOM 970  C CG2 . ILE A 1 142 ? -3.913  7.950   -4.016  1.00 38.04 ? 168 ILE A CG2 1 
ATOM 971  C CD1 . ILE A 1 142 ? -4.195  10.935  -4.490  1.00 35.05 ? 168 ILE A CD1 1 
ATOM 972  N N   . ILE A 1 143 ? -6.800  6.271   -4.677  1.00 36.30 ? 169 ILE A N   1 
ATOM 973  C CA  . ILE A 1 143 ? -7.063  4.838   -4.458  1.00 36.17 ? 169 ILE A CA  1 
ATOM 974  C C   . ILE A 1 143 ? -5.754  4.078   -4.252  1.00 36.00 ? 169 ILE A C   1 
ATOM 975  O O   . ILE A 1 143 ? -4.942  4.007   -5.173  1.00 36.09 ? 169 ILE A O   1 
ATOM 976  C CB  . ILE A 1 143 ? -7.778  4.160   -5.660  1.00 36.22 ? 169 ILE A CB  1 
ATOM 977  C CG1 . ILE A 1 143 ? -9.077  4.876   -6.040  1.00 36.42 ? 169 ILE A CG1 1 
ATOM 978  C CG2 . ILE A 1 143 ? -8.058  2.689   -5.352  1.00 35.92 ? 169 ILE A CG2 1 
ATOM 979  C CD1 . ILE A 1 143 ? -9.540  4.573   -7.476  1.00 36.23 ? 169 ILE A CD1 1 
ATOM 980  N N   . TYR A 1 144 ? -5.559  3.500   -3.067  1.00 35.67 ? 170 TYR A N   1 
ATOM 981  C CA  . TYR A 1 144 ? -4.374  2.674   -2.795  1.00 35.29 ? 170 TYR A CA  1 
ATOM 982  C C   . TYR A 1 144 ? -4.667  1.194   -2.951  1.00 34.89 ? 170 TYR A C   1 
ATOM 983  O O   . TYR A 1 144 ? -5.764  0.736   -2.629  1.00 35.33 ? 170 TYR A O   1 
ATOM 984  C CB  . TYR A 1 144 ? -3.855  2.898   -1.381  1.00 35.57 ? 170 TYR A CB  1 
ATOM 985  C CG  . TYR A 1 144 ? -3.433  4.307   -1.077  1.00 36.15 ? 170 TYR A CG  1 
ATOM 986  C CD1 . TYR A 1 144 ? -4.148  5.077   -0.161  1.00 36.35 ? 170 TYR A CD1 1 
ATOM 987  C CD2 . TYR A 1 144 ? -2.305  4.871   -1.690  1.00 36.89 ? 170 TYR A CD2 1 
ATOM 988  C CE1 . TYR A 1 144 ? -3.765  6.375   0.136   1.00 37.15 ? 170 TYR A CE1 1 
ATOM 989  C CE2 . TYR A 1 144 ? -1.911  6.176   -1.410  1.00 36.70 ? 170 TYR A CE2 1 
ATOM 990  C CZ  . TYR A 1 144 ? -2.647  6.920   -0.491  1.00 37.15 ? 170 TYR A CZ  1 
ATOM 991  O OH  . TYR A 1 144 ? -2.272  8.205   -0.188  1.00 37.04 ? 170 TYR A OH  1 
ATOM 992  N N   . PHE A 1 145 ? -3.672  0.448   -3.420  1.00 34.12 ? 171 PHE A N   1 
ATOM 993  C CA  . PHE A 1 145 ? -3.778  -1.003  -3.606  1.00 33.27 ? 171 PHE A CA  1 
ATOM 994  C C   . PHE A 1 145 ? -2.380  -1.636  -3.561  1.00 33.17 ? 171 PHE A C   1 
ATOM 995  O O   . PHE A 1 145 ? -1.373  -0.919  -3.569  1.00 33.17 ? 171 PHE A O   1 
ATOM 996  C CB  . PHE A 1 145 ? -4.491  -1.332  -4.926  1.00 32.67 ? 171 PHE A CB  1 
ATOM 997  C CG  . PHE A 1 145 ? -3.662  -1.068  -6.157  1.00 32.19 ? 171 PHE A CG  1 
ATOM 998  C CD1 . PHE A 1 145 ? -3.718  0.165   -6.800  1.00 31.93 ? 171 PHE A CD1 1 
ATOM 999  C CD2 . PHE A 1 145 ? -2.834  -2.057  -6.683  1.00 31.16 ? 171 PHE A CD2 1 
ATOM 1000 C CE1 . PHE A 1 145 ? -2.954  0.410   -7.944  1.00 31.12 ? 171 PHE A CE1 1 
ATOM 1001 C CE2 . PHE A 1 145 ? -2.072  -1.818  -7.821  1.00 31.08 ? 171 PHE A CE2 1 
ATOM 1002 C CZ  . PHE A 1 145 ? -2.135  -0.584  -8.453  1.00 31.11 ? 171 PHE A CZ  1 
ATOM 1003 N N   . GLN A 1 146 ? -2.318  -2.968  -3.523  1.00 32.81 ? 172 GLN A N   1 
ATOM 1004 C CA  . GLN A 1 146 ? -1.042  -3.694  -3.394  1.00 32.54 ? 172 GLN A CA  1 
ATOM 1005 C C   . GLN A 1 146 ? -1.193  -5.195  -3.651  1.00 32.57 ? 172 GLN A C   1 
ATOM 1006 O O   . GLN A 1 146 ? -2.305  -5.721  -3.677  1.00 32.99 ? 172 GLN A O   1 
ATOM 1007 C CB  . GLN A 1 146 ? -0.436  -3.482  -1.999  1.00 32.28 ? 172 GLN A CB  1 
ATOM 1008 C CG  . GLN A 1 146 ? -1.447  -3.596  -0.858  1.00 31.95 ? 172 GLN A CG  1 
ATOM 1009 C CD  . GLN A 1 146 ? -0.831  -4.025  0.449   1.00 31.34 ? 172 GLN A CD  1 
ATOM 1010 O OE1 . GLN A 1 146 ? -0.002  -3.321  1.029   1.00 30.48 ? 172 GLN A OE1 1 
ATOM 1011 N NE2 . GLN A 1 146 ? -1.244  -5.186  0.929   1.00 30.74 ? 172 GLN A NE2 1 
ATOM 1012 N N   . ASP A 1 147 ? -0.072  -5.883  -3.833  1.00 32.40 ? 173 ASP A N   1 
ATOM 1013 C CA  . ASP A 1 147 ? -0.083  -7.341  -3.913  1.00 32.24 ? 173 ASP A CA  1 
ATOM 1014 C C   . ASP A 1 147 ? 0.365   -7.971  -2.590  1.00 32.31 ? 173 ASP A C   1 
ATOM 1015 O O   . ASP A 1 147 ? -0.179  -8.988  -2.168  1.00 32.46 ? 173 ASP A O   1 
ATOM 1016 C CB  . ASP A 1 147 ? 0.767   -7.827  -5.090  1.00 32.08 ? 173 ASP A CB  1 
ATOM 1017 C CG  . ASP A 1 147 ? 0.198   -7.398  -6.439  1.00 31.84 ? 173 ASP A CG  1 
ATOM 1018 O OD1 . ASP A 1 147 ? -0.980  -7.716  -6.738  1.00 31.00 ? 173 ASP A OD1 1 
ATOM 1019 O OD2 . ASP A 1 147 ? 0.932   -6.744  -7.204  1.00 31.13 ? 173 ASP A OD2 1 
ATOM 1020 N N   . GLU A 1 148 ? 1.345   -7.353  -1.935  1.00 32.31 ? 174 GLU A N   1 
ATOM 1021 C CA  . GLU A 1 148 ? 1.794   -7.778  -0.609  1.00 32.26 ? 174 GLU A CA  1 
ATOM 1022 C C   . GLU A 1 148 ? 1.713   -6.627  0.395   1.00 32.00 ? 174 GLU A C   1 
ATOM 1023 O O   . GLU A 1 148 ? 1.980   -5.478  0.042   1.00 31.75 ? 174 GLU A O   1 
ATOM 1024 C CB  . GLU A 1 148 ? 3.226   -8.320  -0.673  1.00 32.21 ? 174 GLU A CB  1 
ATOM 1025 C CG  . GLU A 1 148 ? 3.332   -9.744  -1.209  1.00 32.67 ? 174 GLU A CG  1 
ATOM 1026 C CD  . GLU A 1 148 ? 4.770   -10.231 -1.318  1.00 32.69 ? 174 GLU A CD  1 
ATOM 1027 O OE1 . GLU A 1 148 ? 5.637   -9.434  -1.731  1.00 33.75 ? 174 GLU A OE1 1 
ATOM 1028 O OE2 . GLU A 1 148 ? 5.038   -11.413 -1.000  1.00 33.56 ? 174 GLU A OE2 1 
ATOM 1029 N N   . GLY A 1 149 ? 1.344   -6.945  1.639   1.00 31.91 ? 175 GLY A N   1 
ATOM 1030 C CA  . GLY A 1 149 ? 1.298   -5.957  2.725   1.00 31.81 ? 175 GLY A CA  1 
ATOM 1031 C C   . GLY A 1 149 ? 0.045   -6.034  3.572   1.00 31.88 ? 175 GLY A C   1 
ATOM 1032 O O   . GLY A 1 149 ? -0.699  -7.020  3.497   1.00 31.90 ? 175 GLY A O   1 
ATOM 1033 N N   . SER A 1 150 ? -0.210  -4.984  4.357   1.00 31.80 ? 176 SER A N   1 
ATOM 1034 C CA  . SER A 1 150 ? -1.310  -4.999  5.339   1.00 31.89 ? 176 SER A CA  1 
ATOM 1035 C C   . SER A 1 150 ? -2.724  -5.035  4.751   1.00 32.25 ? 176 SER A C   1 
ATOM 1036 O O   . SER A 1 150 ? -3.675  -5.354  5.458   1.00 32.46 ? 176 SER A O   1 
ATOM 1037 C CB  . SER A 1 150 ? -1.178  -3.853  6.349   1.00 31.80 ? 176 SER A CB  1 
ATOM 1038 O OG  . SER A 1 150 ? -1.293  -2.588  5.722   1.00 31.61 ? 176 SER A OG  1 
ATOM 1039 N N   . LEU A 1 151 ? -2.860  -4.709  3.468   1.00 32.69 ? 177 LEU A N   1 
ATOM 1040 C CA  . LEU A 1 151 ? -4.130  -4.853  2.754   1.00 32.93 ? 177 LEU A CA  1 
ATOM 1041 C C   . LEU A 1 151 ? -4.228  -6.223  2.062   1.00 33.18 ? 177 LEU A C   1 
ATOM 1042 O O   . LEU A 1 151 ? -5.067  -6.428  1.176   1.00 32.83 ? 177 LEU A O   1 
ATOM 1043 C CB  . LEU A 1 151 ? -4.293  -3.738  1.725   1.00 33.01 ? 177 LEU A CB  1 
ATOM 1044 C CG  . LEU A 1 151 ? -4.369  -2.292  2.221   1.00 33.94 ? 177 LEU A CG  1 
ATOM 1045 C CD1 . LEU A 1 151 ? -3.891  -1.338  1.141   1.00 34.51 ? 177 LEU A CD1 1 
ATOM 1046 C CD2 . LEU A 1 151 ? -5.781  -1.948  2.653   1.00 34.40 ? 177 LEU A CD2 1 
ATOM 1047 N N   . THR A 1 152 ? -3.376  -7.157  2.484   1.00 33.58 ? 178 THR A N   1 
ATOM 1048 C CA  . THR A 1 152 ? -3.319  -8.492  1.894   1.00 34.09 ? 178 THR A CA  1 
ATOM 1049 C C   . THR A 1 152 ? -3.209  -9.583  2.965   1.00 34.36 ? 178 THR A C   1 
ATOM 1050 O O   . THR A 1 152 ? -2.356  -9.504  3.846   1.00 34.71 ? 178 THR A O   1 
ATOM 1051 C CB  . THR A 1 152 ? -2.151  -8.573  0.887   1.00 34.05 ? 178 THR A CB  1 
ATOM 1052 O OG1 . THR A 1 152 ? -2.548  -7.947  -0.339  1.00 34.04 ? 178 THR A OG1 1 
ATOM 1053 C CG2 . THR A 1 152 ? -1.735  -10.010 0.612   1.00 34.16 ? 178 THR A CG2 1 
ATOM 1054 N N   . LYS A 1 153 ? -4.077  -10.590 2.891   1.00 34.63 ? 179 LYS A N   1 
ATOM 1055 C CA  . LYS A 1 153 ? -4.018  -11.724 3.822   1.00 35.16 ? 179 LYS A CA  1 
ATOM 1056 C C   . LYS A 1 153 ? -4.067  -13.077 3.098   1.00 35.58 ? 179 LYS A C   1 
ATOM 1057 O O   . LYS A 1 153 ? -5.081  -13.418 2.470   1.00 35.74 ? 179 LYS A O   1 
ATOM 1058 C CB  . LYS A 1 153 ? -5.143  -11.633 4.866   1.00 35.10 ? 179 LYS A CB  1 
ATOM 1059 C CG  . LYS A 1 153 ? -5.078  -12.679 5.976   1.00 34.65 ? 179 LYS A CG  1 
ATOM 1060 C CD  . LYS A 1 153 ? -4.153  -12.253 7.117   1.00 35.01 ? 179 LYS A CD  1 
ATOM 1061 C CE  . LYS A 1 153 ? -3.994  -13.358 8.167   1.00 34.19 ? 179 LYS A CE  1 
ATOM 1062 N NZ  . LYS A 1 153 ? -3.045  -14.418 7.728   1.00 32.68 ? 179 LYS A NZ  1 
ATOM 1063 N N   . LYS A 1 154 ? -2.972  -13.837 3.199   1.00 35.94 ? 180 LYS A N   1 
ATOM 1064 C CA  . LYS A 1 154 ? -2.892  -15.188 2.632   1.00 36.34 ? 180 LYS A CA  1 
ATOM 1065 C C   . LYS A 1 154 ? -3.264  -16.226 3.693   1.00 36.33 ? 180 LYS A C   1 
ATOM 1066 O O   . LYS A 1 154 ? -2.694  -16.222 4.789   1.00 36.53 ? 180 LYS A O   1 
ATOM 1067 C CB  . LYS A 1 154 ? -1.489  -15.486 2.084   1.00 36.53 ? 180 LYS A CB  1 
ATOM 1068 C CG  . LYS A 1 154 ? -0.745  -14.289 1.460   1.00 37.01 ? 180 LYS A CG  1 
ATOM 1069 C CD  . LYS A 1 154 ? 0.517   -14.734 0.698   1.00 36.99 ? 180 LYS A CD  1 
ATOM 1070 C CE  . LYS A 1 154 ? 1.440   -13.559 0.328   1.00 37.63 ? 180 LYS A CE  1 
ATOM 1071 N NZ  . LYS A 1 154 ? 0.721   -12.401 -0.291  1.00 37.94 ? 180 LYS A NZ  1 
ATOM 1072 N N   . LEU A 1 155 ? -4.223  -17.097 3.363   1.00 36.23 ? 181 LEU A N   1 
ATOM 1073 C CA  . LEU A 1 155 ? -4.669  -18.195 4.231   1.00 35.80 ? 181 LEU A CA  1 
ATOM 1074 C C   . LEU A 1 155 ? -4.628  -19.555 3.516   1.00 35.71 ? 181 LEU A C   1 
ATOM 1075 O O   . LEU A 1 155 ? -5.164  -19.693 2.412   1.00 35.52 ? 181 LEU A O   1 
ATOM 1076 C CB  . LEU A 1 155 ? -6.095  -17.933 4.713   1.00 35.91 ? 181 LEU A CB  1 
ATOM 1077 C CG  . LEU A 1 155 ? -6.353  -17.212 6.037   1.00 36.31 ? 181 LEU A CG  1 
ATOM 1078 C CD1 . LEU A 1 155 ? -7.824  -16.854 6.144   1.00 36.39 ? 181 LEU A CD1 1 
ATOM 1079 C CD2 . LEU A 1 155 ? -5.934  -18.071 7.223   1.00 36.69 ? 181 LEU A CD2 1 
ATOM 1080 N N   . CYS A 1 156 ? -4.016  -20.553 4.159   1.00 35.64 ? 182 CYS A N   1 
ATOM 1081 C CA  . CYS A 1 156 ? -3.889  -21.915 3.593   1.00 35.47 ? 182 CYS A CA  1 
ATOM 1082 C C   . CYS A 1 156 ? -4.641  -23.010 4.379   1.00 35.33 ? 182 CYS A C   1 
ATOM 1083 O O   . CYS A 1 156 ? -5.127  -22.766 5.484   1.00 35.14 ? 182 CYS A O   1 
ATOM 1084 C CB  . CYS A 1 156 ? -2.416  -22.277 3.403   1.00 35.39 ? 182 CYS A CB  1 
ATOM 1085 S SG  . CYS A 1 156 ? -1.482  -20.965 2.589   1.00 35.76 ? 182 CYS A SG  1 
ATOM 1086 N N   . GLU A 1 157 ? -4.703  -24.215 3.803   1.00 35.22 ? 183 GLU A N   1 
ATOM 1087 C CA  . GLU A 1 157 ? -5.680  -25.246 4.194   1.00 35.16 ? 183 GLU A CA  1 
ATOM 1088 C C   . GLU A 1 157 ? -5.282  -26.244 5.295   1.00 35.29 ? 183 GLU A C   1 
ATOM 1089 O O   . GLU A 1 157 ? -6.161  -26.811 5.958   1.00 35.23 ? 183 GLU A O   1 
ATOM 1090 C CB  . GLU A 1 157 ? -6.167  -26.002 2.950   1.00 34.92 ? 183 GLU A CB  1 
ATOM 1091 N N   . GLN A 1 158 ? -3.981  -26.461 5.487   1.00 35.51 ? 184 GLN A N   1 
ATOM 1092 C CA  . GLN A 1 158 ? -3.500  -27.542 6.366   1.00 35.78 ? 184 GLN A CA  1 
ATOM 1093 C C   . GLN A 1 158 ? -3.685  -27.247 7.854   1.00 35.94 ? 184 GLN A C   1 
ATOM 1094 C CB  . GLN A 1 158 ? -2.038  -27.890 6.058   1.00 35.82 ? 184 GLN A CB  1 
ATOM 1095 N N   . PRO B 1 12  ? 33.842  -8.309  -14.139 1.00 52.60 ? 38  PRO B N   1 
ATOM 1096 C CA  . PRO B 1 12  ? 35.089  -7.573  -13.932 1.00 52.60 ? 38  PRO B CA  1 
ATOM 1097 C C   . PRO B 1 12  ? 35.182  -6.340  -14.835 1.00 52.61 ? 38  PRO B C   1 
ATOM 1098 O O   . PRO B 1 12  ? 36.083  -6.251  -15.672 1.00 52.56 ? 38  PRO B O   1 
ATOM 1099 C CB  . PRO B 1 12  ? 36.163  -8.603  -14.298 1.00 52.61 ? 38  PRO B CB  1 
ATOM 1100 C CG  . PRO B 1 12  ? 35.517  -9.924  -14.039 1.00 52.61 ? 38  PRO B CG  1 
ATOM 1101 C CD  . PRO B 1 12  ? 34.076  -9.740  -14.402 1.00 52.54 ? 38  PRO B CD  1 
ATOM 1102 N N   . LYS B 1 13  ? 34.254  -5.401  -14.652 1.00 52.64 ? 39  LYS B N   1 
ATOM 1103 C CA  . LYS B 1 13  ? 34.159  -4.208  -15.497 1.00 52.73 ? 39  LYS B CA  1 
ATOM 1104 C C   . LYS B 1 13  ? 34.350  -2.913  -14.707 1.00 52.79 ? 39  LYS B C   1 
ATOM 1105 O O   . LYS B 1 13  ? 33.945  -2.819  -13.547 1.00 52.87 ? 39  LYS B O   1 
ATOM 1106 C CB  . LYS B 1 13  ? 32.827  -4.189  -16.236 1.00 52.74 ? 39  LYS B CB  1 
ATOM 1107 N N   . SER B 1 14  ? 34.949  -1.916  -15.359 1.00 52.85 ? 40  SER B N   1 
ATOM 1108 C CA  . SER B 1 14  ? 35.290  -0.633  -14.729 1.00 52.87 ? 40  SER B CA  1 
ATOM 1109 C C   . SER B 1 14  ? 34.070  0.151   -14.260 1.00 52.88 ? 40  SER B C   1 
ATOM 1110 O O   . SER B 1 14  ? 33.969  0.497   -13.081 1.00 52.97 ? 40  SER B O   1 
ATOM 1111 C CB  . SER B 1 14  ? 36.155  0.226   -15.660 1.00 52.95 ? 40  SER B CB  1 
ATOM 1112 O OG  . SER B 1 14  ? 35.567  0.360   -16.942 1.00 52.98 ? 40  SER B OG  1 
ATOM 1113 N N   . GLU B 1 15  ? 33.156  0.438   -15.185 1.00 52.84 ? 41  GLU B N   1 
ATOM 1114 C CA  . GLU B 1 15  ? 31.860  1.003   -14.835 1.00 52.70 ? 41  GLU B CA  1 
ATOM 1115 C C   . GLU B 1 15  ? 31.117  -0.014  -13.970 1.00 52.59 ? 41  GLU B C   1 
ATOM 1116 O O   . GLU B 1 15  ? 31.126  -1.210  -14.274 1.00 52.53 ? 41  GLU B O   1 
ATOM 1117 C CB  . GLU B 1 15  ? 31.072  1.333   -16.089 1.00 52.77 ? 41  GLU B CB  1 
ATOM 1118 N N   . GLY B 1 16  ? 30.498  0.465   -12.892 1.00 52.48 ? 42  GLY B N   1 
ATOM 1119 C CA  . GLY B 1 16  ? 29.934  -0.408  -11.859 1.00 52.37 ? 42  GLY B CA  1 
ATOM 1120 C C   . GLY B 1 16  ? 28.426  -0.366  -11.689 1.00 52.38 ? 42  GLY B C   1 
ATOM 1121 O O   . GLY B 1 16  ? 27.705  0.136   -12.557 1.00 52.49 ? 42  GLY B O   1 
ATOM 1122 N N   . TYR B 1 17  ? 27.960  -0.889  -10.554 1.00 52.15 ? 43  TYR B N   1 
ATOM 1123 C CA  . TYR B 1 17  ? 26.530  -1.071  -10.280 1.00 51.89 ? 43  TYR B CA  1 
ATOM 1124 C C   . TYR B 1 17  ? 25.762  0.229   -9.998  1.00 51.78 ? 43  TYR B C   1 
ATOM 1125 O O   . TYR B 1 17  ? 24.613  0.370   -10.424 1.00 51.79 ? 43  TYR B O   1 
ATOM 1126 C CB  . TYR B 1 17  ? 26.336  -2.064  -9.146  1.00 51.97 ? 43  TYR B CB  1 
ATOM 1127 N N   . CYS B 1 18  ? 26.391  1.146   -9.259  1.00 51.46 ? 44  CYS B N   1 
ATOM 1128 C CA  . CYS B 1 18  ? 25.890  2.514   -9.046  1.00 51.03 ? 44  CYS B CA  1 
ATOM 1129 C C   . CYS B 1 18  ? 27.077  3.477   -8.988  1.00 51.14 ? 44  CYS B C   1 
ATOM 1130 O O   . CYS B 1 18  ? 27.129  4.363   -8.134  1.00 51.11 ? 44  CYS B O   1 
ATOM 1131 C CB  . CYS B 1 18  ? 25.103  2.618   -7.740  1.00 50.67 ? 44  CYS B CB  1 
ATOM 1132 S SG  . CYS B 1 18  ? 23.495  1.838   -7.736  1.00 49.96 ? 44  CYS B SG  1 
ATOM 1133 N N   . SER B 1 19  ? 28.023  3.305   -9.909  1.00 51.12 ? 45  SER B N   1 
ATOM 1134 C CA  . SER B 1 19  ? 29.338  3.940   -9.807  1.00 51.06 ? 45  SER B CA  1 
ATOM 1135 C C   . SER B 1 19  ? 29.370  5.449   -10.082 1.00 51.01 ? 45  SER B C   1 
ATOM 1136 O O   . SER B 1 19  ? 30.375  5.967   -10.575 1.00 50.99 ? 45  SER B O   1 
ATOM 1137 C CB  . SER B 1 19  ? 30.345  3.209   -10.702 1.00 51.05 ? 45  SER B CB  1 
ATOM 1138 O OG  . SER B 1 19  ? 30.014  3.362   -12.072 1.00 51.21 ? 45  SER B OG  1 
ATOM 1139 N N   . ARG B 1 20  ? 28.278  6.149   -9.776  1.00 51.03 ? 46  ARG B N   1 
ATOM 1140 C CA  . ARG B 1 20  ? 28.263  7.622   -9.834  1.00 51.19 ? 46  ARG B CA  1 
ATOM 1141 C C   . ARG B 1 20  ? 27.445  8.228   -8.680  1.00 50.81 ? 46  ARG B C   1 
ATOM 1142 O O   . ARG B 1 20  ? 26.750  9.226   -8.852  1.00 51.25 ? 46  ARG B O   1 
ATOM 1143 C CB  . ARG B 1 20  ? 27.798  8.156   -11.213 1.00 51.05 ? 46  ARG B CB  1 
ATOM 1144 C CG  . ARG B 1 20  ? 28.506  7.532   -12.439 1.00 51.61 ? 46  ARG B CG  1 
ATOM 1145 C CD  . ARG B 1 20  ? 28.376  8.319   -13.752 1.00 51.90 ? 46  ARG B CD  1 
ATOM 1146 N NE  . ARG B 1 20  ? 27.192  9.180   -13.827 1.00 54.58 ? 46  ARG B NE  1 
ATOM 1147 C CZ  . ARG B 1 20  ? 25.963  8.784   -14.159 1.00 55.51 ? 46  ARG B CZ  1 
ATOM 1148 N NH1 . ARG B 1 20  ? 25.709  7.511   -14.446 1.00 55.92 ? 46  ARG B NH1 1 
ATOM 1149 N NH2 . ARG B 1 20  ? 24.973  9.671   -14.190 1.00 55.49 ? 46  ARG B NH2 1 
ATOM 1150 N N   . ILE B 1 21  ? 27.549  7.625   -7.499  1.00 50.36 ? 47  ILE B N   1 
ATOM 1151 C CA  . ILE B 1 21  ? 26.861  8.122   -6.309  1.00 49.73 ? 47  ILE B CA  1 
ATOM 1152 C C   . ILE B 1 21  ? 27.773  8.030   -5.091  1.00 49.40 ? 47  ILE B C   1 
ATOM 1153 O O   . ILE B 1 21  ? 28.249  6.952   -4.751  1.00 49.33 ? 47  ILE B O   1 
ATOM 1154 C CB  . ILE B 1 21  ? 25.538  7.366   -6.074  1.00 49.93 ? 47  ILE B CB  1 
ATOM 1155 C CG1 . ILE B 1 21  ? 24.975  7.658   -4.684  1.00 49.52 ? 47  ILE B CG1 1 
ATOM 1156 C CG2 . ILE B 1 21  ? 25.721  5.873   -6.283  1.00 49.71 ? 47  ILE B CG2 1 
ATOM 1157 C CD1 . ILE B 1 21  ? 23.655  7.032   -4.464  1.00 49.56 ? 47  ILE B CD1 1 
ATOM 1158 N N   . LEU B 1 22  ? 28.022  9.166   -4.443  1.00 49.10 ? 48  LEU B N   1 
ATOM 1159 C CA  . LEU B 1 22  ? 29.091  9.262   -3.450  1.00 48.86 ? 48  LEU B CA  1 
ATOM 1160 C C   . LEU B 1 22  ? 28.795  10.285  -2.343  1.00 48.82 ? 48  LEU B C   1 
ATOM 1161 O O   . LEU B 1 22  ? 27.770  10.964  -2.374  1.00 48.38 ? 48  LEU B O   1 
ATOM 1162 C CB  . LEU B 1 22  ? 30.418  9.613   -4.148  1.00 48.90 ? 48  LEU B CB  1 
ATOM 1163 C CG  . LEU B 1 22  ? 30.735  9.139   -5.580  1.00 48.86 ? 48  LEU B CG  1 
ATOM 1164 C CD1 . LEU B 1 22  ? 31.840  9.982   -6.184  1.00 48.74 ? 48  LEU B CD1 1 
ATOM 1165 C CD2 . LEU B 1 22  ? 31.111  7.659   -5.649  1.00 48.93 ? 48  LEU B CD2 1 
ATOM 1166 N N   . ARG B 1 23  ? 29.714  10.390  -1.379  1.00 49.09 ? 49  ARG B N   1 
ATOM 1167 C CA  . ARG B 1 23  ? 29.602  11.326  -0.252  1.00 49.35 ? 49  ARG B CA  1 
ATOM 1168 C C   . ARG B 1 23  ? 30.747  12.359  -0.219  1.00 49.81 ? 49  ARG B C   1 
ATOM 1169 O O   . ARG B 1 23  ? 30.506  13.570  -0.193  1.00 49.70 ? 49  ARG B O   1 
ATOM 1170 C CB  . ARG B 1 23  ? 29.595  10.563  1.077   1.00 49.30 ? 49  ARG B CB  1 
ATOM 1171 C CG  . ARG B 1 23  ? 29.136  9.115   1.001   1.00 48.77 ? 49  ARG B CG  1 
ATOM 1172 C CD  . ARG B 1 23  ? 29.938  8.247   1.957   1.00 47.85 ? 49  ARG B CD  1 
ATOM 1173 N NE  . ARG B 1 23  ? 29.422  8.269   3.322   1.00 47.12 ? 49  ARG B NE  1 
ATOM 1174 C CZ  . ARG B 1 23  ? 29.822  7.452   4.293   1.00 46.41 ? 49  ARG B CZ  1 
ATOM 1175 N NH1 . ARG B 1 23  ? 30.757  6.535   4.065   1.00 46.05 ? 49  ARG B NH1 1 
ATOM 1176 N NH2 . ARG B 1 23  ? 29.283  7.552   5.499   1.00 46.09 ? 49  ARG B NH2 1 
ATOM 1177 N N   . ALA B 1 24  ? 31.982  11.852  -0.216  1.00 50.42 ? 50  ALA B N   1 
ATOM 1178 C CA  . ALA B 1 24  ? 33.223  12.637  -0.017  1.00 51.20 ? 50  ALA B CA  1 
ATOM 1179 C C   . ALA B 1 24  ? 33.357  13.243  1.397   1.00 51.57 ? 50  ALA B C   1 
ATOM 1180 O O   . ALA B 1 24  ? 32.854  12.664  2.371   1.00 51.82 ? 50  ALA B O   1 
ATOM 1181 C CB  . ALA B 1 24  ? 33.414  13.703  -1.122  1.00 51.08 ? 50  ALA B CB  1 
ATOM 1182 N N   . GLN B 1 25  ? 34.057  14.375  1.511   1.00 51.77 ? 51  GLN B N   1 
ATOM 1183 C CA  . GLN B 1 25  ? 34.142  15.112  2.776   1.00 51.95 ? 51  GLN B CA  1 
ATOM 1184 C C   . GLN B 1 25  ? 33.462  16.490  2.715   1.00 52.06 ? 51  GLN B C   1 
ATOM 1185 O O   . GLN B 1 25  ? 32.509  16.689  1.949   1.00 52.04 ? 51  GLN B O   1 
ATOM 1186 C CB  . GLN B 1 25  ? 35.595  15.225  3.252   1.00 52.02 ? 51  GLN B CB  1 
ATOM 1187 C CG  . GLN B 1 25  ? 36.120  13.971  3.949   1.00 52.08 ? 51  GLN B CG  1 
ATOM 1188 C CD  . GLN B 1 25  ? 37.385  14.220  4.757   1.00 52.03 ? 51  GLN B CD  1 
ATOM 1189 O OE1 . GLN B 1 25  ? 37.555  13.661  5.842   1.00 52.61 ? 51  GLN B OE1 1 
ATOM 1190 N NE2 . GLN B 1 25  ? 38.276  15.061  4.235   1.00 51.59 ? 51  GLN B NE2 1 
ATOM 1191 N N   . GLY B 1 26  ? 33.955  17.428  3.529   1.00 52.08 ? 52  GLY B N   1 
ATOM 1192 C CA  . GLY B 1 26  ? 33.345  18.750  3.695   1.00 52.12 ? 52  GLY B CA  1 
ATOM 1193 C C   . GLY B 1 26  ? 33.160  19.543  2.414   1.00 52.11 ? 52  GLY B C   1 
ATOM 1194 O O   . GLY B 1 26  ? 32.108  20.144  2.196   1.00 52.10 ? 52  GLY B O   1 
ATOM 1195 N N   . GLY B 1 31  ? 25.008  24.640  3.610   1.00 43.84 ? 57  GLY B N   1 
ATOM 1196 C CA  . GLY B 1 31  ? 23.946  25.239  4.411   1.00 43.89 ? 57  GLY B CA  1 
ATOM 1197 C C   . GLY B 1 31  ? 22.767  25.722  3.585   1.00 43.99 ? 57  GLY B C   1 
ATOM 1198 O O   . GLY B 1 31  ? 22.441  26.915  3.597   1.00 43.92 ? 57  GLY B O   1 
ATOM 1199 N N   . TYR B 1 32  ? 22.129  24.791  2.870   1.00 44.03 ? 58  TYR B N   1 
ATOM 1200 C CA  . TYR B 1 32  ? 20.931  25.083  2.076   1.00 44.08 ? 58  TYR B CA  1 
ATOM 1201 C C   . TYR B 1 32  ? 19.682  24.446  2.677   1.00 43.96 ? 58  TYR B C   1 
ATOM 1202 O O   . TYR B 1 32  ? 19.142  23.470  2.149   1.00 44.09 ? 58  TYR B O   1 
ATOM 1203 C CB  . TYR B 1 32  ? 21.122  24.659  0.619   1.00 44.35 ? 58  TYR B CB  1 
ATOM 1204 C CG  . TYR B 1 32  ? 22.129  25.513  -0.107  1.00 44.67 ? 58  TYR B CG  1 
ATOM 1205 C CD1 . TYR B 1 32  ? 23.475  25.159  -0.129  1.00 45.16 ? 58  TYR B CD1 1 
ATOM 1206 C CD2 . TYR B 1 32  ? 21.740  26.687  -0.757  1.00 44.80 ? 58  TYR B CD2 1 
ATOM 1207 C CE1 . TYR B 1 32  ? 24.415  25.947  -0.787  1.00 45.58 ? 58  TYR B CE1 1 
ATOM 1208 C CE2 . TYR B 1 32  ? 22.670  27.484  -1.417  1.00 44.92 ? 58  TYR B CE2 1 
ATOM 1209 C CZ  . TYR B 1 32  ? 24.009  27.107  -1.427  1.00 45.16 ? 58  TYR B CZ  1 
ATOM 1210 O OH  . TYR B 1 32  ? 24.949  27.879  -2.076  1.00 45.07 ? 58  TYR B OH  1 
ATOM 1211 N N   . THR B 1 33  ? 19.223  25.035  3.777   1.00 43.77 ? 59  THR B N   1 
ATOM 1212 C CA  . THR B 1 33  ? 18.130  24.494  4.578   1.00 43.56 ? 59  THR B CA  1 
ATOM 1213 C C   . THR B 1 33  ? 16.735  24.898  4.089   1.00 43.39 ? 59  THR B C   1 
ATOM 1214 O O   . THR B 1 33  ? 15.729  24.562  4.726   1.00 43.43 ? 59  THR B O   1 
ATOM 1215 C CB  . THR B 1 33  ? 18.297  24.861  6.074   1.00 43.66 ? 59  THR B CB  1 
ATOM 1216 O OG1 . THR B 1 33  ? 18.917  26.148  6.187   1.00 43.32 ? 59  THR B OG1 1 
ATOM 1217 C CG2 . THR B 1 33  ? 19.161  23.828  6.788   1.00 43.70 ? 59  THR B CG2 1 
ATOM 1218 N N   . GLU B 1 34  ? 16.669  25.605  2.961   1.00 42.97 ? 60  GLU B N   1 
ATOM 1219 C CA  . GLU B 1 34  ? 15.379  25.874  2.311   1.00 42.61 ? 60  GLU B CA  1 
ATOM 1220 C C   . GLU B 1 34  ? 14.850  24.629  1.592   1.00 42.15 ? 60  GLU B C   1 
ATOM 1221 O O   . GLU B 1 34  ? 13.738  24.631  1.071   1.00 42.15 ? 60  GLU B O   1 
ATOM 1222 C CB  . GLU B 1 34  ? 15.456  27.075  1.358   1.00 42.65 ? 60  GLU B CB  1 
ATOM 1223 C CG  . GLU B 1 34  ? 16.240  26.844  0.068   1.00 43.19 ? 60  GLU B CG  1 
ATOM 1224 C CD  . GLU B 1 34  ? 17.725  27.125  0.209   1.00 44.05 ? 60  GLU B CD  1 
ATOM 1225 O OE1 . GLU B 1 34  ? 18.280  26.902  1.306   1.00 44.15 ? 60  GLU B OE1 1 
ATOM 1226 O OE2 . GLU B 1 34  ? 18.341  27.571  -0.787  1.00 44.70 ? 60  GLU B OE2 1 
ATOM 1227 N N   . PHE B 1 35  ? 15.664  23.576  1.570   1.00 41.70 ? 61  PHE B N   1 
ATOM 1228 C CA  . PHE B 1 35  ? 15.266  22.275  1.045   1.00 41.34 ? 61  PHE B CA  1 
ATOM 1229 C C   . PHE B 1 35  ? 15.365  21.249  2.168   1.00 41.29 ? 61  PHE B C   1 
ATOM 1230 O O   . PHE B 1 35  ? 16.346  21.244  2.915   1.00 41.46 ? 61  PHE B O   1 
ATOM 1231 C CB  . PHE B 1 35  ? 16.174  21.855  -0.117  1.00 40.91 ? 61  PHE B CB  1 
ATOM 1232 C CG  . PHE B 1 35  ? 16.310  22.892  -1.202  1.00 40.47 ? 61  PHE B CG  1 
ATOM 1233 C CD1 . PHE B 1 35  ? 17.503  23.592  -1.366  1.00 39.69 ? 61  PHE B CD1 1 
ATOM 1234 C CD2 . PHE B 1 35  ? 15.254  23.165  -2.067  1.00 40.08 ? 61  PHE B CD2 1 
ATOM 1235 C CE1 . PHE B 1 35  ? 17.639  24.549  -2.367  1.00 38.71 ? 61  PHE B CE1 1 
ATOM 1236 C CE2 . PHE B 1 35  ? 15.390  24.129  -3.077  1.00 39.76 ? 61  PHE B CE2 1 
ATOM 1237 C CZ  . PHE B 1 35  ? 16.582  24.816  -3.222  1.00 38.92 ? 61  PHE B CZ  1 
ATOM 1238 N N   . SER B 1 36  ? 14.357  20.388  2.289   1.00 41.13 ? 62  SER B N   1 
ATOM 1239 C CA  . SER B 1 36  ? 14.358  19.358  3.332   1.00 41.11 ? 62  SER B CA  1 
ATOM 1240 C C   . SER B 1 36  ? 13.725  18.028  2.917   1.00 41.15 ? 62  SER B C   1 
ATOM 1241 O O   . SER B 1 36  ? 12.727  17.989  2.192   1.00 41.02 ? 62  SER B O   1 
ATOM 1242 C CB  . SER B 1 36  ? 13.690  19.877  4.609   1.00 41.07 ? 62  SER B CB  1 
ATOM 1243 O OG  . SER B 1 36  ? 12.299  20.062  4.424   1.00 40.85 ? 62  SER B OG  1 
ATOM 1244 N N   . LEU B 1 37  ? 14.339  16.947  3.391   1.00 41.25 ? 63  LEU B N   1 
ATOM 1245 C CA  . LEU B 1 37  ? 13.817  15.599  3.268   1.00 41.39 ? 63  LEU B CA  1 
ATOM 1246 C C   . LEU B 1 37  ? 13.085  15.266  4.558   1.00 41.83 ? 63  LEU B C   1 
ATOM 1247 O O   . LEU B 1 37  ? 13.629  15.443  5.652   1.00 41.80 ? 63  LEU B O   1 
ATOM 1248 C CB  . LEU B 1 37  ? 14.965  14.608  3.073   1.00 41.29 ? 63  LEU B CB  1 
ATOM 1249 C CG  . LEU B 1 37  ? 14.606  13.124  2.980   1.00 41.18 ? 63  LEU B CG  1 
ATOM 1250 C CD1 . LEU B 1 37  ? 14.914  12.569  1.597   1.00 40.79 ? 63  LEU B CD1 1 
ATOM 1251 C CD2 . LEU B 1 37  ? 15.362  12.353  4.039   1.00 41.41 ? 63  LEU B CD2 1 
ATOM 1252 N N   . ARG B 1 38  ? 11.853  14.782  4.433   1.00 42.28 ? 64  ARG B N   1 
ATOM 1253 C CA  . ARG B 1 38  ? 11.067  14.415  5.601   1.00 42.65 ? 64  ARG B CA  1 
ATOM 1254 C C   . ARG B 1 38  ? 10.296  13.112  5.418   1.00 42.64 ? 64  ARG B C   1 
ATOM 1255 O O   . ARG B 1 38  ? 9.925   12.742  4.303   1.00 42.65 ? 64  ARG B O   1 
ATOM 1256 C CB  . ARG B 1 38  ? 10.141  15.565  6.020   1.00 42.60 ? 64  ARG B CB  1 
ATOM 1257 C CG  . ARG B 1 38  ? 8.972   15.835  5.076   1.00 43.49 ? 64  ARG B CG  1 
ATOM 1258 C CD  . ARG B 1 38  ? 8.021   16.908  5.617   1.00 43.26 ? 64  ARG B CD  1 
ATOM 1259 N NE  . ARG B 1 38  ? 7.813   16.813  7.066   1.00 44.23 ? 64  ARG B NE  1 
ATOM 1260 C CZ  . ARG B 1 38  ? 6.967   15.976  7.665   1.00 44.17 ? 64  ARG B CZ  1 
ATOM 1261 N NH1 . ARG B 1 38  ? 6.858   15.983  8.989   1.00 44.15 ? 64  ARG B NH1 1 
ATOM 1262 N NH2 . ARG B 1 38  ? 6.235   15.132  6.949   1.00 43.84 ? 64  ARG B NH2 1 
ATOM 1263 N N   . VAL B 1 39  ? 10.089  12.417  6.535   1.00 42.95 ? 65  VAL B N   1 
ATOM 1264 C CA  . VAL B 1 39  ? 9.319   11.175  6.587   1.00 43.05 ? 65  VAL B CA  1 
ATOM 1265 C C   . VAL B 1 39  ? 8.076   11.436  7.436   1.00 43.41 ? 65  VAL B C   1 
ATOM 1266 O O   . VAL B 1 39  ? 8.180   11.697  8.643   1.00 43.34 ? 65  VAL B O   1 
ATOM 1267 C CB  . VAL B 1 39  ? 10.148  10.015  7.203   1.00 42.95 ? 65  VAL B CB  1 
ATOM 1268 C CG1 . VAL B 1 39  ? 9.402   8.697   7.091   1.00 42.61 ? 65  VAL B CG1 1 
ATOM 1269 C CG2 . VAL B 1 39  ? 11.517  9.909   6.536   1.00 42.72 ? 65  VAL B CG2 1 
ATOM 1270 N N   . GLU B 1 40  ? 6.906   11.372  6.804   1.00 43.79 ? 66  GLU B N   1 
ATOM 1271 C CA  . GLU B 1 40  ? 5.648   11.759  7.462   1.00 44.30 ? 66  GLU B CA  1 
ATOM 1272 C C   . GLU B 1 40  ? 5.449   11.026  8.790   1.00 44.18 ? 66  GLU B C   1 
ATOM 1273 O O   . GLU B 1 40  ? 5.780   9.848   8.913   1.00 44.05 ? 66  GLU B O   1 
ATOM 1274 C CB  . GLU B 1 40  ? 4.443   11.558  6.535   1.00 44.37 ? 66  GLU B CB  1 
ATOM 1275 C CG  . GLU B 1 40  ? 4.747   11.715  5.039   1.00 45.51 ? 66  GLU B CG  1 
ATOM 1276 C CD  . GLU B 1 40  ? 5.257   13.099  4.638   1.00 46.90 ? 66  GLU B CD  1 
ATOM 1277 O OE1 . GLU B 1 40  ? 6.480   13.233  4.398   1.00 47.20 ? 66  GLU B OE1 1 
ATOM 1278 O OE2 . GLU B 1 40  ? 4.438   14.046  4.552   1.00 47.31 ? 66  GLU B OE2 1 
ATOM 1279 N N   . GLY B 1 41  ? 4.941   11.747  9.785   1.00 44.33 ? 67  GLY B N   1 
ATOM 1280 C CA  . GLY B 1 41  ? 4.801   11.217  11.139  1.00 44.69 ? 67  GLY B CA  1 
ATOM 1281 C C   . GLY B 1 41  ? 6.074   11.296  11.967  1.00 44.94 ? 67  GLY B C   1 
ATOM 1282 O O   . GLY B 1 41  ? 6.046   11.044  13.170  1.00 45.09 ? 67  GLY B O   1 
ATOM 1283 N N   . ASP B 1 42  ? 7.184   11.648  11.318  1.00 45.28 ? 68  ASP B N   1 
ATOM 1284 C CA  . ASP B 1 42  ? 8.506   11.755  11.950  1.00 45.60 ? 68  ASP B CA  1 
ATOM 1285 C C   . ASP B 1 42  ? 8.811   10.572  12.867  1.00 45.68 ? 68  ASP B C   1 
ATOM 1286 O O   . ASP B 1 42  ? 8.766   10.704  14.094  1.00 45.83 ? 68  ASP B O   1 
ATOM 1287 C CB  . ASP B 1 42  ? 8.654   13.078  12.711  1.00 45.70 ? 68  ASP B CB  1 
ATOM 1288 C CG  . ASP B 1 42  ? 8.177   14.270  11.908  1.00 46.28 ? 68  ASP B CG  1 
ATOM 1289 O OD1 . ASP B 1 42  ? 8.852   14.638  10.917  1.00 46.66 ? 68  ASP B OD1 1 
ATOM 1290 O OD2 . ASP B 1 42  ? 7.124   14.837  12.276  1.00 46.84 ? 68  ASP B OD2 1 
ATOM 1291 N N   . PRO B 1 43  ? 9.105   9.404   12.275  1.00 45.74 ? 69  PRO B N   1 
ATOM 1292 C CA  . PRO B 1 43  ? 9.439   8.241   13.084  1.00 45.72 ? 69  PRO B CA  1 
ATOM 1293 C C   . PRO B 1 43  ? 10.949  8.124   13.277  1.00 45.67 ? 69  PRO B C   1 
ATOM 1294 O O   . PRO B 1 43  ? 11.701  8.918   12.712  1.00 45.41 ? 69  PRO B O   1 
ATOM 1295 C CB  . PRO B 1 43  ? 8.919   7.081   12.234  1.00 45.61 ? 69  PRO B CB  1 
ATOM 1296 C CG  . PRO B 1 43  ? 9.032   7.580   10.803  1.00 45.84 ? 69  PRO B CG  1 
ATOM 1297 C CD  . PRO B 1 43  ? 9.139   9.091   10.834  1.00 45.79 ? 69  PRO B CD  1 
ATOM 1298 N N   . ASP B 1 44  ? 11.379  7.157   14.083  1.00 45.69 ? 70  ASP B N   1 
ATOM 1299 C CA  . ASP B 1 44  ? 12.791  6.782   14.146  1.00 45.78 ? 70  ASP B CA  1 
ATOM 1300 C C   . ASP B 1 44  ? 12.898  5.266   14.150  1.00 45.57 ? 70  ASP B C   1 
ATOM 1301 O O   . ASP B 1 44  ? 13.848  4.689   13.613  1.00 45.68 ? 70  ASP B O   1 
ATOM 1302 C CB  . ASP B 1 44  ? 13.488  7.380   15.373  1.00 45.87 ? 70  ASP B CB  1 
ATOM 1303 C CG  . ASP B 1 44  ? 14.969  7.648   15.127  1.00 46.84 ? 70  ASP B CG  1 
ATOM 1304 O OD1 . ASP B 1 44  ? 15.515  7.127   14.127  1.00 48.24 ? 70  ASP B OD1 1 
ATOM 1305 O OD2 . ASP B 1 44  ? 15.594  8.388   15.921  1.00 47.59 ? 70  ASP B OD2 1 
ATOM 1306 N N   . PHE B 1 45  ? 11.904  4.637   14.768  1.00 45.20 ? 71  PHE B N   1 
ATOM 1307 C CA  . PHE B 1 45  ? 11.764  3.191   14.799  1.00 44.75 ? 71  PHE B CA  1 
ATOM 1308 C C   . PHE B 1 45  ? 11.116  2.740   13.477  1.00 44.36 ? 71  PHE B C   1 
ATOM 1309 O O   . PHE B 1 45  ? 9.960   2.287   13.480  1.00 44.55 ? 71  PHE B O   1 
ATOM 1310 C CB  . PHE B 1 45  ? 10.887  2.804   16.004  1.00 44.61 ? 71  PHE B CB  1 
ATOM 1311 C CG  . PHE B 1 45  ? 10.936  1.339   16.379  1.00 45.04 ? 71  PHE B CG  1 
ATOM 1312 C CD1 . PHE B 1 45  ? 11.872  0.872   17.299  1.00 45.18 ? 71  PHE B CD1 1 
ATOM 1313 C CD2 . PHE B 1 45  ? 10.012  0.436   15.859  1.00 45.39 ? 71  PHE B CD2 1 
ATOM 1314 C CE1 . PHE B 1 45  ? 11.909  -0.477  17.672  1.00 44.85 ? 71  PHE B CE1 1 
ATOM 1315 C CE2 . PHE B 1 45  ? 10.044  -0.916  16.225  1.00 45.10 ? 71  PHE B CE2 1 
ATOM 1316 C CZ  . PHE B 1 45  ? 10.998  -1.369  17.131  1.00 44.70 ? 71  PHE B CZ  1 
ATOM 1317 N N   . TYR B 1 46  ? 11.831  2.874   12.353  1.00 43.18 ? 72  TYR B N   1 
ATOM 1318 C CA  . TYR B 1 46  ? 11.334  2.305   11.102  1.00 42.43 ? 72  TYR B CA  1 
ATOM 1319 C C   . TYR B 1 46  ? 10.965  0.851   11.345  1.00 41.85 ? 72  TYR B C   1 
ATOM 1320 O O   . TYR B 1 46  ? 11.797  0.068   11.809  1.00 42.05 ? 72  TYR B O   1 
ATOM 1321 C CB  . TYR B 1 46  ? 12.329  2.435   9.936   1.00 42.75 ? 72  TYR B CB  1 
ATOM 1322 C CG  . TYR B 1 46  ? 13.436  1.388   9.861   1.00 43.00 ? 72  TYR B CG  1 
ATOM 1323 C CD1 . TYR B 1 46  ? 14.772  1.754   10.017  1.00 42.75 ? 72  TYR B CD1 1 
ATOM 1324 C CD2 . TYR B 1 46  ? 13.151  0.042   9.595   1.00 42.86 ? 72  TYR B CD2 1 
ATOM 1325 C CE1 . TYR B 1 46  ? 15.797  0.813   9.942   1.00 42.90 ? 72  TYR B CE1 1 
ATOM 1326 C CE2 . TYR B 1 46  ? 14.170  -0.913  9.530   1.00 43.19 ? 72  TYR B CE2 1 
ATOM 1327 C CZ  . TYR B 1 46  ? 15.494  -0.516  9.701   1.00 43.11 ? 72  TYR B CZ  1 
ATOM 1328 O OH  . TYR B 1 46  ? 16.520  -1.436  9.632   1.00 42.88 ? 72  TYR B OH  1 
ATOM 1329 N N   . LYS B 1 47  ? 9.705   0.509   11.082  1.00 40.86 ? 73  LYS B N   1 
ATOM 1330 C CA  . LYS B 1 47  ? 9.234   -0.860  11.242  1.00 39.75 ? 73  LYS B CA  1 
ATOM 1331 C C   . LYS B 1 47  ? 9.379   -1.616  9.924   1.00 38.73 ? 73  LYS B C   1 
ATOM 1332 O O   . LYS B 1 47  ? 8.795   -1.215  8.916   1.00 38.72 ? 73  LYS B O   1 
ATOM 1333 C CB  . LYS B 1 47  ? 7.782   -0.899  11.739  1.00 40.05 ? 73  LYS B CB  1 
ATOM 1334 C CG  . LYS B 1 47  ? 7.627   -0.696  13.249  1.00 40.77 ? 73  LYS B CG  1 
ATOM 1335 C CD  . LYS B 1 47  ? 6.389   -1.406  13.800  1.00 42.39 ? 73  LYS B CD  1 
ATOM 1336 C CE  . LYS B 1 47  ? 5.123   -0.555  13.689  1.00 43.11 ? 73  LYS B CE  1 
ATOM 1337 N NZ  . LYS B 1 47  ? 5.102   0.558   14.685  1.00 43.53 ? 73  LYS B NZ  1 
ATOM 1338 N N   . PRO B 1 48  ? 10.180  -2.700  9.929   1.00 37.73 ? 74  PRO B N   1 
ATOM 1339 C CA  . PRO B 1 48  ? 10.446  -3.581  8.780   1.00 36.99 ? 74  PRO B CA  1 
ATOM 1340 C C   . PRO B 1 48  ? 9.200   -3.997  7.989   1.00 36.28 ? 74  PRO B C   1 
ATOM 1341 O O   . PRO B 1 48  ? 8.299   -4.636  8.538   1.00 36.19 ? 74  PRO B O   1 
ATOM 1342 C CB  . PRO B 1 48  ? 11.108  -4.817  9.419   1.00 37.14 ? 74  PRO B CB  1 
ATOM 1343 C CG  . PRO B 1 48  ? 11.078  -4.593  10.914  1.00 37.12 ? 74  PRO B CG  1 
ATOM 1344 C CD  . PRO B 1 48  ? 10.931  -3.129  11.123  1.00 37.42 ? 74  PRO B CD  1 
ATOM 1345 N N   . GLY B 1 49  ? 9.167   -3.631  6.709   1.00 35.54 ? 75  GLY B N   1 
ATOM 1346 C CA  . GLY B 1 49  ? 8.060   -3.968  5.824   1.00 34.50 ? 75  GLY B CA  1 
ATOM 1347 C C   . GLY B 1 49  ? 7.067   -2.839  5.607   1.00 34.07 ? 75  GLY B C   1 
ATOM 1348 O O   . GLY B 1 49  ? 6.168   -2.960  4.772   1.00 33.95 ? 75  GLY B O   1 
ATOM 1349 N N   . THR B 1 50  ? 7.233   -1.741  6.345   1.00 33.50 ? 76  THR B N   1 
ATOM 1350 C CA  . THR B 1 50  ? 6.288   -0.620  6.314   1.00 33.33 ? 76  THR B CA  1 
ATOM 1351 C C   . THR B 1 50  ? 6.531   0.349   5.152   1.00 33.03 ? 76  THR B C   1 
ATOM 1352 O O   . THR B 1 50  ? 7.673   0.664   4.811   1.00 32.85 ? 76  THR B O   1 
ATOM 1353 C CB  . THR B 1 50  ? 6.312   0.178   7.642   1.00 33.47 ? 76  THR B CB  1 
ATOM 1354 O OG1 . THR B 1 50  ? 6.183   -0.717  8.755   1.00 34.50 ? 76  THR B OG1 1 
ATOM 1355 C CG2 . THR B 1 50  ? 5.183   1.211   7.692   1.00 33.67 ? 76  THR B CG2 1 
ATOM 1356 N N   . SER B 1 51  ? 5.438   0.821   4.558   1.00 32.71 ? 77  SER B N   1 
ATOM 1357 C CA  . SER B 1 51  ? 5.493   1.836   3.524   1.00 32.39 ? 77  SER B CA  1 
ATOM 1358 C C   . SER B 1 51  ? 5.554   3.232   4.139   1.00 32.33 ? 77  SER B C   1 
ATOM 1359 O O   . SER B 1 51  ? 4.574   3.712   4.697   1.00 32.45 ? 77  SER B O   1 
ATOM 1360 C CB  . SER B 1 51  ? 4.286   1.721   2.602   1.00 32.12 ? 77  SER B CB  1 
ATOM 1361 O OG  . SER B 1 51  ? 4.252   2.797   1.679   1.00 32.53 ? 77  SER B OG  1 
ATOM 1362 N N   . TYR B 1 52  ? 6.711   3.878   4.032   1.00 32.22 ? 78  TYR B N   1 
ATOM 1363 C CA  . TYR B 1 52  ? 6.869   5.243   4.505   1.00 32.20 ? 78  TYR B CA  1 
ATOM 1364 C C   . TYR B 1 52  ? 6.756   6.220   3.334   1.00 32.67 ? 78  TYR B C   1 
ATOM 1365 O O   . TYR B 1 52  ? 7.321   6.000   2.260   1.00 32.58 ? 78  TYR B O   1 
ATOM 1366 C CB  . TYR B 1 52  ? 8.200   5.413   5.260   1.00 31.90 ? 78  TYR B CB  1 
ATOM 1367 C CG  . TYR B 1 52  ? 8.238   4.680   6.594   1.00 31.18 ? 78  TYR B CG  1 
ATOM 1368 C CD1 . TYR B 1 52  ? 8.774   3.393   6.695   1.00 30.50 ? 78  TYR B CD1 1 
ATOM 1369 C CD2 . TYR B 1 52  ? 7.729   5.269   7.748   1.00 30.49 ? 78  TYR B CD2 1 
ATOM 1370 C CE1 . TYR B 1 52  ? 8.806   2.715   7.906   1.00 30.80 ? 78  TYR B CE1 1 
ATOM 1371 C CE2 . TYR B 1 52  ? 7.750   4.597   8.968   1.00 31.14 ? 78  TYR B CE2 1 
ATOM 1372 C CZ  . TYR B 1 52  ? 8.288   3.317   9.043   1.00 31.43 ? 78  TYR B CZ  1 
ATOM 1373 O OH  . TYR B 1 52  ? 8.297   2.644   10.250  1.00 30.93 ? 78  TYR B OH  1 
ATOM 1374 N N   . ARG B 1 53  ? 5.990   7.283   3.541   1.00 33.07 ? 79  ARG B N   1 
ATOM 1375 C CA  . ARG B 1 53  ? 5.858   8.339   2.555   1.00 33.48 ? 79  ARG B CA  1 
ATOM 1376 C C   . ARG B 1 53  ? 6.996   9.305   2.794   1.00 33.61 ? 79  ARG B C   1 
ATOM 1377 O O   . ARG B 1 53  ? 7.150   9.807   3.906   1.00 34.07 ? 79  ARG B O   1 
ATOM 1378 C CB  . ARG B 1 53  ? 4.522   9.045   2.737   1.00 33.54 ? 79  ARG B CB  1 
ATOM 1379 C CG  . ARG B 1 53  ? 4.197   10.068  1.685   1.00 34.81 ? 79  ARG B CG  1 
ATOM 1380 C CD  . ARG B 1 53  ? 2.866   10.730  1.979   1.00 36.85 ? 79  ARG B CD  1 
ATOM 1381 N NE  . ARG B 1 53  ? 1.761   9.772   2.082   1.00 37.42 ? 79  ARG B NE  1 
ATOM 1382 C CZ  . ARG B 1 53  ? 1.043   9.336   1.049   1.00 38.19 ? 79  ARG B CZ  1 
ATOM 1383 N NH1 . ARG B 1 53  ? 1.314   9.757   -0.184  1.00 39.08 ? 79  ARG B NH1 1 
ATOM 1384 N NH2 . ARG B 1 53  ? 0.049   8.475   1.246   1.00 38.14 ? 79  ARG B NH2 1 
ATOM 1385 N N   . VAL B 1 54  ? 7.807   9.537   1.765   1.00 33.67 ? 80  VAL B N   1 
ATOM 1386 C CA  . VAL B 1 54  ? 8.989   10.396  1.884   1.00 33.73 ? 80  VAL B CA  1 
ATOM 1387 C C   . VAL B 1 54  ? 8.853   11.622  0.983   1.00 33.85 ? 80  VAL B C   1 
ATOM 1388 O O   . VAL B 1 54  ? 8.627   11.502  -0.223  1.00 33.51 ? 80  VAL B O   1 
ATOM 1389 C CB  . VAL B 1 54  ? 10.302  9.636   1.573   1.00 33.66 ? 80  VAL B CB  1 
ATOM 1390 C CG1 . VAL B 1 54  ? 11.506  10.512  1.866   1.00 33.76 ? 80  VAL B CG1 1 
ATOM 1391 C CG2 . VAL B 1 54  ? 10.392  8.354   2.390   1.00 33.66 ? 80  VAL B CG2 1 
ATOM 1392 N N   . THR B 1 55  ? 8.991   12.798  1.587   1.00 34.08 ? 81  THR B N   1 
ATOM 1393 C CA  . THR B 1 55  ? 8.760   14.061  0.891   1.00 34.28 ? 81  THR B CA  1 
ATOM 1394 C C   . THR B 1 55  ? 10.028  14.904  0.834   1.00 34.41 ? 81  THR B C   1 
ATOM 1395 O O   . THR B 1 55  ? 10.734  15.054  1.836   1.00 34.55 ? 81  THR B O   1 
ATOM 1396 C CB  . THR B 1 55  ? 7.608   14.851  1.555   1.00 34.15 ? 81  THR B CB  1 
ATOM 1397 O OG1 . THR B 1 55  ? 6.381   14.166  1.313   1.00 34.09 ? 81  THR B OG1 1 
ATOM 1398 C CG2 . THR B 1 55  ? 7.492   16.259  1.000   1.00 34.32 ? 81  THR B CG2 1 
ATOM 1399 N N   . LEU B 1 56  ? 10.313  15.424  -0.357  1.00 34.42 ? 82  LEU B N   1 
ATOM 1400 C CA  . LEU B 1 56  ? 11.364  16.406  -0.566  1.00 34.78 ? 82  LEU B CA  1 
ATOM 1401 C C   . LEU B 1 56  ? 10.679  17.696  -0.987  1.00 35.10 ? 82  LEU B C   1 
ATOM 1402 O O   . LEU B 1 56  ? 10.014  17.726  -2.026  1.00 35.37 ? 82  LEU B O   1 
ATOM 1403 C CB  . LEU B 1 56  ? 12.328  15.926  -1.656  1.00 34.54 ? 82  LEU B CB  1 
ATOM 1404 C CG  . LEU B 1 56  ? 13.331  16.902  -2.277  1.00 34.67 ? 82  LEU B CG  1 
ATOM 1405 C CD1 . LEU B 1 56  ? 14.353  17.421  -1.268  1.00 34.42 ? 82  LEU B CD1 1 
ATOM 1406 C CD2 . LEU B 1 56  ? 14.036  16.237  -3.443  1.00 34.93 ? 82  LEU B CD2 1 
ATOM 1407 N N   . SER B 1 57  ? 10.826  18.752  -0.187  1.00 35.33 ? 83  SER B N   1 
ATOM 1408 C CA  . SER B 1 57  ? 10.121  20.009  -0.457  1.00 35.53 ? 83  SER B CA  1 
ATOM 1409 C C   . SER B 1 57  ? 11.009  21.249  -0.406  1.00 35.72 ? 83  SER B C   1 
ATOM 1410 O O   . SER B 1 57  ? 12.066  21.245  0.234   1.00 35.79 ? 83  SER B O   1 
ATOM 1411 C CB  . SER B 1 57  ? 8.933   20.176  0.494   1.00 35.58 ? 83  SER B CB  1 
ATOM 1412 O OG  . SER B 1 57  ? 9.362   20.228  1.841   1.00 35.72 ? 83  SER B OG  1 
ATOM 1413 N N   . ALA B 1 58  ? 10.558  22.305  -1.085  1.00 35.82 ? 84  ALA B N   1 
ATOM 1414 C CA  . ALA B 1 58  ? 11.256  23.583  -1.118  1.00 36.03 ? 84  ALA B CA  1 
ATOM 1415 C C   . ALA B 1 58  ? 10.479  24.677  -0.391  1.00 36.37 ? 84  ALA B C   1 
ATOM 1416 O O   . ALA B 1 58  ? 9.376   25.046  -0.800  1.00 36.37 ? 84  ALA B O   1 
ATOM 1417 C CB  . ALA B 1 58  ? 11.516  23.994  -2.544  1.00 36.01 ? 84  ALA B CB  1 
ATOM 1418 N N   . ALA B 1 59  ? 11.078  25.198  0.677   1.00 36.79 ? 85  ALA B N   1 
ATOM 1419 C CA  . ALA B 1 59  ? 10.516  26.293  1.473   1.00 37.25 ? 85  ALA B CA  1 
ATOM 1420 C C   . ALA B 1 59  ? 9.812   27.361  0.623   1.00 37.61 ? 85  ALA B C   1 
ATOM 1421 O O   . ALA B 1 59  ? 10.289  27.685  -0.467  1.00 37.62 ? 85  ALA B O   1 
ATOM 1422 C CB  . ALA B 1 59  ? 11.612  26.929  2.327   1.00 37.26 ? 85  ALA B CB  1 
ATOM 1423 N N   . PRO B 1 60  ? 8.690   27.920  1.139   1.00 37.95 ? 86  PRO B N   1 
ATOM 1424 C CA  . PRO B 1 60  ? 7.757   28.843  0.485   1.00 38.04 ? 86  PRO B CA  1 
ATOM 1425 C C   . PRO B 1 60  ? 8.195   29.536  -0.824  1.00 38.12 ? 86  PRO B C   1 
ATOM 1426 O O   . PRO B 1 60  ? 7.555   29.304  -1.847  1.00 38.53 ? 86  PRO B O   1 
ATOM 1427 C CB  . PRO B 1 60  ? 7.434   29.839  1.603   1.00 38.17 ? 86  PRO B CB  1 
ATOM 1428 C CG  . PRO B 1 60  ? 7.530   28.982  2.891   1.00 38.17 ? 86  PRO B CG  1 
ATOM 1429 C CD  . PRO B 1 60  ? 8.245   27.679  2.526   1.00 38.01 ? 86  PRO B CD  1 
ATOM 1430 N N   . PRO B 1 61  ? 9.251   30.381  -0.809  1.00 37.86 ? 87  PRO B N   1 
ATOM 1431 C CA  . PRO B 1 61  ? 9.586   31.051  -2.081  1.00 37.60 ? 87  PRO B CA  1 
ATOM 1432 C C   . PRO B 1 61  ? 10.365  30.211  -3.112  1.00 37.37 ? 87  PRO B C   1 
ATOM 1433 O O   . PRO B 1 61  ? 10.170  30.391  -4.318  1.00 37.43 ? 87  PRO B O   1 
ATOM 1434 C CB  . PRO B 1 61  ? 10.434  32.256  -1.638  1.00 37.58 ? 87  PRO B CB  1 
ATOM 1435 C CG  . PRO B 1 61  ? 10.455  32.221  -0.116  1.00 37.86 ? 87  PRO B CG  1 
ATOM 1436 C CD  . PRO B 1 61  ? 10.145  30.815  0.276   1.00 37.84 ? 87  PRO B CD  1 
ATOM 1437 N N   . SER B 1 62  ? 11.223  29.306  -2.642  1.00 36.96 ? 88  SER B N   1 
ATOM 1438 C CA  . SER B 1 62  ? 12.209  28.622  -3.494  1.00 36.47 ? 88  SER B CA  1 
ATOM 1439 C C   . SER B 1 62  ? 11.676  27.438  -4.312  1.00 36.07 ? 88  SER B C   1 
ATOM 1440 O O   . SER B 1 62  ? 10.572  26.953  -4.076  1.00 35.97 ? 88  SER B O   1 
ATOM 1441 C CB  . SER B 1 62  ? 13.395  28.163  -2.642  1.00 36.55 ? 88  SER B CB  1 
ATOM 1442 O OG  . SER B 1 62  ? 12.979  27.218  -1.669  1.00 37.13 ? 88  SER B OG  1 
ATOM 1443 N N   . TYR B 1 63  ? 12.483  26.980  -5.271  1.00 35.71 ? 89  TYR B N   1 
ATOM 1444 C CA  . TYR B 1 63  ? 12.157  25.810  -6.101  1.00 35.35 ? 89  TYR B CA  1 
ATOM 1445 C C   . TYR B 1 63  ? 13.388  24.959  -6.425  1.00 35.06 ? 89  TYR B C   1 
ATOM 1446 O O   . TYR B 1 63  ? 14.518  25.404  -6.241  1.00 34.88 ? 89  TYR B O   1 
ATOM 1447 C CB  . TYR B 1 63  ? 11.487  26.249  -7.411  1.00 35.06 ? 89  TYR B CB  1 
ATOM 1448 C CG  . TYR B 1 63  ? 12.438  26.844  -8.424  1.00 34.78 ? 89  TYR B CG  1 
ATOM 1449 C CD1 . TYR B 1 63  ? 12.779  28.197  -8.376  1.00 35.26 ? 89  TYR B CD1 1 
ATOM 1450 C CD2 . TYR B 1 63  ? 12.994  26.059  -9.435  1.00 34.39 ? 89  TYR B CD2 1 
ATOM 1451 C CE1 . TYR B 1 63  ? 13.656  28.756  -9.309  1.00 34.51 ? 89  TYR B CE1 1 
ATOM 1452 C CE2 . TYR B 1 63  ? 13.874  26.609  -10.371 1.00 34.46 ? 89  TYR B CE2 1 
ATOM 1453 C CZ  . TYR B 1 63  ? 14.197  27.960  -10.301 1.00 34.31 ? 89  TYR B CZ  1 
ATOM 1454 O OH  . TYR B 1 63  ? 15.061  28.518  -11.217 1.00 34.05 ? 89  TYR B OH  1 
ATOM 1455 N N   . PHE B 1 64  ? 13.154  23.741  -6.915  1.00 34.89 ? 90  PHE B N   1 
ATOM 1456 C CA  . PHE B 1 64  ? 14.214  22.912  -7.506  1.00 34.86 ? 90  PHE B CA  1 
ATOM 1457 C C   . PHE B 1 64  ? 13.757  22.268  -8.812  1.00 35.22 ? 90  PHE B C   1 
ATOM 1458 O O   . PHE B 1 64  ? 12.561  22.187  -9.089  1.00 35.17 ? 90  PHE B O   1 
ATOM 1459 C CB  . PHE B 1 64  ? 14.722  21.853  -6.518  1.00 34.47 ? 90  PHE B CB  1 
ATOM 1460 C CG  . PHE B 1 64  ? 13.644  20.965  -5.966  1.00 33.53 ? 90  PHE B CG  1 
ATOM 1461 C CD1 . PHE B 1 64  ? 12.975  21.307  -4.803  1.00 32.38 ? 90  PHE B CD1 1 
ATOM 1462 C CD2 . PHE B 1 64  ? 13.304  19.782  -6.607  1.00 32.42 ? 90  PHE B CD2 1 
ATOM 1463 C CE1 . PHE B 1 64  ? 11.984  20.487  -4.293  1.00 32.42 ? 90  PHE B CE1 1 
ATOM 1464 C CE2 . PHE B 1 64  ? 12.317  18.961  -6.100  1.00 31.52 ? 90  PHE B CE2 1 
ATOM 1465 C CZ  . PHE B 1 64  ? 11.656  19.313  -4.944  1.00 32.25 ? 90  PHE B CZ  1 
ATOM 1466 N N   . ARG B 1 65  ? 14.706  21.823  -9.628  1.00 36.05 ? 91  ARG B N   1 
ATOM 1467 C CA  . ARG B 1 65  ? 14.347  21.200  -10.903 1.00 37.01 ? 91  ARG B CA  1 
ATOM 1468 C C   . ARG B 1 65  ? 14.501  19.684  -10.804 1.00 37.55 ? 91  ARG B C   1 
ATOM 1469 O O   . ARG B 1 65  ? 13.499  18.958  -10.703 1.00 38.27 ? 91  ARG B O   1 
ATOM 1470 C CB  . ARG B 1 65  ? 15.124  21.811  -12.079 1.00 36.75 ? 91  ARG B CB  1 
ATOM 1471 C CG  . ARG B 1 65  ? 15.021  23.354  -12.154 1.00 37.42 ? 91  ARG B CG  1 
ATOM 1472 C CD  . ARG B 1 65  ? 15.490  23.931  -13.491 1.00 36.84 ? 91  ARG B CD  1 
ATOM 1473 N NE  . ARG B 1 65  ? 14.376  24.440  -14.290 1.00 37.55 ? 91  ARG B NE  1 
ATOM 1474 C CZ  . ARG B 1 65  ? 14.263  25.696  -14.720 1.00 38.49 ? 91  ARG B CZ  1 
ATOM 1475 N NH1 . ARG B 1 65  ? 15.207  26.591  -14.452 1.00 40.24 ? 91  ARG B NH1 1 
ATOM 1476 N NH2 . ARG B 1 65  ? 13.210  26.061  -15.431 1.00 37.47 ? 91  ARG B NH2 1 
ATOM 1477 N N   . GLY B 1 66  ? 15.742  19.216  -10.798 1.00 37.94 ? 92  GLY B N   1 
ATOM 1478 C CA  . GLY B 1 66  ? 16.048  17.807  -10.592 1.00 38.29 ? 92  GLY B CA  1 
ATOM 1479 C C   . GLY B 1 66  ? 16.478  17.513  -9.167  1.00 38.73 ? 92  GLY B C   1 
ATOM 1480 O O   . GLY B 1 66  ? 16.681  18.431  -8.370  1.00 38.97 ? 92  GLY B O   1 
ATOM 1481 N N   . PHE B 1 67  ? 16.624  16.225  -8.852  1.00 38.92 ? 93  PHE B N   1 
ATOM 1482 C CA  . PHE B 1 67  ? 16.903  15.759  -7.491  1.00 38.79 ? 93  PHE B CA  1 
ATOM 1483 C C   . PHE B 1 67  ? 17.260  14.288  -7.546  1.00 38.74 ? 93  PHE B C   1 
ATOM 1484 O O   . PHE B 1 67  ? 17.056  13.640  -8.569  1.00 38.65 ? 93  PHE B O   1 
ATOM 1485 C CB  . PHE B 1 67  ? 15.661  15.898  -6.614  1.00 39.07 ? 93  PHE B CB  1 
ATOM 1486 C CG  . PHE B 1 67  ? 14.559  14.950  -6.988  1.00 39.01 ? 93  PHE B CG  1 
ATOM 1487 C CD1 . PHE B 1 67  ? 14.499  13.678  -6.427  1.00 38.88 ? 93  PHE B CD1 1 
ATOM 1488 C CD2 . PHE B 1 67  ? 13.599  15.317  -7.930  1.00 38.84 ? 93  PHE B CD2 1 
ATOM 1489 C CE1 . PHE B 1 67  ? 13.492  12.784  -6.787  1.00 39.58 ? 93  PHE B CE1 1 
ATOM 1490 C CE2 . PHE B 1 67  ? 12.584  14.432  -8.294  1.00 39.23 ? 93  PHE B CE2 1 
ATOM 1491 C CZ  . PHE B 1 67  ? 12.531  13.161  -7.721  1.00 38.99 ? 93  PHE B CZ  1 
ATOM 1492 N N   . THR B 1 68  ? 17.767  13.764  -6.431  1.00 38.79 ? 94  THR B N   1 
ATOM 1493 C CA  . THR B 1 68  ? 18.079  12.343  -6.307  1.00 38.81 ? 94  THR B CA  1 
ATOM 1494 C C   . THR B 1 68  ? 17.858  11.908  -4.861  1.00 38.84 ? 94  THR B C   1 
ATOM 1495 O O   . THR B 1 68  ? 18.232  12.631  -3.946  1.00 38.99 ? 94  THR B O   1 
ATOM 1496 C CB  . THR B 1 68  ? 19.530  12.049  -6.741  1.00 38.94 ? 94  THR B CB  1 
ATOM 1497 O OG1 . THR B 1 68  ? 19.753  12.542  -8.074  1.00 39.04 ? 94  THR B OG1 1 
ATOM 1498 C CG2 . THR B 1 68  ? 19.821  10.555  -6.699  1.00 38.73 ? 94  THR B CG2 1 
ATOM 1499 N N   . LEU B 1 69  ? 17.228  10.748  -4.661  1.00 38.90 ? 95  LEU B N   1 
ATOM 1500 C CA  . LEU B 1 69  ? 17.033  10.182  -3.318  1.00 39.05 ? 95  LEU B CA  1 
ATOM 1501 C C   . LEU B 1 69  ? 17.555  8.767   -3.254  1.00 38.80 ? 95  LEU B C   1 
ATOM 1502 O O   . LEU B 1 69  ? 17.313  7.976   -4.163  1.00 38.91 ? 95  LEU B O   1 
ATOM 1503 C CB  . LEU B 1 69  ? 15.558  10.136  -2.910  1.00 39.13 ? 95  LEU B CB  1 
ATOM 1504 C CG  . LEU B 1 69  ? 14.583  11.214  -3.350  1.00 40.34 ? 95  LEU B CG  1 
ATOM 1505 C CD1 . LEU B 1 69  ? 13.206  10.800  -2.889  1.00 41.40 ? 95  LEU B CD1 1 
ATOM 1506 C CD2 . LEU B 1 69  ? 14.965  12.577  -2.788  1.00 41.13 ? 95  LEU B CD2 1 
ATOM 1507 N N   . ILE B 1 70  ? 18.245  8.444   -2.165  1.00 38.57 ? 96  ILE B N   1 
ATOM 1508 C CA  . ILE B 1 70  ? 18.738  7.089   -1.943  1.00 38.47 ? 96  ILE B CA  1 
ATOM 1509 C C   . ILE B 1 70  ? 18.404  6.614   -0.545  1.00 38.60 ? 96  ILE B C   1 
ATOM 1510 O O   . ILE B 1 70  ? 17.976  7.405   0.298   1.00 38.62 ? 96  ILE B O   1 
ATOM 1511 C CB  . ILE B 1 70  ? 20.257  6.986   -2.160  1.00 38.47 ? 96  ILE B CB  1 
ATOM 1512 C CG1 . ILE B 1 70  ? 21.003  7.861   -1.142  1.00 38.22 ? 96  ILE B CG1 1 
ATOM 1513 C CG2 . ILE B 1 70  ? 20.589  7.328   -3.609  1.00 38.38 ? 96  ILE B CG2 1 
ATOM 1514 C CD1 . ILE B 1 70  ? 22.504  7.938   -1.337  1.00 38.09 ? 96  ILE B CD1 1 
ATOM 1515 N N   . ALA B 1 71  ? 18.601  5.317   -0.319  1.00 38.61 ? 97  ALA B N   1 
ATOM 1516 C CA  . ALA B 1 71  ? 18.402  4.702   0.986   1.00 38.70 ? 97  ALA B CA  1 
ATOM 1517 C C   . ALA B 1 71  ? 19.600  3.818   1.293   1.00 38.92 ? 97  ALA B C   1 
ATOM 1518 O O   . ALA B 1 71  ? 19.664  2.664   0.864   1.00 38.93 ? 97  ALA B O   1 
ATOM 1519 C CB  . ALA B 1 71  ? 17.122  3.886   0.993   1.00 38.76 ? 97  ALA B CB  1 
ATOM 1520 N N   . LEU B 1 72  ? 20.564  4.363   2.024   1.00 39.15 ? 98  LEU B N   1 
ATOM 1521 C CA  . LEU B 1 72  ? 21.781  3.620   2.290   1.00 39.57 ? 98  LEU B CA  1 
ATOM 1522 C C   . LEU B 1 72  ? 21.800  3.045   3.684   1.00 39.80 ? 98  LEU B C   1 
ATOM 1523 O O   . LEU B 1 72  ? 21.237  3.625   4.610   1.00 39.84 ? 98  LEU B O   1 
ATOM 1524 C CB  . LEU B 1 72  ? 23.016  4.499   2.086   1.00 39.70 ? 98  LEU B CB  1 
ATOM 1525 C CG  . LEU B 1 72  ? 23.271  5.130   0.717   1.00 39.47 ? 98  LEU B CG  1 
ATOM 1526 C CD1 . LEU B 1 72  ? 24.662  5.732   0.696   1.00 39.88 ? 98  LEU B CD1 1 
ATOM 1527 C CD2 . LEU B 1 72  ? 23.121  4.122   -0.402  1.00 39.18 ? 98  LEU B CD2 1 
ATOM 1528 N N   . ARG B 1 73  ? 22.462  1.900   3.819   1.00 40.24 ? 99  ARG B N   1 
ATOM 1529 C CA  . ARG B 1 73  ? 22.765  1.320   5.126   1.00 40.57 ? 99  ARG B CA  1 
ATOM 1530 C C   . ARG B 1 73  ? 23.726  2.244   5.848   1.00 40.96 ? 99  ARG B C   1 
ATOM 1531 O O   . ARG B 1 73  ? 24.568  2.880   5.222   1.00 41.21 ? 99  ARG B O   1 
ATOM 1532 C CB  . ARG B 1 73  ? 23.398  -0.062  4.968   1.00 40.31 ? 99  ARG B CB  1 
ATOM 1533 C CG  . ARG B 1 73  ? 22.479  -1.087  4.334   1.00 40.33 ? 99  ARG B CG  1 
ATOM 1534 C CD  . ARG B 1 73  ? 23.246  -2.154  3.586   1.00 40.95 ? 99  ARG B CD  1 
ATOM 1535 N NE  . ARG B 1 73  ? 23.628  -3.252  4.471   1.00 42.64 ? 99  ARG B NE  1 
ATOM 1536 C CZ  . ARG B 1 73  ? 22.880  -4.329  4.694   1.00 43.20 ? 99  ARG B CZ  1 
ATOM 1537 N NH1 . ARG B 1 73  ? 23.311  -5.271  5.522   1.00 42.52 ? 99  ARG B NH1 1 
ATOM 1538 N NH2 . ARG B 1 73  ? 21.701  -4.466  4.090   1.00 43.48 ? 99  ARG B NH2 1 
ATOM 1539 N N   . GLU B 1 74  ? 23.580  2.320   7.165   1.00 41.65 ? 100 GLU B N   1 
ATOM 1540 C CA  . GLU B 1 74  ? 24.475  3.078   8.042   1.00 42.25 ? 100 GLU B CA  1 
ATOM 1541 C C   . GLU B 1 74  ? 25.945  3.083   7.588   1.00 42.66 ? 100 GLU B C   1 
ATOM 1542 O O   . GLU B 1 74  ? 26.553  2.022   7.406   1.00 42.68 ? 100 GLU B O   1 
ATOM 1543 C CB  . GLU B 1 74  ? 24.373  2.514   9.464   1.00 42.25 ? 100 GLU B CB  1 
ATOM 1544 C CG  . GLU B 1 74  ? 25.208  3.230   10.508  1.00 42.54 ? 100 GLU B CG  1 
ATOM 1545 C CD  . GLU B 1 74  ? 25.432  2.389   11.747  1.00 42.76 ? 100 GLU B CD  1 
ATOM 1546 O OE1 . GLU B 1 74  ? 24.463  1.783   12.252  1.00 42.62 ? 100 GLU B OE1 1 
ATOM 1547 O OE2 . GLU B 1 74  ? 26.586  2.339   12.220  1.00 43.56 ? 100 GLU B OE2 1 
ATOM 1548 N N   . ASN B 1 75  ? 26.492  4.288   7.410   1.00 43.18 ? 101 ASN B N   1 
ATOM 1549 C CA  . ASN B 1 75  ? 27.920  4.501   7.131   1.00 43.53 ? 101 ASN B CA  1 
ATOM 1550 C C   . ASN B 1 75  ? 28.410  3.925   5.803   1.00 43.63 ? 101 ASN B C   1 
ATOM 1551 O O   . ASN B 1 75  ? 29.560  3.494   5.692   1.00 43.53 ? 101 ASN B O   1 
ATOM 1552 C CB  . ASN B 1 75  ? 28.788  3.986   8.292   1.00 43.69 ? 101 ASN B CB  1 
ATOM 1553 C CG  . ASN B 1 75  ? 28.987  5.022   9.382   1.00 44.47 ? 101 ASN B CG  1 
ATOM 1554 O OD1 . ASN B 1 75  ? 29.557  6.092   9.142   1.00 45.60 ? 101 ASN B OD1 1 
ATOM 1555 N ND2 . ASN B 1 75  ? 28.536  4.704   10.593  1.00 44.76 ? 101 ASN B ND2 1 
ATOM 1556 N N   . ARG B 1 76  ? 27.542  3.926   4.796   1.00 43.80 ? 102 ARG B N   1 
ATOM 1557 C CA  . ARG B 1 76  ? 27.910  3.414   3.477   1.00 44.05 ? 102 ARG B CA  1 
ATOM 1558 C C   . ARG B 1 76  ? 28.042  4.499   2.417   1.00 44.58 ? 102 ARG B C   1 
ATOM 1559 O O   . ARG B 1 76  ? 27.459  5.579   2.540   1.00 44.75 ? 102 ARG B O   1 
ATOM 1560 C CB  . ARG B 1 76  ? 26.935  2.334   3.016   1.00 43.83 ? 102 ARG B CB  1 
ATOM 1561 C CG  . ARG B 1 76  ? 27.483  0.915   3.080   1.00 42.97 ? 102 ARG B CG  1 
ATOM 1562 C CD  . ARG B 1 76  ? 27.343  0.291   4.448   1.00 41.27 ? 102 ARG B CD  1 
ATOM 1563 N NE  . ARG B 1 76  ? 27.215  -1.162  4.348   1.00 40.19 ? 102 ARG B NE  1 
ATOM 1564 C CZ  . ARG B 1 76  ? 26.968  -1.975  5.379   1.00 39.83 ? 102 ARG B CZ  1 
ATOM 1565 N NH1 . ARG B 1 76  ? 26.864  -3.283  5.181   1.00 39.69 ? 102 ARG B NH1 1 
ATOM 1566 N NH2 . ARG B 1 76  ? 26.830  -1.485  6.608   1.00 39.56 ? 102 ARG B NH2 1 
ATOM 1567 N N   . GLU B 1 77  ? 28.816  4.190   1.379   1.00 45.22 ? 103 GLU B N   1 
ATOM 1568 C CA  . GLU B 1 77  ? 29.122  5.124   0.295   1.00 45.69 ? 103 GLU B CA  1 
ATOM 1569 C C   . GLU B 1 77  ? 27.959  5.267   -0.685  1.00 46.01 ? 103 GLU B C   1 
ATOM 1570 O O   . GLU B 1 77  ? 27.605  6.377   -1.088  1.00 46.09 ? 103 GLU B O   1 
ATOM 1571 C CB  . GLU B 1 77  ? 30.388  4.670   -0.449  1.00 45.68 ? 103 GLU B CB  1 
ATOM 1572 C CG  . GLU B 1 77  ? 30.985  5.706   -1.410  1.00 46.18 ? 103 GLU B CG  1 
ATOM 1573 C CD  . GLU B 1 77  ? 31.760  6.807   -0.704  1.00 46.71 ? 103 GLU B CD  1 
ATOM 1574 O OE1 . GLU B 1 77  ? 31.876  7.914   -1.266  1.00 46.70 ? 103 GLU B OE1 1 
ATOM 1575 O OE2 . GLU B 1 77  ? 32.256  6.569   0.415   1.00 47.34 ? 103 GLU B OE2 1 
ATOM 1576 N N   . GLY B 1 78  ? 27.362  4.139   -1.057  1.00 46.37 ? 104 GLY B N   1 
ATOM 1577 C CA  . GLY B 1 78  ? 26.350  4.119   -2.108  1.00 46.70 ? 104 GLY B CA  1 
ATOM 1578 C C   . GLY B 1 78  ? 26.986  3.753   -3.430  1.00 46.99 ? 104 GLY B C   1 
ATOM 1579 O O   . GLY B 1 78  ? 26.285  3.460   -4.401  1.00 46.88 ? 104 GLY B O   1 
ATOM 1580 N N   . ASP B 1 79  ? 28.322  3.761   -3.440  1.00 47.29 ? 105 ASP B N   1 
ATOM 1581 C CA  . ASP B 1 79  ? 29.162  3.478   -4.613  1.00 47.59 ? 105 ASP B CA  1 
ATOM 1582 C C   . ASP B 1 79  ? 28.837  2.158   -5.321  1.00 47.76 ? 105 ASP B C   1 
ATOM 1583 O O   . ASP B 1 79  ? 29.180  1.989   -6.498  1.00 47.65 ? 105 ASP B O   1 
ATOM 1584 C CB  . ASP B 1 79  ? 30.638  3.480   -4.195  1.00 47.65 ? 105 ASP B CB  1 
ATOM 1585 C CG  . ASP B 1 79  ? 31.586  3.516   -5.377  1.00 48.20 ? 105 ASP B CG  1 
ATOM 1586 O OD1 . ASP B 1 79  ? 32.539  2.707   -5.397  1.00 48.68 ? 105 ASP B OD1 1 
ATOM 1587 O OD2 . ASP B 1 79  ? 31.381  4.349   -6.289  1.00 49.15 ? 105 ASP B OD2 1 
ATOM 1588 N N   . LYS B 1 80  ? 28.193  1.235   -4.597  1.00 47.78 ? 106 LYS B N   1 
ATOM 1589 C CA  . LYS B 1 80  ? 27.774  -0.057  -5.148  1.00 47.73 ? 106 LYS B CA  1 
ATOM 1590 C C   . LYS B 1 80  ? 26.345  -0.424  -4.715  1.00 47.66 ? 106 LYS B C   1 
ATOM 1591 O O   . LYS B 1 80  ? 25.761  0.235   -3.854  1.00 47.72 ? 106 LYS B O   1 
ATOM 1592 C CB  . LYS B 1 80  ? 28.784  -1.155  -4.786  1.00 47.74 ? 106 LYS B CB  1 
ATOM 1593 C CG  . LYS B 1 80  ? 28.902  -2.241  -5.852  1.00 48.06 ? 106 LYS B CG  1 
ATOM 1594 C CD  . LYS B 1 80  ? 30.257  -2.928  -5.838  1.00 48.36 ? 106 LYS B CD  1 
ATOM 1595 C CE  . LYS B 1 80  ? 30.402  -3.867  -7.031  1.00 48.45 ? 106 LYS B CE  1 
ATOM 1596 N NZ  . LYS B 1 80  ? 31.756  -4.485  -7.111  1.00 48.25 ? 106 LYS B NZ  1 
ATOM 1597 N N   . GLU B 1 81  ? 25.787  -1.470  -5.320  1.00 47.48 ? 107 GLU B N   1 
ATOM 1598 C CA  . GLU B 1 81  ? 24.366  -1.792  -5.172  1.00 47.32 ? 107 GLU B CA  1 
ATOM 1599 C C   . GLU B 1 81  ? 24.020  -2.407  -3.814  1.00 47.11 ? 107 GLU B C   1 
ATOM 1600 O O   . GLU B 1 81  ? 23.138  -1.896  -3.113  1.00 47.22 ? 107 GLU B O   1 
ATOM 1601 C CB  . GLU B 1 81  ? 23.908  -2.707  -6.313  1.00 47.34 ? 107 GLU B CB  1 
ATOM 1602 C CG  . GLU B 1 81  ? 22.411  -2.693  -6.582  1.00 47.59 ? 107 GLU B CG  1 
ATOM 1603 C CD  . GLU B 1 81  ? 22.024  -3.569  -7.763  1.00 47.67 ? 107 GLU B CD  1 
ATOM 1604 O OE1 . GLU B 1 81  ? 22.065  -4.814  -7.627  1.00 47.50 ? 107 GLU B OE1 1 
ATOM 1605 O OE2 . GLU B 1 81  ? 21.674  -3.007  -8.827  1.00 48.21 ? 107 GLU B OE2 1 
ATOM 1606 N N   . GLU B 1 82  ? 24.707  -3.496  -3.455  1.00 46.65 ? 108 GLU B N   1 
ATOM 1607 C CA  . GLU B 1 82  ? 24.499  -4.192  -2.175  1.00 46.26 ? 108 GLU B CA  1 
ATOM 1608 C C   . GLU B 1 82  ? 25.021  -3.346  -1.007  1.00 45.91 ? 108 GLU B C   1 
ATOM 1609 O O   . GLU B 1 82  ? 25.956  -3.717  -0.294  1.00 46.05 ? 108 GLU B O   1 
ATOM 1610 C CB  . GLU B 1 82  ? 25.118  -5.603  -2.199  1.00 46.38 ? 108 GLU B CB  1 
ATOM 1611 C CG  . GLU B 1 82  ? 26.600  -5.686  -2.604  1.00 46.58 ? 108 GLU B CG  1 
ATOM 1612 C CD  . GLU B 1 82  ? 26.817  -5.794  -4.109  1.00 46.88 ? 108 GLU B CD  1 
ATOM 1613 O OE1 . GLU B 1 82  ? 27.421  -6.799  -4.543  1.00 46.72 ? 108 GLU B OE1 1 
ATOM 1614 O OE2 . GLU B 1 82  ? 26.392  -4.884  -4.857  1.00 46.68 ? 108 GLU B OE2 1 
ATOM 1615 N N   . ASP B 1 83  ? 24.358  -2.213  -0.817  1.00 45.47 ? 109 ASP B N   1 
ATOM 1616 C CA  . ASP B 1 83  ? 24.879  -1.069  -0.095  1.00 45.01 ? 109 ASP B CA  1 
ATOM 1617 C C   . ASP B 1 83  ? 23.691  -0.124  0.066   1.00 44.48 ? 109 ASP B C   1 
ATOM 1618 O O   . ASP B 1 83  ? 23.677  0.751   0.937   1.00 44.26 ? 109 ASP B O   1 
ATOM 1619 C CB  . ASP B 1 83  ? 25.975  -0.430  -0.948  1.00 45.33 ? 109 ASP B CB  1 
ATOM 1620 C CG  . ASP B 1 83  ? 26.737  0.666   -0.233  1.00 46.12 ? 109 ASP B CG  1 
ATOM 1621 O OD1 . ASP B 1 83  ? 27.974  0.541   -0.115  1.00 46.24 ? 109 ASP B OD1 1 
ATOM 1622 O OD2 . ASP B 1 83  ? 26.116  1.667   0.176   1.00 47.93 ? 109 ASP B OD2 1 
ATOM 1623 N N   . HIS B 1 84  ? 22.695  -0.321  -0.797  1.00 43.81 ? 110 HIS B N   1 
ATOM 1624 C CA  . HIS B 1 84  ? 21.390  0.306   -0.662  1.00 43.40 ? 110 HIS B CA  1 
ATOM 1625 C C   . HIS B 1 84  ? 20.429  -0.641  0.062   1.00 43.11 ? 110 HIS B C   1 
ATOM 1626 O O   . HIS B 1 84  ? 20.295  -1.819  -0.298  1.00 43.12 ? 110 HIS B O   1 
ATOM 1627 C CB  . HIS B 1 84  ? 20.822  0.651   -2.032  1.00 43.53 ? 110 HIS B CB  1 
ATOM 1628 C CG  . HIS B 1 84  ? 21.490  1.815   -2.699  1.00 43.81 ? 110 HIS B CG  1 
ATOM 1629 N ND1 . HIS B 1 84  ? 22.695  1.705   -3.359  1.00 43.93 ? 110 HIS B ND1 1 
ATOM 1630 C CD2 . HIS B 1 84  ? 21.101  3.104   -2.837  1.00 44.13 ? 110 HIS B CD2 1 
ATOM 1631 C CE1 . HIS B 1 84  ? 23.030  2.881   -3.859  1.00 43.85 ? 110 HIS B CE1 1 
ATOM 1632 N NE2 . HIS B 1 84  ? 22.080  3.747   -3.557  1.00 44.16 ? 110 HIS B NE2 1 
ATOM 1633 N N   . ALA B 1 85  ? 19.761  -0.125  1.087   1.00 42.49 ? 111 ALA B N   1 
ATOM 1634 C CA  . ALA B 1 85  ? 18.831  -0.930  1.858   1.00 41.83 ? 111 ALA B CA  1 
ATOM 1635 C C   . ALA B 1 85  ? 17.489  -0.243  1.970   1.00 41.38 ? 111 ALA B C   1 
ATOM 1636 O O   . ALA B 1 85  ? 17.426  0.960   2.220   1.00 41.55 ? 111 ALA B O   1 
ATOM 1637 C CB  . ALA B 1 85  ? 19.390  -1.212  3.227   1.00 42.01 ? 111 ALA B CB  1 
ATOM 1638 N N   . GLY B 1 86  ? 16.425  -1.030  1.818   1.00 40.72 ? 112 GLY B N   1 
ATOM 1639 C CA  . GLY B 1 86  ? 15.060  -0.524  1.735   1.00 39.68 ? 112 GLY B CA  1 
ATOM 1640 C C   . GLY B 1 86  ? 14.561  -0.749  0.326   1.00 39.09 ? 112 GLY B C   1 
ATOM 1641 O O   . GLY B 1 86  ? 15.257  -1.358  -0.486  1.00 39.12 ? 112 GLY B O   1 
ATOM 1642 N N   . THR B 1 87  ? 13.357  -0.273  0.028   1.00 38.37 ? 113 THR B N   1 
ATOM 1643 C CA  . THR B 1 87  ? 12.805  -0.396  -1.313  1.00 37.93 ? 113 THR B CA  1 
ATOM 1644 C C   . THR B 1 87  ? 11.901  0.792   -1.596  1.00 37.73 ? 113 THR B C   1 
ATOM 1645 O O   . THR B 1 87  ? 10.858  0.960   -0.950  1.00 37.87 ? 113 THR B O   1 
ATOM 1646 C CB  . THR B 1 87  ? 12.042  -1.732  -1.508  1.00 38.21 ? 113 THR B CB  1 
ATOM 1647 O OG1 . THR B 1 87  ? 12.971  -2.823  -1.468  1.00 38.68 ? 113 THR B OG1 1 
ATOM 1648 C CG2 . THR B 1 87  ? 11.293  -1.766  -2.848  1.00 37.80 ? 113 THR B CG2 1 
ATOM 1649 N N   . PHE B 1 88  ? 12.327  1.622   -2.549  1.00 37.12 ? 114 PHE B N   1 
ATOM 1650 C CA  . PHE B 1 88  ? 11.561  2.782   -2.987  1.00 36.32 ? 114 PHE B CA  1 
ATOM 1651 C C   . PHE B 1 88  ? 10.439  2.373   -3.938  1.00 36.32 ? 114 PHE B C   1 
ATOM 1652 O O   . PHE B 1 88  ? 10.514  1.339   -4.611  1.00 35.80 ? 114 PHE B O   1 
ATOM 1653 C CB  . PHE B 1 88  ? 12.464  3.806   -3.683  1.00 35.87 ? 114 PHE B CB  1 
ATOM 1654 C CG  . PHE B 1 88  ? 13.187  4.744   -2.743  1.00 35.42 ? 114 PHE B CG  1 
ATOM 1655 C CD1 . PHE B 1 88  ? 12.479  5.609   -1.905  1.00 34.58 ? 114 PHE B CD1 1 
ATOM 1656 C CD2 . PHE B 1 88  ? 14.581  4.797   -2.732  1.00 33.92 ? 114 PHE B CD2 1 
ATOM 1657 C CE1 . PHE B 1 88  ? 13.155  6.487   -1.051  1.00 33.72 ? 114 PHE B CE1 1 
ATOM 1658 C CE2 . PHE B 1 88  ? 15.258  5.671   -1.886  1.00 33.07 ? 114 PHE B CE2 1 
ATOM 1659 C CZ  . PHE B 1 88  ? 14.548  6.516   -1.046  1.00 33.46 ? 114 PHE B CZ  1 
ATOM 1660 N N   . GLN B 1 89  ? 9.400   3.201   -3.976  1.00 36.43 ? 115 GLN B N   1 
ATOM 1661 C CA  . GLN B 1 89  ? 8.306   3.036   -4.906  1.00 36.87 ? 115 GLN B CA  1 
ATOM 1662 C C   . GLN B 1 89  ? 7.875   4.369   -5.507  1.00 37.13 ? 115 GLN B C   1 
ATOM 1663 O O   . GLN B 1 89  ? 7.671   5.347   -4.790  1.00 37.03 ? 115 GLN B O   1 
ATOM 1664 C CB  . GLN B 1 89  ? 7.132   2.352   -4.224  1.00 36.71 ? 115 GLN B CB  1 
ATOM 1665 C CG  . GLN B 1 89  ? 7.157   0.863   -4.390  1.00 37.58 ? 115 GLN B CG  1 
ATOM 1666 C CD  . GLN B 1 89  ? 5.769   0.292   -4.531  1.00 39.41 ? 115 GLN B CD  1 
ATOM 1667 O OE1 . GLN B 1 89  ? 4.979   0.307   -3.583  1.00 40.00 ? 115 GLN B OE1 1 
ATOM 1668 N NE2 . GLN B 1 89  ? 5.457   -0.219  -5.721  1.00 39.68 ? 115 GLN B NE2 1 
ATOM 1669 N N   . ILE B 1 90  ? 7.738   4.405   -6.828  1.00 37.64 ? 116 ILE B N   1 
ATOM 1670 C CA  . ILE B 1 90  ? 7.371   5.649   -7.492  1.00 38.54 ? 116 ILE B CA  1 
ATOM 1671 C C   . ILE B 1 90  ? 5.895   5.918   -7.316  1.00 38.72 ? 116 ILE B C   1 
ATOM 1672 O O   . ILE B 1 90  ? 5.082   5.005   -7.432  1.00 38.91 ? 116 ILE B O   1 
ATOM 1673 C CB  . ILE B 1 90  ? 7.823   5.728   -9.003  1.00 38.57 ? 116 ILE B CB  1 
ATOM 1674 C CG1 . ILE B 1 90  ? 7.532   4.429   -9.762  1.00 39.71 ? 116 ILE B CG1 1 
ATOM 1675 C CG2 . ILE B 1 90  ? 9.320   6.015   -9.090  1.00 38.01 ? 116 ILE B CG2 1 
ATOM 1676 C CD1 . ILE B 1 90  ? 6.203   4.385   -10.487 1.00 41.12 ? 116 ILE B CD1 1 
ATOM 1677 N N   . ILE B 1 91  ? 5.566   7.167   -7.001  1.00 39.33 ? 117 ILE B N   1 
ATOM 1678 C CA  . ILE B 1 91  ? 4.177   7.602   -6.910  1.00 39.91 ? 117 ILE B CA  1 
ATOM 1679 C C   . ILE B 1 91  ? 3.753   8.320   -8.194  1.00 40.71 ? 117 ILE B C   1 
ATOM 1680 O O   . ILE B 1 91  ? 2.757   7.944   -8.817  1.00 40.74 ? 117 ILE B O   1 
ATOM 1681 C CB  . ILE B 1 91  ? 3.917   8.498   -5.674  1.00 39.81 ? 117 ILE B CB  1 
ATOM 1682 C CG1 . ILE B 1 91  ? 4.181   7.712   -4.383  1.00 39.92 ? 117 ILE B CG1 1 
ATOM 1683 C CG2 . ILE B 1 91  ? 2.483   9.022   -5.691  1.00 39.65 ? 117 ILE B CG2 1 
ATOM 1684 C CD1 . ILE B 1 91  ? 4.025   8.510   -3.091  1.00 39.44 ? 117 ILE B CD1 1 
ATOM 1685 N N   . ASP B 1 92  ? 4.504   9.348   -8.583  1.00 41.61 ? 118 ASP B N   1 
ATOM 1686 C CA  . ASP B 1 92  ? 4.168   10.117  -9.770  1.00 42.66 ? 118 ASP B CA  1 
ATOM 1687 C C   . ASP B 1 92  ? 4.345   9.341   -11.074 1.00 43.25 ? 118 ASP B C   1 
ATOM 1688 O O   . ASP B 1 92  ? 3.419   9.294   -11.899 1.00 43.83 ? 118 ASP B O   1 
ATOM 1689 C CB  . ASP B 1 92  ? 4.925   11.436  -9.846  1.00 42.75 ? 118 ASP B CB  1 
ATOM 1690 C CG  . ASP B 1 92  ? 4.377   12.342  -10.946 1.00 44.15 ? 118 ASP B CG  1 
ATOM 1691 O OD1 . ASP B 1 92  ? 5.152   13.153  -11.500 1.00 45.36 ? 118 ASP B OD1 1 
ATOM 1692 O OD2 . ASP B 1 92  ? 3.166   12.220  -11.269 1.00 43.52 ? 118 ASP B OD2 1 
ATOM 1693 N N   . GLU B 1 93  ? 5.523   8.757   -11.276 1.00 43.57 ? 119 GLU B N   1 
ATOM 1694 C CA  . GLU B 1 93  ? 5.759   7.876   -12.430 1.00 44.22 ? 119 GLU B CA  1 
ATOM 1695 C C   . GLU B 1 93  ? 5.874   8.660   -13.727 1.00 44.17 ? 119 GLU B C   1 
ATOM 1696 O O   . GLU B 1 93  ? 6.635   8.288   -14.622 1.00 44.44 ? 119 GLU B O   1 
ATOM 1697 C CB  . GLU B 1 93  ? 4.661   6.810   -12.550 1.00 43.94 ? 119 GLU B CB  1 
ATOM 1698 C CG  . GLU B 1 93  ? 4.918   5.729   -13.591 1.00 44.68 ? 119 GLU B CG  1 
ATOM 1699 C CD  . GLU B 1 93  ? 3.841   4.652   -13.585 1.00 45.21 ? 119 GLU B CD  1 
ATOM 1700 O OE1 . GLU B 1 93  ? 3.919   3.746   -12.719 1.00 46.65 ? 119 GLU B OE1 1 
ATOM 1701 O OE2 . GLU B 1 93  ? 2.924   4.709   -14.448 1.00 45.30 ? 119 GLU B OE2 1 
ATOM 1702 N N   . GLU B 1 94  ? 5.112   9.743   -13.822 1.00 44.19 ? 120 GLU B N   1 
ATOM 1703 C CA  . GLU B 1 94  ? 5.211   10.652  -14.939 1.00 44.30 ? 120 GLU B CA  1 
ATOM 1704 C C   . GLU B 1 94  ? 6.495   11.463  -14.837 1.00 44.38 ? 120 GLU B C   1 
ATOM 1705 O O   . GLU B 1 94  ? 7.220   11.621  -15.818 1.00 44.57 ? 120 GLU B O   1 
ATOM 1706 C CB  . GLU B 1 94  ? 4.004   11.581  -14.959 1.00 44.36 ? 120 GLU B CB  1 
ATOM 1707 C CG  . GLU B 1 94  ? 3.829   12.322  -16.260 1.00 45.00 ? 120 GLU B CG  1 
ATOM 1708 C CD  . GLU B 1 94  ? 3.541   11.403  -17.437 1.00 46.59 ? 120 GLU B CD  1 
ATOM 1709 O OE1 . GLU B 1 94  ? 4.229   11.557  -18.473 1.00 46.91 ? 120 GLU B OE1 1 
ATOM 1710 O OE2 . GLU B 1 94  ? 2.634   10.537  -17.330 1.00 46.45 ? 120 GLU B OE2 1 
ATOM 1711 N N   . GLU B 1 95  ? 6.781   11.965  -13.643 1.00 44.56 ? 121 GLU B N   1 
ATOM 1712 C CA  . GLU B 1 95  ? 7.945   12.818  -13.447 1.00 44.73 ? 121 GLU B CA  1 
ATOM 1713 C C   . GLU B 1 95  ? 8.924   12.395  -12.348 1.00 44.17 ? 121 GLU B C   1 
ATOM 1714 O O   . GLU B 1 95  ? 9.755   13.192  -11.917 1.00 44.35 ? 121 GLU B O   1 
ATOM 1715 C CB  . GLU B 1 95  ? 7.513   14.266  -13.256 1.00 45.20 ? 121 GLU B CB  1 
ATOM 1716 C CG  . GLU B 1 95  ? 7.395   15.030  -14.552 1.00 46.35 ? 121 GLU B CG  1 
ATOM 1717 C CD  . GLU B 1 95  ? 6.997   16.474  -14.323 1.00 48.68 ? 121 GLU B CD  1 
ATOM 1718 O OE1 . GLU B 1 95  ? 7.272   17.301  -15.221 1.00 49.26 ? 121 GLU B OE1 1 
ATOM 1719 O OE2 . GLU B 1 95  ? 6.413   16.775  -13.248 1.00 48.61 ? 121 GLU B OE2 1 
ATOM 1720 N N   . THR B 1 96  ? 8.822   11.149  -11.899 1.00 43.44 ? 122 THR B N   1 
ATOM 1721 C CA  . THR B 1 96  ? 9.909   10.519  -11.157 1.00 42.69 ? 122 THR B CA  1 
ATOM 1722 C C   . THR B 1 96  ? 10.185  9.135   -11.744 1.00 42.49 ? 122 THR B C   1 
ATOM 1723 O O   . THR B 1 96  ? 9.300   8.497   -12.330 1.00 42.33 ? 122 THR B O   1 
ATOM 1724 C CB  . THR B 1 96  ? 9.673   10.438  -9.616  1.00 42.44 ? 122 THR B CB  1 
ATOM 1725 O OG1 . THR B 1 96  ? 8.575   9.565   -9.323  1.00 42.68 ? 122 THR B OG1 1 
ATOM 1726 C CG2 . THR B 1 96  ? 9.407   11.806  -9.024  1.00 41.78 ? 122 THR B CG2 1 
ATOM 1727 N N   . GLN B 1 97  ? 11.424  8.687   -11.587 1.00 42.18 ? 123 GLN B N   1 
ATOM 1728 C CA  . GLN B 1 97  ? 11.879  7.422   -12.137 1.00 41.92 ? 123 GLN B CA  1 
ATOM 1729 C C   . GLN B 1 97  ? 13.053  6.872   -11.324 1.00 41.73 ? 123 GLN B C   1 
ATOM 1730 O O   . GLN B 1 97  ? 13.721  7.611   -10.584 1.00 41.27 ? 123 GLN B O   1 
ATOM 1731 C CB  . GLN B 1 97  ? 12.312  7.615   -13.593 1.00 41.95 ? 123 GLN B CB  1 
ATOM 1732 C CG  . GLN B 1 97  ? 13.366  8.701   -13.762 1.00 42.27 ? 123 GLN B CG  1 
ATOM 1733 C CD  . GLN B 1 97  ? 14.018  8.708   -15.124 1.00 42.92 ? 123 GLN B CD  1 
ATOM 1734 O OE1 . GLN B 1 97  ? 13.346  8.596   -16.152 1.00 44.11 ? 123 GLN B OE1 1 
ATOM 1735 N NE2 . GLN B 1 97  ? 15.338  8.867   -15.144 1.00 42.02 ? 123 GLN B NE2 1 
ATOM 1736 N N   . PHE B 1 98  ? 13.295  5.571   -11.469 1.00 41.56 ? 124 PHE B N   1 
ATOM 1737 C CA  . PHE B 1 98  ? 14.529  4.976   -10.980 1.00 41.53 ? 124 PHE B CA  1 
ATOM 1738 C C   . PHE B 1 98  ? 15.684  5.352   -11.902 1.00 41.79 ? 124 PHE B C   1 
ATOM 1739 O O   . PHE B 1 98  ? 15.554  5.328   -13.130 1.00 41.67 ? 124 PHE B O   1 
ATOM 1740 C CB  . PHE B 1 98  ? 14.396  3.458   -10.824 1.00 41.16 ? 124 PHE B CB  1 
ATOM 1741 C CG  . PHE B 1 98  ? 13.467  3.045   -9.710  1.00 40.24 ? 124 PHE B CG  1 
ATOM 1742 C CD1 . PHE B 1 98  ? 12.251  2.434   -9.992  1.00 39.20 ? 124 PHE B CD1 1 
ATOM 1743 C CD2 . PHE B 1 98  ? 13.799  3.290   -8.381  1.00 39.30 ? 124 PHE B CD2 1 
ATOM 1744 C CE1 . PHE B 1 98  ? 11.392  2.061   -8.973  1.00 38.76 ? 124 PHE B CE1 1 
ATOM 1745 C CE2 . PHE B 1 98  ? 12.942  2.922   -7.354  1.00 39.20 ? 124 PHE B CE2 1 
ATOM 1746 C CZ  . PHE B 1 98  ? 11.736  2.306   -7.651  1.00 39.10 ? 124 PHE B CZ  1 
ATOM 1747 N N   . MET B 1 99  ? 16.798  5.737   -11.286 1.00 42.27 ? 125 MET B N   1 
ATOM 1748 C CA  . MET B 1 99  ? 17.996  6.144   -11.999 1.00 42.66 ? 125 MET B CA  1 
ATOM 1749 C C   . MET B 1 99  ? 18.563  4.968   -12.798 1.00 42.86 ? 125 MET B C   1 
ATOM 1750 O O   . MET B 1 99  ? 18.702  3.862   -12.280 1.00 42.61 ? 125 MET B O   1 
ATOM 1751 C CB  . MET B 1 99  ? 19.029  6.675   -11.008 1.00 42.43 ? 125 MET B CB  1 
ATOM 1752 C CG  . MET B 1 99  ? 19.975  7.717   -11.592 1.00 43.12 ? 125 MET B CG  1 
ATOM 1753 S SD  . MET B 1 99  ? 21.459  8.005   -10.603 1.00 43.33 ? 125 MET B SD  1 
ATOM 1754 C CE  . MET B 1 99  ? 20.756  8.350   -8.997  1.00 42.38 ? 125 MET B CE  1 
ATOM 1755 N N   . SER B 1 100 ? 18.868  5.224   -14.067 1.00 43.53 ? 126 SER B N   1 
ATOM 1756 C CA  . SER B 1 100 ? 19.397  4.219   -14.990 1.00 44.18 ? 126 SER B CA  1 
ATOM 1757 C C   . SER B 1 100 ? 20.701  3.594   -14.484 1.00 44.60 ? 126 SER B C   1 
ATOM 1758 O O   . SER B 1 100 ? 20.836  2.368   -14.457 1.00 44.39 ? 126 SER B O   1 
ATOM 1759 C CB  . SER B 1 100 ? 19.599  4.835   -16.381 1.00 44.24 ? 126 SER B CB  1 
ATOM 1760 O OG  . SER B 1 100 ? 19.702  3.835   -17.381 1.00 44.36 ? 126 SER B OG  1 
ATOM 1761 N N   . ASN B 1 101 ? 21.648  4.443   -14.077 1.00 45.27 ? 127 ASN B N   1 
ATOM 1762 C CA  . ASN B 1 101 ? 22.918  3.986   -13.498 1.00 45.79 ? 127 ASN B CA  1 
ATOM 1763 C C   . ASN B 1 101 ? 22.719  3.264   -12.169 1.00 45.88 ? 127 ASN B C   1 
ATOM 1764 O O   . ASN B 1 101 ? 23.478  2.355   -11.838 1.00 46.17 ? 127 ASN B O   1 
ATOM 1765 C CB  . ASN B 1 101 ? 23.877  5.164   -13.295 1.00 45.96 ? 127 ASN B CB  1 
ATOM 1766 C CG  . ASN B 1 101 ? 25.201  4.744   -12.656 1.00 47.00 ? 127 ASN B CG  1 
ATOM 1767 O OD1 . ASN B 1 101 ? 25.407  4.918   -11.449 1.00 47.63 ? 127 ASN B OD1 1 
ATOM 1768 N ND2 . ASN B 1 101 ? 26.101  4.178   -13.464 1.00 47.28 ? 127 ASN B ND2 1 
ATOM 1769 N N   . CYS B 1 102 ? 21.699  3.677   -11.418 1.00 45.96 ? 128 CYS B N   1 
ATOM 1770 C CA  . CYS B 1 102 ? 21.441  3.146   -10.085 1.00 45.54 ? 128 CYS B CA  1 
ATOM 1771 C C   . CYS B 1 102 ? 19.946  2.900   -9.884  1.00 45.11 ? 128 CYS B C   1 
ATOM 1772 O O   . CYS B 1 102 ? 19.213  3.803   -9.455  1.00 45.05 ? 128 CYS B O   1 
ATOM 1773 C CB  . CYS B 1 102 ? 21.979  4.107   -9.027  1.00 45.78 ? 128 CYS B CB  1 
ATOM 1774 S SG  . CYS B 1 102 ? 22.188  3.367   -7.406  1.00 46.88 ? 128 CYS B SG  1 
ATOM 1775 N N   . PRO B 1 103 ? 19.491  1.662   -10.171 1.00 44.55 ? 129 PRO B N   1 
ATOM 1776 C CA  . PRO B 1 103 ? 18.059  1.337   -10.266 1.00 43.94 ? 129 PRO B CA  1 
ATOM 1777 C C   . PRO B 1 103 ? 17.351  1.350   -8.915  1.00 43.32 ? 129 PRO B C   1 
ATOM 1778 O O   . PRO B 1 103 ? 16.131  1.175   -8.850  1.00 43.40 ? 129 PRO B O   1 
ATOM 1779 C CB  . PRO B 1 103 ? 18.060  -0.075  -10.864 1.00 44.03 ? 129 PRO B CB  1 
ATOM 1780 C CG  . PRO B 1 103 ? 19.360  -0.660  -10.448 1.00 44.04 ? 129 PRO B CG  1 
ATOM 1781 C CD  . PRO B 1 103 ? 20.341  0.476   -10.392 1.00 44.35 ? 129 PRO B CD  1 
ATOM 1782 N N   . VAL B 1 104 ? 18.125  1.554   -7.855  1.00 42.61 ? 130 VAL B N   1 
ATOM 1783 C CA  . VAL B 1 104 ? 17.618  1.584   -6.489  1.00 41.99 ? 130 VAL B CA  1 
ATOM 1784 C C   . VAL B 1 104 ? 17.617  3.037   -5.994  1.00 41.63 ? 130 VAL B C   1 
ATOM 1785 O O   . VAL B 1 104 ? 17.313  3.327   -4.837  1.00 41.35 ? 130 VAL B O   1 
ATOM 1786 C CB  . VAL B 1 104 ? 18.450  0.636   -5.581  1.00 41.89 ? 130 VAL B CB  1 
ATOM 1787 C CG1 . VAL B 1 104 ? 19.871  1.152   -5.421  1.00 41.93 ? 130 VAL B CG1 1 
ATOM 1788 C CG2 . VAL B 1 104 ? 17.778  0.414   -4.230  1.00 42.10 ? 130 VAL B CG2 1 
ATOM 1789 N N   . ALA B 1 105 ? 17.963  3.948   -6.899  1.00 41.36 ? 131 ALA B N   1 
ATOM 1790 C CA  . ALA B 1 105 ? 17.906  5.372   -6.612  1.00 41.17 ? 131 ALA B CA  1 
ATOM 1791 C C   . ALA B 1 105 ? 16.820  6.055   -7.460  1.00 41.11 ? 131 ALA B C   1 
ATOM 1792 O O   . ALA B 1 105 ? 16.558  5.645   -8.594  1.00 40.79 ? 131 ALA B O   1 
ATOM 1793 C CB  . ALA B 1 105 ? 19.251  6.002   -6.831  1.00 41.01 ? 131 ALA B CB  1 
ATOM 1794 N N   . VAL B 1 106 ? 16.186  7.079   -6.891  1.00 40.93 ? 132 VAL B N   1 
ATOM 1795 C CA  . VAL B 1 106 ? 15.058  7.750   -7.532  1.00 41.31 ? 132 VAL B CA  1 
ATOM 1796 C C   . VAL B 1 106 ? 15.418  9.194   -7.897  1.00 41.16 ? 132 VAL B C   1 
ATOM 1797 O O   . VAL B 1 106 ? 16.128  9.866   -7.148  1.00 41.46 ? 132 VAL B O   1 
ATOM 1798 C CB  . VAL B 1 106 ? 13.753  7.634   -6.684  1.00 41.34 ? 132 VAL B CB  1 
ATOM 1799 C CG1 . VAL B 1 106 ? 14.043  7.803   -5.200  1.00 42.47 ? 132 VAL B CG1 1 
ATOM 1800 C CG2 . VAL B 1 106 ? 12.689  8.620   -7.152  1.00 41.68 ? 132 VAL B CG2 1 
ATOM 1801 N N   . THR B 1 107 ? 14.941  9.641   -9.061  1.00 40.66 ? 133 THR B N   1 
ATOM 1802 C CA  . THR B 1 107 ? 15.372  10.895  -9.674  1.00 40.30 ? 133 THR B CA  1 
ATOM 1803 C C   . THR B 1 107 ? 14.203  11.540  -10.434 1.00 39.98 ? 133 THR B C   1 
ATOM 1804 O O   . THR B 1 107 ? 13.122  10.961  -10.505 1.00 39.99 ? 133 THR B O   1 
ATOM 1805 C CB  . THR B 1 107 ? 16.594  10.633  -10.610 1.00 40.44 ? 133 THR B CB  1 
ATOM 1806 O OG1 . THR B 1 107 ? 17.400  11.810  -10.718 1.00 41.44 ? 133 THR B OG1 1 
ATOM 1807 C CG2 . THR B 1 107 ? 16.166  10.171  -12.002 1.00 39.91 ? 133 THR B CG2 1 
ATOM 1808 N N   . GLU B 1 108 ? 14.398  12.731  -10.992 1.00 39.57 ? 134 GLU B N   1 
ATOM 1809 C CA  . GLU B 1 108 ? 13.340  13.368  -11.782 1.00 39.36 ? 134 GLU B CA  1 
ATOM 1810 C C   . GLU B 1 108 ? 13.305  12.781  -13.186 1.00 39.33 ? 134 GLU B C   1 
ATOM 1811 O O   . GLU B 1 108 ? 14.287  12.198  -13.632 1.00 39.39 ? 134 GLU B O   1 
ATOM 1812 C CB  . GLU B 1 108 ? 13.554  14.881  -11.858 1.00 39.53 ? 134 GLU B CB  1 
ATOM 1813 C CG  . GLU B 1 108 ? 14.609  15.353  -12.883 1.00 39.31 ? 134 GLU B CG  1 
ATOM 1814 C CD  . GLU B 1 108 ? 16.042  14.991  -12.498 1.00 38.96 ? 134 GLU B CD  1 
ATOM 1815 O OE1 . GLU B 1 108 ? 16.926  15.059  -13.379 1.00 38.69 ? 134 GLU B OE1 1 
ATOM 1816 O OE2 . GLU B 1 108 ? 16.289  14.642  -11.322 1.00 39.25 ? 134 GLU B OE2 1 
ATOM 1817 N N   . SER B 1 109 ? 12.182  12.931  -13.882 1.00 39.23 ? 135 SER B N   1 
ATOM 1818 C CA  . SER B 1 109 ? 12.097  12.523  -15.286 1.00 39.21 ? 135 SER B CA  1 
ATOM 1819 C C   . SER B 1 109 ? 12.387  13.718  -16.197 1.00 39.01 ? 135 SER B C   1 
ATOM 1820 O O   . SER B 1 109 ? 13.133  13.601  -17.175 1.00 39.08 ? 135 SER B O   1 
ATOM 1821 C CB  . SER B 1 109 ? 10.718  11.941  -15.608 1.00 39.50 ? 135 SER B CB  1 
ATOM 1822 O OG  . SER B 1 109 ? 10.333  10.937  -14.676 1.00 40.14 ? 135 SER B OG  1 
ATOM 1823 N N   . THR B 1 110 ? 11.790  14.864  -15.860 1.00 38.39 ? 136 THR B N   1 
ATOM 1824 C CA  . THR B 1 110 ? 11.970  16.119  -16.587 1.00 37.50 ? 136 THR B CA  1 
ATOM 1825 C C   . THR B 1 110 ? 12.566  17.165  -15.646 1.00 36.85 ? 136 THR B C   1 
ATOM 1826 O O   . THR B 1 110 ? 12.385  17.063  -14.442 1.00 37.11 ? 136 THR B O   1 
ATOM 1827 C CB  . THR B 1 110 ? 10.625  16.664  -17.059 1.00 37.46 ? 136 THR B CB  1 
ATOM 1828 O OG1 . THR B 1 110 ? 9.809   16.946  -15.917 1.00 38.38 ? 136 THR B OG1 1 
ATOM 1829 C CG2 . THR B 1 110 ? 9.915   15.662  -17.943 1.00 37.41 ? 136 THR B CG2 1 
ATOM 1830 N N   . PRO B 1 111 ? 13.279  18.173  -16.184 1.00 36.12 ? 137 PRO B N   1 
ATOM 1831 C CA  . PRO B 1 111 ? 13.710  19.310  -15.355 1.00 35.54 ? 137 PRO B CA  1 
ATOM 1832 C C   . PRO B 1 111 ? 12.605  20.350  -15.059 1.00 35.09 ? 137 PRO B C   1 
ATOM 1833 O O   . PRO B 1 111 ? 12.888  21.547  -14.950 1.00 34.77 ? 137 PRO B O   1 
ATOM 1834 C CB  . PRO B 1 111 ? 14.834  19.936  -16.185 1.00 35.51 ? 137 PRO B CB  1 
ATOM 1835 C CG  . PRO B 1 111 ? 14.480  19.614  -17.582 1.00 35.81 ? 137 PRO B CG  1 
ATOM 1836 C CD  . PRO B 1 111 ? 13.759  18.292  -17.572 1.00 35.86 ? 137 PRO B CD  1 
ATOM 1837 N N   . ARG B 1 112 ? 11.360  19.896  -14.925 1.00 34.63 ? 138 ARG B N   1 
ATOM 1838 C CA  . ARG B 1 112 ? 10.278  20.777  -14.504 1.00 34.37 ? 138 ARG B CA  1 
ATOM 1839 C C   . ARG B 1 112 ? 10.614  21.417  -13.161 1.00 34.13 ? 138 ARG B C   1 
ATOM 1840 O O   . ARG B 1 112 ? 11.099  20.735  -12.231 1.00 34.09 ? 138 ARG B O   1 
ATOM 1841 C CB  . ARG B 1 112 ? 8.952   20.009  -14.390 1.00 34.36 ? 138 ARG B CB  1 
ATOM 1842 C CG  . ARG B 1 112 ? 7.757   20.881  -13.974 1.00 34.44 ? 138 ARG B CG  1 
ATOM 1843 C CD  . ARG B 1 112 ? 6.407   20.128  -13.942 1.00 34.67 ? 138 ARG B CD  1 
ATOM 1844 N NE  . ARG B 1 112 ? 6.056   19.540  -15.237 1.00 34.28 ? 138 ARG B NE  1 
ATOM 1845 C CZ  . ARG B 1 112 ? 5.640   20.229  -16.295 1.00 33.91 ? 138 ARG B CZ  1 
ATOM 1846 N NH1 . ARG B 1 112 ? 5.358   19.596  -17.423 1.00 34.07 ? 138 ARG B NH1 1 
ATOM 1847 N NH2 . ARG B 1 112 ? 5.501   21.548  -16.234 1.00 34.13 ? 138 ARG B NH2 1 
ATOM 1848 N N   . ARG B 1 113 ? 10.375  22.725  -13.072 1.00 33.48 ? 139 ARG B N   1 
ATOM 1849 C CA  . ARG B 1 113 ? 10.415  23.430  -11.794 1.00 33.17 ? 139 ARG B CA  1 
ATOM 1850 C C   . ARG B 1 113 ? 9.364   22.851  -10.833 1.00 33.09 ? 139 ARG B C   1 
ATOM 1851 O O   . ARG B 1 113 ? 8.226   22.580  -11.223 1.00 32.83 ? 139 ARG B O   1 
ATOM 1852 C CB  . ARG B 1 113 ? 10.197  24.928  -11.987 1.00 32.76 ? 139 ARG B CB  1 
ATOM 1853 C CG  . ARG B 1 113 ? 11.218  25.595  -12.883 1.00 32.86 ? 139 ARG B CG  1 
ATOM 1854 C CD  . ARG B 1 113 ? 11.123  27.110  -12.823 1.00 32.88 ? 139 ARG B CD  1 
ATOM 1855 N NE  . ARG B 1 113 ? 9.733   27.548  -12.918 1.00 33.46 ? 139 ARG B NE  1 
ATOM 1856 C CZ  . ARG B 1 113 ? 9.100   27.844  -14.048 1.00 33.12 ? 139 ARG B CZ  1 
ATOM 1857 N NH1 . ARG B 1 113 ? 9.731   27.782  -15.218 1.00 32.82 ? 139 ARG B NH1 1 
ATOM 1858 N NH2 . ARG B 1 113 ? 7.828   28.215  -14.000 1.00 33.02 ? 139 ARG B NH2 1 
ATOM 1859 N N   . ARG B 1 114 ? 9.760   22.647  -9.581  1.00 33.13 ? 140 ARG B N   1 
ATOM 1860 C CA  . ARG B 1 114 ? 8.869   22.058  -8.587  1.00 33.29 ? 140 ARG B CA  1 
ATOM 1861 C C   . ARG B 1 114 ? 9.267   22.394  -7.152  1.00 32.97 ? 140 ARG B C   1 
ATOM 1862 O O   . ARG B 1 114 ? 10.394  22.811  -6.891  1.00 32.74 ? 140 ARG B O   1 
ATOM 1863 C CB  . ARG B 1 114 ? 8.732   20.538  -8.799  1.00 33.32 ? 140 ARG B CB  1 
ATOM 1864 C CG  . ARG B 1 114 ? 9.973   19.725  -8.561  1.00 34.43 ? 140 ARG B CG  1 
ATOM 1865 C CD  . ARG B 1 114 ? 9.867   18.369  -9.233  1.00 37.12 ? 140 ARG B CD  1 
ATOM 1866 N NE  . ARG B 1 114 ? 10.688  18.321  -10.441 1.00 41.09 ? 140 ARG B NE  1 
ATOM 1867 C CZ  . ARG B 1 114 ? 10.564  17.422  -11.416 1.00 40.92 ? 140 ARG B CZ  1 
ATOM 1868 N NH1 . ARG B 1 114 ? 9.641   16.467  -11.348 1.00 40.57 ? 140 ARG B NH1 1 
ATOM 1869 N NH2 . ARG B 1 114 ? 11.364  17.496  -12.467 1.00 39.57 ? 140 ARG B NH2 1 
ATOM 1870 N N   . THR B 1 115 ? 8.313   22.228  -6.239  1.00 33.07 ? 141 THR B N   1 
ATOM 1871 C CA  . THR B 1 115 ? 8.490   22.568  -4.827  1.00 33.08 ? 141 THR B CA  1 
ATOM 1872 C C   . THR B 1 115 ? 8.333   21.341  -3.941  1.00 33.09 ? 141 THR B C   1 
ATOM 1873 O O   . THR B 1 115 ? 8.435   21.439  -2.723  1.00 33.20 ? 141 THR B O   1 
ATOM 1874 C CB  . THR B 1 115 ? 7.455   23.608  -4.358  1.00 33.17 ? 141 THR B CB  1 
ATOM 1875 O OG1 . THR B 1 115 ? 6.187   22.964  -4.156  1.00 33.83 ? 141 THR B OG1 1 
ATOM 1876 C CG2 . THR B 1 115 ? 7.309   24.742  -5.368  1.00 32.49 ? 141 THR B CG2 1 
ATOM 1877 N N   . ARG B 1 116 ? 8.074   20.192  -4.556  1.00 33.27 ? 142 ARG B N   1 
ATOM 1878 C CA  . ARG B 1 116 ? 7.759   18.984  -3.814  1.00 33.61 ? 142 ARG B CA  1 
ATOM 1879 C C   . ARG B 1 116 ? 7.798   17.744  -4.699  1.00 33.61 ? 142 ARG B C   1 
ATOM 1880 O O   . ARG B 1 116 ? 7.368   17.786  -5.847  1.00 33.36 ? 142 ARG B O   1 
ATOM 1881 C CB  . ARG B 1 116 ? 6.374   19.124  -3.193  1.00 33.71 ? 142 ARG B CB  1 
ATOM 1882 C CG  . ARG B 1 116 ? 6.089   18.270  -1.969  1.00 34.24 ? 142 ARG B CG  1 
ATOM 1883 C CD  . ARG B 1 116 ? 4.777   18.764  -1.330  1.00 35.77 ? 142 ARG B CD  1 
ATOM 1884 N NE  . ARG B 1 116 ? 4.370   17.983  -0.164  1.00 36.79 ? 142 ARG B NE  1 
ATOM 1885 C CZ  . ARG B 1 116 ? 3.238   18.167  0.513   1.00 37.45 ? 142 ARG B CZ  1 
ATOM 1886 N NH1 . ARG B 1 116 ? 2.382   19.114  0.145   1.00 37.70 ? 142 ARG B NH1 1 
ATOM 1887 N NH2 . ARG B 1 116 ? 2.960   17.403  1.566   1.00 37.20 ? 142 ARG B NH2 1 
ATOM 1888 N N   . ILE B 1 117 ? 8.336   16.650  -4.154  1.00 33.65 ? 143 ILE B N   1 
ATOM 1889 C CA  . ILE B 1 117 ? 8.175   15.316  -4.736  1.00 33.78 ? 143 ILE B CA  1 
ATOM 1890 C C   . ILE B 1 117 ? 8.017   14.310  -3.612  1.00 33.94 ? 143 ILE B C   1 
ATOM 1891 O O   . ILE B 1 117 ? 8.644   14.451  -2.567  1.00 33.99 ? 143 ILE B O   1 
ATOM 1892 C CB  . ILE B 1 117 ? 9.338   14.896  -5.675  1.00 33.69 ? 143 ILE B CB  1 
ATOM 1893 C CG1 . ILE B 1 117 ? 10.700  15.003  -4.981  1.00 34.12 ? 143 ILE B CG1 1 
ATOM 1894 C CG2 . ILE B 1 117 ? 9.342   15.739  -6.945  1.00 33.75 ? 143 ILE B CG2 1 
ATOM 1895 C CD1 . ILE B 1 117 ? 11.237  13.703  -4.456  1.00 35.34 ? 143 ILE B CD1 1 
ATOM 1896 N N   . GLN B 1 118 ? 7.167   13.308  -3.825  1.00 34.09 ? 144 GLN B N   1 
ATOM 1897 C CA  . GLN B 1 118 ? 6.952   12.257  -2.831  1.00 34.35 ? 144 GLN B CA  1 
ATOM 1898 C C   . GLN B 1 118 ? 7.147   10.859  -3.402  1.00 33.96 ? 144 GLN B C   1 
ATOM 1899 O O   . GLN B 1 118 ? 6.814   10.597  -4.550  1.00 34.21 ? 144 GLN B O   1 
ATOM 1900 C CB  . GLN B 1 118 ? 5.572   12.391  -2.163  1.00 34.35 ? 144 GLN B CB  1 
ATOM 1901 C CG  . GLN B 1 118 ? 4.401   12.599  -3.129  1.00 35.16 ? 144 GLN B CG  1 
ATOM 1902 C CD  . GLN B 1 118 ? 3.051   12.673  -2.439  1.00 35.19 ? 144 GLN B CD  1 
ATOM 1903 O OE1 . GLN B 1 118 ? 2.854   12.101  -1.357  1.00 38.66 ? 144 GLN B OE1 1 
ATOM 1904 N NE2 . GLN B 1 118 ? 2.104   13.363  -3.067  1.00 35.24 ? 144 GLN B NE2 1 
ATOM 1905 N N   . VAL B 1 119 ? 7.712   9.975   -2.587  1.00 33.75 ? 145 VAL B N   1 
ATOM 1906 C CA  . VAL B 1 119 ? 7.853   8.560   -2.914  1.00 33.55 ? 145 VAL B CA  1 
ATOM 1907 C C   . VAL B 1 119 ? 7.430   7.764   -1.695  1.00 33.77 ? 145 VAL B C   1 
ATOM 1908 O O   . VAL B 1 119 ? 7.338   8.308   -0.595  1.00 33.87 ? 145 VAL B O   1 
ATOM 1909 C CB  . VAL B 1 119 ? 9.319   8.156   -3.278  1.00 33.35 ? 145 VAL B CB  1 
ATOM 1910 C CG1 . VAL B 1 119 ? 9.781   8.836   -4.564  1.00 33.78 ? 145 VAL B CG1 1 
ATOM 1911 C CG2 . VAL B 1 119 ? 10.293  8.450   -2.127  1.00 32.91 ? 145 VAL B CG2 1 
ATOM 1912 N N   . PHE B 1 120 ? 7.159   6.481   -1.890  1.00 33.96 ? 146 PHE B N   1 
ATOM 1913 C CA  . PHE B 1 120 ? 7.064   5.569   -0.772  1.00 34.22 ? 146 PHE B CA  1 
ATOM 1914 C C   . PHE B 1 120 ? 8.419   4.908   -0.571  1.00 34.60 ? 146 PHE B C   1 
ATOM 1915 O O   . PHE B 1 120 ? 9.220   4.828   -1.498  1.00 34.91 ? 146 PHE B O   1 
ATOM 1916 C CB  . PHE B 1 120 ? 5.983   4.510   -1.010  1.00 34.21 ? 146 PHE B CB  1 
ATOM 1917 C CG  . PHE B 1 120 ? 4.589   5.065   -1.095  1.00 33.33 ? 146 PHE B CG  1 
ATOM 1918 C CD1 . PHE B 1 120 ? 3.805   4.825   -2.221  1.00 32.31 ? 146 PHE B CD1 1 
ATOM 1919 C CD2 . PHE B 1 120 ? 4.061   5.824   -0.054  1.00 32.75 ? 146 PHE B CD2 1 
ATOM 1920 C CE1 . PHE B 1 120 ? 2.517   5.333   -2.315  1.00 32.00 ? 146 PHE B CE1 1 
ATOM 1921 C CE2 . PHE B 1 120 ? 2.774   6.343   -0.140  1.00 33.26 ? 146 PHE B CE2 1 
ATOM 1922 C CZ  . PHE B 1 120 ? 1.998   6.093   -1.277  1.00 32.86 ? 146 PHE B CZ  1 
ATOM 1923 N N   . TRP B 1 121 ? 8.680   4.445   0.645   1.00 35.09 ? 147 TRP B N   1 
ATOM 1924 C CA  . TRP B 1 121 ? 9.877   3.660   0.923   1.00 35.33 ? 147 TRP B CA  1 
ATOM 1925 C C   . TRP B 1 121 ? 9.550   2.520   1.871   1.00 35.50 ? 147 TRP B C   1 
ATOM 1926 O O   . TRP B 1 121 ? 9.362   2.735   3.071   1.00 35.50 ? 147 TRP B O   1 
ATOM 1927 C CB  . TRP B 1 121 ? 10.979  4.539   1.508   1.00 35.58 ? 147 TRP B CB  1 
ATOM 1928 C CG  . TRP B 1 121 ? 12.180  3.766   1.948   1.00 35.69 ? 147 TRP B CG  1 
ATOM 1929 C CD1 . TRP B 1 121 ? 13.140  3.215   1.147   1.00 36.24 ? 147 TRP B CD1 1 
ATOM 1930 C CD2 . TRP B 1 121 ? 12.553  3.456   3.292   1.00 35.91 ? 147 TRP B CD2 1 
ATOM 1931 N NE1 . TRP B 1 121 ? 14.091  2.579   1.910   1.00 36.47 ? 147 TRP B NE1 1 
ATOM 1932 C CE2 . TRP B 1 121 ? 13.753  2.709   3.232   1.00 36.45 ? 147 TRP B CE2 1 
ATOM 1933 C CE3 . TRP B 1 121 ? 11.989  3.732   4.544   1.00 36.22 ? 147 TRP B CE3 1 
ATOM 1934 C CZ2 . TRP B 1 121 ? 14.399  2.234   4.377   1.00 36.01 ? 147 TRP B CZ2 1 
ATOM 1935 C CZ3 . TRP B 1 121 ? 12.630  3.258   5.685   1.00 36.08 ? 147 TRP B CZ3 1 
ATOM 1936 C CH2 . TRP B 1 121 ? 13.824  2.519   5.591   1.00 36.14 ? 147 TRP B CH2 1 
ATOM 1937 N N   . ILE B 1 122 ? 9.469   1.311   1.321   1.00 35.71 ? 148 ILE B N   1 
ATOM 1938 C CA  . ILE B 1 122 ? 9.221   0.106   2.113   1.00 35.84 ? 148 ILE B CA  1 
ATOM 1939 C C   . ILE B 1 122 ? 10.469  -0.275  2.913   1.00 35.98 ? 148 ILE B C   1 
ATOM 1940 O O   . ILE B 1 122 ? 11.526  -0.543  2.338   1.00 35.96 ? 148 ILE B O   1 
ATOM 1941 C CB  . ILE B 1 122 ? 8.787   -1.081  1.222   1.00 35.84 ? 148 ILE B CB  1 
ATOM 1942 C CG1 . ILE B 1 122 ? 7.765   -0.619  0.182   1.00 35.48 ? 148 ILE B CG1 1 
ATOM 1943 C CG2 . ILE B 1 122 ? 8.254   -2.230  2.081   1.00 35.21 ? 148 ILE B CG2 1 
ATOM 1944 C CD1 . ILE B 1 122 ? 7.612   -1.562  -0.990  1.00 36.08 ? 148 ILE B CD1 1 
ATOM 1945 N N   . ALA B 1 123 ? 10.328  -0.297  4.237   1.00 36.31 ? 149 ALA B N   1 
ATOM 1946 C CA  . ALA B 1 123 ? 11.439  -0.562  5.167   1.00 36.56 ? 149 ALA B CA  1 
ATOM 1947 C C   . ALA B 1 123 ? 12.012  -1.975  5.037   1.00 36.74 ? 149 ALA B C   1 
ATOM 1948 O O   . ALA B 1 123 ? 11.265  -2.918  4.765   1.00 36.97 ? 149 ALA B O   1 
ATOM 1949 C CB  . ALA B 1 123 ? 10.992  -0.309  6.591   1.00 36.56 ? 149 ALA B CB  1 
ATOM 1950 N N   . PRO B 1 124 ? 13.336  -2.127  5.247   1.00 36.98 ? 150 PRO B N   1 
ATOM 1951 C CA  . PRO B 1 124 ? 14.015  -3.404  4.995   1.00 37.07 ? 150 PRO B CA  1 
ATOM 1952 C C   . PRO B 1 124 ? 13.733  -4.438  6.083   1.00 37.23 ? 150 PRO B C   1 
ATOM 1953 O O   . PRO B 1 124 ? 13.421  -4.055  7.214   1.00 37.23 ? 150 PRO B O   1 
ATOM 1954 C CB  . PRO B 1 124 ? 15.496  -3.011  4.984   1.00 37.07 ? 150 PRO B CB  1 
ATOM 1955 C CG  . PRO B 1 124 ? 15.582  -1.829  5.874   1.00 36.79 ? 150 PRO B CG  1 
ATOM 1956 C CD  . PRO B 1 124 ? 14.273  -1.100  5.749   1.00 37.13 ? 150 PRO B CD  1 
ATOM 1957 N N   . PRO B 1 125 ? 13.843  -5.742  5.749   1.00 37.41 ? 151 PRO B N   1 
ATOM 1958 C CA  . PRO B 1 125 ? 13.534  -6.816  6.707   1.00 37.38 ? 151 PRO B CA  1 
ATOM 1959 C C   . PRO B 1 125 ? 14.371  -6.714  7.982   1.00 37.41 ? 151 PRO B C   1 
ATOM 1960 O O   . PRO B 1 125 ? 15.536  -6.332  7.917   1.00 37.57 ? 151 PRO B O   1 
ATOM 1961 C CB  . PRO B 1 125 ? 13.879  -8.098  5.932   1.00 37.20 ? 151 PRO B CB  1 
ATOM 1962 C CG  . PRO B 1 125 ? 14.758  -7.663  4.817   1.00 37.45 ? 151 PRO B CG  1 
ATOM 1963 C CD  . PRO B 1 125 ? 14.279  -6.286  4.451   1.00 37.49 ? 151 PRO B CD  1 
ATOM 1964 N N   . ALA B 1 126 ? 13.771  -7.043  9.125   1.00 37.56 ? 152 ALA B N   1 
ATOM 1965 C CA  . ALA B 1 126 ? 14.430  -6.904  10.431  1.00 37.62 ? 152 ALA B CA  1 
ATOM 1966 C C   . ALA B 1 126 ? 15.786  -7.605  10.463  1.00 37.66 ? 152 ALA B C   1 
ATOM 1967 O O   . ALA B 1 126 ? 15.876  -8.802  10.192  1.00 37.69 ? 152 ALA B O   1 
ATOM 1968 C CB  . ALA B 1 126 ? 13.526  -7.427  11.543  1.00 37.46 ? 152 ALA B CB  1 
ATOM 1969 N N   . GLY B 1 127 ? 16.834  -6.846  10.779  1.00 37.68 ? 153 GLY B N   1 
ATOM 1970 C CA  . GLY B 1 127 ? 18.203  -7.365  10.777  1.00 37.92 ? 153 GLY B CA  1 
ATOM 1971 C C   . GLY B 1 127 ? 19.126  -6.612  9.837   1.00 38.19 ? 153 GLY B C   1 
ATOM 1972 O O   . GLY B 1 127 ? 20.305  -6.950  9.697   1.00 38.19 ? 153 GLY B O   1 
ATOM 1973 N N   . THR B 1 128 ? 18.580  -5.589  9.187   1.00 38.35 ? 154 THR B N   1 
ATOM 1974 C CA  . THR B 1 128 ? 19.334  -4.751  8.270   1.00 38.51 ? 154 THR B CA  1 
ATOM 1975 C C   . THR B 1 128 ? 20.128  -3.689  9.042   1.00 38.85 ? 154 THR B C   1 
ATOM 1976 O O   . THR B 1 128 ? 21.179  -3.232  8.580   1.00 38.90 ? 154 THR B O   1 
ATOM 1977 C CB  . THR B 1 128 ? 18.394  -4.081  7.235   1.00 38.43 ? 154 THR B CB  1 
ATOM 1978 O OG1 . THR B 1 128 ? 17.557  -5.075  6.631   1.00 37.85 ? 154 THR B OG1 1 
ATOM 1979 C CG2 . THR B 1 128 ? 19.189  -3.392  6.144   1.00 38.43 ? 154 THR B CG2 1 
ATOM 1980 N N   . GLY B 1 129 ? 19.626  -3.312  10.218  1.00 39.12 ? 155 GLY B N   1 
ATOM 1981 C CA  . GLY B 1 129 ? 20.234  -2.256  11.027  1.00 39.44 ? 155 GLY B CA  1 
ATOM 1982 C C   . GLY B 1 129 ? 19.863  -0.866  10.539  1.00 39.84 ? 155 GLY B C   1 
ATOM 1983 O O   . GLY B 1 129 ? 18.937  -0.708  9.733   1.00 39.95 ? 155 GLY B O   1 
ATOM 1984 N N   . CYS B 1 130 ? 20.596  0.138   11.019  1.00 40.02 ? 156 CYS B N   1 
ATOM 1985 C CA  . CYS B 1 130 ? 20.298  1.540   10.740  1.00 40.37 ? 156 CYS B CA  1 
ATOM 1986 C C   . CYS B 1 130 ? 20.403  1.866   9.268   1.00 40.45 ? 156 CYS B C   1 
ATOM 1987 O O   . CYS B 1 130 ? 21.313  1.394   8.588   1.00 40.59 ? 156 CYS B O   1 
ATOM 1988 C CB  . CYS B 1 130 ? 21.246  2.455   11.503  1.00 40.54 ? 156 CYS B CB  1 
ATOM 1989 S SG  . CYS B 1 130 ? 21.037  2.435   13.282  1.00 41.82 ? 156 CYS B SG  1 
ATOM 1990 N N   . VAL B 1 131 ? 19.462  2.676   8.790   1.00 40.45 ? 157 VAL B N   1 
ATOM 1991 C CA  . VAL B 1 131 ? 19.479  3.177   7.417   1.00 40.43 ? 157 VAL B CA  1 
ATOM 1992 C C   . VAL B 1 131 ? 19.448  4.701   7.366   1.00 40.31 ? 157 VAL B C   1 
ATOM 1993 O O   . VAL B 1 131 ? 18.893  5.365   8.249   1.00 40.06 ? 157 VAL B O   1 
ATOM 1994 C CB  . VAL B 1 131 ? 18.314  2.618   6.555   1.00 40.40 ? 157 VAL B CB  1 
ATOM 1995 C CG1 . VAL B 1 131 ? 18.460  1.112   6.362   1.00 40.26 ? 157 VAL B CG1 1 
ATOM 1996 C CG2 . VAL B 1 131 ? 16.963  2.982   7.164   1.00 40.44 ? 157 VAL B CG2 1 
ATOM 1997 N N   . ILE B 1 132 ? 20.052  5.243   6.316   1.00 40.22 ? 158 ILE B N   1 
ATOM 1998 C CA  . ILE B 1 132 ? 20.123  6.677   6.128   1.00 40.18 ? 158 ILE B CA  1 
ATOM 1999 C C   . ILE B 1 132 ? 19.483  7.036   4.784   1.00 39.99 ? 158 ILE B C   1 
ATOM 2000 O O   . ILE B 1 132 ? 19.942  6.596   3.726   1.00 39.72 ? 158 ILE B O   1 
ATOM 2001 C CB  . ILE B 1 132 ? 21.582  7.187   6.244   1.00 40.20 ? 158 ILE B CB  1 
ATOM 2002 C CG1 . ILE B 1 132 ? 22.175  6.809   7.604   1.00 40.36 ? 158 ILE B CG1 1 
ATOM 2003 C CG2 . ILE B 1 132 ? 21.640  8.690   6.082   1.00 40.64 ? 158 ILE B CG2 1 
ATOM 2004 C CD1 . ILE B 1 132 ? 23.707  6.797   7.645   1.00 42.10 ? 158 ILE B CD1 1 
ATOM 2005 N N   . LEU B 1 133 ? 18.391  7.796   4.859   1.00 39.93 ? 159 LEU B N   1 
ATOM 2006 C CA  . LEU B 1 133 ? 17.705  8.330   3.688   1.00 39.88 ? 159 LEU B CA  1 
ATOM 2007 C C   . LEU B 1 133 ? 18.310  9.676   3.344   1.00 39.59 ? 159 LEU B C   1 
ATOM 2008 O O   . LEU B 1 133 ? 18.461  10.531  4.218   1.00 39.18 ? 159 LEU B O   1 
ATOM 2009 C CB  . LEU B 1 133 ? 16.209  8.517   3.963   1.00 40.13 ? 159 LEU B CB  1 
ATOM 2010 C CG  . LEU B 1 133 ? 15.334  7.358   4.440   1.00 40.45 ? 159 LEU B CG  1 
ATOM 2011 C CD1 . LEU B 1 133 ? 13.900  7.848   4.581   1.00 40.78 ? 159 LEU B CD1 1 
ATOM 2012 C CD2 . LEU B 1 133 ? 15.391  6.169   3.488   1.00 41.07 ? 159 LEU B CD2 1 
ATOM 2013 N N   . LYS B 1 134 ? 18.640  9.862   2.068   1.00 39.61 ? 160 LYS B N   1 
ATOM 2014 C CA  . LYS B 1 134 ? 19.391  11.035  1.637   1.00 39.76 ? 160 LYS B CA  1 
ATOM 2015 C C   . LYS B 1 134 ? 18.918  11.600  0.300   1.00 39.89 ? 160 LYS B C   1 
ATOM 2016 O O   . LYS B 1 134 ? 18.685  10.858  -0.659  1.00 39.92 ? 160 LYS B O   1 
ATOM 2017 C CB  . LYS B 1 134 ? 20.880  10.706  1.567   1.00 39.63 ? 160 LYS B CB  1 
ATOM 2018 C CG  . LYS B 1 134 ? 21.517  10.412  2.916   1.00 39.85 ? 160 LYS B CG  1 
ATOM 2019 C CD  . LYS B 1 134 ? 23.021  10.175  2.814   1.00 40.14 ? 160 LYS B CD  1 
ATOM 2020 C CE  . LYS B 1 134 ? 23.350  8.715   2.532   1.00 40.63 ? 160 LYS B CE  1 
ATOM 2021 N NZ  . LYS B 1 134 ? 24.812  8.453   2.696   1.00 42.07 ? 160 LYS B NZ  1 
ATOM 2022 N N   . ALA B 1 135 ? 18.785  12.924  0.254   1.00 39.90 ? 161 ALA B N   1 
ATOM 2023 C CA  . ALA B 1 135 ? 18.400  13.633  -0.956  1.00 39.97 ? 161 ALA B CA  1 
ATOM 2024 C C   . ALA B 1 135 ? 19.560  14.474  -1.462  1.00 40.30 ? 161 ALA B C   1 
ATOM 2025 O O   . ALA B 1 135 ? 20.362  14.978  -0.673  1.00 40.55 ? 161 ALA B O   1 
ATOM 2026 C CB  . ALA B 1 135 ? 17.214  14.519  -0.684  1.00 39.95 ? 161 ALA B CB  1 
ATOM 2027 N N   . SER B 1 136 ? 19.647  14.627  -2.778  1.00 40.42 ? 162 SER B N   1 
ATOM 2028 C CA  . SER B 1 136 ? 20.616  15.532  -3.371  1.00 40.54 ? 162 SER B CA  1 
ATOM 2029 C C   . SER B 1 136 ? 19.980  16.404  -4.443  1.00 40.37 ? 162 SER B C   1 
ATOM 2030 O O   . SER B 1 136 ? 19.386  15.895  -5.397  1.00 40.48 ? 162 SER B O   1 
ATOM 2031 C CB  . SER B 1 136 ? 21.790  14.763  -3.957  1.00 40.62 ? 162 SER B CB  1 
ATOM 2032 O OG  . SER B 1 136 ? 22.573  15.612  -4.782  1.00 41.76 ? 162 SER B OG  1 
ATOM 2033 N N   . ILE B 1 137 ? 20.120  17.715  -4.279  1.00 40.12 ? 163 ILE B N   1 
ATOM 2034 C CA  . ILE B 1 137 ? 19.584  18.680  -5.238  1.00 39.96 ? 163 ILE B CA  1 
ATOM 2035 C C   . ILE B 1 137 ? 20.659  19.308  -6.159  1.00 40.04 ? 163 ILE B C   1 
ATOM 2036 O O   . ILE B 1 137 ? 20.327  20.038  -7.086  1.00 39.90 ? 163 ILE B O   1 
ATOM 2037 C CB  . ILE B 1 137 ? 18.667  19.751  -4.552  1.00 39.88 ? 163 ILE B CB  1 
ATOM 2038 C CG1 . ILE B 1 137 ? 19.392  20.496  -3.429  1.00 39.78 ? 163 ILE B CG1 1 
ATOM 2039 C CG2 . ILE B 1 137 ? 17.403  19.106  -4.003  1.00 39.21 ? 163 ILE B CG2 1 
ATOM 2040 C CD1 . ILE B 1 137 ? 20.091  21.758  -3.874  1.00 39.57 ? 163 ILE B CD1 1 
ATOM 2041 N N   . VAL B 1 138 ? 21.934  19.014  -5.916  1.00 40.13 ? 164 VAL B N   1 
ATOM 2042 C CA  . VAL B 1 138 ? 22.993  19.465  -6.821  1.00 40.49 ? 164 VAL B CA  1 
ATOM 2043 C C   . VAL B 1 138 ? 23.013  18.571  -8.061  1.00 40.68 ? 164 VAL B C   1 
ATOM 2044 O O   . VAL B 1 138 ? 22.929  17.354  -7.947  1.00 40.80 ? 164 VAL B O   1 
ATOM 2045 C CB  . VAL B 1 138 ? 24.394  19.567  -6.126  1.00 40.47 ? 164 VAL B CB  1 
ATOM 2046 C CG1 . VAL B 1 138 ? 24.947  18.191  -5.748  1.00 40.50 ? 164 VAL B CG1 1 
ATOM 2047 C CG2 . VAL B 1 138 ? 25.389  20.351  -7.005  1.00 40.73 ? 164 VAL B CG2 1 
ATOM 2048 N N   . GLN B 1 139 ? 23.101  19.185  -9.239  1.00 41.04 ? 165 GLN B N   1 
ATOM 2049 C CA  . GLN B 1 139 ? 22.930  18.465  -10.505 1.00 41.32 ? 165 GLN B CA  1 
ATOM 2050 C C   . GLN B 1 139 ? 24.200  18.388  -11.339 1.00 40.81 ? 165 GLN B C   1 
ATOM 2051 O O   . GLN B 1 139 ? 24.495  19.282  -12.136 1.00 40.66 ? 165 GLN B O   1 
ATOM 2052 C CB  . GLN B 1 139 ? 21.784  19.068  -11.335 1.00 41.73 ? 165 GLN B CB  1 
ATOM 2053 C CG  . GLN B 1 139 ? 20.394  18.927  -10.720 1.00 43.76 ? 165 GLN B CG  1 
ATOM 2054 C CD  . GLN B 1 139 ? 20.027  17.483  -10.392 1.00 46.15 ? 165 GLN B CD  1 
ATOM 2055 O OE1 . GLN B 1 139 ? 19.265  16.849  -11.123 1.00 47.15 ? 165 GLN B OE1 1 
ATOM 2056 N NE2 . GLN B 1 139 ? 20.560  16.962  -9.282  1.00 46.67 ? 165 GLN B NE2 1 
ATOM 2057 N N   . LYS B 1 140 ? 24.940  17.305  -11.139 1.00 40.45 ? 166 LYS B N   1 
ATOM 2058 C CA  . LYS B 1 140 ? 26.161  17.026  -11.875 1.00 40.25 ? 166 LYS B CA  1 
ATOM 2059 C C   . LYS B 1 140 ? 26.033  15.607  -12.398 1.00 40.13 ? 166 LYS B C   1 
ATOM 2060 O O   . LYS B 1 140 ? 25.033  14.946  -12.133 1.00 40.17 ? 166 LYS B O   1 
ATOM 2061 C CB  . LYS B 1 140 ? 27.383  17.153  -10.960 1.00 40.19 ? 166 LYS B CB  1 
ATOM 2062 C CG  . LYS B 1 140 ? 27.556  18.509  -10.278 1.00 40.18 ? 166 LYS B CG  1 
ATOM 2063 C CD  . LYS B 1 140 ? 28.347  19.475  -11.129 1.00 40.77 ? 166 LYS B CD  1 
ATOM 2064 C CE  . LYS B 1 140 ? 28.929  20.603  -10.288 1.00 40.97 ? 166 LYS B CE  1 
ATOM 2065 N NZ  . LYS B 1 140 ? 27.997  21.740  -10.053 1.00 41.43 ? 166 LYS B NZ  1 
ATOM 2066 N N   . ARG B 1 141 ? 27.024  15.134  -13.149 1.00 40.22 ? 167 ARG B N   1 
ATOM 2067 C CA  . ARG B 1 141 ? 27.004  13.744  -13.597 1.00 40.50 ? 167 ARG B CA  1 
ATOM 2068 C C   . ARG B 1 141 ? 27.392  12.803  -12.458 1.00 40.37 ? 167 ARG B C   1 
ATOM 2069 O O   . ARG B 1 141 ? 27.080  11.615  -12.495 1.00 40.41 ? 167 ARG B O   1 
ATOM 2070 C CB  . ARG B 1 141 ? 27.862  13.523  -14.847 1.00 40.56 ? 167 ARG B CB  1 
ATOM 2071 C CG  . ARG B 1 141 ? 29.332  13.391  -14.597 1.00 41.40 ? 167 ARG B CG  1 
ATOM 2072 C CD  . ARG B 1 141 ? 30.040  12.786  -15.799 1.00 43.04 ? 167 ARG B CD  1 
ATOM 2073 N NE  . ARG B 1 141 ? 31.474  12.661  -15.544 1.00 43.87 ? 167 ARG B NE  1 
ATOM 2074 C CZ  . ARG B 1 141 ? 32.035  11.631  -14.919 1.00 44.00 ? 167 ARG B CZ  1 
ATOM 2075 N NH1 . ARG B 1 141 ? 33.347  11.617  -14.727 1.00 44.33 ? 167 ARG B NH1 1 
ATOM 2076 N NH2 . ARG B 1 141 ? 31.288  10.617  -14.488 1.00 43.54 ? 167 ARG B NH2 1 
ATOM 2077 N N   . ILE B 1 142 ? 28.060  13.361  -11.451 1.00 40.41 ? 168 ILE B N   1 
ATOM 2078 C CA  . ILE B 1 142 ? 28.382  12.665  -10.210 1.00 40.31 ? 168 ILE B CA  1 
ATOM 2079 C C   . ILE B 1 142 ? 27.607  13.341  -9.070  1.00 40.27 ? 168 ILE B C   1 
ATOM 2080 O O   . ILE B 1 142 ? 27.736  14.546  -8.849  1.00 40.15 ? 168 ILE B O   1 
ATOM 2081 C CB  . ILE B 1 142 ? 29.896  12.699  -9.935  1.00 40.40 ? 168 ILE B CB  1 
ATOM 2082 C CG1 . ILE B 1 142 ? 30.676  12.119  -11.123 1.00 40.25 ? 168 ILE B CG1 1 
ATOM 2083 C CG2 . ILE B 1 142 ? 30.219  11.943  -8.660  1.00 40.74 ? 168 ILE B CG2 1 
ATOM 2084 C CD1 . ILE B 1 142 ? 32.114  12.600  -11.229 1.00 40.38 ? 168 ILE B CD1 1 
ATOM 2085 N N   . ILE B 1 143 ? 26.792  12.559  -8.365  1.00 40.29 ? 169 ILE B N   1 
ATOM 2086 C CA  . ILE B 1 143 ? 25.877  13.096  -7.359  1.00 40.32 ? 169 ILE B CA  1 
ATOM 2087 C C   . ILE B 1 143 ? 26.446  12.892  -5.955  1.00 40.54 ? 169 ILE B C   1 
ATOM 2088 O O   . ILE B 1 143 ? 26.664  11.757  -5.523  1.00 40.52 ? 169 ILE B O   1 
ATOM 2089 C CB  . ILE B 1 143 ? 24.450  12.469  -7.479  1.00 40.41 ? 169 ILE B CB  1 
ATOM 2090 C CG1 . ILE B 1 143 ? 23.830  12.735  -8.857  1.00 40.49 ? 169 ILE B CG1 1 
ATOM 2091 C CG2 . ILE B 1 143 ? 23.517  13.018  -6.433  1.00 39.95 ? 169 ILE B CG2 1 
ATOM 2092 C CD1 . ILE B 1 143 ? 23.998  11.588  -9.833  1.00 41.03 ? 169 ILE B CD1 1 
ATOM 2093 N N   . TYR B 1 144 ? 26.685  14.003  -5.259  1.00 40.73 ? 170 TYR B N   1 
ATOM 2094 C CA  . TYR B 1 144 ? 27.280  13.995  -3.922  1.00 40.88 ? 170 TYR B CA  1 
ATOM 2095 C C   . TYR B 1 144 ? 26.271  14.276  -2.819  1.00 41.15 ? 170 TYR B C   1 
ATOM 2096 O O   . TYR B 1 144 ? 25.436  15.180  -2.932  1.00 41.24 ? 170 TYR B O   1 
ATOM 2097 C CB  . TYR B 1 144 ? 28.413  15.012  -3.836  1.00 40.91 ? 170 TYR B CB  1 
ATOM 2098 C CG  . TYR B 1 144 ? 29.644  14.597  -4.594  1.00 41.20 ? 170 TYR B CG  1 
ATOM 2099 C CD1 . TYR B 1 144 ? 30.574  13.727  -4.026  1.00 40.91 ? 170 TYR B CD1 1 
ATOM 2100 C CD2 . TYR B 1 144 ? 29.877  15.060  -5.887  1.00 40.84 ? 170 TYR B CD2 1 
ATOM 2101 C CE1 . TYR B 1 144 ? 31.710  13.341  -4.727  1.00 41.08 ? 170 TYR B CE1 1 
ATOM 2102 C CE2 . TYR B 1 144 ? 31.005  14.675  -6.589  1.00 40.46 ? 170 TYR B CE2 1 
ATOM 2103 C CZ  . TYR B 1 144 ? 31.919  13.823  -6.007  1.00 40.78 ? 170 TYR B CZ  1 
ATOM 2104 O OH  . TYR B 1 144 ? 33.042  13.445  -6.705  1.00 41.21 ? 170 TYR B OH  1 
ATOM 2105 N N   . PHE B 1 145 ? 26.376  13.502  -1.743  1.00 41.27 ? 171 PHE B N   1 
ATOM 2106 C CA  . PHE B 1 145 ? 25.438  13.577  -0.636  1.00 41.46 ? 171 PHE B CA  1 
ATOM 2107 C C   . PHE B 1 145 ? 26.142  13.957  0.658   1.00 41.88 ? 171 PHE B C   1 
ATOM 2108 O O   . PHE B 1 145 ? 27.288  13.552  0.910   1.00 41.95 ? 171 PHE B O   1 
ATOM 2109 C CB  . PHE B 1 145 ? 24.740  12.231  -0.434  1.00 41.15 ? 171 PHE B CB  1 
ATOM 2110 C CG  . PHE B 1 145 ? 23.810  11.831  -1.556  1.00 41.04 ? 171 PHE B CG  1 
ATOM 2111 C CD1 . PHE B 1 145 ? 22.428  11.942  -1.400  1.00 40.36 ? 171 PHE B CD1 1 
ATOM 2112 C CD2 . PHE B 1 145 ? 24.310  11.301  -2.746  1.00 39.95 ? 171 PHE B CD2 1 
ATOM 2113 C CE1 . PHE B 1 145 ? 21.562  11.550  -2.412  1.00 39.52 ? 171 PHE B CE1 1 
ATOM 2114 C CE2 . PHE B 1 145 ? 23.455  10.909  -3.763  1.00 39.74 ? 171 PHE B CE2 1 
ATOM 2115 C CZ  . PHE B 1 145 ? 22.075  11.034  -3.598  1.00 40.14 ? 171 PHE B CZ  1 
ATOM 2116 N N   . GLN B 1 146 ? 25.439  14.726  1.481   1.00 42.09 ? 172 GLN B N   1 
ATOM 2117 C CA  . GLN B 1 146 ? 25.888  15.036  2.821   1.00 42.70 ? 172 GLN B CA  1 
ATOM 2118 C C   . GLN B 1 146 ? 25.799  13.793  3.721   1.00 43.01 ? 172 GLN B C   1 
ATOM 2119 O O   . GLN B 1 146 ? 25.043  12.858  3.438   1.00 43.31 ? 172 GLN B O   1 
ATOM 2120 C CB  . GLN B 1 146 ? 25.037  16.174  3.382   1.00 42.69 ? 172 GLN B CB  1 
ATOM 2121 C CG  . GLN B 1 146 ? 23.551  15.836  3.487   1.00 43.55 ? 172 GLN B CG  1 
ATOM 2122 C CD  . GLN B 1 146 ? 22.647  17.056  3.579   1.00 44.23 ? 172 GLN B CD  1 
ATOM 2123 O OE1 . GLN B 1 146 ? 22.993  18.150  3.115   1.00 44.22 ? 172 GLN B OE1 1 
ATOM 2124 N NE2 . GLN B 1 146 ? 21.467  16.866  4.164   1.00 43.51 ? 172 GLN B NE2 1 
ATOM 2125 N N   . ASP B 1 147 ? 26.582  13.777  4.796   1.00 43.42 ? 173 ASP B N   1 
ATOM 2126 C CA  . ASP B 1 147 ? 26.436  12.756  5.838   1.00 43.77 ? 173 ASP B CA  1 
ATOM 2127 C C   . ASP B 1 147 ? 25.179  13.045  6.653   1.00 44.01 ? 173 ASP B C   1 
ATOM 2128 O O   . ASP B 1 147 ? 24.414  12.130  6.983   1.00 44.27 ? 173 ASP B O   1 
ATOM 2129 C CB  . ASP B 1 147 ? 27.658  12.724  6.770   1.00 43.73 ? 173 ASP B CB  1 
ATOM 2130 C CG  . ASP B 1 147 ? 28.894  12.099  6.119   1.00 43.94 ? 173 ASP B CG  1 
ATOM 2131 O OD1 . ASP B 1 147 ? 29.114  12.297  4.902   1.00 44.03 ? 173 ASP B OD1 1 
ATOM 2132 O OD2 . ASP B 1 147 ? 29.659  11.414  6.836   1.00 43.45 ? 173 ASP B OD2 1 
ATOM 2133 N N   . GLU B 1 148 ? 24.973  14.326  6.964   1.00 44.07 ? 174 GLU B N   1 
ATOM 2134 C CA  . GLU B 1 148 ? 23.875  14.770  7.825   1.00 44.10 ? 174 GLU B CA  1 
ATOM 2135 C C   . GLU B 1 148 ? 23.344  16.134  7.380   1.00 43.62 ? 174 GLU B C   1 
ATOM 2136 O O   . GLU B 1 148 ? 23.996  16.837  6.608   1.00 43.47 ? 174 GLU B O   1 
ATOM 2137 C CB  . GLU B 1 148 ? 24.333  14.815  9.294   1.00 44.34 ? 174 GLU B CB  1 
ATOM 2138 C CG  . GLU B 1 148 ? 24.381  13.447  9.992   1.00 44.54 ? 174 GLU B CG  1 
ATOM 2139 C CD  . GLU B 1 148 ? 25.060  13.487  11.355  1.00 44.73 ? 174 GLU B CD  1 
ATOM 2140 O OE1 . GLU B 1 148 ? 26.251  13.869  11.433  1.00 45.37 ? 174 GLU B OE1 1 
ATOM 2141 O OE2 . GLU B 1 148 ? 24.404  13.114  12.353  1.00 45.76 ? 174 GLU B OE2 1 
ATOM 2142 N N   . GLY B 1 149 ? 22.160  16.499  7.870   1.00 43.26 ? 175 GLY B N   1 
ATOM 2143 C CA  . GLY B 1 149 ? 21.494  17.741  7.459   1.00 42.64 ? 175 GLY B CA  1 
ATOM 2144 C C   . GLY B 1 149 ? 20.016  17.560  7.149   1.00 42.17 ? 175 GLY B C   1 
ATOM 2145 O O   . GLY B 1 149 ? 19.438  16.503  7.425   1.00 42.09 ? 175 GLY B O   1 
ATOM 2146 N N   . SER B 1 150 ? 19.407  18.596  6.574   1.00 41.62 ? 176 SER B N   1 
ATOM 2147 C CA  . SER B 1 150 ? 17.976  18.603  6.291   1.00 41.20 ? 176 SER B CA  1 
ATOM 2148 C C   . SER B 1 150 ? 17.605  17.577  5.225   1.00 41.10 ? 176 SER B C   1 
ATOM 2149 O O   . SER B 1 150 ? 16.571  16.915  5.326   1.00 41.13 ? 176 SER B O   1 
ATOM 2150 C CB  . SER B 1 150 ? 17.508  19.996  5.881   1.00 41.06 ? 176 SER B CB  1 
ATOM 2151 O OG  . SER B 1 150 ? 18.095  20.380  4.652   1.00 41.29 ? 176 SER B OG  1 
ATOM 2152 N N   . LEU B 1 151 ? 18.463  17.430  4.221   1.00 40.91 ? 177 LEU B N   1 
ATOM 2153 C CA  . LEU B 1 151 ? 18.246  16.453  3.154   1.00 40.81 ? 177 LEU B CA  1 
ATOM 2154 C C   . LEU B 1 151 ? 18.610  15.028  3.587   1.00 40.82 ? 177 LEU B C   1 
ATOM 2155 O O   . LEU B 1 151 ? 18.909  14.169  2.751   1.00 40.95 ? 177 LEU B O   1 
ATOM 2156 C CB  . LEU B 1 151 ? 19.020  16.848  1.888   1.00 40.69 ? 177 LEU B CB  1 
ATOM 2157 C CG  . LEU B 1 151 ? 18.703  18.212  1.266   1.00 40.46 ? 177 LEU B CG  1 
ATOM 2158 C CD1 . LEU B 1 151 ? 19.772  18.620  0.253   1.00 40.84 ? 177 LEU B CD1 1 
ATOM 2159 C CD2 . LEU B 1 151 ? 17.327  18.223  0.633   1.00 40.17 ? 177 LEU B CD2 1 
ATOM 2160 N N   . THR B 1 152 ? 18.569  14.784  4.895   1.00 40.76 ? 178 THR B N   1 
ATOM 2161 C CA  . THR B 1 152 ? 18.891  13.480  5.460   1.00 40.83 ? 178 THR B CA  1 
ATOM 2162 C C   . THR B 1 152 ? 18.060  13.206  6.708   1.00 40.87 ? 178 THR B C   1 
ATOM 2163 O O   . THR B 1 152 ? 17.953  14.056  7.593   1.00 40.97 ? 178 THR B O   1 
ATOM 2164 C CB  . THR B 1 152 ? 20.407  13.363  5.787   1.00 40.85 ? 178 THR B CB  1 
ATOM 2165 O OG1 . THR B 1 152 ? 21.148  13.172  4.577   1.00 41.02 ? 178 THR B OG1 1 
ATOM 2166 C CG2 . THR B 1 152 ? 20.694  12.196  6.721   1.00 41.15 ? 178 THR B CG2 1 
ATOM 2167 N N   . LYS B 1 153 ? 17.459  12.020  6.748   1.00 41.06 ? 179 LYS B N   1 
ATOM 2168 C CA  . LYS B 1 153 ? 16.844  11.474  7.960   1.00 41.20 ? 179 LYS B CA  1 
ATOM 2169 C C   . LYS B 1 153 ? 17.308  10.023  8.133   1.00 41.38 ? 179 LYS B C   1 
ATOM 2170 O O   . LYS B 1 153 ? 17.297  9.245   7.174   1.00 41.41 ? 179 LYS B O   1 
ATOM 2171 C CB  . LYS B 1 153 ? 15.306  11.532  7.894   1.00 41.11 ? 179 LYS B CB  1 
ATOM 2172 C CG  . LYS B 1 153 ? 14.687  12.932  7.749   1.00 40.98 ? 179 LYS B CG  1 
ATOM 2173 C CD  . LYS B 1 153 ? 14.885  13.808  8.986   1.00 40.13 ? 179 LYS B CD  1 
ATOM 2174 C CE  . LYS B 1 153 ? 14.565  15.274  8.696   1.00 40.34 ? 179 LYS B CE  1 
ATOM 2175 N NZ  . LYS B 1 153 ? 15.540  15.927  7.752   1.00 39.95 ? 179 LYS B NZ  1 
ATOM 2176 N N   . LYS B 1 154 ? 17.734  9.667   9.344   1.00 41.63 ? 180 LYS B N   1 
ATOM 2177 C CA  . LYS B 1 154 ? 18.105  8.282   9.645   1.00 41.73 ? 180 LYS B CA  1 
ATOM 2178 C C   . LYS B 1 154 ? 17.105  7.614   10.583  1.00 41.79 ? 180 LYS B C   1 
ATOM 2179 O O   . LYS B 1 154 ? 16.490  8.272   11.424  1.00 41.82 ? 180 LYS B O   1 
ATOM 2180 C CB  . LYS B 1 154 ? 19.538  8.172   10.188  1.00 41.64 ? 180 LYS B CB  1 
ATOM 2181 C CG  . LYS B 1 154 ? 19.833  8.970   11.453  1.00 41.92 ? 180 LYS B CG  1 
ATOM 2182 C CD  . LYS B 1 154 ? 21.311  8.868   11.869  1.00 42.05 ? 180 LYS B CD  1 
ATOM 2183 C CE  . LYS B 1 154 ? 22.213  9.752   10.990  1.00 43.00 ? 180 LYS B CE  1 
ATOM 2184 N NZ  . LYS B 1 154 ? 23.649  9.759   11.422  1.00 42.21 ? 180 LYS B NZ  1 
ATOM 2185 N N   . LEU B 1 155 ? 16.940  6.305   10.402  1.00 41.93 ? 181 LEU B N   1 
ATOM 2186 C CA  . LEU B 1 155 ? 16.081  5.470   11.244  1.00 41.82 ? 181 LEU B CA  1 
ATOM 2187 C C   . LEU B 1 155 ? 16.807  4.159   11.548  1.00 41.70 ? 181 LEU B C   1 
ATOM 2188 O O   . LEU B 1 155 ? 17.712  3.763   10.816  1.00 41.66 ? 181 LEU B O   1 
ATOM 2189 C CB  . LEU B 1 155 ? 14.766  5.162   10.524  1.00 41.97 ? 181 LEU B CB  1 
ATOM 2190 C CG  . LEU B 1 155 ? 14.022  6.224   9.705   1.00 42.04 ? 181 LEU B CG  1 
ATOM 2191 C CD1 . LEU B 1 155 ? 13.463  5.618   8.425   1.00 41.89 ? 181 LEU B CD1 1 
ATOM 2192 C CD2 . LEU B 1 155 ? 12.923  6.881   10.516  1.00 41.26 ? 181 LEU B CD2 1 
ATOM 2193 N N   . CYS B 1 156 ? 16.411  3.476   12.617  1.00 41.72 ? 182 CYS B N   1 
ATOM 2194 C CA  . CYS B 1 156 ? 17.062  2.214   12.979  1.00 41.77 ? 182 CYS B CA  1 
ATOM 2195 C C   . CYS B 1 156 ? 16.078  1.105   13.358  1.00 41.45 ? 182 CYS B C   1 
ATOM 2196 O O   . CYS B 1 156 ? 14.884  1.211   13.075  1.00 41.24 ? 182 CYS B O   1 
ATOM 2197 C CB  . CYS B 1 156 ? 18.102  2.444   14.083  1.00 41.83 ? 182 CYS B CB  1 
ATOM 2198 S SG  . CYS B 1 156 ? 19.404  3.605   13.585  1.00 43.16 ? 182 CYS B SG  1 
ATOM 2199 N N   . GLU B 1 157 ? 16.612  0.051   13.992  1.00 41.46 ? 183 GLU B N   1 
ATOM 2200 C CA  . GLU B 1 157 ? 15.860  -1.122  14.482  1.00 41.36 ? 183 GLU B CA  1 
ATOM 2201 C C   . GLU B 1 157 ? 15.558  -2.138  13.355  1.00 41.37 ? 183 GLU B C   1 
ATOM 2202 C CB  . GLU B 1 157 ? 14.560  -0.688  15.217  1.00 41.21 ? 183 GLU B CB  1 
ATOM 2203 N N   . CYS C 1 18  ? 38.985  43.508  42.477  1.00 51.05 ? 44  CYS C N   1 
ATOM 2204 C CA  . CYS C 1 18  ? 37.576  43.969  42.312  1.00 50.96 ? 44  CYS C CA  1 
ATOM 2205 C C   . CYS C 1 18  ? 36.577  42.875  42.720  1.00 51.56 ? 44  CYS C C   1 
ATOM 2206 O O   . CYS C 1 18  ? 36.588  42.397  43.860  1.00 51.42 ? 44  CYS C O   1 
ATOM 2207 C CB  . CYS C 1 18  ? 37.329  44.439  40.863  1.00 50.65 ? 44  CYS C CB  1 
ATOM 2208 S SG  . CYS C 1 18  ? 36.818  43.150  39.640  1.00 48.43 ? 44  CYS C SG  1 
ATOM 2209 N N   . SER C 1 19  ? 35.724  42.497  41.770  1.00 52.19 ? 45  SER C N   1 
ATOM 2210 C CA  . SER C 1 19  ? 34.752  41.432  41.929  1.00 52.79 ? 45  SER C CA  1 
ATOM 2211 C C   . SER C 1 19  ? 34.783  40.523  40.693  1.00 53.17 ? 45  SER C C   1 
ATOM 2212 O O   . SER C 1 19  ? 34.122  40.791  39.682  1.00 53.11 ? 45  SER C O   1 
ATOM 2213 C CB  . SER C 1 19  ? 33.353  42.019  42.149  1.00 52.75 ? 45  SER C CB  1 
ATOM 2214 O OG  . SER C 1 19  ? 32.361  41.009  42.109  1.00 53.13 ? 45  SER C OG  1 
ATOM 2215 N N   . ARG C 1 20  ? 35.579  39.459  40.777  1.00 53.61 ? 46  ARG C N   1 
ATOM 2216 C CA  . ARG C 1 20  ? 35.510  38.370  39.805  1.00 53.86 ? 46  ARG C CA  1 
ATOM 2217 C C   . ARG C 1 20  ? 34.221  37.570  39.991  1.00 54.05 ? 46  ARG C C   1 
ATOM 2218 O O   . ARG C 1 20  ? 33.851  36.767  39.132  1.00 54.18 ? 46  ARG C O   1 
ATOM 2219 C CB  . ARG C 1 20  ? 36.737  37.459  39.908  1.00 53.88 ? 46  ARG C CB  1 
ATOM 2220 C CG  . ARG C 1 20  ? 37.716  37.601  38.743  1.00 53.82 ? 46  ARG C CG  1 
ATOM 2221 C CD  . ARG C 1 20  ? 37.204  36.900  37.485  1.00 53.81 ? 46  ARG C CD  1 
ATOM 2222 N NE  . ARG C 1 20  ? 37.144  35.444  37.640  1.00 53.92 ? 46  ARG C NE  1 
ATOM 2223 C CZ  . ARG C 1 20  ? 36.595  34.604  36.763  1.00 53.81 ? 46  ARG C CZ  1 
ATOM 2224 N NH1 . ARG C 1 20  ? 36.597  33.300  37.012  1.00 53.52 ? 46  ARG C NH1 1 
ATOM 2225 N NH2 . ARG C 1 20  ? 36.038  35.058  35.641  1.00 53.77 ? 46  ARG C NH2 1 
ATOM 2226 N N   . ILE C 1 21  ? 33.552  37.792  41.124  1.00 54.20 ? 47  ILE C N   1 
ATOM 2227 C CA  . ILE C 1 21  ? 32.193  37.299  41.346  1.00 54.28 ? 47  ILE C CA  1 
ATOM 2228 C C   . ILE C 1 21  ? 31.167  38.295  40.784  1.00 54.37 ? 47  ILE C C   1 
ATOM 2229 O O   . ILE C 1 21  ? 30.186  38.642  41.448  1.00 54.19 ? 47  ILE C O   1 
ATOM 2230 C CB  . ILE C 1 21  ? 31.908  36.953  42.842  1.00 54.30 ? 47  ILE C CB  1 
ATOM 2231 C CG1 . ILE C 1 21  ? 32.356  38.088  43.776  1.00 54.26 ? 47  ILE C CG1 1 
ATOM 2232 C CG2 . ILE C 1 21  ? 32.583  35.634  43.223  1.00 54.57 ? 47  ILE C CG2 1 
ATOM 2233 C CD1 . ILE C 1 21  ? 31.698  38.073  45.152  1.00 54.22 ? 47  ILE C CD1 1 
ATOM 2234 N N   . LEU C 1 22  ? 31.431  38.759  39.556  1.00 54.57 ? 48  LEU C N   1 
ATOM 2235 C CA  . LEU C 1 22  ? 30.452  39.463  38.712  1.00 54.47 ? 48  LEU C CA  1 
ATOM 2236 C C   . LEU C 1 22  ? 29.147  38.692  38.820  1.00 54.36 ? 48  LEU C C   1 
ATOM 2237 O O   . LEU C 1 22  ? 28.090  39.264  39.113  1.00 54.27 ? 48  LEU C O   1 
ATOM 2238 C CB  . LEU C 1 22  ? 30.899  39.470  37.240  1.00 54.29 ? 48  LEU C CB  1 
ATOM 2239 C CG  . LEU C 1 22  ? 32.368  39.673  36.838  1.00 54.41 ? 48  LEU C CG  1 
ATOM 2240 C CD1 . LEU C 1 22  ? 32.698  38.867  35.592  1.00 53.92 ? 48  LEU C CD1 1 
ATOM 2241 C CD2 . LEU C 1 22  ? 32.721  41.154  36.641  1.00 54.73 ? 48  LEU C CD2 1 
ATOM 2242 N N   . ARG C 1 23  ? 29.265  37.382  38.587  1.00 54.11 ? 49  ARG C N   1 
ATOM 2243 C CA  . ARG C 1 23  ? 28.228  36.393  38.836  1.00 54.01 ? 49  ARG C CA  1 
ATOM 2244 C C   . ARG C 1 23  ? 27.484  36.684  40.134  1.00 53.94 ? 49  ARG C C   1 
ATOM 2245 O O   . ARG C 1 23  ? 28.101  36.995  41.152  1.00 53.98 ? 49  ARG C O   1 
ATOM 2246 C CB  . ARG C 1 23  ? 28.876  35.013  38.923  1.00 53.97 ? 49  ARG C CB  1 
ATOM 2247 C CG  . ARG C 1 23  ? 27.900  33.852  38.986  1.00 54.09 ? 49  ARG C CG  1 
ATOM 2248 C CD  . ARG C 1 23  ? 28.345  32.820  40.000  1.00 54.10 ? 49  ARG C CD  1 
ATOM 2249 N NE  . ARG C 1 23  ? 28.262  33.370  41.348  1.00 54.73 ? 49  ARG C NE  1 
ATOM 2250 C CZ  . ARG C 1 23  ? 27.141  33.435  42.063  1.00 54.91 ? 49  ARG C CZ  1 
ATOM 2251 N NH1 . ARG C 1 23  ? 27.166  33.967  43.271  1.00 54.99 ? 49  ARG C NH1 1 
ATOM 2252 N NH2 . ARG C 1 23  ? 25.996  32.972  41.575  1.00 54.92 ? 49  ARG C NH2 1 
ATOM 2253 N N   . GLN C 1 25  ? 24.510  35.410  40.621  1.00 33.95 ? 51  GLN C N   1 
ATOM 2254 C CA  . GLN C 1 25  ? 23.519  35.733  39.593  1.00 34.04 ? 51  GLN C CA  1 
ATOM 2255 C C   . GLN C 1 25  ? 23.585  34.889  38.305  1.00 33.82 ? 51  GLN C C   1 
ATOM 2256 O O   . GLN C 1 25  ? 22.562  34.680  37.650  1.00 33.90 ? 51  GLN C O   1 
ATOM 2257 C CB  . GLN C 1 25  ? 23.586  37.218  39.229  1.00 34.03 ? 51  GLN C CB  1 
ATOM 2258 C CG  . GLN C 1 25  ? 22.908  38.151  40.228  1.00 34.49 ? 51  GLN C CG  1 
ATOM 2259 C CD  . GLN C 1 25  ? 22.397  39.434  39.575  1.00 35.18 ? 51  GLN C CD  1 
ATOM 2260 O OE1 . GLN C 1 25  ? 21.188  39.655  39.472  1.00 34.62 ? 51  GLN C OE1 1 
ATOM 2261 N NE2 . GLN C 1 25  ? 23.321  40.274  39.114  1.00 35.37 ? 51  GLN C NE2 1 
ATOM 2262 N N   . GLY C 1 26  ? 24.772  34.410  37.948  1.00 33.59 ? 52  GLY C N   1 
ATOM 2263 C CA  . GLY C 1 26  ? 24.994  33.805  36.625  1.00 33.37 ? 52  GLY C CA  1 
ATOM 2264 C C   . GLY C 1 26  ? 24.749  32.313  36.411  1.00 33.16 ? 52  GLY C C   1 
ATOM 2265 O O   . GLY C 1 26  ? 24.665  31.520  37.358  1.00 32.82 ? 52  GLY C O   1 
ATOM 2266 N N   . THR C 1 27  ? 24.626  31.948  35.138  1.00 33.04 ? 53  THR C N   1 
ATOM 2267 C CA  . THR C 1 27  ? 24.549  30.557  34.723  1.00 33.00 ? 53  THR C CA  1 
ATOM 2268 C C   . THR C 1 27  ? 25.794  30.154  33.937  1.00 32.91 ? 53  THR C C   1 
ATOM 2269 O O   . THR C 1 27  ? 26.138  30.763  32.916  1.00 32.77 ? 53  THR C O   1 
ATOM 2270 C CB  . THR C 1 27  ? 23.285  30.276  33.912  1.00 33.02 ? 53  THR C CB  1 
ATOM 2271 O OG1 . THR C 1 27  ? 22.143  30.552  34.727  1.00 33.54 ? 53  THR C OG1 1 
ATOM 2272 C CG2 . THR C 1 27  ? 23.234  28.819  33.477  1.00 32.90 ? 53  THR C CG2 1 
ATOM 2273 N N   . ARG C 1 28  ? 26.477  29.139  34.458  1.00 32.75 ? 54  ARG C N   1 
ATOM 2274 C CA  . ARG C 1 28  ? 27.660  28.585  33.841  1.00 32.70 ? 54  ARG C CA  1 
ATOM 2275 C C   . ARG C 1 28  ? 27.221  27.855  32.581  1.00 32.71 ? 54  ARG C C   1 
ATOM 2276 O O   . ARG C 1 28  ? 26.189  27.192  32.571  1.00 32.90 ? 54  ARG C O   1 
ATOM 2277 C CB  . ARG C 1 28  ? 28.346  27.633  34.824  1.00 32.57 ? 54  ARG C CB  1 
ATOM 2278 C CG  . ARG C 1 28  ? 29.581  26.935  34.282  1.00 32.85 ? 54  ARG C CG  1 
ATOM 2279 C CD  . ARG C 1 28  ? 30.208  25.990  35.303  1.00 33.22 ? 54  ARG C CD  1 
ATOM 2280 N NE  . ARG C 1 28  ? 31.009  26.707  36.289  1.00 34.73 ? 54  ARG C NE  1 
ATOM 2281 C CZ  . ARG C 1 28  ? 32.245  27.149  36.074  1.00 36.63 ? 54  ARG C CZ  1 
ATOM 2282 N NH1 . ARG C 1 28  ? 32.890  27.803  37.033  1.00 38.11 ? 54  ARG C NH1 1 
ATOM 2283 N NH2 . ARG C 1 28  ? 32.842  26.951  34.901  1.00 36.88 ? 54  ARG C NH2 1 
ATOM 2284 N N   . ARG C 1 29  ? 27.982  28.013  31.507  1.00 32.83 ? 55  ARG C N   1 
ATOM 2285 C CA  . ARG C 1 29  ? 27.708  27.305  30.266  1.00 32.95 ? 55  ARG C CA  1 
ATOM 2286 C C   . ARG C 1 29  ? 29.037  27.053  29.556  1.00 32.92 ? 55  ARG C C   1 
ATOM 2287 O O   . ARG C 1 29  ? 29.492  27.853  28.737  1.00 33.11 ? 55  ARG C O   1 
ATOM 2288 C CB  . ARG C 1 29  ? 26.730  28.097  29.388  1.00 32.96 ? 55  ARG C CB  1 
ATOM 2289 C CG  . ARG C 1 29  ? 26.203  27.311  28.201  1.00 33.17 ? 55  ARG C CG  1 
ATOM 2290 C CD  . ARG C 1 29  ? 25.303  28.141  27.299  1.00 33.21 ? 55  ARG C CD  1 
ATOM 2291 N NE  . ARG C 1 29  ? 25.001  27.419  26.063  1.00 34.67 ? 55  ARG C NE  1 
ATOM 2292 C CZ  . ARG C 1 29  ? 23.848  27.473  25.402  1.00 34.68 ? 55  ARG C CZ  1 
ATOM 2293 N NH1 . ARG C 1 29  ? 22.849  28.207  25.851  1.00 35.83 ? 55  ARG C NH1 1 
ATOM 2294 N NH2 . ARG C 1 29  ? 23.687  26.774  24.287  1.00 35.28 ? 55  ARG C NH2 1 
ATOM 2295 N N   . GLU C 1 30  ? 29.667  25.940  29.904  1.00 32.82 ? 56  GLU C N   1 
ATOM 2296 C CA  . GLU C 1 30  ? 30.974  25.603  29.374  1.00 32.65 ? 56  GLU C CA  1 
ATOM 2297 C C   . GLU C 1 30  ? 30.824  25.238  27.910  1.00 32.37 ? 56  GLU C C   1 
ATOM 2298 O O   . GLU C 1 30  ? 29.773  24.769  27.487  1.00 32.25 ? 56  GLU C O   1 
ATOM 2299 C CB  . GLU C 1 30  ? 31.563  24.427  30.157  1.00 32.85 ? 56  GLU C CB  1 
ATOM 2300 C CG  . GLU C 1 30  ? 33.006  24.622  30.638  1.00 33.55 ? 56  GLU C CG  1 
ATOM 2301 C CD  . GLU C 1 30  ? 33.159  25.746  31.664  1.00 34.23 ? 56  GLU C CD  1 
ATOM 2302 O OE1 . GLU C 1 30  ? 32.283  25.919  32.541  1.00 34.40 ? 56  GLU C OE1 1 
ATOM 2303 O OE2 . GLU C 1 30  ? 34.171  26.462  31.591  1.00 34.23 ? 56  GLU C OE2 1 
ATOM 2304 N N   . GLY C 1 31  ? 31.869  25.484  27.132  1.00 32.35 ? 57  GLY C N   1 
ATOM 2305 C CA  . GLY C 1 31  ? 31.894  25.046  25.748  1.00 32.26 ? 57  GLY C CA  1 
ATOM 2306 C C   . GLY C 1 31  ? 31.533  26.075  24.704  1.00 32.32 ? 57  GLY C C   1 
ATOM 2307 O O   . GLY C 1 31  ? 31.484  27.276  24.967  1.00 32.13 ? 57  GLY C O   1 
ATOM 2308 N N   . TYR C 1 32  ? 31.294  25.581  23.498  1.00 32.71 ? 58  TYR C N   1 
ATOM 2309 C CA  . TYR C 1 32  ? 31.082  26.433  22.347  1.00 33.01 ? 58  TYR C CA  1 
ATOM 2310 C C   . TYR C 1 32  ? 29.607  26.747  22.199  1.00 33.00 ? 58  TYR C C   1 
ATOM 2311 O O   . TYR C 1 32  ? 28.772  25.850  22.131  1.00 32.85 ? 58  TYR C O   1 
ATOM 2312 C CB  . TYR C 1 32  ? 31.680  25.790  21.087  1.00 33.37 ? 58  TYR C CB  1 
ATOM 2313 C CG  . TYR C 1 32  ? 33.186  25.662  21.171  1.00 33.86 ? 58  TYR C CG  1 
ATOM 2314 C CD1 . TYR C 1 32  ? 33.819  24.428  21.059  1.00 35.21 ? 58  TYR C CD1 1 
ATOM 2315 C CD2 . TYR C 1 32  ? 33.974  26.778  21.396  1.00 34.22 ? 58  TYR C CD2 1 
ATOM 2316 C CE1 . TYR C 1 32  ? 35.210  24.323  21.153  1.00 35.31 ? 58  TYR C CE1 1 
ATOM 2317 C CE2 . TYR C 1 32  ? 35.344  26.691  21.496  1.00 34.57 ? 58  TYR C CE2 1 
ATOM 2318 C CZ  . TYR C 1 32  ? 35.962  25.471  21.376  1.00 35.04 ? 58  TYR C CZ  1 
ATOM 2319 O OH  . TYR C 1 32  ? 37.339  25.421  21.477  1.00 35.42 ? 58  TYR C OH  1 
ATOM 2320 N N   . THR C 1 33  ? 29.301  28.036  22.166  1.00 33.17 ? 59  THR C N   1 
ATOM 2321 C CA  . THR C 1 33  ? 27.925  28.508  22.159  1.00 33.54 ? 59  THR C CA  1 
ATOM 2322 C C   . THR C 1 33  ? 27.663  29.436  20.962  1.00 33.82 ? 59  THR C C   1 
ATOM 2323 O O   . THR C 1 33  ? 28.544  29.625  20.124  1.00 33.88 ? 59  THR C O   1 
ATOM 2324 C CB  . THR C 1 33  ? 27.575  29.193  23.510  1.00 33.33 ? 59  THR C CB  1 
ATOM 2325 O OG1 . THR C 1 33  ? 26.183  29.509  23.536  1.00 34.91 ? 59  THR C OG1 1 
ATOM 2326 C CG2 . THR C 1 33  ? 28.366  30.456  23.719  1.00 32.09 ? 59  THR C CG2 1 
ATOM 2327 N N   . GLU C 1 34  ? 26.462  30.007  20.878  1.00 34.07 ? 60  GLU C N   1 
ATOM 2328 C CA  . GLU C 1 34  ? 26.141  30.962  19.816  1.00 34.55 ? 60  GLU C CA  1 
ATOM 2329 C C   . GLU C 1 34  ? 26.864  32.306  19.983  1.00 34.41 ? 60  GLU C C   1 
ATOM 2330 O O   . GLU C 1 34  ? 26.695  33.211  19.171  1.00 34.20 ? 60  GLU C O   1 
ATOM 2331 C CB  . GLU C 1 34  ? 24.629  31.193  19.741  1.00 34.91 ? 60  GLU C CB  1 
ATOM 2332 C CG  . GLU C 1 34  ? 24.045  31.955  20.933  1.00 36.50 ? 60  GLU C CG  1 
ATOM 2333 C CD  . GLU C 1 34  ? 23.414  31.048  21.975  1.00 39.74 ? 60  GLU C CD  1 
ATOM 2334 O OE1 . GLU C 1 34  ? 22.369  31.452  22.553  1.00 41.47 ? 60  GLU C OE1 1 
ATOM 2335 O OE2 . GLU C 1 34  ? 23.944  29.933  22.207  1.00 40.16 ? 60  GLU C OE2 1 
ATOM 2336 N N   . PHE C 1 35  ? 27.651  32.427  21.051  1.00 34.66 ? 61  PHE C N   1 
ATOM 2337 C CA  . PHE C 1 35  ? 28.366  33.652  21.396  1.00 34.45 ? 61  PHE C CA  1 
ATOM 2338 C C   . PHE C 1 35  ? 29.868  33.402  21.349  1.00 34.70 ? 61  PHE C C   1 
ATOM 2339 O O   . PHE C 1 35  ? 30.335  32.404  21.871  1.00 35.14 ? 61  PHE C O   1 
ATOM 2340 C CB  . PHE C 1 35  ? 27.958  34.115  22.789  1.00 34.13 ? 61  PHE C CB  1 
ATOM 2341 C CG  . PHE C 1 35  ? 26.538  34.608  22.882  1.00 34.00 ? 61  PHE C CG  1 
ATOM 2342 C CD1 . PHE C 1 35  ? 25.603  33.922  23.650  1.00 33.59 ? 61  PHE C CD1 1 
ATOM 2343 C CD2 . PHE C 1 35  ? 26.135  35.766  22.212  1.00 33.96 ? 61  PHE C CD2 1 
ATOM 2344 C CE1 . PHE C 1 35  ? 24.291  34.372  23.752  1.00 33.49 ? 61  PHE C CE1 1 
ATOM 2345 C CE2 . PHE C 1 35  ? 24.827  36.225  22.301  1.00 32.87 ? 61  PHE C CE2 1 
ATOM 2346 C CZ  . PHE C 1 35  ? 23.903  35.523  23.077  1.00 34.07 ? 61  PHE C CZ  1 
ATOM 2347 N N   . SER C 1 36  ? 30.623  34.310  20.735  1.00 34.95 ? 62  SER C N   1 
ATOM 2348 C CA  . SER C 1 36  ? 32.047  34.087  20.495  1.00 34.96 ? 62  SER C CA  1 
ATOM 2349 C C   . SER C 1 36  ? 32.924  35.271  20.856  1.00 34.78 ? 62  SER C C   1 
ATOM 2350 O O   . SER C 1 36  ? 32.669  36.401  20.440  1.00 35.02 ? 62  SER C O   1 
ATOM 2351 C CB  . SER C 1 36  ? 32.270  33.723  19.033  1.00 35.04 ? 62  SER C CB  1 
ATOM 2352 O OG  . SER C 1 36  ? 31.269  32.811  18.609  1.00 36.65 ? 62  SER C OG  1 
ATOM 2353 N N   . LEU C 1 37  ? 33.961  34.996  21.633  1.00 34.71 ? 63  LEU C N   1 
ATOM 2354 C CA  . LEU C 1 37  ? 34.999  35.969  21.918  1.00 35.03 ? 63  LEU C CA  1 
ATOM 2355 C C   . LEU C 1 37  ? 36.192  35.624  21.058  1.00 35.40 ? 63  LEU C C   1 
ATOM 2356 O O   . LEU C 1 37  ? 36.597  34.460  21.003  1.00 35.82 ? 63  LEU C O   1 
ATOM 2357 C CB  . LEU C 1 37  ? 35.396  35.914  23.399  1.00 35.05 ? 63  LEU C CB  1 
ATOM 2358 C CG  . LEU C 1 37  ? 36.499  36.848  23.916  1.00 34.77 ? 63  LEU C CG  1 
ATOM 2359 C CD1 . LEU C 1 37  ? 36.132  38.327  23.737  1.00 33.78 ? 63  LEU C CD1 1 
ATOM 2360 C CD2 . LEU C 1 37  ? 36.768  36.550  25.367  1.00 34.55 ? 63  LEU C CD2 1 
ATOM 2361 N N   . ARG C 1 38  ? 36.750  36.611  20.364  1.00 35.60 ? 64  ARG C N   1 
ATOM 2362 C CA  . ARG C 1 38  ? 37.968  36.350  19.598  1.00 36.26 ? 64  ARG C CA  1 
ATOM 2363 C C   . ARG C 1 38  ? 38.807  37.591  19.275  1.00 36.04 ? 64  ARG C C   1 
ATOM 2364 O O   . ARG C 1 38  ? 38.535  38.691  19.768  1.00 36.37 ? 64  ARG C O   1 
ATOM 2365 C CB  . ARG C 1 38  ? 37.688  35.478  18.355  1.00 36.45 ? 64  ARG C CB  1 
ATOM 2366 C CG  . ARG C 1 38  ? 37.215  36.218  17.134  1.00 37.99 ? 64  ARG C CG  1 
ATOM 2367 C CD  . ARG C 1 38  ? 36.672  35.237  16.113  1.00 40.20 ? 64  ARG C CD  1 
ATOM 2368 N NE  . ARG C 1 38  ? 35.222  35.100  16.231  1.00 42.29 ? 64  ARG C NE  1 
ATOM 2369 C CZ  . ARG C 1 38  ? 34.457  34.418  15.383  1.00 43.76 ? 64  ARG C CZ  1 
ATOM 2370 N NH1 . ARG C 1 38  ? 35.005  33.789  14.346  1.00 44.60 ? 64  ARG C NH1 1 
ATOM 2371 N NH2 . ARG C 1 38  ? 33.142  34.361  15.574  1.00 43.39 ? 64  ARG C NH2 1 
ATOM 2372 N N   . VAL C 1 39  ? 39.849  37.384  18.479  1.00 35.65 ? 65  VAL C N   1 
ATOM 2373 C CA  . VAL C 1 39  ? 40.784  38.432  18.144  1.00 35.49 ? 65  VAL C CA  1 
ATOM 2374 C C   . VAL C 1 39  ? 40.910  38.513  16.632  1.00 35.50 ? 65  VAL C C   1 
ATOM 2375 O O   . VAL C 1 39  ? 41.134  37.504  15.961  1.00 34.82 ? 65  VAL C O   1 
ATOM 2376 C CB  . VAL C 1 39  ? 42.162  38.193  18.817  1.00 35.47 ? 65  VAL C CB  1 
ATOM 2377 C CG1 . VAL C 1 39  ? 43.170  39.298  18.436  1.00 35.29 ? 65  VAL C CG1 1 
ATOM 2378 C CG2 . VAL C 1 39  ? 41.999  38.116  20.324  1.00 35.05 ? 65  VAL C CG2 1 
ATOM 2379 N N   . GLU C 1 40  ? 40.758  39.725  16.104  1.00 36.07 ? 66  GLU C N   1 
ATOM 2380 C CA  . GLU C 1 40  ? 40.857  39.953  14.663  1.00 36.57 ? 66  GLU C CA  1 
ATOM 2381 C C   . GLU C 1 40  ? 42.235  39.558  14.156  1.00 37.04 ? 66  GLU C C   1 
ATOM 2382 O O   . GLU C 1 40  ? 43.247  39.878  14.781  1.00 37.27 ? 66  GLU C O   1 
ATOM 2383 C CB  . GLU C 1 40  ? 40.582  41.411  14.327  1.00 36.46 ? 66  GLU C CB  1 
ATOM 2384 C CG  . GLU C 1 40  ? 39.191  41.897  14.657  1.00 35.83 ? 66  GLU C CG  1 
ATOM 2385 C CD  . GLU C 1 40  ? 38.800  43.110  13.827  1.00 36.43 ? 66  GLU C CD  1 
ATOM 2386 O OE1 . GLU C 1 40  ? 39.687  43.719  13.171  1.00 36.18 ? 66  GLU C OE1 1 
ATOM 2387 O OE2 . GLU C 1 40  ? 37.598  43.447  13.816  1.00 36.37 ? 66  GLU C OE2 1 
ATOM 2388 N N   . GLY C 1 41  ? 42.273  38.851  13.034  1.00 37.61 ? 67  GLY C N   1 
ATOM 2389 C CA  . GLY C 1 41  ? 43.531  38.342  12.496  1.00 38.29 ? 67  GLY C CA  1 
ATOM 2390 C C   . GLY C 1 41  ? 43.788  36.921  12.955  1.00 38.94 ? 67  GLY C C   1 
ATOM 2391 O O   . GLY C 1 41  ? 44.566  36.190  12.333  1.00 38.97 ? 67  GLY C O   1 
ATOM 2392 N N   . ASP C 1 42  ? 43.106  36.533  14.034  1.00 39.55 ? 68  ASP C N   1 
ATOM 2393 C CA  . ASP C 1 42  ? 43.288  35.236  14.688  1.00 40.16 ? 68  ASP C CA  1 
ATOM 2394 C C   . ASP C 1 42  ? 44.776  34.906  14.847  1.00 40.20 ? 68  ASP C C   1 
ATOM 2395 O O   . ASP C 1 42  ? 45.300  34.040  14.149  1.00 40.19 ? 68  ASP C O   1 
ATOM 2396 C CB  . ASP C 1 42  ? 42.538  34.132  13.927  1.00 40.50 ? 68  ASP C CB  1 
ATOM 2397 C CG  . ASP C 1 42  ? 42.665  32.758  14.591  1.00 42.06 ? 68  ASP C CG  1 
ATOM 2398 O OD1 . ASP C 1 42  ? 42.953  31.776  13.861  1.00 42.27 ? 68  ASP C OD1 1 
ATOM 2399 O OD2 . ASP C 1 42  ? 42.486  32.659  15.834  1.00 43.64 ? 68  ASP C OD2 1 
ATOM 2400 N N   . PRO C 1 43  ? 45.474  35.631  15.741  1.00 40.26 ? 69  PRO C N   1 
ATOM 2401 C CA  . PRO C 1 43  ? 46.878  35.321  15.978  1.00 40.28 ? 69  PRO C CA  1 
ATOM 2402 C C   . PRO C 1 43  ? 47.027  34.147  16.942  1.00 40.28 ? 69  PRO C C   1 
ATOM 2403 O O   . PRO C 1 43  ? 46.171  33.955  17.816  1.00 40.48 ? 69  PRO C O   1 
ATOM 2404 C CB  . PRO C 1 43  ? 47.411  36.603  16.612  1.00 40.19 ? 69  PRO C CB  1 
ATOM 2405 C CG  . PRO C 1 43  ? 46.251  37.153  17.340  1.00 40.54 ? 69  PRO C CG  1 
ATOM 2406 C CD  . PRO C 1 43  ? 45.023  36.775  16.552  1.00 40.27 ? 69  PRO C CD  1 
ATOM 2407 N N   . ASP C 1 44  ? 48.106  33.383  16.775  1.00 39.93 ? 70  ASP C N   1 
ATOM 2408 C CA  . ASP C 1 44  ? 48.366  32.194  17.583  1.00 39.82 ? 70  ASP C CA  1 
ATOM 2409 C C   . ASP C 1 44  ? 49.090  32.576  18.866  1.00 39.59 ? 70  ASP C C   1 
ATOM 2410 O O   . ASP C 1 44  ? 48.922  31.935  19.908  1.00 39.64 ? 70  ASP C O   1 
ATOM 2411 C CB  . ASP C 1 44  ? 49.208  31.172  16.805  1.00 39.84 ? 70  ASP C CB  1 
ATOM 2412 C CG  . ASP C 1 44  ? 49.093  31.336  15.293  1.00 40.29 ? 70  ASP C CG  1 
ATOM 2413 O OD1 . ASP C 1 44  ? 48.574  30.411  14.628  1.00 40.03 ? 70  ASP C OD1 1 
ATOM 2414 O OD2 . ASP C 1 44  ? 49.523  32.394  14.770  1.00 41.07 ? 70  ASP C OD2 1 
ATOM 2415 N N   . PHE C 1 45  ? 49.904  33.621  18.775  1.00 39.27 ? 71  PHE C N   1 
ATOM 2416 C CA  . PHE C 1 45  ? 50.708  34.086  19.899  1.00 38.91 ? 71  PHE C CA  1 
ATOM 2417 C C   . PHE C 1 45  ? 50.618  35.604  19.994  1.00 38.26 ? 71  PHE C C   1 
ATOM 2418 O O   . PHE C 1 45  ? 50.316  36.265  19.000  1.00 38.29 ? 71  PHE C O   1 
ATOM 2419 C CB  . PHE C 1 45  ? 52.169  33.606  19.766  1.00 39.06 ? 71  PHE C CB  1 
ATOM 2420 C CG  . PHE C 1 45  ? 52.902  34.141  18.548  1.00 39.81 ? 71  PHE C CG  1 
ATOM 2421 C CD1 . PHE C 1 45  ? 53.786  35.220  18.666  1.00 40.60 ? 71  PHE C CD1 1 
ATOM 2422 C CD2 . PHE C 1 45  ? 52.741  33.547  17.292  1.00 40.23 ? 71  PHE C CD2 1 
ATOM 2423 C CE1 . PHE C 1 45  ? 54.482  35.718  17.545  1.00 40.20 ? 71  PHE C CE1 1 
ATOM 2424 C CE2 . PHE C 1 45  ? 53.433  34.036  16.163  1.00 39.98 ? 71  PHE C CE2 1 
ATOM 2425 C CZ  . PHE C 1 45  ? 54.305  35.121  16.297  1.00 39.85 ? 71  PHE C CZ  1 
ATOM 2426 N N   . TYR C 1 46  ? 50.847  36.155  21.184  1.00 37.42 ? 72  TYR C N   1 
ATOM 2427 C CA  . TYR C 1 46  ? 50.887  37.610  21.327  1.00 36.42 ? 72  TYR C CA  1 
ATOM 2428 C C   . TYR C 1 46  ? 52.316  38.133  21.294  1.00 35.78 ? 72  TYR C C   1 
ATOM 2429 O O   . TYR C 1 46  ? 53.264  37.399  21.589  1.00 35.73 ? 72  TYR C O   1 
ATOM 2430 C CB  . TYR C 1 46  ? 50.162  38.089  22.590  1.00 36.38 ? 72  TYR C CB  1 
ATOM 2431 C CG  . TYR C 1 46  ? 50.847  37.752  23.894  1.00 36.16 ? 72  TYR C CG  1 
ATOM 2432 C CD1 . TYR C 1 46  ? 50.379  36.711  24.689  1.00 36.58 ? 72  TYR C CD1 1 
ATOM 2433 C CD2 . TYR C 1 46  ? 51.947  38.487  24.347  1.00 35.75 ? 72  TYR C CD2 1 
ATOM 2434 C CE1 . TYR C 1 46  ? 50.996  36.393  25.902  1.00 37.05 ? 72  TYR C CE1 1 
ATOM 2435 C CE2 . TYR C 1 46  ? 52.577  38.179  25.554  1.00 36.18 ? 72  TYR C CE2 1 
ATOM 2436 C CZ  . TYR C 1 46  ? 52.094  37.129  26.328  1.00 36.86 ? 72  TYR C CZ  1 
ATOM 2437 O OH  . TYR C 1 46  ? 52.700  36.805  27.525  1.00 36.61 ? 72  TYR C OH  1 
ATOM 2438 N N   . LYS C 1 47  ? 52.448  39.405  20.921  1.00 34.94 ? 73  LYS C N   1 
ATOM 2439 C CA  . LYS C 1 47  ? 53.715  40.128  20.941  1.00 34.01 ? 73  LYS C CA  1 
ATOM 2440 C C   . LYS C 1 47  ? 53.569  41.319  21.891  1.00 33.62 ? 73  LYS C C   1 
ATOM 2441 O O   . LYS C 1 47  ? 52.798  42.236  21.618  1.00 33.28 ? 73  LYS C O   1 
ATOM 2442 C CB  . LYS C 1 47  ? 54.097  40.601  19.529  1.00 33.87 ? 73  LYS C CB  1 
ATOM 2443 C CG  . LYS C 1 47  ? 54.359  39.471  18.529  1.00 33.65 ? 73  LYS C CG  1 
ATOM 2444 C CD  . LYS C 1 47  ? 54.239  39.917  17.065  1.00 33.68 ? 73  LYS C CD  1 
ATOM 2445 C CE  . LYS C 1 47  ? 52.774  40.106  16.610  1.00 35.05 ? 73  LYS C CE  1 
ATOM 2446 N NZ  . LYS C 1 47  ? 51.800  38.961  16.860  1.00 34.43 ? 73  LYS C NZ  1 
ATOM 2447 N N   . PRO C 1 48  ? 54.295  41.297  23.025  1.00 33.42 ? 74  PRO C N   1 
ATOM 2448 C CA  . PRO C 1 48  ? 54.253  42.350  24.041  1.00 33.35 ? 74  PRO C CA  1 
ATOM 2449 C C   . PRO C 1 48  ? 54.188  43.771  23.473  1.00 33.36 ? 74  PRO C C   1 
ATOM 2450 O O   . PRO C 1 48  ? 54.885  44.094  22.505  1.00 33.49 ? 74  PRO C O   1 
ATOM 2451 C CB  . PRO C 1 48  ? 55.568  42.141  24.787  1.00 33.25 ? 74  PRO C CB  1 
ATOM 2452 C CG  . PRO C 1 48  ? 55.752  40.675  24.749  1.00 33.15 ? 74  PRO C CG  1 
ATOM 2453 C CD  . PRO C 1 48  ? 55.233  40.224  23.410  1.00 33.34 ? 74  PRO C CD  1 
ATOM 2454 N N   . GLY C 1 49  ? 53.353  44.612  24.072  1.00 33.22 ? 75  GLY C N   1 
ATOM 2455 C CA  . GLY C 1 49  ? 53.198  45.981  23.602  1.00 32.99 ? 75  GLY C CA  1 
ATOM 2456 C C   . GLY C 1 49  ? 52.212  46.113  22.455  1.00 33.02 ? 75  GLY C C   1 
ATOM 2457 O O   . GLY C 1 49  ? 51.568  47.155  22.312  1.00 33.02 ? 75  GLY C O   1 
ATOM 2458 N N   . THR C 1 50  ? 52.085  45.062  21.640  1.00 32.79 ? 76  THR C N   1 
ATOM 2459 C CA  . THR C 1 50  ? 51.170  45.083  20.502  1.00 32.52 ? 76  THR C CA  1 
ATOM 2460 C C   . THR C 1 50  ? 49.746  45.160  20.995  1.00 32.48 ? 76  THR C C   1 
ATOM 2461 O O   . THR C 1 50  ? 49.349  44.438  21.919  1.00 32.66 ? 76  THR C O   1 
ATOM 2462 C CB  . THR C 1 50  ? 51.312  43.853  19.590  1.00 32.45 ? 76  THR C CB  1 
ATOM 2463 O OG1 . THR C 1 50  ? 52.657  43.754  19.120  1.00 32.84 ? 76  THR C OG1 1 
ATOM 2464 C CG2 . THR C 1 50  ? 50.383  43.962  18.388  1.00 32.88 ? 76  THR C CG2 1 
ATOM 2465 N N   . SER C 1 51  ? 48.984  46.057  20.387  1.00 32.31 ? 77  SER C N   1 
ATOM 2466 C CA  . SER C 1 51  ? 47.579  46.160  20.696  1.00 32.29 ? 77  SER C CA  1 
ATOM 2467 C C   . SER C 1 51  ? 46.808  45.317  19.687  1.00 32.14 ? 77  SER C C   1 
ATOM 2468 O O   . SER C 1 51  ? 47.085  45.356  18.489  1.00 32.42 ? 77  SER C O   1 
ATOM 2469 C CB  . SER C 1 51  ? 47.126  47.615  20.682  1.00 32.13 ? 77  SER C CB  1 
ATOM 2470 O OG  . SER C 1 51  ? 47.159  48.116  19.370  1.00 32.70 ? 77  SER C OG  1 
ATOM 2471 N N   . TYR C 1 52  ? 45.856  44.543  20.197  1.00 31.67 ? 78  TYR C N   1 
ATOM 2472 C CA  . TYR C 1 52  ? 45.068  43.618  19.405  1.00 31.09 ? 78  TYR C CA  1 
ATOM 2473 C C   . TYR C 1 52  ? 43.606  44.016  19.518  1.00 30.95 ? 78  TYR C C   1 
ATOM 2474 O O   . TYR C 1 52  ? 43.172  44.502  20.561  1.00 30.94 ? 78  TYR C O   1 
ATOM 2475 C CB  . TYR C 1 52  ? 45.253  42.193  19.936  1.00 30.79 ? 78  TYR C CB  1 
ATOM 2476 C CG  . TYR C 1 52  ? 46.633  41.625  19.715  1.00 30.35 ? 78  TYR C CG  1 
ATOM 2477 C CD1 . TYR C 1 52  ? 47.667  41.850  20.631  1.00 29.70 ? 78  TYR C CD1 1 
ATOM 2478 C CD2 . TYR C 1 52  ? 46.907  40.862  18.586  1.00 30.44 ? 78  TYR C CD2 1 
ATOM 2479 C CE1 . TYR C 1 52  ? 48.943  41.323  20.419  1.00 29.62 ? 78  TYR C CE1 1 
ATOM 2480 C CE2 . TYR C 1 52  ? 48.173  40.336  18.360  1.00 30.60 ? 78  TYR C CE2 1 
ATOM 2481 C CZ  . TYR C 1 52  ? 49.190  40.569  19.275  1.00 30.38 ? 78  TYR C CZ  1 
ATOM 2482 O OH  . TYR C 1 52  ? 50.436  40.029  19.028  1.00 30.12 ? 78  TYR C OH  1 
ATOM 2483 N N   . ARG C 1 53  ? 42.848  43.805  18.450  1.00 30.63 ? 79  ARG C N   1 
ATOM 2484 C CA  . ARG C 1 53  ? 41.434  44.114  18.464  1.00 30.84 ? 79  ARG C CA  1 
ATOM 2485 C C   . ARG C 1 53  ? 40.612  42.907  18.894  1.00 30.75 ? 79  ARG C C   1 
ATOM 2486 O O   . ARG C 1 53  ? 40.526  41.908  18.166  1.00 30.60 ? 79  ARG C O   1 
ATOM 2487 C CB  . ARG C 1 53  ? 40.986  44.591  17.095  1.00 31.01 ? 79  ARG C CB  1 
ATOM 2488 C CG  . ARG C 1 53  ? 39.795  45.498  17.127  1.00 31.76 ? 79  ARG C CG  1 
ATOM 2489 C CD  . ARG C 1 53  ? 39.559  46.032  15.750  1.00 34.17 ? 79  ARG C CD  1 
ATOM 2490 N NE  . ARG C 1 53  ? 38.550  47.078  15.749  1.00 36.35 ? 79  ARG C NE  1 
ATOM 2491 C CZ  . ARG C 1 53  ? 38.776  48.354  15.461  1.00 35.90 ? 79  ARG C CZ  1 
ATOM 2492 N NH1 . ARG C 1 53  ? 39.990  48.773  15.123  1.00 36.09 ? 79  ARG C NH1 1 
ATOM 2493 N NH2 . ARG C 1 53  ? 37.767  49.211  15.497  1.00 36.64 ? 79  ARG C NH2 1 
ATOM 2494 N N   . VAL C 1 54  ? 40.020  43.006  20.083  1.00 30.64 ? 80  VAL C N   1 
ATOM 2495 C CA  . VAL C 1 54  ? 39.171  41.945  20.613  1.00 30.87 ? 80  VAL C CA  1 
ATOM 2496 C C   . VAL C 1 54  ? 37.706  42.181  20.230  1.00 31.10 ? 80  VAL C C   1 
ATOM 2497 O O   . VAL C 1 54  ? 37.182  43.292  20.386  1.00 31.07 ? 80  VAL C O   1 
ATOM 2498 C CB  . VAL C 1 54  ? 39.292  41.812  22.149  1.00 30.71 ? 80  VAL C CB  1 
ATOM 2499 C CG1 . VAL C 1 54  ? 38.537  40.590  22.621  1.00 30.97 ? 80  VAL C CG1 1 
ATOM 2500 C CG2 . VAL C 1 54  ? 40.737  41.692  22.570  1.00 30.37 ? 80  VAL C CG2 1 
ATOM 2501 N N   . THR C 1 55  ? 37.044  41.143  19.724  1.00 31.23 ? 81  THR C N   1 
ATOM 2502 C CA  . THR C 1 55  ? 35.616  41.270  19.423  1.00 31.46 ? 81  THR C CA  1 
ATOM 2503 C C   . THR C 1 55  ? 34.762  40.241  20.131  1.00 31.52 ? 81  THR C C   1 
ATOM 2504 O O   . THR C 1 55  ? 35.166  39.097  20.316  1.00 32.14 ? 81  THR C O   1 
ATOM 2505 C CB  . THR C 1 55  ? 35.311  41.199  17.926  1.00 31.24 ? 81  THR C CB  1 
ATOM 2506 O OG1 . THR C 1 55  ? 35.412  39.837  17.500  1.00 32.24 ? 81  THR C OG1 1 
ATOM 2507 C CG2 . THR C 1 55  ? 36.267  42.098  17.121  1.00 29.88 ? 81  THR C CG2 1 
ATOM 2508 N N   . LEU C 1 56  ? 33.573  40.664  20.527  1.00 31.65 ? 82  LEU C N   1 
ATOM 2509 C CA  . LEU C 1 56  ? 32.598  39.773  21.107  1.00 31.70 ? 82  LEU C CA  1 
ATOM 2510 C C   . LEU C 1 56  ? 31.372  39.872  20.227  1.00 31.77 ? 82  LEU C C   1 
ATOM 2511 O O   . LEU C 1 56  ? 30.881  40.976  19.984  1.00 31.83 ? 82  LEU C O   1 
ATOM 2512 C CB  . LEU C 1 56  ? 32.291  40.204  22.539  1.00 32.00 ? 82  LEU C CB  1 
ATOM 2513 C CG  . LEU C 1 56  ? 31.486  39.283  23.454  1.00 31.90 ? 82  LEU C CG  1 
ATOM 2514 C CD1 . LEU C 1 56  ? 32.016  37.846  23.404  1.00 32.99 ? 82  LEU C CD1 1 
ATOM 2515 C CD2 . LEU C 1 56  ? 31.562  39.832  24.860  1.00 31.42 ? 82  LEU C CD2 1 
ATOM 2516 N N   . SER C 1 57  ? 30.899  38.733  19.720  1.00 31.94 ? 83  SER C N   1 
ATOM 2517 C CA  . SER C 1 57  ? 29.821  38.744  18.734  1.00 32.21 ? 83  SER C CA  1 
ATOM 2518 C C   . SER C 1 57  ? 28.855  37.567  18.804  1.00 32.54 ? 83  SER C C   1 
ATOM 2519 O O   . SER C 1 57  ? 29.186  36.504  19.337  1.00 32.66 ? 83  SER C O   1 
ATOM 2520 C CB  . SER C 1 57  ? 30.395  38.879  17.323  1.00 32.23 ? 83  SER C CB  1 
ATOM 2521 O OG  . SER C 1 57  ? 31.279  37.822  17.031  1.00 32.39 ? 83  SER C OG  1 
ATOM 2522 N N   . ALA C 1 58  ? 27.664  37.778  18.241  1.00 32.85 ? 84  ALA C N   1 
ATOM 2523 C CA  . ALA C 1 58  ? 26.550  36.830  18.306  1.00 32.97 ? 84  ALA C CA  1 
ATOM 2524 C C   . ALA C 1 58  ? 26.184  36.321  16.932  1.00 33.15 ? 84  ALA C C   1 
ATOM 2525 O O   . ALA C 1 58  ? 25.920  37.108  16.037  1.00 33.37 ? 84  ALA C O   1 
ATOM 2526 C CB  . ALA C 1 58  ? 25.338  37.494  18.933  1.00 32.85 ? 84  ALA C CB  1 
ATOM 2527 N N   . ALA C 1 59  ? 26.124  35.003  16.785  1.00 33.64 ? 85  ALA C N   1 
ATOM 2528 C CA  . ALA C 1 59  ? 25.838  34.355  15.503  1.00 34.24 ? 85  ALA C CA  1 
ATOM 2529 C C   . ALA C 1 59  ? 24.498  34.804  14.883  1.00 34.60 ? 85  ALA C C   1 
ATOM 2530 O O   . ALA C 1 59  ? 23.573  35.161  15.610  1.00 34.61 ? 85  ALA C O   1 
ATOM 2531 C CB  . ALA C 1 59  ? 25.889  32.831  15.670  1.00 34.11 ? 85  ALA C CB  1 
ATOM 2532 N N   . PRO C 1 60  ? 24.395  34.776  13.537  1.00 35.08 ? 86  PRO C N   1 
ATOM 2533 C CA  . PRO C 1 60  ? 23.256  35.252  12.731  1.00 35.43 ? 86  PRO C CA  1 
ATOM 2534 C C   . PRO C 1 60  ? 21.874  35.426  13.419  1.00 35.59 ? 86  PRO C C   1 
ATOM 2535 O O   . PRO C 1 60  ? 21.339  36.540  13.393  1.00 35.84 ? 86  PRO C O   1 
ATOM 2536 C CB  . PRO C 1 60  ? 23.215  34.254  11.561  1.00 35.35 ? 86  PRO C CB  1 
ATOM 2537 C CG  . PRO C 1 60  ? 24.658  33.778  11.408  1.00 35.23 ? 86  PRO C CG  1 
ATOM 2538 C CD  . PRO C 1 60  ? 25.444  34.235  12.652  1.00 35.28 ? 86  PRO C CD  1 
ATOM 2539 N N   . PRO C 1 61  ? 21.286  34.359  14.009  1.00 35.56 ? 87  PRO C N   1 
ATOM 2540 C CA  . PRO C 1 61  ? 20.021  34.643  14.715  1.00 35.44 ? 87  PRO C CA  1 
ATOM 2541 C C   . PRO C 1 61  ? 20.196  35.431  16.027  1.00 35.41 ? 87  PRO C C   1 
ATOM 2542 O O   . PRO C 1 61  ? 19.534  36.452  16.215  1.00 35.56 ? 87  PRO C O   1 
ATOM 2543 C CB  . PRO C 1 61  ? 19.430  33.247  14.992  1.00 35.27 ? 87  PRO C CB  1 
ATOM 2544 C CG  . PRO C 1 61  ? 20.290  32.273  14.228  1.00 35.68 ? 87  PRO C CG  1 
ATOM 2545 C CD  . PRO C 1 61  ? 21.633  32.928  14.066  1.00 35.60 ? 87  PRO C CD  1 
ATOM 2546 N N   . SER C 1 62  ? 21.087  34.976  16.907  1.00 35.20 ? 88  SER C N   1 
ATOM 2547 C CA  . SER C 1 62  ? 21.204  35.532  18.261  1.00 35.06 ? 88  SER C CA  1 
ATOM 2548 C C   . SER C 1 62  ? 21.688  36.977  18.348  1.00 34.90 ? 88  SER C C   1 
ATOM 2549 O O   . SER C 1 62  ? 22.282  37.509  17.412  1.00 35.16 ? 88  SER C O   1 
ATOM 2550 C CB  . SER C 1 62  ? 22.109  34.647  19.120  1.00 35.17 ? 88  SER C CB  1 
ATOM 2551 O OG  . SER C 1 62  ? 21.375  33.606  19.732  1.00 35.51 ? 88  SER C OG  1 
ATOM 2552 N N   . TYR C 1 63  ? 21.413  37.600  19.489  1.00 34.61 ? 89  TYR C N   1 
ATOM 2553 C CA  . TYR C 1 63  ? 21.938  38.917  19.840  1.00 34.57 ? 89  TYR C CA  1 
ATOM 2554 C C   . TYR C 1 63  ? 22.241  38.906  21.337  1.00 34.55 ? 89  TYR C C   1 
ATOM 2555 O O   . TYR C 1 63  ? 22.000  37.908  22.006  1.00 34.69 ? 89  TYR C O   1 
ATOM 2556 C CB  . TYR C 1 63  ? 20.912  40.014  19.507  1.00 34.47 ? 89  TYR C CB  1 
ATOM 2557 C CG  . TYR C 1 63  ? 19.593  39.844  20.223  1.00 34.68 ? 89  TYR C CG  1 
ATOM 2558 C CD1 . TYR C 1 63  ? 18.554  39.107  19.652  1.00 34.82 ? 89  TYR C CD1 1 
ATOM 2559 C CD2 . TYR C 1 63  ? 19.388  40.397  21.488  1.00 35.28 ? 89  TYR C CD2 1 
ATOM 2560 C CE1 . TYR C 1 63  ? 17.339  38.935  20.317  1.00 33.76 ? 89  TYR C CE1 1 
ATOM 2561 C CE2 . TYR C 1 63  ? 18.177  40.230  22.158  1.00 34.72 ? 89  TYR C CE2 1 
ATOM 2562 C CZ  . TYR C 1 63  ? 17.162  39.500  21.565  1.00 34.11 ? 89  TYR C CZ  1 
ATOM 2563 O OH  . TYR C 1 63  ? 15.971  39.337  22.235  1.00 34.79 ? 89  TYR C OH  1 
ATOM 2564 N N   . PHE C 1 64  ? 22.751  40.014  21.867  1.00 34.61 ? 90  PHE C N   1 
ATOM 2565 C CA  . PHE C 1 64  ? 22.856  40.184  23.324  1.00 34.40 ? 90  PHE C CA  1 
ATOM 2566 C C   . PHE C 1 64  ? 22.593  41.625  23.778  1.00 34.68 ? 90  PHE C C   1 
ATOM 2567 O O   . PHE C 1 64  ? 22.546  42.545  22.952  1.00 34.82 ? 90  PHE C O   1 
ATOM 2568 C CB  . PHE C 1 64  ? 24.184  39.632  23.869  1.00 34.05 ? 90  PHE C CB  1 
ATOM 2569 C CG  . PHE C 1 64  ? 25.414  40.403  23.441  1.00 33.20 ? 90  PHE C CG  1 
ATOM 2570 C CD1 . PHE C 1 64  ? 26.013  41.315  24.308  1.00 32.75 ? 90  PHE C CD1 1 
ATOM 2571 C CD2 . PHE C 1 64  ? 26.000  40.180  22.202  1.00 32.15 ? 90  PHE C CD2 1 
ATOM 2572 C CE1 . PHE C 1 64  ? 27.162  42.016  23.934  1.00 32.22 ? 90  PHE C CE1 1 
ATOM 2573 C CE2 . PHE C 1 64  ? 27.147  40.879  21.815  1.00 32.73 ? 90  PHE C CE2 1 
ATOM 2574 C CZ  . PHE C 1 64  ? 27.730  41.799  22.683  1.00 32.05 ? 90  PHE C CZ  1 
ATOM 2575 N N   . ARG C 1 65  ? 22.401  41.817  25.084  1.00 34.58 ? 91  ARG C N   1 
ATOM 2576 C CA  . ARG C 1 65  ? 22.136  43.151  25.624  1.00 34.64 ? 91  ARG C CA  1 
ATOM 2577 C C   . ARG C 1 65  ? 23.214  43.657  26.578  1.00 34.52 ? 91  ARG C C   1 
ATOM 2578 O O   . ARG C 1 65  ? 23.224  44.828  26.940  1.00 34.53 ? 91  ARG C O   1 
ATOM 2579 C CB  . ARG C 1 65  ? 20.765  43.203  26.312  1.00 34.68 ? 91  ARG C CB  1 
ATOM 2580 C CG  . ARG C 1 65  ? 19.585  42.970  25.385  1.00 34.91 ? 91  ARG C CG  1 
ATOM 2581 C CD  . ARG C 1 65  ? 18.286  43.208  26.114  1.00 35.87 ? 91  ARG C CD  1 
ATOM 2582 N NE  . ARG C 1 65  ? 17.313  42.152  25.842  1.00 36.92 ? 91  ARG C NE  1 
ATOM 2583 C CZ  . ARG C 1 65  ? 16.374  42.219  24.901  1.00 38.07 ? 91  ARG C CZ  1 
ATOM 2584 N NH1 . ARG C 1 65  ? 15.532  41.202  24.736  1.00 37.27 ? 91  ARG C NH1 1 
ATOM 2585 N NH2 . ARG C 1 65  ? 16.272  43.301  24.125  1.00 38.42 ? 91  ARG C NH2 1 
ATOM 2586 N N   . GLY C 1 66  ? 24.115  42.778  26.991  1.00 34.68 ? 92  GLY C N   1 
ATOM 2587 C CA  . GLY C 1 66  ? 25.151  43.149  27.942  1.00 34.94 ? 92  GLY C CA  1 
ATOM 2588 C C   . GLY C 1 66  ? 26.218  42.083  28.030  1.00 35.52 ? 92  GLY C C   1 
ATOM 2589 O O   . GLY C 1 66  ? 25.990  40.932  27.638  1.00 35.37 ? 92  GLY C O   1 
ATOM 2590 N N   . PHE C 1 67  ? 27.384  42.470  28.548  1.00 35.90 ? 93  PHE C N   1 
ATOM 2591 C CA  . PHE C 1 67  ? 28.539  41.578  28.625  1.00 36.23 ? 93  PHE C CA  1 
ATOM 2592 C C   . PHE C 1 67  ? 29.528  42.081  29.659  1.00 36.51 ? 93  PHE C C   1 
ATOM 2593 O O   . PHE C 1 67  ? 29.413  43.213  30.126  1.00 36.57 ? 93  PHE C O   1 
ATOM 2594 C CB  . PHE C 1 67  ? 29.238  41.511  27.264  1.00 36.10 ? 93  PHE C CB  1 
ATOM 2595 C CG  . PHE C 1 67  ? 30.055  42.741  26.942  1.00 37.00 ? 93  PHE C CG  1 
ATOM 2596 C CD1 . PHE C 1 67  ? 31.424  42.769  27.192  1.00 36.66 ? 93  PHE C CD1 1 
ATOM 2597 C CD2 . PHE C 1 67  ? 29.448  43.880  26.410  1.00 36.37 ? 93  PHE C CD2 1 
ATOM 2598 C CE1 . PHE C 1 67  ? 32.165  43.892  26.903  1.00 37.09 ? 93  PHE C CE1 1 
ATOM 2599 C CE2 . PHE C 1 67  ? 30.190  45.010  26.117  1.00 35.78 ? 93  PHE C CE2 1 
ATOM 2600 C CZ  . PHE C 1 67  ? 31.545  45.022  26.368  1.00 36.76 ? 93  PHE C CZ  1 
ATOM 2601 N N   . THR C 1 68  ? 30.493  41.235  30.012  1.00 37.09 ? 94  THR C N   1 
ATOM 2602 C CA  . THR C 1 68  ? 31.718  41.678  30.686  1.00 38.02 ? 94  THR C CA  1 
ATOM 2603 C C   . THR C 1 68  ? 32.917  41.067  29.974  1.00 38.65 ? 94  THR C C   1 
ATOM 2604 O O   . THR C 1 68  ? 32.783  40.080  29.250  1.00 38.59 ? 94  THR C O   1 
ATOM 2605 C CB  . THR C 1 68  ? 31.786  41.294  32.182  1.00 37.92 ? 94  THR C CB  1 
ATOM 2606 O OG1 . THR C 1 68  ? 31.883  39.866  32.323  1.00 38.17 ? 94  THR C OG1 1 
ATOM 2607 C CG2 . THR C 1 68  ? 30.576  41.824  32.941  1.00 38.03 ? 94  THR C CG2 1 
ATOM 2608 N N   . LEU C 1 69  ? 34.089  41.654  30.195  1.00 39.48 ? 95  LEU C N   1 
ATOM 2609 C CA  . LEU C 1 69  ? 35.313  41.203  29.553  1.00 40.10 ? 95  LEU C CA  1 
ATOM 2610 C C   . LEU C 1 69  ? 36.500  41.488  30.456  1.00 40.70 ? 95  LEU C C   1 
ATOM 2611 O O   . LEU C 1 69  ? 36.661  42.606  30.945  1.00 40.80 ? 95  LEU C O   1 
ATOM 2612 C CB  . LEU C 1 69  ? 35.485  41.902  28.200  1.00 40.13 ? 95  LEU C CB  1 
ATOM 2613 C CG  . LEU C 1 69  ? 36.613  41.495  27.249  1.00 40.45 ? 95  LEU C CG  1 
ATOM 2614 C CD1 . LEU C 1 69  ? 36.648  39.986  27.041  1.00 41.65 ? 95  LEU C CD1 1 
ATOM 2615 C CD2 . LEU C 1 69  ? 36.469  42.209  25.916  1.00 39.89 ? 95  LEU C CD2 1 
ATOM 2616 N N   . ILE C 1 70  ? 37.316  40.464  30.693  1.00 41.39 ? 96  ILE C N   1 
ATOM 2617 C CA  . ILE C 1 70  ? 38.553  40.618  31.456  1.00 41.93 ? 96  ILE C CA  1 
ATOM 2618 C C   . ILE C 1 70  ? 39.697  39.893  30.759  1.00 42.49 ? 96  ILE C C   1 
ATOM 2619 O O   . ILE C 1 70  ? 39.459  39.028  29.904  1.00 42.65 ? 96  ILE C O   1 
ATOM 2620 C CB  . ILE C 1 70  ? 38.425  40.066  32.887  1.00 41.79 ? 96  ILE C CB  1 
ATOM 2621 C CG1 . ILE C 1 70  ? 37.873  38.638  32.872  1.00 42.06 ? 96  ILE C CG1 1 
ATOM 2622 C CG2 . ILE C 1 70  ? 37.562  40.974  33.733  1.00 42.06 ? 96  ILE C CG2 1 
ATOM 2623 C CD1 . ILE C 1 70  ? 38.192  37.838  34.126  1.00 41.53 ? 96  ILE C CD1 1 
ATOM 2624 N N   . ALA C 1 71  ? 40.929  40.251  31.125  1.00 42.89 ? 97  ALA C N   1 
ATOM 2625 C CA  . ALA C 1 71  ? 42.115  39.506  30.698  1.00 43.39 ? 97  ALA C CA  1 
ATOM 2626 C C   . ALA C 1 71  ? 42.844  38.917  31.911  1.00 43.68 ? 97  ALA C C   1 
ATOM 2627 O O   . ALA C 1 71  ? 43.068  39.608  32.899  1.00 43.71 ? 97  ALA C O   1 
ATOM 2628 C CB  . ALA C 1 71  ? 43.036  40.391  29.885  1.00 43.32 ? 97  ALA C CB  1 
ATOM 2629 N N   . LEU C 1 72  ? 43.202  37.637  31.824  1.00 44.16 ? 98  LEU C N   1 
ATOM 2630 C CA  . LEU C 1 72  ? 43.748  36.886  32.961  1.00 44.56 ? 98  LEU C CA  1 
ATOM 2631 C C   . LEU C 1 72  ? 44.929  36.005  32.578  1.00 44.86 ? 98  LEU C C   1 
ATOM 2632 O O   . LEU C 1 72  ? 44.919  35.383  31.518  1.00 45.19 ? 98  LEU C O   1 
ATOM 2633 C CB  . LEU C 1 72  ? 42.669  35.978  33.547  1.00 44.53 ? 98  LEU C CB  1 
ATOM 2634 C CG  . LEU C 1 72  ? 41.670  36.514  34.564  1.00 44.64 ? 98  LEU C CG  1 
ATOM 2635 C CD1 . LEU C 1 72  ? 40.745  35.382  34.987  1.00 44.17 ? 98  LEU C CD1 1 
ATOM 2636 C CD2 . LEU C 1 72  ? 42.389  37.103  35.770  1.00 44.52 ? 98  LEU C CD2 1 
ATOM 2637 N N   . ARG C 1 73  ? 45.925  35.921  33.456  1.00 45.08 ? 99  ARG C N   1 
ATOM 2638 C CA  . ARG C 1 73  ? 47.074  35.042  33.227  1.00 45.31 ? 99  ARG C CA  1 
ATOM 2639 C C   . ARG C 1 73  ? 46.718  33.586  33.541  1.00 45.39 ? 99  ARG C C   1 
ATOM 2640 O O   . ARG C 1 73  ? 45.863  33.325  34.392  1.00 45.42 ? 99  ARG C O   1 
ATOM 2641 C CB  . ARG C 1 73  ? 48.270  35.488  34.064  1.00 45.30 ? 99  ARG C CB  1 
ATOM 2642 C CG  . ARG C 1 73  ? 49.604  35.298  33.362  1.00 45.54 ? 99  ARG C CG  1 
ATOM 2643 C CD  . ARG C 1 73  ? 50.780  35.585  34.283  1.00 46.37 ? 99  ARG C CD  1 
ATOM 2644 N NE  . ARG C 1 73  ? 50.684  36.892  34.932  1.00 46.76 ? 99  ARG C NE  1 
ATOM 2645 C CZ  . ARG C 1 73  ? 50.570  37.075  36.245  1.00 46.65 ? 99  ARG C CZ  1 
ATOM 2646 N NH1 . ARG C 1 73  ? 50.486  38.304  36.739  1.00 46.67 ? 99  ARG C NH1 1 
ATOM 2647 N NH2 . ARG C 1 73  ? 50.549  36.035  37.068  1.00 46.61 ? 99  ARG C NH2 1 
ATOM 2648 N N   . GLU C 1 74  ? 47.377  32.647  32.857  1.00 45.44 ? 100 GLU C N   1 
ATOM 2649 C CA  . GLU C 1 74  ? 47.042  31.222  32.968  1.00 45.48 ? 100 GLU C CA  1 
ATOM 2650 C C   . GLU C 1 74  ? 47.303  30.631  34.351  1.00 45.60 ? 100 GLU C C   1 
ATOM 2651 O O   . GLU C 1 74  ? 48.249  31.026  35.039  1.00 45.60 ? 100 GLU C O   1 
ATOM 2652 C CB  . GLU C 1 74  ? 47.745  30.391  31.887  1.00 45.42 ? 100 GLU C CB  1 
ATOM 2653 C CG  . GLU C 1 74  ? 47.121  29.009  31.683  1.00 45.15 ? 100 GLU C CG  1 
ATOM 2654 C CD  . GLU C 1 74  ? 47.313  28.454  30.285  1.00 45.01 ? 100 GLU C CD  1 
ATOM 2655 O OE1 . GLU C 1 74  ? 48.459  28.088  29.932  1.00 44.46 ? 100 GLU C OE1 1 
ATOM 2656 O OE2 . GLU C 1 74  ? 46.305  28.366  29.547  1.00 44.66 ? 100 GLU C OE2 1 
ATOM 2657 N N   . ASN C 1 75  ? 46.438  29.688  34.733  1.00 45.77 ? 101 ASN C N   1 
ATOM 2658 C CA  . ASN C 1 75  ? 46.477  28.989  36.027  1.00 45.93 ? 101 ASN C CA  1 
ATOM 2659 C C   . ASN C 1 75  ? 46.244  29.894  37.240  1.00 46.02 ? 101 ASN C C   1 
ATOM 2660 O O   . ASN C 1 75  ? 46.110  29.416  38.372  1.00 46.03 ? 101 ASN C O   1 
ATOM 2661 C CB  . ASN C 1 75  ? 47.758  28.144  36.179  1.00 45.93 ? 101 ASN C CB  1 
ATOM 2662 C CG  . ASN C 1 75  ? 47.746  26.884  35.310  1.00 45.90 ? 101 ASN C CG  1 
ATOM 2663 O OD1 . ASN C 1 75  ? 47.201  26.875  34.206  1.00 45.75 ? 101 ASN C OD1 1 
ATOM 2664 N ND2 . ASN C 1 75  ? 48.359  25.817  35.812  1.00 45.86 ? 101 ASN C ND2 1 
ATOM 2665 N N   . ARG C 1 76  ? 46.191  31.200  36.983  1.00 46.10 ? 102 ARG C N   1 
ATOM 2666 C CA  . ARG C 1 76  ? 45.840  32.194  37.987  1.00 46.24 ? 102 ARG C CA  1 
ATOM 2667 C C   . ARG C 1 76  ? 44.327  32.322  38.015  1.00 46.46 ? 102 ARG C C   1 
ATOM 2668 O O   . ARG C 1 76  ? 43.687  32.407  36.964  1.00 46.48 ? 102 ARG C O   1 
ATOM 2669 C CB  . ARG C 1 76  ? 46.475  33.543  37.647  1.00 46.14 ? 102 ARG C CB  1 
ATOM 2670 C CG  . ARG C 1 76  ? 48.001  33.522  37.532  1.00 46.11 ? 102 ARG C CG  1 
ATOM 2671 C CD  . ARG C 1 76  ? 48.695  33.998  38.806  1.00 45.96 ? 102 ARG C CD  1 
ATOM 2672 N NE  . ARG C 1 76  ? 48.577  33.057  39.918  1.00 46.13 ? 102 ARG C NE  1 
ATOM 2673 C CZ  . ARG C 1 76  ? 49.247  33.160  41.063  1.00 46.17 ? 102 ARG C CZ  1 
ATOM 2674 N NH1 . ARG C 1 76  ? 50.098  34.160  41.260  1.00 46.17 ? 102 ARG C NH1 1 
ATOM 2675 N NH2 . ARG C 1 76  ? 49.071  32.256  42.015  1.00 46.43 ? 102 ARG C NH2 1 
ATOM 2676 N N   . GLU C 1 77  ? 43.755  32.322  39.217  1.00 46.83 ? 103 GLU C N   1 
ATOM 2677 C CA  . GLU C 1 77  ? 42.300  32.372  39.377  1.00 47.19 ? 103 GLU C CA  1 
ATOM 2678 C C   . GLU C 1 77  ? 41.737  33.764  39.081  1.00 47.38 ? 103 GLU C C   1 
ATOM 2679 O O   . GLU C 1 77  ? 40.645  33.897  38.518  1.00 47.37 ? 103 GLU C O   1 
ATOM 2680 C CB  . GLU C 1 77  ? 41.888  31.928  40.785  1.00 47.12 ? 103 GLU C CB  1 
ATOM 2681 C CG  . GLU C 1 77  ? 40.419  31.514  40.888  1.00 47.33 ? 103 GLU C CG  1 
ATOM 2682 C CD  . GLU C 1 77  ? 39.860  31.593  42.303  1.00 47.55 ? 103 GLU C CD  1 
ATOM 2683 O OE1 . GLU C 1 77  ? 40.613  31.344  43.275  1.00 47.54 ? 103 GLU C OE1 1 
ATOM 2684 O OE2 . GLU C 1 77  ? 38.655  31.899  42.436  1.00 47.21 ? 103 GLU C OE2 1 
ATOM 2685 N N   . GLY C 1 78  ? 42.496  34.790  39.456  1.00 47.57 ? 104 GLY C N   1 
ATOM 2686 C CA  . GLY C 1 78  ? 42.014  36.164  39.422  1.00 47.78 ? 104 GLY C CA  1 
ATOM 2687 C C   . GLY C 1 78  ? 41.196  36.488  40.661  1.00 48.00 ? 104 GLY C C   1 
ATOM 2688 O O   . GLY C 1 78  ? 40.280  37.309  40.605  1.00 48.20 ? 104 GLY C O   1 
ATOM 2689 N N   . ASP C 1 79  ? 41.530  35.839  41.779  1.00 47.95 ? 105 ASP C N   1 
ATOM 2690 C CA  . ASP C 1 79  ? 40.835  36.055  43.048  1.00 47.90 ? 105 ASP C CA  1 
ATOM 2691 C C   . ASP C 1 79  ? 41.237  37.391  43.685  1.00 47.84 ? 105 ASP C C   1 
ATOM 2692 O O   . ASP C 1 79  ? 42.079  37.432  44.591  1.00 47.77 ? 105 ASP C O   1 
ATOM 2693 C CB  . ASP C 1 79  ? 41.092  34.885  44.009  1.00 47.95 ? 105 ASP C CB  1 
ATOM 2694 N N   . LYS C 1 80  ? 40.625  38.473  43.195  1.00 47.65 ? 106 LYS C N   1 
ATOM 2695 C CA  . LYS C 1 80  ? 40.916  39.847  43.637  1.00 47.43 ? 106 LYS C CA  1 
ATOM 2696 C C   . LYS C 1 80  ? 42.413  40.179  43.553  1.00 47.22 ? 106 LYS C C   1 
ATOM 2697 O O   . LYS C 1 80  ? 42.964  40.888  44.408  1.00 47.26 ? 106 LYS C O   1 
ATOM 2698 C CB  . LYS C 1 80  ? 40.364  40.099  45.054  1.00 47.46 ? 106 LYS C CB  1 
ATOM 2699 N N   . GLU C 1 81  ? 43.055  39.661  42.507  1.00 46.80 ? 107 GLU C N   1 
ATOM 2700 C CA  . GLU C 1 81  ? 44.497  39.786  42.335  1.00 46.43 ? 107 GLU C CA  1 
ATOM 2701 C C   . GLU C 1 81  ? 44.866  40.610  41.102  1.00 46.09 ? 107 GLU C C   1 
ATOM 2702 O O   . GLU C 1 81  ? 44.010  40.933  40.278  1.00 45.91 ? 107 GLU C O   1 
ATOM 2703 C CB  . GLU C 1 81  ? 45.140  38.407  42.275  1.00 46.51 ? 107 GLU C CB  1 
ATOM 2704 N N   . GLU C 1 82  ? 46.151  40.947  40.998  1.00 45.76 ? 108 GLU C N   1 
ATOM 2705 C CA  . GLU C 1 82  ? 46.687  41.763  39.906  1.00 45.33 ? 108 GLU C CA  1 
ATOM 2706 C C   . GLU C 1 82  ? 47.209  40.904  38.751  1.00 45.08 ? 108 GLU C C   1 
ATOM 2707 O O   . GLU C 1 82  ? 47.950  41.384  37.889  1.00 45.17 ? 108 GLU C O   1 
ATOM 2708 C CB  . GLU C 1 82  ? 47.788  42.697  40.429  1.00 45.25 ? 108 GLU C CB  1 
ATOM 2709 C CG  . GLU C 1 82  ? 49.039  41.996  40.971  1.00 45.25 ? 108 GLU C CG  1 
ATOM 2710 C CD  . GLU C 1 82  ? 48.913  41.560  42.427  1.00 45.20 ? 108 GLU C CD  1 
ATOM 2711 O OE1 . GLU C 1 82  ? 49.660  42.095  43.273  1.00 44.74 ? 108 GLU C OE1 1 
ATOM 2712 O OE2 . GLU C 1 82  ? 48.074  40.684  42.728  1.00 45.37 ? 108 GLU C OE2 1 
ATOM 2713 N N   . ASP C 1 83  ? 46.801  39.636  38.736  1.00 44.65 ? 109 ASP C N   1 
ATOM 2714 C CA  . ASP C 1 83  ? 47.220  38.680  37.710  1.00 44.17 ? 109 ASP C CA  1 
ATOM 2715 C C   . ASP C 1 83  ? 46.515  38.892  36.363  1.00 43.72 ? 109 ASP C C   1 
ATOM 2716 O O   . ASP C 1 83  ? 46.324  37.943  35.592  1.00 43.73 ? 109 ASP C O   1 
ATOM 2717 C CB  . ASP C 1 83  ? 47.019  37.245  38.214  1.00 44.23 ? 109 ASP C CB  1 
ATOM 2718 C CG  . ASP C 1 83  ? 45.676  37.044  38.898  1.00 44.67 ? 109 ASP C CG  1 
ATOM 2719 O OD1 . ASP C 1 83  ? 44.698  37.730  38.527  1.00 45.12 ? 109 ASP C OD1 1 
ATOM 2720 O OD2 . ASP C 1 83  ? 45.598  36.193  39.809  1.00 45.03 ? 109 ASP C OD2 1 
ATOM 2721 N N   . HIS C 1 84  ? 46.139  40.143  36.091  1.00 43.07 ? 110 HIS C N   1 
ATOM 2722 C CA  . HIS C 1 84  ? 45.482  40.522  34.840  1.00 42.37 ? 110 HIS C CA  1 
ATOM 2723 C C   . HIS C 1 84  ? 46.511  40.991  33.812  1.00 41.84 ? 110 HIS C C   1 
ATOM 2724 O O   . HIS C 1 84  ? 47.082  42.083  33.932  1.00 41.80 ? 110 HIS C O   1 
ATOM 2725 C CB  . HIS C 1 84  ? 44.431  41.613  35.084  1.00 42.42 ? 110 HIS C CB  1 
ATOM 2726 C CG  . HIS C 1 84  ? 43.297  41.180  35.961  1.00 42.38 ? 110 HIS C CG  1 
ATOM 2727 N ND1 . HIS C 1 84  ? 42.046  40.877  35.465  1.00 42.23 ? 110 HIS C ND1 1 
ATOM 2728 C CD2 . HIS C 1 84  ? 43.225  40.999  37.301  1.00 42.18 ? 110 HIS C CD2 1 
ATOM 2729 C CE1 . HIS C 1 84  ? 41.253  40.528  36.463  1.00 42.40 ? 110 HIS C CE1 1 
ATOM 2730 N NE2 . HIS C 1 84  ? 41.944  40.594  37.588  1.00 42.18 ? 110 HIS C NE2 1 
ATOM 2731 N N   . ALA C 1 85  ? 46.748  40.152  32.810  1.00 41.05 ? 111 ALA C N   1 
ATOM 2732 C CA  . ALA C 1 85  ? 47.735  40.443  31.780  1.00 40.40 ? 111 ALA C CA  1 
ATOM 2733 C C   . ALA C 1 85  ? 47.246  41.540  30.842  1.00 39.92 ? 111 ALA C C   1 
ATOM 2734 O O   . ALA C 1 85  ? 46.065  41.601  30.497  1.00 39.96 ? 111 ALA C O   1 
ATOM 2735 C CB  . ALA C 1 85  ? 48.076  39.191  31.009  1.00 40.34 ? 111 ALA C CB  1 
ATOM 2736 N N   . GLY C 1 86  ? 48.164  42.414  30.448  1.00 39.33 ? 112 GLY C N   1 
ATOM 2737 C CA  . GLY C 1 86  ? 47.849  43.519  29.559  1.00 38.53 ? 112 GLY C CA  1 
ATOM 2738 C C   . GLY C 1 86  ? 46.878  44.522  30.143  1.00 37.99 ? 112 GLY C C   1 
ATOM 2739 O O   . GLY C 1 86  ? 46.557  44.475  31.330  1.00 37.96 ? 112 GLY C O   1 
ATOM 2740 N N   . THR C 1 87  ? 46.420  45.434  29.290  1.00 37.56 ? 113 THR C N   1 
ATOM 2741 C CA  . THR C 1 87  ? 45.482  46.494  29.655  1.00 37.13 ? 113 THR C CA  1 
ATOM 2742 C C   . THR C 1 87  ? 44.535  46.706  28.488  1.00 36.86 ? 113 THR C C   1 
ATOM 2743 O O   . THR C 1 87  ? 44.953  46.653  27.328  1.00 37.12 ? 113 THR C O   1 
ATOM 2744 C CB  . THR C 1 87  ? 46.202  47.849  29.945  1.00 37.28 ? 113 THR C CB  1 
ATOM 2745 O OG1 . THR C 1 87  ? 47.175  48.109  28.926  1.00 36.84 ? 113 THR C OG1 1 
ATOM 2746 C CG2 . THR C 1 87  ? 46.891  47.849  31.324  1.00 37.13 ? 113 THR C CG2 1 
ATOM 2747 N N   . PHE C 1 88  ? 43.261  46.940  28.780  1.00 36.27 ? 114 PHE C N   1 
ATOM 2748 C CA  . PHE C 1 88  ? 42.303  47.221  27.720  1.00 35.75 ? 114 PHE C CA  1 
ATOM 2749 C C   . PHE C 1 88  ? 42.275  48.713  27.416  1.00 35.41 ? 114 PHE C C   1 
ATOM 2750 O O   . PHE C 1 88  ? 42.638  49.531  28.253  1.00 35.33 ? 114 PHE C O   1 
ATOM 2751 C CB  . PHE C 1 88  ? 40.899  46.718  28.081  1.00 35.82 ? 114 PHE C CB  1 
ATOM 2752 C CG  . PHE C 1 88  ? 40.742  45.220  28.009  1.00 35.55 ? 114 PHE C CG  1 
ATOM 2753 C CD1 . PHE C 1 88  ? 40.612  44.574  26.777  1.00 35.82 ? 114 PHE C CD1 1 
ATOM 2754 C CD2 . PHE C 1 88  ? 40.701  44.455  29.177  1.00 35.24 ? 114 PHE C CD2 1 
ATOM 2755 C CE1 . PHE C 1 88  ? 40.457  43.184  26.709  1.00 36.04 ? 114 PHE C CE1 1 
ATOM 2756 C CE2 . PHE C 1 88  ? 40.545  43.064  29.129  1.00 35.63 ? 114 PHE C CE2 1 
ATOM 2757 C CZ  . PHE C 1 88  ? 40.422  42.424  27.893  1.00 36.46 ? 114 PHE C CZ  1 
ATOM 2758 N N   . GLN C 1 89  ? 41.859  49.052  26.201  1.00 34.93 ? 115 GLN C N   1 
ATOM 2759 C CA  . GLN C 1 89  ? 41.629  50.432  25.809  1.00 34.41 ? 115 GLN C CA  1 
ATOM 2760 C C   . GLN C 1 89  ? 40.315  50.471  25.039  1.00 33.95 ? 115 GLN C C   1 
ATOM 2761 O O   . GLN C 1 89  ? 40.008  49.549  24.297  1.00 34.09 ? 115 GLN C O   1 
ATOM 2762 C CB  . GLN C 1 89  ? 42.779  50.928  24.942  1.00 34.32 ? 115 GLN C CB  1 
ATOM 2763 C CG  . GLN C 1 89  ? 42.669  52.389  24.525  1.00 34.86 ? 115 GLN C CG  1 
ATOM 2764 C CD  . GLN C 1 89  ? 43.675  52.779  23.448  1.00 34.71 ? 115 GLN C CD  1 
ATOM 2765 O OE1 . GLN C 1 89  ? 44.540  53.615  23.679  1.00 34.40 ? 115 GLN C OE1 1 
ATOM 2766 N NE2 . GLN C 1 89  ? 43.562  52.171  22.269  1.00 35.20 ? 115 GLN C NE2 1 
ATOM 2767 N N   . ILE C 1 90  ? 39.547  51.538  25.215  1.00 33.51 ? 116 ILE C N   1 
ATOM 2768 C CA  . ILE C 1 90  ? 38.210  51.643  24.627  1.00 32.87 ? 116 ILE C CA  1 
ATOM 2769 C C   . ILE C 1 90  ? 38.269  52.184  23.200  1.00 32.93 ? 116 ILE C C   1 
ATOM 2770 O O   . ILE C 1 90  ? 39.041  53.097  22.910  1.00 32.89 ? 116 ILE C O   1 
ATOM 2771 C CB  . ILE C 1 90  ? 37.290  52.553  25.489  1.00 32.51 ? 116 ILE C CB  1 
ATOM 2772 C CG1 . ILE C 1 90  ? 37.362  52.177  26.976  1.00 31.58 ? 116 ILE C CG1 1 
ATOM 2773 C CG2 . ILE C 1 90  ? 35.857  52.547  24.978  1.00 32.35 ? 116 ILE C CG2 1 
ATOM 2774 C CD1 . ILE C 1 90  ? 36.983  50.760  27.320  1.00 29.81 ? 116 ILE C CD1 1 
ATOM 2775 N N   . ILE C 1 91  ? 37.457  51.601  22.319  1.00 32.99 ? 117 ILE C N   1 
ATOM 2776 C CA  . ILE C 1 91  ? 37.290  52.092  20.950  1.00 33.15 ? 117 ILE C CA  1 
ATOM 2777 C C   . ILE C 1 91  ? 35.964  52.832  20.813  1.00 33.63 ? 117 ILE C C   1 
ATOM 2778 O O   . ILE C 1 91  ? 35.927  53.953  20.305  1.00 33.50 ? 117 ILE C O   1 
ATOM 2779 C CB  . ILE C 1 91  ? 37.314  50.944  19.898  1.00 33.17 ? 117 ILE C CB  1 
ATOM 2780 C CG1 . ILE C 1 91  ? 38.479  49.971  20.161  1.00 33.35 ? 117 ILE C CG1 1 
ATOM 2781 C CG2 . ILE C 1 91  ? 37.334  51.519  18.467  1.00 32.24 ? 117 ILE C CG2 1 
ATOM 2782 C CD1 . ILE C 1 91  ? 38.409  48.668  19.386  1.00 33.01 ? 117 ILE C CD1 1 
ATOM 2783 N N   . ASP C 1 92  ? 34.883  52.182  21.255  1.00 34.30 ? 118 ASP C N   1 
ATOM 2784 C CA  . ASP C 1 92  ? 33.524  52.699  21.123  1.00 34.77 ? 118 ASP C CA  1 
ATOM 2785 C C   . ASP C 1 92  ? 32.945  53.084  22.473  1.00 35.16 ? 118 ASP C C   1 
ATOM 2786 O O   . ASP C 1 92  ? 32.397  52.240  23.198  1.00 35.18 ? 118 ASP C O   1 
ATOM 2787 C CB  . ASP C 1 92  ? 32.619  51.663  20.456  1.00 34.86 ? 118 ASP C CB  1 
ATOM 2788 C CG  . ASP C 1 92  ? 32.997  51.399  19.010  1.00 35.63 ? 118 ASP C CG  1 
ATOM 2789 O OD1 . ASP C 1 92  ? 33.655  52.275  18.393  1.00 36.25 ? 118 ASP C OD1 1 
ATOM 2790 O OD2 . ASP C 1 92  ? 32.623  50.318  18.488  1.00 35.44 ? 118 ASP C OD2 1 
ATOM 2791 N N   . GLU C 1 93  ? 33.054  54.369  22.799  1.00 35.48 ? 119 GLU C N   1 
ATOM 2792 C CA  . GLU C 1 93  ? 32.550  54.883  24.069  1.00 35.87 ? 119 GLU C CA  1 
ATOM 2793 C C   . GLU C 1 93  ? 31.022  54.948  24.113  1.00 35.95 ? 119 GLU C C   1 
ATOM 2794 O O   . GLU C 1 93  ? 30.441  55.268  25.149  1.00 36.09 ? 119 GLU C O   1 
ATOM 2795 C CB  . GLU C 1 93  ? 33.200  56.229  24.400  1.00 35.92 ? 119 GLU C CB  1 
ATOM 2796 C CG  . GLU C 1 93  ? 34.669  56.074  24.789  1.00 36.86 ? 119 GLU C CG  1 
ATOM 2797 C CD  . GLU C 1 93  ? 35.348  57.367  25.166  1.00 38.27 ? 119 GLU C CD  1 
ATOM 2798 O OE1 . GLU C 1 93  ? 34.729  58.197  25.871  1.00 39.14 ? 119 GLU C OE1 1 
ATOM 2799 O OE2 . GLU C 1 93  ? 36.520  57.548  24.762  1.00 39.47 ? 119 GLU C OE2 1 
ATOM 2800 N N   . GLU C 1 94  ? 30.387  54.610  22.993  1.00 36.11 ? 120 GLU C N   1 
ATOM 2801 C CA  . GLU C 1 94  ? 28.927  54.533  22.894  1.00 36.16 ? 120 GLU C CA  1 
ATOM 2802 C C   . GLU C 1 94  ? 28.374  53.106  23.064  1.00 36.20 ? 120 GLU C C   1 
ATOM 2803 O O   . GLU C 1 94  ? 27.163  52.921  23.203  1.00 36.16 ? 120 GLU C O   1 
ATOM 2804 C CB  . GLU C 1 94  ? 28.420  55.174  21.587  1.00 36.16 ? 120 GLU C CB  1 
ATOM 2805 C CG  . GLU C 1 94  ? 29.242  54.872  20.332  1.00 36.86 ? 120 GLU C CG  1 
ATOM 2806 C CD  . GLU C 1 94  ? 30.365  55.881  20.088  1.00 37.28 ? 120 GLU C CD  1 
ATOM 2807 O OE1 . GLU C 1 94  ? 31.547  55.508  20.258  1.00 37.67 ? 120 GLU C OE1 1 
ATOM 2808 O OE2 . GLU C 1 94  ? 30.068  57.043  19.727  1.00 36.98 ? 120 GLU C OE2 1 
ATOM 2809 N N   . GLU C 1 95  ? 29.256  52.107  23.058  1.00 36.27 ? 121 GLU C N   1 
ATOM 2810 C CA  . GLU C 1 95  ? 28.845  50.728  23.303  1.00 36.41 ? 121 GLU C CA  1 
ATOM 2811 C C   . GLU C 1 95  ? 29.504  50.153  24.553  1.00 36.41 ? 121 GLU C C   1 
ATOM 2812 O O   . GLU C 1 95  ? 28.913  49.321  25.243  1.00 36.37 ? 121 GLU C O   1 
ATOM 2813 C CB  . GLU C 1 95  ? 29.166  49.814  22.112  1.00 36.49 ? 121 GLU C CB  1 
ATOM 2814 C CG  . GLU C 1 95  ? 28.933  50.407  20.723  1.00 38.05 ? 121 GLU C CG  1 
ATOM 2815 C CD  . GLU C 1 95  ? 27.468  50.619  20.370  1.00 40.14 ? 121 GLU C CD  1 
ATOM 2816 O OE1 . GLU C 1 95  ? 26.604  49.875  20.882  1.00 41.62 ? 121 GLU C OE1 1 
ATOM 2817 O OE2 . GLU C 1 95  ? 27.179  51.533  19.561  1.00 40.92 ? 121 GLU C OE2 1 
ATOM 2818 N N   . THR C 1 96  ? 30.729  50.589  24.839  1.00 36.46 ? 122 THR C N   1 
ATOM 2819 C CA  . THR C 1 96  ? 31.549  49.949  25.872  1.00 36.54 ? 122 THR C CA  1 
ATOM 2820 C C   . THR C 1 96  ? 32.133  50.951  26.848  1.00 36.59 ? 122 THR C C   1 
ATOM 2821 O O   . THR C 1 96  ? 32.397  52.086  26.483  1.00 36.86 ? 122 THR C O   1 
ATOM 2822 C CB  . THR C 1 96  ? 32.738  49.173  25.257  1.00 36.43 ? 122 THR C CB  1 
ATOM 2823 O OG1 . THR C 1 96  ? 33.630  50.099  24.630  1.00 36.75 ? 122 THR C OG1 1 
ATOM 2824 C CG2 . THR C 1 96  ? 32.264  48.148  24.231  1.00 35.86 ? 122 THR C CG2 1 
ATOM 2825 N N   . GLN C 1 97  ? 32.350  50.508  28.082  1.00 36.73 ? 123 GLN C N   1 
ATOM 2826 C CA  . GLN C 1 97  ? 32.967  51.321  29.130  1.00 36.99 ? 123 GLN C CA  1 
ATOM 2827 C C   . GLN C 1 97  ? 33.675  50.411  30.126  1.00 37.08 ? 123 GLN C C   1 
ATOM 2828 O O   . GLN C 1 97  ? 33.382  49.213  30.201  1.00 37.18 ? 123 GLN C O   1 
ATOM 2829 C CB  . GLN C 1 97  ? 31.917  52.177  29.860  1.00 36.76 ? 123 GLN C CB  1 
ATOM 2830 C CG  . GLN C 1 97  ? 30.814  51.386  30.573  1.00 37.31 ? 123 GLN C CG  1 
ATOM 2831 C CD  . GLN C 1 97  ? 29.973  52.237  31.510  1.00 37.57 ? 123 GLN C CD  1 
ATOM 2832 O OE1 . GLN C 1 97  ? 30.495  53.086  32.232  1.00 39.46 ? 123 GLN C OE1 1 
ATOM 2833 N NE2 . GLN C 1 97  ? 28.665  52.002  31.515  1.00 38.13 ? 123 GLN C NE2 1 
ATOM 2834 N N   . PHE C 1 98  ? 34.612  50.971  30.884  1.00 37.20 ? 124 PHE C N   1 
ATOM 2835 C CA  . PHE C 1 98  ? 35.164  50.256  32.025  1.00 37.19 ? 124 PHE C CA  1 
ATOM 2836 C C   . PHE C 1 98  ? 34.080  50.187  33.081  1.00 37.32 ? 124 PHE C C   1 
ATOM 2837 O O   . PHE C 1 98  ? 33.286  51.112  33.226  1.00 36.96 ? 124 PHE C O   1 
ATOM 2838 C CB  . PHE C 1 98  ? 36.404  50.951  32.583  1.00 37.17 ? 124 PHE C CB  1 
ATOM 2839 C CG  . PHE C 1 98  ? 37.617  50.843  31.700  1.00 37.23 ? 124 PHE C CG  1 
ATOM 2840 C CD1 . PHE C 1 98  ? 38.093  51.956  31.016  1.00 37.12 ? 124 PHE C CD1 1 
ATOM 2841 C CD2 . PHE C 1 98  ? 38.290  49.631  31.557  1.00 36.95 ? 124 PHE C CD2 1 
ATOM 2842 C CE1 . PHE C 1 98  ? 39.219  51.861  30.198  1.00 37.09 ? 124 PHE C CE1 1 
ATOM 2843 C CE2 . PHE C 1 98  ? 39.415  49.527  30.746  1.00 36.94 ? 124 PHE C CE2 1 
ATOM 2844 C CZ  . PHE C 1 98  ? 39.878  50.642  30.063  1.00 36.94 ? 124 PHE C CZ  1 
ATOM 2845 N N   . MET C 1 99  ? 34.023  49.073  33.795  1.00 37.91 ? 125 MET C N   1 
ATOM 2846 C CA  . MET C 1 99  ? 33.051  48.927  34.858  1.00 38.58 ? 125 MET C CA  1 
ATOM 2847 C C   . MET C 1 99  ? 33.536  49.735  36.046  1.00 38.95 ? 125 MET C C   1 
ATOM 2848 O O   . MET C 1 99  ? 34.663  49.558  36.498  1.00 39.01 ? 125 MET C O   1 
ATOM 2849 C CB  . MET C 1 99  ? 32.879  47.459  35.234  1.00 38.30 ? 125 MET C CB  1 
ATOM 2850 C CG  . MET C 1 99  ? 31.742  47.218  36.198  1.00 38.57 ? 125 MET C CG  1 
ATOM 2851 S SD  . MET C 1 99  ? 31.450  45.473  36.531  1.00 39.08 ? 125 MET C SD  1 
ATOM 2852 C CE  . MET C 1 99  ? 30.750  44.957  34.967  1.00 38.00 ? 125 MET C CE  1 
ATOM 2853 N N   . SER C 1 100 ? 32.699  50.640  36.538  1.00 39.53 ? 126 SER C N   1 
ATOM 2854 C CA  . SER C 1 100 ? 33.076  51.423  37.705  1.00 40.27 ? 126 SER C CA  1 
ATOM 2855 C C   . SER C 1 100 ? 33.085  50.537  38.947  1.00 40.71 ? 126 SER C C   1 
ATOM 2856 O O   . SER C 1 100 ? 33.792  50.817  39.914  1.00 40.78 ? 126 SER C O   1 
ATOM 2857 C CB  . SER C 1 100 ? 32.146  52.620  37.888  1.00 40.33 ? 126 SER C CB  1 
ATOM 2858 O OG  . SER C 1 100 ? 30.819  52.202  38.136  1.00 41.15 ? 126 SER C OG  1 
ATOM 2859 N N   . ASN C 1 101 ? 32.301  49.461  38.901  1.00 41.32 ? 127 ASN C N   1 
ATOM 2860 C CA  . ASN C 1 101 ? 32.267  48.471  39.975  1.00 41.83 ? 127 ASN C CA  1 
ATOM 2861 C C   . ASN C 1 101 ? 33.515  47.591  39.938  1.00 42.05 ? 127 ASN C C   1 
ATOM 2862 O O   . ASN C 1 101 ? 33.941  47.060  40.963  1.00 42.18 ? 127 ASN C O   1 
ATOM 2863 C CB  . ASN C 1 101 ? 31.005  47.603  39.881  1.00 41.87 ? 127 ASN C CB  1 
ATOM 2864 C CG  . ASN C 1 101 ? 29.763  48.402  39.496  1.00 42.05 ? 127 ASN C CG  1 
ATOM 2865 O OD1 . ASN C 1 101 ? 29.597  48.802  38.338  1.00 41.71 ? 127 ASN C OD1 1 
ATOM 2866 N ND2 . ASN C 1 101 ? 28.877  48.620  40.463  1.00 41.15 ? 127 ASN C ND2 1 
ATOM 2867 N N   . CYS C 1 102 ? 34.090  47.447  38.745  1.00 42.48 ? 128 CYS C N   1 
ATOM 2868 C CA  . CYS C 1 102 ? 35.319  46.681  38.539  1.00 42.43 ? 128 CYS C CA  1 
ATOM 2869 C C   . CYS C 1 102 ? 36.096  47.244  37.350  1.00 42.12 ? 128 CYS C C   1 
ATOM 2870 O O   . CYS C 1 102 ? 35.811  46.893  36.204  1.00 42.12 ? 128 CYS C O   1 
ATOM 2871 C CB  . CYS C 1 102 ? 35.007  45.198  38.334  1.00 42.72 ? 128 CYS C CB  1 
ATOM 2872 S SG  . CYS C 1 102 ? 36.446  44.204  37.949  1.00 43.54 ? 128 CYS C SG  1 
ATOM 2873 N N   . PRO C 1 103 ? 37.081  48.124  37.628  1.00 41.88 ? 129 PRO C N   1 
ATOM 2874 C CA  . PRO C 1 103 ? 37.785  48.950  36.638  1.00 41.63 ? 129 PRO C CA  1 
ATOM 2875 C C   . PRO C 1 103 ? 38.638  48.196  35.611  1.00 41.42 ? 129 PRO C C   1 
ATOM 2876 O O   . PRO C 1 103 ? 38.794  48.669  34.487  1.00 41.47 ? 129 PRO C O   1 
ATOM 2877 C CB  . PRO C 1 103 ? 38.666  49.858  37.502  1.00 41.71 ? 129 PRO C CB  1 
ATOM 2878 C CG  . PRO C 1 103 ? 38.859  49.108  38.763  1.00 41.89 ? 129 PRO C CG  1 
ATOM 2879 C CD  . PRO C 1 103 ? 37.580  48.372  38.994  1.00 41.89 ? 129 PRO C CD  1 
ATOM 2880 N N   . VAL C 1 104 ? 39.176  47.039  35.985  1.00 41.08 ? 130 VAL C N   1 
ATOM 2881 C CA  . VAL C 1 104 ? 40.031  46.261  35.083  1.00 40.55 ? 130 VAL C CA  1 
ATOM 2882 C C   . VAL C 1 104 ? 39.216  45.439  34.060  1.00 40.10 ? 130 VAL C C   1 
ATOM 2883 O O   . VAL C 1 104 ? 39.762  44.594  33.333  1.00 39.72 ? 130 VAL C O   1 
ATOM 2884 C CB  . VAL C 1 104 ? 41.032  45.385  35.892  1.00 40.75 ? 130 VAL C CB  1 
ATOM 2885 C CG1 . VAL C 1 104 ? 40.370  44.090  36.400  1.00 40.64 ? 130 VAL C CG1 1 
ATOM 2886 C CG2 . VAL C 1 104 ? 42.302  45.107  35.080  1.00 40.89 ? 130 VAL C CG2 1 
ATOM 2887 N N   . ALA C 1 105 ? 37.915  45.722  33.998  1.00 39.62 ? 131 ALA C N   1 
ATOM 2888 C CA  . ALA C 1 105 ? 36.985  44.973  33.153  1.00 39.44 ? 131 ALA C CA  1 
ATOM 2889 C C   . ALA C 1 105 ? 36.197  45.865  32.197  1.00 39.18 ? 131 ALA C C   1 
ATOM 2890 O O   . ALA C 1 105 ? 35.759  46.955  32.566  1.00 39.08 ? 131 ALA C O   1 
ATOM 2891 C CB  . ALA C 1 105 ? 36.026  44.155  34.016  1.00 39.26 ? 131 ALA C CB  1 
ATOM 2892 N N   . VAL C 1 106 ? 36.014  45.380  30.974  1.00 38.93 ? 132 VAL C N   1 
ATOM 2893 C CA  . VAL C 1 106 ? 35.205  46.065  29.975  1.00 38.85 ? 132 VAL C CA  1 
ATOM 2894 C C   . VAL C 1 106 ? 33.788  45.482  29.936  1.00 38.78 ? 132 VAL C C   1 
ATOM 2895 O O   . VAL C 1 106 ? 33.596  44.284  29.720  1.00 38.75 ? 132 VAL C O   1 
ATOM 2896 C CB  . VAL C 1 106 ? 35.876  46.038  28.565  1.00 38.82 ? 132 VAL C CB  1 
ATOM 2897 C CG1 . VAL C 1 106 ? 34.868  46.342  27.460  1.00 38.64 ? 132 VAL C CG1 1 
ATOM 2898 C CG2 . VAL C 1 106 ? 37.031  47.033  28.510  1.00 38.47 ? 132 VAL C CG2 1 
ATOM 2899 N N   . THR C 1 107 ? 32.811  46.357  30.150  1.00 38.61 ? 133 THR C N   1 
ATOM 2900 C CA  . THR C 1 107 ? 31.401  46.007  30.154  1.00 38.53 ? 133 THR C CA  1 
ATOM 2901 C C   . THR C 1 107 ? 30.634  46.958  29.229  1.00 38.46 ? 133 THR C C   1 
ATOM 2902 O O   . THR C 1 107 ? 31.214  47.913  28.707  1.00 38.46 ? 133 THR C O   1 
ATOM 2903 C CB  . THR C 1 107 ? 30.836  46.091  31.576  1.00 38.51 ? 133 THR C CB  1 
ATOM 2904 O OG1 . THR C 1 107 ? 29.457  45.716  31.567  1.00 39.39 ? 133 THR C OG1 1 
ATOM 2905 C CG2 . THR C 1 107 ? 30.958  47.510  32.126  1.00 38.37 ? 133 THR C CG2 1 
ATOM 2906 N N   . GLU C 1 108 ? 29.340  46.715  29.031  1.00 38.36 ? 134 GLU C N   1 
ATOM 2907 C CA  . GLU C 1 108 ? 28.551  47.567  28.146  1.00 38.70 ? 134 GLU C CA  1 
ATOM 2908 C C   . GLU C 1 108 ? 28.163  48.884  28.816  1.00 39.18 ? 134 GLU C C   1 
ATOM 2909 O O   . GLU C 1 108 ? 28.250  49.017  30.039  1.00 39.21 ? 134 GLU C O   1 
ATOM 2910 C CB  . GLU C 1 108 ? 27.316  46.837  27.618  1.00 38.59 ? 134 GLU C CB  1 
ATOM 2911 C CG  . GLU C 1 108 ? 26.063  46.914  28.514  1.00 38.85 ? 134 GLU C CG  1 
ATOM 2912 C CD  . GLU C 1 108 ? 26.120  46.016  29.744  1.00 37.90 ? 134 GLU C CD  1 
ATOM 2913 O OE1 . GLU C 1 108 ? 26.849  44.995  29.736  1.00 38.38 ? 134 GLU C OE1 1 
ATOM 2914 O OE2 . GLU C 1 108 ? 25.414  46.330  30.721  1.00 36.89 ? 134 GLU C OE2 1 
ATOM 2915 N N   . SER C 1 109 ? 27.748  49.851  28.002  1.00 39.65 ? 135 SER C N   1 
ATOM 2916 C CA  . SER C 1 109 ? 27.339  51.160  28.496  1.00 40.21 ? 135 SER C CA  1 
ATOM 2917 C C   . SER C 1 109 ? 25.825  51.307  28.497  1.00 40.74 ? 135 SER C C   1 
ATOM 2918 O O   . SER C 1 109 ? 25.269  51.974  29.371  1.00 40.87 ? 135 SER C O   1 
ATOM 2919 C CB  . SER C 1 109 ? 27.996  52.284  27.694  1.00 40.14 ? 135 SER C CB  1 
ATOM 2920 O OG  . SER C 1 109 ? 28.007  52.002  26.307  1.00 40.02 ? 135 SER C OG  1 
ATOM 2921 N N   . THR C 1 110 ? 25.165  50.677  27.524  1.00 41.25 ? 136 THR C N   1 
ATOM 2922 C CA  . THR C 1 110 ? 23.698  50.636  27.469  1.00 41.48 ? 136 THR C CA  1 
ATOM 2923 C C   . THR C 1 110 ? 23.252  49.192  27.306  1.00 41.52 ? 136 THR C C   1 
ATOM 2924 O O   . THR C 1 110 ? 23.877  48.437  26.561  1.00 41.78 ? 136 THR C O   1 
ATOM 2925 C CB  . THR C 1 110 ? 23.136  51.475  26.294  1.00 41.54 ? 136 THR C CB  1 
ATOM 2926 O OG1 . THR C 1 110 ? 23.735  52.775  26.300  1.00 41.86 ? 136 THR C OG1 1 
ATOM 2927 C CG2 . THR C 1 110 ? 21.608  51.623  26.391  1.00 41.22 ? 136 THR C CG2 1 
ATOM 2928 N N   . PRO C 1 111 ? 22.187  48.789  28.020  1.00 41.47 ? 137 PRO C N   1 
ATOM 2929 C CA  . PRO C 1 111 ? 21.621  47.465  27.809  1.00 41.51 ? 137 PRO C CA  1 
ATOM 2930 C C   . PRO C 1 111 ? 20.645  47.366  26.623  1.00 41.43 ? 137 PRO C C   1 
ATOM 2931 O O   . PRO C 1 111 ? 19.469  47.044  26.822  1.00 41.73 ? 137 PRO C O   1 
ATOM 2932 C CB  . PRO C 1 111 ? 20.895  47.192  29.133  1.00 41.53 ? 137 PRO C CB  1 
ATOM 2933 C CG  . PRO C 1 111 ? 20.470  48.527  29.597  1.00 41.46 ? 137 PRO C CG  1 
ATOM 2934 C CD  . PRO C 1 111 ? 21.493  49.513  29.102  1.00 41.47 ? 137 PRO C CD  1 
ATOM 2935 N N   . ARG C 1 112 ? 21.114  47.634  25.406  1.00 41.26 ? 138 ARG C N   1 
ATOM 2936 C CA  . ARG C 1 112 ? 20.294  47.351  24.227  1.00 41.30 ? 138 ARG C CA  1 
ATOM 2937 C C   . ARG C 1 112 ? 20.913  46.289  23.324  1.00 41.12 ? 138 ARG C C   1 
ATOM 2938 O O   . ARG C 1 112 ? 22.077  45.919  23.489  1.00 41.19 ? 138 ARG C O   1 
ATOM 2939 C CB  . ARG C 1 112 ? 19.953  48.612  23.430  1.00 41.48 ? 138 ARG C CB  1 
ATOM 2940 C CG  . ARG C 1 112 ? 18.482  48.628  22.990  1.00 42.29 ? 138 ARG C CG  1 
ATOM 2941 C CD  . ARG C 1 112 ? 18.279  49.271  21.627  1.00 43.67 ? 138 ARG C CD  1 
ATOM 2942 N NE  . ARG C 1 112 ? 16.860  49.472  21.330  1.00 44.30 ? 138 ARG C NE  1 
ATOM 2943 C CZ  . ARG C 1 112 ? 16.386  50.007  20.205  1.00 44.36 ? 138 ARG C CZ  1 
ATOM 2944 N NH1 . ARG C 1 112 ? 15.076  50.145  20.045  1.00 44.32 ? 138 ARG C NH1 1 
ATOM 2945 N NH2 . ARG C 1 112 ? 17.210  50.402  19.241  1.00 44.11 ? 138 ARG C NH2 1 
ATOM 2946 N N   . ARG C 1 113 ? 20.117  45.806  22.374  1.00 40.92 ? 139 ARG C N   1 
ATOM 2947 C CA  . ARG C 1 113 ? 20.518  44.728  21.475  1.00 40.78 ? 139 ARG C CA  1 
ATOM 2948 C C   . ARG C 1 113 ? 21.744  45.082  20.633  1.00 40.59 ? 139 ARG C C   1 
ATOM 2949 O O   . ARG C 1 113 ? 21.775  46.106  19.953  1.00 40.51 ? 139 ARG C O   1 
ATOM 2950 C CB  . ARG C 1 113 ? 19.353  44.333  20.563  1.00 40.84 ? 139 ARG C CB  1 
ATOM 2951 C CG  . ARG C 1 113 ? 18.131  43.823  21.296  1.00 41.31 ? 139 ARG C CG  1 
ATOM 2952 C CD  . ARG C 1 113 ? 16.888  43.853  20.423  1.00 42.83 ? 139 ARG C CD  1 
ATOM 2953 N NE  . ARG C 1 113 ? 16.514  45.212  20.017  1.00 43.53 ? 139 ARG C NE  1 
ATOM 2954 C CZ  . ARG C 1 113 ? 15.260  45.622  19.830  1.00 43.73 ? 139 ARG C CZ  1 
ATOM 2955 N NH1 . ARG C 1 113 ? 14.247  44.784  20.029  1.00 43.59 ? 139 ARG C NH1 1 
ATOM 2956 N NH2 . ARG C 1 113 ? 15.016  46.876  19.457  1.00 43.30 ? 139 ARG C NH2 1 
ATOM 2957 N N   . ARG C 1 114 ? 22.757  44.228  20.718  1.00 40.46 ? 140 ARG C N   1 
ATOM 2958 C CA  . ARG C 1 114 ? 23.934  44.293  19.866  1.00 40.32 ? 140 ARG C CA  1 
ATOM 2959 C C   . ARG C 1 114 ? 24.217  42.884  19.336  1.00 39.91 ? 140 ARG C C   1 
ATOM 2960 O O   . ARG C 1 114 ? 23.785  41.883  19.923  1.00 39.95 ? 140 ARG C O   1 
ATOM 2961 C CB  . ARG C 1 114 ? 25.156  44.811  20.640  1.00 40.59 ? 140 ARG C CB  1 
ATOM 2962 C CG  . ARG C 1 114 ? 24.840  45.795  21.750  1.00 41.99 ? 140 ARG C CG  1 
ATOM 2963 C CD  . ARG C 1 114 ? 26.020  46.696  22.102  1.00 44.30 ? 140 ARG C CD  1 
ATOM 2964 N NE  . ARG C 1 114 ? 25.744  47.519  23.289  1.00 45.90 ? 140 ARG C NE  1 
ATOM 2965 C CZ  . ARG C 1 114 ? 25.103  48.689  23.276  1.00 46.58 ? 140 ARG C CZ  1 
ATOM 2966 N NH1 . ARG C 1 114 ? 24.652  49.211  22.136  1.00 45.96 ? 140 ARG C NH1 1 
ATOM 2967 N NH2 . ARG C 1 114 ? 24.915  49.350  24.411  1.00 47.57 ? 140 ARG C NH2 1 
ATOM 2968 N N   . THR C 1 115 ? 24.933  42.808  18.220  1.00 39.14 ? 141 THR C N   1 
ATOM 2969 C CA  . THR C 1 115 ? 25.389  41.527  17.702  1.00 38.23 ? 141 THR C CA  1 
ATOM 2970 C C   . THR C 1 115 ? 26.900  41.488  17.722  1.00 37.87 ? 141 THR C C   1 
ATOM 2971 O O   . THR C 1 115 ? 27.505  40.468  17.401  1.00 37.53 ? 141 THR C O   1 
ATOM 2972 C CB  . THR C 1 115 ? 24.909  41.295  16.271  1.00 38.09 ? 141 THR C CB  1 
ATOM 2973 O OG1 . THR C 1 115 ? 25.152  42.474  15.501  1.00 37.66 ? 141 THR C OG1 1 
ATOM 2974 C CG2 . THR C 1 115 ? 23.421  40.970  16.252  1.00 37.84 ? 141 THR C CG2 1 
ATOM 2975 N N   . ARG C 1 116 ? 27.498  42.609  18.119  1.00 37.75 ? 142 ARG C N   1 
ATOM 2976 C CA  . ARG C 1 116 ? 28.942  42.800  18.061  1.00 37.65 ? 142 ARG C CA  1 
ATOM 2977 C C   . ARG C 1 116 ? 29.397  43.937  18.973  1.00 37.04 ? 142 ARG C C   1 
ATOM 2978 O O   . ARG C 1 116 ? 28.821  45.019  18.955  1.00 36.92 ? 142 ARG C O   1 
ATOM 2979 C CB  . ARG C 1 116 ? 29.364  43.108  16.617  1.00 37.87 ? 142 ARG C CB  1 
ATOM 2980 C CG  . ARG C 1 116 ? 30.847  42.949  16.353  1.00 39.52 ? 142 ARG C CG  1 
ATOM 2981 C CD  . ARG C 1 116 ? 31.179  43.234  14.898  1.00 41.74 ? 142 ARG C CD  1 
ATOM 2982 N NE  . ARG C 1 116 ? 32.624  43.224  14.675  1.00 43.80 ? 142 ARG C NE  1 
ATOM 2983 C CZ  . ARG C 1 116 ? 33.441  44.237  14.964  1.00 44.64 ? 142 ARG C CZ  1 
ATOM 2984 N NH1 . ARG C 1 116 ? 34.739  44.126  14.726  1.00 45.45 ? 142 ARG C NH1 1 
ATOM 2985 N NH2 . ARG C 1 116 ? 32.968  45.359  15.491  1.00 45.21 ? 142 ARG C NH2 1 
ATOM 2986 N N   . ILE C 1 117 ? 30.414  43.682  19.788  1.00 36.49 ? 143 ILE C N   1 
ATOM 2987 C CA  . ILE C 1 117 ? 31.191  44.770  20.386  1.00 36.07 ? 143 ILE C CA  1 
ATOM 2988 C C   . ILE C 1 117 ? 32.664  44.528  20.098  1.00 35.76 ? 143 ILE C C   1 
ATOM 2989 O O   . ILE C 1 117 ? 33.069  43.403  19.803  1.00 35.65 ? 143 ILE C O   1 
ATOM 2990 C CB  . ILE C 1 117 ? 30.940  44.977  21.914  1.00 36.12 ? 143 ILE C CB  1 
ATOM 2991 C CG1 . ILE C 1 117 ? 31.479  43.810  22.758  1.00 36.65 ? 143 ILE C CG1 1 
ATOM 2992 C CG2 . ILE C 1 117 ? 29.466  45.269  22.199  1.00 35.63 ? 143 ILE C CG2 1 
ATOM 2993 C CD1 . ILE C 1 117 ? 32.855  44.072  23.379  1.00 36.40 ? 143 ILE C CD1 1 
ATOM 2994 N N   . GLN C 1 118 ? 33.462  45.585  20.164  1.00 35.46 ? 144 GLN C N   1 
ATOM 2995 C CA  . GLN C 1 118 ? 34.893  45.456  19.926  1.00 34.89 ? 144 GLN C CA  1 
ATOM 2996 C C   . GLN C 1 118 ? 35.654  46.364  20.882  1.00 34.85 ? 144 GLN C C   1 
ATOM 2997 O O   . GLN C 1 118 ? 35.218  47.479  21.173  1.00 34.78 ? 144 GLN C O   1 
ATOM 2998 C CB  . GLN C 1 118 ? 35.231  45.785  18.477  1.00 34.53 ? 144 GLN C CB  1 
ATOM 2999 C CG  . GLN C 1 118 ? 35.005  47.244  18.120  1.00 34.70 ? 144 GLN C CG  1 
ATOM 3000 C CD  . GLN C 1 118 ? 35.199  47.546  16.647  1.00 34.29 ? 144 GLN C CD  1 
ATOM 3001 O OE1 . GLN C 1 118 ? 35.986  46.897  15.955  1.00 35.03 ? 144 GLN C OE1 1 
ATOM 3002 N NE2 . GLN C 1 118 ? 34.475  48.531  16.161  1.00 31.20 ? 144 GLN C NE2 1 
ATOM 3003 N N   . VAL C 1 119 ? 36.784  45.872  21.373  1.00 34.55 ? 145 VAL C N   1 
ATOM 3004 C CA  . VAL C 1 119 ? 37.621  46.638  22.282  1.00 34.53 ? 145 VAL C CA  1 
ATOM 3005 C C   . VAL C 1 119 ? 39.083  46.307  21.976  1.00 34.40 ? 145 VAL C C   1 
ATOM 3006 O O   . VAL C 1 119 ? 39.380  45.199  21.517  1.00 34.48 ? 145 VAL C O   1 
ATOM 3007 C CB  . VAL C 1 119 ? 37.235  46.351  23.782  1.00 34.57 ? 145 VAL C CB  1 
ATOM 3008 C CG1 . VAL C 1 119 ? 37.844  45.048  24.274  1.00 34.62 ? 145 VAL C CG1 1 
ATOM 3009 C CG2 . VAL C 1 119 ? 37.631  47.494  24.688  1.00 33.97 ? 145 VAL C CG2 1 
ATOM 3010 N N   . PHE C 1 120 ? 39.980  47.271  22.187  1.00 34.03 ? 146 PHE C N   1 
ATOM 3011 C CA  . PHE C 1 120 ? 41.418  47.020  22.077  1.00 33.89 ? 146 PHE C CA  1 
ATOM 3012 C C   . PHE C 1 120 ? 41.939  46.335  23.341  1.00 33.88 ? 146 PHE C C   1 
ATOM 3013 O O   . PHE C 1 120 ? 41.525  46.676  24.444  1.00 34.20 ? 146 PHE C O   1 
ATOM 3014 C CB  . PHE C 1 120 ? 42.201  48.324  21.885  1.00 33.84 ? 146 PHE C CB  1 
ATOM 3015 C CG  . PHE C 1 120 ? 42.322  48.796  20.447  1.00 33.73 ? 146 PHE C CG  1 
ATOM 3016 C CD1 . PHE C 1 120 ? 42.029  50.128  20.115  1.00 33.07 ? 146 PHE C CD1 1 
ATOM 3017 C CD2 . PHE C 1 120 ? 42.766  47.944  19.439  1.00 33.41 ? 146 PHE C CD2 1 
ATOM 3018 C CE1 . PHE C 1 120 ? 42.150  50.597  18.798  1.00 32.08 ? 146 PHE C CE1 1 
ATOM 3019 C CE2 . PHE C 1 120 ? 42.892  48.409  18.119  1.00 33.34 ? 146 PHE C CE2 1 
ATOM 3020 C CZ  . PHE C 1 120 ? 42.582  49.744  17.805  1.00 32.23 ? 146 PHE C CZ  1 
ATOM 3021 N N   . TRP C 1 121 ? 42.844  45.372  23.169  1.00 33.84 ? 147 TRP C N   1 
ATOM 3022 C CA  . TRP C 1 121 ? 43.617  44.795  24.270  1.00 33.62 ? 147 TRP C CA  1 
ATOM 3023 C C   . TRP C 1 121 ? 45.110  44.890  23.982  1.00 33.72 ? 147 TRP C C   1 
ATOM 3024 O O   . TRP C 1 121 ? 45.577  44.409  22.950  1.00 33.97 ? 147 TRP C O   1 
ATOM 3025 C CB  . TRP C 1 121 ? 43.253  43.334  24.485  1.00 33.26 ? 147 TRP C CB  1 
ATOM 3026 C CG  . TRP C 1 121 ? 44.126  42.644  25.505  1.00 32.97 ? 147 TRP C CG  1 
ATOM 3027 C CD1 . TRP C 1 121 ? 44.082  42.793  26.868  1.00 32.24 ? 147 TRP C CD1 1 
ATOM 3028 C CD2 . TRP C 1 121 ? 45.167  41.701  25.241  1.00 32.55 ? 147 TRP C CD2 1 
ATOM 3029 N NE1 . TRP C 1 121 ? 45.028  41.997  27.463  1.00 31.53 ? 147 TRP C NE1 1 
ATOM 3030 C CE2 . TRP C 1 121 ? 45.707  41.314  26.490  1.00 32.04 ? 147 TRP C CE2 1 
ATOM 3031 C CE3 . TRP C 1 121 ? 45.702  41.147  24.067  1.00 32.43 ? 147 TRP C CE3 1 
ATOM 3032 C CZ2 . TRP C 1 121 ? 46.753  40.397  26.600  1.00 32.42 ? 147 TRP C CZ2 1 
ATOM 3033 C CZ3 . TRP C 1 121 ? 46.740  40.230  24.175  1.00 32.10 ? 147 TRP C CZ3 1 
ATOM 3034 C CH2 . TRP C 1 121 ? 47.257  39.867  25.435  1.00 32.83 ? 147 TRP C CH2 1 
ATOM 3035 N N   . ILE C 1 122 ? 45.853  45.491  24.907  1.00 33.70 ? 148 ILE C N   1 
ATOM 3036 C CA  . ILE C 1 122 ? 47.294  45.700  24.738  1.00 33.68 ? 148 ILE C CA  1 
ATOM 3037 C C   . ILE C 1 122 ? 48.062  44.609  25.480  1.00 33.76 ? 148 ILE C C   1 
ATOM 3038 O O   . ILE C 1 122 ? 47.859  44.401  26.676  1.00 33.67 ? 148 ILE C O   1 
ATOM 3039 C CB  . ILE C 1 122 ? 47.722  47.101  25.241  1.00 33.64 ? 148 ILE C CB  1 
ATOM 3040 C CG1 . ILE C 1 122 ? 46.779  48.176  24.687  1.00 33.54 ? 148 ILE C CG1 1 
ATOM 3041 C CG2 . ILE C 1 122 ? 49.177  47.394  24.862  1.00 33.77 ? 148 ILE C CG2 1 
ATOM 3042 C CD1 . ILE C 1 122 ? 46.945  49.545  25.310  1.00 33.64 ? 148 ILE C CD1 1 
ATOM 3043 N N   . ALA C 1 123 ? 48.943  43.914  24.766  1.00 33.92 ? 149 ALA C N   1 
ATOM 3044 C CA  . ALA C 1 123 ? 49.638  42.749  25.320  1.00 34.05 ? 149 ALA C CA  1 
ATOM 3045 C C   . ALA C 1 123 ? 50.694  43.136  26.367  1.00 34.23 ? 149 ALA C C   1 
ATOM 3046 O O   . ALA C 1 123 ? 51.293  44.210  26.268  1.00 34.42 ? 149 ALA C O   1 
ATOM 3047 C CB  . ALA C 1 123 ? 50.248  41.919  24.203  1.00 33.83 ? 149 ALA C CB  1 
ATOM 3048 N N   . PRO C 1 124 ? 50.919  42.261  27.374  1.00 34.31 ? 150 PRO C N   1 
ATOM 3049 C CA  . PRO C 1 124 ? 51.837  42.495  28.493  1.00 34.28 ? 150 PRO C CA  1 
ATOM 3050 C C   . PRO C 1 124 ? 53.307  42.305  28.112  1.00 34.35 ? 150 PRO C C   1 
ATOM 3051 O O   . PRO C 1 124 ? 53.588  41.727  27.066  1.00 34.40 ? 150 PRO C O   1 
ATOM 3052 C CB  . PRO C 1 124 ? 51.423  41.421  29.494  1.00 34.36 ? 150 PRO C CB  1 
ATOM 3053 C CG  . PRO C 1 124 ? 50.955  40.306  28.652  1.00 34.42 ? 150 PRO C CG  1 
ATOM 3054 C CD  . PRO C 1 124 ? 50.262  40.944  27.489  1.00 34.42 ? 150 PRO C CD  1 
ATOM 3055 N N   . PRO C 1 125 ? 54.240  42.779  28.964  1.00 34.33 ? 151 PRO C N   1 
ATOM 3056 C CA  . PRO C 1 125 ? 55.691  42.698  28.750  1.00 34.42 ? 151 PRO C CA  1 
ATOM 3057 C C   . PRO C 1 125 ? 56.271  41.296  28.489  1.00 34.54 ? 151 PRO C C   1 
ATOM 3058 O O   . PRO C 1 125 ? 55.601  40.289  28.700  1.00 34.50 ? 151 PRO C O   1 
ATOM 3059 C CB  . PRO C 1 125 ? 56.257  43.274  30.050  1.00 34.53 ? 151 PRO C CB  1 
ATOM 3060 C CG  . PRO C 1 125 ? 55.194  44.195  30.530  1.00 34.34 ? 151 PRO C CG  1 
ATOM 3061 C CD  . PRO C 1 125 ? 53.928  43.481  30.223  1.00 34.25 ? 151 PRO C CD  1 
ATOM 3062 N N   . ALA C 1 126 ? 57.529  41.264  28.050  1.00 34.80 ? 152 ALA C N   1 
ATOM 3063 C CA  . ALA C 1 126 ? 58.216  40.049  27.591  1.00 35.00 ? 152 ALA C CA  1 
ATOM 3064 C C   . ALA C 1 126 ? 58.247  38.908  28.604  1.00 35.12 ? 152 ALA C C   1 
ATOM 3065 O O   . ALA C 1 126 ? 58.800  39.048  29.695  1.00 35.19 ? 152 ALA C O   1 
ATOM 3066 C CB  . ALA C 1 126 ? 59.641  40.390  27.138  1.00 34.99 ? 152 ALA C CB  1 
ATOM 3067 N N   . GLY C 1 127 ? 57.658  37.778  28.220  1.00 35.31 ? 153 GLY C N   1 
ATOM 3068 C CA  . GLY C 1 127 ? 57.633  36.582  29.059  1.00 35.51 ? 153 GLY C CA  1 
ATOM 3069 C C   . GLY C 1 127 ? 56.584  36.605  30.158  1.00 35.66 ? 153 GLY C C   1 
ATOM 3070 O O   . GLY C 1 127 ? 56.866  36.230  31.294  1.00 35.59 ? 153 GLY C O   1 
ATOM 3071 N N   . THR C 1 128 ? 55.374  37.044  29.823  1.00 35.89 ? 154 THR C N   1 
ATOM 3072 C CA  . THR C 1 128 ? 54.263  37.047  30.780  1.00 36.19 ? 154 THR C CA  1 
ATOM 3073 C C   . THR C 1 128 ? 53.579  35.674  30.835  1.00 36.24 ? 154 THR C C   1 
ATOM 3074 O O   . THR C 1 128 ? 52.896  35.352  31.809  1.00 36.21 ? 154 THR C O   1 
ATOM 3075 C CB  . THR C 1 128 ? 53.231  38.162  30.459  1.00 36.25 ? 154 THR C CB  1 
ATOM 3076 O OG1 . THR C 1 128 ? 53.916  39.401  30.246  1.00 36.20 ? 154 THR C OG1 1 
ATOM 3077 C CG2 . THR C 1 128 ? 52.224  38.342  31.599  1.00 36.32 ? 154 THR C CG2 1 
ATOM 3078 N N   . GLY C 1 129 ? 53.774  34.871  29.791  1.00 36.33 ? 155 GLY C N   1 
ATOM 3079 C CA  . GLY C 1 129 ? 53.214  33.523  29.732  1.00 36.52 ? 155 GLY C CA  1 
ATOM 3080 C C   . GLY C 1 129 ? 51.970  33.454  28.872  1.00 36.67 ? 155 GLY C C   1 
ATOM 3081 O O   . GLY C 1 129 ? 51.940  34.019  27.779  1.00 36.76 ? 155 GLY C O   1 
ATOM 3082 N N   . CYS C 1 130 ? 50.947  32.757  29.367  1.00 36.82 ? 156 CYS C N   1 
ATOM 3083 C CA  . CYS C 1 130 ? 49.672  32.645  28.663  1.00 37.04 ? 156 CYS C CA  1 
ATOM 3084 C C   . CYS C 1 130 ? 48.615  33.535  29.281  1.00 37.12 ? 156 CYS C C   1 
ATOM 3085 O O   . CYS C 1 130 ? 48.563  33.707  30.501  1.00 36.96 ? 156 CYS C O   1 
ATOM 3086 C CB  . CYS C 1 130 ? 49.171  31.205  28.614  1.00 36.95 ? 156 CYS C CB  1 
ATOM 3087 S SG  . CYS C 1 130 ? 50.172  30.109  27.597  1.00 38.05 ? 156 CYS C SG  1 
ATOM 3088 N N   . VAL C 1 131 ? 47.779  34.092  28.406  1.00 37.30 ? 157 VAL C N   1 
ATOM 3089 C CA  . VAL C 1 131 ? 46.717  35.011  28.778  1.00 37.53 ? 157 VAL C CA  1 
ATOM 3090 C C   . VAL C 1 131 ? 45.371  34.422  28.359  1.00 37.77 ? 157 VAL C C   1 
ATOM 3091 O O   . VAL C 1 131 ? 45.229  33.896  27.251  1.00 37.77 ? 157 VAL C O   1 
ATOM 3092 C CB  . VAL C 1 131 ? 46.898  36.387  28.094  1.00 37.53 ? 157 VAL C CB  1 
ATOM 3093 C CG1 . VAL C 1 131 ? 45.822  37.375  28.552  1.00 37.78 ? 157 VAL C CG1 1 
ATOM 3094 C CG2 . VAL C 1 131 ? 48.282  36.945  28.359  1.00 37.38 ? 157 VAL C CG2 1 
ATOM 3095 N N   . ILE C 1 132 ? 44.392  34.513  29.254  1.00 37.93 ? 158 ILE C N   1 
ATOM 3096 C CA  . ILE C 1 132 ? 43.034  34.083  28.957  1.00 38.34 ? 158 ILE C CA  1 
ATOM 3097 C C   . ILE C 1 132 ? 42.087  35.284  28.975  1.00 38.36 ? 158 ILE C C   1 
ATOM 3098 O O   . ILE C 1 132 ? 41.908  35.927  30.017  1.00 38.31 ? 158 ILE C O   1 
ATOM 3099 C CB  . ILE C 1 132 ? 42.544  32.990  29.945  1.00 38.44 ? 158 ILE C CB  1 
ATOM 3100 C CG1 . ILE C 1 132 ? 43.302  31.676  29.736  1.00 38.66 ? 158 ILE C CG1 1 
ATOM 3101 C CG2 . ILE C 1 132 ? 41.065  32.717  29.757  1.00 38.64 ? 158 ILE C CG2 1 
ATOM 3102 C CD1 . ILE C 1 132 ? 44.640  31.601  30.429  1.00 38.85 ? 158 ILE C CD1 1 
ATOM 3103 N N   . LEU C 1 133 ? 41.506  35.595  27.815  1.00 38.30 ? 159 LEU C N   1 
ATOM 3104 C CA  . LEU C 1 133 ? 40.445  36.597  27.739  1.00 38.34 ? 159 LEU C CA  1 
ATOM 3105 C C   . LEU C 1 133 ? 39.121  35.909  28.050  1.00 38.45 ? 159 LEU C C   1 
ATOM 3106 O O   . LEU C 1 133 ? 38.811  34.868  27.481  1.00 38.70 ? 159 LEU C O   1 
ATOM 3107 C CB  . LEU C 1 133 ? 40.384  37.248  26.361  1.00 38.37 ? 159 LEU C CB  1 
ATOM 3108 C CG  . LEU C 1 133 ? 41.604  37.846  25.644  1.00 38.18 ? 159 LEU C CG  1 
ATOM 3109 C CD1 . LEU C 1 133 ? 41.155  38.315  24.277  1.00 38.39 ? 159 LEU C CD1 1 
ATOM 3110 C CD2 . LEU C 1 133 ? 42.242  38.994  26.395  1.00 38.10 ? 159 LEU C CD2 1 
ATOM 3111 N N   . LYS C 1 134 ? 38.357  36.483  28.969  1.00 38.65 ? 160 LYS C N   1 
ATOM 3112 C CA  . LYS C 1 134 ? 37.126  35.861  29.457  1.00 38.79 ? 160 LYS C CA  1 
ATOM 3113 C C   . LYS C 1 134 ? 35.948  36.799  29.260  1.00 38.80 ? 160 LYS C C   1 
ATOM 3114 O O   . LYS C 1 134 ? 36.011  37.981  29.625  1.00 39.11 ? 160 LYS C O   1 
ATOM 3115 C CB  . LYS C 1 134 ? 37.245  35.517  30.948  1.00 38.84 ? 160 LYS C CB  1 
ATOM 3116 C CG  . LYS C 1 134 ? 38.075  34.289  31.271  1.00 38.81 ? 160 LYS C CG  1 
ATOM 3117 C CD  . LYS C 1 134 ? 37.675  33.728  32.626  1.00 39.48 ? 160 LYS C CD  1 
ATOM 3118 C CE  . LYS C 1 134 ? 38.289  32.358  32.892  1.00 40.67 ? 160 LYS C CE  1 
ATOM 3119 N NZ  . LYS C 1 134 ? 39.741  32.431  33.250  1.00 41.34 ? 160 LYS C NZ  1 
ATOM 3120 N N   . ALA C 1 135 ? 34.879  36.278  28.678  1.00 38.58 ? 161 ALA C N   1 
ATOM 3121 C CA  . ALA C 1 135 ? 33.681  37.063  28.497  1.00 38.77 ? 161 ALA C CA  1 
ATOM 3122 C C   . ALA C 1 135 ? 32.504  36.388  29.162  1.00 39.15 ? 161 ALA C C   1 
ATOM 3123 O O   . ALA C 1 135 ? 32.427  35.160  29.207  1.00 39.46 ? 161 ALA C O   1 
ATOM 3124 C CB  . ALA C 1 135 ? 33.402  37.273  27.031  1.00 38.81 ? 161 ALA C CB  1 
ATOM 3125 N N   . SER C 1 136 ? 31.598  37.199  29.697  1.00 39.57 ? 162 SER C N   1 
ATOM 3126 C CA  . SER C 1 136 ? 30.280  36.727  30.103  1.00 39.97 ? 162 SER C CA  1 
ATOM 3127 C C   . SER C 1 136 ? 29.278  37.465  29.226  1.00 40.25 ? 162 SER C C   1 
ATOM 3128 O O   . SER C 1 136 ? 29.598  38.512  28.678  1.00 40.19 ? 162 SER C O   1 
ATOM 3129 C CB  . SER C 1 136 ? 30.027  36.988  31.589  1.00 39.93 ? 162 SER C CB  1 
ATOM 3130 O OG  . SER C 1 136 ? 29.319  38.197  31.796  1.00 40.28 ? 162 SER C OG  1 
ATOM 3131 N N   . ILE C 1 137 ? 28.079  36.911  29.078  1.00 40.72 ? 163 ILE C N   1 
ATOM 3132 C CA  . ILE C 1 137 ? 27.079  37.456  28.159  1.00 40.92 ? 163 ILE C CA  1 
ATOM 3133 C C   . ILE C 1 137 ? 25.720  37.507  28.851  1.00 40.91 ? 163 ILE C C   1 
ATOM 3134 O O   . ILE C 1 137 ? 25.313  36.556  29.521  1.00 40.61 ? 163 ILE C O   1 
ATOM 3135 C CB  . ILE C 1 137 ? 26.980  36.580  26.859  1.00 41.07 ? 163 ILE C CB  1 
ATOM 3136 C CG1 . ILE C 1 137 ? 28.190  36.792  25.937  1.00 41.23 ? 163 ILE C CG1 1 
ATOM 3137 C CG2 . ILE C 1 137 ? 25.675  36.837  26.088  1.00 41.62 ? 163 ILE C CG2 1 
ATOM 3138 C CD1 . ILE C 1 137 ? 28.159  38.071  25.091  1.00 41.31 ? 163 ILE C CD1 1 
ATOM 3139 N N   . VAL C 1 138 ? 25.019  38.621  28.698  1.00 41.04 ? 164 VAL C N   1 
ATOM 3140 C CA  . VAL C 1 138 ? 23.629  38.651  29.108  1.00 41.42 ? 164 VAL C CA  1 
ATOM 3141 C C   . VAL C 1 138 ? 22.705  39.001  27.954  1.00 41.74 ? 164 VAL C C   1 
ATOM 3142 O O   . VAL C 1 138 ? 22.890  39.985  27.238  1.00 41.46 ? 164 VAL C O   1 
ATOM 3143 C CB  . VAL C 1 138 ? 23.370  39.512  30.380  1.00 41.37 ? 164 VAL C CB  1 
ATOM 3144 C CG1 . VAL C 1 138 ? 23.831  40.941  30.197  1.00 41.03 ? 164 VAL C CG1 1 
ATOM 3145 C CG2 . VAL C 1 138 ? 21.893  39.456  30.775  1.00 41.25 ? 164 VAL C CG2 1 
ATOM 3146 N N   . GLN C 1 139 ? 21.715  38.143  27.784  1.00 42.52 ? 165 GLN C N   1 
ATOM 3147 C CA  . GLN C 1 139 ? 20.751  38.248  26.719  1.00 43.34 ? 165 GLN C CA  1 
ATOM 3148 C C   . GLN C 1 139 ? 19.428  37.942  27.382  1.00 43.58 ? 165 GLN C C   1 
ATOM 3149 O O   . GLN C 1 139 ? 19.170  36.793  27.765  1.00 43.77 ? 165 GLN C O   1 
ATOM 3150 C CB  . GLN C 1 139 ? 21.079  37.202  25.660  1.00 43.44 ? 165 GLN C CB  1 
ATOM 3151 C CG  . GLN C 1 139 ? 20.080  37.088  24.545  1.00 44.89 ? 165 GLN C CG  1 
ATOM 3152 C CD  . GLN C 1 139 ? 19.995  35.674  24.023  1.00 46.95 ? 165 GLN C CD  1 
ATOM 3153 O OE1 . GLN C 1 139 ? 20.373  34.723  24.717  1.00 47.73 ? 165 GLN C OE1 1 
ATOM 3154 N NE2 . GLN C 1 139 ? 19.490  35.518  22.796  1.00 47.69 ? 165 GLN C NE2 1 
ATOM 3155 N N   . LYS C 1 140 ? 18.598  38.974  27.534  1.00 43.73 ? 166 LYS C N   1 
ATOM 3156 C CA  . LYS C 1 140 ? 17.383  38.884  28.364  1.00 43.93 ? 166 LYS C CA  1 
ATOM 3157 C C   . LYS C 1 140 ? 17.786  38.763  29.841  1.00 43.36 ? 166 LYS C C   1 
ATOM 3158 O O   . LYS C 1 140 ? 18.638  39.518  30.297  1.00 43.70 ? 166 LYS C O   1 
ATOM 3159 C CB  . LYS C 1 140 ? 16.454  37.743  27.906  1.00 43.81 ? 166 LYS C CB  1 
ATOM 3160 C CG  . LYS C 1 140 ? 15.878  37.936  26.503  1.00 44.46 ? 166 LYS C CG  1 
ATOM 3161 C CD  . LYS C 1 140 ? 15.278  36.640  25.946  1.00 45.03 ? 166 LYS C CD  1 
ATOM 3162 C CE  . LYS C 1 140 ? 14.727  36.843  24.528  1.00 46.64 ? 166 LYS C CE  1 
ATOM 3163 N NZ  . LYS C 1 140 ? 13.958  35.659  24.031  1.00 46.83 ? 166 LYS C NZ  1 
ATOM 3164 N N   . ARG C 1 141 ? 17.204  37.821  30.579  1.00 42.81 ? 167 ARG C N   1 
ATOM 3165 C CA  . ARG C 1 141 ? 17.450  37.724  32.022  1.00 42.23 ? 167 ARG C CA  1 
ATOM 3166 C C   . ARG C 1 141 ? 18.814  37.150  32.374  1.00 41.82 ? 167 ARG C C   1 
ATOM 3167 O O   . ARG C 1 141 ? 19.539  37.708  33.191  1.00 41.99 ? 167 ARG C O   1 
ATOM 3168 C CB  . ARG C 1 141 ? 16.375  36.881  32.717  1.00 42.09 ? 167 ARG C CB  1 
ATOM 3169 C CG  . ARG C 1 141 ? 15.016  37.527  32.788  1.00 41.97 ? 167 ARG C CG  1 
ATOM 3170 C CD  . ARG C 1 141 ? 14.250  37.044  34.009  1.00 42.04 ? 167 ARG C CD  1 
ATOM 3171 N NE  . ARG C 1 141 ? 14.480  37.911  35.165  1.00 41.51 ? 167 ARG C NE  1 
ATOM 3172 C CZ  . ARG C 1 141 ? 13.833  37.817  36.321  1.00 40.82 ? 167 ARG C CZ  1 
ATOM 3173 N NH1 . ARG C 1 141 ? 14.117  38.655  37.308  1.00 40.06 ? 167 ARG C NH1 1 
ATOM 3174 N NH2 . ARG C 1 141 ? 12.908  36.884  36.494  1.00 41.23 ? 167 ARG C NH2 1 
ATOM 3175 N N   . ILE C 1 142 ? 19.157  36.036  31.742  1.00 41.34 ? 168 ILE C N   1 
ATOM 3176 C CA  . ILE C 1 142 ? 20.205  35.164  32.242  1.00 40.71 ? 168 ILE C CA  1 
ATOM 3177 C C   . ILE C 1 142 ? 21.617  35.557  31.794  1.00 40.26 ? 168 ILE C C   1 
ATOM 3178 O O   . ILE C 1 142 ? 21.855  35.791  30.608  1.00 40.30 ? 168 ILE C O   1 
ATOM 3179 C CB  . ILE C 1 142 ? 19.870  33.689  31.900  1.00 41.13 ? 168 ILE C CB  1 
ATOM 3180 C CG1 . ILE C 1 142 ? 18.426  33.371  32.334  1.00 40.70 ? 168 ILE C CG1 1 
ATOM 3181 C CG2 . ILE C 1 142 ? 20.880  32.731  32.555  1.00 41.72 ? 168 ILE C CG2 1 
ATOM 3182 C CD1 . ILE C 1 142 ? 17.940  31.974  32.020  1.00 40.32 ? 168 ILE C CD1 1 
ATOM 3183 N N   . ILE C 1 143 ? 22.533  35.640  32.763  1.00 39.66 ? 169 ILE C N   1 
ATOM 3184 C CA  . ILE C 1 143 ? 23.956  35.895  32.511  1.00 39.17 ? 169 ILE C CA  1 
ATOM 3185 C C   . ILE C 1 143 ? 24.723  34.585  32.319  1.00 39.03 ? 169 ILE C C   1 
ATOM 3186 O O   . ILE C 1 143 ? 24.850  33.805  33.255  1.00 39.03 ? 169 ILE C O   1 
ATOM 3187 C CB  . ILE C 1 143 ? 24.642  36.654  33.687  1.00 39.20 ? 169 ILE C CB  1 
ATOM 3188 C CG1 . ILE C 1 143 ? 23.896  37.940  34.061  1.00 39.23 ? 169 ILE C CG1 1 
ATOM 3189 C CG2 . ILE C 1 143 ? 26.099  36.965  33.348  1.00 38.87 ? 169 ILE C CG2 1 
ATOM 3190 C CD1 . ILE C 1 143 ? 24.302  38.515  35.428  1.00 38.73 ? 169 ILE C CD1 1 
ATOM 3191 N N   . TYR C 1 144 ? 25.249  34.357  31.118  1.00 38.90 ? 170 TYR C N   1 
ATOM 3192 C CA  . TYR C 1 144 ? 26.098  33.187  30.851  1.00 38.82 ? 170 TYR C CA  1 
ATOM 3193 C C   . TYR C 1 144 ? 27.561  33.509  31.104  1.00 38.42 ? 170 TYR C C   1 
ATOM 3194 O O   . TYR C 1 144 ? 27.980  34.654  30.946  1.00 38.68 ? 170 TYR C O   1 
ATOM 3195 C CB  . TYR C 1 144 ? 25.921  32.692  29.413  1.00 39.08 ? 170 TYR C CB  1 
ATOM 3196 C CG  . TYR C 1 144 ? 24.488  32.371  29.060  1.00 39.97 ? 170 TYR C CG  1 
ATOM 3197 C CD1 . TYR C 1 144 ? 23.658  33.342  28.503  1.00 40.28 ? 170 TYR C CD1 1 
ATOM 3198 C CD2 . TYR C 1 144 ? 23.954  31.099  29.291  1.00 40.42 ? 170 TYR C CD2 1 
ATOM 3199 C CE1 . TYR C 1 144 ? 22.336  33.065  28.181  1.00 40.50 ? 170 TYR C CE1 1 
ATOM 3200 C CE2 . TYR C 1 144 ? 22.625  30.805  28.970  1.00 40.71 ? 170 TYR C CE2 1 
ATOM 3201 C CZ  . TYR C 1 144 ? 21.824  31.799  28.414  1.00 41.03 ? 170 TYR C CZ  1 
ATOM 3202 O OH  . TYR C 1 144 ? 20.510  31.538  28.084  1.00 40.96 ? 170 TYR C OH  1 
ATOM 3203 N N   . PHE C 1 145 ? 28.329  32.495  31.500  1.00 37.91 ? 171 PHE C N   1 
ATOM 3204 C CA  . PHE C 1 145 ? 29.785  32.608  31.710  1.00 37.08 ? 171 PHE C CA  1 
ATOM 3205 C C   . PHE C 1 145 ? 30.428  31.218  31.733  1.00 36.91 ? 171 PHE C C   1 
ATOM 3206 O O   . PHE C 1 145 ? 29.735  30.203  31.851  1.00 37.03 ? 171 PHE C O   1 
ATOM 3207 C CB  . PHE C 1 145 ? 30.106  33.369  33.006  1.00 36.66 ? 171 PHE C CB  1 
ATOM 3208 C CG  . PHE C 1 145 ? 29.881  32.570  34.265  1.00 36.21 ? 171 PHE C CG  1 
ATOM 3209 C CD1 . PHE C 1 145 ? 28.641  32.578  34.899  1.00 36.30 ? 171 PHE C CD1 1 
ATOM 3210 C CD2 . PHE C 1 145 ? 30.910  31.818  34.826  1.00 35.73 ? 171 PHE C CD2 1 
ATOM 3211 C CE1 . PHE C 1 145 ? 28.422  31.839  36.068  1.00 35.37 ? 171 PHE C CE1 1 
ATOM 3212 C CE2 . PHE C 1 145 ? 30.701  31.079  35.992  1.00 35.51 ? 171 PHE C CE2 1 
ATOM 3213 C CZ  . PHE C 1 145 ? 29.456  31.093  36.613  1.00 35.50 ? 171 PHE C CZ  1 
ATOM 3214 N N   . GLN C 1 146 ? 31.753  31.171  31.649  1.00 36.67 ? 172 GLN C N   1 
ATOM 3215 C CA  . GLN C 1 146 ? 32.463  29.897  31.536  1.00 36.23 ? 172 GLN C CA  1 
ATOM 3216 C C   . GLN C 1 146 ? 33.943  30.030  31.862  1.00 36.21 ? 172 GLN C C   1 
ATOM 3217 O O   . GLN C 1 146 ? 34.447  31.132  32.073  1.00 36.32 ? 172 GLN C O   1 
ATOM 3218 C CB  . GLN C 1 146 ? 32.312  29.336  30.116  1.00 36.29 ? 172 GLN C CB  1 
ATOM 3219 C CG  . GLN C 1 146 ? 32.851  30.268  29.035  1.00 35.67 ? 172 GLN C CG  1 
ATOM 3220 C CD  . GLN C 1 146 ? 32.801  29.672  27.647  1.00 35.62 ? 172 GLN C CD  1 
ATOM 3221 O OE1 . GLN C 1 146 ? 31.835  29.008  27.269  1.00 34.60 ? 172 GLN C OE1 1 
ATOM 3222 N NE2 . GLN C 1 146 ? 33.843  29.918  26.875  1.00 34.46 ? 172 GLN C NE2 1 
ATOM 3223 N N   . ASP C 1 147 ? 34.631  28.893  31.886  1.00 36.06 ? 173 ASP C N   1 
ATOM 3224 C CA  . ASP C 1 147 ? 36.081  28.859  32.010  1.00 35.90 ? 173 ASP C CA  1 
ATOM 3225 C C   . ASP C 1 147 ? 36.735  28.356  30.714  1.00 35.84 ? 173 ASP C C   1 
ATOM 3226 O O   . ASP C 1 147 ? 37.832  28.778  30.369  1.00 36.04 ? 173 ASP C O   1 
ATOM 3227 C CB  . ASP C 1 147 ? 36.488  28.020  33.229  1.00 35.89 ? 173 ASP C CB  1 
ATOM 3228 C CG  . ASP C 1 147 ? 36.019  28.636  34.551  1.00 35.77 ? 173 ASP C CG  1 
ATOM 3229 O OD1 . ASP C 1 147 ? 36.043  29.879  34.685  1.00 35.75 ? 173 ASP C OD1 1 
ATOM 3230 O OD2 . ASP C 1 147 ? 35.628  27.880  35.462  1.00 35.81 ? 173 ASP C OD2 1 
ATOM 3231 N N   . GLU C 1 148 ? 36.045  27.475  29.994  1.00 35.82 ? 174 GLU C N   1 
ATOM 3232 C CA  . GLU C 1 148 ? 36.495  26.997  28.683  1.00 35.75 ? 174 GLU C CA  1 
ATOM 3233 C C   . GLU C 1 148 ? 35.376  27.070  27.634  1.00 35.65 ? 174 GLU C C   1 
ATOM 3234 O O   . GLU C 1 148 ? 34.207  26.851  27.951  1.00 35.56 ? 174 GLU C O   1 
ATOM 3235 C CB  . GLU C 1 148 ? 37.018  25.565  28.786  1.00 35.81 ? 174 GLU C CB  1 
ATOM 3236 C CG  . GLU C 1 148 ? 38.445  25.444  29.321  1.00 36.09 ? 174 GLU C CG  1 
ATOM 3237 C CD  . GLU C 1 148 ? 38.988  24.024  29.223  1.00 35.90 ? 174 GLU C CD  1 
ATOM 3238 O OE1 . GLU C 1 148 ? 38.432  23.119  29.878  1.00 35.90 ? 174 GLU C OE1 1 
ATOM 3239 O OE2 . GLU C 1 148 ? 39.976  23.810  28.492  1.00 36.55 ? 174 GLU C OE2 1 
ATOM 3240 N N   . GLY C 1 149 ? 35.744  27.378  26.389  1.00 35.64 ? 175 GLY C N   1 
ATOM 3241 C CA  . GLY C 1 149 ? 34.780  27.500  25.285  1.00 35.53 ? 175 GLY C CA  1 
ATOM 3242 C C   . GLY C 1 149 ? 34.872  28.784  24.477  1.00 35.44 ? 175 GLY C C   1 
ATOM 3243 O O   . GLY C 1 149 ? 35.856  29.524  24.580  1.00 35.50 ? 175 GLY C O   1 
ATOM 3244 N N   . SER C 1 150 ? 33.831  29.063  23.694  1.00 35.41 ? 176 SER C N   1 
ATOM 3245 C CA  . SER C 1 150 ? 33.841  30.190  22.745  1.00 35.69 ? 176 SER C CA  1 
ATOM 3246 C C   . SER C 1 150 ? 33.861  31.605  23.354  1.00 36.24 ? 176 SER C C   1 
ATOM 3247 O O   . SER C 1 150 ? 34.183  32.570  22.663  1.00 36.49 ? 176 SER C O   1 
ATOM 3248 C CB  . SER C 1 150 ? 32.700  30.054  21.733  1.00 35.63 ? 176 SER C CB  1 
ATOM 3249 O OG  . SER C 1 150 ? 31.450  29.864  22.371  1.00 35.24 ? 176 SER C OG  1 
ATOM 3250 N N   . LEU C 1 151 ? 33.519  31.729  24.636  1.00 36.83 ? 177 LEU C N   1 
ATOM 3251 C CA  . LEU C 1 151 ? 33.648  32.991  25.376  1.00 36.97 ? 177 LEU C CA  1 
ATOM 3252 C C   . LEU C 1 151 ? 35.006  33.096  26.078  1.00 37.24 ? 177 LEU C C   1 
ATOM 3253 O O   . LEU C 1 151 ? 35.211  33.953  26.943  1.00 37.16 ? 177 LEU C O   1 
ATOM 3254 C CB  . LEU C 1 151 ? 32.536  33.104  26.412  1.00 36.99 ? 177 LEU C CB  1 
ATOM 3255 C CG  . LEU C 1 151 ? 31.120  33.202  25.860  1.00 37.50 ? 177 LEU C CG  1 
ATOM 3256 C CD1 . LEU C 1 151 ? 30.109  32.845  26.929  1.00 37.35 ? 177 LEU C CD1 1 
ATOM 3257 C CD2 . LEU C 1 151 ? 30.878  34.605  25.316  1.00 38.51 ? 177 LEU C CD2 1 
ATOM 3258 N N   . THR C 1 152 ? 35.931  32.224  25.692  1.00 37.54 ? 178 THR C N   1 
ATOM 3259 C CA  . THR C 1 152 ? 37.238  32.149  26.312  1.00 38.02 ? 178 THR C CA  1 
ATOM 3260 C C   . THR C 1 152 ? 38.316  32.007  25.235  1.00 38.28 ? 178 THR C C   1 
ATOM 3261 O O   . THR C 1 152 ? 38.279  31.059  24.449  1.00 38.52 ? 178 THR C O   1 
ATOM 3262 C CB  . THR C 1 152 ? 37.269  30.968  27.326  1.00 38.08 ? 178 THR C CB  1 
ATOM 3263 O OG1 . THR C 1 152 ? 36.420  31.284  28.437  1.00 37.81 ? 178 THR C OG1 1 
ATOM 3264 C CG2 . THR C 1 152 ? 38.680  30.688  27.833  1.00 37.98 ? 178 THR C CG2 1 
ATOM 3265 N N   . LYS C 1 153 ? 39.255  32.953  25.191  1.00 38.49 ? 179 LYS C N   1 
ATOM 3266 C CA  . LYS C 1 153 ? 40.392  32.886  24.256  1.00 39.04 ? 179 LYS C CA  1 
ATOM 3267 C C   . LYS C 1 153 ? 41.750  32.881  24.970  1.00 39.13 ? 179 LYS C C   1 
ATOM 3268 O O   . LYS C 1 153 ? 42.079  33.832  25.693  1.00 39.21 ? 179 LYS C O   1 
ATOM 3269 C CB  . LYS C 1 153 ? 40.356  34.045  23.250  1.00 39.29 ? 179 LYS C CB  1 
ATOM 3270 C CG  . LYS C 1 153 ? 41.540  34.071  22.264  1.00 39.55 ? 179 LYS C CG  1 
ATOM 3271 C CD  . LYS C 1 153 ? 41.184  33.408  20.939  1.00 40.67 ? 179 LYS C CD  1 
ATOM 3272 C CE  . LYS C 1 153 ? 42.414  33.066  20.112  1.00 40.95 ? 179 LYS C CE  1 
ATOM 3273 N NZ  . LYS C 1 153 ? 42.883  31.666  20.370  1.00 40.05 ? 179 LYS C NZ  1 
ATOM 3274 N N   . LYS C 1 154 ? 42.530  31.821  24.742  1.00 39.00 ? 180 LYS C N   1 
ATOM 3275 C CA  . LYS C 1 154 ? 43.887  31.702  25.282  1.00 39.22 ? 180 LYS C CA  1 
ATOM 3276 C C   . LYS C 1 154 ? 44.952  32.117  24.264  1.00 39.12 ? 180 LYS C C   1 
ATOM 3277 O O   . LYS C 1 154 ? 44.952  31.634  23.129  1.00 39.10 ? 180 LYS C O   1 
ATOM 3278 C CB  . LYS C 1 154 ? 44.148  30.273  25.753  1.00 39.42 ? 180 LYS C CB  1 
ATOM 3279 C CG  . LYS C 1 154 ? 43.041  29.729  26.648  1.00 40.17 ? 180 LYS C CG  1 
ATOM 3280 C CD  . LYS C 1 154 ? 43.037  28.207  26.733  1.00 40.37 ? 180 LYS C CD  1 
ATOM 3281 C CE  . LYS C 1 154 ? 41.688  27.692  27.239  1.00 40.24 ? 180 LYS C CE  1 
ATOM 3282 N NZ  . LYS C 1 154 ? 41.286  28.298  28.545  1.00 39.90 ? 180 LYS C NZ  1 
ATOM 3283 N N   . LEU C 1 155 ? 45.845  33.015  24.685  1.00 38.96 ? 181 LEU C N   1 
ATOM 3284 C CA  . LEU C 1 155 ? 46.967  33.491  23.866  1.00 38.76 ? 181 LEU C CA  1 
ATOM 3285 C C   . LEU C 1 155 ? 48.281  33.523  24.649  1.00 38.69 ? 181 LEU C C   1 
ATOM 3286 O O   . LEU C 1 155 ? 48.336  34.047  25.764  1.00 38.46 ? 181 LEU C O   1 
ATOM 3287 C CB  . LEU C 1 155 ? 46.677  34.895  23.344  1.00 39.02 ? 181 LEU C CB  1 
ATOM 3288 C CG  . LEU C 1 155 ? 46.107  35.111  21.945  1.00 39.39 ? 181 LEU C CG  1 
ATOM 3289 C CD1 . LEU C 1 155 ? 45.660  36.556  21.823  1.00 39.47 ? 181 LEU C CD1 1 
ATOM 3290 C CD2 . LEU C 1 155 ? 47.137  34.776  20.867  1.00 39.72 ? 181 LEU C CD2 1 
ATOM 3291 N N   . CYS C 1 156 ? 49.343  32.988  24.049  1.00 38.77 ? 182 CYS C N   1 
ATOM 3292 C CA  . CYS C 1 156 ? 50.654  32.888  24.714  1.00 38.86 ? 182 CYS C CA  1 
ATOM 3293 C C   . CYS C 1 156 ? 51.797  33.626  23.988  1.00 38.71 ? 182 CYS C C   1 
ATOM 3294 O O   . CYS C 1 156 ? 51.636  34.060  22.845  1.00 38.52 ? 182 CYS C O   1 
ATOM 3295 C CB  . CYS C 1 156 ? 51.004  31.419  24.965  1.00 38.82 ? 182 CYS C CB  1 
ATOM 3296 S SG  . CYS C 1 156 ? 49.619  30.488  25.670  1.00 39.43 ? 182 CYS C SG  1 
ATOM 3297 N N   . GLU C 1 157 ? 52.936  33.766  24.668  1.00 38.65 ? 183 GLU C N   1 
ATOM 3298 C CA  . GLU C 1 157 ? 54.025  34.642  24.220  1.00 38.84 ? 183 GLU C CA  1 
ATOM 3299 C C   . GLU C 1 157 ? 54.911  34.079  23.108  1.00 39.06 ? 183 GLU C C   1 
ATOM 3300 O O   . GLU C 1 157 ? 55.431  34.840  22.287  1.00 39.10 ? 183 GLU C O   1 
ATOM 3301 C CB  . GLU C 1 157 ? 54.882  35.081  25.406  1.00 38.68 ? 183 GLU C CB  1 
ATOM 3302 N N   . GLN C 1 158 ? 55.083  32.759  23.081  1.00 39.39 ? 184 GLN C N   1 
ATOM 3303 C CA  . GLN C 1 158 ? 56.032  32.116  22.160  1.00 39.79 ? 184 GLN C CA  1 
ATOM 3304 C C   . GLN C 1 158 ? 55.611  32.246  20.697  1.00 39.95 ? 184 GLN C C   1 
ATOM 3305 C CB  . GLN C 1 158 ? 56.245  30.640  22.538  1.00 39.84 ? 184 GLN C CB  1 
ATOM 3306 N N   . PRO D 1 12  ? 37.184  -5.978  42.231  1.00 47.89 ? 38  PRO D N   1 
ATOM 3307 C CA  . PRO D 1 12  ? 36.159  -7.011  42.198  1.00 47.93 ? 38  PRO D CA  1 
ATOM 3308 C C   . PRO D 1 12  ? 34.974  -6.663  43.102  1.00 47.99 ? 38  PRO D C   1 
ATOM 3309 O O   . PRO D 1 12  ? 34.995  -6.968  44.296  1.00 48.00 ? 38  PRO D O   1 
ATOM 3310 C CB  . PRO D 1 12  ? 36.897  -8.246  42.724  1.00 47.89 ? 38  PRO D CB  1 
ATOM 3311 C CG  . PRO D 1 12  ? 38.376  -7.963  42.500  1.00 47.98 ? 38  PRO D CG  1 
ATOM 3312 C CD  . PRO D 1 12  ? 38.530  -6.538  42.036  1.00 47.83 ? 38  PRO D CD  1 
ATOM 3313 N N   . LYS D 1 13  ? 33.953  -6.028  42.527  1.00 48.06 ? 39  LYS D N   1 
ATOM 3314 C CA  . LYS D 1 13  ? 32.779  -5.584  43.282  1.00 48.23 ? 39  LYS D CA  1 
ATOM 3315 C C   . LYS D 1 13  ? 31.500  -5.658  42.451  1.00 48.36 ? 39  LYS D C   1 
ATOM 3316 O O   . LYS D 1 13  ? 31.454  -5.154  41.327  1.00 48.47 ? 39  LYS D O   1 
ATOM 3317 C CB  . LYS D 1 13  ? 32.990  -4.169  43.806  1.00 48.18 ? 39  LYS D CB  1 
ATOM 3318 N N   . SER D 1 14  ? 30.464  -6.273  43.020  1.00 48.53 ? 40  SER D N   1 
ATOM 3319 C CA  . SER D 1 14  ? 29.185  -6.459  42.329  1.00 48.72 ? 40  SER D CA  1 
ATOM 3320 C C   . SER D 1 14  ? 28.448  -5.142  42.133  1.00 48.92 ? 40  SER D C   1 
ATOM 3321 O O   . SER D 1 14  ? 28.074  -4.799  41.011  1.00 48.97 ? 40  SER D O   1 
ATOM 3322 C CB  . SER D 1 14  ? 28.299  -7.460  43.072  1.00 48.72 ? 40  SER D CB  1 
ATOM 3323 O OG  . SER D 1 14  ? 27.739  -6.884  44.236  1.00 48.68 ? 40  SER D OG  1 
ATOM 3324 N N   . GLU D 1 15  ? 28.230  -4.418  43.229  1.00 49.18 ? 41  GLU D N   1 
ATOM 3325 C CA  . GLU D 1 15  ? 27.742  -3.046  43.166  1.00 49.35 ? 41  GLU D CA  1 
ATOM 3326 C C   . GLU D 1 15  ? 28.906  -2.153  42.744  1.00 49.50 ? 41  GLU D C   1 
ATOM 3327 O O   . GLU D 1 15  ? 29.967  -2.165  43.378  1.00 49.36 ? 41  GLU D O   1 
ATOM 3328 C CB  . GLU D 1 15  ? 27.179  -2.612  44.515  1.00 49.30 ? 41  GLU D CB  1 
ATOM 3329 N N   . GLY D 1 16  ? 28.713  -1.399  41.664  1.00 49.71 ? 42  GLY D N   1 
ATOM 3330 C CA  . GLY D 1 16  ? 29.797  -0.618  41.078  1.00 50.06 ? 42  GLY D CA  1 
ATOM 3331 C C   . GLY D 1 16  ? 29.402  0.727   40.499  1.00 50.38 ? 42  GLY D C   1 
ATOM 3332 O O   . GLY D 1 16  ? 29.114  1.672   41.238  1.00 50.37 ? 42  GLY D O   1 
ATOM 3333 N N   . TYR D 1 17  ? 29.392  0.803   39.169  1.00 50.59 ? 43  TYR D N   1 
ATOM 3334 C CA  . TYR D 1 17  ? 29.233  2.067   38.450  1.00 50.69 ? 43  TYR D CA  1 
ATOM 3335 C C   . TYR D 1 17  ? 27.767  2.454   38.254  1.00 50.80 ? 43  TYR D C   1 
ATOM 3336 O O   . TYR D 1 17  ? 26.967  2.363   39.190  1.00 51.09 ? 43  TYR D O   1 
ATOM 3337 C CB  . TYR D 1 17  ? 29.961  2.000   37.112  1.00 50.66 ? 43  TYR D CB  1 
ATOM 3338 N N   . CYS D 1 18  ? 27.425  2.884   37.039  1.00 50.66 ? 44  CYS D N   1 
ATOM 3339 C CA  . CYS D 1 18  ? 26.056  3.247   36.673  1.00 50.39 ? 44  CYS D CA  1 
ATOM 3340 C C   . CYS D 1 18  ? 25.141  2.037   36.495  1.00 50.64 ? 44  CYS D C   1 
ATOM 3341 O O   . CYS D 1 18  ? 24.206  2.078   35.691  1.00 50.62 ? 44  CYS D O   1 
ATOM 3342 C CB  . CYS D 1 18  ? 26.073  4.043   35.376  1.00 50.15 ? 44  CYS D CB  1 
ATOM 3343 S SG  . CYS D 1 18  ? 26.832  5.641   35.525  1.00 49.50 ? 44  CYS D SG  1 
ATOM 3344 N N   . SER D 1 19  ? 25.404  0.973   37.254  1.00 50.92 ? 45  SER D N   1 
ATOM 3345 C CA  . SER D 1 19  ? 24.706  -0.305  37.108  1.00 51.05 ? 45  SER D CA  1 
ATOM 3346 C C   . SER D 1 19  ? 23.276  -0.276  37.645  1.00 51.16 ? 45  SER D C   1 
ATOM 3347 O O   . SER D 1 19  ? 22.795  -1.266  38.195  1.00 51.15 ? 45  SER D O   1 
ATOM 3348 C CB  . SER D 1 19  ? 25.504  -1.417  37.790  1.00 51.07 ? 45  SER D CB  1 
ATOM 3349 O OG  . SER D 1 19  ? 25.603  -1.178  39.182  1.00 51.18 ? 45  SER D OG  1 
ATOM 3350 N N   . ARG D 1 20  ? 22.615  0.870   37.495  1.00 51.40 ? 46  ARG D N   1 
ATOM 3351 C CA  . ARG D 1 20  ? 21.189  1.012   37.800  1.00 51.67 ? 46  ARG D CA  1 
ATOM 3352 C C   . ARG D 1 20  ? 20.459  1.451   36.540  1.00 51.46 ? 46  ARG D C   1 
ATOM 3353 O O   . ARG D 1 20  ? 19.260  1.204   36.387  1.00 51.71 ? 46  ARG D O   1 
ATOM 3354 C CB  . ARG D 1 20  ? 20.953  2.018   38.935  1.00 51.86 ? 46  ARG D CB  1 
ATOM 3355 C CG  . ARG D 1 20  ? 21.805  1.781   40.178  1.00 52.83 ? 46  ARG D CG  1 
ATOM 3356 C CD  . ARG D 1 20  ? 21.514  0.432   40.821  1.00 53.64 ? 46  ARG D CD  1 
ATOM 3357 N NE  . ARG D 1 20  ? 20.688  0.582   42.012  1.00 55.10 ? 46  ARG D NE  1 
ATOM 3358 C CZ  . ARG D 1 20  ? 21.143  0.515   43.261  1.00 55.81 ? 46  ARG D CZ  1 
ATOM 3359 N NH1 . ARG D 1 20  ? 22.429  0.285   43.503  1.00 55.83 ? 46  ARG D NH1 1 
ATOM 3360 N NH2 . ARG D 1 20  ? 20.303  0.669   44.278  1.00 56.57 ? 46  ARG D NH2 1 
ATOM 3361 N N   . ILE D 1 21  ? 21.201  2.111   35.653  1.00 51.02 ? 47  ILE D N   1 
ATOM 3362 C CA  . ILE D 1 21  ? 20.736  2.465   34.319  1.00 50.60 ? 47  ILE D CA  1 
ATOM 3363 C C   . ILE D 1 21  ? 20.890  1.262   33.390  1.00 50.21 ? 47  ILE D C   1 
ATOM 3364 O O   . ILE D 1 21  ? 21.962  0.660   33.307  1.00 50.01 ? 47  ILE D O   1 
ATOM 3365 C CB  . ILE D 1 21  ? 21.509  3.699   33.774  1.00 50.80 ? 47  ILE D CB  1 
ATOM 3366 C CG1 . ILE D 1 21  ? 21.018  4.974   34.468  1.00 51.01 ? 47  ILE D CG1 1 
ATOM 3367 C CG2 . ILE D 1 21  ? 21.353  3.835   32.260  1.00 50.76 ? 47  ILE D CG2 1 
ATOM 3368 C CD1 . ILE D 1 21  ? 22.076  6.020   34.642  1.00 51.21 ? 47  ILE D CD1 1 
ATOM 3369 N N   . LEU D 1 22  ? 19.798  0.912   32.716  1.00 49.86 ? 48  LEU D N   1 
ATOM 3370 C CA  . LEU D 1 22  ? 19.749  -0.211  31.789  1.00 49.45 ? 48  LEU D CA  1 
ATOM 3371 C C   . LEU D 1 22  ? 18.786  0.110   30.649  1.00 49.39 ? 48  LEU D C   1 
ATOM 3372 O O   . LEU D 1 22  ? 18.077  1.108   30.691  1.00 48.97 ? 48  LEU D O   1 
ATOM 3373 C CB  . LEU D 1 22  ? 19.293  -1.482  32.513  1.00 49.43 ? 48  LEU D CB  1 
ATOM 3374 C CG  . LEU D 1 22  ? 20.018  -1.962  33.778  1.00 49.40 ? 48  LEU D CG  1 
ATOM 3375 C CD1 . LEU D 1 22  ? 19.143  -2.925  34.557  1.00 48.64 ? 48  LEU D CD1 1 
ATOM 3376 C CD2 . LEU D 1 22  ? 21.364  -2.605  33.459  1.00 49.24 ? 48  LEU D CD2 1 
ATOM 3377 N N   . ARG D 1 23  ? 18.756  -0.746  29.633  1.00 49.77 ? 49  ARG D N   1 
ATOM 3378 C CA  . ARG D 1 23  ? 17.892  -0.539  28.473  1.00 50.03 ? 49  ARG D CA  1 
ATOM 3379 C C   . ARG D 1 23  ? 16.975  -1.724  28.243  1.00 50.29 ? 49  ARG D C   1 
ATOM 3380 O O   . ARG D 1 23  ? 17.435  -2.867  28.235  1.00 50.51 ? 49  ARG D O   1 
ATOM 3381 C CB  . ARG D 1 23  ? 18.733  -0.280  27.219  1.00 50.07 ? 49  ARG D CB  1 
ATOM 3382 C CG  . ARG D 1 23  ? 19.863  -1.277  26.998  1.00 50.24 ? 49  ARG D CG  1 
ATOM 3383 C CD  . ARG D 1 23  ? 20.882  -0.746  26.007  1.00 50.66 ? 49  ARG D CD  1 
ATOM 3384 N NE  . ARG D 1 23  ? 20.601  -1.144  24.629  1.00 50.50 ? 49  ARG D NE  1 
ATOM 3385 C CZ  . ARG D 1 23  ? 21.045  -0.491  23.557  1.00 50.55 ? 49  ARG D CZ  1 
ATOM 3386 N NH1 . ARG D 1 23  ? 21.783  0.606   23.693  1.00 50.25 ? 49  ARG D NH1 1 
ATOM 3387 N NH2 . ARG D 1 23  ? 20.740  -0.926  22.344  1.00 50.40 ? 49  ARG D NH2 1 
ATOM 3388 N N   . ALA D 1 24  ? 15.681  -1.452  28.070  1.00 50.52 ? 50  ALA D N   1 
ATOM 3389 C CA  . ALA D 1 24  ? 14.722  -2.480  27.649  1.00 50.84 ? 50  ALA D CA  1 
ATOM 3390 C C   . ALA D 1 24  ? 13.319  -1.938  27.365  1.00 51.03 ? 50  ALA D C   1 
ATOM 3391 O O   . ALA D 1 24  ? 12.974  -0.828  27.781  1.00 50.62 ? 50  ALA D O   1 
ATOM 3392 C CB  . ALA D 1 24  ? 14.665  -3.638  28.660  1.00 50.94 ? 50  ALA D CB  1 
ATOM 3393 N N   . GLN D 1 25  ? 12.527  -2.745  26.650  1.00 51.41 ? 51  GLN D N   1 
ATOM 3394 C CA  . GLN D 1 25  ? 11.158  -2.397  26.248  1.00 51.61 ? 51  GLN D CA  1 
ATOM 3395 C C   . GLN D 1 25  ? 10.214  -3.581  26.419  1.00 51.37 ? 51  GLN D C   1 
ATOM 3396 O O   . GLN D 1 25  ? 10.352  -4.597  25.739  1.00 51.29 ? 51  GLN D O   1 
ATOM 3397 C CB  . GLN D 1 25  ? 11.125  -1.919  24.790  1.00 51.68 ? 51  GLN D CB  1 
ATOM 3398 C CG  . GLN D 1 25  ? 11.763  -0.546  24.552  1.00 51.95 ? 51  GLN D CG  1 
ATOM 3399 C CD  . GLN D 1 25  ? 11.653  -0.081  23.107  1.00 51.93 ? 51  GLN D CD  1 
ATOM 3400 O OE1 . GLN D 1 25  ? 11.582  -0.895  22.176  1.00 52.19 ? 51  GLN D OE1 1 
ATOM 3401 N NE2 . GLN D 1 25  ? 11.639  1.235   22.913  1.00 51.23 ? 51  GLN D NE2 1 
ATOM 3402 N N   . GLY D 1 31  ? 5.125   3.695   23.895  1.00 47.63 ? 57  GLY D N   1 
ATOM 3403 C CA  . GLY D 1 31  ? 5.517   4.506   25.044  1.00 47.75 ? 57  GLY D CA  1 
ATOM 3404 C C   . GLY D 1 31  ? 4.519   5.605   25.366  1.00 47.69 ? 57  GLY D C   1 
ATOM 3405 O O   . GLY D 1 31  ? 3.307   5.412   25.234  1.00 47.63 ? 57  GLY D O   1 
ATOM 3406 N N   . TYR D 1 32  ? 5.036   6.757   25.793  1.00 47.57 ? 58  TYR D N   1 
ATOM 3407 C CA  . TYR D 1 32  ? 4.208   7.909   26.152  1.00 47.41 ? 58  TYR D CA  1 
ATOM 3408 C C   . TYR D 1 32  ? 4.683   9.158   25.418  1.00 47.14 ? 58  TYR D C   1 
ATOM 3409 O O   . TYR D 1 32  ? 5.788   9.647   25.657  1.00 47.27 ? 58  TYR D O   1 
ATOM 3410 C CB  . TYR D 1 32  ? 4.219   8.132   27.668  1.00 47.54 ? 58  TYR D CB  1 
ATOM 3411 C CG  . TYR D 1 32  ? 3.462   7.074   28.441  1.00 48.00 ? 58  TYR D CG  1 
ATOM 3412 C CD1 . TYR D 1 32  ? 4.089   5.891   28.844  1.00 48.58 ? 58  TYR D CD1 1 
ATOM 3413 C CD2 . TYR D 1 32  ? 2.114   7.253   28.772  1.00 48.26 ? 58  TYR D CD2 1 
ATOM 3414 C CE1 . TYR D 1 32  ? 3.389   4.909   29.555  1.00 48.45 ? 58  TYR D CE1 1 
ATOM 3415 C CE2 . TYR D 1 32  ? 1.408   6.279   29.484  1.00 48.06 ? 58  TYR D CE2 1 
ATOM 3416 C CZ  . TYR D 1 32  ? 2.052   5.112   29.869  1.00 48.05 ? 58  TYR D CZ  1 
ATOM 3417 O OH  . TYR D 1 32  ? 1.363   4.147   30.565  1.00 47.93 ? 58  TYR D OH  1 
ATOM 3418 N N   . THR D 1 33  ? 3.835   9.670   24.531  1.00 46.70 ? 59  THR D N   1 
ATOM 3419 C CA  . THR D 1 33  ? 4.211   10.749  23.621  1.00 46.32 ? 59  THR D CA  1 
ATOM 3420 C C   . THR D 1 33  ? 3.934   12.151  24.164  1.00 46.10 ? 59  THR D C   1 
ATOM 3421 O O   . THR D 1 33  ? 4.470   13.138  23.644  1.00 46.03 ? 59  THR D O   1 
ATOM 3422 C CB  . THR D 1 33  ? 3.528   10.590  22.258  1.00 46.28 ? 59  THR D CB  1 
ATOM 3423 O OG1 . THR D 1 33  ? 2.170   10.187  22.457  1.00 46.32 ? 59  THR D OG1 1 
ATOM 3424 C CG2 . THR D 1 33  ? 4.249   9.540   21.427  1.00 46.31 ? 59  THR D CG2 1 
ATOM 3425 N N   . GLU D 1 34  ? 3.106   12.237  25.203  1.00 45.66 ? 60  GLU D N   1 
ATOM 3426 C CA  . GLU D 1 34  ? 2.859   13.509  25.892  1.00 45.25 ? 60  GLU D CA  1 
ATOM 3427 C C   . GLU D 1 34  ? 4.145   14.079  26.507  1.00 44.98 ? 60  GLU D C   1 
ATOM 3428 O O   . GLU D 1 34  ? 4.246   15.284  26.763  1.00 44.94 ? 60  GLU D O   1 
ATOM 3429 C CB  . GLU D 1 34  ? 1.763   13.360  26.954  1.00 45.17 ? 60  GLU D CB  1 
ATOM 3430 C CG  . GLU D 1 34  ? 2.076   12.395  28.091  1.00 45.07 ? 60  GLU D CG  1 
ATOM 3431 C CD  . GLU D 1 34  ? 1.634   10.966  27.807  1.00 45.43 ? 60  GLU D CD  1 
ATOM 3432 O OE1 . GLU D 1 34  ? 1.894   10.460  26.691  1.00 45.29 ? 60  GLU D OE1 1 
ATOM 3433 O OE2 . GLU D 1 34  ? 1.032   10.345  28.712  1.00 45.23 ? 60  GLU D OE2 1 
ATOM 3434 N N   . PHE D 1 35  ? 5.116   13.196  26.736  1.00 44.53 ? 61  PHE D N   1 
ATOM 3435 C CA  . PHE D 1 35  ? 6.438   13.583  27.211  1.00 44.24 ? 61  PHE D CA  1 
ATOM 3436 C C   . PHE D 1 35  ? 7.457   13.452  26.080  1.00 44.17 ? 61  PHE D C   1 
ATOM 3437 O O   . PHE D 1 35  ? 7.468   12.448  25.363  1.00 44.17 ? 61  PHE D O   1 
ATOM 3438 C CB  . PHE D 1 35  ? 6.853   12.716  28.404  1.00 43.96 ? 61  PHE D CB  1 
ATOM 3439 C CG  . PHE D 1 35  ? 5.848   12.701  29.532  1.00 43.69 ? 61  PHE D CG  1 
ATOM 3440 C CD1 . PHE D 1 35  ? 5.076   11.569  29.778  1.00 42.76 ? 61  PHE D CD1 1 
ATOM 3441 C CD2 . PHE D 1 35  ? 5.676   13.813  30.354  1.00 43.08 ? 61  PHE D CD2 1 
ATOM 3442 C CE1 . PHE D 1 35  ? 4.152   11.548  30.819  1.00 42.00 ? 61  PHE D CE1 1 
ATOM 3443 C CE2 . PHE D 1 35  ? 4.746   13.793  31.400  1.00 42.52 ? 61  PHE D CE2 1 
ATOM 3444 C CZ  . PHE D 1 35  ? 3.989   12.661  31.629  1.00 42.05 ? 61  PHE D CZ  1 
ATOM 3445 N N   . SER D 1 36  ? 8.305   14.466  25.916  1.00 44.11 ? 62  SER D N   1 
ATOM 3446 C CA  . SER D 1 36  ? 9.300   14.467  24.838  1.00 44.15 ? 62  SER D CA  1 
ATOM 3447 C C   . SER D 1 36  ? 10.647  15.099  25.210  1.00 44.27 ? 62  SER D C   1 
ATOM 3448 O O   . SER D 1 36  ? 10.726  16.000  26.054  1.00 44.25 ? 62  SER D O   1 
ATOM 3449 C CB  . SER D 1 36  ? 8.735   15.125  23.571  1.00 44.02 ? 62  SER D CB  1 
ATOM 3450 O OG  . SER D 1 36  ? 8.727   16.536  23.681  1.00 43.81 ? 62  SER D OG  1 
ATOM 3451 N N   . LEU D 1 37  ? 11.696  14.609  24.555  1.00 44.42 ? 63  LEU D N   1 
ATOM 3452 C CA  . LEU D 1 37  ? 13.047  15.114  24.706  1.00 44.70 ? 63  LEU D CA  1 
ATOM 3453 C C   . LEU D 1 37  ? 13.492  15.751  23.402  1.00 45.27 ? 63  LEU D C   1 
ATOM 3454 O O   . LEU D 1 37  ? 13.476  15.106  22.355  1.00 45.43 ? 63  LEU D O   1 
ATOM 3455 C CB  . LEU D 1 37  ? 13.994  13.969  25.060  1.00 44.72 ? 63  LEU D CB  1 
ATOM 3456 C CG  . LEU D 1 37  ? 15.441  14.277  25.453  1.00 44.59 ? 63  LEU D CG  1 
ATOM 3457 C CD1 . LEU D 1 37  ? 15.499  14.978  26.802  1.00 44.16 ? 63  LEU D CD1 1 
ATOM 3458 C CD2 . LEU D 1 37  ? 16.238  12.987  25.493  1.00 44.53 ? 63  LEU D CD2 1 
ATOM 3459 N N   . ARG D 1 38  ? 13.886  17.019  23.461  1.00 45.87 ? 64  ARG D N   1 
ATOM 3460 C CA  . ARG D 1 38  ? 14.376  17.704  22.273  1.00 46.39 ? 64  ARG D CA  1 
ATOM 3461 C C   . ARG D 1 38  ? 15.621  18.546  22.536  1.00 46.43 ? 64  ARG D C   1 
ATOM 3462 O O   . ARG D 1 38  ? 15.823  19.050  23.635  1.00 46.34 ? 64  ARG D O   1 
ATOM 3463 C CB  . ARG D 1 38  ? 13.259  18.511  21.602  1.00 46.43 ? 64  ARG D CB  1 
ATOM 3464 C CG  . ARG D 1 38  ? 12.638  19.608  22.452  1.00 46.97 ? 64  ARG D CG  1 
ATOM 3465 C CD  . ARG D 1 38  ? 11.235  20.010  21.956  1.00 47.11 ? 64  ARG D CD  1 
ATOM 3466 N NE  . ARG D 1 38  ? 11.067  19.984  20.495  1.00 47.54 ? 64  ARG D NE  1 
ATOM 3467 C CZ  . ARG D 1 38  ? 11.618  20.846  19.640  1.00 48.00 ? 64  ARG D CZ  1 
ATOM 3468 N NH1 . ARG D 1 38  ? 11.385  20.725  18.338  1.00 48.05 ? 64  ARG D NH1 1 
ATOM 3469 N NH2 . ARG D 1 38  ? 12.411  21.822  20.072  1.00 48.36 ? 64  ARG D NH2 1 
ATOM 3470 N N   . VAL D 1 39  ? 16.458  18.671  21.512  1.00 46.85 ? 65  VAL D N   1 
ATOM 3471 C CA  . VAL D 1 39  ? 17.674  19.479  21.578  1.00 47.14 ? 65  VAL D CA  1 
ATOM 3472 C C   . VAL D 1 39  ? 17.455  20.737  20.750  1.00 47.47 ? 65  VAL D C   1 
ATOM 3473 O O   . VAL D 1 39  ? 17.321  20.659  19.530  1.00 47.59 ? 65  VAL D O   1 
ATOM 3474 C CB  . VAL D 1 39  ? 18.896  18.704  21.028  1.00 47.10 ? 65  VAL D CB  1 
ATOM 3475 C CG1 . VAL D 1 39  ? 20.166  19.534  21.167  1.00 46.54 ? 65  VAL D CG1 1 
ATOM 3476 C CG2 . VAL D 1 39  ? 19.039  17.348  21.730  1.00 46.79 ? 65  VAL D CG2 1 
ATOM 3477 N N   . GLU D 1 40  ? 17.413  21.892  21.406  1.00 47.88 ? 66  GLU D N   1 
ATOM 3478 C CA  . GLU D 1 40  ? 17.049  23.140  20.726  1.00 48.54 ? 66  GLU D CA  1 
ATOM 3479 C C   . GLU D 1 40  ? 17.862  23.344  19.449  1.00 48.42 ? 66  GLU D C   1 
ATOM 3480 O O   . GLU D 1 40  ? 19.076  23.135  19.435  1.00 48.40 ? 66  GLU D O   1 
ATOM 3481 C CB  . GLU D 1 40  ? 17.151  24.352  21.664  1.00 48.72 ? 66  GLU D CB  1 
ATOM 3482 C CG  . GLU D 1 40  ? 16.439  24.185  23.031  1.00 50.26 ? 66  GLU D CG  1 
ATOM 3483 C CD  . GLU D 1 40  ? 15.041  23.548  22.955  1.00 52.20 ? 66  GLU D CD  1 
ATOM 3484 O OE1 . GLU D 1 40  ? 14.711  22.731  23.849  1.00 52.40 ? 66  GLU D OE1 1 
ATOM 3485 O OE2 . GLU D 1 40  ? 14.276  23.854  22.010  1.00 53.14 ? 66  GLU D OE2 1 
ATOM 3486 N N   . GLY D 1 41  ? 17.171  23.718  18.377  1.00 48.44 ? 67  GLY D N   1 
ATOM 3487 C CA  . GLY D 1 41  ? 17.762  23.744  17.043  1.00 48.62 ? 67  GLY D CA  1 
ATOM 3488 C C   . GLY D 1 41  ? 17.508  22.447  16.292  1.00 48.77 ? 67  GLY D C   1 
ATOM 3489 O O   . GLY D 1 41  ? 17.567  22.416  15.063  1.00 48.84 ? 67  GLY D O   1 
ATOM 3490 N N   . ASP D 1 42  ? 17.226  21.383  17.046  1.00 48.86 ? 68  ASP D N   1 
ATOM 3491 C CA  . ASP D 1 42  ? 16.924  20.041  16.519  1.00 48.95 ? 68  ASP D CA  1 
ATOM 3492 C C   . ASP D 1 42  ? 17.974  19.504  15.545  1.00 48.80 ? 68  ASP D C   1 
ATOM 3493 O O   . ASP D 1 42  ? 17.626  18.994  14.481  1.00 48.88 ? 68  ASP D O   1 
ATOM 3494 C CB  . ASP D 1 42  ? 15.516  19.998  15.908  1.00 49.01 ? 68  ASP D CB  1 
ATOM 3495 C CG  . ASP D 1 42  ? 14.430  20.294  16.930  1.00 49.61 ? 68  ASP D CG  1 
ATOM 3496 O OD1 . ASP D 1 42  ? 14.279  19.509  17.896  1.00 50.34 ? 68  ASP D OD1 1 
ATOM 3497 O OD2 . ASP D 1 42  ? 13.729  21.314  16.768  1.00 50.08 ? 68  ASP D OD2 1 
ATOM 3498 N N   . PRO D 1 43  ? 19.261  19.566  15.933  1.00 48.68 ? 69  PRO D N   1 
ATOM 3499 C CA  . PRO D 1 43  ? 20.347  19.367  14.977  1.00 48.59 ? 69  PRO D CA  1 
ATOM 3500 C C   . PRO D 1 43  ? 20.689  17.894  14.771  1.00 48.48 ? 69  PRO D C   1 
ATOM 3501 O O   . PRO D 1 43  ? 20.009  17.024  15.311  1.00 48.25 ? 69  PRO D O   1 
ATOM 3502 C CB  . PRO D 1 43  ? 21.522  20.114  15.620  1.00 48.54 ? 69  PRO D CB  1 
ATOM 3503 C CG  . PRO D 1 43  ? 21.171  20.249  17.082  1.00 48.77 ? 69  PRO D CG  1 
ATOM 3504 C CD  . PRO D 1 43  ? 19.771  19.760  17.302  1.00 48.65 ? 69  PRO D CD  1 
ATOM 3505 N N   . ASP D 1 44  ? 21.726  17.623  13.981  1.00 48.45 ? 70  ASP D N   1 
ATOM 3506 C CA  . ASP D 1 44  ? 22.167  16.250  13.763  1.00 48.39 ? 70  ASP D CA  1 
ATOM 3507 C C   . ASP D 1 44  ? 23.691  16.135  13.722  1.00 48.25 ? 70  ASP D C   1 
ATOM 3508 O O   . ASP D 1 44  ? 24.275  15.337  14.462  1.00 48.23 ? 70  ASP D O   1 
ATOM 3509 C CB  . ASP D 1 44  ? 21.535  15.667  12.497  1.00 48.40 ? 70  ASP D CB  1 
ATOM 3510 C CG  . ASP D 1 44  ? 20.920  14.301  12.738  1.00 48.76 ? 70  ASP D CG  1 
ATOM 3511 O OD1 . ASP D 1 44  ? 21.502  13.297  12.281  1.00 49.40 ? 70  ASP D OD1 1 
ATOM 3512 O OD2 . ASP D 1 44  ? 19.859  14.228  13.401  1.00 48.65 ? 70  ASP D OD2 1 
ATOM 3513 N N   . PHE D 1 45  ? 24.320  16.937  12.861  1.00 48.03 ? 71  PHE D N   1 
ATOM 3514 C CA  . PHE D 1 45  ? 25.780  16.977  12.724  1.00 47.75 ? 71  PHE D CA  1 
ATOM 3515 C C   . PHE D 1 45  ? 26.412  17.657  13.948  1.00 47.54 ? 71  PHE D C   1 
ATOM 3516 O O   . PHE D 1 45  ? 27.165  18.637  13.787  1.00 47.50 ? 71  PHE D O   1 
ATOM 3517 C CB  . PHE D 1 45  ? 26.158  17.738  11.442  1.00 47.86 ? 71  PHE D CB  1 
ATOM 3518 C CG  . PHE D 1 45  ? 27.486  17.325  10.833  1.00 48.27 ? 71  PHE D CG  1 
ATOM 3519 C CD1 . PHE D 1 45  ? 27.531  16.388  9.799   1.00 48.69 ? 71  PHE D CD1 1 
ATOM 3520 C CD2 . PHE D 1 45  ? 28.683  17.895  11.264  1.00 48.60 ? 71  PHE D CD2 1 
ATOM 3521 C CE1 . PHE D 1 45  ? 28.749  16.010  9.218   1.00 48.74 ? 71  PHE D CE1 1 
ATOM 3522 C CE2 . PHE D 1 45  ? 29.907  17.523  10.687  1.00 48.69 ? 71  PHE D CE2 1 
ATOM 3523 C CZ  . PHE D 1 45  ? 29.937  16.580  9.663   1.00 48.42 ? 71  PHE D CZ  1 
ATOM 3524 N N   . TYR D 1 46  ? 26.106  17.142  15.153  1.00 46.72 ? 72  TYR D N   1 
ATOM 3525 C CA  . TYR D 1 46  ? 26.582  17.725  16.414  1.00 46.06 ? 72  TYR D CA  1 
ATOM 3526 C C   . TYR D 1 46  ? 28.061  18.096  16.366  1.00 45.71 ? 72  TYR D C   1 
ATOM 3527 O O   . TYR D 1 46  ? 28.912  17.246  16.100  1.00 46.06 ? 72  TYR D O   1 
ATOM 3528 C CB  . TYR D 1 46  ? 26.294  16.817  17.621  1.00 46.26 ? 72  TYR D CB  1 
ATOM 3529 C CG  . TYR D 1 46  ? 27.282  15.683  17.879  1.00 46.42 ? 72  TYR D CG  1 
ATOM 3530 C CD1 . TYR D 1 46  ? 26.896  14.353  17.717  1.00 46.66 ? 72  TYR D CD1 1 
ATOM 3531 C CD2 . TYR D 1 46  ? 28.583  15.936  18.327  1.00 46.35 ? 72  TYR D CD2 1 
ATOM 3532 C CE1 . TYR D 1 46  ? 27.783  13.304  17.957  1.00 46.74 ? 72  TYR D CE1 1 
ATOM 3533 C CE2 . TYR D 1 46  ? 29.485  14.893  18.561  1.00 46.74 ? 72  TYR D CE2 1 
ATOM 3534 C CZ  . TYR D 1 46  ? 29.073  13.576  18.376  1.00 46.80 ? 72  TYR D CZ  1 
ATOM 3535 O OH  . TYR D 1 46  ? 29.940  12.530  18.605  1.00 46.15 ? 72  TYR D OH  1 
ATOM 3536 N N   . LYS D 1 47  ? 28.357  19.372  16.597  1.00 44.85 ? 73  LYS D N   1 
ATOM 3537 C CA  . LYS D 1 47  ? 29.737  19.843  16.622  1.00 44.00 ? 73  LYS D CA  1 
ATOM 3538 C C   . LYS D 1 47  ? 30.370  19.539  17.980  1.00 43.12 ? 73  LYS D C   1 
ATOM 3539 O O   . LYS D 1 47  ? 29.852  19.969  19.011  1.00 43.03 ? 73  LYS D O   1 
ATOM 3540 C CB  . LYS D 1 47  ? 29.815  21.342  16.303  1.00 44.03 ? 73  LYS D CB  1 
ATOM 3541 C CG  . LYS D 1 47  ? 29.800  21.660  14.808  1.00 44.33 ? 73  LYS D CG  1 
ATOM 3542 C CD  . LYS D 1 47  ? 29.932  23.161  14.532  1.00 44.38 ? 73  LYS D CD  1 
ATOM 3543 C CE  . LYS D 1 47  ? 28.581  23.875  14.583  1.00 44.87 ? 73  LYS D CE  1 
ATOM 3544 N NZ  . LYS D 1 47  ? 27.667  23.440  13.482  1.00 44.50 ? 73  LYS D NZ  1 
ATOM 3545 N N   . PRO D 1 48  ? 31.481  18.776  17.980  1.00 42.22 ? 74  PRO D N   1 
ATOM 3546 C CA  . PRO D 1 48  ? 32.220  18.398  19.190  1.00 41.52 ? 74  PRO D CA  1 
ATOM 3547 C C   . PRO D 1 48  ? 32.593  19.594  20.067  1.00 40.85 ? 74  PRO D C   1 
ATOM 3548 O O   . PRO D 1 48  ? 33.188  20.559  19.573  1.00 40.80 ? 74  PRO D O   1 
ATOM 3549 C CB  . PRO D 1 48  ? 33.492  17.747  18.629  1.00 41.57 ? 74  PRO D CB  1 
ATOM 3550 C CG  . PRO D 1 48  ? 33.091  17.225  17.306  1.00 41.66 ? 74  PRO D CG  1 
ATOM 3551 C CD  . PRO D 1 48  ? 32.094  18.205  16.766  1.00 42.05 ? 74  PRO D CD  1 
ATOM 3552 N N   . GLY D 1 49  ? 32.240  19.523  21.350  1.00 39.96 ? 75  GLY D N   1 
ATOM 3553 C CA  . GLY D 1 49  ? 32.583  20.567  22.320  1.00 38.99 ? 75  GLY D CA  1 
ATOM 3554 C C   . GLY D 1 49  ? 31.566  21.687  22.456  1.00 38.36 ? 75  GLY D C   1 
ATOM 3555 O O   . GLY D 1 49  ? 31.838  22.700  23.100  1.00 38.32 ? 75  GLY D O   1 
ATOM 3556 N N   . THR D 1 50  ? 30.392  21.495  21.860  1.00 37.65 ? 76  THR D N   1 
ATOM 3557 C CA  . THR D 1 50  ? 29.346  22.511  21.831  1.00 37.15 ? 76  THR D CA  1 
ATOM 3558 C C   . THR D 1 50  ? 28.325  22.302  22.951  1.00 36.96 ? 76  THR D C   1 
ATOM 3559 O O   . THR D 1 50  ? 27.902  21.176  23.228  1.00 36.97 ? 76  THR D O   1 
ATOM 3560 C CB  . THR D 1 50  ? 28.627  22.516  20.461  1.00 37.09 ? 76  THR D CB  1 
ATOM 3561 O OG1 . THR D 1 50  ? 29.592  22.689  19.416  1.00 37.80 ? 76  THR D OG1 1 
ATOM 3562 C CG2 . THR D 1 50  ? 27.581  23.620  20.367  1.00 36.84 ? 76  THR D CG2 1 
ATOM 3563 N N   . SER D 1 51  ? 27.937  23.399  23.591  1.00 36.58 ? 77  SER D N   1 
ATOM 3564 C CA  . SER D 1 51  ? 26.906  23.367  24.608  1.00 36.32 ? 77  SER D CA  1 
ATOM 3565 C C   . SER D 1 51  ? 25.524  23.290  23.957  1.00 36.31 ? 77  SER D C   1 
ATOM 3566 O O   . SER D 1 51  ? 25.077  24.250  23.332  1.00 36.47 ? 77  SER D O   1 
ATOM 3567 C CB  . SER D 1 51  ? 27.003  24.601  25.495  1.00 36.02 ? 77  SER D CB  1 
ATOM 3568 O OG  . SER D 1 51  ? 26.000  24.575  26.486  1.00 35.86 ? 77  SER D OG  1 
ATOM 3569 N N   . TYR D 1 52  ? 24.861  22.144  24.098  1.00 36.04 ? 78  TYR D N   1 
ATOM 3570 C CA  . TYR D 1 52  ? 23.507  21.975  23.590  1.00 35.88 ? 78  TYR D CA  1 
ATOM 3571 C C   . TYR D 1 52  ? 22.503  22.048  24.724  1.00 35.97 ? 78  TYR D C   1 
ATOM 3572 O O   . TYR D 1 52  ? 22.652  21.374  25.750  1.00 36.15 ? 78  TYR D O   1 
ATOM 3573 C CB  . TYR D 1 52  ? 23.355  20.649  22.837  1.00 35.80 ? 78  TYR D CB  1 
ATOM 3574 C CG  . TYR D 1 52  ? 24.056  20.625  21.498  1.00 35.80 ? 78  TYR D CG  1 
ATOM 3575 C CD1 . TYR D 1 52  ? 25.357  20.134  21.384  1.00 35.85 ? 78  TYR D CD1 1 
ATOM 3576 C CD2 . TYR D 1 52  ? 23.429  21.106  20.348  1.00 35.61 ? 78  TYR D CD2 1 
ATOM 3577 C CE1 . TYR D 1 52  ? 26.013  20.113  20.165  1.00 36.15 ? 78  TYR D CE1 1 
ATOM 3578 C CE2 . TYR D 1 52  ? 24.082  21.091  19.114  1.00 35.79 ? 78  TYR D CE2 1 
ATOM 3579 C CZ  . TYR D 1 52  ? 25.376  20.594  19.034  1.00 36.06 ? 78  TYR D CZ  1 
ATOM 3580 O OH  . TYR D 1 52  ? 26.047  20.575  17.831  1.00 36.02 ? 78  TYR D OH  1 
ATOM 3581 N N   . ARG D 1 53  ? 21.483  22.876  24.531  1.00 35.90 ? 79  ARG D N   1 
ATOM 3582 C CA  . ARG D 1 53  ? 20.379  22.997  25.475  1.00 35.78 ? 79  ARG D CA  1 
ATOM 3583 C C   . ARG D 1 53  ? 19.466  21.787  25.289  1.00 35.84 ? 79  ARG D C   1 
ATOM 3584 O O   . ARG D 1 53  ? 18.919  21.582  24.205  1.00 36.00 ? 79  ARG D O   1 
ATOM 3585 C CB  . ARG D 1 53  ? 19.636  24.296  25.195  1.00 35.61 ? 79  ARG D CB  1 
ATOM 3586 C CG  . ARG D 1 53  ? 18.521  24.654  26.146  1.00 35.85 ? 79  ARG D CG  1 
ATOM 3587 C CD  . ARG D 1 53  ? 17.959  26.045  25.797  1.00 35.92 ? 79  ARG D CD  1 
ATOM 3588 N NE  . ARG D 1 53  ? 18.937  27.132  25.950  1.00 34.82 ? 79  ARG D NE  1 
ATOM 3589 C CZ  . ARG D 1 53  ? 19.286  27.667  27.121  1.00 34.65 ? 79  ARG D CZ  1 
ATOM 3590 N NH1 . ARG D 1 53  ? 18.753  27.211  28.250  1.00 35.29 ? 79  ARG D NH1 1 
ATOM 3591 N NH2 . ARG D 1 53  ? 20.176  28.652  27.169  1.00 34.35 ? 79  ARG D NH2 1 
ATOM 3592 N N   . VAL D 1 54  ? 19.328  20.978  26.336  1.00 35.83 ? 80  VAL D N   1 
ATOM 3593 C CA  . VAL D 1 54  ? 18.518  19.750  26.285  1.00 35.93 ? 80  VAL D CA  1 
ATOM 3594 C C   . VAL D 1 54  ? 17.303  19.841  27.212  1.00 36.07 ? 80  VAL D C   1 
ATOM 3595 O O   . VAL D 1 54  ? 17.427  20.198  28.391  1.00 35.89 ? 80  VAL D O   1 
ATOM 3596 C CB  . VAL D 1 54  ? 19.365  18.499  26.615  1.00 35.92 ? 80  VAL D CB  1 
ATOM 3597 C CG1 . VAL D 1 54  ? 18.528  17.239  26.550  1.00 35.72 ? 80  VAL D CG1 1 
ATOM 3598 C CG2 . VAL D 1 54  ? 20.540  18.395  25.649  1.00 35.99 ? 80  VAL D CG2 1 
ATOM 3599 N N   . THR D 1 55  ? 16.137  19.505  26.667  1.00 36.27 ? 81  THR D N   1 
ATOM 3600 C CA  . THR D 1 55  ? 14.860  19.776  27.324  1.00 36.59 ? 81  THR D CA  1 
ATOM 3601 C C   . THR D 1 55  ? 13.917  18.585  27.321  1.00 36.76 ? 81  THR D C   1 
ATOM 3602 O O   . THR D 1 55  ? 13.748  17.912  26.303  1.00 36.76 ? 81  THR D O   1 
ATOM 3603 C CB  . THR D 1 55  ? 14.166  20.993  26.670  1.00 36.56 ? 81  THR D CB  1 
ATOM 3604 O OG1 . THR D 1 55  ? 14.838  22.187  27.078  1.00 36.81 ? 81  THR D OG1 1 
ATOM 3605 C CG2 . THR D 1 55  ? 12.701  21.094  27.064  1.00 36.68 ? 81  THR D CG2 1 
ATOM 3606 N N   . LEU D 1 56  ? 13.303  18.345  28.476  1.00 37.03 ? 82  LEU D N   1 
ATOM 3607 C CA  . LEU D 1 56  ? 12.279  17.319  28.633  1.00 37.39 ? 82  LEU D CA  1 
ATOM 3608 C C   . LEU D 1 56  ? 10.949  18.010  28.917  1.00 37.52 ? 82  LEU D C   1 
ATOM 3609 O O   . LEU D 1 56  ? 10.831  18.722  29.911  1.00 37.79 ? 82  LEU D O   1 
ATOM 3610 C CB  . LEU D 1 56  ? 12.677  16.375  29.773  1.00 37.17 ? 82  LEU D CB  1 
ATOM 3611 C CG  . LEU D 1 56  ? 11.738  15.336  30.387  1.00 37.36 ? 82  LEU D CG  1 
ATOM 3612 C CD1 . LEU D 1 56  ? 11.013  14.455  29.362  1.00 37.27 ? 82  LEU D CD1 1 
ATOM 3613 C CD2 . LEU D 1 56  ? 12.566  14.476  31.312  1.00 37.71 ? 82  LEU D CD2 1 
ATOM 3614 N N   . SER D 1 57  ? 9.957   17.804  28.049  1.00 37.67 ? 83  SER D N   1 
ATOM 3615 C CA  . SER D 1 57  ? 8.696   18.562  28.123  1.00 37.92 ? 83  SER D CA  1 
ATOM 3616 C C   . SER D 1 57  ? 7.450   17.708  28.354  1.00 37.87 ? 83  SER D C   1 
ATOM 3617 O O   . SER D 1 57  ? 7.366   16.573  27.880  1.00 37.97 ? 83  SER D O   1 
ATOM 3618 C CB  . SER D 1 57  ? 8.494   19.382  26.846  1.00 38.00 ? 83  SER D CB  1 
ATOM 3619 O OG  . SER D 1 57  ? 9.712   19.949  26.390  1.00 39.01 ? 83  SER D OG  1 
ATOM 3620 N N   . ALA D 1 58  ? 6.482   18.276  29.070  1.00 37.79 ? 84  ALA D N   1 
ATOM 3621 C CA  . ALA D 1 58  ? 5.151   17.692  29.222  1.00 37.91 ? 84  ALA D CA  1 
ATOM 3622 C C   . ALA D 1 58  ? 4.110   18.645  28.621  1.00 38.21 ? 84  ALA D C   1 
ATOM 3623 O O   . ALA D 1 58  ? 3.278   19.223  29.334  1.00 38.24 ? 84  ALA D O   1 
ATOM 3624 C CB  . ALA D 1 58  ? 4.864   17.430  30.673  1.00 37.72 ? 84  ALA D CB  1 
ATOM 3625 N N   . ALA D 1 59  ? 4.154   18.778  27.296  1.00 38.50 ? 85  ALA D N   1 
ATOM 3626 C CA  . ALA D 1 59  ? 3.481   19.874  26.575  1.00 38.84 ? 85  ALA D CA  1 
ATOM 3627 C C   . ALA D 1 59  ? 1.935   19.935  26.640  1.00 38.92 ? 85  ALA D C   1 
ATOM 3628 O O   . ALA D 1 59  ? 1.359   21.024  26.510  1.00 38.78 ? 85  ALA D O   1 
ATOM 3629 C CB  . ALA D 1 59  ? 3.982   19.954  25.116  1.00 38.76 ? 85  ALA D CB  1 
ATOM 3630 N N   . PRO D 1 60  ? 1.259   18.783  26.838  1.00 38.98 ? 86  PRO D N   1 
ATOM 3631 C CA  . PRO D 1 60  ? -0.195  18.847  27.034  1.00 38.93 ? 86  PRO D CA  1 
ATOM 3632 C C   . PRO D 1 60  ? -0.518  19.227  28.490  1.00 38.77 ? 86  PRO D C   1 
ATOM 3633 O O   . PRO D 1 60  ? 0.393   19.657  29.212  1.00 38.94 ? 86  PRO D O   1 
ATOM 3634 C CB  . PRO D 1 60  ? -0.632  17.414  26.728  1.00 38.99 ? 86  PRO D CB  1 
ATOM 3635 C CG  . PRO D 1 60  ? 0.515   16.592  27.211  1.00 39.23 ? 86  PRO D CG  1 
ATOM 3636 C CD  . PRO D 1 60  ? 1.752   17.391  26.880  1.00 38.98 ? 86  PRO D CD  1 
ATOM 3637 N N   . PRO D 1 61  ? -1.794  19.077  28.928  1.00 38.39 ? 87  PRO D N   1 
ATOM 3638 C CA  . PRO D 1 61  ? -2.127  19.261  30.350  1.00 38.01 ? 87  PRO D CA  1 
ATOM 3639 C C   . PRO D 1 61  ? -1.575  18.146  31.246  1.00 37.69 ? 87  PRO D C   1 
ATOM 3640 O O   . PRO D 1 61  ? -2.293  17.633  32.106  1.00 37.91 ? 87  PRO D O   1 
ATOM 3641 C CB  . PRO D 1 61  ? -3.658  19.218  30.354  1.00 37.95 ? 87  PRO D CB  1 
ATOM 3642 C CG  . PRO D 1 61  ? -3.998  18.366  29.189  1.00 38.07 ? 87  PRO D CG  1 
ATOM 3643 C CD  . PRO D 1 61  ? -2.998  18.756  28.138  1.00 38.37 ? 87  PRO D CD  1 
ATOM 3644 N N   . SER D 1 62  ? -0.311  17.783  31.047  1.00 37.15 ? 88  SER D N   1 
ATOM 3645 C CA  . SER D 1 62  ? 0.314   16.706  31.804  1.00 36.68 ? 88  SER D CA  1 
ATOM 3646 C C   . SER D 1 62  ? 1.549   17.186  32.560  1.00 36.23 ? 88  SER D C   1 
ATOM 3647 O O   . SER D 1 62  ? 2.049   18.279  32.323  1.00 36.10 ? 88  SER D O   1 
ATOM 3648 C CB  . SER D 1 62  ? 0.682   15.544  30.878  1.00 36.78 ? 88  SER D CB  1 
ATOM 3649 O OG  . SER D 1 62  ? 1.887   15.803  30.178  1.00 36.99 ? 88  SER D OG  1 
ATOM 3650 N N   . TYR D 1 63  ? 2.031   16.350  33.473  1.00 35.98 ? 89  TYR D N   1 
ATOM 3651 C CA  . TYR D 1 63  ? 3.198   16.672  34.287  1.00 35.45 ? 89  TYR D CA  1 
ATOM 3652 C C   . TYR D 1 63  ? 4.022   15.430  34.632  1.00 35.02 ? 89  TYR D C   1 
ATOM 3653 O O   . TYR D 1 63  ? 3.582   14.301  34.439  1.00 34.66 ? 89  TYR D O   1 
ATOM 3654 C CB  . TYR D 1 63  ? 2.763   17.371  35.578  1.00 35.28 ? 89  TYR D CB  1 
ATOM 3655 C CG  . TYR D 1 63  ? 2.131   16.441  36.578  1.00 34.97 ? 89  TYR D CG  1 
ATOM 3656 C CD1 . TYR D 1 63  ? 0.791   16.079  36.466  1.00 35.28 ? 89  TYR D CD1 1 
ATOM 3657 C CD2 . TYR D 1 63  ? 2.870   15.914  37.637  1.00 35.10 ? 89  TYR D CD2 1 
ATOM 3658 C CE1 . TYR D 1 63  ? 0.199   15.214  37.385  1.00 34.67 ? 89  TYR D CE1 1 
ATOM 3659 C CE2 . TYR D 1 63  ? 2.284   15.045  38.561  1.00 34.94 ? 89  TYR D CE2 1 
ATOM 3660 C CZ  . TYR D 1 63  ? 0.946   14.705  38.424  1.00 34.50 ? 89  TYR D CZ  1 
ATOM 3661 O OH  . TYR D 1 63  ? 0.349   13.860  39.323  1.00 35.01 ? 89  TYR D OH  1 
ATOM 3662 N N   . PHE D 1 64  ? 5.221   15.665  35.148  1.00 34.83 ? 90  PHE D N   1 
ATOM 3663 C CA  . PHE D 1 64  ? 6.052   14.612  35.703  1.00 34.76 ? 90  PHE D CA  1 
ATOM 3664 C C   . PHE D 1 64  ? 6.683   15.097  36.998  1.00 35.22 ? 90  PHE D C   1 
ATOM 3665 O O   . PHE D 1 64  ? 6.787   16.302  37.236  1.00 35.14 ? 90  PHE D O   1 
ATOM 3666 C CB  . PHE D 1 64  ? 7.111   14.138  34.700  1.00 34.35 ? 90  PHE D CB  1 
ATOM 3667 C CG  . PHE D 1 64  ? 7.988   15.234  34.164  1.00 33.40 ? 90  PHE D CG  1 
ATOM 3668 C CD1 . PHE D 1 64  ? 7.551   16.051  33.134  1.00 32.16 ? 90  PHE D CD1 1 
ATOM 3669 C CD2 . PHE D 1 64  ? 9.262   15.431  34.677  1.00 33.00 ? 90  PHE D CD2 1 
ATOM 3670 C CE1 . PHE D 1 64  ? 8.356   17.051  32.639  1.00 32.60 ? 90  PHE D CE1 1 
ATOM 3671 C CE2 . PHE D 1 64  ? 10.086  16.432  34.177  1.00 32.57 ? 90  PHE D CE2 1 
ATOM 3672 C CZ  . PHE D 1 64  ? 9.631   17.243  33.161  1.00 33.23 ? 90  PHE D CZ  1 
ATOM 3673 N N   . ARG D 1 65  ? 7.077   14.155  37.846  1.00 35.99 ? 91  ARG D N   1 
ATOM 3674 C CA  . ARG D 1 65  ? 7.666   14.490  39.136  1.00 36.71 ? 91  ARG D CA  1 
ATOM 3675 C C   . ARG D 1 65  ? 9.169   14.258  39.050  1.00 37.37 ? 91  ARG D C   1 
ATOM 3676 O O   . ARG D 1 65  ? 9.960   15.212  39.104  1.00 38.14 ? 91  ARG D O   1 
ATOM 3677 C CB  . ARG D 1 65  ? 7.015   13.686  40.267  1.00 36.32 ? 91  ARG D CB  1 
ATOM 3678 C CG  . ARG D 1 65  ? 5.491   13.599  40.149  1.00 36.18 ? 91  ARG D CG  1 
ATOM 3679 C CD  . ARG D 1 65  ? 4.845   13.060  41.399  1.00 34.58 ? 91  ARG D CD  1 
ATOM 3680 N NE  . ARG D 1 65  ? 4.654   14.117  42.378  1.00 35.12 ? 91  ARG D NE  1 
ATOM 3681 C CZ  . ARG D 1 65  ? 3.483   14.478  42.896  1.00 35.36 ? 91  ARG D CZ  1 
ATOM 3682 N NH1 . ARG D 1 65  ? 2.356   13.863  42.551  1.00 35.46 ? 91  ARG D NH1 1 
ATOM 3683 N NH2 . ARG D 1 65  ? 3.443   15.458  43.779  1.00 34.95 ? 91  ARG D NH2 1 
ATOM 3684 N N   . GLY D 1 66  ? 9.553   13.001  38.866  1.00 37.82 ? 92  GLY D N   1 
ATOM 3685 C CA  . GLY D 1 66  ? 10.953  12.629  38.697  1.00 38.35 ? 92  GLY D CA  1 
ATOM 3686 C C   . GLY D 1 66  ? 11.323  12.244  37.278  1.00 38.52 ? 92  GLY D C   1 
ATOM 3687 O O   . GLY D 1 66  ? 10.460  11.897  36.472  1.00 38.76 ? 92  GLY D O   1 
ATOM 3688 N N   . PHE D 1 67  ? 12.615  12.303  36.972  1.00 38.63 ? 93  PHE D N   1 
ATOM 3689 C CA  . PHE D 1 67  ? 13.101  12.017  35.629  1.00 38.86 ? 93  PHE D CA  1 
ATOM 3690 C C   . PHE D 1 67  ? 14.549  11.616  35.694  1.00 38.92 ? 93  PHE D C   1 
ATOM 3691 O O   . PHE D 1 67  ? 15.266  11.995  36.613  1.00 39.13 ? 93  PHE D O   1 
ATOM 3692 C CB  . PHE D 1 67  ? 12.980  13.252  34.736  1.00 39.06 ? 93  PHE D CB  1 
ATOM 3693 C CG  . PHE D 1 67  ? 13.945  14.346  35.090  1.00 39.31 ? 93  PHE D CG  1 
ATOM 3694 C CD1 . PHE D 1 67  ? 15.165  14.449  34.435  1.00 39.09 ? 93  PHE D CD1 1 
ATOM 3695 C CD2 . PHE D 1 67  ? 13.638  15.269  36.096  1.00 40.11 ? 93  PHE D CD2 1 
ATOM 3696 C CE1 . PHE D 1 67  ? 16.074  15.451  34.769  1.00 39.43 ? 93  PHE D CE1 1 
ATOM 3697 C CE2 . PHE D 1 67  ? 14.532  16.283  36.429  1.00 39.49 ? 93  PHE D CE2 1 
ATOM 3698 C CZ  . PHE D 1 67  ? 15.757  16.368  35.768  1.00 39.74 ? 93  PHE D CZ  1 
ATOM 3699 N N   . THR D 1 68  ? 14.978  10.856  34.697  1.00 39.04 ? 94  THR D N   1 
ATOM 3700 C CA  . THR D 1 68  ? 16.360  10.421  34.599  1.00 38.95 ? 94  THR D CA  1 
ATOM 3701 C C   . THR D 1 68  ? 16.794  10.620  33.159  1.00 38.82 ? 94  THR D C   1 
ATOM 3702 O O   . THR D 1 68  ? 16.029  10.346  32.234  1.00 38.97 ? 94  THR D O   1 
ATOM 3703 C CB  . THR D 1 68  ? 16.512  8.958   35.021  1.00 39.01 ? 94  THR D CB  1 
ATOM 3704 O OG1 . THR D 1 68  ? 15.962  8.790   36.337  1.00 38.95 ? 94  THR D OG1 1 
ATOM 3705 C CG2 . THR D 1 68  ? 17.977  8.551   35.026  1.00 38.67 ? 94  THR D CG2 1 
ATOM 3706 N N   . LEU D 1 69  ? 18.018  11.097  32.980  1.00 38.47 ? 95  LEU D N   1 
ATOM 3707 C CA  . LEU D 1 69  ? 18.469  11.579  31.690  1.00 38.43 ? 95  LEU D CA  1 
ATOM 3708 C C   . LEU D 1 69  ? 19.924  11.191  31.428  1.00 38.18 ? 95  LEU D C   1 
ATOM 3709 O O   . LEU D 1 69  ? 20.799  11.475  32.239  1.00 37.86 ? 95  LEU D O   1 
ATOM 3710 C CB  . LEU D 1 69  ? 18.280  13.093  31.671  1.00 38.73 ? 95  LEU D CB  1 
ATOM 3711 C CG  . LEU D 1 69  ? 18.821  13.954  30.551  1.00 38.46 ? 95  LEU D CG  1 
ATOM 3712 C CD1 . LEU D 1 69  ? 17.805  14.039  29.440  1.00 39.06 ? 95  LEU D CD1 1 
ATOM 3713 C CD2 . LEU D 1 69  ? 19.066  15.308  31.151  1.00 38.33 ? 95  LEU D CD2 1 
ATOM 3714 N N   . ILE D 1 70  ? 20.174  10.526  30.300  1.00 38.42 ? 96  ILE D N   1 
ATOM 3715 C CA  . ILE D 1 70  ? 21.515  9.988   30.000  1.00 38.59 ? 96  ILE D CA  1 
ATOM 3716 C C   . ILE D 1 70  ? 22.040  10.345  28.623  1.00 38.49 ? 96  ILE D C   1 
ATOM 3717 O O   . ILE D 1 70  ? 21.278  10.783  27.759  1.00 38.64 ? 96  ILE D O   1 
ATOM 3718 C CB  . ILE D 1 70  ? 21.590  8.446   30.174  1.00 38.62 ? 96  ILE D CB  1 
ATOM 3719 C CG1 . ILE D 1 70  ? 20.604  7.741   29.232  1.00 38.82 ? 96  ILE D CG1 1 
ATOM 3720 C CG2 . ILE D 1 70  ? 21.385  8.071   31.642  1.00 38.81 ? 96  ILE D CG2 1 
ATOM 3721 C CD1 . ILE D 1 70  ? 20.562  6.216   29.369  1.00 38.36 ? 96  ILE D CD1 1 
ATOM 3722 N N   . ALA D 1 71  ? 23.347  10.137  28.439  1.00 38.58 ? 97  ALA D N   1 
ATOM 3723 C CA  . ALA D 1 71  ? 24.046  10.379  27.166  1.00 38.52 ? 97  ALA D CA  1 
ATOM 3724 C C   . ALA D 1 71  ? 24.974  9.208   26.804  1.00 38.51 ? 97  ALA D C   1 
ATOM 3725 O O   . ALA D 1 71  ? 26.116  9.127   27.274  1.00 38.39 ? 97  ALA D O   1 
ATOM 3726 C CB  . ALA D 1 71  ? 24.829  11.682  27.241  1.00 38.30 ? 97  ALA D CB  1 
ATOM 3727 N N   . LEU D 1 72  ? 24.486  8.304   25.962  1.00 38.68 ? 98  LEU D N   1 
ATOM 3728 C CA  . LEU D 1 72  ? 25.200  7.047   25.706  1.00 38.91 ? 98  LEU D CA  1 
ATOM 3729 C C   . LEU D 1 72  ? 25.785  6.923   24.309  1.00 39.06 ? 98  LEU D C   1 
ATOM 3730 O O   . LEU D 1 72  ? 25.249  7.477   23.345  1.00 38.98 ? 98  LEU D O   1 
ATOM 3731 C CB  . LEU D 1 72  ? 24.297  5.839   25.989  1.00 38.81 ? 98  LEU D CB  1 
ATOM 3732 C CG  . LEU D 1 72  ? 23.765  5.614   27.405  1.00 38.57 ? 98  LEU D CG  1 
ATOM 3733 C CD1 . LEU D 1 72  ? 22.978  4.323   27.425  1.00 39.48 ? 98  LEU D CD1 1 
ATOM 3734 C CD2 . LEU D 1 72  ? 24.871  5.575   28.455  1.00 38.33 ? 98  LEU D CD2 1 
ATOM 3735 N N   . ARG D 1 73  ? 26.866  6.149   24.218  1.00 39.50 ? 99  ARG D N   1 
ATOM 3736 C CA  . ARG D 1 73  ? 27.621  5.948   22.976  1.00 39.70 ? 99  ARG D CA  1 
ATOM 3737 C C   . ARG D 1 73  ? 26.869  5.144   21.912  1.00 40.16 ? 99  ARG D C   1 
ATOM 3738 O O   . ARG D 1 73  ? 25.692  4.834   22.067  1.00 40.14 ? 99  ARG D O   1 
ATOM 3739 C CB  . ARG D 1 73  ? 28.986  5.320   23.285  1.00 39.52 ? 99  ARG D CB  1 
ATOM 3740 C CG  . ARG D 1 73  ? 29.950  6.259   24.000  1.00 39.37 ? 99  ARG D CG  1 
ATOM 3741 C CD  . ARG D 1 73  ? 31.208  5.554   24.480  1.00 39.53 ? 99  ARG D CD  1 
ATOM 3742 N NE  . ARG D 1 73  ? 32.215  5.449   23.425  1.00 40.68 ? 99  ARG D NE  1 
ATOM 3743 C CZ  . ARG D 1 73  ? 33.146  6.370   23.168  1.00 41.06 ? 99  ARG D CZ  1 
ATOM 3744 N NH1 . ARG D 1 73  ? 34.012  6.177   22.179  1.00 40.17 ? 99  ARG D NH1 1 
ATOM 3745 N NH2 . ARG D 1 73  ? 33.213  7.484   23.893  1.00 40.73 ? 99  ARG D NH2 1 
ATOM 3746 N N   . GLU D 1 74  ? 27.580  4.797   20.842  1.00 41.05 ? 100 GLU D N   1 
ATOM 3747 C CA  . GLU D 1 74  ? 26.995  4.235   19.610  1.00 41.69 ? 100 GLU D CA  1 
ATOM 3748 C C   . GLU D 1 74  ? 25.840  3.266   19.817  1.00 41.96 ? 100 GLU D C   1 
ATOM 3749 O O   . GLU D 1 74  ? 24.773  3.451   19.230  1.00 42.18 ? 100 GLU D O   1 
ATOM 3750 C CB  . GLU D 1 74  ? 28.078  3.641   18.691  1.00 41.67 ? 100 GLU D CB  1 
ATOM 3751 C CG  . GLU D 1 74  ? 29.177  4.654   18.333  1.00 41.79 ? 100 GLU D CG  1 
ATOM 3752 C CD  . GLU D 1 74  ? 29.647  4.536   16.884  1.00 42.05 ? 100 GLU D CD  1 
ATOM 3753 O OE1 . GLU D 1 74  ? 30.788  5.056   16.550  1.00 41.29 ? 100 GLU D OE1 1 
ATOM 3754 O OE2 . GLU D 1 74  ? 28.861  3.934   16.076  1.00 42.57 ? 100 GLU D OE2 1 
ATOM 3755 N N   . ASN D 1 75  ? 26.056  2.238   20.638  1.00 42.29 ? 101 ASN D N   1 
ATOM 3756 C CA  . ASN D 1 75  ? 24.985  1.311   21.020  1.00 42.58 ? 101 ASN D CA  1 
ATOM 3757 C C   . ASN D 1 75  ? 25.304  0.608   22.337  1.00 42.64 ? 101 ASN D C   1 
ATOM 3758 O O   . ASN D 1 75  ? 25.607  -0.585  22.361  1.00 42.77 ? 101 ASN D O   1 
ATOM 3759 C CB  . ASN D 1 75  ? 24.710  0.291   19.901  1.00 42.62 ? 101 ASN D CB  1 
ATOM 3760 C CG  . ASN D 1 75  ? 23.270  -0.205  19.905  1.00 42.96 ? 101 ASN D CG  1 
ATOM 3761 O OD1 . ASN D 1 75  ? 22.388  0.415   20.511  1.00 43.62 ? 101 ASN D OD1 1 
ATOM 3762 N ND2 . ASN D 1 75  ? 23.024  -1.321  19.224  1.00 41.58 ? 101 ASN D ND2 1 
ATOM 3763 N N   . ARG D 1 76  ? 25.236  1.354   23.433  1.00 42.86 ? 102 ARG D N   1 
ATOM 3764 C CA  . ARG D 1 76  ? 25.713  0.851   24.720  1.00 43.16 ? 102 ARG D CA  1 
ATOM 3765 C C   . ARG D 1 76  ? 24.652  0.802   25.817  1.00 43.55 ? 102 ARG D C   1 
ATOM 3766 O O   . ARG D 1 76  ? 23.720  1.609   25.831  1.00 43.61 ? 102 ARG D O   1 
ATOM 3767 C CB  . ARG D 1 76  ? 26.932  1.649   25.187  1.00 43.04 ? 102 ARG D CB  1 
ATOM 3768 C CG  . ARG D 1 76  ? 28.283  1.044   24.782  1.00 42.55 ? 102 ARG D CG  1 
ATOM 3769 C CD  . ARG D 1 76  ? 28.740  1.477   23.399  1.00 40.92 ? 102 ARG D CD  1 
ATOM 3770 N NE  . ARG D 1 76  ? 30.179  1.718   23.389  1.00 40.01 ? 102 ARG D NE  1 
ATOM 3771 C CZ  . ARG D 1 76  ? 30.837  2.242   22.336  1.00 40.43 ? 102 ARG D CZ  1 
ATOM 3772 N NH1 . ARG D 1 76  ? 32.149  2.432   22.432  1.00 40.34 ? 102 ARG D NH1 1 
ATOM 3773 N NH2 . ARG D 1 76  ? 30.187  2.539   21.181  1.00 40.97 ? 102 ARG D NH2 1 
ATOM 3774 N N   . GLU D 1 77  ? 24.824  -0.153  26.733  1.00 43.94 ? 103 GLU D N   1 
ATOM 3775 C CA  . GLU D 1 77  ? 23.888  -0.425  27.831  1.00 44.26 ? 103 GLU D CA  1 
ATOM 3776 C C   . GLU D 1 77  ? 23.579  0.785   28.726  1.00 44.44 ? 103 GLU D C   1 
ATOM 3777 O O   . GLU D 1 77  ? 22.440  1.251   28.792  1.00 44.47 ? 103 GLU D O   1 
ATOM 3778 C CB  . GLU D 1 77  ? 24.411  -1.599  28.677  1.00 44.18 ? 103 GLU D CB  1 
ATOM 3779 C CG  . GLU D 1 77  ? 23.404  -2.190  29.669  1.00 44.42 ? 103 GLU D CG  1 
ATOM 3780 C CD  . GLU D 1 77  ? 22.272  -2.962  29.002  1.00 44.68 ? 103 GLU D CD  1 
ATOM 3781 O OE1 . GLU D 1 77  ? 21.280  -3.279  29.690  1.00 43.80 ? 103 GLU D OE1 1 
ATOM 3782 O OE2 . GLU D 1 77  ? 22.370  -3.251  27.790  1.00 45.22 ? 103 GLU D OE2 1 
ATOM 3783 N N   . GLY D 1 78  ? 24.608  1.298   29.389  1.00 44.77 ? 104 GLY D N   1 
ATOM 3784 C CA  . GLY D 1 78  ? 24.451  2.323   30.412  1.00 45.08 ? 104 GLY D CA  1 
ATOM 3785 C C   . GLY D 1 78  ? 25.011  1.736   31.686  1.00 45.46 ? 104 GLY D C   1 
ATOM 3786 O O   . GLY D 1 78  ? 25.307  2.454   32.641  1.00 45.39 ? 104 GLY D O   1 
ATOM 3787 N N   . ASP D 1 79  ? 25.164  0.410   31.658  1.00 45.91 ? 105 ASP D N   1 
ATOM 3788 C CA  . ASP D 1 79  ? 25.639  -0.421  32.769  1.00 46.31 ? 105 ASP D CA  1 
ATOM 3789 C C   . ASP D 1 79  ? 26.895  0.125   33.460  1.00 46.40 ? 105 ASP D C   1 
ATOM 3790 O O   . ASP D 1 79  ? 27.023  0.005   34.683  1.00 46.44 ? 105 ASP D O   1 
ATOM 3791 C CB  . ASP D 1 79  ? 25.908  -1.837  32.234  1.00 46.49 ? 105 ASP D CB  1 
ATOM 3792 C CG  . ASP D 1 79  ? 25.942  -2.899  33.324  1.00 47.29 ? 105 ASP D CG  1 
ATOM 3793 O OD1 . ASP D 1 79  ? 25.050  -2.908  34.197  1.00 48.39 ? 105 ASP D OD1 1 
ATOM 3794 O OD2 . ASP D 1 79  ? 26.852  -3.759  33.283  1.00 48.26 ? 105 ASP D OD2 1 
ATOM 3795 N N   . LYS D 1 80  ? 27.797  0.729   32.678  1.00 46.34 ? 106 LYS D N   1 
ATOM 3796 C CA  . LYS D 1 80  ? 29.127  1.143   33.155  1.00 46.26 ? 106 LYS D CA  1 
ATOM 3797 C C   . LYS D 1 80  ? 29.387  2.646   33.045  1.00 46.18 ? 106 LYS D C   1 
ATOM 3798 O O   . LYS D 1 80  ? 28.831  3.323   32.177  1.00 46.08 ? 106 LYS D O   1 
ATOM 3799 C CB  . LYS D 1 80  ? 30.238  0.388   32.409  1.00 46.34 ? 106 LYS D CB  1 
ATOM 3800 C CG  . LYS D 1 80  ? 30.168  -1.137  32.496  1.00 46.48 ? 106 LYS D CG  1 
ATOM 3801 C CD  . LYS D 1 80  ? 29.441  -1.742  31.296  1.00 46.82 ? 106 LYS D CD  1 
ATOM 3802 C CE  . LYS D 1 80  ? 30.346  -1.841  30.071  1.00 46.70 ? 106 LYS D CE  1 
ATOM 3803 N NZ  . LYS D 1 80  ? 29.629  -2.432  28.907  1.00 46.56 ? 106 LYS D NZ  1 
ATOM 3804 N N   . GLU D 1 81  ? 30.267  3.145   33.915  1.00 46.11 ? 107 GLU D N   1 
ATOM 3805 C CA  . GLU D 1 81  ? 30.559  4.581   34.045  1.00 45.97 ? 107 GLU D CA  1 
ATOM 3806 C C   . GLU D 1 81  ? 31.362  5.113   32.859  1.00 45.73 ? 107 GLU D C   1 
ATOM 3807 O O   . GLU D 1 81  ? 31.486  6.326   32.681  1.00 45.74 ? 107 GLU D O   1 
ATOM 3808 C CB  . GLU D 1 81  ? 31.305  4.850   35.363  1.00 46.13 ? 107 GLU D CB  1 
ATOM 3809 C CG  . GLU D 1 81  ? 30.879  6.128   36.110  1.00 46.70 ? 107 GLU D CG  1 
ATOM 3810 C CD  . GLU D 1 81  ? 30.862  5.956   37.642  1.00 47.25 ? 107 GLU D CD  1 
ATOM 3811 O OE1 . GLU D 1 81  ? 31.761  6.511   38.316  1.00 46.38 ? 107 GLU D OE1 1 
ATOM 3812 O OE2 . GLU D 1 81  ? 29.951  5.266   38.170  1.00 46.98 ? 107 GLU D OE2 1 
ATOM 3813 N N   . GLU D 1 82  ? 31.904  4.192   32.061  1.00 45.33 ? 108 GLU D N   1 
ATOM 3814 C CA  . GLU D 1 82  ? 32.663  4.512   30.849  1.00 44.76 ? 108 GLU D CA  1 
ATOM 3815 C C   . GLU D 1 82  ? 31.838  4.282   29.574  1.00 44.27 ? 108 GLU D C   1 
ATOM 3816 O O   . GLU D 1 82  ? 32.354  4.362   28.459  1.00 44.14 ? 108 GLU D O   1 
ATOM 3817 C CB  . GLU D 1 82  ? 33.982  3.722   30.809  1.00 44.95 ? 108 GLU D CB  1 
ATOM 3818 C CG  . GLU D 1 82  ? 33.863  2.218   31.094  1.00 45.28 ? 108 GLU D CG  1 
ATOM 3819 C CD  . GLU D 1 82  ? 33.747  1.879   32.582  1.00 46.10 ? 108 GLU D CD  1 
ATOM 3820 O OE1 . GLU D 1 82  ? 33.711  2.808   33.424  1.00 45.90 ? 108 GLU D OE1 1 
ATOM 3821 O OE2 . GLU D 1 82  ? 33.685  0.672   32.907  1.00 46.35 ? 108 GLU D OE2 1 
ATOM 3822 N N   . ASP D 1 83  ? 30.550  4.011   29.760  1.00 43.78 ? 109 ASP D N   1 
ATOM 3823 C CA  . ASP D 1 83  ? 29.610  3.797   28.668  1.00 43.25 ? 109 ASP D CA  1 
ATOM 3824 C C   . ASP D 1 83  ? 28.971  5.121   28.265  1.00 42.79 ? 109 ASP D C   1 
ATOM 3825 O O   . ASP D 1 83  ? 28.316  5.219   27.222  1.00 42.54 ? 109 ASP D O   1 
ATOM 3826 C CB  . ASP D 1 83  ? 28.516  2.839   29.127  1.00 43.39 ? 109 ASP D CB  1 
ATOM 3827 C CG  . ASP D 1 83  ? 28.451  1.582   28.293  1.00 44.08 ? 109 ASP D CG  1 
ATOM 3828 O OD1 . ASP D 1 83  ? 27.373  0.951   28.275  1.00 44.60 ? 109 ASP D OD1 1 
ATOM 3829 O OD2 . ASP D 1 83  ? 29.474  1.214   27.667  1.00 44.86 ? 109 ASP D OD2 1 
ATOM 3830 N N   . HIS D 1 84  ? 29.157  6.133   29.106  1.00 42.22 ? 110 HIS D N   1 
ATOM 3831 C CA  . HIS D 1 84  ? 28.552  7.436   28.882  1.00 42.05 ? 110 HIS D CA  1 
ATOM 3832 C C   . HIS D 1 84  ? 29.486  8.385   28.142  1.00 41.76 ? 110 HIS D C   1 
ATOM 3833 O O   . HIS D 1 84  ? 30.706  8.378   28.348  1.00 41.61 ? 110 HIS D O   1 
ATOM 3834 C CB  . HIS D 1 84  ? 28.134  8.069   30.204  1.00 42.23 ? 110 HIS D CB  1 
ATOM 3835 C CG  . HIS D 1 84  ? 27.024  7.349   30.909  1.00 42.60 ? 110 HIS D CG  1 
ATOM 3836 N ND1 . HIS D 1 84  ? 27.176  6.090   31.450  1.00 43.16 ? 110 HIS D ND1 1 
ATOM 3837 C CD2 . HIS D 1 84  ? 25.761  7.734   31.204  1.00 43.10 ? 110 HIS D CD2 1 
ATOM 3838 C CE1 . HIS D 1 84  ? 26.046  5.723   32.030  1.00 43.38 ? 110 HIS D CE1 1 
ATOM 3839 N NE2 . HIS D 1 84  ? 25.173  6.704   31.898  1.00 43.71 ? 110 HIS D NE2 1 
ATOM 3840 N N   . ALA D 1 85  ? 28.892  9.207   27.284  1.00 41.39 ? 111 ALA D N   1 
ATOM 3841 C CA  . ALA D 1 85  ? 29.627  10.194  26.508  1.00 40.96 ? 111 ALA D CA  1 
ATOM 3842 C C   . ALA D 1 85  ? 29.106  11.592  26.812  1.00 40.72 ? 111 ALA D C   1 
ATOM 3843 O O   . ALA D 1 85  ? 28.133  11.756  27.556  1.00 41.09 ? 111 ALA D O   1 
ATOM 3844 C CB  . ALA D 1 85  ? 29.512  9.889   25.026  1.00 40.98 ? 111 ALA D CB  1 
ATOM 3845 N N   . GLY D 1 86  ? 29.762  12.599  26.242  1.00 40.25 ? 112 GLY D N   1 
ATOM 3846 C CA  . GLY D 1 86  ? 29.376  13.987  26.448  1.00 39.45 ? 112 GLY D CA  1 
ATOM 3847 C C   . GLY D 1 86  ? 29.551  14.418  27.888  1.00 38.90 ? 112 GLY D C   1 
ATOM 3848 O O   . GLY D 1 86  ? 30.167  13.717  28.687  1.00 38.76 ? 112 GLY D O   1 
ATOM 3849 N N   . THR D 1 87  ? 29.013  15.585  28.215  1.00 38.48 ? 113 THR D N   1 
ATOM 3850 C CA  . THR D 1 87  ? 29.097  16.109  29.564  1.00 38.24 ? 113 THR D CA  1 
ATOM 3851 C C   . THR D 1 87  ? 27.893  17.002  29.806  1.00 38.08 ? 113 THR D C   1 
ATOM 3852 O O   . THR D 1 87  ? 27.682  17.975  29.077  1.00 38.26 ? 113 THR D O   1 
ATOM 3853 C CB  . THR D 1 87  ? 30.426  16.879  29.796  1.00 38.40 ? 113 THR D CB  1 
ATOM 3854 O OG1 . THR D 1 87  ? 31.526  15.964  29.703  1.00 38.57 ? 113 THR D OG1 1 
ATOM 3855 C CG2 . THR D 1 87  ? 30.457  17.537  31.169  1.00 38.05 ? 113 THR D CG2 1 
ATOM 3856 N N   . PHE D 1 88  ? 27.097  16.640  30.811  1.00 37.64 ? 114 PHE D N   1 
ATOM 3857 C CA  . PHE D 1 88  ? 25.948  17.433  31.225  1.00 37.28 ? 114 PHE D CA  1 
ATOM 3858 C C   . PHE D 1 88  ? 26.369  18.555  32.170  1.00 37.46 ? 114 PHE D C   1 
ATOM 3859 O O   . PHE D 1 88  ? 27.300  18.390  32.961  1.00 37.33 ? 114 PHE D O   1 
ATOM 3860 C CB  . PHE D 1 88  ? 24.904  16.563  31.925  1.00 36.85 ? 114 PHE D CB  1 
ATOM 3861 C CG  . PHE D 1 88  ? 24.064  15.728  30.995  1.00 36.26 ? 114 PHE D CG  1 
ATOM 3862 C CD1 . PHE D 1 88  ? 23.150  16.324  30.130  1.00 35.11 ? 114 PHE D CD1 1 
ATOM 3863 C CD2 . PHE D 1 88  ? 24.153  14.339  31.019  1.00 34.35 ? 114 PHE D CD2 1 
ATOM 3864 C CE1 . PHE D 1 88  ? 22.360  15.546  29.282  1.00 34.33 ? 114 PHE D CE1 1 
ATOM 3865 C CE2 . PHE D 1 88  ? 23.368  13.566  30.179  1.00 33.73 ? 114 PHE D CE2 1 
ATOM 3866 C CZ  . PHE D 1 88  ? 22.475  14.167  29.309  1.00 34.21 ? 114 PHE D CZ  1 
ATOM 3867 N N   . GLN D 1 89  ? 25.672  19.686  32.068  1.00 37.58 ? 115 GLN D N   1 
ATOM 3868 C CA  . GLN D 1 89  ? 25.793  20.794  33.008  1.00 38.28 ? 115 GLN D CA  1 
ATOM 3869 C C   . GLN D 1 89  ? 24.423  21.130  33.588  1.00 38.10 ? 115 GLN D C   1 
ATOM 3870 O O   . GLN D 1 89  ? 23.470  21.355  32.840  1.00 38.22 ? 115 GLN D O   1 
ATOM 3871 C CB  . GLN D 1 89  ? 26.359  22.033  32.313  1.00 37.96 ? 115 GLN D CB  1 
ATOM 3872 C CG  . GLN D 1 89  ? 27.839  22.245  32.486  1.00 38.47 ? 115 GLN D CG  1 
ATOM 3873 C CD  . GLN D 1 89  ? 28.327  23.503  31.771  1.00 39.67 ? 115 GLN D CD  1 
ATOM 3874 O OE1 . GLN D 1 89  ? 28.005  23.740  30.593  1.00 41.69 ? 115 GLN D OE1 1 
ATOM 3875 N NE2 . GLN D 1 89  ? 29.116  24.313  32.477  1.00 40.35 ? 115 GLN D NE2 1 
ATOM 3876 N N   . ILE D 1 90  ? 24.312  21.174  34.910  1.00 38.10 ? 116 ILE D N   1 
ATOM 3877 C CA  . ILE D 1 90  ? 23.019  21.497  35.500  1.00 38.57 ? 116 ILE D CA  1 
ATOM 3878 C C   . ILE D 1 90  ? 22.754  22.991  35.376  1.00 38.49 ? 116 ILE D C   1 
ATOM 3879 O O   . ILE D 1 90  ? 23.613  23.817  35.695  1.00 38.46 ? 116 ILE D O   1 
ATOM 3880 C CB  . ILE D 1 90  ? 22.850  20.992  36.978  1.00 38.50 ? 116 ILE D CB  1 
ATOM 3881 C CG1 . ILE D 1 90  ? 23.837  21.687  37.920  1.00 39.00 ? 116 ILE D CG1 1 
ATOM 3882 C CG2 . ILE D 1 90  ? 22.950  19.450  37.049  1.00 37.55 ? 116 ILE D CG2 1 
ATOM 3883 C CD1 . ILE D 1 90  ? 23.840  21.153  39.350  1.00 39.53 ? 116 ILE D CD1 1 
ATOM 3884 N N   . ILE D 1 91  ? 21.575  23.327  34.868  1.00 38.61 ? 117 ILE D N   1 
ATOM 3885 C CA  . ILE D 1 91  ? 21.144  24.713  34.812  1.00 38.75 ? 117 ILE D CA  1 
ATOM 3886 C C   . ILE D 1 91  ? 20.547  25.098  36.168  1.00 39.37 ? 117 ILE D C   1 
ATOM 3887 O O   . ILE D 1 91  ? 21.065  25.970  36.859  1.00 38.92 ? 117 ILE D O   1 
ATOM 3888 C CB  . ILE D 1 91  ? 20.146  24.951  33.661  1.00 38.66 ? 117 ILE D CB  1 
ATOM 3889 C CG1 . ILE D 1 91  ? 20.835  24.666  32.314  1.00 38.72 ? 117 ILE D CG1 1 
ATOM 3890 C CG2 . ILE D 1 91  ? 19.562  26.365  33.738  1.00 38.28 ? 117 ILE D CG2 1 
ATOM 3891 C CD1 . ILE D 1 91  ? 20.118  25.189  31.072  1.00 38.33 ? 117 ILE D CD1 1 
ATOM 3892 N N   . ASP D 1 92  ? 19.474  24.413  36.549  1.00 40.20 ? 118 ASP D N   1 
ATOM 3893 C CA  . ASP D 1 92  ? 18.794  24.671  37.798  1.00 40.93 ? 118 ASP D CA  1 
ATOM 3894 C C   . ASP D 1 92  ? 19.283  23.749  38.910  1.00 41.43 ? 118 ASP D C   1 
ATOM 3895 O O   . ASP D 1 92  ? 18.758  22.650  39.094  1.00 41.29 ? 118 ASP D O   1 
ATOM 3896 C CB  . ASP D 1 92  ? 17.300  24.507  37.610  1.00 41.06 ? 118 ASP D CB  1 
ATOM 3897 C CG  . ASP D 1 92  ? 16.532  25.039  38.776  1.00 42.74 ? 118 ASP D CG  1 
ATOM 3898 O OD1 . ASP D 1 92  ? 16.073  24.215  39.600  1.00 43.36 ? 118 ASP D OD1 1 
ATOM 3899 O OD2 . ASP D 1 92  ? 16.432  26.288  38.889  1.00 44.45 ? 118 ASP D OD2 1 
ATOM 3900 N N   . GLU D 1 93  ? 20.279  24.211  39.662  1.00 42.32 ? 119 GLU D N   1 
ATOM 3901 C CA  . GLU D 1 93  ? 20.947  23.369  40.659  1.00 43.31 ? 119 GLU D CA  1 
ATOM 3902 C C   . GLU D 1 93  ? 20.105  23.156  41.907  1.00 43.52 ? 119 GLU D C   1 
ATOM 3903 O O   . GLU D 1 93  ? 20.489  22.417  42.813  1.00 43.66 ? 119 GLU D O   1 
ATOM 3904 C CB  . GLU D 1 93  ? 22.353  23.893  41.019  1.00 43.45 ? 119 GLU D CB  1 
ATOM 3905 C CG  . GLU D 1 93  ? 22.431  25.317  41.574  1.00 45.31 ? 119 GLU D CG  1 
ATOM 3906 C CD  . GLU D 1 93  ? 22.688  26.357  40.496  1.00 47.44 ? 119 GLU D CD  1 
ATOM 3907 O OE1 . GLU D 1 93  ? 21.770  26.602  39.682  1.00 48.53 ? 119 GLU D OE1 1 
ATOM 3908 O OE2 . GLU D 1 93  ? 23.802  26.936  40.468  1.00 47.81 ? 119 GLU D OE2 1 
ATOM 3909 N N   . GLU D 1 94  ? 18.946  23.798  41.940  1.00 44.00 ? 120 GLU D N   1 
ATOM 3910 C CA  . GLU D 1 94  ? 18.049  23.671  43.064  1.00 44.36 ? 120 GLU D CA  1 
ATOM 3911 C C   . GLU D 1 94  ? 17.256  22.376  42.967  1.00 44.81 ? 120 GLU D C   1 
ATOM 3912 O O   . GLU D 1 94  ? 17.154  21.639  43.945  1.00 45.16 ? 120 GLU D O   1 
ATOM 3913 C CB  . GLU D 1 94  ? 17.128  24.886  43.149  1.00 44.30 ? 120 GLU D CB  1 
ATOM 3914 C CG  . GLU D 1 94  ? 16.620  25.190  44.550  1.00 44.37 ? 120 GLU D CG  1 
ATOM 3915 C CD  . GLU D 1 94  ? 17.731  25.421  45.569  1.00 44.54 ? 120 GLU D CD  1 
ATOM 3916 O OE1 . GLU D 1 94  ? 17.714  24.718  46.601  1.00 44.45 ? 120 GLU D OE1 1 
ATOM 3917 O OE2 . GLU D 1 94  ? 18.606  26.294  45.347  1.00 43.59 ? 120 GLU D OE2 1 
ATOM 3918 N N   . GLU D 1 95  ? 16.719  22.076  41.787  1.00 45.33 ? 121 GLU D N   1 
ATOM 3919 C CA  . GLU D 1 95  ? 15.905  20.869  41.636  1.00 45.75 ? 121 GLU D CA  1 
ATOM 3920 C C   . GLU D 1 95  ? 16.287  19.863  40.533  1.00 45.55 ? 121 GLU D C   1 
ATOM 3921 O O   . GLU D 1 95  ? 15.550  18.903  40.299  1.00 45.90 ? 121 GLU D O   1 
ATOM 3922 C CB  . GLU D 1 95  ? 14.414  21.217  41.617  1.00 46.19 ? 121 GLU D CB  1 
ATOM 3923 C CG  . GLU D 1 95  ? 13.781  21.143  43.010  1.00 47.51 ? 121 GLU D CG  1 
ATOM 3924 C CD  . GLU D 1 95  ? 12.553  22.019  43.155  1.00 50.10 ? 121 GLU D CD  1 
ATOM 3925 O OE1 . GLU D 1 95  ? 12.090  22.219  44.307  1.00 50.60 ? 121 GLU D OE1 1 
ATOM 3926 O OE2 . GLU D 1 95  ? 12.051  22.518  42.119  1.00 51.86 ? 121 GLU D OE2 1 
ATOM 3927 N N   . THR D 1 96  ? 17.428  20.068  39.874  1.00 45.06 ? 122 THR D N   1 
ATOM 3928 C CA  . THR D 1 96  ? 18.091  18.970  39.150  1.00 44.41 ? 122 THR D CA  1 
ATOM 3929 C C   . THR D 1 96  ? 19.443  18.651  39.795  1.00 44.20 ? 122 THR D C   1 
ATOM 3930 O O   . THR D 1 96  ? 20.030  19.492  40.486  1.00 44.16 ? 122 THR D O   1 
ATOM 3931 C CB  . THR D 1 96  ? 18.257  19.221  37.630  1.00 44.25 ? 122 THR D CB  1 
ATOM 3932 O OG1 . THR D 1 96  ? 19.195  20.278  37.403  1.00 43.68 ? 122 THR D OG1 1 
ATOM 3933 C CG2 . THR D 1 96  ? 16.925  19.560  36.991  1.00 44.52 ? 122 THR D CG2 1 
ATOM 3934 N N   . GLN D 1 97  ? 19.932  17.436  39.561  1.00 43.85 ? 123 GLN D N   1 
ATOM 3935 C CA  . GLN D 1 97  ? 21.085  16.907  40.281  1.00 43.61 ? 123 GLN D CA  1 
ATOM 3936 C C   . GLN D 1 97  ? 21.710  15.720  39.545  1.00 43.54 ? 123 GLN D C   1 
ATOM 3937 O O   . GLN D 1 97  ? 21.018  14.976  38.838  1.00 43.50 ? 123 GLN D O   1 
ATOM 3938 C CB  . GLN D 1 97  ? 20.637  16.528  41.702  1.00 43.67 ? 123 GLN D CB  1 
ATOM 3939 C CG  . GLN D 1 97  ? 21.177  15.240  42.293  1.00 43.83 ? 123 GLN D CG  1 
ATOM 3940 C CD  . GLN D 1 97  ? 20.299  14.713  43.408  1.00 43.77 ? 123 GLN D CD  1 
ATOM 3941 O OE1 . GLN D 1 97  ? 19.871  15.461  44.286  1.00 45.02 ? 123 GLN D OE1 1 
ATOM 3942 N NE2 . GLN D 1 97  ? 20.025  13.420  43.380  1.00 43.85 ? 123 GLN D NE2 1 
ATOM 3943 N N   . PHE D 1 98  ? 23.022  15.556  39.695  1.00 43.29 ? 124 PHE D N   1 
ATOM 3944 C CA  . PHE D 1 98  ? 23.670  14.329  39.243  1.00 43.29 ? 124 PHE D CA  1 
ATOM 3945 C C   . PHE D 1 98  ? 23.309  13.168  40.163  1.00 43.51 ? 124 PHE D C   1 
ATOM 3946 O O   . PHE D 1 98  ? 23.305  13.312  41.388  1.00 43.43 ? 124 PHE D O   1 
ATOM 3947 C CB  . PHE D 1 98  ? 25.194  14.496  39.137  1.00 42.95 ? 124 PHE D CB  1 
ATOM 3948 C CG  . PHE D 1 98  ? 25.629  15.327  37.965  1.00 42.06 ? 124 PHE D CG  1 
ATOM 3949 C CD1 . PHE D 1 98  ? 26.210  16.576  38.160  1.00 41.53 ? 124 PHE D CD1 1 
ATOM 3950 C CD2 . PHE D 1 98  ? 25.435  14.873  36.663  1.00 41.02 ? 124 PHE D CD2 1 
ATOM 3951 C CE1 . PHE D 1 98  ? 26.604  17.354  37.078  1.00 40.52 ? 124 PHE D CE1 1 
ATOM 3952 C CE2 . PHE D 1 98  ? 25.826  15.641  35.577  1.00 40.67 ? 124 PHE D CE2 1 
ATOM 3953 C CZ  . PHE D 1 98  ? 26.411  16.886  35.785  1.00 41.09 ? 124 PHE D CZ  1 
ATOM 3954 N N   . MET D 1 99  ? 22.983  12.027  39.559  1.00 44.00 ? 125 MET D N   1 
ATOM 3955 C CA  . MET D 1 99  ? 22.665  10.803  40.298  1.00 44.48 ? 125 MET D CA  1 
ATOM 3956 C C   . MET D 1 99  ? 23.879  10.372  41.121  1.00 44.36 ? 125 MET D C   1 
ATOM 3957 O O   . MET D 1 99  ? 24.984  10.269  40.591  1.00 44.25 ? 125 MET D O   1 
ATOM 3958 C CB  . MET D 1 99  ? 22.261  9.705   39.318  1.00 44.23 ? 125 MET D CB  1 
ATOM 3959 C CG  . MET D 1 99  ? 21.386  8.623   39.912  1.00 45.03 ? 125 MET D CG  1 
ATOM 3960 S SD  . MET D 1 99  ? 20.918  7.345   38.721  1.00 45.73 ? 125 MET D SD  1 
ATOM 3961 C CE  . MET D 1 99  ? 20.112  8.322   37.459  1.00 45.13 ? 125 MET D CE  1 
ATOM 3962 N N   . SER D 1 100 ? 23.677  10.140  42.417  1.00 44.66 ? 126 SER D N   1 
ATOM 3963 C CA  . SER D 1 100 ? 24.795  9.859   43.329  1.00 45.03 ? 126 SER D CA  1 
ATOM 3964 C C   . SER D 1 100 ? 25.461  8.500   43.086  1.00 45.14 ? 126 SER D C   1 
ATOM 3965 O O   . SER D 1 100 ? 26.645  8.327   43.381  1.00 45.12 ? 126 SER D O   1 
ATOM 3966 C CB  . SER D 1 100 ? 24.378  10.010  44.799  1.00 45.02 ? 126 SER D CB  1 
ATOM 3967 O OG  . SER D 1 100 ? 23.849  8.803   45.321  1.00 45.57 ? 126 SER D OG  1 
ATOM 3968 N N   . ASN D 1 101 ? 24.699  7.545   42.555  1.00 45.30 ? 127 ASN D N   1 
ATOM 3969 C CA  . ASN D 1 101 ? 25.243  6.237   42.194  1.00 45.42 ? 127 ASN D CA  1 
ATOM 3970 C C   . ASN D 1 101 ? 25.643  6.141   40.719  1.00 45.34 ? 127 ASN D C   1 
ATOM 3971 O O   . ASN D 1 101 ? 26.162  5.113   40.271  1.00 45.49 ? 127 ASN D O   1 
ATOM 3972 C CB  . ASN D 1 101 ? 24.285  5.109   42.602  1.00 45.51 ? 127 ASN D CB  1 
ATOM 3973 C CG  . ASN D 1 101 ? 24.642  4.492   43.964  1.00 46.08 ? 127 ASN D CG  1 
ATOM 3974 O OD1 . ASN D 1 101 ? 23.804  4.428   44.872  1.00 46.16 ? 127 ASN D OD1 1 
ATOM 3975 N ND2 . ASN D 1 101 ? 25.889  4.034   44.103  1.00 45.71 ? 127 ASN D ND2 1 
ATOM 3976 N N   . CYS D 1 102 ? 25.406  7.224   39.979  1.00 45.21 ? 128 CYS D N   1 
ATOM 3977 C CA  . CYS D 1 102 ? 25.847  7.354   38.589  1.00 44.83 ? 128 CYS D CA  1 
ATOM 3978 C C   . CYS D 1 102 ? 26.021  8.846   38.236  1.00 44.29 ? 128 CYS D C   1 
ATOM 3979 O O   . CYS D 1 102 ? 25.102  9.487   37.695  1.00 44.05 ? 128 CYS D O   1 
ATOM 3980 C CB  . CYS D 1 102 ? 24.882  6.635   37.636  1.00 44.99 ? 128 CYS D CB  1 
ATOM 3981 S SG  . CYS D 1 102 ? 25.253  6.856   35.885  1.00 46.09 ? 128 CYS D SG  1 
ATOM 3982 N N   . PRO D 1 103 ? 27.218  9.400   38.536  1.00 43.74 ? 129 PRO D N   1 
ATOM 3983 C CA  . PRO D 1 103 ? 27.486  10.846  38.555  1.00 43.19 ? 129 PRO D CA  1 
ATOM 3984 C C   . PRO D 1 103 ? 27.387  11.505  37.185  1.00 42.52 ? 129 PRO D C   1 
ATOM 3985 O O   . PRO D 1 103 ? 27.380  12.732  37.090  1.00 42.54 ? 129 PRO D O   1 
ATOM 3986 C CB  . PRO D 1 103 ? 28.929  10.926  39.074  1.00 43.27 ? 129 PRO D CB  1 
ATOM 3987 C CG  . PRO D 1 103 ? 29.536  9.637   38.682  1.00 43.41 ? 129 PRO D CG  1 
ATOM 3988 C CD  . PRO D 1 103 ? 28.434  8.626   38.845  1.00 43.65 ? 129 PRO D CD  1 
ATOM 3989 N N   . VAL D 1 104 ? 27.313  10.685  36.144  1.00 41.81 ? 130 VAL D N   1 
ATOM 3990 C CA  . VAL D 1 104 ? 27.241  11.159  34.766  1.00 41.14 ? 130 VAL D CA  1 
ATOM 3991 C C   . VAL D 1 104 ? 25.776  11.209  34.268  1.00 40.65 ? 130 VAL D C   1 
ATOM 3992 O O   . VAL D 1 104 ? 25.502  11.559  33.118  1.00 40.24 ? 130 VAL D O   1 
ATOM 3993 C CB  . VAL D 1 104 ? 28.188  10.312  33.864  1.00 41.06 ? 130 VAL D CB  1 
ATOM 3994 C CG1 . VAL D 1 104 ? 27.714  8.868   33.783  1.00 41.39 ? 130 VAL D CG1 1 
ATOM 3995 C CG2 . VAL D 1 104 ? 28.365  10.935  32.484  1.00 41.43 ? 130 VAL D CG2 1 
ATOM 3996 N N   . ALA D 1 105 ? 24.845  10.874  35.161  1.00 40.30 ? 131 ALA D N   1 
ATOM 3997 C CA  . ALA D 1 105 ? 23.415  10.928  34.863  1.00 40.10 ? 131 ALA D CA  1 
ATOM 3998 C C   . ALA D 1 105 ? 22.704  12.088  35.598  1.00 39.97 ? 131 ALA D C   1 
ATOM 3999 O O   . ALA D 1 105 ? 23.184  12.566  36.630  1.00 39.85 ? 131 ALA D O   1 
ATOM 4000 C CB  . ALA D 1 105 ? 22.767  9.596   35.188  1.00 40.17 ? 131 ALA D CB  1 
ATOM 4001 N N   . VAL D 1 106 ? 21.568  12.533  35.059  1.00 39.51 ? 132 VAL D N   1 
ATOM 4002 C CA  . VAL D 1 106 ? 20.843  13.678  35.606  1.00 39.56 ? 132 VAL D CA  1 
ATOM 4003 C C   . VAL D 1 106 ? 19.422  13.299  36.085  1.00 39.36 ? 132 VAL D C   1 
ATOM 4004 O O   . VAL D 1 106 ? 18.657  12.673  35.345  1.00 39.60 ? 132 VAL D O   1 
ATOM 4005 C CB  . VAL D 1 106 ? 20.784  14.840  34.582  1.00 39.72 ? 132 VAL D CB  1 
ATOM 4006 C CG1 . VAL D 1 106 ? 20.028  16.040  35.153  1.00 39.97 ? 132 VAL D CG1 1 
ATOM 4007 C CG2 . VAL D 1 106 ? 22.188  15.270  34.166  1.00 40.06 ? 132 VAL D CG2 1 
ATOM 4008 N N   . THR D 1 107 ? 19.092  13.662  37.326  1.00 38.68 ? 133 THR D N   1 
ATOM 4009 C CA  . THR D 1 107 ? 17.757  13.425  37.897  1.00 38.41 ? 133 THR D CA  1 
ATOM 4010 C C   . THR D 1 107 ? 17.200  14.658  38.612  1.00 38.03 ? 133 THR D C   1 
ATOM 4011 O O   . THR D 1 107 ? 17.903  15.649  38.800  1.00 38.25 ? 133 THR D O   1 
ATOM 4012 C CB  . THR D 1 107 ? 17.727  12.228  38.918  1.00 38.39 ? 133 THR D CB  1 
ATOM 4013 O OG1 . THR D 1 107 ? 18.620  12.482  40.009  1.00 38.34 ? 133 THR D OG1 1 
ATOM 4014 C CG2 . THR D 1 107 ? 18.101  10.926  38.263  1.00 38.15 ? 133 THR D CG2 1 
ATOM 4015 N N   . GLU D 1 108 ? 15.940  14.582  39.027  1.00 37.44 ? 134 GLU D N   1 
ATOM 4016 C CA  . GLU D 1 108 ? 15.339  15.614  39.865  1.00 37.06 ? 134 GLU D CA  1 
ATOM 4017 C C   . GLU D 1 108 ? 15.935  15.547  41.267  1.00 36.96 ? 134 GLU D C   1 
ATOM 4018 O O   . GLU D 1 108 ? 16.460  14.506  41.660  1.00 37.06 ? 134 GLU D O   1 
ATOM 4019 C CB  . GLU D 1 108 ? 13.812  15.439  39.909  1.00 37.14 ? 134 GLU D CB  1 
ATOM 4020 C CG  . GLU D 1 108 ? 13.276  14.371  40.888  1.00 36.76 ? 134 GLU D CG  1 
ATOM 4021 C CD  . GLU D 1 108 ? 13.758  12.966  40.593  1.00 36.94 ? 134 GLU D CD  1 
ATOM 4022 O OE1 . GLU D 1 108 ? 13.901  12.183  41.550  1.00 37.08 ? 134 GLU D OE1 1 
ATOM 4023 O OE2 . GLU D 1 108 ? 13.996  12.631  39.411  1.00 38.81 ? 134 GLU D OE2 1 
ATOM 4024 N N   . SER D 1 109 ? 15.859  16.650  42.012  1.00 36.78 ? 135 SER D N   1 
ATOM 4025 C CA  . SER D 1 109 ? 16.298  16.676  43.415  1.00 36.74 ? 135 SER D CA  1 
ATOM 4026 C C   . SER D 1 109 ? 15.129  16.475  44.387  1.00 36.54 ? 135 SER D C   1 
ATOM 4027 O O   . SER D 1 109 ? 15.337  16.085  45.537  1.00 36.55 ? 135 SER D O   1 
ATOM 4028 C CB  . SER D 1 109 ? 16.998  18.001  43.752  1.00 37.03 ? 135 SER D CB  1 
ATOM 4029 O OG  . SER D 1 109 ? 18.019  18.334  42.823  1.00 37.54 ? 135 SER D OG  1 
ATOM 4030 N N   . THR D 1 110 ? 13.915  16.793  43.934  1.00 36.15 ? 136 THR D N   1 
ATOM 4031 C CA  . THR D 1 110 ? 12.691  16.659  44.738  1.00 35.80 ? 136 THR D CA  1 
ATOM 4032 C C   . THR D 1 110 ? 11.556  16.184  43.828  1.00 35.48 ? 136 THR D C   1 
ATOM 4033 O O   . THR D 1 110 ? 11.552  16.512  42.643  1.00 35.68 ? 136 THR D O   1 
ATOM 4034 C CB  . THR D 1 110 ? 12.259  17.996  45.416  1.00 35.74 ? 136 THR D CB  1 
ATOM 4035 O OG1 . THR D 1 110 ? 11.600  18.839  44.466  1.00 36.35 ? 136 THR D OG1 1 
ATOM 4036 C CG2 . THR D 1 110 ? 13.441  18.741  46.019  1.00 35.49 ? 136 THR D CG2 1 
ATOM 4037 N N   . PRO D 1 111 ? 10.587  15.419  44.369  1.00 35.02 ? 137 PRO D N   1 
ATOM 4038 C CA  . PRO D 1 111 ? 9.454   14.941  43.564  1.00 34.79 ? 137 PRO D CA  1 
ATOM 4039 C C   . PRO D 1 111 ? 8.402   16.008  43.241  1.00 34.77 ? 137 PRO D C   1 
ATOM 4040 O O   . PRO D 1 111 ? 7.223   15.691  43.086  1.00 34.79 ? 137 PRO D O   1 
ATOM 4041 C CB  . PRO D 1 111 ? 8.851   13.838  44.436  1.00 34.68 ? 137 PRO D CB  1 
ATOM 4042 C CG  . PRO D 1 111 ? 9.174   14.248  45.816  1.00 34.93 ? 137 PRO D CG  1 
ATOM 4043 C CD  . PRO D 1 111 ? 10.516  14.929  45.756  1.00 34.87 ? 137 PRO D CD  1 
ATOM 4044 N N   . ARG D 1 112 ? 8.829   17.262  43.135  1.00 34.92 ? 138 ARG D N   1 
ATOM 4045 C CA  . ARG D 1 112 ? 7.957   18.345  42.710  1.00 34.91 ? 138 ARG D CA  1 
ATOM 4046 C C   . ARG D 1 112 ? 7.297   18.046  41.361  1.00 34.89 ? 138 ARG D C   1 
ATOM 4047 O O   . ARG D 1 112 ? 7.955   17.571  40.427  1.00 34.92 ? 138 ARG D O   1 
ATOM 4048 C CB  . ARG D 1 112 ? 8.760   19.641  42.618  1.00 35.10 ? 138 ARG D CB  1 
ATOM 4049 C CG  . ARG D 1 112 ? 7.925   20.867  42.284  1.00 35.71 ? 138 ARG D CG  1 
ATOM 4050 C CD  . ARG D 1 112 ? 8.788   22.101  42.078  1.00 37.08 ? 138 ARG D CD  1 
ATOM 4051 N NE  . ARG D 1 112 ? 9.506   22.487  43.292  1.00 37.71 ? 138 ARG D NE  1 
ATOM 4052 C CZ  . ARG D 1 112 ? 8.969   23.117  44.336  1.00 38.11 ? 138 ARG D CZ  1 
ATOM 4053 N NH1 . ARG D 1 112 ? 9.734   23.417  45.376  1.00 38.84 ? 138 ARG D NH1 1 
ATOM 4054 N NH2 . ARG D 1 112 ? 7.679   23.444  44.355  1.00 37.25 ? 138 ARG D NH2 1 
ATOM 4055 N N   . ARG D 1 113 ? 5.999   18.323  41.272  1.00 34.90 ? 139 ARG D N   1 
ATOM 4056 C CA  . ARG D 1 113 ? 5.276   18.269  40.003  1.00 35.26 ? 139 ARG D CA  1 
ATOM 4057 C C   . ARG D 1 113 ? 5.836   19.310  39.026  1.00 35.86 ? 139 ARG D C   1 
ATOM 4058 O O   . ARG D 1 113 ? 6.092   20.457  39.406  1.00 35.76 ? 139 ARG D O   1 
ATOM 4059 C CB  . ARG D 1 113 ? 3.779   18.506  40.216  1.00 35.06 ? 139 ARG D CB  1 
ATOM 4060 C CG  . ARG D 1 113 ? 3.085   17.486  41.121  1.00 34.92 ? 139 ARG D CG  1 
ATOM 4061 C CD  . ARG D 1 113 ? 1.575   17.626  41.062  1.00 34.75 ? 139 ARG D CD  1 
ATOM 4062 N NE  . ARG D 1 113 ? 1.195   19.031  40.947  1.00 34.95 ? 139 ARG D NE  1 
ATOM 4063 C CZ  . ARG D 1 113 ? 0.929   19.835  41.972  1.00 33.96 ? 139 ARG D CZ  1 
ATOM 4064 N NH1 . ARG D 1 113 ? 0.976   19.372  43.215  1.00 33.26 ? 139 ARG D NH1 1 
ATOM 4065 N NH2 . ARG D 1 113 ? 0.611   21.105  41.743  1.00 33.18 ? 139 ARG D NH2 1 
ATOM 4066 N N   . ARG D 1 114 ? 6.039   18.907  37.775  1.00 36.47 ? 140 ARG D N   1 
ATOM 4067 C CA  . ARG D 1 114 ? 6.600   19.821  36.782  1.00 37.38 ? 140 ARG D CA  1 
ATOM 4068 C C   . ARG D 1 114 ? 6.279   19.469  35.328  1.00 37.45 ? 140 ARG D C   1 
ATOM 4069 O O   . ARG D 1 114 ? 5.873   18.350  35.020  1.00 37.19 ? 140 ARG D O   1 
ATOM 4070 C CB  . ARG D 1 114 ? 8.113   19.997  36.990  1.00 37.55 ? 140 ARG D CB  1 
ATOM 4071 C CG  . ARG D 1 114 ? 8.947   18.773  36.730  1.00 38.70 ? 140 ARG D CG  1 
ATOM 4072 C CD  . ARG D 1 114 ? 10.342  18.976  37.269  1.00 41.17 ? 140 ARG D CD  1 
ATOM 4073 N NE  . ARG D 1 114 ? 10.505  18.433  38.617  1.00 43.83 ? 140 ARG D NE  1 
ATOM 4074 C CZ  . ARG D 1 114 ? 11.598  18.590  39.358  1.00 43.62 ? 140 ARG D CZ  1 
ATOM 4075 N NH1 . ARG D 1 114 ? 12.622  19.288  38.879  1.00 43.29 ? 140 ARG D NH1 1 
ATOM 4076 N NH2 . ARG D 1 114 ? 11.663  18.056  40.576  1.00 42.37 ? 140 ARG D NH2 1 
ATOM 4077 N N   . THR D 1 115 ? 6.484   20.446  34.448  1.00 37.88 ? 141 THR D N   1 
ATOM 4078 C CA  . THR D 1 115 ? 6.116   20.340  33.040  1.00 38.09 ? 141 THR D CA  1 
ATOM 4079 C C   . THR D 1 115 ? 7.330   20.353  32.126  1.00 38.29 ? 141 THR D C   1 
ATOM 4080 O O   . THR D 1 115 ? 7.223   20.007  30.954  1.00 38.51 ? 141 THR D O   1 
ATOM 4081 C CB  . THR D 1 115 ? 5.201   21.509  32.615  1.00 38.25 ? 141 THR D CB  1 
ATOM 4082 O OG1 . THR D 1 115 ? 5.930   22.743  32.685  1.00 38.26 ? 141 THR D OG1 1 
ATOM 4083 C CG2 . THR D 1 115 ? 3.964   21.594  33.505  1.00 37.80 ? 141 THR D CG2 1 
ATOM 4084 N N   . ARG D 1 116 ? 8.481   20.749  32.664  1.00 38.61 ? 142 ARG D N   1 
ATOM 4085 C CA  . ARG D 1 116 ? 9.679   20.981  31.860  1.00 39.14 ? 142 ARG D CA  1 
ATOM 4086 C C   . ARG D 1 116 ? 10.920  21.062  32.737  1.00 39.01 ? 142 ARG D C   1 
ATOM 4087 O O   . ARG D 1 116 ? 10.887  21.687  33.799  1.00 39.32 ? 142 ARG D O   1 
ATOM 4088 C CB  . ARG D 1 116 ? 9.517   22.288  31.076  1.00 38.99 ? 142 ARG D CB  1 
ATOM 4089 C CG  . ARG D 1 116 ? 10.613  22.630  30.062  1.00 39.77 ? 142 ARG D CG  1 
ATOM 4090 C CD  . ARG D 1 116 ? 10.242  23.955  29.367  1.00 40.34 ? 142 ARG D CD  1 
ATOM 4091 N NE  . ARG D 1 116 ? 11.125  24.326  28.262  1.00 42.77 ? 142 ARG D NE  1 
ATOM 4092 C CZ  . ARG D 1 116 ? 10.954  25.403  27.493  1.00 43.76 ? 142 ARG D CZ  1 
ATOM 4093 N NH1 . ARG D 1 116 ? 9.926   26.221  27.699  1.00 44.49 ? 142 ARG D NH1 1 
ATOM 4094 N NH2 . ARG D 1 116 ? 11.807  25.662  26.507  1.00 43.64 ? 142 ARG D NH2 1 
ATOM 4095 N N   . ILE D 1 117 ? 12.001  20.415  32.299  1.00 38.72 ? 143 ILE D N   1 
ATOM 4096 C CA  . ILE D 1 117 ? 13.331  20.619  32.881  1.00 38.60 ? 143 ILE D CA  1 
ATOM 4097 C C   . ILE D 1 117 ? 14.357  20.761  31.764  1.00 38.67 ? 143 ILE D C   1 
ATOM 4098 O O   . ILE D 1 117 ? 14.133  20.279  30.656  1.00 38.81 ? 143 ILE D O   1 
ATOM 4099 C CB  . ILE D 1 117 ? 13.753  19.484  33.853  1.00 38.58 ? 143 ILE D CB  1 
ATOM 4100 C CG1 . ILE D 1 117 ? 13.786  18.118  33.156  1.00 38.79 ? 143 ILE D CG1 1 
ATOM 4101 C CG2 . ILE D 1 117 ? 12.825  19.432  35.052  1.00 38.51 ? 143 ILE D CG2 1 
ATOM 4102 C CD1 . ILE D 1 117 ? 15.129  17.725  32.607  1.00 38.41 ? 143 ILE D CD1 1 
ATOM 4103 N N   . GLN D 1 118 ? 15.475  21.425  32.047  1.00 38.61 ? 144 GLN D N   1 
ATOM 4104 C CA  . GLN D 1 118 ? 16.533  21.566  31.045  1.00 39.04 ? 144 GLN D CA  1 
ATOM 4105 C C   . GLN D 1 118 ? 17.945  21.482  31.618  1.00 38.40 ? 144 GLN D C   1 
ATOM 4106 O O   . GLN D 1 118 ? 18.197  21.896  32.746  1.00 38.48 ? 144 GLN D O   1 
ATOM 4107 C CB  . GLN D 1 118 ? 16.363  22.844  30.200  1.00 38.88 ? 144 GLN D CB  1 
ATOM 4108 C CG  . GLN D 1 118 ? 16.411  24.152  30.989  1.00 39.67 ? 144 GLN D CG  1 
ATOM 4109 C CD  . GLN D 1 118 ? 16.347  25.413  30.113  1.00 40.43 ? 144 GLN D CD  1 
ATOM 4110 O OE1 . GLN D 1 118 ? 16.712  25.398  28.920  1.00 42.53 ? 144 GLN D OE1 1 
ATOM 4111 N NE2 . GLN D 1 118 ? 15.903  26.520  30.716  1.00 40.97 ? 144 GLN D NE2 1 
ATOM 4112 N N   . VAL D 1 119 ? 18.850  20.938  30.812  1.00 37.86 ? 145 VAL D N   1 
ATOM 4113 C CA  . VAL D 1 119 ? 20.280  20.906  31.113  1.00 37.20 ? 145 VAL D CA  1 
ATOM 4114 C C   . VAL D 1 119 ? 21.055  21.355  29.883  1.00 36.80 ? 145 VAL D C   1 
ATOM 4115 O O   . VAL D 1 119 ? 20.492  21.469  28.792  1.00 36.98 ? 145 VAL D O   1 
ATOM 4116 C CB  . VAL D 1 119 ? 20.758  19.484  31.491  1.00 37.11 ? 145 VAL D CB  1 
ATOM 4117 C CG1 . VAL D 1 119 ? 20.088  19.013  32.776  1.00 37.79 ? 145 VAL D CG1 1 
ATOM 4118 C CG2 . VAL D 1 119 ? 20.494  18.501  30.350  1.00 36.57 ? 145 VAL D CG2 1 
ATOM 4119 N N   . PHE D 1 120 ? 22.344  21.612  30.050  1.00 36.16 ? 146 PHE D N   1 
ATOM 4120 C CA  . PHE D 1 120 ? 23.211  21.738  28.899  1.00 35.74 ? 146 PHE D CA  1 
ATOM 4121 C C   . PHE D 1 120 ? 23.811  20.371  28.631  1.00 35.47 ? 146 PHE D C   1 
ATOM 4122 O O   . PHE D 1 120 ? 23.757  19.489  29.485  1.00 35.45 ? 146 PHE D O   1 
ATOM 4123 C CB  . PHE D 1 120 ? 24.321  22.758  29.140  1.00 35.61 ? 146 PHE D CB  1 
ATOM 4124 C CG  . PHE D 1 120 ? 23.832  24.167  29.321  1.00 35.48 ? 146 PHE D CG  1 
ATOM 4125 C CD1 . PHE D 1 120 ? 24.046  24.840  30.529  1.00 34.49 ? 146 PHE D CD1 1 
ATOM 4126 C CD2 . PHE D 1 120 ? 23.170  24.828  28.294  1.00 34.90 ? 146 PHE D CD2 1 
ATOM 4127 C CE1 . PHE D 1 120 ? 23.616  26.142  30.707  1.00 34.29 ? 146 PHE D CE1 1 
ATOM 4128 C CE2 . PHE D 1 120 ? 22.727  26.137  28.471  1.00 35.23 ? 146 PHE D CE2 1 
ATOM 4129 C CZ  . PHE D 1 120 ? 22.953  26.794  29.684  1.00 34.71 ? 146 PHE D CZ  1 
ATOM 4130 N N   . TRP D 1 121 ? 24.380  20.197  27.446  1.00 35.16 ? 147 TRP D N   1 
ATOM 4131 C CA  . TRP D 1 121 ? 25.117  18.988  27.133  1.00 34.89 ? 147 TRP D CA  1 
ATOM 4132 C C   . TRP D 1 121 ? 26.291  19.310  26.224  1.00 34.94 ? 147 TRP D C   1 
ATOM 4133 O O   . TRP D 1 121 ? 26.123  19.512  25.018  1.00 35.03 ? 147 TRP D O   1 
ATOM 4134 C CB  . TRP D 1 121 ? 24.199  17.949  26.488  1.00 34.75 ? 147 TRP D CB  1 
ATOM 4135 C CG  . TRP D 1 121 ? 24.916  16.721  26.009  1.00 34.69 ? 147 TRP D CG  1 
ATOM 4136 C CD1 . TRP D 1 121 ? 25.421  15.708  26.775  1.00 34.50 ? 147 TRP D CD1 1 
ATOM 4137 C CD2 . TRP D 1 121 ? 25.209  16.380  24.652  1.00 34.67 ? 147 TRP D CD2 1 
ATOM 4138 N NE1 . TRP D 1 121 ? 26.012  14.757  25.977  1.00 34.10 ? 147 TRP D NE1 1 
ATOM 4139 C CE2 . TRP D 1 121 ? 25.892  15.144  24.669  1.00 34.63 ? 147 TRP D CE2 1 
ATOM 4140 C CE3 . TRP D 1 121 ? 24.963  17.001  23.419  1.00 34.89 ? 147 TRP D CE3 1 
ATOM 4141 C CZ2 . TRP D 1 121 ? 26.330  14.517  23.502  1.00 34.60 ? 147 TRP D CZ2 1 
ATOM 4142 C CZ3 . TRP D 1 121 ? 25.398  16.380  22.261  1.00 34.24 ? 147 TRP D CZ3 1 
ATOM 4143 C CH2 . TRP D 1 121 ? 26.075  15.150  22.312  1.00 34.69 ? 147 TRP D CH2 1 
ATOM 4144 N N   . ILE D 1 122 ? 27.481  19.369  26.811  1.00 34.83 ? 148 ILE D N   1 
ATOM 4145 C CA  . ILE D 1 122 ? 28.699  19.581  26.040  1.00 34.76 ? 148 ILE D CA  1 
ATOM 4146 C C   . ILE D 1 122 ? 28.983  18.328  25.216  1.00 34.96 ? 148 ILE D C   1 
ATOM 4147 O O   . ILE D 1 122 ? 29.068  17.226  25.765  1.00 34.91 ? 148 ILE D O   1 
ATOM 4148 C CB  . ILE D 1 122 ? 29.896  19.914  26.960  1.00 34.80 ? 148 ILE D CB  1 
ATOM 4149 C CG1 . ILE D 1 122 ? 29.491  20.975  27.991  1.00 34.06 ? 148 ILE D CG1 1 
ATOM 4150 C CG2 . ILE D 1 122 ? 31.109  20.368  26.131  1.00 34.39 ? 148 ILE D CG2 1 
ATOM 4151 C CD1 . ILE D 1 122 ? 30.363  21.011  29.215  1.00 33.79 ? 148 ILE D CD1 1 
ATOM 4152 N N   . ALA D 1 123 ? 29.105  18.505  23.900  1.00 35.22 ? 149 ALA D N   1 
ATOM 4153 C CA  . ALA D 1 123 ? 29.301  17.385  22.959  1.00 35.41 ? 149 ALA D CA  1 
ATOM 4154 C C   . ALA D 1 123 ? 30.710  16.799  23.043  1.00 35.57 ? 149 ALA D C   1 
ATOM 4155 O O   . ALA D 1 123 ? 31.665  17.539  23.268  1.00 35.97 ? 149 ALA D O   1 
ATOM 4156 C CB  . ALA D 1 123 ? 28.994  17.825  21.543  1.00 35.22 ? 149 ALA D CB  1 
ATOM 4157 N N   . PRO D 1 124 ? 30.845  15.469  22.862  1.00 35.81 ? 150 PRO D N   1 
ATOM 4158 C CA  . PRO D 1 124 ? 32.125  14.767  23.043  1.00 35.86 ? 150 PRO D CA  1 
ATOM 4159 C C   . PRO D 1 124 ? 33.119  15.032  21.904  1.00 36.12 ? 150 PRO D C   1 
ATOM 4160 O O   . PRO D 1 124 ? 32.700  15.464  20.830  1.00 36.13 ? 150 PRO D O   1 
ATOM 4161 C CB  . PRO D 1 124 ? 31.705  13.297  23.095  1.00 35.70 ? 150 PRO D CB  1 
ATOM 4162 C CG  . PRO D 1 124 ? 30.469  13.236  22.302  1.00 35.49 ? 150 PRO D CG  1 
ATOM 4163 C CD  . PRO D 1 124 ? 29.768  14.539  22.472  1.00 35.93 ? 150 PRO D CD  1 
ATOM 4164 N N   . PRO D 1 125 ? 34.426  14.769  22.132  1.00 36.39 ? 151 PRO D N   1 
ATOM 4165 C CA  . PRO D 1 125 ? 35.493  15.218  21.221  1.00 36.64 ? 151 PRO D CA  1 
ATOM 4166 C C   . PRO D 1 125 ? 35.600  14.485  19.877  1.00 36.88 ? 151 PRO D C   1 
ATOM 4167 O O   . PRO D 1 125 ? 34.650  13.833  19.436  1.00 36.80 ? 151 PRO D O   1 
ATOM 4168 C CB  . PRO D 1 125 ? 36.781  15.010  22.045  1.00 36.56 ? 151 PRO D CB  1 
ATOM 4169 C CG  . PRO D 1 125 ? 36.344  14.637  23.417  1.00 36.53 ? 151 PRO D CG  1 
ATOM 4170 C CD  . PRO D 1 125 ? 34.988  14.028  23.273  1.00 36.40 ? 151 PRO D CD  1 
ATOM 4171 N N   . ALA D 1 126 ? 36.772  14.611  19.252  1.00 37.25 ? 152 ALA D N   1 
ATOM 4172 C CA  . ALA D 1 126 ? 37.075  14.091  17.915  1.00 37.50 ? 152 ALA D CA  1 
ATOM 4173 C C   . ALA D 1 126 ? 36.372  12.785  17.553  1.00 37.83 ? 152 ALA D C   1 
ATOM 4174 O O   . ALA D 1 126 ? 36.708  11.719  18.078  1.00 37.88 ? 152 ALA D O   1 
ATOM 4175 C CB  . ALA D 1 126 ? 38.580  13.945  17.748  1.00 37.46 ? 152 ALA D CB  1 
ATOM 4176 N N   . GLY D 1 127 ? 35.387  12.890  16.660  1.00 38.09 ? 153 GLY D N   1 
ATOM 4177 C CA  . GLY D 1 127 ? 34.682  11.740  16.090  1.00 38.36 ? 153 GLY D CA  1 
ATOM 4178 C C   . GLY D 1 127 ? 34.495  10.536  16.996  1.00 38.64 ? 153 GLY D C   1 
ATOM 4179 O O   . GLY D 1 127 ? 34.742  9.400   16.591  1.00 38.89 ? 153 GLY D O   1 
ATOM 4180 N N   . THR D 1 128 ? 34.057  10.788  18.224  1.00 38.82 ? 154 THR D N   1 
ATOM 4181 C CA  . THR D 1 128 ? 33.714  9.736   19.180  1.00 38.86 ? 154 THR D CA  1 
ATOM 4182 C C   . THR D 1 128 ? 32.571  8.869   18.636  1.00 39.14 ? 154 THR D C   1 
ATOM 4183 O O   . THR D 1 128 ? 32.139  7.905   19.282  1.00 39.06 ? 154 THR D O   1 
ATOM 4184 C CB  . THR D 1 128 ? 33.300  10.354  20.548  1.00 38.77 ? 154 THR D CB  1 
ATOM 4185 O OG1 . THR D 1 128 ? 33.290  9.343   21.564  1.00 38.71 ? 154 THR D OG1 1 
ATOM 4186 C CG2 . THR D 1 128 ? 31.927  10.988  20.454  1.00 38.02 ? 154 THR D CG2 1 
ATOM 4187 N N   . GLY D 1 129 ? 32.086  9.234   17.450  1.00 39.37 ? 155 GLY D N   1 
ATOM 4188 C CA  . GLY D 1 129 ? 30.962  8.558   16.825  1.00 40.13 ? 155 GLY D CA  1 
ATOM 4189 C C   . GLY D 1 129 ? 29.617  9.010   17.361  1.00 40.65 ? 155 GLY D C   1 
ATOM 4190 O O   . GLY D 1 129 ? 29.517  10.039  18.036  1.00 40.71 ? 155 GLY D O   1 
ATOM 4191 N N   . CYS D 1 130 ? 28.587  8.220   17.070  1.00 41.15 ? 156 CYS D N   1 
ATOM 4192 C CA  . CYS D 1 130 ? 27.205  8.607   17.331  1.00 41.79 ? 156 CYS D CA  1 
ATOM 4193 C C   . CYS D 1 130 ? 26.810  8.466   18.792  1.00 41.82 ? 156 CYS D C   1 
ATOM 4194 O O   . CYS D 1 130 ? 27.114  7.462   19.434  1.00 41.81 ? 156 CYS D O   1 
ATOM 4195 C CB  . CYS D 1 130 ? 26.254  7.794   16.457  1.00 41.97 ? 156 CYS D CB  1 
ATOM 4196 S SG  . CYS D 1 130 ? 26.506  8.039   14.685  1.00 43.77 ? 156 CYS D SG  1 
ATOM 4197 N N   . VAL D 1 131 ? 26.135  9.489   19.306  1.00 41.87 ? 157 VAL D N   1 
ATOM 4198 C CA  . VAL D 1 131 ? 25.606  9.464   20.665  1.00 41.98 ? 157 VAL D CA  1 
ATOM 4199 C C   . VAL D 1 131 ? 24.081  9.470   20.657  1.00 42.07 ? 157 VAL D C   1 
ATOM 4200 O O   . VAL D 1 131 ? 23.452  9.931   19.699  1.00 42.01 ? 157 VAL D O   1 
ATOM 4201 C CB  . VAL D 1 131 ? 26.120  10.649  21.526  1.00 41.91 ? 157 VAL D CB  1 
ATOM 4202 C CG1 . VAL D 1 131 ? 27.630  10.552  21.727  1.00 41.55 ? 157 VAL D CG1 1 
ATOM 4203 C CG2 . VAL D 1 131 ? 25.724  11.980  20.902  1.00 41.82 ? 157 VAL D CG2 1 
ATOM 4204 N N   . ILE D 1 132 ? 23.496  8.951   21.731  1.00 42.15 ? 158 ILE D N   1 
ATOM 4205 C CA  . ILE D 1 132 ? 22.051  8.935   21.867  1.00 42.28 ? 158 ILE D CA  1 
ATOM 4206 C C   . ILE D 1 132 ? 21.631  9.476   23.240  1.00 42.24 ? 158 ILE D C   1 
ATOM 4207 O O   . ILE D 1 132 ? 21.999  8.932   24.284  1.00 42.01 ? 158 ILE D O   1 
ATOM 4208 C CB  . ILE D 1 132 ? 21.467  7.533   21.519  1.00 42.26 ? 158 ILE D CB  1 
ATOM 4209 C CG1 . ILE D 1 132 ? 19.999  7.643   21.089  1.00 42.59 ? 158 ILE D CG1 1 
ATOM 4210 C CG2 . ILE D 1 132 ? 21.691  6.532   22.653  1.00 42.49 ? 158 ILE D CG2 1 
ATOM 4211 C CD1 . ILE D 1 132 ? 19.581  6.615   20.036  1.00 43.01 ? 158 ILE D CD1 1 
ATOM 4212 N N   . LEU D 1 133 ? 20.905  10.591  23.215  1.00 42.40 ? 159 LEU D N   1 
ATOM 4213 C CA  . LEU D 1 133 ? 20.416  11.233  24.434  1.00 42.66 ? 159 LEU D CA  1 
ATOM 4214 C C   . LEU D 1 133 ? 19.065  10.642  24.794  1.00 42.52 ? 159 LEU D C   1 
ATOM 4215 O O   . LEU D 1 133 ? 18.160  10.590  23.959  1.00 42.51 ? 159 LEU D O   1 
ATOM 4216 C CB  . LEU D 1 133 ? 20.311  12.752  24.252  1.00 42.82 ? 159 LEU D CB  1 
ATOM 4217 C CG  . LEU D 1 133 ? 21.609  13.498  23.921  1.00 43.26 ? 159 LEU D CG  1 
ATOM 4218 C CD1 . LEU D 1 133 ? 21.305  14.836  23.270  1.00 43.71 ? 159 LEU D CD1 1 
ATOM 4219 C CD2 . LEU D 1 133 ? 22.469  13.695  25.163  1.00 43.73 ? 159 LEU D CD2 1 
ATOM 4220 N N   . LYS D 1 134 ? 18.938  10.190  26.036  1.00 42.44 ? 160 LYS D N   1 
ATOM 4221 C CA  . LYS D 1 134 ? 17.768  9.436   26.453  1.00 42.36 ? 160 LYS D CA  1 
ATOM 4222 C C   . LYS D 1 134 ? 17.231  9.917   27.789  1.00 42.29 ? 160 LYS D C   1 
ATOM 4223 O O   . LYS D 1 134 ? 18.003  10.241  28.694  1.00 42.46 ? 160 LYS D O   1 
ATOM 4224 C CB  . LYS D 1 134 ? 18.102  7.947   26.531  1.00 42.39 ? 160 LYS D CB  1 
ATOM 4225 C CG  . LYS D 1 134 ? 18.514  7.342   25.206  1.00 43.01 ? 160 LYS D CG  1 
ATOM 4226 C CD  . LYS D 1 134 ? 18.444  5.822   25.229  1.00 44.41 ? 160 LYS D CD  1 
ATOM 4227 C CE  . LYS D 1 134 ? 19.759  5.199   25.666  1.00 44.57 ? 160 LYS D CE  1 
ATOM 4228 N NZ  . LYS D 1 134 ? 19.695  3.717   25.608  1.00 45.23 ? 160 LYS D NZ  1 
ATOM 4229 N N   . ALA D 1 135 ? 15.905  9.954   27.898  1.00 42.03 ? 161 ALA D N   1 
ATOM 4230 C CA  . ALA D 1 135 ? 15.222  10.339  29.128  1.00 41.78 ? 161 ALA D CA  1 
ATOM 4231 C C   . ALA D 1 135 ? 14.326  9.207   29.592  1.00 41.76 ? 161 ALA D C   1 
ATOM 4232 O O   . ALA D 1 135 ? 13.964  8.335   28.804  1.00 41.90 ? 161 ALA D O   1 
ATOM 4233 C CB  . ALA D 1 135 ? 14.400  11.589  28.907  1.00 41.72 ? 161 ALA D CB  1 
ATOM 4234 N N   . SER D 1 136 ? 13.965  9.228   30.870  1.00 41.63 ? 162 SER D N   1 
ATOM 4235 C CA  . SER D 1 136 ? 13.060  8.229   31.430  1.00 41.61 ? 162 SER D CA  1 
ATOM 4236 C C   . SER D 1 136 ? 12.230  8.810   32.566  1.00 41.41 ? 162 SER D C   1 
ATOM 4237 O O   . SER D 1 136 ? 12.762  9.291   33.563  1.00 41.68 ? 162 SER D O   1 
ATOM 4238 C CB  . SER D 1 136 ? 13.829  7.000   31.910  1.00 41.61 ? 162 SER D CB  1 
ATOM 4239 O OG  . SER D 1 136 ? 13.010  6.174   32.717  1.00 41.91 ? 162 SER D OG  1 
ATOM 4240 N N   . ILE D 1 137 ? 10.919  8.758   32.400  1.00 41.02 ? 163 ILE D N   1 
ATOM 4241 C CA  . ILE D 1 137 ? 10.004  9.299   33.388  1.00 40.84 ? 163 ILE D CA  1 
ATOM 4242 C C   . ILE D 1 137 ? 9.484   8.215   34.345  1.00 40.77 ? 163 ILE D C   1 
ATOM 4243 O O   . ILE D 1 137 ? 8.695   8.502   35.243  1.00 40.47 ? 163 ILE D O   1 
ATOM 4244 C CB  . ILE D 1 137 ? 8.814   10.040  32.718  1.00 41.05 ? 163 ILE D CB  1 
ATOM 4245 C CG1 . ILE D 1 137 ? 8.036   9.090   31.807  1.00 40.87 ? 163 ILE D CG1 1 
ATOM 4246 C CG2 . ILE D 1 137 ? 9.301   11.271  31.931  1.00 40.39 ? 163 ILE D CG2 1 
ATOM 4247 C CD1 . ILE D 1 137 ? 6.566   9.145   32.018  1.00 41.36 ? 163 ILE D CD1 1 
ATOM 4248 N N   . VAL D 1 138 ? 9.934   6.977   34.161  1.00 40.57 ? 164 VAL D N   1 
ATOM 4249 C CA  . VAL D 1 138 ? 9.492   5.896   35.026  1.00 40.76 ? 164 VAL D CA  1 
ATOM 4250 C C   . VAL D 1 138 ? 10.335  5.819   36.301  1.00 40.86 ? 164 VAL D C   1 
ATOM 4251 O O   . VAL D 1 138 ? 11.550  5.680   36.242  1.00 41.18 ? 164 VAL D O   1 
ATOM 4252 C CB  . VAL D 1 138 ? 9.384   4.529   34.279  1.00 40.91 ? 164 VAL D CB  1 
ATOM 4253 C CG1 . VAL D 1 138 ? 10.765  3.957   33.913  1.00 40.64 ? 164 VAL D CG1 1 
ATOM 4254 C CG2 . VAL D 1 138 ? 8.549   3.539   35.102  1.00 40.61 ? 164 VAL D CG2 1 
ATOM 4255 N N   . GLN D 1 139 ? 9.670   5.923   37.447  1.00 40.86 ? 165 GLN D N   1 
ATOM 4256 C CA  . GLN D 1 139 ? 10.344  6.049   38.734  1.00 40.88 ? 165 GLN D CA  1 
ATOM 4257 C C   . GLN D 1 139 ? 10.375  4.731   39.494  1.00 40.46 ? 165 GLN D C   1 
ATOM 4258 O O   . GLN D 1 139 ? 9.481   4.448   40.291  1.00 40.55 ? 165 GLN D O   1 
ATOM 4259 C CB  . GLN D 1 139 ? 9.667   7.135   39.589  1.00 41.07 ? 165 GLN D CB  1 
ATOM 4260 C CG  . GLN D 1 139 ? 9.673   8.531   38.975  1.00 42.82 ? 165 GLN D CG  1 
ATOM 4261 C CD  . GLN D 1 139 ? 11.083  9.047   38.730  1.00 45.02 ? 165 GLN D CD  1 
ATOM 4262 O OE1 . GLN D 1 139 ? 11.590  9.004   37.600  1.00 46.18 ? 165 GLN D OE1 1 
ATOM 4263 N NE2 . GLN D 1 139 ? 11.733  9.514   39.791  1.00 44.87 ? 165 GLN D NE2 1 
ATOM 4264 N N   . LYS D 1 140 ? 11.401  3.928   39.224  1.00 40.21 ? 166 LYS D N   1 
ATOM 4265 C CA  . LYS D 1 140 ? 11.683  2.692   39.966  1.00 40.01 ? 166 LYS D CA  1 
ATOM 4266 C C   . LYS D 1 140 ? 13.122  2.804   40.455  1.00 40.11 ? 166 LYS D C   1 
ATOM 4267 O O   . LYS D 1 140 ? 13.793  3.795   40.155  1.00 40.27 ? 166 LYS D O   1 
ATOM 4268 C CB  . LYS D 1 140 ? 11.530  1.451   39.080  1.00 39.91 ? 166 LYS D CB  1 
ATOM 4269 C CG  . LYS D 1 140 ? 10.300  1.426   38.179  1.00 39.30 ? 166 LYS D CG  1 
ATOM 4270 C CD  . LYS D 1 140 ? 9.141   0.662   38.778  1.00 37.87 ? 166 LYS D CD  1 
ATOM 4271 C CE  . LYS D 1 140 ? 7.943   0.725   37.845  1.00 37.54 ? 166 LYS D CE  1 
ATOM 4272 N NZ  . LYS D 1 140 ? 6.977   -0.371  38.080  1.00 37.30 ? 166 LYS D NZ  1 
ATOM 4273 N N   . ARG D 1 141 ? 13.605  1.814   41.206  1.00 40.18 ? 167 ARG D N   1 
ATOM 4274 C CA  . ARG D 1 141 ? 15.004  1.848   41.643  1.00 40.52 ? 167 ARG D CA  1 
ATOM 4275 C C   . ARG D 1 141 ? 15.939  1.513   40.472  1.00 40.55 ? 167 ARG D C   1 
ATOM 4276 O O   . ARG D 1 141 ? 17.055  2.033   40.379  1.00 40.39 ? 167 ARG D O   1 
ATOM 4277 C CB  . ARG D 1 141 ? 15.254  0.976   42.885  1.00 40.40 ? 167 ARG D CB  1 
ATOM 4278 C CG  . ARG D 1 141 ? 15.785  -0.419  42.625  1.00 41.20 ? 167 ARG D CG  1 
ATOM 4279 C CD  . ARG D 1 141 ? 16.464  -0.997  43.866  1.00 42.38 ? 167 ARG D CD  1 
ATOM 4280 N NE  . ARG D 1 141 ? 16.893  -2.378  43.647  1.00 43.22 ? 167 ARG D NE  1 
ATOM 4281 C CZ  . ARG D 1 141 ? 18.083  -2.732  43.166  1.00 43.74 ? 167 ARG D CZ  1 
ATOM 4282 N NH1 . ARG D 1 141 ? 18.373  -4.014  42.996  1.00 44.34 ? 167 ARG D NH1 1 
ATOM 4283 N NH2 . ARG D 1 141 ? 18.985  -1.815  42.848  1.00 43.34 ? 167 ARG D NH2 1 
ATOM 4284 N N   . ILE D 1 142 ? 15.450  0.663   39.574  1.00 40.83 ? 168 ILE D N   1 
ATOM 4285 C CA  . ILE D 1 142 ? 16.131  0.359   38.325  1.00 41.03 ? 168 ILE D CA  1 
ATOM 4286 C C   . ILE D 1 142 ? 15.471  1.157   37.192  1.00 41.16 ? 168 ILE D C   1 
ATOM 4287 O O   . ILE D 1 142 ? 14.259  1.059   36.974  1.00 41.26 ? 168 ILE D O   1 
ATOM 4288 C CB  . ILE D 1 142 ? 16.087  -1.148  38.027  1.00 41.08 ? 168 ILE D CB  1 
ATOM 4289 C CG1 . ILE D 1 142 ? 16.627  -1.947  39.220  1.00 40.97 ? 168 ILE D CG1 1 
ATOM 4290 C CG2 . ILE D 1 142 ? 16.881  -1.458  36.773  1.00 41.38 ? 168 ILE D CG2 1 
ATOM 4291 C CD1 . ILE D 1 142 ? 16.099  -3.372  39.306  1.00 41.61 ? 168 ILE D CD1 1 
ATOM 4292 N N   . ILE D 1 143 ? 16.271  1.951   36.484  1.00 41.24 ? 169 ILE D N   1 
ATOM 4293 C CA  . ILE D 1 143 ? 15.751  2.857   35.459  1.00 41.42 ? 169 ILE D CA  1 
ATOM 4294 C C   . ILE D 1 143 ? 15.975  2.301   34.051  1.00 41.69 ? 169 ILE D C   1 
ATOM 4295 O O   . ILE D 1 143 ? 17.112  2.171   33.601  1.00 41.76 ? 169 ILE D O   1 
ATOM 4296 C CB  . ILE D 1 143 ? 16.356  4.282   35.595  1.00 41.47 ? 169 ILE D CB  1 
ATOM 4297 C CG1 . ILE D 1 143 ? 16.206  4.800   37.033  1.00 41.52 ? 169 ILE D CG1 1 
ATOM 4298 C CG2 . ILE D 1 143 ? 15.676  5.243   34.642  1.00 41.14 ? 169 ILE D CG2 1 
ATOM 4299 C CD1 . ILE D 1 143 ? 17.474  5.379   37.611  1.00 41.40 ? 169 ILE D CD1 1 
ATOM 4300 N N   . TYR D 1 144 ? 14.877  1.969   33.374  1.00 42.03 ? 170 TYR D N   1 
ATOM 4301 C CA  . TYR D 1 144 ? 14.913  1.428   32.016  1.00 42.28 ? 170 TYR D CA  1 
ATOM 4302 C C   . TYR D 1 144 ? 14.602  2.497   30.992  1.00 42.86 ? 170 TYR D C   1 
ATOM 4303 O O   . TYR D 1 144 ? 13.679  3.304   31.165  1.00 42.70 ? 170 TYR D O   1 
ATOM 4304 C CB  . TYR D 1 144 ? 13.929  0.270   31.846  1.00 42.00 ? 170 TYR D CB  1 
ATOM 4305 C CG  . TYR D 1 144 ? 14.275  -0.928  32.681  1.00 41.91 ? 170 TYR D CG  1 
ATOM 4306 C CD1 . TYR D 1 144 ? 15.167  -1.891  32.215  1.00 41.27 ? 170 TYR D CD1 1 
ATOM 4307 C CD2 . TYR D 1 144 ? 13.733  -1.087  33.955  1.00 41.06 ? 170 TYR D CD2 1 
ATOM 4308 C CE1 . TYR D 1 144 ? 15.493  -2.995  32.993  1.00 41.48 ? 170 TYR D CE1 1 
ATOM 4309 C CE2 . TYR D 1 144 ? 14.060  -2.176  34.732  1.00 41.05 ? 170 TYR D CE2 1 
ATOM 4310 C CZ  . TYR D 1 144 ? 14.931  -3.131  34.249  1.00 41.37 ? 170 TYR D CZ  1 
ATOM 4311 O OH  . TYR D 1 144 ? 15.247  -4.219  35.029  1.00 41.66 ? 170 TYR D OH  1 
ATOM 4312 N N   . PHE D 1 145 ? 15.388  2.479   29.922  1.00 43.55 ? 171 PHE D N   1 
ATOM 4313 C CA  . PHE D 1 145 ? 15.265  3.441   28.849  1.00 44.22 ? 171 PHE D CA  1 
ATOM 4314 C C   . PHE D 1 145 ? 14.905  2.712   27.575  1.00 44.90 ? 171 PHE D C   1 
ATOM 4315 O O   . PHE D 1 145 ? 15.433  1.630   27.290  1.00 45.13 ? 171 PHE D O   1 
ATOM 4316 C CB  . PHE D 1 145 ? 16.581  4.187   28.648  1.00 43.96 ? 171 PHE D CB  1 
ATOM 4317 C CG  . PHE D 1 145 ? 17.015  4.992   29.835  1.00 43.79 ? 171 PHE D CG  1 
ATOM 4318 C CD1 . PHE D 1 145 ? 16.790  6.365   29.873  1.00 43.25 ? 171 PHE D CD1 1 
ATOM 4319 C CD2 . PHE D 1 145 ? 17.665  4.385   30.907  1.00 43.47 ? 171 PHE D CD2 1 
ATOM 4320 C CE1 . PHE D 1 145 ? 17.201  7.123   30.957  1.00 42.74 ? 171 PHE D CE1 1 
ATOM 4321 C CE2 . PHE D 1 145 ? 18.076  5.130   32.000  1.00 43.64 ? 171 PHE D CE2 1 
ATOM 4322 C CZ  . PHE D 1 145 ? 17.844  6.508   32.025  1.00 43.69 ? 171 PHE D CZ  1 
ATOM 4323 N N   . GLN D 1 146 ? 14.000  3.309   26.813  1.00 45.49 ? 172 GLN D N   1 
ATOM 4324 C CA  . GLN D 1 146 ? 13.692  2.827   25.485  1.00 46.33 ? 172 GLN D CA  1 
ATOM 4325 C C   . GLN D 1 146 ? 14.920  3.043   24.592  1.00 46.57 ? 172 GLN D C   1 
ATOM 4326 O O   . GLN D 1 146 ? 15.806  3.826   24.933  1.00 46.86 ? 172 GLN D O   1 
ATOM 4327 C CB  . GLN D 1 146 ? 12.472  3.573   24.950  1.00 46.31 ? 172 GLN D CB  1 
ATOM 4328 C CG  . GLN D 1 146 ? 12.680  5.070   24.770  1.00 46.78 ? 172 GLN D CG  1 
ATOM 4329 C CD  . GLN D 1 146 ? 11.383  5.844   24.585  1.00 46.97 ? 172 GLN D CD  1 
ATOM 4330 O OE1 . GLN D 1 146 ? 10.302  5.400   24.999  1.00 46.75 ? 172 GLN D OE1 1 
ATOM 4331 N NE2 . GLN D 1 146 ? 11.489  7.025   23.973  1.00 47.62 ? 172 GLN D NE2 1 
ATOM 4332 N N   . ASP D 1 147 ? 14.991  2.333   23.471  1.00 46.97 ? 173 ASP D N   1 
ATOM 4333 C CA  . ASP D 1 147 ? 16.061  2.568   22.498  1.00 47.23 ? 173 ASP D CA  1 
ATOM 4334 C C   . ASP D 1 147 ? 15.665  3.726   21.589  1.00 47.35 ? 173 ASP D C   1 
ATOM 4335 O O   . ASP D 1 147 ? 16.465  4.629   21.330  1.00 47.50 ? 173 ASP D O   1 
ATOM 4336 C CB  . ASP D 1 147 ? 16.347  1.314   21.657  1.00 47.26 ? 173 ASP D CB  1 
ATOM 4337 C CG  . ASP D 1 147 ? 16.809  0.122   22.494  1.00 47.50 ? 173 ASP D CG  1 
ATOM 4338 O OD1 . ASP D 1 147 ? 16.290  -0.069  23.616  1.00 47.86 ? 173 ASP D OD1 1 
ATOM 4339 O OD2 . ASP D 1 147 ? 17.678  -0.643  22.014  1.00 47.44 ? 173 ASP D OD2 1 
ATOM 4340 N N   . GLU D 1 148 ? 14.419  3.689   21.120  1.00 47.38 ? 174 GLU D N   1 
ATOM 4341 C CA  . GLU D 1 148 ? 13.891  4.671   20.177  1.00 47.43 ? 174 GLU D CA  1 
ATOM 4342 C C   . GLU D 1 148 ? 12.569  5.243   20.691  1.00 47.07 ? 174 GLU D C   1 
ATOM 4343 O O   . GLU D 1 148 ? 11.874  4.593   21.476  1.00 47.05 ? 174 GLU D O   1 
ATOM 4344 C CB  . GLU D 1 148 ? 13.710  4.019   18.800  1.00 47.67 ? 174 GLU D CB  1 
ATOM 4345 C CG  . GLU D 1 148 ? 15.018  3.811   18.023  1.00 48.67 ? 174 GLU D CG  1 
ATOM 4346 C CD  . GLU D 1 148 ? 15.024  2.532   17.195  1.00 50.23 ? 174 GLU D CD  1 
ATOM 4347 O OE1 . GLU D 1 148 ? 15.004  2.617   15.947  1.00 50.72 ? 174 GLU D OE1 1 
ATOM 4348 O OE2 . GLU D 1 148 ? 15.050  1.435   17.793  1.00 51.37 ? 174 GLU D OE2 1 
ATOM 4349 N N   . GLY D 1 149 ? 12.232  6.458   20.260  1.00 46.68 ? 175 GLY D N   1 
ATOM 4350 C CA  . GLY D 1 149 ? 10.996  7.119   20.696  1.00 46.20 ? 175 GLY D CA  1 
ATOM 4351 C C   . GLY D 1 149 ? 11.145  8.592   21.047  1.00 45.86 ? 175 GLY D C   1 
ATOM 4352 O O   . GLY D 1 149 ? 12.230  9.169   20.912  1.00 45.86 ? 175 GLY D O   1 
ATOM 4353 N N   . SER D 1 150 ? 10.052  9.195   21.514  1.00 45.43 ? 176 SER D N   1 
ATOM 4354 C CA  . SER D 1 150 ? 9.996   10.637  21.767  1.00 44.98 ? 176 SER D CA  1 
ATOM 4355 C C   . SER D 1 150 ? 10.918  11.099  22.892  1.00 44.83 ? 176 SER D C   1 
ATOM 4356 O O   . SER D 1 150 ? 11.194  12.288  23.013  1.00 44.87 ? 176 SER D O   1 
ATOM 4357 C CB  . SER D 1 150 ? 8.560   11.099  22.040  1.00 44.96 ? 176 SER D CB  1 
ATOM 4358 O OG  . SER D 1 150 ? 8.205   10.906  23.400  1.00 44.82 ? 176 SER D OG  1 
ATOM 4359 N N   . LEU D 1 151 ? 11.389  10.163  23.711  1.00 44.71 ? 177 LEU D N   1 
ATOM 4360 C CA  . LEU D 1 151 ? 12.338  10.484  24.776  1.00 44.56 ? 177 LEU D CA  1 
ATOM 4361 C C   . LEU D 1 151 ? 13.767  10.166  24.355  1.00 44.59 ? 177 LEU D C   1 
ATOM 4362 O O   . LEU D 1 151 ? 14.650  9.993   25.200  1.00 44.63 ? 177 LEU D O   1 
ATOM 4363 C CB  . LEU D 1 151 ? 11.987  9.739   26.066  1.00 44.50 ? 177 LEU D CB  1 
ATOM 4364 C CG  . LEU D 1 151 ? 10.663  10.079  26.753  1.00 44.12 ? 177 LEU D CG  1 
ATOM 4365 C CD1 . LEU D 1 151 ? 10.541  9.301   28.048  1.00 44.44 ? 177 LEU D CD1 1 
ATOM 4366 C CD2 . LEU D 1 151 ? 10.531  11.562  27.015  1.00 43.56 ? 177 LEU D CD2 1 
ATOM 4367 N N   . THR D 1 152 ? 13.983  10.100  23.044  1.00 44.56 ? 178 THR D N   1 
ATOM 4368 C CA  . THR D 1 152 ? 15.272  9.738   22.482  1.00 44.61 ? 178 THR D CA  1 
ATOM 4369 C C   . THR D 1 152 ? 15.582  10.594  21.266  1.00 44.76 ? 178 THR D C   1 
ATOM 4370 O O   . THR D 1 152 ? 14.766  10.698  20.345  1.00 45.10 ? 178 THR D O   1 
ATOM 4371 C CB  . THR D 1 152 ? 15.312  8.234   22.105  1.00 44.66 ? 178 THR D CB  1 
ATOM 4372 O OG1 . THR D 1 152 ? 15.733  7.464   23.239  1.00 44.45 ? 178 THR D OG1 1 
ATOM 4373 C CG2 . THR D 1 152 ? 16.264  7.965   20.936  1.00 44.97 ? 178 THR D CG2 1 
ATOM 4374 N N   . LYS D 1 153 ? 16.758  11.217  21.287  1.00 44.82 ? 179 LYS D N   1 
ATOM 4375 C CA  . LYS D 1 153 ? 17.349  11.827  20.097  1.00 44.91 ? 179 LYS D CA  1 
ATOM 4376 C C   . LYS D 1 153 ? 18.779  11.312  19.928  1.00 44.93 ? 179 LYS D C   1 
ATOM 4377 O O   . LYS D 1 153 ? 19.549  11.274  20.893  1.00 44.73 ? 179 LYS D O   1 
ATOM 4378 C CB  . LYS D 1 153 ? 17.344  13.366  20.174  1.00 45.01 ? 179 LYS D CB  1 
ATOM 4379 C CG  . LYS D 1 153 ? 15.969  14.041  20.324  1.00 45.19 ? 179 LYS D CG  1 
ATOM 4380 C CD  . LYS D 1 153 ? 15.061  13.837  19.109  1.00 45.33 ? 179 LYS D CD  1 
ATOM 4381 C CE  . LYS D 1 153 ? 13.595  14.161  19.426  1.00 45.70 ? 179 LYS D CE  1 
ATOM 4382 N NZ  . LYS D 1 153 ? 12.947  13.228  20.419  1.00 44.99 ? 179 LYS D NZ  1 
ATOM 4383 N N   . LYS D 1 154 ? 19.116  10.894  18.707  1.00 45.10 ? 180 LYS D N   1 
ATOM 4384 C CA  . LYS D 1 154 ? 20.489  10.524  18.357  1.00 45.19 ? 180 LYS D CA  1 
ATOM 4385 C C   . LYS D 1 154 ? 21.123  11.602  17.486  1.00 45.14 ? 180 LYS D C   1 
ATOM 4386 O O   . LYS D 1 154 ? 20.427  12.295  16.739  1.00 45.05 ? 180 LYS D O   1 
ATOM 4387 C CB  . LYS D 1 154 ? 20.553  9.159   17.660  1.00 45.22 ? 180 LYS D CB  1 
ATOM 4388 C CG  . LYS D 1 154 ? 19.929  9.098   16.263  1.00 45.58 ? 180 LYS D CG  1 
ATOM 4389 C CD  . LYS D 1 154 ? 19.901  7.671   15.702  1.00 45.68 ? 180 LYS D CD  1 
ATOM 4390 C CE  . LYS D 1 154 ? 18.769  6.847   16.329  1.00 46.95 ? 180 LYS D CE  1 
ATOM 4391 N NZ  . LYS D 1 154 ? 18.784  5.410   15.921  1.00 46.46 ? 180 LYS D NZ  1 
ATOM 4392 N N   . LEU D 1 155 ? 22.444  11.738  17.609  1.00 45.19 ? 181 LEU D N   1 
ATOM 4393 C CA  . LEU D 1 155 ? 23.240  12.713  16.860  1.00 45.03 ? 181 LEU D CA  1 
ATOM 4394 C C   . LEU D 1 155 ? 24.584  12.083  16.498  1.00 44.84 ? 181 LEU D C   1 
ATOM 4395 O O   . LEU D 1 155 ? 25.104  11.261  17.253  1.00 44.75 ? 181 LEU D O   1 
ATOM 4396 C CB  . LEU D 1 155 ? 23.486  13.960  17.712  1.00 45.17 ? 181 LEU D CB  1 
ATOM 4397 C CG  . LEU D 1 155 ? 22.343  14.737  18.381  1.00 45.49 ? 181 LEU D CG  1 
ATOM 4398 C CD1 . LEU D 1 155 ? 22.766  15.256  19.749  1.00 45.39 ? 181 LEU D CD1 1 
ATOM 4399 C CD2 . LEU D 1 155 ? 21.875  15.881  17.504  1.00 45.40 ? 181 LEU D CD2 1 
ATOM 4400 N N   . CYS D 1 156 ? 25.157  12.471  15.362  1.00 44.70 ? 182 CYS D N   1 
ATOM 4401 C CA  . CYS D 1 156 ? 26.431  11.884  14.923  1.00 44.77 ? 182 CYS D CA  1 
ATOM 4402 C C   . CYS D 1 156 ? 27.501  12.909  14.535  1.00 44.54 ? 182 CYS D C   1 
ATOM 4403 O O   . CYS D 1 156 ? 27.397  14.087  14.875  1.00 44.62 ? 182 CYS D O   1 
ATOM 4404 C CB  . CYS D 1 156 ? 26.201  10.898  13.772  1.00 44.71 ? 182 CYS D CB  1 
ATOM 4405 S SG  . CYS D 1 156 ? 25.171  9.499   14.215  1.00 45.67 ? 182 CYS D SG  1 
ATOM 4406 N N   . GLU D 1 157 ? 28.520  12.427  13.812  1.00 44.47 ? 183 GLU D N   1 
ATOM 4407 C CA  . GLU D 1 157 ? 29.663  13.215  13.334  1.00 44.25 ? 183 GLU D CA  1 
ATOM 4408 C C   . GLU D 1 157 ? 30.677  13.542  14.457  1.00 44.23 ? 183 GLU D C   1 
ATOM 4409 C CB  . GLU D 1 157 ? 29.203  14.482  12.609  1.00 44.17 ? 183 GLU D CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   27  ?   ?   ?   A . n 
A 1 2   SER 2   28  ?   ?   ?   A . n 
A 1 3   PHE 3   29  ?   ?   ?   A . n 
A 1 4   SER 4   30  ?   ?   ?   A . n 
A 1 5   ASP 5   31  ?   ?   ?   A . n 
A 1 6   GLU 6   32  ?   ?   ?   A . n 
A 1 7   THR 7   33  ?   ?   ?   A . n 
A 1 8   LEU 8   34  ?   ?   ?   A . n 
A 1 9   ASP 9   35  ?   ?   ?   A . n 
A 1 10  LYS 10  36  ?   ?   ?   A . n 
A 1 11  VAL 11  37  ?   ?   ?   A . n 
A 1 12  PRO 12  38  ?   ?   ?   A . n 
A 1 13  LYS 13  39  ?   ?   ?   A . n 
A 1 14  SER 14  40  ?   ?   ?   A . n 
A 1 15  GLU 15  41  ?   ?   ?   A . n 
A 1 16  GLY 16  42  ?   ?   ?   A . n 
A 1 17  TYR 17  43  ?   ?   ?   A . n 
A 1 18  CYS 18  44  44  CYS CYS A . n 
A 1 19  SER 19  45  45  SER SER A . n 
A 1 20  ARG 20  46  46  ARG ARG A . n 
A 1 21  ILE 21  47  47  ILE ILE A . n 
A 1 22  LEU 22  48  48  LEU LEU A . n 
A 1 23  ARG 23  49  49  ARG ARG A . n 
A 1 24  ALA 24  50  50  ALA ALA A . n 
A 1 25  GLN 25  51  51  GLN GLN A . n 
A 1 26  GLY 26  52  52  GLY GLY A . n 
A 1 27  THR 27  53  53  THR THR A . n 
A 1 28  ARG 28  54  54  ARG ARG A . n 
A 1 29  ARG 29  55  55  ARG ARG A . n 
A 1 30  GLU 30  56  56  GLU GLU A . n 
A 1 31  GLY 31  57  57  GLY GLY A . n 
A 1 32  TYR 32  58  58  TYR TYR A . n 
A 1 33  THR 33  59  59  THR THR A . n 
A 1 34  GLU 34  60  60  GLU GLU A . n 
A 1 35  PHE 35  61  61  PHE PHE A . n 
A 1 36  SER 36  62  62  SER SER A . n 
A 1 37  LEU 37  63  63  LEU LEU A . n 
A 1 38  ARG 38  64  64  ARG ARG A . n 
A 1 39  VAL 39  65  65  VAL VAL A . n 
A 1 40  GLU 40  66  66  GLU GLU A . n 
A 1 41  GLY 41  67  67  GLY GLY A . n 
A 1 42  ASP 42  68  68  ASP ASP A . n 
A 1 43  PRO 43  69  69  PRO PRO A . n 
A 1 44  ASP 44  70  70  ASP ASP A . n 
A 1 45  PHE 45  71  71  PHE PHE A . n 
A 1 46  TYR 46  72  72  TYR TYR A . n 
A 1 47  LYS 47  73  73  LYS LYS A . n 
A 1 48  PRO 48  74  74  PRO PRO A . n 
A 1 49  GLY 49  75  75  GLY GLY A . n 
A 1 50  THR 50  76  76  THR THR A . n 
A 1 51  SER 51  77  77  SER SER A . n 
A 1 52  TYR 52  78  78  TYR TYR A . n 
A 1 53  ARG 53  79  79  ARG ARG A . n 
A 1 54  VAL 54  80  80  VAL VAL A . n 
A 1 55  THR 55  81  81  THR THR A . n 
A 1 56  LEU 56  82  82  LEU LEU A . n 
A 1 57  SER 57  83  83  SER SER A . n 
A 1 58  ALA 58  84  84  ALA ALA A . n 
A 1 59  ALA 59  85  85  ALA ALA A . n 
A 1 60  PRO 60  86  86  PRO PRO A . n 
A 1 61  PRO 61  87  87  PRO PRO A . n 
A 1 62  SER 62  88  88  SER SER A . n 
A 1 63  TYR 63  89  89  TYR TYR A . n 
A 1 64  PHE 64  90  90  PHE PHE A . n 
A 1 65  ARG 65  91  91  ARG ARG A . n 
A 1 66  GLY 66  92  92  GLY GLY A . n 
A 1 67  PHE 67  93  93  PHE PHE A . n 
A 1 68  THR 68  94  94  THR THR A . n 
A 1 69  LEU 69  95  95  LEU LEU A . n 
A 1 70  ILE 70  96  96  ILE ILE A . n 
A 1 71  ALA 71  97  97  ALA ALA A . n 
A 1 72  LEU 72  98  98  LEU LEU A . n 
A 1 73  ARG 73  99  99  ARG ARG A . n 
A 1 74  GLU 74  100 100 GLU GLU A . n 
A 1 75  ASN 75  101 101 ASN ASN A . n 
A 1 76  ARG 76  102 102 ARG ARG A . n 
A 1 77  GLU 77  103 103 GLU GLU A . n 
A 1 78  GLY 78  104 ?   ?   ?   A . n 
A 1 79  ASP 79  105 ?   ?   ?   A . n 
A 1 80  LYS 80  106 ?   ?   ?   A . n 
A 1 81  GLU 81  107 107 GLU GLU A . n 
A 1 82  GLU 82  108 108 GLU GLU A . n 
A 1 83  ASP 83  109 109 ASP ASP A . n 
A 1 84  HIS 84  110 110 HIS HIS A . n 
A 1 85  ALA 85  111 111 ALA ALA A . n 
A 1 86  GLY 86  112 112 GLY GLY A . n 
A 1 87  THR 87  113 113 THR THR A . n 
A 1 88  PHE 88  114 114 PHE PHE A . n 
A 1 89  GLN 89  115 115 GLN GLN A . n 
A 1 90  ILE 90  116 116 ILE ILE A . n 
A 1 91  ILE 91  117 117 ILE ILE A . n 
A 1 92  ASP 92  118 118 ASP ASP A . n 
A 1 93  GLU 93  119 119 GLU GLU A . n 
A 1 94  GLU 94  120 120 GLU GLU A . n 
A 1 95  GLU 95  121 121 GLU GLU A . n 
A 1 96  THR 96  122 122 THR THR A . n 
A 1 97  GLN 97  123 123 GLN GLN A . n 
A 1 98  PHE 98  124 124 PHE PHE A . n 
A 1 99  MET 99  125 125 MET MET A . n 
A 1 100 SER 100 126 126 SER SER A . n 
A 1 101 ASN 101 127 127 ASN ASN A . n 
A 1 102 CYS 102 128 128 CYS CYS A . n 
A 1 103 PRO 103 129 129 PRO PRO A . n 
A 1 104 VAL 104 130 130 VAL VAL A . n 
A 1 105 ALA 105 131 131 ALA ALA A . n 
A 1 106 VAL 106 132 132 VAL VAL A . n 
A 1 107 THR 107 133 133 THR THR A . n 
A 1 108 GLU 108 134 134 GLU GLU A . n 
A 1 109 SER 109 135 135 SER SER A . n 
A 1 110 THR 110 136 136 THR THR A . n 
A 1 111 PRO 111 137 137 PRO PRO A . n 
A 1 112 ARG 112 138 138 ARG ARG A . n 
A 1 113 ARG 113 139 139 ARG ARG A . n 
A 1 114 ARG 114 140 140 ARG ARG A . n 
A 1 115 THR 115 141 141 THR THR A . n 
A 1 116 ARG 116 142 142 ARG ARG A . n 
A 1 117 ILE 117 143 143 ILE ILE A . n 
A 1 118 GLN 118 144 144 GLN GLN A . n 
A 1 119 VAL 119 145 145 VAL VAL A . n 
A 1 120 PHE 120 146 146 PHE PHE A . n 
A 1 121 TRP 121 147 147 TRP TRP A . n 
A 1 122 ILE 122 148 148 ILE ILE A . n 
A 1 123 ALA 123 149 149 ALA ALA A . n 
A 1 124 PRO 124 150 150 PRO PRO A . n 
A 1 125 PRO 125 151 151 PRO PRO A . n 
A 1 126 ALA 126 152 152 ALA ALA A . n 
A 1 127 GLY 127 153 153 GLY GLY A . n 
A 1 128 THR 128 154 154 THR THR A . n 
A 1 129 GLY 129 155 155 GLY GLY A . n 
A 1 130 CYS 130 156 156 CYS CYS A . n 
A 1 131 VAL 131 157 157 VAL VAL A . n 
A 1 132 ILE 132 158 158 ILE ILE A . n 
A 1 133 LEU 133 159 159 LEU LEU A . n 
A 1 134 LYS 134 160 160 LYS LYS A . n 
A 1 135 ALA 135 161 161 ALA ALA A . n 
A 1 136 SER 136 162 162 SER SER A . n 
A 1 137 ILE 137 163 163 ILE ILE A . n 
A 1 138 VAL 138 164 164 VAL VAL A . n 
A 1 139 GLN 139 165 165 GLN GLN A . n 
A 1 140 LYS 140 166 166 LYS LYS A . n 
A 1 141 ARG 141 167 167 ARG ARG A . n 
A 1 142 ILE 142 168 168 ILE ILE A . n 
A 1 143 ILE 143 169 169 ILE ILE A . n 
A 1 144 TYR 144 170 170 TYR TYR A . n 
A 1 145 PHE 145 171 171 PHE PHE A . n 
A 1 146 GLN 146 172 172 GLN GLN A . n 
A 1 147 ASP 147 173 173 ASP ASP A . n 
A 1 148 GLU 148 174 174 GLU GLU A . n 
A 1 149 GLY 149 175 175 GLY GLY A . n 
A 1 150 SER 150 176 176 SER SER A . n 
A 1 151 LEU 151 177 177 LEU LEU A . n 
A 1 152 THR 152 178 178 THR THR A . n 
A 1 153 LYS 153 179 179 LYS LYS A . n 
A 1 154 LYS 154 180 180 LYS LYS A . n 
A 1 155 LEU 155 181 181 LEU LEU A . n 
A 1 156 CYS 156 182 182 CYS CYS A . n 
A 1 157 GLU 157 183 183 GLU GLU A . n 
A 1 158 GLN 158 184 184 GLN GLN A . n 
A 1 159 ASP 159 185 ?   ?   ?   A . n 
A 1 160 SER 160 186 ?   ?   ?   A . n 
A 1 161 THR 161 187 ?   ?   ?   A . n 
A 1 162 PHE 162 188 ?   ?   ?   A . n 
A 1 163 ASP 163 189 ?   ?   ?   A . n 
A 1 164 GLY 164 190 ?   ?   ?   A . n 
A 1 165 VAL 165 191 ?   ?   ?   A . n 
A 1 166 THR 166 192 ?   ?   ?   A . n 
A 1 167 ASP 167 193 ?   ?   ?   A . n 
A 1 168 LYS 168 194 ?   ?   ?   A . n 
A 1 169 PRO 169 195 ?   ?   ?   A . n 
A 1 170 ILE 170 196 ?   ?   ?   A . n 
A 1 171 LEU 171 197 ?   ?   ?   A . n 
A 1 172 ASP 172 198 ?   ?   ?   A . n 
B 1 1   GLY 1   27  ?   ?   ?   B . n 
B 1 2   SER 2   28  ?   ?   ?   B . n 
B 1 3   PHE 3   29  ?   ?   ?   B . n 
B 1 4   SER 4   30  ?   ?   ?   B . n 
B 1 5   ASP 5   31  ?   ?   ?   B . n 
B 1 6   GLU 6   32  ?   ?   ?   B . n 
B 1 7   THR 7   33  ?   ?   ?   B . n 
B 1 8   LEU 8   34  ?   ?   ?   B . n 
B 1 9   ASP 9   35  ?   ?   ?   B . n 
B 1 10  LYS 10  36  ?   ?   ?   B . n 
B 1 11  VAL 11  37  ?   ?   ?   B . n 
B 1 12  PRO 12  38  38  PRO PRO B . n 
B 1 13  LYS 13  39  39  LYS LYS B . n 
B 1 14  SER 14  40  40  SER SER B . n 
B 1 15  GLU 15  41  41  GLU GLU B . n 
B 1 16  GLY 16  42  42  GLY GLY B . n 
B 1 17  TYR 17  43  43  TYR TYR B . n 
B 1 18  CYS 18  44  44  CYS CYS B . n 
B 1 19  SER 19  45  45  SER SER B . n 
B 1 20  ARG 20  46  46  ARG ARG B . n 
B 1 21  ILE 21  47  47  ILE ILE B . n 
B 1 22  LEU 22  48  48  LEU LEU B . n 
B 1 23  ARG 23  49  49  ARG ARG B . n 
B 1 24  ALA 24  50  50  ALA ALA B . n 
B 1 25  GLN 25  51  51  GLN GLN B . n 
B 1 26  GLY 26  52  52  GLY GLY B . n 
B 1 27  THR 27  53  ?   ?   ?   B . n 
B 1 28  ARG 28  54  ?   ?   ?   B . n 
B 1 29  ARG 29  55  ?   ?   ?   B . n 
B 1 30  GLU 30  56  ?   ?   ?   B . n 
B 1 31  GLY 31  57  57  GLY GLY B . n 
B 1 32  TYR 32  58  58  TYR TYR B . n 
B 1 33  THR 33  59  59  THR THR B . n 
B 1 34  GLU 34  60  60  GLU GLU B . n 
B 1 35  PHE 35  61  61  PHE PHE B . n 
B 1 36  SER 36  62  62  SER SER B . n 
B 1 37  LEU 37  63  63  LEU LEU B . n 
B 1 38  ARG 38  64  64  ARG ARG B . n 
B 1 39  VAL 39  65  65  VAL VAL B . n 
B 1 40  GLU 40  66  66  GLU GLU B . n 
B 1 41  GLY 41  67  67  GLY GLY B . n 
B 1 42  ASP 42  68  68  ASP ASP B . n 
B 1 43  PRO 43  69  69  PRO PRO B . n 
B 1 44  ASP 44  70  70  ASP ASP B . n 
B 1 45  PHE 45  71  71  PHE PHE B . n 
B 1 46  TYR 46  72  72  TYR TYR B . n 
B 1 47  LYS 47  73  73  LYS LYS B . n 
B 1 48  PRO 48  74  74  PRO PRO B . n 
B 1 49  GLY 49  75  75  GLY GLY B . n 
B 1 50  THR 50  76  76  THR THR B . n 
B 1 51  SER 51  77  77  SER SER B . n 
B 1 52  TYR 52  78  78  TYR TYR B . n 
B 1 53  ARG 53  79  79  ARG ARG B . n 
B 1 54  VAL 54  80  80  VAL VAL B . n 
B 1 55  THR 55  81  81  THR THR B . n 
B 1 56  LEU 56  82  82  LEU LEU B . n 
B 1 57  SER 57  83  83  SER SER B . n 
B 1 58  ALA 58  84  84  ALA ALA B . n 
B 1 59  ALA 59  85  85  ALA ALA B . n 
B 1 60  PRO 60  86  86  PRO PRO B . n 
B 1 61  PRO 61  87  87  PRO PRO B . n 
B 1 62  SER 62  88  88  SER SER B . n 
B 1 63  TYR 63  89  89  TYR TYR B . n 
B 1 64  PHE 64  90  90  PHE PHE B . n 
B 1 65  ARG 65  91  91  ARG ARG B . n 
B 1 66  GLY 66  92  92  GLY GLY B . n 
B 1 67  PHE 67  93  93  PHE PHE B . n 
B 1 68  THR 68  94  94  THR THR B . n 
B 1 69  LEU 69  95  95  LEU LEU B . n 
B 1 70  ILE 70  96  96  ILE ILE B . n 
B 1 71  ALA 71  97  97  ALA ALA B . n 
B 1 72  LEU 72  98  98  LEU LEU B . n 
B 1 73  ARG 73  99  99  ARG ARG B . n 
B 1 74  GLU 74  100 100 GLU GLU B . n 
B 1 75  ASN 75  101 101 ASN ASN B . n 
B 1 76  ARG 76  102 102 ARG ARG B . n 
B 1 77  GLU 77  103 103 GLU GLU B . n 
B 1 78  GLY 78  104 104 GLY GLY B . n 
B 1 79  ASP 79  105 105 ASP ASP B . n 
B 1 80  LYS 80  106 106 LYS LYS B . n 
B 1 81  GLU 81  107 107 GLU GLU B . n 
B 1 82  GLU 82  108 108 GLU GLU B . n 
B 1 83  ASP 83  109 109 ASP ASP B . n 
B 1 84  HIS 84  110 110 HIS HIS B . n 
B 1 85  ALA 85  111 111 ALA ALA B . n 
B 1 86  GLY 86  112 112 GLY GLY B . n 
B 1 87  THR 87  113 113 THR THR B . n 
B 1 88  PHE 88  114 114 PHE PHE B . n 
B 1 89  GLN 89  115 115 GLN GLN B . n 
B 1 90  ILE 90  116 116 ILE ILE B . n 
B 1 91  ILE 91  117 117 ILE ILE B . n 
B 1 92  ASP 92  118 118 ASP ASP B . n 
B 1 93  GLU 93  119 119 GLU GLU B . n 
B 1 94  GLU 94  120 120 GLU GLU B . n 
B 1 95  GLU 95  121 121 GLU GLU B . n 
B 1 96  THR 96  122 122 THR THR B . n 
B 1 97  GLN 97  123 123 GLN GLN B . n 
B 1 98  PHE 98  124 124 PHE PHE B . n 
B 1 99  MET 99  125 125 MET MET B . n 
B 1 100 SER 100 126 126 SER SER B . n 
B 1 101 ASN 101 127 127 ASN ASN B . n 
B 1 102 CYS 102 128 128 CYS CYS B . n 
B 1 103 PRO 103 129 129 PRO PRO B . n 
B 1 104 VAL 104 130 130 VAL VAL B . n 
B 1 105 ALA 105 131 131 ALA ALA B . n 
B 1 106 VAL 106 132 132 VAL VAL B . n 
B 1 107 THR 107 133 133 THR THR B . n 
B 1 108 GLU 108 134 134 GLU GLU B . n 
B 1 109 SER 109 135 135 SER SER B . n 
B 1 110 THR 110 136 136 THR THR B . n 
B 1 111 PRO 111 137 137 PRO PRO B . n 
B 1 112 ARG 112 138 138 ARG ARG B . n 
B 1 113 ARG 113 139 139 ARG ARG B . n 
B 1 114 ARG 114 140 140 ARG ARG B . n 
B 1 115 THR 115 141 141 THR THR B . n 
B 1 116 ARG 116 142 142 ARG ARG B . n 
B 1 117 ILE 117 143 143 ILE ILE B . n 
B 1 118 GLN 118 144 144 GLN GLN B . n 
B 1 119 VAL 119 145 145 VAL VAL B . n 
B 1 120 PHE 120 146 146 PHE PHE B . n 
B 1 121 TRP 121 147 147 TRP TRP B . n 
B 1 122 ILE 122 148 148 ILE ILE B . n 
B 1 123 ALA 123 149 149 ALA ALA B . n 
B 1 124 PRO 124 150 150 PRO PRO B . n 
B 1 125 PRO 125 151 151 PRO PRO B . n 
B 1 126 ALA 126 152 152 ALA ALA B . n 
B 1 127 GLY 127 153 153 GLY GLY B . n 
B 1 128 THR 128 154 154 THR THR B . n 
B 1 129 GLY 129 155 155 GLY GLY B . n 
B 1 130 CYS 130 156 156 CYS CYS B . n 
B 1 131 VAL 131 157 157 VAL VAL B . n 
B 1 132 ILE 132 158 158 ILE ILE B . n 
B 1 133 LEU 133 159 159 LEU LEU B . n 
B 1 134 LYS 134 160 160 LYS LYS B . n 
B 1 135 ALA 135 161 161 ALA ALA B . n 
B 1 136 SER 136 162 162 SER SER B . n 
B 1 137 ILE 137 163 163 ILE ILE B . n 
B 1 138 VAL 138 164 164 VAL VAL B . n 
B 1 139 GLN 139 165 165 GLN GLN B . n 
B 1 140 LYS 140 166 166 LYS LYS B . n 
B 1 141 ARG 141 167 167 ARG ARG B . n 
B 1 142 ILE 142 168 168 ILE ILE B . n 
B 1 143 ILE 143 169 169 ILE ILE B . n 
B 1 144 TYR 144 170 170 TYR TYR B . n 
B 1 145 PHE 145 171 171 PHE PHE B . n 
B 1 146 GLN 146 172 172 GLN GLN B . n 
B 1 147 ASP 147 173 173 ASP ASP B . n 
B 1 148 GLU 148 174 174 GLU GLU B . n 
B 1 149 GLY 149 175 175 GLY GLY B . n 
B 1 150 SER 150 176 176 SER SER B . n 
B 1 151 LEU 151 177 177 LEU LEU B . n 
B 1 152 THR 152 178 178 THR THR B . n 
B 1 153 LYS 153 179 179 LYS LYS B . n 
B 1 154 LYS 154 180 180 LYS LYS B . n 
B 1 155 LEU 155 181 181 LEU LEU B . n 
B 1 156 CYS 156 182 182 CYS CYS B . n 
B 1 157 GLU 157 183 183 GLU GLU B . n 
B 1 158 GLN 158 184 ?   ?   ?   B . n 
B 1 159 ASP 159 185 ?   ?   ?   B . n 
B 1 160 SER 160 186 ?   ?   ?   B . n 
B 1 161 THR 161 187 ?   ?   ?   B . n 
B 1 162 PHE 162 188 ?   ?   ?   B . n 
B 1 163 ASP 163 189 ?   ?   ?   B . n 
B 1 164 GLY 164 190 ?   ?   ?   B . n 
B 1 165 VAL 165 191 ?   ?   ?   B . n 
B 1 166 THR 166 192 ?   ?   ?   B . n 
B 1 167 ASP 167 193 ?   ?   ?   B . n 
B 1 168 LYS 168 194 ?   ?   ?   B . n 
B 1 169 PRO 169 195 ?   ?   ?   B . n 
B 1 170 ILE 170 196 ?   ?   ?   B . n 
B 1 171 LEU 171 197 ?   ?   ?   B . n 
B 1 172 ASP 172 198 ?   ?   ?   B . n 
C 1 1   GLY 1   27  ?   ?   ?   C . n 
C 1 2   SER 2   28  ?   ?   ?   C . n 
C 1 3   PHE 3   29  ?   ?   ?   C . n 
C 1 4   SER 4   30  ?   ?   ?   C . n 
C 1 5   ASP 5   31  ?   ?   ?   C . n 
C 1 6   GLU 6   32  ?   ?   ?   C . n 
C 1 7   THR 7   33  ?   ?   ?   C . n 
C 1 8   LEU 8   34  ?   ?   ?   C . n 
C 1 9   ASP 9   35  ?   ?   ?   C . n 
C 1 10  LYS 10  36  ?   ?   ?   C . n 
C 1 11  VAL 11  37  ?   ?   ?   C . n 
C 1 12  PRO 12  38  ?   ?   ?   C . n 
C 1 13  LYS 13  39  ?   ?   ?   C . n 
C 1 14  SER 14  40  ?   ?   ?   C . n 
C 1 15  GLU 15  41  ?   ?   ?   C . n 
C 1 16  GLY 16  42  ?   ?   ?   C . n 
C 1 17  TYR 17  43  ?   ?   ?   C . n 
C 1 18  CYS 18  44  44  CYS CYS C . n 
C 1 19  SER 19  45  45  SER SER C . n 
C 1 20  ARG 20  46  46  ARG ARG C . n 
C 1 21  ILE 21  47  47  ILE ILE C . n 
C 1 22  LEU 22  48  48  LEU LEU C . n 
C 1 23  ARG 23  49  49  ARG ARG C . n 
C 1 24  ALA 24  50  ?   ?   ?   C . n 
C 1 25  GLN 25  51  51  GLN GLN C . n 
C 1 26  GLY 26  52  52  GLY GLY C . n 
C 1 27  THR 27  53  53  THR THR C . n 
C 1 28  ARG 28  54  54  ARG ARG C . n 
C 1 29  ARG 29  55  55  ARG ARG C . n 
C 1 30  GLU 30  56  56  GLU GLU C . n 
C 1 31  GLY 31  57  57  GLY GLY C . n 
C 1 32  TYR 32  58  58  TYR TYR C . n 
C 1 33  THR 33  59  59  THR THR C . n 
C 1 34  GLU 34  60  60  GLU GLU C . n 
C 1 35  PHE 35  61  61  PHE PHE C . n 
C 1 36  SER 36  62  62  SER SER C . n 
C 1 37  LEU 37  63  63  LEU LEU C . n 
C 1 38  ARG 38  64  64  ARG ARG C . n 
C 1 39  VAL 39  65  65  VAL VAL C . n 
C 1 40  GLU 40  66  66  GLU GLU C . n 
C 1 41  GLY 41  67  67  GLY GLY C . n 
C 1 42  ASP 42  68  68  ASP ASP C . n 
C 1 43  PRO 43  69  69  PRO PRO C . n 
C 1 44  ASP 44  70  70  ASP ASP C . n 
C 1 45  PHE 45  71  71  PHE PHE C . n 
C 1 46  TYR 46  72  72  TYR TYR C . n 
C 1 47  LYS 47  73  73  LYS LYS C . n 
C 1 48  PRO 48  74  74  PRO PRO C . n 
C 1 49  GLY 49  75  75  GLY GLY C . n 
C 1 50  THR 50  76  76  THR THR C . n 
C 1 51  SER 51  77  77  SER SER C . n 
C 1 52  TYR 52  78  78  TYR TYR C . n 
C 1 53  ARG 53  79  79  ARG ARG C . n 
C 1 54  VAL 54  80  80  VAL VAL C . n 
C 1 55  THR 55  81  81  THR THR C . n 
C 1 56  LEU 56  82  82  LEU LEU C . n 
C 1 57  SER 57  83  83  SER SER C . n 
C 1 58  ALA 58  84  84  ALA ALA C . n 
C 1 59  ALA 59  85  85  ALA ALA C . n 
C 1 60  PRO 60  86  86  PRO PRO C . n 
C 1 61  PRO 61  87  87  PRO PRO C . n 
C 1 62  SER 62  88  88  SER SER C . n 
C 1 63  TYR 63  89  89  TYR TYR C . n 
C 1 64  PHE 64  90  90  PHE PHE C . n 
C 1 65  ARG 65  91  91  ARG ARG C . n 
C 1 66  GLY 66  92  92  GLY GLY C . n 
C 1 67  PHE 67  93  93  PHE PHE C . n 
C 1 68  THR 68  94  94  THR THR C . n 
C 1 69  LEU 69  95  95  LEU LEU C . n 
C 1 70  ILE 70  96  96  ILE ILE C . n 
C 1 71  ALA 71  97  97  ALA ALA C . n 
C 1 72  LEU 72  98  98  LEU LEU C . n 
C 1 73  ARG 73  99  99  ARG ARG C . n 
C 1 74  GLU 74  100 100 GLU GLU C . n 
C 1 75  ASN 75  101 101 ASN ASN C . n 
C 1 76  ARG 76  102 102 ARG ARG C . n 
C 1 77  GLU 77  103 103 GLU GLU C . n 
C 1 78  GLY 78  104 104 GLY GLY C . n 
C 1 79  ASP 79  105 105 ASP ASP C . n 
C 1 80  LYS 80  106 106 LYS LYS C . n 
C 1 81  GLU 81  107 107 GLU GLU C . n 
C 1 82  GLU 82  108 108 GLU GLU C . n 
C 1 83  ASP 83  109 109 ASP ASP C . n 
C 1 84  HIS 84  110 110 HIS HIS C . n 
C 1 85  ALA 85  111 111 ALA ALA C . n 
C 1 86  GLY 86  112 112 GLY GLY C . n 
C 1 87  THR 87  113 113 THR THR C . n 
C 1 88  PHE 88  114 114 PHE PHE C . n 
C 1 89  GLN 89  115 115 GLN GLN C . n 
C 1 90  ILE 90  116 116 ILE ILE C . n 
C 1 91  ILE 91  117 117 ILE ILE C . n 
C 1 92  ASP 92  118 118 ASP ASP C . n 
C 1 93  GLU 93  119 119 GLU GLU C . n 
C 1 94  GLU 94  120 120 GLU GLU C . n 
C 1 95  GLU 95  121 121 GLU GLU C . n 
C 1 96  THR 96  122 122 THR THR C . n 
C 1 97  GLN 97  123 123 GLN GLN C . n 
C 1 98  PHE 98  124 124 PHE PHE C . n 
C 1 99  MET 99  125 125 MET MET C . n 
C 1 100 SER 100 126 126 SER SER C . n 
C 1 101 ASN 101 127 127 ASN ASN C . n 
C 1 102 CYS 102 128 128 CYS CYS C . n 
C 1 103 PRO 103 129 129 PRO PRO C . n 
C 1 104 VAL 104 130 130 VAL VAL C . n 
C 1 105 ALA 105 131 131 ALA ALA C . n 
C 1 106 VAL 106 132 132 VAL VAL C . n 
C 1 107 THR 107 133 133 THR THR C . n 
C 1 108 GLU 108 134 134 GLU GLU C . n 
C 1 109 SER 109 135 135 SER SER C . n 
C 1 110 THR 110 136 136 THR THR C . n 
C 1 111 PRO 111 137 137 PRO PRO C . n 
C 1 112 ARG 112 138 138 ARG ARG C . n 
C 1 113 ARG 113 139 139 ARG ARG C . n 
C 1 114 ARG 114 140 140 ARG ARG C . n 
C 1 115 THR 115 141 141 THR THR C . n 
C 1 116 ARG 116 142 142 ARG ARG C . n 
C 1 117 ILE 117 143 143 ILE ILE C . n 
C 1 118 GLN 118 144 144 GLN GLN C . n 
C 1 119 VAL 119 145 145 VAL VAL C . n 
C 1 120 PHE 120 146 146 PHE PHE C . n 
C 1 121 TRP 121 147 147 TRP TRP C . n 
C 1 122 ILE 122 148 148 ILE ILE C . n 
C 1 123 ALA 123 149 149 ALA ALA C . n 
C 1 124 PRO 124 150 150 PRO PRO C . n 
C 1 125 PRO 125 151 151 PRO PRO C . n 
C 1 126 ALA 126 152 152 ALA ALA C . n 
C 1 127 GLY 127 153 153 GLY GLY C . n 
C 1 128 THR 128 154 154 THR THR C . n 
C 1 129 GLY 129 155 155 GLY GLY C . n 
C 1 130 CYS 130 156 156 CYS CYS C . n 
C 1 131 VAL 131 157 157 VAL VAL C . n 
C 1 132 ILE 132 158 158 ILE ILE C . n 
C 1 133 LEU 133 159 159 LEU LEU C . n 
C 1 134 LYS 134 160 160 LYS LYS C . n 
C 1 135 ALA 135 161 161 ALA ALA C . n 
C 1 136 SER 136 162 162 SER SER C . n 
C 1 137 ILE 137 163 163 ILE ILE C . n 
C 1 138 VAL 138 164 164 VAL VAL C . n 
C 1 139 GLN 139 165 165 GLN GLN C . n 
C 1 140 LYS 140 166 166 LYS LYS C . n 
C 1 141 ARG 141 167 167 ARG ARG C . n 
C 1 142 ILE 142 168 168 ILE ILE C . n 
C 1 143 ILE 143 169 169 ILE ILE C . n 
C 1 144 TYR 144 170 170 TYR TYR C . n 
C 1 145 PHE 145 171 171 PHE PHE C . n 
C 1 146 GLN 146 172 172 GLN GLN C . n 
C 1 147 ASP 147 173 173 ASP ASP C . n 
C 1 148 GLU 148 174 174 GLU GLU C . n 
C 1 149 GLY 149 175 175 GLY GLY C . n 
C 1 150 SER 150 176 176 SER SER C . n 
C 1 151 LEU 151 177 177 LEU LEU C . n 
C 1 152 THR 152 178 178 THR THR C . n 
C 1 153 LYS 153 179 179 LYS LYS C . n 
C 1 154 LYS 154 180 180 LYS LYS C . n 
C 1 155 LEU 155 181 181 LEU LEU C . n 
C 1 156 CYS 156 182 182 CYS CYS C . n 
C 1 157 GLU 157 183 183 GLU GLU C . n 
C 1 158 GLN 158 184 184 GLN GLN C . n 
C 1 159 ASP 159 185 ?   ?   ?   C . n 
C 1 160 SER 160 186 ?   ?   ?   C . n 
C 1 161 THR 161 187 ?   ?   ?   C . n 
C 1 162 PHE 162 188 ?   ?   ?   C . n 
C 1 163 ASP 163 189 ?   ?   ?   C . n 
C 1 164 GLY 164 190 ?   ?   ?   C . n 
C 1 165 VAL 165 191 ?   ?   ?   C . n 
C 1 166 THR 166 192 ?   ?   ?   C . n 
C 1 167 ASP 167 193 ?   ?   ?   C . n 
C 1 168 LYS 168 194 ?   ?   ?   C . n 
C 1 169 PRO 169 195 ?   ?   ?   C . n 
C 1 170 ILE 170 196 ?   ?   ?   C . n 
C 1 171 LEU 171 197 ?   ?   ?   C . n 
C 1 172 ASP 172 198 ?   ?   ?   C . n 
D 1 1   GLY 1   27  ?   ?   ?   D . n 
D 1 2   SER 2   28  ?   ?   ?   D . n 
D 1 3   PHE 3   29  ?   ?   ?   D . n 
D 1 4   SER 4   30  ?   ?   ?   D . n 
D 1 5   ASP 5   31  ?   ?   ?   D . n 
D 1 6   GLU 6   32  ?   ?   ?   D . n 
D 1 7   THR 7   33  ?   ?   ?   D . n 
D 1 8   LEU 8   34  ?   ?   ?   D . n 
D 1 9   ASP 9   35  ?   ?   ?   D . n 
D 1 10  LYS 10  36  ?   ?   ?   D . n 
D 1 11  VAL 11  37  ?   ?   ?   D . n 
D 1 12  PRO 12  38  38  PRO PRO D . n 
D 1 13  LYS 13  39  39  LYS LYS D . n 
D 1 14  SER 14  40  40  SER SER D . n 
D 1 15  GLU 15  41  41  GLU GLU D . n 
D 1 16  GLY 16  42  42  GLY GLY D . n 
D 1 17  TYR 17  43  43  TYR TYR D . n 
D 1 18  CYS 18  44  44  CYS CYS D . n 
D 1 19  SER 19  45  45  SER SER D . n 
D 1 20  ARG 20  46  46  ARG ARG D . n 
D 1 21  ILE 21  47  47  ILE ILE D . n 
D 1 22  LEU 22  48  48  LEU LEU D . n 
D 1 23  ARG 23  49  49  ARG ARG D . n 
D 1 24  ALA 24  50  50  ALA ALA D . n 
D 1 25  GLN 25  51  51  GLN GLN D . n 
D 1 26  GLY 26  52  ?   ?   ?   D . n 
D 1 27  THR 27  53  ?   ?   ?   D . n 
D 1 28  ARG 28  54  ?   ?   ?   D . n 
D 1 29  ARG 29  55  ?   ?   ?   D . n 
D 1 30  GLU 30  56  ?   ?   ?   D . n 
D 1 31  GLY 31  57  57  GLY GLY D . n 
D 1 32  TYR 32  58  58  TYR TYR D . n 
D 1 33  THR 33  59  59  THR THR D . n 
D 1 34  GLU 34  60  60  GLU GLU D . n 
D 1 35  PHE 35  61  61  PHE PHE D . n 
D 1 36  SER 36  62  62  SER SER D . n 
D 1 37  LEU 37  63  63  LEU LEU D . n 
D 1 38  ARG 38  64  64  ARG ARG D . n 
D 1 39  VAL 39  65  65  VAL VAL D . n 
D 1 40  GLU 40  66  66  GLU GLU D . n 
D 1 41  GLY 41  67  67  GLY GLY D . n 
D 1 42  ASP 42  68  68  ASP ASP D . n 
D 1 43  PRO 43  69  69  PRO PRO D . n 
D 1 44  ASP 44  70  70  ASP ASP D . n 
D 1 45  PHE 45  71  71  PHE PHE D . n 
D 1 46  TYR 46  72  72  TYR TYR D . n 
D 1 47  LYS 47  73  73  LYS LYS D . n 
D 1 48  PRO 48  74  74  PRO PRO D . n 
D 1 49  GLY 49  75  75  GLY GLY D . n 
D 1 50  THR 50  76  76  THR THR D . n 
D 1 51  SER 51  77  77  SER SER D . n 
D 1 52  TYR 52  78  78  TYR TYR D . n 
D 1 53  ARG 53  79  79  ARG ARG D . n 
D 1 54  VAL 54  80  80  VAL VAL D . n 
D 1 55  THR 55  81  81  THR THR D . n 
D 1 56  LEU 56  82  82  LEU LEU D . n 
D 1 57  SER 57  83  83  SER SER D . n 
D 1 58  ALA 58  84  84  ALA ALA D . n 
D 1 59  ALA 59  85  85  ALA ALA D . n 
D 1 60  PRO 60  86  86  PRO PRO D . n 
D 1 61  PRO 61  87  87  PRO PRO D . n 
D 1 62  SER 62  88  88  SER SER D . n 
D 1 63  TYR 63  89  89  TYR TYR D . n 
D 1 64  PHE 64  90  90  PHE PHE D . n 
D 1 65  ARG 65  91  91  ARG ARG D . n 
D 1 66  GLY 66  92  92  GLY GLY D . n 
D 1 67  PHE 67  93  93  PHE PHE D . n 
D 1 68  THR 68  94  94  THR THR D . n 
D 1 69  LEU 69  95  95  LEU LEU D . n 
D 1 70  ILE 70  96  96  ILE ILE D . n 
D 1 71  ALA 71  97  97  ALA ALA D . n 
D 1 72  LEU 72  98  98  LEU LEU D . n 
D 1 73  ARG 73  99  99  ARG ARG D . n 
D 1 74  GLU 74  100 100 GLU GLU D . n 
D 1 75  ASN 75  101 101 ASN ASN D . n 
D 1 76  ARG 76  102 102 ARG ARG D . n 
D 1 77  GLU 77  103 103 GLU GLU D . n 
D 1 78  GLY 78  104 104 GLY GLY D . n 
D 1 79  ASP 79  105 105 ASP ASP D . n 
D 1 80  LYS 80  106 106 LYS LYS D . n 
D 1 81  GLU 81  107 107 GLU GLU D . n 
D 1 82  GLU 82  108 108 GLU GLU D . n 
D 1 83  ASP 83  109 109 ASP ASP D . n 
D 1 84  HIS 84  110 110 HIS HIS D . n 
D 1 85  ALA 85  111 111 ALA ALA D . n 
D 1 86  GLY 86  112 112 GLY GLY D . n 
D 1 87  THR 87  113 113 THR THR D . n 
D 1 88  PHE 88  114 114 PHE PHE D . n 
D 1 89  GLN 89  115 115 GLN GLN D . n 
D 1 90  ILE 90  116 116 ILE ILE D . n 
D 1 91  ILE 91  117 117 ILE ILE D . n 
D 1 92  ASP 92  118 118 ASP ASP D . n 
D 1 93  GLU 93  119 119 GLU GLU D . n 
D 1 94  GLU 94  120 120 GLU GLU D . n 
D 1 95  GLU 95  121 121 GLU GLU D . n 
D 1 96  THR 96  122 122 THR THR D . n 
D 1 97  GLN 97  123 123 GLN GLN D . n 
D 1 98  PHE 98  124 124 PHE PHE D . n 
D 1 99  MET 99  125 125 MET MET D . n 
D 1 100 SER 100 126 126 SER SER D . n 
D 1 101 ASN 101 127 127 ASN ASN D . n 
D 1 102 CYS 102 128 128 CYS CYS D . n 
D 1 103 PRO 103 129 129 PRO PRO D . n 
D 1 104 VAL 104 130 130 VAL VAL D . n 
D 1 105 ALA 105 131 131 ALA ALA D . n 
D 1 106 VAL 106 132 132 VAL VAL D . n 
D 1 107 THR 107 133 133 THR THR D . n 
D 1 108 GLU 108 134 134 GLU GLU D . n 
D 1 109 SER 109 135 135 SER SER D . n 
D 1 110 THR 110 136 136 THR THR D . n 
D 1 111 PRO 111 137 137 PRO PRO D . n 
D 1 112 ARG 112 138 138 ARG ARG D . n 
D 1 113 ARG 113 139 139 ARG ARG D . n 
D 1 114 ARG 114 140 140 ARG ARG D . n 
D 1 115 THR 115 141 141 THR THR D . n 
D 1 116 ARG 116 142 142 ARG ARG D . n 
D 1 117 ILE 117 143 143 ILE ILE D . n 
D 1 118 GLN 118 144 144 GLN GLN D . n 
D 1 119 VAL 119 145 145 VAL VAL D . n 
D 1 120 PHE 120 146 146 PHE PHE D . n 
D 1 121 TRP 121 147 147 TRP TRP D . n 
D 1 122 ILE 122 148 148 ILE ILE D . n 
D 1 123 ALA 123 149 149 ALA ALA D . n 
D 1 124 PRO 124 150 150 PRO PRO D . n 
D 1 125 PRO 125 151 151 PRO PRO D . n 
D 1 126 ALA 126 152 152 ALA ALA D . n 
D 1 127 GLY 127 153 153 GLY GLY D . n 
D 1 128 THR 128 154 154 THR THR D . n 
D 1 129 GLY 129 155 155 GLY GLY D . n 
D 1 130 CYS 130 156 156 CYS CYS D . n 
D 1 131 VAL 131 157 157 VAL VAL D . n 
D 1 132 ILE 132 158 158 ILE ILE D . n 
D 1 133 LEU 133 159 159 LEU LEU D . n 
D 1 134 LYS 134 160 160 LYS LYS D . n 
D 1 135 ALA 135 161 161 ALA ALA D . n 
D 1 136 SER 136 162 162 SER SER D . n 
D 1 137 ILE 137 163 163 ILE ILE D . n 
D 1 138 VAL 138 164 164 VAL VAL D . n 
D 1 139 GLN 139 165 165 GLN GLN D . n 
D 1 140 LYS 140 166 166 LYS LYS D . n 
D 1 141 ARG 141 167 167 ARG ARG D . n 
D 1 142 ILE 142 168 168 ILE ILE D . n 
D 1 143 ILE 143 169 169 ILE ILE D . n 
D 1 144 TYR 144 170 170 TYR TYR D . n 
D 1 145 PHE 145 171 171 PHE PHE D . n 
D 1 146 GLN 146 172 172 GLN GLN D . n 
D 1 147 ASP 147 173 173 ASP ASP D . n 
D 1 148 GLU 148 174 174 GLU GLU D . n 
D 1 149 GLY 149 175 175 GLY GLY D . n 
D 1 150 SER 150 176 176 SER SER D . n 
D 1 151 LEU 151 177 177 LEU LEU D . n 
D 1 152 THR 152 178 178 THR THR D . n 
D 1 153 LYS 153 179 179 LYS LYS D . n 
D 1 154 LYS 154 180 180 LYS LYS D . n 
D 1 155 LEU 155 181 181 LEU LEU D . n 
D 1 156 CYS 156 182 182 CYS CYS D . n 
D 1 157 GLU 157 183 183 GLU GLU D . n 
D 1 158 GLN 158 184 ?   ?   ?   D . n 
D 1 159 ASP 159 185 ?   ?   ?   D . n 
D 1 160 SER 160 186 ?   ?   ?   D . n 
D 1 161 THR 161 187 ?   ?   ?   D . n 
D 1 162 PHE 162 188 ?   ?   ?   D . n 
D 1 163 ASP 163 189 ?   ?   ?   D . n 
D 1 164 GLY 164 190 ?   ?   ?   D . n 
D 1 165 VAL 165 191 ?   ?   ?   D . n 
D 1 166 THR 166 192 ?   ?   ?   D . n 
D 1 167 ASP 167 193 ?   ?   ?   D . n 
D 1 168 LYS 168 194 ?   ?   ?   D . n 
D 1 169 PRO 169 195 ?   ?   ?   D . n 
D 1 170 ILE 170 196 ?   ?   ?   D . n 
D 1 171 LEU 171 197 ?   ?   ?   D . n 
D 1 172 ASP 172 198 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A 
2 1 B 
3 1 C 
4 1 D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-14 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-02-22 
4 'Structure model' 1 3 2016-12-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -10.6532 -6.9966 0.9912  -0.1965 0.0198  -0.1565 -0.0984 -0.0093 0.0091  4.4262 8.1597 4.8413 2.5203 -2.4386 -4.8940 
-0.4477 0.5951  -0.2704 -0.6217 0.3760  -0.1422 0.5045  -0.2575 0.0718 'X-RAY DIFFRACTION' 
2 ? refined 17.0244  9.7281  -1.6898 -0.2811 0.1271  -0.0797 -0.1108 -0.0581 0.2765  6.9900 4.8482 4.3058 3.3523 -2.0704 -2.7658 
0.4836  -0.9167 -0.5488 0.3900  -0.6716 -0.5721 -0.1692 0.3657  0.1881 'X-RAY DIFFRACTION' 
3 ? refined 35.8964  39.4044 27.2469 -0.0427 -0.2176 -0.1921 -0.1051 -0.0007 -0.0143 7.7925 5.4133 5.0789 2.4765 -4.8010 -2.4938 
0.4067  -0.7314 -0.1056 0.6210  -0.4916 -0.2301 -0.2996 0.5593  0.0849 'X-RAY DIFFRACTION' 
4 ? refined 19.0679  11.8923 29.8287 0.1077  -0.2619 -0.1480 -0.1406 0.2609  -0.0712 5.0275 8.5152 3.4981 2.3688 -2.0923 -1.7918 
-0.6726 0.3594  -0.5251 -0.8564 0.5575  -0.6415 0.4246  -0.1260 0.1151 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 A 44 ? ? A 184 ? ? ? ? 'X-RAY DIFFRACTION' 
2 2 B 38 ? ? B 183 ? ? ? ? 'X-RAY DIFFRACTION' 
3 3 C 44 ? ? C 184 ? ? ? ? 'X-RAY DIFFRACTION' 
4 4 D 38 ? ? D 183 ? ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
SHARP    phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 50  ? ? -148.65 -4.85   
2  1 PRO A 86  ? ? -13.03  147.02  
3  1 PRO A 87  ? ? -4.05   54.39   
4  1 ASN A 101 ? ? 77.40   -30.28  
5  1 GLU A 108 ? ? -102.49 46.45   
6  1 ASP A 109 ? ? -113.03 53.71   
7  1 PRO A 137 ? ? -78.87  20.93   
8  1 GLN A 165 ? ? -95.37  -67.16  
9  1 LYS A 166 ? ? -108.92 -95.16  
10 1 CYS B 44  ? ? -144.28 44.25   
11 1 SER B 45  ? ? -73.27  30.45   
12 1 ARG B 46  ? ? -141.69 38.24   
13 1 ALA B 50  ? ? 66.54   -151.44 
14 1 GLN B 51  ? ? -113.98 -151.69 
15 1 TYR B 58  ? ? -110.21 73.73   
16 1 ASP B 68  ? ? 44.81   73.88   
17 1 ASP B 70  ? ? -136.02 -33.32  
18 1 ALA B 85  ? ? -38.53  142.89  
19 1 PRO B 86  ? ? -14.69  -63.16  
20 1 ARG B 91  ? ? -103.76 -73.78  
21 1 GLU B 100 ? ? -34.43  124.04  
22 1 ASP B 109 ? ? -170.52 -20.79  
23 1 GLU B 119 ? ? 73.44   -34.43  
24 1 PRO B 137 ? ? -77.90  33.67   
25 1 LEU B 177 ? ? -78.38  24.32   
26 1 ILE C 47  ? ? -86.04  46.11   
27 1 ASP C 68  ? ? 45.05   70.35   
28 1 PRO C 86  ? ? -19.34  -58.97  
29 1 ASN C 101 ? ? 64.11   -7.36   
30 1 ASP C 109 ? ? -75.45  29.07   
31 1 LYS C 166 ? ? 68.78   -132.31 
32 1 TYR D 43  ? ? -85.63  -134.85 
33 1 CYS D 44  ? ? -74.07  31.48   
34 1 SER D 45  ? ? -73.76  34.69   
35 1 ASP D 70  ? ? -140.61 -53.60  
36 1 ALA D 84  ? ? -117.73 68.35   
37 1 PRO D 87  ? ? -70.06  45.83   
38 1 ARG D 91  ? ? -104.37 -65.00  
39 1 ARG D 99  ? ? -69.02  -171.83 
40 1 ASN D 101 ? ? -157.06 71.62   
41 1 CYS D 128 ? ? -153.93 86.08   
42 1 PRO D 137 ? ? -74.83  30.14   
43 1 PRO D 151 ? ? -72.51  -160.80 
44 1 ALA D 152 ? ? -33.40  107.59  
45 1 CYS D 182 ? ? -129.80 -163.14 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 107 ? CG  ? A GLU 81  CG  
2  1 Y 1 A GLU 107 ? CD  ? A GLU 81  CD  
3  1 Y 1 A GLU 107 ? OE1 ? A GLU 81  OE1 
4  1 Y 1 A GLU 107 ? OE2 ? A GLU 81  OE2 
5  1 Y 1 A GLU 183 ? CG  ? A GLU 157 CG  
6  1 Y 1 A GLU 183 ? CD  ? A GLU 157 CD  
7  1 Y 1 A GLU 183 ? OE1 ? A GLU 157 OE1 
8  1 Y 1 A GLU 183 ? OE2 ? A GLU 157 OE2 
9  1 Y 1 A GLN 184 ? O   ? A GLN 158 O   
10 1 Y 1 A GLN 184 ? CG  ? A GLN 158 CG  
11 1 Y 1 A GLN 184 ? CD  ? A GLN 158 CD  
12 1 Y 1 A GLN 184 ? OE1 ? A GLN 158 OE1 
13 1 Y 1 A GLN 184 ? NE2 ? A GLN 158 NE2 
14 1 Y 1 B LYS 39  ? CG  ? B LYS 13  CG  
15 1 Y 1 B LYS 39  ? CD  ? B LYS 13  CD  
16 1 Y 1 B LYS 39  ? CE  ? B LYS 13  CE  
17 1 Y 1 B LYS 39  ? NZ  ? B LYS 13  NZ  
18 1 Y 1 B GLU 41  ? CG  ? B GLU 15  CG  
19 1 Y 1 B GLU 41  ? CD  ? B GLU 15  CD  
20 1 Y 1 B GLU 41  ? OE1 ? B GLU 15  OE1 
21 1 Y 1 B GLU 41  ? OE2 ? B GLU 15  OE2 
22 1 Y 1 B TYR 43  ? CG  ? B TYR 17  CG  
23 1 Y 1 B TYR 43  ? CD1 ? B TYR 17  CD1 
24 1 Y 1 B TYR 43  ? CD2 ? B TYR 17  CD2 
25 1 Y 1 B TYR 43  ? CE1 ? B TYR 17  CE1 
26 1 Y 1 B TYR 43  ? CE2 ? B TYR 17  CE2 
27 1 Y 1 B TYR 43  ? CZ  ? B TYR 17  CZ  
28 1 Y 1 B TYR 43  ? OH  ? B TYR 17  OH  
29 1 Y 1 B GLU 183 ? O   ? B GLU 157 O   
30 1 Y 1 B GLU 183 ? CG  ? B GLU 157 CG  
31 1 Y 1 B GLU 183 ? CD  ? B GLU 157 CD  
32 1 Y 1 B GLU 183 ? OE1 ? B GLU 157 OE1 
33 1 Y 1 B GLU 183 ? OE2 ? B GLU 157 OE2 
34 1 Y 1 C ASP 105 ? CG  ? C ASP 79  CG  
35 1 Y 1 C ASP 105 ? OD1 ? C ASP 79  OD1 
36 1 Y 1 C ASP 105 ? OD2 ? C ASP 79  OD2 
37 1 Y 1 C LYS 106 ? CG  ? C LYS 80  CG  
38 1 Y 1 C LYS 106 ? CD  ? C LYS 80  CD  
39 1 Y 1 C LYS 106 ? CE  ? C LYS 80  CE  
40 1 Y 1 C LYS 106 ? NZ  ? C LYS 80  NZ  
41 1 Y 1 C GLU 107 ? CG  ? C GLU 81  CG  
42 1 Y 1 C GLU 107 ? CD  ? C GLU 81  CD  
43 1 Y 1 C GLU 107 ? OE1 ? C GLU 81  OE1 
44 1 Y 1 C GLU 107 ? OE2 ? C GLU 81  OE2 
45 1 Y 1 C GLU 183 ? CG  ? C GLU 157 CG  
46 1 Y 1 C GLU 183 ? CD  ? C GLU 157 CD  
47 1 Y 1 C GLU 183 ? OE1 ? C GLU 157 OE1 
48 1 Y 1 C GLU 183 ? OE2 ? C GLU 157 OE2 
49 1 Y 1 C GLN 184 ? O   ? C GLN 158 O   
50 1 Y 1 C GLN 184 ? CG  ? C GLN 158 CG  
51 1 Y 1 C GLN 184 ? CD  ? C GLN 158 CD  
52 1 Y 1 C GLN 184 ? OE1 ? C GLN 158 OE1 
53 1 Y 1 C GLN 184 ? NE2 ? C GLN 158 NE2 
54 1 Y 1 D LYS 39  ? CG  ? D LYS 13  CG  
55 1 Y 1 D LYS 39  ? CD  ? D LYS 13  CD  
56 1 Y 1 D LYS 39  ? CE  ? D LYS 13  CE  
57 1 Y 1 D LYS 39  ? NZ  ? D LYS 13  NZ  
58 1 Y 1 D GLU 41  ? CG  ? D GLU 15  CG  
59 1 Y 1 D GLU 41  ? CD  ? D GLU 15  CD  
60 1 Y 1 D GLU 41  ? OE1 ? D GLU 15  OE1 
61 1 Y 1 D GLU 41  ? OE2 ? D GLU 15  OE2 
62 1 Y 1 D TYR 43  ? CG  ? D TYR 17  CG  
63 1 Y 1 D TYR 43  ? CD1 ? D TYR 17  CD1 
64 1 Y 1 D TYR 43  ? CD2 ? D TYR 17  CD2 
65 1 Y 1 D TYR 43  ? CE1 ? D TYR 17  CE1 
66 1 Y 1 D TYR 43  ? CE2 ? D TYR 17  CE2 
67 1 Y 1 D TYR 43  ? CZ  ? D TYR 17  CZ  
68 1 Y 1 D TYR 43  ? OH  ? D TYR 17  OH  
69 1 Y 1 D GLU 183 ? O   ? D GLU 157 O   
70 1 Y 1 D GLU 183 ? CG  ? D GLU 157 CG  
71 1 Y 1 D GLU 183 ? CD  ? D GLU 157 CD  
72 1 Y 1 D GLU 183 ? OE1 ? D GLU 157 OE1 
73 1 Y 1 D GLU 183 ? OE2 ? D GLU 157 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 27  ? A GLY 1   
2   1 Y 1 A SER 28  ? A SER 2   
3   1 Y 1 A PHE 29  ? A PHE 3   
4   1 Y 1 A SER 30  ? A SER 4   
5   1 Y 1 A ASP 31  ? A ASP 5   
6   1 Y 1 A GLU 32  ? A GLU 6   
7   1 Y 1 A THR 33  ? A THR 7   
8   1 Y 1 A LEU 34  ? A LEU 8   
9   1 Y 1 A ASP 35  ? A ASP 9   
10  1 Y 1 A LYS 36  ? A LYS 10  
11  1 Y 1 A VAL 37  ? A VAL 11  
12  1 Y 1 A PRO 38  ? A PRO 12  
13  1 Y 1 A LYS 39  ? A LYS 13  
14  1 Y 1 A SER 40  ? A SER 14  
15  1 Y 1 A GLU 41  ? A GLU 15  
16  1 Y 1 A GLY 42  ? A GLY 16  
17  1 Y 1 A TYR 43  ? A TYR 17  
18  1 Y 1 A GLY 104 ? A GLY 78  
19  1 Y 1 A ASP 105 ? A ASP 79  
20  1 Y 1 A LYS 106 ? A LYS 80  
21  1 Y 1 A ASP 185 ? A ASP 159 
22  1 Y 1 A SER 186 ? A SER 160 
23  1 Y 1 A THR 187 ? A THR 161 
24  1 Y 1 A PHE 188 ? A PHE 162 
25  1 Y 1 A ASP 189 ? A ASP 163 
26  1 Y 1 A GLY 190 ? A GLY 164 
27  1 Y 1 A VAL 191 ? A VAL 165 
28  1 Y 1 A THR 192 ? A THR 166 
29  1 Y 1 A ASP 193 ? A ASP 167 
30  1 Y 1 A LYS 194 ? A LYS 168 
31  1 Y 1 A PRO 195 ? A PRO 169 
32  1 Y 1 A ILE 196 ? A ILE 170 
33  1 Y 1 A LEU 197 ? A LEU 171 
34  1 Y 1 A ASP 198 ? A ASP 172 
35  1 Y 1 B GLY 27  ? B GLY 1   
36  1 Y 1 B SER 28  ? B SER 2   
37  1 Y 1 B PHE 29  ? B PHE 3   
38  1 Y 1 B SER 30  ? B SER 4   
39  1 Y 1 B ASP 31  ? B ASP 5   
40  1 Y 1 B GLU 32  ? B GLU 6   
41  1 Y 1 B THR 33  ? B THR 7   
42  1 Y 1 B LEU 34  ? B LEU 8   
43  1 Y 1 B ASP 35  ? B ASP 9   
44  1 Y 1 B LYS 36  ? B LYS 10  
45  1 Y 1 B VAL 37  ? B VAL 11  
46  1 Y 1 B THR 53  ? B THR 27  
47  1 Y 1 B ARG 54  ? B ARG 28  
48  1 Y 1 B ARG 55  ? B ARG 29  
49  1 Y 1 B GLU 56  ? B GLU 30  
50  1 Y 1 B GLN 184 ? B GLN 158 
51  1 Y 1 B ASP 185 ? B ASP 159 
52  1 Y 1 B SER 186 ? B SER 160 
53  1 Y 1 B THR 187 ? B THR 161 
54  1 Y 1 B PHE 188 ? B PHE 162 
55  1 Y 1 B ASP 189 ? B ASP 163 
56  1 Y 1 B GLY 190 ? B GLY 164 
57  1 Y 1 B VAL 191 ? B VAL 165 
58  1 Y 1 B THR 192 ? B THR 166 
59  1 Y 1 B ASP 193 ? B ASP 167 
60  1 Y 1 B LYS 194 ? B LYS 168 
61  1 Y 1 B PRO 195 ? B PRO 169 
62  1 Y 1 B ILE 196 ? B ILE 170 
63  1 Y 1 B LEU 197 ? B LEU 171 
64  1 Y 1 B ASP 198 ? B ASP 172 
65  1 Y 1 C GLY 27  ? C GLY 1   
66  1 Y 1 C SER 28  ? C SER 2   
67  1 Y 1 C PHE 29  ? C PHE 3   
68  1 Y 1 C SER 30  ? C SER 4   
69  1 Y 1 C ASP 31  ? C ASP 5   
70  1 Y 1 C GLU 32  ? C GLU 6   
71  1 Y 1 C THR 33  ? C THR 7   
72  1 Y 1 C LEU 34  ? C LEU 8   
73  1 Y 1 C ASP 35  ? C ASP 9   
74  1 Y 1 C LYS 36  ? C LYS 10  
75  1 Y 1 C VAL 37  ? C VAL 11  
76  1 Y 1 C PRO 38  ? C PRO 12  
77  1 Y 1 C LYS 39  ? C LYS 13  
78  1 Y 1 C SER 40  ? C SER 14  
79  1 Y 1 C GLU 41  ? C GLU 15  
80  1 Y 1 C GLY 42  ? C GLY 16  
81  1 Y 1 C TYR 43  ? C TYR 17  
82  1 Y 1 C ALA 50  ? C ALA 24  
83  1 Y 1 C ASP 185 ? C ASP 159 
84  1 Y 1 C SER 186 ? C SER 160 
85  1 Y 1 C THR 187 ? C THR 161 
86  1 Y 1 C PHE 188 ? C PHE 162 
87  1 Y 1 C ASP 189 ? C ASP 163 
88  1 Y 1 C GLY 190 ? C GLY 164 
89  1 Y 1 C VAL 191 ? C VAL 165 
90  1 Y 1 C THR 192 ? C THR 166 
91  1 Y 1 C ASP 193 ? C ASP 167 
92  1 Y 1 C LYS 194 ? C LYS 168 
93  1 Y 1 C PRO 195 ? C PRO 169 
94  1 Y 1 C ILE 196 ? C ILE 170 
95  1 Y 1 C LEU 197 ? C LEU 171 
96  1 Y 1 C ASP 198 ? C ASP 172 
97  1 Y 1 D GLY 27  ? D GLY 1   
98  1 Y 1 D SER 28  ? D SER 2   
99  1 Y 1 D PHE 29  ? D PHE 3   
100 1 Y 1 D SER 30  ? D SER 4   
101 1 Y 1 D ASP 31  ? D ASP 5   
102 1 Y 1 D GLU 32  ? D GLU 6   
103 1 Y 1 D THR 33  ? D THR 7   
104 1 Y 1 D LEU 34  ? D LEU 8   
105 1 Y 1 D ASP 35  ? D ASP 9   
106 1 Y 1 D LYS 36  ? D LYS 10  
107 1 Y 1 D VAL 37  ? D VAL 11  
108 1 Y 1 D GLY 52  ? D GLY 26  
109 1 Y 1 D THR 53  ? D THR 27  
110 1 Y 1 D ARG 54  ? D ARG 28  
111 1 Y 1 D ARG 55  ? D ARG 29  
112 1 Y 1 D GLU 56  ? D GLU 30  
113 1 Y 1 D GLN 184 ? D GLN 158 
114 1 Y 1 D ASP 185 ? D ASP 159 
115 1 Y 1 D SER 186 ? D SER 160 
116 1 Y 1 D THR 187 ? D THR 161 
117 1 Y 1 D PHE 188 ? D PHE 162 
118 1 Y 1 D ASP 189 ? D ASP 163 
119 1 Y 1 D GLY 190 ? D GLY 164 
120 1 Y 1 D VAL 191 ? D VAL 165 
121 1 Y 1 D THR 192 ? D THR 166 
122 1 Y 1 D ASP 193 ? D ASP 167 
123 1 Y 1 D LYS 194 ? D LYS 168 
124 1 Y 1 D PRO 195 ? D PRO 169 
125 1 Y 1 D ILE 196 ? D ILE 170 
126 1 Y 1 D LEU 197 ? D LEU 171 
127 1 Y 1 D ASP 198 ? D ASP 172 
#