data_2ZT5
# 
_entry.id   2ZT5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ZT5         
RCSB  RCSB028393   
WWPDB D_1000028393 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2PME 'the sample protein (apo form)' unspecified 
PDB 2PMF 'G526R mutant'                  unspecified 
PDB 2ZT6 .                               unspecified 
PDB 2ZT7 .                               unspecified 
PDB 2ZT8 .                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZT5 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, R.T.'    1 
'Yang, X.L.'   2 
'Schimmel, P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures and biochemical analyses suggest unique mechanism and role for human GlyRS in Ap4A homeostasis' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Guo, R.T.'   1 
primary 'Chong, Y.E.' 2 
primary 'Guo, M.'     3 
primary 'Yang, X.L.'  4 
# 
_cell.entry_id           2ZT5 
_cell.length_a           115.861 
_cell.length_b           139.840 
_cell.length_c           132.943 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZT5 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycyl-tRNA synthetase'           78704.828 1   6.1.1.14 ? 'UNP residues 55-739' ? 
2 non-polymer syn "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" 836.387   1   ?        ? ?                     ? 
3 water       nat water                              18.015    335 ?        ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glycine-tRNA ligase, GlyRS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  PRO n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  ALA n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  GLU n 
1 30  ASP n 
1 31  LYS n 
1 32  ALA n 
1 33  PRO n 
1 34  GLN n 
1 35  VAL n 
1 36  ASP n 
1 37  VAL n 
1 38  ASP n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  ARG n 
1 50  VAL n 
1 51  LEU n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  PRO n 
1 61  LYS n 
1 62  ASP n 
1 63  ASP n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  MET n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LYS n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLY n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  PHE n 
1 97  GLY n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 CYS n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 ASN n 
1 107 ILE n 
1 108 ILE n 
1 109 GLN n 
1 110 THR n 
1 111 TRP n 
1 112 ARG n 
1 113 GLN n 
1 114 HIS n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 GLU n 
1 119 GLU n 
1 120 GLN n 
1 121 ILE n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 ASP n 
1 126 CYS n 
1 127 THR n 
1 128 MET n 
1 129 LEU n 
1 130 THR n 
1 131 PRO n 
1 132 GLU n 
1 133 PRO n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 THR n 
1 138 SER n 
1 139 GLY n 
1 140 HIS n 
1 141 VAL n 
1 142 ASP n 
1 143 LYS n 
1 144 PHE n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 MET n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 VAL n 
1 153 LYS n 
1 154 ASN n 
1 155 GLY n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 ALA n 
1 161 ASP n 
1 162 HIS n 
1 163 LEU n 
1 164 LEU n 
1 165 LYS n 
1 166 ALA n 
1 167 HIS n 
1 168 LEU n 
1 169 GLN n 
1 170 LYS n 
1 171 LEU n 
1 172 MET n 
1 173 SER n 
1 174 ASP n 
1 175 LYS n 
1 176 LYS n 
1 177 CYS n 
1 178 SER n 
1 179 VAL n 
1 180 GLU n 
1 181 LYS n 
1 182 LYS n 
1 183 SER n 
1 184 GLU n 
1 185 MET n 
1 186 GLU n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 ALA n 
1 191 GLN n 
1 192 LEU n 
1 193 ASP n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLU n 
1 200 LEU n 
1 201 ALA n 
1 202 ASP n 
1 203 LEU n 
1 204 PHE n 
1 205 VAL n 
1 206 ASN n 
1 207 TYR n 
1 208 ASN n 
1 209 VAL n 
1 210 LYS n 
1 211 SER n 
1 212 PRO n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 ASN n 
1 217 ASP n 
1 218 LEU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 LEU n 
1 227 MET n 
1 228 PHE n 
1 229 LYS n 
1 230 THR n 
1 231 PHE n 
1 232 ILE n 
1 233 GLY n 
1 234 PRO n 
1 235 GLY n 
1 236 GLY n 
1 237 ASN n 
1 238 MET n 
1 239 PRO n 
1 240 GLY n 
1 241 TYR n 
1 242 LEU n 
1 243 ARG n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 ALA n 
1 248 GLN n 
1 249 GLY n 
1 250 ILE n 
1 251 PHE n 
1 252 LEU n 
1 253 ASN n 
1 254 PHE n 
1 255 LYS n 
1 256 ARG n 
1 257 LEU n 
1 258 LEU n 
1 259 GLU n 
1 260 PHE n 
1 261 ASN n 
1 262 GLN n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 GLN n 
1 272 ILE n 
1 273 GLY n 
1 274 ASN n 
1 275 SER n 
1 276 PHE n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 ILE n 
1 281 SER n 
1 282 PRO n 
1 283 ARG n 
1 284 SER n 
1 285 GLY n 
1 286 LEU n 
1 287 ILE n 
1 288 ARG n 
1 289 VAL n 
1 290 ARG n 
1 291 GLU n 
1 292 PHE n 
1 293 THR n 
1 294 MET n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 GLU n 
1 299 HIS n 
1 300 PHE n 
1 301 VAL n 
1 302 ASP n 
1 303 PRO n 
1 304 SER n 
1 305 GLU n 
1 306 LYS n 
1 307 ASP n 
1 308 HIS n 
1 309 PRO n 
1 310 LYS n 
1 311 PHE n 
1 312 GLN n 
1 313 ASN n 
1 314 VAL n 
1 315 ALA n 
1 316 ASP n 
1 317 LEU n 
1 318 HIS n 
1 319 LEU n 
1 320 TYR n 
1 321 LEU n 
1 322 TYR n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ALA n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 GLN n 
1 332 SER n 
1 333 ALA n 
1 334 ARG n 
1 335 LYS n 
1 336 MET n 
1 337 ARG n 
1 338 LEU n 
1 339 GLY n 
1 340 ASP n 
1 341 ALA n 
1 342 VAL n 
1 343 GLU n 
1 344 GLN n 
1 345 GLY n 
1 346 VAL n 
1 347 ILE n 
1 348 ASN n 
1 349 ASN n 
1 350 THR n 
1 351 VAL n 
1 352 LEU n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 ILE n 
1 357 GLY n 
1 358 ARG n 
1 359 ILE n 
1 360 TYR n 
1 361 LEU n 
1 362 TYR n 
1 363 LEU n 
1 364 THR n 
1 365 LYS n 
1 366 VAL n 
1 367 GLY n 
1 368 ILE n 
1 369 SER n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 LEU n 
1 374 ARG n 
1 375 PHE n 
1 376 ARG n 
1 377 GLN n 
1 378 HIS n 
1 379 MET n 
1 380 GLU n 
1 381 ASN n 
1 382 GLU n 
1 383 MET n 
1 384 ALA n 
1 385 HIS n 
1 386 TYR n 
1 387 ALA n 
1 388 CYS n 
1 389 ASP n 
1 390 CYS n 
1 391 TRP n 
1 392 ASP n 
1 393 ALA n 
1 394 GLU n 
1 395 SER n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 TYR n 
1 400 GLY n 
1 401 TRP n 
1 402 ILE n 
1 403 GLU n 
1 404 ILE n 
1 405 VAL n 
1 406 GLY n 
1 407 CYS n 
1 408 ALA n 
1 409 ASP n 
1 410 ARG n 
1 411 SER n 
1 412 CYS n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 SER n 
1 417 CYS n 
1 418 HIS n 
1 419 ALA n 
1 420 ARG n 
1 421 ALA n 
1 422 THR n 
1 423 LYS n 
1 424 VAL n 
1 425 PRO n 
1 426 LEU n 
1 427 VAL n 
1 428 ALA n 
1 429 GLU n 
1 430 LYS n 
1 431 PRO n 
1 432 LEU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 LYS n 
1 437 THR n 
1 438 VAL n 
1 439 ASN n 
1 440 VAL n 
1 441 VAL n 
1 442 GLN n 
1 443 PHE n 
1 444 GLU n 
1 445 PRO n 
1 446 SER n 
1 447 LYS n 
1 448 GLY n 
1 449 ALA n 
1 450 ILE n 
1 451 GLY n 
1 452 LYS n 
1 453 ALA n 
1 454 TYR n 
1 455 LYS n 
1 456 LYS n 
1 457 ASP n 
1 458 ALA n 
1 459 LYS n 
1 460 LEU n 
1 461 VAL n 
1 462 MET n 
1 463 GLU n 
1 464 TYR n 
1 465 LEU n 
1 466 ALA n 
1 467 ILE n 
1 468 CYS n 
1 469 ASP n 
1 470 GLU n 
1 471 CYS n 
1 472 TYR n 
1 473 ILE n 
1 474 THR n 
1 475 GLU n 
1 476 MET n 
1 477 GLU n 
1 478 MET n 
1 479 LEU n 
1 480 LEU n 
1 481 ASN n 
1 482 GLU n 
1 483 LYS n 
1 484 GLY n 
1 485 GLU n 
1 486 PHE n 
1 487 THR n 
1 488 ILE n 
1 489 GLU n 
1 490 THR n 
1 491 GLU n 
1 492 GLY n 
1 493 LYS n 
1 494 THR n 
1 495 PHE n 
1 496 GLN n 
1 497 LEU n 
1 498 THR n 
1 499 LYS n 
1 500 ASP n 
1 501 MET n 
1 502 ILE n 
1 503 ASN n 
1 504 VAL n 
1 505 LYS n 
1 506 ARG n 
1 507 PHE n 
1 508 GLN n 
1 509 LYS n 
1 510 THR n 
1 511 LEU n 
1 512 TYR n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 VAL n 
1 517 VAL n 
1 518 PRO n 
1 519 ASN n 
1 520 VAL n 
1 521 ILE n 
1 522 GLU n 
1 523 PRO n 
1 524 SER n 
1 525 PHE n 
1 526 GLY n 
1 527 LEU n 
1 528 GLY n 
1 529 ARG n 
1 530 ILE n 
1 531 MET n 
1 532 TYR n 
1 533 THR n 
1 534 VAL n 
1 535 PHE n 
1 536 GLU n 
1 537 HIS n 
1 538 THR n 
1 539 PHE n 
1 540 HIS n 
1 541 VAL n 
1 542 ARG n 
1 543 GLU n 
1 544 GLY n 
1 545 ASP n 
1 546 GLU n 
1 547 GLN n 
1 548 ARG n 
1 549 THR n 
1 550 PHE n 
1 551 PHE n 
1 552 SER n 
1 553 PHE n 
1 554 PRO n 
1 555 ALA n 
1 556 VAL n 
1 557 VAL n 
1 558 ALA n 
1 559 PRO n 
1 560 PHE n 
1 561 LYS n 
1 562 CYS n 
1 563 SER n 
1 564 VAL n 
1 565 LEU n 
1 566 PRO n 
1 567 LEU n 
1 568 SER n 
1 569 GLN n 
1 570 ASN n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 MET n 
1 575 PRO n 
1 576 PHE n 
1 577 VAL n 
1 578 LYS n 
1 579 GLU n 
1 580 LEU n 
1 581 SER n 
1 582 GLU n 
1 583 ALA n 
1 584 LEU n 
1 585 THR n 
1 586 ARG n 
1 587 HIS n 
1 588 GLY n 
1 589 VAL n 
1 590 SER n 
1 591 HIS n 
1 592 LYS n 
1 593 VAL n 
1 594 ASP n 
1 595 ASP n 
1 596 SER n 
1 597 SER n 
1 598 GLY n 
1 599 SER n 
1 600 ILE n 
1 601 GLY n 
1 602 ARG n 
1 603 ARG n 
1 604 TYR n 
1 605 ALA n 
1 606 ARG n 
1 607 THR n 
1 608 ASP n 
1 609 GLU n 
1 610 ILE n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 PHE n 
1 615 GLY n 
1 616 VAL n 
1 617 THR n 
1 618 ILE n 
1 619 ASP n 
1 620 PHE n 
1 621 ASP n 
1 622 THR n 
1 623 VAL n 
1 624 ASN n 
1 625 LYS n 
1 626 THR n 
1 627 PRO n 
1 628 HIS n 
1 629 THR n 
1 630 ALA n 
1 631 THR n 
1 632 LEU n 
1 633 ARG n 
1 634 ASP n 
1 635 ARG n 
1 636 ASP n 
1 637 SER n 
1 638 MET n 
1 639 ARG n 
1 640 GLN n 
1 641 ILE n 
1 642 ARG n 
1 643 ALA n 
1 644 GLU n 
1 645 ILE n 
1 646 SER n 
1 647 GLU n 
1 648 LEU n 
1 649 PRO n 
1 650 SER n 
1 651 ILE n 
1 652 VAL n 
1 653 GLN n 
1 654 ASP n 
1 655 LEU n 
1 656 ALA n 
1 657 ASN n 
1 658 GLY n 
1 659 ASN n 
1 660 ILE n 
1 661 THR n 
1 662 TRP n 
1 663 ALA n 
1 664 ASP n 
1 665 VAL n 
1 666 GLU n 
1 667 ALA n 
1 668 ARG n 
1 669 TYR n 
1 670 PRO n 
1 671 LEU n 
1 672 PHE n 
1 673 GLU n 
1 674 GLY n 
1 675 GLN n 
1 676 GLU n 
1 677 THR n 
1 678 GLY n 
1 679 LYS n 
1 680 LYS n 
1 681 GLU n 
1 682 THR n 
1 683 ILE n 
1 684 GLU n 
1 685 GLU n 
1 686 LEU n 
1 687 GLU n 
1 688 HIS n 
1 689 HIS n 
1 690 HIS n 
1 691 HIS n 
1 692 HIS n 
1 693 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GARS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYG_HUMAN 
_struct_ref.pdbx_db_accession          P41250 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ZT5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 685 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41250 
_struct_ref_seq.db_align_beg                  55 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  739 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ZT5 LEU A 686 ? UNP P41250 ? ? 'EXPRESSION TAG' 686 1 
1 2ZT5 GLU A 687 ? UNP P41250 ? ? 'EXPRESSION TAG' 687 2 
1 2ZT5 HIS A 688 ? UNP P41250 ? ? 'EXPRESSION TAG' 688 3 
1 2ZT5 HIS A 689 ? UNP P41250 ? ? 'EXPRESSION TAG' 689 4 
1 2ZT5 HIS A 690 ? UNP P41250 ? ? 'EXPRESSION TAG' 690 5 
1 2ZT5 HIS A 691 ? UNP P41250 ? ? 'EXPRESSION TAG' 691 6 
1 2ZT5 HIS A 692 ? UNP P41250 ? ? 'EXPRESSION TAG' 692 7 
1 2ZT5 HIS A 693 ? UNP P41250 ? ? 'EXPRESSION TAG' 693 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'         133.103 
B4P non-polymer         . "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" ? 'C20 H28 N10 O19 P4' 836.387 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                              ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          2ZT5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.42 
_exptl_crystal.density_percent_sol   64.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'25mM Tris-HCl, 150mM NaCl, 10mM MgCl2, 4M Sodium Formate, pH7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-20 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     2ZT5 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             50 
_reflns.number_all                   37651 
_reflns.number_obs                   36185 
_reflns.percent_possible_obs         95.7 
_reflns.pdbx_Rmerge_I_obs            0.042 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        39.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   76.6 
_reflns_shell.Rmerge_I_obs           0.287 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.3 
_reflns_shell.pdbx_redundancy        6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2857 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZT5 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     37651 
_refine.ls_number_reflns_obs                     34682 
_refine.ls_number_reflns_R_free                  1718 
_refine.ls_percent_reflns_obs                    92.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.258 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PME' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               51.24 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ZT5 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4228 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             352 
_refine_hist.number_atoms_total               4633 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.5 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.373 
_refine_ls_shell.percent_reflns_obs               68.8 
_refine_ls_shell.R_factor_R_free                  0.403 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2559 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZT5 
_struct.title                     
'Crystal structure of human glycyl-trna synthetase (GLYRS) in complex with AP4A (cocrystallized with ATP)' 
_struct.pdbx_descriptor           'Glycyl-tRNA synthetase (E.C.6.1.1.14)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZT5 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;Ligase, AP4A, Glycine, ATP, Gly-AMP, tRNA, Aminoacyl-tRNA synthetase, ATP-binding, Charcot-Marie-Tooth disease, Disease mutation, Nucleotide-binding, Phosphoprotein, Protein biosynthesis
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? ARG A 77  ? ASP A 66  ARG A 77  1 ? 12 
HELX_P HELX_P2  2  PHE A 84  ? GLY A 88  ? PHE A 84  GLY A 88  5 ? 5  
HELX_P HELX_P3  3  GLY A 97  ? PHE A 115 ? GLY A 97  PHE A 115 1 ? 19 
HELX_P HELX_P4  4  PHE A 115 ? GLN A 120 ? PHE A 115 GLN A 120 1 ? 6  
HELX_P HELX_P5  5  GLU A 132 ? SER A 138 ? GLU A 132 SER A 138 1 ? 7  
HELX_P HELX_P6  6  GLY A 139 ? PHE A 144 ? GLY A 139 PHE A 144 1 ? 6  
HELX_P HELX_P7  7  ALA A 160 ? ASP A 174 ? ALA A 160 ASP A 174 1 ? 15 
HELX_P HELX_P8  8  SER A 178 ? ALA A 190 ? SER A 178 ALA A 190 1 ? 13 
HELX_P HELX_P9  9  GLY A 196 ? TYR A 207 ? GLY A 196 TYR A 207 1 ? 12 
HELX_P HELX_P10 10 THR A 246 ? LEU A 252 ? THR A 246 LEU A 252 1 ? 7  
HELX_P HELX_P11 11 ASN A 253 ? ASN A 261 ? ASN A 253 ASN A 261 1 ? 9  
HELX_P HELX_P12 12 SER A 284 ? ARG A 288 ? SER A 284 ARG A 288 5 ? 5  
HELX_P HELX_P13 13 LYS A 310 ? VAL A 314 ? LYS A 310 VAL A 314 5 ? 5  
HELX_P HELX_P14 14 SER A 323 ? SER A 329 ? SER A 323 SER A 329 1 ? 7  
HELX_P HELX_P15 15 LEU A 338 ? GLN A 344 ? LEU A 338 GLN A 344 1 ? 7  
HELX_P HELX_P16 16 ASN A 349 ? GLY A 367 ? ASN A 349 GLY A 367 1 ? 19 
HELX_P HELX_P17 17 SER A 369 ? ASP A 371 ? SER A 369 ASP A 371 5 ? 3  
HELX_P HELX_P18 18 MET A 379 ? MET A 383 ? MET A 379 MET A 383 5 ? 5  
HELX_P HELX_P19 19 CYS A 412 ? LYS A 423 ? CYS A 412 LYS A 423 1 ? 12 
HELX_P HELX_P20 20 LEU A 527 ? THR A 538 ? LEU A 527 THR A 538 1 ? 12 
HELX_P HELX_P21 21 PHE A 573 ? HIS A 587 ? PHE A 573 HIS A 587 1 ? 15 
HELX_P HELX_P22 22 SER A 599 ? ILE A 610 ? SER A 599 ILE A 610 1 ? 12 
HELX_P HELX_P23 23 ASP A 619 ? ASN A 624 ? ASP A 619 ASN A 624 1 ? 6  
HELX_P HELX_P24 24 GLU A 647 ? ASN A 657 ? GLU A 647 ASN A 657 1 ? 11 
HELX_P HELX_P25 25 THR A 661 ? TYR A 669 ? THR A 661 TYR A 669 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 265 A . ? LEU 265 A PRO 266 A ? PRO 266 A 1 -0.05 
2 THR 626 A . ? THR 626 A PRO 627 A ? PRO 627 A 1 -0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 80  ? GLN A 82  ? TYR A 80  GLN A 82  
A 2 TYR A 94  ? PHE A 96  ? TYR A 94  PHE A 96  
B 1 LEU A 122 ? GLU A 123 ? LEU A 122 GLU A 123 
B 2 PHE A 267 ? PHE A 276 ? PHE A 267 PHE A 276 
B 3 GLU A 291 ? VAL A 301 ? GLU A 291 VAL A 301 
B 4 ASN A 519 ? GLY A 526 ? ASN A 519 GLY A 526 
B 5 GLY A 400 ? ALA A 408 ? GLY A 400 ALA A 408 
B 6 CYS A 390 ? THR A 397 ? CYS A 390 THR A 397 
B 7 LEU A 373 ? GLN A 377 ? LEU A 373 GLN A 377 
B 8 HIS A 318 ? TYR A 322 ? HIS A 318 TYR A 322 
B 9 ARG A 334 ? ARG A 337 ? ARG A 334 ARG A 337 
C 1 LEU A 129 ? PRO A 131 ? LEU A 129 PRO A 131 
C 2 PRO A 239 ? LEU A 242 ? PRO A 239 LEU A 242 
C 3 LYS A 229 ? PHE A 231 ? LYS A 229 PHE A 231 
D 1 CYS A 157 ? ARG A 159 ? CYS A 157 ARG A 159 
D 2 ALA A 145 ? LYS A 150 ? ALA A 145 LYS A 150 
D 3 VAL A 222 ? ASN A 225 ? VAL A 222 ASN A 225 
E 1 ALA A 428 ? LYS A 430 ? ALA A 428 LYS A 430 
E 2 GLU A 514 ? VAL A 516 ? GLU A 514 VAL A 516 
F 1 PHE A 539 ? VAL A 541 ? PHE A 539 VAL A 541 
F 2 THR A 549 ? PHE A 551 ? THR A 549 PHE A 551 
G 1 HIS A 591 ? VAL A 593 ? HIS A 591 VAL A 593 
G 2 CYS A 562 ? PRO A 566 ? CYS A 562 PRO A 566 
G 3 PHE A 614 ? ILE A 618 ? PHE A 614 ILE A 618 
G 4 THR A 629 ? ASP A 634 ? THR A 629 ASP A 634 
G 5 GLN A 640 ? GLU A 644 ? GLN A 640 GLU A 644 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 81  ? N ASP A 81  O ASP A 95  ? O ASP A 95  
B 1 2 N LEU A 122 ? N LEU A 122 O ALA A 270 ? O ALA A 270 
B 2 3 N ALA A 269 ? N ALA A 269 O GLU A 298 ? O GLU A 298 
B 3 4 N VAL A 301 ? N VAL A 301 O ASN A 519 ? O ASN A 519 
B 4 5 O SER A 524 ? O SER A 524 N GLY A 406 ? N GLY A 406 
B 5 6 O VAL A 405 ? O VAL A 405 N ALA A 393 ? N ALA A 393 
B 6 7 O GLU A 394 ? O GLU A 394 N ARG A 374 ? N ARG A 374 
B 7 8 O PHE A 375 ? O PHE A 375 N TYR A 320 ? N TYR A 320 
B 8 9 N LEU A 321 ? N LEU A 321 O ARG A 334 ? O ARG A 334 
C 1 2 N THR A 130 ? N THR A 130 O TYR A 241 ? O TYR A 241 
C 2 3 O GLY A 240 ? O GLY A 240 N THR A 230 ? N THR A 230 
D 1 2 O PHE A 158 ? O PHE A 158 N VAL A 149 ? N VAL A 149 
D 2 3 N MET A 148 ? N MET A 148 O VAL A 222 ? O VAL A 222 
E 1 2 N LYS A 430 ? N LYS A 430 O GLU A 514 ? O GLU A 514 
F 1 2 N HIS A 540 ? N HIS A 540 O PHE A 550 ? O PHE A 550 
G 1 2 O LYS A 592 ? O LYS A 592 N VAL A 564 ? N VAL A 564 
G 2 3 N SER A 563 ? N SER A 563 O PHE A 614 ? O PHE A 614 
G 3 4 N THR A 617 ? N THR A 617 O THR A 631 ? O THR A 631 
G 4 5 N ALA A 630 ? N ALA A 630 O ALA A 643 ? O ALA A 643 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    23 
_struct_site.details              'BINDING SITE FOR RESIDUE B4P A1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 146 ? ASP A 146  . ? 1_555 ? 
2  AC1 23 ARG A 159 ? ARG A 159  . ? 1_555 ? 
3  AC1 23 ASP A 193 ? ASP A 193  . ? 1_555 ? 
4  AC1 23 LEU A 226 ? LEU A 226  . ? 1_555 ? 
5  AC1 23 ARG A 277 ? ARG A 277  . ? 1_555 ? 
6  AC1 23 GLU A 279 ? GLU A 279  . ? 1_555 ? 
7  AC1 23 ILE A 287 ? ILE A 287  . ? 1_555 ? 
8  AC1 23 ARG A 288 ? ARG A 288  . ? 1_555 ? 
9  AC1 23 VAL A 289 ? VAL A 289  . ? 1_555 ? 
10 AC1 23 PHE A 292 ? PHE A 292  . ? 1_555 ? 
11 AC1 23 MET A 294 ? MET A 294  . ? 1_555 ? 
12 AC1 23 ASN A 381 ? ASN A 381  . ? 1_555 ? 
13 AC1 23 GLU A 382 ? GLU A 382  . ? 1_555 ? 
14 AC1 23 GLU A 403 ? GLU A 403  . ? 1_555 ? 
15 AC1 23 ILE A 404 ? ILE A 404  . ? 1_555 ? 
16 AC1 23 VAL A 405 ? VAL A 405  . ? 1_555 ? 
17 AC1 23 GLY A 406 ? GLY A 406  . ? 1_555 ? 
18 AC1 23 GLY A 526 ? GLY A 526  . ? 1_555 ? 
19 AC1 23 ARG A 529 ? ARG A 529  . ? 1_555 ? 
20 AC1 23 HOH C .   ? HOH A 918  . ? 1_555 ? 
21 AC1 23 HOH C .   ? HOH A 919  . ? 1_555 ? 
22 AC1 23 HOH C .   ? HOH A 920  . ? 1_555 ? 
23 AC1 23 HOH C .   ? HOH A 1021 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZT5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZT5 
_atom_sites.fract_transf_matrix[1][1]   0.008631 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007151 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007522 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 64  ? 17.856  -32.266 64.655  1.00 95.83  ? 64   ILE A N   1 
ATOM   2    C CA  . ILE A 1 64  ? 18.585  -32.787 63.463  1.00 96.07  ? 64   ILE A CA  1 
ATOM   3    C C   . ILE A 1 64  ? 18.197  -31.963 62.238  1.00 95.21  ? 64   ILE A C   1 
ATOM   4    O O   . ILE A 1 64  ? 17.107  -32.135 61.690  1.00 96.86  ? 64   ILE A O   1 
ATOM   5    C CB  . ILE A 1 64  ? 18.229  -34.269 63.177  1.00 97.23  ? 64   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 64  ? 18.086  -35.051 64.487  1.00 97.78  ? 64   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 64  ? 19.312  -34.903 62.313  1.00 97.05  ? 64   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 64  ? 16.754  -34.845 65.195  1.00 96.95  ? 64   ILE A CD1 1 
ATOM   9    N N   . VAL A 1 65  ? 19.087  -31.071 61.811  1.00 92.38  ? 65   VAL A N   1 
ATOM   10   C CA  . VAL A 1 65  ? 18.816  -30.224 60.653  1.00 88.65  ? 65   VAL A CA  1 
ATOM   11   C C   . VAL A 1 65  ? 19.968  -30.227 59.648  1.00 86.77  ? 65   VAL A C   1 
ATOM   12   O O   . VAL A 1 65  ? 21.137  -30.291 60.030  1.00 86.62  ? 65   VAL A O   1 
ATOM   13   C CB  . VAL A 1 65  ? 18.537  -28.766 61.093  1.00 88.09  ? 65   VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 65  ? 19.751  -28.196 61.805  1.00 88.22  ? 65   VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 65  ? 18.177  -27.915 59.890  1.00 88.07  ? 65   VAL A CG2 1 
ATOM   16   N N   . ASP A 1 66  ? 19.628  -30.163 58.362  1.00 84.39  ? 66   ASP A N   1 
ATOM   17   C CA  . ASP A 1 66  ? 20.628  -30.145 57.298  1.00 81.39  ? 66   ASP A CA  1 
ATOM   18   C C   . ASP A 1 66  ? 21.144  -28.720 57.110  1.00 79.00  ? 66   ASP A C   1 
ATOM   19   O O   . ASP A 1 66  ? 20.688  -27.989 56.228  1.00 77.36  ? 66   ASP A O   1 
ATOM   20   C CB  . ASP A 1 66  ? 20.019  -30.673 55.990  1.00 81.47  ? 66   ASP A CB  1 
ATOM   21   C CG  . ASP A 1 66  ? 20.991  -30.616 54.819  1.00 81.16  ? 66   ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 66  ? 22.215  -30.726 55.045  1.00 81.08  ? 66   ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 66  ? 20.527  -30.477 53.667  1.00 79.83  ? 66   ASP A OD2 1 
ATOM   24   N N   . ARG A 1 67  ? 22.098  -28.338 57.956  1.00 75.69  ? 67   ARG A N   1 
ATOM   25   C CA  . ARG A 1 67  ? 22.689  -27.006 57.926  1.00 73.58  ? 67   ARG A CA  1 
ATOM   26   C C   . ARG A 1 67  ? 22.974  -26.527 56.509  1.00 72.64  ? 67   ARG A C   1 
ATOM   27   O O   . ARG A 1 67  ? 22.629  -25.404 56.141  1.00 72.27  ? 67   ARG A O   1 
ATOM   28   C CB  . ARG A 1 67  ? 23.991  -26.991 58.728  1.00 73.12  ? 67   ARG A CB  1 
ATOM   29   C CG  . ARG A 1 67  ? 24.587  -25.607 58.909  1.00 71.95  ? 67   ARG A CG  1 
ATOM   30   C CD  . ARG A 1 67  ? 26.025  -25.693 59.375  1.00 71.66  ? 67   ARG A CD  1 
ATOM   31   N NE  . ARG A 1 67  ? 26.167  -26.533 60.558  1.00 72.37  ? 67   ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 67  ? 27.336  -26.901 61.073  1.00 73.87  ? 67   ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 67  ? 28.466  -26.499 60.506  1.00 72.10  ? 67   ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 67  ? 27.378  -27.675 62.150  1.00 74.33  ? 67   ARG A NH2 1 
ATOM   35   N N   . ALA A 1 68  ? 23.610  -27.383 55.720  1.00 72.24  ? 68   ALA A N   1 
ATOM   36   C CA  . ALA A 1 68  ? 23.951  -27.047 54.344  1.00 70.99  ? 68   ALA A CA  1 
ATOM   37   C C   . ALA A 1 68  ? 22.760  -26.470 53.592  1.00 69.77  ? 68   ALA A C   1 
ATOM   38   O O   . ALA A 1 68  ? 22.784  -25.318 53.164  1.00 68.24  ? 68   ALA A O   1 
ATOM   39   C CB  . ALA A 1 68  ? 24.470  -28.283 53.625  1.00 72.08  ? 68   ALA A CB  1 
ATOM   40   N N   . LYS A 1 69  ? 21.718  -27.278 53.441  1.00 70.46  ? 69   LYS A N   1 
ATOM   41   C CA  . LYS A 1 69  ? 20.515  -26.866 52.727  1.00 71.39  ? 69   LYS A CA  1 
ATOM   42   C C   . LYS A 1 69  ? 19.936  -25.565 53.278  1.00 70.58  ? 69   LYS A C   1 
ATOM   43   O O   . LYS A 1 69  ? 19.498  -24.700 52.516  1.00 71.44  ? 69   LYS A O   1 
ATOM   44   C CB  . LYS A 1 69  ? 19.465  -27.978 52.805  1.00 73.70  ? 69   LYS A CB  1 
ATOM   45   C CG  . LYS A 1 69  ? 18.283  -27.821 51.862  1.00 75.97  ? 69   LYS A CG  1 
ATOM   46   C CD  . LYS A 1 69  ? 17.347  -29.020 51.980  1.00 80.10  ? 69   LYS A CD  1 
ATOM   47   C CE  . LYS A 1 69  ? 16.171  -28.931 51.014  1.00 82.62  ? 69   LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 69  ? 16.602  -28.943 49.587  1.00 84.82  ? 69   LYS A NZ  1 
ATOM   49   N N   . MET A 1 70  ? 19.942  -25.424 54.599  1.00 68.14  ? 70   MET A N   1 
ATOM   50   C CA  . MET A 1 70  ? 19.403  -24.228 55.236  1.00 66.83  ? 70   MET A CA  1 
ATOM   51   C C   . MET A 1 70  ? 20.192  -22.967 54.897  1.00 66.20  ? 70   MET A C   1 
ATOM   52   O O   . MET A 1 70  ? 19.621  -21.981 54.432  1.00 65.68  ? 70   MET A O   1 
ATOM   53   C CB  . MET A 1 70  ? 19.360  -24.410 56.754  1.00 65.49  ? 70   MET A CB  1 
ATOM   54   C CG  . MET A 1 70  ? 18.738  -23.241 57.493  1.00 62.84  ? 70   MET A CG  1 
ATOM   55   S SD  . MET A 1 70  ? 18.812  -23.440 59.275  1.00 62.96  ? 70   MET A SD  1 
ATOM   56   C CE  . MET A 1 70  ? 20.469  -22.842 59.600  1.00 60.29  ? 70   MET A CE  1 
ATOM   57   N N   . GLU A 1 71  ? 21.501  -22.996 55.130  1.00 65.88  ? 71   GLU A N   1 
ATOM   58   C CA  . GLU A 1 71  ? 22.343  -21.840 54.844  1.00 66.42  ? 71   GLU A CA  1 
ATOM   59   C C   . GLU A 1 71  ? 22.161  -21.407 53.392  1.00 66.64  ? 71   GLU A C   1 
ATOM   60   O O   . GLU A 1 71  ? 22.325  -20.233 53.057  1.00 68.07  ? 71   GLU A O   1 
ATOM   61   C CB  . GLU A 1 71  ? 23.816  -22.167 55.125  1.00 67.07  ? 71   GLU A CB  1 
ATOM   62   C CG  . GLU A 1 71  ? 24.071  -22.679 56.542  1.00 69.54  ? 71   GLU A CG  1 
ATOM   63   C CD  . GLU A 1 71  ? 25.549  -22.753 56.899  1.00 72.60  ? 71   GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 71  ? 26.334  -23.287 56.088  1.00 74.08  ? 71   GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 71  ? 25.924  -22.284 57.997  1.00 73.72  ? 71   GLU A OE2 1 
ATOM   66   N N   . ASP A 1 72  ? 21.808  -22.359 52.535  1.00 66.76  ? 72   ASP A N   1 
ATOM   67   C CA  . ASP A 1 72  ? 21.584  -22.075 51.122  1.00 67.37  ? 72   ASP A CA  1 
ATOM   68   C C   . ASP A 1 72  ? 20.302  -21.269 50.919  1.00 65.32  ? 72   ASP A C   1 
ATOM   69   O O   . ASP A 1 72  ? 20.228  -20.415 50.035  1.00 64.42  ? 72   ASP A O   1 
ATOM   70   C CB  . ASP A 1 72  ? 21.501  -23.382 50.326  1.00 72.32  ? 72   ASP A CB  1 
ATOM   71   C CG  . ASP A 1 72  ? 22.866  -23.997 50.065  1.00 77.10  ? 72   ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 72  ? 23.616  -24.238 51.037  1.00 78.23  ? 72   ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 72  ? 23.187  -24.241 48.882  1.00 79.20  ? 72   ASP A OD2 1 
ATOM   74   N N   . THR A 1 73  ? 19.295  -21.547 51.742  1.00 62.75  ? 73   THR A N   1 
ATOM   75   C CA  . THR A 1 73  ? 18.016  -20.850 51.654  1.00 59.83  ? 73   THR A CA  1 
ATOM   76   C C   . THR A 1 73  ? 18.094  -19.490 52.341  1.00 57.52  ? 73   THR A C   1 
ATOM   77   O O   . THR A 1 73  ? 17.524  -18.507 51.867  1.00 57.55  ? 73   THR A O   1 
ATOM   78   C CB  . THR A 1 73  ? 16.889  -21.678 52.305  1.00 59.46  ? 73   THR A CB  1 
ATOM   79   O OG1 . THR A 1 73  ? 16.812  -22.959 51.669  1.00 62.10  ? 73   THR A OG1 1 
ATOM   80   C CG2 . THR A 1 73  ? 15.552  -20.970 52.161  1.00 58.50  ? 73   THR A CG2 1 
ATOM   81   N N   . LEU A 1 74  ? 18.804  -19.437 53.462  1.00 56.57  ? 74   LEU A N   1 
ATOM   82   C CA  . LEU A 1 74  ? 18.958  -18.193 54.201  1.00 54.68  ? 74   LEU A CA  1 
ATOM   83   C C   . LEU A 1 74  ? 19.782  -17.192 53.393  1.00 56.14  ? 74   LEU A C   1 
ATOM   84   O O   . LEU A 1 74  ? 19.546  -15.987 53.459  1.00 57.25  ? 74   LEU A O   1 
ATOM   85   C CB  . LEU A 1 74  ? 19.637  -18.466 55.544  1.00 51.39  ? 74   LEU A CB  1 
ATOM   86   C CG  . LEU A 1 74  ? 18.863  -19.342 56.535  1.00 50.09  ? 74   LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 74  ? 19.793  -19.817 57.638  1.00 46.32  ? 74   LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 74  ? 17.692  -18.559 57.110  1.00 47.85  ? 74   LEU A CD2 1 
ATOM   89   N N   . LYS A 1 75  ? 20.744  -17.693 52.621  1.00 57.41  ? 75   LYS A N   1 
ATOM   90   C CA  . LYS A 1 75  ? 21.594  -16.825 51.810  1.00 58.95  ? 75   LYS A CA  1 
ATOM   91   C C   . LYS A 1 75  ? 20.954  -16.467 50.470  1.00 58.66  ? 75   LYS A C   1 
ATOM   92   O O   . LYS A 1 75  ? 21.130  -15.357 49.963  1.00 57.84  ? 75   LYS A O   1 
ATOM   93   C CB  . LYS A 1 75  ? 22.957  -17.486 51.574  1.00 59.53  ? 75   LYS A CB  1 
ATOM   94   C CG  . LYS A 1 75  ? 23.818  -17.597 52.825  1.00 62.14  ? 75   LYS A CG  1 
ATOM   95   C CD  . LYS A 1 75  ? 25.187  -18.178 52.510  1.00 62.80  ? 75   LYS A CD  1 
ATOM   96   C CE  . LYS A 1 75  ? 26.047  -18.277 53.762  1.00 65.12  ? 75   LYS A CE  1 
ATOM   97   N NZ  . LYS A 1 75  ? 27.399  -18.830 53.460  1.00 66.28  ? 75   LYS A NZ  1 
ATOM   98   N N   . ARG A 1 76  ? 20.207  -17.407 49.904  1.00 58.33  ? 76   ARG A N   1 
ATOM   99   C CA  . ARG A 1 76  ? 19.548  -17.189 48.624  1.00 58.14  ? 76   ARG A CA  1 
ATOM   100  C C   . ARG A 1 76  ? 18.426  -16.161 48.740  1.00 56.64  ? 76   ARG A C   1 
ATOM   101  O O   . ARG A 1 76  ? 18.320  -15.257 47.912  1.00 56.41  ? 76   ARG A O   1 
ATOM   102  C CB  . ARG A 1 76  ? 19.009  -18.519 48.092  1.00 60.18  ? 76   ARG A CB  1 
ATOM   103  C CG  . ARG A 1 76  ? 18.381  -18.449 46.708  1.00 60.83  ? 76   ARG A CG  1 
ATOM   104  C CD  . ARG A 1 76  ? 18.378  -19.828 46.065  1.00 61.03  ? 76   ARG A CD  1 
ATOM   105  N NE  . ARG A 1 76  ? 17.862  -20.850 46.972  1.00 59.09  ? 76   ARG A NE  1 
ATOM   106  C CZ  . ARG A 1 76  ? 16.591  -20.947 47.345  1.00 57.57  ? 76   ARG A CZ  1 
ATOM   107  N NH1 . ARG A 1 76  ? 15.693  -20.084 46.886  1.00 57.18  ? 76   ARG A NH1 1 
ATOM   108  N NH2 . ARG A 1 76  ? 16.221  -21.900 48.191  1.00 55.51  ? 76   ARG A NH2 1 
ATOM   109  N N   . ARG A 1 77  ? 17.591  -16.293 49.767  1.00 56.15  ? 77   ARG A N   1 
ATOM   110  C CA  . ARG A 1 77  ? 16.495  -15.350 49.965  1.00 56.48  ? 77   ARG A CA  1 
ATOM   111  C C   . ARG A 1 77  ? 16.998  -14.090 50.659  1.00 56.90  ? 77   ARG A C   1 
ATOM   112  O O   . ARG A 1 77  ? 16.245  -13.142 50.891  1.00 56.56  ? 77   ARG A O   1 
ATOM   113  C CB  . ARG A 1 77  ? 15.365  -16.000 50.767  1.00 55.83  ? 77   ARG A CB  1 
ATOM   114  C CG  . ARG A 1 77  ? 14.673  -17.130 50.011  1.00 54.85  ? 77   ARG A CG  1 
ATOM   115  C CD  . ARG A 1 77  ? 14.277  -16.686 48.603  1.00 51.23  ? 77   ARG A CD  1 
ATOM   116  N NE  . ARG A 1 77  ? 13.271  -15.628 48.616  1.00 47.81  ? 77   ARG A NE  1 
ATOM   117  C CZ  . ARG A 1 77  ? 11.981  -15.830 48.869  1.00 47.92  ? 77   ARG A CZ  1 
ATOM   118  N NH1 . ARG A 1 77  ? 11.541  -17.053 49.126  1.00 47.74  ? 77   ARG A NH1 1 
ATOM   119  N NH2 . ARG A 1 77  ? 11.133  -14.810 48.872  1.00 48.20  ? 77   ARG A NH2 1 
ATOM   120  N N   . PHE A 1 78  ? 18.287  -14.103 50.981  1.00 56.10  ? 78   PHE A N   1 
ATOM   121  C CA  . PHE A 1 78  ? 18.971  -12.980 51.609  1.00 55.20  ? 78   PHE A CA  1 
ATOM   122  C C   . PHE A 1 78  ? 18.545  -12.587 53.022  1.00 53.95  ? 78   PHE A C   1 
ATOM   123  O O   . PHE A 1 78  ? 18.120  -11.457 53.266  1.00 54.59  ? 78   PHE A O   1 
ATOM   124  C CB  . PHE A 1 78  ? 18.906  -11.756 50.687  1.00 51.82  ? 78   PHE A CB  1 
ATOM   125  C CG  . PHE A 1 78  ? 19.924  -10.694 51.010  1.00 52.23  ? 78   PHE A CG  1 
ATOM   126  C CD1 . PHE A 1 78  ? 21.093  -11.014 51.697  1.00 52.39  ? 78   PHE A CD1 1 
ATOM   127  C CD2 . PHE A 1 78  ? 19.737  -9.380  50.589  1.00 51.39  ? 78   PHE A CD2 1 
ATOM   128  C CE1 . PHE A 1 78  ? 22.059  -10.043 51.958  1.00 51.87  ? 78   PHE A CE1 1 
ATOM   129  C CE2 . PHE A 1 78  ? 20.699  -8.402  50.844  1.00 50.87  ? 78   PHE A CE2 1 
ATOM   130  C CZ  . PHE A 1 78  ? 21.861  -8.735  51.529  1.00 50.42  ? 78   PHE A CZ  1 
ATOM   131  N N   . PHE A 1 79  ? 18.655  -13.527 53.950  1.00 53.03  ? 79   PHE A N   1 
ATOM   132  C CA  . PHE A 1 79  ? 18.347  -13.248 55.343  1.00 53.47  ? 79   PHE A CA  1 
ATOM   133  C C   . PHE A 1 79  ? 19.641  -12.605 55.815  1.00 54.44  ? 79   PHE A C   1 
ATOM   134  O O   . PHE A 1 79  ? 19.641  -11.594 56.518  1.00 54.08  ? 79   PHE A O   1 
ATOM   135  C CB  . PHE A 1 79  ? 18.090  -14.547 56.109  1.00 52.39  ? 79   PHE A CB  1 
ATOM   136  C CG  . PHE A 1 79  ? 16.674  -15.038 56.015  1.00 52.97  ? 79   PHE A CG  1 
ATOM   137  C CD1 . PHE A 1 79  ? 15.670  -14.443 56.769  1.00 52.13  ? 79   PHE A CD1 1 
ATOM   138  C CD2 . PHE A 1 79  ? 16.345  -16.100 55.180  1.00 54.02  ? 79   PHE A CD2 1 
ATOM   139  C CE1 . PHE A 1 79  ? 14.357  -14.901 56.697  1.00 53.07  ? 79   PHE A CE1 1 
ATOM   140  C CE2 . PHE A 1 79  ? 15.034  -16.564 55.100  1.00 52.10  ? 79   PHE A CE2 1 
ATOM   141  C CZ  . PHE A 1 79  ? 14.039  -15.964 55.860  1.00 50.97  ? 79   PHE A CZ  1 
ATOM   142  N N   . TYR A 1 80  ? 20.746  -13.210 55.391  1.00 55.89  ? 80   TYR A N   1 
ATOM   143  C CA  . TYR A 1 80  ? 22.081  -12.727 55.707  1.00 58.16  ? 80   TYR A CA  1 
ATOM   144  C C   . TYR A 1 80  ? 23.056  -13.344 54.712  1.00 59.18  ? 80   TYR A C   1 
ATOM   145  O O   . TYR A 1 80  ? 22.676  -14.184 53.899  1.00 58.73  ? 80   TYR A O   1 
ATOM   146  C CB  . TYR A 1 80  ? 22.489  -13.115 57.130  1.00 59.32  ? 80   TYR A CB  1 
ATOM   147  C CG  . TYR A 1 80  ? 22.879  -14.568 57.301  1.00 61.24  ? 80   TYR A CG  1 
ATOM   148  C CD1 . TYR A 1 80  ? 21.915  -15.555 57.501  1.00 62.37  ? 80   TYR A CD1 1 
ATOM   149  C CD2 . TYR A 1 80  ? 24.220  -14.952 57.272  1.00 62.16  ? 80   TYR A CD2 1 
ATOM   150  C CE1 . TYR A 1 80  ? 22.278  -16.892 57.673  1.00 64.24  ? 80   TYR A CE1 1 
ATOM   151  C CE2 . TYR A 1 80  ? 24.593  -16.282 57.441  1.00 65.08  ? 80   TYR A CE2 1 
ATOM   152  C CZ  . TYR A 1 80  ? 23.619  -17.247 57.642  1.00 66.40  ? 80   TYR A CZ  1 
ATOM   153  O OH  . TYR A 1 80  ? 23.991  -18.562 57.821  1.00 67.94  ? 80   TYR A OH  1 
ATOM   154  N N   . ASP A 1 81  ? 24.313  -12.924 54.777  1.00 61.11  ? 81   ASP A N   1 
ATOM   155  C CA  . ASP A 1 81  ? 25.331  -13.451 53.881  1.00 62.50  ? 81   ASP A CA  1 
ATOM   156  C C   . ASP A 1 81  ? 26.691  -12.870 54.243  1.00 61.49  ? 81   ASP A C   1 
ATOM   157  O O   . ASP A 1 81  ? 26.783  -11.959 55.067  1.00 62.08  ? 81   ASP A O   1 
ATOM   158  C CB  . ASP A 1 81  ? 24.987  -13.109 52.430  1.00 64.98  ? 81   ASP A CB  1 
ATOM   159  C CG  . ASP A 1 81  ? 25.630  -14.062 51.440  1.00 66.51  ? 81   ASP A CG  1 
ATOM   160  O OD1 . ASP A 1 81  ? 25.382  -13.915 50.226  1.00 67.20  ? 81   ASP A OD1 1 
ATOM   161  O OD2 . ASP A 1 81  ? 26.378  -14.963 51.880  1.00 64.96  ? 81   ASP A OD2 1 
ATOM   162  N N   . GLN A 1 82  ? 27.743  -13.404 53.631  1.00 59.86  ? 82   GLN A N   1 
ATOM   163  C CA  . GLN A 1 82  ? 29.098  -12.937 53.893  1.00 59.60  ? 82   GLN A CA  1 
ATOM   164  C C   . GLN A 1 82  ? 29.239  -11.448 53.630  1.00 57.42  ? 82   GLN A C   1 
ATOM   165  O O   . GLN A 1 82  ? 28.844  -10.955 52.574  1.00 55.99  ? 82   GLN A O   1 
ATOM   166  C CB  . GLN A 1 82  ? 30.103  -13.692 53.022  1.00 60.88  ? 82   GLN A CB  1 
ATOM   167  C CG  . GLN A 1 82  ? 30.322  -15.133 53.425  1.00 66.90  ? 82   GLN A CG  1 
ATOM   168  C CD  . GLN A 1 82  ? 31.340  -15.825 52.537  1.00 71.03  ? 82   GLN A CD  1 
ATOM   169  O OE1 . GLN A 1 82  ? 32.458  -15.337 52.356  1.00 70.30  ? 82   GLN A OE1 1 
ATOM   170  N NE2 . GLN A 1 82  ? 30.959  -16.972 51.981  1.00 72.20  ? 82   GLN A NE2 1 
ATOM   171  N N   . ALA A 1 83  ? 29.799  -10.734 54.599  1.00 56.38  ? 83   ALA A N   1 
ATOM   172  C CA  . ALA A 1 83  ? 30.009  -9.301  54.451  1.00 57.24  ? 83   ALA A CA  1 
ATOM   173  C C   . ALA A 1 83  ? 31.250  -9.108  53.582  1.00 57.50  ? 83   ALA A C   1 
ATOM   174  O O   . ALA A 1 83  ? 32.221  -9.856  53.705  1.00 56.72  ? 83   ALA A O   1 
ATOM   175  C CB  . ALA A 1 83  ? 30.207  -8.655  55.814  1.00 55.91  ? 83   ALA A CB  1 
ATOM   176  N N   . PHE A 1 84  ? 31.213  -8.109  52.706  1.00 57.19  ? 84   PHE A N   1 
ATOM   177  C CA  . PHE A 1 84  ? 32.330  -7.835  51.808  1.00 58.13  ? 84   PHE A CA  1 
ATOM   178  C C   . PHE A 1 84  ? 32.608  -9.099  50.998  1.00 58.75  ? 84   PHE A C   1 
ATOM   179  O O   . PHE A 1 84  ? 33.759  -9.506  50.828  1.00 58.08  ? 84   PHE A O   1 
ATOM   180  C CB  . PHE A 1 84  ? 33.588  -7.446  52.599  1.00 57.41  ? 84   PHE A CB  1 
ATOM   181  C CG  . PHE A 1 84  ? 33.325  -6.514  53.749  1.00 55.17  ? 84   PHE A CG  1 
ATOM   182  C CD1 . PHE A 1 84  ? 33.230  -7.004  55.048  1.00 54.19  ? 84   PHE A CD1 1 
ATOM   183  C CD2 . PHE A 1 84  ? 33.154  -5.152  53.533  1.00 54.35  ? 84   PHE A CD2 1 
ATOM   184  C CE1 . PHE A 1 84  ? 32.968  -6.153  56.115  1.00 53.72  ? 84   PHE A CE1 1 
ATOM   185  C CE2 . PHE A 1 84  ? 32.890  -4.287  54.595  1.00 54.45  ? 84   PHE A CE2 1 
ATOM   186  C CZ  . PHE A 1 84  ? 32.797  -4.789  55.890  1.00 55.20  ? 84   PHE A CZ  1 
ATOM   187  N N   . ALA A 1 85  ? 31.540  -9.720  50.509  1.00 58.74  ? 85   ALA A N   1 
ATOM   188  C CA  . ALA A 1 85  ? 31.649  -10.944 49.728  1.00 59.33  ? 85   ALA A CA  1 
ATOM   189  C C   . ALA A 1 85  ? 32.575  -10.796 48.520  1.00 60.64  ? 85   ALA A C   1 
ATOM   190  O O   . ALA A 1 85  ? 33.474  -11.615 48.320  1.00 61.56  ? 85   ALA A O   1 
ATOM   191  C CB  . ALA A 1 85  ? 30.265  -11.392 49.275  1.00 59.43  ? 85   ALA A CB  1 
ATOM   192  N N   . ILE A 1 86  ? 32.363  -9.751  47.723  1.00 59.84  ? 86   ILE A N   1 
ATOM   193  C CA  . ILE A 1 86  ? 33.181  -9.528  46.534  1.00 59.03  ? 86   ILE A CA  1 
ATOM   194  C C   . ILE A 1 86  ? 34.656  -9.241  46.822  1.00 60.72  ? 86   ILE A C   1 
ATOM   195  O O   . ILE A 1 86  ? 35.418  -8.930  45.907  1.00 63.56  ? 86   ILE A O   1 
ATOM   196  C CB  . ILE A 1 86  ? 32.614  -8.380  45.663  1.00 58.65  ? 86   ILE A CB  1 
ATOM   197  C CG1 . ILE A 1 86  ? 32.576  -7.076  46.459  1.00 55.68  ? 86   ILE A CG1 1 
ATOM   198  C CG2 . ILE A 1 86  ? 31.223  -8.745  45.168  1.00 59.20  ? 86   ILE A CG2 1 
ATOM   199  C CD1 . ILE A 1 86  ? 32.029  -5.903  45.673  1.00 52.03  ? 86   ILE A CD1 1 
ATOM   200  N N   . TYR A 1 87  ? 35.058  -9.340  48.086  1.00 60.35  ? 87   TYR A N   1 
ATOM   201  C CA  . TYR A 1 87  ? 36.452  -9.117  48.465  1.00 59.37  ? 87   TYR A CA  1 
ATOM   202  C C   . TYR A 1 87  ? 37.037  -10.367 49.110  1.00 59.89  ? 87   TYR A C   1 
ATOM   203  O O   . TYR A 1 87  ? 38.171  -10.355 49.589  1.00 61.05  ? 87   TYR A O   1 
ATOM   204  C CB  . TYR A 1 87  ? 36.581  -7.952  49.451  1.00 58.20  ? 87   TYR A CB  1 
ATOM   205  C CG  . TYR A 1 87  ? 36.557  -6.581  48.819  1.00 55.50  ? 87   TYR A CG  1 
ATOM   206  C CD1 . TYR A 1 87  ? 35.364  -6.011  48.385  1.00 55.08  ? 87   TYR A CD1 1 
ATOM   207  C CD2 . TYR A 1 87  ? 37.733  -5.847  48.663  1.00 54.67  ? 87   TYR A CD2 1 
ATOM   208  C CE1 . TYR A 1 87  ? 35.339  -4.741  47.813  1.00 56.02  ? 87   TYR A CE1 1 
ATOM   209  C CE2 . TYR A 1 87  ? 37.721  -4.579  48.092  1.00 56.69  ? 87   TYR A CE2 1 
ATOM   210  C CZ  . TYR A 1 87  ? 36.519  -4.031  47.670  1.00 57.41  ? 87   TYR A CZ  1 
ATOM   211  O OH  . TYR A 1 87  ? 36.499  -2.774  47.108  1.00 58.71  ? 87   TYR A OH  1 
ATOM   212  N N   . GLY A 1 88  ? 36.259  -11.444 49.124  1.00 60.45  ? 88   GLY A N   1 
ATOM   213  C CA  . GLY A 1 88  ? 36.718  -12.680 49.730  1.00 60.62  ? 88   GLY A CA  1 
ATOM   214  C C   . GLY A 1 88  ? 35.980  -12.932 51.030  1.00 61.61  ? 88   GLY A C   1 
ATOM   215  O O   . GLY A 1 88  ? 35.899  -14.066 51.506  1.00 61.73  ? 88   GLY A O   1 
ATOM   216  N N   . GLY A 1 89  ? 35.439  -11.861 51.605  1.00 61.60  ? 89   GLY A N   1 
ATOM   217  C CA  . GLY A 1 89  ? 34.701  -11.971 52.849  1.00 61.32  ? 89   GLY A CA  1 
ATOM   218  C C   . GLY A 1 89  ? 35.568  -12.126 54.086  1.00 61.66  ? 89   GLY A C   1 
ATOM   219  O O   . GLY A 1 89  ? 36.603  -12.796 54.065  1.00 64.17  ? 89   GLY A O   1 
ATOM   220  N N   . VAL A 1 90  ? 35.144  -11.494 55.172  1.00 60.10  ? 90   VAL A N   1 
ATOM   221  C CA  . VAL A 1 90  ? 35.866  -11.571 56.433  1.00 57.12  ? 90   VAL A CA  1 
ATOM   222  C C   . VAL A 1 90  ? 35.085  -12.519 57.326  1.00 54.88  ? 90   VAL A C   1 
ATOM   223  O O   . VAL A 1 90  ? 33.870  -12.387 57.457  1.00 54.24  ? 90   VAL A O   1 
ATOM   224  C CB  . VAL A 1 90  ? 35.948  -10.190 57.117  1.00 56.47  ? 90   VAL A CB  1 
ATOM   225  C CG1 . VAL A 1 90  ? 36.708  -10.302 58.430  1.00 56.72  ? 90   VAL A CG1 1 
ATOM   226  C CG2 . VAL A 1 90  ? 36.628  -9.194  56.195  1.00 54.30  ? 90   VAL A CG2 1 
ATOM   227  N N   . SER A 1 91  ? 35.771  -13.482 57.929  1.00 54.16  ? 91   SER A N   1 
ATOM   228  C CA  . SER A 1 91  ? 35.091  -14.432 58.802  1.00 54.54  ? 91   SER A CA  1 
ATOM   229  C C   . SER A 1 91  ? 34.583  -13.720 60.054  1.00 52.31  ? 91   SER A C   1 
ATOM   230  O O   . SER A 1 91  ? 35.214  -12.782 60.546  1.00 50.33  ? 91   SER A O   1 
ATOM   231  C CB  . SER A 1 91  ? 36.034  -15.576 59.191  1.00 56.69  ? 91   SER A CB  1 
ATOM   232  O OG  . SER A 1 91  ? 37.116  -15.112 59.976  1.00 61.64  ? 91   SER A OG  1 
ATOM   233  N N   . GLY A 1 92  ? 33.438  -14.167 60.559  1.00 51.71  ? 92   GLY A N   1 
ATOM   234  C CA  . GLY A 1 92  ? 32.861  -13.560 61.744  1.00 51.98  ? 92   GLY A CA  1 
ATOM   235  C C   . GLY A 1 92  ? 32.046  -12.317 61.435  1.00 52.57  ? 92   GLY A C   1 
ATOM   236  O O   . GLY A 1 92  ? 31.533  -11.664 62.345  1.00 53.39  ? 92   GLY A O   1 
ATOM   237  N N   . LEU A 1 93  ? 31.925  -11.988 60.151  1.00 51.38  ? 93   LEU A N   1 
ATOM   238  C CA  . LEU A 1 93  ? 31.169  -10.813 59.726  1.00 51.43  ? 93   LEU A CA  1 
ATOM   239  C C   . LEU A 1 93  ? 30.113  -11.156 58.679  1.00 50.49  ? 93   LEU A C   1 
ATOM   240  O O   . LEU A 1 93  ? 30.393  -11.851 57.702  1.00 50.76  ? 93   LEU A O   1 
ATOM   241  C CB  . LEU A 1 93  ? 32.113  -9.745  59.159  1.00 49.31  ? 93   LEU A CB  1 
ATOM   242  C CG  . LEU A 1 93  ? 33.119  -9.100  60.116  1.00 49.07  ? 93   LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 93  ? 33.977  -8.095  59.361  1.00 46.41  ? 93   LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 93  ? 32.377  -8.410  61.250  1.00 50.48  ? 93   LEU A CD2 1 
ATOM   245  N N   . TYR A 1 94  ? 28.895  -10.667 58.891  1.00 49.17  ? 94   TYR A N   1 
ATOM   246  C CA  . TYR A 1 94  ? 27.803  -10.915 57.961  1.00 46.79  ? 94   TYR A CA  1 
ATOM   247  C C   . TYR A 1 94  ? 26.872  -9.715  57.893  1.00 45.30  ? 94   TYR A C   1 
ATOM   248  O O   . TYR A 1 94  ? 26.806  -8.916  58.825  1.00 44.91  ? 94   TYR A O   1 
ATOM   249  C CB  . TYR A 1 94  ? 26.991  -12.146 58.386  1.00 45.79  ? 94   TYR A CB  1 
ATOM   250  C CG  . TYR A 1 94  ? 27.790  -13.423 58.488  1.00 46.14  ? 94   TYR A CG  1 
ATOM   251  C CD1 . TYR A 1 94  ? 28.538  -13.709 59.628  1.00 47.62  ? 94   TYR A CD1 1 
ATOM   252  C CD2 . TYR A 1 94  ? 27.815  -14.339 57.435  1.00 46.49  ? 94   TYR A CD2 1 
ATOM   253  C CE1 . TYR A 1 94  ? 29.294  -14.875 59.720  1.00 49.24  ? 94   TYR A CE1 1 
ATOM   254  C CE2 . TYR A 1 94  ? 28.569  -15.510 57.516  1.00 48.24  ? 94   TYR A CE2 1 
ATOM   255  C CZ  . TYR A 1 94  ? 29.306  -15.770 58.662  1.00 48.50  ? 94   TYR A CZ  1 
ATOM   256  O OH  . TYR A 1 94  ? 30.058  -16.918 58.751  1.00 50.77  ? 94   TYR A OH  1 
ATOM   257  N N   . ASP A 1 95  ? 26.160  -9.592  56.777  1.00 46.77  ? 95   ASP A N   1 
ATOM   258  C CA  . ASP A 1 95  ? 25.202  -8.509  56.588  1.00 47.37  ? 95   ASP A CA  1 
ATOM   259  C C   . ASP A 1 95  ? 23.814  -9.127  56.522  1.00 46.55  ? 95   ASP A C   1 
ATOM   260  O O   . ASP A 1 95  ? 23.659  -10.269 56.088  1.00 46.81  ? 95   ASP A O   1 
ATOM   261  C CB  . ASP A 1 95  ? 25.475  -7.755  55.285  1.00 48.92  ? 95   ASP A CB  1 
ATOM   262  C CG  . ASP A 1 95  ? 26.865  -7.163  55.232  1.00 51.22  ? 95   ASP A CG  1 
ATOM   263  O OD1 . ASP A 1 95  ? 27.307  -6.584  56.249  1.00 52.48  ? 95   ASP A OD1 1 
ATOM   264  O OD2 . ASP A 1 95  ? 27.509  -7.267  54.169  1.00 53.37  ? 95   ASP A OD2 1 
ATOM   265  N N   . PHE A 1 96  ? 22.803  -8.381  56.949  1.00 45.76  ? 96   PHE A N   1 
ATOM   266  C CA  . PHE A 1 96  ? 21.445  -8.899  56.914  1.00 45.06  ? 96   PHE A CA  1 
ATOM   267  C C   . PHE A 1 96  ? 20.637  -8.240  55.807  1.00 46.72  ? 96   PHE A C   1 
ATOM   268  O O   . PHE A 1 96  ? 20.591  -7.014  55.697  1.00 48.04  ? 96   PHE A O   1 
ATOM   269  C CB  . PHE A 1 96  ? 20.759  -8.693  58.268  1.00 46.19  ? 96   PHE A CB  1 
ATOM   270  C CG  . PHE A 1 96  ? 21.445  -9.400  59.409  1.00 48.67  ? 96   PHE A CG  1 
ATOM   271  C CD1 . PHE A 1 96  ? 22.519  -8.810  60.067  1.00 49.07  ? 96   PHE A CD1 1 
ATOM   272  C CD2 . PHE A 1 96  ? 21.029  -10.667 59.812  1.00 50.60  ? 96   PHE A CD2 1 
ATOM   273  C CE1 . PHE A 1 96  ? 23.168  -9.472  61.110  1.00 50.54  ? 96   PHE A CE1 1 
ATOM   274  C CE2 . PHE A 1 96  ? 21.671  -11.337 60.854  1.00 48.38  ? 96   PHE A CE2 1 
ATOM   275  C CZ  . PHE A 1 96  ? 22.742  -10.737 61.503  1.00 48.98  ? 96   PHE A CZ  1 
ATOM   276  N N   . GLY A 1 97  ? 20.009  -9.066  54.977  1.00 47.13  ? 97   GLY A N   1 
ATOM   277  C CA  . GLY A 1 97  ? 19.206  -8.543  53.889  1.00 45.55  ? 97   GLY A CA  1 
ATOM   278  C C   . GLY A 1 97  ? 17.829  -8.148  54.377  1.00 46.40  ? 97   GLY A C   1 
ATOM   279  O O   . GLY A 1 97  ? 17.549  -8.240  55.573  1.00 44.64  ? 97   GLY A O   1 
ATOM   280  N N   . PRO A 1 98  ? 16.943  -7.701  53.475  1.00 46.52  ? 98   PRO A N   1 
ATOM   281  C CA  . PRO A 1 98  ? 15.580  -7.289  53.816  1.00 47.82  ? 98   PRO A CA  1 
ATOM   282  C C   . PRO A 1 98  ? 14.857  -8.196  54.813  1.00 48.98  ? 98   PRO A C   1 
ATOM   283  O O   . PRO A 1 98  ? 14.542  -7.761  55.921  1.00 50.04  ? 98   PRO A O   1 
ATOM   284  C CB  . PRO A 1 98  ? 14.899  -7.238  52.456  1.00 46.22  ? 98   PRO A CB  1 
ATOM   285  C CG  . PRO A 1 98  ? 15.993  -6.682  51.600  1.00 46.54  ? 98   PRO A CG  1 
ATOM   286  C CD  . PRO A 1 98  ? 17.199  -7.500  52.037  1.00 45.51  ? 98   PRO A CD  1 
ATOM   287  N N   . VAL A 1 99  ? 14.592  -9.445  54.429  1.00 48.59  ? 99   VAL A N   1 
ATOM   288  C CA  . VAL A 1 99  ? 13.898  -10.375 55.323  1.00 48.85  ? 99   VAL A CA  1 
ATOM   289  C C   . VAL A 1 99  ? 14.658  -10.603 56.624  1.00 48.62  ? 99   VAL A C   1 
ATOM   290  O O   . VAL A 1 99  ? 14.052  -10.860 57.664  1.00 48.72  ? 99   VAL A O   1 
ATOM   291  C CB  . VAL A 1 99  ? 13.646  -11.754 54.657  1.00 48.74  ? 99   VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 99  ? 12.514  -11.646 53.660  1.00 49.39  ? 99   VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 99  ? 14.907  -12.246 53.974  1.00 47.18  ? 99   VAL A CG2 1 
ATOM   294  N N   . GLY A 1 100 ? 15.983  -10.514 56.563  1.00 48.38  ? 100  GLY A N   1 
ATOM   295  C CA  . GLY A 1 100 ? 16.785  -10.702 57.757  1.00 48.13  ? 100  GLY A CA  1 
ATOM   296  C C   . GLY A 1 100 ? 16.540  -9.571  58.738  1.00 48.09  ? 100  GLY A C   1 
ATOM   297  O O   . GLY A 1 100 ? 16.463  -9.792  59.945  1.00 49.48  ? 100  GLY A O   1 
ATOM   298  N N   . CYS A 1 101 ? 16.418  -8.353  58.218  1.00 45.88  ? 101  CYS A N   1 
ATOM   299  C CA  . CYS A 1 101 ? 16.171  -7.185  59.055  1.00 45.77  ? 101  CYS A CA  1 
ATOM   300  C C   . CYS A 1 101 ? 14.752  -7.217  59.618  1.00 45.61  ? 101  CYS A C   1 
ATOM   301  O O   . CYS A 1 101 ? 14.532  -6.885  60.781  1.00 44.09  ? 101  CYS A O   1 
ATOM   302  C CB  . CYS A 1 101 ? 16.384  -5.900  58.251  1.00 43.76  ? 101  CYS A CB  1 
ATOM   303  S SG  . CYS A 1 101 ? 18.095  -5.644  57.724  1.00 46.10  ? 101  CYS A SG  1 
ATOM   304  N N   . ALA A 1 102 ? 13.794  -7.624  58.793  1.00 44.39  ? 102  ALA A N   1 
ATOM   305  C CA  . ALA A 1 102 ? 12.405  -7.704  59.226  1.00 45.66  ? 102  ALA A CA  1 
ATOM   306  C C   . ALA A 1 102 ? 12.283  -8.672  60.400  1.00 45.27  ? 102  ALA A C   1 
ATOM   307  O O   . ALA A 1 102 ? 11.612  -8.383  61.393  1.00 45.25  ? 102  ALA A O   1 
ATOM   308  C CB  . ALA A 1 102 ? 11.520  -8.168  58.069  1.00 43.10  ? 102  ALA A CB  1 
ATOM   309  N N   . LEU A 1 103 ? 12.944  -9.819  60.279  1.00 44.46  ? 103  LEU A N   1 
ATOM   310  C CA  . LEU A 1 103 ? 12.917  -10.842 61.317  1.00 45.73  ? 103  LEU A CA  1 
ATOM   311  C C   . LEU A 1 103 ? 13.675  -10.372 62.554  1.00 47.20  ? 103  LEU A C   1 
ATOM   312  O O   . LEU A 1 103 ? 13.221  -10.555 63.685  1.00 48.16  ? 103  LEU A O   1 
ATOM   313  C CB  . LEU A 1 103 ? 13.539  -12.134 60.785  1.00 44.75  ? 103  LEU A CB  1 
ATOM   314  C CG  . LEU A 1 103 ? 13.568  -13.353 61.709  1.00 46.54  ? 103  LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 103 ? 12.155  -13.795 62.052  1.00 46.75  ? 103  LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 103 ? 14.310  -14.477 61.018  1.00 48.59  ? 103  LEU A CD2 1 
ATOM   317  N N   . LYS A 1 104 ? 14.831  -9.759  62.330  1.00 48.66  ? 104  LYS A N   1 
ATOM   318  C CA  . LYS A 1 104 ? 15.654  -9.259  63.419  1.00 48.40  ? 104  LYS A CA  1 
ATOM   319  C C   . LYS A 1 104 ? 14.902  -8.168  64.175  1.00 49.34  ? 104  LYS A C   1 
ATOM   320  O O   . LYS A 1 104 ? 14.964  -8.092  65.404  1.00 49.89  ? 104  LYS A O   1 
ATOM   321  C CB  . LYS A 1 104 ? 16.974  -8.720  62.859  1.00 50.07  ? 104  LYS A CB  1 
ATOM   322  C CG  . LYS A 1 104 ? 18.005  -8.356  63.912  1.00 52.08  ? 104  LYS A CG  1 
ATOM   323  C CD  . LYS A 1 104 ? 19.420  -8.377  63.338  1.00 55.03  ? 104  LYS A CD  1 
ATOM   324  C CE  . LYS A 1 104 ? 19.607  -7.367  62.216  1.00 55.41  ? 104  LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 104 ? 19.422  -5.962  62.677  1.00 56.40  ? 104  LYS A NZ  1 
ATOM   326  N N   . ASN A 1 105 ? 14.182  -7.327  63.441  1.00 49.68  ? 105  ASN A N   1 
ATOM   327  C CA  . ASN A 1 105 ? 13.424  -6.257  64.071  1.00 51.82  ? 105  ASN A CA  1 
ATOM   328  C C   . ASN A 1 105 ? 12.251  -6.820  64.876  1.00 51.24  ? 105  ASN A C   1 
ATOM   329  O O   . ASN A 1 105 ? 11.905  -6.296  65.935  1.00 49.09  ? 105  ASN A O   1 
ATOM   330  C CB  . ASN A 1 105 ? 12.924  -5.258  63.019  1.00 55.42  ? 105  ASN A CB  1 
ATOM   331  C CG  . ASN A 1 105 ? 14.067  -4.576  62.262  1.00 61.82  ? 105  ASN A CG  1 
ATOM   332  O OD1 . ASN A 1 105 ? 15.160  -4.383  62.802  1.00 63.15  ? 105  ASN A OD1 1 
ATOM   333  N ND2 . ASN A 1 105 ? 13.809  -4.197  61.011  1.00 61.05  ? 105  ASN A ND2 1 
ATOM   334  N N   . ASN A 1 106 ? 11.642  -7.892  64.380  1.00 50.90  ? 106  ASN A N   1 
ATOM   335  C CA  . ASN A 1 106 ? 10.526  -8.504  65.091  1.00 51.46  ? 106  ASN A CA  1 
ATOM   336  C C   . ASN A 1 106 ? 11.016  -9.126  66.393  1.00 51.11  ? 106  ASN A C   1 
ATOM   337  O O   . ASN A 1 106 ? 10.319  -9.096  67.406  1.00 50.98  ? 106  ASN A O   1 
ATOM   338  C CB  . ASN A 1 106 ? 9.856   -9.573  64.225  1.00 51.86  ? 106  ASN A CB  1 
ATOM   339  C CG  . ASN A 1 106 ? 9.003   -8.979  63.119  1.00 51.81  ? 106  ASN A CG  1 
ATOM   340  O OD1 . ASN A 1 106 ? 8.585   -9.683  62.202  1.00 54.86  ? 106  ASN A OD1 1 
ATOM   341  N ND2 . ASN A 1 106 ? 8.733   -7.682  63.206  1.00 53.59  ? 106  ASN A ND2 1 
ATOM   342  N N   . ILE A 1 107 ? 12.222  -9.685  66.364  1.00 50.09  ? 107  ILE A N   1 
ATOM   343  C CA  . ILE A 1 107 ? 12.798  -10.310 67.548  1.00 50.00  ? 107  ILE A CA  1 
ATOM   344  C C   . ILE A 1 107 ? 13.169  -9.262  68.590  1.00 50.66  ? 107  ILE A C   1 
ATOM   345  O O   . ILE A 1 107 ? 13.028  -9.491  69.791  1.00 51.37  ? 107  ILE A O   1 
ATOM   346  C CB  . ILE A 1 107 ? 14.043  -11.148 67.180  1.00 49.17  ? 107  ILE A CB  1 
ATOM   347  C CG1 . ILE A 1 107 ? 13.600  -12.417 66.451  1.00 49.41  ? 107  ILE A CG1 1 
ATOM   348  C CG2 . ILE A 1 107 ? 14.839  -11.501 68.429  1.00 50.21  ? 107  ILE A CG2 1 
ATOM   349  C CD1 . ILE A 1 107 ? 14.740  -13.291 65.989  1.00 53.76  ? 107  ILE A CD1 1 
ATOM   350  N N   . ILE A 1 108 ? 13.640  -8.110  68.129  1.00 50.53  ? 108  ILE A N   1 
ATOM   351  C CA  . ILE A 1 108 ? 14.012  -7.036  69.037  1.00 51.31  ? 108  ILE A CA  1 
ATOM   352  C C   . ILE A 1 108 ? 12.758  -6.441  69.666  1.00 51.19  ? 108  ILE A C   1 
ATOM   353  O O   . ILE A 1 108 ? 12.712  -6.195  70.869  1.00 51.11  ? 108  ILE A O   1 
ATOM   354  C CB  . ILE A 1 108 ? 14.762  -5.908  68.304  1.00 51.77  ? 108  ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 108 ? 16.103  -6.427  67.782  1.00 54.62  ? 108  ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 108 ? 14.965  -4.725  69.239  1.00 50.45  ? 108  ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 108 ? 16.904  -5.391  67.009  1.00 56.00  ? 108  ILE A CD1 1 
ATOM   358  N N   . GLN A 1 109 ? 11.742  -6.213  68.841  1.00 51.13  ? 109  GLN A N   1 
ATOM   359  C CA  . GLN A 1 109 ? 10.493  -5.632  69.312  1.00 51.27  ? 109  GLN A CA  1 
ATOM   360  C C   . GLN A 1 109 ? 9.813   -6.558  70.310  1.00 50.20  ? 109  GLN A C   1 
ATOM   361  O O   . GLN A 1 109 ? 9.271   -6.107  71.319  1.00 49.81  ? 109  GLN A O   1 
ATOM   362  C CB  . GLN A 1 109 ? 9.560   -5.358  68.130  1.00 53.39  ? 109  GLN A CB  1 
ATOM   363  C CG  . GLN A 1 109 ? 8.581   -4.227  68.382  1.00 61.64  ? 109  GLN A CG  1 
ATOM   364  C CD  . GLN A 1 109 ? 9.280   -2.961  68.854  1.00 67.03  ? 109  GLN A CD  1 
ATOM   365  O OE1 . GLN A 1 109 ? 10.243  -2.498  68.232  1.00 66.62  ? 109  GLN A OE1 1 
ATOM   366  N NE2 . GLN A 1 109 ? 8.799   -2.394  69.957  1.00 67.48  ? 109  GLN A NE2 1 
ATOM   367  N N   . THR A 1 110 ? 9.844   -7.857  70.029  1.00 49.60  ? 110  THR A N   1 
ATOM   368  C CA  . THR A 1 110 ? 9.239   -8.830  70.925  1.00 50.38  ? 110  THR A CA  1 
ATOM   369  C C   . THR A 1 110 ? 9.979   -8.795  72.258  1.00 50.30  ? 110  THR A C   1 
ATOM   370  O O   . THR A 1 110 ? 9.368   -8.903  73.323  1.00 50.71  ? 110  THR A O   1 
ATOM   371  C CB  . THR A 1 110 ? 9.308   -10.253 70.339  1.00 49.92  ? 110  THR A CB  1 
ATOM   372  O OG1 . THR A 1 110 ? 8.543   -10.307 69.129  1.00 52.35  ? 110  THR A OG1 1 
ATOM   373  C CG2 . THR A 1 110 ? 8.747   -11.266 71.328  1.00 49.74  ? 110  THR A CG2 1 
ATOM   374  N N   . TRP A 1 111 ? 11.297  -8.632  72.192  1.00 49.06  ? 111  TRP A N   1 
ATOM   375  C CA  . TRP A 1 111 ? 12.117  -8.573  73.395  1.00 47.90  ? 111  TRP A CA  1 
ATOM   376  C C   . TRP A 1 111 ? 11.777  -7.323  74.205  1.00 46.99  ? 111  TRP A C   1 
ATOM   377  O O   . TRP A 1 111 ? 11.725  -7.367  75.433  1.00 46.90  ? 111  TRP A O   1 
ATOM   378  C CB  . TRP A 1 111 ? 13.604  -8.553  73.033  1.00 46.84  ? 111  TRP A CB  1 
ATOM   379  C CG  . TRP A 1 111 ? 14.498  -8.694  74.223  1.00 43.12  ? 111  TRP A CG  1 
ATOM   380  C CD1 . TRP A 1 111 ? 14.906  -9.858  74.809  1.00 44.41  ? 111  TRP A CD1 1 
ATOM   381  C CD2 . TRP A 1 111 ? 15.049  -7.633  75.011  1.00 40.86  ? 111  TRP A CD2 1 
ATOM   382  N NE1 . TRP A 1 111 ? 15.679  -9.588  75.913  1.00 43.60  ? 111  TRP A NE1 1 
ATOM   383  C CE2 . TRP A 1 111 ? 15.783  -8.230  76.061  1.00 41.56  ? 111  TRP A CE2 1 
ATOM   384  C CE3 . TRP A 1 111 ? 14.994  -6.234  74.932  1.00 42.01  ? 111  TRP A CE3 1 
ATOM   385  C CZ2 . TRP A 1 111 ? 16.459  -7.477  77.029  1.00 39.81  ? 111  TRP A CZ2 1 
ATOM   386  C CZ3 . TRP A 1 111 ? 15.668  -5.482  75.896  1.00 41.86  ? 111  TRP A CZ3 1 
ATOM   387  C CH2 . TRP A 1 111 ? 16.391  -6.110  76.930  1.00 42.38  ? 111  TRP A CH2 1 
ATOM   388  N N   . ARG A 1 112 ? 11.556  -6.208  73.516  1.00 46.01  ? 112  ARG A N   1 
ATOM   389  C CA  . ARG A 1 112 ? 11.218  -4.959  74.187  1.00 48.05  ? 112  ARG A CA  1 
ATOM   390  C C   . ARG A 1 112 ? 9.923   -5.104  74.977  1.00 50.27  ? 112  ARG A C   1 
ATOM   391  O O   . ARG A 1 112 ? 9.799   -4.585  76.089  1.00 51.45  ? 112  ARG A O   1 
ATOM   392  C CB  . ARG A 1 112 ? 11.076  -3.828  73.170  1.00 46.75  ? 112  ARG A CB  1 
ATOM   393  C CG  . ARG A 1 112 ? 12.390  -3.201  72.758  1.00 47.61  ? 112  ARG A CG  1 
ATOM   394  C CD  . ARG A 1 112 ? 12.191  -2.168  71.661  1.00 46.22  ? 112  ARG A CD  1 
ATOM   395  N NE  . ARG A 1 112 ? 13.410  -1.403  71.430  1.00 49.64  ? 112  ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 112 ? 13.885  -0.479  72.262  1.00 51.17  ? 112  ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 112 ? 13.240  -0.193  73.386  1.00 50.99  ? 112  ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 112 ? 15.015  0.152   71.973  1.00 50.47  ? 112  ARG A NH2 1 
ATOM   399  N N   . GLN A 1 113 ? 8.959   -5.808  74.395  1.00 50.54  ? 113  GLN A N   1 
ATOM   400  C CA  . GLN A 1 113 ? 7.673   -6.032  75.044  1.00 52.73  ? 113  GLN A CA  1 
ATOM   401  C C   . GLN A 1 113 ? 7.810   -6.974  76.232  1.00 51.38  ? 113  GLN A C   1 
ATOM   402  O O   . GLN A 1 113 ? 7.311   -6.699  77.324  1.00 50.79  ? 113  GLN A O   1 
ATOM   403  C CB  . GLN A 1 113 ? 6.677   -6.630  74.045  1.00 56.25  ? 113  GLN A CB  1 
ATOM   404  C CG  . GLN A 1 113 ? 6.040   -5.622  73.113  1.00 63.90  ? 113  GLN A CG  1 
ATOM   405  C CD  . GLN A 1 113 ? 5.146   -4.648  73.858  1.00 70.64  ? 113  GLN A CD  1 
ATOM   406  O OE1 . GLN A 1 113 ? 4.198   -5.054  74.535  1.00 72.60  ? 113  GLN A OE1 1 
ATOM   407  N NE2 . GLN A 1 113 ? 5.445   -3.357  73.740  1.00 70.37  ? 113  GLN A NE2 1 
ATOM   408  N N   . HIS A 1 114 ? 8.499   -8.086  76.004  1.00 50.28  ? 114  HIS A N   1 
ATOM   409  C CA  . HIS A 1 114 ? 8.700   -9.110  77.020  1.00 49.44  ? 114  HIS A CA  1 
ATOM   410  C C   . HIS A 1 114 ? 9.436   -8.644  78.273  1.00 48.01  ? 114  HIS A C   1 
ATOM   411  O O   . HIS A 1 114 ? 9.091   -9.048  79.381  1.00 47.02  ? 114  HIS A O   1 
ATOM   412  C CB  . HIS A 1 114 ? 9.460   -10.288 76.417  1.00 48.80  ? 114  HIS A CB  1 
ATOM   413  C CG  . HIS A 1 114 ? 9.227   -11.584 77.128  1.00 49.94  ? 114  HIS A CG  1 
ATOM   414  N ND1 . HIS A 1 114 ? 8.121   -12.371 76.892  1.00 49.87  ? 114  HIS A ND1 1 
ATOM   415  C CD2 . HIS A 1 114 ? 9.954   -12.227 78.072  1.00 51.15  ? 114  HIS A CD2 1 
ATOM   416  C CE1 . HIS A 1 114 ? 8.177   -13.445 77.659  1.00 50.39  ? 114  HIS A CE1 1 
ATOM   417  N NE2 . HIS A 1 114 ? 9.279   -13.382 78.383  1.00 51.68  ? 114  HIS A NE2 1 
ATOM   418  N N   . PHE A 1 115 ? 10.451  -7.803  78.107  1.00 48.38  ? 115  PHE A N   1 
ATOM   419  C CA  . PHE A 1 115 ? 11.215  -7.344  79.260  1.00 50.30  ? 115  PHE A CA  1 
ATOM   420  C C   . PHE A 1 115 ? 11.078  -5.873  79.625  1.00 52.05  ? 115  PHE A C   1 
ATOM   421  O O   . PHE A 1 115 ? 10.468  -5.544  80.641  1.00 56.21  ? 115  PHE A O   1 
ATOM   422  C CB  . PHE A 1 115 ? 12.692  -7.694  79.081  1.00 49.06  ? 115  PHE A CB  1 
ATOM   423  C CG  . PHE A 1 115 ? 12.951  -9.168  78.983  1.00 48.66  ? 115  PHE A CG  1 
ATOM   424  C CD1 . PHE A 1 115 ? 12.910  -9.816  77.753  1.00 46.83  ? 115  PHE A CD1 1 
ATOM   425  C CD2 . PHE A 1 115 ? 13.199  -9.919  80.129  1.00 48.16  ? 115  PHE A CD2 1 
ATOM   426  C CE1 . PHE A 1 115 ? 13.111  -11.190 77.664  1.00 46.63  ? 115  PHE A CE1 1 
ATOM   427  C CE2 . PHE A 1 115 ? 13.400  -11.294 80.050  1.00 47.32  ? 115  PHE A CE2 1 
ATOM   428  C CZ  . PHE A 1 115 ? 13.355  -11.931 78.814  1.00 45.79  ? 115  PHE A CZ  1 
ATOM   429  N N   . ILE A 1 116 ? 11.649  -4.989  78.813  1.00 51.85  ? 116  ILE A N   1 
ATOM   430  C CA  . ILE A 1 116 ? 11.583  -3.559  79.092  1.00 51.51  ? 116  ILE A CA  1 
ATOM   431  C C   . ILE A 1 116 ? 10.174  -3.084  79.439  1.00 54.24  ? 116  ILE A C   1 
ATOM   432  O O   . ILE A 1 116 ? 9.968   -2.416  80.451  1.00 54.60  ? 116  ILE A O   1 
ATOM   433  C CB  . ILE A 1 116 ? 12.091  -2.729  77.895  1.00 50.08  ? 116  ILE A CB  1 
ATOM   434  C CG1 . ILE A 1 116 ? 13.563  -3.053  77.628  1.00 49.00  ? 116  ILE A CG1 1 
ATOM   435  C CG2 . ILE A 1 116 ? 11.908  -1.238  78.180  1.00 46.65  ? 116  ILE A CG2 1 
ATOM   436  C CD1 . ILE A 1 116 ? 14.160  -2.297  76.458  1.00 42.73  ? 116  ILE A CD1 1 
ATOM   437  N N   . GLN A 1 117 ? 9.208   -3.442  78.602  1.00 57.03  ? 117  GLN A N   1 
ATOM   438  C CA  . GLN A 1 117 ? 7.823   -3.030  78.804  1.00 59.75  ? 117  GLN A CA  1 
ATOM   439  C C   . GLN A 1 117 ? 7.132   -3.781  79.937  1.00 59.33  ? 117  GLN A C   1 
ATOM   440  O O   . GLN A 1 117 ? 6.300   -3.219  80.647  1.00 58.50  ? 117  GLN A O   1 
ATOM   441  C CB  . GLN A 1 117 ? 7.038   -3.229  77.506  1.00 64.08  ? 117  GLN A CB  1 
ATOM   442  C CG  . GLN A 1 117 ? 5.746   -2.445  77.429  1.00 72.07  ? 117  GLN A CG  1 
ATOM   443  C CD  . GLN A 1 117 ? 5.977   -0.952  77.560  1.00 78.04  ? 117  GLN A CD  1 
ATOM   444  O OE1 . GLN A 1 117 ? 6.900   -0.401  76.955  1.00 80.66  ? 117  GLN A OE1 1 
ATOM   445  N NE2 . GLN A 1 117 ? 5.135   -0.286  78.347  1.00 79.86  ? 117  GLN A NE2 1 
ATOM   446  N N   . GLU A 1 118 ? 7.483   -5.051  80.104  1.00 59.77  ? 118  GLU A N   1 
ATOM   447  C CA  . GLU A 1 118 ? 6.884   -5.891  81.136  1.00 60.79  ? 118  GLU A CA  1 
ATOM   448  C C   . GLU A 1 118 ? 7.393   -5.583  82.544  1.00 60.90  ? 118  GLU A C   1 
ATOM   449  O O   . GLU A 1 118 ? 6.648   -5.694  83.518  1.00 60.77  ? 118  GLU A O   1 
ATOM   450  C CB  . GLU A 1 118 ? 7.140   -7.364  80.803  1.00 61.38  ? 118  GLU A CB  1 
ATOM   451  C CG  . GLU A 1 118 ? 6.491   -8.366  81.744  1.00 64.31  ? 118  GLU A CG  1 
ATOM   452  C CD  . GLU A 1 118 ? 4.978   -8.247  81.786  1.00 67.03  ? 118  GLU A CD  1 
ATOM   453  O OE1 . GLU A 1 118 ? 4.351   -8.157  80.708  1.00 66.54  ? 118  GLU A OE1 1 
ATOM   454  O OE2 . GLU A 1 118 ? 4.415   -8.255  82.902  1.00 68.53  ? 118  GLU A OE2 1 
ATOM   455  N N   . GLU A 1 119 ? 8.658   -5.192  82.652  1.00 59.73  ? 119  GLU A N   1 
ATOM   456  C CA  . GLU A 1 119 ? 9.245   -4.894  83.952  1.00 59.64  ? 119  GLU A CA  1 
ATOM   457  C C   . GLU A 1 119 ? 9.502   -3.403  84.138  1.00 60.68  ? 119  GLU A C   1 
ATOM   458  O O   . GLU A 1 119 ? 10.066  -2.989  85.151  1.00 62.97  ? 119  GLU A O   1 
ATOM   459  C CB  . GLU A 1 119 ? 10.562  -5.663  84.119  1.00 59.84  ? 119  GLU A CB  1 
ATOM   460  C CG  . GLU A 1 119 ? 10.501  -7.111  83.652  1.00 58.65  ? 119  GLU A CG  1 
ATOM   461  C CD  . GLU A 1 119 ? 9.499   -7.944  84.428  1.00 58.98  ? 119  GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 119 ? 9.094   -9.008  83.916  1.00 58.04  ? 119  GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 119 ? 9.124   -7.544  85.551  1.00 60.18  ? 119  GLU A OE2 1 
ATOM   464  N N   . GLN A 1 120 ? 9.089   -2.596  83.165  1.00 60.74  ? 120  GLN A N   1 
ATOM   465  C CA  . GLN A 1 120 ? 9.294   -1.152  83.240  1.00 60.38  ? 120  GLN A CA  1 
ATOM   466  C C   . GLN A 1 120 ? 10.774  -0.839  83.436  1.00 58.43  ? 120  GLN A C   1 
ATOM   467  O O   . GLN A 1 120 ? 11.150  -0.096  84.344  1.00 58.75  ? 120  GLN A O   1 
ATOM   468  C CB  . GLN A 1 120 ? 8.483   -0.559  84.396  1.00 62.78  ? 120  GLN A CB  1 
ATOM   469  C CG  . GLN A 1 120 ? 6.982   -0.667  84.206  1.00 69.62  ? 120  GLN A CG  1 
ATOM   470  C CD  . GLN A 1 120 ? 6.503   0.080   82.973  1.00 74.50  ? 120  GLN A CD  1 
ATOM   471  O OE1 . GLN A 1 120 ? 6.649   1.300   82.876  1.00 77.82  ? 120  GLN A OE1 1 
ATOM   472  N NE2 . GLN A 1 120 ? 5.933   -0.652  82.020  1.00 74.86  ? 120  GLN A NE2 1 
ATOM   473  N N   . ILE A 1 121 ? 11.607  -1.411  82.573  1.00 55.90  ? 121  ILE A N   1 
ATOM   474  C CA  . ILE A 1 121 ? 13.049  -1.214  82.644  1.00 53.50  ? 121  ILE A CA  1 
ATOM   475  C C   . ILE A 1 121 ? 13.464  0.128   82.052  1.00 53.97  ? 121  ILE A C   1 
ATOM   476  O O   . ILE A 1 121 ? 12.917  0.565   81.039  1.00 56.06  ? 121  ILE A O   1 
ATOM   477  C CB  . ILE A 1 121 ? 13.801  -2.334  81.885  1.00 51.14  ? 121  ILE A CB  1 
ATOM   478  C CG1 . ILE A 1 121 ? 13.346  -3.705  82.393  1.00 49.88  ? 121  ILE A CG1 1 
ATOM   479  C CG2 . ILE A 1 121 ? 15.302  -2.170  82.070  1.00 46.85  ? 121  ILE A CG2 1 
ATOM   480  C CD1 . ILE A 1 121 ? 14.015  -4.880  81.700  1.00 50.72  ? 121  ILE A CD1 1 
ATOM   481  N N   . LEU A 1 122 ? 14.428  0.779   82.694  1.00 52.69  ? 122  LEU A N   1 
ATOM   482  C CA  . LEU A 1 122 ? 14.934  2.061   82.219  1.00 52.82  ? 122  LEU A CA  1 
ATOM   483  C C   . LEU A 1 122 ? 15.896  1.800   81.066  1.00 53.43  ? 122  LEU A C   1 
ATOM   484  O O   . LEU A 1 122 ? 16.812  0.988   81.187  1.00 52.95  ? 122  LEU A O   1 
ATOM   485  C CB  . LEU A 1 122 ? 15.667  2.791   83.344  1.00 52.34  ? 122  LEU A CB  1 
ATOM   486  C CG  . LEU A 1 122 ? 14.810  3.171   84.553  1.00 55.36  ? 122  LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 122 ? 15.698  3.637   85.694  1.00 54.54  ? 122  LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 122 ? 13.822  4.254   84.150  1.00 55.44  ? 122  LEU A CD2 1 
ATOM   489  N N   . GLU A 1 123 ? 15.689  2.484   79.949  1.00 53.28  ? 123  GLU A N   1 
ATOM   490  C CA  . GLU A 1 123 ? 16.549  2.296   78.791  1.00 53.91  ? 123  GLU A CA  1 
ATOM   491  C C   . GLU A 1 123 ? 17.542  3.434   78.591  1.00 53.18  ? 123  GLU A C   1 
ATOM   492  O O   . GLU A 1 123 ? 17.225  4.604   78.811  1.00 52.61  ? 123  GLU A O   1 
ATOM   493  C CB  . GLU A 1 123 ? 15.704  2.137   77.526  1.00 55.43  ? 123  GLU A CB  1 
ATOM   494  C CG  . GLU A 1 123 ? 16.528  2.002   76.257  1.00 58.54  ? 123  GLU A CG  1 
ATOM   495  C CD  . GLU A 1 123 ? 15.674  1.939   75.008  1.00 60.00  ? 123  GLU A CD  1 
ATOM   496  O OE1 . GLU A 1 123 ? 16.248  1.838   73.903  1.00 62.87  ? 123  GLU A OE1 1 
ATOM   497  O OE2 . GLU A 1 123 ? 14.432  1.991   75.129  1.00 58.95  ? 123  GLU A OE2 1 
ATOM   498  N N   . ILE A 1 124 ? 18.752  3.072   78.181  1.00 50.90  ? 124  ILE A N   1 
ATOM   499  C CA  . ILE A 1 124 ? 19.802  4.044   77.914  1.00 51.78  ? 124  ILE A CA  1 
ATOM   500  C C   . ILE A 1 124 ? 20.594  3.538   76.716  1.00 51.38  ? 124  ILE A C   1 
ATOM   501  O O   . ILE A 1 124 ? 20.517  2.359   76.372  1.00 52.01  ? 124  ILE A O   1 
ATOM   502  C CB  . ILE A 1 124 ? 20.751  4.218   79.121  1.00 52.23  ? 124  ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 124 ? 21.438  2.894   79.454  1.00 52.80  ? 124  ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 124 ? 19.972  4.723   80.320  1.00 53.53  ? 124  ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 124 ? 22.436  3.004   80.582  1.00 52.74  ? 124  ILE A CD1 1 
ATOM   506  N N   . ASP A 1 125 ? 21.342  4.428   76.076  1.00 49.73  ? 125  ASP A N   1 
ATOM   507  C CA  . ASP A 1 125 ? 22.135  4.052   74.914  1.00 49.99  ? 125  ASP A CA  1 
ATOM   508  C C   . ASP A 1 125 ? 23.541  4.622   75.056  1.00 49.49  ? 125  ASP A C   1 
ATOM   509  O O   . ASP A 1 125 ? 23.786  5.789   74.754  1.00 51.02  ? 125  ASP A O   1 
ATOM   510  C CB  . ASP A 1 125 ? 21.460  4.575   73.639  1.00 50.90  ? 125  ASP A CB  1 
ATOM   511  C CG  . ASP A 1 125 ? 22.119  4.065   72.367  1.00 52.79  ? 125  ASP A CG  1 
ATOM   512  O OD1 . ASP A 1 125 ? 22.336  2.839   72.250  1.00 55.98  ? 125  ASP A OD1 1 
ATOM   513  O OD2 . ASP A 1 125 ? 22.409  4.889   71.474  1.00 55.59  ? 125  ASP A OD2 1 
ATOM   514  N N   . CYS A 1 126 ? 24.464  3.791   75.528  1.00 49.07  ? 126  CYS A N   1 
ATOM   515  C CA  . CYS A 1 126 ? 25.844  4.215   75.721  1.00 49.64  ? 126  CYS A CA  1 
ATOM   516  C C   . CYS A 1 126 ? 26.708  3.990   74.490  1.00 50.36  ? 126  CYS A C   1 
ATOM   517  O O   . CYS A 1 126 ? 26.334  3.252   73.579  1.00 53.32  ? 126  CYS A O   1 
ATOM   518  C CB  . CYS A 1 126 ? 26.453  3.489   76.918  1.00 48.48  ? 126  CYS A CB  1 
ATOM   519  S SG  . CYS A 1 126 ? 25.587  3.826   78.458  1.00 49.94  ? 126  CYS A SG  1 
ATOM   520  N N   . THR A 1 127 ? 27.871  4.630   74.479  1.00 50.93  ? 127  THR A N   1 
ATOM   521  C CA  . THR A 1 127 ? 28.805  4.533   73.364  1.00 50.01  ? 127  THR A CA  1 
ATOM   522  C C   . THR A 1 127 ? 29.500  3.175   73.262  1.00 48.83  ? 127  THR A C   1 
ATOM   523  O O   . THR A 1 127 ? 29.574  2.421   74.233  1.00 46.88  ? 127  THR A O   1 
ATOM   524  C CB  . THR A 1 127 ? 29.887  5.625   73.467  1.00 51.17  ? 127  THR A CB  1 
ATOM   525  O OG1 . THR A 1 127 ? 30.622  5.460   74.688  1.00 50.42  ? 127  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 127 ? 29.248  7.006   73.450  1.00 49.80  ? 127  THR A CG2 1 
ATOM   527  N N   . MET A 1 128 ? 30.003  2.874   72.069  1.00 47.62  ? 128  MET A N   1 
ATOM   528  C CA  . MET A 1 128 ? 30.710  1.626   71.819  1.00 48.00  ? 128  MET A CA  1 
ATOM   529  C C   . MET A 1 128 ? 32.197  1.845   72.086  1.00 48.89  ? 128  MET A C   1 
ATOM   530  O O   . MET A 1 128 ? 32.875  0.980   72.642  1.00 48.03  ? 128  MET A O   1 
ATOM   531  C CB  . MET A 1 128 ? 30.465  1.168   70.378  1.00 46.84  ? 128  MET A CB  1 
ATOM   532  C CG  . MET A 1 128 ? 29.024  0.718   70.141  1.00 48.53  ? 128  MET A CG  1 
ATOM   533  S SD  . MET A 1 128 ? 28.593  0.421   68.414  1.00 48.02  ? 128  MET A SD  1 
ATOM   534  C CE  . MET A 1 128 ? 28.194  2.089   67.890  1.00 47.57  ? 128  MET A CE  1 
ATOM   535  N N   . LEU A 1 129 ? 32.699  3.010   71.690  1.00 49.47  ? 129  LEU A N   1 
ATOM   536  C CA  . LEU A 1 129 ? 34.094  3.352   71.932  1.00 50.62  ? 129  LEU A CA  1 
ATOM   537  C C   . LEU A 1 129 ? 34.250  3.487   73.444  1.00 50.53  ? 129  LEU A C   1 
ATOM   538  O O   . LEU A 1 129 ? 33.402  4.083   74.109  1.00 50.41  ? 129  LEU A O   1 
ATOM   539  C CB  . LEU A 1 129 ? 34.443  4.677   71.249  1.00 48.99  ? 129  LEU A CB  1 
ATOM   540  C CG  . LEU A 1 129 ? 34.506  4.645   69.721  1.00 50.85  ? 129  LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 129 ? 34.579  6.059   69.166  1.00 48.78  ? 129  LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 129 ? 35.712  3.830   69.287  1.00 47.50  ? 129  LEU A CD2 1 
ATOM   543  N N   . THR A 1 130 ? 35.324  2.928   73.988  1.00 51.36  ? 130  THR A N   1 
ATOM   544  C CA  . THR A 1 130 ? 35.559  2.988   75.427  1.00 52.14  ? 130  THR A CA  1 
ATOM   545  C C   . THR A 1 130 ? 37.023  3.266   75.740  1.00 52.74  ? 130  THR A C   1 
ATOM   546  O O   . THR A 1 130 ? 37.913  2.577   75.241  1.00 52.45  ? 130  THR A O   1 
ATOM   547  C CB  . THR A 1 130 ? 35.160  1.661   76.107  1.00 50.88  ? 130  THR A CB  1 
ATOM   548  O OG1 . THR A 1 130 ? 33.791  1.361   75.807  1.00 49.97  ? 130  THR A OG1 1 
ATOM   549  C CG2 . THR A 1 130 ? 35.331  1.760   77.618  1.00 51.82  ? 130  THR A CG2 1 
ATOM   550  N N   . PRO A 1 131 ? 37.296  4.290   76.564  1.00 53.93  ? 131  PRO A N   1 
ATOM   551  C CA  . PRO A 1 131 ? 38.687  4.597   76.904  1.00 55.10  ? 131  PRO A CA  1 
ATOM   552  C C   . PRO A 1 131 ? 39.267  3.449   77.729  1.00 56.93  ? 131  PRO A C   1 
ATOM   553  O O   . PRO A 1 131 ? 38.590  2.898   78.602  1.00 54.05  ? 131  PRO A O   1 
ATOM   554  C CB  . PRO A 1 131 ? 38.570  5.901   77.689  1.00 55.54  ? 131  PRO A CB  1 
ATOM   555  C CG  . PRO A 1 131 ? 37.237  5.767   78.354  1.00 56.26  ? 131  PRO A CG  1 
ATOM   556  C CD  . PRO A 1 131 ? 36.371  5.212   77.246  1.00 54.92  ? 131  PRO A CD  1 
ATOM   557  N N   . GLU A 1 132 ? 40.516  3.092   77.438  1.00 58.07  ? 132  GLU A N   1 
ATOM   558  C CA  . GLU A 1 132 ? 41.198  1.991   78.116  1.00 61.24  ? 132  GLU A CA  1 
ATOM   559  C C   . GLU A 1 132 ? 41.014  1.906   79.637  1.00 59.79  ? 132  GLU A C   1 
ATOM   560  O O   . GLU A 1 132 ? 40.724  0.833   80.171  1.00 58.54  ? 132  GLU A O   1 
ATOM   561  C CB  . GLU A 1 132 ? 42.692  2.025   77.770  1.00 65.46  ? 132  GLU A CB  1 
ATOM   562  C CG  . GLU A 1 132 ? 43.506  0.904   78.393  1.00 73.63  ? 132  GLU A CG  1 
ATOM   563  C CD  . GLU A 1 132 ? 44.856  0.726   77.721  1.00 79.78  ? 132  GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 132 ? 45.595  1.727   77.593  1.00 82.41  ? 132  GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 132 ? 45.179  -0.416  77.322  1.00 81.37  ? 132  GLU A OE2 1 
ATOM   566  N N   . PRO A 1 133 ? 41.178  3.029   80.355  1.00 59.50  ? 133  PRO A N   1 
ATOM   567  C CA  . PRO A 1 133 ? 41.016  3.011   81.814  1.00 59.74  ? 133  PRO A CA  1 
ATOM   568  C C   . PRO A 1 133 ? 39.728  2.350   82.311  1.00 60.82  ? 133  PRO A C   1 
ATOM   569  O O   . PRO A 1 133 ? 39.735  1.649   83.324  1.00 61.64  ? 133  PRO A O   1 
ATOM   570  C CB  . PRO A 1 133 ? 41.093  4.488   82.180  1.00 59.67  ? 133  PRO A CB  1 
ATOM   571  C CG  . PRO A 1 133 ? 42.082  5.010   81.180  1.00 58.99  ? 133  PRO A CG  1 
ATOM   572  C CD  . PRO A 1 133 ? 41.601  4.365   79.896  1.00 58.42  ? 133  PRO A CD  1 
ATOM   573  N N   . VAL A 1 134 ? 38.628  2.572   81.597  1.00 61.20  ? 134  VAL A N   1 
ATOM   574  C CA  . VAL A 1 134 ? 37.340  2.000   81.978  1.00 61.03  ? 134  VAL A CA  1 
ATOM   575  C C   . VAL A 1 134 ? 37.347  0.474   81.954  1.00 61.98  ? 134  VAL A C   1 
ATOM   576  O O   . VAL A 1 134 ? 36.927  -0.174  82.915  1.00 62.54  ? 134  VAL A O   1 
ATOM   577  C CB  . VAL A 1 134 ? 36.208  2.489   81.045  1.00 60.97  ? 134  VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 134 ? 34.897  1.808   81.415  1.00 58.87  ? 134  VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 134 ? 36.066  3.998   81.147  1.00 60.73  ? 134  VAL A CG2 1 
ATOM   580  N N   . LEU A 1 135 ? 37.817  -0.097  80.851  1.00 61.20  ? 135  LEU A N   1 
ATOM   581  C CA  . LEU A 1 135 ? 37.856  -1.545  80.714  1.00 60.66  ? 135  LEU A CA  1 
ATOM   582  C C   . LEU A 1 135 ? 38.963  -2.184  81.541  1.00 61.66  ? 135  LEU A C   1 
ATOM   583  O O   . LEU A 1 135 ? 38.933  -3.386  81.813  1.00 61.14  ? 135  LEU A O   1 
ATOM   584  C CB  . LEU A 1 135 ? 37.989  -1.918  79.238  1.00 60.44  ? 135  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 135 ? 36.690  -1.638  78.478  1.00 59.16  ? 135  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 135 ? 36.895  -1.806  76.985  1.00 60.82  ? 135  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 135 ? 35.608  -2.579  78.992  1.00 57.95  ? 135  LEU A CD2 1 
ATOM   588  N N   . LYS A 1 136 ? 39.940  -1.377  81.944  1.00 62.19  ? 136  LYS A N   1 
ATOM   589  C CA  . LYS A 1 136 ? 41.032  -1.873  82.770  1.00 63.22  ? 136  LYS A CA  1 
ATOM   590  C C   . LYS A 1 136 ? 40.485  -2.075  84.182  1.00 64.68  ? 136  LYS A C   1 
ATOM   591  O O   . LYS A 1 136 ? 40.834  -3.038  84.867  1.00 66.09  ? 136  LYS A O   1 
ATOM   592  C CB  . LYS A 1 136 ? 42.187  -0.866  82.789  1.00 62.29  ? 136  LYS A CB  1 
ATOM   593  C CG  . LYS A 1 136 ? 43.330  -1.237  83.724  1.00 62.53  ? 136  LYS A CG  1 
ATOM   594  C CD  . LYS A 1 136 ? 43.942  -2.586  83.376  1.00 62.84  ? 136  LYS A CD  1 
ATOM   595  C CE  . LYS A 1 136 ? 45.072  -2.939  84.335  1.00 65.02  ? 136  LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 136 ? 45.671  -4.275  84.053  1.00 64.92  ? 136  LYS A NZ  1 
ATOM   597  N N   . THR A 1 137 ? 39.612  -1.163  84.602  1.00 64.73  ? 137  THR A N   1 
ATOM   598  C CA  . THR A 1 137 ? 38.997  -1.225  85.922  1.00 64.52  ? 137  THR A CA  1 
ATOM   599  C C   . THR A 1 137 ? 38.024  -2.396  86.018  1.00 66.82  ? 137  THR A C   1 
ATOM   600  O O   . THR A 1 137 ? 38.031  -3.134  87.002  1.00 68.64  ? 137  THR A O   1 
ATOM   601  C CB  . THR A 1 137 ? 38.224  0.074   86.239  1.00 64.39  ? 137  THR A CB  1 
ATOM   602  O OG1 . THR A 1 137 ? 39.119  1.192   86.179  1.00 62.42  ? 137  THR A OG1 1 
ATOM   603  C CG2 . THR A 1 137 ? 37.596  -0.003  87.624  1.00 62.32  ? 137  THR A CG2 1 
ATOM   604  N N   . SER A 1 138 ? 37.187  -2.561  84.994  1.00 67.97  ? 138  SER A N   1 
ATOM   605  C CA  . SER A 1 138 ? 36.203  -3.641  84.972  1.00 67.79  ? 138  SER A CA  1 
ATOM   606  C C   . SER A 1 138 ? 36.869  -5.014  84.978  1.00 68.78  ? 138  SER A C   1 
ATOM   607  O O   . SER A 1 138 ? 36.227  -6.022  85.276  1.00 68.60  ? 138  SER A O   1 
ATOM   608  C CB  . SER A 1 138 ? 35.297  -3.518  83.743  1.00 66.82  ? 138  SER A CB  1 
ATOM   609  O OG  . SER A 1 138 ? 36.015  -3.753  82.545  1.00 66.60  ? 138  SER A OG  1 
ATOM   610  N N   . GLY A 1 139 ? 38.155  -5.046  84.638  1.00 69.42  ? 139  GLY A N   1 
ATOM   611  C CA  . GLY A 1 139 ? 38.888  -6.298  84.624  1.00 69.91  ? 139  GLY A CA  1 
ATOM   612  C C   . GLY A 1 139 ? 38.905  -7.021  83.290  1.00 70.53  ? 139  GLY A C   1 
ATOM   613  O O   . GLY A 1 139 ? 39.421  -8.134  83.197  1.00 70.33  ? 139  GLY A O   1 
ATOM   614  N N   . HIS A 1 140 ? 38.348  -6.401  82.255  1.00 70.43  ? 140  HIS A N   1 
ATOM   615  C CA  . HIS A 1 140 ? 38.318  -7.026  80.938  1.00 70.41  ? 140  HIS A CA  1 
ATOM   616  C C   . HIS A 1 140 ? 39.694  -7.066  80.284  1.00 70.33  ? 140  HIS A C   1 
ATOM   617  O O   . HIS A 1 140 ? 40.045  -8.038  79.613  1.00 71.73  ? 140  HIS A O   1 
ATOM   618  C CB  . HIS A 1 140 ? 37.324  -6.303  80.022  1.00 69.63  ? 140  HIS A CB  1 
ATOM   619  C CG  . HIS A 1 140 ? 35.892  -6.630  80.314  1.00 69.93  ? 140  HIS A CG  1 
ATOM   620  N ND1 . HIS A 1 140 ? 35.273  -6.277  81.493  1.00 70.45  ? 140  HIS A ND1 1 
ATOM   621  C CD2 . HIS A 1 140 ? 34.972  -7.317  79.597  1.00 69.67  ? 140  HIS A CD2 1 
ATOM   622  C CE1 . HIS A 1 140 ? 34.034  -6.735  81.492  1.00 68.89  ? 140  HIS A CE1 1 
ATOM   623  N NE2 . HIS A 1 140 ? 33.826  -7.370  80.352  1.00 68.00  ? 140  HIS A NE2 1 
ATOM   624  N N   . VAL A 1 141 ? 40.476  -6.013  80.488  1.00 69.38  ? 141  VAL A N   1 
ATOM   625  C CA  . VAL A 1 141 ? 41.810  -5.942  79.910  1.00 68.85  ? 141  VAL A CA  1 
ATOM   626  C C   . VAL A 1 141 ? 42.688  -7.099  80.382  1.00 69.12  ? 141  VAL A C   1 
ATOM   627  O O   . VAL A 1 141 ? 43.663  -7.458  79.723  1.00 69.60  ? 141  VAL A O   1 
ATOM   628  C CB  . VAL A 1 141 ? 42.505  -4.612  80.277  1.00 67.43  ? 141  VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 141 ? 43.919  -4.593  79.726  1.00 67.02  ? 141  VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 141 ? 41.710  -3.440  79.723  1.00 65.43  ? 141  VAL A CG2 1 
ATOM   631  N N   . ASP A 1 142 ? 42.327  -7.695  81.514  1.00 70.00  ? 142  ASP A N   1 
ATOM   632  C CA  . ASP A 1 142 ? 43.110  -8.790  82.072  1.00 70.41  ? 142  ASP A CA  1 
ATOM   633  C C   . ASP A 1 142 ? 42.499  -10.184 81.976  1.00 69.96  ? 142  ASP A C   1 
ATOM   634  O O   . ASP A 1 142 ? 43.225  -11.163 81.804  1.00 70.27  ? 142  ASP A O   1 
ATOM   635  C CB  . ASP A 1 142 ? 43.435  -8.492  83.538  1.00 72.23  ? 142  ASP A CB  1 
ATOM   636  C CG  . ASP A 1 142 ? 44.370  -7.312  83.701  1.00 73.52  ? 142  ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 142 ? 44.567  -6.866  84.852  1.00 75.86  ? 142  ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 142 ? 44.912  -6.834  82.681  1.00 74.74  ? 142  ASP A OD2 1 
ATOM   639  N N   . LYS A 1 143 ? 41.177  -10.289 82.084  1.00 69.63  ? 143  LYS A N   1 
ATOM   640  C CA  . LYS A 1 143 ? 40.538  -11.602 82.040  1.00 69.34  ? 143  LYS A CA  1 
ATOM   641  C C   . LYS A 1 143 ? 39.657  -11.906 80.828  1.00 68.28  ? 143  LYS A C   1 
ATOM   642  O O   . LYS A 1 143 ? 39.308  -13.066 80.597  1.00 69.27  ? 143  LYS A O   1 
ATOM   643  C CB  . LYS A 1 143 ? 39.716  -11.829 83.314  1.00 71.24  ? 143  LYS A CB  1 
ATOM   644  C CG  . LYS A 1 143 ? 40.471  -11.626 84.624  1.00 73.21  ? 143  LYS A CG  1 
ATOM   645  C CD  . LYS A 1 143 ? 40.564  -10.150 84.988  1.00 77.80  ? 143  LYS A CD  1 
ATOM   646  C CE  . LYS A 1 143 ? 41.139  -9.944  86.384  1.00 80.39  ? 143  LYS A CE  1 
ATOM   647  N NZ  . LYS A 1 143 ? 41.169  -8.500  86.766  1.00 80.58  ? 143  LYS A NZ  1 
ATOM   648  N N   . PHE A 1 144 ? 39.290  -10.888 80.057  1.00 66.42  ? 144  PHE A N   1 
ATOM   649  C CA  . PHE A 1 144 ? 38.439  -11.116 78.890  1.00 64.01  ? 144  PHE A CA  1 
ATOM   650  C C   . PHE A 1 144 ? 39.245  -11.660 77.717  1.00 62.61  ? 144  PHE A C   1 
ATOM   651  O O   . PHE A 1 144 ? 39.776  -10.898 76.905  1.00 62.73  ? 144  PHE A O   1 
ATOM   652  C CB  . PHE A 1 144 ? 37.740  -9.820  78.469  1.00 63.80  ? 144  PHE A CB  1 
ATOM   653  C CG  . PHE A 1 144 ? 36.637  -10.027 77.469  1.00 62.19  ? 144  PHE A CG  1 
ATOM   654  C CD1 . PHE A 1 144 ? 35.477  -10.711 77.827  1.00 61.02  ? 144  PHE A CD1 1 
ATOM   655  C CD2 . PHE A 1 144 ? 36.757  -9.547  76.170  1.00 61.08  ? 144  PHE A CD2 1 
ATOM   656  C CE1 . PHE A 1 144 ? 34.451  -10.911 76.905  1.00 60.30  ? 144  PHE A CE1 1 
ATOM   657  C CE2 . PHE A 1 144 ? 35.738  -9.743  75.241  1.00 61.57  ? 144  PHE A CE2 1 
ATOM   658  C CZ  . PHE A 1 144 ? 34.582  -10.426 75.610  1.00 60.33  ? 144  PHE A CZ  1 
ATOM   659  N N   . ALA A 1 145 ? 39.331  -12.983 77.628  1.00 59.89  ? 145  ALA A N   1 
ATOM   660  C CA  . ALA A 1 145 ? 40.083  -13.612 76.555  1.00 58.84  ? 145  ALA A CA  1 
ATOM   661  C C   . ALA A 1 145 ? 39.823  -15.108 76.450  1.00 57.92  ? 145  ALA A C   1 
ATOM   662  O O   . ALA A 1 145 ? 39.230  -15.719 77.340  1.00 56.90  ? 145  ALA A O   1 
ATOM   663  C CB  . ALA A 1 145 ? 41.573  -13.364 76.760  1.00 56.25  ? 145  ALA A CB  1 
ATOM   664  N N   . ASP A 1 146 ? 40.268  -15.684 75.339  1.00 58.50  ? 146  ASP A N   1 
ATOM   665  C CA  . ASP A 1 146 ? 40.137  -17.112 75.084  1.00 59.01  ? 146  ASP A CA  1 
ATOM   666  C C   . ASP A 1 146 ? 41.544  -17.650 74.896  1.00 58.76  ? 146  ASP A C   1 
ATOM   667  O O   . ASP A 1 146 ? 42.439  -16.924 74.465  1.00 58.56  ? 146  ASP A O   1 
ATOM   668  C CB  . ASP A 1 146 ? 39.337  -17.370 73.804  1.00 59.46  ? 146  ASP A CB  1 
ATOM   669  C CG  . ASP A 1 146 ? 37.860  -17.092 73.968  1.00 61.56  ? 146  ASP A CG  1 
ATOM   670  O OD1 . ASP A 1 146 ? 37.121  -17.226 72.968  1.00 62.07  ? 146  ASP A OD1 1 
ATOM   671  O OD2 . ASP A 1 146 ? 37.437  -16.745 75.092  1.00 61.92  ? 146  ASP A OD2 1 
ATOM   672  N N   . PHE A 1 147 ? 41.745  -18.919 75.223  1.00 59.39  ? 147  PHE A N   1 
ATOM   673  C CA  . PHE A 1 147 ? 43.057  -19.516 75.052  1.00 58.93  ? 147  PHE A CA  1 
ATOM   674  C C   . PHE A 1 147 ? 43.240  -19.830 73.578  1.00 61.34  ? 147  PHE A C   1 
ATOM   675  O O   . PHE A 1 147 ? 42.357  -20.398 72.932  1.00 61.30  ? 147  PHE A O   1 
ATOM   676  C CB  . PHE A 1 147 ? 43.183  -20.765 75.917  1.00 57.09  ? 147  PHE A CB  1 
ATOM   677  C CG  . PHE A 1 147 ? 43.269  -20.462 77.386  1.00 56.23  ? 147  PHE A CG  1 
ATOM   678  C CD1 . PHE A 1 147 ? 42.341  -20.988 78.278  1.00 53.12  ? 147  PHE A CD1 1 
ATOM   679  C CD2 . PHE A 1 147 ? 44.275  -19.630 77.876  1.00 54.50  ? 147  PHE A CD2 1 
ATOM   680  C CE1 . PHE A 1 147 ? 42.412  -20.689 79.639  1.00 54.22  ? 147  PHE A CE1 1 
ATOM   681  C CE2 . PHE A 1 147 ? 44.355  -19.326 79.233  1.00 53.95  ? 147  PHE A CE2 1 
ATOM   682  C CZ  . PHE A 1 147 ? 43.421  -19.856 80.116  1.00 52.80  ? 147  PHE A CZ  1 
ATOM   683  N N   . MET A 1 148 ? 44.392  -19.437 73.049  1.00 63.43  ? 148  MET A N   1 
ATOM   684  C CA  . MET A 1 148 ? 44.699  -19.623 71.642  1.00 65.45  ? 148  MET A CA  1 
ATOM   685  C C   . MET A 1 148 ? 45.968  -20.431 71.392  1.00 68.09  ? 148  MET A C   1 
ATOM   686  O O   . MET A 1 148 ? 46.923  -20.370 72.167  1.00 67.33  ? 148  MET A O   1 
ATOM   687  C CB  . MET A 1 148 ? 44.822  -18.247 70.989  1.00 64.02  ? 148  MET A CB  1 
ATOM   688  C CG  . MET A 1 148 ? 45.276  -18.249 69.550  1.00 65.47  ? 148  MET A CG  1 
ATOM   689  S SD  . MET A 1 148 ? 45.307  -16.567 68.908  1.00 69.03  ? 148  MET A SD  1 
ATOM   690  C CE  . MET A 1 148 ? 46.728  -15.891 69.783  1.00 68.63  ? 148  MET A CE  1 
ATOM   691  N N   . VAL A 1 149 ? 45.959  -21.192 70.302  1.00 70.97  ? 149  VAL A N   1 
ATOM   692  C CA  . VAL A 1 149 ? 47.106  -21.998 69.905  1.00 74.52  ? 149  VAL A CA  1 
ATOM   693  C C   . VAL A 1 149 ? 47.371  -21.737 68.426  1.00 77.91  ? 149  VAL A C   1 
ATOM   694  O O   . VAL A 1 149 ? 46.538  -21.155 67.730  1.00 78.06  ? 149  VAL A O   1 
ATOM   695  C CB  . VAL A 1 149 ? 46.853  -23.513 70.107  1.00 73.24  ? 149  VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 149 ? 46.592  -23.809 71.576  1.00 72.80  ? 149  VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 149 ? 45.687  -23.968 69.249  1.00 73.49  ? 149  VAL A CG2 1 
ATOM   698  N N   . LYS A 1 150 ? 48.534  -22.163 67.949  1.00 81.58  ? 150  LYS A N   1 
ATOM   699  C CA  . LYS A 1 150 ? 48.895  -21.969 66.553  1.00 84.43  ? 150  LYS A CA  1 
ATOM   700  C C   . LYS A 1 150 ? 50.041  -22.890 66.167  1.00 86.74  ? 150  LYS A C   1 
ATOM   701  O O   . LYS A 1 150 ? 50.996  -23.057 66.927  1.00 87.38  ? 150  LYS A O   1 
ATOM   702  C CB  . LYS A 1 150 ? 49.276  -20.507 66.311  1.00 84.65  ? 150  LYS A CB  1 
ATOM   703  C CG  . LYS A 1 150 ? 50.176  -19.911 67.376  1.00 84.39  ? 150  LYS A CG  1 
ATOM   704  C CD  . LYS A 1 150 ? 50.322  -18.412 67.181  1.00 84.79  ? 150  LYS A CD  1 
ATOM   705  C CE  . LYS A 1 150 ? 51.121  -17.785 68.310  1.00 85.65  ? 150  LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 150 ? 51.217  -16.308 68.156  1.00 88.00  ? 150  LYS A NZ  1 
ATOM   707  N N   . ASP A 1 151 ? 49.938  -23.494 64.988  1.00 88.90  ? 151  ASP A N   1 
ATOM   708  C CA  . ASP A 1 151 ? 50.974  -24.407 64.525  1.00 91.65  ? 151  ASP A CA  1 
ATOM   709  C C   . ASP A 1 151 ? 52.277  -23.662 64.265  1.00 92.31  ? 151  ASP A C   1 
ATOM   710  O O   . ASP A 1 151 ? 52.286  -22.596 63.647  1.00 91.42  ? 151  ASP A O   1 
ATOM   711  C CB  . ASP A 1 151 ? 50.514  -25.144 63.262  1.00 92.36  ? 151  ASP A CB  1 
ATOM   712  C CG  . ASP A 1 151 ? 50.286  -24.217 62.091  1.00 92.71  ? 151  ASP A CG  1 
ATOM   713  O OD1 . ASP A 1 151 ? 49.523  -23.239 62.244  1.00 93.63  ? 151  ASP A OD1 1 
ATOM   714  O OD2 . ASP A 1 151 ? 50.865  -24.475 61.015  1.00 92.01  ? 151  ASP A OD2 1 
ATOM   715  N N   . VAL A 1 152 ? 53.373  -24.236 64.754  1.00 93.25  ? 152  VAL A N   1 
ATOM   716  C CA  . VAL A 1 152 ? 54.700  -23.647 64.617  1.00 94.00  ? 152  VAL A CA  1 
ATOM   717  C C   . VAL A 1 152 ? 55.061  -23.322 63.173  1.00 94.72  ? 152  VAL A C   1 
ATOM   718  O O   . VAL A 1 152 ? 55.872  -22.433 62.916  1.00 94.44  ? 152  VAL A O   1 
ATOM   719  C CB  . VAL A 1 152 ? 55.779  -24.586 65.204  1.00 94.73  ? 152  VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 152 ? 57.135  -23.892 65.211  1.00 95.82  ? 152  VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 152 ? 55.386  -25.004 66.615  1.00 94.17  ? 152  VAL A CG2 1 
ATOM   722  N N   . LYS A 1 153 ? 54.458  -24.038 62.232  1.00 96.57  ? 153  LYS A N   1 
ATOM   723  C CA  . LYS A 1 153 ? 54.731  -23.807 60.818  1.00 97.92  ? 153  LYS A CA  1 
ATOM   724  C C   . LYS A 1 153 ? 54.333  -22.380 60.439  1.00 98.05  ? 153  LYS A C   1 
ATOM   725  O O   . LYS A 1 153 ? 55.134  -21.450 60.572  1.00 97.93  ? 153  LYS A O   1 
ATOM   726  C CB  . LYS A 1 153 ? 53.961  -24.818 59.965  1.00 99.68  ? 153  LYS A CB  1 
ATOM   727  C CG  . LYS A 1 153 ? 54.279  -26.279 60.286  1.00 100.87 ? 153  LYS A CG  1 
ATOM   728  C CD  . LYS A 1 153 ? 55.745  -26.621 60.053  1.00 101.20 ? 153  LYS A CD  1 
ATOM   729  C CE  . LYS A 1 153 ? 56.127  -26.500 58.588  1.00 101.19 ? 153  LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 153 ? 57.569  -26.810 58.377  1.00 101.47 ? 153  LYS A NZ  1 
ATOM   731  N N   . ASN A 1 154 ? 53.102  -22.210 59.960  1.00 97.60  ? 154  ASN A N   1 
ATOM   732  C CA  . ASN A 1 154 ? 52.607  -20.885 59.592  1.00 97.47  ? 154  ASN A CA  1 
ATOM   733  C C   . ASN A 1 154 ? 51.971  -20.206 60.814  1.00 97.43  ? 154  ASN A C   1 
ATOM   734  O O   . ASN A 1 154 ? 52.138  -20.672 61.944  1.00 97.18  ? 154  ASN A O   1 
ATOM   735  C CB  . ASN A 1 154 ? 51.602  -20.975 58.430  1.00 96.96  ? 154  ASN A CB  1 
ATOM   736  C CG  . ASN A 1 154 ? 50.422  -21.882 58.732  1.00 97.21  ? 154  ASN A CG  1 
ATOM   737  O OD1 . ASN A 1 154 ? 49.623  -22.194 57.848  1.00 96.43  ? 154  ASN A OD1 1 
ATOM   738  N ND2 . ASN A 1 154 ? 50.303  -22.304 59.981  1.00 97.37  ? 154  ASN A ND2 1 
ATOM   739  N N   . GLY A 1 155 ? 51.249  -19.111 60.596  1.00 97.01  ? 155  GLY A N   1 
ATOM   740  C CA  . GLY A 1 155 ? 50.648  -18.412 61.720  1.00 96.34  ? 155  GLY A CA  1 
ATOM   741  C C   . GLY A 1 155 ? 49.183  -18.687 62.023  1.00 94.67  ? 155  GLY A C   1 
ATOM   742  O O   . GLY A 1 155 ? 48.522  -17.851 62.639  1.00 95.21  ? 155  GLY A O   1 
ATOM   743  N N   . GLU A 1 156 ? 48.663  -19.833 61.593  1.00 92.80  ? 156  GLU A N   1 
ATOM   744  C CA  . GLU A 1 156 ? 47.260  -20.164 61.840  1.00 90.47  ? 156  GLU A CA  1 
ATOM   745  C C   . GLU A 1 156 ? 46.903  -20.218 63.318  1.00 88.46  ? 156  GLU A C   1 
ATOM   746  O O   . GLU A 1 156 ? 47.519  -20.946 64.087  1.00 87.75  ? 156  GLU A O   1 
ATOM   747  C CB  . GLU A 1 156 ? 46.892  -21.497 61.176  1.00 92.12  ? 156  GLU A CB  1 
ATOM   748  C CG  . GLU A 1 156 ? 46.390  -21.358 59.737  1.00 93.76  ? 156  GLU A CG  1 
ATOM   749  C CD  . GLU A 1 156 ? 45.089  -20.592 59.672  1.00 94.45  ? 156  GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 156 ? 44.098  -21.083 60.252  1.00 94.12  ? 156  GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 156 ? 45.057  -19.501 59.061  1.00 96.02  ? 156  GLU A OE2 1 
ATOM   752  N N   . CYS A 1 157 ? 45.894  -19.442 63.704  1.00 85.12  ? 157  CYS A N   1 
ATOM   753  C CA  . CYS A 1 157 ? 45.436  -19.394 65.092  1.00 81.24  ? 157  CYS A CA  1 
ATOM   754  C C   . CYS A 1 157 ? 44.126  -20.157 65.274  1.00 79.48  ? 157  CYS A C   1 
ATOM   755  O O   . CYS A 1 157 ? 43.269  -20.155 64.390  1.00 78.65  ? 157  CYS A O   1 
ATOM   756  C CB  . CYS A 1 157 ? 45.238  -17.945 65.536  1.00 81.44  ? 157  CYS A CB  1 
ATOM   757  S SG  . CYS A 1 157 ? 46.729  -16.933 65.506  1.00 79.53  ? 157  CYS A SG  1 
ATOM   758  N N   . PHE A 1 158 ? 43.974  -20.797 66.430  1.00 77.16  ? 158  PHE A N   1 
ATOM   759  C CA  . PHE A 1 158 ? 42.777  -21.573 66.745  1.00 76.04  ? 158  PHE A CA  1 
ATOM   760  C C   . PHE A 1 158 ? 42.439  -21.375 68.215  1.00 74.63  ? 158  PHE A C   1 
ATOM   761  O O   . PHE A 1 158 ? 43.331  -21.145 69.030  1.00 75.27  ? 158  PHE A O   1 
ATOM   762  C CB  . PHE A 1 158 ? 43.028  -23.066 66.502  1.00 77.77  ? 158  PHE A CB  1 
ATOM   763  C CG  . PHE A 1 158 ? 43.451  -23.396 65.100  1.00 79.69  ? 158  PHE A CG  1 
ATOM   764  C CD1 . PHE A 1 158 ? 42.576  -23.214 64.033  1.00 79.92  ? 158  PHE A CD1 1 
ATOM   765  C CD2 . PHE A 1 158 ? 44.724  -23.895 64.845  1.00 79.50  ? 158  PHE A CD2 1 
ATOM   766  C CE1 . PHE A 1 158 ? 42.963  -23.525 62.731  1.00 80.66  ? 158  PHE A CE1 1 
ATOM   767  C CE2 . PHE A 1 158 ? 45.122  -24.209 63.547  1.00 80.43  ? 158  PHE A CE2 1 
ATOM   768  C CZ  . PHE A 1 158 ? 44.239  -24.024 62.488  1.00 80.52  ? 158  PHE A CZ  1 
ATOM   769  N N   . ARG A 1 159 ? 41.158  -21.456 68.556  1.00 72.51  ? 159  ARG A N   1 
ATOM   770  C CA  . ARG A 1 159 ? 40.766  -21.314 69.948  1.00 71.20  ? 159  ARG A CA  1 
ATOM   771  C C   . ARG A 1 159 ? 40.979  -22.677 70.595  1.00 72.06  ? 159  ARG A C   1 
ATOM   772  O O   . ARG A 1 159 ? 40.175  -23.591 70.411  1.00 72.65  ? 159  ARG A O   1 
ATOM   773  C CB  . ARG A 1 159 ? 39.298  -20.895 70.070  1.00 67.58  ? 159  ARG A CB  1 
ATOM   774  C CG  . ARG A 1 159 ? 38.812  -20.897 71.513  1.00 68.33  ? 159  ARG A CG  1 
ATOM   775  C CD  . ARG A 1 159 ? 37.409  -20.334 71.688  1.00 65.01  ? 159  ARG A CD  1 
ATOM   776  N NE  . ARG A 1 159 ? 36.873  -20.680 73.003  1.00 63.76  ? 159  ARG A NE  1 
ATOM   777  C CZ  . ARG A 1 159 ? 35.741  -20.200 73.509  1.00 63.38  ? 159  ARG A CZ  1 
ATOM   778  N NH1 . ARG A 1 159 ? 35.012  -19.338 72.812  1.00 62.87  ? 159  ARG A NH1 1 
ATOM   779  N NH2 . ARG A 1 159 ? 35.330  -20.587 74.710  1.00 60.82  ? 159  ARG A NH2 1 
ATOM   780  N N   . ALA A 1 160 ? 42.078  -22.809 71.333  1.00 73.60  ? 160  ALA A N   1 
ATOM   781  C CA  . ALA A 1 160 ? 42.429  -24.058 72.006  1.00 74.58  ? 160  ALA A CA  1 
ATOM   782  C C   . ALA A 1 160 ? 41.206  -24.718 72.627  1.00 75.18  ? 160  ALA A C   1 
ATOM   783  O O   . ALA A 1 160 ? 41.002  -25.928 72.504  1.00 75.11  ? 160  ALA A O   1 
ATOM   784  C CB  . ALA A 1 160 ? 43.476  -23.788 73.082  1.00 75.53  ? 160  ALA A CB  1 
ATOM   785  N N   . ASP A 1 161 ? 40.401  -23.903 73.296  1.00 75.10  ? 161  ASP A N   1 
ATOM   786  C CA  . ASP A 1 161 ? 39.185  -24.361 73.948  1.00 73.91  ? 161  ASP A CA  1 
ATOM   787  C C   . ASP A 1 161 ? 38.379  -25.277 73.027  1.00 72.11  ? 161  ASP A C   1 
ATOM   788  O O   . ASP A 1 161 ? 38.068  -26.416 73.379  1.00 70.06  ? 161  ASP A O   1 
ATOM   789  C CB  . ASP A 1 161 ? 38.343  -23.144 74.349  1.00 75.97  ? 161  ASP A CB  1 
ATOM   790  C CG  . ASP A 1 161 ? 37.120  -23.517 75.154  1.00 77.92  ? 161  ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 161 ? 37.278  -24.155 76.214  1.00 81.97  ? 161  ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 161 ? 35.999  -23.167 74.730  1.00 81.68  ? 161  ASP A OD2 1 
ATOM   793  N N   . HIS A 1 162 ? 38.063  -24.773 71.837  1.00 69.96  ? 162  HIS A N   1 
ATOM   794  C CA  . HIS A 1 162 ? 37.272  -25.512 70.860  1.00 68.28  ? 162  HIS A CA  1 
ATOM   795  C C   . HIS A 1 162 ? 38.025  -26.557 70.036  1.00 68.06  ? 162  HIS A C   1 
ATOM   796  O O   . HIS A 1 162 ? 37.425  -27.529 69.576  1.00 68.35  ? 162  HIS A O   1 
ATOM   797  C CB  . HIS A 1 162 ? 36.571  -24.527 69.918  1.00 66.65  ? 162  HIS A CB  1 
ATOM   798  C CG  . HIS A 1 162 ? 35.547  -23.666 70.594  1.00 66.02  ? 162  HIS A CG  1 
ATOM   799  N ND1 . HIS A 1 162 ? 34.848  -22.681 69.930  1.00 65.22  ? 162  HIS A ND1 1 
ATOM   800  C CD2 . HIS A 1 162 ? 35.095  -23.651 71.871  1.00 64.91  ? 162  HIS A CD2 1 
ATOM   801  C CE1 . HIS A 1 162 ? 34.011  -22.096 70.768  1.00 63.82  ? 162  HIS A CE1 1 
ATOM   802  N NE2 . HIS A 1 162 ? 34.141  -22.665 71.952  1.00 64.34  ? 162  HIS A NE2 1 
ATOM   803  N N   . LEU A 1 163 ? 39.326  -26.367 69.837  1.00 68.03  ? 163  LEU A N   1 
ATOM   804  C CA  . LEU A 1 163 ? 40.108  -27.326 69.059  1.00 66.76  ? 163  LEU A CA  1 
ATOM   805  C C   . LEU A 1 163 ? 40.167  -28.656 69.801  1.00 65.56  ? 163  LEU A C   1 
ATOM   806  O O   . LEU A 1 163 ? 39.951  -29.720 69.219  1.00 65.51  ? 163  LEU A O   1 
ATOM   807  C CB  . LEU A 1 163 ? 41.532  -26.810 68.834  1.00 67.04  ? 163  LEU A CB  1 
ATOM   808  C CG  . LEU A 1 163 ? 42.090  -26.948 67.414  1.00 67.48  ? 163  LEU A CG  1 
ATOM   809  C CD1 . LEU A 1 163 ? 43.561  -26.565 67.413  1.00 66.10  ? 163  LEU A CD1 1 
ATOM   810  C CD2 . LEU A 1 163 ? 41.911  -28.372 66.913  1.00 68.10  ? 163  LEU A CD2 1 
ATOM   811  N N   . LEU A 1 164 ? 40.460  -28.581 71.094  1.00 64.02  ? 164  LEU A N   1 
ATOM   812  C CA  . LEU A 1 164 ? 40.545  -29.766 71.934  1.00 63.98  ? 164  LEU A CA  1 
ATOM   813  C C   . LEU A 1 164 ? 39.213  -30.510 71.909  1.00 64.62  ? 164  LEU A C   1 
ATOM   814  O O   . LEU A 1 164 ? 39.173  -31.739 71.962  1.00 64.31  ? 164  LEU A O   1 
ATOM   815  C CB  . LEU A 1 164 ? 40.902  -29.355 73.369  1.00 62.06  ? 164  LEU A CB  1 
ATOM   816  C CG  . LEU A 1 164 ? 41.093  -30.422 74.453  1.00 62.20  ? 164  LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 164 ? 39.747  -30.963 74.902  1.00 61.87  ? 164  LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 164 ? 41.992  -31.535 73.928  1.00 61.50  ? 164  LEU A CD2 1 
ATOM   819  N N   . LYS A 1 165 ? 38.124  -29.753 71.818  1.00 66.71  ? 165  LYS A N   1 
ATOM   820  C CA  . LYS A 1 165 ? 36.786  -30.331 71.791  1.00 68.14  ? 165  LYS A CA  1 
ATOM   821  C C   . LYS A 1 165 ? 36.513  -31.057 70.477  1.00 68.81  ? 165  LYS A C   1 
ATOM   822  O O   . LYS A 1 165 ? 35.909  -32.130 70.467  1.00 69.27  ? 165  LYS A O   1 
ATOM   823  C CB  . LYS A 1 165 ? 35.744  -29.232 72.019  1.00 69.35  ? 165  LYS A CB  1 
ATOM   824  C CG  . LYS A 1 165 ? 34.305  -29.722 72.115  1.00 71.65  ? 165  LYS A CG  1 
ATOM   825  C CD  . LYS A 1 165 ? 33.476  -28.769 72.969  1.00 74.34  ? 165  LYS A CD  1 
ATOM   826  C CE  . LYS A 1 165 ? 31.996  -29.121 72.956  1.00 75.63  ? 165  LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 165 ? 31.376  -28.821 71.637  1.00 75.50  ? 165  LYS A NZ  1 
ATOM   828  N N   . ALA A 1 166 ? 36.963  -30.474 69.371  1.00 69.18  ? 166  ALA A N   1 
ATOM   829  C CA  . ALA A 1 166 ? 36.764  -31.082 68.062  1.00 71.57  ? 166  ALA A CA  1 
ATOM   830  C C   . ALA A 1 166 ? 37.656  -32.313 67.906  1.00 72.95  ? 166  ALA A C   1 
ATOM   831  O O   . ALA A 1 166 ? 37.330  -33.238 67.159  1.00 72.56  ? 166  ALA A O   1 
ATOM   832  C CB  . ALA A 1 166 ? 37.069  -30.071 66.963  1.00 69.42  ? 166  ALA A CB  1 
ATOM   833  N N   . HIS A 1 167 ? 38.780  -32.318 68.619  1.00 73.66  ? 167  HIS A N   1 
ATOM   834  C CA  . HIS A 1 167 ? 39.719  -33.432 68.557  1.00 73.98  ? 167  HIS A CA  1 
ATOM   835  C C   . HIS A 1 167 ? 39.197  -34.668 69.282  1.00 73.07  ? 167  HIS A C   1 
ATOM   836  O O   . HIS A 1 167 ? 39.319  -35.785 68.781  1.00 71.91  ? 167  HIS A O   1 
ATOM   837  C CB  . HIS A 1 167 ? 41.065  -33.032 69.161  1.00 75.94  ? 167  HIS A CB  1 
ATOM   838  C CG  . HIS A 1 167 ? 42.120  -34.084 69.026  1.00 78.16  ? 167  HIS A CG  1 
ATOM   839  N ND1 . HIS A 1 167 ? 42.677  -34.426 67.813  1.00 79.05  ? 167  HIS A ND1 1 
ATOM   840  C CD2 . HIS A 1 167 ? 42.703  -34.887 69.948  1.00 78.48  ? 167  HIS A CD2 1 
ATOM   841  C CE1 . HIS A 1 167 ? 43.559  -35.393 67.992  1.00 79.42  ? 167  HIS A CE1 1 
ATOM   842  N NE2 . HIS A 1 167 ? 43.593  -35.692 69.279  1.00 79.85  ? 167  HIS A NE2 1 
ATOM   843  N N   . LEU A 1 168 ? 38.626  -34.467 70.467  1.00 72.24  ? 168  LEU A N   1 
ATOM   844  C CA  . LEU A 1 168 ? 38.096  -35.579 71.245  1.00 73.41  ? 168  LEU A CA  1 
ATOM   845  C C   . LEU A 1 168 ? 36.883  -36.195 70.559  1.00 74.05  ? 168  LEU A C   1 
ATOM   846  O O   . LEU A 1 168 ? 36.719  -37.416 70.549  1.00 74.30  ? 168  LEU A O   1 
ATOM   847  C CB  . LEU A 1 168 ? 37.717  -35.116 72.654  1.00 72.31  ? 168  LEU A CB  1 
ATOM   848  C CG  . LEU A 1 168 ? 38.849  -34.532 73.503  1.00 73.97  ? 168  LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 168 ? 38.352  -34.288 74.917  1.00 74.19  ? 168  LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 168 ? 40.025  -35.490 73.521  1.00 73.20  ? 168  LEU A CD2 1 
ATOM   851  N N   . GLN A 1 169 ? 36.033  -35.348 69.989  1.00 74.85  ? 169  GLN A N   1 
ATOM   852  C CA  . GLN A 1 169 ? 34.846  -35.826 69.291  1.00 76.23  ? 169  GLN A CA  1 
ATOM   853  C C   . GLN A 1 169 ? 35.292  -36.691 68.117  1.00 76.78  ? 169  GLN A C   1 
ATOM   854  O O   . GLN A 1 169 ? 34.605  -37.637 67.729  1.00 76.14  ? 169  GLN A O   1 
ATOM   855  C CB  . GLN A 1 169 ? 34.013  -34.641 68.793  1.00 76.42  ? 169  GLN A CB  1 
ATOM   856  C CG  . GLN A 1 169 ? 33.325  -33.860 69.904  1.00 77.05  ? 169  GLN A CG  1 
ATOM   857  C CD  . GLN A 1 169 ? 32.670  -32.579 69.412  1.00 77.76  ? 169  GLN A CD  1 
ATOM   858  O OE1 . GLN A 1 169 ? 31.959  -31.908 70.159  1.00 77.71  ? 169  GLN A OE1 1 
ATOM   859  N NE2 . GLN A 1 169 ? 32.914  -32.231 68.153  1.00 77.75  ? 169  GLN A NE2 1 
ATOM   860  N N   . LYS A 1 170 ? 36.456  -36.358 67.567  1.00 76.48  ? 170  LYS A N   1 
ATOM   861  C CA  . LYS A 1 170 ? 37.025  -37.089 66.441  1.00 77.08  ? 170  LYS A CA  1 
ATOM   862  C C   . LYS A 1 170 ? 37.404  -38.499 66.894  1.00 77.14  ? 170  LYS A C   1 
ATOM   863  O O   . LYS A 1 170 ? 37.097  -39.484 66.222  1.00 77.25  ? 170  LYS A O   1 
ATOM   864  C CB  . LYS A 1 170 ? 38.276  -36.370 65.932  1.00 78.56  ? 170  LYS A CB  1 
ATOM   865  C CG  . LYS A 1 170 ? 38.510  -36.486 64.436  1.00 79.14  ? 170  LYS A CG  1 
ATOM   866  C CD  . LYS A 1 170 ? 37.565  -35.572 63.669  1.00 83.15  ? 170  LYS A CD  1 
ATOM   867  C CE  . LYS A 1 170 ? 37.777  -34.110 64.056  1.00 84.30  ? 170  LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 170 ? 36.825  -33.192 63.370  1.00 83.79  ? 170  LYS A NZ  1 
ATOM   869  N N   . LEU A 1 171 ? 38.072  -38.579 68.042  1.00 76.41  ? 171  LEU A N   1 
ATOM   870  C CA  . LEU A 1 171 ? 38.512  -39.850 68.606  1.00 77.23  ? 171  LEU A CA  1 
ATOM   871  C C   . LEU A 1 171 ? 37.346  -40.724 69.064  1.00 78.85  ? 171  LEU A C   1 
ATOM   872  O O   . LEU A 1 171 ? 37.404  -41.950 68.965  1.00 79.63  ? 171  LEU A O   1 
ATOM   873  C CB  . LEU A 1 171 ? 39.450  -39.596 69.788  1.00 75.66  ? 171  LEU A CB  1 
ATOM   874  C CG  . LEU A 1 171 ? 40.692  -38.745 69.511  1.00 75.25  ? 171  LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 171 ? 41.416  -38.461 70.819  1.00 72.91  ? 171  LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 171 ? 41.608  -39.467 68.530  1.00 74.62  ? 171  LEU A CD2 1 
ATOM   877  N N   . MET A 1 172 ? 36.292  -40.093 69.571  1.00 80.53  ? 172  MET A N   1 
ATOM   878  C CA  . MET A 1 172 ? 35.121  -40.825 70.039  1.00 82.49  ? 172  MET A CA  1 
ATOM   879  C C   . MET A 1 172 ? 34.284  -41.328 68.871  1.00 84.45  ? 172  MET A C   1 
ATOM   880  O O   . MET A 1 172 ? 33.382  -42.146 69.051  1.00 84.89  ? 172  MET A O   1 
ATOM   881  C CB  . MET A 1 172 ? 34.254  -39.930 70.925  1.00 81.98  ? 172  MET A CB  1 
ATOM   882  C CG  . MET A 1 172 ? 34.935  -39.446 72.189  1.00 83.36  ? 172  MET A CG  1 
ATOM   883  S SD  . MET A 1 172 ? 33.854  -38.381 73.160  1.00 84.12  ? 172  MET A SD  1 
ATOM   884  C CE  . MET A 1 172 ? 34.202  -36.802 72.422  1.00 82.18  ? 172  MET A CE  1 
ATOM   885  N N   . SER A 1 173 ? 34.582  -40.833 67.674  1.00 86.80  ? 173  SER A N   1 
ATOM   886  C CA  . SER A 1 173 ? 33.848  -41.224 66.477  1.00 89.23  ? 173  SER A CA  1 
ATOM   887  C C   . SER A 1 173 ? 34.480  -42.427 65.787  1.00 90.47  ? 173  SER A C   1 
ATOM   888  O O   . SER A 1 173 ? 33.798  -43.183 65.095  1.00 89.98  ? 173  SER A O   1 
ATOM   889  C CB  . SER A 1 173 ? 33.778  -40.051 65.499  1.00 90.54  ? 173  SER A CB  1 
ATOM   890  O OG  . SER A 1 173 ? 33.050  -40.401 64.335  1.00 93.75  ? 173  SER A OG  1 
ATOM   891  N N   . ASP A 1 174 ? 35.784  -42.597 65.975  1.00 92.46  ? 174  ASP A N   1 
ATOM   892  C CA  . ASP A 1 174 ? 36.502  -43.712 65.369  1.00 94.78  ? 174  ASP A CA  1 
ATOM   893  C C   . ASP A 1 174 ? 36.102  -45.014 66.059  1.00 95.03  ? 174  ASP A C   1 
ATOM   894  O O   . ASP A 1 174 ? 36.243  -45.151 67.275  1.00 95.03  ? 174  ASP A O   1 
ATOM   895  C CB  . ASP A 1 174 ? 38.011  -43.491 65.492  1.00 96.17  ? 174  ASP A CB  1 
ATOM   896  C CG  . ASP A 1 174 ? 38.815  -44.525 64.734  1.00 98.33  ? 174  ASP A CG  1 
ATOM   897  O OD1 . ASP A 1 174 ? 38.659  -44.617 63.497  1.00 98.90  ? 174  ASP A OD1 1 
ATOM   898  O OD2 . ASP A 1 174 ? 39.603  -45.245 65.379  1.00 99.03  ? 174  ASP A OD2 1 
ATOM   899  N N   . LYS A 1 175 ? 35.606  -45.967 65.276  1.00 95.63  ? 175  LYS A N   1 
ATOM   900  C CA  . LYS A 1 175 ? 35.160  -47.252 65.809  1.00 96.11  ? 175  LYS A CA  1 
ATOM   901  C C   . LYS A 1 175 ? 36.211  -47.996 66.628  1.00 95.46  ? 175  LYS A C   1 
ATOM   902  O O   . LYS A 1 175 ? 35.872  -48.833 67.468  1.00 94.89  ? 175  LYS A O   1 
ATOM   903  C CB  . LYS A 1 175 ? 34.672  -48.153 64.669  1.00 96.48  ? 175  LYS A CB  1 
ATOM   904  C CG  . LYS A 1 175 ? 33.522  -47.568 63.853  1.00 97.43  ? 175  LYS A CG  1 
ATOM   905  C CD  . LYS A 1 175 ? 32.371  -47.094 64.738  1.00 97.58  ? 175  LYS A CD  1 
ATOM   906  C CE  . LYS A 1 175 ? 31.843  -48.207 65.634  1.00 97.77  ? 175  LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 175 ? 31.335  -49.368 64.853  1.00 98.43  ? 175  LYS A NZ  1 
ATOM   908  N N   . LYS A 1 176 ? 37.482  -47.692 66.388  1.00 94.81  ? 176  LYS A N   1 
ATOM   909  C CA  . LYS A 1 176 ? 38.569  -48.345 67.109  1.00 94.28  ? 176  LYS A CA  1 
ATOM   910  C C   . LYS A 1 176 ? 38.659  -47.874 68.559  1.00 93.04  ? 176  LYS A C   1 
ATOM   911  O O   . LYS A 1 176 ? 39.399  -48.446 69.361  1.00 93.57  ? 176  LYS A O   1 
ATOM   912  C CB  . LYS A 1 176 ? 39.901  -48.090 66.395  1.00 95.24  ? 176  LYS A CB  1 
ATOM   913  C CG  . LYS A 1 176 ? 40.003  -48.748 65.023  1.00 97.36  ? 176  LYS A CG  1 
ATOM   914  C CD  . LYS A 1 176 ? 41.298  -48.382 64.304  1.00 98.62  ? 176  LYS A CD  1 
ATOM   915  C CE  . LYS A 1 176 ? 41.344  -46.902 63.947  1.00 99.60  ? 176  LYS A CE  1 
ATOM   916  N NZ  . LYS A 1 176 ? 42.579  -46.521 63.207  1.00 101.26 ? 176  LYS A NZ  1 
ATOM   917  N N   . CYS A 1 177 ? 37.898  -46.836 68.893  1.00 90.92  ? 177  CYS A N   1 
ATOM   918  C CA  . CYS A 1 177 ? 37.902  -46.293 70.247  1.00 88.52  ? 177  CYS A CA  1 
ATOM   919  C C   . CYS A 1 177 ? 37.196  -47.234 71.216  1.00 87.31  ? 177  CYS A C   1 
ATOM   920  O O   . CYS A 1 177 ? 36.088  -47.700 70.948  1.00 86.93  ? 177  CYS A O   1 
ATOM   921  C CB  . CYS A 1 177 ? 37.220  -44.922 70.269  1.00 88.82  ? 177  CYS A CB  1 
ATOM   922  S SG  . CYS A 1 177 ? 37.279  -44.078 71.869  1.00 85.64  ? 177  CYS A SG  1 
ATOM   923  N N   . SER A 1 178 ? 37.847  -47.510 72.341  1.00 86.24  ? 178  SER A N   1 
ATOM   924  C CA  . SER A 1 178 ? 37.286  -48.393 73.356  1.00 85.63  ? 178  SER A CA  1 
ATOM   925  C C   . SER A 1 178 ? 36.226  -47.659 74.163  1.00 85.67  ? 178  SER A C   1 
ATOM   926  O O   . SER A 1 178 ? 36.216  -46.431 74.221  1.00 86.22  ? 178  SER A O   1 
ATOM   927  C CB  . SER A 1 178 ? 38.383  -48.883 74.300  1.00 85.60  ? 178  SER A CB  1 
ATOM   928  O OG  . SER A 1 178 ? 38.908  -47.813 75.066  1.00 84.04  ? 178  SER A OG  1 
ATOM   929  N N   . VAL A 1 179 ? 35.340  -48.421 74.792  1.00 85.59  ? 179  VAL A N   1 
ATOM   930  C CA  . VAL A 1 179 ? 34.276  -47.841 75.597  1.00 85.24  ? 179  VAL A CA  1 
ATOM   931  C C   . VAL A 1 179 ? 34.823  -47.035 76.772  1.00 84.13  ? 179  VAL A C   1 
ATOM   932  O O   . VAL A 1 179 ? 34.309  -45.964 77.088  1.00 84.22  ? 179  VAL A O   1 
ATOM   933  C CB  . VAL A 1 179 ? 33.329  -48.937 76.138  1.00 86.02  ? 179  VAL A CB  1 
ATOM   934  C CG1 . VAL A 1 179 ? 32.599  -49.604 74.985  1.00 85.69  ? 179  VAL A CG1 1 
ATOM   935  C CG2 . VAL A 1 179 ? 34.124  -49.971 76.930  1.00 86.87  ? 179  VAL A CG2 1 
ATOM   936  N N   . GLU A 1 180 ? 35.871  -47.546 77.411  1.00 83.36  ? 180  GLU A N   1 
ATOM   937  C CA  . GLU A 1 180 ? 36.461  -46.863 78.556  1.00 83.54  ? 180  GLU A CA  1 
ATOM   938  C C   . GLU A 1 180 ? 37.070  -45.510 78.216  1.00 81.47  ? 180  GLU A C   1 
ATOM   939  O O   . GLU A 1 180 ? 36.957  -44.566 78.997  1.00 81.09  ? 180  GLU A O   1 
ATOM   940  C CB  . GLU A 1 180 ? 37.515  -47.750 79.225  1.00 87.58  ? 180  GLU A CB  1 
ATOM   941  C CG  . GLU A 1 180 ? 36.925  -48.854 80.092  1.00 93.88  ? 180  GLU A CG  1 
ATOM   942  C CD  . GLU A 1 180 ? 37.980  -49.615 80.878  1.00 98.13  ? 180  GLU A CD  1 
ATOM   943  O OE1 . GLU A 1 180 ? 37.603  -50.468 81.713  1.00 99.88  ? 180  GLU A OE1 1 
ATOM   944  O OE2 . GLU A 1 180 ? 39.187  -49.363 80.660  1.00 99.84  ? 180  GLU A OE2 1 
ATOM   945  N N   . LYS A 1 181 ? 37.717  -45.411 77.059  1.00 79.27  ? 181  LYS A N   1 
ATOM   946  C CA  . LYS A 1 181 ? 38.326  -44.148 76.658  1.00 77.05  ? 181  LYS A CA  1 
ATOM   947  C C   . LYS A 1 181 ? 37.245  -43.165 76.224  1.00 77.05  ? 181  LYS A C   1 
ATOM   948  O O   . LYS A 1 181 ? 37.320  -41.972 76.521  1.00 76.25  ? 181  LYS A O   1 
ATOM   949  C CB  . LYS A 1 181 ? 39.318  -44.358 75.511  1.00 74.55  ? 181  LYS A CB  1 
ATOM   950  C CG  . LYS A 1 181 ? 40.050  -43.083 75.122  1.00 71.29  ? 181  LYS A CG  1 
ATOM   951  C CD  . LYS A 1 181 ? 41.041  -43.306 73.999  1.00 66.69  ? 181  LYS A CD  1 
ATOM   952  C CE  . LYS A 1 181 ? 41.820  -42.033 73.721  1.00 65.06  ? 181  LYS A CE  1 
ATOM   953  N NZ  . LYS A 1 181 ? 42.508  -41.537 74.948  1.00 63.77  ? 181  LYS A NZ  1 
ATOM   954  N N   . LYS A 1 182 ? 36.243  -43.676 75.516  1.00 76.95  ? 182  LYS A N   1 
ATOM   955  C CA  . LYS A 1 182 ? 35.136  -42.853 75.049  1.00 76.84  ? 182  LYS A CA  1 
ATOM   956  C C   . LYS A 1 182 ? 34.525  -42.149 76.256  1.00 76.93  ? 182  LYS A C   1 
ATOM   957  O O   . LYS A 1 182 ? 34.205  -40.962 76.203  1.00 76.95  ? 182  LYS A O   1 
ATOM   958  C CB  . LYS A 1 182 ? 34.087  -43.733 74.365  1.00 76.90  ? 182  LYS A CB  1 
ATOM   959  C CG  . LYS A 1 182 ? 32.931  -42.970 73.744  1.00 79.62  ? 182  LYS A CG  1 
ATOM   960  C CD  . LYS A 1 182 ? 31.972  -43.919 73.039  1.00 81.93  ? 182  LYS A CD  1 
ATOM   961  C CE  . LYS A 1 182 ? 30.818  -43.169 72.393  1.00 83.32  ? 182  LYS A CE  1 
ATOM   962  N NZ  . LYS A 1 182 ? 29.883  -44.091 71.689  1.00 84.65  ? 182  LYS A NZ  1 
ATOM   963  N N   . SER A 1 183 ? 34.376  -42.894 77.347  1.00 76.88  ? 183  SER A N   1 
ATOM   964  C CA  . SER A 1 183 ? 33.819  -42.353 78.579  1.00 77.28  ? 183  SER A CA  1 
ATOM   965  C C   . SER A 1 183 ? 34.780  -41.324 79.164  1.00 77.25  ? 183  SER A C   1 
ATOM   966  O O   . SER A 1 183 ? 34.368  -40.253 79.606  1.00 77.19  ? 183  SER A O   1 
ATOM   967  C CB  . SER A 1 183 ? 33.585  -43.480 79.589  1.00 77.41  ? 183  SER A CB  1 
ATOM   968  O OG  . SER A 1 183 ? 33.071  -42.977 80.810  1.00 79.32  ? 183  SER A OG  1 
ATOM   969  N N   . GLU A 1 184 ? 36.066  -41.660 79.164  1.00 78.38  ? 184  GLU A N   1 
ATOM   970  C CA  . GLU A 1 184 ? 37.095  -40.767 79.683  1.00 79.50  ? 184  GLU A CA  1 
ATOM   971  C C   . GLU A 1 184 ? 37.024  -39.412 78.988  1.00 78.30  ? 184  GLU A C   1 
ATOM   972  O O   . GLU A 1 184 ? 37.050  -38.369 79.638  1.00 78.52  ? 184  GLU A O   1 
ATOM   973  C CB  . GLU A 1 184 ? 38.483  -41.383 79.471  1.00 81.99  ? 184  GLU A CB  1 
ATOM   974  C CG  . GLU A 1 184 ? 39.646  -40.412 79.676  1.00 87.52  ? 184  GLU A CG  1 
ATOM   975  C CD  . GLU A 1 184 ? 40.999  -41.025 79.335  1.00 90.61  ? 184  GLU A CD  1 
ATOM   976  O OE1 . GLU A 1 184 ? 41.448  -41.929 80.073  1.00 92.54  ? 184  GLU A OE1 1 
ATOM   977  O OE2 . GLU A 1 184 ? 41.610  -40.606 78.326  1.00 91.04  ? 184  GLU A OE2 1 
ATOM   978  N N   . MET A 1 185 ? 36.932  -39.436 77.662  1.00 77.20  ? 185  MET A N   1 
ATOM   979  C CA  . MET A 1 185 ? 36.867  -38.208 76.882  1.00 77.16  ? 185  MET A CA  1 
ATOM   980  C C   . MET A 1 185 ? 35.585  -37.418 77.119  1.00 76.82  ? 185  MET A C   1 
ATOM   981  O O   . MET A 1 185 ? 35.610  -36.189 77.136  1.00 76.57  ? 185  MET A O   1 
ATOM   982  C CB  . MET A 1 185 ? 37.023  -38.521 75.393  1.00 76.76  ? 185  MET A CB  1 
ATOM   983  C CG  . MET A 1 185 ? 38.400  -39.050 75.027  1.00 76.12  ? 185  MET A CG  1 
ATOM   984  S SD  . MET A 1 185 ? 38.622  -39.275 73.253  1.00 75.48  ? 185  MET A SD  1 
ATOM   985  C CE  . MET A 1 185 ? 37.957  -40.930 73.040  1.00 74.87  ? 185  MET A CE  1 
ATOM   986  N N   . GLU A 1 186 ? 34.467  -38.115 77.296  1.00 77.05  ? 186  GLU A N   1 
ATOM   987  C CA  . GLU A 1 186 ? 33.200  -37.437 77.545  1.00 77.91  ? 186  GLU A CA  1 
ATOM   988  C C   . GLU A 1 186 ? 33.296  -36.633 78.834  1.00 77.62  ? 186  GLU A C   1 
ATOM   989  O O   . GLU A 1 186 ? 32.837  -35.493 78.903  1.00 78.02  ? 186  GLU A O   1 
ATOM   990  C CB  . GLU A 1 186 ? 32.054  -38.442 77.667  1.00 78.81  ? 186  GLU A CB  1 
ATOM   991  C CG  . GLU A 1 186 ? 31.666  -39.126 76.372  1.00 81.75  ? 186  GLU A CG  1 
ATOM   992  C CD  . GLU A 1 186 ? 30.460  -40.032 76.543  1.00 84.14  ? 186  GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 186 ? 30.051  -40.679 75.555  1.00 83.11  ? 186  GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 186 ? 29.922  -40.095 77.670  1.00 84.82  ? 186  GLU A OE2 1 
ATOM   995  N N   . SER A 1 187 ? 33.899  -37.236 79.855  1.00 77.45  ? 187  SER A N   1 
ATOM   996  C CA  . SER A 1 187 ? 34.062  -36.582 81.148  1.00 77.08  ? 187  SER A CA  1 
ATOM   997  C C   . SER A 1 187 ? 34.941  -35.344 81.011  1.00 76.44  ? 187  SER A C   1 
ATOM   998  O O   . SER A 1 187 ? 34.789  -34.375 81.757  1.00 76.75  ? 187  SER A O   1 
ATOM   999  C CB  . SER A 1 187 ? 34.695  -37.549 82.151  1.00 77.24  ? 187  SER A CB  1 
ATOM   1000 O OG  . SER A 1 187 ? 33.911  -38.720 82.295  1.00 78.78  ? 187  SER A OG  1 
ATOM   1001 N N   . VAL A 1 188 ? 35.859  -35.386 80.051  1.00 74.75  ? 188  VAL A N   1 
ATOM   1002 C CA  . VAL A 1 188 ? 36.767  -34.273 79.809  1.00 74.77  ? 188  VAL A CA  1 
ATOM   1003 C C   . VAL A 1 188 ? 36.058  -33.103 79.131  1.00 75.49  ? 188  VAL A C   1 
ATOM   1004 O O   . VAL A 1 188 ? 36.287  -31.943 79.478  1.00 75.73  ? 188  VAL A O   1 
ATOM   1005 C CB  . VAL A 1 188 ? 37.959  -34.709 78.928  1.00 74.07  ? 188  VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 188 ? 38.865  -33.519 78.645  1.00 73.39  ? 188  VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 188 ? 38.738  -35.813 79.623  1.00 72.89  ? 188  VAL A CG2 1 
ATOM   1008 N N   . LEU A 1 189 ? 35.197  -33.408 78.166  1.00 74.75  ? 189  LEU A N   1 
ATOM   1009 C CA  . LEU A 1 189 ? 34.468  -32.368 77.450  1.00 75.22  ? 189  LEU A CA  1 
ATOM   1010 C C   . LEU A 1 189 ? 33.455  -31.661 78.339  1.00 75.86  ? 189  LEU A C   1 
ATOM   1011 O O   . LEU A 1 189 ? 33.186  -30.473 78.162  1.00 76.07  ? 189  LEU A O   1 
ATOM   1012 C CB  . LEU A 1 189 ? 33.757  -32.962 76.234  1.00 73.36  ? 189  LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 189 ? 34.676  -33.481 75.129  1.00 72.16  ? 189  LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 189 ? 33.838  -33.983 73.970  1.00 72.40  ? 189  LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 189 ? 35.604  -32.366 74.668  1.00 71.21  ? 189  LEU A CD2 1 
ATOM   1016 N N   . ALA A 1 190 ? 32.898  -32.393 79.297  1.00 76.45  ? 190  ALA A N   1 
ATOM   1017 C CA  . ALA A 1 190 ? 31.912  -31.833 80.211  1.00 77.02  ? 190  ALA A CA  1 
ATOM   1018 C C   . ALA A 1 190 ? 32.576  -30.992 81.299  1.00 77.25  ? 190  ALA A C   1 
ATOM   1019 O O   . ALA A 1 190 ? 31.962  -30.685 82.319  1.00 77.74  ? 190  ALA A O   1 
ATOM   1020 C CB  . ALA A 1 190 ? 31.092  -32.957 80.843  1.00 75.78  ? 190  ALA A CB  1 
ATOM   1021 N N   . GLN A 1 191 ? 33.830  -30.614 81.072  1.00 77.84  ? 191  GLN A N   1 
ATOM   1022 C CA  . GLN A 1 191 ? 34.574  -29.815 82.039  1.00 79.62  ? 191  GLN A CA  1 
ATOM   1023 C C   . GLN A 1 191 ? 35.550  -28.887 81.318  1.00 79.69  ? 191  GLN A C   1 
ATOM   1024 O O   . GLN A 1 191 ? 36.440  -28.306 81.937  1.00 79.83  ? 191  GLN A O   1 
ATOM   1025 C CB  . GLN A 1 191 ? 35.346  -30.741 82.987  1.00 82.17  ? 191  GLN A CB  1 
ATOM   1026 C CG  . GLN A 1 191 ? 35.230  -30.384 84.463  1.00 85.60  ? 191  GLN A CG  1 
ATOM   1027 C CD  . GLN A 1 191 ? 34.581  -31.491 85.285  1.00 87.94  ? 191  GLN A CD  1 
ATOM   1028 O OE1 . GLN A 1 191 ? 34.349  -31.336 86.486  1.00 87.81  ? 191  GLN A OE1 1 
ATOM   1029 N NE2 . GLN A 1 191 ? 34.287  -32.615 84.639  1.00 89.26  ? 191  GLN A NE2 1 
ATOM   1030 N N   . LEU A 1 192 ? 35.368  -28.751 80.008  1.00 80.02  ? 192  LEU A N   1 
ATOM   1031 C CA  . LEU A 1 192 ? 36.228  -27.915 79.175  1.00 81.11  ? 192  LEU A CA  1 
ATOM   1032 C C   . LEU A 1 192 ? 36.331  -26.455 79.604  1.00 83.18  ? 192  LEU A C   1 
ATOM   1033 O O   . LEU A 1 192 ? 37.415  -25.868 79.571  1.00 82.41  ? 192  LEU A O   1 
ATOM   1034 C CB  . LEU A 1 192 ? 35.755  -27.974 77.722  1.00 80.55  ? 192  LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 192 ? 36.670  -28.677 76.719  1.00 80.79  ? 192  LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 192 ? 35.995  -28.702 75.359  1.00 81.01  ? 192  LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 192 ? 38.008  -27.956 76.641  1.00 79.89  ? 192  LEU A CD2 1 
ATOM   1038 N N   . ASP A 1 193 ? 35.207  -25.867 79.998  1.00 85.43  ? 193  ASP A N   1 
ATOM   1039 C CA  . ASP A 1 193 ? 35.190  -24.468 80.410  1.00 87.87  ? 193  ASP A CA  1 
ATOM   1040 C C   . ASP A 1 193 ? 35.803  -24.216 81.787  1.00 88.94  ? 193  ASP A C   1 
ATOM   1041 O O   . ASP A 1 193 ? 35.817  -23.082 82.267  1.00 89.85  ? 193  ASP A O   1 
ATOM   1042 C CB  . ASP A 1 193 ? 33.757  -23.928 80.370  1.00 87.91  ? 193  ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 193 ? 33.225  -23.789 78.954  1.00 87.16  ? 193  ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 193 ? 33.812  -23.012 78.170  1.00 86.39  ? 193  ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 193 ? 32.222  -24.457 78.627  1.00 85.65  ? 193  ASP A OD2 1 
ATOM   1046 N N   . ASN A 1 194 ? 36.311  -25.269 82.420  1.00 89.41  ? 194  ASN A N   1 
ATOM   1047 C CA  . ASN A 1 194 ? 36.930  -25.141 83.736  1.00 90.23  ? 194  ASN A CA  1 
ATOM   1048 C C   . ASN A 1 194 ? 38.444  -25.095 83.624  1.00 90.42  ? 194  ASN A C   1 
ATOM   1049 O O   . ASN A 1 194 ? 39.103  -24.253 84.234  1.00 91.81  ? 194  ASN A O   1 
ATOM   1050 C CB  . ASN A 1 194 ? 36.542  -26.319 84.626  1.00 91.05  ? 194  ASN A CB  1 
ATOM   1051 C CG  . ASN A 1 194 ? 35.111  -26.249 85.084  1.00 92.50  ? 194  ASN A CG  1 
ATOM   1052 O OD1 . ASN A 1 194 ? 34.187  -26.232 84.272  1.00 94.13  ? 194  ASN A OD1 1 
ATOM   1053 N ND2 . ASN A 1 194 ? 34.915  -26.206 86.397  1.00 93.02  ? 194  ASN A ND2 1 
ATOM   1054 N N   . TYR A 1 195 ? 38.984  -26.022 82.843  1.00 89.69  ? 195  TYR A N   1 
ATOM   1055 C CA  . TYR A 1 195 ? 40.418  -26.131 82.629  1.00 89.01  ? 195  TYR A CA  1 
ATOM   1056 C C   . TYR A 1 195 ? 41.069  -24.767 82.446  1.00 88.12  ? 195  TYR A C   1 
ATOM   1057 O O   . TYR A 1 195 ? 40.597  -23.939 81.667  1.00 87.95  ? 195  TYR A O   1 
ATOM   1058 C CB  . TYR A 1 195 ? 40.672  -27.024 81.411  1.00 89.52  ? 195  TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 195 ? 40.034  -28.395 81.542  1.00 90.69  ? 195  TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 195 ? 39.728  -29.157 80.416  1.00 91.07  ? 195  TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 195 ? 39.726  -28.925 82.797  1.00 91.04  ? 195  TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 195 ? 39.128  -30.412 80.537  1.00 92.21  ? 195  TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 195 ? 39.130  -30.174 82.928  1.00 91.99  ? 195  TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 195 ? 38.833  -30.912 81.796  1.00 92.58  ? 195  TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 195 ? 38.237  -32.146 81.930  1.00 93.61  ? 195  TYR A OH  1 
ATOM   1066 N N   . GLY A 1 196 ? 42.150  -24.536 83.184  1.00 87.09  ? 196  GLY A N   1 
ATOM   1067 C CA  . GLY A 1 196 ? 42.849  -23.270 83.094  1.00 86.51  ? 196  GLY A CA  1 
ATOM   1068 C C   . GLY A 1 196 ? 44.071  -23.344 82.202  1.00 86.79  ? 196  GLY A C   1 
ATOM   1069 O O   . GLY A 1 196 ? 44.333  -24.367 81.571  1.00 86.33  ? 196  GLY A O   1 
ATOM   1070 N N   . GLN A 1 197 ? 44.819  -22.248 82.157  1.00 87.98  ? 197  GLN A N   1 
ATOM   1071 C CA  . GLN A 1 197 ? 46.028  -22.147 81.349  1.00 89.03  ? 197  GLN A CA  1 
ATOM   1072 C C   . GLN A 1 197 ? 46.874  -23.419 81.321  1.00 89.89  ? 197  GLN A C   1 
ATOM   1073 O O   . GLN A 1 197 ? 47.322  -23.847 80.256  1.00 89.85  ? 197  GLN A O   1 
ATOM   1074 C CB  . GLN A 1 197 ? 46.879  -20.977 81.854  1.00 90.07  ? 197  GLN A CB  1 
ATOM   1075 C CG  . GLN A 1 197 ? 48.300  -20.943 81.314  1.00 92.53  ? 197  GLN A CG  1 
ATOM   1076 C CD  . GLN A 1 197 ? 48.354  -20.847 79.805  1.00 93.24  ? 197  GLN A CD  1 
ATOM   1077 O OE1 . GLN A 1 197 ? 47.880  -19.877 79.214  1.00 94.71  ? 197  GLN A OE1 1 
ATOM   1078 N NE2 . GLN A 1 197 ? 48.934  -21.859 79.171  1.00 93.76  ? 197  GLN A NE2 1 
ATOM   1079 N N   . GLN A 1 198 ? 47.088  -24.024 82.485  1.00 90.26  ? 198  GLN A N   1 
ATOM   1080 C CA  . GLN A 1 198 ? 47.905  -25.230 82.568  1.00 89.81  ? 198  GLN A CA  1 
ATOM   1081 C C   . GLN A 1 198 ? 47.170  -26.516 82.199  1.00 89.14  ? 198  GLN A C   1 
ATOM   1082 O O   . GLN A 1 198 ? 47.619  -27.260 81.326  1.00 89.21  ? 198  GLN A O   1 
ATOM   1083 C CB  . GLN A 1 198 ? 48.503  -25.367 83.971  1.00 90.12  ? 198  GLN A CB  1 
ATOM   1084 C CG  . GLN A 1 198 ? 49.539  -26.476 84.089  1.00 89.93  ? 198  GLN A CG  1 
ATOM   1085 C CD  . GLN A 1 198 ? 50.679  -26.314 83.098  1.00 89.40  ? 198  GLN A CD  1 
ATOM   1086 O OE1 . GLN A 1 198 ? 51.377  -25.301 83.098  1.00 90.10  ? 198  GLN A OE1 1 
ATOM   1087 N NE2 . GLN A 1 198 ? 50.872  -27.316 82.248  1.00 89.68  ? 198  GLN A NE2 1 
ATOM   1088 N N   . GLU A 1 199 ? 46.049  -26.779 82.864  1.00 87.47  ? 199  GLU A N   1 
ATOM   1089 C CA  . GLU A 1 199 ? 45.266  -27.984 82.597  1.00 86.53  ? 199  GLU A CA  1 
ATOM   1090 C C   . GLU A 1 199 ? 45.013  -28.203 81.109  1.00 86.30  ? 199  GLU A C   1 
ATOM   1091 O O   . GLU A 1 199 ? 45.068  -29.332 80.618  1.00 86.28  ? 199  GLU A O   1 
ATOM   1092 C CB  . GLU A 1 199 ? 43.927  -27.913 83.325  1.00 85.08  ? 199  GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 199 ? 44.036  -27.998 84.827  1.00 85.76  ? 199  GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 199 ? 42.683  -27.965 85.496  1.00 86.85  ? 199  GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 199 ? 42.021  -26.907 85.445  1.00 87.73  ? 199  GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 199 ? 42.277  -29.000 86.065  1.00 87.93  ? 199  GLU A OE2 1 
ATOM   1097 N N   . LEU A 1 200 ? 44.732  -27.115 80.402  1.00 86.17  ? 200  LEU A N   1 
ATOM   1098 C CA  . LEU A 1 200 ? 44.461  -27.166 78.971  1.00 85.51  ? 200  LEU A CA  1 
ATOM   1099 C C   . LEU A 1 200 ? 45.744  -27.454 78.195  1.00 85.29  ? 200  LEU A C   1 
ATOM   1100 O O   . LEU A 1 200 ? 45.712  -28.052 77.117  1.00 84.65  ? 200  LEU A O   1 
ATOM   1101 C CB  . LEU A 1 200 ? 43.858  -25.833 78.517  1.00 84.76  ? 200  LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 200 ? 42.569  -25.870 77.691  1.00 83.80  ? 200  LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 200 ? 41.970  -24.475 77.631  1.00 83.26  ? 200  LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 200 ? 42.857  -26.397 76.296  1.00 83.69  ? 200  LEU A CD2 1 
ATOM   1105 N N   . ALA A 1 201 ? 46.872  -27.025 78.753  1.00 84.61  ? 201  ALA A N   1 
ATOM   1106 C CA  . ALA A 1 201 ? 48.169  -27.237 78.124  1.00 84.29  ? 201  ALA A CA  1 
ATOM   1107 C C   . ALA A 1 201 ? 48.543  -28.716 78.152  1.00 83.74  ? 201  ALA A C   1 
ATOM   1108 O O   . ALA A 1 201 ? 49.104  -29.240 77.189  1.00 82.82  ? 201  ALA A O   1 
ATOM   1109 C CB  . ALA A 1 201 ? 49.235  -26.413 78.838  1.00 84.29  ? 201  ALA A CB  1 
ATOM   1110 N N   . ASP A 1 202 ? 48.226  -29.383 79.260  1.00 83.40  ? 202  ASP A N   1 
ATOM   1111 C CA  . ASP A 1 202 ? 48.529  -30.803 79.413  1.00 83.81  ? 202  ASP A CA  1 
ATOM   1112 C C   . ASP A 1 202 ? 47.695  -31.663 78.468  1.00 83.17  ? 202  ASP A C   1 
ATOM   1113 O O   . ASP A 1 202 ? 48.226  -32.544 77.788  1.00 83.49  ? 202  ASP A O   1 
ATOM   1114 C CB  . ASP A 1 202 ? 48.291  -31.253 80.861  1.00 84.73  ? 202  ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 202 ? 49.265  -30.615 81.841  1.00 85.61  ? 202  ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 202 ? 50.487  -30.654 81.580  1.00 86.41  ? 202  ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 202 ? 48.809  -30.082 82.876  1.00 84.81  ? 202  ASP A OD2 1 
ATOM   1118 N N   . LEU A 1 203 ? 46.390  -31.408 78.429  1.00 81.63  ? 203  LEU A N   1 
ATOM   1119 C CA  . LEU A 1 203 ? 45.497  -32.163 77.556  1.00 80.09  ? 203  LEU A CA  1 
ATOM   1120 C C   . LEU A 1 203 ? 45.969  -32.075 76.111  1.00 79.33  ? 203  LEU A C   1 
ATOM   1121 O O   . LEU A 1 203 ? 45.857  -33.037 75.349  1.00 78.32  ? 203  LEU A O   1 
ATOM   1122 C CB  . LEU A 1 203 ? 44.069  -31.628 77.664  1.00 79.31  ? 203  LEU A CB  1 
ATOM   1123 C CG  . LEU A 1 203 ? 43.346  -31.847 78.993  1.00 78.29  ? 203  LEU A CG  1 
ATOM   1124 C CD1 . LEU A 1 203 ? 42.003  -31.146 78.950  1.00 77.24  ? 203  LEU A CD1 1 
ATOM   1125 C CD2 . LEU A 1 203 ? 43.163  -33.335 79.251  1.00 77.18  ? 203  LEU A CD2 1 
ATOM   1126 N N   . PHE A 1 204 ? 46.497  -30.915 75.737  1.00 79.00  ? 204  PHE A N   1 
ATOM   1127 C CA  . PHE A 1 204 ? 46.992  -30.707 74.384  1.00 80.27  ? 204  PHE A CA  1 
ATOM   1128 C C   . PHE A 1 204 ? 48.202  -31.593 74.113  1.00 81.22  ? 204  PHE A C   1 
ATOM   1129 O O   . PHE A 1 204 ? 48.587  -31.808 72.962  1.00 80.46  ? 204  PHE A O   1 
ATOM   1130 C CB  . PHE A 1 204 ? 47.350  -29.233 74.178  1.00 79.36  ? 204  PHE A CB  1 
ATOM   1131 C CG  . PHE A 1 204 ? 46.345  -28.481 73.355  1.00 78.97  ? 204  PHE A CG  1 
ATOM   1132 C CD1 . PHE A 1 204 ? 46.455  -28.443 71.969  1.00 78.75  ? 204  PHE A CD1 1 
ATOM   1133 C CD2 . PHE A 1 204 ? 45.264  -27.848 73.959  1.00 78.97  ? 204  PHE A CD2 1 
ATOM   1134 C CE1 . PHE A 1 204 ? 45.501  -27.787 71.193  1.00 79.24  ? 204  PHE A CE1 1 
ATOM   1135 C CE2 . PHE A 1 204 ? 44.302  -27.190 73.194  1.00 78.41  ? 204  PHE A CE2 1 
ATOM   1136 C CZ  . PHE A 1 204 ? 44.422  -27.160 71.808  1.00 79.04  ? 204  PHE A CZ  1 
ATOM   1137 N N   . VAL A 1 205 ? 48.794  -32.112 75.185  1.00 81.81  ? 205  VAL A N   1 
ATOM   1138 C CA  . VAL A 1 205 ? 49.954  -32.984 75.072  1.00 82.20  ? 205  VAL A CA  1 
ATOM   1139 C C   . VAL A 1 205 ? 49.523  -34.443 75.168  1.00 81.99  ? 205  VAL A C   1 
ATOM   1140 O O   . VAL A 1 205 ? 49.915  -35.269 74.344  1.00 82.47  ? 205  VAL A O   1 
ATOM   1141 C CB  . VAL A 1 205 ? 50.984  -32.696 76.183  1.00 82.61  ? 205  VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 205 ? 52.183  -33.620 76.034  1.00 81.71  ? 205  VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 205 ? 51.424  -31.242 76.118  1.00 82.50  ? 205  VAL A CG2 1 
ATOM   1144 N N   . ASN A 1 206 ? 48.714  -34.752 76.177  1.00 81.33  ? 206  ASN A N   1 
ATOM   1145 C CA  . ASN A 1 206 ? 48.233  -36.114 76.375  1.00 82.15  ? 206  ASN A CA  1 
ATOM   1146 C C   . ASN A 1 206 ? 47.565  -36.639 75.108  1.00 82.47  ? 206  ASN A C   1 
ATOM   1147 O O   . ASN A 1 206 ? 47.793  -37.781 74.702  1.00 83.17  ? 206  ASN A O   1 
ATOM   1148 C CB  . ASN A 1 206 ? 47.249  -36.168 77.548  1.00 82.19  ? 206  ASN A CB  1 
ATOM   1149 C CG  . ASN A 1 206 ? 47.919  -35.892 78.884  1.00 83.15  ? 206  ASN A CG  1 
ATOM   1150 O OD1 . ASN A 1 206 ? 47.277  -35.928 79.934  1.00 83.56  ? 206  ASN A OD1 1 
ATOM   1151 N ND2 . ASN A 1 206 ? 49.217  -35.616 78.850  1.00 83.64  ? 206  ASN A ND2 1 
ATOM   1152 N N   . TYR A 1 207 ? 46.743  -35.801 74.485  1.00 81.03  ? 207  TYR A N   1 
ATOM   1153 C CA  . TYR A 1 207 ? 46.059  -36.192 73.261  1.00 80.48  ? 207  TYR A CA  1 
ATOM   1154 C C   . TYR A 1 207 ? 46.869  -35.784 72.039  1.00 81.21  ? 207  TYR A C   1 
ATOM   1155 O O   . TYR A 1 207 ? 46.436  -35.973 70.903  1.00 80.39  ? 207  TYR A O   1 
ATOM   1156 C CB  . TYR A 1 207 ? 44.661  -35.570 73.205  1.00 78.64  ? 207  TYR A CB  1 
ATOM   1157 C CG  . TYR A 1 207 ? 43.722  -36.126 74.253  1.00 77.15  ? 207  TYR A CG  1 
ATOM   1158 C CD1 . TYR A 1 207 ? 43.700  -35.608 75.548  1.00 76.34  ? 207  TYR A CD1 1 
ATOM   1159 C CD2 . TYR A 1 207 ? 42.884  -37.201 73.961  1.00 77.00  ? 207  TYR A CD2 1 
ATOM   1160 C CE1 . TYR A 1 207 ? 42.867  -36.150 76.528  1.00 75.77  ? 207  TYR A CE1 1 
ATOM   1161 C CE2 . TYR A 1 207 ? 42.049  -37.752 74.931  1.00 77.17  ? 207  TYR A CE2 1 
ATOM   1162 C CZ  . TYR A 1 207 ? 42.044  -37.223 76.211  1.00 76.82  ? 207  TYR A CZ  1 
ATOM   1163 O OH  . TYR A 1 207 ? 41.218  -37.768 77.168  1.00 75.74  ? 207  TYR A OH  1 
ATOM   1164 N N   . ASN A 1 208 ? 48.052  -35.230 72.288  1.00 83.27  ? 208  ASN A N   1 
ATOM   1165 C CA  . ASN A 1 208 ? 48.950  -34.800 71.223  1.00 86.44  ? 208  ASN A CA  1 
ATOM   1166 C C   . ASN A 1 208 ? 48.181  -34.072 70.123  1.00 87.55  ? 208  ASN A C   1 
ATOM   1167 O O   . ASN A 1 208 ? 48.364  -34.345 68.935  1.00 87.66  ? 208  ASN A O   1 
ATOM   1168 C CB  . ASN A 1 208 ? 49.676  -36.019 70.640  1.00 88.41  ? 208  ASN A CB  1 
ATOM   1169 C CG  . ASN A 1 208 ? 50.847  -35.636 69.755  1.00 90.41  ? 208  ASN A CG  1 
ATOM   1170 O OD1 . ASN A 1 208 ? 51.809  -35.017 70.212  1.00 91.53  ? 208  ASN A OD1 1 
ATOM   1171 N ND2 . ASN A 1 208 ? 50.772  -36.006 68.480  1.00 90.28  ? 208  ASN A ND2 1 
ATOM   1172 N N   . VAL A 1 209 ? 47.316  -33.145 70.528  1.00 88.27  ? 209  VAL A N   1 
ATOM   1173 C CA  . VAL A 1 209 ? 46.514  -32.377 69.582  1.00 88.37  ? 209  VAL A CA  1 
ATOM   1174 C C   . VAL A 1 209 ? 47.398  -31.640 68.582  1.00 89.12  ? 209  VAL A C   1 
ATOM   1175 O O   . VAL A 1 209 ? 48.405  -31.035 68.954  1.00 89.09  ? 209  VAL A O   1 
ATOM   1176 C CB  . VAL A 1 209 ? 45.629  -31.339 70.307  1.00 87.32  ? 209  VAL A CB  1 
ATOM   1177 C CG1 . VAL A 1 209 ? 44.774  -30.589 69.298  1.00 86.23  ? 209  VAL A CG1 1 
ATOM   1178 C CG2 . VAL A 1 209 ? 44.755  -32.030 71.338  1.00 86.84  ? 209  VAL A CG2 1 
ATOM   1179 N N   . LYS A 1 210 ? 47.012  -31.694 67.312  1.00 90.07  ? 210  LYS A N   1 
ATOM   1180 C CA  . LYS A 1 210 ? 47.765  -31.032 66.255  1.00 91.67  ? 210  LYS A CA  1 
ATOM   1181 C C   . LYS A 1 210 ? 46.808  -30.308 65.311  1.00 92.53  ? 210  LYS A C   1 
ATOM   1182 O O   . LYS A 1 210 ? 45.620  -30.628 65.255  1.00 93.00  ? 210  LYS A O   1 
ATOM   1183 C CB  . LYS A 1 210 ? 48.604  -32.065 65.497  1.00 92.38  ? 210  LYS A CB  1 
ATOM   1184 C CG  . LYS A 1 210 ? 49.587  -32.811 66.398  1.00 93.24  ? 210  LYS A CG  1 
ATOM   1185 C CD  . LYS A 1 210 ? 50.314  -33.944 65.683  1.00 93.67  ? 210  LYS A CD  1 
ATOM   1186 C CE  . LYS A 1 210 ? 51.301  -33.433 64.644  1.00 93.98  ? 210  LYS A CE  1 
ATOM   1187 N NZ  . LYS A 1 210 ? 50.629  -32.746 63.509  1.00 93.43  ? 210  LYS A NZ  1 
ATOM   1188 N N   . SER A 1 211 ? 47.330  -29.328 64.580  1.00 93.29  ? 211  SER A N   1 
ATOM   1189 C CA  . SER A 1 211 ? 46.527  -28.537 63.652  1.00 93.97  ? 211  SER A CA  1 
ATOM   1190 C C   . SER A 1 211 ? 45.570  -29.379 62.818  1.00 94.90  ? 211  SER A C   1 
ATOM   1191 O O   . SER A 1 211 ? 45.959  -30.396 62.246  1.00 95.18  ? 211  SER A O   1 
ATOM   1192 C CB  . SER A 1 211 ? 47.437  -27.734 62.718  1.00 93.28  ? 211  SER A CB  1 
ATOM   1193 O OG  . SER A 1 211 ? 46.674  -26.973 61.797  1.00 92.18  ? 211  SER A OG  1 
ATOM   1194 N N   . PRO A 1 212 ? 44.297  -28.962 62.744  1.00 95.79  ? 212  PRO A N   1 
ATOM   1195 C CA  . PRO A 1 212 ? 43.294  -29.696 61.968  1.00 96.63  ? 212  PRO A CA  1 
ATOM   1196 C C   . PRO A 1 212 ? 43.647  -29.714 60.483  1.00 97.11  ? 212  PRO A C   1 
ATOM   1197 O O   . PRO A 1 212 ? 43.288  -30.642 59.760  1.00 97.01  ? 212  PRO A O   1 
ATOM   1198 C CB  . PRO A 1 212 ? 42.006  -28.930 62.260  1.00 96.79  ? 212  PRO A CB  1 
ATOM   1199 C CG  . PRO A 1 212 ? 42.494  -27.529 62.481  1.00 96.33  ? 212  PRO A CG  1 
ATOM   1200 C CD  . PRO A 1 212 ? 43.711  -27.749 63.343  1.00 95.57  ? 212  PRO A CD  1 
ATOM   1201 N N   . ILE A 1 213 ? 44.355  -28.681 60.038  1.00 98.53  ? 213  ILE A N   1 
ATOM   1202 C CA  . ILE A 1 213 ? 44.776  -28.586 58.647  1.00 100.74 ? 213  ILE A CA  1 
ATOM   1203 C C   . ILE A 1 213 ? 46.220  -29.063 58.536  1.00 102.10 ? 213  ILE A C   1 
ATOM   1204 O O   . ILE A 1 213 ? 47.099  -28.576 59.248  1.00 102.83 ? 213  ILE A O   1 
ATOM   1205 C CB  . ILE A 1 213 ? 44.645  -27.131 58.116  1.00 100.63 ? 213  ILE A CB  1 
ATOM   1206 C CG1 . ILE A 1 213 ? 45.320  -26.139 59.070  1.00 101.52 ? 213  ILE A CG1 1 
ATOM   1207 C CG2 . ILE A 1 213 ? 43.176  -26.775 57.957  1.00 99.89  ? 213  ILE A CG2 1 
ATOM   1208 C CD1 . ILE A 1 213 ? 46.779  -25.858 58.761  1.00 101.83 ? 213  ILE A CD1 1 
ATOM   1209 N N   . THR A 1 214 ? 46.452  -30.031 57.652  1.00 103.30 ? 214  THR A N   1 
ATOM   1210 C CA  . THR A 1 214 ? 47.780  -30.608 57.447  1.00 104.49 ? 214  THR A CA  1 
ATOM   1211 C C   . THR A 1 214 ? 48.548  -30.723 58.768  1.00 103.63 ? 214  THR A C   1 
ATOM   1212 O O   . THR A 1 214 ? 49.664  -30.221 58.908  1.00 103.49 ? 214  THR A O   1 
ATOM   1213 C CB  . THR A 1 214 ? 48.606  -29.780 56.421  1.00 105.61 ? 214  THR A CB  1 
ATOM   1214 O OG1 . THR A 1 214 ? 49.887  -30.394 56.231  1.00 106.39 ? 214  THR A OG1 1 
ATOM   1215 C CG2 . THR A 1 214 ? 48.793  -28.345 56.899  1.00 106.45 ? 214  THR A CG2 1 
ATOM   1216 N N   . GLY A 1 215 ? 47.917  -31.398 59.725  1.00 102.65 ? 215  GLY A N   1 
ATOM   1217 C CA  . GLY A 1 215 ? 48.482  -31.610 61.048  1.00 101.02 ? 215  GLY A CA  1 
ATOM   1218 C C   . GLY A 1 215 ? 49.902  -31.157 61.323  1.00 100.44 ? 215  GLY A C   1 
ATOM   1219 O O   . GLY A 1 215 ? 50.862  -31.849 60.985  1.00 101.55 ? 215  GLY A O   1 
ATOM   1220 N N   . ASN A 1 216 ? 50.035  -29.989 61.944  1.00 99.20  ? 216  ASN A N   1 
ATOM   1221 C CA  . ASN A 1 216 ? 51.339  -29.445 62.302  1.00 97.95  ? 216  ASN A CA  1 
ATOM   1222 C C   . ASN A 1 216 ? 51.361  -29.418 63.828  1.00 97.63  ? 216  ASN A C   1 
ATOM   1223 O O   . ASN A 1 216 ? 50.374  -29.783 64.465  1.00 98.09  ? 216  ASN A O   1 
ATOM   1224 C CB  . ASN A 1 216 ? 51.504  -28.023 61.759  1.00 97.93  ? 216  ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 216 ? 51.022  -27.880 60.326  1.00 98.17  ? 216  ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 216 ? 49.819  -27.888 60.058  1.00 96.07  ? 216  ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 216 ? 51.961  -27.752 59.397  1.00 97.16  ? 216  ASN A ND2 1 
ATOM   1228 N N   . ASP A 1 217 ? 52.471  -28.992 64.420  1.00 96.95  ? 217  ASP A N   1 
ATOM   1229 C CA  . ASP A 1 217 ? 52.551  -28.936 65.875  1.00 96.30  ? 217  ASP A CA  1 
ATOM   1230 C C   . ASP A 1 217 ? 52.093  -27.593 66.430  1.00 95.43  ? 217  ASP A C   1 
ATOM   1231 O O   . ASP A 1 217 ? 52.623  -26.542 66.071  1.00 95.29  ? 217  ASP A O   1 
ATOM   1232 C CB  . ASP A 1 217 ? 53.971  -29.245 66.350  1.00 96.84  ? 217  ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 217 ? 54.215  -30.732 66.510  1.00 97.28  ? 217  ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 217 ? 54.078  -31.470 65.512  1.00 97.06  ? 217  ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 217 ? 54.537  -31.164 67.637  1.00 97.50  ? 217  ASP A OD2 1 
ATOM   1236 N N   . LEU A 1 218 ? 51.100  -27.649 67.312  1.00 94.30  ? 218  LEU A N   1 
ATOM   1237 C CA  . LEU A 1 218 ? 50.530  -26.460 67.935  1.00 92.01  ? 218  LEU A CA  1 
ATOM   1238 C C   . LEU A 1 218 ? 51.339  -25.954 69.122  1.00 90.08  ? 218  LEU A C   1 
ATOM   1239 O O   . LEU A 1 218 ? 51.775  -26.734 69.969  1.00 89.76  ? 218  LEU A O   1 
ATOM   1240 C CB  . LEU A 1 218 ? 49.097  -26.753 68.392  1.00 92.28  ? 218  LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 218 ? 47.953  -26.603 67.385  1.00 92.12  ? 218  LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 218 ? 48.389  -27.055 66.007  1.00 91.86  ? 218  LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 218 ? 46.756  -27.406 67.875  1.00 91.73  ? 218  LEU A CD2 1 
ATOM   1244 N N   . SER A 1 219 ? 51.531  -24.642 69.179  1.00 88.13  ? 219  SER A N   1 
ATOM   1245 C CA  . SER A 1 219 ? 52.268  -24.031 70.276  1.00 86.93  ? 219  SER A CA  1 
ATOM   1246 C C   . SER A 1 219 ? 51.400  -24.141 71.523  1.00 85.57  ? 219  SER A C   1 
ATOM   1247 O O   . SER A 1 219 ? 50.197  -24.372 71.427  1.00 85.91  ? 219  SER A O   1 
ATOM   1248 C CB  . SER A 1 219 ? 52.553  -22.559 69.967  1.00 86.62  ? 219  SER A CB  1 
ATOM   1249 O OG  . SER A 1 219 ? 51.350  -21.826 69.811  1.00 87.56  ? 219  SER A OG  1 
ATOM   1250 N N   . PRO A 1 220 ? 51.997  -23.979 72.713  1.00 84.98  ? 220  PRO A N   1 
ATOM   1251 C CA  . PRO A 1 220 ? 51.211  -24.076 73.946  1.00 84.68  ? 220  PRO A CA  1 
ATOM   1252 C C   . PRO A 1 220 ? 50.067  -23.058 73.985  1.00 84.67  ? 220  PRO A C   1 
ATOM   1253 O O   . PRO A 1 220 ? 50.187  -21.953 73.450  1.00 83.84  ? 220  PRO A O   1 
ATOM   1254 C CB  . PRO A 1 220 ? 52.254  -23.835 75.036  1.00 84.44  ? 220  PRO A CB  1 
ATOM   1255 C CG  . PRO A 1 220 ? 53.228  -22.916 74.363  1.00 85.37  ? 220  PRO A CG  1 
ATOM   1256 C CD  . PRO A 1 220 ? 53.377  -23.555 73.004  1.00 85.43  ? 220  PRO A CD  1 
ATOM   1257 N N   . PRO A 1 221 ? 48.939  -23.424 74.617  1.00 83.66  ? 221  PRO A N   1 
ATOM   1258 C CA  . PRO A 1 221 ? 47.772  -22.542 74.723  1.00 82.96  ? 221  PRO A CA  1 
ATOM   1259 C C   . PRO A 1 221 ? 48.045  -21.257 75.509  1.00 81.55  ? 221  PRO A C   1 
ATOM   1260 O O   . PRO A 1 221 ? 48.483  -21.304 76.657  1.00 81.72  ? 221  PRO A O   1 
ATOM   1261 C CB  . PRO A 1 221 ? 46.731  -23.435 75.399  1.00 83.30  ? 221  PRO A CB  1 
ATOM   1262 C CG  . PRO A 1 221 ? 47.568  -24.332 76.256  1.00 82.40  ? 221  PRO A CG  1 
ATOM   1263 C CD  . PRO A 1 221 ? 48.701  -24.694 75.326  1.00 83.62  ? 221  PRO A CD  1 
ATOM   1264 N N   . VAL A 1 222 ? 47.783  -20.114 74.883  1.00 80.06  ? 222  VAL A N   1 
ATOM   1265 C CA  . VAL A 1 222 ? 48.005  -18.820 75.523  1.00 78.23  ? 222  VAL A CA  1 
ATOM   1266 C C   . VAL A 1 222 ? 46.754  -17.946 75.473  1.00 77.28  ? 222  VAL A C   1 
ATOM   1267 O O   . VAL A 1 222 ? 45.887  -18.130 74.618  1.00 75.87  ? 222  VAL A O   1 
ATOM   1268 C CB  . VAL A 1 222 ? 49.169  -18.051 74.851  1.00 78.14  ? 222  VAL A CB  1 
ATOM   1269 C CG1 . VAL A 1 222 ? 50.444  -18.875 74.923  1.00 77.74  ? 222  VAL A CG1 1 
ATOM   1270 C CG2 . VAL A 1 222 ? 48.820  -17.730 73.402  1.00 77.63  ? 222  VAL A CG2 1 
ATOM   1271 N N   . SER A 1 223 ? 46.669  -16.990 76.390  1.00 76.00  ? 223  SER A N   1 
ATOM   1272 C CA  . SER A 1 223 ? 45.524  -16.091 76.448  1.00 73.33  ? 223  SER A CA  1 
ATOM   1273 C C   . SER A 1 223 ? 45.577  -15.034 75.350  1.00 71.73  ? 223  SER A C   1 
ATOM   1274 O O   . SER A 1 223 ? 46.636  -14.476 75.057  1.00 70.99  ? 223  SER A O   1 
ATOM   1275 C CB  . SER A 1 223 ? 45.462  -15.405 77.815  1.00 73.30  ? 223  SER A CB  1 
ATOM   1276 O OG  . SER A 1 223 ? 45.332  -16.360 78.853  1.00 75.65  ? 223  SER A OG  1 
ATOM   1277 N N   . PHE A 1 224 ? 44.424  -14.771 74.742  1.00 69.32  ? 224  PHE A N   1 
ATOM   1278 C CA  . PHE A 1 224 ? 44.314  -13.775 73.682  1.00 66.43  ? 224  PHE A CA  1 
ATOM   1279 C C   . PHE A 1 224 ? 43.132  -12.862 73.978  1.00 64.88  ? 224  PHE A C   1 
ATOM   1280 O O   . PHE A 1 224 ? 41.979  -13.268 73.829  1.00 64.63  ? 224  PHE A O   1 
ATOM   1281 C CB  . PHE A 1 224 ? 44.101  -14.452 72.326  1.00 63.88  ? 224  PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 224 ? 43.900  -13.484 71.196  1.00 62.68  ? 224  PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 224 ? 44.942  -12.669 70.766  1.00 61.71  ? 224  PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 224 ? 42.660  -13.370 70.575  1.00 62.45  ? 224  PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 224 ? 44.751  -11.750 69.734  1.00 63.12  ? 224  PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 224 ? 42.457  -12.454 69.541  1.00 62.64  ? 224  PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 224 ? 43.504  -11.643 69.120  1.00 62.08  ? 224  PHE A CZ  1 
ATOM   1288 N N   . ASN A 1 225 ? 43.415  -11.631 74.394  1.00 63.47  ? 225  ASN A N   1 
ATOM   1289 C CA  . ASN A 1 225 ? 42.351  -10.686 74.709  1.00 61.88  ? 225  ASN A CA  1 
ATOM   1290 C C   . ASN A 1 225 ? 41.460  -10.468 73.494  1.00 59.69  ? 225  ASN A C   1 
ATOM   1291 O O   . ASN A 1 225 ? 41.925  -10.062 72.427  1.00 58.02  ? 225  ASN A O   1 
ATOM   1292 C CB  . ASN A 1 225 ? 42.935  -9.354  75.173  1.00 63.07  ? 225  ASN A CB  1 
ATOM   1293 C CG  . ASN A 1 225 ? 41.893  -8.464  75.809  1.00 64.53  ? 225  ASN A CG  1 
ATOM   1294 O OD1 . ASN A 1 225 ? 40.965  -8.000  75.145  1.00 65.29  ? 225  ASN A OD1 1 
ATOM   1295 N ND2 . ASN A 1 225 ? 42.032  -8.230  77.109  1.00 66.55  ? 225  ASN A ND2 1 
ATOM   1296 N N   . LEU A 1 226 ? 40.171  -10.735 73.678  1.00 58.69  ? 226  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 226 ? 39.179  -10.619 72.615  1.00 58.20  ? 226  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 226 ? 38.723  -9.199  72.270  1.00 56.76  ? 226  LEU A C   1 
ATOM   1299 O O   . LEU A 1 226 ? 37.893  -9.021  71.381  1.00 57.43  ? 226  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 226 ? 37.953  -11.462 72.981  1.00 58.78  ? 226  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 226 ? 38.166  -12.967 73.172  1.00 59.48  ? 226  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 226 ? 36.935  -13.585 73.826  1.00 59.30  ? 226  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 226 ? 38.451  -13.616 71.824  1.00 58.71  ? 226  LEU A CD2 1 
ATOM   1304 N N   . MET A 1 227 ? 39.257  -8.191  72.951  1.00 54.60  ? 227  MET A N   1 
ATOM   1305 C CA  . MET A 1 227 ? 38.841  -6.818  72.681  1.00 55.49  ? 227  MET A CA  1 
ATOM   1306 C C   . MET A 1 227 ? 39.576  -6.116  71.546  1.00 55.91  ? 227  MET A C   1 
ATOM   1307 O O   . MET A 1 227 ? 40.799  -6.202  71.433  1.00 57.41  ? 227  MET A O   1 
ATOM   1308 C CB  . MET A 1 227 ? 38.956  -5.970  73.949  1.00 55.01  ? 227  MET A CB  1 
ATOM   1309 C CG  . MET A 1 227 ? 38.034  -6.409  75.067  1.00 57.16  ? 227  MET A CG  1 
ATOM   1310 S SD  . MET A 1 227 ? 37.889  -5.154  76.343  1.00 60.95  ? 227  MET A SD  1 
ATOM   1311 C CE  . MET A 1 227 ? 39.341  -5.509  77.346  1.00 60.81  ? 227  MET A CE  1 
ATOM   1312 N N   . PHE A 1 228 ? 38.813  -5.420  70.707  1.00 55.72  ? 228  PHE A N   1 
ATOM   1313 C CA  . PHE A 1 228 ? 39.377  -4.669  69.589  1.00 56.65  ? 228  PHE A CA  1 
ATOM   1314 C C   . PHE A 1 228 ? 40.093  -3.449  70.149  1.00 57.61  ? 228  PHE A C   1 
ATOM   1315 O O   . PHE A 1 228 ? 39.619  -2.825  71.098  1.00 58.44  ? 228  PHE A O   1 
ATOM   1316 C CB  . PHE A 1 228 ? 38.269  -4.223  68.630  1.00 55.01  ? 228  PHE A CB  1 
ATOM   1317 C CG  . PHE A 1 228 ? 37.811  -5.299  67.688  1.00 55.60  ? 228  PHE A CG  1 
ATOM   1318 C CD1 . PHE A 1 228 ? 38.586  -5.652  66.586  1.00 56.16  ? 228  PHE A CD1 1 
ATOM   1319 C CD2 . PHE A 1 228 ? 36.615  -5.970  67.908  1.00 53.05  ? 228  PHE A CD2 1 
ATOM   1320 C CE1 . PHE A 1 228 ? 38.174  -6.662  65.716  1.00 55.89  ? 228  PHE A CE1 1 
ATOM   1321 C CE2 . PHE A 1 228 ? 36.194  -6.980  67.047  1.00 54.39  ? 228  PHE A CE2 1 
ATOM   1322 C CZ  . PHE A 1 228 ? 36.975  -7.327  65.948  1.00 55.46  ? 228  PHE A CZ  1 
ATOM   1323 N N   . LYS A 1 229 ? 41.232  -3.108  69.557  1.00 58.17  ? 229  LYS A N   1 
ATOM   1324 C CA  . LYS A 1 229 ? 42.014  -1.970  70.019  1.00 58.80  ? 229  LYS A CA  1 
ATOM   1325 C C   . LYS A 1 229 ? 41.911  -0.815  69.027  1.00 58.39  ? 229  LYS A C   1 
ATOM   1326 O O   . LYS A 1 229 ? 41.772  -1.033  67.822  1.00 58.51  ? 229  LYS A O   1 
ATOM   1327 C CB  . LYS A 1 229 ? 43.478  -2.392  70.182  1.00 63.79  ? 229  LYS A CB  1 
ATOM   1328 C CG  . LYS A 1 229 ? 44.250  -1.670  71.283  1.00 70.44  ? 229  LYS A CG  1 
ATOM   1329 C CD  . LYS A 1 229 ? 44.400  -0.179  71.021  1.00 74.08  ? 229  LYS A CD  1 
ATOM   1330 C CE  . LYS A 1 229 ? 45.241  0.478   72.103  1.00 77.32  ? 229  LYS A CE  1 
ATOM   1331 N NZ  . LYS A 1 229 ? 44.694  0.203   73.464  1.00 80.12  ? 229  LYS A NZ  1 
ATOM   1332 N N   . THR A 1 230 ? 41.973  0.409   69.545  1.00 57.72  ? 230  THR A N   1 
ATOM   1333 C CA  . THR A 1 230 ? 41.901  1.610   68.719  1.00 58.56  ? 230  THR A CA  1 
ATOM   1334 C C   . THR A 1 230 ? 42.458  2.798   69.486  1.00 57.94  ? 230  THR A C   1 
ATOM   1335 O O   . THR A 1 230 ? 42.806  2.685   70.661  1.00 57.74  ? 230  THR A O   1 
ATOM   1336 C CB  . THR A 1 230 ? 40.454  1.965   68.345  1.00 59.50  ? 230  THR A CB  1 
ATOM   1337 O OG1 . THR A 1 230 ? 39.720  0.767   68.078  1.00 67.08  ? 230  THR A OG1 1 
ATOM   1338 C CG2 . THR A 1 230 ? 40.433  2.855   67.107  1.00 57.19  ? 230  THR A CG2 1 
ATOM   1339 N N   . PHE A 1 231 ? 42.533  3.938   68.812  1.00 57.77  ? 231  PHE A N   1 
ATOM   1340 C CA  . PHE A 1 231 ? 43.013  5.159   69.433  1.00 59.61  ? 231  PHE A CA  1 
ATOM   1341 C C   . PHE A 1 231 ? 41.985  6.267   69.247  1.00 59.39  ? 231  PHE A C   1 
ATOM   1342 O O   . PHE A 1 231 ? 41.574  6.565   68.124  1.00 58.74  ? 231  PHE A O   1 
ATOM   1343 C CB  . PHE A 1 231 ? 44.358  5.579   68.835  1.00 61.52  ? 231  PHE A CB  1 
ATOM   1344 C CG  . PHE A 1 231 ? 45.499  4.686   69.231  1.00 65.60  ? 231  PHE A CG  1 
ATOM   1345 C CD1 . PHE A 1 231 ? 46.000  3.734   68.348  1.00 67.27  ? 231  PHE A CD1 1 
ATOM   1346 C CD2 . PHE A 1 231 ? 46.061  4.783   70.502  1.00 66.61  ? 231  PHE A CD2 1 
ATOM   1347 C CE1 . PHE A 1 231 ? 47.045  2.890   68.725  1.00 69.17  ? 231  PHE A CE1 1 
ATOM   1348 C CE2 . PHE A 1 231 ? 47.105  3.945   70.891  1.00 68.51  ? 231  PHE A CE2 1 
ATOM   1349 C CZ  . PHE A 1 231 ? 47.598  2.996   70.001  1.00 69.39  ? 231  PHE A CZ  1 
ATOM   1350 N N   . ILE A 1 232 ? 41.560  6.860   70.357  1.00 59.11  ? 232  ILE A N   1 
ATOM   1351 C CA  . ILE A 1 232 ? 40.584  7.939   70.320  1.00 59.76  ? 232  ILE A CA  1 
ATOM   1352 C C   . ILE A 1 232 ? 41.302  9.272   70.159  1.00 61.20  ? 232  ILE A C   1 
ATOM   1353 O O   . ILE A 1 232 ? 42.213  9.596   70.925  1.00 60.71  ? 232  ILE A O   1 
ATOM   1354 C CB  . ILE A 1 232 ? 39.748  7.974   71.608  1.00 59.03  ? 232  ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 232 ? 39.091  6.612   71.831  1.00 57.33  ? 232  ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 232 ? 38.687  9.062   71.510  1.00 58.93  ? 232  ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 232 ? 38.322  6.508   73.127  1.00 60.08  ? 232  ILE A CD1 1 
ATOM   1358 N N   . GLY A 1 233 ? 40.886  10.040  69.157  1.00 63.31  ? 233  GLY A N   1 
ATOM   1359 C CA  . GLY A 1 233 ? 41.502  11.330  68.903  1.00 64.62  ? 233  GLY A CA  1 
ATOM   1360 C C   . GLY A 1 233 ? 42.873  11.180  68.273  1.00 65.76  ? 233  GLY A C   1 
ATOM   1361 O O   . GLY A 1 233 ? 43.396  10.068  68.191  1.00 64.05  ? 233  GLY A O   1 
ATOM   1362 N N   . PRO A 1 234 ? 43.479  12.283  67.804  1.00 67.81  ? 234  PRO A N   1 
ATOM   1363 C CA  . PRO A 1 234 ? 44.806  12.234  67.181  1.00 69.33  ? 234  PRO A CA  1 
ATOM   1364 C C   . PRO A 1 234 ? 45.881  11.876  68.201  1.00 71.26  ? 234  PRO A C   1 
ATOM   1365 O O   . PRO A 1 234 ? 45.800  12.270  69.366  1.00 71.57  ? 234  PRO A O   1 
ATOM   1366 C CB  . PRO A 1 234 ? 44.972  13.642  66.617  1.00 69.52  ? 234  PRO A CB  1 
ATOM   1367 C CG  . PRO A 1 234 ? 44.193  14.479  67.583  1.00 69.85  ? 234  PRO A CG  1 
ATOM   1368 C CD  . PRO A 1 234 ? 42.946  13.656  67.794  1.00 68.44  ? 234  PRO A CD  1 
ATOM   1369 N N   . GLY A 1 235 ? 46.884  11.125  67.758  1.00 73.14  ? 235  GLY A N   1 
ATOM   1370 C CA  . GLY A 1 235 ? 47.949  10.715  68.654  1.00 75.18  ? 235  GLY A CA  1 
ATOM   1371 C C   . GLY A 1 235 ? 47.610  9.392   69.315  1.00 76.73  ? 235  GLY A C   1 
ATOM   1372 O O   . GLY A 1 235 ? 46.543  8.825   69.065  1.00 78.23  ? 235  GLY A O   1 
ATOM   1373 N N   . GLY A 1 236 ? 48.512  8.895   70.157  1.00 75.95  ? 236  GLY A N   1 
ATOM   1374 C CA  . GLY A 1 236 ? 48.276  7.634   70.837  1.00 75.60  ? 236  GLY A CA  1 
ATOM   1375 C C   . GLY A 1 236 ? 48.202  7.797   72.343  1.00 75.86  ? 236  GLY A C   1 
ATOM   1376 O O   . GLY A 1 236 ? 48.492  6.866   73.097  1.00 74.96  ? 236  GLY A O   1 
ATOM   1377 N N   . ASN A 1 237 ? 47.806  8.987   72.780  1.00 75.70  ? 237  ASN A N   1 
ATOM   1378 C CA  . ASN A 1 237 ? 47.695  9.295   74.199  1.00 77.63  ? 237  ASN A CA  1 
ATOM   1379 C C   . ASN A 1 237 ? 46.434  8.731   74.853  1.00 76.53  ? 237  ASN A C   1 
ATOM   1380 O O   . ASN A 1 237 ? 46.385  8.563   76.072  1.00 76.20  ? 237  ASN A O   1 
ATOM   1381 C CB  . ASN A 1 237 ? 47.753  10.812  74.400  1.00 81.74  ? 237  ASN A CB  1 
ATOM   1382 C CG  . ASN A 1 237 ? 47.385  11.580  73.140  1.00 86.80  ? 237  ASN A CG  1 
ATOM   1383 O OD1 . ASN A 1 237 ? 46.312  11.383  72.566  1.00 88.02  ? 237  ASN A OD1 1 
ATOM   1384 N ND2 . ASN A 1 237 ? 48.279  12.462  72.704  1.00 88.95  ? 237  ASN A ND2 1 
ATOM   1385 N N   . MET A 1 238 ? 45.416  8.438   74.047  1.00 74.72  ? 238  MET A N   1 
ATOM   1386 C CA  . MET A 1 238 ? 44.170  7.896   74.578  1.00 71.54  ? 238  MET A CA  1 
ATOM   1387 C C   . MET A 1 238 ? 43.752  6.600   73.888  1.00 69.70  ? 238  MET A C   1 
ATOM   1388 O O   . MET A 1 238 ? 42.784  6.574   73.127  1.00 69.09  ? 238  MET A O   1 
ATOM   1389 C CB  . MET A 1 238 ? 43.041  8.922   74.447  1.00 71.26  ? 238  MET A CB  1 
ATOM   1390 C CG  . MET A 1 238 ? 41.763  8.513   75.168  1.00 70.67  ? 238  MET A CG  1 
ATOM   1391 S SD  . MET A 1 238 ? 40.389  9.640   74.887  1.00 70.35  ? 238  MET A SD  1 
ATOM   1392 C CE  . MET A 1 238 ? 40.991  11.125  75.708  1.00 69.88  ? 238  MET A CE  1 
ATOM   1393 N N   . PRO A 1 239 ? 44.481  5.504   74.144  1.00 67.95  ? 239  PRO A N   1 
ATOM   1394 C CA  . PRO A 1 239 ? 44.132  4.228   73.519  1.00 66.22  ? 239  PRO A CA  1 
ATOM   1395 C C   . PRO A 1 239 ? 42.788  3.740   74.049  1.00 65.28  ? 239  PRO A C   1 
ATOM   1396 O O   . PRO A 1 239 ? 42.475  3.924   75.226  1.00 65.81  ? 239  PRO A O   1 
ATOM   1397 C CB  . PRO A 1 239 ? 45.292  3.323   73.925  1.00 65.93  ? 239  PRO A CB  1 
ATOM   1398 C CG  . PRO A 1 239 ? 45.672  3.859   75.267  1.00 64.93  ? 239  PRO A CG  1 
ATOM   1399 C CD  . PRO A 1 239 ? 45.646  5.351   75.034  1.00 66.84  ? 239  PRO A CD  1 
ATOM   1400 N N   . GLY A 1 240 ? 41.994  3.124   73.180  1.00 64.17  ? 240  GLY A N   1 
ATOM   1401 C CA  . GLY A 1 240 ? 40.694  2.640   73.602  1.00 62.46  ? 240  GLY A CA  1 
ATOM   1402 C C   . GLY A 1 240 ? 40.312  1.297   73.015  1.00 61.81  ? 240  GLY A C   1 
ATOM   1403 O O   . GLY A 1 240 ? 41.084  0.678   72.285  1.00 63.03  ? 240  GLY A O   1 
ATOM   1404 N N   . TYR A 1 241 ? 39.105  0.849   73.339  1.00 60.09  ? 241  TYR A N   1 
ATOM   1405 C CA  . TYR A 1 241 ? 38.597  -0.426  72.854  1.00 59.90  ? 241  TYR A CA  1 
ATOM   1406 C C   . TYR A 1 241 ? 37.146  -0.263  72.429  1.00 58.96  ? 241  TYR A C   1 
ATOM   1407 O O   . TYR A 1 241 ? 36.515  0.756   72.712  1.00 57.59  ? 241  TYR A O   1 
ATOM   1408 C CB  . TYR A 1 241 ? 38.630  -1.477  73.964  1.00 61.34  ? 241  TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 241 ? 39.979  -1.755  74.577  1.00 65.42  ? 241  TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 241 ? 40.967  -2.431  73.864  1.00 67.09  ? 241  TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 241 ? 40.249  -1.394  75.896  1.00 66.88  ? 241  TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 241 ? 42.188  -2.748  74.452  1.00 68.38  ? 241  TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 241 ? 41.467  -1.705  76.493  1.00 68.79  ? 241  TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 241 ? 42.429  -2.384  75.766  1.00 68.94  ? 241  TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 241 ? 43.626  -2.715  76.358  1.00 72.05  ? 241  TYR A OH  1 
ATOM   1416 N N   . LEU A 1 242 ? 36.624  -1.273  71.742  1.00 57.70  ? 242  LEU A N   1 
ATOM   1417 C CA  . LEU A 1 242 ? 35.224  -1.279  71.344  1.00 54.07  ? 242  LEU A CA  1 
ATOM   1418 C C   . LEU A 1 242 ? 34.612  -2.151  72.433  1.00 52.66  ? 242  LEU A C   1 
ATOM   1419 O O   . LEU A 1 242 ? 35.123  -3.232  72.720  1.00 51.59  ? 242  LEU A O   1 
ATOM   1420 C CB  . LEU A 1 242 ? 35.042  -1.924  69.970  1.00 52.99  ? 242  LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 242 ? 35.603  -1.166  68.764  1.00 53.18  ? 242  LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 242 ? 35.290  -1.951  67.502  1.00 53.04  ? 242  LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 242 ? 34.997  0.229   68.679  1.00 50.26  ? 242  LEU A CD2 1 
ATOM   1424 N N   . ARG A 1 243 ? 33.540  -1.680  73.057  1.00 50.60  ? 243  ARG A N   1 
ATOM   1425 C CA  . ARG A 1 243 ? 32.918  -2.429  74.141  1.00 50.23  ? 243  ARG A CA  1 
ATOM   1426 C C   . ARG A 1 243 ? 32.573  -3.872  73.794  1.00 49.70  ? 243  ARG A C   1 
ATOM   1427 O O   . ARG A 1 243 ? 31.891  -4.141  72.806  1.00 49.58  ? 243  ARG A O   1 
ATOM   1428 C CB  . ARG A 1 243 ? 31.655  -1.711  74.630  1.00 50.91  ? 243  ARG A CB  1 
ATOM   1429 C CG  . ARG A 1 243 ? 30.529  -1.683  73.618  1.00 51.61  ? 243  ARG A CG  1 
ATOM   1430 C CD  . ARG A 1 243 ? 29.305  -0.979  74.161  1.00 52.05  ? 243  ARG A CD  1 
ATOM   1431 N NE  . ARG A 1 243 ? 28.183  -1.088  73.233  1.00 55.85  ? 243  ARG A NE  1 
ATOM   1432 C CZ  . ARG A 1 243 ? 27.018  -0.471  73.391  1.00 57.36  ? 243  ARG A CZ  1 
ATOM   1433 N NH1 . ARG A 1 243 ? 26.815  0.308   74.446  1.00 56.04  ? 243  ARG A NH1 1 
ATOM   1434 N NH2 . ARG A 1 243 ? 26.056  -0.635  72.493  1.00 57.62  ? 243  ARG A NH2 1 
ATOM   1435 N N   . PRO A 1 244 ? 33.068  -4.823  74.600  1.00 50.97  ? 244  PRO A N   1 
ATOM   1436 C CA  . PRO A 1 244 ? 32.800  -6.249  74.385  1.00 50.78  ? 244  PRO A CA  1 
ATOM   1437 C C   . PRO A 1 244 ? 31.417  -6.613  74.926  1.00 50.35  ? 244  PRO A C   1 
ATOM   1438 O O   . PRO A 1 244 ? 30.903  -7.701  74.678  1.00 52.01  ? 244  PRO A O   1 
ATOM   1439 C CB  . PRO A 1 244 ? 33.930  -6.930  75.153  1.00 50.37  ? 244  PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 244 ? 34.202  -5.973  76.268  1.00 49.87  ? 244  PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 244 ? 34.166  -4.640  75.567  1.00 50.10  ? 244  PRO A CD  1 
ATOM   1442 N N   . GLU A 1 245 ? 30.828  -5.686  75.673  1.00 51.54  ? 245  GLU A N   1 
ATOM   1443 C CA  . GLU A 1 245 ? 29.499  -5.864  76.250  1.00 52.66  ? 245  GLU A CA  1 
ATOM   1444 C C   . GLU A 1 245 ? 28.966  -4.463  76.537  1.00 52.05  ? 245  GLU A C   1 
ATOM   1445 O O   . GLU A 1 245 ? 29.702  -3.486  76.406  1.00 51.74  ? 245  GLU A O   1 
ATOM   1446 C CB  . GLU A 1 245 ? 29.571  -6.673  77.550  1.00 52.78  ? 245  GLU A CB  1 
ATOM   1447 C CG  . GLU A 1 245 ? 29.960  -5.856  78.776  1.00 58.92  ? 245  GLU A CG  1 
ATOM   1448 C CD  . GLU A 1 245 ? 30.000  -6.685  80.047  1.00 60.35  ? 245  GLU A CD  1 
ATOM   1449 O OE1 . GLU A 1 245 ? 29.065  -7.485  80.271  1.00 64.93  ? 245  GLU A OE1 1 
ATOM   1450 O OE2 . GLU A 1 245 ? 30.961  -6.528  80.826  1.00 59.41  ? 245  GLU A OE2 1 
ATOM   1451 N N   . THR A 1 246 ? 27.702  -4.359  76.936  1.00 52.56  ? 246  THR A N   1 
ATOM   1452 C CA  . THR A 1 246 ? 27.111  -3.051  77.213  1.00 53.29  ? 246  THR A CA  1 
ATOM   1453 C C   . THR A 1 246 ? 27.035  -2.719  78.704  1.00 52.64  ? 246  THR A C   1 
ATOM   1454 O O   . THR A 1 246 ? 27.048  -1.548  79.084  1.00 53.80  ? 246  THR A O   1 
ATOM   1455 C CB  . THR A 1 246 ? 25.682  -2.945  76.626  1.00 53.68  ? 246  THR A CB  1 
ATOM   1456 O OG1 . THR A 1 246 ? 24.777  -3.736  77.409  1.00 54.92  ? 246  THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 246 ? 25.657  -3.445  75.186  1.00 53.30  ? 246  THR A CG2 1 
ATOM   1458 N N   . ALA A 1 247 ? 26.960  -3.754  79.536  1.00 50.47  ? 247  ALA A N   1 
ATOM   1459 C CA  . ALA A 1 247 ? 26.856  -3.601  80.987  1.00 49.97  ? 247  ALA A CA  1 
ATOM   1460 C C   . ALA A 1 247 ? 27.631  -2.434  81.599  1.00 49.41  ? 247  ALA A C   1 
ATOM   1461 O O   . ALA A 1 247 ? 27.093  -1.692  82.423  1.00 47.02  ? 247  ALA A O   1 
ATOM   1462 C CB  . ALA A 1 247 ? 27.270  -4.897  81.669  1.00 49.45  ? 247  ALA A CB  1 
ATOM   1463 N N   . GLN A 1 248 ? 28.889  -2.271  81.208  1.00 48.67  ? 248  GLN A N   1 
ATOM   1464 C CA  . GLN A 1 248 ? 29.702  -1.197  81.763  1.00 51.67  ? 248  GLN A CA  1 
ATOM   1465 C C   . GLN A 1 248 ? 29.047  0.163   81.627  1.00 52.95  ? 248  GLN A C   1 
ATOM   1466 O O   . GLN A 1 248 ? 29.094  0.976   82.549  1.00 54.92  ? 248  GLN A O   1 
ATOM   1467 C CB  . GLN A 1 248 ? 31.080  -1.174  81.104  1.00 51.26  ? 248  GLN A CB  1 
ATOM   1468 C CG  . GLN A 1 248 ? 31.896  -2.421  81.382  1.00 53.76  ? 248  GLN A CG  1 
ATOM   1469 C CD  . GLN A 1 248 ? 31.826  -2.840  82.840  1.00 54.70  ? 248  GLN A CD  1 
ATOM   1470 O OE1 . GLN A 1 248 ? 31.990  -2.019  83.742  1.00 56.18  ? 248  GLN A OE1 1 
ATOM   1471 N NE2 . GLN A 1 248 ? 31.585  -4.125  83.077  1.00 54.83  ? 248  GLN A NE2 1 
ATOM   1472 N N   . GLY A 1 249 ? 28.431  0.409   80.477  1.00 53.69  ? 249  GLY A N   1 
ATOM   1473 C CA  . GLY A 1 249 ? 27.778  1.684   80.256  1.00 52.67  ? 249  GLY A CA  1 
ATOM   1474 C C   . GLY A 1 249 ? 26.739  1.997   81.314  1.00 52.93  ? 249  GLY A C   1 
ATOM   1475 O O   . GLY A 1 249 ? 26.629  3.139   81.763  1.00 53.19  ? 249  GLY A O   1 
ATOM   1476 N N   . ILE A 1 250 ? 25.975  0.985   81.712  1.00 53.14  ? 250  ILE A N   1 
ATOM   1477 C CA  . ILE A 1 250 ? 24.938  1.166   82.723  1.00 53.57  ? 250  ILE A CA  1 
ATOM   1478 C C   . ILE A 1 250 ? 25.537  1.441   84.099  1.00 54.04  ? 250  ILE A C   1 
ATOM   1479 O O   . ILE A 1 250 ? 24.998  2.233   84.873  1.00 54.21  ? 250  ILE A O   1 
ATOM   1480 C CB  . ILE A 1 250 ? 24.031  -0.077  82.828  1.00 53.45  ? 250  ILE A CB  1 
ATOM   1481 C CG1 . ILE A 1 250 ? 23.283  -0.288  81.509  1.00 54.05  ? 250  ILE A CG1 1 
ATOM   1482 C CG2 . ILE A 1 250 ? 23.046  0.095   83.979  1.00 52.31  ? 250  ILE A CG2 1 
ATOM   1483 C CD1 . ILE A 1 250 ? 22.349  -1.488  81.507  1.00 51.29  ? 250  ILE A CD1 1 
ATOM   1484 N N   . PHE A 1 251 ? 26.655  0.789   84.396  1.00 53.89  ? 251  PHE A N   1 
ATOM   1485 C CA  . PHE A 1 251 ? 27.312  0.962   85.683  1.00 51.06  ? 251  PHE A CA  1 
ATOM   1486 C C   . PHE A 1 251 ? 27.876  2.363   85.873  1.00 52.74  ? 251  PHE A C   1 
ATOM   1487 O O   . PHE A 1 251 ? 27.760  2.938   86.956  1.00 55.65  ? 251  PHE A O   1 
ATOM   1488 C CB  . PHE A 1 251 ? 28.424  -0.075  85.849  1.00 47.92  ? 251  PHE A CB  1 
ATOM   1489 C CG  . PHE A 1 251 ? 27.948  -1.497  85.738  1.00 45.04  ? 251  PHE A CG  1 
ATOM   1490 C CD1 . PHE A 1 251 ? 26.719  -1.877  86.272  1.00 43.54  ? 251  PHE A CD1 1 
ATOM   1491 C CD2 . PHE A 1 251 ? 28.741  -2.465  85.132  1.00 42.84  ? 251  PHE A CD2 1 
ATOM   1492 C CE1 . PHE A 1 251 ? 26.288  -3.202  86.205  1.00 43.72  ? 251  PHE A CE1 1 
ATOM   1493 C CE2 . PHE A 1 251 ? 28.321  -3.789  85.061  1.00 42.73  ? 251  PHE A CE2 1 
ATOM   1494 C CZ  . PHE A 1 251 ? 27.089  -4.159  85.600  1.00 42.32  ? 251  PHE A CZ  1 
ATOM   1495 N N   . LEU A 1 252 ? 28.480  2.917   84.827  1.00 53.05  ? 252  LEU A N   1 
ATOM   1496 C CA  . LEU A 1 252 ? 29.057  4.256   84.907  1.00 54.12  ? 252  LEU A CA  1 
ATOM   1497 C C   . LEU A 1 252 ? 27.985  5.332   85.029  1.00 55.68  ? 252  LEU A C   1 
ATOM   1498 O O   . LEU A 1 252 ? 28.293  6.499   85.272  1.00 57.58  ? 252  LEU A O   1 
ATOM   1499 C CB  . LEU A 1 252 ? 29.924  4.538   83.680  1.00 54.64  ? 252  LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 252 ? 31.121  3.612   83.462  1.00 54.67  ? 252  LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 252 ? 31.837  4.010   82.188  1.00 54.96  ? 252  LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 252 ? 32.065  3.691   84.650  1.00 56.75  ? 252  LEU A CD2 1 
ATOM   1503 N N   . ASN A 1 253 ? 26.727  4.936   84.852  1.00 56.11  ? 253  ASN A N   1 
ATOM   1504 C CA  . ASN A 1 253 ? 25.602  5.863   84.954  1.00 56.21  ? 253  ASN A CA  1 
ATOM   1505 C C   . ASN A 1 253 ? 24.658  5.388   86.054  1.00 57.46  ? 253  ASN A C   1 
ATOM   1506 O O   . ASN A 1 253 ? 23.457  5.659   86.015  1.00 56.30  ? 253  ASN A O   1 
ATOM   1507 C CB  . ASN A 1 253 ? 24.841  5.935   83.625  1.00 55.23  ? 253  ASN A CB  1 
ATOM   1508 C CG  . ASN A 1 253 ? 25.674  6.524   82.502  1.00 55.83  ? 253  ASN A CG  1 
ATOM   1509 O OD1 . ASN A 1 253 ? 26.133  7.659   82.588  1.00 56.57  ? 253  ASN A OD1 1 
ATOM   1510 N ND2 . ASN A 1 253 ? 25.869  5.753   81.437  1.00 56.29  ? 253  ASN A ND2 1 
ATOM   1511 N N   . PHE A 1 254 ? 25.208  4.683   87.038  1.00 59.03  ? 254  PHE A N   1 
ATOM   1512 C CA  . PHE A 1 254 ? 24.406  4.154   88.136  1.00 60.30  ? 254  PHE A CA  1 
ATOM   1513 C C   . PHE A 1 254 ? 23.704  5.219   88.965  1.00 61.00  ? 254  PHE A C   1 
ATOM   1514 O O   . PHE A 1 254 ? 22.526  5.079   89.286  1.00 60.66  ? 254  PHE A O   1 
ATOM   1515 C CB  . PHE A 1 254 ? 25.265  3.295   89.065  1.00 60.86  ? 254  PHE A CB  1 
ATOM   1516 C CG  . PHE A 1 254 ? 24.491  2.678   90.197  1.00 62.05  ? 254  PHE A CG  1 
ATOM   1517 C CD1 . PHE A 1 254 ? 23.613  1.623   89.964  1.00 61.49  ? 254  PHE A CD1 1 
ATOM   1518 C CD2 . PHE A 1 254 ? 24.614  3.174   91.493  1.00 60.86  ? 254  PHE A CD2 1 
ATOM   1519 C CE1 . PHE A 1 254 ? 22.868  1.070   91.005  1.00 62.38  ? 254  PHE A CE1 1 
ATOM   1520 C CE2 . PHE A 1 254 ? 23.874  2.629   92.539  1.00 61.08  ? 254  PHE A CE2 1 
ATOM   1521 C CZ  . PHE A 1 254 ? 22.998  1.576   92.295  1.00 61.88  ? 254  PHE A CZ  1 
ATOM   1522 N N   . LYS A 1 255 ? 24.422  6.279   89.322  1.00 62.95  ? 255  LYS A N   1 
ATOM   1523 C CA  . LYS A 1 255 ? 23.829  7.335   90.131  1.00 66.82  ? 255  LYS A CA  1 
ATOM   1524 C C   . LYS A 1 255 ? 22.592  7.973   89.516  1.00 67.40  ? 255  LYS A C   1 
ATOM   1525 O O   . LYS A 1 255 ? 21.552  8.067   90.168  1.00 67.91  ? 255  LYS A O   1 
ATOM   1526 C CB  . LYS A 1 255 ? 24.869  8.412   90.455  1.00 69.22  ? 255  LYS A CB  1 
ATOM   1527 C CG  . LYS A 1 255 ? 25.710  8.071   91.677  1.00 74.17  ? 255  LYS A CG  1 
ATOM   1528 C CD  . LYS A 1 255 ? 24.811  7.872   92.899  1.00 78.65  ? 255  LYS A CD  1 
ATOM   1529 C CE  . LYS A 1 255 ? 25.536  7.170   94.044  1.00 80.61  ? 255  LYS A CE  1 
ATOM   1530 N NZ  . LYS A 1 255 ? 26.706  7.942   94.546  1.00 82.40  ? 255  LYS A NZ  1 
ATOM   1531 N N   . ARG A 1 256 ? 22.697  8.410   88.267  1.00 68.90  ? 256  ARG A N   1 
ATOM   1532 C CA  . ARG A 1 256 ? 21.564  9.033   87.596  1.00 69.97  ? 256  ARG A CA  1 
ATOM   1533 C C   . ARG A 1 256 ? 20.424  8.042   87.375  1.00 69.25  ? 256  ARG A C   1 
ATOM   1534 O O   . ARG A 1 256 ? 19.255  8.429   87.364  1.00 69.81  ? 256  ARG A O   1 
ATOM   1535 C CB  . ARG A 1 256 ? 22.018  9.653   86.270  1.00 72.99  ? 256  ARG A CB  1 
ATOM   1536 C CG  . ARG A 1 256 ? 23.347  9.109   85.764  1.00 81.11  ? 256  ARG A CG  1 
ATOM   1537 C CD  . ARG A 1 256 ? 24.013  10.058  84.776  1.00 85.11  ? 256  ARG A CD  1 
ATOM   1538 N NE  . ARG A 1 256 ? 25.347  9.594   84.395  1.00 89.90  ? 256  ARG A NE  1 
ATOM   1539 C CZ  . ARG A 1 256 ? 26.206  10.297  83.660  1.00 92.57  ? 256  ARG A CZ  1 
ATOM   1540 N NH1 . ARG A 1 256 ? 25.875  11.503  83.223  1.00 93.54  ? 256  ARG A NH1 1 
ATOM   1541 N NH2 . ARG A 1 256 ? 27.398  9.792   83.360  1.00 92.86  ? 256  ARG A NH2 1 
ATOM   1542 N N   . LEU A 1 257 ? 20.763  6.764   87.216  1.00 68.07  ? 257  LEU A N   1 
ATOM   1543 C CA  . LEU A 1 257 ? 19.758  5.721   87.011  1.00 67.31  ? 257  LEU A CA  1 
ATOM   1544 C C   . LEU A 1 257 ? 19.036  5.402   88.316  1.00 68.16  ? 257  LEU A C   1 
ATOM   1545 O O   . LEU A 1 257 ? 17.811  5.283   88.345  1.00 67.19  ? 257  LEU A O   1 
ATOM   1546 C CB  . LEU A 1 257 ? 20.406  4.447   86.452  1.00 64.64  ? 257  LEU A CB  1 
ATOM   1547 C CG  . LEU A 1 257 ? 20.827  4.465   84.977  1.00 64.09  ? 257  LEU A CG  1 
ATOM   1548 C CD1 . LEU A 1 257 ? 21.567  3.186   84.631  1.00 62.15  ? 257  LEU A CD1 1 
ATOM   1549 C CD2 . LEU A 1 257 ? 19.599  4.621   84.095  1.00 62.18  ? 257  LEU A CD2 1 
ATOM   1550 N N   . LEU A 1 258 ? 19.800  5.257   89.394  1.00 70.05  ? 258  LEU A N   1 
ATOM   1551 C CA  . LEU A 1 258 ? 19.226  4.968   90.706  1.00 71.67  ? 258  LEU A CA  1 
ATOM   1552 C C   . LEU A 1 258 ? 18.296  6.110   91.094  1.00 73.49  ? 258  LEU A C   1 
ATOM   1553 O O   . LEU A 1 258 ? 17.281  5.908   91.764  1.00 72.90  ? 258  LEU A O   1 
ATOM   1554 C CB  . LEU A 1 258 ? 20.338  4.836   91.752  1.00 70.47  ? 258  LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 258 ? 19.927  4.733   93.226  1.00 68.75  ? 258  LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 258 ? 19.081  3.488   93.448  1.00 67.15  ? 258  LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 258 ? 21.175  4.692   94.097  1.00 66.88  ? 258  LEU A CD2 1 
ATOM   1558 N N   . GLU A 1 259 ? 18.658  7.310   90.655  1.00 75.21  ? 259  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 259 ? 17.895  8.518   90.936  1.00 78.31  ? 259  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 259 ? 16.476  8.470   90.368  1.00 78.69  ? 259  GLU A C   1 
ATOM   1561 O O   . GLU A 1 259 ? 15.555  9.057   90.937  1.00 77.71  ? 259  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 259 ? 18.652  9.727   90.383  1.00 80.30  ? 259  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 259 ? 17.998  11.068  90.640  1.00 84.33  ? 259  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 259 ? 18.934  12.229  90.342  1.00 86.69  ? 259  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 259 ? 18.467  13.388  90.344  1.00 88.24  ? 259  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 259 ? 20.139  11.982  90.113  1.00 86.18  ? 259  GLU A OE2 1 
ATOM   1567 N N   . PHE A 1 260 ? 16.301  7.772   89.251  1.00 79.45  ? 260  PHE A N   1 
ATOM   1568 C CA  . PHE A 1 260 ? 14.985  7.655   88.630  1.00 80.48  ? 260  PHE A CA  1 
ATOM   1569 C C   . PHE A 1 260 ? 14.000  6.900   89.513  1.00 81.78  ? 260  PHE A C   1 
ATOM   1570 O O   . PHE A 1 260 ? 12.799  7.171   89.491  1.00 82.22  ? 260  PHE A O   1 
ATOM   1571 C CB  . PHE A 1 260 ? 15.085  6.934   87.283  1.00 81.06  ? 260  PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 260 ? 15.377  7.841   86.127  1.00 82.01  ? 260  PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 260 ? 16.619  8.449   85.996  1.00 82.67  ? 260  PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 260 ? 14.402  8.093   85.167  1.00 83.12  ? 260  PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 260 ? 16.887  9.298   84.924  1.00 84.35  ? 260  PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 260 ? 14.658  8.939   84.093  1.00 84.92  ? 260  PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 260 ? 15.905  9.544   83.971  1.00 84.81  ? 260  PHE A CZ  1 
ATOM   1578 N N   . ASN A 1 261 ? 14.511  5.952   90.291  1.00 83.08  ? 261  ASN A N   1 
ATOM   1579 C CA  . ASN A 1 261 ? 13.662  5.146   91.157  1.00 83.97  ? 261  ASN A CA  1 
ATOM   1580 C C   . ASN A 1 261 ? 13.598  5.669   92.591  1.00 84.01  ? 261  ASN A C   1 
ATOM   1581 O O   . ASN A 1 261 ? 13.452  4.894   93.537  1.00 83.95  ? 261  ASN A O   1 
ATOM   1582 C CB  . ASN A 1 261 ? 14.155  3.697   91.150  1.00 85.13  ? 261  ASN A CB  1 
ATOM   1583 C CG  . ASN A 1 261 ? 13.019  2.699   91.081  1.00 86.42  ? 261  ASN A CG  1 
ATOM   1584 O OD1 . ASN A 1 261 ? 12.172  2.643   91.971  1.00 87.23  ? 261  ASN A OD1 1 
ATOM   1585 N ND2 . ASN A 1 261 ? 12.993  1.905   90.015  1.00 87.40  ? 261  ASN A ND2 1 
ATOM   1586 N N   . GLN A 1 262 ? 13.705  6.986   92.744  1.00 84.03  ? 262  GLN A N   1 
ATOM   1587 C CA  . GLN A 1 262 ? 13.649  7.623   94.057  1.00 83.59  ? 262  GLN A CA  1 
ATOM   1588 C C   . GLN A 1 262 ? 14.814  7.183   94.939  1.00 82.65  ? 262  GLN A C   1 
ATOM   1589 O O   . GLN A 1 262 ? 14.860  7.504   96.127  1.00 82.80  ? 262  GLN A O   1 
ATOM   1590 C CB  . GLN A 1 262 ? 12.333  7.278   94.758  1.00 84.97  ? 262  GLN A CB  1 
ATOM   1591 C CG  . GLN A 1 262 ? 11.102  7.335   93.867  1.00 87.31  ? 262  GLN A CG  1 
ATOM   1592 C CD  . GLN A 1 262 ? 10.845  8.717   93.310  1.00 88.73  ? 262  GLN A CD  1 
ATOM   1593 O OE1 . GLN A 1 262 ? 11.677  9.275   92.594  1.00 89.29  ? 262  GLN A OE1 1 
ATOM   1594 N NE2 . GLN A 1 262 ? 9.686   9.279   93.635  1.00 90.17  ? 262  GLN A NE2 1 
ATOM   1595 N N   . GLY A 1 263 ? 15.750  6.444   94.353  1.00 81.21  ? 263  GLY A N   1 
ATOM   1596 C CA  . GLY A 1 263 ? 16.896  5.969   95.106  1.00 78.10  ? 263  GLY A CA  1 
ATOM   1597 C C   . GLY A 1 263 ? 16.627  4.633   95.770  1.00 76.71  ? 263  GLY A C   1 
ATOM   1598 O O   . GLY A 1 263 ? 17.435  4.155   96.567  1.00 75.67  ? 263  GLY A O   1 
ATOM   1599 N N   . LYS A 1 264 ? 15.488  4.029   95.442  1.00 76.53  ? 264  LYS A N   1 
ATOM   1600 C CA  . LYS A 1 264 ? 15.110  2.740   96.011  1.00 76.28  ? 264  LYS A CA  1 
ATOM   1601 C C   . LYS A 1 264 ? 15.467  1.548   95.128  1.00 75.04  ? 264  LYS A C   1 
ATOM   1602 O O   . LYS A 1 264 ? 15.557  1.661   93.904  1.00 74.31  ? 264  LYS A O   1 
ATOM   1603 C CB  . LYS A 1 264 ? 13.603  2.695   96.303  1.00 78.29  ? 264  LYS A CB  1 
ATOM   1604 C CG  . LYS A 1 264 ? 13.190  3.248   97.664  1.00 82.72  ? 264  LYS A CG  1 
ATOM   1605 C CD  . LYS A 1 264 ? 12.799  4.718   97.604  1.00 84.11  ? 264  LYS A CD  1 
ATOM   1606 C CE  . LYS A 1 264 ? 11.519  4.917   96.801  1.00 85.25  ? 264  LYS A CE  1 
ATOM   1607 N NZ  . LYS A 1 264 ? 10.374  4.137   97.348  1.00 86.24  ? 264  LYS A NZ  1 
ATOM   1608 N N   . LEU A 1 265 ? 15.668  0.404   95.775  1.00 72.88  ? 265  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 265 ? 15.979  -0.846  95.096  1.00 70.00  ? 265  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 265 ? 14.776  -1.763  95.281  1.00 68.53  ? 265  LEU A C   1 
ATOM   1611 O O   . LEU A 1 265 ? 14.049  -1.647  96.265  1.00 68.08  ? 265  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 265 ? 17.223  -1.497  95.707  1.00 69.94  ? 265  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 265 ? 18.595  -1.120  95.139  1.00 71.50  ? 265  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 265 ? 18.727  0.388   95.009  1.00 73.37  ? 265  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 265 ? 19.676  -1.680  96.046  1.00 70.89  ? 265  LEU A CD2 1 
ATOM   1616 N N   . PRO A 1 266 ? 14.547  -2.687  94.336  1.00 67.65  ? 266  PRO A N   1 
ATOM   1617 C CA  . PRO A 1 266 ? 15.354  -2.895  93.133  1.00 66.61  ? 266  PRO A CA  1 
ATOM   1618 C C   . PRO A 1 266 ? 14.861  -2.083  91.937  1.00 65.41  ? 266  PRO A C   1 
ATOM   1619 O O   . PRO A 1 266 ? 13.809  -1.446  91.986  1.00 66.45  ? 266  PRO A O   1 
ATOM   1620 C CB  . PRO A 1 266 ? 15.206  -4.387  92.896  1.00 67.39  ? 266  PRO A CB  1 
ATOM   1621 C CG  . PRO A 1 266 ? 13.759  -4.591  93.216  1.00 67.11  ? 266  PRO A CG  1 
ATOM   1622 C CD  . PRO A 1 266 ? 13.575  -3.784  94.499  1.00 67.45  ? 266  PRO A CD  1 
ATOM   1623 N N   . PHE A 1 267 ? 15.641  -2.123  90.863  1.00 63.15  ? 267  PHE A N   1 
ATOM   1624 C CA  . PHE A 1 267 ? 15.312  -1.436  89.623  1.00 61.32  ? 267  PHE A CA  1 
ATOM   1625 C C   . PHE A 1 267 ? 16.251  -1.986  88.559  1.00 60.30  ? 267  PHE A C   1 
ATOM   1626 O O   . PHE A 1 267 ? 17.351  -2.445  88.868  1.00 60.25  ? 267  PHE A O   1 
ATOM   1627 C CB  . PHE A 1 267 ? 15.481  0.083   89.777  1.00 58.31  ? 267  PHE A CB  1 
ATOM   1628 C CG  . PHE A 1 267 ? 16.901  0.564   89.659  1.00 58.04  ? 267  PHE A CG  1 
ATOM   1629 C CD1 . PHE A 1 267 ? 17.441  0.888   88.415  1.00 57.47  ? 267  PHE A CD1 1 
ATOM   1630 C CD2 . PHE A 1 267 ? 17.695  0.712   90.791  1.00 57.09  ? 267  PHE A CD2 1 
ATOM   1631 C CE1 . PHE A 1 267 ? 18.751  1.356   88.301  1.00 54.94  ? 267  PHE A CE1 1 
ATOM   1632 C CE2 . PHE A 1 267 ? 19.007  1.179   90.688  1.00 57.43  ? 267  PHE A CE2 1 
ATOM   1633 C CZ  . PHE A 1 267 ? 19.535  1.502   89.440  1.00 54.81  ? 267  PHE A CZ  1 
ATOM   1634 N N   . ALA A 1 268 ? 15.816  -1.955  87.307  1.00 59.28  ? 268  ALA A N   1 
ATOM   1635 C CA  . ALA A 1 268 ? 16.642  -2.476  86.233  1.00 56.51  ? 268  ALA A CA  1 
ATOM   1636 C C   . ALA A 1 268 ? 16.831  -1.480  85.104  1.00 55.74  ? 268  ALA A C   1 
ATOM   1637 O O   . ALA A 1 268 ? 15.926  -0.719  84.760  1.00 54.73  ? 268  ALA A O   1 
ATOM   1638 C CB  . ALA A 1 268 ? 16.035  -3.762  85.694  1.00 54.77  ? 268  ALA A CB  1 
ATOM   1639 N N   . ALA A 1 269 ? 18.031  -1.486  84.542  1.00 54.69  ? 269  ALA A N   1 
ATOM   1640 C CA  . ALA A 1 269 ? 18.366  -0.625  83.422  1.00 54.71  ? 269  ALA A CA  1 
ATOM   1641 C C   . ALA A 1 269 ? 18.732  -1.593  82.303  1.00 54.33  ? 269  ALA A C   1 
ATOM   1642 O O   . ALA A 1 269 ? 19.151  -2.722  82.566  1.00 54.04  ? 269  ALA A O   1 
ATOM   1643 C CB  . ALA A 1 269 ? 19.552  0.270   83.770  1.00 54.24  ? 269  ALA A CB  1 
ATOM   1644 N N   . ALA A 1 270 ? 18.566  -1.171  81.057  1.00 52.01  ? 270  ALA A N   1 
ATOM   1645 C CA  . ALA A 1 270 ? 18.887  -2.052  79.949  1.00 49.23  ? 270  ALA A CA  1 
ATOM   1646 C C   . ALA A 1 270 ? 19.439  -1.300  78.758  1.00 48.33  ? 270  ALA A C   1 
ATOM   1647 O O   . ALA A 1 270 ? 19.316  -0.078  78.658  1.00 48.67  ? 270  ALA A O   1 
ATOM   1648 C CB  . ALA A 1 270 ? 17.653  -2.841  79.535  1.00 45.74  ? 270  ALA A CB  1 
ATOM   1649 N N   . GLN A 1 271 ? 20.054  -2.052  77.858  1.00 46.04  ? 271  GLN A N   1 
ATOM   1650 C CA  . GLN A 1 271 ? 20.624  -1.494  76.650  1.00 45.80  ? 271  GLN A CA  1 
ATOM   1651 C C   . GLN A 1 271 ? 20.477  -2.494  75.516  1.00 46.42  ? 271  GLN A C   1 
ATOM   1652 O O   . GLN A 1 271 ? 20.591  -3.705  75.722  1.00 48.58  ? 271  GLN A O   1 
ATOM   1653 C CB  . GLN A 1 271 ? 22.105  -1.185  76.855  1.00 47.31  ? 271  GLN A CB  1 
ATOM   1654 C CG  . GLN A 1 271 ? 22.438  0.284   76.820  1.00 48.58  ? 271  GLN A CG  1 
ATOM   1655 C CD  . GLN A 1 271 ? 23.925  0.536   76.737  1.00 48.73  ? 271  GLN A CD  1 
ATOM   1656 O OE1 . GLN A 1 271 ? 24.674  0.210   77.656  1.00 50.24  ? 271  GLN A OE1 1 
ATOM   1657 N NE2 . GLN A 1 271 ? 24.363  1.115   75.626  1.00 50.69  ? 271  GLN A NE2 1 
ATOM   1658 N N   . ILE A 1 272 ? 20.206  -1.982  74.324  1.00 43.22  ? 272  ILE A N   1 
ATOM   1659 C CA  . ILE A 1 272 ? 20.080  -2.815  73.141  1.00 42.89  ? 272  ILE A CA  1 
ATOM   1660 C C   . ILE A 1 272 ? 20.975  -2.166  72.106  1.00 42.91  ? 272  ILE A C   1 
ATOM   1661 O O   . ILE A 1 272 ? 20.583  -1.200  71.453  1.00 43.80  ? 272  ILE A O   1 
ATOM   1662 C CB  . ILE A 1 272 ? 18.637  -2.852  72.613  1.00 45.71  ? 272  ILE A CB  1 
ATOM   1663 C CG1 . ILE A 1 272 ? 17.707  -3.433  73.677  1.00 45.16  ? 272  ILE A CG1 1 
ATOM   1664 C CG2 . ILE A 1 272 ? 18.567  -3.696  71.347  1.00 42.84  ? 272  ILE A CG2 1 
ATOM   1665 C CD1 . ILE A 1 272 ? 16.264  -3.492  73.242  1.00 48.19  ? 272  ILE A CD1 1 
ATOM   1666 N N   . GLY A 1 273 ? 22.188  -2.689  71.976  1.00 43.42  ? 273  GLY A N   1 
ATOM   1667 C CA  . GLY A 1 273 ? 23.132  -2.135  71.027  1.00 44.11  ? 273  GLY A CA  1 
ATOM   1668 C C   . GLY A 1 273 ? 24.208  -3.117  70.608  1.00 45.66  ? 273  GLY A C   1 
ATOM   1669 O O   . GLY A 1 273 ? 24.181  -4.290  70.983  1.00 44.94  ? 273  GLY A O   1 
ATOM   1670 N N   . ASN A 1 274 ? 25.172  -2.625  69.839  1.00 48.06  ? 274  ASN A N   1 
ATOM   1671 C CA  . ASN A 1 274 ? 26.255  -3.455  69.338  1.00 50.58  ? 274  ASN A CA  1 
ATOM   1672 C C   . ASN A 1 274 ? 27.449  -3.609  70.276  1.00 50.96  ? 274  ASN A C   1 
ATOM   1673 O O   . ASN A 1 274 ? 27.813  -2.690  71.010  1.00 51.26  ? 274  ASN A O   1 
ATOM   1674 C CB  . ASN A 1 274 ? 26.736  -2.907  67.995  1.00 51.83  ? 274  ASN A CB  1 
ATOM   1675 C CG  . ASN A 1 274 ? 25.636  -2.887  66.949  1.00 55.56  ? 274  ASN A CG  1 
ATOM   1676 O OD1 . ASN A 1 274 ? 25.088  -3.930  66.588  1.00 53.80  ? 274  ASN A OD1 1 
ATOM   1677 N ND2 . ASN A 1 274 ? 25.308  -1.696  66.456  1.00 56.86  ? 274  ASN A ND2 1 
ATOM   1678 N N   . SER A 1 275 ? 28.048  -4.795  70.236  1.00 51.14  ? 275  SER A N   1 
ATOM   1679 C CA  . SER A 1 275 ? 29.222  -5.121  71.034  1.00 50.68  ? 275  SER A CA  1 
ATOM   1680 C C   . SER A 1 275 ? 30.203  -5.813  70.100  1.00 49.27  ? 275  SER A C   1 
ATOM   1681 O O   . SER A 1 275 ? 29.795  -6.472  69.146  1.00 47.26  ? 275  SER A O   1 
ATOM   1682 C CB  . SER A 1 275 ? 28.854  -6.055  72.188  1.00 51.98  ? 275  SER A CB  1 
ATOM   1683 O OG  . SER A 1 275 ? 28.078  -5.378  73.160  1.00 55.45  ? 275  SER A OG  1 
ATOM   1684 N N   . PHE A 1 276 ? 31.495  -5.666  70.369  1.00 50.21  ? 276  PHE A N   1 
ATOM   1685 C CA  . PHE A 1 276 ? 32.502  -6.278  69.515  1.00 49.74  ? 276  PHE A CA  1 
ATOM   1686 C C   . PHE A 1 276 ? 33.402  -7.252  70.264  1.00 50.73  ? 276  PHE A C   1 
ATOM   1687 O O   . PHE A 1 276 ? 33.857  -6.974  71.373  1.00 52.71  ? 276  PHE A O   1 
ATOM   1688 C CB  . PHE A 1 276 ? 33.357  -5.195  68.858  1.00 46.75  ? 276  PHE A CB  1 
ATOM   1689 C CG  . PHE A 1 276 ? 32.563  -4.154  68.119  1.00 46.97  ? 276  PHE A CG  1 
ATOM   1690 C CD1 . PHE A 1 276 ? 31.784  -3.231  68.809  1.00 45.90  ? 276  PHE A CD1 1 
ATOM   1691 C CD2 . PHE A 1 276 ? 32.612  -4.082  66.730  1.00 46.99  ? 276  PHE A CD2 1 
ATOM   1692 C CE1 . PHE A 1 276 ? 31.067  -2.249  68.128  1.00 46.88  ? 276  PHE A CE1 1 
ATOM   1693 C CE2 . PHE A 1 276 ? 31.900  -3.105  66.039  1.00 46.60  ? 276  PHE A CE2 1 
ATOM   1694 C CZ  . PHE A 1 276 ? 31.125  -2.185  66.740  1.00 47.15  ? 276  PHE A CZ  1 
ATOM   1695 N N   . ARG A 1 277 ? 33.654  -8.396  69.640  1.00 50.33  ? 277  ARG A N   1 
ATOM   1696 C CA  . ARG A 1 277 ? 34.504  -9.428  70.218  1.00 52.62  ? 277  ARG A CA  1 
ATOM   1697 C C   . ARG A 1 277 ? 35.381  -9.945  69.084  1.00 52.68  ? 277  ARG A C   1 
ATOM   1698 O O   . ARG A 1 277 ? 34.894  -10.620 68.177  1.00 52.05  ? 277  ARG A O   1 
ATOM   1699 C CB  . ARG A 1 277 ? 33.652  -10.575 70.769  1.00 52.34  ? 277  ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 277 ? 32.238  -10.160 71.130  1.00 56.86  ? 277  ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 277 ? 32.020  -9.995  72.622  1.00 54.23  ? 277  ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 277 ? 31.887  -11.282 73.292  1.00 52.12  ? 277  ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 277 ? 31.300  -11.450 74.472  1.00 54.67  ? 277  ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 277 ? 30.786  -10.408 75.114  1.00 52.45  ? 277  ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 277 ? 31.221  -12.662 75.009  1.00 54.27  ? 277  ARG A NH2 1 
ATOM   1706 N N   . ASN A 1 278 ? 36.665  -9.613  69.125  1.00 53.37  ? 278  ASN A N   1 
ATOM   1707 C CA  . ASN A 1 278 ? 37.591  -10.053 68.093  1.00 54.72  ? 278  ASN A CA  1 
ATOM   1708 C C   . ASN A 1 278 ? 37.841  -11.550 68.244  1.00 55.53  ? 278  ASN A C   1 
ATOM   1709 O O   . ASN A 1 278 ? 38.919  -11.980 68.655  1.00 57.02  ? 278  ASN A O   1 
ATOM   1710 C CB  . ASN A 1 278 ? 38.899  -9.269  68.204  1.00 56.94  ? 278  ASN A CB  1 
ATOM   1711 C CG  . ASN A 1 278 ? 39.846  -9.550  67.056  1.00 59.77  ? 278  ASN A CG  1 
ATOM   1712 O OD1 . ASN A 1 278 ? 39.418  -9.886  65.952  1.00 59.99  ? 278  ASN A OD1 1 
ATOM   1713 N ND2 . ASN A 1 278 ? 41.140  -9.394  67.306  1.00 61.75  ? 278  ASN A ND2 1 
ATOM   1714 N N   . GLU A 1 279 ? 36.819  -12.331 67.909  1.00 55.27  ? 279  GLU A N   1 
ATOM   1715 C CA  . GLU A 1 279 ? 36.861  -13.784 67.997  1.00 56.31  ? 279  GLU A CA  1 
ATOM   1716 C C   . GLU A 1 279 ? 38.086  -14.341 67.257  1.00 57.55  ? 279  GLU A C   1 
ATOM   1717 O O   . GLU A 1 279 ? 38.365  -13.959 66.118  1.00 56.08  ? 279  GLU A O   1 
ATOM   1718 C CB  . GLU A 1 279 ? 35.566  -14.356 67.408  1.00 56.98  ? 279  GLU A CB  1 
ATOM   1719 C CG  . GLU A 1 279 ? 34.904  -15.459 68.230  1.00 59.06  ? 279  GLU A CG  1 
ATOM   1720 C CD  . GLU A 1 279 ? 34.444  -14.998 69.607  1.00 58.20  ? 279  GLU A CD  1 
ATOM   1721 O OE1 . GLU A 1 279 ? 33.730  -13.975 69.699  1.00 53.98  ? 279  GLU A OE1 1 
ATOM   1722 O OE2 . GLU A 1 279 ? 34.790  -15.672 70.600  1.00 57.27  ? 279  GLU A OE2 1 
ATOM   1723 N N   . ILE A 1 280 ? 38.810  -15.242 67.916  1.00 57.18  ? 280  ILE A N   1 
ATOM   1724 C CA  . ILE A 1 280 ? 40.013  -15.840 67.344  1.00 58.83  ? 280  ILE A CA  1 
ATOM   1725 C C   . ILE A 1 280 ? 39.789  -16.453 65.971  1.00 60.48  ? 280  ILE A C   1 
ATOM   1726 O O   . ILE A 1 280 ? 40.302  -15.952 64.970  1.00 61.25  ? 280  ILE A O   1 
ATOM   1727 C CB  . ILE A 1 280 ? 40.598  -16.933 68.268  1.00 57.36  ? 280  ILE A CB  1 
ATOM   1728 C CG1 . ILE A 1 280 ? 40.989  -16.323 69.614  1.00 56.54  ? 280  ILE A CG1 1 
ATOM   1729 C CG2 . ILE A 1 280 ? 41.824  -17.566 67.618  1.00 55.30  ? 280  ILE A CG2 1 
ATOM   1730 C CD1 . ILE A 1 280 ? 41.443  -17.342 70.640  1.00 56.60  ? 280  ILE A CD1 1 
ATOM   1731 N N   . SER A 1 281 ? 39.026  -17.539 65.925  1.00 61.70  ? 281  SER A N   1 
ATOM   1732 C CA  . SER A 1 281 ? 38.760  -18.215 64.663  1.00 62.43  ? 281  SER A CA  1 
ATOM   1733 C C   . SER A 1 281 ? 37.279  -18.545 64.483  1.00 61.41  ? 281  SER A C   1 
ATOM   1734 O O   . SER A 1 281 ? 36.850  -19.677 64.721  1.00 60.67  ? 281  SER A O   1 
ATOM   1735 C CB  . SER A 1 281 ? 39.596  -19.496 64.580  1.00 63.49  ? 281  SER A CB  1 
ATOM   1736 O OG  . SER A 1 281 ? 39.491  -20.095 63.303  1.00 69.53  ? 281  SER A OG  1 
ATOM   1737 N N   . PRO A 1 282 ? 36.477  -17.557 64.056  1.00 61.19  ? 282  PRO A N   1 
ATOM   1738 C CA  . PRO A 1 282 ? 35.039  -17.740 63.842  1.00 61.47  ? 282  PRO A CA  1 
ATOM   1739 C C   . PRO A 1 282 ? 34.724  -18.668 62.673  1.00 62.20  ? 282  PRO A C   1 
ATOM   1740 O O   . PRO A 1 282 ? 35.084  -18.387 61.531  1.00 61.08  ? 282  PRO A O   1 
ATOM   1741 C CB  . PRO A 1 282 ? 34.544  -16.318 63.603  1.00 60.76  ? 282  PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 282 ? 35.710  -15.683 62.912  1.00 61.87  ? 282  PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 282 ? 36.878  -16.173 63.740  1.00 62.93  ? 282  PRO A CD  1 
ATOM   1744 N N   . ARG A 1 283 ? 34.048  -19.773 62.968  1.00 63.92  ? 283  ARG A N   1 
ATOM   1745 C CA  . ARG A 1 283 ? 33.685  -20.747 61.947  1.00 67.06  ? 283  ARG A CA  1 
ATOM   1746 C C   . ARG A 1 283 ? 32.375  -21.439 62.313  1.00 66.19  ? 283  ARG A C   1 
ATOM   1747 O O   . ARG A 1 283 ? 32.223  -22.645 62.120  1.00 66.45  ? 283  ARG A O   1 
ATOM   1748 C CB  . ARG A 1 283 ? 34.803  -21.787 61.797  1.00 72.82  ? 283  ARG A CB  1 
ATOM   1749 C CG  . ARG A 1 283 ? 36.151  -21.186 61.411  1.00 81.25  ? 283  ARG A CG  1 
ATOM   1750 C CD  . ARG A 1 283 ? 37.259  -22.232 61.332  1.00 87.49  ? 283  ARG A CD  1 
ATOM   1751 N NE  . ARG A 1 283 ? 38.559  -21.617 61.057  1.00 92.90  ? 283  ARG A NE  1 
ATOM   1752 C CZ  . ARG A 1 283 ? 39.702  -22.289 60.938  1.00 95.21  ? 283  ARG A CZ  1 
ATOM   1753 N NH1 . ARG A 1 283 ? 39.718  -23.610 61.068  1.00 95.92  ? 283  ARG A NH1 1 
ATOM   1754 N NH2 . ARG A 1 283 ? 40.833  -21.638 60.693  1.00 95.86  ? 283  ARG A NH2 1 
ATOM   1755 N N   . SER A 1 284 ? 31.431  -20.667 62.845  1.00 64.52  ? 284  SER A N   1 
ATOM   1756 C CA  . SER A 1 284 ? 30.132  -21.204 63.241  1.00 63.19  ? 284  SER A CA  1 
ATOM   1757 C C   . SER A 1 284 ? 28.983  -20.399 62.642  1.00 61.47  ? 284  SER A C   1 
ATOM   1758 O O   . SER A 1 284 ? 27.877  -20.388 63.183  1.00 58.94  ? 284  SER A O   1 
ATOM   1759 C CB  . SER A 1 284 ? 30.003  -21.210 64.767  1.00 63.66  ? 284  SER A CB  1 
ATOM   1760 O OG  . SER A 1 284 ? 30.966  -22.059 65.364  1.00 63.77  ? 284  SER A OG  1 
ATOM   1761 N N   . GLY A 1 285 ? 29.245  -19.734 61.521  1.00 59.40  ? 285  GLY A N   1 
ATOM   1762 C CA  . GLY A 1 285 ? 28.211  -18.934 60.891  1.00 58.46  ? 285  GLY A CA  1 
ATOM   1763 C C   . GLY A 1 285 ? 27.854  -17.765 61.786  1.00 57.42  ? 285  GLY A C   1 
ATOM   1764 O O   . GLY A 1 285 ? 28.745  -17.079 62.288  1.00 57.96  ? 285  GLY A O   1 
ATOM   1765 N N   . LEU A 1 286 ? 26.559  -17.539 61.994  1.00 56.23  ? 286  LEU A N   1 
ATOM   1766 C CA  . LEU A 1 286 ? 26.100  -16.444 62.844  1.00 53.54  ? 286  LEU A CA  1 
ATOM   1767 C C   . LEU A 1 286 ? 26.321  -16.734 64.324  1.00 54.50  ? 286  LEU A C   1 
ATOM   1768 O O   . LEU A 1 286 ? 26.172  -15.845 65.161  1.00 57.40  ? 286  LEU A O   1 
ATOM   1769 C CB  . LEU A 1 286 ? 24.614  -16.162 62.602  1.00 50.65  ? 286  LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 286 ? 24.233  -15.446 61.304  1.00 49.93  ? 286  LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 286 ? 22.715  -15.364 61.195  1.00 49.84  ? 286  LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 286 ? 24.850  -14.050 61.283  1.00 46.74  ? 286  LEU A CD2 1 
ATOM   1773 N N   . ILE A 1 287 ? 26.673  -17.975 64.646  1.00 52.63  ? 287  ILE A N   1 
ATOM   1774 C CA  . ILE A 1 287 ? 26.913  -18.364 66.033  1.00 51.28  ? 287  ILE A CA  1 
ATOM   1775 C C   . ILE A 1 287 ? 28.142  -17.669 66.621  1.00 50.29  ? 287  ILE A C   1 
ATOM   1776 O O   . ILE A 1 287 ? 28.204  -17.428 67.827  1.00 50.85  ? 287  ILE A O   1 
ATOM   1777 C CB  . ILE A 1 287 ? 27.095  -19.898 66.161  1.00 51.45  ? 287  ILE A CB  1 
ATOM   1778 C CG1 . ILE A 1 287 ? 25.794  -20.608 65.789  1.00 50.81  ? 287  ILE A CG1 1 
ATOM   1779 C CG2 . ILE A 1 287 ? 27.511  -20.268 67.576  1.00 52.20  ? 287  ILE A CG2 1 
ATOM   1780 C CD1 . ILE A 1 287 ? 24.594  -20.134 66.572  1.00 52.11  ? 287  ILE A CD1 1 
ATOM   1781 N N   . ARG A 1 288 ? 29.115  -17.353 65.769  1.00 49.04  ? 288  ARG A N   1 
ATOM   1782 C CA  . ARG A 1 288 ? 30.339  -16.686 66.207  1.00 47.40  ? 288  ARG A CA  1 
ATOM   1783 C C   . ARG A 1 288 ? 30.723  -15.502 65.343  1.00 47.72  ? 288  ARG A C   1 
ATOM   1784 O O   . ARG A 1 288 ? 31.510  -15.638 64.404  1.00 48.67  ? 288  ARG A O   1 
ATOM   1785 C CB  . ARG A 1 288 ? 31.512  -17.661 66.223  1.00 48.93  ? 288  ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 288 ? 31.668  -18.381 67.522  1.00 54.40  ? 288  ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 288 ? 33.077  -18.239 68.053  1.00 55.52  ? 288  ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 288 ? 33.067  -18.194 69.509  1.00 57.47  ? 288  ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 288 ? 32.489  -19.110 70.277  1.00 59.76  ? 288  ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 288 ? 31.874  -20.151 69.731  1.00 59.38  ? 288  ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 288 ? 32.513  -18.979 71.593  1.00 64.11  ? 288  ARG A NH2 1 
ATOM   1792 N N   . VAL A 1 289 ? 30.176  -14.336 65.661  1.00 45.98  ? 289  VAL A N   1 
ATOM   1793 C CA  . VAL A 1 289 ? 30.495  -13.141 64.901  1.00 46.41  ? 289  VAL A CA  1 
ATOM   1794 C C   . VAL A 1 289 ? 31.370  -12.227 65.745  1.00 46.07  ? 289  VAL A C   1 
ATOM   1795 O O   . VAL A 1 289 ? 31.411  -12.349 66.968  1.00 48.34  ? 289  VAL A O   1 
ATOM   1796 C CB  . VAL A 1 289 ? 29.214  -12.398 64.466  1.00 46.42  ? 289  VAL A CB  1 
ATOM   1797 C CG1 . VAL A 1 289 ? 28.456  -13.241 63.453  1.00 42.81  ? 289  VAL A CG1 1 
ATOM   1798 C CG2 . VAL A 1 289 ? 28.334  -12.114 65.674  1.00 47.22  ? 289  VAL A CG2 1 
ATOM   1799 N N   . ARG A 1 290 ? 32.084  -11.324 65.087  1.00 46.70  ? 290  ARG A N   1 
ATOM   1800 C CA  . ARG A 1 290 ? 32.962  -10.393 65.782  1.00 48.78  ? 290  ARG A CA  1 
ATOM   1801 C C   . ARG A 1 290 ? 32.230  -9.090  66.030  1.00 48.34  ? 290  ARG A C   1 
ATOM   1802 O O   . ARG A 1 290 ? 32.784  -8.138  66.582  1.00 47.27  ? 290  ARG A O   1 
ATOM   1803 C CB  . ARG A 1 290 ? 34.208  -10.135 64.936  1.00 49.29  ? 290  ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 290 ? 35.122  -11.330 64.871  1.00 50.45  ? 290  ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 290 ? 36.137  -11.215 63.759  1.00 51.25  ? 290  ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 290 ? 37.120  -12.285 63.868  1.00 50.68  ? 290  ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 290 ? 37.945  -12.644 62.897  1.00 48.88  ? 290  ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 290 ? 37.907  -12.016 61.731  1.00 52.68  ? 290  ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 290 ? 38.809  -13.630 63.094  1.00 49.70  ? 290  ARG A NH2 1 
ATOM   1810 N N   . GLU A 1 291 ? 30.963  -9.073  65.639  1.00 48.92  ? 291  GLU A N   1 
ATOM   1811 C CA  . GLU A 1 291 ? 30.137  -7.888  65.764  1.00 48.75  ? 291  GLU A CA  1 
ATOM   1812 C C   . GLU A 1 291 ? 28.674  -8.328  65.799  1.00 48.67  ? 291  GLU A C   1 
ATOM   1813 O O   . GLU A 1 291 ? 28.203  -8.999  64.880  1.00 49.98  ? 291  GLU A O   1 
ATOM   1814 C CB  . GLU A 1 291 ? 30.400  -7.009  64.547  1.00 47.16  ? 291  GLU A CB  1 
ATOM   1815 C CG  . GLU A 1 291 ? 29.803  -5.642  64.573  1.00 51.48  ? 291  GLU A CG  1 
ATOM   1816 C CD  . GLU A 1 291 ? 30.017  -4.931  63.256  1.00 54.66  ? 291  GLU A CD  1 
ATOM   1817 O OE1 . GLU A 1 291 ? 31.158  -4.966  62.743  1.00 53.15  ? 291  GLU A OE1 1 
ATOM   1818 O OE2 . GLU A 1 291 ? 29.046  -4.341  62.736  1.00 57.99  ? 291  GLU A OE2 1 
ATOM   1819 N N   . PHE A 1 292 ? 27.957  -7.963  66.856  1.00 46.45  ? 292  PHE A N   1 
ATOM   1820 C CA  . PHE A 1 292 ? 26.553  -8.342  66.958  1.00 48.17  ? 292  PHE A CA  1 
ATOM   1821 C C   . PHE A 1 292 ? 25.733  -7.415  67.848  1.00 47.95  ? 292  PHE A C   1 
ATOM   1822 O O   . PHE A 1 292 ? 26.270  -6.543  68.534  1.00 48.05  ? 292  PHE A O   1 
ATOM   1823 C CB  . PHE A 1 292 ? 26.420  -9.783  67.471  1.00 45.93  ? 292  PHE A CB  1 
ATOM   1824 C CG  . PHE A 1 292 ? 27.038  -10.008 68.824  1.00 48.98  ? 292  PHE A CG  1 
ATOM   1825 C CD1 . PHE A 1 292 ? 28.413  -10.178 68.958  1.00 48.81  ? 292  PHE A CD1 1 
ATOM   1826 C CD2 . PHE A 1 292 ? 26.245  -10.039 69.968  1.00 49.40  ? 292  PHE A CD2 1 
ATOM   1827 C CE1 . PHE A 1 292 ? 28.991  -10.377 70.213  1.00 48.45  ? 292  PHE A CE1 1 
ATOM   1828 C CE2 . PHE A 1 292 ? 26.814  -10.236 71.228  1.00 49.64  ? 292  PHE A CE2 1 
ATOM   1829 C CZ  . PHE A 1 292 ? 28.189  -10.406 71.350  1.00 47.78  ? 292  PHE A CZ  1 
ATOM   1830 N N   . THR A 1 293 ? 24.421  -7.615  67.821  1.00 46.83  ? 293  THR A N   1 
ATOM   1831 C CA  . THR A 1 293 ? 23.504  -6.826  68.624  1.00 46.28  ? 293  THR A CA  1 
ATOM   1832 C C   . THR A 1 293 ? 23.131  -7.626  69.859  1.00 46.13  ? 293  THR A C   1 
ATOM   1833 O O   . THR A 1 293 ? 22.776  -8.801  69.761  1.00 45.39  ? 293  THR A O   1 
ATOM   1834 C CB  . THR A 1 293 ? 22.208  -6.506  67.855  1.00 44.77  ? 293  THR A CB  1 
ATOM   1835 O OG1 . THR A 1 293 ? 22.514  -5.703  66.710  1.00 48.96  ? 293  THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 293 ? 21.229  -5.759  68.749  1.00 43.78  ? 293  THR A CG2 1 
ATOM   1837 N N   . MET A 1 294 ? 23.222  -6.997  71.024  1.00 45.30  ? 294  MET A N   1 
ATOM   1838 C CA  . MET A 1 294 ? 22.858  -7.683  72.249  1.00 47.10  ? 294  MET A CA  1 
ATOM   1839 C C   . MET A 1 294 ? 21.981  -6.820  73.139  1.00 46.70  ? 294  MET A C   1 
ATOM   1840 O O   . MET A 1 294 ? 22.117  -5.596  73.182  1.00 45.41  ? 294  MET A O   1 
ATOM   1841 C CB  . MET A 1 294 ? 24.107  -8.133  73.017  1.00 49.12  ? 294  MET A CB  1 
ATOM   1842 C CG  . MET A 1 294 ? 25.001  -7.018  73.529  1.00 51.72  ? 294  MET A CG  1 
ATOM   1843 S SD  . MET A 1 294 ? 26.378  -7.638  74.549  1.00 60.91  ? 294  MET A SD  1 
ATOM   1844 C CE  . MET A 1 294 ? 26.124  -9.421  74.478  1.00 58.06  ? 294  MET A CE  1 
ATOM   1845 N N   . ALA A 1 295 ? 21.061  -7.476  73.832  1.00 46.32  ? 295  ALA A N   1 
ATOM   1846 C CA  . ALA A 1 295 ? 20.155  -6.803  74.744  1.00 47.41  ? 295  ALA A CA  1 
ATOM   1847 C C   . ALA A 1 295 ? 20.561  -7.252  76.138  1.00 48.02  ? 295  ALA A C   1 
ATOM   1848 O O   . ALA A 1 295 ? 20.475  -8.436  76.458  1.00 50.83  ? 295  ALA A O   1 
ATOM   1849 C CB  . ALA A 1 295 ? 18.716  -7.212  74.451  1.00 43.78  ? 295  ALA A CB  1 
ATOM   1850 N N   . GLU A 1 296 ? 21.023  -6.316  76.960  1.00 48.27  ? 296  GLU A N   1 
ATOM   1851 C CA  . GLU A 1 296 ? 21.439  -6.652  78.315  1.00 49.37  ? 296  GLU A CA  1 
ATOM   1852 C C   . GLU A 1 296 ? 20.644  -5.902  79.375  1.00 49.18  ? 296  GLU A C   1 
ATOM   1853 O O   . GLU A 1 296 ? 20.433  -4.691  79.279  1.00 48.54  ? 296  GLU A O   1 
ATOM   1854 C CB  . GLU A 1 296 ? 22.934  -6.371  78.501  1.00 49.91  ? 296  GLU A CB  1 
ATOM   1855 C CG  . GLU A 1 296 ? 23.829  -7.198  77.595  1.00 53.87  ? 296  GLU A CG  1 
ATOM   1856 C CD  . GLU A 1 296 ? 25.300  -7.064  77.939  1.00 53.23  ? 296  GLU A CD  1 
ATOM   1857 O OE1 . GLU A 1 296 ? 25.828  -5.932  77.885  1.00 50.98  ? 296  GLU A OE1 1 
ATOM   1858 O OE2 . GLU A 1 296 ? 25.927  -8.096  78.262  1.00 55.53  ? 296  GLU A OE2 1 
ATOM   1859 N N   . ILE A 1 297 ? 20.207  -6.641  80.386  1.00 48.24  ? 297  ILE A N   1 
ATOM   1860 C CA  . ILE A 1 297 ? 19.442  -6.081  81.487  1.00 48.51  ? 297  ILE A CA  1 
ATOM   1861 C C   . ILE A 1 297 ? 20.272  -6.156  82.766  1.00 50.72  ? 297  ILE A C   1 
ATOM   1862 O O   . ILE A 1 297 ? 20.780  -7.219  83.116  1.00 52.14  ? 297  ILE A O   1 
ATOM   1863 C CB  . ILE A 1 297 ? 18.138  -6.876  81.717  1.00 46.78  ? 297  ILE A CB  1 
ATOM   1864 C CG1 . ILE A 1 297 ? 17.303  -6.906  80.435  1.00 44.01  ? 297  ILE A CG1 1 
ATOM   1865 C CG2 . ILE A 1 297 ? 17.345  -6.254  82.858  1.00 47.76  ? 297  ILE A CG2 1 
ATOM   1866 C CD1 . ILE A 1 297 ? 16.082  -7.811  80.521  1.00 40.28  ? 297  ILE A CD1 1 
ATOM   1867 N N   . GLU A 1 298 ? 20.425  -5.028  83.452  1.00 53.05  ? 298  GLU A N   1 
ATOM   1868 C CA  . GLU A 1 298 ? 21.169  -5.001  84.709  1.00 53.80  ? 298  GLU A CA  1 
ATOM   1869 C C   . GLU A 1 298 ? 20.146  -4.775  85.816  1.00 54.87  ? 298  GLU A C   1 
ATOM   1870 O O   . GLU A 1 298 ? 19.658  -3.663  86.007  1.00 55.04  ? 298  GLU A O   1 
ATOM   1871 C CB  . GLU A 1 298 ? 22.204  -3.871  84.718  1.00 54.16  ? 298  GLU A CB  1 
ATOM   1872 C CG  . GLU A 1 298 ? 23.257  -3.953  83.618  1.00 57.62  ? 298  GLU A CG  1 
ATOM   1873 C CD  . GLU A 1 298 ? 24.007  -5.274  83.595  1.00 59.84  ? 298  GLU A CD  1 
ATOM   1874 O OE1 . GLU A 1 298 ? 24.547  -5.684  84.645  1.00 61.24  ? 298  GLU A OE1 1 
ATOM   1875 O OE2 . GLU A 1 298 ? 24.066  -5.900  82.516  1.00 61.45  ? 298  GLU A OE2 1 
ATOM   1876 N N   . HIS A 1 299 ? 19.818  -5.844  86.535  1.00 56.62  ? 299  HIS A N   1 
ATOM   1877 C CA  . HIS A 1 299 ? 18.836  -5.785  87.609  1.00 58.53  ? 299  HIS A CA  1 
ATOM   1878 C C   . HIS A 1 299 ? 19.502  -5.579  88.970  1.00 60.35  ? 299  HIS A C   1 
ATOM   1879 O O   . HIS A 1 299 ? 20.008  -6.522  89.576  1.00 59.68  ? 299  HIS A O   1 
ATOM   1880 C CB  . HIS A 1 299 ? 18.011  -7.077  87.598  1.00 59.46  ? 299  HIS A CB  1 
ATOM   1881 C CG  . HIS A 1 299 ? 16.799  -7.036  88.474  1.00 61.48  ? 299  HIS A CG  1 
ATOM   1882 N ND1 . HIS A 1 299 ? 16.826  -7.400  89.803  1.00 63.65  ? 299  HIS A ND1 1 
ATOM   1883 C CD2 . HIS A 1 299 ? 15.521  -6.674  88.209  1.00 61.46  ? 299  HIS A CD2 1 
ATOM   1884 C CE1 . HIS A 1 299 ? 15.616  -7.266  90.318  1.00 63.53  ? 299  HIS A CE1 1 
ATOM   1885 N NE2 . HIS A 1 299 ? 14.807  -6.826  89.372  1.00 63.55  ? 299  HIS A NE2 1 
ATOM   1886 N N   . PHE A 1 300 ? 19.496  -4.333  89.438  1.00 62.36  ? 300  PHE A N   1 
ATOM   1887 C CA  . PHE A 1 300 ? 20.097  -3.971  90.720  1.00 64.21  ? 300  PHE A CA  1 
ATOM   1888 C C   . PHE A 1 300 ? 19.164  -4.309  91.878  1.00 67.07  ? 300  PHE A C   1 
ATOM   1889 O O   . PHE A 1 300 ? 18.045  -3.800  91.957  1.00 67.63  ? 300  PHE A O   1 
ATOM   1890 C CB  . PHE A 1 300 ? 20.420  -2.478  90.727  1.00 62.41  ? 300  PHE A CB  1 
ATOM   1891 C CG  . PHE A 1 300 ? 21.405  -2.072  89.672  1.00 61.22  ? 300  PHE A CG  1 
ATOM   1892 C CD1 . PHE A 1 300 ? 22.765  -2.300  89.848  1.00 59.95  ? 300  PHE A CD1 1 
ATOM   1893 C CD2 . PHE A 1 300 ? 20.972  -1.482  88.489  1.00 60.64  ? 300  PHE A CD2 1 
ATOM   1894 C CE1 . PHE A 1 300 ? 23.681  -1.947  88.860  1.00 61.30  ? 300  PHE A CE1 1 
ATOM   1895 C CE2 . PHE A 1 300 ? 21.879  -1.126  87.494  1.00 60.23  ? 300  PHE A CE2 1 
ATOM   1896 C CZ  . PHE A 1 300 ? 23.235  -1.358  87.679  1.00 61.20  ? 300  PHE A CZ  1 
ATOM   1897 N N   . VAL A 1 301 ? 19.629  -5.162  92.784  1.00 68.44  ? 301  VAL A N   1 
ATOM   1898 C CA  . VAL A 1 301 ? 18.810  -5.570  93.916  1.00 70.52  ? 301  VAL A CA  1 
ATOM   1899 C C   . VAL A 1 301 ? 19.582  -5.558  95.232  1.00 72.70  ? 301  VAL A C   1 
ATOM   1900 O O   . VAL A 1 301 ? 20.809  -5.631  95.244  1.00 73.55  ? 301  VAL A O   1 
ATOM   1901 C CB  . VAL A 1 301 ? 18.237  -6.987  93.681  1.00 68.16  ? 301  VAL A CB  1 
ATOM   1902 C CG1 . VAL A 1 301 ? 19.369  -7.994  93.593  1.00 68.17  ? 301  VAL A CG1 1 
ATOM   1903 C CG2 . VAL A 1 301 ? 17.274  -7.357  94.789  1.00 69.06  ? 301  VAL A CG2 1 
ATOM   1904 N N   . ASP A 1 302 ? 18.850  -5.454  96.337  1.00 75.43  ? 302  ASP A N   1 
ATOM   1905 C CA  . ASP A 1 302 ? 19.452  -5.448  97.665  1.00 77.73  ? 302  ASP A CA  1 
ATOM   1906 C C   . ASP A 1 302 ? 20.012  -6.849  97.905  1.00 78.43  ? 302  ASP A C   1 
ATOM   1907 O O   . ASP A 1 302 ? 19.292  -7.842  97.789  1.00 77.81  ? 302  ASP A O   1 
ATOM   1908 C CB  . ASP A 1 302 ? 18.391  -5.122  98.722  1.00 79.58  ? 302  ASP A CB  1 
ATOM   1909 C CG  . ASP A 1 302 ? 18.993  -4.776  100.074 1.00 80.63  ? 302  ASP A CG  1 
ATOM   1910 O OD1 . ASP A 1 302 ? 19.819  -5.561  100.585 1.00 81.69  ? 302  ASP A OD1 1 
ATOM   1911 O OD2 . ASP A 1 302 ? 18.631  -3.717  100.629 1.00 81.75  ? 302  ASP A OD2 1 
ATOM   1912 N N   . PRO A 1 303 ? 21.307  -6.949  98.242  1.00 79.59  ? 303  PRO A N   1 
ATOM   1913 C CA  . PRO A 1 303 ? 21.930  -8.253  98.487  1.00 81.21  ? 303  PRO A CA  1 
ATOM   1914 C C   . PRO A 1 303 ? 21.229  -9.099  99.551  1.00 82.99  ? 303  PRO A C   1 
ATOM   1915 O O   . PRO A 1 303 ? 21.478  -10.300 99.659  1.00 83.80  ? 303  PRO A O   1 
ATOM   1916 C CB  . PRO A 1 303 ? 23.362  -7.884  98.874  1.00 80.53  ? 303  PRO A CB  1 
ATOM   1917 C CG  . PRO A 1 303 ? 23.210  -6.523  99.484  1.00 80.81  ? 303  PRO A CG  1 
ATOM   1918 C CD  . PRO A 1 303 ? 22.248  -5.855  98.539  1.00 79.92  ? 303  PRO A CD  1 
ATOM   1919 N N   . SER A 1 304 ? 20.349  -8.473  100.325 1.00 84.70  ? 304  SER A N   1 
ATOM   1920 C CA  . SER A 1 304 ? 19.617  -9.178  101.372 1.00 85.72  ? 304  SER A CA  1 
ATOM   1921 C C   . SER A 1 304 ? 18.154  -9.375  100.984 1.00 86.50  ? 304  SER A C   1 
ATOM   1922 O O   . SER A 1 304 ? 17.422  -10.111 101.644 1.00 86.16  ? 304  SER A O   1 
ATOM   1923 C CB  . SER A 1 304 ? 19.699  -8.400  102.686 1.00 85.86  ? 304  SER A CB  1 
ATOM   1924 O OG  . SER A 1 304 ? 19.127  -7.111  102.548 1.00 88.46  ? 304  SER A OG  1 
ATOM   1925 N N   . GLU A 1 305 ? 17.734  -8.710  99.912  1.00 87.91  ? 305  GLU A N   1 
ATOM   1926 C CA  . GLU A 1 305 ? 16.360  -8.817  99.432  1.00 89.29  ? 305  GLU A CA  1 
ATOM   1927 C C   . GLU A 1 305 ? 16.316  -9.476  98.055  1.00 88.99  ? 305  GLU A C   1 
ATOM   1928 O O   . GLU A 1 305 ? 15.518  -9.095  97.199  1.00 89.66  ? 305  GLU A O   1 
ATOM   1929 C CB  . GLU A 1 305 ? 15.712  -7.429  99.357  1.00 91.39  ? 305  GLU A CB  1 
ATOM   1930 C CG  . GLU A 1 305 ? 15.600  -6.700  100.694 1.00 95.18  ? 305  GLU A CG  1 
ATOM   1931 C CD  . GLU A 1 305 ? 14.715  -7.426  101.691 1.00 97.02  ? 305  GLU A CD  1 
ATOM   1932 O OE1 . GLU A 1 305 ? 15.080  -8.545  102.109 1.00 98.92  ? 305  GLU A OE1 1 
ATOM   1933 O OE2 . GLU A 1 305 ? 13.652  -6.878  102.056 1.00 98.17  ? 305  GLU A OE2 1 
ATOM   1934 N N   . LYS A 1 306 ? 17.183  -10.465 97.851  1.00 88.22  ? 306  LYS A N   1 
ATOM   1935 C CA  . LYS A 1 306 ? 17.256  -11.194 96.587  1.00 86.78  ? 306  LYS A CA  1 
ATOM   1936 C C   . LYS A 1 306 ? 16.013  -12.051 96.372  1.00 86.52  ? 306  LYS A C   1 
ATOM   1937 O O   . LYS A 1 306 ? 16.113  -13.253 96.120  1.00 86.75  ? 306  LYS A O   1 
ATOM   1938 C CB  . LYS A 1 306 ? 18.495  -12.094 96.569  1.00 87.18  ? 306  LYS A CB  1 
ATOM   1939 C CG  . LYS A 1 306 ? 19.608  -11.642 95.638  1.00 87.81  ? 306  LYS A CG  1 
ATOM   1940 C CD  . LYS A 1 306 ? 20.741  -12.661 95.632  1.00 88.93  ? 306  LYS A CD  1 
ATOM   1941 C CE  . LYS A 1 306 ? 21.794  -12.330 94.587  1.00 89.54  ? 306  LYS A CE  1 
ATOM   1942 N NZ  . LYS A 1 306 ? 22.432  -11.011 94.836  1.00 89.65  ? 306  LYS A NZ  1 
ATOM   1943 N N   . ASP A 1 307 ? 14.842  -11.431 96.470  1.00 86.12  ? 307  ASP A N   1 
ATOM   1944 C CA  . ASP A 1 307 ? 13.583  -12.142 96.287  1.00 86.24  ? 307  ASP A CA  1 
ATOM   1945 C C   . ASP A 1 307 ? 12.720  -11.375 95.279  1.00 85.28  ? 307  ASP A C   1 
ATOM   1946 O O   . ASP A 1 307 ? 12.436  -10.191 95.473  1.00 86.12  ? 307  ASP A O   1 
ATOM   1947 C CB  . ASP A 1 307 ? 12.862  -12.255 97.632  1.00 88.69  ? 307  ASP A CB  1 
ATOM   1948 C CG  . ASP A 1 307 ? 12.011  -13.502 97.735  1.00 91.62  ? 307  ASP A CG  1 
ATOM   1949 O OD1 . ASP A 1 307 ? 12.580  -14.614 97.696  1.00 93.54  ? 307  ASP A OD1 1 
ATOM   1950 O OD2 . ASP A 1 307 ? 10.775  -13.371 97.854  1.00 94.13  ? 307  ASP A OD2 1 
ATOM   1951 N N   . HIS A 1 308 ? 12.305  -12.043 94.206  1.00 82.75  ? 308  HIS A N   1 
ATOM   1952 C CA  . HIS A 1 308 ? 11.497  -11.388 93.180  1.00 79.81  ? 308  HIS A CA  1 
ATOM   1953 C C   . HIS A 1 308 ? 9.997   -11.613 93.358  1.00 78.25  ? 308  HIS A C   1 
ATOM   1954 O O   . HIS A 1 308 ? 9.515   -12.744 93.306  1.00 78.24  ? 308  HIS A O   1 
ATOM   1955 C CB  . HIS A 1 308 ? 11.927  -11.855 91.787  1.00 78.68  ? 308  HIS A CB  1 
ATOM   1956 C CG  . HIS A 1 308 ? 11.471  -10.950 90.685  1.00 77.06  ? 308  HIS A CG  1 
ATOM   1957 N ND1 . HIS A 1 308 ? 10.141  -10.692 90.435  1.00 75.11  ? 308  HIS A ND1 1 
ATOM   1958 C CD2 . HIS A 1 308 ? 12.171  -10.217 89.786  1.00 75.86  ? 308  HIS A CD2 1 
ATOM   1959 C CE1 . HIS A 1 308 ? 10.041  -9.840  89.431  1.00 74.75  ? 308  HIS A CE1 1 
ATOM   1960 N NE2 . HIS A 1 308 ? 11.258  -9.536  89.020  1.00 74.09  ? 308  HIS A NE2 1 
ATOM   1961 N N   . PRO A 1 309 ? 9.241   -10.520 93.553  1.00 77.02  ? 309  PRO A N   1 
ATOM   1962 C CA  . PRO A 1 309 ? 7.788   -10.508 93.750  1.00 75.49  ? 309  PRO A CA  1 
ATOM   1963 C C   . PRO A 1 309 ? 6.958   -11.243 92.700  1.00 75.12  ? 309  PRO A C   1 
ATOM   1964 O O   . PRO A 1 309 ? 5.860   -11.712 92.997  1.00 75.91  ? 309  PRO A O   1 
ATOM   1965 C CB  . PRO A 1 309 ? 7.460   -9.016  93.783  1.00 75.33  ? 309  PRO A CB  1 
ATOM   1966 C CG  . PRO A 1 309 ? 8.696   -8.414  94.360  1.00 75.52  ? 309  PRO A CG  1 
ATOM   1967 C CD  . PRO A 1 309 ? 9.778   -9.149  93.610  1.00 77.15  ? 309  PRO A CD  1 
ATOM   1968 N N   . LYS A 1 310 ? 7.475   -11.346 91.480  1.00 74.03  ? 310  LYS A N   1 
ATOM   1969 C CA  . LYS A 1 310 ? 6.735   -12.004 90.405  1.00 73.02  ? 310  LYS A CA  1 
ATOM   1970 C C   . LYS A 1 310 ? 7.121   -13.454 90.134  1.00 73.02  ? 310  LYS A C   1 
ATOM   1971 O O   . LYS A 1 310 ? 6.527   -14.097 89.269  1.00 71.58  ? 310  LYS A O   1 
ATOM   1972 C CB  . LYS A 1 310 ? 6.888   -11.219 89.100  1.00 73.27  ? 310  LYS A CB  1 
ATOM   1973 C CG  . LYS A 1 310 ? 6.271   -9.833  89.089  1.00 72.90  ? 310  LYS A CG  1 
ATOM   1974 C CD  . LYS A 1 310 ? 6.469   -9.192  87.724  1.00 72.68  ? 310  LYS A CD  1 
ATOM   1975 C CE  . LYS A 1 310 ? 5.814   -7.830  87.632  1.00 72.79  ? 310  LYS A CE  1 
ATOM   1976 N NZ  . LYS A 1 310 ? 5.969   -7.258  86.267  1.00 73.20  ? 310  LYS A NZ  1 
ATOM   1977 N N   . PHE A 1 311 ? 8.104   -13.974 90.863  1.00 73.47  ? 311  PHE A N   1 
ATOM   1978 C CA  . PHE A 1 311 ? 8.552   -15.344 90.641  1.00 73.90  ? 311  PHE A CA  1 
ATOM   1979 C C   . PHE A 1 311 ? 7.426   -16.356 90.470  1.00 75.06  ? 311  PHE A C   1 
ATOM   1980 O O   . PHE A 1 311 ? 7.512   -17.250 89.627  1.00 75.50  ? 311  PHE A O   1 
ATOM   1981 C CB  . PHE A 1 311 ? 9.457   -15.821 91.775  1.00 74.44  ? 311  PHE A CB  1 
ATOM   1982 C CG  . PHE A 1 311 ? 9.932   -17.236 91.599  1.00 75.34  ? 311  PHE A CG  1 
ATOM   1983 C CD1 . PHE A 1 311 ? 10.817  -17.563 90.575  1.00 75.54  ? 311  PHE A CD1 1 
ATOM   1984 C CD2 . PHE A 1 311 ? 9.458   -18.252 92.422  1.00 74.63  ? 311  PHE A CD2 1 
ATOM   1985 C CE1 . PHE A 1 311 ? 11.221  -18.881 90.373  1.00 75.58  ? 311  PHE A CE1 1 
ATOM   1986 C CE2 . PHE A 1 311 ? 9.856   -19.574 92.228  1.00 74.97  ? 311  PHE A CE2 1 
ATOM   1987 C CZ  . PHE A 1 311 ? 10.738  -19.889 91.201  1.00 75.26  ? 311  PHE A CZ  1 
ATOM   1988 N N   . GLN A 1 312 ? 6.374   -16.217 91.267  1.00 75.39  ? 312  GLN A N   1 
ATOM   1989 C CA  . GLN A 1 312 ? 5.253   -17.146 91.200  1.00 76.83  ? 312  GLN A CA  1 
ATOM   1990 C C   . GLN A 1 312 ? 4.585   -17.172 89.824  1.00 75.83  ? 312  GLN A C   1 
ATOM   1991 O O   . GLN A 1 312 ? 3.821   -18.087 89.518  1.00 76.00  ? 312  GLN A O   1 
ATOM   1992 C CB  . GLN A 1 312 ? 4.223   -16.797 92.279  1.00 80.29  ? 312  GLN A CB  1 
ATOM   1993 C CG  . GLN A 1 312 ? 3.227   -17.912 92.584  1.00 83.88  ? 312  GLN A CG  1 
ATOM   1994 C CD  . GLN A 1 312 ? 3.903   -19.188 93.066  1.00 86.46  ? 312  GLN A CD  1 
ATOM   1995 O OE1 . GLN A 1 312 ? 4.665   -19.175 94.035  1.00 86.67  ? 312  GLN A OE1 1 
ATOM   1996 N NE2 . GLN A 1 312 ? 3.622   -20.298 92.390  1.00 86.07  ? 312  GLN A NE2 1 
ATOM   1997 N N   . ASN A 1 313 ? 4.877   -16.173 88.995  1.00 74.15  ? 313  ASN A N   1 
ATOM   1998 C CA  . ASN A 1 313 ? 4.298   -16.100 87.656  1.00 74.02  ? 313  ASN A CA  1 
ATOM   1999 C C   . ASN A 1 313 ? 4.887   -17.136 86.706  1.00 74.06  ? 313  ASN A C   1 
ATOM   2000 O O   . ASN A 1 313 ? 4.268   -17.488 85.702  1.00 73.35  ? 313  ASN A O   1 
ATOM   2001 C CB  . ASN A 1 313 ? 4.496   -14.703 87.062  1.00 74.31  ? 313  ASN A CB  1 
ATOM   2002 C CG  . ASN A 1 313 ? 3.551   -13.678 87.654  1.00 74.01  ? 313  ASN A CG  1 
ATOM   2003 O OD1 . ASN A 1 313 ? 3.591   -12.500 87.296  1.00 72.74  ? 313  ASN A OD1 1 
ATOM   2004 N ND2 . ASN A 1 313 ? 2.689   -14.122 88.561  1.00 75.42  ? 313  ASN A ND2 1 
ATOM   2005 N N   . VAL A 1 314 ? 6.081   -17.623 87.028  1.00 74.85  ? 314  VAL A N   1 
ATOM   2006 C CA  . VAL A 1 314 ? 6.752   -18.613 86.193  1.00 75.09  ? 314  VAL A CA  1 
ATOM   2007 C C   . VAL A 1 314 ? 7.157   -19.853 86.983  1.00 75.65  ? 314  VAL A C   1 
ATOM   2008 O O   . VAL A 1 314 ? 7.726   -20.793 86.428  1.00 77.04  ? 314  VAL A O   1 
ATOM   2009 C CB  . VAL A 1 314 ? 8.021   -18.019 85.544  1.00 73.99  ? 314  VAL A CB  1 
ATOM   2010 C CG1 . VAL A 1 314 ? 7.651   -16.835 84.668  1.00 72.41  ? 314  VAL A CG1 1 
ATOM   2011 C CG2 . VAL A 1 314 ? 9.006   -17.597 86.624  1.00 70.78  ? 314  VAL A CG2 1 
ATOM   2012 N N   . ALA A 1 315 ? 6.853   -19.853 88.276  1.00 75.57  ? 315  ALA A N   1 
ATOM   2013 C CA  . ALA A 1 315 ? 7.198   -20.966 89.155  1.00 75.54  ? 315  ALA A CA  1 
ATOM   2014 C C   . ALA A 1 315 ? 6.684   -22.330 88.691  1.00 75.60  ? 315  ALA A C   1 
ATOM   2015 O O   . ALA A 1 315 ? 7.210   -23.362 89.107  1.00 74.74  ? 315  ALA A O   1 
ATOM   2016 C CB  . ALA A 1 315 ? 6.699   -20.679 90.567  1.00 75.35  ? 315  ALA A CB  1 
ATOM   2017 N N   . ASP A 1 316 ? 5.668   -22.339 87.832  1.00 75.87  ? 316  ASP A N   1 
ATOM   2018 C CA  . ASP A 1 316 ? 5.100   -23.596 87.348  1.00 77.72  ? 316  ASP A CA  1 
ATOM   2019 C C   . ASP A 1 316 ? 5.599   -24.064 85.987  1.00 77.73  ? 316  ASP A C   1 
ATOM   2020 O O   . ASP A 1 316 ? 4.978   -24.918 85.354  1.00 77.10  ? 316  ASP A O   1 
ATOM   2021 C CB  . ASP A 1 316 ? 3.574   -23.507 87.313  1.00 80.39  ? 316  ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 316 ? 2.932   -24.125 88.534  1.00 82.80  ? 316  ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 316 ? 3.133   -25.340 88.756  1.00 83.41  ? 316  ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 316 ? 2.229   -23.402 89.270  1.00 84.07  ? 316  ASP A OD2 1 
ATOM   2025 N N   . LEU A 1 317 ? 6.718   -23.513 85.535  1.00 77.73  ? 317  LEU A N   1 
ATOM   2026 C CA  . LEU A 1 317 ? 7.270   -23.910 84.248  1.00 77.32  ? 317  LEU A CA  1 
ATOM   2027 C C   . LEU A 1 317 ? 8.186   -25.116 84.404  1.00 76.88  ? 317  LEU A C   1 
ATOM   2028 O O   . LEU A 1 317 ? 8.942   -25.216 85.371  1.00 76.52  ? 317  LEU A O   1 
ATOM   2029 C CB  . LEU A 1 317 ? 8.056   -22.753 83.622  1.00 77.73  ? 317  LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 317 ? 7.272   -21.520 83.172  1.00 78.10  ? 317  LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 317 ? 8.243   -20.456 82.680  1.00 78.34  ? 317  LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 317 ? 6.290   -21.903 82.072  1.00 78.17  ? 317  LEU A CD2 1 
ATOM   2033 N N   . HIS A 1 318 ? 8.102   -26.038 83.452  1.00 77.05  ? 318  HIS A N   1 
ATOM   2034 C CA  . HIS A 1 318 ? 8.947   -27.224 83.463  1.00 77.02  ? 318  HIS A CA  1 
ATOM   2035 C C   . HIS A 1 318 ? 10.011  -27.035 82.391  1.00 75.44  ? 318  HIS A C   1 
ATOM   2036 O O   . HIS A 1 318 ? 9.710   -27.000 81.198  1.00 74.58  ? 318  HIS A O   1 
ATOM   2037 C CB  . HIS A 1 318 ? 8.123   -28.482 83.173  1.00 80.08  ? 318  HIS A CB  1 
ATOM   2038 C CG  . HIS A 1 318 ? 7.189   -28.859 84.281  1.00 83.64  ? 318  HIS A CG  1 
ATOM   2039 N ND1 . HIS A 1 318 ? 7.625   -29.138 85.558  1.00 86.02  ? 318  HIS A ND1 1 
ATOM   2040 C CD2 . HIS A 1 318 ? 5.842   -28.996 84.305  1.00 85.52  ? 318  HIS A CD2 1 
ATOM   2041 C CE1 . HIS A 1 318 ? 6.587   -29.430 86.322  1.00 86.61  ? 318  HIS A CE1 1 
ATOM   2042 N NE2 . HIS A 1 318 ? 5.494   -29.351 85.585  1.00 86.59  ? 318  HIS A NE2 1 
ATOM   2043 N N   . LEU A 1 319 ? 11.256  -26.898 82.829  1.00 73.94  ? 319  LEU A N   1 
ATOM   2044 C CA  . LEU A 1 319 ? 12.369  -26.697 81.914  1.00 73.53  ? 319  LEU A CA  1 
ATOM   2045 C C   . LEU A 1 319 ? 13.592  -27.507 82.336  1.00 72.55  ? 319  LEU A C   1 
ATOM   2046 O O   . LEU A 1 319 ? 13.787  -27.784 83.519  1.00 73.01  ? 319  LEU A O   1 
ATOM   2047 C CB  . LEU A 1 319 ? 12.702  -25.201 81.838  1.00 73.57  ? 319  LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 319 ? 12.661  -24.403 83.147  1.00 74.03  ? 319  LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 319 ? 13.810  -24.821 84.051  1.00 73.89  ? 319  LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 319 ? 12.749  -22.917 82.841  1.00 73.44  ? 319  LEU A CD2 1 
ATOM   2051 N N   . TYR A 1 320 ? 14.411  -27.891 81.361  1.00 70.30  ? 320  TYR A N   1 
ATOM   2052 C CA  . TYR A 1 320 ? 15.604  -28.679 81.640  1.00 68.67  ? 320  TYR A CA  1 
ATOM   2053 C C   . TYR A 1 320 ? 16.723  -27.864 82.280  1.00 68.59  ? 320  TYR A C   1 
ATOM   2054 O O   . TYR A 1 320 ? 17.199  -26.880 81.712  1.00 68.56  ? 320  TYR A O   1 
ATOM   2055 C CB  . TYR A 1 320 ? 16.123  -29.334 80.356  1.00 68.42  ? 320  TYR A CB  1 
ATOM   2056 C CG  . TYR A 1 320 ? 15.178  -30.352 79.756  1.00 68.85  ? 320  TYR A CG  1 
ATOM   2057 C CD1 . TYR A 1 320 ? 13.974  -29.957 79.177  1.00 68.91  ? 320  TYR A CD1 1 
ATOM   2058 C CD2 . TYR A 1 320 ? 15.483  -31.714 79.776  1.00 69.00  ? 320  TYR A CD2 1 
ATOM   2059 C CE1 . TYR A 1 320 ? 13.094  -30.891 78.633  1.00 71.26  ? 320  TYR A CE1 1 
ATOM   2060 C CE2 . TYR A 1 320 ? 14.610  -32.657 79.234  1.00 70.31  ? 320  TYR A CE2 1 
ATOM   2061 C CZ  . TYR A 1 320 ? 13.416  -32.237 78.665  1.00 71.09  ? 320  TYR A CZ  1 
ATOM   2062 O OH  . TYR A 1 320 ? 12.545  -33.158 78.130  1.00 71.40  ? 320  TYR A OH  1 
ATOM   2063 N N   . LEU A 1 321 ? 17.134  -28.286 83.470  1.00 67.99  ? 321  LEU A N   1 
ATOM   2064 C CA  . LEU A 1 321 ? 18.205  -27.625 84.202  1.00 66.62  ? 321  LEU A CA  1 
ATOM   2065 C C   . LEU A 1 321 ? 19.411  -28.555 84.245  1.00 66.58  ? 321  LEU A C   1 
ATOM   2066 O O   . LEU A 1 321 ? 19.266  -29.766 84.409  1.00 67.32  ? 321  LEU A O   1 
ATOM   2067 C CB  . LEU A 1 321 ? 17.750  -27.298 85.626  1.00 66.03  ? 321  LEU A CB  1 
ATOM   2068 C CG  . LEU A 1 321 ? 16.614  -26.282 85.763  1.00 65.34  ? 321  LEU A CG  1 
ATOM   2069 C CD1 . LEU A 1 321 ? 16.139  -26.231 87.205  1.00 66.56  ? 321  LEU A CD1 1 
ATOM   2070 C CD2 . LEU A 1 321 ? 17.096  -24.913 85.307  1.00 65.87  ? 321  LEU A CD2 1 
ATOM   2071 N N   . TYR A 1 322 ? 20.600  -27.987 84.089  1.00 66.27  ? 322  TYR A N   1 
ATOM   2072 C CA  . TYR A 1 322 ? 21.828  -28.768 84.109  1.00 67.85  ? 322  TYR A CA  1 
ATOM   2073 C C   . TYR A 1 322 ? 22.779  -28.112 85.102  1.00 68.27  ? 322  TYR A C   1 
ATOM   2074 O O   . TYR A 1 322 ? 23.701  -27.395 84.716  1.00 68.38  ? 322  TYR A O   1 
ATOM   2075 C CB  . TYR A 1 322 ? 22.434  -28.798 82.702  1.00 69.74  ? 322  TYR A CB  1 
ATOM   2076 C CG  . TYR A 1 322 ? 23.532  -29.819 82.488  1.00 71.53  ? 322  TYR A CG  1 
ATOM   2077 C CD1 . TYR A 1 322 ? 23.428  -31.108 83.012  1.00 73.49  ? 322  TYR A CD1 1 
ATOM   2078 C CD2 . TYR A 1 322 ? 24.651  -29.513 81.713  1.00 72.58  ? 322  TYR A CD2 1 
ATOM   2079 C CE1 . TYR A 1 322 ? 24.412  -32.068 82.768  1.00 73.79  ? 322  TYR A CE1 1 
ATOM   2080 C CE2 . TYR A 1 322 ? 25.639  -30.466 81.462  1.00 73.38  ? 322  TYR A CE2 1 
ATOM   2081 C CZ  . TYR A 1 322 ? 25.513  -31.739 81.992  1.00 73.57  ? 322  TYR A CZ  1 
ATOM   2082 O OH  . TYR A 1 322 ? 26.482  -32.684 81.741  1.00 75.00  ? 322  TYR A OH  1 
ATOM   2083 N N   . SER A 1 323 ? 22.534  -28.363 86.387  1.00 68.67  ? 323  SER A N   1 
ATOM   2084 C CA  . SER A 1 323 ? 23.332  -27.796 87.472  1.00 70.85  ? 323  SER A CA  1 
ATOM   2085 C C   . SER A 1 323 ? 24.815  -28.133 87.388  1.00 71.56  ? 323  SER A C   1 
ATOM   2086 O O   . SER A 1 323 ? 25.219  -29.036 86.657  1.00 71.57  ? 323  SER A O   1 
ATOM   2087 C CB  . SER A 1 323 ? 22.788  -28.267 88.824  1.00 71.12  ? 323  SER A CB  1 
ATOM   2088 O OG  . SER A 1 323 ? 22.868  -29.677 88.945  1.00 71.78  ? 323  SER A OG  1 
ATOM   2089 N N   . ALA A 1 324 ? 25.620  -27.396 88.147  1.00 73.12  ? 324  ALA A N   1 
ATOM   2090 C CA  . ALA A 1 324 ? 27.061  -27.614 88.176  1.00 75.01  ? 324  ALA A CA  1 
ATOM   2091 C C   . ALA A 1 324 ? 27.340  -29.007 88.724  1.00 76.93  ? 324  ALA A C   1 
ATOM   2092 O O   . ALA A 1 324 ? 28.240  -29.703 88.251  1.00 77.11  ? 324  ALA A O   1 
ATOM   2093 C CB  . ALA A 1 324 ? 27.733  -26.561 89.046  1.00 72.91  ? 324  ALA A CB  1 
ATOM   2094 N N   . LYS A 1 325 ? 26.562  -29.407 89.725  1.00 78.95  ? 325  LYS A N   1 
ATOM   2095 C CA  . LYS A 1 325 ? 26.719  -30.723 90.330  1.00 80.77  ? 325  LYS A CA  1 
ATOM   2096 C C   . LYS A 1 325 ? 26.513  -31.801 89.274  1.00 80.80  ? 325  LYS A C   1 
ATOM   2097 O O   . LYS A 1 325 ? 27.386  -32.637 89.049  1.00 82.23  ? 325  LYS A O   1 
ATOM   2098 C CB  . LYS A 1 325 ? 25.705  -30.919 91.461  1.00 83.37  ? 325  LYS A CB  1 
ATOM   2099 C CG  . LYS A 1 325 ? 25.977  -30.102 92.718  1.00 86.73  ? 325  LYS A CG  1 
ATOM   2100 C CD  . LYS A 1 325 ? 24.905  -30.355 93.778  1.00 89.30  ? 325  LYS A CD  1 
ATOM   2101 C CE  . LYS A 1 325 ? 24.814  -31.835 94.145  1.00 91.03  ? 325  LYS A CE  1 
ATOM   2102 N NZ  . LYS A 1 325 ? 23.692  -32.128 95.085  1.00 91.09  ? 325  LYS A NZ  1 
ATOM   2103 N N   . ALA A 1 326 ? 25.353  -31.770 88.625  1.00 79.66  ? 326  ALA A N   1 
ATOM   2104 C CA  . ALA A 1 326 ? 25.026  -32.746 87.593  1.00 79.32  ? 326  ALA A CA  1 
ATOM   2105 C C   . ALA A 1 326 ? 26.129  -32.850 86.543  1.00 79.00  ? 326  ALA A C   1 
ATOM   2106 O O   . ALA A 1 326 ? 26.271  -33.879 85.881  1.00 78.49  ? 326  ALA A O   1 
ATOM   2107 C CB  . ALA A 1 326 ? 23.703  -32.379 86.929  1.00 79.27  ? 326  ALA A CB  1 
ATOM   2108 N N   . GLN A 1 327 ? 26.910  -31.785 86.395  1.00 78.68  ? 327  GLN A N   1 
ATOM   2109 C CA  . GLN A 1 327 ? 27.993  -31.769 85.420  1.00 78.97  ? 327  GLN A CA  1 
ATOM   2110 C C   . GLN A 1 327 ? 29.252  -32.426 85.974  1.00 80.02  ? 327  GLN A C   1 
ATOM   2111 O O   . GLN A 1 327 ? 30.010  -33.055 85.236  1.00 79.53  ? 327  GLN A O   1 
ATOM   2112 C CB  . GLN A 1 327 ? 28.300  -30.331 84.997  1.00 77.69  ? 327  GLN A CB  1 
ATOM   2113 C CG  . GLN A 1 327 ? 27.136  -29.633 84.315  1.00 75.72  ? 327  GLN A CG  1 
ATOM   2114 C CD  . GLN A 1 327 ? 27.440  -28.191 83.967  1.00 74.63  ? 327  GLN A CD  1 
ATOM   2115 O OE1 . GLN A 1 327 ? 28.300  -27.907 83.132  1.00 72.84  ? 327  GLN A OE1 1 
ATOM   2116 N NE2 . GLN A 1 327 ? 26.737  -27.270 84.612  1.00 72.83  ? 327  GLN A NE2 1 
ATOM   2117 N N   . VAL A 1 328 ? 29.472  -32.277 87.276  1.00 81.59  ? 328  VAL A N   1 
ATOM   2118 C CA  . VAL A 1 328 ? 30.641  -32.870 87.913  1.00 83.51  ? 328  VAL A CA  1 
ATOM   2119 C C   . VAL A 1 328 ? 30.353  -34.315 88.306  1.00 84.38  ? 328  VAL A C   1 
ATOM   2120 O O   . VAL A 1 328 ? 31.233  -35.171 88.230  1.00 85.03  ? 328  VAL A O   1 
ATOM   2121 C CB  . VAL A 1 328 ? 31.061  -32.080 89.172  1.00 83.04  ? 328  VAL A CB  1 
ATOM   2122 C CG1 . VAL A 1 328 ? 32.293  -32.718 89.798  1.00 84.39  ? 328  VAL A CG1 1 
ATOM   2123 C CG2 . VAL A 1 328 ? 31.350  -30.634 88.805  1.00 83.21  ? 328  VAL A CG2 1 
ATOM   2124 N N   . SER A 1 329 ? 29.116  -34.584 88.717  1.00 86.26  ? 329  SER A N   1 
ATOM   2125 C CA  . SER A 1 329 ? 28.716  -35.931 89.114  1.00 86.82  ? 329  SER A CA  1 
ATOM   2126 C C   . SER A 1 329 ? 28.376  -36.770 87.883  1.00 87.60  ? 329  SER A C   1 
ATOM   2127 O O   . SER A 1 329 ? 27.790  -37.847 87.991  1.00 88.49  ? 329  SER A O   1 
ATOM   2128 C CB  . SER A 1 329 ? 27.513  -35.876 90.060  1.00 86.18  ? 329  SER A CB  1 
ATOM   2129 O OG  . SER A 1 329 ? 26.390  -35.285 89.432  1.00 87.57  ? 329  SER A OG  1 
ATOM   2130 N N   . GLY A 1 330 ? 28.741  -36.253 86.715  1.00 88.46  ? 330  GLY A N   1 
ATOM   2131 C CA  . GLY A 1 330 ? 28.509  -36.953 85.464  1.00 90.08  ? 330  GLY A CA  1 
ATOM   2132 C C   . GLY A 1 330 ? 27.111  -37.447 85.130  1.00 91.13  ? 330  GLY A C   1 
ATOM   2133 O O   . GLY A 1 330 ? 26.973  -38.454 84.436  1.00 91.74  ? 330  GLY A O   1 
ATOM   2134 N N   . GLN A 1 331 ? 26.073  -36.766 85.604  1.00 91.70  ? 331  GLN A N   1 
ATOM   2135 C CA  . GLN A 1 331 ? 24.714  -37.194 85.286  1.00 93.44  ? 331  GLN A CA  1 
ATOM   2136 C C   . GLN A 1 331 ? 24.054  -36.207 84.325  1.00 92.68  ? 331  GLN A C   1 
ATOM   2137 O O   . GLN A 1 331 ? 24.538  -35.092 84.142  1.00 92.18  ? 331  GLN A O   1 
ATOM   2138 C CB  . GLN A 1 331 ? 23.872  -37.336 86.557  1.00 96.17  ? 331  GLN A CB  1 
ATOM   2139 C CG  . GLN A 1 331 ? 23.613  -36.041 87.297  1.00 100.91 ? 331  GLN A CG  1 
ATOM   2140 C CD  . GLN A 1 331 ? 22.515  -36.185 88.332  1.00 104.10 ? 331  GLN A CD  1 
ATOM   2141 O OE1 . GLN A 1 331 ? 21.373  -36.510 87.999  1.00 105.29 ? 331  GLN A OE1 1 
ATOM   2142 N NE2 . GLN A 1 331 ? 22.854  -35.945 89.594  1.00 105.50 ? 331  GLN A NE2 1 
ATOM   2143 N N   . SER A 1 332 ? 22.949  -36.624 83.715  1.00 92.60  ? 332  SER A N   1 
ATOM   2144 C CA  . SER A 1 332 ? 22.232  -35.787 82.756  1.00 92.10  ? 332  SER A CA  1 
ATOM   2145 C C   . SER A 1 332 ? 21.414  -34.670 83.400  1.00 91.69  ? 332  SER A C   1 
ATOM   2146 O O   . SER A 1 332 ? 21.248  -34.623 84.620  1.00 91.80  ? 332  SER A O   1 
ATOM   2147 C CB  . SER A 1 332 ? 21.307  -36.653 81.896  1.00 92.25  ? 332  SER A CB  1 
ATOM   2148 O OG  . SER A 1 332 ? 22.039  -37.633 81.181  1.00 93.73  ? 332  SER A OG  1 
ATOM   2149 N N   . ALA A 1 333 ? 20.905  -33.771 82.559  1.00 90.27  ? 333  ALA A N   1 
ATOM   2150 C CA  . ALA A 1 333 ? 20.090  -32.650 83.015  1.00 88.67  ? 333  ALA A CA  1 
ATOM   2151 C C   . ALA A 1 333 ? 18.675  -33.138 83.313  1.00 87.75  ? 333  ALA A C   1 
ATOM   2152 O O   . ALA A 1 333 ? 18.167  -34.037 82.642  1.00 87.83  ? 333  ALA A O   1 
ATOM   2153 C CB  . ALA A 1 333 ? 20.058  -31.561 81.949  1.00 87.97  ? 333  ALA A CB  1 
ATOM   2154 N N   . ARG A 1 334 ? 18.045  -32.538 84.318  1.00 86.25  ? 334  ARG A N   1 
ATOM   2155 C CA  . ARG A 1 334 ? 16.693  -32.913 84.724  1.00 84.76  ? 334  ARG A CA  1 
ATOM   2156 C C   . ARG A 1 334 ? 15.664  -31.882 84.274  1.00 83.18  ? 334  ARG A C   1 
ATOM   2157 O O   . ARG A 1 334 ? 15.992  -30.715 84.068  1.00 82.98  ? 334  ARG A O   1 
ATOM   2158 C CB  . ARG A 1 334 ? 16.625  -33.033 86.248  1.00 86.15  ? 334  ARG A CB  1 
ATOM   2159 C CG  . ARG A 1 334 ? 17.627  -33.994 86.864  1.00 88.60  ? 334  ARG A CG  1 
ATOM   2160 C CD  . ARG A 1 334 ? 17.924  -33.599 88.305  1.00 90.07  ? 334  ARG A CD  1 
ATOM   2161 N NE  . ARG A 1 334 ? 16.702  -33.358 89.070  1.00 91.91  ? 334  ARG A NE  1 
ATOM   2162 C CZ  . ARG A 1 334 ? 16.674  -32.863 90.304  1.00 92.01  ? 334  ARG A CZ  1 
ATOM   2163 N NH1 . ARG A 1 334 ? 17.805  -32.552 90.926  1.00 91.47  ? 334  ARG A NH1 1 
ATOM   2164 N NH2 . ARG A 1 334 ? 15.514  -32.673 90.918  1.00 91.32  ? 334  ARG A NH2 1 
ATOM   2165 N N   . LYS A 1 335 ? 14.416  -32.318 84.125  1.00 81.35  ? 335  LYS A N   1 
ATOM   2166 C CA  . LYS A 1 335 ? 13.337  -31.418 83.735  1.00 79.58  ? 335  LYS A CA  1 
ATOM   2167 C C   . LYS A 1 335 ? 12.521  -31.119 84.987  1.00 79.18  ? 335  LYS A C   1 
ATOM   2168 O O   . LYS A 1 335 ? 11.553  -31.817 85.294  1.00 79.83  ? 335  LYS A O   1 
ATOM   2169 C CB  . LYS A 1 335 ? 12.442  -32.058 82.671  1.00 78.16  ? 335  LYS A CB  1 
ATOM   2170 C CG  . LYS A 1 335 ? 11.313  -31.145 82.209  1.00 77.07  ? 335  LYS A CG  1 
ATOM   2171 C CD  . LYS A 1 335 ? 10.494  -31.763 81.090  1.00 76.45  ? 335  LYS A CD  1 
ATOM   2172 C CE  . LYS A 1 335 ? 9.429   -30.794 80.599  1.00 76.40  ? 335  LYS A CE  1 
ATOM   2173 N NZ  . LYS A 1 335 ? 8.642   -31.351 79.464  1.00 75.45  ? 335  LYS A NZ  1 
ATOM   2174 N N   . MET A 1 336 ? 12.924  -30.075 85.703  1.00 78.76  ? 336  MET A N   1 
ATOM   2175 C CA  . MET A 1 336 ? 12.267  -29.676 86.943  1.00 77.68  ? 336  MET A CA  1 
ATOM   2176 C C   . MET A 1 336 ? 11.286  -28.521 86.794  1.00 76.74  ? 336  MET A C   1 
ATOM   2177 O O   . MET A 1 336 ? 11.209  -27.866 85.755  1.00 75.88  ? 336  MET A O   1 
ATOM   2178 C CB  . MET A 1 336 ? 13.317  -29.266 87.975  1.00 77.53  ? 336  MET A CB  1 
ATOM   2179 C CG  . MET A 1 336 ? 14.368  -30.307 88.265  1.00 78.94  ? 336  MET A CG  1 
ATOM   2180 S SD  . MET A 1 336 ? 15.693  -29.601 89.256  1.00 81.02  ? 336  MET A SD  1 
ATOM   2181 C CE  . MET A 1 336 ? 14.878  -29.443 90.850  1.00 80.73  ? 336  MET A CE  1 
ATOM   2182 N N   . ARG A 1 337 ? 10.543  -28.282 87.867  1.00 76.43  ? 337  ARG A N   1 
ATOM   2183 C CA  . ARG A 1 337 ? 9.582   -27.195 87.931  1.00 75.79  ? 337  ARG A CA  1 
ATOM   2184 C C   . ARG A 1 337 ? 10.362  -26.066 88.594  1.00 75.06  ? 337  ARG A C   1 
ATOM   2185 O O   . ARG A 1 337 ? 10.974  -26.271 89.641  1.00 76.19  ? 337  ARG A O   1 
ATOM   2186 C CB  . ARG A 1 337 ? 8.389   -27.605 88.797  1.00 76.28  ? 337  ARG A CB  1 
ATOM   2187 C CG  . ARG A 1 337 ? 7.386   -26.498 89.065  1.00 78.24  ? 337  ARG A CG  1 
ATOM   2188 C CD  . ARG A 1 337 ? 6.205   -27.013 89.876  1.00 79.15  ? 337  ARG A CD  1 
ATOM   2189 N NE  . ARG A 1 337 ? 5.291   -25.939 90.254  1.00 81.69  ? 337  ARG A NE  1 
ATOM   2190 C CZ  . ARG A 1 337 ? 5.586   -24.971 91.118  1.00 82.72  ? 337  ARG A CZ  1 
ATOM   2191 N NH1 . ARG A 1 337 ? 6.777   -24.941 91.704  1.00 82.32  ? 337  ARG A NH1 1 
ATOM   2192 N NH2 . ARG A 1 337 ? 4.692   -24.031 91.397  1.00 82.26  ? 337  ARG A NH2 1 
ATOM   2193 N N   . LEU A 1 338 ? 10.361  -24.886 87.981  1.00 73.50  ? 338  LEU A N   1 
ATOM   2194 C CA  . LEU A 1 338 ? 11.098  -23.749 88.525  1.00 72.19  ? 338  LEU A CA  1 
ATOM   2195 C C   . LEU A 1 338 ? 10.949  -23.599 90.035  1.00 72.43  ? 338  LEU A C   1 
ATOM   2196 O O   . LEU A 1 338 ? 11.944  -23.480 90.751  1.00 71.16  ? 338  LEU A O   1 
ATOM   2197 C CB  . LEU A 1 338 ? 10.669  -22.451 87.838  1.00 71.12  ? 338  LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 338 ? 11.733  -21.785 86.963  1.00 69.13  ? 338  LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 338 ? 11.194  -20.472 86.418  1.00 69.62  ? 338  LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 338 ? 12.997  -21.542 87.780  1.00 68.00  ? 338  LEU A CD2 1 
ATOM   2201 N N   . GLY A 1 339 ? 9.709   -23.600 90.515  1.00 73.44  ? 339  GLY A N   1 
ATOM   2202 C CA  . GLY A 1 339 ? 9.472   -23.468 91.942  1.00 75.79  ? 339  GLY A CA  1 
ATOM   2203 C C   . GLY A 1 339 ? 10.251  -24.501 92.734  1.00 77.62  ? 339  GLY A C   1 
ATOM   2204 O O   . GLY A 1 339 ? 10.904  -24.175 93.727  1.00 76.66  ? 339  GLY A O   1 
ATOM   2205 N N   . ASP A 1 340 ? 10.182  -25.752 92.288  1.00 79.27  ? 340  ASP A N   1 
ATOM   2206 C CA  . ASP A 1 340 ? 10.885  -26.852 92.940  1.00 81.91  ? 340  ASP A CA  1 
ATOM   2207 C C   . ASP A 1 340 ? 12.394  -26.646 92.888  1.00 83.53  ? 340  ASP A C   1 
ATOM   2208 O O   . ASP A 1 340 ? 13.105  -26.950 93.847  1.00 83.58  ? 340  ASP A O   1 
ATOM   2209 C CB  . ASP A 1 340 ? 10.536  -28.177 92.258  1.00 83.04  ? 340  ASP A CB  1 
ATOM   2210 C CG  . ASP A 1 340 ? 9.080   -28.558 92.434  1.00 84.27  ? 340  ASP A CG  1 
ATOM   2211 O OD1 . ASP A 1 340 ? 8.203   -27.718 92.146  1.00 85.75  ? 340  ASP A OD1 1 
ATOM   2212 O OD2 . ASP A 1 340 ? 8.817   -29.703 92.857  1.00 85.32  ? 340  ASP A OD2 1 
ATOM   2213 N N   . ALA A 1 341 ? 12.876  -26.132 91.761  1.00 85.02  ? 341  ALA A N   1 
ATOM   2214 C CA  . ALA A 1 341 ? 14.301  -25.888 91.573  1.00 86.24  ? 341  ALA A CA  1 
ATOM   2215 C C   . ALA A 1 341 ? 14.857  -24.954 92.641  1.00 87.03  ? 341  ALA A C   1 
ATOM   2216 O O   . ALA A 1 341 ? 15.954  -25.172 93.157  1.00 87.05  ? 341  ALA A O   1 
ATOM   2217 C CB  . ALA A 1 341 ? 14.548  -25.302 90.188  1.00 86.99  ? 341  ALA A CB  1 
ATOM   2218 N N   . VAL A 1 342 ? 14.097  -23.913 92.967  1.00 87.91  ? 342  VAL A N   1 
ATOM   2219 C CA  . VAL A 1 342 ? 14.518  -22.943 93.971  1.00 88.87  ? 342  VAL A CA  1 
ATOM   2220 C C   . VAL A 1 342 ? 14.411  -23.533 95.376  1.00 89.32  ? 342  VAL A C   1 
ATOM   2221 O O   . VAL A 1 342 ? 15.256  -23.271 96.234  1.00 89.09  ? 342  VAL A O   1 
ATOM   2222 C CB  . VAL A 1 342 ? 13.665  -21.659 93.893  1.00 89.22  ? 342  VAL A CB  1 
ATOM   2223 C CG1 . VAL A 1 342 ? 14.172  -20.634 94.897  1.00 89.31  ? 342  VAL A CG1 1 
ATOM   2224 C CG2 . VAL A 1 342 ? 13.712  -21.092 92.485  1.00 87.58  ? 342  VAL A CG2 1 
ATOM   2225 N N   . GLU A 1 343 ? 13.368  -24.328 95.600  1.00 89.18  ? 343  GLU A N   1 
ATOM   2226 C CA  . GLU A 1 343 ? 13.144  -24.971 96.892  1.00 89.19  ? 343  GLU A CA  1 
ATOM   2227 C C   . GLU A 1 343 ? 14.374  -25.766 97.313  1.00 88.27  ? 343  GLU A C   1 
ATOM   2228 O O   . GLU A 1 343 ? 14.987  -25.493 98.346  1.00 89.14  ? 343  GLU A O   1 
ATOM   2229 C CB  . GLU A 1 343 ? 11.944  -25.921 96.810  1.00 91.22  ? 343  GLU A CB  1 
ATOM   2230 C CG  . GLU A 1 343 ? 10.590  -25.237 96.735  1.00 94.15  ? 343  GLU A CG  1 
ATOM   2231 C CD  . GLU A 1 343 ? 10.178  -24.625 98.059  1.00 95.88  ? 343  GLU A CD  1 
ATOM   2232 O OE1 . GLU A 1 343 ? 10.059  -25.379 99.049  1.00 97.72  ? 343  GLU A OE1 1 
ATOM   2233 O OE2 . GLU A 1 343 ? 9.972   -23.395 98.111  1.00 96.59  ? 343  GLU A OE2 1 
ATOM   2234 N N   . GLN A 1 344 ? 14.724  -26.751 96.495  1.00 86.10  ? 344  GLN A N   1 
ATOM   2235 C CA  . GLN A 1 344 ? 15.865  -27.617 96.752  1.00 84.77  ? 344  GLN A CA  1 
ATOM   2236 C C   . GLN A 1 344 ? 17.195  -26.871 96.818  1.00 84.35  ? 344  GLN A C   1 
ATOM   2237 O O   . GLN A 1 344 ? 18.180  -27.393 97.338  1.00 84.56  ? 344  GLN A O   1 
ATOM   2238 C CB  . GLN A 1 344 ? 15.914  -28.707 95.682  1.00 84.08  ? 344  GLN A CB  1 
ATOM   2239 C CG  . GLN A 1 344 ? 14.728  -29.657 95.754  1.00 84.61  ? 344  GLN A CG  1 
ATOM   2240 C CD  . GLN A 1 344 ? 14.481  -30.397 94.457  1.00 85.23  ? 344  GLN A CD  1 
ATOM   2241 O OE1 . GLN A 1 344 ? 15.387  -31.012 93.894  1.00 86.24  ? 344  GLN A OE1 1 
ATOM   2242 N NE2 . GLN A 1 344 ? 13.242  -30.348 93.977  1.00 84.76  ? 344  GLN A NE2 1 
ATOM   2243 N N   . GLY A 1 345 ? 17.223  -25.650 96.295  1.00 83.98  ? 345  GLY A N   1 
ATOM   2244 C CA  . GLY A 1 345 ? 18.446  -24.869 96.330  1.00 83.18  ? 345  GLY A CA  1 
ATOM   2245 C C   . GLY A 1 345 ? 19.252  -24.896 95.045  1.00 83.01  ? 345  GLY A C   1 
ATOM   2246 O O   . GLY A 1 345 ? 20.308  -24.264 94.964  1.00 82.61  ? 345  GLY A O   1 
ATOM   2247 N N   . VAL A 1 346 ? 18.766  -25.626 94.044  1.00 82.34  ? 346  VAL A N   1 
ATOM   2248 C CA  . VAL A 1 346 ? 19.453  -25.711 92.757  1.00 81.26  ? 346  VAL A CA  1 
ATOM   2249 C C   . VAL A 1 346 ? 19.710  -24.291 92.263  1.00 80.45  ? 346  VAL A C   1 
ATOM   2250 O O   . VAL A 1 346 ? 20.857  -23.886 92.067  1.00 79.22  ? 346  VAL A O   1 
ATOM   2251 C CB  . VAL A 1 346 ? 18.601  -26.458 91.712  1.00 80.98  ? 346  VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 346 ? 19.365  -26.574 90.408  1.00 81.12  ? 346  VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 346 ? 18.229  -27.835 92.232  1.00 79.23  ? 346  VAL A CG2 1 
ATOM   2254 N N   . ILE A 1 347 ? 18.629  -23.543 92.065  1.00 80.33  ? 347  ILE A N   1 
ATOM   2255 C CA  . ILE A 1 347 ? 18.718  -22.156 91.628  1.00 80.66  ? 347  ILE A CA  1 
ATOM   2256 C C   . ILE A 1 347 ? 18.759  -21.295 92.888  1.00 80.78  ? 347  ILE A C   1 
ATOM   2257 O O   . ILE A 1 347 ? 17.776  -21.212 93.624  1.00 81.49  ? 347  ILE A O   1 
ATOM   2258 C CB  . ILE A 1 347 ? 17.496  -21.755 90.769  1.00 79.53  ? 347  ILE A CB  1 
ATOM   2259 C CG1 . ILE A 1 347 ? 17.486  -22.567 89.471  1.00 78.75  ? 347  ILE A CG1 1 
ATOM   2260 C CG2 . ILE A 1 347 ? 17.538  -20.263 90.466  1.00 78.93  ? 347  ILE A CG2 1 
ATOM   2261 C CD1 . ILE A 1 347 ? 16.317  -22.264 88.558  1.00 78.24  ? 347  ILE A CD1 1 
ATOM   2262 N N   . ASN A 1 348 ? 19.905  -20.666 93.127  1.00 81.06  ? 348  ASN A N   1 
ATOM   2263 C CA  . ASN A 1 348 ? 20.122  -19.825 94.301  1.00 81.64  ? 348  ASN A CA  1 
ATOM   2264 C C   . ASN A 1 348 ? 18.869  -19.143 94.854  1.00 80.60  ? 348  ASN A C   1 
ATOM   2265 O O   . ASN A 1 348 ? 18.275  -19.621 95.820  1.00 81.19  ? 348  ASN A O   1 
ATOM   2266 C CB  . ASN A 1 348 ? 21.186  -18.766 93.996  1.00 85.65  ? 348  ASN A CB  1 
ATOM   2267 C CG  . ASN A 1 348 ? 21.672  -18.046 95.246  1.00 89.48  ? 348  ASN A CG  1 
ATOM   2268 O OD1 . ASN A 1 348 ? 22.444  -17.087 95.165  1.00 91.09  ? 348  ASN A OD1 1 
ATOM   2269 N ND2 . ASN A 1 348 ? 21.227  -18.510 96.409  1.00 90.48  ? 348  ASN A ND2 1 
ATOM   2270 N N   . ASN A 1 349 ? 18.469  -18.031 94.242  1.00 79.01  ? 349  ASN A N   1 
ATOM   2271 C CA  . ASN A 1 349 ? 17.301  -17.280 94.701  1.00 76.83  ? 349  ASN A CA  1 
ATOM   2272 C C   . ASN A 1 349 ? 16.137  -17.255 93.710  1.00 76.03  ? 349  ASN A C   1 
ATOM   2273 O O   . ASN A 1 349 ? 16.100  -18.035 92.759  1.00 75.85  ? 349  ASN A O   1 
ATOM   2274 C CB  . ASN A 1 349 ? 17.722  -15.848 95.031  1.00 75.31  ? 349  ASN A CB  1 
ATOM   2275 C CG  . ASN A 1 349 ? 18.337  -15.142 93.844  1.00 74.01  ? 349  ASN A CG  1 
ATOM   2276 O OD1 . ASN A 1 349 ? 17.653  -14.833 92.871  1.00 74.26  ? 349  ASN A OD1 1 
ATOM   2277 N ND2 . ASN A 1 349 ? 19.640  -14.893 93.913  1.00 73.25  ? 349  ASN A ND2 1 
ATOM   2278 N N   . THR A 1 350 ? 15.185  -16.354 93.945  1.00 75.05  ? 350  THR A N   1 
ATOM   2279 C CA  . THR A 1 350 ? 14.015  -16.226 93.082  1.00 74.69  ? 350  THR A CA  1 
ATOM   2280 C C   . THR A 1 350 ? 14.175  -15.136 92.026  1.00 74.40  ? 350  THR A C   1 
ATOM   2281 O O   . THR A 1 350 ? 13.472  -15.138 91.016  1.00 74.61  ? 350  THR A O   1 
ATOM   2282 C CB  . THR A 1 350 ? 12.742  -15.934 93.902  1.00 75.36  ? 350  THR A CB  1 
ATOM   2283 O OG1 . THR A 1 350 ? 12.951  -14.780 94.725  1.00 75.51  ? 350  THR A OG1 1 
ATOM   2284 C CG2 . THR A 1 350 ? 12.393  -17.124 94.778  1.00 75.22  ? 350  THR A CG2 1 
ATOM   2285 N N   . VAL A 1 351 ? 15.087  -14.197 92.263  1.00 73.56  ? 351  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 351 ? 15.330  -13.131 91.296  1.00 72.36  ? 351  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 351 ? 15.906  -13.803 90.057  1.00 71.44  ? 351  VAL A C   1 
ATOM   2288 O O   . VAL A 1 351 ? 15.534  -13.494 88.925  1.00 70.54  ? 351  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 351 ? 16.356  -12.105 91.826  1.00 71.57  ? 351  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 351 ? 16.639  -11.053 90.763  1.00 69.04  ? 351  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 351 ? 15.828  -11.450 93.088  1.00 72.61  ? 351  VAL A CG2 1 
ATOM   2292 N N   . LEU A 1 352 ? 16.817  -14.736 90.300  1.00 70.04  ? 352  LEU A N   1 
ATOM   2293 C CA  . LEU A 1 352 ? 17.465  -15.490 89.243  1.00 68.93  ? 352  LEU A CA  1 
ATOM   2294 C C   . LEU A 1 352 ? 16.419  -16.423 88.640  1.00 68.67  ? 352  LEU A C   1 
ATOM   2295 O O   . LEU A 1 352 ? 16.388  -16.648 87.431  1.00 69.86  ? 352  LEU A O   1 
ATOM   2296 C CB  . LEU A 1 352 ? 18.610  -16.310 89.836  1.00 69.74  ? 352  LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 352 ? 19.871  -16.501 89.000  1.00 73.08  ? 352  LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 352 ? 20.574  -15.160 88.827  1.00 73.57  ? 352  LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 352 ? 20.792  -17.492 89.695  1.00 74.30  ? 352  LEU A CD2 1 
ATOM   2300 N N   . GLY A 1 353 ? 15.557  -16.955 89.500  1.00 66.49  ? 353  GLY A N   1 
ATOM   2301 C CA  . GLY A 1 353 ? 14.522  -17.865 89.052  1.00 63.22  ? 353  GLY A CA  1 
ATOM   2302 C C   . GLY A 1 353 ? 13.486  -17.198 88.175  1.00 61.71  ? 353  GLY A C   1 
ATOM   2303 O O   . GLY A 1 353 ? 12.994  -17.801 87.221  1.00 61.00  ? 353  GLY A O   1 
ATOM   2304 N N   . TYR A 1 354 ? 13.145  -15.954 88.494  1.00 60.74  ? 354  TYR A N   1 
ATOM   2305 C CA  . TYR A 1 354 ? 12.156  -15.233 87.707  1.00 60.29  ? 354  TYR A CA  1 
ATOM   2306 C C   . TYR A 1 354 ? 12.677  -15.029 86.298  1.00 59.72  ? 354  TYR A C   1 
ATOM   2307 O O   . TYR A 1 354 ? 12.024  -15.407 85.324  1.00 59.61  ? 354  TYR A O   1 
ATOM   2308 C CB  . TYR A 1 354 ? 11.846  -13.868 88.324  1.00 60.04  ? 354  TYR A CB  1 
ATOM   2309 C CG  . TYR A 1 354 ? 10.821  -13.083 87.532  1.00 60.00  ? 354  TYR A CG  1 
ATOM   2310 C CD1 . TYR A 1 354 ? 9.538   -13.590 87.326  1.00 59.15  ? 354  TYR A CD1 1 
ATOM   2311 C CD2 . TYR A 1 354 ? 11.133  -11.839 86.982  1.00 59.49  ? 354  TYR A CD2 1 
ATOM   2312 C CE1 . TYR A 1 354 ? 8.590   -12.879 86.592  1.00 58.63  ? 354  TYR A CE1 1 
ATOM   2313 C CE2 . TYR A 1 354 ? 10.190  -11.117 86.246  1.00 57.04  ? 354  TYR A CE2 1 
ATOM   2314 C CZ  . TYR A 1 354 ? 8.921   -11.646 86.056  1.00 56.64  ? 354  TYR A CZ  1 
ATOM   2315 O OH  . TYR A 1 354 ? 7.980   -10.944 85.335  1.00 55.10  ? 354  TYR A OH  1 
ATOM   2316 N N   . PHE A 1 355 ? 13.858  -14.430 86.197  1.00 58.02  ? 355  PHE A N   1 
ATOM   2317 C CA  . PHE A 1 355 ? 14.460  -14.174 84.901  1.00 57.64  ? 355  PHE A CA  1 
ATOM   2318 C C   . PHE A 1 355 ? 14.674  -15.444 84.092  1.00 57.50  ? 355  PHE A C   1 
ATOM   2319 O O   . PHE A 1 355 ? 14.494  -15.438 82.875  1.00 58.53  ? 355  PHE A O   1 
ATOM   2320 C CB  . PHE A 1 355 ? 15.772  -13.407 85.066  1.00 56.56  ? 355  PHE A CB  1 
ATOM   2321 C CG  . PHE A 1 355 ? 15.572  -11.951 85.378  1.00 58.51  ? 355  PHE A CG  1 
ATOM   2322 C CD1 . PHE A 1 355 ? 15.843  -11.449 86.644  1.00 59.25  ? 355  PHE A CD1 1 
ATOM   2323 C CD2 . PHE A 1 355 ? 15.071  -11.088 84.409  1.00 59.23  ? 355  PHE A CD2 1 
ATOM   2324 C CE1 . PHE A 1 355 ? 15.615  -10.106 86.942  1.00 61.20  ? 355  PHE A CE1 1 
ATOM   2325 C CE2 . PHE A 1 355 ? 14.839  -9.744  84.696  1.00 60.63  ? 355  PHE A CE2 1 
ATOM   2326 C CZ  . PHE A 1 355 ? 15.111  -9.252  85.965  1.00 60.91  ? 355  PHE A CZ  1 
ATOM   2327 N N   . ILE A 1 356 ? 15.046  -16.536 84.753  1.00 55.98  ? 356  ILE A N   1 
ATOM   2328 C CA  . ILE A 1 356 ? 15.241  -17.791 84.036  1.00 55.46  ? 356  ILE A CA  1 
ATOM   2329 C C   . ILE A 1 356 ? 13.912  -18.200 83.404  1.00 54.99  ? 356  ILE A C   1 
ATOM   2330 O O   . ILE A 1 356 ? 13.881  -18.769 82.315  1.00 55.06  ? 356  ILE A O   1 
ATOM   2331 C CB  . ILE A 1 356 ? 15.733  -18.925 84.972  1.00 54.84  ? 356  ILE A CB  1 
ATOM   2332 C CG1 . ILE A 1 356 ? 17.175  -18.655 85.407  1.00 53.21  ? 356  ILE A CG1 1 
ATOM   2333 C CG2 . ILE A 1 356 ? 15.659  -20.269 84.256  1.00 53.67  ? 356  ILE A CG2 1 
ATOM   2334 C CD1 . ILE A 1 356 ? 17.779  -19.761 86.254  1.00 52.39  ? 356  ILE A CD1 1 
ATOM   2335 N N   . GLY A 1 357 ? 12.816  -17.896 84.092  1.00 55.71  ? 357  GLY A N   1 
ATOM   2336 C CA  . GLY A 1 357 ? 11.498  -18.233 83.581  1.00 55.75  ? 357  GLY A CA  1 
ATOM   2337 C C   . GLY A 1 357 ? 11.093  -17.327 82.433  1.00 55.18  ? 357  GLY A C   1 
ATOM   2338 O O   . GLY A 1 357 ? 10.614  -17.793 81.396  1.00 55.11  ? 357  GLY A O   1 
ATOM   2339 N N   . ARG A 1 358 ? 11.277  -16.025 82.624  1.00 53.85  ? 358  ARG A N   1 
ATOM   2340 C CA  . ARG A 1 358 ? 10.946  -15.046 81.597  1.00 53.26  ? 358  ARG A CA  1 
ATOM   2341 C C   . ARG A 1 358 ? 11.776  -15.314 80.342  1.00 52.35  ? 358  ARG A C   1 
ATOM   2342 O O   . ARG A 1 358 ? 11.281  -15.181 79.220  1.00 50.92  ? 358  ARG A O   1 
ATOM   2343 C CB  . ARG A 1 358 ? 11.220  -13.637 82.117  1.00 52.32  ? 358  ARG A CB  1 
ATOM   2344 C CG  . ARG A 1 358 ? 10.237  -13.160 83.176  1.00 53.12  ? 358  ARG A CG  1 
ATOM   2345 C CD  . ARG A 1 358 ? 9.144   -12.291 82.566  1.00 51.76  ? 358  ARG A CD  1 
ATOM   2346 N NE  . ARG A 1 358 ? 8.149   -13.063 81.831  1.00 51.58  ? 358  ARG A NE  1 
ATOM   2347 C CZ  . ARG A 1 358 ? 7.277   -12.534 80.978  1.00 51.61  ? 358  ARG A CZ  1 
ATOM   2348 N NH1 . ARG A 1 358 ? 7.280   -11.231 80.745  1.00 50.04  ? 358  ARG A NH1 1 
ATOM   2349 N NH2 . ARG A 1 358 ? 6.388   -13.307 80.368  1.00 53.89  ? 358  ARG A NH2 1 
ATOM   2350 N N   . ILE A 1 359 ? 13.039  -15.686 80.539  1.00 50.34  ? 359  ILE A N   1 
ATOM   2351 C CA  . ILE A 1 359 ? 13.931  -15.998 79.427  1.00 47.90  ? 359  ILE A CA  1 
ATOM   2352 C C   . ILE A 1 359 ? 13.360  -17.194 78.678  1.00 49.73  ? 359  ILE A C   1 
ATOM   2353 O O   . ILE A 1 359 ? 13.225  -17.169 77.451  1.00 50.23  ? 359  ILE A O   1 
ATOM   2354 C CB  . ILE A 1 359 ? 15.354  -16.352 79.920  1.00 46.63  ? 359  ILE A CB  1 
ATOM   2355 C CG1 . ILE A 1 359 ? 16.051  -15.100 80.454  1.00 45.41  ? 359  ILE A CG1 1 
ATOM   2356 C CG2 . ILE A 1 359 ? 16.168  -16.958 78.788  1.00 43.84  ? 359  ILE A CG2 1 
ATOM   2357 C CD1 . ILE A 1 359 ? 17.414  -15.370 81.057  1.00 45.15  ? 359  ILE A CD1 1 
ATOM   2358 N N   . TYR A 1 360 ? 13.023  -18.242 79.423  1.00 49.48  ? 360  TYR A N   1 
ATOM   2359 C CA  . TYR A 1 360 ? 12.454  -19.440 78.823  1.00 51.19  ? 360  TYR A CA  1 
ATOM   2360 C C   . TYR A 1 360 ? 11.247  -19.064 77.976  1.00 51.40  ? 360  TYR A C   1 
ATOM   2361 O O   . TYR A 1 360 ? 11.113  -19.509 76.836  1.00 53.45  ? 360  TYR A O   1 
ATOM   2362 C CB  . TYR A 1 360 ? 12.009  -20.433 79.898  1.00 51.93  ? 360  TYR A CB  1 
ATOM   2363 C CG  . TYR A 1 360 ? 11.296  -21.637 79.326  1.00 52.31  ? 360  TYR A CG  1 
ATOM   2364 C CD1 . TYR A 1 360 ? 12.005  -22.650 78.680  1.00 54.46  ? 360  TYR A CD1 1 
ATOM   2365 C CD2 . TYR A 1 360 ? 9.905   -21.741 79.384  1.00 51.37  ? 360  TYR A CD2 1 
ATOM   2366 C CE1 . TYR A 1 360 ? 11.349  -23.737 78.104  1.00 55.37  ? 360  TYR A CE1 1 
ATOM   2367 C CE2 . TYR A 1 360 ? 9.238   -22.819 78.810  1.00 53.43  ? 360  TYR A CE2 1 
ATOM   2368 C CZ  . TYR A 1 360 ? 9.966   -23.814 78.170  1.00 56.76  ? 360  TYR A CZ  1 
ATOM   2369 O OH  . TYR A 1 360 ? 9.312   -24.880 77.590  1.00 60.31  ? 360  TYR A OH  1 
ATOM   2370 N N   . LEU A 1 361 ? 10.367  -18.246 78.545  1.00 49.93  ? 361  LEU A N   1 
ATOM   2371 C CA  . LEU A 1 361 ? 9.167   -17.816 77.845  1.00 48.94  ? 361  LEU A CA  1 
ATOM   2372 C C   . LEU A 1 361 ? 9.494   -17.026 76.581  1.00 48.19  ? 361  LEU A C   1 
ATOM   2373 O O   . LEU A 1 361 ? 8.855   -17.214 75.548  1.00 47.87  ? 361  LEU A O   1 
ATOM   2374 C CB  . LEU A 1 361 ? 8.287   -16.982 78.779  1.00 48.84  ? 361  LEU A CB  1 
ATOM   2375 C CG  . LEU A 1 361 ? 7.656   -17.759 79.941  1.00 50.82  ? 361  LEU A CG  1 
ATOM   2376 C CD1 . LEU A 1 361 ? 6.950   -16.796 80.892  1.00 49.03  ? 361  LEU A CD1 1 
ATOM   2377 C CD2 . LEU A 1 361 ? 6.681   -18.794 79.391  1.00 46.71  ? 361  LEU A CD2 1 
ATOM   2378 N N   . TYR A 1 362 ? 10.492  -16.151 76.655  1.00 48.06  ? 362  TYR A N   1 
ATOM   2379 C CA  . TYR A 1 362 ? 10.872  -15.356 75.494  1.00 46.74  ? 362  TYR A CA  1 
ATOM   2380 C C   . TYR A 1 362 ? 11.356  -16.223 74.334  1.00 47.37  ? 362  TYR A C   1 
ATOM   2381 O O   . TYR A 1 362 ? 10.814  -16.163 73.230  1.00 46.17  ? 362  TYR A O   1 
ATOM   2382 C CB  . TYR A 1 362 ? 11.970  -14.357 75.853  1.00 45.93  ? 362  TYR A CB  1 
ATOM   2383 C CG  . TYR A 1 362 ? 12.475  -13.611 74.642  1.00 46.88  ? 362  TYR A CG  1 
ATOM   2384 C CD1 . TYR A 1 362 ? 11.644  -12.734 73.947  1.00 47.51  ? 362  TYR A CD1 1 
ATOM   2385 C CD2 . TYR A 1 362 ? 13.758  -13.832 74.148  1.00 46.39  ? 362  TYR A CD2 1 
ATOM   2386 C CE1 . TYR A 1 362 ? 12.074  -12.100 72.787  1.00 48.67  ? 362  TYR A CE1 1 
ATOM   2387 C CE2 . TYR A 1 362 ? 14.200  -13.203 72.988  1.00 49.57  ? 362  TYR A CE2 1 
ATOM   2388 C CZ  . TYR A 1 362 ? 13.352  -12.341 72.312  1.00 49.86  ? 362  TYR A CZ  1 
ATOM   2389 O OH  . TYR A 1 362 ? 13.775  -11.730 71.155  1.00 51.07  ? 362  TYR A OH  1 
ATOM   2390 N N   . LEU A 1 363 ? 12.388  -17.019 74.592  1.00 47.96  ? 363  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 363 ? 12.966  -17.899 73.586  1.00 48.13  ? 363  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 363 ? 11.905  -18.807 72.971  1.00 50.85  ? 363  LEU A C   1 
ATOM   2393 O O   . LEU A 1 363 ? 11.891  -19.045 71.762  1.00 51.85  ? 363  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 363 ? 14.069  -18.744 74.222  1.00 46.05  ? 363  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 363 ? 15.185  -17.949 74.905  1.00 44.42  ? 363  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 363 ? 16.130  -18.895 75.631  1.00 43.65  ? 363  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 363 ? 15.933  -17.130 73.865  1.00 42.98  ? 363  LEU A CD2 1 
ATOM   2398 N N   . THR A 1 364 ? 11.014  -19.309 73.817  1.00 52.10  ? 364  THR A N   1 
ATOM   2399 C CA  . THR A 1 364 ? 9.939   -20.189 73.382  1.00 53.67  ? 364  THR A CA  1 
ATOM   2400 C C   . THR A 1 364 ? 8.974   -19.471 72.445  1.00 53.64  ? 364  THR A C   1 
ATOM   2401 O O   . THR A 1 364 ? 8.617   -19.987 71.386  1.00 54.81  ? 364  THR A O   1 
ATOM   2402 C CB  . THR A 1 364 ? 9.146   -20.710 74.590  1.00 54.43  ? 364  THR A CB  1 
ATOM   2403 O OG1 . THR A 1 364 ? 9.991   -21.549 75.385  1.00 59.12  ? 364  THR A OG1 1 
ATOM   2404 C CG2 . THR A 1 364 ? 7.930   -21.497 74.135  1.00 59.04  ? 364  THR A CG2 1 
ATOM   2405 N N   . LYS A 1 365 ? 8.553   -18.279 72.851  1.00 52.52  ? 365  LYS A N   1 
ATOM   2406 C CA  . LYS A 1 365 ? 7.619   -17.477 72.074  1.00 54.43  ? 365  LYS A CA  1 
ATOM   2407 C C   . LYS A 1 365 ? 8.181   -17.098 70.706  1.00 54.61  ? 365  LYS A C   1 
ATOM   2408 O O   . LYS A 1 365 ? 7.442   -17.000 69.725  1.00 54.50  ? 365  LYS A O   1 
ATOM   2409 C CB  . LYS A 1 365 ? 7.249   -16.215 72.868  1.00 54.40  ? 365  LYS A CB  1 
ATOM   2410 C CG  . LYS A 1 365 ? 6.326   -15.243 72.144  1.00 57.07  ? 365  LYS A CG  1 
ATOM   2411 C CD  . LYS A 1 365 ? 5.646   -14.282 73.121  1.00 58.22  ? 365  LYS A CD  1 
ATOM   2412 C CE  . LYS A 1 365 ? 6.651   -13.494 73.949  1.00 57.25  ? 365  LYS A CE  1 
ATOM   2413 N NZ  . LYS A 1 365 ? 5.977   -12.641 74.971  1.00 57.53  ? 365  LYS A NZ  1 
ATOM   2414 N N   . VAL A 1 366 ? 9.493   -16.898 70.644  1.00 52.82  ? 366  VAL A N   1 
ATOM   2415 C CA  . VAL A 1 366 ? 10.152  -16.516 69.403  1.00 52.23  ? 366  VAL A CA  1 
ATOM   2416 C C   . VAL A 1 366 ? 10.337  -17.676 68.422  1.00 51.19  ? 366  VAL A C   1 
ATOM   2417 O O   . VAL A 1 366 ? 10.527  -17.458 67.226  1.00 48.27  ? 366  VAL A O   1 
ATOM   2418 C CB  . VAL A 1 366 ? 11.514  -15.855 69.705  1.00 52.34  ? 366  VAL A CB  1 
ATOM   2419 C CG1 . VAL A 1 366 ? 12.287  -15.624 68.421  1.00 56.48  ? 366  VAL A CG1 1 
ATOM   2420 C CG2 . VAL A 1 366 ? 11.287  -14.527 70.411  1.00 51.77  ? 366  VAL A CG2 1 
ATOM   2421 N N   . GLY A 1 367 ? 10.279  -18.906 68.923  1.00 52.52  ? 367  GLY A N   1 
ATOM   2422 C CA  . GLY A 1 367 ? 10.429  -20.049 68.040  1.00 52.65  ? 367  GLY A CA  1 
ATOM   2423 C C   . GLY A 1 367 ? 11.403  -21.127 68.477  1.00 54.47  ? 367  GLY A C   1 
ATOM   2424 O O   . GLY A 1 367 ? 11.564  -22.127 67.777  1.00 55.30  ? 367  GLY A O   1 
ATOM   2425 N N   . ILE A 1 368 ? 12.057  -20.942 69.619  1.00 56.10  ? 368  ILE A N   1 
ATOM   2426 C CA  . ILE A 1 368 ? 13.008  -21.940 70.103  1.00 57.65  ? 368  ILE A CA  1 
ATOM   2427 C C   . ILE A 1 368 ? 12.235  -23.158 70.613  1.00 58.60  ? 368  ILE A C   1 
ATOM   2428 O O   . ILE A 1 368 ? 11.242  -23.012 71.327  1.00 59.35  ? 368  ILE A O   1 
ATOM   2429 C CB  . ILE A 1 368 ? 13.876  -21.384 71.252  1.00 57.71  ? 368  ILE A CB  1 
ATOM   2430 C CG1 . ILE A 1 368 ? 14.482  -20.032 70.858  1.00 56.71  ? 368  ILE A CG1 1 
ATOM   2431 C CG2 . ILE A 1 368 ? 14.975  -22.377 71.592  1.00 57.38  ? 368  ILE A CG2 1 
ATOM   2432 C CD1 . ILE A 1 368 ? 15.386  -20.079 69.649  1.00 58.56  ? 368  ILE A CD1 1 
ATOM   2433 N N   . SER A 1 369 ? 12.693  -24.353 70.242  1.00 59.62  ? 369  SER A N   1 
ATOM   2434 C CA  . SER A 1 369 ? 12.043  -25.603 70.647  1.00 60.17  ? 369  SER A CA  1 
ATOM   2435 C C   . SER A 1 369 ? 12.374  -26.012 72.080  1.00 60.20  ? 369  SER A C   1 
ATOM   2436 O O   . SER A 1 369 ? 13.541  -26.170 72.436  1.00 61.30  ? 369  SER A O   1 
ATOM   2437 C CB  . SER A 1 369 ? 12.445  -26.742 69.703  1.00 61.00  ? 369  SER A CB  1 
ATOM   2438 O OG  . SER A 1 369 ? 12.019  -26.495 68.375  1.00 63.90  ? 369  SER A OG  1 
ATOM   2439 N N   . PRO A 1 370 ? 11.342  -26.205 72.919  1.00 61.01  ? 370  PRO A N   1 
ATOM   2440 C CA  . PRO A 1 370 ? 11.509  -26.601 74.321  1.00 62.28  ? 370  PRO A CA  1 
ATOM   2441 C C   . PRO A 1 370 ? 12.359  -27.860 74.483  1.00 63.79  ? 370  PRO A C   1 
ATOM   2442 O O   . PRO A 1 370 ? 13.084  -28.012 75.467  1.00 63.74  ? 370  PRO A O   1 
ATOM   2443 C CB  . PRO A 1 370 ? 10.074  -26.820 74.788  1.00 59.56  ? 370  PRO A CB  1 
ATOM   2444 C CG  . PRO A 1 370 ? 9.310   -25.839 73.973  1.00 60.38  ? 370  PRO A CG  1 
ATOM   2445 C CD  . PRO A 1 370 ? 9.916   -26.015 72.602  1.00 60.24  ? 370  PRO A CD  1 
ATOM   2446 N N   . ASP A 1 371 ? 12.258  -28.758 73.509  1.00 65.80  ? 371  ASP A N   1 
ATOM   2447 C CA  . ASP A 1 371 ? 13.001  -30.014 73.527  1.00 68.05  ? 371  ASP A CA  1 
ATOM   2448 C C   . ASP A 1 371 ? 14.473  -29.821 73.172  1.00 67.50  ? 371  ASP A C   1 
ATOM   2449 O O   . ASP A 1 371 ? 15.276  -30.747 73.297  1.00 68.17  ? 371  ASP A O   1 
ATOM   2450 C CB  . ASP A 1 371 ? 12.363  -31.006 72.551  1.00 72.59  ? 371  ASP A CB  1 
ATOM   2451 C CG  . ASP A 1 371 ? 12.255  -30.448 71.140  1.00 79.20  ? 371  ASP A CG  1 
ATOM   2452 O OD1 . ASP A 1 371 ? 11.569  -29.416 70.955  1.00 81.65  ? 371  ASP A OD1 1 
ATOM   2453 O OD2 . ASP A 1 371 ? 12.858  -31.038 70.216  1.00 80.16  ? 371  ASP A OD2 1 
ATOM   2454 N N   . LYS A 1 372 ? 14.824  -28.617 72.730  1.00 65.06  ? 372  LYS A N   1 
ATOM   2455 C CA  . LYS A 1 372 ? 16.202  -28.313 72.361  1.00 62.56  ? 372  LYS A CA  1 
ATOM   2456 C C   . LYS A 1 372 ? 16.678  -27.080 73.123  1.00 61.08  ? 372  LYS A C   1 
ATOM   2457 O O   . LYS A 1 372 ? 17.537  -26.332 72.649  1.00 60.92  ? 372  LYS A O   1 
ATOM   2458 C CB  . LYS A 1 372 ? 16.294  -28.065 70.855  1.00 64.52  ? 372  LYS A CB  1 
ATOM   2459 C CG  . LYS A 1 372 ? 15.712  -29.187 70.003  1.00 66.52  ? 372  LYS A CG  1 
ATOM   2460 C CD  . LYS A 1 372 ? 15.618  -28.776 68.540  1.00 68.17  ? 372  LYS A CD  1 
ATOM   2461 C CE  . LYS A 1 372 ? 14.851  -29.804 67.726  1.00 70.07  ? 372  LYS A CE  1 
ATOM   2462 N NZ  . LYS A 1 372 ? 14.618  -29.346 66.327  1.00 74.50  ? 372  LYS A NZ  1 
ATOM   2463 N N   . LEU A 1 373 ? 16.112  -26.883 74.311  1.00 58.36  ? 373  LEU A N   1 
ATOM   2464 C CA  . LEU A 1 373 ? 16.447  -25.748 75.163  1.00 54.50  ? 373  LEU A CA  1 
ATOM   2465 C C   . LEU A 1 373 ? 16.704  -26.202 76.597  1.00 55.30  ? 373  LEU A C   1 
ATOM   2466 O O   . LEU A 1 373 ? 15.966  -27.025 77.140  1.00 56.74  ? 373  LEU A O   1 
ATOM   2467 C CB  . LEU A 1 373 ? 15.301  -24.731 75.144  1.00 51.45  ? 373  LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 373 ? 15.433  -23.491 76.033  1.00 50.34  ? 373  LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 373 ? 16.666  -22.700 75.636  1.00 49.74  ? 373  LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 373 ? 14.186  -22.633 75.898  1.00 49.12  ? 373  LEU A CD2 1 
ATOM   2471 N N   . ARG A 1 374 ? 17.752  -25.660 77.209  1.00 55.55  ? 374  ARG A N   1 
ATOM   2472 C CA  . ARG A 1 374 ? 18.104  -26.009 78.582  1.00 54.86  ? 374  ARG A CA  1 
ATOM   2473 C C   . ARG A 1 374 ? 18.923  -24.878 79.196  1.00 56.61  ? 374  ARG A C   1 
ATOM   2474 O O   . ARG A 1 374 ? 19.529  -24.082 78.477  1.00 57.27  ? 374  ARG A O   1 
ATOM   2475 C CB  . ARG A 1 374 ? 18.945  -27.285 78.603  1.00 53.83  ? 374  ARG A CB  1 
ATOM   2476 C CG  . ARG A 1 374 ? 20.362  -27.061 78.093  1.00 54.03  ? 374  ARG A CG  1 
ATOM   2477 C CD  . ARG A 1 374 ? 21.223  -28.307 78.179  1.00 54.17  ? 374  ARG A CD  1 
ATOM   2478 N NE  . ARG A 1 374 ? 22.602  -28.017 77.789  1.00 56.31  ? 374  ARG A NE  1 
ATOM   2479 C CZ  . ARG A 1 374 ? 23.579  -28.917 77.752  1.00 57.49  ? 374  ARG A CZ  1 
ATOM   2480 N NH1 . ARG A 1 374 ? 23.337  -30.179 78.081  1.00 59.47  ? 374  ARG A NH1 1 
ATOM   2481 N NH2 . ARG A 1 374 ? 24.802  -28.552 77.392  1.00 55.71  ? 374  ARG A NH2 1 
ATOM   2482 N N   . PHE A 1 375 ? 18.944  -24.815 80.524  1.00 56.64  ? 375  PHE A N   1 
ATOM   2483 C CA  . PHE A 1 375 ? 19.715  -23.798 81.233  1.00 57.31  ? 375  PHE A CA  1 
ATOM   2484 C C   . PHE A 1 375 ? 20.849  -24.482 81.986  1.00 57.55  ? 375  PHE A C   1 
ATOM   2485 O O   . PHE A 1 375 ? 20.606  -25.262 82.904  1.00 59.19  ? 375  PHE A O   1 
ATOM   2486 C CB  . PHE A 1 375 ? 18.826  -23.034 82.220  1.00 57.20  ? 375  PHE A CB  1 
ATOM   2487 C CG  . PHE A 1 375 ? 17.817  -22.141 81.560  1.00 56.53  ? 375  PHE A CG  1 
ATOM   2488 C CD1 . PHE A 1 375 ? 16.736  -22.679 80.869  1.00 56.95  ? 375  PHE A CD1 1 
ATOM   2489 C CD2 . PHE A 1 375 ? 17.962  -20.757 81.605  1.00 55.07  ? 375  PHE A CD2 1 
ATOM   2490 C CE1 . PHE A 1 375 ? 15.813  -21.850 80.229  1.00 57.41  ? 375  PHE A CE1 1 
ATOM   2491 C CE2 . PHE A 1 375 ? 17.047  -19.920 80.970  1.00 55.11  ? 375  PHE A CE2 1 
ATOM   2492 C CZ  . PHE A 1 375 ? 15.971  -20.466 80.280  1.00 54.91  ? 375  PHE A CZ  1 
ATOM   2493 N N   . ARG A 1 376 ? 22.087  -24.192 81.596  1.00 58.16  ? 376  ARG A N   1 
ATOM   2494 C CA  . ARG A 1 376 ? 23.248  -24.800 82.239  1.00 58.46  ? 376  ARG A CA  1 
ATOM   2495 C C   . ARG A 1 376 ? 23.969  -23.848 83.182  1.00 59.32  ? 376  ARG A C   1 
ATOM   2496 O O   . ARG A 1 376 ? 24.305  -22.723 82.811  1.00 59.10  ? 376  ARG A O   1 
ATOM   2497 C CB  . ARG A 1 376 ? 24.238  -25.301 81.185  1.00 58.29  ? 376  ARG A CB  1 
ATOM   2498 C CG  . ARG A 1 376 ? 25.418  -26.064 81.765  1.00 55.11  ? 376  ARG A CG  1 
ATOM   2499 C CD  . ARG A 1 376 ? 26.401  -26.463 80.681  1.00 54.46  ? 376  ARG A CD  1 
ATOM   2500 N NE  . ARG A 1 376 ? 27.113  -25.313 80.135  1.00 54.81  ? 376  ARG A NE  1 
ATOM   2501 C CZ  . ARG A 1 376 ? 28.009  -24.599 80.808  1.00 55.51  ? 376  ARG A CZ  1 
ATOM   2502 N NH1 . ARG A 1 376 ? 28.310  -24.916 82.061  1.00 56.05  ? 376  ARG A NH1 1 
ATOM   2503 N NH2 . ARG A 1 376 ? 28.607  -23.565 80.231  1.00 53.00  ? 376  ARG A NH2 1 
ATOM   2504 N N   . GLN A 1 377 ? 24.213  -24.316 84.401  1.00 61.11  ? 377  GLN A N   1 
ATOM   2505 C CA  . GLN A 1 377 ? 24.899  -23.522 85.414  1.00 63.12  ? 377  GLN A CA  1 
ATOM   2506 C C   . GLN A 1 377 ? 26.410  -23.648 85.254  1.00 64.05  ? 377  GLN A C   1 
ATOM   2507 O O   . GLN A 1 377 ? 26.915  -24.700 84.870  1.00 62.68  ? 377  GLN A O   1 
ATOM   2508 C CB  . GLN A 1 377 ? 24.479  -23.991 86.807  1.00 63.17  ? 377  GLN A CB  1 
ATOM   2509 C CG  . GLN A 1 377 ? 25.208  -23.308 87.949  1.00 64.92  ? 377  GLN A CG  1 
ATOM   2510 C CD  . GLN A 1 377 ? 24.649  -23.702 89.304  1.00 65.99  ? 377  GLN A CD  1 
ATOM   2511 O OE1 . GLN A 1 377 ? 24.564  -24.887 89.634  1.00 63.85  ? 377  GLN A OE1 1 
ATOM   2512 N NE2 . GLN A 1 377 ? 24.265  -22.706 90.097  1.00 65.37  ? 377  GLN A NE2 1 
ATOM   2513 N N   . HIS A 1 378 ? 27.129  -22.571 85.543  1.00 66.56  ? 378  HIS A N   1 
ATOM   2514 C CA  . HIS A 1 378 ? 28.578  -22.591 85.421  1.00 70.61  ? 378  HIS A CA  1 
ATOM   2515 C C   . HIS A 1 378 ? 29.224  -23.414 86.522  1.00 74.33  ? 378  HIS A C   1 
ATOM   2516 O O   . HIS A 1 378 ? 28.614  -23.679 87.557  1.00 75.65  ? 378  HIS A O   1 
ATOM   2517 C CB  . HIS A 1 378 ? 29.147  -21.171 85.456  1.00 67.53  ? 378  HIS A CB  1 
ATOM   2518 C CG  . HIS A 1 378 ? 28.856  -20.371 84.226  1.00 65.95  ? 378  HIS A CG  1 
ATOM   2519 N ND1 . HIS A 1 378 ? 29.415  -19.132 83.996  1.00 66.81  ? 378  HIS A ND1 1 
ATOM   2520 C CD2 . HIS A 1 378 ? 28.062  -20.629 83.160  1.00 64.79  ? 378  HIS A CD2 1 
ATOM   2521 C CE1 . HIS A 1 378 ? 28.979  -18.662 82.841  1.00 66.48  ? 378  HIS A CE1 1 
ATOM   2522 N NE2 . HIS A 1 378 ? 28.156  -19.550 82.314  1.00 64.68  ? 378  HIS A NE2 1 
ATOM   2523 N N   . MET A 1 379 ? 30.465  -23.819 86.280  1.00 78.75  ? 379  MET A N   1 
ATOM   2524 C CA  . MET A 1 379 ? 31.231  -24.604 87.236  1.00 82.01  ? 379  MET A CA  1 
ATOM   2525 C C   . MET A 1 379 ? 32.012  -23.616 88.099  1.00 83.51  ? 379  MET A C   1 
ATOM   2526 O O   . MET A 1 379 ? 31.988  -22.414 87.841  1.00 84.00  ? 379  MET A O   1 
ATOM   2527 C CB  . MET A 1 379 ? 32.196  -25.527 86.492  1.00 83.86  ? 379  MET A CB  1 
ATOM   2528 C CG  . MET A 1 379 ? 31.558  -26.353 85.375  1.00 86.01  ? 379  MET A CG  1 
ATOM   2529 S SD  . MET A 1 379 ? 30.991  -27.989 85.882  1.00 89.49  ? 379  MET A SD  1 
ATOM   2530 C CE  . MET A 1 379 ? 32.502  -28.921 85.738  1.00 89.58  ? 379  MET A CE  1 
ATOM   2531 N N   . GLU A 1 380 ? 32.712  -24.121 89.109  1.00 86.28  ? 380  GLU A N   1 
ATOM   2532 C CA  . GLU A 1 380 ? 33.478  -23.265 90.009  1.00 88.28  ? 380  GLU A CA  1 
ATOM   2533 C C   . GLU A 1 380 ? 34.390  -22.265 89.302  1.00 88.55  ? 380  GLU A C   1 
ATOM   2534 O O   . GLU A 1 380 ? 34.184  -21.057 89.407  1.00 89.29  ? 380  GLU A O   1 
ATOM   2535 C CB  . GLU A 1 380 ? 34.309  -24.114 90.972  1.00 91.45  ? 380  GLU A CB  1 
ATOM   2536 C CG  . GLU A 1 380 ? 34.067  -23.782 92.438  1.00 95.06  ? 380  GLU A CG  1 
ATOM   2537 C CD  . GLU A 1 380 ? 35.065  -24.451 93.361  1.00 97.66  ? 380  GLU A CD  1 
ATOM   2538 O OE1 . GLU A 1 380 ? 36.269  -24.125 93.270  1.00 98.22  ? 380  GLU A OE1 1 
ATOM   2539 O OE2 . GLU A 1 380 ? 34.648  -25.301 94.176  1.00 99.08  ? 380  GLU A OE2 1 
ATOM   2540 N N   . ASN A 1 381 ? 35.395  -22.759 88.586  1.00 89.38  ? 381  ASN A N   1 
ATOM   2541 C CA  . ASN A 1 381 ? 36.324  -21.870 87.893  1.00 91.02  ? 381  ASN A CA  1 
ATOM   2542 C C   . ASN A 1 381 ? 35.967  -21.585 86.434  1.00 90.33  ? 381  ASN A C   1 
ATOM   2543 O O   . ASN A 1 381 ? 36.839  -21.278 85.619  1.00 90.19  ? 381  ASN A O   1 
ATOM   2544 C CB  . ASN A 1 381 ? 37.754  -22.417 87.985  1.00 93.77  ? 381  ASN A CB  1 
ATOM   2545 C CG  . ASN A 1 381 ? 37.875  -23.836 87.468  1.00 96.29  ? 381  ASN A CG  1 
ATOM   2546 O OD1 . ASN A 1 381 ? 38.963  -24.412 87.459  1.00 98.00  ? 381  ASN A OD1 1 
ATOM   2547 N ND2 . ASN A 1 381 ? 36.757  -24.409 87.037  1.00 97.73  ? 381  ASN A ND2 1 
ATOM   2548 N N   . GLU A 1 382 ? 34.682  -21.689 86.110  1.00 90.01  ? 382  GLU A N   1 
ATOM   2549 C CA  . GLU A 1 382 ? 34.204  -21.406 84.759  1.00 89.23  ? 382  GLU A CA  1 
ATOM   2550 C C   . GLU A 1 382 ? 33.677  -19.979 84.816  1.00 89.46  ? 382  GLU A C   1 
ATOM   2551 O O   . GLU A 1 382 ? 33.565  -19.291 83.800  1.00 88.57  ? 382  GLU A O   1 
ATOM   2552 C CB  . GLU A 1 382 ? 33.064  -22.352 84.380  1.00 88.58  ? 382  GLU A CB  1 
ATOM   2553 C CG  . GLU A 1 382 ? 32.627  -22.238 82.930  1.00 86.35  ? 382  GLU A CG  1 
ATOM   2554 C CD  . GLU A 1 382 ? 31.324  -22.960 82.652  1.00 85.14  ? 382  GLU A CD  1 
ATOM   2555 O OE1 . GLU A 1 382 ? 31.174  -24.119 83.088  1.00 83.23  ? 382  GLU A OE1 1 
ATOM   2556 O OE2 . GLU A 1 382 ? 30.451  -22.366 81.987  1.00 85.76  ? 382  GLU A OE2 1 
ATOM   2557 N N   . MET A 1 383 ? 33.358  -19.561 86.037  1.00 90.05  ? 383  MET A N   1 
ATOM   2558 C CA  . MET A 1 383 ? 32.835  -18.237 86.342  1.00 90.68  ? 383  MET A CA  1 
ATOM   2559 C C   . MET A 1 383 ? 33.504  -17.134 85.533  1.00 91.17  ? 383  MET A C   1 
ATOM   2560 O O   . MET A 1 383 ? 34.710  -17.179 85.287  1.00 91.40  ? 383  MET A O   1 
ATOM   2561 C CB  . MET A 1 383 ? 33.040  -17.940 87.831  1.00 91.99  ? 383  MET A CB  1 
ATOM   2562 C CG  . MET A 1 383 ? 31.802  -17.478 88.572  1.00 93.05  ? 383  MET A CG  1 
ATOM   2563 S SD  . MET A 1 383 ? 30.584  -18.790 88.736  1.00 95.35  ? 383  MET A SD  1 
ATOM   2564 C CE  . MET A 1 383 ? 29.498  -18.403 87.368  1.00 96.12  ? 383  MET A CE  1 
ATOM   2565 N N   . ALA A 1 384 ? 32.717  -16.146 85.121  1.00 91.29  ? 384  ALA A N   1 
ATOM   2566 C CA  . ALA A 1 384 ? 33.257  -15.016 84.378  1.00 90.80  ? 384  ALA A CA  1 
ATOM   2567 C C   . ALA A 1 384 ? 34.029  -14.203 85.413  1.00 90.76  ? 384  ALA A C   1 
ATOM   2568 O O   . ALA A 1 384 ? 33.687  -14.221 86.596  1.00 91.24  ? 384  ALA A O   1 
ATOM   2569 C CB  . ALA A 1 384 ? 32.128  -14.186 83.780  1.00 89.82  ? 384  ALA A CB  1 
ATOM   2570 N N   . HIS A 1 385 ? 35.065  -13.496 84.976  1.00 90.08  ? 385  HIS A N   1 
ATOM   2571 C CA  . HIS A 1 385 ? 35.880  -12.704 85.893  1.00 90.09  ? 385  HIS A CA  1 
ATOM   2572 C C   . HIS A 1 385 ? 35.062  -11.738 86.753  1.00 90.44  ? 385  HIS A C   1 
ATOM   2573 O O   . HIS A 1 385 ? 35.549  -11.233 87.765  1.00 91.00  ? 385  HIS A O   1 
ATOM   2574 C CB  . HIS A 1 385 ? 36.941  -11.922 85.110  1.00 88.41  ? 385  HIS A CB  1 
ATOM   2575 C CG  . HIS A 1 385 ? 36.393  -10.770 84.325  1.00 87.98  ? 385  HIS A CG  1 
ATOM   2576 N ND1 . HIS A 1 385 ? 35.894  -9.632  84.923  1.00 86.73  ? 385  HIS A ND1 1 
ATOM   2577 C CD2 . HIS A 1 385 ? 36.272  -10.577 82.991  1.00 87.40  ? 385  HIS A CD2 1 
ATOM   2578 C CE1 . HIS A 1 385 ? 35.491  -8.788  83.991  1.00 86.52  ? 385  HIS A CE1 1 
ATOM   2579 N NE2 . HIS A 1 385 ? 35.709  -9.336  82.809  1.00 86.80  ? 385  HIS A NE2 1 
ATOM   2580 N N   . TYR A 1 386 ? 33.816  -11.496 86.356  1.00 90.00  ? 386  TYR A N   1 
ATOM   2581 C CA  . TYR A 1 386 ? 32.946  -10.572 87.080  1.00 88.31  ? 386  TYR A CA  1 
ATOM   2582 C C   . TYR A 1 386 ? 31.788  -11.228 87.832  1.00 87.48  ? 386  TYR A C   1 
ATOM   2583 O O   . TYR A 1 386 ? 31.077  -10.554 88.576  1.00 87.66  ? 386  TYR A O   1 
ATOM   2584 C CB  . TYR A 1 386 ? 32.387  -9.527  86.104  1.00 88.14  ? 386  TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 386 ? 31.701  -10.122 84.887  1.00 88.82  ? 386  TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 386 ? 30.528  -10.870 85.015  1.00 88.36  ? 386  TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 386 ? 32.236  -9.957  83.608  1.00 88.61  ? 386  TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 386 ? 29.906  -11.440 83.902  1.00 88.78  ? 386  TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 386 ? 31.621  -10.522 82.487  1.00 89.01  ? 386  TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 386 ? 30.457  -11.263 82.643  1.00 89.23  ? 386  TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 386 ? 29.847  -11.829 81.545  1.00 88.67  ? 386  TYR A OH  1 
ATOM   2592 N N   . ALA A 1 387 ? 31.605  -12.534 87.655  1.00 86.84  ? 387  ALA A N   1 
ATOM   2593 C CA  . ALA A 1 387 ? 30.498  -13.236 88.307  1.00 86.33  ? 387  ALA A CA  1 
ATOM   2594 C C   . ALA A 1 387 ? 30.877  -14.217 89.416  1.00 84.87  ? 387  ALA A C   1 
ATOM   2595 O O   . ALA A 1 387 ? 32.040  -14.598 89.566  1.00 84.67  ? 387  ALA A O   1 
ATOM   2596 C CB  . ALA A 1 387 ? 29.661  -13.956 87.251  1.00 86.77  ? 387  ALA A CB  1 
ATOM   2597 N N   . CYS A 1 388 ? 29.868  -14.615 90.188  1.00 82.72  ? 388  CYS A N   1 
ATOM   2598 C CA  . CYS A 1 388 ? 30.036  -15.563 91.284  1.00 81.29  ? 388  CYS A CA  1 
ATOM   2599 C C   . CYS A 1 388 ? 29.160  -16.784 91.000  1.00 79.16  ? 388  CYS A C   1 
ATOM   2600 O O   . CYS A 1 388 ? 29.511  -17.911 91.349  1.00 79.39  ? 388  CYS A O   1 
ATOM   2601 C CB  . CYS A 1 388 ? 29.623  -14.926 92.613  1.00 82.43  ? 388  CYS A CB  1 
ATOM   2602 S SG  . CYS A 1 388 ? 27.857  -14.566 92.762  1.00 86.45  ? 388  CYS A SG  1 
ATOM   2603 N N   . ASP A 1 389 ? 28.014  -16.543 90.369  1.00 76.13  ? 389  ASP A N   1 
ATOM   2604 C CA  . ASP A 1 389 ? 27.083  -17.606 89.992  1.00 74.54  ? 389  ASP A CA  1 
ATOM   2605 C C   . ASP A 1 389 ? 26.508  -17.244 88.626  1.00 73.27  ? 389  ASP A C   1 
ATOM   2606 O O   . ASP A 1 389 ? 26.486  -16.069 88.256  1.00 73.13  ? 389  ASP A O   1 
ATOM   2607 C CB  . ASP A 1 389 ? 25.952  -17.740 91.019  1.00 73.21  ? 389  ASP A CB  1 
ATOM   2608 C CG  . ASP A 1 389 ? 24.971  -18.850 90.665  1.00 72.12  ? 389  ASP A CG  1 
ATOM   2609 O OD1 . ASP A 1 389 ? 25.422  -19.981 90.387  1.00 71.15  ? 389  ASP A OD1 1 
ATOM   2610 O OD2 . ASP A 1 389 ? 23.749  -18.597 90.669  1.00 72.39  ? 389  ASP A OD2 1 
ATOM   2611 N N   . CYS A 1 390 ? 26.046  -18.240 87.874  1.00 69.91  ? 390  CYS A N   1 
ATOM   2612 C CA  . CYS A 1 390 ? 25.500  -17.968 86.551  1.00 67.71  ? 390  CYS A CA  1 
ATOM   2613 C C   . CYS A 1 390 ? 24.788  -19.154 85.912  1.00 66.41  ? 390  CYS A C   1 
ATOM   2614 O O   . CYS A 1 390 ? 25.076  -20.309 86.219  1.00 66.78  ? 390  CYS A O   1 
ATOM   2615 C CB  . CYS A 1 390 ? 26.624  -17.494 85.622  1.00 67.62  ? 390  CYS A CB  1 
ATOM   2616 S SG  . CYS A 1 390 ? 26.107  -17.061 83.943  1.00 66.80  ? 390  CYS A SG  1 
ATOM   2617 N N   . TRP A 1 391 ? 23.845  -18.847 85.025  1.00 64.64  ? 391  TRP A N   1 
ATOM   2618 C CA  . TRP A 1 391 ? 23.089  -19.859 84.295  1.00 63.87  ? 391  TRP A CA  1 
ATOM   2619 C C   . TRP A 1 391 ? 22.932  -19.383 82.856  1.00 61.95  ? 391  TRP A C   1 
ATOM   2620 O O   . TRP A 1 391 ? 22.528  -18.245 82.610  1.00 63.46  ? 391  TRP A O   1 
ATOM   2621 C CB  . TRP A 1 391 ? 21.700  -20.074 84.903  1.00 64.88  ? 391  TRP A CB  1 
ATOM   2622 C CG  . TRP A 1 391 ? 21.685  -20.830 86.197  1.00 67.56  ? 391  TRP A CG  1 
ATOM   2623 C CD1 . TRP A 1 391 ? 22.011  -20.351 87.434  1.00 68.34  ? 391  TRP A CD1 1 
ATOM   2624 C CD2 . TRP A 1 391 ? 21.301  -22.198 86.386  1.00 67.99  ? 391  TRP A CD2 1 
ATOM   2625 N NE1 . TRP A 1 391 ? 21.849  -21.335 88.382  1.00 69.35  ? 391  TRP A NE1 1 
ATOM   2626 C CE2 . TRP A 1 391 ? 21.415  -22.479 87.766  1.00 67.16  ? 391  TRP A CE2 1 
ATOM   2627 C CE3 . TRP A 1 391 ? 20.871  -23.215 85.521  1.00 67.98  ? 391  TRP A CE3 1 
ATOM   2628 C CZ2 . TRP A 1 391 ? 21.113  -23.734 88.304  1.00 66.26  ? 391  TRP A CZ2 1 
ATOM   2629 C CZ3 . TRP A 1 391 ? 20.571  -24.466 86.057  1.00 67.04  ? 391  TRP A CZ3 1 
ATOM   2630 C CH2 . TRP A 1 391 ? 20.694  -24.712 87.436  1.00 68.01  ? 391  TRP A CH2 1 
ATOM   2631 N N   . ASP A 1 392 ? 23.255  -20.256 81.910  1.00 58.57  ? 392  ASP A N   1 
ATOM   2632 C CA  . ASP A 1 392 ? 23.151  -19.918 80.498  1.00 56.10  ? 392  ASP A CA  1 
ATOM   2633 C C   . ASP A 1 392 ? 22.037  -20.696 79.825  1.00 54.63  ? 392  ASP A C   1 
ATOM   2634 O O   . ASP A 1 392 ? 21.838  -21.880 80.097  1.00 54.73  ? 392  ASP A O   1 
ATOM   2635 C CB  . ASP A 1 392 ? 24.462  -20.227 79.770  1.00 53.71  ? 392  ASP A CB  1 
ATOM   2636 C CG  . ASP A 1 392 ? 25.597  -19.328 80.196  1.00 52.72  ? 392  ASP A CG  1 
ATOM   2637 O OD1 . ASP A 1 392 ? 26.749  -19.606 79.798  1.00 53.94  ? 392  ASP A OD1 1 
ATOM   2638 O OD2 . ASP A 1 392 ? 25.344  -18.342 80.920  1.00 53.04  ? 392  ASP A OD2 1 
ATOM   2639 N N   . ALA A 1 393 ? 21.306  -20.019 78.950  1.00 53.26  ? 393  ALA A N   1 
ATOM   2640 C CA  . ALA A 1 393 ? 20.242  -20.662 78.200  1.00 52.43  ? 393  ALA A CA  1 
ATOM   2641 C C   . ALA A 1 393 ? 20.943  -21.177 76.952  1.00 51.74  ? 393  ALA A C   1 
ATOM   2642 O O   . ALA A 1 393 ? 21.349  -20.396 76.090  1.00 50.93  ? 393  ALA A O   1 
ATOM   2643 C CB  . ALA A 1 393 ? 19.161  -19.652 77.829  1.00 51.46  ? 393  ALA A CB  1 
ATOM   2644 N N   . GLU A 1 394 ? 21.117  -22.490 76.875  1.00 52.27  ? 394  GLU A N   1 
ATOM   2645 C CA  . GLU A 1 394 ? 21.784  -23.096 75.730  1.00 52.93  ? 394  GLU A CA  1 
ATOM   2646 C C   . GLU A 1 394 ? 20.758  -23.784 74.839  1.00 52.59  ? 394  GLU A C   1 
ATOM   2647 O O   . GLU A 1 394 ? 19.792  -24.375 75.329  1.00 52.26  ? 394  GLU A O   1 
ATOM   2648 C CB  . GLU A 1 394 ? 22.823  -24.122 76.200  1.00 52.26  ? 394  GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 394 ? 23.772  -23.612 77.276  1.00 52.30  ? 394  GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 394 ? 24.759  -24.672 77.741  1.00 52.53  ? 394  GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 394 ? 24.327  -25.807 78.036  1.00 49.00  ? 394  GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 394 ? 25.968  -24.365 77.820  1.00 53.37  ? 394  GLU A OE2 1 
ATOM   2653 N N   . SER A 1 395 ? 20.966  -23.699 73.529  1.00 50.91  ? 395  SER A N   1 
ATOM   2654 C CA  . SER A 1 395 ? 20.063  -24.336 72.582  1.00 50.49  ? 395  SER A CA  1 
ATOM   2655 C C   . SER A 1 395 ? 20.801  -25.444 71.835  1.00 52.86  ? 395  SER A C   1 
ATOM   2656 O O   . SER A 1 395 ? 21.980  -25.308 71.502  1.00 52.25  ? 395  SER A O   1 
ATOM   2657 C CB  . SER A 1 395 ? 19.511  -23.308 71.590  1.00 46.86  ? 395  SER A CB  1 
ATOM   2658 O OG  . SER A 1 395 ? 20.536  -22.754 70.789  1.00 41.37  ? 395  SER A OG  1 
ATOM   2659 N N   . LYS A 1 396 ? 20.101  -26.545 71.589  1.00 54.63  ? 396  LYS A N   1 
ATOM   2660 C CA  . LYS A 1 396 ? 20.675  -27.684 70.885  1.00 57.47  ? 396  LYS A CA  1 
ATOM   2661 C C   . LYS A 1 396 ? 20.670  -27.358 69.389  1.00 57.90  ? 396  LYS A C   1 
ATOM   2662 O O   . LYS A 1 396 ? 19.607  -27.232 68.776  1.00 57.56  ? 396  LYS A O   1 
ATOM   2663 C CB  . LYS A 1 396 ? 19.828  -28.932 71.160  1.00 60.34  ? 396  LYS A CB  1 
ATOM   2664 C CG  . LYS A 1 396 ? 20.590  -30.253 71.242  1.00 61.42  ? 396  LYS A CG  1 
ATOM   2665 C CD  . LYS A 1 396 ? 21.329  -30.584 69.962  1.00 64.36  ? 396  LYS A CD  1 
ATOM   2666 C CE  . LYS A 1 396 ? 21.598  -32.084 69.857  1.00 67.57  ? 396  LYS A CE  1 
ATOM   2667 N NZ  . LYS A 1 396 ? 22.305  -32.638 71.049  1.00 68.20  ? 396  LYS A NZ  1 
ATOM   2668 N N   . THR A 1 397 ? 21.857  -27.212 68.807  1.00 56.29  ? 397  THR A N   1 
ATOM   2669 C CA  . THR A 1 397 ? 21.972  -26.889 67.389  1.00 55.70  ? 397  THR A CA  1 
ATOM   2670 C C   . THR A 1 397 ? 22.923  -27.845 66.680  1.00 57.04  ? 397  THR A C   1 
ATOM   2671 O O   . THR A 1 397 ? 23.480  -28.753 67.299  1.00 55.63  ? 397  THR A O   1 
ATOM   2672 C CB  . THR A 1 397 ? 22.503  -25.456 67.183  1.00 55.55  ? 397  THR A CB  1 
ATOM   2673 O OG1 . THR A 1 397 ? 23.831  -25.358 67.714  1.00 53.76  ? 397  THR A OG1 1 
ATOM   2674 C CG2 . THR A 1 397 ? 21.605  -24.448 67.886  1.00 53.89  ? 397  THR A CG2 1 
ATOM   2675 N N   . SER A 1 398 ? 23.111  -27.630 65.381  1.00 56.92  ? 398  SER A N   1 
ATOM   2676 C CA  . SER A 1 398 ? 24.005  -28.469 64.597  1.00 56.22  ? 398  SER A CA  1 
ATOM   2677 C C   . SER A 1 398 ? 25.434  -28.301 65.106  1.00 57.09  ? 398  SER A C   1 
ATOM   2678 O O   . SER A 1 398 ? 26.329  -29.067 64.743  1.00 58.54  ? 398  SER A O   1 
ATOM   2679 C CB  . SER A 1 398 ? 23.936  -28.089 63.118  1.00 56.24  ? 398  SER A CB  1 
ATOM   2680 O OG  . SER A 1 398 ? 24.464  -26.794 62.903  1.00 59.44  ? 398  SER A OG  1 
ATOM   2681 N N   . TYR A 1 399 ? 25.648  -27.288 65.942  1.00 55.83  ? 399  TYR A N   1 
ATOM   2682 C CA  . TYR A 1 399 ? 26.967  -27.042 66.513  1.00 53.99  ? 399  TYR A CA  1 
ATOM   2683 C C   . TYR A 1 399 ? 26.956  -27.493 67.969  1.00 53.73  ? 399  TYR A C   1 
ATOM   2684 O O   . TYR A 1 399 ? 27.839  -27.135 68.749  1.00 54.21  ? 399  TYR A O   1 
ATOM   2685 C CB  . TYR A 1 399 ? 27.331  -25.554 66.452  1.00 52.92  ? 399  TYR A CB  1 
ATOM   2686 C CG  . TYR A 1 399 ? 27.363  -24.948 65.063  1.00 52.24  ? 399  TYR A CG  1 
ATOM   2687 C CD1 . TYR A 1 399 ? 26.231  -24.342 64.518  1.00 50.96  ? 399  TYR A CD1 1 
ATOM   2688 C CD2 . TYR A 1 399 ? 28.538  -24.946 64.307  1.00 50.47  ? 399  TYR A CD2 1 
ATOM   2689 C CE1 . TYR A 1 399 ? 26.267  -23.743 63.260  1.00 50.09  ? 399  TYR A CE1 1 
ATOM   2690 C CE2 . TYR A 1 399 ? 28.585  -24.350 63.046  1.00 50.47  ? 399  TYR A CE2 1 
ATOM   2691 C CZ  . TYR A 1 399 ? 27.446  -23.748 62.530  1.00 51.98  ? 399  TYR A CZ  1 
ATOM   2692 O OH  . TYR A 1 399 ? 27.486  -23.135 61.297  1.00 52.91  ? 399  TYR A OH  1 
ATOM   2693 N N   . GLY A 1 400 ? 25.945  -28.278 68.327  1.00 54.36  ? 400  GLY A N   1 
ATOM   2694 C CA  . GLY A 1 400 ? 25.829  -28.760 69.690  1.00 54.13  ? 400  GLY A CA  1 
ATOM   2695 C C   . GLY A 1 400 ? 25.185  -27.719 70.583  1.00 55.99  ? 400  GLY A C   1 
ATOM   2696 O O   . GLY A 1 400 ? 24.559  -26.775 70.094  1.00 55.77  ? 400  GLY A O   1 
ATOM   2697 N N   . TRP A 1 401 ? 25.332  -27.886 71.894  1.00 55.96  ? 401  TRP A N   1 
ATOM   2698 C CA  . TRP A 1 401 ? 24.755  -26.937 72.833  1.00 56.14  ? 401  TRP A CA  1 
ATOM   2699 C C   . TRP A 1 401 ? 25.593  -25.671 72.883  1.00 56.79  ? 401  TRP A C   1 
ATOM   2700 O O   . TRP A 1 401 ? 26.808  -25.725 73.071  1.00 59.46  ? 401  TRP A O   1 
ATOM   2701 C CB  . TRP A 1 401 ? 24.661  -27.542 74.237  1.00 55.99  ? 401  TRP A CB  1 
ATOM   2702 C CG  . TRP A 1 401 ? 23.729  -28.711 74.332  1.00 58.27  ? 401  TRP A CG  1 
ATOM   2703 C CD1 . TRP A 1 401 ? 24.055  -30.032 74.222  1.00 58.56  ? 401  TRP A CD1 1 
ATOM   2704 C CD2 . TRP A 1 401 ? 22.311  -28.665 74.541  1.00 56.63  ? 401  TRP A CD2 1 
ATOM   2705 N NE1 . TRP A 1 401 ? 22.930  -30.812 74.352  1.00 58.26  ? 401  TRP A NE1 1 
ATOM   2706 C CE2 . TRP A 1 401 ? 21.846  -29.999 74.548  1.00 57.13  ? 401  TRP A CE2 1 
ATOM   2707 C CE3 . TRP A 1 401 ? 21.388  -27.625 74.722  1.00 55.62  ? 401  TRP A CE3 1 
ATOM   2708 C CZ2 . TRP A 1 401 ? 20.497  -30.323 74.731  1.00 55.74  ? 401  TRP A CZ2 1 
ATOM   2709 C CZ3 . TRP A 1 401 ? 20.044  -27.948 74.903  1.00 54.99  ? 401  TRP A CZ3 1 
ATOM   2710 C CH2 . TRP A 1 401 ? 19.614  -29.288 74.906  1.00 56.95  ? 401  TRP A CH2 1 
ATOM   2711 N N   . ILE A 1 402 ? 24.935  -24.530 72.704  1.00 56.35  ? 402  ILE A N   1 
ATOM   2712 C CA  . ILE A 1 402 ? 25.611  -23.240 72.739  1.00 55.83  ? 402  ILE A CA  1 
ATOM   2713 C C   . ILE A 1 402 ? 24.745  -22.244 73.501  1.00 54.12  ? 402  ILE A C   1 
ATOM   2714 O O   . ILE A 1 402 ? 23.516  -22.280 73.408  1.00 52.86  ? 402  ILE A O   1 
ATOM   2715 C CB  . ILE A 1 402 ? 25.866  -22.703 71.317  1.00 58.39  ? 402  ILE A CB  1 
ATOM   2716 C CG1 . ILE A 1 402 ? 24.538  -22.532 70.584  1.00 60.38  ? 402  ILE A CG1 1 
ATOM   2717 C CG2 . ILE A 1 402 ? 26.771  -23.667 70.548  1.00 56.33  ? 402  ILE A CG2 1 
ATOM   2718 C CD1 . ILE A 1 402 ? 24.677  -21.880 69.236  1.00 65.78  ? 402  ILE A CD1 1 
ATOM   2719 N N   . GLU A 1 403 ? 25.382  -21.357 74.258  1.00 52.82  ? 403  GLU A N   1 
ATOM   2720 C CA  . GLU A 1 403 ? 24.635  -20.379 75.031  1.00 52.26  ? 403  GLU A CA  1 
ATOM   2721 C C   . GLU A 1 403 ? 24.130  -19.260 74.129  1.00 51.23  ? 403  GLU A C   1 
ATOM   2722 O O   . GLU A 1 403 ? 24.868  -18.735 73.294  1.00 49.60  ? 403  GLU A O   1 
ATOM   2723 C CB  . GLU A 1 403 ? 25.502  -19.798 76.160  1.00 52.10  ? 403  GLU A CB  1 
ATOM   2724 C CG  . GLU A 1 403 ? 26.446  -18.684 75.740  1.00 54.30  ? 403  GLU A CG  1 
ATOM   2725 C CD  . GLU A 1 403 ? 27.150  -18.038 76.919  1.00 54.10  ? 403  GLU A CD  1 
ATOM   2726 O OE1 . GLU A 1 403 ? 28.117  -18.632 77.448  1.00 60.23  ? 403  GLU A OE1 1 
ATOM   2727 O OE2 . GLU A 1 403 ? 26.728  -16.936 77.324  1.00 52.88  ? 403  GLU A OE2 1 
ATOM   2728 N N   . ILE A 1 404 ? 22.857  -18.916 74.289  1.00 50.42  ? 404  ILE A N   1 
ATOM   2729 C CA  . ILE A 1 404 ? 22.250  -17.852 73.506  1.00 50.87  ? 404  ILE A CA  1 
ATOM   2730 C C   . ILE A 1 404 ? 21.780  -16.754 74.456  1.00 52.30  ? 404  ILE A C   1 
ATOM   2731 O O   . ILE A 1 404 ? 21.436  -15.647 74.033  1.00 53.89  ? 404  ILE A O   1 
ATOM   2732 C CB  . ILE A 1 404 ? 21.060  -18.382 72.668  1.00 49.89  ? 404  ILE A CB  1 
ATOM   2733 C CG1 . ILE A 1 404 ? 20.043  -19.084 73.570  1.00 48.85  ? 404  ILE A CG1 1 
ATOM   2734 C CG2 . ILE A 1 404 ? 21.567  -19.349 71.611  1.00 48.04  ? 404  ILE A CG2 1 
ATOM   2735 C CD1 . ILE A 1 404 ? 18.846  -19.638 72.822  1.00 48.69  ? 404  ILE A CD1 1 
ATOM   2736 N N   . VAL A 1 405 ? 21.778  -17.076 75.747  1.00 51.08  ? 405  VAL A N   1 
ATOM   2737 C CA  . VAL A 1 405 ? 21.380  -16.134 76.786  1.00 50.79  ? 405  VAL A CA  1 
ATOM   2738 C C   . VAL A 1 405 ? 22.168  -16.411 78.061  1.00 51.14  ? 405  VAL A C   1 
ATOM   2739 O O   . VAL A 1 405 ? 22.094  -17.503 78.627  1.00 49.67  ? 405  VAL A O   1 
ATOM   2740 C CB  . VAL A 1 405 ? 19.871  -16.238 77.126  1.00 50.17  ? 405  VAL A CB  1 
ATOM   2741 C CG1 . VAL A 1 405 ? 19.509  -15.206 78.187  1.00 47.89  ? 405  VAL A CG1 1 
ATOM   2742 C CG2 . VAL A 1 405 ? 19.033  -16.021 75.883  1.00 49.82  ? 405  VAL A CG2 1 
ATOM   2743 N N   . GLY A 1 406 ? 22.930  -15.422 78.505  1.00 52.42  ? 406  GLY A N   1 
ATOM   2744 C CA  . GLY A 1 406 ? 23.698  -15.583 79.724  1.00 54.15  ? 406  GLY A CA  1 
ATOM   2745 C C   . GLY A 1 406 ? 22.976  -14.875 80.854  1.00 56.25  ? 406  GLY A C   1 
ATOM   2746 O O   . GLY A 1 406 ? 22.491  -13.762 80.672  1.00 55.52  ? 406  GLY A O   1 
ATOM   2747 N N   . CYS A 1 407 ? 22.885  -15.516 82.014  1.00 57.73  ? 407  CYS A N   1 
ATOM   2748 C CA  . CYS A 1 407 ? 22.212  -14.908 83.155  1.00 59.60  ? 407  CYS A CA  1 
ATOM   2749 C C   . CYS A 1 407 ? 23.102  -15.049 84.385  1.00 61.75  ? 407  CYS A C   1 
ATOM   2750 O O   . CYS A 1 407 ? 22.997  -16.027 85.126  1.00 61.91  ? 407  CYS A O   1 
ATOM   2751 C CB  . CYS A 1 407 ? 20.865  -15.591 83.395  1.00 59.71  ? 407  CYS A CB  1 
ATOM   2752 S SG  . CYS A 1 407 ? 19.733  -14.648 84.445  1.00 58.95  ? 407  CYS A SG  1 
ATOM   2753 N N   . ALA A 1 408 ? 23.976  -14.063 84.592  1.00 63.70  ? 408  ALA A N   1 
ATOM   2754 C CA  . ALA A 1 408 ? 24.913  -14.071 85.714  1.00 66.60  ? 408  ALA A CA  1 
ATOM   2755 C C   . ALA A 1 408 ? 24.423  -13.333 86.956  1.00 69.51  ? 408  ALA A C   1 
ATOM   2756 O O   . ALA A 1 408 ? 23.549  -12.468 86.884  1.00 69.72  ? 408  ALA A O   1 
ATOM   2757 C CB  . ALA A 1 408 ? 26.262  -13.491 85.273  1.00 66.72  ? 408  ALA A CB  1 
ATOM   2758 N N   . ASP A 1 409 ? 25.012  -13.684 88.096  1.00 72.93  ? 409  ASP A N   1 
ATOM   2759 C CA  . ASP A 1 409 ? 24.669  -13.083 89.381  1.00 74.87  ? 409  ASP A CA  1 
ATOM   2760 C C   . ASP A 1 409 ? 25.882  -12.330 89.925  1.00 76.36  ? 409  ASP A C   1 
ATOM   2761 O O   . ASP A 1 409 ? 26.184  -12.376 91.118  1.00 77.20  ? 409  ASP A O   1 
ATOM   2762 C CB  . ASP A 1 409 ? 24.247  -14.181 90.364  1.00 75.98  ? 409  ASP A CB  1 
ATOM   2763 C CG  . ASP A 1 409 ? 23.608  -13.631 91.632  1.00 77.29  ? 409  ASP A CG  1 
ATOM   2764 O OD1 . ASP A 1 409 ? 24.259  -12.856 92.365  1.00 74.48  ? 409  ASP A OD1 1 
ATOM   2765 O OD2 . ASP A 1 409 ? 22.442  -13.993 91.901  1.00 80.00  ? 409  ASP A OD2 1 
ATOM   2766 N N   . ARG A 1 410 ? 26.573  -11.634 89.029  1.00 77.90  ? 410  ARG A N   1 
ATOM   2767 C CA  . ARG A 1 410 ? 27.760  -10.866 89.383  1.00 79.64  ? 410  ARG A CA  1 
ATOM   2768 C C   . ARG A 1 410 ? 27.514  -9.877  90.519  1.00 80.91  ? 410  ARG A C   1 
ATOM   2769 O O   . ARG A 1 410 ? 27.401  -8.677  90.285  1.00 82.23  ? 410  ARG A O   1 
ATOM   2770 C CB  . ARG A 1 410 ? 28.266  -10.109 88.156  1.00 79.74  ? 410  ARG A CB  1 
ATOM   2771 C CG  . ARG A 1 410 ? 27.213  -9.197  87.524  1.00 80.05  ? 410  ARG A CG  1 
ATOM   2772 C CD  . ARG A 1 410 ? 27.832  -8.208  86.558  1.00 79.53  ? 410  ARG A CD  1 
ATOM   2773 N NE  . ARG A 1 410 ? 27.960  -8.748  85.213  1.00 79.95  ? 410  ARG A NE  1 
ATOM   2774 C CZ  . ARG A 1 410 ? 28.617  -8.139  84.233  1.00 80.41  ? 410  ARG A CZ  1 
ATOM   2775 N NH1 . ARG A 1 410 ? 29.213  -6.977  84.457  1.00 79.62  ? 410  ARG A NH1 1 
ATOM   2776 N NH2 . ARG A 1 410 ? 28.647  -8.673  83.021  1.00 81.06  ? 410  ARG A NH2 1 
ATOM   2777 N N   . SER A 1 411 ? 27.463  -10.392 91.743  1.00 81.76  ? 411  SER A N   1 
ATOM   2778 C CA  . SER A 1 411 ? 27.237  -9.607  92.955  1.00 82.18  ? 411  SER A CA  1 
ATOM   2779 C C   . SER A 1 411 ? 27.449  -8.089  92.866  1.00 82.61  ? 411  SER A C   1 
ATOM   2780 O O   . SER A 1 411 ? 26.676  -7.383  92.223  1.00 83.30  ? 411  SER A O   1 
ATOM   2781 C CB  . SER A 1 411 ? 28.098  -10.172 94.081  1.00 82.53  ? 411  SER A CB  1 
ATOM   2782 O OG  . SER A 1 411 ? 29.474  -10.067 93.755  1.00 84.14  ? 411  SER A OG  1 
ATOM   2783 N N   . CYS A 1 412 ? 28.476  -7.589  93.551  1.00 83.41  ? 412  CYS A N   1 
ATOM   2784 C CA  . CYS A 1 412 ? 28.789  -6.157  93.565  1.00 85.49  ? 412  CYS A CA  1 
ATOM   2785 C C   . CYS A 1 412 ? 30.166  -5.886  92.972  1.00 83.94  ? 412  CYS A C   1 
ATOM   2786 O O   . CYS A 1 412 ? 30.788  -4.863  93.258  1.00 84.03  ? 412  CYS A O   1 
ATOM   2787 C CB  . CYS A 1 412 ? 28.754  -5.629  95.007  1.00 88.83  ? 412  CYS A CB  1 
ATOM   2788 S SG  . CYS A 1 412 ? 29.836  -6.566  96.132  1.00 95.22  ? 412  CYS A SG  1 
ATOM   2789 N N   . TYR A 1 413 ? 30.641  -6.809  92.145  1.00 82.87  ? 413  TYR A N   1 
ATOM   2790 C CA  . TYR A 1 413 ? 31.949  -6.663  91.530  1.00 82.28  ? 413  TYR A CA  1 
ATOM   2791 C C   . TYR A 1 413 ? 32.099  -5.314  90.820  1.00 81.98  ? 413  TYR A C   1 
ATOM   2792 O O   . TYR A 1 413 ? 32.918  -4.473  91.207  1.00 81.50  ? 413  TYR A O   1 
ATOM   2793 C CB  . TYR A 1 413 ? 32.180  -7.820  90.537  1.00 82.68  ? 413  TYR A CB  1 
ATOM   2794 C CG  . TYR A 1 413 ? 33.534  -7.824  89.854  1.00 84.36  ? 413  TYR A CG  1 
ATOM   2795 C CD1 . TYR A 1 413 ? 33.834  -6.916  88.835  1.00 85.41  ? 413  TYR A CD1 1 
ATOM   2796 C CD2 . TYR A 1 413 ? 34.513  -8.746  90.221  1.00 84.62  ? 413  TYR A CD2 1 
ATOM   2797 C CE1 . TYR A 1 413 ? 35.074  -6.933  88.199  1.00 86.00  ? 413  TYR A CE1 1 
ATOM   2798 C CE2 . TYR A 1 413 ? 35.746  -8.770  89.597  1.00 84.62  ? 413  TYR A CE2 1 
ATOM   2799 C CZ  . TYR A 1 413 ? 36.023  -7.865  88.588  1.00 85.64  ? 413  TYR A CZ  1 
ATOM   2800 O OH  . TYR A 1 413 ? 37.248  -7.899  87.965  1.00 86.43  ? 413  TYR A OH  1 
ATOM   2801 N N   . ASP A 1 414 ? 31.290  -5.112  89.789  1.00 82.01  ? 414  ASP A N   1 
ATOM   2802 C CA  . ASP A 1 414 ? 31.348  -3.908  88.973  1.00 81.29  ? 414  ASP A CA  1 
ATOM   2803 C C   . ASP A 1 414 ? 31.305  -2.570  89.678  1.00 80.73  ? 414  ASP A C   1 
ATOM   2804 O O   . ASP A 1 414 ? 32.274  -1.822  89.619  1.00 80.74  ? 414  ASP A O   1 
ATOM   2805 C CB  . ASP A 1 414 ? 30.254  -3.959  87.915  1.00 81.48  ? 414  ASP A CB  1 
ATOM   2806 C CG  . ASP A 1 414 ? 30.360  -5.185  87.049  1.00 81.86  ? 414  ASP A CG  1 
ATOM   2807 O OD1 . ASP A 1 414 ? 31.320  -5.279  86.252  1.00 79.58  ? 414  ASP A OD1 1 
ATOM   2808 O OD2 . ASP A 1 414 ? 29.489  -6.064  87.182  1.00 82.67  ? 414  ASP A OD2 1 
ATOM   2809 N N   . LEU A 1 415 ? 30.189  -2.271  90.338  1.00 79.77  ? 415  LEU A N   1 
ATOM   2810 C CA  . LEU A 1 415 ? 30.014  -0.994  91.032  1.00 78.65  ? 415  LEU A CA  1 
ATOM   2811 C C   . LEU A 1 415 ? 31.160  -0.630  91.964  1.00 79.48  ? 415  LEU A C   1 
ATOM   2812 O O   . LEU A 1 415 ? 31.539  0.537   92.069  1.00 79.26  ? 415  LEU A O   1 
ATOM   2813 C CB  . LEU A 1 415 ? 28.691  -0.989  91.810  1.00 76.72  ? 415  LEU A CB  1 
ATOM   2814 C CG  . LEU A 1 415 ? 27.488  -0.256  91.196  1.00 74.69  ? 415  LEU A CG  1 
ATOM   2815 C CD1 . LEU A 1 415 ? 27.318  -0.655  89.743  1.00 75.22  ? 415  LEU A CD1 1 
ATOM   2816 C CD2 . LEU A 1 415 ? 26.224  -0.576  91.988  1.00 74.03  ? 415  LEU A CD2 1 
ATOM   2817 N N   . SER A 1 416 ? 31.710  -1.631  92.641  1.00 79.73  ? 416  SER A N   1 
ATOM   2818 C CA  . SER A 1 416 ? 32.815  -1.399  93.559  1.00 80.36  ? 416  SER A CA  1 
ATOM   2819 C C   . SER A 1 416 ? 34.083  -1.017  92.803  1.00 80.28  ? 416  SER A C   1 
ATOM   2820 O O   . SER A 1 416 ? 34.760  -0.055  93.162  1.00 79.08  ? 416  SER A O   1 
ATOM   2821 C CB  . SER A 1 416 ? 33.087  -2.654  94.391  1.00 80.58  ? 416  SER A CB  1 
ATOM   2822 O OG  . SER A 1 416 ? 31.958  -3.022  95.162  1.00 82.58  ? 416  SER A OG  1 
ATOM   2823 N N   . CYS A 1 417 ? 34.401  -1.779  91.761  1.00 80.39  ? 417  CYS A N   1 
ATOM   2824 C CA  . CYS A 1 417 ? 35.595  -1.533  90.957  1.00 80.88  ? 417  CYS A CA  1 
ATOM   2825 C C   . CYS A 1 417 ? 35.674  -0.100  90.451  1.00 79.27  ? 417  CYS A C   1 
ATOM   2826 O O   . CYS A 1 417 ? 36.694  0.572   90.614  1.00 79.24  ? 417  CYS A O   1 
ATOM   2827 C CB  . CYS A 1 417 ? 35.632  -2.489  89.766  1.00 82.87  ? 417  CYS A CB  1 
ATOM   2828 S SG  . CYS A 1 417 ? 35.688  -4.233  90.217  1.00 90.79  ? 417  CYS A SG  1 
ATOM   2829 N N   . HIS A 1 418 ? 34.596  0.361   89.826  1.00 77.09  ? 418  HIS A N   1 
ATOM   2830 C CA  . HIS A 1 418 ? 34.549  1.715   89.289  1.00 75.82  ? 418  HIS A CA  1 
ATOM   2831 C C   . HIS A 1 418 ? 34.557  2.757   90.398  1.00 76.18  ? 418  HIS A C   1 
ATOM   2832 O O   . HIS A 1 418 ? 35.141  3.832   90.250  1.00 75.28  ? 418  HIS A O   1 
ATOM   2833 C CB  . HIS A 1 418 ? 33.305  1.886   88.416  1.00 73.42  ? 418  HIS A CB  1 
ATOM   2834 C CG  . HIS A 1 418 ? 33.344  1.084   87.153  1.00 70.28  ? 418  HIS A CG  1 
ATOM   2835 N ND1 . HIS A 1 418 ? 34.247  1.336   86.143  1.00 67.90  ? 418  HIS A ND1 1 
ATOM   2836 C CD2 . HIS A 1 418 ? 32.617  0.015   86.752  1.00 68.43  ? 418  HIS A CD2 1 
ATOM   2837 C CE1 . HIS A 1 418 ? 34.075  0.455   85.173  1.00 68.79  ? 418  HIS A CE1 1 
ATOM   2838 N NE2 . HIS A 1 418 ? 33.093  -0.358  85.518  1.00 67.76  ? 418  HIS A NE2 1 
ATOM   2839 N N   . ALA A 1 419 ? 33.906  2.436   91.510  1.00 77.05  ? 419  ALA A N   1 
ATOM   2840 C CA  . ALA A 1 419 ? 33.849  3.350   92.640  1.00 77.96  ? 419  ALA A CA  1 
ATOM   2841 C C   . ALA A 1 419 ? 35.252  3.566   93.197  1.00 78.68  ? 419  ALA A C   1 
ATOM   2842 O O   . ALA A 1 419 ? 35.677  4.701   93.411  1.00 79.54  ? 419  ALA A O   1 
ATOM   2843 C CB  . ALA A 1 419 ? 32.934  2.788   93.719  1.00 78.38  ? 419  ALA A CB  1 
ATOM   2844 N N   . ARG A 1 420 ? 35.969  2.467   93.419  1.00 79.48  ? 420  ARG A N   1 
ATOM   2845 C CA  . ARG A 1 420 ? 37.326  2.522   93.953  1.00 80.51  ? 420  ARG A CA  1 
ATOM   2846 C C   . ARG A 1 420 ? 38.311  3.221   93.019  1.00 80.12  ? 420  ARG A C   1 
ATOM   2847 O O   . ARG A 1 420 ? 39.136  4.019   93.463  1.00 80.04  ? 420  ARG A O   1 
ATOM   2848 C CB  . ARG A 1 420 ? 37.832  1.107   94.254  1.00 81.15  ? 420  ARG A CB  1 
ATOM   2849 C CG  . ARG A 1 420 ? 37.228  0.471   95.497  1.00 84.33  ? 420  ARG A CG  1 
ATOM   2850 C CD  . ARG A 1 420 ? 37.760  -0.940  95.700  1.00 87.08  ? 420  ARG A CD  1 
ATOM   2851 N NE  . ARG A 1 420 ? 37.159  -1.892  94.768  1.00 90.59  ? 420  ARG A NE  1 
ATOM   2852 C CZ  . ARG A 1 420 ? 37.841  -2.799  94.075  1.00 90.83  ? 420  ARG A CZ  1 
ATOM   2853 N NH1 . ARG A 1 420 ? 39.159  -2.883  94.201  1.00 90.70  ? 420  ARG A NH1 1 
ATOM   2854 N NH2 . ARG A 1 420 ? 37.203  -3.629  93.259  1.00 90.62  ? 420  ARG A NH2 1 
ATOM   2855 N N   . ALA A 1 421 ? 38.221  2.925   91.727  1.00 79.99  ? 421  ALA A N   1 
ATOM   2856 C CA  . ALA A 1 421 ? 39.123  3.511   90.743  1.00 79.90  ? 421  ALA A CA  1 
ATOM   2857 C C   . ALA A 1 421 ? 38.906  5.002   90.486  1.00 80.28  ? 421  ALA A C   1 
ATOM   2858 O O   . ALA A 1 421 ? 39.868  5.760   90.364  1.00 79.78  ? 421  ALA A O   1 
ATOM   2859 C CB  . ALA A 1 421 ? 39.022  2.742   89.433  1.00 79.52  ? 421  ALA A CB  1 
ATOM   2860 N N   . THR A 1 422 ? 37.647  5.422   90.406  1.00 80.58  ? 422  THR A N   1 
ATOM   2861 C CA  . THR A 1 422 ? 37.328  6.822   90.139  1.00 81.94  ? 422  THR A CA  1 
ATOM   2862 C C   . THR A 1 422 ? 37.190  7.665   91.399  1.00 83.09  ? 422  THR A C   1 
ATOM   2863 O O   . THR A 1 422 ? 37.045  8.887   91.322  1.00 83.38  ? 422  THR A O   1 
ATOM   2864 C CB  . THR A 1 422 ? 36.011  6.949   89.351  1.00 81.72  ? 422  THR A CB  1 
ATOM   2865 O OG1 . THR A 1 422 ? 34.924  6.496   90.167  1.00 80.85  ? 422  THR A OG1 1 
ATOM   2866 C CG2 . THR A 1 422 ? 36.067  6.113   88.085  1.00 82.78  ? 422  THR A CG2 1 
ATOM   2867 N N   . LYS A 1 423 ? 37.240  7.015   92.557  1.00 83.89  ? 423  LYS A N   1 
ATOM   2868 C CA  . LYS A 1 423 ? 37.091  7.720   93.823  1.00 84.39  ? 423  LYS A CA  1 
ATOM   2869 C C   . LYS A 1 423 ? 35.724  8.402   93.837  1.00 83.66  ? 423  LYS A C   1 
ATOM   2870 O O   . LYS A 1 423 ? 35.583  9.538   94.294  1.00 84.02  ? 423  LYS A O   1 
ATOM   2871 C CB  . LYS A 1 423 ? 38.200  8.765   94.003  1.00 85.99  ? 423  LYS A CB  1 
ATOM   2872 C CG  . LYS A 1 423 ? 39.592  8.189   94.246  1.00 87.65  ? 423  LYS A CG  1 
ATOM   2873 C CD  . LYS A 1 423 ? 40.588  9.295   94.593  1.00 90.78  ? 423  LYS A CD  1 
ATOM   2874 C CE  . LYS A 1 423 ? 41.969  8.742   94.924  1.00 91.54  ? 423  LYS A CE  1 
ATOM   2875 N NZ  . LYS A 1 423 ? 42.603  8.063   93.757  1.00 92.97  ? 423  LYS A NZ  1 
ATOM   2876 N N   . VAL A 1 424 ? 34.725  7.698   93.316  1.00 82.10  ? 424  VAL A N   1 
ATOM   2877 C CA  . VAL A 1 424 ? 33.357  8.200   93.265  1.00 79.53  ? 424  VAL A CA  1 
ATOM   2878 C C   . VAL A 1 424 ? 32.416  7.118   93.786  1.00 79.65  ? 424  VAL A C   1 
ATOM   2879 O O   . VAL A 1 424 ? 32.230  6.082   93.149  1.00 79.23  ? 424  VAL A O   1 
ATOM   2880 C CB  . VAL A 1 424 ? 32.950  8.573   91.825  1.00 78.02  ? 424  VAL A CB  1 
ATOM   2881 C CG1 . VAL A 1 424 ? 31.509  9.063   91.801  1.00 77.83  ? 424  VAL A CG1 1 
ATOM   2882 C CG2 . VAL A 1 424 ? 33.883  9.643   91.286  1.00 76.32  ? 424  VAL A CG2 1 
ATOM   2883 N N   . PRO A 1 425 ? 31.807  7.351   94.958  1.00 79.66  ? 425  PRO A N   1 
ATOM   2884 C CA  . PRO A 1 425 ? 30.883  6.397   95.577  1.00 79.59  ? 425  PRO A CA  1 
ATOM   2885 C C   . PRO A 1 425 ? 29.679  6.038   94.710  1.00 79.49  ? 425  PRO A C   1 
ATOM   2886 O O   . PRO A 1 425 ? 29.092  6.897   94.055  1.00 79.29  ? 425  PRO A O   1 
ATOM   2887 C CB  . PRO A 1 425 ? 30.479  7.104   96.867  1.00 80.02  ? 425  PRO A CB  1 
ATOM   2888 C CG  . PRO A 1 425 ? 30.527  8.548   96.477  1.00 79.36  ? 425  PRO A CG  1 
ATOM   2889 C CD  . PRO A 1 425 ? 31.826  8.617   95.712  1.00 79.11  ? 425  PRO A CD  1 
ATOM   2890 N N   . LEU A 1 426 ? 29.325  4.759   94.714  1.00 80.02  ? 426  LEU A N   1 
ATOM   2891 C CA  . LEU A 1 426 ? 28.188  4.263   93.948  1.00 80.76  ? 426  LEU A CA  1 
ATOM   2892 C C   . LEU A 1 426 ? 27.404  3.303   94.838  1.00 82.40  ? 426  LEU A C   1 
ATOM   2893 O O   . LEU A 1 426 ? 27.579  2.085   94.758  1.00 82.78  ? 426  LEU A O   1 
ATOM   2894 C CB  . LEU A 1 426 ? 28.671  3.530   92.692  1.00 79.44  ? 426  LEU A CB  1 
ATOM   2895 C CG  . LEU A 1 426 ? 29.492  4.327   91.672  1.00 78.57  ? 426  LEU A CG  1 
ATOM   2896 C CD1 . LEU A 1 426 ? 29.960  3.402   90.561  1.00 76.98  ? 426  LEU A CD1 1 
ATOM   2897 C CD2 . LEU A 1 426 ? 28.654  5.460   91.103  1.00 77.68  ? 426  LEU A CD2 1 
ATOM   2898 N N   . VAL A 1 427 ? 26.543  3.858   95.688  1.00 83.89  ? 427  VAL A N   1 
ATOM   2899 C CA  . VAL A 1 427 ? 25.744  3.052   96.608  1.00 85.15  ? 427  VAL A CA  1 
ATOM   2900 C C   . VAL A 1 427 ? 24.316  3.570   96.762  1.00 85.63  ? 427  VAL A C   1 
ATOM   2901 O O   . VAL A 1 427 ? 23.912  4.519   96.092  1.00 86.61  ? 427  VAL A O   1 
ATOM   2902 C CB  . VAL A 1 427 ? 26.392  3.015   98.008  1.00 85.81  ? 427  VAL A CB  1 
ATOM   2903 C CG1 . VAL A 1 427 ? 27.761  2.357   97.934  1.00 86.43  ? 427  VAL A CG1 1 
ATOM   2904 C CG2 . VAL A 1 427 ? 26.514  4.428   98.557  1.00 85.66  ? 427  VAL A CG2 1 
ATOM   2905 N N   . ALA A 1 428 ? 23.563  2.933   97.655  1.00 86.49  ? 428  ALA A N   1 
ATOM   2906 C CA  . ALA A 1 428 ? 22.179  3.307   97.932  1.00 88.11  ? 428  ALA A CA  1 
ATOM   2907 C C   . ALA A 1 428 ? 21.924  3.155   99.429  1.00 89.94  ? 428  ALA A C   1 
ATOM   2908 O O   . ALA A 1 428 ? 22.778  2.650   100.154 1.00 90.53  ? 428  ALA A O   1 
ATOM   2909 C CB  . ALA A 1 428 ? 21.226  2.418   97.145  1.00 86.64  ? 428  ALA A CB  1 
ATOM   2910 N N   . GLU A 1 429 ? 20.755  3.586   99.892  1.00 91.65  ? 429  GLU A N   1 
ATOM   2911 C CA  . GLU A 1 429 ? 20.429  3.489   101.312 1.00 93.79  ? 429  GLU A CA  1 
ATOM   2912 C C   . GLU A 1 429 ? 19.147  2.708   101.582 1.00 94.86  ? 429  GLU A C   1 
ATOM   2913 O O   . GLU A 1 429 ? 18.275  2.606   100.720 1.00 95.68  ? 429  GLU A O   1 
ATOM   2914 C CB  . GLU A 1 429 ? 20.304  4.885   101.921 1.00 95.29  ? 429  GLU A CB  1 
ATOM   2915 C CG  . GLU A 1 429 ? 21.567  5.720   101.834 1.00 97.41  ? 429  GLU A CG  1 
ATOM   2916 C CD  . GLU A 1 429 ? 21.428  7.050   102.549 1.00 99.64  ? 429  GLU A CD  1 
ATOM   2917 O OE1 . GLU A 1 429 ? 20.499  7.815   102.210 1.00 99.74  ? 429  GLU A OE1 1 
ATOM   2918 O OE2 . GLU A 1 429 ? 22.247  7.331   103.450 1.00 100.92 ? 429  GLU A OE2 1 
ATOM   2919 N N   . LYS A 1 430 ? 19.045  2.165   102.792 1.00 95.93  ? 430  LYS A N   1 
ATOM   2920 C CA  . LYS A 1 430 ? 17.881  1.390   103.212 1.00 96.94  ? 430  LYS A CA  1 
ATOM   2921 C C   . LYS A 1 430 ? 17.668  1.535   104.720 1.00 98.14  ? 430  LYS A C   1 
ATOM   2922 O O   . LYS A 1 430 ? 18.627  1.546   105.492 1.00 99.30  ? 430  LYS A O   1 
ATOM   2923 C CB  . LYS A 1 430 ? 18.077  -0.091  102.867 1.00 95.52  ? 430  LYS A CB  1 
ATOM   2924 C CG  . LYS A 1 430 ? 19.313  -0.719  103.507 1.00 94.24  ? 430  LYS A CG  1 
ATOM   2925 C CD  . LYS A 1 430 ? 19.413  -2.213  103.222 1.00 92.18  ? 430  LYS A CD  1 
ATOM   2926 C CE  . LYS A 1 430 ? 18.255  -2.978  103.844 1.00 91.71  ? 430  LYS A CE  1 
ATOM   2927 N NZ  . LYS A 1 430 ? 18.363  -4.447  103.618 1.00 91.17  ? 430  LYS A NZ  1 
ATOM   2928 N N   . PRO A 1 431 ? 16.405  1.648   105.159 1.00 98.48  ? 431  PRO A N   1 
ATOM   2929 C CA  . PRO A 1 431 ? 16.091  1.791   106.585 1.00 98.67  ? 431  PRO A CA  1 
ATOM   2930 C C   . PRO A 1 431 ? 16.406  0.539   107.404 1.00 98.34  ? 431  PRO A C   1 
ATOM   2931 O O   . PRO A 1 431 ? 17.225  0.641   108.342 1.00 97.25  ? 431  PRO A O   1 
ATOM   2932 C CB  . PRO A 1 431 ? 14.602  2.120   106.574 1.00 99.36  ? 431  PRO A CB  1 
ATOM   2933 C CG  . PRO A 1 431 ? 14.110  1.374   105.373 1.00 98.96  ? 431  PRO A CG  1 
ATOM   2934 C CD  . PRO A 1 431 ? 15.174  1.687   104.349 1.00 98.74  ? 431  PRO A CD  1 
ATOM   2935 N N   . TYR A 1 512 ? 19.747  4.680   111.425 1.00 94.61  ? 512  TYR A N   1 
ATOM   2936 C CA  . TYR A 1 512 ? 18.399  4.625   110.795 1.00 96.27  ? 512  TYR A CA  1 
ATOM   2937 C C   . TYR A 1 512 ? 18.454  4.141   109.351 1.00 97.06  ? 512  TYR A C   1 
ATOM   2938 O O   . TYR A 1 512 ? 17.572  3.409   108.901 1.00 97.45  ? 512  TYR A O   1 
ATOM   2939 C CB  . TYR A 1 512 ? 17.741  6.004   110.851 1.00 96.35  ? 512  TYR A CB  1 
ATOM   2940 C CG  . TYR A 1 512 ? 17.060  6.303   112.168 1.00 97.20  ? 512  TYR A CG  1 
ATOM   2941 C CD1 . TYR A 1 512 ? 15.866  5.671   112.515 1.00 96.64  ? 512  TYR A CD1 1 
ATOM   2942 C CD2 . TYR A 1 512 ? 17.606  7.217   113.067 1.00 97.06  ? 512  TYR A CD2 1 
ATOM   2943 C CE1 . TYR A 1 512 ? 15.230  5.944   113.724 1.00 97.06  ? 512  TYR A CE1 1 
ATOM   2944 C CE2 . TYR A 1 512 ? 16.979  7.497   114.279 1.00 97.33  ? 512  TYR A CE2 1 
ATOM   2945 C CZ  . TYR A 1 512 ? 15.792  6.858   114.600 1.00 97.27  ? 512  TYR A CZ  1 
ATOM   2946 O OH  . TYR A 1 512 ? 15.166  7.137   115.793 1.00 98.23  ? 512  TYR A OH  1 
ATOM   2947 N N   . VAL A 1 513 ? 19.489  4.552   108.626 1.00 97.57  ? 513  VAL A N   1 
ATOM   2948 C CA  . VAL A 1 513 ? 19.647  4.148   107.234 1.00 97.50  ? 513  VAL A CA  1 
ATOM   2949 C C   . VAL A 1 513 ? 21.021  3.533   106.992 1.00 97.91  ? 513  VAL A C   1 
ATOM   2950 O O   . VAL A 1 513 ? 22.024  3.989   107.542 1.00 98.16  ? 513  VAL A O   1 
ATOM   2951 C CB  . VAL A 1 513 ? 19.459  5.346   106.275 1.00 97.05  ? 513  VAL A CB  1 
ATOM   2952 C CG1 . VAL A 1 513 ? 18.072  5.942   106.456 1.00 96.56  ? 513  VAL A CG1 1 
ATOM   2953 C CG2 . VAL A 1 513 ? 20.530  6.394   106.530 1.00 96.93  ? 513  VAL A CG2 1 
ATOM   2954 N N   . GLU A 1 514 ? 21.056  2.495   106.164 1.00 98.15  ? 514  GLU A N   1 
ATOM   2955 C CA  . GLU A 1 514 ? 22.297  1.802   105.841 1.00 98.28  ? 514  GLU A CA  1 
ATOM   2956 C C   . GLU A 1 514 ? 22.570  1.881   104.342 1.00 97.38  ? 514  GLU A C   1 
ATOM   2957 O O   . GLU A 1 514 ? 21.643  1.823   103.534 1.00 97.83  ? 514  GLU A O   1 
ATOM   2958 C CB  . GLU A 1 514 ? 22.195  0.333   106.262 1.00 98.97  ? 514  GLU A CB  1 
ATOM   2959 C CG  . GLU A 1 514 ? 23.438  -0.490  105.974 1.00 101.01 ? 514  GLU A CG  1 
ATOM   2960 C CD  . GLU A 1 514 ? 23.187  -1.981  106.096 1.00 102.63 ? 514  GLU A CD  1 
ATOM   2961 O OE1 . GLU A 1 514 ? 22.757  -2.429  107.179 1.00 102.42 ? 514  GLU A OE1 1 
ATOM   2962 O OE2 . GLU A 1 514 ? 23.422  -2.706  105.104 1.00 103.54 ? 514  GLU A OE2 1 
ATOM   2963 N N   . GLU A 1 515 ? 23.839  2.018   103.971 1.00 95.80  ? 515  GLU A N   1 
ATOM   2964 C CA  . GLU A 1 515 ? 24.198  2.080   102.560 1.00 94.77  ? 515  GLU A CA  1 
ATOM   2965 C C   . GLU A 1 515 ? 24.618  0.684   102.121 1.00 93.71  ? 515  GLU A C   1 
ATOM   2966 O O   . GLU A 1 515 ? 25.204  -0.066  102.902 1.00 93.16  ? 515  GLU A O   1 
ATOM   2967 C CB  . GLU A 1 515 ? 25.345  3.067   102.324 1.00 94.67  ? 515  GLU A CB  1 
ATOM   2968 C CG  . GLU A 1 515 ? 26.724  2.533   102.675 1.00 96.34  ? 515  GLU A CG  1 
ATOM   2969 C CD  . GLU A 1 515 ? 27.838  3.455   102.213 1.00 97.71  ? 515  GLU A CD  1 
ATOM   2970 O OE1 . GLU A 1 515 ? 29.021  3.071   102.336 1.00 98.49  ? 515  GLU A OE1 1 
ATOM   2971 O OE2 . GLU A 1 515 ? 27.529  4.565   101.727 1.00 97.25  ? 515  GLU A OE2 1 
ATOM   2972 N N   . VAL A 1 516 ? 24.318  0.332   100.875 1.00 92.75  ? 516  VAL A N   1 
ATOM   2973 C CA  . VAL A 1 516 ? 24.666  -0.988  100.364 1.00 91.59  ? 516  VAL A CA  1 
ATOM   2974 C C   . VAL A 1 516 ? 25.013  -0.974  98.881  1.00 90.69  ? 516  VAL A C   1 
ATOM   2975 O O   . VAL A 1 516 ? 24.536  -0.122  98.131  1.00 91.05  ? 516  VAL A O   1 
ATOM   2976 C CB  . VAL A 1 516 ? 23.503  -1.984  100.574 1.00 91.56  ? 516  VAL A CB  1 
ATOM   2977 C CG1 . VAL A 1 516 ? 23.217  -2.152  102.057 1.00 93.27  ? 516  VAL A CG1 1 
ATOM   2978 C CG2 . VAL A 1 516 ? 22.260  -1.487  99.853  1.00 90.37  ? 516  VAL A CG2 1 
ATOM   2979 N N   . VAL A 1 517 ? 25.854  -1.918  98.468  1.00 89.70  ? 517  VAL A N   1 
ATOM   2980 C CA  . VAL A 1 517 ? 26.240  -2.041  97.068  1.00 88.77  ? 517  VAL A CA  1 
ATOM   2981 C C   . VAL A 1 517 ? 25.329  -3.091  96.446  1.00 87.55  ? 517  VAL A C   1 
ATOM   2982 O O   . VAL A 1 517 ? 25.437  -4.282  96.742  1.00 88.01  ? 517  VAL A O   1 
ATOM   2983 C CB  . VAL A 1 517 ? 27.716  -2.475  96.909  1.00 89.39  ? 517  VAL A CB  1 
ATOM   2984 C CG1 . VAL A 1 517 ? 28.635  -1.313  97.257  1.00 89.34  ? 517  VAL A CG1 1 
ATOM   2985 C CG2 . VAL A 1 517 ? 28.012  -3.673  97.802  1.00 89.07  ? 517  VAL A CG2 1 
ATOM   2986 N N   . PRO A 1 518 ? 24.406  -2.653  95.580  1.00 86.19  ? 518  PRO A N   1 
ATOM   2987 C CA  . PRO A 1 518 ? 23.443  -3.520  94.897  1.00 85.40  ? 518  PRO A CA  1 
ATOM   2988 C C   . PRO A 1 518 ? 24.048  -4.699  94.144  1.00 84.80  ? 518  PRO A C   1 
ATOM   2989 O O   . PRO A 1 518 ? 25.004  -4.541  93.386  1.00 85.36  ? 518  PRO A O   1 
ATOM   2990 C CB  . PRO A 1 518 ? 22.725  -2.557  93.951  1.00 85.62  ? 518  PRO A CB  1 
ATOM   2991 C CG  . PRO A 1 518 ? 22.808  -1.248  94.669  1.00 85.50  ? 518  PRO A CG  1 
ATOM   2992 C CD  . PRO A 1 518 ? 24.228  -1.251  95.163  1.00 85.65  ? 518  PRO A CD  1 
ATOM   2993 N N   . ASN A 1 519 ? 23.492  -5.885  94.370  1.00 83.55  ? 519  ASN A N   1 
ATOM   2994 C CA  . ASN A 1 519 ? 23.940  -7.077  93.664  1.00 82.17  ? 519  ASN A CA  1 
ATOM   2995 C C   . ASN A 1 519 ? 23.180  -7.036  92.346  1.00 80.37  ? 519  ASN A C   1 
ATOM   2996 O O   . ASN A 1 519 ? 21.984  -6.747  92.328  1.00 79.68  ? 519  ASN A O   1 
ATOM   2997 C CB  . ASN A 1 519 ? 23.576  -8.343  94.443  1.00 84.10  ? 519  ASN A CB  1 
ATOM   2998 C CG  . ASN A 1 519 ? 24.655  -8.756  95.428  1.00 86.90  ? 519  ASN A CG  1 
ATOM   2999 O OD1 . ASN A 1 519 ? 25.088  -7.963  96.268  1.00 88.71  ? 519  ASN A OD1 1 
ATOM   3000 N ND2 . ASN A 1 519 ? 25.095  -10.007 95.331  1.00 86.42  ? 519  ASN A ND2 1 
ATOM   3001 N N   . VAL A 1 520 ? 23.868  -7.315  91.245  1.00 78.13  ? 520  VAL A N   1 
ATOM   3002 C CA  . VAL A 1 520 ? 23.227  -7.271  89.939  1.00 75.24  ? 520  VAL A CA  1 
ATOM   3003 C C   . VAL A 1 520 ? 23.155  -8.599  89.197  1.00 72.30  ? 520  VAL A C   1 
ATOM   3004 O O   . VAL A 1 520 ? 24.138  -9.332  89.100  1.00 71.71  ? 520  VAL A O   1 
ATOM   3005 C CB  . VAL A 1 520 ? 23.913  -6.205  89.026  1.00 75.87  ? 520  VAL A CB  1 
ATOM   3006 C CG1 . VAL A 1 520 ? 25.349  -5.988  89.465  1.00 75.94  ? 520  VAL A CG1 1 
ATOM   3007 C CG2 . VAL A 1 520 ? 23.880  -6.646  87.566  1.00 75.30  ? 520  VAL A CG2 1 
ATOM   3008 N N   . ILE A 1 521 ? 21.964  -8.899  88.687  1.00 69.65  ? 521  ILE A N   1 
ATOM   3009 C CA  . ILE A 1 521 ? 21.722  -10.105 87.905  1.00 68.03  ? 521  ILE A CA  1 
ATOM   3010 C C   . ILE A 1 521 ? 21.652  -9.615  86.460  1.00 66.01  ? 521  ILE A C   1 
ATOM   3011 O O   . ILE A 1 521 ? 20.800  -8.792  86.127  1.00 64.60  ? 521  ILE A O   1 
ATOM   3012 C CB  . ILE A 1 521 ? 20.378  -10.775 88.287  1.00 67.78  ? 521  ILE A CB  1 
ATOM   3013 C CG1 . ILE A 1 521 ? 20.519  -11.545 89.604  1.00 68.41  ? 521  ILE A CG1 1 
ATOM   3014 C CG2 . ILE A 1 521 ? 19.940  -11.724 87.187  1.00 68.55  ? 521  ILE A CG2 1 
ATOM   3015 C CD1 . ILE A 1 521 ? 20.857  -10.686 90.801  1.00 70.15  ? 521  ILE A CD1 1 
ATOM   3016 N N   . GLU A 1 522 ? 22.547  -10.110 85.608  1.00 63.59  ? 522  GLU A N   1 
ATOM   3017 C CA  . GLU A 1 522 ? 22.577  -9.667  84.218  1.00 60.27  ? 522  GLU A CA  1 
ATOM   3018 C C   . GLU A 1 522 ? 22.128  -10.642 83.136  1.00 57.41  ? 522  GLU A C   1 
ATOM   3019 O O   . GLU A 1 522 ? 22.892  -11.514 82.722  1.00 56.64  ? 522  GLU A O   1 
ATOM   3020 C CB  . GLU A 1 522 ? 23.979  -9.172  83.846  1.00 61.98  ? 522  GLU A CB  1 
ATOM   3021 C CG  . GLU A 1 522 ? 24.137  -8.899  82.347  1.00 67.21  ? 522  GLU A CG  1 
ATOM   3022 C CD  . GLU A 1 522 ? 25.556  -8.553  81.945  1.00 69.52  ? 522  GLU A CD  1 
ATOM   3023 O OE1 . GLU A 1 522 ? 26.057  -7.499  82.385  1.00 74.34  ? 522  GLU A OE1 1 
ATOM   3024 O OE2 . GLU A 1 522 ? 26.171  -9.336  81.188  1.00 70.23  ? 522  GLU A OE2 1 
ATOM   3025 N N   . PRO A 1 523 ? 20.874  -10.514 82.673  1.00 54.93  ? 523  PRO A N   1 
ATOM   3026 C CA  . PRO A 1 523 ? 20.391  -11.406 81.615  1.00 53.88  ? 523  PRO A CA  1 
ATOM   3027 C C   . PRO A 1 523 ? 20.963  -10.828 80.321  1.00 52.71  ? 523  PRO A C   1 
ATOM   3028 O O   . PRO A 1 523 ? 20.582  -9.732  79.905  1.00 53.73  ? 523  PRO A O   1 
ATOM   3029 C CB  . PRO A 1 523 ? 18.875  -11.244 81.689  1.00 53.45  ? 523  PRO A CB  1 
ATOM   3030 C CG  . PRO A 1 523 ? 18.637  -10.876 83.116  1.00 54.62  ? 523  PRO A CG  1 
ATOM   3031 C CD  . PRO A 1 523 ? 19.741  -9.883  83.367  1.00 54.47  ? 523  PRO A CD  1 
ATOM   3032 N N   . SER A 1 524 ? 21.888  -11.550 79.699  1.00 50.83  ? 524  SER A N   1 
ATOM   3033 C CA  . SER A 1 524 ? 22.519  -11.083 78.471  1.00 48.22  ? 524  SER A CA  1 
ATOM   3034 C C   . SER A 1 524 ? 21.999  -11.857 77.263  1.00 48.29  ? 524  SER A C   1 
ATOM   3035 O O   . SER A 1 524 ? 22.084  -13.084 77.221  1.00 51.05  ? 524  SER A O   1 
ATOM   3036 C CB  . SER A 1 524 ? 24.033  -11.239 78.591  1.00 46.10  ? 524  SER A CB  1 
ATOM   3037 O OG  . SER A 1 524 ? 24.703  -10.270 77.811  1.00 51.28  ? 524  SER A OG  1 
ATOM   3038 N N   . PHE A 1 525 ? 21.466  -11.135 76.279  1.00 46.83  ? 525  PHE A N   1 
ATOM   3039 C CA  . PHE A 1 525 ? 20.907  -11.761 75.084  1.00 44.78  ? 525  PHE A CA  1 
ATOM   3040 C C   . PHE A 1 525 ? 21.677  -11.502 73.797  1.00 44.99  ? 525  PHE A C   1 
ATOM   3041 O O   . PHE A 1 525 ? 21.894  -10.355 73.412  1.00 45.63  ? 525  PHE A O   1 
ATOM   3042 C CB  . PHE A 1 525 ? 19.466  -11.292 74.855  1.00 44.37  ? 525  PHE A CB  1 
ATOM   3043 C CG  . PHE A 1 525 ? 18.531  -11.604 75.982  1.00 43.49  ? 525  PHE A CG  1 
ATOM   3044 C CD1 . PHE A 1 525 ? 18.680  -10.988 77.221  1.00 43.31  ? 525  PHE A CD1 1 
ATOM   3045 C CD2 . PHE A 1 525 ? 17.487  -12.505 75.800  1.00 41.51  ? 525  PHE A CD2 1 
ATOM   3046 C CE1 . PHE A 1 525 ? 17.803  -11.266 78.263  1.00 42.85  ? 525  PHE A CE1 1 
ATOM   3047 C CE2 . PHE A 1 525 ? 16.606  -12.789 76.834  1.00 42.65  ? 525  PHE A CE2 1 
ATOM   3048 C CZ  . PHE A 1 525 ? 16.765  -12.168 78.070  1.00 42.21  ? 525  PHE A CZ  1 
ATOM   3049 N N   . GLY A 1 526 ? 22.076  -12.578 73.129  1.00 45.53  ? 526  GLY A N   1 
ATOM   3050 C CA  . GLY A 1 526 ? 22.769  -12.447 71.863  1.00 44.67  ? 526  GLY A CA  1 
ATOM   3051 C C   . GLY A 1 526 ? 21.698  -12.646 70.805  1.00 43.96  ? 526  GLY A C   1 
ATOM   3052 O O   . GLY A 1 526 ? 21.443  -13.768 70.370  1.00 41.97  ? 526  GLY A O   1 
ATOM   3053 N N   . LEU A 1 527 ? 21.054  -11.555 70.409  1.00 44.34  ? 527  LEU A N   1 
ATOM   3054 C CA  . LEU A 1 527 ? 19.981  -11.610 69.424  1.00 47.18  ? 527  LEU A CA  1 
ATOM   3055 C C   . LEU A 1 527 ? 20.328  -12.409 68.174  1.00 47.54  ? 527  LEU A C   1 
ATOM   3056 O O   . LEU A 1 527 ? 19.497  -13.162 67.663  1.00 47.19  ? 527  LEU A O   1 
ATOM   3057 C CB  . LEU A 1 527 ? 19.556  -10.192 69.039  1.00 48.30  ? 527  LEU A CB  1 
ATOM   3058 C CG  . LEU A 1 527 ? 19.058  -9.336  70.209  1.00 51.77  ? 527  LEU A CG  1 
ATOM   3059 C CD1 . LEU A 1 527 ? 18.528  -8.016  69.672  1.00 54.46  ? 527  LEU A CD1 1 
ATOM   3060 C CD2 . LEU A 1 527 ? 17.962  -10.072 70.975  1.00 50.05  ? 527  LEU A CD2 1 
ATOM   3061 N N   . GLY A 1 528 ? 21.553  -12.247 67.684  1.00 46.17  ? 528  GLY A N   1 
ATOM   3062 C CA  . GLY A 1 528 ? 21.973  -12.977 66.501  1.00 44.88  ? 528  GLY A CA  1 
ATOM   3063 C C   . GLY A 1 528 ? 21.879  -14.480 66.689  1.00 42.81  ? 528  GLY A C   1 
ATOM   3064 O O   . GLY A 1 528 ? 21.317  -15.182 65.847  1.00 42.59  ? 528  GLY A O   1 
ATOM   3065 N N   . ARG A 1 529 ? 22.432  -14.977 67.793  1.00 42.95  ? 529  ARG A N   1 
ATOM   3066 C CA  . ARG A 1 529 ? 22.406  -16.407 68.092  1.00 42.65  ? 529  ARG A CA  1 
ATOM   3067 C C   . ARG A 1 529 ? 20.992  -16.908 68.327  1.00 43.80  ? 529  ARG A C   1 
ATOM   3068 O O   . ARG A 1 529 ? 20.659  -18.044 67.985  1.00 45.39  ? 529  ARG A O   1 
ATOM   3069 C CB  . ARG A 1 529 ? 23.245  -16.715 69.328  1.00 42.67  ? 529  ARG A CB  1 
ATOM   3070 C CG  . ARG A 1 529 ? 24.737  -16.621 69.113  1.00 44.37  ? 529  ARG A CG  1 
ATOM   3071 C CD  . ARG A 1 529 ? 25.466  -17.156 70.327  1.00 43.85  ? 529  ARG A CD  1 
ATOM   3072 N NE  . ARG A 1 529 ? 26.911  -17.094 70.165  1.00 44.24  ? 529  ARG A NE  1 
ATOM   3073 C CZ  . ARG A 1 529 ? 27.772  -17.428 71.117  1.00 45.08  ? 529  ARG A CZ  1 
ATOM   3074 N NH1 . ARG A 1 529 ? 27.324  -17.845 72.292  1.00 48.20  ? 529  ARG A NH1 1 
ATOM   3075 N NH2 . ARG A 1 529 ? 29.076  -17.337 70.899  1.00 45.92  ? 529  ARG A NH2 1 
ATOM   3076 N N   . ILE A 1 530 ? 20.166  -16.064 68.932  1.00 45.06  ? 530  ILE A N   1 
ATOM   3077 C CA  . ILE A 1 530 ? 18.785  -16.430 69.204  1.00 46.10  ? 530  ILE A CA  1 
ATOM   3078 C C   . ILE A 1 530 ? 18.045  -16.596 67.881  1.00 47.40  ? 530  ILE A C   1 
ATOM   3079 O O   . ILE A 1 530 ? 17.250  -17.521 67.716  1.00 46.47  ? 530  ILE A O   1 
ATOM   3080 C CB  . ILE A 1 530 ? 18.090  -15.353 70.069  1.00 44.90  ? 530  ILE A CB  1 
ATOM   3081 C CG1 . ILE A 1 530 ? 18.676  -15.378 71.485  1.00 43.00  ? 530  ILE A CG1 1 
ATOM   3082 C CG2 . ILE A 1 530 ? 16.589  -15.589 70.099  1.00 42.39  ? 530  ILE A CG2 1 
ATOM   3083 C CD1 . ILE A 1 530 ? 18.167  -14.270 72.392  1.00 39.84  ? 530  ILE A CD1 1 
ATOM   3084 N N   . MET A 1 531 ? 18.324  -15.703 66.935  1.00 47.39  ? 531  MET A N   1 
ATOM   3085 C CA  . MET A 1 531 ? 17.682  -15.761 65.631  1.00 48.69  ? 531  MET A CA  1 
ATOM   3086 C C   . MET A 1 531 ? 18.148  -16.992 64.865  1.00 49.21  ? 531  MET A C   1 
ATOM   3087 O O   . MET A 1 531 ? 17.350  -17.662 64.208  1.00 49.28  ? 531  MET A O   1 
ATOM   3088 C CB  . MET A 1 531 ? 18.005  -14.509 64.818  1.00 50.73  ? 531  MET A CB  1 
ATOM   3089 C CG  . MET A 1 531 ? 17.138  -14.347 63.578  1.00 53.13  ? 531  MET A CG  1 
ATOM   3090 S SD  . MET A 1 531 ? 17.745  -13.064 62.473  1.00 61.57  ? 531  MET A SD  1 
ATOM   3091 C CE  . MET A 1 531 ? 17.892  -11.697 63.600  1.00 61.60  ? 531  MET A CE  1 
ATOM   3092 N N   . TYR A 1 532 ? 19.442  -17.288 64.946  1.00 49.27  ? 532  TYR A N   1 
ATOM   3093 C CA  . TYR A 1 532 ? 19.981  -18.445 64.248  1.00 47.91  ? 532  TYR A CA  1 
ATOM   3094 C C   . TYR A 1 532 ? 19.332  -19.717 64.769  1.00 48.19  ? 532  TYR A C   1 
ATOM   3095 O O   . TYR A 1 532 ? 18.948  -20.597 63.993  1.00 48.63  ? 532  TYR A O   1 
ATOM   3096 C CB  . TYR A 1 532 ? 21.496  -18.553 64.431  1.00 49.04  ? 532  TYR A CB  1 
ATOM   3097 C CG  . TYR A 1 532 ? 22.072  -19.723 63.668  1.00 49.85  ? 532  TYR A CG  1 
ATOM   3098 C CD1 . TYR A 1 532 ? 22.283  -19.643 62.291  1.00 49.87  ? 532  TYR A CD1 1 
ATOM   3099 C CD2 . TYR A 1 532 ? 22.324  -20.938 64.304  1.00 50.43  ? 532  TYR A CD2 1 
ATOM   3100 C CE1 . TYR A 1 532 ? 22.723  -20.742 61.566  1.00 50.58  ? 532  TYR A CE1 1 
ATOM   3101 C CE2 . TYR A 1 532 ? 22.764  -22.047 63.588  1.00 52.14  ? 532  TYR A CE2 1 
ATOM   3102 C CZ  . TYR A 1 532 ? 22.961  -21.941 62.218  1.00 52.43  ? 532  TYR A CZ  1 
ATOM   3103 O OH  . TYR A 1 532 ? 23.396  -23.031 61.501  1.00 53.09  ? 532  TYR A OH  1 
ATOM   3104 N N   . THR A 1 533 ? 19.220  -19.816 66.090  1.00 46.71  ? 533  THR A N   1 
ATOM   3105 C CA  . THR A 1 533 ? 18.612  -20.987 66.701  1.00 46.42  ? 533  THR A CA  1 
ATOM   3106 C C   . THR A 1 533 ? 17.201  -21.154 66.155  1.00 46.95  ? 533  THR A C   1 
ATOM   3107 O O   . THR A 1 533 ? 16.775  -22.268 65.851  1.00 47.02  ? 533  THR A O   1 
ATOM   3108 C CB  . THR A 1 533 ? 18.554  -20.852 68.231  1.00 45.50  ? 533  THR A CB  1 
ATOM   3109 O OG1 . THR A 1 533 ? 19.879  -20.659 68.738  1.00 45.42  ? 533  THR A OG1 1 
ATOM   3110 C CG2 . THR A 1 533 ? 17.960  -22.109 68.853  1.00 44.31  ? 533  THR A CG2 1 
ATOM   3111 N N   . VAL A 1 534 ? 16.484  -20.041 66.025  1.00 46.58  ? 534  VAL A N   1 
ATOM   3112 C CA  . VAL A 1 534 ? 15.126  -20.066 65.498  1.00 48.31  ? 534  VAL A CA  1 
ATOM   3113 C C   . VAL A 1 534 ? 15.147  -20.680 64.098  1.00 50.03  ? 534  VAL A C   1 
ATOM   3114 O O   . VAL A 1 534 ? 14.253  -21.446 63.737  1.00 50.28  ? 534  VAL A O   1 
ATOM   3115 C CB  . VAL A 1 534 ? 14.522  -18.638 65.432  1.00 49.26  ? 534  VAL A CB  1 
ATOM   3116 C CG1 . VAL A 1 534 ? 13.132  -18.679 64.818  1.00 48.40  ? 534  VAL A CG1 1 
ATOM   3117 C CG2 . VAL A 1 534 ? 14.446  -18.047 66.827  1.00 48.79  ? 534  VAL A CG2 1 
ATOM   3118 N N   . PHE A 1 535 ? 16.176  -20.354 63.318  1.00 50.13  ? 535  PHE A N   1 
ATOM   3119 C CA  . PHE A 1 535 ? 16.302  -20.897 61.969  1.00 51.22  ? 535  PHE A CA  1 
ATOM   3120 C C   . PHE A 1 535 ? 16.368  -22.425 61.988  1.00 52.75  ? 535  PHE A C   1 
ATOM   3121 O O   . PHE A 1 535 ? 15.566  -23.096 61.338  1.00 54.25  ? 535  PHE A O   1 
ATOM   3122 C CB  . PHE A 1 535 ? 17.559  -20.361 61.266  1.00 48.79  ? 535  PHE A CB  1 
ATOM   3123 C CG  . PHE A 1 535 ? 17.508  -18.893 60.936  1.00 47.10  ? 535  PHE A CG  1 
ATOM   3124 C CD1 . PHE A 1 535 ? 16.328  -18.301 60.499  1.00 46.73  ? 535  PHE A CD1 1 
ATOM   3125 C CD2 . PHE A 1 535 ? 18.657  -18.111 61.023  1.00 45.94  ? 535  PHE A CD2 1 
ATOM   3126 C CE1 . PHE A 1 535 ? 16.293  -16.950 60.154  1.00 45.97  ? 535  PHE A CE1 1 
ATOM   3127 C CE2 . PHE A 1 535 ? 18.633  -16.759 60.679  1.00 44.13  ? 535  PHE A CE2 1 
ATOM   3128 C CZ  . PHE A 1 535 ? 17.449  -16.178 60.244  1.00 45.94  ? 535  PHE A CZ  1 
ATOM   3129 N N   . GLU A 1 536 ? 17.324  -22.972 62.734  1.00 53.03  ? 536  GLU A N   1 
ATOM   3130 C CA  . GLU A 1 536 ? 17.493  -24.420 62.805  1.00 53.56  ? 536  GLU A CA  1 
ATOM   3131 C C   . GLU A 1 536 ? 16.347  -25.168 63.469  1.00 53.51  ? 536  GLU A C   1 
ATOM   3132 O O   . GLU A 1 536 ? 16.141  -26.350 63.202  1.00 56.06  ? 536  GLU A O   1 
ATOM   3133 C CB  . GLU A 1 536 ? 18.804  -24.774 63.517  1.00 53.39  ? 536  GLU A CB  1 
ATOM   3134 C CG  . GLU A 1 536 ? 20.044  -24.541 62.670  1.00 52.82  ? 536  GLU A CG  1 
ATOM   3135 C CD  . GLU A 1 536 ? 21.266  -25.267 63.205  1.00 55.71  ? 536  GLU A CD  1 
ATOM   3136 O OE1 . GLU A 1 536 ? 22.348  -25.132 62.596  1.00 54.90  ? 536  GLU A OE1 1 
ATOM   3137 O OE2 . GLU A 1 536 ? 21.146  -25.974 64.229  1.00 55.22  ? 536  GLU A OE2 1 
ATOM   3138 N N   . HIS A 1 537 ? 15.596  -24.488 64.325  1.00 53.20  ? 537  HIS A N   1 
ATOM   3139 C CA  . HIS A 1 537 ? 14.486  -25.136 65.010  1.00 53.61  ? 537  HIS A CA  1 
ATOM   3140 C C   . HIS A 1 537 ? 13.152  -25.037 64.282  1.00 54.03  ? 537  HIS A C   1 
ATOM   3141 O O   . HIS A 1 537 ? 12.197  -25.724 64.639  1.00 55.83  ? 537  HIS A O   1 
ATOM   3142 C CB  . HIS A 1 537 ? 14.341  -24.575 66.425  1.00 51.56  ? 537  HIS A CB  1 
ATOM   3143 C CG  . HIS A 1 537 ? 15.435  -25.001 67.352  1.00 51.41  ? 537  HIS A CG  1 
ATOM   3144 N ND1 . HIS A 1 537 ? 15.422  -24.714 68.699  1.00 51.63  ? 537  HIS A ND1 1 
ATOM   3145 C CD2 . HIS A 1 537 ? 16.569  -25.707 67.127  1.00 49.18  ? 537  HIS A CD2 1 
ATOM   3146 C CE1 . HIS A 1 537 ? 16.500  -25.226 69.266  1.00 53.19  ? 537  HIS A CE1 1 
ATOM   3147 N NE2 . HIS A 1 537 ? 17.212  -25.835 68.334  1.00 51.22  ? 537  HIS A NE2 1 
ATOM   3148 N N   . THR A 1 538 ? 13.083  -24.191 63.261  1.00 54.16  ? 538  THR A N   1 
ATOM   3149 C CA  . THR A 1 538 ? 11.845  -24.037 62.512  1.00 55.10  ? 538  THR A CA  1 
ATOM   3150 C C   . THR A 1 538 ? 12.016  -24.361 61.031  1.00 55.59  ? 538  THR A C   1 
ATOM   3151 O O   . THR A 1 538 ? 11.056  -24.302 60.262  1.00 56.63  ? 538  THR A O   1 
ATOM   3152 C CB  . THR A 1 538 ? 11.281  -22.605 62.656  1.00 57.19  ? 538  THR A CB  1 
ATOM   3153 O OG1 . THR A 1 538 ? 12.233  -21.656 62.160  1.00 57.28  ? 538  THR A OG1 1 
ATOM   3154 C CG2 . THR A 1 538 ? 10.981  -22.300 64.116  1.00 57.07  ? 538  THR A CG2 1 
ATOM   3155 N N   . PHE A 1 539 ? 13.236  -24.710 60.634  1.00 55.14  ? 539  PHE A N   1 
ATOM   3156 C CA  . PHE A 1 539 ? 13.515  -25.044 59.242  1.00 56.04  ? 539  PHE A CA  1 
ATOM   3157 C C   . PHE A 1 539 ? 13.040  -26.459 58.912  1.00 57.66  ? 539  PHE A C   1 
ATOM   3158 O O   . PHE A 1 539 ? 13.415  -27.426 59.577  1.00 57.73  ? 539  PHE A O   1 
ATOM   3159 C CB  . PHE A 1 539 ? 15.013  -24.905 58.963  1.00 55.34  ? 539  PHE A CB  1 
ATOM   3160 C CG  . PHE A 1 539 ? 15.411  -25.302 57.571  1.00 56.58  ? 539  PHE A CG  1 
ATOM   3161 C CD1 . PHE A 1 539 ? 15.902  -26.579 57.313  1.00 57.29  ? 539  PHE A CD1 1 
ATOM   3162 C CD2 . PHE A 1 539 ? 15.289  -24.403 56.515  1.00 55.69  ? 539  PHE A CD2 1 
ATOM   3163 C CE1 . PHE A 1 539 ? 16.269  -26.956 56.023  1.00 56.80  ? 539  PHE A CE1 1 
ATOM   3164 C CE2 . PHE A 1 539 ? 15.652  -24.769 55.220  1.00 56.04  ? 539  PHE A CE2 1 
ATOM   3165 C CZ  . PHE A 1 539 ? 16.144  -26.048 54.974  1.00 56.95  ? 539  PHE A CZ  1 
ATOM   3166 N N   . HIS A 1 540 ? 12.210  -26.572 57.879  1.00 58.96  ? 540  HIS A N   1 
ATOM   3167 C CA  . HIS A 1 540 ? 11.673  -27.866 57.475  1.00 60.76  ? 540  HIS A CA  1 
ATOM   3168 C C   . HIS A 1 540 ? 11.696  -28.070 55.966  1.00 61.91  ? 540  HIS A C   1 
ATOM   3169 O O   . HIS A 1 540 ? 11.634  -27.111 55.193  1.00 61.58  ? 540  HIS A O   1 
ATOM   3170 C CB  . HIS A 1 540 ? 10.230  -28.012 57.959  1.00 60.09  ? 540  HIS A CB  1 
ATOM   3171 C CG  . HIS A 1 540 ? 10.062  -27.828 59.434  1.00 61.35  ? 540  HIS A CG  1 
ATOM   3172 N ND1 . HIS A 1 540 ? 10.630  -28.677 60.360  1.00 62.23  ? 540  HIS A ND1 1 
ATOM   3173 C CD2 . HIS A 1 540 ? 9.382   -26.898 60.144  1.00 61.00  ? 540  HIS A CD2 1 
ATOM   3174 C CE1 . HIS A 1 540 ? 10.308  -28.276 61.577  1.00 61.85  ? 540  HIS A CE1 1 
ATOM   3175 N NE2 . HIS A 1 540 ? 9.550   -27.199 61.474  1.00 61.80  ? 540  HIS A NE2 1 
ATOM   3176 N N   . VAL A 1 541 ? 11.783  -29.332 55.556  1.00 64.38  ? 541  VAL A N   1 
ATOM   3177 C CA  . VAL A 1 541 ? 11.781  -29.687 54.142  1.00 66.47  ? 541  VAL A CA  1 
ATOM   3178 C C   . VAL A 1 541 ? 10.425  -30.320 53.835  1.00 68.68  ? 541  VAL A C   1 
ATOM   3179 O O   . VAL A 1 541 ? 9.989   -31.235 54.534  1.00 68.16  ? 541  VAL A O   1 
ATOM   3180 C CB  . VAL A 1 541 ? 12.897  -30.701 53.810  1.00 64.65  ? 541  VAL A CB  1 
ATOM   3181 C CG1 . VAL A 1 541 ? 12.845  -31.063 52.338  1.00 62.82  ? 541  VAL A CG1 1 
ATOM   3182 C CG2 . VAL A 1 541 ? 14.256  -30.114 54.158  1.00 64.47  ? 541  VAL A CG2 1 
ATOM   3183 N N   . ARG A 1 542 ? 9.755   -29.825 52.798  1.00 72.17  ? 542  ARG A N   1 
ATOM   3184 C CA  . ARG A 1 542 ? 8.448   -30.352 52.424  1.00 76.41  ? 542  ARG A CA  1 
ATOM   3185 C C   . ARG A 1 542 ? 8.601   -31.778 51.902  1.00 80.54  ? 542  ARG A C   1 
ATOM   3186 O O   . ARG A 1 542 ? 9.586   -32.107 51.237  1.00 79.96  ? 542  ARG A O   1 
ATOM   3187 C CB  . ARG A 1 542 ? 7.801   -29.472 51.347  1.00 74.93  ? 542  ARG A CB  1 
ATOM   3188 C CG  . ARG A 1 542 ? 8.030   -27.976 51.536  1.00 74.62  ? 542  ARG A CG  1 
ATOM   3189 C CD  . ARG A 1 542 ? 6.735   -27.187 51.719  1.00 71.35  ? 542  ARG A CD  1 
ATOM   3190 N NE  . ARG A 1 542 ? 6.097   -27.456 53.003  1.00 67.16  ? 542  ARG A NE  1 
ATOM   3191 C CZ  . ARG A 1 542 ? 5.172   -26.677 53.555  1.00 64.32  ? 542  ARG A CZ  1 
ATOM   3192 N NH1 . ARG A 1 542 ? 4.774   -25.575 52.934  1.00 63.81  ? 542  ARG A NH1 1 
ATOM   3193 N NH2 . ARG A 1 542 ? 4.649   -26.997 54.731  1.00 60.57  ? 542  ARG A NH2 1 
ATOM   3194 N N   . GLU A 1 543 ? 7.624   -32.621 52.213  1.00 86.02  ? 543  GLU A N   1 
ATOM   3195 C CA  . GLU A 1 543 ? 7.649   -34.010 51.779  1.00 90.82  ? 543  GLU A CA  1 
ATOM   3196 C C   . GLU A 1 543 ? 7.315   -34.066 50.292  1.00 92.92  ? 543  GLU A C   1 
ATOM   3197 O O   . GLU A 1 543 ? 6.207   -34.435 49.904  1.00 94.31  ? 543  GLU A O   1 
ATOM   3198 C CB  . GLU A 1 543 ? 6.633   -34.822 52.587  1.00 92.77  ? 543  GLU A CB  1 
ATOM   3199 C CG  . GLU A 1 543 ? 6.889   -36.321 52.596  1.00 98.13  ? 543  GLU A CG  1 
ATOM   3200 C CD  . GLU A 1 543 ? 5.902   -37.081 53.470  1.00 101.12 ? 543  GLU A CD  1 
ATOM   3201 O OE1 . GLU A 1 543 ? 6.083   -38.306 53.647  1.00 102.08 ? 543  GLU A OE1 1 
ATOM   3202 O OE2 . GLU A 1 543 ? 4.944   -36.456 53.976  1.00 102.49 ? 543  GLU A OE2 1 
ATOM   3203 N N   . GLY A 1 544 ? 8.282   -33.680 49.465  1.00 95.24  ? 544  GLY A N   1 
ATOM   3204 C CA  . GLY A 1 544 ? 8.086   -33.683 48.028  1.00 97.86  ? 544  GLY A CA  1 
ATOM   3205 C C   . GLY A 1 544 ? 9.410   -33.630 47.290  1.00 100.80 ? 544  GLY A C   1 
ATOM   3206 O O   . GLY A 1 544 ? 10.302  -32.864 47.659  1.00 101.12 ? 544  GLY A O   1 
ATOM   3207 N N   . ASP A 1 545 ? 9.533   -34.446 46.246  1.00 103.15 ? 545  ASP A N   1 
ATOM   3208 C CA  . ASP A 1 545 ? 10.749  -34.525 45.435  1.00 105.09 ? 545  ASP A CA  1 
ATOM   3209 C C   . ASP A 1 545 ? 11.391  -33.169 45.149  1.00 104.74 ? 545  ASP A C   1 
ATOM   3210 O O   . ASP A 1 545 ? 12.616  -33.034 45.179  1.00 104.90 ? 545  ASP A O   1 
ATOM   3211 C CB  . ASP A 1 545 ? 10.450  -35.218 44.099  1.00 107.38 ? 545  ASP A CB  1 
ATOM   3212 C CG  . ASP A 1 545 ? 9.894   -36.619 44.274  1.00 109.65 ? 545  ASP A CG  1 
ATOM   3213 O OD1 . ASP A 1 545 ? 8.800   -36.760 44.864  1.00 110.77 ? 545  ASP A OD1 1 
ATOM   3214 O OD2 . ASP A 1 545 ? 10.550  -37.581 43.820  1.00 110.32 ? 545  ASP A OD2 1 
ATOM   3215 N N   . GLU A 1 546 ? 10.559  -32.171 44.869  1.00 103.64 ? 546  GLU A N   1 
ATOM   3216 C CA  . GLU A 1 546 ? 11.042  -30.831 44.555  1.00 101.72 ? 546  GLU A CA  1 
ATOM   3217 C C   . GLU A 1 546 ? 11.955  -30.265 45.642  1.00 98.86  ? 546  GLU A C   1 
ATOM   3218 O O   . GLU A 1 546 ? 12.700  -29.313 45.406  1.00 98.17  ? 546  GLU A O   1 
ATOM   3219 C CB  . GLU A 1 546 ? 9.854   -29.893 44.325  1.00 103.18 ? 546  GLU A CB  1 
ATOM   3220 C CG  . GLU A 1 546 ? 10.221  -28.603 43.614  1.00 107.10 ? 546  GLU A CG  1 
ATOM   3221 C CD  . GLU A 1 546 ? 9.003   -27.808 43.183  1.00 109.69 ? 546  GLU A CD  1 
ATOM   3222 O OE1 . GLU A 1 546 ? 8.151   -28.371 42.462  1.00 111.15 ? 546  GLU A OE1 1 
ATOM   3223 O OE2 . GLU A 1 546 ? 8.901   -26.622 43.561  1.00 110.25 ? 546  GLU A OE2 1 
ATOM   3224 N N   . GLN A 1 547 ? 11.896  -30.859 46.830  1.00 95.53  ? 547  GLN A N   1 
ATOM   3225 C CA  . GLN A 1 547 ? 12.721  -30.425 47.950  1.00 92.02  ? 547  GLN A CA  1 
ATOM   3226 C C   . GLN A 1 547 ? 12.555  -28.949 48.279  1.00 89.35  ? 547  GLN A C   1 
ATOM   3227 O O   . GLN A 1 547 ? 13.518  -28.181 48.245  1.00 89.35  ? 547  GLN A O   1 
ATOM   3228 C CB  . GLN A 1 547 ? 14.197  -30.720 47.668  1.00 93.06  ? 547  GLN A CB  1 
ATOM   3229 C CG  . GLN A 1 547 ? 14.546  -32.198 47.663  1.00 94.31  ? 547  GLN A CG  1 
ATOM   3230 C CD  . GLN A 1 547 ? 14.265  -32.865 48.996  1.00 95.05  ? 547  GLN A CD  1 
ATOM   3231 O OE1 . GLN A 1 547 ? 13.123  -32.903 49.457  1.00 95.19  ? 547  GLN A OE1 1 
ATOM   3232 N NE2 . GLN A 1 547 ? 15.309  -33.396 49.624  1.00 94.78  ? 547  GLN A NE2 1 
ATOM   3233 N N   . ARG A 1 548 ? 11.326  -28.553 48.590  1.00 85.12  ? 548  ARG A N   1 
ATOM   3234 C CA  . ARG A 1 548 ? 11.045  -27.172 48.952  1.00 80.04  ? 548  ARG A CA  1 
ATOM   3235 C C   . ARG A 1 548 ? 11.306  -27.033 50.443  1.00 76.91  ? 548  ARG A C   1 
ATOM   3236 O O   . ARG A 1 548 ? 11.291  -28.023 51.176  1.00 75.94  ? 548  ARG A O   1 
ATOM   3237 C CB  . ARG A 1 548 ? 9.586   -26.823 48.657  1.00 79.57  ? 548  ARG A CB  1 
ATOM   3238 C CG  . ARG A 1 548 ? 9.216   -26.825 47.190  1.00 78.63  ? 548  ARG A CG  1 
ATOM   3239 C CD  . ARG A 1 548 ? 7.742   -26.510 47.032  1.00 82.43  ? 548  ARG A CD  1 
ATOM   3240 N NE  . ARG A 1 548 ? 7.329   -26.449 45.634  1.00 84.69  ? 548  ARG A NE  1 
ATOM   3241 C CZ  . ARG A 1 548 ? 6.078   -26.236 45.237  1.00 86.71  ? 548  ARG A CZ  1 
ATOM   3242 N NH1 . ARG A 1 548 ? 5.116   -26.065 46.136  1.00 86.57  ? 548  ARG A NH1 1 
ATOM   3243 N NH2 . ARG A 1 548 ? 5.788   -26.191 43.943  1.00 86.96  ? 548  ARG A NH2 1 
ATOM   3244 N N   . THR A 1 549 ? 11.549  -25.809 50.894  1.00 73.33  ? 549  THR A N   1 
ATOM   3245 C CA  . THR A 1 549 ? 11.811  -25.572 52.307  1.00 69.83  ? 549  THR A CA  1 
ATOM   3246 C C   . THR A 1 549 ? 10.948  -24.443 52.845  1.00 67.52  ? 549  THR A C   1 
ATOM   3247 O O   . THR A 1 549 ? 10.442  -23.615 52.086  1.00 67.19  ? 549  THR A O   1 
ATOM   3248 C CB  . THR A 1 549 ? 13.289  -25.205 52.550  1.00 68.75  ? 549  THR A CB  1 
ATOM   3249 O OG1 . THR A 1 549 ? 13.609  -24.005 51.836  1.00 67.12  ? 549  THR A OG1 1 
ATOM   3250 C CG2 . THR A 1 549 ? 14.199  -26.326 52.080  1.00 68.12  ? 549  THR A CG2 1 
ATOM   3251 N N   . PHE A 1 550 ? 10.775  -24.422 54.161  1.00 63.90  ? 550  PHE A N   1 
ATOM   3252 C CA  . PHE A 1 550 ? 9.993   -23.381 54.808  1.00 60.89  ? 550  PHE A CA  1 
ATOM   3253 C C   . PHE A 1 550 ? 10.378  -23.278 56.278  1.00 58.64  ? 550  PHE A C   1 
ATOM   3254 O O   . PHE A 1 550 ? 10.964  -24.203 56.842  1.00 58.41  ? 550  PHE A O   1 
ATOM   3255 C CB  . PHE A 1 550 ? 8.489   -23.665 54.682  1.00 60.79  ? 550  PHE A CB  1 
ATOM   3256 C CG  . PHE A 1 550 ? 8.002   -24.805 55.536  1.00 60.78  ? 550  PHE A CG  1 
ATOM   3257 C CD1 . PHE A 1 550 ? 8.219   -26.125 55.154  1.00 61.72  ? 550  PHE A CD1 1 
ATOM   3258 C CD2 . PHE A 1 550 ? 7.318   -24.555 56.724  1.00 60.34  ? 550  PHE A CD2 1 
ATOM   3259 C CE1 . PHE A 1 550 ? 7.757   -27.182 55.945  1.00 62.17  ? 550  PHE A CE1 1 
ATOM   3260 C CE2 . PHE A 1 550 ? 6.855   -25.601 57.520  1.00 60.32  ? 550  PHE A CE2 1 
ATOM   3261 C CZ  . PHE A 1 550 ? 7.074   -26.919 57.129  1.00 60.68  ? 550  PHE A CZ  1 
ATOM   3262 N N   . PHE A 1 551 ? 10.063  -22.143 56.890  1.00 55.45  ? 551  PHE A N   1 
ATOM   3263 C CA  . PHE A 1 551 ? 10.361  -21.939 58.300  1.00 53.37  ? 551  PHE A CA  1 
ATOM   3264 C C   . PHE A 1 551 ? 9.056   -21.778 59.063  1.00 53.03  ? 551  PHE A C   1 
ATOM   3265 O O   . PHE A 1 551 ? 8.235   -20.923 58.731  1.00 54.08  ? 551  PHE A O   1 
ATOM   3266 C CB  . PHE A 1 551 ? 11.220  -20.687 58.511  1.00 51.04  ? 551  PHE A CB  1 
ATOM   3267 C CG  . PHE A 1 551 ? 12.623  -20.807 57.988  1.00 48.95  ? 551  PHE A CG  1 
ATOM   3268 C CD1 . PHE A 1 551 ? 12.918  -20.501 56.664  1.00 50.31  ? 551  PHE A CD1 1 
ATOM   3269 C CD2 . PHE A 1 551 ? 13.657  -21.206 58.829  1.00 48.91  ? 551  PHE A CD2 1 
ATOM   3270 C CE1 . PHE A 1 551 ? 14.226  -20.588 56.185  1.00 49.61  ? 551  PHE A CE1 1 
ATOM   3271 C CE2 . PHE A 1 551 ? 14.966  -21.297 58.361  1.00 47.99  ? 551  PHE A CE2 1 
ATOM   3272 C CZ  . PHE A 1 551 ? 15.251  -20.987 57.037  1.00 48.76  ? 551  PHE A CZ  1 
ATOM   3273 N N   . SER A 1 552 ? 8.858   -22.606 60.080  1.00 53.38  ? 552  SER A N   1 
ATOM   3274 C CA  . SER A 1 552 ? 7.646   -22.521 60.880  1.00 54.62  ? 552  SER A CA  1 
ATOM   3275 C C   . SER A 1 552 ? 7.817   -21.417 61.922  1.00 53.79  ? 552  SER A C   1 
ATOM   3276 O O   . SER A 1 552 ? 7.767   -21.663 63.128  1.00 56.10  ? 552  SER A O   1 
ATOM   3277 C CB  . SER A 1 552 ? 7.365   -23.865 61.557  1.00 55.07  ? 552  SER A CB  1 
ATOM   3278 O OG  . SER A 1 552 ? 8.455   -24.265 62.369  1.00 62.50  ? 552  SER A OG  1 
ATOM   3279 N N   . PHE A 1 553 ? 8.028   -20.197 61.434  1.00 52.41  ? 553  PHE A N   1 
ATOM   3280 C CA  . PHE A 1 553 ? 8.209   -19.021 62.279  1.00 51.02  ? 553  PHE A CA  1 
ATOM   3281 C C   . PHE A 1 553 ? 6.925   -18.654 63.014  1.00 50.78  ? 553  PHE A C   1 
ATOM   3282 O O   . PHE A 1 553 ? 5.846   -18.649 62.422  1.00 51.39  ? 553  PHE A O   1 
ATOM   3283 C CB  . PHE A 1 553 ? 8.618   -17.813 61.426  1.00 49.39  ? 553  PHE A CB  1 
ATOM   3284 C CG  . PHE A 1 553 ? 10.024  -17.868 60.899  1.00 47.45  ? 553  PHE A CG  1 
ATOM   3285 C CD1 . PHE A 1 553 ? 10.340  -17.255 59.687  1.00 45.19  ? 553  PHE A CD1 1 
ATOM   3286 C CD2 . PHE A 1 553 ? 11.042  -18.479 61.625  1.00 46.42  ? 553  PHE A CD2 1 
ATOM   3287 C CE1 . PHE A 1 553 ? 11.647  -17.247 59.206  1.00 44.10  ? 553  PHE A CE1 1 
ATOM   3288 C CE2 . PHE A 1 553 ? 12.356  -18.477 61.153  1.00 46.61  ? 553  PHE A CE2 1 
ATOM   3289 C CZ  . PHE A 1 553 ? 12.658  -17.859 59.940  1.00 44.02  ? 553  PHE A CZ  1 
ATOM   3290 N N   . PRO A 1 554 ? 7.019   -18.357 64.319  1.00 51.35  ? 554  PRO A N   1 
ATOM   3291 C CA  . PRO A 1 554 ? 5.808   -17.981 65.058  1.00 51.61  ? 554  PRO A CA  1 
ATOM   3292 C C   . PRO A 1 554 ? 5.293   -16.673 64.452  1.00 52.14  ? 554  PRO A C   1 
ATOM   3293 O O   . PRO A 1 554 ? 6.085   -15.832 64.029  1.00 54.30  ? 554  PRO A O   1 
ATOM   3294 C CB  . PRO A 1 554 ? 6.320   -17.800 66.485  1.00 49.66  ? 554  PRO A CB  1 
ATOM   3295 C CG  . PRO A 1 554 ? 7.419   -18.815 66.566  1.00 49.58  ? 554  PRO A CG  1 
ATOM   3296 C CD  . PRO A 1 554 ? 8.136   -18.619 65.244  1.00 50.68  ? 554  PRO A CD  1 
ATOM   3297 N N   . ALA A 1 555 ? 3.978   -16.503 64.404  1.00 52.38  ? 555  ALA A N   1 
ATOM   3298 C CA  . ALA A 1 555 ? 3.386   -15.300 63.824  1.00 53.61  ? 555  ALA A CA  1 
ATOM   3299 C C   . ALA A 1 555 ? 4.009   -13.975 64.289  1.00 53.86  ? 555  ALA A C   1 
ATOM   3300 O O   . ALA A 1 555 ? 4.093   -13.026 63.508  1.00 52.30  ? 555  ALA A O   1 
ATOM   3301 C CB  . ALA A 1 555 ? 1.879   -15.286 64.088  1.00 54.49  ? 555  ALA A CB  1 
ATOM   3302 N N   . VAL A 1 556 ? 4.446   -13.910 65.545  1.00 53.57  ? 556  VAL A N   1 
ATOM   3303 C CA  . VAL A 1 556 ? 5.035   -12.680 66.081  1.00 54.03  ? 556  VAL A CA  1 
ATOM   3304 C C   . VAL A 1 556 ? 6.425   -12.331 65.562  1.00 52.86  ? 556  VAL A C   1 
ATOM   3305 O O   . VAL A 1 556 ? 6.887   -11.204 65.752  1.00 53.23  ? 556  VAL A O   1 
ATOM   3306 C CB  . VAL A 1 556 ? 5.123   -12.705 67.626  1.00 55.38  ? 556  VAL A CB  1 
ATOM   3307 C CG1 . VAL A 1 556 ? 3.732   -12.761 68.230  1.00 57.26  ? 556  VAL A CG1 1 
ATOM   3308 C CG2 . VAL A 1 556 ? 5.959   -13.891 68.078  1.00 56.94  ? 556  VAL A CG2 1 
ATOM   3309 N N   . VAL A 1 557 ? 7.103   -13.278 64.917  1.00 48.57  ? 557  VAL A N   1 
ATOM   3310 C CA  . VAL A 1 557 ? 8.439   -12.987 64.411  1.00 48.81  ? 557  VAL A CA  1 
ATOM   3311 C C   . VAL A 1 557 ? 8.596   -13.086 62.897  1.00 47.79  ? 557  VAL A C   1 
ATOM   3312 O O   . VAL A 1 557 ? 9.521   -12.504 62.335  1.00 49.53  ? 557  VAL A O   1 
ATOM   3313 C CB  . VAL A 1 557 ? 9.514   -13.889 65.077  1.00 49.06  ? 557  VAL A CB  1 
ATOM   3314 C CG1 . VAL A 1 557 ? 9.465   -13.726 66.583  1.00 49.69  ? 557  VAL A CG1 1 
ATOM   3315 C CG2 . VAL A 1 557 ? 9.310   -15.339 64.684  1.00 49.08  ? 557  VAL A CG2 1 
ATOM   3316 N N   . ALA A 1 558 ? 7.699   -13.813 62.237  1.00 47.04  ? 558  ALA A N   1 
ATOM   3317 C CA  . ALA A 1 558 ? 7.764   -13.970 60.783  1.00 46.26  ? 558  ALA A CA  1 
ATOM   3318 C C   . ALA A 1 558 ? 7.847   -12.618 60.074  1.00 45.94  ? 558  ALA A C   1 
ATOM   3319 O O   . ALA A 1 558 ? 7.199   -11.656 60.491  1.00 45.29  ? 558  ALA A O   1 
ATOM   3320 C CB  . ALA A 1 558 ? 6.543   -14.741 60.291  1.00 46.36  ? 558  ALA A CB  1 
ATOM   3321 N N   . PRO A 1 559 ? 8.645   -12.531 58.988  1.00 47.11  ? 559  PRO A N   1 
ATOM   3322 C CA  . PRO A 1 559 ? 8.822   -11.296 58.207  1.00 47.40  ? 559  PRO A CA  1 
ATOM   3323 C C   . PRO A 1 559 ? 7.517   -10.509 58.098  1.00 47.82  ? 559  PRO A C   1 
ATOM   3324 O O   . PRO A 1 559 ? 7.493   -9.295  58.294  1.00 50.06  ? 559  PRO A O   1 
ATOM   3325 C CB  . PRO A 1 559 ? 9.326   -11.817 56.869  1.00 46.07  ? 559  PRO A CB  1 
ATOM   3326 C CG  . PRO A 1 559 ? 10.200  -12.957 57.299  1.00 46.81  ? 559  PRO A CG  1 
ATOM   3327 C CD  . PRO A 1 559 ? 9.354   -13.655 58.351  1.00 45.87  ? 559  PRO A CD  1 
ATOM   3328 N N   . PHE A 1 560 ? 6.440   -11.209 57.765  1.00 49.21  ? 560  PHE A N   1 
ATOM   3329 C CA  . PHE A 1 560 ? 5.115   -10.608 57.704  1.00 51.75  ? 560  PHE A CA  1 
ATOM   3330 C C   . PHE A 1 560 ? 4.092   -11.730 57.825  1.00 51.46  ? 560  PHE A C   1 
ATOM   3331 O O   . PHE A 1 560 ? 4.189   -12.759 57.159  1.00 52.29  ? 560  PHE A O   1 
ATOM   3332 C CB  . PHE A 1 560 ? 4.922   -9.740  56.443  1.00 52.31  ? 560  PHE A CB  1 
ATOM   3333 C CG  . PHE A 1 560 ? 5.124   -10.454 55.138  1.00 54.29  ? 560  PHE A CG  1 
ATOM   3334 C CD1 . PHE A 1 560 ? 4.102   -11.216 54.576  1.00 54.75  ? 560  PHE A CD1 1 
ATOM   3335 C CD2 . PHE A 1 560 ? 6.314   -10.300 54.429  1.00 53.76  ? 560  PHE A CD2 1 
ATOM   3336 C CE1 . PHE A 1 560 ? 4.260   -11.808 53.322  1.00 56.09  ? 560  PHE A CE1 1 
ATOM   3337 C CE2 . PHE A 1 560 ? 6.483   -10.887 53.176  1.00 54.12  ? 560  PHE A CE2 1 
ATOM   3338 C CZ  . PHE A 1 560 ? 5.454   -11.640 52.619  1.00 55.56  ? 560  PHE A CZ  1 
ATOM   3339 N N   . LYS A 1 561 ? 3.136   -11.528 58.723  1.00 51.45  ? 561  LYS A N   1 
ATOM   3340 C CA  . LYS A 1 561 ? 2.111   -12.514 59.029  1.00 50.99  ? 561  LYS A CA  1 
ATOM   3341 C C   . LYS A 1 561 ? 1.297   -13.089 57.877  1.00 52.07  ? 561  LYS A C   1 
ATOM   3342 O O   . LYS A 1 561 ? 1.168   -14.306 57.760  1.00 49.83  ? 561  LYS A O   1 
ATOM   3343 C CB  . LYS A 1 561 ? 1.158   -11.948 60.084  1.00 51.21  ? 561  LYS A CB  1 
ATOM   3344 C CG  . LYS A 1 561 ? 1.861   -11.330 61.284  1.00 50.71  ? 561  LYS A CG  1 
ATOM   3345 C CD  . LYS A 1 561 ? 0.938   -11.275 62.487  1.00 51.09  ? 561  LYS A CD  1 
ATOM   3346 C CE  . LYS A 1 561 ? 1.548   -10.484 63.620  1.00 49.28  ? 561  LYS A CE  1 
ATOM   3347 N NZ  . LYS A 1 561 ? 1.563   -9.041  63.284  1.00 54.51  ? 561  LYS A NZ  1 
ATOM   3348 N N   . CYS A 1 562 ? 0.742   -12.235 57.027  1.00 53.83  ? 562  CYS A N   1 
ATOM   3349 C CA  . CYS A 1 562 ? -0.075  -12.745 55.935  1.00 55.83  ? 562  CYS A CA  1 
ATOM   3350 C C   . CYS A 1 562 ? 0.377   -12.339 54.542  1.00 57.62  ? 562  CYS A C   1 
ATOM   3351 O O   . CYS A 1 562 ? 0.862   -11.231 54.321  1.00 57.95  ? 562  CYS A O   1 
ATOM   3352 C CB  . CYS A 1 562 ? -1.531  -12.322 56.139  1.00 55.42  ? 562  CYS A CB  1 
ATOM   3353 S SG  . CYS A 1 562 ? -2.716  -13.110 55.019  1.00 55.59  ? 562  CYS A SG  1 
ATOM   3354 N N   . SER A 1 563 ? 0.211   -13.263 53.605  1.00 59.46  ? 563  SER A N   1 
ATOM   3355 C CA  . SER A 1 563 ? 0.565   -13.028 52.217  1.00 61.04  ? 563  SER A CA  1 
ATOM   3356 C C   . SER A 1 563 ? -0.725  -13.046 51.410  1.00 62.17  ? 563  SER A C   1 
ATOM   3357 O O   . SER A 1 563 ? -1.442  -14.046 51.401  1.00 62.85  ? 563  SER A O   1 
ATOM   3358 C CB  . SER A 1 563 ? 1.505   -14.123 51.713  1.00 62.32  ? 563  SER A CB  1 
ATOM   3359 O OG  . SER A 1 563 ? 1.753   -13.978 50.325  1.00 64.51  ? 563  SER A OG  1 
ATOM   3360 N N   . VAL A 1 564 ? -1.028  -11.934 50.750  1.00 62.83  ? 564  VAL A N   1 
ATOM   3361 C CA  . VAL A 1 564 ? -2.233  -11.837 49.935  1.00 63.15  ? 564  VAL A CA  1 
ATOM   3362 C C   . VAL A 1 564 ? -1.833  -12.020 48.481  1.00 65.17  ? 564  VAL A C   1 
ATOM   3363 O O   . VAL A 1 564 ? -1.063  -11.223 47.947  1.00 65.05  ? 564  VAL A O   1 
ATOM   3364 C CB  . VAL A 1 564 ? -2.907  -10.458 50.085  1.00 61.79  ? 564  VAL A CB  1 
ATOM   3365 C CG1 . VAL A 1 564 ? -4.161  -10.404 49.237  1.00 61.30  ? 564  VAL A CG1 1 
ATOM   3366 C CG2 . VAL A 1 564 ? -3.241  -10.193 51.541  1.00 60.94  ? 564  VAL A CG2 1 
ATOM   3367 N N   . LEU A 1 565 ? -2.342  -13.066 47.837  1.00 68.08  ? 565  LEU A N   1 
ATOM   3368 C CA  . LEU A 1 565 ? -1.993  -13.299 46.442  1.00 71.01  ? 565  LEU A CA  1 
ATOM   3369 C C   . LEU A 1 565 ? -3.185  -13.603 45.540  1.00 73.08  ? 565  LEU A C   1 
ATOM   3370 O O   . LEU A 1 565 ? -3.893  -14.592 45.726  1.00 70.99  ? 565  LEU A O   1 
ATOM   3371 C CB  . LEU A 1 565 ? -0.942  -14.415 46.335  1.00 71.19  ? 565  LEU A CB  1 
ATOM   3372 C CG  . LEU A 1 565 ? -1.268  -15.885 46.607  1.00 70.21  ? 565  LEU A CG  1 
ATOM   3373 C CD1 . LEU A 1 565 ? -1.920  -16.510 45.385  1.00 71.62  ? 565  LEU A CD1 1 
ATOM   3374 C CD2 . LEU A 1 565 ? 0.023   -16.626 46.919  1.00 71.52  ? 565  LEU A CD2 1 
ATOM   3375 N N   . PRO A 1 566 ? -3.437  -12.721 44.563  1.00 76.52  ? 566  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 566 ? -4.539  -12.873 43.611  1.00 78.88  ? 566  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 566 ? -4.030  -13.513 42.321  1.00 80.87  ? 566  PRO A C   1 
ATOM   3378 O O   . PRO A 1 566 ? -2.823  -13.562 42.083  1.00 80.74  ? 566  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 566 ? -4.992  -11.437 43.404  1.00 78.36  ? 566  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 566 ? -3.686  -10.709 43.383  1.00 77.31  ? 566  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 566 ? -2.909  -11.344 44.528  1.00 76.73  ? 566  PRO A CD  1 
ATOM   3382 N N   . LEU A 1 567 ? -4.945  -14.002 41.492  1.00 83.83  ? 567  LEU A N   1 
ATOM   3383 C CA  . LEU A 1 567 ? -4.561  -14.632 40.234  1.00 87.78  ? 567  LEU A CA  1 
ATOM   3384 C C   . LEU A 1 567 ? -4.278  -13.588 39.159  1.00 90.29  ? 567  LEU A C   1 
ATOM   3385 O O   . LEU A 1 567 ? -3.223  -13.607 38.527  1.00 90.91  ? 567  LEU A O   1 
ATOM   3386 C CB  . LEU A 1 567 ? -5.657  -15.592 39.762  1.00 88.18  ? 567  LEU A CB  1 
ATOM   3387 C CG  . LEU A 1 567 ? -5.813  -16.885 40.570  1.00 88.18  ? 567  LEU A CG  1 
ATOM   3388 C CD1 . LEU A 1 567 ? -6.186  -16.558 42.004  1.00 88.71  ? 567  LEU A CD1 1 
ATOM   3389 C CD2 . LEU A 1 567 ? -6.875  -17.764 39.931  1.00 88.90  ? 567  LEU A CD2 1 
ATOM   3390 N N   . SER A 1 568 ? -5.223  -12.675 38.955  1.00 93.63  ? 568  SER A N   1 
ATOM   3391 C CA  . SER A 1 568 ? -5.064  -11.620 37.962  1.00 97.12  ? 568  SER A CA  1 
ATOM   3392 C C   . SER A 1 568 ? -4.897  -10.281 38.672  1.00 99.40  ? 568  SER A C   1 
ATOM   3393 O O   . SER A 1 568 ? -5.306  -10.125 39.822  1.00 99.61  ? 568  SER A O   1 
ATOM   3394 C CB  . SER A 1 568 ? -6.283  -11.570 37.037  1.00 97.39  ? 568  SER A CB  1 
ATOM   3395 O OG  . SER A 1 568 ? -6.121  -10.589 36.026  1.00 97.40  ? 568  SER A OG  1 
ATOM   3396 N N   . GLN A 1 569 ? -4.295  -9.314  37.984  1.00 102.06 ? 569  GLN A N   1 
ATOM   3397 C CA  . GLN A 1 569 ? -4.073  -7.998  38.570  1.00 104.63 ? 569  GLN A CA  1 
ATOM   3398 C C   . GLN A 1 569 ? -5.039  -6.964  37.990  1.00 105.03 ? 569  GLN A C   1 
ATOM   3399 O O   . GLN A 1 569 ? -5.038  -5.802  38.400  1.00 105.30 ? 569  GLN A O   1 
ATOM   3400 C CB  . GLN A 1 569 ? -2.627  -7.556  38.322  1.00 105.90 ? 569  GLN A CB  1 
ATOM   3401 C CG  . GLN A 1 569 ? -2.096  -6.546  39.333  1.00 108.52 ? 569  GLN A CG  1 
ATOM   3402 C CD  . GLN A 1 569 ? -1.899  -7.152  40.714  1.00 109.67 ? 569  GLN A CD  1 
ATOM   3403 O OE1 . GLN A 1 569 ? -1.122  -8.091  40.887  1.00 110.65 ? 569  GLN A OE1 1 
ATOM   3404 N NE2 . GLN A 1 569 ? -2.606  -6.616  41.704  1.00 109.82 ? 569  GLN A NE2 1 
ATOM   3405 N N   . ASN A 1 570 ? -5.865  -7.396  37.041  1.00 105.29 ? 570  ASN A N   1 
ATOM   3406 C CA  . ASN A 1 570 ? -6.833  -6.512  36.396  1.00 105.41 ? 570  ASN A CA  1 
ATOM   3407 C C   . ASN A 1 570 ? -7.715  -5.773  37.398  1.00 104.62 ? 570  ASN A C   1 
ATOM   3408 O O   . ASN A 1 570 ? -7.815  -6.162  38.562  1.00 104.33 ? 570  ASN A O   1 
ATOM   3409 C CB  . ASN A 1 570 ? -7.707  -7.311  35.421  1.00 106.80 ? 570  ASN A CB  1 
ATOM   3410 C CG  . ASN A 1 570 ? -8.410  -8.481  36.085  1.00 107.27 ? 570  ASN A CG  1 
ATOM   3411 O OD1 . ASN A 1 570 ? -9.114  -9.250  35.428  1.00 107.26 ? 570  ASN A OD1 1 
ATOM   3412 N ND2 . ASN A 1 570 ? -8.223  -8.622  37.392  1.00 107.82 ? 570  ASN A ND2 1 
ATOM   3413 N N   . GLN A 1 571 ? -8.356  -4.704  36.935  1.00 104.56 ? 571  GLN A N   1 
ATOM   3414 C CA  . GLN A 1 571 ? -9.224  -3.892  37.781  1.00 104.76 ? 571  GLN A CA  1 
ATOM   3415 C C   . GLN A 1 571 ? -10.398 -4.690  38.337  1.00 103.85 ? 571  GLN A C   1 
ATOM   3416 O O   . GLN A 1 571 ? -11.262 -4.144  39.024  1.00 103.09 ? 571  GLN A O   1 
ATOM   3417 C CB  . GLN A 1 571 ? -9.750  -2.692  36.992  1.00 105.87 ? 571  GLN A CB  1 
ATOM   3418 C CG  . GLN A 1 571 ? -8.659  -1.837  36.372  1.00 108.53 ? 571  GLN A CG  1 
ATOM   3419 C CD  . GLN A 1 571 ? -9.208  -0.615  35.662  1.00 110.27 ? 571  GLN A CD  1 
ATOM   3420 O OE1 . GLN A 1 571 ? -10.055 -0.726  34.773  1.00 111.65 ? 571  GLN A OE1 1 
ATOM   3421 N NE2 . GLN A 1 571 ? -8.725  0.560   36.049  1.00 110.21 ? 571  GLN A NE2 1 
ATOM   3422 N N   . GLU A 1 572 ? -10.424 -5.985  38.036  1.00 103.05 ? 572  GLU A N   1 
ATOM   3423 C CA  . GLU A 1 572 ? -11.493 -6.860  38.503  1.00 102.14 ? 572  GLU A CA  1 
ATOM   3424 C C   . GLU A 1 572 ? -11.195 -7.349  39.919  1.00 100.01 ? 572  GLU A C   1 
ATOM   3425 O O   . GLU A 1 572 ? -12.091 -7.443  40.758  1.00 99.54  ? 572  GLU A O   1 
ATOM   3426 C CB  . GLU A 1 572 ? -11.630 -8.065  37.568  1.00 104.30 ? 572  GLU A CB  1 
ATOM   3427 C CG  . GLU A 1 572 ? -11.599 -7.727  36.082  1.00 107.10 ? 572  GLU A CG  1 
ATOM   3428 C CD  . GLU A 1 572 ? -12.713 -6.790  35.663  1.00 108.98 ? 572  GLU A CD  1 
ATOM   3429 O OE1 . GLU A 1 572 ? -13.895 -7.139  35.867  1.00 109.67 ? 572  GLU A OE1 1 
ATOM   3430 O OE2 . GLU A 1 572 ? -12.406 -5.704  35.126  1.00 110.05 ? 572  GLU A OE2 1 
ATOM   3431 N N   . PHE A 1 573 ? -9.926  -7.656  40.174  1.00 97.31  ? 573  PHE A N   1 
ATOM   3432 C CA  . PHE A 1 573 ? -9.490  -8.149  41.476  1.00 94.19  ? 573  PHE A CA  1 
ATOM   3433 C C   . PHE A 1 573 ? -9.088  -7.040  42.442  1.00 93.01  ? 573  PHE A C   1 
ATOM   3434 O O   . PHE A 1 573 ? -9.269  -7.171  43.652  1.00 92.90  ? 573  PHE A O   1 
ATOM   3435 C CB  . PHE A 1 573 ? -8.312  -9.112  41.303  1.00 93.31  ? 573  PHE A CB  1 
ATOM   3436 C CG  . PHE A 1 573 ? -8.692  -10.443 40.720  1.00 92.48  ? 573  PHE A CG  1 
ATOM   3437 C CD1 . PHE A 1 573 ? -9.378  -10.524 39.514  1.00 92.23  ? 573  PHE A CD1 1 
ATOM   3438 C CD2 . PHE A 1 573 ? -8.349  -11.621 41.374  1.00 92.49  ? 573  PHE A CD2 1 
ATOM   3439 C CE1 . PHE A 1 573 ? -9.716  -11.760 38.966  1.00 92.09  ? 573  PHE A CE1 1 
ATOM   3440 C CE2 . PHE A 1 573 ? -8.681  -12.861 40.835  1.00 92.72  ? 573  PHE A CE2 1 
ATOM   3441 C CZ  . PHE A 1 573 ? -9.366  -12.930 39.628  1.00 92.49  ? 573  PHE A CZ  1 
ATOM   3442 N N   . MET A 1 574 ? -8.538  -5.954  41.907  1.00 91.23  ? 574  MET A N   1 
ATOM   3443 C CA  . MET A 1 574 ? -8.102  -4.833  42.732  1.00 90.51  ? 574  MET A CA  1 
ATOM   3444 C C   . MET A 1 574 ? -9.090  -4.420  43.820  1.00 88.51  ? 574  MET A C   1 
ATOM   3445 O O   . MET A 1 574 ? -8.701  -4.205  44.968  1.00 88.06  ? 574  MET A O   1 
ATOM   3446 C CB  . MET A 1 574 ? -7.775  -3.623  41.853  1.00 92.92  ? 574  MET A CB  1 
ATOM   3447 C CG  . MET A 1 574 ? -6.450  -3.744  41.123  1.00 95.60  ? 574  MET A CG  1 
ATOM   3448 S SD  . MET A 1 574 ? -5.097  -4.115  42.264  1.00 98.44  ? 574  MET A SD  1 
ATOM   3449 C CE  . MET A 1 574 ? -4.963  -2.562  43.158  1.00 97.85  ? 574  MET A CE  1 
ATOM   3450 N N   . PRO A 1 575 ? -10.380 -4.292  43.476  1.00 86.98  ? 575  PRO A N   1 
ATOM   3451 C CA  . PRO A 1 575 ? -11.368 -3.898  44.485  1.00 85.73  ? 575  PRO A CA  1 
ATOM   3452 C C   . PRO A 1 575 ? -11.350 -4.812  45.709  1.00 84.43  ? 575  PRO A C   1 
ATOM   3453 O O   . PRO A 1 575 ? -11.636 -4.373  46.824  1.00 84.21  ? 575  PRO A O   1 
ATOM   3454 C CB  . PRO A 1 575 ? -12.685 -3.977  43.720  1.00 86.60  ? 575  PRO A CB  1 
ATOM   3455 C CG  . PRO A 1 575 ? -12.276 -3.592  42.330  1.00 87.12  ? 575  PRO A CG  1 
ATOM   3456 C CD  . PRO A 1 575 ? -11.004 -4.388  42.144  1.00 87.11  ? 575  PRO A CD  1 
ATOM   3457 N N   . PHE A 1 576 ? -11.010 -6.081  45.493  1.00 82.09  ? 576  PHE A N   1 
ATOM   3458 C CA  . PHE A 1 576 ? -10.951 -7.060  46.574  1.00 79.39  ? 576  PHE A CA  1 
ATOM   3459 C C   . PHE A 1 576 ? -9.598  -7.035  47.280  1.00 77.74  ? 576  PHE A C   1 
ATOM   3460 O O   . PHE A 1 576 ? -9.529  -7.069  48.509  1.00 76.60  ? 576  PHE A O   1 
ATOM   3461 C CB  . PHE A 1 576 ? -11.220 -8.470  46.038  1.00 79.08  ? 576  PHE A CB  1 
ATOM   3462 C CG  . PHE A 1 576 ? -12.584 -8.640  45.429  1.00 80.07  ? 576  PHE A CG  1 
ATOM   3463 C CD1 . PHE A 1 576 ? -12.875 -8.109  44.176  1.00 80.21  ? 576  PHE A CD1 1 
ATOM   3464 C CD2 . PHE A 1 576 ? -13.581 -9.330  46.112  1.00 79.47  ? 576  PHE A CD2 1 
ATOM   3465 C CE1 . PHE A 1 576 ? -14.140 -8.264  43.610  1.00 79.59  ? 576  PHE A CE1 1 
ATOM   3466 C CE2 . PHE A 1 576 ? -14.849 -9.490  45.555  1.00 79.92  ? 576  PHE A CE2 1 
ATOM   3467 C CZ  . PHE A 1 576 ? -15.128 -8.956  44.302  1.00 79.60  ? 576  PHE A CZ  1 
ATOM   3468 N N   . VAL A 1 577 ? -8.525  -6.982  46.497  1.00 75.99  ? 577  VAL A N   1 
ATOM   3469 C CA  . VAL A 1 577 ? -7.177  -6.946  47.050  1.00 75.74  ? 577  VAL A CA  1 
ATOM   3470 C C   . VAL A 1 577 ? -6.992  -5.696  47.909  1.00 76.46  ? 577  VAL A C   1 
ATOM   3471 O O   . VAL A 1 577 ? -6.440  -5.762  49.008  1.00 76.47  ? 577  VAL A O   1 
ATOM   3472 C CB  . VAL A 1 577 ? -6.114  -6.947  45.931  1.00 74.96  ? 577  VAL A CB  1 
ATOM   3473 C CG1 . VAL A 1 577 ? -4.722  -6.895  46.533  1.00 74.63  ? 577  VAL A CG1 1 
ATOM   3474 C CG2 . VAL A 1 577 ? -6.269  -8.189  45.071  1.00 74.63  ? 577  VAL A CG2 1 
ATOM   3475 N N   . LYS A 1 578 ? -7.456  -4.558  47.399  1.00 76.38  ? 578  LYS A N   1 
ATOM   3476 C CA  . LYS A 1 578 ? -7.354  -3.293  48.118  1.00 75.86  ? 578  LYS A CA  1 
ATOM   3477 C C   . LYS A 1 578 ? -8.076  -3.387  49.457  1.00 74.96  ? 578  LYS A C   1 
ATOM   3478 O O   . LYS A 1 578 ? -7.498  -3.112  50.509  1.00 74.37  ? 578  LYS A O   1 
ATOM   3479 C CB  . LYS A 1 578 ? -7.970  -2.161  47.291  1.00 78.19  ? 578  LYS A CB  1 
ATOM   3480 C CG  . LYS A 1 578 ? -8.027  -0.822  48.018  1.00 80.88  ? 578  LYS A CG  1 
ATOM   3481 C CD  . LYS A 1 578 ? -8.869  0.200   47.262  1.00 82.55  ? 578  LYS A CD  1 
ATOM   3482 C CE  . LYS A 1 578 ? -8.974  1.510   48.038  1.00 83.71  ? 578  LYS A CE  1 
ATOM   3483 N NZ  . LYS A 1 578 ? -9.840  2.516   47.357  1.00 83.58  ? 578  LYS A NZ  1 
ATOM   3484 N N   . GLU A 1 579 ? -9.347  -3.774  49.406  1.00 74.00  ? 579  GLU A N   1 
ATOM   3485 C CA  . GLU A 1 579 ? -10.158 -3.903  50.609  1.00 74.13  ? 579  GLU A CA  1 
ATOM   3486 C C   . GLU A 1 579 ? -9.515  -4.833  51.635  1.00 73.08  ? 579  GLU A C   1 
ATOM   3487 O O   . GLU A 1 579 ? -9.371  -4.470  52.803  1.00 72.80  ? 579  GLU A O   1 
ATOM   3488 C CB  . GLU A 1 579 ? -11.557 -4.415  50.249  1.00 75.55  ? 579  GLU A CB  1 
ATOM   3489 C CG  . GLU A 1 579 ? -12.423 -4.772  51.452  1.00 79.06  ? 579  GLU A CG  1 
ATOM   3490 C CD  . GLU A 1 579 ? -12.650 -3.599  52.388  1.00 81.18  ? 579  GLU A CD  1 
ATOM   3491 O OE1 . GLU A 1 579 ? -13.265 -3.804  53.457  1.00 82.60  ? 579  GLU A OE1 1 
ATOM   3492 O OE2 . GLU A 1 579 ? -12.218 -2.473  52.058  1.00 81.77  ? 579  GLU A OE2 1 
ATOM   3493 N N   . LEU A 1 580 ? -9.129  -6.028  51.197  1.00 70.55  ? 580  LEU A N   1 
ATOM   3494 C CA  . LEU A 1 580 ? -8.506  -6.998  52.090  1.00 67.45  ? 580  LEU A CA  1 
ATOM   3495 C C   . LEU A 1 580 ? -7.255  -6.419  52.737  1.00 66.44  ? 580  LEU A C   1 
ATOM   3496 O O   . LEU A 1 580 ? -7.070  -6.519  53.952  1.00 65.09  ? 580  LEU A O   1 
ATOM   3497 C CB  . LEU A 1 580 ? -8.140  -8.275  51.327  1.00 65.69  ? 580  LEU A CB  1 
ATOM   3498 C CG  . LEU A 1 580 ? -7.521  -9.399  52.166  1.00 63.54  ? 580  LEU A CG  1 
ATOM   3499 C CD1 . LEU A 1 580 ? -8.511  -9.844  53.228  1.00 62.44  ? 580  LEU A CD1 1 
ATOM   3500 C CD2 . LEU A 1 580 ? -7.146  -10.568 51.276  1.00 62.14  ? 580  LEU A CD2 1 
ATOM   3501 N N   . SER A 1 581 ? -6.401  -5.812  51.919  1.00 64.96  ? 581  SER A N   1 
ATOM   3502 C CA  . SER A 1 581 ? -5.162  -5.218  52.407  1.00 64.47  ? 581  SER A CA  1 
ATOM   3503 C C   . SER A 1 581 ? -5.419  -4.192  53.503  1.00 64.34  ? 581  SER A C   1 
ATOM   3504 O O   . SER A 1 581 ? -4.865  -4.287  54.596  1.00 64.28  ? 581  SER A O   1 
ATOM   3505 C CB  . SER A 1 581 ? -4.405  -4.551  51.259  1.00 63.45  ? 581  SER A CB  1 
ATOM   3506 O OG  . SER A 1 581 ? -3.269  -3.856  51.744  1.00 63.00  ? 581  SER A OG  1 
ATOM   3507 N N   . GLU A 1 582 ? -6.259  -3.210  53.202  1.00 65.28  ? 582  GLU A N   1 
ATOM   3508 C CA  . GLU A 1 582 ? -6.578  -2.168  54.165  1.00 66.86  ? 582  GLU A CA  1 
ATOM   3509 C C   . GLU A 1 582 ? -7.221  -2.773  55.407  1.00 66.05  ? 582  GLU A C   1 
ATOM   3510 O O   . GLU A 1 582 ? -6.923  -2.369  56.532  1.00 65.32  ? 582  GLU A O   1 
ATOM   3511 C CB  . GLU A 1 582 ? -7.510  -1.135  53.523  1.00 69.40  ? 582  GLU A CB  1 
ATOM   3512 C CG  . GLU A 1 582 ? -6.900  -0.447  52.304  1.00 72.35  ? 582  GLU A CG  1 
ATOM   3513 C CD  . GLU A 1 582 ? -7.819  0.590   51.681  1.00 75.10  ? 582  GLU A CD  1 
ATOM   3514 O OE1 . GLU A 1 582 ? -7.428  1.190   50.657  1.00 75.68  ? 582  GLU A OE1 1 
ATOM   3515 O OE2 . GLU A 1 582 ? -8.929  0.807   52.215  1.00 76.63  ? 582  GLU A OE2 1 
ATOM   3516 N N   . ALA A 1 583 ? -8.098  -3.750  55.199  1.00 65.86  ? 583  ALA A N   1 
ATOM   3517 C CA  . ALA A 1 583 ? -8.772  -4.417  56.306  1.00 65.26  ? 583  ALA A CA  1 
ATOM   3518 C C   . ALA A 1 583 ? -7.730  -5.057  57.216  1.00 65.13  ? 583  ALA A C   1 
ATOM   3519 O O   . ALA A 1 583 ? -7.821  -4.961  58.440  1.00 65.48  ? 583  ALA A O   1 
ATOM   3520 C CB  . ALA A 1 583 ? -9.734  -5.475  55.776  1.00 64.66  ? 583  ALA A CB  1 
ATOM   3521 N N   . LEU A 1 584 ? -6.743  -5.712  56.613  1.00 63.34  ? 584  LEU A N   1 
ATOM   3522 C CA  . LEU A 1 584 ? -5.680  -6.352  57.376  1.00 63.65  ? 584  LEU A CA  1 
ATOM   3523 C C   . LEU A 1 584 ? -4.887  -5.294  58.128  1.00 64.66  ? 584  LEU A C   1 
ATOM   3524 O O   . LEU A 1 584 ? -4.439  -5.521  59.253  1.00 65.46  ? 584  LEU A O   1 
ATOM   3525 C CB  . LEU A 1 584 ? -4.744  -7.129  56.446  1.00 62.08  ? 584  LEU A CB  1 
ATOM   3526 C CG  . LEU A 1 584 ? -5.271  -8.441  55.863  1.00 59.35  ? 584  LEU A CG  1 
ATOM   3527 C CD1 . LEU A 1 584 ? -4.320  -8.955  54.792  1.00 57.04  ? 584  LEU A CD1 1 
ATOM   3528 C CD2 . LEU A 1 584 ? -5.425  -9.456  56.983  1.00 59.03  ? 584  LEU A CD2 1 
ATOM   3529 N N   . THR A 1 585 ? -4.715  -4.135  57.498  1.00 65.54  ? 585  THR A N   1 
ATOM   3530 C CA  . THR A 1 585 ? -3.978  -3.035  58.106  1.00 65.68  ? 585  THR A CA  1 
ATOM   3531 C C   . THR A 1 585 ? -4.715  -2.506  59.330  1.00 66.24  ? 585  THR A C   1 
ATOM   3532 O O   . THR A 1 585 ? -4.093  -2.148  60.327  1.00 66.97  ? 585  THR A O   1 
ATOM   3533 C CB  . THR A 1 585 ? -3.765  -1.884  57.101  1.00 65.91  ? 585  THR A CB  1 
ATOM   3534 O OG1 . THR A 1 585 ? -2.896  -2.325  56.051  1.00 64.51  ? 585  THR A OG1 1 
ATOM   3535 C CG2 . THR A 1 585 ? -3.145  -0.675  57.788  1.00 65.44  ? 585  THR A CG2 1 
ATOM   3536 N N   . ARG A 1 586 ? -6.042  -2.458  59.253  1.00 67.30  ? 586  ARG A N   1 
ATOM   3537 C CA  . ARG A 1 586 ? -6.843  -1.983  60.375  1.00 69.52  ? 586  ARG A CA  1 
ATOM   3538 C C   . ARG A 1 586 ? -6.753  -2.965  61.543  1.00 69.01  ? 586  ARG A C   1 
ATOM   3539 O O   . ARG A 1 586 ? -6.962  -2.593  62.701  1.00 69.65  ? 586  ARG A O   1 
ATOM   3540 C CB  . ARG A 1 586 ? -8.307  -1.812  59.953  1.00 71.65  ? 586  ARG A CB  1 
ATOM   3541 C CG  . ARG A 1 586 ? -8.531  -0.750  58.885  1.00 76.10  ? 586  ARG A CG  1 
ATOM   3542 C CD  . ARG A 1 586 ? -10.006 -0.374  58.773  1.00 77.96  ? 586  ARG A CD  1 
ATOM   3543 N NE  . ARG A 1 586 ? -10.828 -1.438  58.200  1.00 80.56  ? 586  ARG A NE  1 
ATOM   3544 C CZ  . ARG A 1 586 ? -10.834 -1.769  56.912  1.00 82.32  ? 586  ARG A CZ  1 
ATOM   3545 N NH1 . ARG A 1 586 ? -10.059 -1.119  56.053  1.00 81.21  ? 586  ARG A NH1 1 
ATOM   3546 N NH2 . ARG A 1 586 ? -11.619 -2.748  56.480  1.00 82.53  ? 586  ARG A NH2 1 
ATOM   3547 N N   . HIS A 1 587 ? -6.436  -4.218  61.228  1.00 67.28  ? 587  HIS A N   1 
ATOM   3548 C CA  . HIS A 1 587 ? -6.311  -5.271  62.231  1.00 66.60  ? 587  HIS A CA  1 
ATOM   3549 C C   . HIS A 1 587 ? -4.866  -5.464  62.672  1.00 64.82  ? 587  HIS A C   1 
ATOM   3550 O O   . HIS A 1 587 ? -4.555  -6.397  63.412  1.00 64.38  ? 587  HIS A O   1 
ATOM   3551 C CB  . HIS A 1 587 ? -6.848  -6.593  61.678  1.00 69.40  ? 587  HIS A CB  1 
ATOM   3552 C CG  . HIS A 1 587 ? -8.339  -6.640  61.560  1.00 72.00  ? 587  HIS A CG  1 
ATOM   3553 N ND1 . HIS A 1 587 ? -9.171  -6.656  62.659  1.00 73.92  ? 587  HIS A ND1 1 
ATOM   3554 C CD2 . HIS A 1 587 ? -9.149  -6.676  60.475  1.00 72.34  ? 587  HIS A CD2 1 
ATOM   3555 C CE1 . HIS A 1 587 ? -10.429 -6.702  62.256  1.00 73.47  ? 587  HIS A CE1 1 
ATOM   3556 N NE2 . HIS A 1 587 ? -10.443 -6.715  60.935  1.00 72.29  ? 587  HIS A NE2 1 
ATOM   3557 N N   . GLY A 1 588 ? -3.986  -4.582  62.208  1.00 62.86  ? 588  GLY A N   1 
ATOM   3558 C CA  . GLY A 1 588 ? -2.585  -4.676  62.571  1.00 60.73  ? 588  GLY A CA  1 
ATOM   3559 C C   . GLY A 1 588 ? -1.927  -5.980  62.156  1.00 60.14  ? 588  GLY A C   1 
ATOM   3560 O O   . GLY A 1 588 ? -1.130  -6.542  62.907  1.00 61.29  ? 588  GLY A O   1 
ATOM   3561 N N   . VAL A 1 589 ? -2.261  -6.463  60.963  1.00 58.87  ? 589  VAL A N   1 
ATOM   3562 C CA  . VAL A 1 589 ? -1.689  -7.702  60.445  1.00 55.49  ? 589  VAL A CA  1 
ATOM   3563 C C   . VAL A 1 589 ? -0.771  -7.392  59.269  1.00 55.53  ? 589  VAL A C   1 
ATOM   3564 O O   . VAL A 1 589 ? -1.239  -7.049  58.184  1.00 56.13  ? 589  VAL A O   1 
ATOM   3565 C CB  . VAL A 1 589 ? -2.791  -8.675  59.965  1.00 54.76  ? 589  VAL A CB  1 
ATOM   3566 C CG1 . VAL A 1 589 ? -2.161  -9.935  59.388  1.00 53.19  ? 589  VAL A CG1 1 
ATOM   3567 C CG2 . VAL A 1 589 ? -3.714  -9.026  61.120  1.00 53.02  ? 589  VAL A CG2 1 
ATOM   3568 N N   . SER A 1 590 ? 0.536   -7.507  59.484  1.00 55.42  ? 590  SER A N   1 
ATOM   3569 C CA  . SER A 1 590 ? 1.501   -7.234  58.425  1.00 55.05  ? 590  SER A CA  1 
ATOM   3570 C C   . SER A 1 590 ? 1.241   -8.156  57.239  1.00 56.65  ? 590  SER A C   1 
ATOM   3571 O O   . SER A 1 590 ? 0.941   -9.340  57.416  1.00 57.14  ? 590  SER A O   1 
ATOM   3572 C CB  . SER A 1 590 ? 2.930   -7.427  58.942  1.00 53.20  ? 590  SER A CB  1 
ATOM   3573 O OG  . SER A 1 590 ? 3.131   -8.737  59.440  1.00 52.29  ? 590  SER A OG  1 
ATOM   3574 N N   . HIS A 1 591 ? 1.353   -7.613  56.030  1.00 56.94  ? 591  HIS A N   1 
ATOM   3575 C CA  . HIS A 1 591 ? 1.109   -8.400  54.827  1.00 58.84  ? 591  HIS A CA  1 
ATOM   3576 C C   . HIS A 1 591 ? 1.755   -7.800  53.585  1.00 60.21  ? 591  HIS A C   1 
ATOM   3577 O O   . HIS A 1 591 ? 2.248   -6.673  53.607  1.00 60.61  ? 591  HIS A O   1 
ATOM   3578 C CB  . HIS A 1 591 ? -0.393  -8.520  54.586  1.00 56.81  ? 591  HIS A CB  1 
ATOM   3579 C CG  . HIS A 1 591 ? -1.066  -7.205  54.355  1.00 59.10  ? 591  HIS A CG  1 
ATOM   3580 N ND1 . HIS A 1 591 ? -1.259  -6.281  55.360  1.00 60.51  ? 591  HIS A ND1 1 
ATOM   3581 C CD2 . HIS A 1 591 ? -1.565  -6.644  53.227  1.00 59.41  ? 591  HIS A CD2 1 
ATOM   3582 C CE1 . HIS A 1 591 ? -1.848  -5.209  54.861  1.00 62.85  ? 591  HIS A CE1 1 
ATOM   3583 N NE2 . HIS A 1 591 ? -2.044  -5.403  53.569  1.00 61.81  ? 591  HIS A NE2 1 
ATOM   3584 N N   . LYS A 1 592 ? 1.737   -8.569  52.501  1.00 63.02  ? 592  LYS A N   1 
ATOM   3585 C CA  . LYS A 1 592 ? 2.296   -8.142  51.224  1.00 66.37  ? 592  LYS A CA  1 
ATOM   3586 C C   . LYS A 1 592 ? 1.565   -8.828  50.077  1.00 67.29  ? 592  LYS A C   1 
ATOM   3587 O O   . LYS A 1 592 ? 1.401   -10.048 50.076  1.00 68.18  ? 592  LYS A O   1 
ATOM   3588 C CB  . LYS A 1 592 ? 3.792   -8.469  51.144  1.00 67.32  ? 592  LYS A CB  1 
ATOM   3589 C CG  . LYS A 1 592 ? 4.675   -7.568  51.993  1.00 70.86  ? 592  LYS A CG  1 
ATOM   3590 C CD  . LYS A 1 592 ? 6.148   -7.769  51.672  1.00 73.16  ? 592  LYS A CD  1 
ATOM   3591 C CE  . LYS A 1 592 ? 7.019   -6.761  52.411  1.00 74.74  ? 592  LYS A CE  1 
ATOM   3592 N NZ  . LYS A 1 592 ? 8.462   -6.926  52.080  1.00 75.37  ? 592  LYS A NZ  1 
ATOM   3593 N N   . VAL A 1 593 ? 1.123   -8.035  49.106  1.00 68.19  ? 593  VAL A N   1 
ATOM   3594 C CA  . VAL A 1 593 ? 0.416   -8.563  47.949  1.00 69.76  ? 593  VAL A CA  1 
ATOM   3595 C C   . VAL A 1 593 ? 1.413   -9.216  47.001  1.00 73.19  ? 593  VAL A C   1 
ATOM   3596 O O   . VAL A 1 593 ? 2.277   -8.542  46.443  1.00 74.34  ? 593  VAL A O   1 
ATOM   3597 C CB  . VAL A 1 593 ? -0.330  -7.444  47.196  1.00 67.86  ? 593  VAL A CB  1 
ATOM   3598 C CG1 . VAL A 1 593 ? -1.044  -8.016  45.984  1.00 67.95  ? 593  VAL A CG1 1 
ATOM   3599 C CG2 . VAL A 1 593 ? -1.320  -6.768  48.127  1.00 64.72  ? 593  VAL A CG2 1 
ATOM   3600 N N   . ASP A 1 594 ? 1.293   -10.528 46.825  1.00 77.43  ? 594  ASP A N   1 
ATOM   3601 C CA  . ASP A 1 594 ? 2.192   -11.271 45.948  1.00 82.26  ? 594  ASP A CA  1 
ATOM   3602 C C   . ASP A 1 594 ? 1.933   -10.962 44.475  1.00 85.25  ? 594  ASP A C   1 
ATOM   3603 O O   . ASP A 1 594 ? 0.786   -10.930 44.027  1.00 84.83  ? 594  ASP A O   1 
ATOM   3604 C CB  . ASP A 1 594 ? 2.038   -12.777 46.190  1.00 82.70  ? 594  ASP A CB  1 
ATOM   3605 C CG  . ASP A 1 594 ? 3.008   -13.607 45.363  1.00 83.47  ? 594  ASP A CG  1 
ATOM   3606 O OD1 . ASP A 1 594 ? 2.950   -14.852 45.448  1.00 84.46  ? 594  ASP A OD1 1 
ATOM   3607 O OD2 . ASP A 1 594 ? 3.831   -13.020 44.631  1.00 84.49  ? 594  ASP A OD2 1 
ATOM   3608 N N   . ASP A 1 595 ? 3.011   -10.736 43.729  1.00 89.31  ? 595  ASP A N   1 
ATOM   3609 C CA  . ASP A 1 595 ? 2.916   -10.435 42.304  1.00 93.50  ? 595  ASP A CA  1 
ATOM   3610 C C   . ASP A 1 595 ? 3.715   -11.432 41.475  1.00 94.27  ? 595  ASP A C   1 
ATOM   3611 O O   . ASP A 1 595 ? 3.443   -11.617 40.289  1.00 95.39  ? 595  ASP A O   1 
ATOM   3612 C CB  . ASP A 1 595 ? 3.430   -9.021  42.020  1.00 96.55  ? 595  ASP A CB  1 
ATOM   3613 C CG  . ASP A 1 595 ? 2.642   -7.955  42.754  1.00 100.86 ? 595  ASP A CG  1 
ATOM   3614 O OD1 . ASP A 1 595 ? 1.404   -7.904  42.584  1.00 102.60 ? 595  ASP A OD1 1 
ATOM   3615 O OD2 . ASP A 1 595 ? 3.263   -7.165  43.500  1.00 102.56 ? 595  ASP A OD2 1 
ATOM   3616 N N   . SER A 1 596 ? 4.699   -12.070 42.104  1.00 94.77  ? 596  SER A N   1 
ATOM   3617 C CA  . SER A 1 596 ? 5.547   -13.045 41.424  1.00 96.09  ? 596  SER A CA  1 
ATOM   3618 C C   . SER A 1 596 ? 4.750   -13.926 40.466  1.00 96.13  ? 596  SER A C   1 
ATOM   3619 O O   . SER A 1 596 ? 3.573   -14.210 40.695  1.00 96.12  ? 596  SER A O   1 
ATOM   3620 C CB  . SER A 1 596 ? 6.276   -13.921 42.449  1.00 96.11  ? 596  SER A CB  1 
ATOM   3621 O OG  . SER A 1 596 ? 5.363   -14.655 43.246  1.00 98.04  ? 596  SER A OG  1 
ATOM   3622 N N   . SER A 1 597 ? 5.400   -14.350 39.387  1.00 96.22  ? 597  SER A N   1 
ATOM   3623 C CA  . SER A 1 597 ? 4.758   -15.190 38.383  1.00 95.86  ? 597  SER A CA  1 
ATOM   3624 C C   . SER A 1 597 ? 4.751   -16.655 38.801  1.00 94.14  ? 597  SER A C   1 
ATOM   3625 O O   . SER A 1 597 ? 5.476   -17.056 39.711  1.00 94.01  ? 597  SER A O   1 
ATOM   3626 C CB  . SER A 1 597 ? 5.478   -15.044 37.039  1.00 96.99  ? 597  SER A CB  1 
ATOM   3627 O OG  . SER A 1 597 ? 6.838   -15.434 37.144  1.00 97.57  ? 597  SER A OG  1 
ATOM   3628 N N   . GLY A 1 598 ? 3.928   -17.450 38.125  1.00 92.32  ? 598  GLY A N   1 
ATOM   3629 C CA  . GLY A 1 598 ? 3.842   -18.863 38.438  1.00 89.43  ? 598  GLY A CA  1 
ATOM   3630 C C   . GLY A 1 598 ? 2.496   -19.239 39.024  1.00 87.90  ? 598  GLY A C   1 
ATOM   3631 O O   . GLY A 1 598 ? 1.699   -18.368 39.380  1.00 87.57  ? 598  GLY A O   1 
ATOM   3632 N N   . SER A 1 599 ? 2.244   -20.540 39.123  1.00 85.65  ? 599  SER A N   1 
ATOM   3633 C CA  . SER A 1 599 ? 0.987   -21.039 39.669  1.00 83.78  ? 599  SER A CA  1 
ATOM   3634 C C   . SER A 1 599 ? 0.896   -20.736 41.159  1.00 83.31  ? 599  SER A C   1 
ATOM   3635 O O   . SER A 1 599 ? 1.915   -20.607 41.836  1.00 83.49  ? 599  SER A O   1 
ATOM   3636 C CB  . SER A 1 599 ? 0.881   -22.547 39.448  1.00 83.06  ? 599  SER A CB  1 
ATOM   3637 O OG  . SER A 1 599 ? 1.955   -23.226 40.074  1.00 80.26  ? 599  SER A OG  1 
ATOM   3638 N N   . ILE A 1 600 ? -0.329  -20.625 41.663  1.00 81.96  ? 600  ILE A N   1 
ATOM   3639 C CA  . ILE A 1 600 ? -0.553  -20.343 43.076  1.00 80.38  ? 600  ILE A CA  1 
ATOM   3640 C C   . ILE A 1 600 ? 0.343   -21.194 43.973  1.00 79.42  ? 600  ILE A C   1 
ATOM   3641 O O   . ILE A 1 600 ? 0.913   -20.695 44.943  1.00 79.22  ? 600  ILE A O   1 
ATOM   3642 C CB  . ILE A 1 600 ? -2.028  -20.591 43.468  1.00 80.56  ? 600  ILE A CB  1 
ATOM   3643 C CG1 . ILE A 1 600 ? -2.171  -20.552 44.992  1.00 81.96  ? 600  ILE A CG1 1 
ATOM   3644 C CG2 . ILE A 1 600 ? -2.501  -21.920 42.904  1.00 80.03  ? 600  ILE A CG2 1 
ATOM   3645 C CD1 . ILE A 1 600 ? -3.576  -20.808 45.495  1.00 85.49  ? 600  ILE A CD1 1 
ATOM   3646 N N   . GLY A 1 601 ? 0.465   -22.477 43.642  1.00 78.48  ? 601  GLY A N   1 
ATOM   3647 C CA  . GLY A 1 601 ? 1.292   -23.375 44.429  1.00 77.91  ? 601  GLY A CA  1 
ATOM   3648 C C   . GLY A 1 601 ? 2.751   -22.961 44.460  1.00 78.24  ? 601  GLY A C   1 
ATOM   3649 O O   . GLY A 1 601 ? 3.421   -23.098 45.484  1.00 78.14  ? 601  GLY A O   1 
ATOM   3650 N N   . ARG A 1 602 ? 3.244   -22.459 43.333  1.00 78.62  ? 602  ARG A N   1 
ATOM   3651 C CA  . ARG A 1 602 ? 4.628   -22.013 43.224  1.00 79.24  ? 602  ARG A CA  1 
ATOM   3652 C C   . ARG A 1 602 ? 4.782   -20.657 43.907  1.00 77.65  ? 602  ARG A C   1 
ATOM   3653 O O   . ARG A 1 602 ? 5.852   -20.320 44.414  1.00 76.84  ? 602  ARG A O   1 
ATOM   3654 C CB  . ARG A 1 602 ? 5.023   -21.911 41.749  1.00 82.62  ? 602  ARG A CB  1 
ATOM   3655 C CG  . ARG A 1 602 ? 6.432   -21.403 41.494  1.00 88.16  ? 602  ARG A CG  1 
ATOM   3656 C CD  . ARG A 1 602 ? 6.731   -21.409 40.003  1.00 93.77  ? 602  ARG A CD  1 
ATOM   3657 N NE  . ARG A 1 602 ? 8.008   -20.775 39.683  1.00 99.25  ? 602  ARG A NE  1 
ATOM   3658 C CZ  . ARG A 1 602 ? 8.496   -20.660 38.450  1.00 101.25 ? 602  ARG A CZ  1 
ATOM   3659 N NH1 . ARG A 1 602 ? 7.816   -21.138 37.416  1.00 101.93 ? 602  ARG A NH1 1 
ATOM   3660 N NH2 . ARG A 1 602 ? 9.662   -20.061 38.249  1.00 101.74 ? 602  ARG A NH2 1 
ATOM   3661 N N   . ARG A 1 603 ? 3.697   -19.888 43.914  1.00 75.86  ? 603  ARG A N   1 
ATOM   3662 C CA  . ARG A 1 603 ? 3.682   -18.569 44.537  1.00 74.17  ? 603  ARG A CA  1 
ATOM   3663 C C   . ARG A 1 603 ? 3.919   -18.730 46.034  1.00 72.97  ? 603  ARG A C   1 
ATOM   3664 O O   . ARG A 1 603 ? 4.780   -18.067 46.613  1.00 72.56  ? 603  ARG A O   1 
ATOM   3665 C CB  . ARG A 1 603 ? 2.328   -17.897 44.302  1.00 74.83  ? 603  ARG A CB  1 
ATOM   3666 C CG  . ARG A 1 603 ? 1.904   -17.837 42.839  1.00 76.09  ? 603  ARG A CG  1 
ATOM   3667 C CD  . ARG A 1 603 ? 2.491   -16.637 42.120  1.00 74.59  ? 603  ARG A CD  1 
ATOM   3668 N NE  . ARG A 1 603 ? 1.871   -15.390 42.556  1.00 74.83  ? 603  ARG A NE  1 
ATOM   3669 C CZ  . ARG A 1 603 ? 0.580   -15.105 42.413  1.00 75.38  ? 603  ARG A CZ  1 
ATOM   3670 N NH1 . ARG A 1 603 ? -0.238  -15.980 41.842  1.00 75.13  ? 603  ARG A NH1 1 
ATOM   3671 N NH2 . ARG A 1 603 ? 0.103   -13.945 42.845  1.00 75.13  ? 603  ARG A NH2 1 
ATOM   3672 N N   . TYR A 1 604 ? 3.146   -19.619 46.652  1.00 71.47  ? 604  TYR A N   1 
ATOM   3673 C CA  . TYR A 1 604 ? 3.261   -19.883 48.082  1.00 69.84  ? 604  TYR A CA  1 
ATOM   3674 C C   . TYR A 1 604 ? 4.586   -20.546 48.433  1.00 70.01  ? 604  TYR A C   1 
ATOM   3675 O O   . TYR A 1 604 ? 5.050   -20.453 49.568  1.00 70.66  ? 604  TYR A O   1 
ATOM   3676 C CB  . TYR A 1 604 ? 2.111   -20.774 48.555  1.00 67.77  ? 604  TYR A CB  1 
ATOM   3677 C CG  . TYR A 1 604 ? 0.803   -20.046 48.746  1.00 65.77  ? 604  TYR A CG  1 
ATOM   3678 C CD1 . TYR A 1 604 ? 0.709   -18.965 49.621  1.00 65.75  ? 604  TYR A CD1 1 
ATOM   3679 C CD2 . TYR A 1 604 ? -0.347  -20.452 48.074  1.00 65.16  ? 604  TYR A CD2 1 
ATOM   3680 C CE1 . TYR A 1 604 ? -0.498  -18.306 49.823  1.00 65.04  ? 604  TYR A CE1 1 
ATOM   3681 C CE2 . TYR A 1 604 ? -1.561  -19.799 48.268  1.00 64.38  ? 604  TYR A CE2 1 
ATOM   3682 C CZ  . TYR A 1 604 ? -1.628  -18.728 49.144  1.00 64.66  ? 604  TYR A CZ  1 
ATOM   3683 O OH  . TYR A 1 604 ? -2.823  -18.079 49.343  1.00 66.06  ? 604  TYR A OH  1 
ATOM   3684 N N   . ALA A 1 605 ? 5.187   -21.225 47.461  1.00 70.22  ? 605  ALA A N   1 
ATOM   3685 C CA  . ALA A 1 605 ? 6.462   -21.893 47.684  1.00 70.76  ? 605  ALA A CA  1 
ATOM   3686 C C   . ALA A 1 605 ? 7.487   -20.858 48.131  1.00 70.96  ? 605  ALA A C   1 
ATOM   3687 O O   . ALA A 1 605 ? 8.300   -21.116 49.017  1.00 71.31  ? 605  ALA A O   1 
ATOM   3688 C CB  . ALA A 1 605 ? 6.924   -22.579 46.406  1.00 71.14  ? 605  ALA A CB  1 
ATOM   3689 N N   . ARG A 1 606 ? 7.437   -19.684 47.510  1.00 71.24  ? 606  ARG A N   1 
ATOM   3690 C CA  . ARG A 1 606 ? 8.346   -18.594 47.845  1.00 72.71  ? 606  ARG A CA  1 
ATOM   3691 C C   . ARG A 1 606 ? 7.955   -18.006 49.197  1.00 70.04  ? 606  ARG A C   1 
ATOM   3692 O O   . ARG A 1 606 ? 8.810   -17.630 49.998  1.00 69.16  ? 606  ARG A O   1 
ATOM   3693 C CB  . ARG A 1 606 ? 8.283   -17.514 46.762  1.00 77.19  ? 606  ARG A CB  1 
ATOM   3694 C CG  . ARG A 1 606 ? 9.495   -17.484 45.846  1.00 83.16  ? 606  ARG A CG  1 
ATOM   3695 C CD  . ARG A 1 606 ? 9.193   -16.756 44.545  1.00 88.47  ? 606  ARG A CD  1 
ATOM   3696 N NE  . ARG A 1 606 ? 8.318   -17.542 43.678  1.00 92.75  ? 606  ARG A NE  1 
ATOM   3697 C CZ  . ARG A 1 606 ? 7.963   -17.187 42.446  1.00 93.90  ? 606  ARG A CZ  1 
ATOM   3698 N NH1 . ARG A 1 606 ? 8.406   -16.050 41.927  1.00 94.58  ? 606  ARG A NH1 1 
ATOM   3699 N NH2 . ARG A 1 606 ? 7.171   -17.974 41.730  1.00 94.84  ? 606  ARG A NH2 1 
ATOM   3700 N N   . THR A 1 607 ? 6.650   -17.936 49.436  1.00 67.54  ? 607  THR A N   1 
ATOM   3701 C CA  . THR A 1 607 ? 6.113   -17.415 50.685  1.00 65.77  ? 607  THR A CA  1 
ATOM   3702 C C   . THR A 1 607 ? 6.550   -18.283 51.861  1.00 64.42  ? 607  THR A C   1 
ATOM   3703 O O   . THR A 1 607 ? 6.937   -17.769 52.911  1.00 62.72  ? 607  THR A O   1 
ATOM   3704 C CB  . THR A 1 607 ? 4.568   -17.360 50.627  1.00 66.42  ? 607  THR A CB  1 
ATOM   3705 O OG1 . THR A 1 607 ? 4.163   -16.181 49.924  1.00 66.72  ? 607  THR A OG1 1 
ATOM   3706 C CG2 . THR A 1 607 ? 3.962   -17.358 52.023  1.00 68.22  ? 607  THR A CG2 1 
ATOM   3707 N N   . ASP A 1 608 ? 6.489   -19.599 51.677  1.00 62.76  ? 608  ASP A N   1 
ATOM   3708 C CA  . ASP A 1 608 ? 6.878   -20.532 52.727  1.00 62.51  ? 608  ASP A CA  1 
ATOM   3709 C C   . ASP A 1 608 ? 8.368   -20.430 53.036  1.00 61.54  ? 608  ASP A C   1 
ATOM   3710 O O   . ASP A 1 608 ? 8.775   -20.561 54.191  1.00 61.14  ? 608  ASP A O   1 
ATOM   3711 C CB  . ASP A 1 608 ? 6.541   -21.973 52.325  1.00 63.66  ? 608  ASP A CB  1 
ATOM   3712 C CG  . ASP A 1 608 ? 5.054   -22.192 52.111  1.00 65.07  ? 608  ASP A CG  1 
ATOM   3713 O OD1 . ASP A 1 608 ? 4.258   -21.797 52.988  1.00 65.60  ? 608  ASP A OD1 1 
ATOM   3714 O OD2 . ASP A 1 608 ? 4.683   -22.772 51.068  1.00 65.44  ? 608  ASP A OD2 1 
ATOM   3715 N N   . GLU A 1 609 ? 9.177   -20.197 52.006  1.00 59.91  ? 609  GLU A N   1 
ATOM   3716 C CA  . GLU A 1 609 ? 10.621  -20.085 52.186  1.00 60.03  ? 609  GLU A CA  1 
ATOM   3717 C C   . GLU A 1 609 ? 11.024  -19.063 53.239  1.00 58.66  ? 609  GLU A C   1 
ATOM   3718 O O   . GLU A 1 609 ? 11.935  -19.312 54.029  1.00 59.04  ? 609  GLU A O   1 
ATOM   3719 C CB  . GLU A 1 609 ? 11.312  -19.731 50.869  1.00 61.26  ? 609  GLU A CB  1 
ATOM   3720 C CG  . GLU A 1 609 ? 11.711  -20.929 50.034  1.00 62.17  ? 609  GLU A CG  1 
ATOM   3721 C CD  . GLU A 1 609 ? 12.800  -20.595 49.034  1.00 63.04  ? 609  GLU A CD  1 
ATOM   3722 O OE1 . GLU A 1 609 ? 12.565  -19.742 48.153  1.00 63.34  ? 609  GLU A OE1 1 
ATOM   3723 O OE2 . GLU A 1 609 ? 13.897  -21.183 49.135  1.00 64.98  ? 609  GLU A OE2 1 
ATOM   3724 N N   . ILE A 1 610 ? 10.361  -17.912 53.249  1.00 56.38  ? 610  ILE A N   1 
ATOM   3725 C CA  . ILE A 1 610 ? 10.689  -16.882 54.225  1.00 55.22  ? 610  ILE A CA  1 
ATOM   3726 C C   . ILE A 1 610 ? 9.805   -16.965 55.467  1.00 53.13  ? 610  ILE A C   1 
ATOM   3727 O O   . ILE A 1 610 ? 9.797   -16.059 56.298  1.00 53.60  ? 610  ILE A O   1 
ATOM   3728 C CB  . ILE A 1 610 ? 10.610  -15.471 53.603  1.00 53.49  ? 610  ILE A CB  1 
ATOM   3729 C CG1 . ILE A 1 610 ? 9.190   -15.168 53.136  1.00 54.29  ? 610  ILE A CG1 1 
ATOM   3730 C CG2 . ILE A 1 610 ? 11.563  -15.385 52.427  1.00 53.67  ? 610  ILE A CG2 1 
ATOM   3731 C CD1 . ILE A 1 610 ? 9.049   -13.806 52.478  1.00 52.18  ? 610  ILE A CD1 1 
ATOM   3732 N N   . GLY A 1 611 ? 9.059   -18.062 55.573  1.00 50.81  ? 611  GLY A N   1 
ATOM   3733 C CA  . GLY A 1 611 ? 8.211   -18.301 56.730  1.00 48.55  ? 611  GLY A CA  1 
ATOM   3734 C C   . GLY A 1 611 ? 6.935   -17.510 56.949  1.00 47.99  ? 611  GLY A C   1 
ATOM   3735 O O   . GLY A 1 611 ? 6.507   -17.356 58.094  1.00 48.42  ? 611  GLY A O   1 
ATOM   3736 N N   . VAL A 1 612 ? 6.314   -17.011 55.886  1.00 46.74  ? 612  VAL A N   1 
ATOM   3737 C CA  . VAL A 1 612 ? 5.075   -16.259 56.051  1.00 46.60  ? 612  VAL A CA  1 
ATOM   3738 C C   . VAL A 1 612 ? 4.027   -17.196 56.649  1.00 47.85  ? 612  VAL A C   1 
ATOM   3739 O O   . VAL A 1 612 ? 3.746   -18.264 56.104  1.00 49.16  ? 612  VAL A O   1 
ATOM   3740 C CB  . VAL A 1 612 ? 4.579   -15.694 54.708  1.00 46.91  ? 612  VAL A CB  1 
ATOM   3741 C CG1 . VAL A 1 612 ? 3.276   -14.930 54.911  1.00 45.06  ? 612  VAL A CG1 1 
ATOM   3742 C CG2 . VAL A 1 612 ? 5.641   -14.781 54.116  1.00 41.98  ? 612  VAL A CG2 1 
ATOM   3743 N N   . ALA A 1 613 ? 3.455   -16.779 57.774  1.00 48.01  ? 613  ALA A N   1 
ATOM   3744 C CA  . ALA A 1 613 ? 2.471   -17.569 58.506  1.00 48.37  ? 613  ALA A CA  1 
ATOM   3745 C C   . ALA A 1 613 ? 1.187   -17.967 57.779  1.00 51.76  ? 613  ALA A C   1 
ATOM   3746 O O   . ALA A 1 613 ? 0.754   -19.117 57.878  1.00 53.35  ? 613  ALA A O   1 
ATOM   3747 C CB  . ALA A 1 613 ? 2.118   -16.855 59.804  1.00 46.07  ? 613  ALA A CB  1 
ATOM   3748 N N   . PHE A 1 614 ? 0.572   -17.034 57.058  1.00 52.67  ? 614  PHE A N   1 
ATOM   3749 C CA  . PHE A 1 614 ? -0.681  -17.334 56.370  1.00 54.57  ? 614  PHE A CA  1 
ATOM   3750 C C   . PHE A 1 614 ? -0.802  -16.713 54.986  1.00 57.03  ? 614  PHE A C   1 
ATOM   3751 O O   . PHE A 1 614 ? -0.044  -15.811 54.621  1.00 58.86  ? 614  PHE A O   1 
ATOM   3752 C CB  . PHE A 1 614 ? -1.855  -16.871 57.236  1.00 55.42  ? 614  PHE A CB  1 
ATOM   3753 C CG  . PHE A 1 614 ? -1.799  -17.383 58.646  1.00 57.73  ? 614  PHE A CG  1 
ATOM   3754 C CD1 . PHE A 1 614 ? -2.097  -18.711 58.931  1.00 56.72  ? 614  PHE A CD1 1 
ATOM   3755 C CD2 . PHE A 1 614 ? -1.397  -16.548 59.686  1.00 57.85  ? 614  PHE A CD2 1 
ATOM   3756 C CE1 . PHE A 1 614 ? -1.991  -19.203 60.230  1.00 59.02  ? 614  PHE A CE1 1 
ATOM   3757 C CE2 . PHE A 1 614 ? -1.287  -17.029 60.989  1.00 58.83  ? 614  PHE A CE2 1 
ATOM   3758 C CZ  . PHE A 1 614 ? -1.585  -18.359 61.261  1.00 59.03  ? 614  PHE A CZ  1 
ATOM   3759 N N   . GLY A 1 615 ? -1.770  -17.205 54.220  1.00 57.19  ? 615  GLY A N   1 
ATOM   3760 C CA  . GLY A 1 615 ? -1.989  -16.693 52.883  1.00 57.84  ? 615  GLY A CA  1 
ATOM   3761 C C   . GLY A 1 615 ? -3.454  -16.700 52.496  1.00 58.07  ? 615  GLY A C   1 
ATOM   3762 O O   . GLY A 1 615 ? -4.213  -17.577 52.909  1.00 57.70  ? 615  GLY A O   1 
ATOM   3763 N N   . VAL A 1 616 ? -3.857  -15.706 51.713  1.00 58.45  ? 616  VAL A N   1 
ATOM   3764 C CA  . VAL A 1 616 ? -5.234  -15.610 51.253  1.00 59.53  ? 616  VAL A CA  1 
ATOM   3765 C C   . VAL A 1 616 ? -5.246  -15.602 49.729  1.00 61.71  ? 616  VAL A C   1 
ATOM   3766 O O   . VAL A 1 616 ? -4.696  -14.699 49.097  1.00 62.12  ? 616  VAL A O   1 
ATOM   3767 C CB  . VAL A 1 616 ? -5.923  -14.327 51.764  1.00 57.43  ? 616  VAL A CB  1 
ATOM   3768 C CG1 . VAL A 1 616 ? -7.314  -14.210 51.158  1.00 57.44  ? 616  VAL A CG1 1 
ATOM   3769 C CG2 . VAL A 1 616 ? -6.018  -14.356 53.277  1.00 56.62  ? 616  VAL A CG2 1 
ATOM   3770 N N   . THR A 1 617 ? -5.866  -16.623 49.147  1.00 63.91  ? 617  THR A N   1 
ATOM   3771 C CA  . THR A 1 617 ? -5.957  -16.738 47.699  1.00 65.66  ? 617  THR A CA  1 
ATOM   3772 C C   . THR A 1 617 ? -7.235  -16.073 47.210  1.00 65.92  ? 617  THR A C   1 
ATOM   3773 O O   . THR A 1 617 ? -8.325  -16.355 47.711  1.00 66.19  ? 617  THR A O   1 
ATOM   3774 C CB  . THR A 1 617 ? -5.975  -18.216 47.248  1.00 66.75  ? 617  THR A CB  1 
ATOM   3775 O OG1 . THR A 1 617 ? -4.760  -18.859 47.653  1.00 68.75  ? 617  THR A OG1 1 
ATOM   3776 C CG2 . THR A 1 617 ? -6.110  -18.310 45.737  1.00 66.49  ? 617  THR A CG2 1 
ATOM   3777 N N   . ILE A 1 618 ? -7.098  -15.178 46.241  1.00 66.55  ? 618  ILE A N   1 
ATOM   3778 C CA  . ILE A 1 618 ? -8.254  -14.498 45.680  1.00 67.01  ? 618  ILE A CA  1 
ATOM   3779 C C   . ILE A 1 618 ? -8.380  -14.908 44.221  1.00 69.31  ? 618  ILE A C   1 
ATOM   3780 O O   . ILE A 1 618 ? -7.668  -14.393 43.359  1.00 69.47  ? 618  ILE A O   1 
ATOM   3781 C CB  . ILE A 1 618 ? -8.114  -12.963 45.775  1.00 64.92  ? 618  ILE A CB  1 
ATOM   3782 C CG1 . ILE A 1 618 ? -8.041  -12.539 47.245  1.00 63.23  ? 618  ILE A CG1 1 
ATOM   3783 C CG2 . ILE A 1 618 ? -9.298  -12.288 45.094  1.00 62.70  ? 618  ILE A CG2 1 
ATOM   3784 C CD1 . ILE A 1 618 ? -7.829  -11.051 47.452  1.00 60.31  ? 618  ILE A CD1 1 
ATOM   3785 N N   . ASP A 1 619 ? -9.277  -15.852 43.956  1.00 72.06  ? 619  ASP A N   1 
ATOM   3786 C CA  . ASP A 1 619 ? -9.502  -16.338 42.601  1.00 74.56  ? 619  ASP A CA  1 
ATOM   3787 C C   . ASP A 1 619 ? -10.763 -15.737 41.988  1.00 76.22  ? 619  ASP A C   1 
ATOM   3788 O O   . ASP A 1 619 ? -11.352 -14.804 42.537  1.00 75.98  ? 619  ASP A O   1 
ATOM   3789 C CB  . ASP A 1 619 ? -9.594  -17.867 42.591  1.00 74.55  ? 619  ASP A CB  1 
ATOM   3790 C CG  . ASP A 1 619 ? -10.558 -18.403 43.631  1.00 74.97  ? 619  ASP A CG  1 
ATOM   3791 O OD1 . ASP A 1 619 ? -11.707 -17.914 43.692  1.00 75.37  ? 619  ASP A OD1 1 
ATOM   3792 O OD2 . ASP A 1 619 ? -10.168 -19.320 44.383  1.00 73.89  ? 619  ASP A OD2 1 
ATOM   3793 N N   . PHE A 1 620 ? -11.178 -16.284 40.850  1.00 78.49  ? 620  PHE A N   1 
ATOM   3794 C CA  . PHE A 1 620 ? -12.355 -15.789 40.150  1.00 80.48  ? 620  PHE A CA  1 
ATOM   3795 C C   . PHE A 1 620 ? -13.664 -16.048 40.891  1.00 80.91  ? 620  PHE A C   1 
ATOM   3796 O O   . PHE A 1 620 ? -14.601 -15.255 40.791  1.00 81.23  ? 620  PHE A O   1 
ATOM   3797 C CB  . PHE A 1 620 ? -12.405 -16.387 38.741  1.00 81.93  ? 620  PHE A CB  1 
ATOM   3798 C CG  . PHE A 1 620 ? -11.141 -16.168 37.950  1.00 83.92  ? 620  PHE A CG  1 
ATOM   3799 C CD1 . PHE A 1 620 ? -10.019 -16.962 38.173  1.00 84.19  ? 620  PHE A CD1 1 
ATOM   3800 C CD2 . PHE A 1 620 ? -11.058 -15.143 37.011  1.00 84.38  ? 620  PHE A CD2 1 
ATOM   3801 C CE1 . PHE A 1 620 ? -8.832  -16.738 37.474  1.00 84.56  ? 620  PHE A CE1 1 
ATOM   3802 C CE2 . PHE A 1 620 ? -9.874  -14.910 36.306  1.00 83.97  ? 620  PHE A CE2 1 
ATOM   3803 C CZ  . PHE A 1 620 ? -8.761  -15.709 36.539  1.00 84.11  ? 620  PHE A CZ  1 
ATOM   3804 N N   . ASP A 1 621 ? -13.733 -17.148 41.636  1.00 81.21  ? 621  ASP A N   1 
ATOM   3805 C CA  . ASP A 1 621 ? -14.939 -17.466 42.397  1.00 82.82  ? 621  ASP A CA  1 
ATOM   3806 C C   . ASP A 1 621 ? -15.097 -16.458 43.529  1.00 82.72  ? 621  ASP A C   1 
ATOM   3807 O O   . ASP A 1 621 ? -16.107 -16.444 44.234  1.00 82.09  ? 621  ASP A O   1 
ATOM   3808 C CB  . ASP A 1 621 ? -14.860 -18.877 42.986  1.00 85.10  ? 621  ASP A CB  1 
ATOM   3809 C CG  . ASP A 1 621 ? -14.863 -19.955 41.922  1.00 87.21  ? 621  ASP A CG  1 
ATOM   3810 O OD1 . ASP A 1 621 ? -13.909 -20.001 41.118  1.00 89.90  ? 621  ASP A OD1 1 
ATOM   3811 O OD2 . ASP A 1 621 ? -15.823 -20.755 41.892  1.00 87.05  ? 621  ASP A OD2 1 
ATOM   3812 N N   . THR A 1 622 ? -14.078 -15.624 43.702  1.00 82.63  ? 622  THR A N   1 
ATOM   3813 C CA  . THR A 1 622 ? -14.087 -14.601 44.736  1.00 83.41  ? 622  THR A CA  1 
ATOM   3814 C C   . THR A 1 622 ? -14.670 -13.328 44.140  1.00 84.13  ? 622  THR A C   1 
ATOM   3815 O O   . THR A 1 622 ? -15.398 -12.588 44.803  1.00 84.22  ? 622  THR A O   1 
ATOM   3816 C CB  . THR A 1 622 ? -12.657 -14.294 45.232  1.00 82.77  ? 622  THR A CB  1 
ATOM   3817 O OG1 . THR A 1 622 ? -12.022 -15.505 45.660  1.00 82.42  ? 622  THR A OG1 1 
ATOM   3818 C CG2 . THR A 1 622 ? -12.698 -13.312 46.391  1.00 81.71  ? 622  THR A CG2 1 
ATOM   3819 N N   . VAL A 1 623 ? -14.347 -13.092 42.873  1.00 84.92  ? 623  VAL A N   1 
ATOM   3820 C CA  . VAL A 1 623 ? -14.810 -11.909 42.161  1.00 85.75  ? 623  VAL A CA  1 
ATOM   3821 C C   . VAL A 1 623 ? -16.174 -12.096 41.502  1.00 86.14  ? 623  VAL A C   1 
ATOM   3822 O O   . VAL A 1 623 ? -17.024 -11.209 41.568  1.00 86.20  ? 623  VAL A O   1 
ATOM   3823 C CB  . VAL A 1 623 ? -13.797 -11.498 41.069  1.00 85.37  ? 623  VAL A CB  1 
ATOM   3824 C CG1 . VAL A 1 623 ? -14.252 -10.216 40.387  1.00 85.54  ? 623  VAL A CG1 1 
ATOM   3825 C CG2 . VAL A 1 623 ? -12.421 -11.317 41.682  1.00 85.84  ? 623  VAL A CG2 1 
ATOM   3826 N N   . ASN A 1 624 ? -16.382 -13.249 40.873  1.00 86.22  ? 624  ASN A N   1 
ATOM   3827 C CA  . ASN A 1 624 ? -17.638 -13.523 40.182  1.00 86.77  ? 624  ASN A CA  1 
ATOM   3828 C C   . ASN A 1 624 ? -18.737 -14.143 41.043  1.00 86.80  ? 624  ASN A C   1 
ATOM   3829 O O   . ASN A 1 624 ? -19.912 -13.811 40.883  1.00 87.37  ? 624  ASN A O   1 
ATOM   3830 C CB  . ASN A 1 624 ? -17.376 -14.408 38.961  1.00 87.08  ? 624  ASN A CB  1 
ATOM   3831 C CG  . ASN A 1 624 ? -16.460 -13.745 37.945  1.00 87.31  ? 624  ASN A CG  1 
ATOM   3832 O OD1 . ASN A 1 624 ? -16.758 -12.664 37.432  1.00 85.88  ? 624  ASN A OD1 1 
ATOM   3833 N ND2 . ASN A 1 624 ? -15.338 -14.391 37.651  1.00 87.12  ? 624  ASN A ND2 1 
ATOM   3834 N N   . LYS A 1 625 ? -18.367 -15.044 41.948  1.00 86.33  ? 625  LYS A N   1 
ATOM   3835 C CA  . LYS A 1 625 ? -19.355 -15.683 42.815  1.00 85.82  ? 625  LYS A CA  1 
ATOM   3836 C C   . LYS A 1 625 ? -19.804 -14.753 43.937  1.00 85.32  ? 625  LYS A C   1 
ATOM   3837 O O   . LYS A 1 625 ? -19.192 -13.713 44.180  1.00 85.12  ? 625  LYS A O   1 
ATOM   3838 C CB  . LYS A 1 625 ? -18.786 -16.969 43.424  1.00 87.93  ? 625  LYS A CB  1 
ATOM   3839 C CG  . LYS A 1 625 ? -19.330 -18.259 42.824  1.00 88.74  ? 625  LYS A CG  1 
ATOM   3840 C CD  . LYS A 1 625 ? -18.903 -18.439 41.377  1.00 90.37  ? 625  LYS A CD  1 
ATOM   3841 C CE  . LYS A 1 625 ? -19.481 -19.719 40.794  1.00 90.73  ? 625  LYS A CE  1 
ATOM   3842 N NZ  . LYS A 1 625 ? -19.064 -20.923 41.566  1.00 91.94  ? 625  LYS A NZ  1 
ATOM   3843 N N   . THR A 1 626 ? -20.880 -15.138 44.615  1.00 84.45  ? 626  THR A N   1 
ATOM   3844 C CA  . THR A 1 626 ? -21.420 -14.358 45.723  1.00 83.06  ? 626  THR A CA  1 
ATOM   3845 C C   . THR A 1 626 ? -22.225 -15.258 46.661  1.00 82.72  ? 626  THR A C   1 
ATOM   3846 O O   . THR A 1 626 ? -23.057 -16.047 46.211  1.00 83.75  ? 626  THR A O   1 
ATOM   3847 C CB  . THR A 1 626 ? -22.333 -13.224 45.220  1.00 82.96  ? 626  THR A CB  1 
ATOM   3848 O OG1 . THR A 1 626 ? -22.843 -12.491 46.341  1.00 81.40  ? 626  THR A OG1 1 
ATOM   3849 C CG2 . THR A 1 626 ? -23.496 -13.790 44.415  1.00 83.01  ? 626  THR A CG2 1 
ATOM   3850 N N   . PRO A 1 627 ? -21.986 -15.154 47.981  1.00 81.51  ? 627  PRO A N   1 
ATOM   3851 C CA  . PRO A 1 627 ? -21.024 -14.261 48.639  1.00 79.54  ? 627  PRO A CA  1 
ATOM   3852 C C   . PRO A 1 627 ? -19.597 -14.426 48.123  1.00 78.39  ? 627  PRO A C   1 
ATOM   3853 O O   . PRO A 1 627 ? -19.203 -15.502 47.671  1.00 77.90  ? 627  PRO A O   1 
ATOM   3854 C CB  . PRO A 1 627 ? -21.151 -14.646 50.110  1.00 79.32  ? 627  PRO A CB  1 
ATOM   3855 C CG  . PRO A 1 627 ? -22.580 -15.059 50.221  1.00 79.48  ? 627  PRO A CG  1 
ATOM   3856 C CD  . PRO A 1 627 ? -22.752 -15.910 48.988  1.00 80.14  ? 627  PRO A CD  1 
ATOM   3857 N N   . HIS A 1 628 ? -18.830 -13.345 48.194  1.00 77.20  ? 628  HIS A N   1 
ATOM   3858 C CA  . HIS A 1 628 ? -17.447 -13.346 47.741  1.00 76.08  ? 628  HIS A CA  1 
ATOM   3859 C C   . HIS A 1 628 ? -16.560 -14.006 48.793  1.00 75.07  ? 628  HIS A C   1 
ATOM   3860 O O   . HIS A 1 628 ? -16.314 -13.437 49.859  1.00 75.76  ? 628  HIS A O   1 
ATOM   3861 C CB  . HIS A 1 628 ? -16.997 -11.907 47.497  1.00 76.54  ? 628  HIS A CB  1 
ATOM   3862 C CG  . HIS A 1 628 ? -17.915 -11.140 46.597  1.00 77.50  ? 628  HIS A CG  1 
ATOM   3863 N ND1 . HIS A 1 628 ? -17.942 -11.320 45.231  1.00 77.14  ? 628  HIS A ND1 1 
ATOM   3864 C CD2 . HIS A 1 628 ? -18.863 -10.213 46.873  1.00 77.90  ? 628  HIS A CD2 1 
ATOM   3865 C CE1 . HIS A 1 628 ? -18.866 -10.536 44.704  1.00 77.58  ? 628  HIS A CE1 1 
ATOM   3866 N NE2 . HIS A 1 628 ? -19.439 -9.854  45.679  1.00 78.04  ? 628  HIS A NE2 1 
ATOM   3867 N N   . THR A 1 629 ? -16.084 -15.211 48.491  1.00 72.87  ? 629  THR A N   1 
ATOM   3868 C CA  . THR A 1 629 ? -15.235 -15.950 49.418  1.00 70.00  ? 629  THR A CA  1 
ATOM   3869 C C   . THR A 1 629 ? -13.814 -16.110 48.889  1.00 68.69  ? 629  THR A C   1 
ATOM   3870 O O   . THR A 1 629 ? -13.591 -16.135 47.678  1.00 69.19  ? 629  THR A O   1 
ATOM   3871 C CB  . THR A 1 629 ? -15.806 -17.355 49.700  1.00 69.53  ? 629  THR A CB  1 
ATOM   3872 O OG1 . THR A 1 629 ? -15.851 -18.108 48.481  1.00 69.72  ? 629  THR A OG1 1 
ATOM   3873 C CG2 . THR A 1 629 ? -17.209 -17.253 50.280  1.00 67.79  ? 629  THR A CG2 1 
ATOM   3874 N N   . ALA A 1 630 ? -12.860 -16.220 49.807  1.00 65.95  ? 630  ALA A N   1 
ATOM   3875 C CA  . ALA A 1 630 ? -11.458 -16.386 49.449  1.00 63.58  ? 630  ALA A CA  1 
ATOM   3876 C C   . ALA A 1 630 ? -10.894 -17.604 50.172  1.00 63.14  ? 630  ALA A C   1 
ATOM   3877 O O   . ALA A 1 630 ? -11.532 -18.149 51.073  1.00 63.20  ? 630  ALA A O   1 
ATOM   3878 C CB  . ALA A 1 630 ? -10.672 -15.141 49.827  1.00 63.11  ? 630  ALA A CB  1 
ATOM   3879 N N   . THR A 1 631 ? -9.698  -18.027 49.776  1.00 61.25  ? 631  THR A N   1 
ATOM   3880 C CA  . THR A 1 631 ? -9.065  -19.186 50.392  1.00 60.61  ? 631  THR A CA  1 
ATOM   3881 C C   . THR A 1 631 ? -7.993  -18.788 51.398  1.00 60.97  ? 631  THR A C   1 
ATOM   3882 O O   . THR A 1 631 ? -7.122  -17.968 51.104  1.00 61.84  ? 631  THR A O   1 
ATOM   3883 C CB  . THR A 1 631 ? -8.411  -20.098 49.334  1.00 60.37  ? 631  THR A CB  1 
ATOM   3884 O OG1 . THR A 1 631 ? -9.393  -20.499 48.372  1.00 60.35  ? 631  THR A OG1 1 
ATOM   3885 C CG2 . THR A 1 631 ? -7.825  -21.340 49.993  1.00 59.45  ? 631  THR A CG2 1 
ATOM   3886 N N   . LEU A 1 632 ? -8.070  -19.374 52.590  1.00 59.25  ? 632  LEU A N   1 
ATOM   3887 C CA  . LEU A 1 632 ? -7.101  -19.119 53.649  1.00 57.55  ? 632  LEU A CA  1 
ATOM   3888 C C   . LEU A 1 632 ? -6.188  -20.337 53.685  1.00 57.87  ? 632  LEU A C   1 
ATOM   3889 O O   . LEU A 1 632 ? -6.665  -21.471 53.648  1.00 58.60  ? 632  LEU A O   1 
ATOM   3890 C CB  . LEU A 1 632 ? -7.816  -18.950 54.991  1.00 55.41  ? 632  LEU A CB  1 
ATOM   3891 C CG  . LEU A 1 632 ? -6.955  -18.651 56.218  1.00 54.59  ? 632  LEU A CG  1 
ATOM   3892 C CD1 . LEU A 1 632 ? -6.132  -17.393 55.991  1.00 56.64  ? 632  LEU A CD1 1 
ATOM   3893 C CD2 . LEU A 1 632 ? -7.857  -18.488 57.429  1.00 54.19  ? 632  LEU A CD2 1 
ATOM   3894 N N   . ARG A 1 633 ? -4.880  -20.111 53.754  1.00 58.23  ? 633  ARG A N   1 
ATOM   3895 C CA  . ARG A 1 633 ? -3.922  -21.214 53.755  1.00 58.13  ? 633  ARG A CA  1 
ATOM   3896 C C   . ARG A 1 633 ? -2.941  -21.194 54.925  1.00 58.48  ? 633  ARG A C   1 
ATOM   3897 O O   . ARG A 1 633 ? -2.303  -20.179 55.198  1.00 59.47  ? 633  ARG A O   1 
ATOM   3898 C CB  . ARG A 1 633 ? -3.157  -21.207 52.426  1.00 55.72  ? 633  ARG A CB  1 
ATOM   3899 C CG  . ARG A 1 633 ? -2.044  -22.238 52.291  1.00 56.28  ? 633  ARG A CG  1 
ATOM   3900 C CD  . ARG A 1 633 ? -1.487  -22.208 50.869  1.00 56.28  ? 633  ARG A CD  1 
ATOM   3901 N NE  . ARG A 1 633 ? -0.355  -23.110 50.664  1.00 55.76  ? 633  ARG A NE  1 
ATOM   3902 C CZ  . ARG A 1 633 ? 0.842   -22.951 51.219  1.00 57.36  ? 633  ARG A CZ  1 
ATOM   3903 N NH1 . ARG A 1 633 ? 1.077   -21.921 52.024  1.00 58.40  ? 633  ARG A NH1 1 
ATOM   3904 N NH2 . ARG A 1 633 ? 1.812   -23.818 50.963  1.00 55.91  ? 633  ARG A NH2 1 
ATOM   3905 N N   . ASP A 1 634 ? -2.833  -22.326 55.616  1.00 59.34  ? 634  ASP A N   1 
ATOM   3906 C CA  . ASP A 1 634 ? -1.913  -22.455 56.741  1.00 58.53  ? 634  ASP A CA  1 
ATOM   3907 C C   . ASP A 1 634 ? -0.558  -22.840 56.167  1.00 58.30  ? 634  ASP A C   1 
ATOM   3908 O O   . ASP A 1 634 ? -0.450  -23.804 55.411  1.00 60.21  ? 634  ASP A O   1 
ATOM   3909 C CB  . ASP A 1 634 ? -2.390  -23.540 57.710  1.00 58.59  ? 634  ASP A CB  1 
ATOM   3910 C CG  . ASP A 1 634 ? -1.470  -23.698 58.912  1.00 59.41  ? 634  ASP A CG  1 
ATOM   3911 O OD1 . ASP A 1 634 ? -0.964  -24.818 59.135  1.00 59.81  ? 634  ASP A OD1 1 
ATOM   3912 O OD2 . ASP A 1 634 ? -1.254  -22.706 59.639  1.00 60.73  ? 634  ASP A OD2 1 
ATOM   3913 N N   . ARG A 1 635 ? 0.472   -22.084 56.524  1.00 57.44  ? 635  ARG A N   1 
ATOM   3914 C CA  . ARG A 1 635 ? 1.819   -22.342 56.026  1.00 56.95  ? 635  ARG A CA  1 
ATOM   3915 C C   . ARG A 1 635 ? 2.334   -23.747 56.336  1.00 57.42  ? 635  ARG A C   1 
ATOM   3916 O O   . ARG A 1 635 ? 2.694   -24.497 55.426  1.00 57.75  ? 635  ARG A O   1 
ATOM   3917 C CB  . ARG A 1 635 ? 2.788   -21.309 56.603  1.00 54.27  ? 635  ARG A CB  1 
ATOM   3918 C CG  . ARG A 1 635 ? 4.246   -21.542 56.258  1.00 50.66  ? 635  ARG A CG  1 
ATOM   3919 C CD  . ARG A 1 635 ? 5.124   -20.833 57.271  1.00 49.97  ? 635  ARG A CD  1 
ATOM   3920 N NE  . ARG A 1 635 ? 4.852   -21.321 58.621  1.00 47.69  ? 635  ARG A NE  1 
ATOM   3921 C CZ  . ARG A 1 635 ? 4.989   -20.596 59.725  1.00 48.75  ? 635  ARG A CZ  1 
ATOM   3922 N NH1 . ARG A 1 635 ? 5.399   -19.335 59.651  1.00 46.54  ? 635  ARG A NH1 1 
ATOM   3923 N NH2 . ARG A 1 635 ? 4.711   -21.130 60.907  1.00 47.63  ? 635  ARG A NH2 1 
ATOM   3924 N N   . ASP A 1 636 ? 2.368   -24.099 57.618  1.00 57.46  ? 636  ASP A N   1 
ATOM   3925 C CA  . ASP A 1 636 ? 2.872   -25.403 58.038  1.00 58.83  ? 636  ASP A CA  1 
ATOM   3926 C C   . ASP A 1 636 ? 2.163   -26.612 57.429  1.00 60.29  ? 636  ASP A C   1 
ATOM   3927 O O   . ASP A 1 636 ? 2.810   -27.488 56.850  1.00 59.55  ? 636  ASP A O   1 
ATOM   3928 C CB  . ASP A 1 636 ? 2.832   -25.519 59.565  1.00 59.71  ? 636  ASP A CB  1 
ATOM   3929 C CG  . ASP A 1 636 ? 3.657   -24.449 60.254  1.00 59.45  ? 636  ASP A CG  1 
ATOM   3930 O OD1 . ASP A 1 636 ? 4.793   -24.188 59.803  1.00 58.66  ? 636  ASP A OD1 1 
ATOM   3931 O OD2 . ASP A 1 636 ? 3.173   -23.878 61.253  1.00 61.37  ? 636  ASP A OD2 1 
ATOM   3932 N N   . SER A 1 637 ? 0.840   -26.658 57.557  1.00 60.74  ? 637  SER A N   1 
ATOM   3933 C CA  . SER A 1 637 ? 0.056   -27.779 57.044  1.00 61.81  ? 637  SER A CA  1 
ATOM   3934 C C   . SER A 1 637 ? -0.286  -27.680 55.561  1.00 64.61  ? 637  SER A C   1 
ATOM   3935 O O   . SER A 1 637 ? -0.549  -28.691 54.913  1.00 65.09  ? 637  SER A O   1 
ATOM   3936 C CB  . SER A 1 637 ? -1.243  -27.907 57.836  1.00 60.30  ? 637  SER A CB  1 
ATOM   3937 O OG  . SER A 1 637 ? -2.093  -26.802 57.581  1.00 57.72  ? 637  SER A OG  1 
ATOM   3938 N N   . MET A 1 638 ? -0.290  -26.461 55.033  1.00 67.00  ? 638  MET A N   1 
ATOM   3939 C CA  . MET A 1 638 ? -0.623  -26.224 53.630  1.00 67.99  ? 638  MET A CA  1 
ATOM   3940 C C   . MET A 1 638 ? -2.108  -26.474 53.389  1.00 67.71  ? 638  MET A C   1 
ATOM   3941 O O   . MET A 1 638 ? -2.587  -26.367 52.261  1.00 68.43  ? 638  MET A O   1 
ATOM   3942 C CB  . MET A 1 638 ? 0.208   -27.125 52.709  1.00 67.62  ? 638  MET A CB  1 
ATOM   3943 C CG  . MET A 1 638 ? 1.700   -26.850 52.752  1.00 69.01  ? 638  MET A CG  1 
ATOM   3944 S SD  . MET A 1 638 ? 2.633   -27.875 51.597  1.00 72.74  ? 638  MET A SD  1 
ATOM   3945 C CE  . MET A 1 638 ? 2.809   -26.756 50.209  1.00 70.03  ? 638  MET A CE  1 
ATOM   3946 N N   . ARG A 1 639 ? -2.830  -26.810 54.452  1.00 67.66  ? 639  ARG A N   1 
ATOM   3947 C CA  . ARG A 1 639 ? -4.262  -27.060 54.350  1.00 69.89  ? 639  ARG A CA  1 
ATOM   3948 C C   . ARG A 1 639 ? -4.952  -25.718 54.137  1.00 70.70  ? 639  ARG A C   1 
ATOM   3949 O O   . ARG A 1 639 ? -4.449  -24.684 54.579  1.00 71.51  ? 639  ARG A O   1 
ATOM   3950 C CB  . ARG A 1 639 ? -4.773  -27.728 55.631  1.00 71.38  ? 639  ARG A CB  1 
ATOM   3951 C CG  . ARG A 1 639 ? -4.035  -29.013 55.982  1.00 74.58  ? 639  ARG A CG  1 
ATOM   3952 C CD  . ARG A 1 639 ? -4.472  -29.568 57.328  1.00 76.99  ? 639  ARG A CD  1 
ATOM   3953 N NE  . ARG A 1 639 ? -5.827  -30.107 57.294  1.00 82.13  ? 639  ARG A NE  1 
ATOM   3954 C CZ  . ARG A 1 639 ? -6.449  -30.627 58.348  1.00 84.37  ? 639  ARG A CZ  1 
ATOM   3955 N NH1 . ARG A 1 639 ? -5.837  -30.677 59.524  1.00 85.82  ? 639  ARG A NH1 1 
ATOM   3956 N NH2 . ARG A 1 639 ? -7.681  -31.103 58.226  1.00 85.00  ? 639  ARG A NH2 1 
ATOM   3957 N N   . GLN A 1 640 ? -6.096  -25.727 53.461  1.00 71.03  ? 640  GLN A N   1 
ATOM   3958 C CA  . GLN A 1 640 ? -6.808  -24.484 53.193  1.00 70.26  ? 640  GLN A CA  1 
ATOM   3959 C C   . GLN A 1 640 ? -8.234  -24.431 53.729  1.00 69.47  ? 640  GLN A C   1 
ATOM   3960 O O   . GLN A 1 640 ? -8.795  -25.435 54.165  1.00 70.50  ? 640  GLN A O   1 
ATOM   3961 C CB  . GLN A 1 640 ? -6.803  -24.202 51.688  1.00 70.04  ? 640  GLN A CB  1 
ATOM   3962 C CG  . GLN A 1 640 ? -5.403  -24.059 51.108  1.00 71.86  ? 640  GLN A CG  1 
ATOM   3963 C CD  . GLN A 1 640 ? -5.409  -23.773 49.621  1.00 73.89  ? 640  GLN A CD  1 
ATOM   3964 O OE1 . GLN A 1 640 ? -5.972  -24.533 48.834  1.00 76.90  ? 640  GLN A OE1 1 
ATOM   3965 N NE2 . GLN A 1 640 ? -4.777  -22.673 49.226  1.00 75.30  ? 640  GLN A NE2 1 
ATOM   3966 N N   . ILE A 1 641 ? -8.806  -23.233 53.685  1.00 68.96  ? 641  ILE A N   1 
ATOM   3967 C CA  . ILE A 1 641 ? -10.155 -22.972 54.166  1.00 67.47  ? 641  ILE A CA  1 
ATOM   3968 C C   . ILE A 1 641 ? -10.827 -21.981 53.217  1.00 67.52  ? 641  ILE A C   1 
ATOM   3969 O O   . ILE A 1 641 ? -10.147 -21.241 52.506  1.00 67.82  ? 641  ILE A O   1 
ATOM   3970 C CB  . ILE A 1 641 ? -10.103 -22.380 55.605  1.00 67.86  ? 641  ILE A CB  1 
ATOM   3971 C CG1 . ILE A 1 641 ? -10.500 -23.451 56.617  1.00 68.66  ? 641  ILE A CG1 1 
ATOM   3972 C CG2 . ILE A 1 641 ? -10.990 -21.144 55.723  1.00 65.57  ? 641  ILE A CG2 1 
ATOM   3973 C CD1 . ILE A 1 641 ? -11.930 -23.910 56.486  1.00 73.49  ? 641  ILE A CD1 1 
ATOM   3974 N N   . ARG A 1 642 ? -12.156 -21.970 53.203  1.00 65.98  ? 642  ARG A N   1 
ATOM   3975 C CA  . ARG A 1 642 ? -12.894 -21.054 52.340  1.00 64.90  ? 642  ARG A CA  1 
ATOM   3976 C C   . ARG A 1 642 ? -13.899 -20.264 53.168  1.00 64.79  ? 642  ARG A C   1 
ATOM   3977 O O   . ARG A 1 642 ? -14.790 -20.838 53.792  1.00 65.84  ? 642  ARG A O   1 
ATOM   3978 C CB  . ARG A 1 642 ? -13.631 -21.827 51.246  1.00 63.73  ? 642  ARG A CB  1 
ATOM   3979 C CG  . ARG A 1 642 ? -14.153 -20.951 50.117  1.00 62.97  ? 642  ARG A CG  1 
ATOM   3980 C CD  . ARG A 1 642 ? -13.020 -20.473 49.221  1.00 62.10  ? 642  ARG A CD  1 
ATOM   3981 N NE  . ARG A 1 642 ? -13.499 -19.649 48.114  1.00 61.32  ? 642  ARG A NE  1 
ATOM   3982 C CZ  . ARG A 1 642 ? -12.754 -19.292 47.071  1.00 60.42  ? 642  ARG A CZ  1 
ATOM   3983 N NH1 . ARG A 1 642 ? -11.491 -19.687 46.989  1.00 56.28  ? 642  ARG A NH1 1 
ATOM   3984 N NH2 . ARG A 1 642 ? -13.270 -18.541 46.108  1.00 60.20  ? 642  ARG A NH2 1 
ATOM   3985 N N   . ALA A 1 643 ? -13.755 -18.944 53.171  1.00 64.73  ? 643  ALA A N   1 
ATOM   3986 C CA  . ALA A 1 643 ? -14.655 -18.087 53.931  1.00 65.93  ? 643  ALA A CA  1 
ATOM   3987 C C   . ALA A 1 643 ? -14.838 -16.752 53.224  1.00 66.16  ? 643  ALA A C   1 
ATOM   3988 O O   . ALA A 1 643 ? -14.038 -16.388 52.361  1.00 64.89  ? 643  ALA A O   1 
ATOM   3989 C CB  . ALA A 1 643 ? -14.101 -17.867 55.331  1.00 65.77  ? 643  ALA A CB  1 
ATOM   3990 N N   . GLU A 1 644 ? -15.889 -16.023 53.591  1.00 67.42  ? 644  GLU A N   1 
ATOM   3991 C CA  . GLU A 1 644 ? -16.149 -14.729 52.973  1.00 69.97  ? 644  GLU A CA  1 
ATOM   3992 C C   . GLU A 1 644 ? -14.946 -13.822 53.199  1.00 68.50  ? 644  GLU A C   1 
ATOM   3993 O O   . GLU A 1 644 ? -14.456 -13.691 54.321  1.00 68.78  ? 644  GLU A O   1 
ATOM   3994 C CB  . GLU A 1 644 ? -17.398 -14.078 53.563  1.00 74.27  ? 644  GLU A CB  1 
ATOM   3995 C CG  . GLU A 1 644 ? -18.007 -13.043 52.632  1.00 80.69  ? 644  GLU A CG  1 
ATOM   3996 C CD  . GLU A 1 644 ? -18.721 -11.930 53.367  1.00 84.47  ? 644  GLU A CD  1 
ATOM   3997 O OE1 . GLU A 1 644 ? -19.624 -12.226 54.182  1.00 85.27  ? 644  GLU A OE1 1 
ATOM   3998 O OE2 . GLU A 1 644 ? -18.376 -10.754 53.120  1.00 85.97  ? 644  GLU A OE2 1 
ATOM   3999 N N   . ILE A 1 645 ? -14.485 -13.191 52.125  1.00 66.29  ? 645  ILE A N   1 
ATOM   4000 C CA  . ILE A 1 645 ? -13.317 -12.319 52.168  1.00 63.77  ? 645  ILE A CA  1 
ATOM   4001 C C   . ILE A 1 645 ? -13.375 -11.158 53.166  1.00 64.12  ? 645  ILE A C   1 
ATOM   4002 O O   . ILE A 1 645 ? -12.352 -10.532 53.446  1.00 64.85  ? 645  ILE A O   1 
ATOM   4003 C CB  . ILE A 1 645 ? -13.014 -11.762 50.756  1.00 61.29  ? 645  ILE A CB  1 
ATOM   4004 C CG1 . ILE A 1 645 ? -11.590 -11.208 50.705  1.00 58.50  ? 645  ILE A CG1 1 
ATOM   4005 C CG2 . ILE A 1 645 ? -14.024 -10.685 50.392  1.00 59.24  ? 645  ILE A CG2 1 
ATOM   4006 C CD1 . ILE A 1 645 ? -11.096 -10.928 49.305  1.00 57.07  ? 645  ILE A CD1 1 
ATOM   4007 N N   . SER A 1 646 ? -14.552 -10.869 53.711  1.00 64.39  ? 646  SER A N   1 
ATOM   4008 C CA  . SER A 1 646 ? -14.674 -9.770  54.666  1.00 65.72  ? 646  SER A CA  1 
ATOM   4009 C C   . SER A 1 646 ? -14.438 -10.239 56.097  1.00 66.17  ? 646  SER A C   1 
ATOM   4010 O O   . SER A 1 646 ? -14.167 -9.431  56.984  1.00 66.81  ? 646  SER A O   1 
ATOM   4011 C CB  . SER A 1 646 ? -16.058 -9.122  54.574  1.00 65.63  ? 646  SER A CB  1 
ATOM   4012 O OG  . SER A 1 646 ? -17.050 -9.949  55.159  1.00 67.42  ? 646  SER A OG  1 
ATOM   4013 N N   . GLU A 1 647 ? -14.547 -11.546 56.316  1.00 67.53  ? 647  GLU A N   1 
ATOM   4014 C CA  . GLU A 1 647 ? -14.349 -12.122 57.642  1.00 69.18  ? 647  GLU A CA  1 
ATOM   4015 C C   . GLU A 1 647 ? -12.920 -12.599 57.877  1.00 67.70  ? 647  GLU A C   1 
ATOM   4016 O O   . GLU A 1 647 ? -12.465 -12.674 59.018  1.00 66.42  ? 647  GLU A O   1 
ATOM   4017 C CB  . GLU A 1 647 ? -15.322 -13.285 57.859  1.00 72.48  ? 647  GLU A CB  1 
ATOM   4018 C CG  . GLU A 1 647 ? -16.676 -12.865 58.412  1.00 78.85  ? 647  GLU A CG  1 
ATOM   4019 C CD  . GLU A 1 647 ? -17.668 -14.015 58.465  1.00 84.02  ? 647  GLU A CD  1 
ATOM   4020 O OE1 . GLU A 1 647 ? -17.282 -15.123 58.901  1.00 85.26  ? 647  GLU A OE1 1 
ATOM   4021 O OE2 . GLU A 1 647 ? -18.839 -13.806 58.078  1.00 86.75  ? 647  GLU A OE2 1 
ATOM   4022 N N   . LEU A 1 648 ? -12.215 -12.916 56.794  1.00 65.26  ? 648  LEU A N   1 
ATOM   4023 C CA  . LEU A 1 648 ? -10.839 -13.389 56.885  1.00 63.08  ? 648  LEU A CA  1 
ATOM   4024 C C   . LEU A 1 648 ? -9.924  -12.491 57.717  1.00 62.27  ? 648  LEU A C   1 
ATOM   4025 O O   . LEU A 1 648 ? -9.113  -12.984 58.502  1.00 62.77  ? 648  LEU A O   1 
ATOM   4026 C CB  . LEU A 1 648 ? -10.249 -13.566 55.484  1.00 60.77  ? 648  LEU A CB  1 
ATOM   4027 C CG  . LEU A 1 648 ? -10.769 -14.770 54.695  1.00 60.24  ? 648  LEU A CG  1 
ATOM   4028 C CD1 . LEU A 1 648 ? -10.197 -14.754 53.287  1.00 59.63  ? 648  LEU A CD1 1 
ATOM   4029 C CD2 . LEU A 1 648 ? -10.381 -16.053 55.413  1.00 58.99  ? 648  LEU A CD2 1 
ATOM   4030 N N   . PRO A 1 649 ? -10.033 -11.162 57.554  1.00 61.68  ? 649  PRO A N   1 
ATOM   4031 C CA  . PRO A 1 649 ? -9.179  -10.255 58.327  1.00 61.53  ? 649  PRO A CA  1 
ATOM   4032 C C   . PRO A 1 649 ? -9.138  -10.562 59.824  1.00 61.24  ? 649  PRO A C   1 
ATOM   4033 O O   . PRO A 1 649 ? -8.060  -10.702 60.401  1.00 62.04  ? 649  PRO A O   1 
ATOM   4034 C CB  . PRO A 1 649 ? -9.779  -8.889  58.023  1.00 60.21  ? 649  PRO A CB  1 
ATOM   4035 C CG  . PRO A 1 649 ? -10.194 -9.044  56.598  1.00 60.75  ? 649  PRO A CG  1 
ATOM   4036 C CD  . PRO A 1 649 ? -10.869 -10.403 56.606  1.00 61.48  ? 649  PRO A CD  1 
ATOM   4037 N N   . SER A 1 650 ? -10.307 -10.675 60.449  1.00 60.35  ? 650  SER A N   1 
ATOM   4038 C CA  . SER A 1 650 ? -10.372 -10.959 61.878  1.00 60.37  ? 650  SER A CA  1 
ATOM   4039 C C   . SER A 1 650 ? -9.927  -12.387 62.184  1.00 59.49  ? 650  SER A C   1 
ATOM   4040 O O   . SER A 1 650 ? -9.401  -12.662 63.263  1.00 61.13  ? 650  SER A O   1 
ATOM   4041 C CB  . SER A 1 650 ? -11.791 -10.733 62.408  1.00 60.65  ? 650  SER A CB  1 
ATOM   4042 O OG  . SER A 1 650 ? -12.701 -11.660 61.846  1.00 65.92  ? 650  SER A OG  1 
ATOM   4043 N N   . ILE A 1 651 ? -10.140 -13.294 61.236  1.00 57.25  ? 651  ILE A N   1 
ATOM   4044 C CA  . ILE A 1 651 ? -9.743  -14.687 61.417  1.00 56.37  ? 651  ILE A CA  1 
ATOM   4045 C C   . ILE A 1 651 ? -8.221  -14.778 61.472  1.00 56.86  ? 651  ILE A C   1 
ATOM   4046 O O   . ILE A 1 651 ? -7.658  -15.407 62.369  1.00 58.09  ? 651  ILE A O   1 
ATOM   4047 C CB  . ILE A 1 651 ? -10.253 -15.572 60.261  1.00 56.30  ? 651  ILE A CB  1 
ATOM   4048 C CG1 . ILE A 1 651 ? -11.782 -15.604 60.272  1.00 55.60  ? 651  ILE A CG1 1 
ATOM   4049 C CG2 . ILE A 1 651 ? -9.687  -16.981 60.388  1.00 52.78  ? 651  ILE A CG2 1 
ATOM   4050 C CD1 . ILE A 1 651 ? -12.386 -16.307 59.080  1.00 57.52  ? 651  ILE A CD1 1 
ATOM   4051 N N   . VAL A 1 652 ? -7.559  -14.146 60.509  1.00 55.66  ? 652  VAL A N   1 
ATOM   4052 C CA  . VAL A 1 652 ? -6.105  -14.152 60.466  1.00 54.28  ? 652  VAL A CA  1 
ATOM   4053 C C   . VAL A 1 652 ? -5.557  -13.495 61.728  1.00 54.47  ? 652  VAL A C   1 
ATOM   4054 O O   . VAL A 1 652 ? -4.613  -13.996 62.339  1.00 53.56  ? 652  VAL A O   1 
ATOM   4055 C CB  . VAL A 1 652 ? -5.581  -13.394 59.234  1.00 53.35  ? 652  VAL A CB  1 
ATOM   4056 C CG1 . VAL A 1 652 ? -4.061  -13.349 59.257  1.00 53.13  ? 652  VAL A CG1 1 
ATOM   4057 C CG2 . VAL A 1 652 ? -6.072  -14.070 57.968  1.00 51.73  ? 652  VAL A CG2 1 
ATOM   4058 N N   . GLN A 1 653 ? -6.157  -12.373 62.116  1.00 53.96  ? 653  GLN A N   1 
ATOM   4059 C CA  . GLN A 1 653 ? -5.728  -11.660 63.311  1.00 55.45  ? 653  GLN A CA  1 
ATOM   4060 C C   . GLN A 1 653 ? -5.698  -12.595 64.516  1.00 56.18  ? 653  GLN A C   1 
ATOM   4061 O O   . GLN A 1 653 ? -4.700  -12.657 65.235  1.00 56.35  ? 653  GLN A O   1 
ATOM   4062 C CB  . GLN A 1 653 ? -6.665  -10.486 63.609  1.00 54.90  ? 653  GLN A CB  1 
ATOM   4063 C CG  . GLN A 1 653 ? -6.246  -9.677  64.828  1.00 56.59  ? 653  GLN A CG  1 
ATOM   4064 C CD  . GLN A 1 653 ? -7.236  -8.586  65.182  1.00 57.29  ? 653  GLN A CD  1 
ATOM   4065 O OE1 . GLN A 1 653 ? -8.390  -8.862  65.518  1.00 58.75  ? 653  GLN A OE1 1 
ATOM   4066 N NE2 . GLN A 1 653 ? -6.790  -7.335  65.110  1.00 56.09  ? 653  GLN A NE2 1 
ATOM   4067 N N   . ASP A 1 654 ? -6.789  -13.323 64.732  1.00 56.33  ? 654  ASP A N   1 
ATOM   4068 C CA  . ASP A 1 654 ? -6.867  -14.247 65.859  1.00 58.70  ? 654  ASP A CA  1 
ATOM   4069 C C   . ASP A 1 654 ? -5.909  -15.426 65.717  1.00 57.86  ? 654  ASP A C   1 
ATOM   4070 O O   . ASP A 1 654 ? -5.389  -15.933 66.709  1.00 58.22  ? 654  ASP A O   1 
ATOM   4071 C CB  . ASP A 1 654 ? -8.300  -14.754 66.036  1.00 60.91  ? 654  ASP A CB  1 
ATOM   4072 C CG  . ASP A 1 654 ? -9.255  -13.655 66.456  1.00 62.40  ? 654  ASP A CG  1 
ATOM   4073 O OD1 . ASP A 1 654 ? -8.937  -12.935 67.425  1.00 63.94  ? 654  ASP A OD1 1 
ATOM   4074 O OD2 . ASP A 1 654 ? -10.323 -13.512 65.825  1.00 64.98  ? 654  ASP A OD2 1 
ATOM   4075 N N   . LEU A 1 655 ? -5.678  -15.867 64.485  1.00 57.01  ? 655  LEU A N   1 
ATOM   4076 C CA  . LEU A 1 655 ? -4.760  -16.973 64.247  1.00 57.27  ? 655  LEU A CA  1 
ATOM   4077 C C   . LEU A 1 655 ? -3.338  -16.548 64.609  1.00 57.51  ? 655  LEU A C   1 
ATOM   4078 O O   . LEU A 1 655 ? -2.588  -17.306 65.221  1.00 57.52  ? 655  LEU A O   1 
ATOM   4079 C CB  . LEU A 1 655 ? -4.804  -17.397 62.776  1.00 56.50  ? 655  LEU A CB  1 
ATOM   4080 C CG  . LEU A 1 655 ? -5.971  -18.271 62.314  1.00 54.89  ? 655  LEU A CG  1 
ATOM   4081 C CD1 . LEU A 1 655 ? -5.973  -18.371 60.797  1.00 53.46  ? 655  LEU A CD1 1 
ATOM   4082 C CD2 . LEU A 1 655 ? -5.846  -19.648 62.940  1.00 53.78  ? 655  LEU A CD2 1 
ATOM   4083 N N   . ALA A 1 656 ? -2.981  -15.326 64.229  1.00 57.60  ? 656  ALA A N   1 
ATOM   4084 C CA  . ALA A 1 656 ? -1.650  -14.795 64.492  1.00 58.28  ? 656  ALA A CA  1 
ATOM   4085 C C   . ALA A 1 656 ? -1.451  -14.389 65.947  1.00 57.91  ? 656  ALA A C   1 
ATOM   4086 O O   . ALA A 1 656 ? -0.373  -14.582 66.508  1.00 57.35  ? 656  ALA A O   1 
ATOM   4087 C CB  . ALA A 1 656 ? -1.381  -13.605 63.581  1.00 57.57  ? 656  ALA A CB  1 
ATOM   4088 N N   . ASN A 1 657 ? -2.487  -13.820 66.553  1.00 58.03  ? 657  ASN A N   1 
ATOM   4089 C CA  . ASN A 1 657 ? -2.404  -13.389 67.943  1.00 60.44  ? 657  ASN A CA  1 
ATOM   4090 C C   . ASN A 1 657 ? -2.604  -14.551 68.909  1.00 61.05  ? 657  ASN A C   1 
ATOM   4091 O O   . ASN A 1 657 ? -2.668  -14.354 70.123  1.00 62.02  ? 657  ASN A O   1 
ATOM   4092 C CB  . ASN A 1 657 ? -3.437  -12.296 68.221  1.00 62.27  ? 657  ASN A CB  1 
ATOM   4093 C CG  . ASN A 1 657 ? -3.158  -11.021 67.443  1.00 65.47  ? 657  ASN A CG  1 
ATOM   4094 O OD1 . ASN A 1 657 ? -3.953  -10.082 67.466  1.00 67.30  ? 657  ASN A OD1 1 
ATOM   4095 N ND2 . ASN A 1 657 ? -2.021  -10.981 66.753  1.00 66.32  ? 657  ASN A ND2 1 
ATOM   4096 N N   . GLY A 1 658 ? -2.701  -15.758 68.360  1.00 61.54  ? 658  GLY A N   1 
ATOM   4097 C CA  . GLY A 1 658 ? -2.876  -16.942 69.181  1.00 62.53  ? 658  GLY A CA  1 
ATOM   4098 C C   . GLY A 1 658 ? -4.209  -17.041 69.898  1.00 63.67  ? 658  GLY A C   1 
ATOM   4099 O O   . GLY A 1 658 ? -4.325  -17.746 70.899  1.00 64.67  ? 658  GLY A O   1 
ATOM   4100 N N   . ASN A 1 659 ? -5.217  -16.338 69.392  1.00 64.71  ? 659  ASN A N   1 
ATOM   4101 C CA  . ASN A 1 659 ? -6.546  -16.366 69.994  1.00 66.07  ? 659  ASN A CA  1 
ATOM   4102 C C   . ASN A 1 659 ? -7.391  -17.500 69.415  1.00 67.86  ? 659  ASN A C   1 
ATOM   4103 O O   . ASN A 1 659 ? -8.442  -17.835 69.956  1.00 70.28  ? 659  ASN A O   1 
ATOM   4104 C CB  . ASN A 1 659 ? -7.260  -15.031 69.765  1.00 66.01  ? 659  ASN A CB  1 
ATOM   4105 C CG  . ASN A 1 659 ? -6.618  -13.884 70.526  1.00 67.36  ? 659  ASN A CG  1 
ATOM   4106 O OD1 . ASN A 1 659 ? -7.003  -12.726 70.365  1.00 66.10  ? 659  ASN A OD1 1 
ATOM   4107 N ND2 . ASN A 1 659 ? -5.638  -14.202 71.365  1.00 67.43  ? 659  ASN A ND2 1 
ATOM   4108 N N   . ILE A 1 660 ? -6.924  -18.087 68.317  1.00 68.09  ? 660  ILE A N   1 
ATOM   4109 C CA  . ILE A 1 660 ? -7.635  -19.176 67.653  1.00 67.85  ? 660  ILE A CA  1 
ATOM   4110 C C   . ILE A 1 660 ? -6.632  -20.176 67.074  1.00 67.87  ? 660  ILE A C   1 
ATOM   4111 O O   . ILE A 1 660 ? -5.528  -19.799 66.680  1.00 68.09  ? 660  ILE A O   1 
ATOM   4112 C CB  . ILE A 1 660 ? -8.548  -18.616 66.513  1.00 68.86  ? 660  ILE A CB  1 
ATOM   4113 C CG1 . ILE A 1 660 ? -10.019 -18.832 66.866  1.00 69.85  ? 660  ILE A CG1 1 
ATOM   4114 C CG2 . ILE A 1 660 ? -8.241  -19.289 65.185  1.00 69.65  ? 660  ILE A CG2 1 
ATOM   4115 C CD1 . ILE A 1 660 ? -10.496 -18.023 68.047  1.00 70.71  ? 660  ILE A CD1 1 
ATOM   4116 N N   . THR A 1 661 ? -7.015  -21.449 67.031  1.00 67.85  ? 661  THR A N   1 
ATOM   4117 C CA  . THR A 1 661 ? -6.145  -22.492 66.491  1.00 69.48  ? 661  THR A CA  1 
ATOM   4118 C C   . THR A 1 661 ? -6.545  -22.793 65.054  1.00 69.34  ? 661  THR A C   1 
ATOM   4119 O O   . THR A 1 661 ? -7.691  -22.573 64.667  1.00 69.18  ? 661  THR A O   1 
ATOM   4120 C CB  . THR A 1 661 ? -6.258  -23.803 67.300  1.00 70.18  ? 661  THR A CB  1 
ATOM   4121 O OG1 . THR A 1 661 ? -5.915  -23.553 68.667  1.00 72.59  ? 661  THR A OG1 1 
ATOM   4122 C CG2 . THR A 1 661 ? -5.320  -24.865 66.734  1.00 70.75  ? 661  THR A CG2 1 
ATOM   4123 N N   . TRP A 1 662 ? -5.604  -23.291 64.261  1.00 70.16  ? 662  TRP A N   1 
ATOM   4124 C CA  . TRP A 1 662 ? -5.921  -23.618 62.881  1.00 73.08  ? 662  TRP A CA  1 
ATOM   4125 C C   . TRP A 1 662 ? -6.997  -24.690 62.890  1.00 74.93  ? 662  TRP A C   1 
ATOM   4126 O O   . TRP A 1 662 ? -7.761  -24.830 61.935  1.00 76.49  ? 662  TRP A O   1 
ATOM   4127 C CB  . TRP A 1 662 ? -4.691  -24.132 62.136  1.00 72.45  ? 662  TRP A CB  1 
ATOM   4128 C CG  . TRP A 1 662 ? -4.998  -24.489 60.718  1.00 74.12  ? 662  TRP A CG  1 
ATOM   4129 C CD1 . TRP A 1 662 ? -5.016  -25.740 60.172  1.00 75.35  ? 662  TRP A CD1 1 
ATOM   4130 C CD2 . TRP A 1 662 ? -5.376  -23.587 59.671  1.00 74.08  ? 662  TRP A CD2 1 
ATOM   4131 N NE1 . TRP A 1 662 ? -5.383  -25.674 58.849  1.00 76.05  ? 662  TRP A NE1 1 
ATOM   4132 C CE2 . TRP A 1 662 ? -5.609  -24.364 58.515  1.00 74.74  ? 662  TRP A CE2 1 
ATOM   4133 C CE3 . TRP A 1 662 ? -5.540  -22.197 59.598  1.00 73.69  ? 662  TRP A CE3 1 
ATOM   4134 C CZ2 . TRP A 1 662 ? -6.000  -23.797 57.295  1.00 73.69  ? 662  TRP A CZ2 1 
ATOM   4135 C CZ3 . TRP A 1 662 ? -5.928  -21.632 58.384  1.00 73.23  ? 662  TRP A CZ3 1 
ATOM   4136 C CH2 . TRP A 1 662 ? -6.154  -22.434 57.250  1.00 72.87  ? 662  TRP A CH2 1 
ATOM   4137 N N   . ALA A 1 663 ? -7.047  -25.449 63.981  1.00 76.80  ? 663  ALA A N   1 
ATOM   4138 C CA  . ALA A 1 663 ? -8.040  -26.501 64.132  1.00 76.79  ? 663  ALA A CA  1 
ATOM   4139 C C   . ALA A 1 663 ? -9.403  -25.831 64.228  1.00 77.67  ? 663  ALA A C   1 
ATOM   4140 O O   . ALA A 1 663 ? -10.340 -26.198 63.517  1.00 77.62  ? 663  ALA A O   1 
ATOM   4141 C CB  . ALA A 1 663 ? -7.761  -27.308 65.390  1.00 77.54  ? 663  ALA A CB  1 
ATOM   4142 N N   . ASP A 1 664 ? -9.502  -24.840 65.110  1.00 78.00  ? 664  ASP A N   1 
ATOM   4143 C CA  . ASP A 1 664 ? -10.743 -24.102 65.301  1.00 79.91  ? 664  ASP A CA  1 
ATOM   4144 C C   . ASP A 1 664 ? -11.277 -23.617 63.959  1.00 80.15  ? 664  ASP A C   1 
ATOM   4145 O O   . ASP A 1 664 ? -12.467 -23.744 63.667  1.00 80.80  ? 664  ASP A O   1 
ATOM   4146 C CB  . ASP A 1 664 ? -10.510 -22.903 66.221  1.00 81.42  ? 664  ASP A CB  1 
ATOM   4147 C CG  . ASP A 1 664 ? -10.148 -23.312 67.633  1.00 83.57  ? 664  ASP A CG  1 
ATOM   4148 O OD1 . ASP A 1 664 ? -10.967 -23.996 68.282  1.00 84.33  ? 664  ASP A OD1 1 
ATOM   4149 O OD2 . ASP A 1 664 ? -9.046  -22.949 68.095  1.00 86.03  ? 664  ASP A OD2 1 
ATOM   4150 N N   . VAL A 1 665 ? -10.385 -23.061 63.147  1.00 80.02  ? 665  VAL A N   1 
ATOM   4151 C CA  . VAL A 1 665 ? -10.750 -22.551 61.832  1.00 79.41  ? 665  VAL A CA  1 
ATOM   4152 C C   . VAL A 1 665 ? -11.433 -23.627 60.990  1.00 78.74  ? 665  VAL A C   1 
ATOM   4153 O O   . VAL A 1 665 ? -12.503 -23.397 60.427  1.00 78.24  ? 665  VAL A O   1 
ATOM   4154 C CB  . VAL A 1 665 ? -9.503  -22.033 61.075  1.00 79.03  ? 665  VAL A CB  1 
ATOM   4155 C CG1 . VAL A 1 665 ? -9.880  -21.610 59.664  1.00 78.93  ? 665  VAL A CG1 1 
ATOM   4156 C CG2 . VAL A 1 665 ? -8.893  -20.863 61.828  1.00 78.24  ? 665  VAL A CG2 1 
ATOM   4157 N N   . GLU A 1 666 ? -10.816 -24.802 60.914  1.00 78.18  ? 666  GLU A N   1 
ATOM   4158 C CA  . GLU A 1 666 ? -11.372 -25.901 60.134  1.00 78.20  ? 666  GLU A CA  1 
ATOM   4159 C C   . GLU A 1 666 ? -12.690 -26.428 60.693  1.00 78.81  ? 666  GLU A C   1 
ATOM   4160 O O   . GLU A 1 666 ? -13.402 -27.169 60.018  1.00 80.62  ? 666  GLU A O   1 
ATOM   4161 C CB  . GLU A 1 666 ? -10.357 -27.043 60.035  1.00 75.42  ? 666  GLU A CB  1 
ATOM   4162 C CG  . GLU A 1 666 ? -9.182  -26.736 59.123  1.00 74.03  ? 666  GLU A CG  1 
ATOM   4163 C CD  . GLU A 1 666 ? -8.258  -27.921 58.934  1.00 73.63  ? 666  GLU A CD  1 
ATOM   4164 O OE1 . GLU A 1 666 ? -7.335  -27.827 58.098  1.00 73.58  ? 666  GLU A OE1 1 
ATOM   4165 O OE2 . GLU A 1 666 ? -8.451  -28.946 59.621  1.00 75.70  ? 666  GLU A OE2 1 
ATOM   4166 N N   . ALA A 1 667 ? -13.015 -26.037 61.920  1.00 79.34  ? 667  ALA A N   1 
ATOM   4167 C CA  . ALA A 1 667 ? -14.247 -26.479 62.565  1.00 78.79  ? 667  ALA A CA  1 
ATOM   4168 C C   . ALA A 1 667 ? -15.421 -25.562 62.239  1.00 78.91  ? 667  ALA A C   1 
ATOM   4169 O O   . ALA A 1 667 ? -16.566 -26.009 62.157  1.00 79.43  ? 667  ALA A O   1 
ATOM   4170 C CB  . ALA A 1 667 ? -14.048 -26.547 64.072  1.00 78.00  ? 667  ALA A CB  1 
ATOM   4171 N N   . ARG A 1 668 ? -15.131 -24.278 62.055  1.00 78.64  ? 668  ARG A N   1 
ATOM   4172 C CA  . ARG A 1 668 ? -16.166 -23.299 61.749  1.00 78.52  ? 668  ARG A CA  1 
ATOM   4173 C C   . ARG A 1 668 ? -16.400 -23.139 60.252  1.00 75.63  ? 668  ARG A C   1 
ATOM   4174 O O   . ARG A 1 668 ? -17.543 -23.086 59.800  1.00 75.91  ? 668  ARG A O   1 
ATOM   4175 C CB  . ARG A 1 668 ? -15.793 -21.933 62.336  1.00 81.99  ? 668  ARG A CB  1 
ATOM   4176 C CG  . ARG A 1 668 ? -15.570 -21.923 63.837  1.00 87.88  ? 668  ARG A CG  1 
ATOM   4177 C CD  . ARG A 1 668 ? -15.050 -20.565 64.297  1.00 92.73  ? 668  ARG A CD  1 
ATOM   4178 N NE  . ARG A 1 668 ? -14.770 -20.526 65.732  1.00 96.96  ? 668  ARG A NE  1 
ATOM   4179 C CZ  . ARG A 1 668 ? -13.956 -21.369 66.363  1.00 98.33  ? 668  ARG A CZ  1 
ATOM   4180 N NH1 . ARG A 1 668 ? -13.335 -22.328 65.691  1.00 98.17  ? 668  ARG A NH1 1 
ATOM   4181 N NH2 . ARG A 1 668 ? -13.756 -21.249 67.670  1.00 98.52  ? 668  ARG A NH2 1 
ATOM   4182 N N   . TYR A 1 669 ? -15.317 -23.069 59.484  1.00 72.70  ? 669  TYR A N   1 
ATOM   4183 C CA  . TYR A 1 669 ? -15.425 -22.873 58.043  1.00 71.19  ? 669  TYR A CA  1 
ATOM   4184 C C   . TYR A 1 669 ? -15.178 -24.121 57.204  1.00 70.20  ? 669  TYR A C   1 
ATOM   4185 O O   . TYR A 1 669 ? -14.457 -25.032 57.612  1.00 68.78  ? 669  TYR A O   1 
ATOM   4186 C CB  . TYR A 1 669 ? -14.473 -21.753 57.605  1.00 69.33  ? 669  TYR A CB  1 
ATOM   4187 C CG  . TYR A 1 669 ? -14.593 -20.515 58.464  1.00 68.92  ? 669  TYR A CG  1 
ATOM   4188 C CD1 . TYR A 1 669 ? -13.881 -20.400 59.657  1.00 68.98  ? 669  TYR A CD1 1 
ATOM   4189 C CD2 . TYR A 1 669 ? -15.475 -19.490 58.125  1.00 70.02  ? 669  TYR A CD2 1 
ATOM   4190 C CE1 . TYR A 1 669 ? -14.049 -19.300 60.495  1.00 69.75  ? 669  TYR A CE1 1 
ATOM   4191 C CE2 . TYR A 1 669 ? -15.652 -18.386 58.957  1.00 70.44  ? 669  TYR A CE2 1 
ATOM   4192 C CZ  . TYR A 1 669 ? -14.938 -18.299 60.141  1.00 70.56  ? 669  TYR A CZ  1 
ATOM   4193 O OH  . TYR A 1 669 ? -15.130 -17.225 60.981  1.00 71.77  ? 669  TYR A OH  1 
ATOM   4194 N N   . PRO A 1 670 ? -15.785 -24.173 56.006  1.00 70.86  ? 670  PRO A N   1 
ATOM   4195 C CA  . PRO A 1 670 ? -15.651 -25.300 55.079  1.00 72.35  ? 670  PRO A CA  1 
ATOM   4196 C C   . PRO A 1 670 ? -14.241 -25.490 54.525  1.00 73.73  ? 670  PRO A C   1 
ATOM   4197 O O   . PRO A 1 670 ? -13.610 -24.541 54.062  1.00 74.22  ? 670  PRO A O   1 
ATOM   4198 C CB  . PRO A 1 670 ? -16.661 -24.963 53.983  1.00 71.25  ? 670  PRO A CB  1 
ATOM   4199 C CG  . PRO A 1 670 ? -16.665 -23.466 53.983  1.00 69.42  ? 670  PRO A CG  1 
ATOM   4200 C CD  . PRO A 1 670 ? -16.697 -23.154 55.455  1.00 69.11  ? 670  PRO A CD  1 
ATOM   4201 N N   . LEU A 1 671 ? -13.758 -26.727 54.574  1.00 76.11  ? 671  LEU A N   1 
ATOM   4202 C CA  . LEU A 1 671 ? -12.430 -27.057 54.070  1.00 77.81  ? 671  LEU A CA  1 
ATOM   4203 C C   . LEU A 1 671 ? -12.385 -26.758 52.574  1.00 79.44  ? 671  LEU A C   1 
ATOM   4204 O O   . LEU A 1 671 ? -13.420 -26.733 51.908  1.00 79.95  ? 671  LEU A O   1 
ATOM   4205 C CB  . LEU A 1 671 ? -12.132 -28.536 54.320  1.00 77.11  ? 671  LEU A CB  1 
ATOM   4206 C CG  . LEU A 1 671 ? -12.409 -29.035 55.743  1.00 77.85  ? 671  LEU A CG  1 
ATOM   4207 C CD1 . LEU A 1 671 ? -12.145 -30.531 55.819  1.00 78.05  ? 671  LEU A CD1 1 
ATOM   4208 C CD2 . LEU A 1 671 ? -11.541 -28.280 56.741  1.00 76.57  ? 671  LEU A CD2 1 
ATOM   4209 N N   . PHE A 1 672 ? -11.187 -26.533 52.047  1.00 80.85  ? 672  PHE A N   1 
ATOM   4210 C CA  . PHE A 1 672 ? -11.031 -26.227 50.630  1.00 82.52  ? 672  PHE A CA  1 
ATOM   4211 C C   . PHE A 1 672 ? -9.750  -26.837 50.075  1.00 84.62  ? 672  PHE A C   1 
ATOM   4212 O O   . PHE A 1 672 ? -8.653  -26.391 50.407  1.00 85.19  ? 672  PHE A O   1 
ATOM   4213 C CB  . PHE A 1 672 ? -10.998 -24.713 50.425  1.00 80.94  ? 672  PHE A CB  1 
ATOM   4214 C CG  . PHE A 1 672 ? -10.960 -24.296 48.985  1.00 80.90  ? 672  PHE A CG  1 
ATOM   4215 C CD1 . PHE A 1 672 ? -12.118 -24.310 48.212  1.00 80.54  ? 672  PHE A CD1 1 
ATOM   4216 C CD2 . PHE A 1 672 ? -9.764  -23.896 48.395  1.00 80.53  ? 672  PHE A CD2 1 
ATOM   4217 C CE1 . PHE A 1 672 ? -12.086 -23.929 46.872  1.00 80.40  ? 672  PHE A CE1 1 
ATOM   4218 C CE2 . PHE A 1 672 ? -9.720  -23.514 47.056  1.00 80.86  ? 672  PHE A CE2 1 
ATOM   4219 C CZ  . PHE A 1 672 ? -10.884 -23.530 46.293  1.00 80.98  ? 672  PHE A CZ  1 
ATOM   4220 N N   . GLU A 1 673 ? -9.889  -27.851 49.228  1.00 88.14  ? 673  GLU A N   1 
ATOM   4221 C CA  . GLU A 1 673 ? -8.728  -28.504 48.635  1.00 91.71  ? 673  GLU A CA  1 
ATOM   4222 C C   . GLU A 1 673 ? -8.447  -27.896 47.259  1.00 92.52  ? 673  GLU A C   1 
ATOM   4223 O O   . GLU A 1 673 ? -7.805  -28.565 46.421  1.00 93.23  ? 673  GLU A O   1 
ATOM   4224 C CB  . GLU A 1 673 ? -8.989  -30.012 48.511  1.00 94.97  ? 673  GLU A CB  1 
ATOM   4225 C CG  . GLU A 1 673 ? -7.793  -30.842 48.049  1.00 99.74  ? 673  GLU A CG  1 
ATOM   4226 C CD  . GLU A 1 673 ? -6.614  -30.772 49.006  1.00 102.70 ? 673  GLU A CD  1 
ATOM   4227 O OE1 . GLU A 1 673 ? -6.774  -31.159 50.184  1.00 104.21 ? 673  GLU A OE1 1 
ATOM   4228 O OE2 . GLU A 1 673 ? -5.524  -30.333 48.577  1.00 104.16 ? 673  GLU A OE2 1 
HETATM 4229 P PA  . B4P B 2 .   ? 33.313  -16.147 73.928  1.00 92.00  ? 1101 B4P A PA  1 
HETATM 4230 O O1A . B4P B 2 .   ? 32.194  -15.003 73.750  1.00 89.75  ? 1101 B4P A O1A 1 
HETATM 4231 O O2A . B4P B 2 .   ? 34.508  -15.904 73.090  1.00 91.44  ? 1101 B4P A O2A 1 
HETATM 4232 O O3A . B4P B 2 .   ? 32.593  -17.547 73.583  1.00 82.90  ? 1101 B4P A O3A 1 
HETATM 4233 P PB  . B4P B 2 .   ? 31.194  -17.981 74.255  1.00 72.24  ? 1101 B4P A PB  1 
HETATM 4234 O O1B . B4P B 2 .   ? 30.384  -18.756 73.099  1.00 69.54  ? 1101 B4P A O1B 1 
HETATM 4235 O O2B . B4P B 2 .   ? 31.365  -18.800 75.476  1.00 73.16  ? 1101 B4P A O2B 1 
HETATM 4236 O O3B . B4P B 2 .   ? 30.375  -16.620 74.518  1.00 70.46  ? 1101 B4P A O3B 1 
HETATM 4237 P PG  . B4P B 2 .   ? 30.285  -15.994 76.000  1.00 67.05  ? 1101 B4P A PG  1 
HETATM 4238 O O1G . B4P B 2 .   ? 31.663  -15.193 76.228  1.00 67.82  ? 1101 B4P A O1G 1 
HETATM 4239 O O2G . B4P B 2 .   ? 30.072  -17.033 77.034  1.00 66.59  ? 1101 B4P A O2G 1 
HETATM 4240 O O3G . B4P B 2 .   ? 29.123  -14.879 75.952  1.00 64.65  ? 1101 B4P A O3G 1 
HETATM 4241 P PD  . B4P B 2 .   ? 28.857  -13.955 77.244  1.00 58.78  ? 1101 B4P A PD  1 
HETATM 4242 O O1D . B4P B 2 .   ? 30.197  -13.084 77.439  1.00 60.83  ? 1101 B4P A O1D 1 
HETATM 4243 O O2D . B4P B 2 .   ? 28.543  -14.767 78.442  1.00 64.35  ? 1101 B4P A O2D 1 
HETATM 4244 O O5E . B4P B 2 .   ? 33.664  -16.194 75.499  1.00 99.12  ? 1101 B4P A O5E 1 
HETATM 4245 C C5E . B4P B 2 .   ? 34.515  -17.222 76.011  1.00 111.61 ? 1101 B4P A C5E 1 
HETATM 4246 C C4E . B4P B 2 .   ? 34.744  -17.055 77.515  1.00 120.24 ? 1101 B4P A C4E 1 
HETATM 4247 O O4E . B4P B 2 .   ? 35.516  -18.138 78.068  1.00 124.20 ? 1101 B4P A O4E 1 
HETATM 4248 C C3E . B4P B 2 .   ? 33.415  -17.026 78.274  1.00 123.53 ? 1101 B4P A C3E 1 
HETATM 4249 O O3E . B4P B 2 .   ? 32.943  -15.679 78.358  1.00 124.72 ? 1101 B4P A O3E 1 
HETATM 4250 C C2E . B4P B 2 .   ? 33.916  -17.474 79.645  1.00 125.90 ? 1101 B4P A C2E 1 
HETATM 4251 O O2E . B4P B 2 .   ? 32.844  -17.949 80.465  1.00 126.28 ? 1101 B4P A O2E 1 
HETATM 4252 C C1E . B4P B 2 .   ? 34.773  -18.653 79.188  1.00 127.23 ? 1101 B4P A C1E 1 
HETATM 4253 N N9A . B4P B 2 .   ? 35.629  -19.196 80.267  1.00 129.77 ? 1101 B4P A N9A 1 
HETATM 4254 C C8A . B4P B 2 .   ? 35.544  -20.420 80.784  1.00 130.44 ? 1101 B4P A C8A 1 
HETATM 4255 N N7A . B4P B 2 .   ? 36.445  -20.559 81.753  1.00 131.55 ? 1101 B4P A N7A 1 
HETATM 4256 C C5A . B4P B 2 .   ? 37.114  -19.413 81.855  1.00 131.72 ? 1101 B4P A C5A 1 
HETATM 4257 C C6A . B4P B 2 .   ? 38.144  -18.966 82.670  1.00 131.74 ? 1101 B4P A C6A 1 
HETATM 4258 N N6A . B4P B 2 .   ? 38.668  -19.762 83.598  1.00 131.27 ? 1101 B4P A N6A 1 
HETATM 4259 N N1A . B4P B 2 .   ? 38.600  -17.714 82.510  1.00 131.53 ? 1101 B4P A N1A 1 
HETATM 4260 C C2A . B4P B 2 .   ? 38.082  -16.913 81.595  1.00 131.59 ? 1101 B4P A C2A 1 
HETATM 4261 N N3A . B4P B 2 .   ? 37.101  -17.305 80.804  1.00 131.41 ? 1101 B4P A N3A 1 
HETATM 4262 C C4A . B4P B 2 .   ? 36.595  -18.544 80.907  1.00 131.15 ? 1101 B4P A C4A 1 
HETATM 4263 O O5F . B4P B 2 .   ? 27.697  -12.900 76.875  1.00 65.56  ? 1101 B4P A O5F 1 
HETATM 4264 C C5F . B4P B 2 .   ? 26.381  -13.359 76.554  1.00 65.72  ? 1101 B4P A C5F 1 
HETATM 4265 C C4F . B4P B 2 .   ? 26.376  -13.947 75.143  1.00 65.09  ? 1101 B4P A C4F 1 
HETATM 4266 O O4F . B4P B 2 .   ? 26.498  -12.915 74.154  1.00 60.57  ? 1101 B4P A O4F 1 
HETATM 4267 C C3F . B4P B 2 .   ? 25.069  -14.600 74.701  1.00 64.75  ? 1101 B4P A C3F 1 
HETATM 4268 O O3F . B4P B 2 .   ? 24.866  -15.817 75.424  1.00 71.00  ? 1101 B4P A O3F 1 
HETATM 4269 C C2F . B4P B 2 .   ? 25.468  -14.864 73.251  1.00 63.77  ? 1101 B4P A C2F 1 
HETATM 4270 O O2F . B4P B 2 .   ? 24.288  -14.993 72.454  1.00 67.66  ? 1101 B4P A O2F 1 
HETATM 4271 C C1F . B4P B 2 .   ? 26.187  -13.557 72.903  1.00 61.59  ? 1101 B4P A C1F 1 
HETATM 4272 N N9B . B4P B 2 .   ? 27.450  -13.819 72.178  1.00 59.54  ? 1101 B4P A N9B 1 
HETATM 4273 C C8B . B4P B 2 .   ? 28.640  -14.006 72.746  1.00 58.74  ? 1101 B4P A C8B 1 
HETATM 4274 N N7B . B4P B 2 .   ? 29.573  -14.120 71.804  1.00 57.91  ? 1101 B4P A N7B 1 
HETATM 4275 C C5B . B4P B 2 .   ? 28.972  -14.010 70.623  1.00 57.89  ? 1101 B4P A C5B 1 
HETATM 4276 C C6B . B4P B 2 .   ? 29.416  -14.038 69.308  1.00 57.08  ? 1101 B4P A C6B 1 
HETATM 4277 N N6B . B4P B 2 .   ? 30.712  -14.168 69.035  1.00 53.51  ? 1101 B4P A N6B 1 
HETATM 4278 N N1B . B4P B 2 .   ? 28.522  -13.897 68.320  1.00 58.01  ? 1101 B4P A N1B 1 
HETATM 4279 C C2B . B4P B 2 .   ? 27.238  -13.729 68.583  1.00 59.01  ? 1101 B4P A C2B 1 
HETATM 4280 N N3B . B4P B 2 .   ? 26.780  -13.691 69.822  1.00 57.78  ? 1101 B4P A N3B 1 
HETATM 4281 C C4B . B4P B 2 .   ? 27.617  -13.827 70.860  1.00 58.36  ? 1101 B4P A C4B 1 
HETATM 4282 O O   . HOH C 3 .   ? 30.993  -22.075 68.290  1.00 30.50  ? 700  HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? -0.039  -19.895 53.444  1.00 40.67  ? 701  HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? 29.797  2.640   77.080  1.00 33.62  ? 702  HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? 3.471   -16.062 67.308  1.00 48.51  ? 703  HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 4.970   -14.714 77.783  1.00 52.06  ? 704  HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? 6.214   -25.374 80.483  1.00 48.94  ? 705  HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? 32.032  -21.710 74.066  1.00 42.44  ? 706  HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? 23.063  -9.049  65.629  1.00 54.06  ? 707  HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? 5.023   -14.579 83.617  1.00 57.30  ? 708  HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? 23.073  3.434   68.676  1.00 54.02  ? 709  HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? -12.785 -9.232  59.821  1.00 51.07  ? 710  HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? 0.021   -3.527  59.092  1.00 48.06  ? 711  HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? 12.931  3.582   79.656  1.00 47.66  ? 712  HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? 30.001  -18.000 55.226  1.00 57.68  ? 713  HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? 19.954  -12.087 47.034  1.00 55.18  ? 714  HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? -10.181 -23.511 72.381  1.00 60.16  ? 715  HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? 28.027  -10.701 79.464  1.00 55.71  ? 716  HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? 1.517   -4.428  56.093  1.00 46.26  ? 717  HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? 29.697  -22.655 56.256  1.00 62.30  ? 718  HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? 38.988  -23.747 66.647  1.00 58.96  ? 719  HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? 4.945   -20.143 69.219  1.00 55.65  ? 720  HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? 27.187  -19.422 56.883  1.00 78.50  ? 721  HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? 31.229  -20.135 59.526  1.00 54.05  ? 722  HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? 21.375  4.304   113.195 1.00 65.13  ? 723  HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? 39.421  -8.091  51.893  1.00 56.19  ? 724  HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? -11.912 -7.876  50.098  1.00 54.69  ? 725  HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? 27.898  -29.304 73.198  1.00 56.72  ? 726  HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? 20.918  1.135   115.867 1.00 59.44  ? 727  HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? 24.925  -11.263 64.303  1.00 50.20  ? 728  HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? 28.368  -10.155 61.537  1.00 50.30  ? 729  HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? 5.168   -28.786 81.100  1.00 60.27  ? 730  HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? -1.979  -15.963 72.878  1.00 69.41  ? 731  HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? 14.387  -0.329  112.759 1.00 57.27  ? 732  HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? 13.477  -12.534 49.184  1.00 69.92  ? 733  HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? 11.968  -4.175  89.449  1.00 61.07  ? 734  HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? 16.477  -0.375  98.819  1.00 57.27  ? 735  HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? 22.634  -33.551 74.727  1.00 57.10  ? 736  HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? 46.528  -12.875 81.351  1.00 51.90  ? 737  HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? 11.225  1.125   69.908  1.00 50.65  ? 738  HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? 3.342   -19.893 66.879  1.00 54.32  ? 739  HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? 20.788  5.718   115.992 1.00 72.06  ? 740  HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? 29.272  -31.014 63.570  1.00 60.44  ? 741  HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? 38.892  -12.647 46.950  1.00 59.05  ? 742  HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? 49.147  -10.474 78.612  1.00 62.09  ? 743  HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? 27.236  -22.027 78.203  1.00 49.46  ? 744  HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? 41.928  -18.807 57.196  1.00 73.64  ? 745  HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? 10.323  -9.151  53.520  1.00 70.54  ? 746  HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? 14.820  -30.383 59.018  1.00 64.14  ? 747  HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? 46.411  -10.564 73.425  1.00 64.87  ? 748  HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? -11.105 2.386   34.095  1.00 60.28  ? 749  HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? -6.821  -1.803  67.222  1.00 66.69  ? 750  HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? 45.046  8.218   71.231  1.00 55.26  ? 751  HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? 14.706  -31.467 64.356  1.00 64.33  ? 752  HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? 9.532   -12.910 42.603  1.00 67.60  ? 753  HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? 39.305  -13.750 58.448  1.00 61.38  ? 754  HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? 39.900  -20.381 56.323  1.00 67.39  ? 755  HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? 5.020   -11.169 78.717  1.00 56.64  ? 756  HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? -1.348  -12.686 35.893  1.00 59.13  ? 757  HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? 6.909   -5.711  62.198  1.00 73.00  ? 758  HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? 3.086   -11.412 82.435  1.00 63.39  ? 759  HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? -2.893  2.993   57.292  1.00 62.22  ? 760  HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? 0.680   -9.163  82.695  1.00 68.14  ? 761  HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? 14.143  -37.690 49.948  1.00 63.07  ? 762  HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? -11.519 -8.472  32.537  1.00 77.66  ? 763  HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 24.221  5.160   117.603 1.00 71.07  ? 764  HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? -17.016 -11.216 34.193  1.00 78.46  ? 765  HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? 10.032  -0.542  74.394  1.00 65.33  ? 766  HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? 51.024  -30.330 70.570  1.00 66.81  ? 767  HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? 3.545   -20.435 80.491  1.00 55.77  ? 768  HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 30.085  -35.007 62.864  1.00 72.40  ? 769  HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? 25.504  2.668   118.452 1.00 63.89  ? 770  HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? 19.948  -31.402 90.152  1.00 59.51  ? 771  HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 30.190  0.639   104.627 1.00 70.87  ? 772  HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 12.753  -6.275  86.698  1.00 63.01  ? 773  HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? 4.708   -21.485 65.134  1.00 68.07  ? 774  HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? 22.228  -33.846 79.983  1.00 54.37  ? 775  HOH A O   1 
HETATM 4358 O O   . HOH C 3 .   ? 1.440   -18.563 64.838  1.00 69.26  ? 776  HOH A O   1 
HETATM 4359 O O   . HOH C 3 .   ? 31.263  -17.856 62.996  1.00 42.76  ? 777  HOH A O   1 
HETATM 4360 O O   . HOH C 3 .   ? -17.533 -18.457 62.803  1.00 79.03  ? 778  HOH A O   1 
HETATM 4361 O O   . HOH C 3 .   ? 29.722  -35.255 59.487  1.00 57.16  ? 779  HOH A O   1 
HETATM 4362 O O   . HOH C 3 .   ? 33.693  -28.680 95.202  1.00 70.87  ? 780  HOH A O   1 
HETATM 4363 O O   . HOH C 3 .   ? 40.506  -8.676  46.906  1.00 65.86  ? 781  HOH A O   1 
HETATM 4364 O O   . HOH C 3 .   ? -4.972  -0.414  69.843  1.00 78.66  ? 782  HOH A O   1 
HETATM 4365 O O   . HOH C 3 .   ? 3.759   -21.392 84.706  1.00 69.03  ? 783  HOH A O   1 
HETATM 4366 O O   . HOH C 3 .   ? 16.328  2.273   114.883 1.00 65.94  ? 784  HOH A O   1 
HETATM 4367 O O   . HOH C 3 .   ? 44.421  -6.322  76.459  1.00 60.35  ? 785  HOH A O   1 
HETATM 4368 O O   . HOH C 3 .   ? 13.046  -0.847  87.362  1.00 57.30  ? 786  HOH A O   1 
HETATM 4369 O O   . HOH C 3 .   ? -4.071  -2.903  46.489  1.00 59.61  ? 787  HOH A O   1 
HETATM 4370 O O   . HOH C 3 .   ? -0.008  -12.285 39.113  1.00 77.74  ? 788  HOH A O   1 
HETATM 4371 O O   . HOH C 3 .   ? 20.863  10.996  103.868 1.00 73.18  ? 789  HOH A O   1 
HETATM 4372 O O   . HOH C 3 .   ? -16.614 -19.891 46.091  1.00 61.91  ? 790  HOH A O   1 
HETATM 4373 O O   . HOH C 3 .   ? 47.709  -0.393  73.600  1.00 62.24  ? 791  HOH A O   1 
HETATM 4374 O O   . HOH C 3 .   ? 53.594  -16.372 60.481  1.00 82.68  ? 792  HOH A O   1 
HETATM 4375 O O   . HOH C 3 .   ? 2.550   -4.378  79.988  1.00 64.19  ? 793  HOH A O   1 
HETATM 4376 O O   . HOH C 3 .   ? 1.198   -3.422  53.350  1.00 64.64  ? 794  HOH A O   1 
HETATM 4377 O O   . HOH C 3 .   ? 12.599  -5.045  56.220  1.00 60.87  ? 795  HOH A O   1 
HETATM 4378 O O   . HOH C 3 .   ? 11.671  -4.381  59.332  1.00 45.63  ? 796  HOH A O   1 
HETATM 4379 O O   . HOH C 3 .   ? 49.116  -7.760  75.784  1.00 72.57  ? 797  HOH A O   1 
HETATM 4380 O O   . HOH C 3 .   ? 8.733   -32.402 84.984  1.00 66.22  ? 798  HOH A O   1 
HETATM 4381 O O   . HOH C 3 .   ? 33.346  -20.947 66.126  1.00 77.52  ? 799  HOH A O   1 
HETATM 4382 O O   . HOH C 3 .   ? 11.761  -15.473 45.315  1.00 65.95  ? 800  HOH A O   1 
HETATM 4383 O O   . HOH C 3 .   ? 10.386  -31.089 75.847  1.00 55.97  ? 801  HOH A O   1 
HETATM 4384 O O   . HOH C 3 .   ? 1.479   -18.181 35.187  1.00 79.61  ? 802  HOH A O   1 
HETATM 4385 O O   . HOH C 3 .   ? 23.201  1.106   117.551 1.00 80.04  ? 803  HOH A O   1 
HETATM 4386 O O   . HOH C 3 .   ? 25.965  4.158   70.340  1.00 69.40  ? 804  HOH A O   1 
HETATM 4387 O O   . HOH C 3 .   ? 25.320  -18.416 46.142  1.00 54.32  ? 805  HOH A O   1 
HETATM 4388 O O   . HOH C 3 .   ? 21.471  1.223   123.563 1.00 65.22  ? 806  HOH A O   1 
HETATM 4389 O O   . HOH C 3 .   ? 17.095  -37.219 62.794  1.00 69.69  ? 807  HOH A O   1 
HETATM 4390 O O   . HOH C 3 .   ? 4.551   -31.517 51.122  1.00 62.82  ? 808  HOH A O   1 
HETATM 4391 O O   . HOH C 3 .   ? 24.684  0.492   69.445  1.00 69.90  ? 809  HOH A O   1 
HETATM 4392 O O   . HOH C 3 .   ? -20.894 -10.283 56.046  1.00 84.42  ? 810  HOH A O   1 
HETATM 4393 O O   . HOH C 3 .   ? 17.626  -11.547 46.108  1.00 53.67  ? 811  HOH A O   1 
HETATM 4394 O O   . HOH C 3 .   ? 48.143  -16.763 79.449  1.00 50.43  ? 812  HOH A O   1 
HETATM 4395 O O   . HOH C 3 .   ? 53.335  -32.397 50.500  1.00 75.70  ? 813  HOH A O   1 
HETATM 4396 O O   . HOH C 3 .   ? 19.732  -1.522  68.092  1.00 69.70  ? 814  HOH A O   1 
HETATM 4397 O O   . HOH C 3 .   ? 41.758  -20.164 54.269  1.00 79.42  ? 815  HOH A O   1 
HETATM 4398 O O   . HOH C 3 .   ? -11.623 3.071   53.342  1.00 61.61  ? 816  HOH A O   1 
HETATM 4399 O O   . HOH C 3 .   ? -2.344  -19.968 72.986  1.00 73.10  ? 817  HOH A O   1 
HETATM 4400 O O   . HOH C 3 .   ? 30.020  -25.296 74.775  1.00 71.95  ? 818  HOH A O   1 
HETATM 4401 O O   . HOH C 3 .   ? 25.443  -6.865  61.116  1.00 62.60  ? 819  HOH A O   1 
HETATM 4402 O O   . HOH C 3 .   ? 39.884  -15.667 50.365  1.00 69.88  ? 820  HOH A O   1 
HETATM 4403 O O   . HOH C 3 .   ? 8.193   -31.896 88.284  1.00 64.42  ? 821  HOH A O   1 
HETATM 4404 O O   . HOH C 3 .   ? 55.376  -19.847 58.251  1.00 79.35  ? 822  HOH A O   1 
HETATM 4405 O O   . HOH C 3 .   ? 30.824  1.870   95.900  1.00 62.53  ? 823  HOH A O   1 
HETATM 4406 O O   . HOH C 3 .   ? 8.831   -2.251  89.408  1.00 62.35  ? 824  HOH A O   1 
HETATM 4407 O O   . HOH C 3 .   ? 0.949   -1.205  56.706  1.00 72.36  ? 825  HOH A O   1 
HETATM 4408 O O   . HOH C 3 .   ? 16.669  0.019   113.986 1.00 54.89  ? 826  HOH A O   1 
HETATM 4409 O O   . HOH C 3 .   ? 40.626  -18.849 51.743  1.00 77.97  ? 827  HOH A O   1 
HETATM 4410 O O   . HOH C 3 .   ? 42.641  -16.715 55.633  1.00 62.74  ? 828  HOH A O   1 
HETATM 4411 O O   . HOH C 3 .   ? 26.839  -15.794 45.155  1.00 70.96  ? 829  HOH A O   1 
HETATM 4412 O O   . HOH C 3 .   ? 23.060  7.657   116.977 1.00 59.62  ? 830  HOH A O   1 
HETATM 4413 O O   . HOH C 3 .   ? 12.178  0.047   111.190 1.00 61.17  ? 831  HOH A O   1 
HETATM 4414 O O   . HOH C 3 .   ? 12.776  -28.936 64.011  1.00 80.23  ? 832  HOH A O   1 
HETATM 4415 O O   . HOH C 3 .   ? 16.920  -39.316 57.890  1.00 73.09  ? 833  HOH A O   1 
HETATM 4416 O O   . HOH C 3 .   ? 28.771  -31.015 60.964  1.00 77.10  ? 834  HOH A O   1 
HETATM 4417 O O   . HOH C 3 .   ? -0.185  -21.996 72.908  1.00 72.95  ? 835  HOH A O   1 
HETATM 4418 O O   . HOH C 3 .   ? -9.202  -1.288  66.405  1.00 66.72  ? 836  HOH A O   1 
HETATM 4419 O O   . HOH C 3 .   ? 22.163  3.485   115.982 1.00 65.31  ? 837  HOH A O   1 
HETATM 4420 O O   . HOH C 3 .   ? 18.583  -3.435  122.635 1.00 68.70  ? 838  HOH A O   1 
HETATM 4421 O O   . HOH C 3 .   ? 28.672  -21.216 74.473  1.00 53.80  ? 839  HOH A O   1 
HETATM 4422 O O   . HOH C 3 .   ? 31.521  3.281   104.015 1.00 73.66  ? 840  HOH A O   1 
HETATM 4423 O O   . HOH C 3 .   ? 34.559  4.220   103.793 1.00 73.39  ? 841  HOH A O   1 
HETATM 4424 O O   . HOH C 3 .   ? 17.392  -28.562 64.525  1.00 67.26  ? 842  HOH A O   1 
HETATM 4425 O O   . HOH C 3 .   ? -10.487 5.259   34.399  1.00 73.52  ? 843  HOH A O   1 
HETATM 4426 O O   . HOH C 3 .   ? 7.435   -33.780 75.535  1.00 79.11  ? 844  HOH A O   1 
HETATM 4427 O O   . HOH C 3 .   ? 51.031  -33.553 57.327  1.00 62.65  ? 845  HOH A O   1 
HETATM 4428 O O   . HOH C 3 .   ? 3.854   -23.121 78.446  1.00 77.75  ? 846  HOH A O   1 
HETATM 4429 O O   . HOH C 3 .   ? 23.008  -29.211 50.607  1.00 66.62  ? 847  HOH A O   1 
HETATM 4430 O O   . HOH C 3 .   ? 40.351  4.546   104.234 1.00 76.91  ? 848  HOH A O   1 
HETATM 4431 O O   . HOH C 3 .   ? -13.503 -12.755 67.578  1.00 67.77  ? 849  HOH A O   1 
HETATM 4432 O O   . HOH C 3 .   ? 9.606   6.223   89.293  1.00 66.95  ? 850  HOH A O   1 
HETATM 4433 O O   . HOH C 3 .   ? 50.675  -1.715  75.616  1.00 76.05  ? 851  HOH A O   1 
HETATM 4434 O O   . HOH C 3 .   ? 3.989   -11.683 71.990  1.00 75.64  ? 852  HOH A O   1 
HETATM 4435 O O   . HOH C 3 .   ? -3.000  -1.453  53.625  1.00 50.23  ? 853  HOH A O   1 
HETATM 4436 O O   . HOH C 3 .   ? 22.141  -29.736 46.583  1.00 71.92  ? 854  HOH A O   1 
HETATM 4437 O O   . HOH C 3 .   ? -13.316 -6.366  54.886  1.00 60.45  ? 855  HOH A O   1 
HETATM 4438 O O   . HOH C 3 .   ? -9.974  4.326   51.459  1.00 67.50  ? 856  HOH A O   1 
HETATM 4439 O O   . HOH C 3 .   ? 48.982  5.819   67.461  1.00 77.35  ? 857  HOH A O   1 
HETATM 4440 O O   . HOH C 3 .   ? 8.747   -10.820 100.830 1.00 57.28  ? 858  HOH A O   1 
HETATM 4441 O O   . HOH C 3 .   ? 54.279  -17.224 62.924  1.00 69.41  ? 859  HOH A O   1 
HETATM 4442 O O   . HOH C 3 .   ? -3.440  -29.323 44.758  1.00 63.01  ? 860  HOH A O   1 
HETATM 4443 O O   . HOH C 3 .   ? 33.966  -12.792 90.891  1.00 62.89  ? 861  HOH A O   1 
HETATM 4444 O O   . HOH C 3 .   ? 34.757  -39.627 85.260  1.00 74.29  ? 862  HOH A O   1 
HETATM 4445 O O   . HOH C 3 .   ? 20.821  -18.579 43.871  1.00 66.94  ? 863  HOH A O   1 
HETATM 4446 O O   . HOH C 3 .   ? -18.299 -16.135 65.384  1.00 70.26  ? 864  HOH A O   1 
HETATM 4447 O O   . HOH C 3 .   ? 15.985  -5.066  96.302  1.00 57.83  ? 865  HOH A O   1 
HETATM 4448 O O   . HOH C 3 .   ? 42.494  -12.677 51.998  1.00 58.65  ? 866  HOH A O   1 
HETATM 4449 O O   . HOH C 3 .   ? -6.361  2.304   34.028  1.00 66.90  ? 867  HOH A O   1 
HETATM 4450 O O   . HOH C 3 .   ? 3.327   -8.992  66.398  1.00 60.08  ? 868  HOH A O   1 
HETATM 4451 O O   . HOH C 3 .   ? -17.362 -12.930 31.318  1.00 84.64  ? 869  HOH A O   1 
HETATM 4452 O O   . HOH C 3 .   ? 8.392   -10.734 104.439 1.00 70.88  ? 870  HOH A O   1 
HETATM 4453 O O   . HOH C 3 .   ? -2.337  -30.122 51.952  1.00 67.92  ? 871  HOH A O   1 
HETATM 4454 O O   . HOH C 3 .   ? -0.613  -25.260 62.903  1.00 68.03  ? 872  HOH A O   1 
HETATM 4455 O O   . HOH C 3 .   ? 21.050  -32.049 77.748  1.00 55.06  ? 873  HOH A O   1 
HETATM 4456 O O   . HOH C 3 .   ? -2.001  -12.906 73.855  1.00 69.72  ? 874  HOH A O   1 
HETATM 4457 O O   . HOH C 3 .   ? 38.388  -27.797 57.928  1.00 61.63  ? 875  HOH A O   1 
HETATM 4458 O O   . HOH C 3 .   ? 9.259   -40.832 50.604  1.00 76.47  ? 876  HOH A O   1 
HETATM 4459 O O   . HOH C 3 .   ? 1.553   -15.819 84.966  1.00 74.44  ? 877  HOH A O   1 
HETATM 4460 O O   . HOH C 3 .   ? -0.137  -16.180 88.348  1.00 77.12  ? 878  HOH A O   1 
HETATM 4461 O O   . HOH C 3 .   ? 42.834  0.551   104.302 1.00 63.72  ? 879  HOH A O   1 
HETATM 4462 O O   . HOH C 3 .   ? 18.942  0.284   114.640 1.00 69.26  ? 880  HOH A O   1 
HETATM 4463 O O   . HOH C 3 .   ? 20.089  -32.559 43.699  1.00 68.49  ? 881  HOH A O   1 
HETATM 4464 O O   . HOH C 3 .   ? 0.488   -25.563 66.063  1.00 69.98  ? 882  HOH A O   1 
HETATM 4465 O O   . HOH C 3 .   ? 14.372  -41.161 54.938  1.00 70.33  ? 883  HOH A O   1 
HETATM 4466 O O   . HOH C 3 .   ? -13.764 -8.897  68.014  1.00 75.39  ? 884  HOH A O   1 
HETATM 4467 O O   . HOH C 3 .   ? 44.513  2.776   106.464 1.00 57.37  ? 885  HOH A O   1 
HETATM 4468 O O   . HOH C 3 .   ? -2.146  -18.718 83.906  1.00 67.30  ? 886  HOH A O   1 
HETATM 4469 O O   . HOH C 3 .   ? 38.019  4.928   106.633 1.00 77.38  ? 887  HOH A O   1 
HETATM 4470 O O   . HOH C 3 .   ? 30.673  -42.471 86.944  1.00 82.24  ? 888  HOH A O   1 
HETATM 4471 O O   . HOH C 3 .   ? 36.142  1.370   100.934 1.00 79.49  ? 889  HOH A O   1 
HETATM 4472 O O   . HOH C 3 .   ? -0.808  -28.493 64.761  1.00 63.82  ? 890  HOH A O   1 
HETATM 4473 O O   . HOH C 3 .   ? -0.654  -33.144 45.474  1.00 62.85  ? 891  HOH A O   1 
HETATM 4474 O O   . HOH C 3 .   ? -6.048  -31.710 41.754  1.00 74.40  ? 892  HOH A O   1 
HETATM 4475 O O   . HOH C 3 .   ? 22.613  -12.758 48.385  1.00 56.15  ? 893  HOH A O   1 
HETATM 4476 O O   . HOH C 3 .   ? 55.612  -16.713 58.580  1.00 87.72  ? 894  HOH A O   1 
HETATM 4477 O O   . HOH C 3 .   ? -5.315  -3.167  65.045  1.00 58.06  ? 895  HOH A O   1 
HETATM 4478 O O   . HOH C 3 .   ? 48.687  -33.582 54.247  1.00 72.87  ? 896  HOH A O   1 
HETATM 4479 O O   . HOH C 3 .   ? 42.149  -5.598  87.250  1.00 71.46  ? 897  HOH A O   1 
HETATM 4480 O O   . HOH C 3 .   ? 37.472  -12.793 42.337  1.00 65.07  ? 898  HOH A O   1 
HETATM 4481 O O   . HOH C 3 .   ? 48.778  -14.341 80.751  1.00 62.06  ? 899  HOH A O   1 
HETATM 4482 O O   . HOH C 3 .   ? 9.976   -0.377  87.600  1.00 60.76  ? 900  HOH A O   1 
HETATM 4483 O O   . HOH C 3 .   ? -11.441 -10.004 66.351  1.00 92.48  ? 901  HOH A O   1 
HETATM 4484 O O   . HOH C 3 .   ? 13.970  -0.482  109.405 1.00 65.66  ? 902  HOH A O   1 
HETATM 4485 O O   . HOH C 3 .   ? 12.387  -41.186 50.240  1.00 68.41  ? 903  HOH A O   1 
HETATM 4486 O O   . HOH C 3 .   ? 17.947  -34.006 95.088  1.00 74.22  ? 904  HOH A O   1 
HETATM 4487 O O   . HOH C 3 .   ? 22.188  -16.635 46.077  1.00 58.87  ? 905  HOH A O   1 
HETATM 4488 O O   . HOH C 3 .   ? 31.057  -18.334 93.334  1.00 76.17  ? 906  HOH A O   1 
HETATM 4489 O O   . HOH C 3 .   ? 30.468  -27.632 62.746  1.00 54.04  ? 907  HOH A O   1 
HETATM 4490 O O   . HOH C 3 .   ? 29.215  -14.963 82.706  1.00 67.95  ? 908  HOH A O   1 
HETATM 4491 O O   . HOH C 3 .   ? -4.475  -16.053 73.751  1.00 70.77  ? 909  HOH A O   1 
HETATM 4492 O O   . HOH C 3 .   ? 8.738   -4.590  54.996  1.00 81.81  ? 910  HOH A O   1 
HETATM 4493 O O   . HOH C 3 .   ? 13.966  -35.656 62.224  1.00 85.76  ? 911  HOH A O   1 
HETATM 4494 O O   . HOH C 3 .   ? 16.110  -3.307  107.010 1.00 70.28  ? 912  HOH A O   1 
HETATM 4495 O O   . HOH C 3 .   ? 40.909  -21.972 91.404  1.00 58.74  ? 913  HOH A O   1 
HETATM 4496 O O   . HOH C 3 .   ? 3.330   -5.341  86.445  1.00 74.81  ? 914  HOH A O   1 
HETATM 4497 O O   . HOH C 3 .   ? 8.239   3.527   84.418  1.00 67.79  ? 915  HOH A O   1 
HETATM 4498 O O   . HOH C 3 .   ? -14.026 0.051   67.864  1.00 66.88  ? 916  HOH A O   1 
HETATM 4499 O O   . HOH C 3 .   ? 36.349  -15.604 54.360  1.00 68.16  ? 917  HOH A O   1 
HETATM 4500 O O   . HOH C 3 .   ? 31.525  -20.272 80.651  1.00 55.11  ? 918  HOH A O   1 
HETATM 4501 O O   . HOH C 3 .   ? 30.242  -15.753 80.139  1.00 47.48  ? 919  HOH A O   1 
HETATM 4502 O O   . HOH C 3 .   ? 27.954  -16.792 79.837  1.00 45.42  ? 920  HOH A O   1 
HETATM 4503 O O   . HOH C 3 .   ? 44.331  -26.426 91.208  1.00 64.13  ? 921  HOH A O   1 
HETATM 4504 O O   . HOH C 3 .   ? 57.090  -21.949 81.754  1.00 83.62  ? 922  HOH A O   1 
HETATM 4505 O O   . HOH C 3 .   ? 60.488  -21.375 80.466  1.00 69.30  ? 923  HOH A O   1 
HETATM 4506 O O   . HOH C 3 .   ? 63.054  -19.118 79.542  1.00 85.81  ? 924  HOH A O   1 
HETATM 4507 O O   . HOH C 3 .   ? 18.848  -38.382 94.861  1.00 73.29  ? 925  HOH A O   1 
HETATM 4508 O O   . HOH C 3 .   ? 2.649   -18.963 99.138  1.00 61.08  ? 926  HOH A O   1 
HETATM 4509 O O   . HOH C 3 .   ? 17.267  -24.167 99.614  1.00 56.45  ? 927  HOH A O   1 
HETATM 4510 O O   . HOH C 3 .   ? 19.545  -23.046 101.584 1.00 76.93  ? 928  HOH A O   1 
HETATM 4511 O O   . HOH C 3 .   ? 20.470  -18.363 103.879 1.00 67.63  ? 929  HOH A O   1 
HETATM 4512 O O   . HOH C 3 .   ? 26.812  -16.550 105.320 1.00 89.78  ? 930  HOH A O   1 
HETATM 4513 O O   . HOH C 3 .   ? 26.952  -12.872 102.370 1.00 72.40  ? 931  HOH A O   1 
HETATM 4514 O O   . HOH C 3 .   ? 38.882  -9.671  100.350 1.00 62.83  ? 932  HOH A O   1 
HETATM 4515 O O   . HOH C 3 .   ? 38.760  -9.876  95.409  1.00 68.98  ? 933  HOH A O   1 
HETATM 4516 O O   . HOH C 3 .   ? 46.062  -5.385  91.967  1.00 55.02  ? 934  HOH A O   1 
HETATM 4517 O O   . HOH C 3 .   ? 51.295  -3.651  86.592  1.00 49.21  ? 935  HOH A O   1 
HETATM 4518 O O   . HOH C 3 .   ? 49.709  -6.812  71.495  1.00 82.83  ? 936  HOH A O   1 
HETATM 4519 O O   . HOH C 3 .   ? 57.011  -27.029 78.199  1.00 61.34  ? 937  HOH A O   1 
HETATM 4520 O O   . HOH C 3 .   ? 58.683  -16.056 70.564  1.00 61.31  ? 938  HOH A O   1 
HETATM 4521 O O   . HOH C 3 .   ? 40.957  -40.886 86.370  1.00 76.67  ? 939  HOH A O   1 
HETATM 4522 O O   . HOH C 3 .   ? 45.686  -28.334 49.066  1.00 74.33  ? 940  HOH A O   1 
HETATM 4523 O O   . HOH C 3 .   ? 15.048  -33.431 60.535  1.00 63.24  ? 941  HOH A O   1 
HETATM 4524 O O   . HOH C 3 .   ? 15.503  -39.060 66.273  1.00 80.16  ? 942  HOH A O   1 
HETATM 4525 O O   . HOH C 3 .   ? 15.803  -36.693 71.376  1.00 74.01  ? 943  HOH A O   1 
HETATM 4526 O O   . HOH C 3 .   ? 13.376  -39.585 83.647  1.00 68.22  ? 944  HOH A O   1 
HETATM 4527 O O   . HOH C 3 .   ? 11.873  -40.468 85.851  1.00 68.79  ? 945  HOH A O   1 
HETATM 4528 O O   . HOH C 3 .   ? 24.856  -37.970 68.484  1.00 70.44  ? 946  HOH A O   1 
HETATM 4529 O O   . HOH C 3 .   ? 11.165  -34.652 73.954  1.00 80.26  ? 947  HOH A O   1 
HETATM 4530 O O   . HOH C 3 .   ? 20.631  -31.306 49.218  1.00 72.33  ? 948  HOH A O   1 
HETATM 4531 O O   . HOH C 3 .   ? 27.094  -31.165 42.517  1.00 62.99  ? 949  HOH A O   1 
HETATM 4532 O O   . HOH C 3 .   ? 30.125  -25.097 43.556  1.00 63.34  ? 950  HOH A O   1 
HETATM 4533 O O   . HOH C 3 .   ? 21.794  -38.332 50.034  1.00 80.80  ? 951  HOH A O   1 
HETATM 4534 O O   . HOH C 3 .   ? 20.472  -37.971 56.725  1.00 88.62  ? 952  HOH A O   1 
HETATM 4535 O O   . HOH C 3 .   ? 1.937   -29.310 60.247  1.00 62.25  ? 953  HOH A O   1 
HETATM 4536 O O   . HOH C 3 .   ? 1.982   -32.436 58.721  1.00 70.14  ? 954  HOH A O   1 
HETATM 4537 O O   . HOH C 3 .   ? 2.741   -34.531 42.895  1.00 60.15  ? 955  HOH A O   1 
HETATM 4538 O O   . HOH C 3 .   ? 29.591  -0.388  107.509 1.00 79.29  ? 956  HOH A O   1 
HETATM 4539 O O   . HOH C 3 .   ? 19.012  -0.086  109.931 1.00 60.81  ? 957  HOH A O   1 
HETATM 4540 O O   . HOH C 3 .   ? 41.743  -29.902 48.613  1.00 71.79  ? 958  HOH A O   1 
HETATM 4541 O O   . HOH C 3 .   ? 29.825  -1.241  77.884  1.00 51.50  ? 959  HOH A O   1 
HETATM 4542 O O   . HOH C 3 .   ? 22.926  -21.365 94.654  1.00 63.12  ? 960  HOH A O   1 
HETATM 4543 O O   . HOH C 3 .   ? 1.413   -7.324  84.653  1.00 62.19  ? 961  HOH A O   1 
HETATM 4544 O O   . HOH C 3 .   ? -13.577 0.772   56.526  1.00 73.58  ? 962  HOH A O   1 
HETATM 4545 O O   . HOH C 3 .   ? 31.217  -2.755  110.631 1.00 63.11  ? 963  HOH A O   1 
HETATM 4546 O O   . HOH C 3 .   ? 52.994  -12.169 58.641  1.00 57.61  ? 964  HOH A O   1 
HETATM 4547 O O   . HOH C 3 .   ? -1.558  -22.300 83.784  1.00 70.08  ? 965  HOH A O   1 
HETATM 4548 O O   . HOH C 3 .   ? -0.451  -12.008 81.769  1.00 74.84  ? 966  HOH A O   1 
HETATM 4549 O O   . HOH C 3 .   ? 24.332  -12.891 105.522 1.00 68.91  ? 967  HOH A O   1 
HETATM 4550 O O   . HOH C 3 .   ? 39.018  -14.683 52.849  1.00 74.37  ? 968  HOH A O   1 
HETATM 4551 O O   . HOH C 3 .   ? -6.309  -33.521 39.695  1.00 71.00  ? 969  HOH A O   1 
HETATM 4552 O O   . HOH C 3 .   ? 29.161  -48.523 76.412  1.00 64.40  ? 970  HOH A O   1 
HETATM 4553 O O   . HOH C 3 .   ? 12.020  -21.217 35.165  1.00 81.20  ? 971  HOH A O   1 
HETATM 4554 O O   . HOH C 3 .   ? 28.670  -13.561 106.807 1.00 64.28  ? 972  HOH A O   1 
HETATM 4555 O O   . HOH C 3 .   ? 36.055  -5.315  71.266  1.00 49.82  ? 973  HOH A O   1 
HETATM 4556 O O   . HOH C 3 .   ? 41.024  -12.923 49.486  1.00 62.36  ? 974  HOH A O   1 
HETATM 4557 O O   . HOH C 3 .   ? 14.328  -19.096 33.790  1.00 70.97  ? 975  HOH A O   1 
HETATM 4558 O O   . HOH C 3 .   ? 10.927  -42.107 53.227  1.00 71.86  ? 976  HOH A O   1 
HETATM 4559 O O   . HOH C 3 .   ? -2.858  -8.361  81.629  1.00 91.31  ? 977  HOH A O   1 
HETATM 4560 O O   . HOH C 3 .   ? 41.463  -44.396 61.813  1.00 66.43  ? 978  HOH A O   1 
HETATM 4561 O O   . HOH C 3 .   ? 13.091  -36.129 80.497  1.00 64.60  ? 979  HOH A O   1 
HETATM 4562 O O   . HOH C 3 .   ? 8.923   -11.133 97.509  1.00 69.51  ? 980  HOH A O   1 
HETATM 4563 O O   . HOH C 3 .   ? 1.571   -8.407  77.573  1.00 63.39  ? 981  HOH A O   1 
HETATM 4564 O O   . HOH C 3 .   ? 56.884  -11.954 58.886  1.00 68.01  ? 982  HOH A O   1 
HETATM 4565 O O   . HOH C 3 .   ? 21.881  -31.543 63.735  1.00 68.09  ? 983  HOH A O   1 
HETATM 4566 O O   . HOH C 3 .   ? 41.338  -8.798  49.900  1.00 61.56  ? 984  HOH A O   1 
HETATM 4567 O O   . HOH C 3 .   ? 41.622  -32.964 49.351  1.00 82.67  ? 985  HOH A O   1 
HETATM 4568 O O   . HOH C 3 .   ? 13.620  -8.334  92.337  1.00 65.42  ? 987  HOH A O   1 
HETATM 4569 O O   . HOH C 3 .   ? 4.820   -10.066 75.935  1.00 61.47  ? 988  HOH A O   1 
HETATM 4570 O O   . HOH C 3 .   ? 39.317  -21.724 53.102  1.00 71.87  ? 989  HOH A O   1 
HETATM 4571 O O   . HOH C 3 .   ? -17.300 -11.579 67.406  1.00 60.67  ? 991  HOH A O   1 
HETATM 4572 O O   . HOH C 3 .   ? 45.425  -24.654 85.274  1.00 71.24  ? 992  HOH A O   1 
HETATM 4573 O O   . HOH C 3 .   ? 48.716  -16.821 83.487  1.00 85.86  ? 993  HOH A O   1 
HETATM 4574 O O   . HOH C 3 .   ? 5.135   -11.651 84.763  1.00 71.88  ? 994  HOH A O   1 
HETATM 4575 O O   . HOH C 3 .   ? 27.167  -12.184 114.270 1.00 63.34  ? 995  HOH A O   1 
HETATM 4576 O O   . HOH C 3 .   ? 45.315  -6.575  102.456 1.00 63.91  ? 996  HOH A O   1 
HETATM 4577 O O   . HOH C 3 .   ? 45.471  -8.934  104.025 1.00 69.59  ? 997  HOH A O   1 
HETATM 4578 O O   . HOH C 3 .   ? 41.609  14.656  106.453 1.00 70.07  ? 998  HOH A O   1 
HETATM 4579 O O   . HOH C 3 .   ? 49.237  -26.165 96.788  1.00 69.38  ? 1003 HOH A O   1 
HETATM 4580 O O   . HOH C 3 .   ? 9.605   -6.193  61.052  1.00 62.48  ? 1004 HOH A O   1 
HETATM 4581 O O   . HOH C 3 .   ? -3.079  -22.182 39.929  1.00 64.75  ? 1005 HOH A O   1 
HETATM 4582 O O   . HOH C 3 .   ? -8.243  -21.290 44.049  1.00 76.12  ? 1006 HOH A O   1 
HETATM 4583 O O   . HOH C 3 .   ? 22.986  10.244  102.415 1.00 69.56  ? 1007 HOH A O   1 
HETATM 4584 O O   . HOH C 3 .   ? -14.613 -10.141 36.717  1.00 81.15  ? 1008 HOH A O   1 
HETATM 4585 O O   . HOH C 3 .   ? -0.837  -30.100 75.014  1.00 62.27  ? 1009 HOH A O   1 
HETATM 4586 O O   . HOH C 3 .   ? 52.255  -12.528 72.220  1.00 70.57  ? 1010 HOH A O   1 
HETATM 4587 O O   . HOH C 3 .   ? 2.426   -42.223 44.067  1.00 59.17  ? 1011 HOH A O   1 
HETATM 4588 O O   . HOH C 3 .   ? 29.116  -44.334 54.112  1.00 73.88  ? 1012 HOH A O   1 
HETATM 4589 O O   . HOH C 3 .   ? 34.796  -38.422 56.503  1.00 64.27  ? 1014 HOH A O   1 
HETATM 4590 O O   . HOH C 3 .   ? 22.172  -28.645 38.758  1.00 74.61  ? 1015 HOH A O   1 
HETATM 4591 O O   . HOH C 3 .   ? 53.012  2.735   101.958 1.00 71.65  ? 1020 HOH A O   1 
HETATM 4592 O O   . HOH C 3 .   ? 24.278  -12.740 68.403  1.00 51.10  ? 1021 HOH A O   1 
HETATM 4593 O O   . HOH C 3 .   ? 51.310  4.660   93.275  1.00 75.82  ? 1026 HOH A O   1 
HETATM 4594 O O   . HOH C 3 .   ? 40.407  0.788   106.162 1.00 70.36  ? 1027 HOH A O   1 
HETATM 4595 O O   . HOH C 3 .   ? 33.768  2.090   106.087 1.00 69.23  ? 1028 HOH A O   1 
HETATM 4596 O O   . HOH C 3 .   ? 29.897  4.163   120.604 1.00 84.97  ? 1029 HOH A O   1 
HETATM 4597 O O   . HOH C 3 .   ? 52.389  -16.022 86.020  1.00 67.58  ? 1030 HOH A O   1 
HETATM 4598 O O   . HOH C 3 .   ? 44.981  -25.789 87.983  1.00 66.77  ? 1031 HOH A O   1 
HETATM 4599 O O   . HOH C 3 .   ? -19.036 -6.357  59.610  1.00 69.97  ? 1032 HOH A O   1 
HETATM 4600 O O   . HOH C 3 .   ? 16.384  -42.455 71.681  1.00 66.08  ? 1033 HOH A O   1 
HETATM 4601 O O   . HOH C 3 .   ? 26.187  -37.526 75.245  1.00 72.52  ? 1034 HOH A O   1 
HETATM 4602 O O   . HOH C 3 .   ? 20.302  -45.435 85.715  1.00 66.23  ? 1035 HOH A O   1 
HETATM 4603 O O   . HOH C 3 .   ? 27.650  -47.697 83.177  1.00 74.61  ? 1036 HOH A O   1 
HETATM 4604 O O   . HOH C 3 .   ? 16.236  -37.241 101.464 1.00 72.52  ? 1037 HOH A O   1 
HETATM 4605 O O   . HOH C 3 .   ? 36.031  -27.198 52.165  1.00 69.69  ? 1039 HOH A O   1 
HETATM 4606 O O   . HOH C 3 .   ? 38.203  -32.216 47.015  1.00 85.38  ? 1040 HOH A O   1 
HETATM 4607 O O   . HOH C 3 .   ? 42.349  -36.314 48.507  1.00 69.72  ? 1041 HOH A O   1 
HETATM 4608 O O   . HOH C 3 .   ? 29.491  -35.321 65.782  1.00 74.96  ? 1042 HOH A O   1 
HETATM 4609 O O   . HOH C 3 .   ? 8.961   -19.786 34.073  1.00 78.78  ? 1043 HOH A O   1 
HETATM 4610 O O   . HOH C 3 .   ? 28.517  -39.063 45.818  1.00 73.53  ? 1044 HOH A O   1 
HETATM 4611 O O   . HOH C 3 .   ? 39.913  -7.567  98.653  1.00 72.01  ? 1046 HOH A O   1 
HETATM 4612 O O   . HOH C 3 .   ? 35.475  -21.880 67.584  1.00 61.08  ? 1047 HOH A O   1 
HETATM 4613 O O   . HOH C 3 .   ? 32.410  -17.014 60.039  1.00 58.27  ? 1048 HOH A O   1 
HETATM 4614 O O   . HOH C 3 .   ? 0.454   -36.057 57.131  1.00 67.48  ? 1049 HOH A O   1 
HETATM 4615 O O   . HOH C 3 .   ? 6.600   -23.273 93.840  1.00 64.26  ? 1050 HOH A O   1 
HETATM 4616 O O   . HOH C 3 .   ? -9.902  -19.792 74.948  1.00 69.12  ? 1051 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  ASP 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  ASP 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  VAL 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  VAL 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  VAL 41  41  ?   ?   ?   A . n 
A 1 42  ALA 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  LEU 44  44  ?   ?   ?   A . n 
A 1 45  LYS 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  ARG 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  ?   ?   ?   A . n 
A 1 50  VAL 50  50  ?   ?   ?   A . n 
A 1 51  LEU 51  51  ?   ?   ?   A . n 
A 1 52  GLU 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  GLU 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLN 59  59  ?   ?   ?   A . n 
A 1 60  PRO 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  ASP 62  62  ?   ?   ?   A . n 
A 1 63  ASP 63  63  ?   ?   ?   A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ARG 288 288 288 ARG ARG A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 HIS 378 378 378 HIS HIS A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 GLU 382 382 382 GLU GLU A . n 
A 1 383 MET 383 383 383 MET MET A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 HIS 385 385 385 HIS HIS A . n 
A 1 386 TYR 386 386 386 TYR TYR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 CYS 388 388 388 CYS CYS A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 CYS 390 390 390 CYS CYS A . n 
A 1 391 TRP 391 391 391 TRP TRP A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 VAL 424 424 424 VAL VAL A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 VAL 427 427 427 VAL VAL A . n 
A 1 428 ALA 428 428 428 ALA ALA A . n 
A 1 429 GLU 429 429 429 GLU GLU A . n 
A 1 430 LYS 430 430 430 LYS LYS A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 LEU 432 432 ?   ?   ?   A . n 
A 1 433 LYS 433 433 ?   ?   ?   A . n 
A 1 434 GLU 434 434 ?   ?   ?   A . n 
A 1 435 PRO 435 435 ?   ?   ?   A . n 
A 1 436 LYS 436 436 ?   ?   ?   A . n 
A 1 437 THR 437 437 ?   ?   ?   A . n 
A 1 438 VAL 438 438 ?   ?   ?   A . n 
A 1 439 ASN 439 439 ?   ?   ?   A . n 
A 1 440 VAL 440 440 ?   ?   ?   A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 GLN 442 442 ?   ?   ?   A . n 
A 1 443 PHE 443 443 ?   ?   ?   A . n 
A 1 444 GLU 444 444 ?   ?   ?   A . n 
A 1 445 PRO 445 445 ?   ?   ?   A . n 
A 1 446 SER 446 446 ?   ?   ?   A . n 
A 1 447 LYS 447 447 ?   ?   ?   A . n 
A 1 448 GLY 448 448 ?   ?   ?   A . n 
A 1 449 ALA 449 449 ?   ?   ?   A . n 
A 1 450 ILE 450 450 ?   ?   ?   A . n 
A 1 451 GLY 451 451 ?   ?   ?   A . n 
A 1 452 LYS 452 452 ?   ?   ?   A . n 
A 1 453 ALA 453 453 ?   ?   ?   A . n 
A 1 454 TYR 454 454 ?   ?   ?   A . n 
A 1 455 LYS 455 455 ?   ?   ?   A . n 
A 1 456 LYS 456 456 ?   ?   ?   A . n 
A 1 457 ASP 457 457 ?   ?   ?   A . n 
A 1 458 ALA 458 458 ?   ?   ?   A . n 
A 1 459 LYS 459 459 ?   ?   ?   A . n 
A 1 460 LEU 460 460 ?   ?   ?   A . n 
A 1 461 VAL 461 461 ?   ?   ?   A . n 
A 1 462 MET 462 462 ?   ?   ?   A . n 
A 1 463 GLU 463 463 ?   ?   ?   A . n 
A 1 464 TYR 464 464 ?   ?   ?   A . n 
A 1 465 LEU 465 465 ?   ?   ?   A . n 
A 1 466 ALA 466 466 ?   ?   ?   A . n 
A 1 467 ILE 467 467 ?   ?   ?   A . n 
A 1 468 CYS 468 468 ?   ?   ?   A . n 
A 1 469 ASP 469 469 ?   ?   ?   A . n 
A 1 470 GLU 470 470 ?   ?   ?   A . n 
A 1 471 CYS 471 471 ?   ?   ?   A . n 
A 1 472 TYR 472 472 ?   ?   ?   A . n 
A 1 473 ILE 473 473 ?   ?   ?   A . n 
A 1 474 THR 474 474 ?   ?   ?   A . n 
A 1 475 GLU 475 475 ?   ?   ?   A . n 
A 1 476 MET 476 476 ?   ?   ?   A . n 
A 1 477 GLU 477 477 ?   ?   ?   A . n 
A 1 478 MET 478 478 ?   ?   ?   A . n 
A 1 479 LEU 479 479 ?   ?   ?   A . n 
A 1 480 LEU 480 480 ?   ?   ?   A . n 
A 1 481 ASN 481 481 ?   ?   ?   A . n 
A 1 482 GLU 482 482 ?   ?   ?   A . n 
A 1 483 LYS 483 483 ?   ?   ?   A . n 
A 1 484 GLY 484 484 ?   ?   ?   A . n 
A 1 485 GLU 485 485 ?   ?   ?   A . n 
A 1 486 PHE 486 486 ?   ?   ?   A . n 
A 1 487 THR 487 487 ?   ?   ?   A . n 
A 1 488 ILE 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 THR 490 490 ?   ?   ?   A . n 
A 1 491 GLU 491 491 ?   ?   ?   A . n 
A 1 492 GLY 492 492 ?   ?   ?   A . n 
A 1 493 LYS 493 493 ?   ?   ?   A . n 
A 1 494 THR 494 494 ?   ?   ?   A . n 
A 1 495 PHE 495 495 ?   ?   ?   A . n 
A 1 496 GLN 496 496 ?   ?   ?   A . n 
A 1 497 LEU 497 497 ?   ?   ?   A . n 
A 1 498 THR 498 498 ?   ?   ?   A . n 
A 1 499 LYS 499 499 ?   ?   ?   A . n 
A 1 500 ASP 500 500 ?   ?   ?   A . n 
A 1 501 MET 501 501 ?   ?   ?   A . n 
A 1 502 ILE 502 502 ?   ?   ?   A . n 
A 1 503 ASN 503 503 ?   ?   ?   A . n 
A 1 504 VAL 504 504 ?   ?   ?   A . n 
A 1 505 LYS 505 505 ?   ?   ?   A . n 
A 1 506 ARG 506 506 ?   ?   ?   A . n 
A 1 507 PHE 507 507 ?   ?   ?   A . n 
A 1 508 GLN 508 508 ?   ?   ?   A . n 
A 1 509 LYS 509 509 ?   ?   ?   A . n 
A 1 510 THR 510 510 ?   ?   ?   A . n 
A 1 511 LEU 511 511 ?   ?   ?   A . n 
A 1 512 TYR 512 512 512 TYR TYR A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ARG 529 529 529 ARG ARG A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 MET 531 531 531 MET MET A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 THR 533 533 533 THR THR A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 HIS 540 540 540 HIS HIS A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ARG 542 542 542 ARG ARG A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 PHE 553 553 553 PHE PHE A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PRO 559 559 559 PRO PRO A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 PHE 573 573 573 PHE PHE A . n 
A 1 574 MET 574 574 574 MET MET A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 SER 581 581 581 SER SER A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 HIS 591 591 591 HIS HIS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 SER 596 596 596 SER SER A . n 
A 1 597 SER 597 597 597 SER SER A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 SER 599 599 599 SER SER A . n 
A 1 600 ILE 600 600 600 ILE ILE A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ARG 602 602 602 ARG ARG A . n 
A 1 603 ARG 603 603 603 ARG ARG A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 ALA 605 605 605 ALA ALA A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 ASP 608 608 608 ASP ASP A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 PHE 614 614 614 PHE PHE A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 THR 617 617 617 THR THR A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ASP 619 619 619 ASP ASP A . n 
A 1 620 PHE 620 620 620 PHE PHE A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 VAL 623 623 623 VAL VAL A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LYS 625 625 625 LYS LYS A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 PRO 627 627 627 PRO PRO A . n 
A 1 628 HIS 628 628 628 HIS HIS A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ARG 633 633 633 ARG ARG A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 ARG 635 635 635 ARG ARG A . n 
A 1 636 ASP 636 636 636 ASP ASP A . n 
A 1 637 SER 637 637 637 SER SER A . n 
A 1 638 MET 638 638 638 MET MET A . n 
A 1 639 ARG 639 639 639 ARG ARG A . n 
A 1 640 GLN 640 640 640 GLN GLN A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 PRO 649 649 649 PRO PRO A . n 
A 1 650 SER 650 650 650 SER SER A . n 
A 1 651 ILE 651 651 651 ILE ILE A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 GLN 653 653 653 GLN GLN A . n 
A 1 654 ASP 654 654 654 ASP ASP A . n 
A 1 655 LEU 655 655 655 LEU LEU A . n 
A 1 656 ALA 656 656 656 ALA ALA A . n 
A 1 657 ASN 657 657 657 ASN ASN A . n 
A 1 658 GLY 658 658 658 GLY GLY A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 TRP 662 662 662 TRP TRP A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 VAL 665 665 665 VAL VAL A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 ALA 667 667 667 ALA ALA A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 TYR 669 669 669 TYR TYR A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 PHE 672 672 672 PHE PHE A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 GLY 674 674 ?   ?   ?   A . n 
A 1 675 GLN 675 675 ?   ?   ?   A . n 
A 1 676 GLU 676 676 ?   ?   ?   A . n 
A 1 677 THR 677 677 ?   ?   ?   A . n 
A 1 678 GLY 678 678 ?   ?   ?   A . n 
A 1 679 LYS 679 679 ?   ?   ?   A . n 
A 1 680 LYS 680 680 ?   ?   ?   A . n 
A 1 681 GLU 681 681 ?   ?   ?   A . n 
A 1 682 THR 682 682 ?   ?   ?   A . n 
A 1 683 ILE 683 683 ?   ?   ?   A . n 
A 1 684 GLU 684 684 ?   ?   ?   A . n 
A 1 685 GLU 685 685 ?   ?   ?   A . n 
A 1 686 LEU 686 686 ?   ?   ?   A . n 
A 1 687 GLU 687 687 ?   ?   ?   A . n 
A 1 688 HIS 688 688 ?   ?   ?   A . n 
A 1 689 HIS 689 689 ?   ?   ?   A . n 
A 1 690 HIS 690 690 ?   ?   ?   A . n 
A 1 691 HIS 691 691 ?   ?   ?   A . n 
A 1 692 HIS 692 692 ?   ?   ?   A . n 
A 1 693 HIS 693 693 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7630  ? 
1 MORE         -40.7 ? 
1 'SSA (A^2)'  44070 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 132.9430000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-25 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
CNS      refinement        . ? 2 
HKL-2000 'data reduction'  . ? 3 
HKL-2000 'data scaling'    . ? 4 
CNS      phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 86  ? ? -64.56  5.75    
2  1 PHE A 115 ? ? -111.93 -71.43  
3  1 LYS A 153 ? ? -61.45  -92.97  
4  1 GLN A 191 ? ? -147.61 13.59   
5  1 THR A 214 ? ? 37.07   55.02   
6  1 ASN A 261 ? ? -96.23  31.73   
7  1 ARG A 283 ? ? -149.09 39.84   
8  1 LYS A 306 ? ? -68.73  53.03   
9  1 ASN A 348 ? ? -29.18  -81.04  
10 1 ASN A 349 ? ? -114.69 -165.58 
11 1 MET A 383 ? ? -39.61  142.10  
12 1 ARG A 410 ? ? -54.08  77.13   
13 1 SER A 411 ? ? -17.23  -112.39 
14 1 GLN A 571 ? ? -61.16  3.19    
15 1 SER A 596 ? ? -39.80  148.55  
16 1 ASP A 619 ? ? -101.94 -169.02 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C4E ? A B4P 1101 ? 'WRONG HAND' . 
2 1 C3E ? A B4P 1101 ? 'WRONG HAND' . 
3 1 C4F ? A B4P 1101 ? 'WRONG HAND' . 
4 1 C3F ? A B4P 1101 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A ALA 6   ? A ALA 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A LEU 10  ? A LEU 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A LEU 15  ? A LEU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A ASP 22  ? A ASP 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LYS 28  ? A LYS 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A ASP 30  ? A ASP 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A VAL 35  ? A VAL 35  
36  1 Y 1 A ASP 36  ? A ASP 36  
37  1 Y 1 A VAL 37  ? A VAL 37  
38  1 Y 1 A ASP 38  ? A ASP 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A VAL 41  ? A VAL 41  
42  1 Y 1 A ALA 42  ? A ALA 42  
43  1 Y 1 A GLU 43  ? A GLU 43  
44  1 Y 1 A LEU 44  ? A LEU 44  
45  1 Y 1 A LYS 45  ? A LYS 45  
46  1 Y 1 A ALA 46  ? A ALA 46  
47  1 Y 1 A ARG 47  ? A ARG 47  
48  1 Y 1 A LYS 48  ? A LYS 48  
49  1 Y 1 A ARG 49  ? A ARG 49  
50  1 Y 1 A VAL 50  ? A VAL 50  
51  1 Y 1 A LEU 51  ? A LEU 51  
52  1 Y 1 A GLU 52  ? A GLU 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A LYS 54  ? A LYS 54  
55  1 Y 1 A GLU 55  ? A GLU 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A LEU 58  ? A LEU 58  
59  1 Y 1 A GLN 59  ? A GLN 59  
60  1 Y 1 A PRO 60  ? A PRO 60  
61  1 Y 1 A LYS 61  ? A LYS 61  
62  1 Y 1 A ASP 62  ? A ASP 62  
63  1 Y 1 A ASP 63  ? A ASP 63  
64  1 Y 1 A LEU 432 ? A LEU 432 
65  1 Y 1 A LYS 433 ? A LYS 433 
66  1 Y 1 A GLU 434 ? A GLU 434 
67  1 Y 1 A PRO 435 ? A PRO 435 
68  1 Y 1 A LYS 436 ? A LYS 436 
69  1 Y 1 A THR 437 ? A THR 437 
70  1 Y 1 A VAL 438 ? A VAL 438 
71  1 Y 1 A ASN 439 ? A ASN 439 
72  1 Y 1 A VAL 440 ? A VAL 440 
73  1 Y 1 A VAL 441 ? A VAL 441 
74  1 Y 1 A GLN 442 ? A GLN 442 
75  1 Y 1 A PHE 443 ? A PHE 443 
76  1 Y 1 A GLU 444 ? A GLU 444 
77  1 Y 1 A PRO 445 ? A PRO 445 
78  1 Y 1 A SER 446 ? A SER 446 
79  1 Y 1 A LYS 447 ? A LYS 447 
80  1 Y 1 A GLY 448 ? A GLY 448 
81  1 Y 1 A ALA 449 ? A ALA 449 
82  1 Y 1 A ILE 450 ? A ILE 450 
83  1 Y 1 A GLY 451 ? A GLY 451 
84  1 Y 1 A LYS 452 ? A LYS 452 
85  1 Y 1 A ALA 453 ? A ALA 453 
86  1 Y 1 A TYR 454 ? A TYR 454 
87  1 Y 1 A LYS 455 ? A LYS 455 
88  1 Y 1 A LYS 456 ? A LYS 456 
89  1 Y 1 A ASP 457 ? A ASP 457 
90  1 Y 1 A ALA 458 ? A ALA 458 
91  1 Y 1 A LYS 459 ? A LYS 459 
92  1 Y 1 A LEU 460 ? A LEU 460 
93  1 Y 1 A VAL 461 ? A VAL 461 
94  1 Y 1 A MET 462 ? A MET 462 
95  1 Y 1 A GLU 463 ? A GLU 463 
96  1 Y 1 A TYR 464 ? A TYR 464 
97  1 Y 1 A LEU 465 ? A LEU 465 
98  1 Y 1 A ALA 466 ? A ALA 466 
99  1 Y 1 A ILE 467 ? A ILE 467 
100 1 Y 1 A CYS 468 ? A CYS 468 
101 1 Y 1 A ASP 469 ? A ASP 469 
102 1 Y 1 A GLU 470 ? A GLU 470 
103 1 Y 1 A CYS 471 ? A CYS 471 
104 1 Y 1 A TYR 472 ? A TYR 472 
105 1 Y 1 A ILE 473 ? A ILE 473 
106 1 Y 1 A THR 474 ? A THR 474 
107 1 Y 1 A GLU 475 ? A GLU 475 
108 1 Y 1 A MET 476 ? A MET 476 
109 1 Y 1 A GLU 477 ? A GLU 477 
110 1 Y 1 A MET 478 ? A MET 478 
111 1 Y 1 A LEU 479 ? A LEU 479 
112 1 Y 1 A LEU 480 ? A LEU 480 
113 1 Y 1 A ASN 481 ? A ASN 481 
114 1 Y 1 A GLU 482 ? A GLU 482 
115 1 Y 1 A LYS 483 ? A LYS 483 
116 1 Y 1 A GLY 484 ? A GLY 484 
117 1 Y 1 A GLU 485 ? A GLU 485 
118 1 Y 1 A PHE 486 ? A PHE 486 
119 1 Y 1 A THR 487 ? A THR 487 
120 1 Y 1 A ILE 488 ? A ILE 488 
121 1 Y 1 A GLU 489 ? A GLU 489 
122 1 Y 1 A THR 490 ? A THR 490 
123 1 Y 1 A GLU 491 ? A GLU 491 
124 1 Y 1 A GLY 492 ? A GLY 492 
125 1 Y 1 A LYS 493 ? A LYS 493 
126 1 Y 1 A THR 494 ? A THR 494 
127 1 Y 1 A PHE 495 ? A PHE 495 
128 1 Y 1 A GLN 496 ? A GLN 496 
129 1 Y 1 A LEU 497 ? A LEU 497 
130 1 Y 1 A THR 498 ? A THR 498 
131 1 Y 1 A LYS 499 ? A LYS 499 
132 1 Y 1 A ASP 500 ? A ASP 500 
133 1 Y 1 A MET 501 ? A MET 501 
134 1 Y 1 A ILE 502 ? A ILE 502 
135 1 Y 1 A ASN 503 ? A ASN 503 
136 1 Y 1 A VAL 504 ? A VAL 504 
137 1 Y 1 A LYS 505 ? A LYS 505 
138 1 Y 1 A ARG 506 ? A ARG 506 
139 1 Y 1 A PHE 507 ? A PHE 507 
140 1 Y 1 A GLN 508 ? A GLN 508 
141 1 Y 1 A LYS 509 ? A LYS 509 
142 1 Y 1 A THR 510 ? A THR 510 
143 1 Y 1 A LEU 511 ? A LEU 511 
144 1 Y 1 A GLY 674 ? A GLY 674 
145 1 Y 1 A GLN 675 ? A GLN 675 
146 1 Y 1 A GLU 676 ? A GLU 676 
147 1 Y 1 A THR 677 ? A THR 677 
148 1 Y 1 A GLY 678 ? A GLY 678 
149 1 Y 1 A LYS 679 ? A LYS 679 
150 1 Y 1 A LYS 680 ? A LYS 680 
151 1 Y 1 A GLU 681 ? A GLU 681 
152 1 Y 1 A THR 682 ? A THR 682 
153 1 Y 1 A ILE 683 ? A ILE 683 
154 1 Y 1 A GLU 684 ? A GLU 684 
155 1 Y 1 A GLU 685 ? A GLU 685 
156 1 Y 1 A LEU 686 ? A LEU 686 
157 1 Y 1 A GLU 687 ? A GLU 687 
158 1 Y 1 A HIS 688 ? A HIS 688 
159 1 Y 1 A HIS 689 ? A HIS 689 
160 1 Y 1 A HIS 690 ? A HIS 690 
161 1 Y 1 A HIS 691 ? A HIS 691 
162 1 Y 1 A HIS 692 ? A HIS 692 
163 1 Y 1 A HIS 693 ? A HIS 693 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" B4P 
3 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 B4P 1   1101 1101 B4P DRG A . 
C 3 HOH 1   700  700  HOH WAT A . 
C 3 HOH 2   701  701  HOH WAT A . 
C 3 HOH 3   702  702  HOH WAT A . 
C 3 HOH 4   703  703  HOH WAT A . 
C 3 HOH 5   704  704  HOH WAT A . 
C 3 HOH 6   705  705  HOH WAT A . 
C 3 HOH 7   706  706  HOH WAT A . 
C 3 HOH 8   707  707  HOH WAT A . 
C 3 HOH 9   708  708  HOH WAT A . 
C 3 HOH 10  709  709  HOH WAT A . 
C 3 HOH 11  710  710  HOH WAT A . 
C 3 HOH 12  711  711  HOH WAT A . 
C 3 HOH 13  712  712  HOH WAT A . 
C 3 HOH 14  713  713  HOH WAT A . 
C 3 HOH 15  714  714  HOH WAT A . 
C 3 HOH 16  715  715  HOH WAT A . 
C 3 HOH 17  716  716  HOH WAT A . 
C 3 HOH 18  717  717  HOH WAT A . 
C 3 HOH 19  718  718  HOH WAT A . 
C 3 HOH 20  719  719  HOH WAT A . 
C 3 HOH 21  720  720  HOH WAT A . 
C 3 HOH 22  721  721  HOH WAT A . 
C 3 HOH 23  722  722  HOH WAT A . 
C 3 HOH 24  723  723  HOH WAT A . 
C 3 HOH 25  724  724  HOH WAT A . 
C 3 HOH 26  725  725  HOH WAT A . 
C 3 HOH 27  726  726  HOH WAT A . 
C 3 HOH 28  727  727  HOH WAT A . 
C 3 HOH 29  728  728  HOH WAT A . 
C 3 HOH 30  729  729  HOH WAT A . 
C 3 HOH 31  730  730  HOH WAT A . 
C 3 HOH 32  731  731  HOH WAT A . 
C 3 HOH 33  732  732  HOH WAT A . 
C 3 HOH 34  733  733  HOH WAT A . 
C 3 HOH 35  734  734  HOH WAT A . 
C 3 HOH 36  735  735  HOH WAT A . 
C 3 HOH 37  736  736  HOH WAT A . 
C 3 HOH 38  737  737  HOH WAT A . 
C 3 HOH 39  738  738  HOH WAT A . 
C 3 HOH 40  739  739  HOH WAT A . 
C 3 HOH 41  740  740  HOH WAT A . 
C 3 HOH 42  741  741  HOH WAT A . 
C 3 HOH 43  742  742  HOH WAT A . 
C 3 HOH 44  743  743  HOH WAT A . 
C 3 HOH 45  744  744  HOH WAT A . 
C 3 HOH 46  745  745  HOH WAT A . 
C 3 HOH 47  746  746  HOH WAT A . 
C 3 HOH 48  747  747  HOH WAT A . 
C 3 HOH 49  748  748  HOH WAT A . 
C 3 HOH 50  749  749  HOH WAT A . 
C 3 HOH 51  750  750  HOH WAT A . 
C 3 HOH 52  751  751  HOH WAT A . 
C 3 HOH 53  752  752  HOH WAT A . 
C 3 HOH 54  753  753  HOH WAT A . 
C 3 HOH 55  754  754  HOH WAT A . 
C 3 HOH 56  755  755  HOH WAT A . 
C 3 HOH 57  756  756  HOH WAT A . 
C 3 HOH 58  757  757  HOH WAT A . 
C 3 HOH 59  758  758  HOH WAT A . 
C 3 HOH 60  759  759  HOH WAT A . 
C 3 HOH 61  760  760  HOH WAT A . 
C 3 HOH 62  761  761  HOH WAT A . 
C 3 HOH 63  762  762  HOH WAT A . 
C 3 HOH 64  763  763  HOH WAT A . 
C 3 HOH 65  764  764  HOH WAT A . 
C 3 HOH 66  765  765  HOH WAT A . 
C 3 HOH 67  766  766  HOH WAT A . 
C 3 HOH 68  767  767  HOH WAT A . 
C 3 HOH 69  768  768  HOH WAT A . 
C 3 HOH 70  769  769  HOH WAT A . 
C 3 HOH 71  770  770  HOH WAT A . 
C 3 HOH 72  771  771  HOH WAT A . 
C 3 HOH 73  772  772  HOH WAT A . 
C 3 HOH 74  773  773  HOH WAT A . 
C 3 HOH 75  774  774  HOH WAT A . 
C 3 HOH 76  775  775  HOH WAT A . 
C 3 HOH 77  776  776  HOH WAT A . 
C 3 HOH 78  777  777  HOH WAT A . 
C 3 HOH 79  778  778  HOH WAT A . 
C 3 HOH 80  779  779  HOH WAT A . 
C 3 HOH 81  780  780  HOH WAT A . 
C 3 HOH 82  781  781  HOH WAT A . 
C 3 HOH 83  782  782  HOH WAT A . 
C 3 HOH 84  783  783  HOH WAT A . 
C 3 HOH 85  784  784  HOH WAT A . 
C 3 HOH 86  785  785  HOH WAT A . 
C 3 HOH 87  786  786  HOH WAT A . 
C 3 HOH 88  787  787  HOH WAT A . 
C 3 HOH 89  788  788  HOH WAT A . 
C 3 HOH 90  789  789  HOH WAT A . 
C 3 HOH 91  790  790  HOH WAT A . 
C 3 HOH 92  791  791  HOH WAT A . 
C 3 HOH 93  792  792  HOH WAT A . 
C 3 HOH 94  793  793  HOH WAT A . 
C 3 HOH 95  794  794  HOH WAT A . 
C 3 HOH 96  795  795  HOH WAT A . 
C 3 HOH 97  796  796  HOH WAT A . 
C 3 HOH 98  797  797  HOH WAT A . 
C 3 HOH 99  798  798  HOH WAT A . 
C 3 HOH 100 799  799  HOH WAT A . 
C 3 HOH 101 800  800  HOH WAT A . 
C 3 HOH 102 801  801  HOH WAT A . 
C 3 HOH 103 802  802  HOH WAT A . 
C 3 HOH 104 803  803  HOH WAT A . 
C 3 HOH 105 804  804  HOH WAT A . 
C 3 HOH 106 805  805  HOH WAT A . 
C 3 HOH 107 806  806  HOH WAT A . 
C 3 HOH 108 807  807  HOH WAT A . 
C 3 HOH 109 808  808  HOH WAT A . 
C 3 HOH 110 809  809  HOH WAT A . 
C 3 HOH 111 810  810  HOH WAT A . 
C 3 HOH 112 811  811  HOH WAT A . 
C 3 HOH 113 812  812  HOH WAT A . 
C 3 HOH 114 813  813  HOH WAT A . 
C 3 HOH 115 814  814  HOH WAT A . 
C 3 HOH 116 815  815  HOH WAT A . 
C 3 HOH 117 816  816  HOH WAT A . 
C 3 HOH 118 817  817  HOH WAT A . 
C 3 HOH 119 818  818  HOH WAT A . 
C 3 HOH 120 819  819  HOH WAT A . 
C 3 HOH 121 820  820  HOH WAT A . 
C 3 HOH 122 821  821  HOH WAT A . 
C 3 HOH 123 822  822  HOH WAT A . 
C 3 HOH 124 823  823  HOH WAT A . 
C 3 HOH 125 824  824  HOH WAT A . 
C 3 HOH 126 825  825  HOH WAT A . 
C 3 HOH 127 826  826  HOH WAT A . 
C 3 HOH 128 827  827  HOH WAT A . 
C 3 HOH 129 828  828  HOH WAT A . 
C 3 HOH 130 829  829  HOH WAT A . 
C 3 HOH 131 830  830  HOH WAT A . 
C 3 HOH 132 831  831  HOH WAT A . 
C 3 HOH 133 832  832  HOH WAT A . 
C 3 HOH 134 833  833  HOH WAT A . 
C 3 HOH 135 834  834  HOH WAT A . 
C 3 HOH 136 835  835  HOH WAT A . 
C 3 HOH 137 836  836  HOH WAT A . 
C 3 HOH 138 837  837  HOH WAT A . 
C 3 HOH 139 838  838  HOH WAT A . 
C 3 HOH 140 839  839  HOH WAT A . 
C 3 HOH 141 840  840  HOH WAT A . 
C 3 HOH 142 841  841  HOH WAT A . 
C 3 HOH 143 842  842  HOH WAT A . 
C 3 HOH 144 843  843  HOH WAT A . 
C 3 HOH 145 844  844  HOH WAT A . 
C 3 HOH 146 845  845  HOH WAT A . 
C 3 HOH 147 846  846  HOH WAT A . 
C 3 HOH 148 847  847  HOH WAT A . 
C 3 HOH 149 848  848  HOH WAT A . 
C 3 HOH 150 849  849  HOH WAT A . 
C 3 HOH 151 850  850  HOH WAT A . 
C 3 HOH 152 851  851  HOH WAT A . 
C 3 HOH 153 852  852  HOH WAT A . 
C 3 HOH 154 853  853  HOH WAT A . 
C 3 HOH 155 854  854  HOH WAT A . 
C 3 HOH 156 855  855  HOH WAT A . 
C 3 HOH 157 856  856  HOH WAT A . 
C 3 HOH 158 857  857  HOH WAT A . 
C 3 HOH 159 858  858  HOH WAT A . 
C 3 HOH 160 859  859  HOH WAT A . 
C 3 HOH 161 860  860  HOH WAT A . 
C 3 HOH 162 861  861  HOH WAT A . 
C 3 HOH 163 862  862  HOH WAT A . 
C 3 HOH 164 863  863  HOH WAT A . 
C 3 HOH 165 864  864  HOH WAT A . 
C 3 HOH 166 865  865  HOH WAT A . 
C 3 HOH 167 866  866  HOH WAT A . 
C 3 HOH 168 867  867  HOH WAT A . 
C 3 HOH 169 868  868  HOH WAT A . 
C 3 HOH 170 869  869  HOH WAT A . 
C 3 HOH 171 870  870  HOH WAT A . 
C 3 HOH 172 871  871  HOH WAT A . 
C 3 HOH 173 872  872  HOH WAT A . 
C 3 HOH 174 873  873  HOH WAT A . 
C 3 HOH 175 874  874  HOH WAT A . 
C 3 HOH 176 875  875  HOH WAT A . 
C 3 HOH 177 876  876  HOH WAT A . 
C 3 HOH 178 877  877  HOH WAT A . 
C 3 HOH 179 878  878  HOH WAT A . 
C 3 HOH 180 879  879  HOH WAT A . 
C 3 HOH 181 880  880  HOH WAT A . 
C 3 HOH 182 881  881  HOH WAT A . 
C 3 HOH 183 882  882  HOH WAT A . 
C 3 HOH 184 883  883  HOH WAT A . 
C 3 HOH 185 884  884  HOH WAT A . 
C 3 HOH 186 885  885  HOH WAT A . 
C 3 HOH 187 886  886  HOH WAT A . 
C 3 HOH 188 887  887  HOH WAT A . 
C 3 HOH 189 888  888  HOH WAT A . 
C 3 HOH 190 889  889  HOH WAT A . 
C 3 HOH 191 890  890  HOH WAT A . 
C 3 HOH 192 891  891  HOH WAT A . 
C 3 HOH 193 892  892  HOH WAT A . 
C 3 HOH 194 893  893  HOH WAT A . 
C 3 HOH 195 894  894  HOH WAT A . 
C 3 HOH 196 895  895  HOH WAT A . 
C 3 HOH 197 896  896  HOH WAT A . 
C 3 HOH 198 897  897  HOH WAT A . 
C 3 HOH 199 898  898  HOH WAT A . 
C 3 HOH 200 899  899  HOH WAT A . 
C 3 HOH 201 900  900  HOH WAT A . 
C 3 HOH 202 901  901  HOH WAT A . 
C 3 HOH 203 902  902  HOH WAT A . 
C 3 HOH 204 903  903  HOH WAT A . 
C 3 HOH 205 904  904  HOH WAT A . 
C 3 HOH 206 905  905  HOH WAT A . 
C 3 HOH 207 906  906  HOH WAT A . 
C 3 HOH 208 907  907  HOH WAT A . 
C 3 HOH 209 908  908  HOH WAT A . 
C 3 HOH 210 909  909  HOH WAT A . 
C 3 HOH 211 910  910  HOH WAT A . 
C 3 HOH 212 911  911  HOH WAT A . 
C 3 HOH 213 912  912  HOH WAT A . 
C 3 HOH 214 913  913  HOH WAT A . 
C 3 HOH 215 914  914  HOH WAT A . 
C 3 HOH 216 915  915  HOH WAT A . 
C 3 HOH 217 916  916  HOH WAT A . 
C 3 HOH 218 917  917  HOH WAT A . 
C 3 HOH 219 918  918  HOH WAT A . 
C 3 HOH 220 919  919  HOH WAT A . 
C 3 HOH 221 920  920  HOH WAT A . 
C 3 HOH 222 921  921  HOH WAT A . 
C 3 HOH 223 922  922  HOH WAT A . 
C 3 HOH 224 923  923  HOH WAT A . 
C 3 HOH 225 924  924  HOH WAT A . 
C 3 HOH 226 925  925  HOH WAT A . 
C 3 HOH 227 926  926  HOH WAT A . 
C 3 HOH 228 927  927  HOH WAT A . 
C 3 HOH 229 928  928  HOH WAT A . 
C 3 HOH 230 929  929  HOH WAT A . 
C 3 HOH 231 930  930  HOH WAT A . 
C 3 HOH 232 931  931  HOH WAT A . 
C 3 HOH 233 932  932  HOH WAT A . 
C 3 HOH 234 933  933  HOH WAT A . 
C 3 HOH 235 934  934  HOH WAT A . 
C 3 HOH 236 935  935  HOH WAT A . 
C 3 HOH 237 936  936  HOH WAT A . 
C 3 HOH 238 937  937  HOH WAT A . 
C 3 HOH 239 938  938  HOH WAT A . 
C 3 HOH 240 939  939  HOH WAT A . 
C 3 HOH 241 940  940  HOH WAT A . 
C 3 HOH 242 941  941  HOH WAT A . 
C 3 HOH 243 942  942  HOH WAT A . 
C 3 HOH 244 943  943  HOH WAT A . 
C 3 HOH 245 944  944  HOH WAT A . 
C 3 HOH 246 945  945  HOH WAT A . 
C 3 HOH 247 946  946  HOH WAT A . 
C 3 HOH 248 947  947  HOH WAT A . 
C 3 HOH 249 948  948  HOH WAT A . 
C 3 HOH 250 949  949  HOH WAT A . 
C 3 HOH 251 950  950  HOH WAT A . 
C 3 HOH 252 951  951  HOH WAT A . 
C 3 HOH 253 952  952  HOH WAT A . 
C 3 HOH 254 953  953  HOH WAT A . 
C 3 HOH 255 954  954  HOH WAT A . 
C 3 HOH 256 955  955  HOH WAT A . 
C 3 HOH 257 956  956  HOH WAT A . 
C 3 HOH 258 957  957  HOH WAT A . 
C 3 HOH 259 958  958  HOH WAT A . 
C 3 HOH 260 959  959  HOH WAT A . 
C 3 HOH 261 960  960  HOH WAT A . 
C 3 HOH 262 961  961  HOH WAT A . 
C 3 HOH 263 962  962  HOH WAT A . 
C 3 HOH 264 963  963  HOH WAT A . 
C 3 HOH 265 964  964  HOH WAT A . 
C 3 HOH 266 965  965  HOH WAT A . 
C 3 HOH 267 966  966  HOH WAT A . 
C 3 HOH 268 967  967  HOH WAT A . 
C 3 HOH 269 968  968  HOH WAT A . 
C 3 HOH 270 969  969  HOH WAT A . 
C 3 HOH 271 970  970  HOH WAT A . 
C 3 HOH 272 971  971  HOH WAT A . 
C 3 HOH 273 972  972  HOH WAT A . 
C 3 HOH 274 973  973  HOH WAT A . 
C 3 HOH 275 974  974  HOH WAT A . 
C 3 HOH 276 975  975  HOH WAT A . 
C 3 HOH 277 976  976  HOH WAT A . 
C 3 HOH 278 977  977  HOH WAT A . 
C 3 HOH 279 978  978  HOH WAT A . 
C 3 HOH 280 979  979  HOH WAT A . 
C 3 HOH 281 980  980  HOH WAT A . 
C 3 HOH 282 981  981  HOH WAT A . 
C 3 HOH 283 982  982  HOH WAT A . 
C 3 HOH 284 983  983  HOH WAT A . 
C 3 HOH 285 984  984  HOH WAT A . 
C 3 HOH 286 985  985  HOH WAT A . 
C 3 HOH 287 987  987  HOH WAT A . 
C 3 HOH 288 988  988  HOH WAT A . 
C 3 HOH 289 989  989  HOH WAT A . 
C 3 HOH 290 991  991  HOH WAT A . 
C 3 HOH 291 992  992  HOH WAT A . 
C 3 HOH 292 993  993  HOH WAT A . 
C 3 HOH 293 994  994  HOH WAT A . 
C 3 HOH 294 995  995  HOH WAT A . 
C 3 HOH 295 996  996  HOH WAT A . 
C 3 HOH 296 997  997  HOH WAT A . 
C 3 HOH 297 998  998  HOH WAT A . 
C 3 HOH 298 1003 1003 HOH WAT A . 
C 3 HOH 299 1004 1004 HOH WAT A . 
C 3 HOH 300 1005 1005 HOH WAT A . 
C 3 HOH 301 1006 1006 HOH WAT A . 
C 3 HOH 302 1007 1007 HOH WAT A . 
C 3 HOH 303 1008 1008 HOH WAT A . 
C 3 HOH 304 1009 1009 HOH WAT A . 
C 3 HOH 305 1010 1010 HOH WAT A . 
C 3 HOH 306 1011 1011 HOH WAT A . 
C 3 HOH 307 1012 1012 HOH WAT A . 
C 3 HOH 308 1014 1014 HOH WAT A . 
C 3 HOH 309 1015 1015 HOH WAT A . 
C 3 HOH 310 1020 1020 HOH WAT A . 
C 3 HOH 311 1021 1021 HOH WAT A . 
C 3 HOH 312 1026 1026 HOH WAT A . 
C 3 HOH 313 1027 1027 HOH WAT A . 
C 3 HOH 314 1028 1028 HOH WAT A . 
C 3 HOH 315 1029 1029 HOH WAT A . 
C 3 HOH 316 1030 1030 HOH WAT A . 
C 3 HOH 317 1031 1031 HOH WAT A . 
C 3 HOH 318 1032 1032 HOH WAT A . 
C 3 HOH 319 1033 1033 HOH WAT A . 
C 3 HOH 320 1034 1034 HOH WAT A . 
C 3 HOH 321 1035 1035 HOH WAT A . 
C 3 HOH 322 1036 1036 HOH WAT A . 
C 3 HOH 323 1037 1037 HOH WAT A . 
C 3 HOH 324 1039 1039 HOH WAT A . 
C 3 HOH 325 1040 1040 HOH WAT A . 
C 3 HOH 326 1041 1041 HOH WAT A . 
C 3 HOH 327 1042 1042 HOH WAT A . 
C 3 HOH 328 1043 1043 HOH WAT A . 
C 3 HOH 329 1044 1044 HOH WAT A . 
C 3 HOH 330 1046 1046 HOH WAT A . 
C 3 HOH 331 1047 1047 HOH WAT A . 
C 3 HOH 332 1048 1048 HOH WAT A . 
C 3 HOH 333 1049 1049 HOH WAT A . 
C 3 HOH 334 1050 1050 HOH WAT A . 
C 3 HOH 335 1051 1051 HOH WAT A . 
#