data_2ZUQ
# 
_entry.id   2ZUQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2ZUQ         pdb_00002zuq 10.2210/pdb2zuq/pdb 
RCSB  RCSB028449   ?            ?                   
WWPDB D_1000028449 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HI7 'The same protein complexed with DsbA' unspecified 
PDB 2ZUP 'The same protein complexed with DsbA' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ZUQ 
_pdbx_database_status.recvd_initial_deposition_date   2008-10-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inaba, K.'    1 
'Suzuki, M.'   2 
'Murakami, S.' 3 
# 
_citation.id                        primary 
_citation.title                     'Dynamic nature of disulphide bond formation catalysts revealed by crystal structures of DsbB' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            28 
_citation.page_first                779 
_citation.page_last                 791 
_citation.year                      2009 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19214188 
_citation.pdbx_database_id_DOI      10.1038/emboj.2009.21 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Inaba, K.'    1 ? 
primary 'Murakami, S.' 2 ? 
primary 'Nakagawa, A.' 3 ? 
primary 'Iida, H.'     4 ? 
primary 'Kinjo, M.'    5 ? 
primary 'Ito, K.'      6 ? 
primary 'Suzuki, M.'   7 ? 
# 
_cell.entry_id           2ZUQ 
_cell.length_a           269.307 
_cell.length_b           51.480 
_cell.length_c           125.845 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.89 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ZUQ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Disulfide bond formation protein B' 20106.982 2 1.8.5.- C8A,C41S,C49V ? ? 
2 polymer     nat 'Fab fragment light chain'           26364.410 2 ?       ?             ? ? 
3 polymer     nat 'Fab fragment heavy chain'           23666.453 2 ?       ?             ? ? 
4 non-polymer syn UBIQUINONE-1                         250.290   2 ?       ?             ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DsbB, Disulfide oxidoreductase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
;MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
A,D ? 
2 'polypeptide(L)' no no 
;MDSQAQVLILLLLWVSGTCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCF
LNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;MDSQAQVLILLLLWVSGTCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCF
LNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
B,E ? 
3 'polypeptide(L)' no no 
;EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
;
;EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ARG n 
1 4   PHE n 
1 5   LEU n 
1 6   ASN n 
1 7   GLN n 
1 8   ALA n 
1 9   SER n 
1 10  GLN n 
1 11  GLY n 
1 12  ARG n 
1 13  GLY n 
1 14  ALA n 
1 15  TRP n 
1 16  LEU n 
1 17  LEU n 
1 18  MET n 
1 19  ALA n 
1 20  PHE n 
1 21  THR n 
1 22  ALA n 
1 23  LEU n 
1 24  ALA n 
1 25  LEU n 
1 26  GLU n 
1 27  LEU n 
1 28  THR n 
1 29  ALA n 
1 30  LEU n 
1 31  TRP n 
1 32  PHE n 
1 33  GLN n 
1 34  HIS n 
1 35  VAL n 
1 36  MET n 
1 37  LEU n 
1 38  LEU n 
1 39  LYS n 
1 40  PRO n 
1 41  SER n 
1 42  VAL n 
1 43  LEU n 
1 44  CYS n 
1 45  ILE n 
1 46  TYR n 
1 47  GLU n 
1 48  ARG n 
1 49  VAL n 
1 50  ALA n 
1 51  LEU n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  ALA n 
1 59  LEU n 
1 60  ILE n 
1 61  GLY n 
1 62  ALA n 
1 63  ILE n 
1 64  ALA n 
1 65  PRO n 
1 66  LYS n 
1 67  THR n 
1 68  PRO n 
1 69  LEU n 
1 70  ARG n 
1 71  TYR n 
1 72  VAL n 
1 73  ALA n 
1 74  MET n 
1 75  VAL n 
1 76  ILE n 
1 77  TRP n 
1 78  LEU n 
1 79  TYR n 
1 80  SER n 
1 81  ALA n 
1 82  PHE n 
1 83  ARG n 
1 84  GLY n 
1 85  VAL n 
1 86  GLN n 
1 87  LEU n 
1 88  THR n 
1 89  TYR n 
1 90  GLU n 
1 91  HIS n 
1 92  THR n 
1 93  MET n 
1 94  LEU n 
1 95  GLN n 
1 96  LEU n 
1 97  TYR n 
1 98  PRO n 
1 99  SER n 
1 100 PRO n 
1 101 PHE n 
1 102 ALA n 
1 103 THR n 
1 104 CYS n 
1 105 ASP n 
1 106 PHE n 
1 107 MET n 
1 108 VAL n 
1 109 ARG n 
1 110 PHE n 
1 111 PRO n 
1 112 GLU n 
1 113 TRP n 
1 114 LEU n 
1 115 PRO n 
1 116 LEU n 
1 117 ASP n 
1 118 LYS n 
1 119 TRP n 
1 120 VAL n 
1 121 PRO n 
1 122 GLN n 
1 123 VAL n 
1 124 PHE n 
1 125 VAL n 
1 126 ALA n 
1 127 SER n 
1 128 GLY n 
1 129 ASP n 
1 130 CYS n 
1 131 ALA n 
1 132 GLU n 
1 133 ARG n 
1 134 GLN n 
1 135 TRP n 
1 136 ASP n 
1 137 PHE n 
1 138 LEU n 
1 139 GLY n 
1 140 LEU n 
1 141 GLU n 
1 142 MET n 
1 143 PRO n 
1 144 GLN n 
1 145 TRP n 
1 146 LEU n 
1 147 LEU n 
1 148 GLY n 
1 149 ILE n 
1 150 PHE n 
1 151 ILE n 
1 152 ALA n 
1 153 TYR n 
1 154 LEU n 
1 155 ILE n 
1 156 VAL n 
1 157 ALA n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 VAL n 
1 162 ILE n 
1 163 SER n 
1 164 GLN n 
1 165 PRO n 
1 166 PHE n 
1 167 LYS n 
1 168 ALA n 
1 169 LYS n 
1 170 LYS n 
1 171 ARG n 
1 172 ASP n 
1 173 LEU n 
1 174 PHE n 
1 175 GLY n 
1 176 ARG n 
2 1   MET n 
2 2   ASP n 
2 3   SER n 
2 4   GLN n 
2 5   ALA n 
2 6   GLN n 
2 7   VAL n 
2 8   LEU n 
2 9   ILE n 
2 10  LEU n 
2 11  LEU n 
2 12  LEU n 
2 13  LEU n 
2 14  TRP n 
2 15  VAL n 
2 16  SER n 
2 17  GLY n 
2 18  THR n 
2 19  CYS n 
2 20  GLY n 
2 21  ASP n 
2 22  ILE n 
2 23  VAL n 
2 24  MET n 
2 25  SER n 
2 26  GLN n 
2 27  SER n 
2 28  PRO n 
2 29  SER n 
2 30  SER n 
2 31  LEU n 
2 32  ALA n 
2 33  VAL n 
2 34  SER n 
2 35  ALA n 
2 36  GLY n 
2 37  GLU n 
2 38  LYS n 
2 39  VAL n 
2 40  THR n 
2 41  MET n 
2 42  SER n 
2 43  CYS n 
2 44  LYS n 
2 45  SER n 
2 46  SER n 
2 47  GLN n 
2 48  SER n 
2 49  LEU n 
2 50  LEU n 
2 51  ASN n 
2 52  SER n 
2 53  ARG n 
2 54  THR n 
2 55  ARG n 
2 56  LYS n 
2 57  ASN n 
2 58  TYR n 
2 59  LEU n 
2 60  ALA n 
2 61  TRP n 
2 62  TYR n 
2 63  GLN n 
2 64  GLN n 
2 65  LYS n 
2 66  PRO n 
2 67  GLY n 
2 68  GLN n 
2 69  SER n 
2 70  PRO n 
2 71  LYS n 
2 72  LEU n 
2 73  LEU n 
2 74  ILE n 
2 75  TYR n 
2 76  TRP n 
2 77  ALA n 
2 78  SER n 
2 79  THR n 
2 80  ARG n 
2 81  GLU n 
2 82  SER n 
2 83  GLY n 
2 84  VAL n 
2 85  PRO n 
2 86  ASP n 
2 87  ARG n 
2 88  PHE n 
2 89  THR n 
2 90  GLY n 
2 91  SER n 
2 92  GLY n 
2 93  SER n 
2 94  GLY n 
2 95  THR n 
2 96  ASP n 
2 97  PHE n 
2 98  THR n 
2 99  LEU n 
2 100 THR n 
2 101 ILE n 
2 102 SER n 
2 103 SER n 
2 104 VAL n 
2 105 GLN n 
2 106 ALA n 
2 107 GLU n 
2 108 ASP n 
2 109 LEU n 
2 110 ALA n 
2 111 VAL n 
2 112 TYR n 
2 113 TYR n 
2 114 CYS n 
2 115 LYS n 
2 116 GLN n 
2 117 SER n 
2 118 TYR n 
2 119 ASN n 
2 120 LEU n 
2 121 TYR n 
2 122 THR n 
2 123 PHE n 
2 124 GLY n 
2 125 GLY n 
2 126 GLY n 
2 127 THR n 
2 128 LYS n 
2 129 LEU n 
2 130 GLU n 
2 131 ILE n 
2 132 LYS n 
2 133 ARG n 
2 134 ALA n 
2 135 ASP n 
2 136 ALA n 
2 137 ALA n 
2 138 PRO n 
2 139 THR n 
2 140 VAL n 
2 141 SER n 
2 142 ILE n 
2 143 PHE n 
2 144 PRO n 
2 145 PRO n 
2 146 SER n 
2 147 SER n 
2 148 GLU n 
2 149 GLN n 
2 150 LEU n 
2 151 THR n 
2 152 SER n 
2 153 GLY n 
2 154 GLY n 
2 155 ALA n 
2 156 SER n 
2 157 VAL n 
2 158 VAL n 
2 159 CYS n 
2 160 PHE n 
2 161 LEU n 
2 162 ASN n 
2 163 ASN n 
2 164 PHE n 
2 165 TYR n 
2 166 PRO n 
2 167 LYS n 
2 168 ASP n 
2 169 ILE n 
2 170 ASN n 
2 171 VAL n 
2 172 LYS n 
2 173 TRP n 
2 174 LYS n 
2 175 ILE n 
2 176 ASP n 
2 177 GLY n 
2 178 SER n 
2 179 GLU n 
2 180 ARG n 
2 181 GLN n 
2 182 ASN n 
2 183 GLY n 
2 184 VAL n 
2 185 LEU n 
2 186 ASN n 
2 187 SER n 
2 188 TRP n 
2 189 THR n 
2 190 ASP n 
2 191 GLN n 
2 192 ASP n 
2 193 SER n 
2 194 LYS n 
2 195 ASP n 
2 196 SER n 
2 197 THR n 
2 198 TYR n 
2 199 SER n 
2 200 MET n 
2 201 SER n 
2 202 SER n 
2 203 THR n 
2 204 LEU n 
2 205 THR n 
2 206 LEU n 
2 207 THR n 
2 208 LYS n 
2 209 ASP n 
2 210 GLU n 
2 211 TYR n 
2 212 GLU n 
2 213 ARG n 
2 214 HIS n 
2 215 ASN n 
2 216 SER n 
2 217 TYR n 
2 218 THR n 
2 219 CYS n 
2 220 GLU n 
2 221 ALA n 
2 222 THR n 
2 223 HIS n 
2 224 LYS n 
2 225 THR n 
2 226 SER n 
2 227 THR n 
2 228 SER n 
2 229 PRO n 
2 230 ILE n 
2 231 VAL n 
2 232 LYS n 
2 233 SER n 
2 234 PHE n 
2 235 ASN n 
2 236 ARG n 
2 237 ASN n 
2 238 GLU n 
2 239 CYS n 
3 1   GLU n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   VAL n 
3 6   GLU n 
3 7   SER n 
3 8   GLY n 
3 9   GLY n 
3 10  GLY n 
3 11  LEU n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  GLY n 
3 17  SER n 
3 18  LEU n 
3 19  LYS n 
3 20  LEU n 
3 21  SER n 
3 22  CYS n 
3 23  ALA n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  PHE n 
3 28  ALA n 
3 29  PHE n 
3 30  SER n 
3 31  SER n 
3 32  TYR n 
3 33  ASP n 
3 34  MET n 
3 35  SER n 
3 36  TRP n 
3 37  VAL n 
3 38  ARG n 
3 39  GLN n 
3 40  THR n 
3 41  PRO n 
3 42  GLU n 
3 43  LYS n 
3 44  ARG n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  VAL n 
3 49  ALA n 
3 50  TYR n 
3 51  ILE n 
3 52  SER n 
3 53  SER n 
3 54  GLY n 
3 55  GLY n 
3 56  GLY n 
3 57  SER n 
3 58  THR n 
3 59  TYR n 
3 60  TYR n 
3 61  PRO n 
3 62  ASP n 
3 63  THR n 
3 64  VAL n 
3 65  LYS n 
3 66  GLY n 
3 67  ARG n 
3 68  PHE n 
3 69  THR n 
3 70  ILE n 
3 71  SER n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  ALA n 
3 76  LYS n 
3 77  ASN n 
3 78  THR n 
3 79  LEU n 
3 80  TYR n 
3 81  LEU n 
3 82  GLN n 
3 83  MET n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  LYS n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  MET n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  ALA n 
3 98  ARG n 
3 99  PRO n 
3 100 ASP n 
3 101 TYR n 
3 102 ARG n 
3 103 SER n 
3 104 TYR n 
3 105 ALA n 
3 106 MET n 
3 107 ASP n 
3 108 TYR n 
3 109 TRP n 
3 110 GLY n 
3 111 GLN n 
3 112 GLY n 
3 113 THR n 
3 114 SER n 
3 115 VAL n 
3 116 THR n 
3 117 VAL n 
3 118 SER n 
3 119 SER n 
3 120 ALA n 
3 121 LYS n 
3 122 THR n 
3 123 THR n 
3 124 ALA n 
3 125 PRO n 
3 126 SER n 
3 127 VAL n 
3 128 TYR n 
3 129 PRO n 
3 130 LEU n 
3 131 ALA n 
3 132 PRO n 
3 133 VAL n 
3 134 CYS n 
3 135 GLY n 
3 136 ASP n 
3 137 THR n 
3 138 THR n 
3 139 GLY n 
3 140 SER n 
3 141 SER n 
3 142 VAL n 
3 143 THR n 
3 144 LEU n 
3 145 GLY n 
3 146 CYS n 
3 147 LEU n 
3 148 VAL n 
3 149 LYS n 
3 150 GLY n 
3 151 TYR n 
3 152 PHE n 
3 153 PRO n 
3 154 GLU n 
3 155 PRO n 
3 156 VAL n 
3 157 THR n 
3 158 LEU n 
3 159 THR n 
3 160 TRP n 
3 161 ASN n 
3 162 SER n 
3 163 GLY n 
3 164 SER n 
3 165 LEU n 
3 166 SER n 
3 167 SER n 
3 168 GLY n 
3 169 VAL n 
3 170 HIS n 
3 171 THR n 
3 172 PHE n 
3 173 PRO n 
3 174 ALA n 
3 175 VAL n 
3 176 LEU n 
3 177 GLN n 
3 178 SER n 
3 179 ASP n 
3 180 LEU n 
3 181 TYR n 
3 182 THR n 
3 183 LEU n 
3 184 SER n 
3 185 SER n 
3 186 SER n 
3 187 VAL n 
3 188 THR n 
3 189 VAL n 
3 190 THR n 
3 191 SER n 
3 192 SER n 
3 193 THR n 
3 194 TRP n 
3 195 PRO n 
3 196 SER n 
3 197 GLN n 
3 198 SER n 
3 199 ILE n 
3 200 THR n 
3 201 CYS n 
3 202 ASN n 
3 203 VAL n 
3 204 ALA n 
3 205 HIS n 
3 206 PRO n 
3 207 ALA n 
3 208 SER n 
3 209 SER n 
3 210 THR n 
3 211 LYS n 
3 212 VAL n 
3 213 ASP n 
3 214 LYS n 
3 215 LYS n 
3 216 ILE n 
3 217 GLU n 
3 218 PRO n 
3 219 ARG n 
3 220 GLY n 
3 221 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 dsbB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               M15 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQE70 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample ? ? mouse 'mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'Fab fragment is obtained by papain digestion of a selected monoclonal antibody.' 
3 1 sample ? ? mouse 'mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'Fab fragment is obtained by papain digestion of a selected monoclonal antibody.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DSBB_ECOLI P0A6M2 1 
;MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
1 ? 
2 PDB 2ZUQ       2ZUQ   2 ? ? ? 
3 PDB 2ZUQ       2ZUQ   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ZUQ A 1 ? 176 ? P0A6M2 1 ? 176 ? 1 176 
2 1 2ZUQ D 1 ? 176 ? P0A6M2 1 ? 176 ? 1 176 
3 2 2ZUQ B 1 ? 239 ? 2ZUQ   1 ? 239 ? 1 239 
4 2 2ZUQ E 1 ? 239 ? 2ZUQ   1 ? 239 ? 1 239 
5 3 2ZUQ C 1 ? 221 ? 2ZUQ   1 ? 221 ? 1 221 
6 3 2ZUQ F 1 ? 221 ? 2ZUQ   1 ? 221 ? 1 221 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ZUQ ALA A 8  ? UNP P0A6M2 CYS 8  'engineered mutation' 8  1 
1 2ZUQ SER A 41 ? UNP P0A6M2 CYS 41 'engineered mutation' 41 2 
1 2ZUQ VAL A 49 ? UNP P0A6M2 CYS 49 'engineered mutation' 49 3 
2 2ZUQ ALA D 8  ? UNP P0A6M2 CYS 8  'engineered mutation' 8  4 
2 2ZUQ SER D 41 ? UNP P0A6M2 CYS 41 'engineered mutation' 41 5 
2 2ZUQ VAL D 49 ? UNP P0A6M2 CYS 49 'engineered mutation' 49 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UQ1 non-polymer         . UBIQUINONE-1    ? 'C14 H18 O4'     250.290 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ZUQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    '15% PEG3350, pH 7, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   2008-05-19 
_diffrn_detector.details                'LH-coated mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.90 
# 
_reflns.entry_id                     2ZUQ 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            3.3 
_reflns.d_resolution_low             47.51 
_reflns.number_all                   ? 
_reflns.number_obs                   25296 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.3 
_reflns_shell.d_res_low              3.48 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           0.865 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3560 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2ZUQ 
_refine.ls_number_reflns_obs                     23953 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.64 
_refine.ls_d_res_high                            3.30 
_refine.ls_percent_reflns_obs                    99.39 
_refine.ls_R_factor_obs                          0.27949 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.27544 
_refine.ls_R_factor_R_free                       0.35119 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1316 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.861 
_refine.correlation_coeff_Fo_to_Fc_free          0.844 
_refine.B_iso_mean                               114.487 
_refine.aniso_B[1][1]                            3.00 
_refine.aniso_B[2][2]                            1.36 
_refine.aniso_B[3][3]                            -5.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.23 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1IGT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.725 
_refine.overall_SU_ML                            0.664 
_refine.overall_SU_B                             39.752 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8955 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8991 
_refine_hist.d_res_high                       3.30 
_refine_hist.d_res_low                        45.64 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.011  0.022  ? 9222  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.492  1.961  ? 12561 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 8.068  5.000  ? 1149  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 35.766 23.797 ? 345   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 23.161 15.000 ? 1477  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 15.443 15.000 ? 36    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.105  0.200  ? 1420  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.007  0.021  ? 6856  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.495  1.500  ? 5778  'X-RAY DIFFRACTION' ? 
r_mcangle_it           0.923  2.000  ? 9343  'X-RAY DIFFRACTION' ? 
r_scbond_it            0.845  3.000  ? 3444  'X-RAY DIFFRACTION' ? 
r_scangle_it           1.527  4.500  ? 3218  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.303 
_refine_ls_shell.d_res_low                        3.388 
_refine_ls_shell.number_reflns_R_work             1638 
_refine_ls_shell.R_factor_R_work                  0.343 
_refine_ls_shell.percent_reflns_obs               93.37 
_refine_ls_shell.R_factor_R_free                  0.419 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ZUQ 
_struct.title                     'Crystal structure of DsbB-Fab complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ZUQ 
_struct_keywords.pdbx_keywords   'Oxidoreductase/IMMUNE SYSTEM' 
_struct_keywords.text            
;disulfide bond, membrane protein, Fab, E. coli, Cell inner membrane, Cell membrane, Chaperone, Electron transport, Membrane, Oxidoreductase, Redox-active center, Transmembrane, Transport, Oxidoreductase-IMMUNE SYSTEM COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 12  ? ALA A 22  ? ARG A 12  ALA A 22  1 ? 11 
HELX_P HELX_P2  2  ALA A 22  ? VAL A 35  ? ALA A 22  VAL A 35  1 ? 14 
HELX_P HELX_P3  3  LEU A 43  ? ILE A 63  ? LEU A 43  ILE A 63  1 ? 21 
HELX_P HELX_P4  4  LEU A 69  ? TYR A 97  ? LEU A 69  TYR A 97  1 ? 29 
HELX_P HELX_P5  5  GLU A 141 ? VAL A 158 ? GLU A 141 VAL A 158 1 ? 18 
HELX_P HELX_P6  6  SER B 146 ? SER B 152 ? SER B 146 SER B 152 1 ? 7  
HELX_P HELX_P7  7  ASP B 209 ? HIS B 214 ? ASP B 209 HIS B 214 5 ? 6  
HELX_P HELX_P8  8  ASN B 237 ? CYS B 239 ? ASN B 237 CYS B 239 5 ? 3  
HELX_P HELX_P9  9  ALA C 28  ? TYR C 32  ? ALA C 28  TYR C 32  5 ? 5  
HELX_P HELX_P10 10 ARG D 12  ? VAL D 35  ? ARG D 12  VAL D 35  1 ? 24 
HELX_P HELX_P11 11 CYS D 44  ? VAL D 49  ? CYS D 44  VAL D 49  1 ? 6  
HELX_P HELX_P12 12 LEU D 51  ? ILE D 63  ? LEU D 51  ILE D 63  1 ? 13 
HELX_P HELX_P13 13 PRO D 68  ? TYR D 97  ? PRO D 68  TYR D 97  1 ? 30 
HELX_P HELX_P14 14 ASP D 136 ? LEU D 140 ? ASP D 136 LEU D 140 5 ? 5  
HELX_P HELX_P15 15 GLU D 141 ? PHE D 150 ? GLU D 141 PHE D 150 1 ? 10 
HELX_P HELX_P16 16 PHE D 150 ? ILE D 155 ? PHE D 150 ILE D 155 1 ? 6  
HELX_P HELX_P17 17 GLN E 105 ? LEU E 109 ? GLN E 105 LEU E 109 5 ? 5  
HELX_P HELX_P18 18 SER E 146 ? SER E 152 ? SER E 146 SER E 152 1 ? 7  
HELX_P HELX_P19 19 LYS E 208 ? GLU E 212 ? LYS E 208 GLU E 212 1 ? 5  
HELX_P HELX_P20 20 ALA F 28  ? TYR F 32  ? ALA F 28  TYR F 32  5 ? 5  
HELX_P HELX_P21 21 LYS F 87  ? THR F 91  ? LYS F 87  THR F 91  5 ? 5  
HELX_P HELX_P22 22 SER F 162 ? SER F 164 ? SER F 162 SER F 164 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 104 SG ? ? ? 1_555 A CYS 130 SG ? ? A CYS 104 A CYS 130 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ? ? B CYS 43  SG ? ? ? 1_555 B CYS 114 SG ? ? B CYS 43  B CYS 114 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf3  disulf ? ? B CYS 159 SG ? ? ? 1_555 B CYS 219 SG ? ? B CYS 159 B CYS 219 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf4  disulf ? ? B CYS 239 SG ? ? ? 1_555 C CYS 134 SG ? ? B CYS 239 C CYS 134 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf5  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? C CYS 22  C CYS 96  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf6  disulf ? ? C CYS 146 SG ? ? ? 1_555 C CYS 201 SG ? ? C CYS 146 C CYS 201 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf7  disulf ? ? D CYS 104 SG ? ? ? 1_555 D CYS 130 SG ? ? D CYS 104 D CYS 130 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf8  disulf ? ? E CYS 43  SG ? ? ? 1_555 E CYS 114 SG ? ? E CYS 43  E CYS 114 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf9  disulf ? ? E CYS 159 SG ? ? ? 1_555 E CYS 219 SG ? ? E CYS 159 E CYS 219 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf10 disulf ? ? E CYS 239 SG ? ? ? 1_555 F CYS 134 SG ? ? E CYS 239 F CYS 134 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf11 disulf ? ? F CYS 22  SG ? ? ? 1_555 F CYS 96  SG ? ? F CYS 22  F CYS 96  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf12 disulf ? ? F CYS 146 SG ? ? ? 1_555 F CYS 201 SG ? ? F CYS 146 F CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 37  A . ? LEU 37  A LEU 38  A ? LEU 38  A 1 2.48   
2  PRO 65  A . ? PRO 65  A LYS 66  A ? LYS 66  A 1 -13.61 
3  SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 1 -2.72  
4  TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 1 3.27   
5  PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 1 -7.59  
6  GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 1 -2.41  
7  LEU 37  D . ? LEU 37  D LEU 38  D ? LEU 38  D 1 -2.02  
8  PRO 65  D . ? PRO 65  D LYS 66  D ? LYS 66  D 1 -28.35 
9  SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 1 0.58   
10 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 1 -22.67 
11 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 1 2.60   
12 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 1 -15.09 
13 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 1 -5.17  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
O ? 3 ? 
P ? 4 ? 
Q ? 2 ? 
R ? 5 ? 
S ? 4 ? 
T ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET B 24  ? SER B 27  ? MET B 24  SER B 27  
A 2 VAL B 39  ? SER B 45  ? VAL B 39  SER B 45  
A 3 ASP B 96  ? ILE B 101 ? ASP B 96  ILE B 101 
A 4 PHE B 88  ? GLY B 92  ? PHE B 88  GLY B 92  
B 1 SER B 30  ? VAL B 33  ? SER B 30  VAL B 33  
B 2 LYS B 128 ? ILE B 131 ? LYS B 128 ILE B 131 
B 3 ALA B 110 ? GLN B 116 ? ALA B 110 GLN B 116 
B 4 LEU B 59  ? GLN B 64  ? LEU B 59  GLN B 64  
B 5 LYS B 71  ? ILE B 74  ? LYS B 71  ILE B 74  
C 1 SER B 30  ? VAL B 33  ? SER B 30  VAL B 33  
C 2 LYS B 128 ? ILE B 131 ? LYS B 128 ILE B 131 
C 3 ALA B 110 ? GLN B 116 ? ALA B 110 GLN B 116 
C 4 THR B 122 ? PHE B 123 ? THR B 122 PHE B 123 
D 1 THR B 139 ? PHE B 143 ? THR B 139 PHE B 143 
D 2 GLY B 154 ? ASN B 162 ? GLY B 154 ASN B 162 
D 3 SER B 201 ? THR B 207 ? SER B 201 THR B 207 
D 4 VAL B 184 ? LEU B 185 ? VAL B 184 LEU B 185 
E 1 LYS B 172 ? ILE B 175 ? LYS B 172 ILE B 175 
E 2 SER B 216 ? GLU B 220 ? SER B 216 GLU B 220 
E 3 VAL B 231 ? ASN B 235 ? VAL B 231 ASN B 235 
F 1 GLN C 3   ? SER C 7   ? GLN C 3   SER C 7   
F 2 GLY C 16  ? SER C 25  ? GLY C 16  SER C 25  
F 3 THR C 78  ? LEU C 86  ? THR C 78  LEU C 86  
F 4 PHE C 68  ? ASP C 73  ? PHE C 68  ASP C 73  
G 1 LEU C 11  ? VAL C 12  ? LEU C 11  VAL C 12  
G 2 SER C 114 ? VAL C 117 ? SER C 114 VAL C 117 
G 3 ALA C 92  ? ALA C 97  ? ALA C 92  ALA C 97  
G 4 MET C 34  ? GLN C 39  ? MET C 34  GLN C 39  
G 5 LEU C 45  ? ILE C 51  ? LEU C 45  ILE C 51  
G 6 THR C 58  ? TYR C 59  ? THR C 58  TYR C 59  
H 1 SER C 126 ? LEU C 130 ? SER C 126 LEU C 130 
H 2 SER C 141 ? TYR C 151 ? SER C 141 TYR C 151 
H 3 TYR C 181 ? THR C 190 ? TYR C 181 THR C 190 
H 4 VAL C 169 ? THR C 171 ? VAL C 169 THR C 171 
I 1 THR C 157 ? TRP C 160 ? THR C 157 TRP C 160 
I 2 THR C 200 ? HIS C 205 ? THR C 200 HIS C 205 
I 3 THR C 210 ? LYS C 215 ? THR C 210 LYS C 215 
J 1 MET E 24  ? SER E 27  ? MET E 24  SER E 27  
J 2 SER E 42  ? SER E 45  ? SER E 42  SER E 45  
K 1 LYS E 38  ? THR E 40  ? LYS E 38  THR E 40  
K 2 THR E 100 ? SER E 102 ? THR E 100 SER E 102 
L 1 LYS E 71  ? ILE E 74  ? LYS E 71  ILE E 74  
L 2 LEU E 59  ? GLN E 64  ? LEU E 59  GLN E 64  
L 3 VAL E 111 ? GLN E 116 ? VAL E 111 GLN E 116 
L 4 THR E 122 ? PHE E 123 ? THR E 122 PHE E 123 
M 1 LYS E 71  ? ILE E 74  ? LYS E 71  ILE E 74  
M 2 LEU E 59  ? GLN E 64  ? LEU E 59  GLN E 64  
M 3 VAL E 111 ? GLN E 116 ? VAL E 111 GLN E 116 
M 4 THR E 127 ? LYS E 128 ? THR E 127 LYS E 128 
N 1 THR E 139 ? PHE E 143 ? THR E 139 PHE E 143 
N 2 GLY E 154 ? PHE E 164 ? GLY E 154 PHE E 164 
N 3 TYR E 198 ? THR E 207 ? TYR E 198 THR E 207 
N 4 VAL E 184 ? TRP E 188 ? VAL E 184 TRP E 188 
O 1 LYS E 174 ? ILE E 175 ? LYS E 174 ILE E 175 
O 2 SER E 216 ? ALA E 221 ? SER E 216 ALA E 221 
O 3 ILE E 230 ? ASN E 235 ? ILE E 230 ASN E 235 
P 1 LEU F 4   ? SER F 7   ? LEU F 4   SER F 7   
P 2 LEU F 18  ? ALA F 24  ? LEU F 18  ALA F 24  
P 3 THR F 78  ? MET F 83  ? THR F 78  MET F 83  
P 4 PHE F 68  ? ASP F 73  ? PHE F 68  ASP F 73  
Q 1 LEU F 11  ? VAL F 12  ? LEU F 11  VAL F 12  
Q 2 THR F 116 ? VAL F 117 ? THR F 116 VAL F 117 
R 1 THR F 58  ? TYR F 59  ? THR F 58  TYR F 59  
R 2 LEU F 45  ? ILE F 51  ? LEU F 45  ILE F 51  
R 3 MET F 34  ? GLN F 39  ? MET F 34  GLN F 39  
R 4 MET F 93  ? PRO F 99  ? MET F 93  PRO F 99  
R 5 MET F 106 ? TRP F 109 ? MET F 106 TRP F 109 
S 1 SER F 126 ? LEU F 130 ? SER F 126 LEU F 130 
S 2 SER F 141 ? TYR F 151 ? SER F 141 TYR F 151 
S 3 TYR F 181 ? THR F 190 ? TYR F 181 THR F 190 
S 4 VAL F 169 ? THR F 171 ? VAL F 169 THR F 171 
T 1 THR F 157 ? TRP F 160 ? THR F 157 TRP F 160 
T 2 CYS F 201 ? HIS F 205 ? CYS F 201 HIS F 205 
T 3 THR F 210 ? LYS F 214 ? THR F 210 LYS F 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER B 25  ? N SER B 25  O LYS B 44  ? O LYS B 44  
A 2 3 N VAL B 39  ? N VAL B 39  O ILE B 101 ? O ILE B 101 
A 3 4 O THR B 98  ? O THR B 98  N SER B 91  ? N SER B 91  
B 1 2 N LEU B 31  ? N LEU B 31  O LYS B 128 ? O LYS B 128 
B 2 3 O LEU B 129 ? O LEU B 129 N ALA B 110 ? N ALA B 110 
B 3 4 O TYR B 113 ? O TYR B 113 N TYR B 62  ? N TYR B 62  
B 4 5 N GLN B 63  ? N GLN B 63  O LYS B 71  ? O LYS B 71  
C 1 2 N LEU B 31  ? N LEU B 31  O LYS B 128 ? O LYS B 128 
C 2 3 O LEU B 129 ? O LEU B 129 N ALA B 110 ? N ALA B 110 
C 3 4 N GLN B 116 ? N GLN B 116 O THR B 122 ? O THR B 122 
D 1 2 N PHE B 143 ? N PHE B 143 O VAL B 158 ? O VAL B 158 
D 2 3 N VAL B 157 ? N VAL B 157 O LEU B 204 ? O LEU B 204 
D 3 4 O THR B 203 ? O THR B 203 N LEU B 185 ? N LEU B 185 
E 1 2 N LYS B 172 ? N LYS B 172 O GLU B 220 ? O GLU B 220 
E 2 3 N TYR B 217 ? N TYR B 217 O PHE B 234 ? O PHE B 234 
F 1 2 N VAL C 5   ? N VAL C 5   O ALA C 23  ? O ALA C 23  
F 2 3 N LEU C 20  ? N LEU C 20  O LEU C 81  ? O LEU C 81  
F 3 4 O TYR C 80  ? O TYR C 80  N SER C 71  ? N SER C 71  
G 1 2 N VAL C 12  ? N VAL C 12  O THR C 116 ? O THR C 116 
G 2 3 O VAL C 115 ? O VAL C 115 N ALA C 92  ? N ALA C 92  
G 3 4 O TYR C 95  ? O TYR C 95  N VAL C 37  ? N VAL C 37  
G 4 5 N MET C 34  ? N MET C 34  O ILE C 51  ? O ILE C 51  
G 5 6 N TYR C 50  ? N TYR C 50  O TYR C 59  ? O TYR C 59  
H 1 2 N TYR C 128 ? N TYR C 128 O LEU C 147 ? O LEU C 147 
H 2 3 N VAL C 148 ? N VAL C 148 O LEU C 183 ? O LEU C 183 
H 3 4 O SER C 186 ? O SER C 186 N HIS C 170 ? N HIS C 170 
I 1 2 N THR C 159 ? N THR C 159 O ASN C 202 ? O ASN C 202 
I 2 3 N CYS C 201 ? N CYS C 201 O LYS C 214 ? O LYS C 214 
J 1 2 N SER E 27  ? N SER E 27  O SER E 42  ? O SER E 42  
K 1 2 N VAL E 39  ? N VAL E 39  O ILE E 101 ? O ILE E 101 
L 1 2 O LEU E 73  ? O LEU E 73  N TRP E 61  ? N TRP E 61  
L 2 3 N ALA E 60  ? N ALA E 60  O LYS E 115 ? O LYS E 115 
L 3 4 N GLN E 116 ? N GLN E 116 O THR E 122 ? O THR E 122 
M 1 2 O LEU E 73  ? O LEU E 73  N TRP E 61  ? N TRP E 61  
M 2 3 N ALA E 60  ? N ALA E 60  O LYS E 115 ? O LYS E 115 
M 3 4 N TYR E 112 ? N TYR E 112 O THR E 127 ? O THR E 127 
N 1 2 N THR E 139 ? N THR E 139 O ASN E 162 ? O ASN E 162 
N 2 3 N LEU E 161 ? N LEU E 161 O MET E 200 ? O MET E 200 
N 3 4 O THR E 203 ? O THR E 203 N LEU E 185 ? N LEU E 185 
O 1 2 N LYS E 174 ? N LYS E 174 O THR E 218 ? O THR E 218 
O 2 3 N TYR E 217 ? N TYR E 217 O PHE E 234 ? O PHE E 234 
P 1 2 N SER F 7   ? N SER F 7   O SER F 21  ? O SER F 21  
P 2 3 N LEU F 20  ? N LEU F 20  O LEU F 81  ? O LEU F 81  
P 3 4 O GLN F 82  ? O GLN F 82  N THR F 69  ? N THR F 69  
Q 1 2 N VAL F 12  ? N VAL F 12  O THR F 116 ? O THR F 116 
R 1 2 O TYR F 59  ? O TYR F 59  N TYR F 50  ? N TYR F 50  
R 2 3 O ILE F 51  ? O ILE F 51  N MET F 34  ? N MET F 34  
R 3 4 N VAL F 37  ? N VAL F 37  O TYR F 95  ? O TYR F 95  
R 4 5 N ARG F 98  ? N ARG F 98  O TYR F 108 ? O TYR F 108 
S 1 2 N TYR F 128 ? N TYR F 128 O LEU F 147 ? O LEU F 147 
S 2 3 N LEU F 144 ? N LEU F 144 O VAL F 187 ? O VAL F 187 
S 3 4 O SER F 186 ? O SER F 186 N HIS F 170 ? N HIS F 170 
T 1 2 N THR F 157 ? N THR F 157 O ALA F 204 ? O ALA F 204 
T 2 3 N CYS F 201 ? N CYS F 201 O LYS F 214 ? O LYS F 214 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A UQ1 177 ? 10 'BINDING SITE FOR RESIDUE UQ1 A 177' 
AC2 Software D UQ1 177 ? 9  'BINDING SITE FOR RESIDUE UQ1 D 177' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 LEU A 25  ? LEU A 25  . ? 1_555 ? 
2  AC1 10 ALA A 29  ? ALA A 29  . ? 1_555 ? 
3  AC1 10 GLN A 33  ? GLN A 33  . ? 1_555 ? 
4  AC1 10 PRO A 40  ? PRO A 40  . ? 1_555 ? 
5  AC1 10 SER A 41  ? SER A 41  . ? 1_555 ? 
6  AC1 10 CYS A 44  ? CYS A 44  . ? 1_555 ? 
7  AC1 10 GLU A 47  ? GLU A 47  . ? 1_555 ? 
8  AC1 10 MET A 142 ? MET A 142 . ? 1_555 ? 
9  AC1 10 PRO A 143 ? PRO A 143 . ? 1_555 ? 
10 AC1 10 LEU A 146 ? LEU A 146 . ? 1_555 ? 
11 AC2 9  LEU D 25  ? LEU D 25  . ? 1_555 ? 
12 AC2 9  ALA D 29  ? ALA D 29  . ? 1_555 ? 
13 AC2 9  PHE D 32  ? PHE D 32  . ? 1_555 ? 
14 AC2 9  LEU D 38  ? LEU D 38  . ? 1_555 ? 
15 AC2 9  CYS D 44  ? CYS D 44  . ? 1_555 ? 
16 AC2 9  ARG D 48  ? ARG D 48  . ? 1_555 ? 
17 AC2 9  MET D 142 ? MET D 142 . ? 1_555 ? 
18 AC2 9  PRO D 143 ? PRO D 143 . ? 1_555 ? 
19 AC2 9  LEU D 146 ? LEU D 146 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ZUQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ZUQ 
_atom_sites.fract_transf_matrix[1][1]   0.003713 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001127 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019425 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008304 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 10  ? -73.833  -7.131  -113.109 1.00 134.69 ? 10  GLN A N   1 
ATOM   2    C CA  . GLN A 1 10  ? -73.025  -8.258  -112.561 1.00 134.60 ? 10  GLN A CA  1 
ATOM   3    C C   . GLN A 1 10  ? -72.204  -8.923  -113.662 1.00 134.68 ? 10  GLN A C   1 
ATOM   4    O O   . GLN A 1 10  ? -72.617  -9.943  -114.229 1.00 134.50 ? 10  GLN A O   1 
ATOM   5    C CB  . GLN A 1 10  ? -73.942  -9.282  -111.896 1.00 134.63 ? 10  GLN A CB  1 
ATOM   6    C CG  . GLN A 1 10  ? -73.265  -10.140 -110.847 1.00 134.02 ? 10  GLN A CG  1 
ATOM   7    C CD  . GLN A 1 10  ? -74.211  -11.150 -110.222 1.00 133.65 ? 10  GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 10  ? -74.016  -12.360 -110.353 1.00 133.11 ? 10  GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 10  ? -75.249  -10.659 -109.543 1.00 133.36 ? 10  GLN A NE2 1 
ATOM   10   N N   . GLY A 1 11  ? -71.046  -8.331  -113.954 1.00 134.80 ? 11  GLY A N   1 
ATOM   11   C CA  . GLY A 1 11  ? -70.119  -8.850  -114.962 1.00 134.99 ? 11  GLY A CA  1 
ATOM   12   C C   . GLY A 1 11  ? -68.722  -9.085  -114.407 1.00 135.07 ? 11  GLY A C   1 
ATOM   13   O O   . GLY A 1 11  ? -68.560  -9.676  -113.336 1.00 134.92 ? 11  GLY A O   1 
ATOM   14   N N   . ARG A 1 12  ? -67.712  -8.643  -115.155 1.00 135.21 ? 12  ARG A N   1 
ATOM   15   C CA  . ARG A 1 12  ? -66.330  -8.592  -114.661 1.00 135.30 ? 12  ARG A CA  1 
ATOM   16   C C   . ARG A 1 12  ? -66.047  -7.266  -113.923 1.00 135.19 ? 12  ARG A C   1 
ATOM   17   O O   . ARG A 1 12  ? -64.989  -7.097  -113.312 1.00 135.17 ? 12  ARG A O   1 
ATOM   18   C CB  . ARG A 1 12  ? -65.316  -8.812  -115.803 1.00 135.38 ? 12  ARG A CB  1 
ATOM   19   C CG  . ARG A 1 12  ? -64.954  -10.281 -116.100 1.00 135.80 ? 12  ARG A CG  1 
ATOM   20   C CD  . ARG A 1 12  ? -63.587  -10.422 -116.813 1.00 136.77 ? 12  ARG A CD  1 
ATOM   21   N NE  . ARG A 1 12  ? -63.609  -9.926  -118.199 1.00 137.79 ? 12  ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 12  ? -62.536  -9.713  -118.965 1.00 137.42 ? 12  ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 12  ? -61.309  -9.941  -118.504 1.00 137.44 ? 12  ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 12  ? -62.692  -9.261  -120.206 1.00 136.57 ? 12  ARG A NH2 1 
ATOM   25   N N   . GLY A 1 13  ? -67.003  -6.338  -113.980 1.00 135.03 ? 13  GLY A N   1 
ATOM   26   C CA  . GLY A 1 13  ? -66.860  -5.023  -113.361 1.00 134.81 ? 13  GLY A CA  1 
ATOM   27   C C   . GLY A 1 13  ? -67.370  -5.015  -111.937 1.00 134.71 ? 13  GLY A C   1 
ATOM   28   O O   . GLY A 1 13  ? -66.610  -4.760  -111.005 1.00 134.69 ? 13  GLY A O   1 
ATOM   29   N N   . ALA A 1 14  ? -68.659  -5.311  -111.775 1.00 134.66 ? 14  ALA A N   1 
ATOM   30   C CA  . ALA A 1 14  ? -69.308  -5.370  -110.461 1.00 134.76 ? 14  ALA A CA  1 
ATOM   31   C C   . ALA A 1 14  ? -68.616  -6.345  -109.490 1.00 134.93 ? 14  ALA A C   1 
ATOM   32   O O   . ALA A 1 14  ? -69.124  -6.633  -108.400 1.00 134.73 ? 14  ALA A O   1 
ATOM   33   C CB  . ALA A 1 14  ? -70.782  -5.717  -110.625 1.00 134.66 ? 14  ALA A CB  1 
ATOM   34   N N   . TRP A 1 15  ? -67.464  -6.858  -109.918 1.00 135.26 ? 15  TRP A N   1 
ATOM   35   C CA  . TRP A 1 15  ? -66.551  -7.602  -109.063 1.00 135.66 ? 15  TRP A CA  1 
ATOM   36   C C   . TRP A 1 15  ? -65.147  -6.991  -109.138 1.00 135.60 ? 15  TRP A C   1 
ATOM   37   O O   . TRP A 1 15  ? -64.626  -6.548  -108.118 1.00 135.75 ? 15  TRP A O   1 
ATOM   38   C CB  . TRP A 1 15  ? -66.516  -9.089  -109.422 1.00 135.84 ? 15  TRP A CB  1 
ATOM   39   C CG  . TRP A 1 15  ? -67.815  -9.798  -109.236 1.00 137.22 ? 15  TRP A CG  1 
ATOM   40   C CD1 . TRP A 1 15  ? -68.802  -9.933  -110.159 1.00 138.72 ? 15  TRP A CD1 1 
ATOM   41   C CD2 . TRP A 1 15  ? -68.268  -10.485 -108.063 1.00 138.70 ? 15  TRP A CD2 1 
ATOM   42   N NE1 . TRP A 1 15  ? -69.850  -10.655 -109.641 1.00 139.28 ? 15  TRP A NE1 1 
ATOM   43   C CE2 . TRP A 1 15  ? -69.551  -11.006 -108.354 1.00 139.15 ? 15  TRP A CE2 1 
ATOM   44   C CE3 . TRP A 1 15  ? -67.720  -10.708 -106.794 1.00 139.65 ? 15  TRP A CE3 1 
ATOM   45   C CZ2 . TRP A 1 15  ? -70.300  -11.732 -107.423 1.00 139.80 ? 15  TRP A CZ2 1 
ATOM   46   C CZ3 . TRP A 1 15  ? -68.464  -11.436 -105.863 1.00 140.37 ? 15  TRP A CZ3 1 
ATOM   47   C CH2 . TRP A 1 15  ? -69.744  -11.937 -106.185 1.00 140.58 ? 15  TRP A CH2 1 
ATOM   48   N N   . LEU A 1 16  ? -64.544  -6.947  -110.332 1.00 135.46 ? 16  LEU A N   1 
ATOM   49   C CA  . LEU A 1 16  ? -63.182  -6.394  -110.489 1.00 135.29 ? 16  LEU A CA  1 
ATOM   50   C C   . LEU A 1 16  ? -63.024  -4.969  -109.932 1.00 135.27 ? 16  LEU A C   1 
ATOM   51   O O   . LEU A 1 16  ? -61.902  -4.499  -109.702 1.00 135.08 ? 16  LEU A O   1 
ATOM   52   C CB  . LEU A 1 16  ? -62.698  -6.463  -111.946 1.00 135.23 ? 16  LEU A CB  1 
ATOM   53   C CG  . LEU A 1 16  ? -61.693  -7.546  -112.355 1.00 134.70 ? 16  LEU A CG  1 
ATOM   54   C CD1 . LEU A 1 16  ? -61.573  -7.616  -113.866 1.00 134.15 ? 16  LEU A CD1 1 
ATOM   55   C CD2 . LEU A 1 16  ? -60.325  -7.298  -111.731 1.00 134.33 ? 16  LEU A CD2 1 
ATOM   56   N N   . LEU A 1 17  ? -64.152  -4.294  -109.720 1.00 135.24 ? 17  LEU A N   1 
ATOM   57   C CA  . LEU A 1 17  ? -64.166  -3.026  -109.006 1.00 135.23 ? 17  LEU A CA  1 
ATOM   58   C C   . LEU A 1 17  ? -63.925  -3.291  -107.527 1.00 135.13 ? 17  LEU A C   1 
ATOM   59   O O   . LEU A 1 17  ? -63.012  -2.712  -106.934 1.00 135.46 ? 17  LEU A O   1 
ATOM   60   C CB  . LEU A 1 17  ? -65.496  -2.290  -109.205 1.00 135.30 ? 17  LEU A CB  1 
ATOM   61   C CG  . LEU A 1 17  ? -65.702  -0.975  -108.438 1.00 135.61 ? 17  LEU A CG  1 
ATOM   62   C CD1 . LEU A 1 17  ? -64.654  0.070   -108.829 1.00 135.53 ? 17  LEU A CD1 1 
ATOM   63   C CD2 . LEU A 1 17  ? -67.118  -0.428  -108.632 1.00 135.68 ? 17  LEU A CD2 1 
ATOM   64   N N   . MET A 1 18  ? -64.746  -4.165  -106.942 1.00 134.68 ? 18  MET A N   1 
ATOM   65   C CA  . MET A 1 18  ? -64.588  -4.570  -105.542 1.00 134.13 ? 18  MET A CA  1 
ATOM   66   C C   . MET A 1 18  ? -63.282  -5.333  -105.286 1.00 133.79 ? 18  MET A C   1 
ATOM   67   O O   . MET A 1 18  ? -62.648  -5.147  -104.247 1.00 133.80 ? 18  MET A O   1 
ATOM   68   C CB  . MET A 1 18  ? -65.796  -5.372  -105.058 1.00 133.99 ? 18  MET A CB  1 
ATOM   69   C CG  . MET A 1 18  ? -66.955  -4.527  -104.522 1.00 133.63 ? 18  MET A CG  1 
ATOM   70   S SD  . MET A 1 18  ? -67.744  -3.456  -105.744 1.00 133.70 ? 18  MET A SD  1 
ATOM   71   C CE  . MET A 1 18  ? -69.473  -3.850  -105.467 1.00 132.43 ? 18  MET A CE  1 
ATOM   72   N N   . ALA A 1 19  ? -62.874  -6.170  -106.236 1.00 133.33 ? 19  ALA A N   1 
ATOM   73   C CA  . ALA A 1 19  ? -61.574  -6.838  -106.167 1.00 132.91 ? 19  ALA A CA  1 
ATOM   74   C C   . ALA A 1 19  ? -60.428  -5.817  -106.124 1.00 132.58 ? 19  ALA A C   1 
ATOM   75   O O   . ALA A 1 19  ? -59.423  -6.035  -105.445 1.00 132.57 ? 19  ALA A O   1 
ATOM   76   C CB  . ALA A 1 19  ? -61.401  -7.809  -107.335 1.00 133.02 ? 19  ALA A CB  1 
ATOM   77   N N   . PHE A 1 20  ? -60.588  -4.706  -106.846 1.00 132.04 ? 20  PHE A N   1 
ATOM   78   C CA  . PHE A 1 20  ? -59.646  -3.588  -106.758 1.00 131.40 ? 20  PHE A CA  1 
ATOM   79   C C   . PHE A 1 20  ? -59.827  -2.867  -105.428 1.00 130.67 ? 20  PHE A C   1 
ATOM   80   O O   . PHE A 1 20  ? -58.842  -2.499  -104.785 1.00 130.58 ? 20  PHE A O   1 
ATOM   81   C CB  . PHE A 1 20  ? -59.820  -2.608  -107.936 1.00 131.65 ? 20  PHE A CB  1 
ATOM   82   C CG  . PHE A 1 20  ? -58.756  -1.520  -108.006 1.00 131.94 ? 20  PHE A CG  1 
ATOM   83   C CD1 . PHE A 1 20  ? -57.456  -1.812  -108.445 1.00 132.11 ? 20  PHE A CD1 1 
ATOM   84   C CD2 . PHE A 1 20  ? -59.060  -0.203  -107.648 1.00 131.87 ? 20  PHE A CD2 1 
ATOM   85   C CE1 . PHE A 1 20  ? -56.471  -0.812  -108.514 1.00 131.91 ? 20  PHE A CE1 1 
ATOM   86   C CE2 . PHE A 1 20  ? -58.085  0.805   -107.715 1.00 131.86 ? 20  PHE A CE2 1 
ATOM   87   C CZ  . PHE A 1 20  ? -56.787  0.499   -108.152 1.00 131.91 ? 20  PHE A CZ  1 
ATOM   88   N N   . THR A 1 21  ? -61.083  -2.699  -105.010 1.00 129.73 ? 21  THR A N   1 
ATOM   89   C CA  . THR A 1 21  ? -61.402  -1.926  -103.813 1.00 129.03 ? 21  THR A CA  1 
ATOM   90   C C   . THR A 1 21  ? -60.779  -2.506  -102.531 1.00 128.65 ? 21  THR A C   1 
ATOM   91   O O   . THR A 1 21  ? -60.505  -1.775  -101.576 1.00 128.69 ? 21  THR A O   1 
ATOM   92   C CB  . THR A 1 21  ? -62.931  -1.647  -103.673 1.00 128.92 ? 21  THR A CB  1 
ATOM   93   O OG1 . THR A 1 21  ? -63.130  -0.495  -102.852 1.00 129.16 ? 21  THR A OG1 1 
ATOM   94   C CG2 . THR A 1 21  ? -63.664  -2.795  -103.046 1.00 128.81 ? 21  THR A CG2 1 
ATOM   95   N N   . ALA A 1 22  ? -60.530  -3.813  -102.539 1.00 127.98 ? 22  ALA A N   1 
ATOM   96   C CA  . ALA A 1 22  ? -59.872  -4.494  -101.429 1.00 127.34 ? 22  ALA A CA  1 
ATOM   97   C C   . ALA A 1 22  ? -58.343  -4.333  -101.425 1.00 126.93 ? 22  ALA A C   1 
ATOM   98   O O   . ALA A 1 22  ? -57.705  -4.461  -100.378 1.00 126.85 ? 22  ALA A O   1 
ATOM   99   C CB  . ALA A 1 22  ? -60.258  -5.952  -101.420 1.00 127.44 ? 22  ALA A CB  1 
ATOM   100  N N   . LEU A 1 23  ? -57.755  -4.067  -102.589 1.00 126.47 ? 23  LEU A N   1 
ATOM   101  C CA  . LEU A 1 23  ? -56.358  -3.634  -102.647 1.00 126.06 ? 23  LEU A CA  1 
ATOM   102  C C   . LEU A 1 23  ? -56.269  -2.176  -102.206 1.00 125.94 ? 23  LEU A C   1 
ATOM   103  O O   . LEU A 1 23  ? -55.250  -1.733  -101.668 1.00 125.71 ? 23  LEU A O   1 
ATOM   104  C CB  . LEU A 1 23  ? -55.782  -3.797  -104.056 1.00 125.91 ? 23  LEU A CB  1 
ATOM   105  C CG  . LEU A 1 23  ? -55.230  -5.159  -104.481 1.00 125.38 ? 23  LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 23  ? -55.154  -5.211  -105.988 1.00 125.16 ? 23  LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 23  ? -53.866  -5.442  -103.871 1.00 124.23 ? 23  LEU A CD2 1 
ATOM   108  N N   . ALA A 1 24  ? -57.359  -1.444  -102.429 1.00 125.98 ? 24  ALA A N   1 
ATOM   109  C CA  . ALA A 1 24  ? -57.458  -0.031  -102.066 1.00 126.14 ? 24  ALA A CA  1 
ATOM   110  C C   . ALA A 1 24  ? -57.732  0.119   -100.580 1.00 126.18 ? 24  ALA A C   1 
ATOM   111  O O   . ALA A 1 24  ? -58.351  1.094   -100.144 1.00 126.21 ? 24  ALA A O   1 
ATOM   112  C CB  . ALA A 1 24  ? -58.548  0.662   -102.888 1.00 126.20 ? 24  ALA A CB  1 
ATOM   113  N N   . LEU A 1 25  ? -57.273  -0.871  -99.819  1.00 126.28 ? 25  LEU A N   1 
ATOM   114  C CA  . LEU A 1 25  ? -57.367  -0.889  -98.364  1.00 126.25 ? 25  LEU A CA  1 
ATOM   115  C C   . LEU A 1 25  ? -56.197  -1.670  -97.786  1.00 126.59 ? 25  LEU A C   1 
ATOM   116  O O   . LEU A 1 25  ? -55.435  -1.150  -96.976  1.00 126.60 ? 25  LEU A O   1 
ATOM   117  C CB  . LEU A 1 25  ? -58.685  -1.506  -97.902  1.00 125.86 ? 25  LEU A CB  1 
ATOM   118  C CG  . LEU A 1 25  ? -59.974  -0.708  -98.080  1.00 125.28 ? 25  LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 25  ? -61.078  -1.440  -97.369  1.00 125.02 ? 25  LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 25  ? -59.862  0.723   -97.563  1.00 124.42 ? 25  LEU A CD2 1 
ATOM   121  N N   . GLU A 1 26  ? -56.052  -2.919  -98.217  1.00 127.09 ? 26  GLU A N   1 
ATOM   122  C CA  . GLU A 1 26  ? -54.964  -3.771  -97.746  1.00 127.62 ? 26  GLU A CA  1 
ATOM   123  C C   . GLU A 1 26  ? -53.562  -3.269  -98.042  1.00 127.79 ? 26  GLU A C   1 
ATOM   124  O O   . GLU A 1 26  ? -52.619  -3.612  -97.327  1.00 127.88 ? 26  GLU A O   1 
ATOM   125  C CB  . GLU A 1 26  ? -55.116  -5.167  -98.295  1.00 127.60 ? 26  GLU A CB  1 
ATOM   126  C CG  . GLU A 1 26  ? -55.742  -6.068  -97.298  1.00 128.50 ? 26  GLU A CG  1 
ATOM   127  C CD  . GLU A 1 26  ? -55.908  -7.453  -97.827  1.00 129.74 ? 26  GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 26  ? -55.870  -7.636  -99.063  1.00 130.16 ? 26  GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 26  ? -56.091  -8.358  -97.000  1.00 130.30 ? 26  GLU A OE2 1 
ATOM   130  N N   . LEU A 1 27  ? -53.423  -2.482  -99.103  1.00 128.04 ? 27  LEU A N   1 
ATOM   131  C CA  . LEU A 1 27  ? -52.179  -1.774  -99.349  1.00 128.20 ? 27  LEU A CA  1 
ATOM   132  C C   . LEU A 1 27  ? -52.189  -0.443  -98.588  1.00 128.43 ? 27  LEU A C   1 
ATOM   133  O O   . LEU A 1 27  ? -51.162  -0.042  -98.031  1.00 128.31 ? 27  LEU A O   1 
ATOM   134  C CB  . LEU A 1 27  ? -51.937  -1.578  -100.848 1.00 128.15 ? 27  LEU A CB  1 
ATOM   135  C CG  . LEU A 1 27  ? -51.713  -2.817  -101.728 1.00 128.25 ? 27  LEU A CG  1 
ATOM   136  C CD1 . LEU A 1 27  ? -51.592  -2.412  -103.196 1.00 128.26 ? 27  LEU A CD1 1 
ATOM   137  C CD2 . LEU A 1 27  ? -50.494  -3.645  -101.298 1.00 127.84 ? 27  LEU A CD2 1 
ATOM   138  N N   . THR A 1 28  ? -53.348  0.223   -98.547  1.00 128.68 ? 28  THR A N   1 
ATOM   139  C CA  . THR A 1 28  ? -53.520  1.438   -97.735  1.00 129.04 ? 28  THR A CA  1 
ATOM   140  C C   . THR A 1 28  ? -52.979  1.169   -96.342  1.00 129.36 ? 28  THR A C   1 
ATOM   141  O O   . THR A 1 28  ? -52.200  1.959   -95.807  1.00 129.53 ? 28  THR A O   1 
ATOM   142  C CB  . THR A 1 28  ? -55.001  1.844   -97.605  1.00 128.97 ? 28  THR A CB  1 
ATOM   143  O OG1 . THR A 1 28  ? -55.588  1.916   -98.907  1.00 129.57 ? 28  THR A OG1 1 
ATOM   144  C CG2 . THR A 1 28  ? -55.156  3.188   -96.884  1.00 128.43 ? 28  THR A CG2 1 
ATOM   145  N N   . ALA A 1 29  ? -53.403  0.042   -95.775  1.00 129.55 ? 29  ALA A N   1 
ATOM   146  C CA  . ALA A 1 29  ? -52.914  -0.444  -94.498  1.00 129.72 ? 29  ALA A CA  1 
ATOM   147  C C   . ALA A 1 29  ? -51.395  -0.646  -94.519  1.00 129.99 ? 29  ALA A C   1 
ATOM   148  O O   . ALA A 1 29  ? -50.698  -0.218  -93.590  1.00 130.00 ? 29  ALA A O   1 
ATOM   149  C CB  . ALA A 1 29  ? -53.618  -1.746  -94.141  1.00 129.67 ? 29  ALA A CB  1 
ATOM   150  N N   . LEU A 1 30  ? -50.899  -1.289  -95.583  1.00 130.19 ? 30  LEU A N   1 
ATOM   151  C CA  . LEU A 1 30  ? -49.485  -1.647  -95.720  1.00 130.35 ? 30  LEU A CA  1 
ATOM   152  C C   . LEU A 1 30  ? -48.572  -0.440  -95.735  1.00 130.90 ? 30  LEU A C   1 
ATOM   153  O O   . LEU A 1 30  ? -47.432  -0.519  -95.276  1.00 131.01 ? 30  LEU A O   1 
ATOM   154  C CB  . LEU A 1 30  ? -49.254  -2.476  -96.978  1.00 130.10 ? 30  LEU A CB  1 
ATOM   155  C CG  . LEU A 1 30  ? -48.922  -3.943  -96.753  1.00 129.65 ? 30  LEU A CG  1 
ATOM   156  C CD1 . LEU A 1 30  ? -49.042  -4.711  -98.050  1.00 129.28 ? 30  LEU A CD1 1 
ATOM   157  C CD2 . LEU A 1 30  ? -47.524  -4.073  -96.176  1.00 129.41 ? 30  LEU A CD2 1 
ATOM   158  N N   . TRP A 1 31  ? -49.083  0.669   -96.269  1.00 131.61 ? 31  TRP A N   1 
ATOM   159  C CA  . TRP A 1 31  ? -48.402  1.969   -96.244  1.00 132.43 ? 31  TRP A CA  1 
ATOM   160  C C   . TRP A 1 31  ? -47.915  2.307   -94.835  1.00 132.83 ? 31  TRP A C   1 
ATOM   161  O O   . TRP A 1 31  ? -46.750  2.652   -94.637  1.00 132.80 ? 31  TRP A O   1 
ATOM   162  C CB  . TRP A 1 31  ? -49.359  3.059   -96.747  1.00 132.53 ? 31  TRP A CB  1 
ATOM   163  C CG  . TRP A 1 31  ? -48.716  4.378   -97.033  1.00 132.89 ? 31  TRP A CG  1 
ATOM   164  C CD1 . TRP A 1 31  ? -47.687  4.615   -97.896  1.00 132.71 ? 31  TRP A CD1 1 
ATOM   165  C CD2 . TRP A 1 31  ? -49.083  5.654   -96.481  1.00 133.36 ? 31  TRP A CD2 1 
ATOM   166  N NE1 . TRP A 1 31  ? -47.378  5.954   -97.904  1.00 133.25 ? 31  TRP A NE1 1 
ATOM   167  C CE2 . TRP A 1 31  ? -48.218  6.616   -97.048  1.00 133.28 ? 31  TRP A CE2 1 
ATOM   168  C CE3 . TRP A 1 31  ? -50.052  6.076   -95.556  1.00 133.71 ? 31  TRP A CE3 1 
ATOM   169  C CZ2 . TRP A 1 31  ? -48.288  7.981   -96.718  1.00 133.05 ? 31  TRP A CZ2 1 
ATOM   170  C CZ3 . TRP A 1 31  ? -50.126  7.440   -95.233  1.00 133.27 ? 31  TRP A CZ3 1 
ATOM   171  C CH2 . TRP A 1 31  ? -49.247  8.371   -95.815  1.00 132.97 ? 31  TRP A CH2 1 
ATOM   172  N N   . PHE A 1 32  ? -48.825  2.177   -93.871  1.00 133.45 ? 32  PHE A N   1 
ATOM   173  C CA  . PHE A 1 32  ? -48.551  2.401   -92.456  1.00 133.97 ? 32  PHE A CA  1 
ATOM   174  C C   . PHE A 1 32  ? -47.392  1.564   -91.923  1.00 134.54 ? 32  PHE A C   1 
ATOM   175  O O   . PHE A 1 32  ? -46.469  2.114   -91.318  1.00 134.82 ? 32  PHE A O   1 
ATOM   176  C CB  . PHE A 1 32  ? -49.804  2.127   -91.626  1.00 133.84 ? 32  PHE A CB  1 
ATOM   177  C CG  . PHE A 1 32  ? -50.959  3.024   -91.961  1.00 133.32 ? 32  PHE A CG  1 
ATOM   178  C CD1 . PHE A 1 32  ? -51.999  2.569   -92.755  1.00 132.57 ? 32  PHE A CD1 1 
ATOM   179  C CD2 . PHE A 1 32  ? -51.010  4.326   -91.477  1.00 132.58 ? 32  PHE A CD2 1 
ATOM   180  C CE1 . PHE A 1 32  ? -53.071  3.395   -93.062  1.00 132.15 ? 32  PHE A CE1 1 
ATOM   181  C CE2 . PHE A 1 32  ? -52.078  5.156   -91.778  1.00 131.90 ? 32  PHE A CE2 1 
ATOM   182  C CZ  . PHE A 1 32  ? -53.108  4.690   -92.572  1.00 131.65 ? 32  PHE A CZ  1 
ATOM   183  N N   . GLN A 1 33  ? -47.438  0.249   -92.144  1.00 134.99 ? 33  GLN A N   1 
ATOM   184  C CA  . GLN A 1 33  ? -46.359  -0.647  -91.715  1.00 135.47 ? 33  GLN A CA  1 
ATOM   185  C C   . GLN A 1 33  ? -44.988  -0.073  -91.965  1.00 135.53 ? 33  GLN A C   1 
ATOM   186  O O   . GLN A 1 33  ? -44.131  -0.115  -91.084  1.00 135.62 ? 33  GLN A O   1 
ATOM   187  C CB  . GLN A 1 33  ? -46.422  -1.987  -92.438  1.00 135.67 ? 33  GLN A CB  1 
ATOM   188  C CG  . GLN A 1 33  ? -46.549  -3.181  -91.536  1.00 136.73 ? 33  GLN A CG  1 
ATOM   189  C CD  . GLN A 1 33  ? -47.990  -3.555  -91.317  1.00 138.98 ? 33  GLN A CD  1 
ATOM   190  O OE1 . GLN A 1 33  ? -48.458  -4.580  -91.828  1.00 139.89 ? 33  GLN A OE1 1 
ATOM   191  N NE2 . GLN A 1 33  ? -48.720  -2.716  -90.573  1.00 140.20 ? 33  GLN A NE2 1 
ATOM   192  N N   . HIS A 1 34  ? -44.793  0.470   -93.164  1.00 135.64 ? 34  HIS A N   1 
ATOM   193  C CA  . HIS A 1 34  ? -43.452  0.735   -93.661  1.00 135.92 ? 34  HIS A CA  1 
ATOM   194  C C   . HIS A 1 34  ? -43.083  2.207   -93.870  1.00 136.03 ? 34  HIS A C   1 
ATOM   195  O O   . HIS A 1 34  ? -41.896  2.551   -93.850  1.00 136.02 ? 34  HIS A O   1 
ATOM   196  C CB  . HIS A 1 34  ? -43.200  -0.102  -94.913  1.00 135.96 ? 34  HIS A CB  1 
ATOM   197  C CG  . HIS A 1 34  ? -43.348  -1.574  -94.681  1.00 136.16 ? 34  HIS A CG  1 
ATOM   198  N ND1 . HIS A 1 34  ? -44.525  -2.253  -94.921  1.00 136.12 ? 34  HIS A ND1 1 
ATOM   199  C CD2 . HIS A 1 34  ? -42.474  -2.493  -94.205  1.00 136.16 ? 34  HIS A CD2 1 
ATOM   200  C CE1 . HIS A 1 34  ? -44.364  -3.529  -94.616  1.00 136.17 ? 34  HIS A CE1 1 
ATOM   201  N NE2 . HIS A 1 34  ? -43.129  -3.700  -94.178  1.00 136.35 ? 34  HIS A NE2 1 
ATOM   202  N N   . VAL A 1 35  ? -44.082  3.069   -94.060  1.00 136.22 ? 35  VAL A N   1 
ATOM   203  C CA  . VAL A 1 35  ? -43.824  4.514   -94.129  1.00 136.40 ? 35  VAL A CA  1 
ATOM   204  C C   . VAL A 1 35  ? -44.133  5.186   -92.791  1.00 136.48 ? 35  VAL A C   1 
ATOM   205  O O   . VAL A 1 35  ? -43.237  5.748   -92.152  1.00 136.51 ? 35  VAL A O   1 
ATOM   206  C CB  . VAL A 1 35  ? -44.562  5.247   -95.309  1.00 136.41 ? 35  VAL A CB  1 
ATOM   207  C CG1 . VAL A 1 35  ? -44.521  4.422   -96.592  1.00 136.49 ? 35  VAL A CG1 1 
ATOM   208  C CG2 . VAL A 1 35  ? -45.992  5.628   -94.935  1.00 136.26 ? 35  VAL A CG2 1 
ATOM   209  N N   . MET A 1 36  ? -45.396  5.110   -92.368  1.00 136.49 ? 36  MET A N   1 
ATOM   210  C CA  . MET A 1 36  ? -45.831  5.732   -91.120  1.00 136.48 ? 36  MET A CA  1 
ATOM   211  C C   . MET A 1 36  ? -45.578  4.851   -89.895  1.00 136.13 ? 36  MET A C   1 
ATOM   212  O O   . MET A 1 36  ? -46.216  5.036   -88.857  1.00 136.06 ? 36  MET A O   1 
ATOM   213  C CB  . MET A 1 36  ? -47.290  6.190   -91.209  1.00 136.57 ? 36  MET A CB  1 
ATOM   214  C CG  . MET A 1 36  ? -47.422  7.671   -91.545  1.00 137.30 ? 36  MET A CG  1 
ATOM   215  S SD  . MET A 1 36  ? -49.116  8.251   -91.825  1.00 139.48 ? 36  MET A SD  1 
ATOM   216  C CE  . MET A 1 36  ? -49.868  8.098   -90.194  1.00 138.89 ? 36  MET A CE  1 
ATOM   217  N N   . LEU A 1 37  ? -44.632  3.916   -90.046  1.00 135.71 ? 37  LEU A N   1 
ATOM   218  C CA  . LEU A 1 37  ? -44.160  2.987   -89.008  1.00 135.43 ? 37  LEU A CA  1 
ATOM   219  C C   . LEU A 1 37  ? -44.351  3.530   -87.587  1.00 135.25 ? 37  LEU A C   1 
ATOM   220  O O   . LEU A 1 37  ? -43.544  4.348   -87.144  1.00 135.35 ? 37  LEU A O   1 
ATOM   221  C CB  . LEU A 1 37  ? -42.671  2.668   -89.257  1.00 135.43 ? 37  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 37  ? -41.992  1.391   -88.734  1.00 135.22 ? 37  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 37  ? -40.719  1.096   -89.530  1.00 134.78 ? 37  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 37  ? -41.686  1.452   -87.244  1.00 134.74 ? 37  LEU A CD2 1 
ATOM   225  N N   . LEU A 1 38  ? -45.390  3.115   -86.850  1.00 134.93 ? 38  LEU A N   1 
ATOM   226  C CA  . LEU A 1 38  ? -46.429  2.108   -87.202  1.00 134.54 ? 38  LEU A CA  1 
ATOM   227  C C   . LEU A 1 38  ? -45.970  0.712   -87.625  1.00 134.33 ? 38  LEU A C   1 
ATOM   228  O O   . LEU A 1 38  ? -45.955  0.353   -88.805  1.00 134.32 ? 38  LEU A O   1 
ATOM   229  C CB  . LEU A 1 38  ? -47.551  2.662   -88.106  1.00 134.50 ? 38  LEU A CB  1 
ATOM   230  C CG  . LEU A 1 38  ? -48.784  3.188   -87.364  1.00 134.01 ? 38  LEU A CG  1 
ATOM   231  C CD1 . LEU A 1 38  ? -49.631  4.078   -88.243  1.00 133.37 ? 38  LEU A CD1 1 
ATOM   232  C CD2 . LEU A 1 38  ? -49.607  2.038   -86.827  1.00 134.04 ? 38  LEU A CD2 1 
ATOM   233  N N   . LYS A 1 39  ? -45.604  -0.064  -86.615  1.00 134.07 ? 39  LYS A N   1 
ATOM   234  C CA  . LYS A 1 39  ? -45.320  -1.481  -86.770  1.00 133.79 ? 39  LYS A CA  1 
ATOM   235  C C   . LYS A 1 39  ? -46.590  -2.300  -86.525  1.00 133.03 ? 39  LYS A C   1 
ATOM   236  O O   . LYS A 1 39  ? -46.945  -3.131  -87.368  1.00 133.07 ? 39  LYS A O   1 
ATOM   237  C CB  . LYS A 1 39  ? -44.205  -1.919  -85.798  1.00 134.09 ? 39  LYS A CB  1 
ATOM   238  C CG  . LYS A 1 39  ? -43.276  -3.019  -86.330  1.00 134.66 ? 39  LYS A CG  1 
ATOM   239  C CD  . LYS A 1 39  ? -41.949  -3.034  -85.571  1.00 135.38 ? 39  LYS A CD  1 
ATOM   240  C CE  . LYS A 1 39  ? -40.757  -3.116  -86.529  1.00 136.06 ? 39  LYS A CE  1 
ATOM   241  N NZ  . LYS A 1 39  ? -40.523  -1.836  -87.286  1.00 136.22 ? 39  LYS A NZ  1 
ATOM   242  N N   . PRO A 1 40  ? -47.302  -2.021  -85.402  1.00 132.24 ? 40  PRO A N   1 
ATOM   243  C CA  . PRO A 1 40  ? -48.243  -2.932  -84.719  1.00 131.46 ? 40  PRO A CA  1 
ATOM   244  C C   . PRO A 1 40  ? -49.123  -3.874  -85.569  1.00 130.47 ? 40  PRO A C   1 
ATOM   245  O O   . PRO A 1 40  ? -49.266  -3.708  -86.790  1.00 130.35 ? 40  PRO A O   1 
ATOM   246  C CB  . PRO A 1 40  ? -49.131  -1.971  -83.888  1.00 131.66 ? 40  PRO A CB  1 
ATOM   247  C CG  . PRO A 1 40  ? -48.789  -0.573  -84.352  1.00 131.81 ? 40  PRO A CG  1 
ATOM   248  C CD  . PRO A 1 40  ? -47.377  -0.667  -84.812  1.00 132.14 ? 40  PRO A CD  1 
ATOM   249  N N   . SER A 1 41  ? -49.705  -4.862  -84.898  1.00 129.24 ? 41  SER A N   1 
ATOM   250  C CA  . SER A 1 41  ? -50.664  -5.741  -85.533  1.00 128.12 ? 41  SER A CA  1 
ATOM   251  C C   . SER A 1 41  ? -51.831  -6.018  -84.610  1.00 127.24 ? 41  SER A C   1 
ATOM   252  O O   . SER A 1 41  ? -52.964  -5.653  -84.905  1.00 127.06 ? 41  SER A O   1 
ATOM   253  C CB  . SER A 1 41  ? -50.007  -7.059  -85.932  1.00 128.28 ? 41  SER A CB  1 
ATOM   254  O OG  . SER A 1 41  ? -50.383  -8.099  -85.045  1.00 128.00 ? 41  SER A OG  1 
ATOM   255  N N   . VAL A 1 42  ? -51.535  -6.639  -83.474  1.00 126.26 ? 42  VAL A N   1 
ATOM   256  C CA  . VAL A 1 42  ? -52.554  -7.299  -82.655  1.00 125.64 ? 42  VAL A CA  1 
ATOM   257  C C   . VAL A 1 42  ? -53.303  -8.343  -83.538  1.00 124.93 ? 42  VAL A C   1 
ATOM   258  O O   . VAL A 1 42  ? -52.665  -9.203  -84.177  1.00 124.50 ? 42  VAL A O   1 
ATOM   259  C CB  . VAL A 1 42  ? -53.530  -6.282  -81.890  1.00 125.86 ? 42  VAL A CB  1 
ATOM   260  C CG1 . VAL A 1 42  ? -53.960  -6.835  -80.498  1.00 125.39 ? 42  VAL A CG1 1 
ATOM   261  C CG2 . VAL A 1 42  ? -52.911  -4.879  -81.735  1.00 125.82 ? 42  VAL A CG2 1 
ATOM   262  N N   . LEU A 1 43  ? -54.638  -8.253  -83.569  1.00 124.06 ? 43  LEU A N   1 
ATOM   263  C CA  . LEU A 1 43  ? -55.493  -9.121  -84.393  1.00 122.93 ? 43  LEU A CA  1 
ATOM   264  C C   . LEU A 1 43  ? -55.491  -8.627  -85.836  1.00 122.38 ? 43  LEU A C   1 
ATOM   265  O O   . LEU A 1 43  ? -56.014  -9.287  -86.726  1.00 122.43 ? 43  LEU A O   1 
ATOM   266  C CB  . LEU A 1 43  ? -56.934  -9.142  -83.853  1.00 122.72 ? 43  LEU A CB  1 
ATOM   267  C CG  . LEU A 1 43  ? -57.206  -9.436  -82.372  1.00 121.78 ? 43  LEU A CG  1 
ATOM   268  C CD1 . LEU A 1 43  ? -58.584  -8.982  -81.987  1.00 120.84 ? 43  LEU A CD1 1 
ATOM   269  C CD2 . LEU A 1 43  ? -57.057  -10.906 -82.064  1.00 121.53 ? 43  LEU A CD2 1 
ATOM   270  N N   . CYS A 1 44  ? -54.893  -7.458  -86.049  1.00 121.55 ? 44  CYS A N   1 
ATOM   271  C CA  . CYS A 1 44  ? -54.793  -6.828  -87.361  1.00 120.74 ? 44  CYS A CA  1 
ATOM   272  C C   . CYS A 1 44  ? -54.249  -7.758  -88.475  1.00 119.79 ? 44  CYS A C   1 
ATOM   273  O O   . CYS A 1 44  ? -54.728  -7.687  -89.606  1.00 119.75 ? 44  CYS A O   1 
ATOM   274  C CB  . CYS A 1 44  ? -53.990  -5.523  -87.236  1.00 120.82 ? 44  CYS A CB  1 
ATOM   275  S SG  . CYS A 1 44  ? -53.798  -4.495  -88.710  1.00 122.28 ? 44  CYS A SG  1 
ATOM   276  N N   . ILE A 1 45  ? -53.278  -8.624  -88.172  1.00 118.61 ? 45  ILE A N   1 
ATOM   277  C CA  . ILE A 1 45  ? -52.821  -9.600  -89.175  1.00 117.62 ? 45  ILE A CA  1 
ATOM   278  C C   . ILE A 1 45  ? -53.910  -10.621 -89.455  1.00 116.98 ? 45  ILE A C   1 
ATOM   279  O O   . ILE A 1 45  ? -54.208  -10.917 -90.611  1.00 117.14 ? 45  ILE A O   1 
ATOM   280  C CB  . ILE A 1 45  ? -51.461  -10.307 -88.845  1.00 117.61 ? 45  ILE A CB  1 
ATOM   281  C CG1 . ILE A 1 45  ? -51.526  -11.128 -87.551  1.00 117.97 ? 45  ILE A CG1 1 
ATOM   282  C CG2 . ILE A 1 45  ? -50.318  -9.312  -88.828  1.00 117.57 ? 45  ILE A CG2 1 
ATOM   283  C CD1 . ILE A 1 45  ? -51.549  -12.641 -87.763  1.00 117.82 ? 45  ILE A CD1 1 
ATOM   284  N N   . TYR A 1 46  ? -54.505  -11.152 -88.392  1.00 116.12 ? 46  TYR A N   1 
ATOM   285  C CA  . TYR A 1 46  ? -55.680  -12.004 -88.506  1.00 115.22 ? 46  TYR A CA  1 
ATOM   286  C C   . TYR A 1 46  ? -56.741  -11.304 -89.365  1.00 113.97 ? 46  TYR A C   1 
ATOM   287  O O   . TYR A 1 46  ? -57.490  -11.953 -90.084  1.00 113.76 ? 46  TYR A O   1 
ATOM   288  C CB  . TYR A 1 46  ? -56.232  -12.303 -87.109  1.00 115.73 ? 46  TYR A CB  1 
ATOM   289  C CG  . TYR A 1 46  ? -56.053  -13.720 -86.608  1.00 116.97 ? 46  TYR A CG  1 
ATOM   290  C CD1 . TYR A 1 46  ? -54.859  -14.143 -86.003  1.00 117.76 ? 46  TYR A CD1 1 
ATOM   291  C CD2 . TYR A 1 46  ? -57.109  -14.632 -86.700  1.00 118.92 ? 46  TYR A CD2 1 
ATOM   292  C CE1 . TYR A 1 46  ? -54.720  -15.461 -85.525  1.00 119.05 ? 46  TYR A CE1 1 
ATOM   293  C CE2 . TYR A 1 46  ? -56.987  -15.941 -86.235  1.00 120.43 ? 46  TYR A CE2 1 
ATOM   294  C CZ  . TYR A 1 46  ? -55.798  -16.354 -85.649  1.00 120.55 ? 46  TYR A CZ  1 
ATOM   295  O OH  . TYR A 1 46  ? -55.729  -17.661 -85.203  1.00 121.52 ? 46  TYR A OH  1 
ATOM   296  N N   . GLU A 1 47  ? -56.769  -9.976  -89.298  1.00 112.64 ? 47  GLU A N   1 
ATOM   297  C CA  . GLU A 1 47  ? -57.710  -9.161  -90.052  1.00 111.62 ? 47  GLU A CA  1 
ATOM   298  C C   . GLU A 1 47  ? -57.271  -8.870  -91.476  1.00 110.91 ? 47  GLU A C   1 
ATOM   299  O O   . GLU A 1 47  ? -58.119  -8.713  -92.355  1.00 110.99 ? 47  GLU A O   1 
ATOM   300  C CB  . GLU A 1 47  ? -57.925  -7.830  -89.357  1.00 111.73 ? 47  GLU A CB  1 
ATOM   301  C CG  . GLU A 1 47  ? -58.744  -7.912  -88.104  1.00 112.18 ? 47  GLU A CG  1 
ATOM   302  C CD  . GLU A 1 47  ? -58.853  -6.575  -87.426  1.00 112.12 ? 47  GLU A CD  1 
ATOM   303  O OE1 . GLU A 1 47  ? -57.883  -5.782  -87.499  1.00 111.85 ? 47  GLU A OE1 1 
ATOM   304  O OE2 . GLU A 1 47  ? -59.911  -6.324  -86.821  1.00 111.88 ? 47  GLU A OE2 1 
ATOM   305  N N   . ARG A 1 48  ? -55.961  -8.742  -91.701  1.00 109.87 ? 48  ARG A N   1 
ATOM   306  C CA  . ARG A 1 48  ? -55.440  -8.622  -93.060  1.00 108.66 ? 48  ARG A CA  1 
ATOM   307  C C   . ARG A 1 48  ? -56.041  -9.776  -93.827  1.00 108.29 ? 48  ARG A C   1 
ATOM   308  O O   . ARG A 1 48  ? -56.718  -9.567  -94.823  1.00 108.33 ? 48  ARG A O   1 
ATOM   309  C CB  . ARG A 1 48  ? -53.912  -8.694  -93.105  1.00 108.39 ? 48  ARG A CB  1 
ATOM   310  C CG  . ARG A 1 48  ? -53.230  -7.488  -92.522  1.00 107.36 ? 48  ARG A CG  1 
ATOM   311  C CD  . ARG A 1 48  ? -51.710  -7.493  -92.704  1.00 105.87 ? 48  ARG A CD  1 
ATOM   312  N NE  . ARG A 1 48  ? -51.113  -6.164  -92.513  1.00 105.07 ? 48  ARG A NE  1 
ATOM   313  C CZ  . ARG A 1 48  ? -51.725  -5.117  -91.945  1.00 105.34 ? 48  ARG A CZ  1 
ATOM   314  N NH1 . ARG A 1 48  ? -52.964  -5.202  -91.468  1.00 105.34 ? 48  ARG A NH1 1 
ATOM   315  N NH2 . ARG A 1 48  ? -51.094  -3.962  -91.842  1.00 105.30 ? 48  ARG A NH2 1 
ATOM   316  N N   . VAL A 1 49  ? -55.831  -10.985 -93.314  1.00 107.75 ? 49  VAL A N   1 
ATOM   317  C CA  . VAL A 1 49  ? -56.420  -12.206 -93.856  1.00 107.51 ? 49  VAL A CA  1 
ATOM   318  C C   . VAL A 1 49  ? -57.905  -12.056 -94.256  1.00 107.43 ? 49  VAL A C   1 
ATOM   319  O O   . VAL A 1 49  ? -58.292  -12.440 -95.357  1.00 107.31 ? 49  VAL A O   1 
ATOM   320  C CB  . VAL A 1 49  ? -56.187  -13.391 -92.877  1.00 107.56 ? 49  VAL A CB  1 
ATOM   321  C CG1 . VAL A 1 49  ? -57.144  -14.560 -93.141  1.00 107.28 ? 49  VAL A CG1 1 
ATOM   322  C CG2 . VAL A 1 49  ? -54.719  -13.843 -92.932  1.00 107.38 ? 49  VAL A CG2 1 
ATOM   323  N N   . ALA A 1 50  ? -58.721  -11.479 -93.381  1.00 107.49 ? 50  ALA A N   1 
ATOM   324  C CA  . ALA A 1 50  ? -60.133  -11.251 -93.687  1.00 107.61 ? 50  ALA A CA  1 
ATOM   325  C C   . ALA A 1 50  ? -60.361  -10.592 -95.057  1.00 107.83 ? 50  ALA A C   1 
ATOM   326  O O   . ALA A 1 50  ? -61.232  -11.025 -95.802  1.00 108.03 ? 50  ALA A O   1 
ATOM   327  C CB  . ALA A 1 50  ? -60.799  -10.449 -92.582  1.00 107.58 ? 50  ALA A CB  1 
ATOM   328  N N   . LEU A 1 51  ? -59.583  -9.559  -95.392  1.00 107.98 ? 51  LEU A N   1 
ATOM   329  C CA  . LEU A 1 51  ? -59.673  -8.922  -96.723  1.00 107.85 ? 51  LEU A CA  1 
ATOM   330  C C   . LEU A 1 51  ? -59.062  -9.749  -97.869  1.00 107.95 ? 51  LEU A C   1 
ATOM   331  O O   . LEU A 1 51  ? -59.530  -9.661  -99.005  1.00 108.13 ? 51  LEU A O   1 
ATOM   332  C CB  . LEU A 1 51  ? -59.091  -7.503  -96.722  1.00 107.56 ? 51  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 51  ? -60.016  -6.284  -96.654  1.00 107.23 ? 51  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 51  ? -59.197  -5.031  -96.868  1.00 107.42 ? 51  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 51  ? -61.147  -6.330  -97.671  1.00 106.63 ? 51  LEU A CD2 1 
ATOM   336  N N   . PHE A 1 52  ? -58.020  -10.532 -97.580  1.00 108.01 ? 52  PHE A N   1 
ATOM   337  C CA  . PHE A 1 52  ? -57.483  -11.482 -98.559  1.00 108.02 ? 52  PHE A CA  1 
ATOM   338  C C   . PHE A 1 52  ? -58.457  -12.638 -98.734  1.00 108.04 ? 52  PHE A C   1 
ATOM   339  O O   . PHE A 1 52  ? -58.252  -13.502 -99.570  1.00 108.43 ? 52  PHE A O   1 
ATOM   340  C CB  . PHE A 1 52  ? -56.094  -12.010 -98.167  1.00 107.94 ? 52  PHE A CB  1 
ATOM   341  C CG  . PHE A 1 52  ? -54.983  -11.009 -98.351  1.00 108.72 ? 52  PHE A CG  1 
ATOM   342  C CD1 . PHE A 1 52  ? -54.789  -10.369 -99.578  1.00 108.98 ? 52  PHE A CD1 1 
ATOM   343  C CD2 . PHE A 1 52  ? -54.108  -10.718 -97.299  1.00 109.28 ? 52  PHE A CD2 1 
ATOM   344  C CE1 . PHE A 1 52  ? -53.748  -9.439  -99.750  1.00 108.81 ? 52  PHE A CE1 1 
ATOM   345  C CE2 . PHE A 1 52  ? -53.066  -9.780  -97.458  1.00 108.93 ? 52  PHE A CE2 1 
ATOM   346  C CZ  . PHE A 1 52  ? -52.891  -9.142  -98.685  1.00 108.93 ? 52  PHE A CZ  1 
ATOM   347  N N   . GLY A 1 53  ? -59.506  -12.663 -97.923  1.00 107.94 ? 53  GLY A N   1 
ATOM   348  C CA  . GLY A 1 53  ? -60.623  -13.553 -98.161  1.00 107.93 ? 53  GLY A CA  1 
ATOM   349  C C   . GLY A 1 53  ? -61.600  -12.842 -99.075  1.00 108.10 ? 53  GLY A C   1 
ATOM   350  O O   . GLY A 1 53  ? -62.111  -13.436 -100.017 1.00 108.31 ? 53  GLY A O   1 
ATOM   351  N N   . VAL A 1 54  ? -61.848  -11.560 -98.798  1.00 108.21 ? 54  VAL A N   1 
ATOM   352  C CA  . VAL A 1 54  ? -62.738  -10.727 -99.614  1.00 108.16 ? 54  VAL A CA  1 
ATOM   353  C C   . VAL A 1 54  ? -62.270  -10.622 -101.069 1.00 108.59 ? 54  VAL A C   1 
ATOM   354  O O   . VAL A 1 54  ? -63.088  -10.724 -101.983 1.00 108.64 ? 54  VAL A O   1 
ATOM   355  C CB  . VAL A 1 54  ? -62.895  -9.315  -99.041  1.00 107.83 ? 54  VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 54  ? -63.820  -8.512  -99.915  1.00 107.72 ? 54  VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 54  ? -63.431  -9.374  -97.646  1.00 107.34 ? 54  VAL A CG2 1 
ATOM   358  N N   . LEU A 1 55  ? -60.970  -10.400 -101.274 1.00 108.95 ? 55  LEU A N   1 
ATOM   359  C CA  . LEU A 1 55  ? -60.384  -10.500 -102.597 1.00 109.56 ? 55  LEU A CA  1 
ATOM   360  C C   . LEU A 1 55  ? -60.946  -11.728 -103.298 1.00 110.38 ? 55  LEU A C   1 
ATOM   361  O O   . LEU A 1 55  ? -61.830  -11.604 -104.148 1.00 110.53 ? 55  LEU A O   1 
ATOM   362  C CB  . LEU A 1 55  ? -58.866  -10.624 -102.529 1.00 109.30 ? 55  LEU A CB  1 
ATOM   363  C CG  . LEU A 1 55  ? -57.978  -9.391  -102.625 1.00 109.11 ? 55  LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 55  ? -56.737  -9.752  -103.428 1.00 108.13 ? 55  LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 55  ? -58.700  -8.239  -103.273 1.00 109.11 ? 55  LEU A CD2 1 
ATOM   366  N N   . GLY A 1 56  ? -60.446  -12.908 -102.925 1.00 111.18 ? 56  GLY A N   1 
ATOM   367  C CA  . GLY A 1 56  ? -60.885  -14.175 -103.511 1.00 112.15 ? 56  GLY A CA  1 
ATOM   368  C C   . GLY A 1 56  ? -62.265  -14.028 -104.113 1.00 112.97 ? 56  GLY A C   1 
ATOM   369  O O   . GLY A 1 56  ? -62.428  -14.100 -105.326 1.00 113.02 ? 56  GLY A O   1 
ATOM   370  N N   . ALA A 1 57  ? -63.242  -13.763 -103.250 1.00 113.83 ? 57  ALA A N   1 
ATOM   371  C CA  . ALA A 1 57  ? -64.646  -13.580 -103.628 1.00 114.76 ? 57  ALA A CA  1 
ATOM   372  C C   . ALA A 1 57  ? -64.850  -12.742 -104.891 1.00 115.42 ? 57  ALA A C   1 
ATOM   373  O O   . ALA A 1 57  ? -65.411  -13.230 -105.884 1.00 115.63 ? 57  ALA A O   1 
ATOM   374  C CB  . ALA A 1 57  ? -65.404  -12.965 -102.473 1.00 114.55 ? 57  ALA A CB  1 
ATOM   375  N N   . ALA A 1 58  ? -64.390  -11.489 -104.837 1.00 116.07 ? 58  ALA A N   1 
ATOM   376  C CA  . ALA A 1 58  ? -64.565  -10.519 -105.924 1.00 116.65 ? 58  ALA A CA  1 
ATOM   377  C C   . ALA A 1 58  ? -63.763  -10.906 -107.159 1.00 117.04 ? 58  ALA A C   1 
ATOM   378  O O   . ALA A 1 58  ? -64.321  -11.053 -108.247 1.00 116.95 ? 58  ALA A O   1 
ATOM   379  C CB  . ALA A 1 58  ? -64.198  -9.116  -105.456 1.00 116.55 ? 58  ALA A CB  1 
ATOM   380  N N   . LEU A 1 59  ? -62.459  -11.084 -106.965 1.00 117.64 ? 59  LEU A N   1 
ATOM   381  C CA  . LEU A 1 59  ? -61.558  -11.564 -108.001 1.00 118.38 ? 59  LEU A CA  1 
ATOM   382  C C   . LEU A 1 59  ? -62.037  -12.869 -108.666 1.00 119.16 ? 59  LEU A C   1 
ATOM   383  O O   . LEU A 1 59  ? -61.713  -13.114 -109.826 1.00 119.57 ? 59  LEU A O   1 
ATOM   384  C CB  . LEU A 1 59  ? -60.144  -11.711 -107.429 1.00 118.12 ? 59  LEU A CB  1 
ATOM   385  C CG  . LEU A 1 59  ? -59.044  -12.448 -108.193 1.00 117.88 ? 59  LEU A CG  1 
ATOM   386  C CD1 . LEU A 1 59  ? -57.706  -11.835 -107.862 1.00 117.49 ? 59  LEU A CD1 1 
ATOM   387  C CD2 . LEU A 1 59  ? -59.044  -13.944 -107.877 1.00 117.72 ? 59  LEU A CD2 1 
ATOM   388  N N   . ILE A 1 60  ? -62.801  -13.697 -107.949 1.00 119.80 ? 60  ILE A N   1 
ATOM   389  C CA  . ILE A 1 60  ? -63.356  -14.934 -108.530 1.00 120.38 ? 60  ILE A CA  1 
ATOM   390  C C   . ILE A 1 60  ? -64.729  -14.688 -109.169 1.00 120.76 ? 60  ILE A C   1 
ATOM   391  O O   . ILE A 1 60  ? -65.031  -15.225 -110.249 1.00 120.60 ? 60  ILE A O   1 
ATOM   392  C CB  . ILE A 1 60  ? -63.418  -16.084 -107.497 1.00 120.42 ? 60  ILE A CB  1 
ATOM   393  C CG1 . ILE A 1 60  ? -62.005  -16.448 -107.029 1.00 120.64 ? 60  ILE A CG1 1 
ATOM   394  C CG2 . ILE A 1 60  ? -64.080  -17.318 -108.096 1.00 120.62 ? 60  ILE A CG2 1 
ATOM   395  C CD1 . ILE A 1 60  ? -61.958  -17.264 -105.742 1.00 120.23 ? 60  ILE A CD1 1 
ATOM   396  N N   . GLY A 1 61  ? -65.544  -13.872 -108.498 1.00 121.28 ? 61  GLY A N   1 
ATOM   397  C CA  . GLY A 1 61  ? -66.795  -13.367 -109.065 1.00 121.90 ? 61  GLY A CA  1 
ATOM   398  C C   . GLY A 1 61  ? -66.527  -12.628 -110.361 1.00 122.34 ? 61  GLY A C   1 
ATOM   399  O O   . GLY A 1 61  ? -67.398  -12.540 -111.231 1.00 122.38 ? 61  GLY A O   1 
ATOM   400  N N   . ALA A 1 62  ? -65.308  -12.100 -110.477 1.00 122.75 ? 62  ALA A N   1 
ATOM   401  C CA  . ALA A 1 62  ? -64.800  -11.529 -111.723 1.00 123.17 ? 62  ALA A CA  1 
ATOM   402  C C   . ALA A 1 62  ? -64.124  -12.591 -112.607 1.00 123.42 ? 62  ALA A C   1 
ATOM   403  O O   . ALA A 1 62  ? -64.800  -13.203 -113.424 1.00 123.33 ? 62  ALA A O   1 
ATOM   404  C CB  . ALA A 1 62  ? -63.861  -10.348 -111.446 1.00 123.15 ? 62  ALA A CB  1 
ATOM   405  N N   . ILE A 1 63  ? -62.814  -12.810 -112.442 1.00 123.78 ? 63  ILE A N   1 
ATOM   406  C CA  . ILE A 1 63  ? -62.058  -13.743 -113.302 1.00 124.30 ? 63  ILE A CA  1 
ATOM   407  C C   . ILE A 1 63  ? -62.858  -15.020 -113.547 1.00 124.74 ? 63  ILE A C   1 
ATOM   408  O O   . ILE A 1 63  ? -63.218  -15.739 -112.602 1.00 124.83 ? 63  ILE A O   1 
ATOM   409  C CB  . ILE A 1 63  ? -60.602  -14.039 -112.782 1.00 124.28 ? 63  ILE A CB  1 
ATOM   410  C CG1 . ILE A 1 63  ? -59.649  -12.903 -113.156 1.00 124.38 ? 63  ILE A CG1 1 
ATOM   411  C CG2 . ILE A 1 63  ? -60.032  -15.333 -113.364 1.00 123.95 ? 63  ILE A CG2 1 
ATOM   412  C CD1 . ILE A 1 63  ? -59.656  -11.734 -112.190 1.00 124.79 ? 63  ILE A CD1 1 
ATOM   413  N N   . ALA A 1 64  ? -63.130  -15.267 -114.832 1.00 125.17 ? 64  ALA A N   1 
ATOM   414  C CA  . ALA A 1 64  ? -64.099  -16.264 -115.290 1.00 125.47 ? 64  ALA A CA  1 
ATOM   415  C C   . ALA A 1 64  ? -65.426  -16.081 -114.530 1.00 125.68 ? 64  ALA A C   1 
ATOM   416  O O   . ALA A 1 64  ? -65.750  -16.875 -113.640 1.00 125.87 ? 64  ALA A O   1 
ATOM   417  C CB  . ALA A 1 64  ? -63.536  -17.688 -115.149 1.00 125.39 ? 64  ALA A CB  1 
ATOM   418  N N   . PRO A 1 65  ? -66.187  -15.019 -114.881 1.00 125.76 ? 65  PRO A N   1 
ATOM   419  C CA  . PRO A 1 65  ? -67.330  -14.506 -114.118 1.00 125.76 ? 65  PRO A CA  1 
ATOM   420  C C   . PRO A 1 65  ? -68.122  -15.562 -113.346 1.00 125.71 ? 65  PRO A C   1 
ATOM   421  O O   . PRO A 1 65  ? -67.928  -15.653 -112.131 1.00 125.82 ? 65  PRO A O   1 
ATOM   422  C CB  . PRO A 1 65  ? -68.149  -13.785 -115.174 1.00 125.87 ? 65  PRO A CB  1 
ATOM   423  C CG  . PRO A 1 65  ? -67.114  -13.225 -116.085 1.00 126.18 ? 65  PRO A CG  1 
ATOM   424  C CD  . PRO A 1 65  ? -65.977  -14.229 -116.112 1.00 125.87 ? 65  PRO A CD  1 
ATOM   425  N N   . LYS A 1 66  ? -69.000  -16.347 -113.976 1.00 125.60 ? 66  LYS A N   1 
ATOM   426  C CA  . LYS A 1 66  ? -69.533  -16.164 -115.321 1.00 125.67 ? 66  LYS A CA  1 
ATOM   427  C C   . LYS A 1 66  ? -71.050  -16.202 -115.172 1.00 125.62 ? 66  LYS A C   1 
ATOM   428  O O   . LYS A 1 66  ? -71.746  -15.276 -115.590 1.00 125.72 ? 66  LYS A O   1 
ATOM   429  C CB  . LYS A 1 66  ? -69.079  -17.280 -116.272 1.00 125.79 ? 66  LYS A CB  1 
ATOM   430  C CG  . LYS A 1 66  ? -67.774  -17.005 -117.032 1.00 126.32 ? 66  LYS A CG  1 
ATOM   431  C CD  . LYS A 1 66  ? -67.736  -17.651 -118.441 1.00 126.34 ? 66  LYS A CD  1 
ATOM   432  C CE  . LYS A 1 66  ? -66.305  -18.042 -118.881 1.00 126.34 ? 66  LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 66  ? -65.266  -16.946 -118.817 1.00 125.92 ? 66  LYS A NZ  1 
ATOM   434  N N   . THR A 1 67  ? -71.542  -17.287 -114.572 1.00 125.44 ? 67  THR A N   1 
ATOM   435  C CA  . THR A 1 67  ? -72.928  -17.430 -114.075 1.00 125.20 ? 67  THR A CA  1 
ATOM   436  C C   . THR A 1 67  ? -73.033  -18.664 -113.143 1.00 124.95 ? 67  THR A C   1 
ATOM   437  O O   . THR A 1 67  ? -73.915  -18.726 -112.274 1.00 124.84 ? 67  THR A O   1 
ATOM   438  C CB  . THR A 1 67  ? -73.999  -17.440 -115.225 1.00 125.27 ? 67  THR A CB  1 
ATOM   439  O OG1 . THR A 1 67  ? -74.200  -16.100 -115.703 1.00 124.87 ? 67  THR A OG1 1 
ATOM   440  C CG2 . THR A 1 67  ? -75.353  -18.009 -114.755 1.00 124.97 ? 67  THR A CG2 1 
ATOM   441  N N   . PRO A 1 68  ? -72.118  -19.643 -113.312 1.00 124.70 ? 68  PRO A N   1 
ATOM   442  C CA  . PRO A 1 68  ? -72.072  -20.746 -112.342 1.00 124.52 ? 68  PRO A CA  1 
ATOM   443  C C   . PRO A 1 68  ? -71.238  -20.416 -111.071 1.00 124.23 ? 68  PRO A C   1 
ATOM   444  O O   . PRO A 1 68  ? -71.712  -20.603 -109.933 1.00 124.08 ? 68  PRO A O   1 
ATOM   445  C CB  . PRO A 1 68  ? -71.434  -21.885 -113.151 1.00 124.46 ? 68  PRO A CB  1 
ATOM   446  C CG  . PRO A 1 68  ? -70.571  -21.197 -114.171 1.00 124.45 ? 68  PRO A CG  1 
ATOM   447  C CD  . PRO A 1 68  ? -71.190  -19.855 -114.448 1.00 124.53 ? 68  PRO A CD  1 
ATOM   448  N N   . LEU A 1 69  ? -70.020  -19.918 -111.297 1.00 123.56 ? 69  LEU A N   1 
ATOM   449  C CA  . LEU A 1 69  ? -69.037  -19.608 -110.267 1.00 122.94 ? 69  LEU A CA  1 
ATOM   450  C C   . LEU A 1 69  ? -69.466  -18.430 -109.397 1.00 122.87 ? 69  LEU A C   1 
ATOM   451  O O   . LEU A 1 69  ? -68.993  -18.279 -108.268 1.00 122.77 ? 69  LEU A O   1 
ATOM   452  C CB  . LEU A 1 69  ? -67.702  -19.309 -110.953 1.00 122.76 ? 69  LEU A CB  1 
ATOM   453  C CG  . LEU A 1 69  ? -66.350  -19.287 -110.243 1.00 122.11 ? 69  LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 69  ? -66.086  -20.534 -109.421 1.00 121.15 ? 69  LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 69  ? -65.272  -19.119 -111.293 1.00 121.88 ? 69  LEU A CD2 1 
ATOM   456  N N   . ARG A 1 70  ? -70.371  -17.610 -109.930 1.00 122.75 ? 70  ARG A N   1 
ATOM   457  C CA  . ARG A 1 70  ? -70.933  -16.452 -109.220 1.00 122.67 ? 70  ARG A CA  1 
ATOM   458  C C   . ARG A 1 70  ? -71.684  -16.841 -107.941 1.00 122.32 ? 70  ARG A C   1 
ATOM   459  O O   . ARG A 1 70  ? -71.855  -16.018 -107.042 1.00 122.20 ? 70  ARG A O   1 
ATOM   460  C CB  . ARG A 1 70  ? -71.843  -15.633 -110.152 1.00 122.88 ? 70  ARG A CB  1 
ATOM   461  C CG  . ARG A 1 70  ? -71.101  -14.952 -111.318 1.00 123.78 ? 70  ARG A CG  1 
ATOM   462  C CD  . ARG A 1 70  ? -72.043  -14.293 -112.342 1.00 124.25 ? 70  ARG A CD  1 
ATOM   463  N NE  . ARG A 1 70  ? -71.300  -13.741 -113.481 1.00 124.26 ? 70  ARG A NE  1 
ATOM   464  C CZ  . ARG A 1 70  ? -70.883  -12.479 -113.588 1.00 124.43 ? 70  ARG A CZ  1 
ATOM   465  N NH1 . ARG A 1 70  ? -71.124  -11.595 -112.631 1.00 124.64 ? 70  ARG A NH1 1 
ATOM   466  N NH2 . ARG A 1 70  ? -70.220  -12.093 -114.666 1.00 124.18 ? 70  ARG A NH2 1 
ATOM   467  N N   . TYR A 1 71  ? -72.116  -18.100 -107.873 1.00 121.98 ? 71  TYR A N   1 
ATOM   468  C CA  . TYR A 1 71  ? -72.761  -18.674 -106.682 1.00 121.51 ? 71  TYR A CA  1 
ATOM   469  C C   . TYR A 1 71  ? -71.751  -19.016 -105.583 1.00 120.47 ? 71  TYR A C   1 
ATOM   470  O O   . TYR A 1 71  ? -72.059  -18.924 -104.396 1.00 120.06 ? 71  TYR A O   1 
ATOM   471  C CB  . TYR A 1 71  ? -73.548  -19.933 -107.071 1.00 122.04 ? 71  TYR A CB  1 
ATOM   472  C CG  . TYR A 1 71  ? -74.989  -19.683 -107.475 1.00 123.28 ? 71  TYR A CG  1 
ATOM   473  C CD1 . TYR A 1 71  ? -76.040  -20.296 -106.783 1.00 124.13 ? 71  TYR A CD1 1 
ATOM   474  C CD2 . TYR A 1 71  ? -75.305  -18.835 -108.548 1.00 124.06 ? 71  TYR A CD2 1 
ATOM   475  C CE1 . TYR A 1 71  ? -77.368  -20.076 -107.145 1.00 124.59 ? 71  TYR A CE1 1 
ATOM   476  C CE2 . TYR A 1 71  ? -76.629  -18.604 -108.917 1.00 124.56 ? 71  TYR A CE2 1 
ATOM   477  C CZ  . TYR A 1 71  ? -77.656  -19.229 -108.213 1.00 125.10 ? 71  TYR A CZ  1 
ATOM   478  O OH  . TYR A 1 71  ? -78.969  -19.005 -108.571 1.00 125.73 ? 71  TYR A OH  1 
ATOM   479  N N   . VAL A 1 72  ? -70.558  -19.440 -105.999 1.00 119.43 ? 72  VAL A N   1 
ATOM   480  C CA  . VAL A 1 72  ? -69.456  -19.665 -105.085 1.00 118.34 ? 72  VAL A CA  1 
ATOM   481  C C   . VAL A 1 72  ? -69.058  -18.326 -104.516 1.00 117.98 ? 72  VAL A C   1 
ATOM   482  O O   . VAL A 1 72  ? -69.142  -18.120 -103.307 1.00 118.11 ? 72  VAL A O   1 
ATOM   483  C CB  . VAL A 1 72  ? -68.253  -20.320 -105.781 1.00 118.19 ? 72  VAL A CB  1 
ATOM   484  C CG1 . VAL A 1 72  ? -66.976  -20.076 -104.999 1.00 117.50 ? 72  VAL A CG1 1 
ATOM   485  C CG2 . VAL A 1 72  ? -68.493  -21.804 -105.944 1.00 118.10 ? 72  VAL A CG2 1 
ATOM   486  N N   . ALA A 1 73  ? -68.667  -17.405 -105.398 1.00 117.39 ? 73  ALA A N   1 
ATOM   487  C CA  . ALA A 1 73  ? -68.192  -16.076 -104.999 1.00 116.68 ? 73  ALA A CA  1 
ATOM   488  C C   . ALA A 1 73  ? -69.066  -15.448 -103.913 1.00 116.10 ? 73  ALA A C   1 
ATOM   489  O O   . ALA A 1 73  ? -68.562  -14.769 -103.025 1.00 115.95 ? 73  ALA A O   1 
ATOM   490  C CB  . ALA A 1 73  ? -68.083  -15.161 -106.208 1.00 116.59 ? 73  ALA A CB  1 
ATOM   491  N N   . MET A 1 74  ? -70.367  -15.710 -103.981 1.00 115.50 ? 74  MET A N   1 
ATOM   492  C CA  . MET A 1 74  ? -71.333  -15.206 -103.002 1.00 115.09 ? 74  MET A CA  1 
ATOM   493  C C   . MET A 1 74  ? -70.964  -15.535 -101.557 1.00 114.01 ? 74  MET A C   1 
ATOM   494  O O   . MET A 1 74  ? -70.841  -14.648 -100.722 1.00 113.84 ? 74  MET A O   1 
ATOM   495  C CB  . MET A 1 74  ? -72.749  -15.764 -103.283 1.00 115.75 ? 74  MET A CB  1 
ATOM   496  C CG  . MET A 1 74  ? -73.380  -15.466 -104.665 1.00 117.01 ? 74  MET A CG  1 
ATOM   497  S SD  . MET A 1 74  ? -73.386  -13.733 -105.208 1.00 119.64 ? 74  MET A SD  1 
ATOM   498  C CE  . MET A 1 74  ? -73.754  -12.865 -103.679 1.00 119.81 ? 74  MET A CE  1 
ATOM   499  N N   . VAL A 1 75  ? -70.809  -16.824 -101.281 1.00 112.94 ? 75  VAL A N   1 
ATOM   500  C CA  . VAL A 1 75  ? -70.647  -17.331 -99.930  1.00 111.87 ? 75  VAL A CA  1 
ATOM   501  C C   . VAL A 1 75  ? -69.293  -16.898 -99.361  1.00 111.12 ? 75  VAL A C   1 
ATOM   502  O O   . VAL A 1 75  ? -69.195  -16.476 -98.213  1.00 111.02 ? 75  VAL A O   1 
ATOM   503  C CB  . VAL A 1 75  ? -70.821  -18.878 -99.903  1.00 111.92 ? 75  VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 75  ? -69.502  -19.578 -100.154 1.00 111.63 ? 75  VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 75  ? -71.430  -19.342 -98.590  1.00 111.92 ? 75  VAL A CG2 1 
ATOM   506  N N   . ILE A 1 76  ? -68.254  -16.984 -100.180 1.00 110.07 ? 76  ILE A N   1 
ATOM   507  C CA  . ILE A 1 76  ? -66.929  -16.552 -99.768  1.00 109.31 ? 76  ILE A CA  1 
ATOM   508  C C   . ILE A 1 76  ? -66.879  -15.017 -99.606  1.00 108.88 ? 76  ILE A C   1 
ATOM   509  O O   . ILE A 1 76  ? -66.124  -14.510 -98.787  1.00 108.86 ? 76  ILE A O   1 
ATOM   510  C CB  . ILE A 1 76  ? -65.821  -17.161 -100.694 1.00 109.21 ? 76  ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 76  ? -64.419  -16.757 -100.251 1.00 109.04 ? 76  ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 76  ? -66.039  -16.809 -102.159 1.00 109.70 ? 76  ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 76  ? -63.316  -17.485 -101.017 1.00 108.84 ? 76  ILE A CD1 1 
ATOM   514  N N   . TRP A 1 77  ? -67.717  -14.304 -100.369 1.00 108.47 ? 77  TRP A N   1 
ATOM   515  C CA  . TRP A 1 77  ? -67.945  -12.840 -100.242 1.00 107.89 ? 77  TRP A CA  1 
ATOM   516  C C   . TRP A 1 77  ? -68.884  -12.596 -99.063  1.00 106.97 ? 77  TRP A C   1 
ATOM   517  O O   . TRP A 1 77  ? -69.250  -11.463 -98.749  1.00 106.53 ? 77  TRP A O   1 
ATOM   518  C CB  . TRP A 1 77  ? -68.530  -12.287 -101.572 1.00 108.30 ? 77  TRP A CB  1 
ATOM   519  C CG  . TRP A 1 77  ? -68.968  -10.798 -101.675 1.00 109.33 ? 77  TRP A CG  1 
ATOM   520  C CD1 . TRP A 1 77  ? -70.113  -10.237 -101.170 1.00 110.20 ? 77  TRP A CD1 1 
ATOM   521  C CD2 . TRP A 1 77  ? -68.307  -9.746  -102.400 1.00 109.80 ? 77  TRP A CD2 1 
ATOM   522  N NE1 . TRP A 1 77  ? -70.188  -8.902  -101.499 1.00 109.77 ? 77  TRP A NE1 1 
ATOM   523  C CE2 . TRP A 1 77  ? -69.093  -8.574  -102.253 1.00 109.62 ? 77  TRP A CE2 1 
ATOM   524  C CE3 . TRP A 1 77  ? -67.116  -9.671  -103.134 1.00 110.04 ? 77  TRP A CE3 1 
ATOM   525  C CZ2 . TRP A 1 77  ? -68.725  -7.349  -102.814 1.00 109.36 ? 77  TRP A CZ2 1 
ATOM   526  C CZ3 . TRP A 1 77  ? -66.755  -8.447  -103.694 1.00 109.79 ? 77  TRP A CZ3 1 
ATOM   527  C CH2 . TRP A 1 77  ? -67.556  -7.308  -103.527 1.00 109.45 ? 77  TRP A CH2 1 
ATOM   528  N N   . LEU A 1 78  ? -69.281  -13.687 -98.423  1.00 106.10 ? 78  LEU A N   1 
ATOM   529  C CA  . LEU A 1 78  ? -70.135  -13.616 -97.266  1.00 105.48 ? 78  LEU A CA  1 
ATOM   530  C C   . LEU A 1 78  ? -69.325  -13.977 -96.044  1.00 105.10 ? 78  LEU A C   1 
ATOM   531  O O   . LEU A 1 78  ? -69.394  -13.275 -95.032  1.00 105.32 ? 78  LEU A O   1 
ATOM   532  C CB  . LEU A 1 78  ? -71.339  -14.562 -97.393  1.00 105.49 ? 78  LEU A CB  1 
ATOM   533  C CG  . LEU A 1 78  ? -72.750  -14.050 -97.708  1.00 105.00 ? 78  LEU A CG  1 
ATOM   534  C CD1 . LEU A 1 78  ? -73.739  -15.053 -97.171  1.00 104.65 ? 78  LEU A CD1 1 
ATOM   535  C CD2 . LEU A 1 78  ? -73.043  -12.696 -97.092  1.00 104.40 ? 78  LEU A CD2 1 
ATOM   536  N N   . TYR A 1 79  ? -68.554  -15.061 -96.147  1.00 104.31 ? 79  TYR A N   1 
ATOM   537  C CA  . TYR A 1 79  ? -67.808  -15.602 -95.010  1.00 103.58 ? 79  TYR A CA  1 
ATOM   538  C C   . TYR A 1 79  ? -66.791  -14.624 -94.456  1.00 102.85 ? 79  TYR A C   1 
ATOM   539  O O   . TYR A 1 79  ? -66.980  -14.078 -93.379  1.00 102.81 ? 79  TYR A O   1 
ATOM   540  C CB  . TYR A 1 79  ? -67.109  -16.905 -95.386  1.00 103.82 ? 79  TYR A CB  1 
ATOM   541  C CG  . TYR A 1 79  ? -66.331  -17.532 -94.252  1.00 104.27 ? 79  TYR A CG  1 
ATOM   542  C CD1 . TYR A 1 79  ? -66.944  -18.442 -93.380  1.00 104.50 ? 79  TYR A CD1 1 
ATOM   543  C CD2 . TYR A 1 79  ? -64.984  -17.222 -94.051  1.00 104.43 ? 79  TYR A CD2 1 
ATOM   544  C CE1 . TYR A 1 79  ? -66.238  -19.018 -92.338  1.00 105.05 ? 79  TYR A CE1 1 
ATOM   545  C CE2 . TYR A 1 79  ? -64.267  -17.787 -93.007  1.00 105.45 ? 79  TYR A CE2 1 
ATOM   546  C CZ  . TYR A 1 79  ? -64.897  -18.687 -92.152  1.00 105.95 ? 79  TYR A CZ  1 
ATOM   547  O OH  . TYR A 1 79  ? -64.183  -19.254 -91.112  1.00 106.70 ? 79  TYR A OH  1 
ATOM   548  N N   . SER A 1 80  ? -65.722  -14.397 -95.206  1.00 102.17 ? 80  SER A N   1 
ATOM   549  C CA  . SER A 1 80  ? -64.616  -13.551 -94.757  1.00 101.74 ? 80  SER A CA  1 
ATOM   550  C C   . SER A 1 80  ? -64.985  -12.083 -94.480  1.00 101.22 ? 80  SER A C   1 
ATOM   551  O O   . SER A 1 80  ? -64.147  -11.305 -94.014  1.00 101.14 ? 80  SER A O   1 
ATOM   552  C CB  . SER A 1 80  ? -63.434  -13.654 -95.730  1.00 101.87 ? 80  SER A CB  1 
ATOM   553  O OG  . SER A 1 80  ? -63.842  -13.499 -97.086  1.00 102.35 ? 80  SER A OG  1 
ATOM   554  N N   . ALA A 1 81  ? -66.231  -11.707 -94.755  1.00 100.61 ? 81  ALA A N   1 
ATOM   555  C CA  . ALA A 1 81  ? -66.720  -10.390 -94.363  1.00 100.33 ? 81  ALA A CA  1 
ATOM   556  C C   . ALA A 1 81  ? -67.320  -10.449 -92.964  1.00 100.12 ? 81  ALA A C   1 
ATOM   557  O O   . ALA A 1 81  ? -66.985  -9.627  -92.102  1.00 100.24 ? 81  ALA A O   1 
ATOM   558  C CB  . ALA A 1 81  ? -67.739  -9.854  -95.366  1.00 100.46 ? 81  ALA A CB  1 
ATOM   559  N N   . PHE A 1 82  ? -68.214  -11.418 -92.749  1.00 99.66  ? 82  PHE A N   1 
ATOM   560  C CA  . PHE A 1 82  ? -68.781  -11.691 -91.424  1.00 99.03  ? 82  PHE A CA  1 
ATOM   561  C C   . PHE A 1 82  ? -67.681  -12.030 -90.425  1.00 98.52  ? 82  PHE A C   1 
ATOM   562  O O   . PHE A 1 82  ? -67.712  -11.575 -89.285  1.00 98.44  ? 82  PHE A O   1 
ATOM   563  C CB  . PHE A 1 82  ? -69.781  -12.840 -91.500  1.00 99.06  ? 82  PHE A CB  1 
ATOM   564  C CG  . PHE A 1 82  ? -69.827  -13.685 -90.261  1.00 99.20  ? 82  PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 82  ? -68.981  -14.792 -90.126  1.00 98.87  ? 82  PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 82  ? -70.712  -13.377 -89.231  1.00 99.36  ? 82  PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 82  ? -69.017  -15.573 -88.991  1.00 99.07  ? 82  PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 82  ? -70.763  -14.156 -88.089  1.00 99.30  ? 82  PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 82  ? -69.916  -15.257 -87.967  1.00 99.60  ? 82  PHE A CZ  1 
ATOM   570  N N   . ARG A 1 83  ? -66.734  -12.857 -90.865  1.00 97.86  ? 83  ARG A N   1 
ATOM   571  C CA  . ARG A 1 83  ? -65.508  -13.099 -90.131  1.00 97.29  ? 83  ARG A CA  1 
ATOM   572  C C   . ARG A 1 83  ? -64.803  -11.776 -89.855  1.00 96.66  ? 83  ARG A C   1 
ATOM   573  O O   . ARG A 1 83  ? -64.516  -11.443 -88.709  1.00 96.81  ? 83  ARG A O   1 
ATOM   574  C CB  . ARG A 1 83  ? -64.597  -14.087 -90.877  1.00 97.33  ? 83  ARG A CB  1 
ATOM   575  C CG  . ARG A 1 83  ? -64.446  -15.439 -90.184  1.00 98.32  ? 83  ARG A CG  1 
ATOM   576  C CD  . ARG A 1 83  ? -63.651  -15.287 -88.863  1.00 100.78 ? 83  ARG A CD  1 
ATOM   577  N NE  . ARG A 1 83  ? -63.268  -16.556 -88.254  1.00 102.85 ? 83  ARG A NE  1 
ATOM   578  C CZ  . ARG A 1 83  ? -62.413  -17.434 -88.788  1.00 105.10 ? 83  ARG A CZ  1 
ATOM   579  N NH1 . ARG A 1 83  ? -61.844  -17.212 -89.975  1.00 105.18 ? 83  ARG A NH1 1 
ATOM   580  N NH2 . ARG A 1 83  ? -62.135  -18.560 -88.138  1.00 106.13 ? 83  ARG A NH2 1 
ATOM   581  N N   . GLY A 1 84  ? -64.558  -11.001 -90.897  1.00 96.07  ? 84  GLY A N   1 
ATOM   582  C CA  . GLY A 1 84  ? -63.990  -9.680  -90.706  1.00 95.74  ? 84  GLY A CA  1 
ATOM   583  C C   . GLY A 1 84  ? -64.632  -8.941  -89.542  1.00 95.43  ? 84  GLY A C   1 
ATOM   584  O O   . GLY A 1 84  ? -63.935  -8.526  -88.614  1.00 95.46  ? 84  GLY A O   1 
ATOM   585  N N   . VAL A 1 85  ? -65.957  -8.796  -89.580  1.00 94.97  ? 85  VAL A N   1 
ATOM   586  C CA  . VAL A 1 85  ? -66.667  -8.045  -88.551  1.00 94.54  ? 85  VAL A CA  1 
ATOM   587  C C   . VAL A 1 85  ? -66.315  -8.532  -87.157  1.00 94.54  ? 85  VAL A C   1 
ATOM   588  O O   . VAL A 1 85  ? -65.796  -7.755  -86.361  1.00 94.72  ? 85  VAL A O   1 
ATOM   589  C CB  . VAL A 1 85  ? -68.199  -8.022  -88.770  1.00 94.50  ? 85  VAL A CB  1 
ATOM   590  C CG1 . VAL A 1 85  ? -68.940  -7.614  -87.496  1.00 93.48  ? 85  VAL A CG1 1 
ATOM   591  C CG2 . VAL A 1 85  ? -68.538  -7.069  -89.896  1.00 94.70  ? 85  VAL A CG2 1 
ATOM   592  N N   . GLN A 1 86  ? -66.552  -9.817  -86.883  1.00 94.48  ? 86  GLN A N   1 
ATOM   593  C CA  . GLN A 1 86  ? -66.366  -10.377 -85.534  1.00 94.44  ? 86  GLN A CA  1 
ATOM   594  C C   . GLN A 1 86  ? -64.924  -10.238 -85.016  1.00 94.85  ? 86  GLN A C   1 
ATOM   595  O O   . GLN A 1 86  ? -64.710  -10.007 -83.809  1.00 94.78  ? 86  GLN A O   1 
ATOM   596  C CB  . GLN A 1 86  ? -66.900  -11.820 -85.426  1.00 94.15  ? 86  GLN A CB  1 
ATOM   597  C CG  . GLN A 1 86  ? -66.126  -12.890 -86.194  1.00 93.33  ? 86  GLN A CG  1 
ATOM   598  C CD  . GLN A 1 86  ? -66.832  -14.247 -86.225  1.00 92.00  ? 86  GLN A CD  1 
ATOM   599  O OE1 . GLN A 1 86  ? -66.255  -15.257 -86.654  1.00 91.55  ? 86  GLN A OE1 1 
ATOM   600  N NE2 . GLN A 1 86  ? -68.078  -14.273 -85.775  1.00 90.54  ? 86  GLN A NE2 1 
ATOM   601  N N   . LEU A 1 87  ? -63.957  -10.329 -85.936  1.00 95.05  ? 87  LEU A N   1 
ATOM   602  C CA  . LEU A 1 87  ? -62.562  -9.964  -85.647  1.00 95.36  ? 87  LEU A CA  1 
ATOM   603  C C   . LEU A 1 87  ? -62.362  -8.459  -85.343  1.00 95.48  ? 87  LEU A C   1 
ATOM   604  O O   . LEU A 1 87  ? -61.779  -8.122  -84.309  1.00 95.87  ? 87  LEU A O   1 
ATOM   605  C CB  . LEU A 1 87  ? -61.610  -10.435 -86.752  1.00 95.27  ? 87  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 87  ? -61.623  -11.922 -87.131  1.00 95.64  ? 87  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 87  ? -60.190  -12.411 -87.302  1.00 95.69  ? 87  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 87  ? -62.364  -12.798 -86.108  1.00 96.19  ? 87  LEU A CD2 1 
ATOM   609  N N   . THR A 1 88  ? -62.855  -7.563  -86.205  1.00 95.22  ? 88  THR A N   1 
ATOM   610  C CA  . THR A 1 88  ? -62.765  -6.116  -85.922  1.00 94.90  ? 88  THR A CA  1 
ATOM   611  C C   . THR A 1 88  ? -63.605  -5.680  -84.741  1.00 94.33  ? 88  THR A C   1 
ATOM   612  O O   . THR A 1 88  ? -63.305  -4.670  -84.119  1.00 94.27  ? 88  THR A O   1 
ATOM   613  C CB  . THR A 1 88  ? -63.183  -5.203  -87.106  1.00 95.15  ? 88  THR A CB  1 
ATOM   614  O OG1 . THR A 1 88  ? -64.574  -5.391  -87.400  1.00 94.99  ? 88  THR A OG1 1 
ATOM   615  C CG2 . THR A 1 88  ? -62.326  -5.441  -88.348  1.00 95.70  ? 88  THR A CG2 1 
ATOM   616  N N   . TYR A 1 89  ? -64.662  -6.425  -84.451  1.00 93.89  ? 89  TYR A N   1 
ATOM   617  C CA  . TYR A 1 89  ? -65.564  -6.075  -83.364  1.00 94.02  ? 89  TYR A CA  1 
ATOM   618  C C   . TYR A 1 89  ? -64.925  -6.273  -81.985  1.00 93.92  ? 89  TYR A C   1 
ATOM   619  O O   . TYR A 1 89  ? -64.805  -5.317  -81.203  1.00 93.76  ? 89  TYR A O   1 
ATOM   620  C CB  . TYR A 1 89  ? -66.843  -6.890  -83.470  1.00 94.20  ? 89  TYR A CB  1 
ATOM   621  C CG  . TYR A 1 89  ? -67.740  -6.782  -82.270  1.00 94.79  ? 89  TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 89  ? -67.776  -7.802  -81.312  1.00 95.54  ? 89  TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 89  ? -68.559  -5.665  -82.091  1.00 95.24  ? 89  TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 89  ? -68.612  -7.715  -80.200  1.00 96.73  ? 89  TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 89  ? -69.406  -5.560  -80.983  1.00 96.54  ? 89  TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 89  ? -69.431  -6.590  -80.037  1.00 97.48  ? 89  TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 89  ? -70.261  -6.493  -78.930  1.00 97.70  ? 89  TYR A OH  1 
ATOM   628  N N   . GLU A 1 90  ? -64.523  -7.513  -81.686  1.00 93.55  ? 90  GLU A N   1 
ATOM   629  C CA  . GLU A 1 90  ? -63.845  -7.794  -80.416  1.00 92.76  ? 90  GLU A CA  1 
ATOM   630  C C   . GLU A 1 90  ? -62.585  -6.972  -80.315  1.00 91.33  ? 90  GLU A C   1 
ATOM   631  O O   . GLU A 1 90  ? -62.301  -6.407  -79.269  1.00 91.25  ? 90  GLU A O   1 
ATOM   632  C CB  . GLU A 1 90  ? -63.560  -9.288  -80.214  1.00 93.18  ? 90  GLU A CB  1 
ATOM   633  C CG  . GLU A 1 90  ? -62.499  -9.908  -81.094  1.00 95.06  ? 90  GLU A CG  1 
ATOM   634  C CD  . GLU A 1 90  ? -62.490  -11.430 -80.970  1.00 99.05  ? 90  GLU A CD  1 
ATOM   635  O OE1 . GLU A 1 90  ? -62.591  -11.943 -79.822  1.00 99.46  ? 90  GLU A OE1 1 
ATOM   636  O OE2 . GLU A 1 90  ? -62.395  -12.118 -82.024  1.00 101.33 ? 90  GLU A OE2 1 
ATOM   637  N N   . HIS A 1 91  ? -61.862  -6.872  -81.419  1.00 89.93  ? 91  HIS A N   1 
ATOM   638  C CA  . HIS A 1 91  ? -60.744  -5.960  -81.489  1.00 89.06  ? 91  HIS A CA  1 
ATOM   639  C C   . HIS A 1 91  ? -61.107  -4.528  -81.078  1.00 88.86  ? 91  HIS A C   1 
ATOM   640  O O   . HIS A 1 91  ? -60.286  -3.832  -80.472  1.00 88.82  ? 91  HIS A O   1 
ATOM   641  C CB  . HIS A 1 91  ? -60.136  -5.946  -82.879  1.00 88.68  ? 91  HIS A CB  1 
ATOM   642  C CG  . HIS A 1 91  ? -58.775  -5.340  -82.921  1.00 87.57  ? 91  HIS A CG  1 
ATOM   643  N ND1 . HIS A 1 91  ? -57.678  -6.017  -83.406  1.00 86.89  ? 91  HIS A ND1 1 
ATOM   644  C CD2 . HIS A 1 91  ? -58.325  -4.132  -82.508  1.00 86.70  ? 91  HIS A CD2 1 
ATOM   645  C CE1 . HIS A 1 91  ? -56.613  -5.240  -83.314  1.00 87.77  ? 91  HIS A CE1 1 
ATOM   646  N NE2 . HIS A 1 91  ? -56.979  -4.091  -82.771  1.00 88.00  ? 91  HIS A NE2 1 
ATOM   647  N N   . THR A 1 92  ? -62.317  -4.085  -81.418  1.00 88.46  ? 92  THR A N   1 
ATOM   648  C CA  . THR A 1 92  ? -62.748  -2.736  -81.075  1.00 87.97  ? 92  THR A CA  1 
ATOM   649  C C   . THR A 1 92  ? -63.132  -2.748  -79.621  1.00 88.15  ? 92  THR A C   1 
ATOM   650  O O   . THR A 1 92  ? -62.532  -2.036  -78.817  1.00 88.25  ? 92  THR A O   1 
ATOM   651  C CB  . THR A 1 92  ? -63.881  -2.233  -81.984  1.00 87.76  ? 92  THR A CB  1 
ATOM   652  O OG1 . THR A 1 92  ? -63.306  -1.729  -83.193  1.00 87.38  ? 92  THR A OG1 1 
ATOM   653  C CG2 . THR A 1 92  ? -64.666  -1.113  -81.332  1.00 87.26  ? 92  THR A CG2 1 
ATOM   654  N N   . MET A 1 93  ? -64.101  -3.597  -79.290  1.00 88.31  ? 93  MET A N   1 
ATOM   655  C CA  . MET A 1 93  ? -64.477  -3.880  -77.910  1.00 88.47  ? 93  MET A CA  1 
ATOM   656  C C   . MET A 1 93  ? -63.290  -3.816  -76.955  1.00 88.24  ? 93  MET A C   1 
ATOM   657  O O   . MET A 1 93  ? -63.325  -3.086  -75.964  1.00 88.64  ? 93  MET A O   1 
ATOM   658  C CB  . MET A 1 93  ? -65.155  -5.254  -77.815  1.00 88.71  ? 93  MET A CB  1 
ATOM   659  C CG  . MET A 1 93  ? -66.636  -5.217  -78.128  1.00 89.74  ? 93  MET A CG  1 
ATOM   660  S SD  . MET A 1 93  ? -67.346  -3.701  -77.437  1.00 93.11  ? 93  MET A SD  1 
ATOM   661  C CE  . MET A 1 93  ? -69.045  -3.736  -78.030  1.00 91.90  ? 93  MET A CE  1 
ATOM   662  N N   . LEU A 1 94  ? -62.228  -4.543  -77.284  1.00 87.61  ? 94  LEU A N   1 
ATOM   663  C CA  . LEU A 1 94  ? -61.059  -4.629  -76.441  1.00 87.19  ? 94  LEU A CA  1 
ATOM   664  C C   . LEU A 1 94  ? -60.337  -3.298  -76.214  1.00 87.13  ? 94  LEU A C   1 
ATOM   665  O O   . LEU A 1 94  ? -59.230  -3.295  -75.717  1.00 86.88  ? 94  LEU A O   1 
ATOM   666  C CB  . LEU A 1 94  ? -60.111  -5.671  -77.015  1.00 87.20  ? 94  LEU A CB  1 
ATOM   667  C CG  . LEU A 1 94  ? -59.613  -6.744  -76.051  1.00 87.58  ? 94  LEU A CG  1 
ATOM   668  C CD1 . LEU A 1 94  ? -59.529  -8.090  -76.764  1.00 86.91  ? 94  LEU A CD1 1 
ATOM   669  C CD2 . LEU A 1 94  ? -58.265  -6.361  -75.406  1.00 88.57  ? 94  LEU A CD2 1 
ATOM   670  N N   . GLN A 1 95  ? -60.958  -2.177  -76.585  1.00 87.57  ? 95  GLN A N   1 
ATOM   671  C CA  . GLN A 1 95  ? -60.519  -0.845  -76.138  1.00 88.18  ? 95  GLN A CA  1 
ATOM   672  C C   . GLN A 1 95  ? -61.561  -0.142  -75.301  1.00 88.98  ? 95  GLN A C   1 
ATOM   673  O O   . GLN A 1 95  ? -61.271  0.358   -74.219  1.00 89.21  ? 95  GLN A O   1 
ATOM   674  C CB  . GLN A 1 95  ? -60.180  0.077   -77.292  1.00 87.89  ? 95  GLN A CB  1 
ATOM   675  C CG  . GLN A 1 95  ? -58.768  -0.030  -77.736  1.00 87.16  ? 95  GLN A CG  1 
ATOM   676  C CD  . GLN A 1 95  ? -58.590  -1.174  -78.667  1.00 86.29  ? 95  GLN A CD  1 
ATOM   677  O OE1 . GLN A 1 95  ? -59.554  -1.668  -79.250  1.00 86.17  ? 95  GLN A OE1 1 
ATOM   678  N NE2 . GLN A 1 95  ? -57.358  -1.616  -78.821  1.00 86.80  ? 95  GLN A NE2 1 
ATOM   679  N N   . LEU A 1 96  ? -62.778  -0.077  -75.815  1.00 89.99  ? 96  LEU A N   1 
ATOM   680  C CA  . LEU A 1 96  ? -63.880  0.522   -75.065  1.00 91.13  ? 96  LEU A CA  1 
ATOM   681  C C   . LEU A 1 96  ? -64.184  -0.342  -73.840  1.00 91.71  ? 96  LEU A C   1 
ATOM   682  O O   . LEU A 1 96  ? -65.180  -0.133  -73.126  1.00 91.57  ? 96  LEU A O   1 
ATOM   683  C CB  . LEU A 1 96  ? -65.121  0.615   -75.955  1.00 91.26  ? 96  LEU A CB  1 
ATOM   684  C CG  . LEU A 1 96  ? -64.848  0.779   -77.445  1.00 90.63  ? 96  LEU A CG  1 
ATOM   685  C CD1 . LEU A 1 96  ? -65.758  -0.182  -78.202  1.00 90.29  ? 96  LEU A CD1 1 
ATOM   686  C CD2 . LEU A 1 96  ? -65.002  2.241   -77.875  1.00 89.57  ? 96  LEU A CD2 1 
ATOM   687  N N   . TYR A 1 97  ? -63.299  -1.304  -73.613  1.00 92.38  ? 97  TYR A N   1 
ATOM   688  C CA  . TYR A 1 97  ? -63.533  -2.399  -72.720  1.00 93.36  ? 97  TYR A CA  1 
ATOM   689  C C   . TYR A 1 97  ? -62.288  -3.289  -72.815  1.00 93.08  ? 97  TYR A C   1 
ATOM   690  O O   . TYR A 1 97  ? -62.357  -4.345  -73.432  1.00 93.39  ? 97  TYR A O   1 
ATOM   691  C CB  . TYR A 1 97  ? -64.749  -3.212  -73.223  1.00 94.10  ? 97  TYR A CB  1 
ATOM   692  C CG  . TYR A 1 97  ? -66.163  -2.722  -72.866  1.00 97.15  ? 97  TYR A CG  1 
ATOM   693  C CD1 . TYR A 1 97  ? -66.796  -1.701  -73.615  1.00 97.74  ? 97  TYR A CD1 1 
ATOM   694  C CD2 . TYR A 1 97  ? -66.894  -3.333  -71.804  1.00 100.08 ? 97  TYR A CD2 1 
ATOM   695  C CE1 . TYR A 1 97  ? -68.088  -1.259  -73.298  1.00 99.75  ? 97  TYR A CE1 1 
ATOM   696  C CE2 . TYR A 1 97  ? -68.201  -2.916  -71.479  1.00 101.04 ? 97  TYR A CE2 1 
ATOM   697  C CZ  . TYR A 1 97  ? -68.797  -1.879  -72.235  1.00 101.67 ? 97  TYR A CZ  1 
ATOM   698  O OH  . TYR A 1 97  ? -70.092  -1.472  -71.931  1.00 101.54 ? 97  TYR A OH  1 
ATOM   699  N N   . PRO A 1 98  ? -61.137  -2.874  -72.238  1.00 92.91  ? 98  PRO A N   1 
ATOM   700  C CA  . PRO A 1 98  ? -59.995  -3.804  -72.265  1.00 92.90  ? 98  PRO A CA  1 
ATOM   701  C C   . PRO A 1 98  ? -60.111  -4.752  -71.091  1.00 93.24  ? 98  PRO A C   1 
ATOM   702  O O   . PRO A 1 98  ? -60.639  -4.361  -70.057  1.00 93.27  ? 98  PRO A O   1 
ATOM   703  C CB  . PRO A 1 98  ? -58.780  -2.890  -72.113  1.00 92.51  ? 98  PRO A CB  1 
ATOM   704  C CG  . PRO A 1 98  ? -59.317  -1.554  -71.684  1.00 92.46  ? 98  PRO A CG  1 
ATOM   705  C CD  . PRO A 1 98  ? -60.806  -1.638  -71.520  1.00 92.62  ? 98  PRO A CD  1 
ATOM   706  N N   . SER A 1 99  ? -59.647  -5.987  -71.237  1.00 93.97  ? 99  SER A N   1 
ATOM   707  C CA  . SER A 1 99  ? -59.994  -7.030  -70.259  1.00 94.94  ? 99  SER A CA  1 
ATOM   708  C C   . SER A 1 99  ? -58.887  -7.268  -69.250  1.00 95.44  ? 99  SER A C   1 
ATOM   709  O O   . SER A 1 99  ? -57.769  -7.542  -69.649  1.00 95.32  ? 99  SER A O   1 
ATOM   710  C CB  . SER A 1 99  ? -60.333  -8.348  -70.964  1.00 95.16  ? 99  SER A CB  1 
ATOM   711  O OG  . SER A 1 99  ? -59.170  -9.137  -71.164  1.00 95.18  ? 99  SER A OG  1 
ATOM   712  N N   . PRO A 1 100 ? -59.206  -7.191  -67.945  1.00 96.23  ? 100 PRO A N   1 
ATOM   713  C CA  . PRO A 1 100 ? -58.262  -7.190  -66.841  1.00 97.42  ? 100 PRO A CA  1 
ATOM   714  C C   . PRO A 1 100 ? -57.031  -8.033  -67.059  1.00 99.10  ? 100 PRO A C   1 
ATOM   715  O O   . PRO A 1 100 ? -56.028  -7.824  -66.382  1.00 98.92  ? 100 PRO A O   1 
ATOM   716  C CB  . PRO A 1 100 ? -59.084  -7.769  -65.707  1.00 97.16  ? 100 PRO A CB  1 
ATOM   717  C CG  . PRO A 1 100 ? -60.404  -7.215  -65.946  1.00 96.43  ? 100 PRO A CG  1 
ATOM   718  C CD  . PRO A 1 100 ? -60.581  -7.075  -67.440  1.00 96.04  ? 100 PRO A CD  1 
ATOM   719  N N   . PHE A 1 101 ? -57.105  -8.961  -68.009  1.00 101.59 ? 101 PHE A N   1 
ATOM   720  C CA  . PHE A 1 101 ? -56.004  -9.900  -68.290  1.00 104.14 ? 101 PHE A CA  1 
ATOM   721  C C   . PHE A 1 101 ? -55.119  -9.504  -69.461  1.00 106.22 ? 101 PHE A C   1 
ATOM   722  O O   . PHE A 1 101 ? -53.914  -9.289  -69.287  1.00 106.51 ? 101 PHE A O   1 
ATOM   723  C CB  . PHE A 1 101 ? -56.552  -11.317 -68.433  1.00 103.53 ? 101 PHE A CB  1 
ATOM   724  C CG  . PHE A 1 101 ? -57.528  -11.639 -67.374  1.00 102.68 ? 101 PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 101 ? -58.880  -11.599 -67.632  1.00 102.28 ? 101 PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 101 ? -57.100  -11.864 -66.082  1.00 102.38 ? 101 PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 101 ? -59.792  -11.845 -66.630  1.00 102.48 ? 101 PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 101 ? -58.002  -12.107 -65.075  1.00 102.63 ? 101 PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 101 ? -59.354  -12.104 -65.348  1.00 102.57 ? 101 PHE A CZ  1 
ATOM   730  N N   . ALA A 1 102 ? -55.704  -9.377  -70.644  1.00 108.86 ? 102 ALA A N   1 
ATOM   731  C CA  . ALA A 1 102 ? -54.901  -9.093  -71.817  1.00 111.68 ? 102 ALA A CA  1 
ATOM   732  C C   . ALA A 1 102 ? -53.836  -10.182 -71.902  1.00 113.76 ? 102 ALA A C   1 
ATOM   733  O O   . ALA A 1 102 ? -54.030  -11.293 -71.389  1.00 114.05 ? 102 ALA A O   1 
ATOM   734  C CB  . ALA A 1 102 ? -54.261  -7.687  -71.727  1.00 111.25 ? 102 ALA A CB  1 
ATOM   735  N N   . THR A 1 103 ? -52.725  -9.861  -72.553  1.00 116.41 ? 103 THR A N   1 
ATOM   736  C CA  . THR A 1 103 ? -51.621  -10.778 -72.749  1.00 118.97 ? 103 THR A CA  1 
ATOM   737  C C   . THR A 1 103 ? -50.542  -9.963  -73.421  1.00 120.98 ? 103 THR A C   1 
ATOM   738  O O   . THR A 1 103 ? -49.450  -9.798  -72.870  1.00 121.45 ? 103 THR A O   1 
ATOM   739  C CB  . THR A 1 103 ? -51.980  -11.976 -73.671  1.00 118.95 ? 103 THR A CB  1 
ATOM   740  O OG1 . THR A 1 103 ? -53.141  -12.657 -73.176  1.00 118.98 ? 103 THR A OG1 1 
ATOM   741  C CG2 . THR A 1 103 ? -50.807  -12.965 -73.761  1.00 119.12 ? 103 THR A CG2 1 
ATOM   742  N N   . CYS A 1 104 ? -50.860  -9.430  -74.603  1.00 123.26 ? 104 CYS A N   1 
ATOM   743  C CA  . CYS A 1 104 ? -49.867  -8.746  -75.418  1.00 125.79 ? 104 CYS A CA  1 
ATOM   744  C C   . CYS A 1 104 ? -48.968  -9.796  -76.105  1.00 126.47 ? 104 CYS A C   1 
ATOM   745  O O   . CYS A 1 104 ? -47.748  -9.851  -75.878  1.00 126.62 ? 104 CYS A O   1 
ATOM   746  C CB  . CYS A 1 104 ? -49.050  -7.778  -74.543  1.00 126.31 ? 104 CYS A CB  1 
ATOM   747  S SG  . CYS A 1 104 ? -47.981  -6.657  -75.441  1.00 130.20 ? 104 CYS A SG  1 
ATOM   748  N N   . ASP A 1 105 ? -49.589  -10.644 -76.929  1.00 127.44 ? 105 ASP A N   1 
ATOM   749  C CA  . ASP A 1 105 ? -48.858  -11.687 -77.662  1.00 128.17 ? 105 ASP A CA  1 
ATOM   750  C C   . ASP A 1 105 ? -48.815  -11.417 -79.175  1.00 128.64 ? 105 ASP A C   1 
ATOM   751  O O   . ASP A 1 105 ? -49.321  -10.391 -79.654  1.00 128.57 ? 105 ASP A O   1 
ATOM   752  C CB  . ASP A 1 105 ? -49.396  -13.097 -77.341  1.00 128.26 ? 105 ASP A CB  1 
ATOM   753  C CG  . ASP A 1 105 ? -50.658  -13.445 -78.121  1.00 128.42 ? 105 ASP A CG  1 
ATOM   754  O OD1 . ASP A 1 105 ? -50.676  -14.505 -78.789  1.00 127.86 ? 105 ASP A OD1 1 
ATOM   755  O OD2 . ASP A 1 105 ? -51.627  -12.657 -78.071  1.00 129.02 ? 105 ASP A OD2 1 
ATOM   756  N N   . PHE A 1 106 ? -48.202  -12.348 -79.909  1.00 129.31 ? 106 PHE A N   1 
ATOM   757  C CA  . PHE A 1 106 ? -47.759  -12.121 -81.288  1.00 129.96 ? 106 PHE A CA  1 
ATOM   758  C C   . PHE A 1 106 ? -47.971  -13.388 -82.132  1.00 130.28 ? 106 PHE A C   1 
ATOM   759  O O   . PHE A 1 106 ? -49.106  -13.713 -82.484  1.00 130.16 ? 106 PHE A O   1 
ATOM   760  C CB  . PHE A 1 106 ? -46.293  -11.655 -81.267  1.00 129.98 ? 106 PHE A CB  1 
ATOM   761  C CG  . PHE A 1 106 ? -45.996  -10.675 -80.152  1.00 130.46 ? 106 PHE A CG  1 
ATOM   762  C CD1 . PHE A 1 106 ? -45.479  -11.118 -78.931  1.00 131.23 ? 106 PHE A CD1 1 
ATOM   763  C CD2 . PHE A 1 106 ? -46.286  -9.319  -80.299  1.00 130.51 ? 106 PHE A CD2 1 
ATOM   764  C CE1 . PHE A 1 106 ? -45.234  -10.219 -77.884  1.00 131.11 ? 106 PHE A CE1 1 
ATOM   765  C CE2 . PHE A 1 106 ? -46.037  -8.418  -79.261  1.00 130.65 ? 106 PHE A CE2 1 
ATOM   766  C CZ  . PHE A 1 106 ? -45.515  -8.870  -78.052  1.00 130.71 ? 106 PHE A CZ  1 
ATOM   767  N N   . MET A 1 107 ? -46.886  -14.084 -82.462  1.00 130.83 ? 107 MET A N   1 
ATOM   768  C CA  . MET A 1 107 ? -46.938  -15.490 -82.916  1.00 131.52 ? 107 MET A CA  1 
ATOM   769  C C   . MET A 1 107 ? -47.963  -15.904 -84.034  1.00 131.53 ? 107 MET A C   1 
ATOM   770  O O   . MET A 1 107 ? -48.538  -15.056 -84.741  1.00 131.39 ? 107 MET A O   1 
ATOM   771  C CB  . MET A 1 107 ? -47.010  -16.428 -81.673  1.00 131.77 ? 107 MET A CB  1 
ATOM   772  C CG  . MET A 1 107 ? -48.362  -16.458 -80.902  1.00 132.41 ? 107 MET A CG  1 
ATOM   773  S SD  . MET A 1 107 ? -48.223  -16.824 -79.127  1.00 133.22 ? 107 MET A SD  1 
ATOM   774  C CE  . MET A 1 107 ? -49.817  -17.575 -78.774  1.00 132.84 ? 107 MET A CE  1 
ATOM   775  N N   . VAL A 1 108 ? -48.136  -17.223 -84.183  1.00 131.60 ? 108 VAL A N   1 
ATOM   776  C CA  . VAL A 1 108 ? -49.050  -17.859 -85.149  1.00 131.45 ? 108 VAL A CA  1 
ATOM   777  C C   . VAL A 1 108 ? -50.512  -17.761 -84.707  1.00 131.35 ? 108 VAL A C   1 
ATOM   778  O O   . VAL A 1 108 ? -51.422  -18.196 -85.420  1.00 131.14 ? 108 VAL A O   1 
ATOM   779  C CB  . VAL A 1 108 ? -48.681  -19.379 -85.416  1.00 131.54 ? 108 VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 108 ? -47.829  -19.551 -86.688  1.00 131.18 ? 108 VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 108 ? -48.011  -20.036 -84.189  1.00 131.18 ? 108 VAL A CG2 1 
ATOM   782  N N   . LEU A 1 114 ? -50.261  -25.447 -93.023  1.00 149.58 ? 114 LEU A N   1 
ATOM   783  C CA  . LEU A 1 114 ? -50.153  -24.204 -93.785  1.00 149.55 ? 114 LEU A CA  1 
ATOM   784  C C   . LEU A 1 114 ? -49.486  -23.092 -92.968  1.00 149.75 ? 114 LEU A C   1 
ATOM   785  O O   . LEU A 1 114 ? -49.877  -22.841 -91.821  1.00 149.75 ? 114 LEU A O   1 
ATOM   786  C CB  . LEU A 1 114 ? -51.529  -23.749 -94.302  1.00 149.36 ? 114 LEU A CB  1 
ATOM   787  C CG  . LEU A 1 114 ? -51.636  -22.439 -95.105  1.00 148.93 ? 114 LEU A CG  1 
ATOM   788  C CD1 . LEU A 1 114 ? -50.950  -22.522 -96.462  1.00 148.43 ? 114 LEU A CD1 1 
ATOM   789  C CD2 . LEU A 1 114 ? -53.085  -22.014 -95.284  1.00 148.46 ? 114 LEU A CD2 1 
ATOM   790  N N   . PRO A 1 115 ? -48.471  -22.430 -93.558  1.00 149.96 ? 115 PRO A N   1 
ATOM   791  C CA  . PRO A 1 115 ? -47.764  -21.324 -92.909  1.00 150.10 ? 115 PRO A CA  1 
ATOM   792  C C   . PRO A 1 115 ? -48.517  -19.996 -92.940  1.00 150.25 ? 115 PRO A C   1 
ATOM   793  O O   . PRO A 1 115 ? -48.677  -19.381 -93.997  1.00 150.16 ? 115 PRO A O   1 
ATOM   794  C CB  . PRO A 1 115 ? -46.469  -21.211 -93.716  1.00 150.08 ? 115 PRO A CB  1 
ATOM   795  C CG  . PRO A 1 115 ? -46.823  -21.732 -95.061  1.00 150.20 ? 115 PRO A CG  1 
ATOM   796  C CD  . PRO A 1 115 ? -47.819  -22.828 -94.821  1.00 150.01 ? 115 PRO A CD  1 
ATOM   797  N N   . LEU A 1 116 ? -48.981  -19.571 -91.771  1.00 150.58 ? 116 LEU A N   1 
ATOM   798  C CA  . LEU A 1 116 ? -49.450  -18.210 -91.591  1.00 150.82 ? 116 LEU A CA  1 
ATOM   799  C C   . LEU A 1 116 ? -48.217  -17.303 -91.682  1.00 151.24 ? 116 LEU A C   1 
ATOM   800  O O   . LEU A 1 116 ? -47.976  -16.673 -92.724  1.00 151.25 ? 116 LEU A O   1 
ATOM   801  C CB  . LEU A 1 116 ? -50.186  -18.072 -90.249  1.00 150.49 ? 116 LEU A CB  1 
ATOM   802  C CG  . LEU A 1 116 ? -50.701  -16.714 -89.768  1.00 149.81 ? 116 LEU A CG  1 
ATOM   803  C CD1 . LEU A 1 116 ? -51.588  -16.013 -90.784  1.00 148.90 ? 116 LEU A CD1 1 
ATOM   804  C CD2 . LEU A 1 116 ? -51.448  -16.918 -88.475  1.00 149.92 ? 116 LEU A CD2 1 
ATOM   805  N N   . ASP A 1 117 ? -47.421  -17.298 -90.608  1.00 151.60 ? 117 ASP A N   1 
ATOM   806  C CA  . ASP A 1 117 ? -46.182  -16.512 -90.501  1.00 151.99 ? 117 ASP A CA  1 
ATOM   807  C C   . ASP A 1 117 ? -45.254  -16.578 -91.731  1.00 152.08 ? 117 ASP A C   1 
ATOM   808  O O   . ASP A 1 117 ? -44.824  -15.540 -92.241  1.00 152.00 ? 117 ASP A O   1 
ATOM   809  C CB  . ASP A 1 117 ? -45.398  -16.921 -89.233  1.00 152.09 ? 117 ASP A CB  1 
ATOM   810  C CG  . ASP A 1 117 ? -45.694  -16.024 -88.021  1.00 152.58 ? 117 ASP A CG  1 
ATOM   811  O OD1 . ASP A 1 117 ? -45.624  -14.780 -88.146  1.00 153.12 ? 117 ASP A OD1 1 
ATOM   812  O OD2 . ASP A 1 117 ? -45.970  -16.564 -86.926  1.00 152.88 ? 117 ASP A OD2 1 
ATOM   813  N N   . LYS A 1 118 ? -44.969  -17.792 -92.205  1.00 152.32 ? 118 LYS A N   1 
ATOM   814  C CA  . LYS A 1 118 ? -43.854  -18.032 -93.133  1.00 152.45 ? 118 LYS A CA  1 
ATOM   815  C C   . LYS A 1 118 ? -44.034  -17.499 -94.555  1.00 152.65 ? 118 LYS A C   1 
ATOM   816  O O   . LYS A 1 118 ? -43.303  -16.593 -94.961  1.00 152.64 ? 118 LYS A O   1 
ATOM   817  C CB  . LYS A 1 118 ? -43.446  -19.513 -93.159  1.00 152.40 ? 118 LYS A CB  1 
ATOM   818  C CG  . LYS A 1 118 ? -42.623  -19.951 -91.957  1.00 152.24 ? 118 LYS A CG  1 
ATOM   819  C CD  . LYS A 1 118 ? -43.496  -20.581 -90.879  1.00 152.56 ? 118 LYS A CD  1 
ATOM   820  C CE  . LYS A 1 118 ? -43.082  -20.142 -89.475  1.00 153.13 ? 118 LYS A CE  1 
ATOM   821  N NZ  . LYS A 1 118 ? -41.640  -20.383 -89.165  1.00 153.45 ? 118 LYS A NZ  1 
ATOM   822  N N   . TRP A 1 119 ? -44.998  -18.057 -95.296  1.00 152.89 ? 119 TRP A N   1 
ATOM   823  C CA  . TRP A 1 119 ? -45.105  -17.842 -96.755  1.00 153.01 ? 119 TRP A CA  1 
ATOM   824  C C   . TRP A 1 119 ? -45.329  -16.371 -97.172  1.00 152.75 ? 119 TRP A C   1 
ATOM   825  O O   . TRP A 1 119 ? -45.625  -16.097 -98.332  1.00 152.85 ? 119 TRP A O   1 
ATOM   826  C CB  . TRP A 1 119 ? -46.131  -18.807 -97.408  1.00 153.19 ? 119 TRP A CB  1 
ATOM   827  C CG  . TRP A 1 119 ? -45.688  -19.412 -98.766  1.00 154.18 ? 119 TRP A CG  1 
ATOM   828  C CD1 . TRP A 1 119 ? -45.477  -18.734 -99.943  1.00 154.87 ? 119 TRP A CD1 1 
ATOM   829  C CD2 . TRP A 1 119 ? -45.428  -20.805 -99.064  1.00 154.97 ? 119 TRP A CD2 1 
ATOM   830  N NE1 . TRP A 1 119 ? -45.095  -19.608 -100.941 1.00 155.03 ? 119 TRP A NE1 1 
ATOM   831  C CE2 . TRP A 1 119 ? -45.058  -20.881 -100.434 1.00 155.01 ? 119 TRP A CE2 1 
ATOM   832  C CE3 . TRP A 1 119 ? -45.466  -21.991 -98.309  1.00 154.84 ? 119 TRP A CE3 1 
ATOM   833  C CZ2 . TRP A 1 119 ? -44.730  -22.096 -101.062 1.00 154.76 ? 119 TRP A CZ2 1 
ATOM   834  C CZ3 . TRP A 1 119 ? -45.139  -23.200 -98.937  1.00 154.40 ? 119 TRP A CZ3 1 
ATOM   835  C CH2 . TRP A 1 119 ? -44.776  -23.237 -100.300 1.00 154.47 ? 119 TRP A CH2 1 
ATOM   836  N N   . VAL A 1 120 ? -45.206  -15.452 -96.210  1.00 152.52 ? 120 VAL A N   1 
ATOM   837  C CA  . VAL A 1 120 ? -44.874  -14.030 -96.450  1.00 152.32 ? 120 VAL A CA  1 
ATOM   838  C C   . VAL A 1 120 ? -44.363  -13.375 -95.164  1.00 152.38 ? 120 VAL A C   1 
ATOM   839  O O   . VAL A 1 120 ? -44.866  -13.660 -94.075  1.00 152.48 ? 120 VAL A O   1 
ATOM   840  C CB  . VAL A 1 120 ? -46.028  -13.194 -97.095  1.00 152.23 ? 120 VAL A CB  1 
ATOM   841  C CG1 . VAL A 1 120 ? -46.230  -11.864 -96.383  1.00 151.93 ? 120 VAL A CG1 1 
ATOM   842  C CG2 . VAL A 1 120 ? -45.735  -12.940 -98.563  1.00 152.09 ? 120 VAL A CG2 1 
ATOM   843  N N   . PRO A 1 121 ? -43.339  -12.513 -95.282  1.00 152.36 ? 121 PRO A N   1 
ATOM   844  C CA  . PRO A 1 121 ? -42.904  -11.742 -94.122  1.00 152.33 ? 121 PRO A CA  1 
ATOM   845  C C   . PRO A 1 121 ? -43.557  -10.359 -94.037  1.00 152.25 ? 121 PRO A C   1 
ATOM   846  O O   . PRO A 1 121 ? -44.190  -10.040 -93.027  1.00 152.21 ? 121 PRO A O   1 
ATOM   847  C CB  . PRO A 1 121 ? -41.391  -11.614 -94.332  1.00 152.34 ? 121 PRO A CB  1 
ATOM   848  C CG  . PRO A 1 121 ? -41.164  -11.826 -95.811  1.00 152.41 ? 121 PRO A CG  1 
ATOM   849  C CD  . PRO A 1 121 ? -42.430  -12.350 -96.432  1.00 152.37 ? 121 PRO A CD  1 
ATOM   850  N N   . GLN A 1 122 ? -43.432  -9.577  -95.111  1.00 152.12 ? 122 GLN A N   1 
ATOM   851  C CA  . GLN A 1 122 ? -43.731  -8.140  -95.124  1.00 151.94 ? 122 GLN A CA  1 
ATOM   852  C C   . GLN A 1 122 ? -45.211  -7.750  -94.913  1.00 151.69 ? 122 GLN A C   1 
ATOM   853  O O   . GLN A 1 122 ? -45.533  -6.558  -94.845  1.00 151.59 ? 122 GLN A O   1 
ATOM   854  C CB  . GLN A 1 122 ? -43.190  -7.521  -96.420  1.00 151.96 ? 122 GLN A CB  1 
ATOM   855  C CG  . GLN A 1 122 ? -42.371  -6.252  -96.211  1.00 152.27 ? 122 GLN A CG  1 
ATOM   856  C CD  . GLN A 1 122 ? -41.984  -5.559  -97.515  1.00 152.70 ? 122 GLN A CD  1 
ATOM   857  O OE1 . GLN A 1 122 ? -40.895  -4.987  -97.627  1.00 152.83 ? 122 GLN A OE1 1 
ATOM   858  N NE2 . GLN A 1 122 ? -42.878  -5.600  -98.503  1.00 152.51 ? 122 GLN A NE2 1 
ATOM   859  N N   . VAL A 1 123 ? -46.099  -8.742  -94.812  1.00 151.42 ? 123 VAL A N   1 
ATOM   860  C CA  . VAL A 1 123 ? -47.522  -8.491  -94.520  1.00 151.12 ? 123 VAL A CA  1 
ATOM   861  C C   . VAL A 1 123 ? -48.157  -9.566  -93.603  1.00 151.05 ? 123 VAL A C   1 
ATOM   862  O O   . VAL A 1 123 ? -49.304  -9.420  -93.161  1.00 151.01 ? 123 VAL A O   1 
ATOM   863  C CB  . VAL A 1 123 ? -48.355  -8.246  -95.825  1.00 151.01 ? 123 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 123 ? -48.835  -9.549  -96.432  1.00 150.80 ? 123 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 123 ? -49.529  -7.324  -95.553  1.00 150.75 ? 123 VAL A CG2 1 
ATOM   866  N N   . PHE A 1 124 ? -47.399  -10.625 -93.308  1.00 150.76 ? 124 PHE A N   1 
ATOM   867  C CA  . PHE A 1 124 ? -47.862  -11.696 -92.410  1.00 150.44 ? 124 PHE A CA  1 
ATOM   868  C C   . PHE A 1 124 ? -47.085  -11.790 -91.090  1.00 150.11 ? 124 PHE A C   1 
ATOM   869  O O   . PHE A 1 124 ? -47.241  -12.760 -90.346  1.00 150.03 ? 124 PHE A O   1 
ATOM   870  C CB  . PHE A 1 124 ? -47.864  -13.049 -93.132  1.00 150.50 ? 124 PHE A CB  1 
ATOM   871  C CG  . PHE A 1 124 ? -49.133  -13.335 -93.892  1.00 150.86 ? 124 PHE A CG  1 
ATOM   872  C CD1 . PHE A 1 124 ? -49.617  -12.434 -94.846  1.00 150.92 ? 124 PHE A CD1 1 
ATOM   873  C CD2 . PHE A 1 124 ? -49.838  -14.516 -93.668  1.00 151.20 ? 124 PHE A CD2 1 
ATOM   874  C CE1 . PHE A 1 124 ? -50.789  -12.695 -95.554  1.00 150.67 ? 124 PHE A CE1 1 
ATOM   875  C CE2 . PHE A 1 124 ? -51.012  -14.793 -94.371  1.00 151.13 ? 124 PHE A CE2 1 
ATOM   876  C CZ  . PHE A 1 124 ? -51.489  -13.877 -95.316  1.00 151.03 ? 124 PHE A CZ  1 
ATOM   877  N N   . VAL A 1 125 ? -46.257  -10.783 -90.810  1.00 149.71 ? 125 VAL A N   1 
ATOM   878  C CA  . VAL A 1 125 ? -45.570  -10.663 -89.518  1.00 149.23 ? 125 VAL A CA  1 
ATOM   879  C C   . VAL A 1 125 ? -46.361  -9.745  -88.577  1.00 148.86 ? 125 VAL A C   1 
ATOM   880  O O   . VAL A 1 125 ? -46.963  -8.759  -89.015  1.00 148.82 ? 125 VAL A O   1 
ATOM   881  C CB  . VAL A 1 125 ? -44.084  -10.195 -89.676  1.00 149.33 ? 125 VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 125 ? -43.987  -8.710  -90.074  1.00 149.26 ? 125 VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 125 ? -43.277  -10.485 -88.404  1.00 149.21 ? 125 VAL A CG2 1 
ATOM   884  N N   . ALA A 1 126 ? -46.348  -10.073 -87.288  1.00 148.38 ? 126 ALA A N   1 
ATOM   885  C CA  . ALA A 1 126 ? -47.213  -9.415  -86.311  1.00 147.81 ? 126 ALA A CA  1 
ATOM   886  C C   . ALA A 1 126 ? -46.476  -9.003  -85.043  1.00 147.38 ? 126 ALA A C   1 
ATOM   887  O O   . ALA A 1 126 ? -46.491  -9.749  -84.066  1.00 147.42 ? 126 ALA A O   1 
ATOM   888  C CB  . ALA A 1 126 ? -48.359  -10.345 -85.954  1.00 147.82 ? 126 ALA A CB  1 
ATOM   889  N N   . SER A 1 127 ? -45.846  -7.827  -85.042  1.00 146.83 ? 127 SER A N   1 
ATOM   890  C CA  . SER A 1 127 ? -45.105  -7.370  -83.849  1.00 146.37 ? 127 SER A CA  1 
ATOM   891  C C   . SER A 1 127 ? -45.705  -6.126  -83.175  1.00 145.88 ? 127 SER A C   1 
ATOM   892  O O   . SER A 1 127 ? -45.089  -5.051  -83.133  1.00 145.90 ? 127 SER A O   1 
ATOM   893  C CB  . SER A 1 127 ? -43.591  -7.220  -84.123  1.00 146.45 ? 127 SER A CB  1 
ATOM   894  O OG  . SER A 1 127 ? -43.277  -6.048  -84.864  1.00 146.69 ? 127 SER A OG  1 
ATOM   895  N N   . GLY A 1 128 ? -46.915  -6.292  -82.644  1.00 145.21 ? 128 GLY A N   1 
ATOM   896  C CA  . GLY A 1 128 ? -47.583  -5.241  -81.881  1.00 144.34 ? 128 GLY A CA  1 
ATOM   897  C C   . GLY A 1 128 ? -47.244  -5.361  -80.411  1.00 143.61 ? 128 GLY A C   1 
ATOM   898  O O   . GLY A 1 128 ? -47.940  -6.062  -79.675  1.00 143.71 ? 128 GLY A O   1 
ATOM   899  N N   . ASP A 1 129 ? -46.181  -4.663  -79.995  1.00 142.75 ? 129 ASP A N   1 
ATOM   900  C CA  . ASP A 1 129 ? -45.593  -4.788  -78.647  1.00 141.75 ? 129 ASP A CA  1 
ATOM   901  C C   . ASP A 1 129 ? -46.248  -3.906  -77.567  1.00 141.08 ? 129 ASP A C   1 
ATOM   902  O O   . ASP A 1 129 ? -45.650  -3.630  -76.519  1.00 140.99 ? 129 ASP A O   1 
ATOM   903  C CB  . ASP A 1 129 ? -44.087  -4.520  -78.708  1.00 141.72 ? 129 ASP A CB  1 
ATOM   904  C CG  . ASP A 1 129 ? -43.762  -3.102  -79.127  1.00 141.55 ? 129 ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 129 ? -44.691  -2.272  -79.270  1.00 140.87 ? 129 ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 129 ? -42.563  -2.817  -79.310  1.00 141.75 ? 129 ASP A OD2 1 
ATOM   907  N N   . CYS A 1 130 ? -47.469  -3.458  -77.854  1.00 140.14 ? 130 CYS A N   1 
ATOM   908  C CA  . CYS A 1 130 ? -48.345  -2.803  -76.888  1.00 139.02 ? 130 CYS A CA  1 
ATOM   909  C C   . CYS A 1 130 ? -47.787  -1.523  -76.314  1.00 138.90 ? 130 CYS A C   1 
ATOM   910  O O   . CYS A 1 130 ? -47.144  -1.518  -75.268  1.00 138.93 ? 130 CYS A O   1 
ATOM   911  C CB  . CYS A 1 130 ? -48.740  -3.757  -75.758  1.00 138.58 ? 130 CYS A CB  1 
ATOM   912  S SG  . CYS A 1 130 ? -49.290  -5.378  -76.325  1.00 136.83 ? 130 CYS A SG  1 
ATOM   913  N N   . ALA A 1 131 ? -48.012  -0.443  -77.040  1.00 138.84 ? 131 ALA A N   1 
ATOM   914  C CA  . ALA A 1 131 ? -48.074  0.865   -76.442  1.00 138.95 ? 131 ALA A CA  1 
ATOM   915  C C   . ALA A 1 131 ? -49.568  1.073   -76.288  1.00 139.02 ? 131 ALA A C   1 
ATOM   916  O O   . ALA A 1 131 ? -50.317  0.942   -77.262  1.00 139.09 ? 131 ALA A O   1 
ATOM   917  C CB  . ALA A 1 131 ? -47.476  1.902   -77.361  1.00 139.02 ? 131 ALA A CB  1 
ATOM   918  N N   . GLU A 1 132 ? -50.018  1.353   -75.070  1.00 139.04 ? 132 GLU A N   1 
ATOM   919  C CA  . GLU A 1 132 ? -51.451  1.487   -74.830  1.00 139.07 ? 132 GLU A CA  1 
ATOM   920  C C   . GLU A 1 132 ? -51.915  2.827   -75.387  1.00 138.90 ? 132 GLU A C   1 
ATOM   921  O O   . GLU A 1 132 ? -52.559  3.616   -74.709  1.00 138.93 ? 132 GLU A O   1 
ATOM   922  C CB  . GLU A 1 132 ? -51.794  1.307   -73.338  1.00 139.28 ? 132 GLU A CB  1 
ATOM   923  C CG  . GLU A 1 132 ? -53.295  1.031   -73.027  1.00 139.60 ? 132 GLU A CG  1 
ATOM   924  C CD  . GLU A 1 132 ? -53.790  -0.381  -73.404  1.00 139.58 ? 132 GLU A CD  1 
ATOM   925  O OE1 . GLU A 1 132 ? -53.193  -1.387  -72.952  1.00 139.74 ? 132 GLU A OE1 1 
ATOM   926  O OE2 . GLU A 1 132 ? -54.806  -0.478  -74.130  1.00 138.64 ? 132 GLU A OE2 1 
ATOM   927  N N   . ARG A 1 133 ? -51.566  3.069   -76.643  1.00 138.81 ? 133 ARG A N   1 
ATOM   928  C CA  . ARG A 1 133 ? -51.929  4.295   -77.320  1.00 138.92 ? 133 ARG A CA  1 
ATOM   929  C C   . ARG A 1 133 ? -51.892  4.118   -78.827  1.00 138.86 ? 133 ARG A C   1 
ATOM   930  O O   . ARG A 1 133 ? -50.997  3.468   -79.365  1.00 138.89 ? 133 ARG A O   1 
ATOM   931  C CB  . ARG A 1 133 ? -51.029  5.464   -76.877  1.00 139.06 ? 133 ARG A CB  1 
ATOM   932  C CG  . ARG A 1 133 ? -49.501  5.236   -76.928  1.00 139.42 ? 133 ARG A CG  1 
ATOM   933  C CD  . ARG A 1 133 ? -48.833  5.599   -78.290  1.00 140.30 ? 133 ARG A CD  1 
ATOM   934  N NE  . ARG A 1 133 ? -49.508  6.650   -79.072  1.00 140.85 ? 133 ARG A NE  1 
ATOM   935  C CZ  . ARG A 1 133 ? -49.430  7.966   -78.850  1.00 140.61 ? 133 ARG A CZ  1 
ATOM   936  N NH1 . ARG A 1 133 ? -48.714  8.451   -77.842  1.00 140.66 ? 133 ARG A NH1 1 
ATOM   937  N NH2 . ARG A 1 133 ? -50.091  8.806   -79.637  1.00 140.38 ? 133 ARG A NH2 1 
ATOM   938  N N   . GLN A 1 134 ? -52.881  4.695   -79.495  1.00 138.87 ? 134 GLN A N   1 
ATOM   939  C CA  . GLN A 1 134 ? -52.914  4.759   -80.947  1.00 139.15 ? 134 GLN A CA  1 
ATOM   940  C C   . GLN A 1 134 ? -53.633  6.030   -81.366  1.00 139.23 ? 134 GLN A C   1 
ATOM   941  O O   . GLN A 1 134 ? -54.764  6.274   -80.934  1.00 139.31 ? 134 GLN A O   1 
ATOM   942  C CB  . GLN A 1 134 ? -53.635  3.540   -81.531  1.00 139.28 ? 134 GLN A CB  1 
ATOM   943  C CG  . GLN A 1 134 ? -52.723  2.462   -82.125  1.00 139.53 ? 134 GLN A CG  1 
ATOM   944  C CD  . GLN A 1 134 ? -52.531  1.247   -81.216  1.00 139.74 ? 134 GLN A CD  1 
ATOM   945  O OE1 . GLN A 1 134 ? -53.099  1.162   -80.120  1.00 139.26 ? 134 GLN A OE1 1 
ATOM   946  N NE2 . GLN A 1 134 ? -51.728  0.294   -81.682  1.00 139.78 ? 134 GLN A NE2 1 
ATOM   947  N N   . TRP A 1 135 ? -52.983  6.846   -82.196  1.00 139.27 ? 135 TRP A N   1 
ATOM   948  C CA  . TRP A 1 135 ? -53.633  8.057   -82.718  1.00 139.25 ? 135 TRP A CA  1 
ATOM   949  C C   . TRP A 1 135 ? -54.327  7.797   -84.067  1.00 138.75 ? 135 TRP A C   1 
ATOM   950  O O   . TRP A 1 135 ? -54.248  8.596   -85.009  1.00 138.81 ? 135 TRP A O   1 
ATOM   951  C CB  . TRP A 1 135 ? -52.692  9.287   -82.725  1.00 139.57 ? 135 TRP A CB  1 
ATOM   952  C CG  . TRP A 1 135 ? -51.513  9.247   -83.675  1.00 140.55 ? 135 TRP A CG  1 
ATOM   953  C CD1 . TRP A 1 135 ? -50.518  8.312   -83.713  1.00 140.85 ? 135 TRP A CD1 1 
ATOM   954  C CD2 . TRP A 1 135 ? -51.191  10.215  -84.692  1.00 142.13 ? 135 TRP A CD2 1 
ATOM   955  N NE1 . TRP A 1 135 ? -49.611  8.621   -84.700  1.00 141.65 ? 135 TRP A NE1 1 
ATOM   956  C CE2 . TRP A 1 135 ? -49.995  9.783   -85.317  1.00 142.33 ? 135 TRP A CE2 1 
ATOM   957  C CE3 . TRP A 1 135 ? -51.803  11.400  -85.143  1.00 143.11 ? 135 TRP A CE3 1 
ATOM   958  C CZ2 . TRP A 1 135 ? -49.391  10.495  -86.375  1.00 142.80 ? 135 TRP A CZ2 1 
ATOM   959  C CZ3 . TRP A 1 135 ? -51.199  12.113  -86.199  1.00 143.57 ? 135 TRP A CZ3 1 
ATOM   960  C CH2 . TRP A 1 135 ? -50.005  11.650  -86.800  1.00 143.32 ? 135 TRP A CH2 1 
ATOM   961  N N   . ASP A 1 136 ? -55.019  6.662   -84.125  1.00 137.99 ? 136 ASP A N   1 
ATOM   962  C CA  . ASP A 1 136 ? -55.826  6.283   -85.272  1.00 137.33 ? 136 ASP A CA  1 
ATOM   963  C C   . ASP A 1 136 ? -56.904  7.346   -85.471  1.00 136.72 ? 136 ASP A C   1 
ATOM   964  O O   . ASP A 1 136 ? -57.794  7.519   -84.633  1.00 136.64 ? 136 ASP A O   1 
ATOM   965  C CB  . ASP A 1 136 ? -56.431  4.893   -85.053  1.00 137.46 ? 136 ASP A CB  1 
ATOM   966  C CG  . ASP A 1 136 ? -55.389  3.843   -84.613  1.00 137.74 ? 136 ASP A CG  1 
ATOM   967  O OD1 . ASP A 1 136 ? -55.786  2.683   -84.339  1.00 136.94 ? 136 ASP A OD1 1 
ATOM   968  O OD2 . ASP A 1 136 ? -54.179  4.172   -84.538  1.00 138.12 ? 136 ASP A OD2 1 
ATOM   969  N N   . PHE A 1 137 ? -56.793  8.053   -86.592  1.00 135.94 ? 137 PHE A N   1 
ATOM   970  C CA  . PHE A 1 137 ? -57.466  9.339   -86.824  1.00 135.18 ? 137 PHE A CA  1 
ATOM   971  C C   . PHE A 1 137 ? -58.995  9.399   -86.618  1.00 134.27 ? 137 PHE A C   1 
ATOM   972  O O   . PHE A 1 137 ? -59.708  8.413   -86.805  1.00 133.96 ? 137 PHE A O   1 
ATOM   973  C CB  . PHE A 1 137 ? -57.112  9.875   -88.230  1.00 135.49 ? 137 PHE A CB  1 
ATOM   974  C CG  . PHE A 1 137 ? -55.661  10.318  -88.391  1.00 136.06 ? 137 PHE A CG  1 
ATOM   975  C CD1 . PHE A 1 137 ? -55.309  11.667  -88.269  1.00 136.49 ? 137 PHE A CD1 1 
ATOM   976  C CD2 . PHE A 1 137 ? -54.656  9.391   -88.700  1.00 136.51 ? 137 PHE A CD2 1 
ATOM   977  C CE1 . PHE A 1 137 ? -53.971  12.084  -88.429  1.00 136.57 ? 137 PHE A CE1 1 
ATOM   978  C CE2 . PHE A 1 137 ? -53.315  9.799   -88.866  1.00 136.44 ? 137 PHE A CE2 1 
ATOM   979  C CZ  . PHE A 1 137 ? -52.977  11.146  -88.731  1.00 136.34 ? 137 PHE A CZ  1 
ATOM   980  N N   . LEU A 1 138 ? -59.455  10.582  -86.205  1.00 133.31 ? 138 LEU A N   1 
ATOM   981  C CA  . LEU A 1 138 ? -60.860  11.024  -86.272  1.00 132.47 ? 138 LEU A CA  1 
ATOM   982  C C   . LEU A 1 138 ? -61.800  10.449  -85.203  1.00 131.83 ? 138 LEU A C   1 
ATOM   983  O O   . LEU A 1 138 ? -63.003  10.252  -85.441  1.00 131.68 ? 138 LEU A O   1 
ATOM   984  C CB  . LEU A 1 138 ? -61.420  10.842  -87.698  1.00 132.65 ? 138 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 138 ? -62.614  11.638  -88.252  1.00 132.37 ? 138 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 138 ? -62.888  12.969  -87.527  1.00 131.57 ? 138 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 138 ? -62.377  11.845  -89.742  1.00 131.95 ? 138 LEU A CD2 1 
ATOM   988  N N   . GLY A 1 139 ? -61.249  10.217  -84.015  1.00 131.03 ? 139 GLY A N   1 
ATOM   989  C CA  . GLY A 1 139 ? -62.031  9.685   -82.899  1.00 130.07 ? 139 GLY A CA  1 
ATOM   990  C C   . GLY A 1 139 ? -62.417  8.223   -83.069  1.00 129.31 ? 139 GLY A C   1 
ATOM   991  O O   . GLY A 1 139 ? -63.215  7.688   -82.296  1.00 129.32 ? 139 GLY A O   1 
ATOM   992  N N   . LEU A 1 140 ? -61.850  7.583   -84.090  1.00 128.37 ? 140 LEU A N   1 
ATOM   993  C CA  . LEU A 1 140 ? -62.077  6.174   -84.368  1.00 127.21 ? 140 LEU A CA  1 
ATOM   994  C C   . LEU A 1 140 ? -60.758  5.501   -84.715  1.00 126.47 ? 140 LEU A C   1 
ATOM   995  O O   . LEU A 1 140 ? -59.997  6.001   -85.549  1.00 126.41 ? 140 LEU A O   1 
ATOM   996  C CB  . LEU A 1 140 ? -63.087  6.000   -85.507  1.00 127.18 ? 140 LEU A CB  1 
ATOM   997  C CG  . LEU A 1 140 ? -64.519  5.545   -85.180  1.00 127.22 ? 140 LEU A CG  1 
ATOM   998  C CD1 . LEU A 1 140 ? -65.268  6.465   -84.215  1.00 127.11 ? 140 LEU A CD1 1 
ATOM   999  C CD2 . LEU A 1 140 ? -65.321  5.384   -86.464  1.00 127.51 ? 140 LEU A CD2 1 
ATOM   1000 N N   . GLU A 1 141 ? -60.489  4.376   -84.056  1.00 125.35 ? 141 GLU A N   1 
ATOM   1001 C CA  . GLU A 1 141 ? -59.291  3.590   -84.326  1.00 124.13 ? 141 GLU A CA  1 
ATOM   1002 C C   . GLU A 1 141 ? -59.462  2.797   -85.610  1.00 123.12 ? 141 GLU A C   1 
ATOM   1003 O O   . GLU A 1 141 ? -60.585  2.525   -86.030  1.00 122.78 ? 141 GLU A O   1 
ATOM   1004 C CB  . GLU A 1 141 ? -58.966  2.648   -83.158  1.00 124.37 ? 141 GLU A CB  1 
ATOM   1005 C CG  . GLU A 1 141 ? -58.203  3.313   -82.002  1.00 124.78 ? 141 GLU A CG  1 
ATOM   1006 C CD  . GLU A 1 141 ? -57.425  2.329   -81.134  1.00 124.82 ? 141 GLU A CD  1 
ATOM   1007 O OE1 . GLU A 1 141 ? -56.612  1.553   -81.683  1.00 125.50 ? 141 GLU A OE1 1 
ATOM   1008 O OE2 . GLU A 1 141 ? -57.615  2.345   -79.901  1.00 124.23 ? 141 GLU A OE2 1 
ATOM   1009 N N   . MET A 1 142 ? -58.345  2.438   -86.237  1.00 121.91 ? 142 MET A N   1 
ATOM   1010 C CA  . MET A 1 142 ? -58.386  1.577   -87.404  1.00 120.75 ? 142 MET A CA  1 
ATOM   1011 C C   . MET A 1 142 ? -59.358  0.434   -87.192  1.00 120.08 ? 142 MET A C   1 
ATOM   1012 O O   . MET A 1 142 ? -60.336  0.340   -87.925  1.00 120.13 ? 142 MET A O   1 
ATOM   1013 C CB  . MET A 1 142 ? -57.002  1.075   -87.781  1.00 120.66 ? 142 MET A CB  1 
ATOM   1014 C CG  . MET A 1 142 ? -56.578  1.561   -89.137  1.00 120.78 ? 142 MET A CG  1 
ATOM   1015 S SD  . MET A 1 142 ? -54.967  2.344   -89.133  1.00 120.98 ? 142 MET A SD  1 
ATOM   1016 C CE  . MET A 1 142 ? -55.423  4.013   -88.603  1.00 120.52 ? 142 MET A CE  1 
ATOM   1017 N N   . PRO A 1 143 ? -59.138  -0.411  -86.161  1.00 119.47 ? 143 PRO A N   1 
ATOM   1018 C CA  . PRO A 1 143 ? -60.104  -1.498  -85.977  1.00 118.87 ? 143 PRO A CA  1 
ATOM   1019 C C   . PRO A 1 143 ? -61.548  -0.994  -85.910  1.00 118.25 ? 143 PRO A C   1 
ATOM   1020 O O   . PRO A 1 143 ? -62.471  -1.741  -86.236  1.00 118.42 ? 143 PRO A O   1 
ATOM   1021 C CB  . PRO A 1 143 ? -59.688  -2.123  -84.637  1.00 118.79 ? 143 PRO A CB  1 
ATOM   1022 C CG  . PRO A 1 143 ? -58.817  -1.104  -83.970  1.00 119.00 ? 143 PRO A CG  1 
ATOM   1023 C CD  . PRO A 1 143 ? -58.121  -0.407  -85.092  1.00 119.49 ? 143 PRO A CD  1 
ATOM   1024 N N   . GLN A 1 144 ? -61.729  0.265   -85.518  1.00 117.31 ? 144 GLN A N   1 
ATOM   1025 C CA  . GLN A 1 144 ? -63.055  0.850   -85.390  1.00 116.54 ? 144 GLN A CA  1 
ATOM   1026 C C   . GLN A 1 144 ? -63.624  1.220   -86.761  1.00 116.10 ? 144 GLN A C   1 
ATOM   1027 O O   . GLN A 1 144 ? -64.809  0.978   -87.036  1.00 115.93 ? 144 GLN A O   1 
ATOM   1028 C CB  . GLN A 1 144 ? -63.006  2.064   -84.460  1.00 116.51 ? 144 GLN A CB  1 
ATOM   1029 C CG  . GLN A 1 144 ? -64.183  2.153   -83.496  1.00 116.25 ? 144 GLN A CG  1 
ATOM   1030 C CD  . GLN A 1 144 ? -63.926  3.088   -82.325  1.00 115.63 ? 144 GLN A CD  1 
ATOM   1031 O OE1 . GLN A 1 144 ? -62.902  3.774   -82.273  1.00 115.42 ? 144 GLN A OE1 1 
ATOM   1032 N NE2 . GLN A 1 144 ? -64.861  3.119   -81.375  1.00 114.93 ? 144 GLN A NE2 1 
ATOM   1033 N N   . TRP A 1 145 ? -62.778  1.809   -87.610  1.00 115.56 ? 145 TRP A N   1 
ATOM   1034 C CA  . TRP A 1 145 ? -63.126  2.034   -89.013  1.00 115.10 ? 145 TRP A CA  1 
ATOM   1035 C C   . TRP A 1 145 ? -63.430  0.667   -89.603  1.00 114.48 ? 145 TRP A C   1 
ATOM   1036 O O   . TRP A 1 145 ? -64.591  0.323   -89.805  1.00 114.38 ? 145 TRP A O   1 
ATOM   1037 C CB  . TRP A 1 145 ? -61.978  2.677   -89.818  1.00 115.31 ? 145 TRP A CB  1 
ATOM   1038 C CG  . TRP A 1 145 ? -61.752  4.168   -89.647  1.00 116.12 ? 145 TRP A CG  1 
ATOM   1039 C CD1 . TRP A 1 145 ? -60.604  4.766   -89.211  1.00 117.08 ? 145 TRP A CD1 1 
ATOM   1040 C CD2 . TRP A 1 145 ? -62.673  5.239   -89.939  1.00 116.96 ? 145 TRP A CD2 1 
ATOM   1041 N NE1 . TRP A 1 145 ? -60.753  6.133   -89.193  1.00 117.78 ? 145 TRP A NE1 1 
ATOM   1042 C CE2 . TRP A 1 145 ? -62.011  6.453   -89.636  1.00 117.62 ? 145 TRP A CE2 1 
ATOM   1043 C CE3 . TRP A 1 145 ? -63.992  5.292   -90.414  1.00 117.05 ? 145 TRP A CE3 1 
ATOM   1044 C CZ2 . TRP A 1 145 ? -62.626  7.713   -89.797  1.00 117.40 ? 145 TRP A CZ2 1 
ATOM   1045 C CZ3 . TRP A 1 145 ? -64.603  6.550   -90.570  1.00 116.78 ? 145 TRP A CZ3 1 
ATOM   1046 C CH2 . TRP A 1 145 ? -63.915  7.738   -90.262  1.00 116.45 ? 145 TRP A CH2 1 
ATOM   1047 N N   . LEU A 1 146 ? -62.364  -0.106  -89.833  1.00 113.76 ? 146 LEU A N   1 
ATOM   1048 C CA  . LEU A 1 146 ? -62.412  -1.454  -90.418  1.00 113.00 ? 146 LEU A CA  1 
ATOM   1049 C C   . LEU A 1 146 ? -63.605  -2.301  -90.029  1.00 112.58 ? 146 LEU A C   1 
ATOM   1050 O O   . LEU A 1 146 ? -64.092  -3.058  -90.851  1.00 112.65 ? 146 LEU A O   1 
ATOM   1051 C CB  . LEU A 1 146 ? -61.125  -2.217  -90.119  1.00 112.84 ? 146 LEU A CB  1 
ATOM   1052 C CG  . LEU A 1 146 ? -60.039  -2.165  -91.196  1.00 112.97 ? 146 LEU A CG  1 
ATOM   1053 C CD1 . LEU A 1 146 ? -59.900  -3.513  -91.895  1.00 112.91 ? 146 LEU A CD1 1 
ATOM   1054 C CD2 . LEU A 1 146 ? -60.235  -1.000  -92.201  1.00 112.76 ? 146 LEU A CD2 1 
ATOM   1055 N N   . LEU A 1 147 ? -64.063  -2.186  -88.785  1.00 111.95 ? 147 LEU A N   1 
ATOM   1056 C CA  . LEU A 1 147 ? -65.325  -2.786  -88.377  1.00 111.40 ? 147 LEU A CA  1 
ATOM   1057 C C   . LEU A 1 147 ? -66.477  -2.324  -89.281  1.00 111.20 ? 147 LEU A C   1 
ATOM   1058 O O   . LEU A 1 147 ? -67.261  -3.144  -89.763  1.00 111.19 ? 147 LEU A O   1 
ATOM   1059 C CB  . LEU A 1 147 ? -65.601  -2.483  -86.897  1.00 111.40 ? 147 LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 147 ? -66.889  -2.869  -86.149  1.00 111.19 ? 147 LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 147 ? -67.935  -1.758  -86.262  1.00 111.60 ? 147 LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 147 ? -67.471  -4.208  -86.582  1.00 110.49 ? 147 LEU A CD2 1 
ATOM   1063 N N   . GLY A 1 148 ? -66.562  -1.018  -89.520  1.00 110.83 ? 148 GLY A N   1 
ATOM   1064 C CA  . GLY A 1 148 ? -67.613  -0.448  -90.363  1.00 110.30 ? 148 GLY A CA  1 
ATOM   1065 C C   . GLY A 1 148 ? -67.509  -0.887  -91.807  1.00 109.79 ? 148 GLY A C   1 
ATOM   1066 O O   . GLY A 1 148 ? -68.455  -1.441  -92.366  1.00 109.71 ? 148 GLY A O   1 
ATOM   1067 N N   . ILE A 1 149 ? -66.347  -0.648  -92.404  1.00 109.39 ? 149 ILE A N   1 
ATOM   1068 C CA  . ILE A 1 149 ? -66.088  -1.045  -93.782  1.00 109.17 ? 149 ILE A CA  1 
ATOM   1069 C C   . ILE A 1 149 ? -66.435  -2.541  -94.025  1.00 109.29 ? 149 ILE A C   1 
ATOM   1070 O O   . ILE A 1 149 ? -66.781  -2.935  -95.148  1.00 109.37 ? 149 ILE A O   1 
ATOM   1071 C CB  . ILE A 1 149 ? -64.620  -0.663  -94.243  1.00 109.06 ? 149 ILE A CB  1 
ATOM   1072 C CG1 . ILE A 1 149 ? -63.599  -1.769  -93.960  1.00 109.24 ? 149 ILE A CG1 1 
ATOM   1073 C CG2 . ILE A 1 149 ? -64.147  0.635   -93.598  1.00 108.37 ? 149 ILE A CG2 1 
ATOM   1074 C CD1 . ILE A 1 149 ? -63.451  -2.811  -95.079  1.00 109.38 ? 149 ILE A CD1 1 
ATOM   1075 N N   . PHE A 1 150 ? -66.349  -3.360  -92.970  1.00 109.12 ? 150 PHE A N   1 
ATOM   1076 C CA  . PHE A 1 150 ? -66.620  -4.800  -93.068  1.00 108.61 ? 150 PHE A CA  1 
ATOM   1077 C C   . PHE A 1 150 ? -68.101  -5.044  -93.013  1.00 108.50 ? 150 PHE A C   1 
ATOM   1078 O O   . PHE A 1 150 ? -68.578  -6.062  -93.494  1.00 108.32 ? 150 PHE A O   1 
ATOM   1079 C CB  . PHE A 1 150 ? -65.920  -5.605  -91.965  1.00 108.37 ? 150 PHE A CB  1 
ATOM   1080 C CG  . PHE A 1 150 ? -64.576  -6.160  -92.367  1.00 107.93 ? 150 PHE A CG  1 
ATOM   1081 C CD1 . PHE A 1 150 ? -63.403  -5.625  -91.850  1.00 107.78 ? 150 PHE A CD1 1 
ATOM   1082 C CD2 . PHE A 1 150 ? -64.483  -7.228  -93.254  1.00 108.10 ? 150 PHE A CD2 1 
ATOM   1083 C CE1 . PHE A 1 150 ? -62.157  -6.141  -92.207  1.00 108.31 ? 150 PHE A CE1 1 
ATOM   1084 C CE2 . PHE A 1 150 ? -63.234  -7.759  -93.626  1.00 108.05 ? 150 PHE A CE2 1 
ATOM   1085 C CZ  . PHE A 1 150 ? -62.070  -7.212  -93.102  1.00 108.33 ? 150 PHE A CZ  1 
ATOM   1086 N N   . ILE A 1 151 ? -68.829  -4.107  -92.419  1.00 108.71 ? 151 ILE A N   1 
ATOM   1087 C CA  . ILE A 1 151 ? -70.281  -4.158  -92.482  1.00 109.19 ? 151 ILE A CA  1 
ATOM   1088 C C   . ILE A 1 151 ? -70.684  -3.737  -93.887  1.00 109.37 ? 151 ILE A C   1 
ATOM   1089 O O   . ILE A 1 151 ? -71.642  -4.270  -94.449  1.00 109.42 ? 151 ILE A O   1 
ATOM   1090 C CB  . ILE A 1 151 ? -70.980  -3.288  -91.405  1.00 109.28 ? 151 ILE A CB  1 
ATOM   1091 C CG1 . ILE A 1 151 ? -70.290  -3.439  -90.038  1.00 109.27 ? 151 ILE A CG1 1 
ATOM   1092 C CG2 . ILE A 1 151 ? -72.448  -3.699  -91.278  1.00 109.40 ? 151 ILE A CG2 1 
ATOM   1093 C CD1 . ILE A 1 151 ? -70.485  -2.260  -89.086  1.00 108.11 ? 151 ILE A CD1 1 
ATOM   1094 N N   . ALA A 1 152 ? -69.908  -2.821  -94.466  1.00 109.64 ? 152 ALA A N   1 
ATOM   1095 C CA  . ALA A 1 152 ? -70.095  -2.381  -95.860  1.00 109.89 ? 152 ALA A CA  1 
ATOM   1096 C C   . ALA A 1 152 ? -69.720  -3.430  -96.935  1.00 110.03 ? 152 ALA A C   1 
ATOM   1097 O O   . ALA A 1 152 ? -69.702  -3.123  -98.131  1.00 110.30 ? 152 ALA A O   1 
ATOM   1098 C CB  . ALA A 1 152 ? -69.346  -1.065  -96.109  1.00 109.76 ? 152 ALA A CB  1 
ATOM   1099 N N   . TYR A 1 153 ? -69.411  -4.652  -96.513  1.00 110.01 ? 153 TYR A N   1 
ATOM   1100 C CA  . TYR A 1 153 ? -69.162  -5.754  -97.434  1.00 109.81 ? 153 TYR A CA  1 
ATOM   1101 C C   . TYR A 1 153 ? -70.129  -6.874  -97.100  1.00 110.00 ? 153 TYR A C   1 
ATOM   1102 O O   . TYR A 1 153 ? -70.527  -7.638  -97.970  1.00 110.02 ? 153 TYR A O   1 
ATOM   1103 C CB  . TYR A 1 153 ? -67.727  -6.264  -97.299  1.00 109.72 ? 153 TYR A CB  1 
ATOM   1104 C CG  . TYR A 1 153 ? -66.664  -5.503  -98.067  1.00 109.00 ? 153 TYR A CG  1 
ATOM   1105 C CD1 . TYR A 1 153 ? -66.790  -4.143  -98.349  1.00 108.67 ? 153 TYR A CD1 1 
ATOM   1106 C CD2 . TYR A 1 153 ? -65.505  -6.146  -98.473  1.00 108.59 ? 153 TYR A CD2 1 
ATOM   1107 C CE1 . TYR A 1 153 ? -65.796  -3.453  -99.047  1.00 108.82 ? 153 TYR A CE1 1 
ATOM   1108 C CE2 . TYR A 1 153 ? -64.505  -5.471  -99.159  1.00 108.71 ? 153 TYR A CE2 1 
ATOM   1109 C CZ  . TYR A 1 153 ? -64.651  -4.130  -99.447  1.00 108.88 ? 153 TYR A CZ  1 
ATOM   1110 O OH  . TYR A 1 153 ? -63.646  -3.481  -100.132 1.00 108.51 ? 153 TYR A OH  1 
ATOM   1111 N N   . LEU A 1 154 ? -70.490  -6.964  -95.825  1.00 110.35 ? 154 LEU A N   1 
ATOM   1112 C CA  . LEU A 1 154 ? -71.462  -7.940  -95.342  1.00 110.80 ? 154 LEU A CA  1 
ATOM   1113 C C   . LEU A 1 154 ? -72.869  -7.510  -95.729  1.00 111.08 ? 154 LEU A C   1 
ATOM   1114 O O   . LEU A 1 154 ? -73.700  -8.329  -96.140  1.00 110.86 ? 154 LEU A O   1 
ATOM   1115 C CB  . LEU A 1 154 ? -71.372  -8.078  -93.814  1.00 110.82 ? 154 LEU A CB  1 
ATOM   1116 C CG  . LEU A 1 154 ? -72.490  -8.844  -93.094  1.00 110.24 ? 154 LEU A CG  1 
ATOM   1117 C CD1 . LEU A 1 154 ? -72.013  -10.227 -92.681  1.00 109.37 ? 154 LEU A CD1 1 
ATOM   1118 C CD2 . LEU A 1 154 ? -72.997  -8.060  -91.895  1.00 109.33 ? 154 LEU A CD2 1 
ATOM   1119 N N   . ILE A 1 155 ? -73.133  -6.219  -95.583  1.00 111.62 ? 155 ILE A N   1 
ATOM   1120 C CA  . ILE A 1 155 ? -74.467  -5.705  -95.862  1.00 112.33 ? 155 ILE A CA  1 
ATOM   1121 C C   . ILE A 1 155 ? -74.710  -5.500  -97.380  1.00 112.70 ? 155 ILE A C   1 
ATOM   1122 O O   . ILE A 1 155 ? -75.857  -5.399  -97.818  1.00 112.58 ? 155 ILE A O   1 
ATOM   1123 C CB  . ILE A 1 155 ? -74.830  -4.481  -94.958  1.00 112.35 ? 155 ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 155 ? -73.857  -3.313  -95.191  1.00 112.56 ? 155 ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 155 ? -74.890  -4.916  -93.478  1.00 111.80 ? 155 ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 155 ? -74.178  -2.020  -94.430  1.00 112.68 ? 155 ILE A CD1 1 
ATOM   1127 N N   . VAL A 1 156 ? -73.626  -5.459  -98.163  1.00 113.13 ? 156 VAL A N   1 
ATOM   1128 C CA  . VAL A 1 156 ? -73.691  -5.639  -99.619  1.00 113.35 ? 156 VAL A CA  1 
ATOM   1129 C C   . VAL A 1 156 ? -74.038  -7.108  -99.870  1.00 113.74 ? 156 VAL A C   1 
ATOM   1130 O O   . VAL A 1 156 ? -75.217  -7.461  -99.892  1.00 113.61 ? 156 VAL A O   1 
ATOM   1131 C CB  . VAL A 1 156 ? -72.361  -5.221  -100.329 1.00 113.41 ? 156 VAL A CB  1 
ATOM   1132 C CG1 . VAL A 1 156 ? -72.148  -5.981  -101.658 1.00 113.33 ? 156 VAL A CG1 1 
ATOM   1133 C CG2 . VAL A 1 156 ? -72.309  -3.708  -100.544 1.00 112.95 ? 156 VAL A CG2 1 
ATOM   1134 N N   . ALA A 1 157 ? -73.016  -7.954  -100.021 1.00 114.25 ? 157 ALA A N   1 
ATOM   1135 C CA  . ALA A 1 157 ? -73.176  -9.407  -100.130 1.00 114.96 ? 157 ALA A CA  1 
ATOM   1136 C C   . ALA A 1 157 ? -74.605  -9.906  -99.876  1.00 115.47 ? 157 ALA A C   1 
ATOM   1137 O O   . ALA A 1 157 ? -75.288  -10.320 -100.809 1.00 115.86 ? 157 ALA A O   1 
ATOM   1138 C CB  . ALA A 1 157 ? -72.195  -10.116 -99.209  1.00 114.79 ? 157 ALA A CB  1 
ATOM   1139 N N   . VAL A 1 158 ? -75.065  -9.869  -98.630  1.00 115.80 ? 158 VAL A N   1 
ATOM   1140 C CA  . VAL A 1 158 ? -76.431  -10.280 -98.368  1.00 116.19 ? 158 VAL A CA  1 
ATOM   1141 C C   . VAL A 1 158 ? -77.386  -9.201  -98.862  1.00 116.59 ? 158 VAL A C   1 
ATOM   1142 O O   . VAL A 1 158 ? -77.913  -9.301  -99.975  1.00 116.61 ? 158 VAL A O   1 
ATOM   1143 C CB  . VAL A 1 158 ? -76.671  -10.666 -96.879  1.00 116.32 ? 158 VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 158 ? -78.155  -10.550 -96.490  1.00 115.89 ? 158 VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 158 ? -76.171  -12.089 -96.616  1.00 116.34 ? 158 VAL A CG2 1 
ATOM   1146 N N   . LEU A 1 159 ? -77.545  -8.144  -98.064  1.00 117.18 ? 159 LEU A N   1 
ATOM   1147 C CA  . LEU A 1 159 ? -78.702  -7.222  -98.184  1.00 117.49 ? 159 LEU A CA  1 
ATOM   1148 C C   . LEU A 1 159 ? -78.689  -6.314  -99.424  1.00 117.18 ? 159 LEU A C   1 
ATOM   1149 O O   . LEU A 1 159 ? -79.589  -5.487  -99.598  1.00 117.06 ? 159 LEU A O   1 
ATOM   1150 C CB  . LEU A 1 159 ? -78.900  -6.404  -96.881  1.00 117.74 ? 159 LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 159 ? -80.324  -6.241  -96.312  1.00 117.93 ? 159 LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 159 ? -80.324  -6.372  -94.778  1.00 117.63 ? 159 LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 159 ? -81.015  -4.943  -96.770  1.00 117.59 ? 159 LEU A CD2 1 
ATOM   1154 N N   . VAL A 1 160 ? -77.665  -6.469  -100.268 1.00 116.87 ? 160 VAL A N   1 
ATOM   1155 C CA  . VAL A 1 160 ? -77.615  -5.801  -101.574 1.00 116.55 ? 160 VAL A CA  1 
ATOM   1156 C C   . VAL A 1 160 ? -77.173  -6.784  -102.691 1.00 116.16 ? 160 VAL A C   1 
ATOM   1157 O O   . VAL A 1 160 ? -76.826  -6.355  -103.807 1.00 116.31 ? 160 VAL A O   1 
ATOM   1158 C CB  . VAL A 1 160 ? -76.743  -4.469  -101.586 1.00 116.70 ? 160 VAL A CB  1 
ATOM   1159 C CG1 . VAL A 1 160 ? -77.292  -3.456  -102.611 1.00 116.61 ? 160 VAL A CG1 1 
ATOM   1160 C CG2 . VAL A 1 160 ? -76.672  -3.802  -100.212 1.00 116.66 ? 160 VAL A CG2 1 
ATOM   1161 N N   . VAL A 1 161 ? -77.177  -8.090  -102.399 1.00 115.27 ? 161 VAL A N   1 
ATOM   1162 C CA  . VAL A 1 161 ? -77.026  -9.098  -103.463 1.00 114.39 ? 161 VAL A CA  1 
ATOM   1163 C C   . VAL A 1 161 ? -78.041  -10.243 -103.329 1.00 114.12 ? 161 VAL A C   1 
ATOM   1164 O O   . VAL A 1 161 ? -79.071  -10.255 -104.014 1.00 114.15 ? 161 VAL A O   1 
ATOM   1165 C CB  . VAL A 1 161 ? -75.568  -9.619  -103.632 1.00 114.15 ? 161 VAL A CB  1 
ATOM   1166 C CG1 . VAL A 1 161 ? -75.506  -10.645 -104.727 1.00 113.94 ? 161 VAL A CG1 1 
ATOM   1167 C CG2 . VAL A 1 161 ? -74.614  -8.493  -103.966 1.00 113.77 ? 161 VAL A CG2 1 
ATOM   1168 N N   . ILE A 1 162 ? -77.762  -11.196 -102.450 1.00 113.71 ? 162 ILE A N   1 
ATOM   1169 C CA  . ILE A 1 162 ? -78.627  -12.362 -102.312 1.00 113.39 ? 162 ILE A CA  1 
ATOM   1170 C C   . ILE A 1 162 ? -79.897  -12.063 -101.495 1.00 113.35 ? 162 ILE A C   1 
ATOM   1171 O O   . ILE A 1 162 ? -80.373  -10.920 -101.436 1.00 113.12 ? 162 ILE A O   1 
ATOM   1172 C CB  . ILE A 1 162 ? -77.863  -13.587 -101.740 1.00 113.32 ? 162 ILE A CB  1 
ATOM   1173 C CG1 . ILE A 1 162 ? -77.317  -13.299 -100.345 1.00 113.49 ? 162 ILE A CG1 1 
ATOM   1174 C CG2 . ILE A 1 162 ? -76.712  -13.982 -102.650 1.00 113.05 ? 162 ILE A CG2 1 
ATOM   1175 C CD1 . ILE A 1 162 ? -77.206  -14.539 -99.479  1.00 114.74 ? 162 ILE A CD1 1 
ATOM   1176 N N   . ASP B 2 21  ? -48.272  -8.199  -57.623  1.00 75.51  ? 21  ASP B N   1 
ATOM   1177 C CA  . ASP B 2 21  ? -49.499  -7.654  -58.296  1.00 75.46  ? 21  ASP B CA  1 
ATOM   1178 C C   . ASP B 2 21  ? -49.738  -6.213  -57.868  1.00 74.45  ? 21  ASP B C   1 
ATOM   1179 O O   . ASP B 2 21  ? -48.853  -5.567  -57.302  1.00 75.06  ? 21  ASP B O   1 
ATOM   1180 C CB  . ASP B 2 21  ? -50.735  -8.513  -57.968  1.00 76.08  ? 21  ASP B CB  1 
ATOM   1181 C CG  . ASP B 2 21  ? -50.504  -10.018 -58.211  1.00 78.47  ? 21  ASP B CG  1 
ATOM   1182 O OD1 . ASP B 2 21  ? -49.502  -10.401 -58.884  1.00 80.82  ? 21  ASP B OD1 1 
ATOM   1183 O OD2 . ASP B 2 21  ? -51.345  -10.819 -57.725  1.00 80.71  ? 21  ASP B OD2 1 
ATOM   1184 N N   . ILE B 2 22  ? -50.926  -5.701  -58.147  1.00 72.81  ? 22  ILE B N   1 
ATOM   1185 C CA  . ILE B 2 22  ? -51.333  -4.449  -57.561  1.00 71.16  ? 22  ILE B CA  1 
ATOM   1186 C C   . ILE B 2 22  ? -51.768  -4.768  -56.122  1.00 70.87  ? 22  ILE B C   1 
ATOM   1187 O O   . ILE B 2 22  ? -52.336  -5.833  -55.872  1.00 70.85  ? 22  ILE B O   1 
ATOM   1188 C CB  . ILE B 2 22  ? -52.454  -3.836  -58.395  1.00 70.75  ? 22  ILE B CB  1 
ATOM   1189 C CG1 . ILE B 2 22  ? -51.893  -3.358  -59.726  1.00 69.17  ? 22  ILE B CG1 1 
ATOM   1190 C CG2 . ILE B 2 22  ? -53.124  -2.684  -57.671  1.00 70.79  ? 22  ILE B CG2 1 
ATOM   1191 C CD1 . ILE B 2 22  ? -52.937  -3.062  -60.745  1.00 67.58  ? 22  ILE B CD1 1 
ATOM   1192 N N   . VAL B 2 23  ? -51.450  -3.883  -55.176  1.00 70.25  ? 23  VAL B N   1 
ATOM   1193 C CA  . VAL B 2 23  ? -52.022  -3.961  -53.822  1.00 69.63  ? 23  VAL B CA  1 
ATOM   1194 C C   . VAL B 2 23  ? -53.000  -2.836  -53.474  1.00 69.73  ? 23  VAL B C   1 
ATOM   1195 O O   . VAL B 2 23  ? -52.645  -1.649  -53.414  1.00 69.57  ? 23  VAL B O   1 
ATOM   1196 C CB  . VAL B 2 23  ? -50.975  -4.128  -52.691  1.00 69.20  ? 23  VAL B CB  1 
ATOM   1197 C CG1 . VAL B 2 23  ? -50.995  -5.534  -52.194  1.00 69.24  ? 23  VAL B CG1 1 
ATOM   1198 C CG2 . VAL B 2 23  ? -49.575  -3.744  -53.144  1.00 69.35  ? 23  VAL B CG2 1 
ATOM   1199 N N   . MET B 2 24  ? -54.246  -3.238  -53.261  1.00 69.98  ? 24  MET B N   1 
ATOM   1200 C CA  . MET B 2 24  ? -55.274  -2.364  -52.723  1.00 70.11  ? 24  MET B CA  1 
ATOM   1201 C C   . MET B 2 24  ? -55.223  -2.432  -51.216  1.00 70.40  ? 24  MET B C   1 
ATOM   1202 O O   . MET B 2 24  ? -55.063  -3.501  -50.624  1.00 70.00  ? 24  MET B O   1 
ATOM   1203 C CB  . MET B 2 24  ? -56.671  -2.760  -53.208  1.00 69.94  ? 24  MET B CB  1 
ATOM   1204 C CG  . MET B 2 24  ? -56.774  -3.023  -54.713  1.00 69.35  ? 24  MET B CG  1 
ATOM   1205 S SD  . MET B 2 24  ? -56.069  -1.739  -55.756  1.00 65.64  ? 24  MET B SD  1 
ATOM   1206 C CE  . MET B 2 24  ? -57.433  -0.587  -55.659  1.00 65.62  ? 24  MET B CE  1 
ATOM   1207 N N   . SER B 2 25  ? -55.368  -1.259  -50.619  1.00 71.02  ? 25  SER B N   1 
ATOM   1208 C CA  . SER B 2 25  ? -55.256  -1.064  -49.200  1.00 71.66  ? 25  SER B CA  1 
ATOM   1209 C C   . SER B 2 25  ? -56.178  0.086   -48.839  1.00 72.69  ? 25  SER B C   1 
ATOM   1210 O O   . SER B 2 25  ? -55.955  1.219   -49.265  1.00 72.97  ? 25  SER B O   1 
ATOM   1211 C CB  . SER B 2 25  ? -53.826  -0.676  -48.885  1.00 71.48  ? 25  SER B CB  1 
ATOM   1212 O OG  . SER B 2 25  ? -53.403  0.323   -49.787  1.00 70.38  ? 25  SER B OG  1 
ATOM   1213 N N   . GLN B 2 26  ? -57.219  -0.212  -48.066  1.00 73.83  ? 26  GLN B N   1 
ATOM   1214 C CA  . GLN B 2 26  ? -58.163  0.798   -47.588  1.00 74.86  ? 26  GLN B CA  1 
ATOM   1215 C C   . GLN B 2 26  ? -57.853  1.219   -46.147  1.00 75.94  ? 26  GLN B C   1 
ATOM   1216 O O   . GLN B 2 26  ? -57.326  0.435   -45.368  1.00 75.89  ? 26  GLN B O   1 
ATOM   1217 C CB  . GLN B 2 26  ? -59.589  0.256   -47.672  1.00 74.57  ? 26  GLN B CB  1 
ATOM   1218 C CG  . GLN B 2 26  ? -59.976  -0.252  -49.044  1.00 74.55  ? 26  GLN B CG  1 
ATOM   1219 C CD  . GLN B 2 26  ? -60.929  -1.439  -48.993  1.00 75.39  ? 26  GLN B CD  1 
ATOM   1220 O OE1 . GLN B 2 26  ? -61.892  -1.514  -49.755  1.00 76.02  ? 26  GLN B OE1 1 
ATOM   1221 N NE2 . GLN B 2 26  ? -60.651  -2.380  -48.107  1.00 75.00  ? 26  GLN B NE2 1 
ATOM   1222 N N   . SER B 2 27  ? -58.150  2.466   -45.809  1.00 77.67  ? 27  SER B N   1 
ATOM   1223 C CA  . SER B 2 27  ? -58.182  2.898   -44.413  1.00 79.76  ? 27  SER B CA  1 
ATOM   1224 C C   . SER B 2 27  ? -59.508  3.608   -44.202  1.00 81.21  ? 27  SER B C   1 
ATOM   1225 O O   . SER B 2 27  ? -60.005  4.244   -45.129  1.00 81.63  ? 27  SER B O   1 
ATOM   1226 C CB  . SER B 2 27  ? -57.018  3.842   -44.081  1.00 79.83  ? 27  SER B CB  1 
ATOM   1227 O OG  . SER B 2 27  ? -57.328  5.204   -44.377  1.00 80.56  ? 27  SER B OG  1 
ATOM   1228 N N   . PRO B 2 28  ? -60.101  3.498   -43.001  1.00 82.68  ? 28  PRO B N   1 
ATOM   1229 C CA  . PRO B 2 28  ? -59.666  2.727   -41.849  1.00 84.03  ? 28  PRO B CA  1 
ATOM   1230 C C   . PRO B 2 28  ? -60.292  1.340   -41.884  1.00 85.71  ? 28  PRO B C   1 
ATOM   1231 O O   . PRO B 2 28  ? -61.085  1.042   -42.787  1.00 86.13  ? 28  PRO B O   1 
ATOM   1232 C CB  . PRO B 2 28  ? -60.293  3.497   -40.707  1.00 84.12  ? 28  PRO B CB  1 
ATOM   1233 C CG  . PRO B 2 28  ? -61.632  3.922   -41.288  1.00 83.12  ? 28  PRO B CG  1 
ATOM   1234 C CD  . PRO B 2 28  ? -61.370  4.206   -42.731  1.00 82.55  ? 28  PRO B CD  1 
ATOM   1235 N N   . SER B 2 29  ? -59.973  0.512   -40.894  1.00 87.34  ? 29  SER B N   1 
ATOM   1236 C CA  . SER B 2 29  ? -60.641  -0.770  -40.734  1.00 89.13  ? 29  SER B CA  1 
ATOM   1237 C C   . SER B 2 29  ? -62.128  -0.587  -40.447  1.00 90.26  ? 29  SER B C   1 
ATOM   1238 O O   . SER B 2 29  ? -62.977  -1.246  -41.063  1.00 90.57  ? 29  SER B O   1 
ATOM   1239 C CB  . SER B 2 29  ? -60.007  -1.527  -39.593  1.00 89.15  ? 29  SER B CB  1 
ATOM   1240 O OG  . SER B 2 29  ? -58.608  -1.352  -39.638  1.00 90.95  ? 29  SER B OG  1 
ATOM   1241 N N   . SER B 2 30  ? -62.439  0.326   -39.528  1.00 91.51  ? 30  SER B N   1 
ATOM   1242 C CA  . SER B 2 30  ? -63.821  0.538   -39.092  1.00 92.64  ? 30  SER B CA  1 
ATOM   1243 C C   . SER B 2 30  ? -64.254  1.999   -39.023  1.00 93.05  ? 30  SER B C   1 
ATOM   1244 O O   . SER B 2 30  ? -63.444  2.890   -38.767  1.00 93.28  ? 30  SER B O   1 
ATOM   1245 C CB  . SER B 2 30  ? -64.029  -0.098  -37.724  1.00 92.82  ? 30  SER B CB  1 
ATOM   1246 O OG  . SER B 2 30  ? -62.921  0.194   -36.888  1.00 94.06  ? 30  SER B OG  1 
ATOM   1247 N N   . LEU B 2 31  ? -65.552  2.214   -39.239  1.00 93.66  ? 31  LEU B N   1 
ATOM   1248 C CA  . LEU B 2 31  ? -66.200  3.513   -39.075  1.00 93.93  ? 31  LEU B CA  1 
ATOM   1249 C C   . LEU B 2 31  ? -67.505  3.400   -38.301  1.00 94.21  ? 31  LEU B C   1 
ATOM   1250 O O   . LEU B 2 31  ? -68.342  2.538   -38.574  1.00 94.27  ? 31  LEU B O   1 
ATOM   1251 C CB  . LEU B 2 31  ? -66.514  4.131   -40.429  1.00 93.85  ? 31  LEU B CB  1 
ATOM   1252 C CG  . LEU B 2 31  ? -65.408  4.709   -41.298  1.00 94.54  ? 31  LEU B CG  1 
ATOM   1253 C CD1 . LEU B 2 31  ? -66.077  5.416   -42.475  1.00 94.83  ? 31  LEU B CD1 1 
ATOM   1254 C CD2 . LEU B 2 31  ? -64.496  5.669   -40.518  1.00 95.31  ? 31  LEU B CD2 1 
ATOM   1255 N N   . ALA B 2 32  ? -67.678  4.285   -37.338  1.00 94.73  ? 32  ALA B N   1 
ATOM   1256 C CA  . ALA B 2 32  ? -68.966  4.441   -36.697  1.00 95.41  ? 32  ALA B CA  1 
ATOM   1257 C C   . ALA B 2 32  ? -69.617  5.716   -37.228  1.00 95.85  ? 32  ALA B C   1 
ATOM   1258 O O   . ALA B 2 32  ? -68.922  6.667   -37.602  1.00 95.93  ? 32  ALA B O   1 
ATOM   1259 C CB  . ALA B 2 32  ? -68.800  4.501   -35.188  1.00 95.56  ? 32  ALA B CB  1 
ATOM   1260 N N   . VAL B 2 33  ? -70.946  5.728   -37.276  1.00 96.24  ? 33  VAL B N   1 
ATOM   1261 C CA  . VAL B 2 33  ? -71.705  6.935   -37.648  1.00 96.65  ? 33  VAL B CA  1 
ATOM   1262 C C   . VAL B 2 33  ? -73.190  6.847   -37.228  1.00 96.72  ? 33  VAL B C   1 
ATOM   1263 O O   . VAL B 2 33  ? -73.799  5.766   -37.250  1.00 97.02  ? 33  VAL B O   1 
ATOM   1264 C CB  . VAL B 2 33  ? -71.502  7.333   -39.160  1.00 96.51  ? 33  VAL B CB  1 
ATOM   1265 C CG1 . VAL B 2 33  ? -72.823  7.375   -39.925  1.00 97.03  ? 33  VAL B CG1 1 
ATOM   1266 C CG2 . VAL B 2 33  ? -70.768  8.670   -39.268  1.00 96.35  ? 33  VAL B CG2 1 
ATOM   1267 N N   . SER B 2 34  ? -73.748  7.980   -36.811  1.00 96.47  ? 34  SER B N   1 
ATOM   1268 C CA  . SER B 2 34  ? -75.148  8.042   -36.435  1.00 96.08  ? 34  SER B CA  1 
ATOM   1269 C C   . SER B 2 34  ? -75.971  8.108   -37.711  1.00 95.68  ? 34  SER B C   1 
ATOM   1270 O O   . SER B 2 34  ? -75.622  8.821   -38.655  1.00 95.15  ? 34  SER B O   1 
ATOM   1271 C CB  . SER B 2 34  ? -75.404  9.240   -35.523  1.00 96.36  ? 34  SER B CB  1 
ATOM   1272 O OG  . SER B 2 34  ? -74.384  9.362   -34.532  1.00 96.43  ? 34  SER B OG  1 
ATOM   1273 N N   . ALA B 2 35  ? -77.056  7.337   -37.724  1.00 95.64  ? 35  ALA B N   1 
ATOM   1274 C CA  . ALA B 2 35  ? -77.826  7.044   -38.948  1.00 95.60  ? 35  ALA B CA  1 
ATOM   1275 C C   . ALA B 2 35  ? -78.317  8.269   -39.725  1.00 95.43  ? 35  ALA B C   1 
ATOM   1276 O O   . ALA B 2 35  ? -79.385  8.802   -39.435  1.00 95.92  ? 35  ALA B O   1 
ATOM   1277 C CB  . ALA B 2 35  ? -79.006  6.100   -38.634  1.00 95.37  ? 35  ALA B CB  1 
ATOM   1278 N N   . GLY B 2 36  ? -77.539  8.711   -40.707  1.00 95.05  ? 36  GLY B N   1 
ATOM   1279 C CA  . GLY B 2 36  ? -77.982  9.778   -41.599  1.00 94.57  ? 36  GLY B CA  1 
ATOM   1280 C C   . GLY B 2 36  ? -76.872  10.730  -41.968  1.00 94.32  ? 36  GLY B C   1 
ATOM   1281 O O   . GLY B 2 36  ? -77.120  11.816  -42.499  1.00 94.33  ? 36  GLY B O   1 
ATOM   1282 N N   . GLU B 2 37  ? -75.641  10.301  -41.716  1.00 94.02  ? 37  GLU B N   1 
ATOM   1283 C CA  . GLU B 2 37  ? -74.473  11.150  -41.920  1.00 93.62  ? 37  GLU B CA  1 
ATOM   1284 C C   . GLU B 2 37  ? -73.736  10.937  -43.248  1.00 93.18  ? 37  GLU B C   1 
ATOM   1285 O O   . GLU B 2 37  ? -74.120  10.087  -44.058  1.00 93.15  ? 37  GLU B O   1 
ATOM   1286 C CB  . GLU B 2 37  ? -73.525  10.985  -40.740  1.00 93.68  ? 37  GLU B CB  1 
ATOM   1287 C CG  . GLU B 2 37  ? -74.180  11.334  -39.417  1.00 94.02  ? 37  GLU B CG  1 
ATOM   1288 C CD  . GLU B 2 37  ? -73.165  11.600  -38.344  1.00 95.02  ? 37  GLU B CD  1 
ATOM   1289 O OE1 . GLU B 2 37  ? -72.484  12.652  -38.422  1.00 95.09  ? 37  GLU B OE1 1 
ATOM   1290 O OE2 . GLU B 2 37  ? -73.041  10.751  -37.431  1.00 95.59  ? 37  GLU B OE2 1 
ATOM   1291 N N   . LYS B 2 38  ? -72.701  11.745  -43.474  1.00 92.59  ? 38  LYS B N   1 
ATOM   1292 C CA  . LYS B 2 38  ? -71.790  11.551  -44.603  1.00 92.07  ? 38  LYS B CA  1 
ATOM   1293 C C   . LYS B 2 38  ? -70.526  10.833  -44.134  1.00 91.81  ? 38  LYS B C   1 
ATOM   1294 O O   . LYS B 2 38  ? -69.923  11.201  -43.124  1.00 91.98  ? 38  LYS B O   1 
ATOM   1295 C CB  . LYS B 2 38  ? -71.429  12.877  -45.260  1.00 91.94  ? 38  LYS B CB  1 
ATOM   1296 C CG  . LYS B 2 38  ? -71.075  12.758  -46.717  1.00 92.07  ? 38  LYS B CG  1 
ATOM   1297 C CD  . LYS B 2 38  ? -71.640  13.937  -47.507  1.00 93.80  ? 38  LYS B CD  1 
ATOM   1298 C CE  . LYS B 2 38  ? -71.818  13.607  -49.007  1.00 95.20  ? 38  LYS B CE  1 
ATOM   1299 N NZ  . LYS B 2 38  ? -72.819  14.457  -49.757  1.00 94.85  ? 38  LYS B NZ  1 
ATOM   1300 N N   . VAL B 2 39  ? -70.160  9.778   -44.860  1.00 91.19  ? 39  VAL B N   1 
ATOM   1301 C CA  . VAL B 2 39  ? -68.940  9.014   -44.605  1.00 90.11  ? 39  VAL B CA  1 
ATOM   1302 C C   . VAL B 2 39  ? -68.220  8.846   -45.911  1.00 89.25  ? 39  VAL B C   1 
ATOM   1303 O O   . VAL B 2 39  ? -68.850  8.579   -46.947  1.00 88.97  ? 39  VAL B O   1 
ATOM   1304 C CB  . VAL B 2 39  ? -69.210  7.603   -44.051  1.00 90.35  ? 39  VAL B CB  1 
ATOM   1305 C CG1 . VAL B 2 39  ? -69.154  7.613   -42.541  1.00 90.69  ? 39  VAL B CG1 1 
ATOM   1306 C CG2 . VAL B 2 39  ? -70.546  7.014   -44.603  1.00 90.23  ? 39  VAL B CG2 1 
ATOM   1307 N N   . THR B 2 40  ? -66.903  9.005   -45.852  1.00 88.08  ? 40  THR B N   1 
ATOM   1308 C CA  . THR B 2 40  ? -66.063  8.907   -47.027  1.00 87.07  ? 40  THR B CA  1 
ATOM   1309 C C   . THR B 2 40  ? -64.822  8.087   -46.682  1.00 86.59  ? 40  THR B C   1 
ATOM   1310 O O   . THR B 2 40  ? -63.798  8.651   -46.282  1.00 86.72  ? 40  THR B O   1 
ATOM   1311 C CB  . THR B 2 40  ? -65.630  10.308  -47.541  1.00 86.90  ? 40  THR B CB  1 
ATOM   1312 O OG1 . THR B 2 40  ? -64.937  10.991  -46.502  1.00 87.18  ? 40  THR B OG1 1 
ATOM   1313 C CG2 . THR B 2 40  ? -66.805  11.173  -47.944  1.00 86.58  ? 40  THR B CG2 1 
ATOM   1314 N N   . MET B 2 41  ? -64.895  6.763   -46.814  1.00 85.73  ? 41  MET B N   1 
ATOM   1315 C CA  . MET B 2 41  ? -63.682  5.961   -46.624  1.00 85.12  ? 41  MET B CA  1 
ATOM   1316 C C   . MET B 2 41  ? -62.810  5.926   -47.904  1.00 84.13  ? 41  MET B C   1 
ATOM   1317 O O   . MET B 2 41  ? -63.284  6.273   -49.007  1.00 84.17  ? 41  MET B O   1 
ATOM   1318 C CB  . MET B 2 41  ? -63.972  4.567   -46.034  1.00 85.43  ? 41  MET B CB  1 
ATOM   1319 C CG  . MET B 2 41  ? -64.349  3.462   -47.024  1.00 87.22  ? 41  MET B CG  1 
ATOM   1320 S SD  . MET B 2 41  ? -66.086  2.962   -46.911  1.00 90.09  ? 41  MET B SD  1 
ATOM   1321 C CE  . MET B 2 41  ? -66.856  4.366   -47.699  1.00 89.47  ? 41  MET B CE  1 
ATOM   1322 N N   . SER B 2 42  ? -61.545  5.529   -47.752  1.00 82.44  ? 42  SER B N   1 
ATOM   1323 C CA  . SER B 2 42  ? -60.585  5.665   -48.836  1.00 81.08  ? 42  SER B CA  1 
ATOM   1324 C C   . SER B 2 42  ? -59.945  4.373   -49.267  1.00 79.82  ? 42  SER B C   1 
ATOM   1325 O O   . SER B 2 42  ? -59.581  3.563   -48.432  1.00 79.91  ? 42  SER B O   1 
ATOM   1326 C CB  . SER B 2 42  ? -59.473  6.635   -48.455  1.00 81.31  ? 42  SER B CB  1 
ATOM   1327 O OG  . SER B 2 42  ? -58.504  6.698   -49.496  1.00 81.84  ? 42  SER B OG  1 
ATOM   1328 N N   . CYS B 2 43  ? -59.773  4.235   -50.582  1.00 78.18  ? 43  CYS B N   1 
ATOM   1329 C CA  . CYS B 2 43  ? -59.078  3.119   -51.200  1.00 76.54  ? 43  CYS B CA  1 
ATOM   1330 C C   . CYS B 2 43  ? -57.896  3.630   -52.003  1.00 75.94  ? 43  CYS B C   1 
ATOM   1331 O O   . CYS B 2 43  ? -58.065  4.431   -52.912  1.00 75.92  ? 43  CYS B O   1 
ATOM   1332 C CB  . CYS B 2 43  ? -60.034  2.365   -52.120  1.00 76.27  ? 43  CYS B CB  1 
ATOM   1333 S SG  . CYS B 2 43  ? -59.267  1.159   -53.205  1.00 75.25  ? 43  CYS B SG  1 
ATOM   1334 N N   . LYS B 2 44  ? -56.701  3.160   -51.665  1.00 75.29  ? 44  LYS B N   1 
ATOM   1335 C CA  . LYS B 2 44  ? -55.489  3.501   -52.405  1.00 74.76  ? 44  LYS B CA  1 
ATOM   1336 C C   . LYS B 2 44  ? -54.807  2.279   -53.020  1.00 74.41  ? 44  LYS B C   1 
ATOM   1337 O O   . LYS B 2 44  ? -54.572  1.278   -52.345  1.00 74.57  ? 44  LYS B O   1 
ATOM   1338 C CB  . LYS B 2 44  ? -54.528  4.291   -51.519  1.00 74.70  ? 44  LYS B CB  1 
ATOM   1339 C CG  . LYS B 2 44  ? -55.013  5.738   -51.292  1.00 75.99  ? 44  LYS B CG  1 
ATOM   1340 C CD  . LYS B 2 44  ? -53.995  6.658   -50.567  1.00 77.94  ? 44  LYS B CD  1 
ATOM   1341 C CE  . LYS B 2 44  ? -52.657  6.851   -51.344  1.00 78.60  ? 44  LYS B CE  1 
ATOM   1342 N NZ  . LYS B 2 44  ? -52.775  7.019   -52.843  1.00 76.63  ? 44  LYS B NZ  1 
ATOM   1343 N N   . SER B 2 45  ? -54.504  2.356   -54.310  1.00 73.98  ? 45  SER B N   1 
ATOM   1344 C CA  . SER B 2 45  ? -53.844  1.249   -54.992  1.00 73.75  ? 45  SER B CA  1 
ATOM   1345 C C   . SER B 2 45  ? -52.364  1.527   -55.256  1.00 73.39  ? 45  SER B C   1 
ATOM   1346 O O   . SER B 2 45  ? -51.963  2.673   -55.441  1.00 72.96  ? 45  SER B O   1 
ATOM   1347 C CB  . SER B 2 45  ? -54.586  0.888   -56.286  1.00 73.94  ? 45  SER B CB  1 
ATOM   1348 O OG  . SER B 2 45  ? -54.090  1.568   -57.424  1.00 74.46  ? 45  SER B OG  1 
ATOM   1349 N N   . SER B 2 46  ? -51.565  0.463   -55.267  1.00 73.34  ? 46  SER B N   1 
ATOM   1350 C CA  . SER B 2 46  ? -50.119  0.573   -55.432  1.00 73.64  ? 46  SER B CA  1 
ATOM   1351 C C   . SER B 2 46  ? -49.700  1.059   -56.814  1.00 74.17  ? 46  SER B C   1 
ATOM   1352 O O   . SER B 2 46  ? -48.620  1.642   -56.976  1.00 74.21  ? 46  SER B O   1 
ATOM   1353 C CB  . SER B 2 46  ? -49.439  -0.762  -55.128  1.00 73.59  ? 46  SER B CB  1 
ATOM   1354 O OG  . SER B 2 46  ? -49.920  -1.815  -55.948  1.00 72.50  ? 46  SER B OG  1 
ATOM   1355 N N   . GLN B 2 47  ? -50.570  0.820   -57.791  1.00 74.61  ? 47  GLN B N   1 
ATOM   1356 C CA  . GLN B 2 47  ? -50.299  1.073   -59.194  1.00 75.48  ? 47  GLN B CA  1 
ATOM   1357 C C   . GLN B 2 47  ? -51.342  2.004   -59.720  1.00 76.45  ? 47  GLN B C   1 
ATOM   1358 O O   . GLN B 2 47  ? -52.521  1.831   -59.404  1.00 76.56  ? 47  GLN B O   1 
ATOM   1359 C CB  . GLN B 2 47  ? -50.476  -0.214  -59.953  1.00 75.16  ? 47  GLN B CB  1 
ATOM   1360 C CG  . GLN B 2 47  ? -49.234  -0.822  -60.456  1.00 75.97  ? 47  GLN B CG  1 
ATOM   1361 C CD  . GLN B 2 47  ? -49.408  -1.227  -61.889  1.00 77.57  ? 47  GLN B CD  1 
ATOM   1362 O OE1 . GLN B 2 47  ? -50.080  -0.519  -62.666  1.00 77.63  ? 47  GLN B OE1 1 
ATOM   1363 N NE2 . GLN B 2 47  ? -48.826  -2.373  -62.264  1.00 77.92  ? 47  GLN B NE2 1 
ATOM   1364 N N   . SER B 2 48  ? -50.957  2.976   -60.543  1.00 77.72  ? 48  SER B N   1 
ATOM   1365 C CA  . SER B 2 48  ? -51.985  3.863   -61.080  1.00 79.02  ? 48  SER B CA  1 
ATOM   1366 C C   . SER B 2 48  ? -52.993  3.076   -61.896  1.00 80.00  ? 48  SER B C   1 
ATOM   1367 O O   . SER B 2 48  ? -52.632  2.119   -62.570  1.00 80.49  ? 48  SER B O   1 
ATOM   1368 C CB  . SER B 2 48  ? -51.416  4.983   -61.922  1.00 78.94  ? 48  SER B CB  1 
ATOM   1369 O OG  . SER B 2 48  ? -52.493  5.818   -62.332  1.00 78.98  ? 48  SER B OG  1 
ATOM   1370 N N   . LEU B 2 49  ? -54.250  3.486   -61.836  1.00 81.26  ? 49  LEU B N   1 
ATOM   1371 C CA  . LEU B 2 49  ? -55.325  2.743   -62.489  1.00 82.55  ? 49  LEU B CA  1 
ATOM   1372 C C   . LEU B 2 49  ? -55.909  3.431   -63.747  1.00 83.77  ? 49  LEU B C   1 
ATOM   1373 O O   . LEU B 2 49  ? -57.010  3.096   -64.192  1.00 83.77  ? 49  LEU B O   1 
ATOM   1374 C CB  . LEU B 2 49  ? -56.423  2.440   -61.462  1.00 82.19  ? 49  LEU B CB  1 
ATOM   1375 C CG  . LEU B 2 49  ? -56.440  1.165   -60.612  1.00 81.37  ? 49  LEU B CG  1 
ATOM   1376 C CD1 . LEU B 2 49  ? -55.100  0.470   -60.439  1.00 79.70  ? 49  LEU B CD1 1 
ATOM   1377 C CD2 . LEU B 2 49  ? -57.041  1.503   -59.269  1.00 81.16  ? 49  LEU B CD2 1 
ATOM   1378 N N   . LEU B 2 50  ? -55.170  4.384   -64.316  1.00 85.35  ? 50  LEU B N   1 
ATOM   1379 C CA  . LEU B 2 50  ? -55.631  5.133   -65.495  1.00 86.82  ? 50  LEU B CA  1 
ATOM   1380 C C   . LEU B 2 50  ? -55.122  4.540   -66.814  1.00 88.02  ? 50  LEU B C   1 
ATOM   1381 O O   . LEU B 2 50  ? -53.946  4.171   -66.938  1.00 88.47  ? 50  LEU B O   1 
ATOM   1382 C CB  . LEU B 2 50  ? -55.179  6.601   -65.415  1.00 86.58  ? 50  LEU B CB  1 
ATOM   1383 C CG  . LEU B 2 50  ? -56.165  7.762   -65.647  1.00 86.46  ? 50  LEU B CG  1 
ATOM   1384 C CD1 . LEU B 2 50  ? -55.529  8.840   -66.503  1.00 86.27  ? 50  LEU B CD1 1 
ATOM   1385 C CD2 . LEU B 2 50  ? -57.474  7.332   -66.274  1.00 86.56  ? 50  LEU B CD2 1 
ATOM   1386 N N   . ASN B 2 51  ? -56.007  4.455   -67.799  1.00 89.29  ? 51  ASN B N   1 
ATOM   1387 C CA  . ASN B 2 51  ? -55.576  4.231   -69.170  1.00 90.79  ? 51  ASN B CA  1 
ATOM   1388 C C   . ASN B 2 51  ? -55.194  5.548   -69.835  1.00 91.68  ? 51  ASN B C   1 
ATOM   1389 O O   . ASN B 2 51  ? -55.716  6.612   -69.489  1.00 91.89  ? 51  ASN B O   1 
ATOM   1390 C CB  . ASN B 2 51  ? -56.675  3.542   -69.985  1.00 91.01  ? 51  ASN B CB  1 
ATOM   1391 C CG  . ASN B 2 51  ? -56.461  2.053   -70.098  1.00 91.98  ? 51  ASN B CG  1 
ATOM   1392 O OD1 . ASN B 2 51  ? -57.303  1.252   -69.675  1.00 92.57  ? 51  ASN B OD1 1 
ATOM   1393 N ND2 . ASN B 2 51  ? -55.316  1.665   -70.655  1.00 93.06  ? 51  ASN B ND2 1 
ATOM   1394 N N   . SER B 2 52  ? -54.274  5.485   -70.787  1.00 92.89  ? 52  SER B N   1 
ATOM   1395 C CA  . SER B 2 52  ? -54.058  6.631   -71.661  1.00 93.95  ? 52  SER B CA  1 
ATOM   1396 C C   . SER B 2 52  ? -55.357  6.907   -72.435  1.00 94.07  ? 52  SER B C   1 
ATOM   1397 O O   . SER B 2 52  ? -55.912  7.992   -72.304  1.00 94.48  ? 52  SER B O   1 
ATOM   1398 C CB  . SER B 2 52  ? -52.848  6.427   -72.594  1.00 94.31  ? 52  SER B CB  1 
ATOM   1399 O OG  . SER B 2 52  ? -52.749  5.083   -73.049  1.00 95.04  ? 52  SER B OG  1 
ATOM   1400 N N   . ARG B 2 53  ? -55.857  5.921   -73.186  1.00 93.94  ? 53  ARG B N   1 
ATOM   1401 C CA  . ARG B 2 53  ? -57.126  6.068   -73.902  1.00 93.97  ? 53  ARG B CA  1 
ATOM   1402 C C   . ARG B 2 53  ? -58.353  5.932   -72.990  1.00 94.09  ? 53  ARG B C   1 
ATOM   1403 O O   . ARG B 2 53  ? -58.613  4.883   -72.367  1.00 93.80  ? 53  ARG B O   1 
ATOM   1404 C CB  . ARG B 2 53  ? -57.202  5.167   -75.142  1.00 94.14  ? 53  ARG B CB  1 
ATOM   1405 C CG  . ARG B 2 53  ? -56.274  3.973   -75.112  1.00 94.58  ? 53  ARG B CG  1 
ATOM   1406 C CD  . ARG B 2 53  ? -56.550  2.986   -76.215  1.00 95.20  ? 53  ARG B CD  1 
ATOM   1407 N NE  . ARG B 2 53  ? -55.660  1.843   -76.057  1.00 98.38  ? 53  ARG B NE  1 
ATOM   1408 C CZ  . ARG B 2 53  ? -55.030  1.211   -77.049  1.00 100.89 ? 53  ARG B CZ  1 
ATOM   1409 N NH1 . ARG B 2 53  ? -55.181  1.593   -78.319  1.00 101.76 ? 53  ARG B NH1 1 
ATOM   1410 N NH2 . ARG B 2 53  ? -54.233  0.183   -76.767  1.00 101.83 ? 53  ARG B NH2 1 
ATOM   1411 N N   . THR B 2 54  ? -59.097  7.036   -72.949  1.00 94.66  ? 54  THR B N   1 
ATOM   1412 C CA  . THR B 2 54  ? -60.177  7.335   -71.979  1.00 95.07  ? 54  THR B CA  1 
ATOM   1413 C C   . THR B 2 54  ? -59.694  7.409   -70.557  1.00 94.77  ? 54  THR B C   1 
ATOM   1414 O O   . THR B 2 54  ? -59.072  6.469   -70.057  1.00 94.74  ? 54  THR B O   1 
ATOM   1415 C CB  . THR B 2 54  ? -61.388  6.338   -72.005  1.00 95.34  ? 54  THR B CB  1 
ATOM   1416 O OG1 . THR B 2 54  ? -61.854  6.145   -73.353  1.00 96.90  ? 54  THR B OG1 1 
ATOM   1417 C CG2 . THR B 2 54  ? -62.540  6.880   -71.148  1.00 94.42  ? 54  THR B CG2 1 
ATOM   1418 N N   . ARG B 2 55  ? -60.004  8.524   -69.905  1.00 94.74  ? 55  ARG B N   1 
ATOM   1419 C CA  . ARG B 2 55  ? -60.028  8.542   -68.440  1.00 94.86  ? 55  ARG B CA  1 
ATOM   1420 C C   . ARG B 2 55  ? -60.969  7.417   -68.044  1.00 94.23  ? 55  ARG B C   1 
ATOM   1421 O O   . ARG B 2 55  ? -62.197  7.539   -68.162  1.00 94.68  ? 55  ARG B O   1 
ATOM   1422 C CB  . ARG B 2 55  ? -60.528  9.880   -67.864  1.00 95.32  ? 55  ARG B CB  1 
ATOM   1423 C CG  . ARG B 2 55  ? -59.435  10.848  -67.347  1.00 96.63  ? 55  ARG B CG  1 
ATOM   1424 C CD  . ARG B 2 55  ? -60.025  12.212  -66.975  1.00 98.47  ? 55  ARG B CD  1 
ATOM   1425 N NE  . ARG B 2 55  ? -61.045  12.641  -67.940  1.00 101.11 ? 55  ARG B NE  1 
ATOM   1426 C CZ  . ARG B 2 55  ? -61.572  13.866  -68.012  1.00 103.13 ? 55  ARG B CZ  1 
ATOM   1427 N NH1 . ARG B 2 55  ? -61.176  14.825  -67.173  1.00 104.08 ? 55  ARG B NH1 1 
ATOM   1428 N NH2 . ARG B 2 55  ? -62.502  14.137  -68.932  1.00 103.74 ? 55  ARG B NH2 1 
ATOM   1429 N N   . LYS B 2 56  ? -60.376  6.304   -67.636  1.00 93.11  ? 56  LYS B N   1 
ATOM   1430 C CA  . LYS B 2 56  ? -61.109  5.104   -67.283  1.00 91.73  ? 56  LYS B CA  1 
ATOM   1431 C C   . LYS B 2 56  ? -60.347  4.525   -66.124  1.00 90.52  ? 56  LYS B C   1 
ATOM   1432 O O   . LYS B 2 56  ? -59.220  4.034   -66.299  1.00 90.44  ? 56  LYS B O   1 
ATOM   1433 C CB  . LYS B 2 56  ? -61.135  4.127   -68.467  1.00 92.02  ? 56  LYS B CB  1 
ATOM   1434 C CG  . LYS B 2 56  ? -62.443  4.107   -69.221  1.00 92.26  ? 56  LYS B CG  1 
ATOM   1435 C CD  . LYS B 2 56  ? -63.625  3.892   -68.285  1.00 93.21  ? 56  LYS B CD  1 
ATOM   1436 C CE  . LYS B 2 56  ? -64.951  4.109   -69.000  1.00 95.51  ? 56  LYS B CE  1 
ATOM   1437 N NZ  . LYS B 2 56  ? -65.221  5.563   -69.286  1.00 96.87  ? 56  LYS B NZ  1 
ATOM   1438 N N   . ASN B 2 57  ? -60.919  4.610   -64.929  1.00 88.83  ? 57  ASN B N   1 
ATOM   1439 C CA  . ASN B 2 57  ? -60.093  4.321   -63.769  1.00 87.48  ? 57  ASN B CA  1 
ATOM   1440 C C   . ASN B 2 57  ? -60.168  2.945   -63.146  1.00 87.00  ? 57  ASN B C   1 
ATOM   1441 O O   . ASN B 2 57  ? -59.602  2.721   -62.073  1.00 87.90  ? 57  ASN B O   1 
ATOM   1442 C CB  . ASN B 2 57  ? -60.074  5.456   -62.742  1.00 86.93  ? 57  ASN B CB  1 
ATOM   1443 C CG  . ASN B 2 57  ? -58.766  6.243   -62.789  1.00 85.99  ? 57  ASN B CG  1 
ATOM   1444 O OD1 . ASN B 2 57  ? -58.763  7.472   -62.830  1.00 85.02  ? 57  ASN B OD1 1 
ATOM   1445 N ND2 . ASN B 2 57  ? -57.649  5.528   -62.808  1.00 83.92  ? 57  ASN B ND2 1 
ATOM   1446 N N   . TYR B 2 58  ? -60.832  2.018   -63.836  1.00 85.43  ? 58  TYR B N   1 
ATOM   1447 C CA  . TYR B 2 58  ? -60.679  0.566   -63.593  1.00 83.53  ? 58  TYR B CA  1 
ATOM   1448 C C   . TYR B 2 58  ? -60.660  0.064   -62.125  1.00 82.69  ? 58  TYR B C   1 
ATOM   1449 O O   . TYR B 2 58  ? -60.040  -0.947  -61.778  1.00 82.55  ? 58  TYR B O   1 
ATOM   1450 C CB  . TYR B 2 58  ? -59.546  0.030   -64.479  1.00 82.79  ? 58  TYR B CB  1 
ATOM   1451 C CG  . TYR B 2 58  ? -59.964  0.178   -65.924  1.00 81.67  ? 58  TYR B CG  1 
ATOM   1452 C CD1 . TYR B 2 58  ? -59.108  0.711   -66.890  1.00 79.66  ? 58  TYR B CD1 1 
ATOM   1453 C CD2 . TYR B 2 58  ? -61.269  -0.171  -66.311  1.00 81.36  ? 58  TYR B CD2 1 
ATOM   1454 C CE1 . TYR B 2 58  ? -59.525  0.857   -68.211  1.00 79.03  ? 58  TYR B CE1 1 
ATOM   1455 C CE2 . TYR B 2 58  ? -61.698  -0.030  -67.614  1.00 81.28  ? 58  TYR B CE2 1 
ATOM   1456 C CZ  . TYR B 2 58  ? -60.826  0.486   -68.565  1.00 80.83  ? 58  TYR B CZ  1 
ATOM   1457 O OH  . TYR B 2 58  ? -61.297  0.616   -69.855  1.00 81.12  ? 58  TYR B OH  1 
ATOM   1458 N N   . LEU B 2 59  ? -61.390  0.784   -61.282  1.00 81.49  ? 59  LEU B N   1 
ATOM   1459 C CA  . LEU B 2 59  ? -61.550  0.403   -59.912  1.00 80.66  ? 59  LEU B CA  1 
ATOM   1460 C C   . LEU B 2 59  ? -63.026  0.240   -59.660  1.00 80.00  ? 59  LEU B C   1 
ATOM   1461 O O   . LEU B 2 59  ? -63.822  1.061   -60.117  1.00 79.94  ? 59  LEU B O   1 
ATOM   1462 C CB  . LEU B 2 59  ? -60.991  1.477   -58.984  1.00 80.53  ? 59  LEU B CB  1 
ATOM   1463 C CG  . LEU B 2 59  ? -61.194  1.186   -57.490  1.00 80.98  ? 59  LEU B CG  1 
ATOM   1464 C CD1 . LEU B 2 59  ? -60.038  1.714   -56.711  1.00 82.43  ? 59  LEU B CD1 1 
ATOM   1465 C CD2 . LEU B 2 59  ? -62.499  1.745   -56.932  1.00 80.33  ? 59  LEU B CD2 1 
ATOM   1466 N N   . ALA B 2 60  ? -63.381  -0.811  -58.923  1.00 78.86  ? 60  ALA B N   1 
ATOM   1467 C CA  . ALA B 2 60  ? -64.733  -0.960  -58.427  1.00 77.89  ? 60  ALA B CA  1 
ATOM   1468 C C   . ALA B 2 60  ? -64.819  -0.949  -56.887  1.00 77.50  ? 60  ALA B C   1 
ATOM   1469 O O   . ALA B 2 60  ? -63.829  -1.231  -56.187  1.00 77.28  ? 60  ALA B O   1 
ATOM   1470 C CB  . ALA B 2 60  ? -65.347  -2.206  -58.990  1.00 77.78  ? 60  ALA B CB  1 
ATOM   1471 N N   . TRP B 2 61  ? -66.010  -0.596  -56.387  1.00 76.73  ? 61  TRP B N   1 
ATOM   1472 C CA  . TRP B 2 61  ? -66.357  -0.658  -54.971  1.00 75.76  ? 61  TRP B CA  1 
ATOM   1473 C C   . TRP B 2 61  ? -67.466  -1.662  -54.794  1.00 76.50  ? 61  TRP B C   1 
ATOM   1474 O O   . TRP B 2 61  ? -68.521  -1.510  -55.407  1.00 76.90  ? 61  TRP B O   1 
ATOM   1475 C CB  . TRP B 2 61  ? -66.899  0.683   -54.503  1.00 74.95  ? 61  TRP B CB  1 
ATOM   1476 C CG  . TRP B 2 61  ? -65.870  1.705   -54.315  1.00 71.29  ? 61  TRP B CG  1 
ATOM   1477 C CD1 . TRP B 2 61  ? -65.509  2.653   -55.199  1.00 68.94  ? 61  TRP B CD1 1 
ATOM   1478 C CD2 . TRP B 2 61  ? -65.050  1.888   -53.167  1.00 67.89  ? 61  TRP B CD2 1 
ATOM   1479 N NE1 . TRP B 2 61  ? -64.512  3.424   -54.680  1.00 67.61  ? 61  TRP B NE1 1 
ATOM   1480 C CE2 . TRP B 2 61  ? -64.211  2.971   -53.428  1.00 67.33  ? 61  TRP B CE2 1 
ATOM   1481 C CE3 . TRP B 2 61  ? -64.936  1.229   -51.947  1.00 68.03  ? 61  TRP B CE3 1 
ATOM   1482 C CZ2 . TRP B 2 61  ? -63.269  3.421   -52.515  1.00 67.85  ? 61  TRP B CZ2 1 
ATOM   1483 C CZ3 . TRP B 2 61  ? -64.004  1.677   -51.038  1.00 68.35  ? 61  TRP B CZ3 1 
ATOM   1484 C CH2 . TRP B 2 61  ? -63.181  2.761   -51.326  1.00 68.07  ? 61  TRP B CH2 1 
ATOM   1485 N N   . TYR B 2 62  ? -67.252  -2.670  -53.957  1.00 76.99  ? 62  TYR B N   1 
ATOM   1486 C CA  . TYR B 2 62  ? -68.305  -3.645  -53.652  1.00 77.60  ? 62  TYR B CA  1 
ATOM   1487 C C   . TYR B 2 62  ? -68.691  -3.522  -52.200  1.00 78.25  ? 62  TYR B C   1 
ATOM   1488 O O   . TYR B 2 62  ? -67.826  -3.486  -51.323  1.00 78.21  ? 62  TYR B O   1 
ATOM   1489 C CB  . TYR B 2 62  ? -67.849  -5.092  -53.918  1.00 77.51  ? 62  TYR B CB  1 
ATOM   1490 C CG  . TYR B 2 62  ? -67.506  -5.399  -55.347  1.00 76.67  ? 62  TYR B CG  1 
ATOM   1491 C CD1 . TYR B 2 62  ? -66.351  -4.901  -55.915  1.00 76.53  ? 62  TYR B CD1 1 
ATOM   1492 C CD2 . TYR B 2 62  ? -68.332  -6.190  -56.126  1.00 77.14  ? 62  TYR B CD2 1 
ATOM   1493 C CE1 . TYR B 2 62  ? -66.024  -5.162  -57.228  1.00 77.59  ? 62  TYR B CE1 1 
ATOM   1494 C CE2 . TYR B 2 62  ? -68.013  -6.472  -57.468  1.00 78.04  ? 62  TYR B CE2 1 
ATOM   1495 C CZ  . TYR B 2 62  ? -66.847  -5.953  -58.013  1.00 78.06  ? 62  TYR B CZ  1 
ATOM   1496 O OH  . TYR B 2 62  ? -66.488  -6.208  -59.327  1.00 76.89  ? 62  TYR B OH  1 
ATOM   1497 N N   . GLN B 2 63  ? -69.987  -3.454  -51.939  1.00 79.23  ? 63  GLN B N   1 
ATOM   1498 C CA  . GLN B 2 63  ? -70.451  -3.524  -50.570  1.00 80.60  ? 63  GLN B CA  1 
ATOM   1499 C C   . GLN B 2 63  ? -70.813  -4.966  -50.284  1.00 81.28  ? 63  GLN B C   1 
ATOM   1500 O O   . GLN B 2 63  ? -71.251  -5.685  -51.193  1.00 81.38  ? 63  GLN B O   1 
ATOM   1501 C CB  . GLN B 2 63  ? -71.653  -2.619  -50.345  1.00 80.83  ? 63  GLN B CB  1 
ATOM   1502 C CG  . GLN B 2 63  ? -72.993  -3.156  -50.836  1.00 82.79  ? 63  GLN B CG  1 
ATOM   1503 C CD  . GLN B 2 63  ? -74.100  -2.939  -49.809  1.00 85.63  ? 63  GLN B CD  1 
ATOM   1504 O OE1 . GLN B 2 63  ? -75.245  -2.618  -50.158  1.00 87.10  ? 63  GLN B OE1 1 
ATOM   1505 N NE2 . GLN B 2 63  ? -73.757  -3.101  -48.527  1.00 86.17  ? 63  GLN B NE2 1 
ATOM   1506 N N   . GLN B 2 64  ? -70.631  -5.391  -49.032  1.00 82.07  ? 64  GLN B N   1 
ATOM   1507 C CA  . GLN B 2 64  ? -70.948  -6.766  -48.638  1.00 82.56  ? 64  GLN B CA  1 
ATOM   1508 C C   . GLN B 2 64  ? -71.594  -6.780  -47.289  1.00 83.01  ? 64  GLN B C   1 
ATOM   1509 O O   . GLN B 2 64  ? -70.928  -6.508  -46.300  1.00 83.14  ? 64  GLN B O   1 
ATOM   1510 C CB  . GLN B 2 64  ? -69.690  -7.626  -48.584  1.00 82.47  ? 64  GLN B CB  1 
ATOM   1511 C CG  . GLN B 2 64  ? -69.963  -9.101  -48.357  1.00 82.06  ? 64  GLN B CG  1 
ATOM   1512 C CD  . GLN B 2 64  ? -68.748  -9.844  -47.841  1.00 82.09  ? 64  GLN B CD  1 
ATOM   1513 O OE1 . GLN B 2 64  ? -68.036  -9.368  -46.951  1.00 81.46  ? 64  GLN B OE1 1 
ATOM   1514 N NE2 . GLN B 2 64  ? -68.500  -11.019 -48.401  1.00 82.76  ? 64  GLN B NE2 1 
ATOM   1515 N N   . LYS B 2 65  ? -72.881  -7.120  -47.250  1.00 83.95  ? 65  LYS B N   1 
ATOM   1516 C CA  . LYS B 2 65  ? -73.643  -7.122  -45.998  1.00 84.83  ? 65  LYS B CA  1 
ATOM   1517 C C   . LYS B 2 65  ? -73.301  -8.324  -45.106  1.00 85.28  ? 65  LYS B C   1 
ATOM   1518 O O   . LYS B 2 65  ? -72.769  -9.313  -45.597  1.00 85.16  ? 65  LYS B O   1 
ATOM   1519 C CB  . LYS B 2 65  ? -75.133  -7.014  -46.293  1.00 84.71  ? 65  LYS B CB  1 
ATOM   1520 C CG  . LYS B 2 65  ? -75.584  -5.582  -46.513  1.00 85.60  ? 65  LYS B CG  1 
ATOM   1521 C CD  . LYS B 2 65  ? -76.617  -5.487  -47.647  1.00 87.63  ? 65  LYS B CD  1 
ATOM   1522 C CE  . LYS B 2 65  ? -77.318  -4.125  -47.654  1.00 88.00  ? 65  LYS B CE  1 
ATOM   1523 N NZ  . LYS B 2 65  ? -78.035  -3.845  -48.930  1.00 87.85  ? 65  LYS B NZ  1 
ATOM   1524 N N   . PRO B 2 66  ? -73.571  -8.233  -43.786  1.00 85.92  ? 66  PRO B N   1 
ATOM   1525 C CA  . PRO B 2 66  ? -73.188  -9.332  -42.898  1.00 86.45  ? 66  PRO B CA  1 
ATOM   1526 C C   . PRO B 2 66  ? -73.739  -10.689 -43.364  1.00 87.09  ? 66  PRO B C   1 
ATOM   1527 O O   . PRO B 2 66  ? -74.965  -10.879 -43.436  1.00 87.08  ? 66  PRO B O   1 
ATOM   1528 C CB  . PRO B 2 66  ? -73.797  -8.924  -41.549  1.00 86.21  ? 66  PRO B CB  1 
ATOM   1529 C CG  . PRO B 2 66  ? -74.852  -7.927  -41.887  1.00 85.89  ? 66  PRO B CG  1 
ATOM   1530 C CD  . PRO B 2 66  ? -74.279  -7.177  -43.042  1.00 85.99  ? 66  PRO B CD  1 
ATOM   1531 N N   . GLY B 2 67  ? -72.819  -11.605 -43.689  1.00 87.57  ? 67  GLY B N   1 
ATOM   1532 C CA  . GLY B 2 67  ? -73.162  -12.927 -44.188  1.00 87.93  ? 67  GLY B CA  1 
ATOM   1533 C C   . GLY B 2 67  ? -73.974  -12.768 -45.447  1.00 88.42  ? 67  GLY B C   1 
ATOM   1534 O O   . GLY B 2 67  ? -75.157  -13.097 -45.483  1.00 88.01  ? 67  GLY B O   1 
ATOM   1535 N N   . GLN B 2 68  ? -73.328  -12.210 -46.464  1.00 89.37  ? 68  GLN B N   1 
ATOM   1536 C CA  . GLN B 2 68  ? -73.888  -12.091 -47.818  1.00 90.27  ? 68  GLN B CA  1 
ATOM   1537 C C   . GLN B 2 68  ? -72.812  -12.006 -48.875  1.00 90.40  ? 68  GLN B C   1 
ATOM   1538 O O   . GLN B 2 68  ? -71.676  -11.587 -48.623  1.00 90.32  ? 68  GLN B O   1 
ATOM   1539 C CB  . GLN B 2 68  ? -74.755  -10.856 -47.958  1.00 90.43  ? 68  GLN B CB  1 
ATOM   1540 C CG  . GLN B 2 68  ? -76.199  -11.129 -47.784  1.00 92.20  ? 68  GLN B CG  1 
ATOM   1541 C CD  . GLN B 2 68  ? -76.882  -9.969  -47.136  1.00 95.01  ? 68  GLN B CD  1 
ATOM   1542 O OE1 . GLN B 2 68  ? -76.552  -9.584  -46.002  1.00 96.51  ? 68  GLN B OE1 1 
ATOM   1543 N NE2 . GLN B 2 68  ? -77.835  -9.380  -47.848  1.00 95.98  ? 68  GLN B NE2 1 
ATOM   1544 N N   . SER B 2 69  ? -73.184  -12.395 -50.078  1.00 90.76  ? 69  SER B N   1 
ATOM   1545 C CA  . SER B 2 69  ? -72.304  -12.190 -51.197  1.00 91.25  ? 69  SER B CA  1 
ATOM   1546 C C   . SER B 2 69  ? -72.155  -10.671 -51.419  1.00 91.33  ? 69  SER B C   1 
ATOM   1547 O O   . SER B 2 69  ? -73.140  -9.920  -51.291  1.00 91.63  ? 69  SER B O   1 
ATOM   1548 C CB  . SER B 2 69  ? -72.866  -12.906 -52.420  1.00 91.32  ? 69  SER B CB  1 
ATOM   1549 O OG  . SER B 2 69  ? -73.098  -14.271 -52.109  1.00 91.28  ? 69  SER B OG  1 
ATOM   1550 N N   . PRO B 2 70  ? -70.920  -10.206 -51.702  1.00 90.95  ? 70  PRO B N   1 
ATOM   1551 C CA  . PRO B 2 70  ? -70.737  -8.800  -52.036  1.00 90.65  ? 70  PRO B CA  1 
ATOM   1552 C C   . PRO B 2 70  ? -71.719  -8.344  -53.128  1.00 90.49  ? 70  PRO B C   1 
ATOM   1553 O O   . PRO B 2 70  ? -72.135  -9.161  -53.946  1.00 90.63  ? 70  PRO B O   1 
ATOM   1554 C CB  . PRO B 2 70  ? -69.305  -8.771  -52.553  1.00 90.60  ? 70  PRO B CB  1 
ATOM   1555 C CG  . PRO B 2 70  ? -68.618  -9.856  -51.797  1.00 90.17  ? 70  PRO B CG  1 
ATOM   1556 C CD  . PRO B 2 70  ? -69.637  -10.933 -51.654  1.00 90.76  ? 70  PRO B CD  1 
ATOM   1557 N N   . LYS B 2 71  ? -72.109  -7.070  -53.112  1.00 90.24  ? 71  LYS B N   1 
ATOM   1558 C CA  . LYS B 2 71  ? -72.930  -6.469  -54.189  1.00 90.05  ? 71  LYS B CA  1 
ATOM   1559 C C   . LYS B 2 71  ? -72.126  -5.403  -54.947  1.00 89.23  ? 71  LYS B C   1 
ATOM   1560 O O   . LYS B 2 71  ? -71.359  -4.649  -54.339  1.00 89.51  ? 71  LYS B O   1 
ATOM   1561 C CB  . LYS B 2 71  ? -74.197  -5.794  -53.632  1.00 90.52  ? 71  LYS B CB  1 
ATOM   1562 C CG  . LYS B 2 71  ? -74.991  -6.564  -52.548  1.00 92.03  ? 71  LYS B CG  1 
ATOM   1563 C CD  . LYS B 2 71  ? -76.031  -5.650  -51.830  1.00 93.63  ? 71  LYS B CD  1 
ATOM   1564 C CE  . LYS B 2 71  ? -77.094  -5.071  -52.810  1.00 94.83  ? 71  LYS B CE  1 
ATOM   1565 N NZ  . LYS B 2 71  ? -77.929  -3.928  -52.272  1.00 94.68  ? 71  LYS B NZ  1 
ATOM   1566 N N   . LEU B 2 72  ? -72.301  -5.326  -56.262  1.00 88.06  ? 72  LEU B N   1 
ATOM   1567 C CA  . LEU B 2 72  ? -71.627  -4.283  -57.037  1.00 86.96  ? 72  LEU B CA  1 
ATOM   1568 C C   . LEU B 2 72  ? -72.260  -2.933  -56.733  1.00 86.44  ? 72  LEU B C   1 
ATOM   1569 O O   . LEU B 2 72  ? -73.475  -2.822  -56.597  1.00 86.26  ? 72  LEU B O   1 
ATOM   1570 C CB  . LEU B 2 72  ? -71.686  -4.590  -58.531  1.00 86.95  ? 72  LEU B CB  1 
ATOM   1571 C CG  . LEU B 2 72  ? -71.146  -3.546  -59.511  1.00 86.40  ? 72  LEU B CG  1 
ATOM   1572 C CD1 . LEU B 2 72  ? -69.683  -3.156  -59.232  1.00 85.63  ? 72  LEU B CD1 1 
ATOM   1573 C CD2 . LEU B 2 72  ? -71.332  -4.046  -60.932  1.00 85.18  ? 72  LEU B CD2 1 
ATOM   1574 N N   . LEU B 2 73  ? -71.428  -1.906  -56.629  1.00 85.94  ? 73  LEU B N   1 
ATOM   1575 C CA  . LEU B 2 73  ? -71.862  -0.620  -56.084  1.00 85.32  ? 73  LEU B CA  1 
ATOM   1576 C C   . LEU B 2 73  ? -71.511  0.532   -57.007  1.00 85.32  ? 73  LEU B C   1 
ATOM   1577 O O   . LEU B 2 73  ? -72.354  1.356   -57.365  1.00 85.26  ? 73  LEU B O   1 
ATOM   1578 C CB  . LEU B 2 73  ? -71.178  -0.416  -54.748  1.00 84.84  ? 73  LEU B CB  1 
ATOM   1579 C CG  . LEU B 2 73  ? -71.911  0.360   -53.690  1.00 83.84  ? 73  LEU B CG  1 
ATOM   1580 C CD1 . LEU B 2 73  ? -73.312  -0.132  -53.594  1.00 83.08  ? 73  LEU B CD1 1 
ATOM   1581 C CD2 . LEU B 2 73  ? -71.174  0.113   -52.407  1.00 83.46  ? 73  LEU B CD2 1 
ATOM   1582 N N   . ILE B 2 74  ? -70.241  0.573   -57.385  1.00 85.24  ? 74  ILE B N   1 
ATOM   1583 C CA  . ILE B 2 74  ? -69.727  1.572   -58.289  1.00 85.06  ? 74  ILE B CA  1 
ATOM   1584 C C   . ILE B 2 74  ? -68.730  0.864   -59.175  1.00 84.90  ? 74  ILE B C   1 
ATOM   1585 O O   . ILE B 2 74  ? -67.864  0.148   -58.664  1.00 84.95  ? 74  ILE B O   1 
ATOM   1586 C CB  . ILE B 2 74  ? -69.031  2.709   -57.489  1.00 85.05  ? 74  ILE B CB  1 
ATOM   1587 C CG1 . ILE B 2 74  ? -70.078  3.677   -56.924  1.00 84.71  ? 74  ILE B CG1 1 
ATOM   1588 C CG2 . ILE B 2 74  ? -68.024  3.475   -58.349  1.00 85.22  ? 74  ILE B CG2 1 
ATOM   1589 C CD1 . ILE B 2 74  ? -69.621  4.459   -55.713  1.00 83.67  ? 74  ILE B CD1 1 
ATOM   1590 N N   . TYR B 2 75  ? -68.853  1.027   -60.489  1.00 84.58  ? 75  TYR B N   1 
ATOM   1591 C CA  . TYR B 2 75  ? -67.738  0.639   -61.338  1.00 84.72  ? 75  TYR B CA  1 
ATOM   1592 C C   . TYR B 2 75  ? -66.980  1.803   -61.974  1.00 84.96  ? 75  TYR B C   1 
ATOM   1593 O O   . TYR B 2 75  ? -67.316  2.978   -61.777  1.00 85.27  ? 75  TYR B O   1 
ATOM   1594 C CB  . TYR B 2 75  ? -68.108  -0.427  -62.355  1.00 84.60  ? 75  TYR B CB  1 
ATOM   1595 C CG  . TYR B 2 75  ? -69.242  -0.124  -63.294  1.00 85.10  ? 75  TYR B CG  1 
ATOM   1596 C CD1 . TYR B 2 75  ? -70.474  -0.740  -63.129  1.00 86.55  ? 75  TYR B CD1 1 
ATOM   1597 C CD2 . TYR B 2 75  ? -69.070  0.711   -64.387  1.00 85.93  ? 75  TYR B CD2 1 
ATOM   1598 C CE1 . TYR B 2 75  ? -71.525  -0.514  -64.003  1.00 87.54  ? 75  TYR B CE1 1 
ATOM   1599 C CE2 . TYR B 2 75  ? -70.117  0.955   -65.274  1.00 87.33  ? 75  TYR B CE2 1 
ATOM   1600 C CZ  . TYR B 2 75  ? -71.343  0.337   -65.072  1.00 88.30  ? 75  TYR B CZ  1 
ATOM   1601 O OH  . TYR B 2 75  ? -72.393  0.562   -65.934  1.00 89.74  ? 75  TYR B OH  1 
ATOM   1602 N N   . TRP B 2 76  ? -65.932  1.456   -62.713  1.00 84.98  ? 76  TRP B N   1 
ATOM   1603 C CA  . TRP B 2 76  ? -65.026  2.424   -63.340  1.00 85.03  ? 76  TRP B CA  1 
ATOM   1604 C C   . TRP B 2 76  ? -64.373  3.445   -62.416  1.00 85.28  ? 76  TRP B C   1 
ATOM   1605 O O   . TRP B 2 76  ? -63.179  3.694   -62.547  1.00 85.55  ? 76  TRP B O   1 
ATOM   1606 C CB  . TRP B 2 76  ? -65.650  3.055   -64.575  1.00 84.79  ? 76  TRP B CB  1 
ATOM   1607 C CG  . TRP B 2 76  ? -65.666  2.086   -65.718  1.00 84.37  ? 76  TRP B CG  1 
ATOM   1608 C CD1 . TRP B 2 76  ? -64.733  1.109   -65.990  1.00 83.83  ? 76  TRP B CD1 1 
ATOM   1609 C CD2 . TRP B 2 76  ? -66.645  1.998   -66.751  1.00 84.12  ? 76  TRP B CD2 1 
ATOM   1610 N NE1 . TRP B 2 76  ? -65.083  0.422   -67.126  1.00 83.14  ? 76  TRP B NE1 1 
ATOM   1611 C CE2 . TRP B 2 76  ? -66.250  0.948   -67.616  1.00 83.59  ? 76  TRP B CE2 1 
ATOM   1612 C CE3 . TRP B 2 76  ? -67.817  2.705   -67.037  1.00 84.51  ? 76  TRP B CE3 1 
ATOM   1613 C CZ2 . TRP B 2 76  ? -66.988  0.592   -68.741  1.00 83.58  ? 76  TRP B CZ2 1 
ATOM   1614 C CZ3 . TRP B 2 76  ? -68.553  2.341   -68.156  1.00 85.28  ? 76  TRP B CZ3 1 
ATOM   1615 C CH2 . TRP B 2 76  ? -68.133  1.292   -68.994  1.00 83.92  ? 76  TRP B CH2 1 
ATOM   1616 N N   . ALA B 2 77  ? -65.146  4.031   -61.508  1.00 85.50  ? 77  ALA B N   1 
ATOM   1617 C CA  . ALA B 2 77  ? -64.626  4.694   -60.294  1.00 86.17  ? 77  ALA B CA  1 
ATOM   1618 C C   . ALA B 2 77  ? -65.661  5.652   -59.797  1.00 86.70  ? 77  ALA B C   1 
ATOM   1619 O O   . ALA B 2 77  ? -65.813  5.851   -58.577  1.00 86.20  ? 77  ALA B O   1 
ATOM   1620 C CB  . ALA B 2 77  ? -63.343  5.453   -60.558  1.00 86.33  ? 77  ALA B CB  1 
ATOM   1621 N N   . SER B 2 78  ? -66.344  6.241   -60.790  1.00 87.50  ? 78  SER B N   1 
ATOM   1622 C CA  . SER B 2 78  ? -67.388  7.253   -60.633  1.00 87.82  ? 78  SER B CA  1 
ATOM   1623 C C   . SER B 2 78  ? -68.762  6.634   -60.777  1.00 88.30  ? 78  SER B C   1 
ATOM   1624 O O   . SER B 2 78  ? -69.609  6.820   -59.908  1.00 88.16  ? 78  SER B O   1 
ATOM   1625 C CB  . SER B 2 78  ? -67.233  8.346   -61.698  1.00 87.73  ? 78  SER B CB  1 
ATOM   1626 O OG  . SER B 2 78  ? -66.197  9.258   -61.372  1.00 87.24  ? 78  SER B OG  1 
ATOM   1627 N N   . THR B 2 79  ? -68.956  5.879   -61.864  1.00 89.10  ? 79  THR B N   1 
ATOM   1628 C CA  . THR B 2 79  ? -70.292  5.435   -62.309  1.00 89.93  ? 79  THR B CA  1 
ATOM   1629 C C   . THR B 2 79  ? -70.983  4.406   -61.401  1.00 90.53  ? 79  THR B C   1 
ATOM   1630 O O   . THR B 2 79  ? -70.435  3.334   -61.123  1.00 90.45  ? 79  THR B O   1 
ATOM   1631 C CB  . THR B 2 79  ? -70.317  4.943   -63.802  1.00 89.88  ? 79  THR B CB  1 
ATOM   1632 O OG1 . THR B 2 79  ? -70.606  3.541   -63.865  1.00 89.41  ? 79  THR B OG1 1 
ATOM   1633 C CG2 . THR B 2 79  ? -69.011  5.263   -64.550  1.00 89.93  ? 79  THR B CG2 1 
ATOM   1634 N N   . ARG B 2 80  ? -72.195  4.754   -60.965  1.00 91.42  ? 80  ARG B N   1 
ATOM   1635 C CA  . ARG B 2 80  ? -73.002  3.911   -60.093  1.00 92.48  ? 80  ARG B CA  1 
ATOM   1636 C C   . ARG B 2 80  ? -73.753  2.852   -60.880  1.00 93.04  ? 80  ARG B C   1 
ATOM   1637 O O   . ARG B 2 80  ? -73.892  2.948   -62.101  1.00 92.81  ? 80  ARG B O   1 
ATOM   1638 C CB  . ARG B 2 80  ? -73.984  4.757   -59.300  1.00 92.61  ? 80  ARG B CB  1 
ATOM   1639 C CG  . ARG B 2 80  ? -73.331  5.557   -58.214  1.00 94.05  ? 80  ARG B CG  1 
ATOM   1640 C CD  . ARG B 2 80  ? -74.333  6.449   -57.529  1.00 97.24  ? 80  ARG B CD  1 
ATOM   1641 N NE  . ARG B 2 80  ? -73.752  7.769   -57.308  1.00 100.03 ? 80  ARG B NE  1 
ATOM   1642 C CZ  . ARG B 2 80  ? -73.898  8.804   -58.132  1.00 101.31 ? 80  ARG B CZ  1 
ATOM   1643 N NH1 . ARG B 2 80  ? -74.631  8.692   -59.238  1.00 101.78 ? 80  ARG B NH1 1 
ATOM   1644 N NH2 . ARG B 2 80  ? -73.309  9.956   -57.845  1.00 102.34 ? 80  ARG B NH2 1 
ATOM   1645 N N   . GLU B 2 81  ? -74.250  1.841   -60.175  1.00 93.99  ? 81  GLU B N   1 
ATOM   1646 C CA  . GLU B 2 81  ? -74.830  0.681   -60.844  1.00 94.98  ? 81  GLU B CA  1 
ATOM   1647 C C   . GLU B 2 81  ? -76.334  0.507   -60.575  1.00 95.66  ? 81  GLU B C   1 
ATOM   1648 O O   . GLU B 2 81  ? -76.828  0.849   -59.498  1.00 95.78  ? 81  GLU B O   1 
ATOM   1649 C CB  . GLU B 2 81  ? -74.033  -0.563  -60.472  1.00 94.88  ? 81  GLU B CB  1 
ATOM   1650 C CG  . GLU B 2 81  ? -74.041  -1.632  -61.529  1.00 95.42  ? 81  GLU B CG  1 
ATOM   1651 C CD  . GLU B 2 81  ? -74.960  -2.780  -61.170  1.00 97.26  ? 81  GLU B CD  1 
ATOM   1652 O OE1 . GLU B 2 81  ? -75.685  -2.683  -60.144  1.00 96.99  ? 81  GLU B OE1 1 
ATOM   1653 O OE2 . GLU B 2 81  ? -74.951  -3.786  -61.916  1.00 98.36  ? 81  GLU B OE2 1 
ATOM   1654 N N   . SER B 2 82  ? -77.046  -0.014  -61.578  1.00 96.42  ? 82  SER B N   1 
ATOM   1655 C CA  . SER B 2 82  ? -78.509  -0.186  -61.564  1.00 97.06  ? 82  SER B CA  1 
ATOM   1656 C C   . SER B 2 82  ? -79.115  -0.303  -60.169  1.00 97.64  ? 82  SER B C   1 
ATOM   1657 O O   . SER B 2 82  ? -79.044  -1.360  -59.534  1.00 97.95  ? 82  SER B O   1 
ATOM   1658 C CB  . SER B 2 82  ? -78.909  -1.405  -62.404  1.00 96.97  ? 82  SER B CB  1 
ATOM   1659 O OG  . SER B 2 82  ? -78.435  -1.288  -63.735  1.00 97.18  ? 82  SER B OG  1 
ATOM   1660 N N   . GLY B 2 83  ? -79.704  0.789   -59.697  1.00 98.21  ? 83  GLY B N   1 
ATOM   1661 C CA  . GLY B 2 83  ? -80.334  0.811   -58.380  1.00 99.08  ? 83  GLY B CA  1 
ATOM   1662 C C   . GLY B 2 83  ? -79.382  1.131   -57.236  1.00 99.72  ? 83  GLY B C   1 
ATOM   1663 O O   . GLY B 2 83  ? -79.587  0.691   -56.101  1.00 99.88  ? 83  GLY B O   1 
ATOM   1664 N N   . VAL B 2 84  ? -78.327  1.882   -57.531  1.00 100.13 ? 84  VAL B N   1 
ATOM   1665 C CA  . VAL B 2 84  ? -77.511  2.464   -56.484  1.00 100.44 ? 84  VAL B CA  1 
ATOM   1666 C C   . VAL B 2 84  ? -78.083  3.842   -56.209  1.00 100.62 ? 84  VAL B C   1 
ATOM   1667 O O   . VAL B 2 84  ? -78.158  4.673   -57.114  1.00 100.69 ? 84  VAL B O   1 
ATOM   1668 C CB  . VAL B 2 84  ? -76.027  2.581   -56.889  1.00 100.46 ? 84  VAL B CB  1 
ATOM   1669 C CG1 . VAL B 2 84  ? -75.262  3.486   -55.912  1.00 100.83 ? 84  VAL B CG1 1 
ATOM   1670 C CG2 . VAL B 2 84  ? -75.393  1.215   -56.930  1.00 100.65 ? 84  VAL B CG2 1 
ATOM   1671 N N   . PRO B 2 85  ? -78.509  4.083   -54.964  1.00 100.90 ? 85  PRO B N   1 
ATOM   1672 C CA  . PRO B 2 85  ? -78.929  5.427   -54.558  1.00 101.09 ? 85  PRO B CA  1 
ATOM   1673 C C   . PRO B 2 85  ? -77.782  6.444   -54.637  1.00 101.09 ? 85  PRO B C   1 
ATOM   1674 O O   . PRO B 2 85  ? -76.667  6.181   -54.158  1.00 101.06 ? 85  PRO B O   1 
ATOM   1675 C CB  . PRO B 2 85  ? -79.394  5.237   -53.109  1.00 101.26 ? 85  PRO B CB  1 
ATOM   1676 C CG  . PRO B 2 85  ? -79.684  3.765   -52.983  1.00 101.61 ? 85  PRO B CG  1 
ATOM   1677 C CD  . PRO B 2 85  ? -78.691  3.091   -53.890  1.00 100.99 ? 85  PRO B CD  1 
ATOM   1678 N N   . ASP B 2 86  ? -78.081  7.592   -55.250  1.00 101.16 ? 86  ASP B N   1 
ATOM   1679 C CA  . ASP B 2 86  ? -77.120  8.682   -55.525  1.00 100.98 ? 86  ASP B CA  1 
ATOM   1680 C C   . ASP B 2 86  ? -76.120  8.888   -54.391  1.00 100.45 ? 86  ASP B C   1 
ATOM   1681 O O   . ASP B 2 86  ? -74.997  9.344   -54.621  1.00 100.07 ? 86  ASP B O   1 
ATOM   1682 C CB  . ASP B 2 86  ? -77.864  10.005  -55.800  1.00 101.13 ? 86  ASP B CB  1 
ATOM   1683 C CG  . ASP B 2 86  ? -79.104  9.826   -56.697  1.00 102.49 ? 86  ASP B CG  1 
ATOM   1684 O OD1 . ASP B 2 86  ? -79.236  10.601  -57.677  1.00 103.87 ? 86  ASP B OD1 1 
ATOM   1685 O OD2 . ASP B 2 86  ? -79.950  8.928   -56.427  1.00 102.96 ? 86  ASP B OD2 1 
ATOM   1686 N N   . ARG B 2 87  ? -76.552  8.523   -53.179  1.00 99.98  ? 87  ARG B N   1 
ATOM   1687 C CA  . ARG B 2 87  ? -75.836  8.787   -51.931  1.00 99.60  ? 87  ARG B CA  1 
ATOM   1688 C C   . ARG B 2 87  ? -74.445  8.160   -51.855  1.00 99.26  ? 87  ARG B C   1 
ATOM   1689 O O   . ARG B 2 87  ? -73.512  8.755   -51.293  1.00 99.70  ? 87  ARG B O   1 
ATOM   1690 C CB  . ARG B 2 87  ? -76.681  8.360   -50.733  1.00 99.55  ? 87  ARG B CB  1 
ATOM   1691 C CG  . ARG B 2 87  ? -77.176  6.941   -50.798  1.00 100.10 ? 87  ARG B CG  1 
ATOM   1692 C CD  . ARG B 2 87  ? -78.486  6.782   -50.033  1.00 101.55 ? 87  ARG B CD  1 
ATOM   1693 N NE  . ARG B 2 87  ? -78.733  5.381   -49.718  1.00 101.10 ? 87  ARG B NE  1 
ATOM   1694 C CZ  . ARG B 2 87  ? -78.162  4.741   -48.703  1.00 101.60 ? 87  ARG B CZ  1 
ATOM   1695 N NH1 . ARG B 2 87  ? -77.321  5.372   -47.890  1.00 101.49 ? 87  ARG B NH1 1 
ATOM   1696 N NH2 . ARG B 2 87  ? -78.428  3.461   -48.500  1.00 102.44 ? 87  ARG B NH2 1 
ATOM   1697 N N   . PHE B 2 88  ? -74.300  6.958   -52.406  1.00 98.28  ? 88  PHE B N   1 
ATOM   1698 C CA  . PHE B 2 88  ? -72.974  6.376   -52.556  1.00 96.89  ? 88  PHE B CA  1 
ATOM   1699 C C   . PHE B 2 88  ? -72.375  7.120   -53.719  1.00 96.38  ? 88  PHE B C   1 
ATOM   1700 O O   . PHE B 2 88  ? -73.004  7.200   -54.779  1.00 96.55  ? 88  PHE B O   1 
ATOM   1701 C CB  . PHE B 2 88  ? -73.057  4.876   -52.855  1.00 96.57  ? 88  PHE B CB  1 
ATOM   1702 C CG  . PHE B 2 88  ? -73.933  4.127   -51.904  1.00 95.02  ? 88  PHE B CG  1 
ATOM   1703 C CD1 . PHE B 2 88  ? -75.228  3.789   -52.259  1.00 94.24  ? 88  PHE B CD1 1 
ATOM   1704 C CD2 . PHE B 2 88  ? -73.473  3.790   -50.641  1.00 93.43  ? 88  PHE B CD2 1 
ATOM   1705 C CE1 . PHE B 2 88  ? -76.040  3.116   -51.377  1.00 94.10  ? 88  PHE B CE1 1 
ATOM   1706 C CE2 . PHE B 2 88  ? -74.273  3.116   -49.751  1.00 92.90  ? 88  PHE B CE2 1 
ATOM   1707 C CZ  . PHE B 2 88  ? -75.557  2.778   -50.114  1.00 93.91  ? 88  PHE B CZ  1 
ATOM   1708 N N   . THR B 2 89  ? -71.198  7.707   -53.517  1.00 95.46  ? 89  THR B N   1 
ATOM   1709 C CA  . THR B 2 89  ? -70.497  8.384   -54.614  1.00 94.82  ? 89  THR B CA  1 
ATOM   1710 C C   . THR B 2 89  ? -69.062  7.905   -54.717  1.00 93.89  ? 89  THR B C   1 
ATOM   1711 O O   . THR B 2 89  ? -68.413  7.612   -53.704  1.00 94.01  ? 89  THR B O   1 
ATOM   1712 C CB  . THR B 2 89  ? -70.499  9.924   -54.474  1.00 95.11  ? 89  THR B CB  1 
ATOM   1713 O OG1 . THR B 2 89  ? -71.399  10.325  -53.426  1.00 96.03  ? 89  THR B OG1 1 
ATOM   1714 C CG2 . THR B 2 89  ? -70.893  10.585  -55.810  1.00 94.82  ? 89  THR B CG2 1 
ATOM   1715 N N   . GLY B 2 90  ? -68.571  7.817   -55.947  1.00 92.75  ? 90  GLY B N   1 
ATOM   1716 C CA  . GLY B 2 90  ? -67.207  7.363   -56.184  1.00 91.21  ? 90  GLY B CA  1 
ATOM   1717 C C   . GLY B 2 90  ? -66.388  8.478   -56.770  1.00 89.99  ? 90  GLY B C   1 
ATOM   1718 O O   . GLY B 2 90  ? -66.647  8.918   -57.886  1.00 90.03  ? 90  GLY B O   1 
ATOM   1719 N N   . SER B 2 91  ? -65.434  8.970   -55.997  1.00 88.65  ? 91  SER B N   1 
ATOM   1720 C CA  . SER B 2 91  ? -64.471  9.912   -56.513  1.00 87.67  ? 91  SER B CA  1 
ATOM   1721 C C   . SER B 2 91  ? -63.177  9.147   -56.582  1.00 87.20  ? 91  SER B C   1 
ATOM   1722 O O   . SER B 2 91  ? -63.142  7.967   -56.221  1.00 87.54  ? 91  SER B O   1 
ATOM   1723 C CB  . SER B 2 91  ? -64.333  11.107  -55.579  1.00 87.69  ? 91  SER B CB  1 
ATOM   1724 O OG  . SER B 2 91  ? -63.907  10.708  -54.284  1.00 88.07  ? 91  SER B OG  1 
ATOM   1725 N N   . GLY B 2 92  ? -62.117  9.803   -57.037  1.00 86.39  ? 92  GLY B N   1 
ATOM   1726 C CA  . GLY B 2 92  ? -60.794  9.200   -57.039  1.00 85.52  ? 92  GLY B CA  1 
ATOM   1727 C C   . GLY B 2 92  ? -60.262  9.105   -58.444  1.00 85.13  ? 92  GLY B C   1 
ATOM   1728 O O   . GLY B 2 92  ? -61.016  9.200   -59.403  1.00 85.00  ? 92  GLY B O   1 
ATOM   1729 N N   . SER B 2 93  ? -58.958  8.903   -58.565  1.00 85.01  ? 93  SER B N   1 
ATOM   1730 C CA  . SER B 2 93  ? -58.300  8.932   -59.856  1.00 85.21  ? 93  SER B CA  1 
ATOM   1731 C C   . SER B 2 93  ? -56.802  8.779   -59.702  1.00 84.92  ? 93  SER B C   1 
ATOM   1732 O O   . SER B 2 93  ? -56.183  9.430   -58.869  1.00 85.09  ? 93  SER B O   1 
ATOM   1733 C CB  . SER B 2 93  ? -58.595  10.252  -60.569  1.00 85.61  ? 93  SER B CB  1 
ATOM   1734 O OG  . SER B 2 93  ? -58.266  10.170  -61.946  1.00 87.00  ? 93  SER B OG  1 
ATOM   1735 N N   . GLY B 2 94  ? -56.213  7.937   -60.536  1.00 84.76  ? 94  GLY B N   1 
ATOM   1736 C CA  . GLY B 2 94  ? -54.824  7.562   -60.365  1.00 84.76  ? 94  GLY B CA  1 
ATOM   1737 C C   . GLY B 2 94  ? -54.743  6.452   -59.336  1.00 84.72  ? 94  GLY B C   1 
ATOM   1738 O O   . GLY B 2 94  ? -55.291  5.364   -59.551  1.00 84.86  ? 94  GLY B O   1 
ATOM   1739 N N   . THR B 2 95  ? -54.074  6.724   -58.217  1.00 84.41  ? 95  THR B N   1 
ATOM   1740 C CA  . THR B 2 95  ? -53.869  5.710   -57.187  1.00 84.11  ? 95  THR B CA  1 
ATOM   1741 C C   . THR B 2 95  ? -54.762  5.962   -55.966  1.00 84.30  ? 95  THR B C   1 
ATOM   1742 O O   . THR B 2 95  ? -54.553  5.368   -54.923  1.00 84.33  ? 95  THR B O   1 
ATOM   1743 C CB  . THR B 2 95  ? -52.366  5.624   -56.757  1.00 83.88  ? 95  THR B CB  1 
ATOM   1744 O OG1 . THR B 2 95  ? -51.953  6.863   -56.191  1.00 84.22  ? 95  THR B OG1 1 
ATOM   1745 C CG2 . THR B 2 95  ? -51.457  5.337   -57.931  1.00 83.00  ? 95  THR B CG2 1 
ATOM   1746 N N   . ASP B 2 96  ? -55.777  6.813   -56.110  1.00 84.73  ? 96  ASP B N   1 
ATOM   1747 C CA  . ASP B 2 96  ? -56.411  7.464   -54.950  1.00 85.13  ? 96  ASP B CA  1 
ATOM   1748 C C   . ASP B 2 96  ? -57.912  7.562   -54.964  1.00 85.10  ? 96  ASP B C   1 
ATOM   1749 O O   . ASP B 2 96  ? -58.479  8.596   -55.325  1.00 85.12  ? 96  ASP B O   1 
ATOM   1750 C CB  . ASP B 2 96  ? -55.884  8.886   -54.802  1.00 85.39  ? 96  ASP B CB  1 
ATOM   1751 C CG  . ASP B 2 96  ? -54.969  9.032   -53.635  1.00 86.60  ? 96  ASP B CG  1 
ATOM   1752 O OD1 . ASP B 2 96  ? -54.065  8.178   -53.500  1.00 85.68  ? 96  ASP B OD1 1 
ATOM   1753 O OD2 . ASP B 2 96  ? -55.159  10.000  -52.858  1.00 89.20  ? 96  ASP B OD2 1 
ATOM   1754 N N   . PHE B 2 97  ? -58.569  6.516   -54.508  1.00 85.23  ? 97  PHE B N   1 
ATOM   1755 C CA  . PHE B 2 97  ? -60.012  6.501   -54.600  1.00 85.54  ? 97  PHE B CA  1 
ATOM   1756 C C   . PHE B 2 97  ? -60.674  6.644   -53.246  1.00 86.26  ? 97  PHE B C   1 
ATOM   1757 O O   . PHE B 2 97  ? -60.086  6.309   -52.205  1.00 86.20  ? 97  PHE B O   1 
ATOM   1758 C CB  . PHE B 2 97  ? -60.464  5.263   -55.368  1.00 85.13  ? 97  PHE B CB  1 
ATOM   1759 C CG  . PHE B 2 97  ? -59.773  5.124   -56.677  1.00 83.58  ? 97  PHE B CG  1 
ATOM   1760 C CD1 . PHE B 2 97  ? -58.427  4.787   -56.728  1.00 82.64  ? 97  PHE B CD1 1 
ATOM   1761 C CD2 . PHE B 2 97  ? -60.437  5.388   -57.852  1.00 82.00  ? 97  PHE B CD2 1 
ATOM   1762 C CE1 . PHE B 2 97  ? -57.771  4.682   -57.926  1.00 82.17  ? 97  PHE B CE1 1 
ATOM   1763 C CE2 . PHE B 2 97  ? -59.784  5.284   -59.056  1.00 81.74  ? 97  PHE B CE2 1 
ATOM   1764 C CZ  . PHE B 2 97  ? -58.447  4.924   -59.093  1.00 81.74  ? 97  PHE B CZ  1 
ATOM   1765 N N   . THR B 2 98  ? -61.892  7.181   -53.279  1.00 87.10  ? 98  THR B N   1 
ATOM   1766 C CA  . THR B 2 98  ? -62.665  7.471   -52.078  1.00 87.75  ? 98  THR B CA  1 
ATOM   1767 C C   . THR B 2 98  ? -64.151  7.164   -52.314  1.00 87.97  ? 98  THR B C   1 
ATOM   1768 O O   . THR B 2 98  ? -64.737  7.560   -53.333  1.00 87.71  ? 98  THR B O   1 
ATOM   1769 C CB  . THR B 2 98  ? -62.465  8.951   -51.633  1.00 87.87  ? 98  THR B CB  1 
ATOM   1770 O OG1 . THR B 2 98  ? -61.124  9.152   -51.147  1.00 87.42  ? 98  THR B OG1 1 
ATOM   1771 C CG2 . THR B 2 98  ? -63.448  9.309   -50.541  1.00 88.67  ? 98  THR B CG2 1 
ATOM   1772 N N   . LEU B 2 99  ? -64.746  6.431   -51.382  1.00 88.58  ? 99  LEU B N   1 
ATOM   1773 C CA  . LEU B 2 99  ? -66.178  6.161   -51.450  1.00 89.43  ? 99  LEU B CA  1 
ATOM   1774 C C   . LEU B 2 99  ? -66.868  6.973   -50.398  1.00 89.98  ? 99  LEU B C   1 
ATOM   1775 O O   . LEU B 2 99  ? -66.387  7.051   -49.267  1.00 90.16  ? 99  LEU B O   1 
ATOM   1776 C CB  . LEU B 2 99  ? -66.498  4.687   -51.217  1.00 89.48  ? 99  LEU B CB  1 
ATOM   1777 C CG  . LEU B 2 99  ? -67.995  4.360   -51.173  1.00 89.06  ? 99  LEU B CG  1 
ATOM   1778 C CD1 . LEU B 2 99  ? -68.607  4.308   -52.566  1.00 88.49  ? 99  LEU B CD1 1 
ATOM   1779 C CD2 . LEU B 2 99  ? -68.202  3.051   -50.469  1.00 89.62  ? 99  LEU B CD2 1 
ATOM   1780 N N   . THR B 2 100 ? -68.007  7.547   -50.774  1.00 90.53  ? 100 THR B N   1 
ATOM   1781 C CA  . THR B 2 100 ? -68.725  8.503   -49.933  1.00 91.08  ? 100 THR B CA  1 
ATOM   1782 C C   . THR B 2 100 ? -70.247  8.233   -49.878  1.00 91.74  ? 100 THR B C   1 
ATOM   1783 O O   . THR B 2 100 ? -70.943  8.252   -50.904  1.00 91.73  ? 100 THR B O   1 
ATOM   1784 C CB  . THR B 2 100 ? -68.343  9.994   -50.296  1.00 90.88  ? 100 THR B CB  1 
ATOM   1785 O OG1 . THR B 2 100 ? -69.436  10.874  -50.025  1.00 90.65  ? 100 THR B OG1 1 
ATOM   1786 C CG2 . THR B 2 100 ? -67.928  10.148  -51.750  1.00 90.53  ? 100 THR B CG2 1 
ATOM   1787 N N   . ILE B 2 101 ? -70.742  7.952   -48.675  1.00 92.42  ? 101 ILE B N   1 
ATOM   1788 C CA  . ILE B 2 101 ? -72.137  7.578   -48.483  1.00 93.31  ? 101 ILE B CA  1 
ATOM   1789 C C   . ILE B 2 101 ? -72.810  8.619   -47.634  1.00 93.78  ? 101 ILE B C   1 
ATOM   1790 O O   . ILE B 2 101 ? -72.585  8.667   -46.420  1.00 93.76  ? 101 ILE B O   1 
ATOM   1791 C CB  . ILE B 2 101 ? -72.286  6.237   -47.725  1.00 93.55  ? 101 ILE B CB  1 
ATOM   1792 C CG1 . ILE B 2 101 ? -71.502  5.108   -48.405  1.00 93.78  ? 101 ILE B CG1 1 
ATOM   1793 C CG2 . ILE B 2 101 ? -73.768  5.869   -47.567  1.00 94.25  ? 101 ILE B CG2 1 
ATOM   1794 C CD1 . ILE B 2 101 ? -71.432  3.819   -47.591  1.00 93.44  ? 101 ILE B CD1 1 
ATOM   1795 N N   . SER B 2 102 ? -73.645  9.443   -48.262  1.00 94.58  ? 102 SER B N   1 
ATOM   1796 C CA  . SER B 2 102 ? -74.439  10.438  -47.527  1.00 95.43  ? 102 SER B CA  1 
ATOM   1797 C C   . SER B 2 102 ? -75.779  9.851   -47.083  1.00 96.01  ? 102 SER B C   1 
ATOM   1798 O O   . SER B 2 102 ? -76.349  8.982   -47.767  1.00 96.22  ? 102 SER B O   1 
ATOM   1799 C CB  . SER B 2 102 ? -74.659  11.711  -48.356  1.00 95.18  ? 102 SER B CB  1 
ATOM   1800 O OG  . SER B 2 102 ? -75.492  11.464  -49.476  1.00 95.38  ? 102 SER B OG  1 
ATOM   1801 N N   . SER B 2 103 ? -76.265  10.327  -45.933  1.00 96.57  ? 103 SER B N   1 
ATOM   1802 C CA  . SER B 2 103 ? -77.573  9.936   -45.386  1.00 97.03  ? 103 SER B CA  1 
ATOM   1803 C C   . SER B 2 103 ? -77.626  8.446   -45.056  1.00 97.03  ? 103 SER B C   1 
ATOM   1804 O O   . SER B 2 103 ? -78.519  7.725   -45.524  1.00 97.25  ? 103 SER B O   1 
ATOM   1805 C CB  . SER B 2 103 ? -78.711  10.330  -46.347  1.00 97.16  ? 103 SER B CB  1 
ATOM   1806 O OG  . SER B 2 103 ? -78.650  11.714  -46.656  1.00 97.60  ? 103 SER B OG  1 
ATOM   1807 N N   . VAL B 2 104 ? -76.662  8.006   -44.248  1.00 96.96  ? 104 VAL B N   1 
ATOM   1808 C CA  . VAL B 2 104 ? -76.504  6.602   -43.872  1.00 97.18  ? 104 VAL B CA  1 
ATOM   1809 C C   . VAL B 2 104 ? -77.767  5.978   -43.285  1.00 97.51  ? 104 VAL B C   1 
ATOM   1810 O O   . VAL B 2 104 ? -78.083  6.170   -42.103  1.00 97.60  ? 104 VAL B O   1 
ATOM   1811 C CB  . VAL B 2 104 ? -75.392  6.420   -42.830  1.00 97.12  ? 104 VAL B CB  1 
ATOM   1812 C CG1 . VAL B 2 104 ? -75.095  4.919   -42.613  1.00 96.71  ? 104 VAL B CG1 1 
ATOM   1813 C CG2 . VAL B 2 104 ? -74.149  7.190   -43.242  1.00 97.48  ? 104 VAL B CG2 1 
ATOM   1814 N N   . GLN B 2 105 ? -78.484  5.216   -44.104  1.00 97.61  ? 105 GLN B N   1 
ATOM   1815 C CA  . GLN B 2 105 ? -79.573  4.439   -43.571  1.00 97.75  ? 105 GLN B CA  1 
ATOM   1816 C C   . GLN B 2 105 ? -79.064  3.283   -42.729  1.00 97.39  ? 105 GLN B C   1 
ATOM   1817 O O   . GLN B 2 105 ? -77.860  3.029   -42.655  1.00 97.16  ? 105 GLN B O   1 
ATOM   1818 C CB  . GLN B 2 105 ? -80.555  3.998   -44.652  1.00 98.02  ? 105 GLN B CB  1 
ATOM   1819 C CG  . GLN B 2 105 ? -81.825  4.867   -44.664  1.00 100.56 ? 105 GLN B CG  1 
ATOM   1820 C CD  . GLN B 2 105 ? -82.409  5.153   -43.240  1.00 103.14 ? 105 GLN B CD  1 
ATOM   1821 O OE1 . GLN B 2 105 ? -82.718  6.308   -42.901  1.00 103.10 ? 105 GLN B OE1 1 
ATOM   1822 N NE2 . GLN B 2 105 ? -82.561  4.096   -42.421  1.00 103.23 ? 105 GLN B NE2 1 
ATOM   1823 N N   . ALA B 2 106 ? -79.996  2.621   -42.056  1.00 97.29  ? 106 ALA B N   1 
ATOM   1824 C CA  . ALA B 2 106 ? -79.675  1.563   -41.109  1.00 96.97  ? 106 ALA B CA  1 
ATOM   1825 C C   . ALA B 2 106 ? -79.205  0.320   -41.857  1.00 96.57  ? 106 ALA B C   1 
ATOM   1826 O O   . ALA B 2 106 ? -78.332  -0.419  -41.377  1.00 96.36  ? 106 ALA B O   1 
ATOM   1827 C CB  . ALA B 2 106 ? -80.897  1.250   -40.242  1.00 97.13  ? 106 ALA B CB  1 
ATOM   1828 N N   . GLU B 2 107 ? -79.794  0.123   -43.040  1.00 95.89  ? 107 GLU B N   1 
ATOM   1829 C CA  . GLU B 2 107 ? -79.477  -0.981  -43.936  1.00 95.40  ? 107 GLU B CA  1 
ATOM   1830 C C   . GLU B 2 107 ? -78.279  -0.588  -44.791  1.00 94.09  ? 107 GLU B C   1 
ATOM   1831 O O   . GLU B 2 107 ? -78.306  -0.685  -46.021  1.00 94.23  ? 107 GLU B O   1 
ATOM   1832 C CB  . GLU B 2 107 ? -80.694  -1.336  -44.810  1.00 96.02  ? 107 GLU B CB  1 
ATOM   1833 C CG  . GLU B 2 107 ? -81.835  -2.096  -44.078  1.00 99.20  ? 107 GLU B CG  1 
ATOM   1834 C CD  . GLU B 2 107 ? -82.623  -1.238  -43.043  1.00 103.22 ? 107 GLU B CD  1 
ATOM   1835 O OE1 . GLU B 2 107 ? -82.522  0.024   -43.088  1.00 104.82 ? 107 GLU B OE1 1 
ATOM   1836 O OE2 . GLU B 2 107 ? -83.347  -1.832  -42.189  1.00 103.03 ? 107 GLU B OE2 1 
ATOM   1837 N N   . ASP B 2 108 ? -77.235  -0.120  -44.113  1.00 92.43  ? 108 ASP B N   1 
ATOM   1838 C CA  . ASP B 2 108 ? -75.967  0.213   -44.733  1.00 90.64  ? 108 ASP B CA  1 
ATOM   1839 C C   . ASP B 2 108 ? -74.864  -0.333  -43.854  1.00 89.19  ? 108 ASP B C   1 
ATOM   1840 O O   . ASP B 2 108 ? -73.718  0.084   -43.939  1.00 89.08  ? 108 ASP B O   1 
ATOM   1841 C CB  . ASP B 2 108 ? -75.828  1.728   -44.904  1.00 90.94  ? 108 ASP B CB  1 
ATOM   1842 C CG  . ASP B 2 108 ? -76.727  2.286   -46.007  1.00 91.41  ? 108 ASP B CG  1 
ATOM   1843 O OD1 . ASP B 2 108 ? -76.797  1.690   -47.108  1.00 91.37  ? 108 ASP B OD1 1 
ATOM   1844 O OD2 . ASP B 2 108 ? -77.361  3.338   -45.777  1.00 92.37  ? 108 ASP B OD2 1 
ATOM   1845 N N   . LEU B 2 109 ? -75.220  -1.277  -42.995  1.00 87.69  ? 109 LEU B N   1 
ATOM   1846 C CA  . LEU B 2 109 ? -74.217  -1.976  -42.212  1.00 86.32  ? 109 LEU B CA  1 
ATOM   1847 C C   . LEU B 2 109 ? -73.475  -2.942  -43.126  1.00 84.95  ? 109 LEU B C   1 
ATOM   1848 O O   . LEU B 2 109 ? -74.072  -3.893  -43.656  1.00 85.26  ? 109 LEU B O   1 
ATOM   1849 C CB  . LEU B 2 109 ? -74.847  -2.724  -41.036  1.00 86.34  ? 109 LEU B CB  1 
ATOM   1850 C CG  . LEU B 2 109 ? -74.036  -2.369  -39.786  1.00 87.01  ? 109 LEU B CG  1 
ATOM   1851 C CD1 . LEU B 2 109 ? -74.872  -2.579  -38.541  1.00 88.15  ? 109 LEU B CD1 1 
ATOM   1852 C CD2 . LEU B 2 109 ? -72.664  -3.077  -39.692  1.00 86.78  ? 109 LEU B CD2 1 
ATOM   1853 N N   . ALA B 2 110 ? -72.186  -2.700  -43.329  1.00 82.69  ? 110 ALA B N   1 
ATOM   1854 C CA  . ALA B 2 110 ? -71.458  -3.493  -44.299  1.00 80.74  ? 110 ALA B CA  1 
ATOM   1855 C C   . ALA B 2 110 ? -69.957  -3.325  -44.217  1.00 79.46  ? 110 ALA B C   1 
ATOM   1856 O O   . ALA B 2 110 ? -69.451  -2.399  -43.585  1.00 79.83  ? 110 ALA B O   1 
ATOM   1857 C CB  . ALA B 2 110 ? -71.934  -3.139  -45.703  1.00 80.85  ? 110 ALA B CB  1 
ATOM   1858 N N   . VAL B 2 111 ? -69.241  -4.232  -44.863  1.00 77.44  ? 111 VAL B N   1 
ATOM   1859 C CA  . VAL B 2 111 ? -67.875  -3.950  -45.228  1.00 75.59  ? 111 VAL B CA  1 
ATOM   1860 C C   . VAL B 2 111 ? -67.859  -3.581  -46.720  1.00 74.56  ? 111 VAL B C   1 
ATOM   1861 O O   . VAL B 2 111 ? -68.573  -4.174  -47.536  1.00 74.01  ? 111 VAL B O   1 
ATOM   1862 C CB  . VAL B 2 111 ? -66.917  -5.077  -44.813  1.00 75.58  ? 111 VAL B CB  1 
ATOM   1863 C CG1 . VAL B 2 111 ? -65.488  -4.796  -45.260  1.00 75.13  ? 111 VAL B CG1 1 
ATOM   1864 C CG2 . VAL B 2 111 ? -66.941  -5.193  -43.319  1.00 75.27  ? 111 VAL B CG2 1 
ATOM   1865 N N   . TYR B 2 112 ? -67.076  -2.547  -47.030  1.00 73.42  ? 112 TYR B N   1 
ATOM   1866 C CA  . TYR B 2 112 ? -66.981  -1.953  -48.357  1.00 72.06  ? 112 TYR B CA  1 
ATOM   1867 C C   . TYR B 2 112 ? -65.601  -2.246  -48.928  1.00 71.70  ? 112 TYR B C   1 
ATOM   1868 O O   . TYR B 2 112 ? -64.574  -1.901  -48.347  1.00 71.44  ? 112 TYR B O   1 
ATOM   1869 C CB  . TYR B 2 112 ? -67.283  -0.450  -48.267  1.00 71.83  ? 112 TYR B CB  1 
ATOM   1870 C CG  . TYR B 2 112 ? -68.736  -0.190  -47.902  1.00 70.15  ? 112 TYR B CG  1 
ATOM   1871 C CD1 . TYR B 2 112 ? -69.710  -0.138  -48.894  1.00 68.33  ? 112 TYR B CD1 1 
ATOM   1872 C CD2 . TYR B 2 112 ? -69.141  -0.040  -46.569  1.00 68.29  ? 112 TYR B CD2 1 
ATOM   1873 C CE1 . TYR B 2 112 ? -71.037  0.070   -48.590  1.00 67.54  ? 112 TYR B CE1 1 
ATOM   1874 C CE2 . TYR B 2 112 ? -70.487  0.167   -46.249  1.00 67.10  ? 112 TYR B CE2 1 
ATOM   1875 C CZ  . TYR B 2 112 ? -71.430  0.219   -47.277  1.00 67.17  ? 112 TYR B CZ  1 
ATOM   1876 O OH  . TYR B 2 112 ? -72.773  0.421   -47.033  1.00 65.82  ? 112 TYR B OH  1 
ATOM   1877 N N   . TYR B 2 113 ? -65.591  -2.948  -50.048  1.00 71.35  ? 113 TYR B N   1 
ATOM   1878 C CA  . TYR B 2 113 ? -64.364  -3.491  -50.602  1.00 71.22  ? 113 TYR B CA  1 
ATOM   1879 C C   . TYR B 2 113 ? -64.099  -2.765  -51.897  1.00 71.23  ? 113 TYR B C   1 
ATOM   1880 O O   . TYR B 2 113 ? -65.033  -2.527  -52.680  1.00 71.50  ? 113 TYR B O   1 
ATOM   1881 C CB  . TYR B 2 113 ? -64.517  -4.995  -50.884  1.00 71.20  ? 113 TYR B CB  1 
ATOM   1882 C CG  . TYR B 2 113 ? -64.485  -5.854  -49.647  1.00 70.99  ? 113 TYR B CG  1 
ATOM   1883 C CD1 . TYR B 2 113 ? -65.659  -6.328  -49.073  1.00 70.98  ? 113 TYR B CD1 1 
ATOM   1884 C CD2 . TYR B 2 113 ? -63.285  -6.185  -49.055  1.00 71.46  ? 113 TYR B CD2 1 
ATOM   1885 C CE1 . TYR B 2 113 ? -65.640  -7.100  -47.938  1.00 71.12  ? 113 TYR B CE1 1 
ATOM   1886 C CE2 . TYR B 2 113 ? -63.247  -6.963  -47.937  1.00 73.23  ? 113 TYR B CE2 1 
ATOM   1887 C CZ  . TYR B 2 113 ? -64.427  -7.411  -47.371  1.00 73.54  ? 113 TYR B CZ  1 
ATOM   1888 O OH  . TYR B 2 113 ? -64.361  -8.176  -46.224  1.00 76.30  ? 113 TYR B OH  1 
ATOM   1889 N N   . CYS B 2 114 ? -62.849  -2.382  -52.129  1.00 70.65  ? 114 CYS B N   1 
ATOM   1890 C CA  . CYS B 2 114 ? -62.526  -1.845  -53.426  1.00 70.41  ? 114 CYS B CA  1 
ATOM   1891 C C   . CYS B 2 114 ? -61.796  -2.927  -54.177  1.00 69.81  ? 114 CYS B C   1 
ATOM   1892 O O   . CYS B 2 114 ? -61.110  -3.742  -53.563  1.00 69.58  ? 114 CYS B O   1 
ATOM   1893 C CB  . CYS B 2 114 ? -61.742  -0.540  -53.326  1.00 70.66  ? 114 CYS B CB  1 
ATOM   1894 S SG  . CYS B 2 114 ? -60.085  -0.631  -52.657  1.00 73.03  ? 114 CYS B SG  1 
ATOM   1895 N N   . LYS B 2 115 ? -62.002  -2.970  -55.492  1.00 69.27  ? 115 LYS B N   1 
ATOM   1896 C CA  . LYS B 2 115 ? -61.338  -3.947  -56.362  1.00 68.86  ? 115 LYS B CA  1 
ATOM   1897 C C   . LYS B 2 115 ? -60.674  -3.212  -57.501  1.00 68.58  ? 115 LYS B C   1 
ATOM   1898 O O   . LYS B 2 115 ? -61.263  -2.290  -58.094  1.00 68.64  ? 115 LYS B O   1 
ATOM   1899 C CB  . LYS B 2 115 ? -62.333  -4.895  -57.010  1.00 68.61  ? 115 LYS B CB  1 
ATOM   1900 C CG  . LYS B 2 115 ? -62.547  -4.562  -58.526  1.00 69.92  ? 115 LYS B CG  1 
ATOM   1901 C CD  . LYS B 2 115 ? -63.445  -5.520  -59.316  1.00 71.38  ? 115 LYS B CD  1 
ATOM   1902 C CE  . LYS B 2 115 ? -63.412  -6.888  -58.709  1.00 73.25  ? 115 LYS B CE  1 
ATOM   1903 N NZ  . LYS B 2 115 ? -62.228  -6.989  -57.779  1.00 75.01  ? 115 LYS B NZ  1 
ATOM   1904 N N   . GLN B 2 116 ? -59.468  -3.634  -57.845  1.00 67.96  ? 116 GLN B N   1 
ATOM   1905 C CA  . GLN B 2 116 ? -58.881  -3.147  -59.073  1.00 67.36  ? 116 GLN B CA  1 
ATOM   1906 C C   . GLN B 2 116 ? -59.128  -4.182  -60.143  1.00 67.25  ? 116 GLN B C   1 
ATOM   1907 O O   . GLN B 2 116 ? -59.098  -5.392  -59.867  1.00 67.44  ? 116 GLN B O   1 
ATOM   1908 C CB  . GLN B 2 116 ? -57.393  -2.902  -58.906  1.00 67.22  ? 116 GLN B CB  1 
ATOM   1909 C CG  . GLN B 2 116 ? -56.611  -4.128  -58.544  1.00 66.05  ? 116 GLN B CG  1 
ATOM   1910 C CD  . GLN B 2 116 ? -56.120  -4.864  -59.757  1.00 64.49  ? 116 GLN B CD  1 
ATOM   1911 O OE1 . GLN B 2 116 ? -55.667  -5.994  -59.657  1.00 64.21  ? 116 GLN B OE1 1 
ATOM   1912 N NE2 . GLN B 2 116 ? -56.205  -4.226  -60.914  1.00 63.64  ? 116 GLN B NE2 1 
ATOM   1913 N N   . SER B 2 117 ? -59.380  -3.707  -61.359  1.00 66.61  ? 117 SER B N   1 
ATOM   1914 C CA  . SER B 2 117 ? -59.498  -4.591  -62.507  1.00 65.86  ? 117 SER B CA  1 
ATOM   1915 C C   . SER B 2 117 ? -58.628  -4.096  -63.664  1.00 65.54  ? 117 SER B C   1 
ATOM   1916 O O   . SER B 2 117 ? -58.931  -4.329  -64.824  1.00 66.00  ? 117 SER B O   1 
ATOM   1917 C CB  . SER B 2 117 ? -60.964  -4.762  -62.912  1.00 65.48  ? 117 SER B CB  1 
ATOM   1918 O OG  . SER B 2 117 ? -61.457  -3.605  -63.561  1.00 65.37  ? 117 SER B OG  1 
ATOM   1919 N N   . TYR B 2 118 ? -57.535  -3.421  -63.334  1.00 65.15  ? 118 TYR B N   1 
ATOM   1920 C CA  . TYR B 2 118 ? -56.615  -2.899  -64.339  1.00 64.80  ? 118 TYR B CA  1 
ATOM   1921 C C   . TYR B 2 118 ? -55.636  -3.953  -64.742  1.00 64.67  ? 118 TYR B C   1 
ATOM   1922 O O   . TYR B 2 118 ? -55.206  -3.955  -65.876  1.00 65.82  ? 118 TYR B O   1 
ATOM   1923 C CB  . TYR B 2 118 ? -55.834  -1.691  -63.821  1.00 64.86  ? 118 TYR B CB  1 
ATOM   1924 C CG  . TYR B 2 118 ? -54.788  -1.121  -64.757  1.00 64.71  ? 118 TYR B CG  1 
ATOM   1925 C CD1 . TYR B 2 118 ? -55.078  -0.031  -65.585  1.00 64.78  ? 118 TYR B CD1 1 
ATOM   1926 C CD2 . TYR B 2 118 ? -53.498  -1.647  -64.784  1.00 66.73  ? 118 TYR B CD2 1 
ATOM   1927 C CE1 . TYR B 2 118 ? -54.114  0.510   -66.439  1.00 66.77  ? 118 TYR B CE1 1 
ATOM   1928 C CE2 . TYR B 2 118 ? -52.512  -1.118  -65.634  1.00 68.79  ? 118 TYR B CE2 1 
ATOM   1929 C CZ  . TYR B 2 118 ? -52.822  -0.038  -66.454  1.00 68.98  ? 118 TYR B CZ  1 
ATOM   1930 O OH  . TYR B 2 118 ? -51.834  0.472   -67.273  1.00 69.38  ? 118 TYR B OH  1 
ATOM   1931 N N   . ASN B 2 119 ? -55.230  -4.812  -63.821  1.00 63.95  ? 119 ASN B N   1 
ATOM   1932 C CA  . ASN B 2 119 ? -54.353  -5.904  -64.181  1.00 63.45  ? 119 ASN B CA  1 
ATOM   1933 C C   . ASN B 2 119 ? -54.582  -7.013  -63.212  1.00 62.93  ? 119 ASN B C   1 
ATOM   1934 O O   . ASN B 2 119 ? -54.067  -6.991  -62.097  1.00 63.02  ? 119 ASN B O   1 
ATOM   1935 C CB  . ASN B 2 119 ? -52.883  -5.487  -64.237  1.00 63.51  ? 119 ASN B CB  1 
ATOM   1936 C CG  . ASN B 2 119 ? -51.931  -6.682  -64.229  1.00 64.78  ? 119 ASN B CG  1 
ATOM   1937 O OD1 . ASN B 2 119 ? -52.310  -7.818  -64.531  1.00 65.23  ? 119 ASN B OD1 1 
ATOM   1938 N ND2 . ASN B 2 119 ? -50.683  -6.427  -63.860  1.00 67.15  ? 119 ASN B ND2 1 
ATOM   1939 N N   . LEU B 2 120 ? -55.356  -7.988  -63.683  1.00 62.40  ? 120 LEU B N   1 
ATOM   1940 C CA  . LEU B 2 120 ? -55.978  -9.030  -62.864  1.00 61.84  ? 120 LEU B CA  1 
ATOM   1941 C C   . LEU B 2 120 ? -56.979  -8.384  -61.882  1.00 61.68  ? 120 LEU B C   1 
ATOM   1942 O O   . LEU B 2 120 ? -57.303  -7.198  -62.015  1.00 62.02  ? 120 LEU B O   1 
ATOM   1943 C CB  . LEU B 2 120 ? -54.930  -9.939  -62.195  1.00 61.65  ? 120 LEU B CB  1 
ATOM   1944 C CG  . LEU B 2 120 ? -53.744  -10.434 -63.052  1.00 61.36  ? 120 LEU B CG  1 
ATOM   1945 C CD1 . LEU B 2 120 ? -53.255  -11.845 -62.656  1.00 60.16  ? 120 LEU B CD1 1 
ATOM   1946 C CD2 . LEU B 2 120 ? -54.055  -10.397 -64.541  1.00 61.21  ? 120 LEU B CD2 1 
ATOM   1947 N N   . TYR B 2 121 ? -57.492  -9.147  -60.928  1.00 61.00  ? 121 TYR B N   1 
ATOM   1948 C CA  . TYR B 2 121 ? -58.447  -8.621  -59.984  1.00 60.34  ? 121 TYR B CA  1 
ATOM   1949 C C   . TYR B 2 121 ? -57.836  -8.612  -58.591  1.00 60.49  ? 121 TYR B C   1 
ATOM   1950 O O   . TYR B 2 121 ? -57.588  -9.679  -58.042  1.00 60.74  ? 121 TYR B O   1 
ATOM   1951 C CB  . TYR B 2 121 ? -59.632  -9.552  -59.951  1.00 59.88  ? 121 TYR B CB  1 
ATOM   1952 C CG  . TYR B 2 121 ? -60.662  -9.340  -61.000  1.00 60.19  ? 121 TYR B CG  1 
ATOM   1953 C CD1 . TYR B 2 121 ? -60.982  -10.343 -61.916  1.00 61.04  ? 121 TYR B CD1 1 
ATOM   1954 C CD2 . TYR B 2 121 ? -61.369  -8.162  -61.055  1.00 62.34  ? 121 TYR B CD2 1 
ATOM   1955 C CE1 . TYR B 2 121 ? -61.987  -10.161 -62.901  1.00 61.44  ? 121 TYR B CE1 1 
ATOM   1956 C CE2 . TYR B 2 121 ? -62.379  -7.957  -62.023  1.00 63.98  ? 121 TYR B CE2 1 
ATOM   1957 C CZ  . TYR B 2 121 ? -62.684  -8.955  -62.949  1.00 62.34  ? 121 TYR B CZ  1 
ATOM   1958 O OH  . TYR B 2 121 ? -63.690  -8.707  -63.875  1.00 59.30  ? 121 TYR B OH  1 
ATOM   1959 N N   . THR B 2 122 ? -57.582  -7.448  -57.990  1.00 60.59  ? 122 THR B N   1 
ATOM   1960 C CA  . THR B 2 122 ? -57.296  -7.448  -56.533  1.00 60.44  ? 122 THR B CA  1 
ATOM   1961 C C   . THR B 2 122 ? -58.286  -6.621  -55.714  1.00 60.83  ? 122 THR B C   1 
ATOM   1962 O O   . THR B 2 122 ? -58.944  -5.708  -56.237  1.00 60.61  ? 122 THR B O   1 
ATOM   1963 C CB  . THR B 2 122 ? -55.824  -7.126  -56.145  1.00 60.00  ? 122 THR B CB  1 
ATOM   1964 O OG1 . THR B 2 122 ? -55.597  -5.734  -56.240  1.00 59.64  ? 122 THR B OG1 1 
ATOM   1965 C CG2 . THR B 2 122 ? -54.827  -7.837  -57.036  1.00 60.34  ? 122 THR B CG2 1 
ATOM   1966 N N   . PHE B 2 123 ? -58.394  -6.979  -54.433  1.00 61.67  ? 123 PHE B N   1 
ATOM   1967 C CA  . PHE B 2 123 ? -59.342  -6.366  -53.481  1.00 62.39  ? 123 PHE B CA  1 
ATOM   1968 C C   . PHE B 2 123 ? -58.596  -5.599  -52.374  1.00 63.10  ? 123 PHE B C   1 
ATOM   1969 O O   . PHE B 2 123 ? -57.412  -5.847  -52.090  1.00 63.24  ? 123 PHE B O   1 
ATOM   1970 C CB  . PHE B 2 123 ? -60.292  -7.421  -52.854  1.00 62.00  ? 123 PHE B CB  1 
ATOM   1971 C CG  . PHE B 2 123 ? -61.323  -8.013  -53.823  1.00 61.53  ? 123 PHE B CG  1 
ATOM   1972 C CD1 . PHE B 2 123 ? -60.978  -9.049  -54.700  1.00 60.15  ? 123 PHE B CD1 1 
ATOM   1973 C CD2 . PHE B 2 123 ? -62.645  -7.550  -53.833  1.00 61.05  ? 123 PHE B CD2 1 
ATOM   1974 C CE1 . PHE B 2 123 ? -61.923  -9.597  -55.588  1.00 59.40  ? 123 PHE B CE1 1 
ATOM   1975 C CE2 . PHE B 2 123 ? -63.607  -8.088  -54.725  1.00 60.35  ? 123 PHE B CE2 1 
ATOM   1976 C CZ  . PHE B 2 123 ? -63.244  -9.124  -55.592  1.00 60.01  ? 123 PHE B CZ  1 
ATOM   1977 N N   . GLY B 2 124 ? -59.287  -4.644  -51.768  1.00 63.79  ? 124 GLY B N   1 
ATOM   1978 C CA  . GLY B 2 124 ? -58.769  -3.992  -50.586  1.00 64.51  ? 124 GLY B CA  1 
ATOM   1979 C C   . GLY B 2 124 ? -59.037  -4.932  -49.445  1.00 65.24  ? 124 GLY B C   1 
ATOM   1980 O O   . GLY B 2 124 ? -59.595  -6.004  -49.635  1.00 64.87  ? 124 GLY B O   1 
ATOM   1981 N N   . GLY B 2 125 ? -58.640  -4.528  -48.254  1.00 66.49  ? 125 GLY B N   1 
ATOM   1982 C CA  . GLY B 2 125 ? -58.850  -5.344  -47.073  1.00 68.25  ? 125 GLY B CA  1 
ATOM   1983 C C   . GLY B 2 125 ? -60.272  -5.245  -46.558  1.00 69.26  ? 125 GLY B C   1 
ATOM   1984 O O   . GLY B 2 125 ? -60.819  -6.216  -46.033  1.00 69.42  ? 125 GLY B O   1 
ATOM   1985 N N   . GLY B 2 126 ? -60.872  -4.074  -46.706  1.00 70.11  ? 126 GLY B N   1 
ATOM   1986 C CA  . GLY B 2 126 ? -62.236  -3.878  -46.271  1.00 72.09  ? 126 GLY B CA  1 
ATOM   1987 C C   . GLY B 2 126 ? -62.287  -2.774  -45.249  1.00 73.51  ? 126 GLY B C   1 
ATOM   1988 O O   . GLY B 2 126 ? -61.289  -2.484  -44.604  1.00 73.53  ? 126 GLY B O   1 
ATOM   1989 N N   . THR B 2 127 ? -63.456  -2.153  -45.129  1.00 75.03  ? 127 THR B N   1 
ATOM   1990 C CA  . THR B 2 127 ? -63.718  -1.068  -44.196  1.00 76.40  ? 127 THR B CA  1 
ATOM   1991 C C   . THR B 2 127 ? -65.087  -1.400  -43.641  1.00 77.84  ? 127 THR B C   1 
ATOM   1992 O O   . THR B 2 127 ? -66.071  -1.412  -44.391  1.00 78.11  ? 127 THR B O   1 
ATOM   1993 C CB  . THR B 2 127 ? -63.773  0.306   -44.924  1.00 76.34  ? 127 THR B CB  1 
ATOM   1994 O OG1 . THR B 2 127 ? -62.449  0.815   -45.119  1.00 76.10  ? 127 THR B OG1 1 
ATOM   1995 C CG2 . THR B 2 127 ? -64.572  1.324   -44.138  1.00 76.03  ? 127 THR B CG2 1 
ATOM   1996 N N   . LYS B 2 128 ? -65.152  -1.678  -42.341  1.00 79.35  ? 128 LYS B N   1 
ATOM   1997 C CA  . LYS B 2 128 ? -66.415  -1.997  -41.680  1.00 80.99  ? 128 LYS B CA  1 
ATOM   1998 C C   . LYS B 2 128 ? -67.162  -0.732  -41.249  1.00 81.69  ? 128 LYS B C   1 
ATOM   1999 O O   . LYS B 2 128 ? -66.711  -0.031  -40.358  1.00 81.73  ? 128 LYS B O   1 
ATOM   2000 C CB  . LYS B 2 128 ? -66.151  -2.883  -40.462  1.00 81.20  ? 128 LYS B CB  1 
ATOM   2001 C CG  . LYS B 2 128 ? -67.408  -3.531  -39.849  1.00 82.62  ? 128 LYS B CG  1 
ATOM   2002 C CD  . LYS B 2 128 ? -67.114  -4.242  -38.508  1.00 84.34  ? 128 LYS B CD  1 
ATOM   2003 C CE  . LYS B 2 128 ? -65.867  -5.148  -38.540  1.00 85.72  ? 128 LYS B CE  1 
ATOM   2004 N NZ  . LYS B 2 128 ? -65.888  -6.197  -39.624  1.00 86.54  ? 128 LYS B NZ  1 
ATOM   2005 N N   . LEU B 2 129 ? -68.295  -0.446  -41.887  1.00 82.88  ? 129 LEU B N   1 
ATOM   2006 C CA  . LEU B 2 129 ? -69.148  0.681   -41.503  1.00 84.25  ? 129 LEU B CA  1 
ATOM   2007 C C   . LEU B 2 129 ? -70.222  0.233   -40.525  1.00 85.87  ? 129 LEU B C   1 
ATOM   2008 O O   . LEU B 2 129 ? -71.356  -0.096  -40.935  1.00 86.19  ? 129 LEU B O   1 
ATOM   2009 C CB  . LEU B 2 129 ? -69.831  1.291   -42.725  1.00 83.89  ? 129 LEU B CB  1 
ATOM   2010 C CG  . LEU B 2 129 ? -70.898  2.367   -42.491  1.00 83.21  ? 129 LEU B CG  1 
ATOM   2011 C CD1 . LEU B 2 129 ? -70.317  3.610   -41.855  1.00 83.00  ? 129 LEU B CD1 1 
ATOM   2012 C CD2 . LEU B 2 129 ? -71.574  2.730   -43.786  1.00 82.73  ? 129 LEU B CD2 1 
ATOM   2013 N N   . GLU B 2 130 ? -69.870  0.214   -39.236  1.00 87.45  ? 130 GLU B N   1 
ATOM   2014 C CA  . GLU B 2 130 ? -70.831  -0.166  -38.184  1.00 88.71  ? 130 GLU B CA  1 
ATOM   2015 C C   . GLU B 2 130 ? -71.593  1.033   -37.634  1.00 89.47  ? 130 GLU B C   1 
ATOM   2016 O O   . GLU B 2 130 ? -71.008  2.098   -37.428  1.00 89.77  ? 130 GLU B O   1 
ATOM   2017 C CB  . GLU B 2 130 ? -70.178  -0.992  -37.064  1.00 88.41  ? 130 GLU B CB  1 
ATOM   2018 C CG  . GLU B 2 130 ? -68.852  -0.485  -36.551  1.00 88.35  ? 130 GLU B CG  1 
ATOM   2019 C CD  . GLU B 2 130 ? -68.110  -1.553  -35.758  1.00 89.21  ? 130 GLU B CD  1 
ATOM   2020 O OE1 . GLU B 2 130 ? -68.580  -2.717  -35.734  1.00 87.86  ? 130 GLU B OE1 1 
ATOM   2021 O OE2 . GLU B 2 130 ? -67.057  -1.230  -35.156  1.00 90.30  ? 130 GLU B OE2 1 
ATOM   2022 N N   . ILE B 2 131 ? -72.896  0.856   -37.413  1.00 90.39  ? 131 ILE B N   1 
ATOM   2023 C CA  . ILE B 2 131 ? -73.766  1.963   -37.002  1.00 91.32  ? 131 ILE B CA  1 
ATOM   2024 C C   . ILE B 2 131 ? -73.682  2.308   -35.509  1.00 91.67  ? 131 ILE B C   1 
ATOM   2025 O O   . ILE B 2 131 ? -73.383  1.454   -34.662  1.00 91.74  ? 131 ILE B O   1 
ATOM   2026 C CB  . ILE B 2 131 ? -75.241  1.743   -37.429  1.00 91.40  ? 131 ILE B CB  1 
ATOM   2027 C CG1 . ILE B 2 131 ? -75.329  1.621   -38.953  1.00 92.38  ? 131 ILE B CG1 1 
ATOM   2028 C CG2 . ILE B 2 131 ? -76.130  2.899   -36.968  1.00 91.15  ? 131 ILE B CG2 1 
ATOM   2029 C CD1 . ILE B 2 131 ? -76.672  1.084   -39.478  1.00 92.81  ? 131 ILE B CD1 1 
ATOM   2030 N N   . LYS B 2 132 ? -73.903  3.593   -35.231  1.00 92.01  ? 132 LYS B N   1 
ATOM   2031 C CA  . LYS B 2 132 ? -74.148  4.107   -33.895  1.00 92.12  ? 132 LYS B CA  1 
ATOM   2032 C C   . LYS B 2 132 ? -75.632  3.928   -33.607  1.00 92.16  ? 132 LYS B C   1 
ATOM   2033 O O   . LYS B 2 132 ? -76.056  3.824   -32.459  1.00 92.39  ? 132 LYS B O   1 
ATOM   2034 C CB  . LYS B 2 132 ? -73.784  5.590   -33.835  1.00 92.09  ? 132 LYS B CB  1 
ATOM   2035 C CG  . LYS B 2 132 ? -72.372  5.883   -34.295  1.00 92.34  ? 132 LYS B CG  1 
ATOM   2036 C CD  . LYS B 2 132 ? -71.869  7.221   -33.773  1.00 93.63  ? 132 LYS B CD  1 
ATOM   2037 C CE  . LYS B 2 132 ? -71.071  7.052   -32.472  1.00 93.76  ? 132 LYS B CE  1 
ATOM   2038 N NZ  . LYS B 2 132 ? -70.437  8.332   -32.050  1.00 93.63  ? 132 LYS B NZ  1 
ATOM   2039 N N   . ALA B 2 134 ? -78.587  5.264   -30.142  1.00 100.21 ? 134 ALA B N   1 
ATOM   2040 C CA  . ALA B 2 134 ? -78.936  5.384   -28.720  1.00 100.49 ? 134 ALA B CA  1 
ATOM   2041 C C   . ALA B 2 134 ? -79.186  4.020   -28.088  1.00 100.44 ? 134 ALA B C   1 
ATOM   2042 O O   . ALA B 2 134 ? -79.733  3.123   -28.735  1.00 100.95 ? 134 ALA B O   1 
ATOM   2043 C CB  . ALA B 2 134 ? -80.149  6.298   -28.522  1.00 100.34 ? 134 ALA B CB  1 
ATOM   2044 N N   . ASP B 2 135 ? -78.791  3.878   -26.824  1.00 100.08 ? 135 ASP B N   1 
ATOM   2045 C CA  . ASP B 2 135 ? -78.801  2.595   -26.116  1.00 99.70  ? 135 ASP B CA  1 
ATOM   2046 C C   . ASP B 2 135 ? -80.190  1.911   -26.093  1.00 99.70  ? 135 ASP B C   1 
ATOM   2047 O O   . ASP B 2 135 ? -81.213  2.544   -26.397  1.00 99.78  ? 135 ASP B O   1 
ATOM   2048 C CB  . ASP B 2 135 ? -78.251  2.778   -24.687  1.00 99.59  ? 135 ASP B CB  1 
ATOM   2049 C CG  . ASP B 2 135 ? -77.095  3.790   -24.610  1.00 99.15  ? 135 ASP B CG  1 
ATOM   2050 O OD1 . ASP B 2 135 ? -75.995  3.417   -24.141  1.00 98.35  ? 135 ASP B OD1 1 
ATOM   2051 O OD2 . ASP B 2 135 ? -77.284  4.961   -25.006  1.00 98.18  ? 135 ASP B OD2 1 
ATOM   2052 N N   . ALA B 2 136 ? -80.212  0.615   -25.769  1.00 99.48  ? 136 ALA B N   1 
ATOM   2053 C CA  . ALA B 2 136 ? -81.458  -0.113  -25.470  1.00 99.39  ? 136 ALA B CA  1 
ATOM   2054 C C   . ALA B 2 136 ? -81.223  -1.289  -24.496  1.00 99.59  ? 136 ALA B C   1 
ATOM   2055 O O   . ALA B 2 136 ? -80.088  -1.770  -24.336  1.00 99.48  ? 136 ALA B O   1 
ATOM   2056 C CB  . ALA B 2 136 ? -82.160  -0.574  -26.748  1.00 99.09  ? 136 ALA B CB  1 
ATOM   2057 N N   . ALA B 2 137 ? -82.302  -1.734  -23.846  1.00 99.76  ? 137 ALA B N   1 
ATOM   2058 C CA  . ALA B 2 137 ? -82.247  -2.777  -22.810  1.00 99.84  ? 137 ALA B CA  1 
ATOM   2059 C C   . ALA B 2 137 ? -82.235  -4.218  -23.341  1.00 99.85  ? 137 ALA B C   1 
ATOM   2060 O O   . ALA B 2 137 ? -83.160  -4.628  -24.040  1.00 99.94  ? 137 ALA B O   1 
ATOM   2061 C CB  . ALA B 2 137 ? -83.406  -2.599  -21.859  1.00 100.09 ? 137 ALA B CB  1 
ATOM   2062 N N   . PRO B 2 138 ? -81.200  -5.000  -22.987  1.00 99.94  ? 138 PRO B N   1 
ATOM   2063 C CA  . PRO B 2 138 ? -81.090  -6.422  -23.380  1.00 99.93  ? 138 PRO B CA  1 
ATOM   2064 C C   . PRO B 2 138 ? -82.284  -7.228  -22.896  1.00 99.70  ? 138 PRO B C   1 
ATOM   2065 O O   . PRO B 2 138 ? -82.777  -6.963  -21.791  1.00 99.92  ? 138 PRO B O   1 
ATOM   2066 C CB  . PRO B 2 138 ? -79.824  -6.902  -22.654  1.00 99.99  ? 138 PRO B CB  1 
ATOM   2067 C CG  . PRO B 2 138 ? -79.593  -5.902  -21.570  1.00 100.40 ? 138 PRO B CG  1 
ATOM   2068 C CD  . PRO B 2 138 ? -80.087  -4.586  -22.117  1.00 100.16 ? 138 PRO B CD  1 
ATOM   2069 N N   . THR B 2 139 ? -82.731  -8.199  -23.697  1.00 99.14  ? 139 THR B N   1 
ATOM   2070 C CA  . THR B 2 139 ? -83.985  -8.909  -23.415  1.00 98.71  ? 139 THR B CA  1 
ATOM   2071 C C   . THR B 2 139 ? -83.774  -10.411 -23.115  1.00 98.86  ? 139 THR B C   1 
ATOM   2072 O O   . THR B 2 139 ? -84.054  -11.253 -23.965  1.00 99.25  ? 139 THR B O   1 
ATOM   2073 C CB  . THR B 2 139 ? -85.015  -8.691  -24.574  1.00 98.44  ? 139 THR B CB  1 
ATOM   2074 O OG1 . THR B 2 139 ? -84.977  -7.327  -25.019  1.00 97.34  ? 139 THR B OG1 1 
ATOM   2075 C CG2 . THR B 2 139 ? -86.425  -9.036  -24.133  1.00 98.11  ? 139 THR B CG2 1 
ATOM   2076 N N   . VAL B 2 140 ? -83.297  -10.750 -21.911  1.00 98.81  ? 140 VAL B N   1 
ATOM   2077 C CA  . VAL B 2 140 ? -82.909  -12.152 -21.599  1.00 98.76  ? 140 VAL B CA  1 
ATOM   2078 C C   . VAL B 2 140 ? -84.088  -13.132 -21.497  1.00 98.88  ? 140 VAL B C   1 
ATOM   2079 O O   . VAL B 2 140 ? -85.244  -12.713 -21.351  1.00 99.21  ? 140 VAL B O   1 
ATOM   2080 C CB  . VAL B 2 140 ? -81.927  -12.280 -20.373  1.00 98.74  ? 140 VAL B CB  1 
ATOM   2081 C CG1 . VAL B 2 140 ? -82.570  -11.802 -19.095  1.00 99.15  ? 140 VAL B CG1 1 
ATOM   2082 C CG2 . VAL B 2 140 ? -81.390  -13.717 -20.217  1.00 97.95  ? 140 VAL B CG2 1 
ATOM   2083 N N   . SER B 2 141 ? -83.771  -14.427 -21.609  1.00 98.78  ? 141 SER B N   1 
ATOM   2084 C CA  . SER B 2 141 ? -84.739  -15.533 -21.610  1.00 98.47  ? 141 SER B CA  1 
ATOM   2085 C C   . SER B 2 141 ? -83.974  -16.854 -21.483  1.00 98.57  ? 141 SER B C   1 
ATOM   2086 O O   . SER B 2 141 ? -83.202  -17.199 -22.370  1.00 98.62  ? 141 SER B O   1 
ATOM   2087 C CB  . SER B 2 141 ? -85.609  -15.519 -22.885  1.00 98.26  ? 141 SER B CB  1 
ATOM   2088 O OG  . SER B 2 141 ? -84.867  -15.153 -24.038  1.00 96.92  ? 141 SER B OG  1 
ATOM   2089 N N   . ILE B 2 142 ? -84.178  -17.582 -20.383  1.00 98.65  ? 142 ILE B N   1 
ATOM   2090 C CA  . ILE B 2 142 ? -83.421  -18.825 -20.122  1.00 98.66  ? 142 ILE B CA  1 
ATOM   2091 C C   . ILE B 2 142 ? -84.063  -20.097 -20.683  1.00 98.45  ? 142 ILE B C   1 
ATOM   2092 O O   . ILE B 2 142 ? -85.295  -20.218 -20.740  1.00 98.24  ? 142 ILE B O   1 
ATOM   2093 C CB  . ILE B 2 142 ? -83.051  -19.010 -18.614  1.00 98.78  ? 142 ILE B CB  1 
ATOM   2094 C CG1 . ILE B 2 142 ? -82.194  -20.272 -18.412  1.00 98.68  ? 142 ILE B CG1 1 
ATOM   2095 C CG2 . ILE B 2 142 ? -84.304  -19.042 -17.735  1.00 99.34  ? 142 ILE B CG2 1 
ATOM   2096 C CD1 . ILE B 2 142 ? -81.254  -20.217 -17.208  1.00 98.78  ? 142 ILE B CD1 1 
ATOM   2097 N N   . PHE B 2 143 ? -83.198  -21.030 -21.088  1.00 98.43  ? 143 PHE B N   1 
ATOM   2098 C CA  . PHE B 2 143 ? -83.601  -22.262 -21.778  1.00 98.49  ? 143 PHE B CA  1 
ATOM   2099 C C   . PHE B 2 143 ? -82.923  -23.518 -21.210  1.00 98.62  ? 143 PHE B C   1 
ATOM   2100 O O   . PHE B 2 143 ? -81.711  -23.696 -21.365  1.00 98.53  ? 143 PHE B O   1 
ATOM   2101 C CB  . PHE B 2 143 ? -83.327  -22.149 -23.285  1.00 98.21  ? 143 PHE B CB  1 
ATOM   2102 C CG  . PHE B 2 143 ? -84.223  -21.180 -23.995  1.00 97.55  ? 143 PHE B CG  1 
ATOM   2103 C CD1 . PHE B 2 143 ? -84.066  -19.806 -23.826  1.00 97.49  ? 143 PHE B CD1 1 
ATOM   2104 C CD2 . PHE B 2 143 ? -85.220  -21.639 -24.843  1.00 97.36  ? 143 PHE B CD2 1 
ATOM   2105 C CE1 . PHE B 2 143 ? -84.905  -18.893 -24.477  1.00 97.67  ? 143 PHE B CE1 1 
ATOM   2106 C CE2 . PHE B 2 143 ? -86.059  -20.740 -25.510  1.00 98.13  ? 143 PHE B CE2 1 
ATOM   2107 C CZ  . PHE B 2 143 ? -85.897  -19.358 -25.326  1.00 97.80  ? 143 PHE B CZ  1 
ATOM   2108 N N   . PRO B 2 144 ? -83.715  -24.399 -20.565  1.00 98.76  ? 144 PRO B N   1 
ATOM   2109 C CA  . PRO B 2 144 ? -83.252  -25.650 -19.966  1.00 98.94  ? 144 PRO B CA  1 
ATOM   2110 C C   . PRO B 2 144 ? -82.756  -26.631 -21.026  1.00 99.40  ? 144 PRO B C   1 
ATOM   2111 O O   . PRO B 2 144 ? -83.075  -26.464 -22.202  1.00 99.69  ? 144 PRO B O   1 
ATOM   2112 C CB  . PRO B 2 144 ? -84.524  -26.208 -19.342  1.00 98.79  ? 144 PRO B CB  1 
ATOM   2113 C CG  . PRO B 2 144 ? -85.615  -25.676 -20.220  1.00 99.02  ? 144 PRO B CG  1 
ATOM   2114 C CD  . PRO B 2 144 ? -85.183  -24.279 -20.495  1.00 98.70  ? 144 PRO B CD  1 
ATOM   2115 N N   . PRO B 2 145 ? -81.975  -27.646 -20.625  1.00 99.78  ? 145 PRO B N   1 
ATOM   2116 C CA  . PRO B 2 145 ? -81.626  -28.749 -21.520  1.00 100.36 ? 145 PRO B CA  1 
ATOM   2117 C C   . PRO B 2 145 ? -82.826  -29.305 -22.273  1.00 101.01 ? 145 PRO B C   1 
ATOM   2118 O O   . PRO B 2 145 ? -83.960  -29.056 -21.882  1.00 100.90 ? 145 PRO B O   1 
ATOM   2119 C CB  . PRO B 2 145 ? -81.101  -29.804 -20.551  1.00 100.28 ? 145 PRO B CB  1 
ATOM   2120 C CG  . PRO B 2 145 ? -80.440  -28.996 -19.472  1.00 99.98  ? 145 PRO B CG  1 
ATOM   2121 C CD  . PRO B 2 145 ? -81.153  -27.666 -19.403  1.00 99.63  ? 145 PRO B CD  1 
ATOM   2122 N N   . SER B 2 146 ? -82.576  -30.041 -23.350  1.00 102.17 ? 146 SER B N   1 
ATOM   2123 C CA  . SER B 2 146 ? -83.649  -30.766 -24.047  1.00 103.47 ? 146 SER B CA  1 
ATOM   2124 C C   . SER B 2 146 ? -83.630  -32.248 -23.719  1.00 104.27 ? 146 SER B C   1 
ATOM   2125 O O   . SER B 2 146 ? -82.586  -32.903 -23.794  1.00 104.16 ? 146 SER B O   1 
ATOM   2126 C CB  . SER B 2 146 ? -83.588  -30.567 -25.560  1.00 103.22 ? 146 SER B CB  1 
ATOM   2127 O OG  . SER B 2 146 ? -82.246  -30.503 -25.984  1.00 104.03 ? 146 SER B OG  1 
ATOM   2128 N N   . SER B 2 147 ? -84.803  -32.757 -23.352  1.00 105.58 ? 147 SER B N   1 
ATOM   2129 C CA  . SER B 2 147 ? -84.996  -34.161 -23.009  1.00 106.84 ? 147 SER B CA  1 
ATOM   2130 C C   . SER B 2 147 ? -83.949  -35.062 -23.673  1.00 108.18 ? 147 SER B C   1 
ATOM   2131 O O   . SER B 2 147 ? -83.174  -35.730 -22.973  1.00 108.47 ? 147 SER B O   1 
ATOM   2132 C CB  . SER B 2 147 ? -86.426  -34.598 -23.361  1.00 106.55 ? 147 SER B CB  1 
ATOM   2133 O OG  . SER B 2 147 ? -86.456  -35.896 -23.925  1.00 105.67 ? 147 SER B OG  1 
ATOM   2134 N N   . GLU B 2 148 ? -83.903  -35.043 -25.010  1.00 109.47 ? 148 GLU B N   1 
ATOM   2135 C CA  . GLU B 2 148 ? -83.060  -35.971 -25.767  1.00 110.59 ? 148 GLU B CA  1 
ATOM   2136 C C   . GLU B 2 148 ? -81.575  -35.762 -25.525  1.00 111.01 ? 148 GLU B C   1 
ATOM   2137 O O   . GLU B 2 148 ? -80.836  -36.739 -25.420  1.00 111.00 ? 148 GLU B O   1 
ATOM   2138 C CB  . GLU B 2 148 ? -83.383  -35.953 -27.263  1.00 110.78 ? 148 GLU B CB  1 
ATOM   2139 C CG  . GLU B 2 148 ? -82.973  -34.689 -27.994  1.00 112.62 ? 148 GLU B CG  1 
ATOM   2140 C CD  . GLU B 2 148 ? -82.917  -34.885 -29.500  1.00 114.63 ? 148 GLU B CD  1 
ATOM   2141 O OE1 . GLU B 2 148 ? -81.790  -35.007 -30.048  1.00 115.39 ? 148 GLU B OE1 1 
ATOM   2142 O OE2 . GLU B 2 148 ? -84.000  -34.927 -30.131  1.00 114.92 ? 148 GLU B OE2 1 
ATOM   2143 N N   . GLN B 2 149 ? -81.149  -34.500 -25.426  1.00 111.85 ? 149 GLN B N   1 
ATOM   2144 C CA  . GLN B 2 149 ? -79.757  -34.176 -25.083  1.00 112.74 ? 149 GLN B CA  1 
ATOM   2145 C C   . GLN B 2 149 ? -79.361  -34.920 -23.805  1.00 113.05 ? 149 GLN B C   1 
ATOM   2146 O O   . GLN B 2 149 ? -78.272  -35.516 -23.717  1.00 113.25 ? 149 GLN B O   1 
ATOM   2147 C CB  . GLN B 2 149 ? -79.557  -32.662 -24.902  1.00 112.71 ? 149 GLN B CB  1 
ATOM   2148 C CG  . GLN B 2 149 ? -78.293  -32.307 -24.102  1.00 114.01 ? 149 GLN B CG  1 
ATOM   2149 C CD  . GLN B 2 149 ? -77.976  -30.813 -24.039  1.00 116.06 ? 149 GLN B CD  1 
ATOM   2150 O OE1 . GLN B 2 149 ? -76.804  -30.424 -24.071  1.00 116.42 ? 149 GLN B OE1 1 
ATOM   2151 N NE2 . GLN B 2 149 ? -79.013  -29.975 -23.940  1.00 116.63 ? 149 GLN B NE2 1 
ATOM   2152 N N   . LEU B 2 150 ? -80.275  -34.887 -22.833  1.00 113.22 ? 150 LEU B N   1 
ATOM   2153 C CA  . LEU B 2 150 ? -80.096  -35.533 -21.544  1.00 113.06 ? 150 LEU B CA  1 
ATOM   2154 C C   . LEU B 2 150 ? -80.030  -37.032 -21.719  1.00 113.06 ? 150 LEU B C   1 
ATOM   2155 O O   . LEU B 2 150 ? -79.008  -37.637 -21.407  1.00 112.90 ? 150 LEU B O   1 
ATOM   2156 C CB  . LEU B 2 150 ? -81.228  -35.139 -20.596  1.00 112.99 ? 150 LEU B CB  1 
ATOM   2157 C CG  . LEU B 2 150 ? -81.214  -33.672 -20.178  1.00 112.89 ? 150 LEU B CG  1 
ATOM   2158 C CD1 . LEU B 2 150 ? -82.593  -33.216 -19.740  1.00 112.81 ? 150 LEU B CD1 1 
ATOM   2159 C CD2 . LEU B 2 150 ? -80.177  -33.454 -19.083  1.00 113.00 ? 150 LEU B CD2 1 
ATOM   2160 N N   . THR B 2 151 ? -81.105  -37.617 -22.251  1.00 113.27 ? 151 THR B N   1 
ATOM   2161 C CA  . THR B 2 151 ? -81.193  -39.073 -22.441  1.00 113.70 ? 151 THR B CA  1 
ATOM   2162 C C   . THR B 2 151 ? -80.137  -39.600 -23.439  1.00 113.90 ? 151 THR B C   1 
ATOM   2163 O O   . THR B 2 151 ? -80.021  -40.814 -23.679  1.00 113.70 ? 151 THR B O   1 
ATOM   2164 C CB  . THR B 2 151 ? -82.646  -39.552 -22.796  1.00 113.73 ? 151 THR B CB  1 
ATOM   2165 O OG1 . THR B 2 151 ? -83.223  -38.688 -23.783  1.00 113.87 ? 151 THR B OG1 1 
ATOM   2166 C CG2 . THR B 2 151 ? -83.548  -39.575 -21.551  1.00 113.43 ? 151 THR B CG2 1 
ATOM   2167 N N   . SER B 2 152 ? -79.356  -38.672 -23.989  1.00 114.18 ? 152 SER B N   1 
ATOM   2168 C CA  . SER B 2 152 ? -78.173  -39.014 -24.768  1.00 114.50 ? 152 SER B CA  1 
ATOM   2169 C C   . SER B 2 152 ? -76.866  -38.574 -24.082  1.00 114.74 ? 152 SER B C   1 
ATOM   2170 O O   . SER B 2 152 ? -75.832  -38.421 -24.736  1.00 114.78 ? 152 SER B O   1 
ATOM   2171 C CB  . SER B 2 152 ? -78.284  -38.451 -26.181  1.00 114.54 ? 152 SER B CB  1 
ATOM   2172 O OG  . SER B 2 152 ? -79.436  -38.965 -26.827  1.00 114.56 ? 152 SER B OG  1 
ATOM   2173 N N   . GLY B 2 153 ? -76.931  -38.363 -22.766  1.00 114.99 ? 153 GLY B N   1 
ATOM   2174 C CA  . GLY B 2 153 ? -75.740  -38.310 -21.915  1.00 115.34 ? 153 GLY B CA  1 
ATOM   2175 C C   . GLY B 2 153 ? -75.049  -36.975 -21.715  1.00 115.61 ? 153 GLY B C   1 
ATOM   2176 O O   . GLY B 2 153 ? -73.843  -36.931 -21.445  1.00 115.60 ? 153 GLY B O   1 
ATOM   2177 N N   . GLY B 2 154 ? -75.809  -35.888 -21.826  1.00 115.85 ? 154 GLY B N   1 
ATOM   2178 C CA  . GLY B 2 154 ? -75.270  -34.541 -21.624  1.00 116.09 ? 154 GLY B CA  1 
ATOM   2179 C C   . GLY B 2 154 ? -76.346  -33.542 -21.249  1.00 116.29 ? 154 GLY B C   1 
ATOM   2180 O O   . GLY B 2 154 ? -77.540  -33.850 -21.324  1.00 116.25 ? 154 GLY B O   1 
ATOM   2181 N N   . ALA B 2 155 ? -75.925  -32.346 -20.840  1.00 116.41 ? 155 ALA B N   1 
ATOM   2182 C CA  . ALA B 2 155 ? -76.865  -31.303 -20.410  1.00 116.54 ? 155 ALA B CA  1 
ATOM   2183 C C   . ALA B 2 155 ? -76.307  -29.894 -20.597  1.00 116.53 ? 155 ALA B C   1 
ATOM   2184 O O   . ALA B 2 155 ? -75.248  -29.572 -20.054  1.00 116.69 ? 155 ALA B O   1 
ATOM   2185 C CB  . ALA B 2 155 ? -77.257  -31.521 -18.953  1.00 116.71 ? 155 ALA B CB  1 
ATOM   2186 N N   . SER B 2 156 ? -77.027  -29.060 -21.348  1.00 116.36 ? 156 SER B N   1 
ATOM   2187 C CA  . SER B 2 156 ? -76.577  -27.699 -21.644  1.00 116.33 ? 156 SER B CA  1 
ATOM   2188 C C   . SER B 2 156 ? -77.682  -26.692 -21.402  1.00 116.34 ? 156 SER B C   1 
ATOM   2189 O O   . SER B 2 156 ? -78.820  -26.904 -21.817  1.00 116.46 ? 156 SER B O   1 
ATOM   2190 C CB  . SER B 2 156 ? -76.104  -27.589 -23.096  1.00 116.32 ? 156 SER B CB  1 
ATOM   2191 O OG  . SER B 2 156 ? -75.177  -28.614 -23.417  1.00 116.40 ? 156 SER B OG  1 
ATOM   2192 N N   . VAL B 2 157 ? -77.342  -25.585 -20.750  1.00 116.28 ? 157 VAL B N   1 
ATOM   2193 C CA  . VAL B 2 157 ? -78.324  -24.555 -20.422  1.00 116.49 ? 157 VAL B CA  1 
ATOM   2194 C C   . VAL B 2 157 ? -77.924  -23.191 -21.001  1.00 116.64 ? 157 VAL B C   1 
ATOM   2195 O O   . VAL B 2 157 ? -76.816  -22.721 -20.762  1.00 116.62 ? 157 VAL B O   1 
ATOM   2196 C CB  . VAL B 2 157 ? -78.521  -24.465 -18.900  1.00 116.53 ? 157 VAL B CB  1 
ATOM   2197 C CG1 . VAL B 2 157 ? -79.726  -23.595 -18.550  1.00 116.80 ? 157 VAL B CG1 1 
ATOM   2198 C CG2 . VAL B 2 157 ? -78.695  -25.858 -18.317  1.00 116.64 ? 157 VAL B CG2 1 
ATOM   2199 N N   . VAL B 2 158 ? -78.833  -22.571 -21.764  1.00 117.00 ? 158 VAL B N   1 
ATOM   2200 C CA  . VAL B 2 158 ? -78.555  -21.316 -22.497  1.00 117.12 ? 158 VAL B CA  1 
ATOM   2201 C C   . VAL B 2 158 ? -79.554  -20.194 -22.202  1.00 117.39 ? 158 VAL B C   1 
ATOM   2202 O O   . VAL B 2 158 ? -80.729  -20.448 -21.945  1.00 117.23 ? 158 VAL B O   1 
ATOM   2203 C CB  . VAL B 2 158 ? -78.506  -21.523 -24.065  1.00 117.03 ? 158 VAL B CB  1 
ATOM   2204 C CG1 . VAL B 2 158 ? -77.573  -22.643 -24.457  1.00 116.98 ? 158 VAL B CG1 1 
ATOM   2205 C CG2 . VAL B 2 158 ? -79.885  -21.780 -24.655  1.00 116.78 ? 158 VAL B CG2 1 
ATOM   2206 N N   . CYS B 2 159 ? -79.080  -18.954 -22.243  1.00 117.90 ? 159 CYS B N   1 
ATOM   2207 C CA  . CYS B 2 159 ? -79.986  -17.808 -22.319  1.00 118.91 ? 159 CYS B CA  1 
ATOM   2208 C C   . CYS B 2 159 ? -79.561  -16.783 -23.362  1.00 118.66 ? 159 CYS B C   1 
ATOM   2209 O O   . CYS B 2 159 ? -78.393  -16.402 -23.441  1.00 118.62 ? 159 CYS B O   1 
ATOM   2210 C CB  . CYS B 2 159 ? -80.246  -17.139 -20.955  1.00 119.44 ? 159 CYS B CB  1 
ATOM   2211 S SG  . CYS B 2 159 ? -79.029  -17.420 -19.648  1.00 122.75 ? 159 CYS B SG  1 
ATOM   2212 N N   . PHE B 2 160 ? -80.534  -16.358 -24.164  1.00 118.60 ? 160 PHE B N   1 
ATOM   2213 C CA  . PHE B 2 160 ? -80.324  -15.370 -25.208  1.00 118.55 ? 160 PHE B CA  1 
ATOM   2214 C C   . PHE B 2 160 ? -80.491  -13.971 -24.647  1.00 118.72 ? 160 PHE B C   1 
ATOM   2215 O O   . PHE B 2 160 ? -81.318  -13.744 -23.772  1.00 118.78 ? 160 PHE B O   1 
ATOM   2216 C CB  . PHE B 2 160 ? -81.314  -15.581 -26.357  1.00 118.47 ? 160 PHE B CB  1 
ATOM   2217 C CG  . PHE B 2 160 ? -81.261  -16.951 -26.963  1.00 118.03 ? 160 PHE B CG  1 
ATOM   2218 C CD1 . PHE B 2 160 ? -80.169  -17.351 -27.716  1.00 117.90 ? 160 PHE B CD1 1 
ATOM   2219 C CD2 . PHE B 2 160 ? -82.307  -17.840 -26.786  1.00 117.90 ? 160 PHE B CD2 1 
ATOM   2220 C CE1 . PHE B 2 160 ? -80.119  -18.614 -28.274  1.00 117.95 ? 160 PHE B CE1 1 
ATOM   2221 C CE2 . PHE B 2 160 ? -82.267  -19.109 -27.345  1.00 117.95 ? 160 PHE B CE2 1 
ATOM   2222 C CZ  . PHE B 2 160 ? -81.173  -19.497 -28.085  1.00 118.12 ? 160 PHE B CZ  1 
ATOM   2223 N N   . LEU B 2 161 ? -79.699  -13.038 -25.162  1.00 118.98 ? 161 LEU B N   1 
ATOM   2224 C CA  . LEU B 2 161 ? -79.768  -11.637 -24.774  1.00 119.22 ? 161 LEU B CA  1 
ATOM   2225 C C   . LEU B 2 161 ? -80.097  -10.817 -26.020  1.00 119.54 ? 161 LEU B C   1 
ATOM   2226 O O   . LEU B 2 161 ? -79.235  -10.150 -26.593  1.00 119.71 ? 161 LEU B O   1 
ATOM   2227 C CB  . LEU B 2 161 ? -78.429  -11.185 -24.172  1.00 119.12 ? 161 LEU B CB  1 
ATOM   2228 C CG  . LEU B 2 161 ? -77.906  -11.607 -22.790  1.00 118.86 ? 161 LEU B CG  1 
ATOM   2229 C CD1 . LEU B 2 161 ? -78.798  -11.042 -21.691  1.00 119.15 ? 161 LEU B CD1 1 
ATOM   2230 C CD2 . LEU B 2 161 ? -77.688  -13.114 -22.619  1.00 117.96 ? 161 LEU B CD2 1 
ATOM   2231 N N   . ASN B 2 162 ? -81.343  -10.882 -26.458  1.00 119.83 ? 162 ASN B N   1 
ATOM   2232 C CA  . ASN B 2 162 ? -81.703  -10.270 -27.725  1.00 120.29 ? 162 ASN B CA  1 
ATOM   2233 C C   . ASN B 2 162 ? -81.719  -8.743  -27.676  1.00 120.61 ? 162 ASN B C   1 
ATOM   2234 O O   . ASN B 2 162 ? -81.835  -8.156  -26.600  1.00 120.64 ? 162 ASN B O   1 
ATOM   2235 C CB  . ASN B 2 162 ? -83.034  -10.839 -28.240  1.00 120.30 ? 162 ASN B CB  1 
ATOM   2236 C CG  . ASN B 2 162 ? -82.938  -12.322 -28.621  1.00 120.39 ? 162 ASN B CG  1 
ATOM   2237 O OD1 . ASN B 2 162 ? -81.926  -12.986 -28.364  1.00 119.68 ? 162 ASN B OD1 1 
ATOM   2238 N ND2 . ASN B 2 162 ? -84.000  -12.841 -29.240  1.00 120.52 ? 162 ASN B ND2 1 
ATOM   2239 N N   . ASN B 2 163 ? -81.526  -8.136  -28.850  1.00 121.16 ? 163 ASN B N   1 
ATOM   2240 C CA  . ASN B 2 163 ? -81.752  -6.706  -29.138  1.00 121.63 ? 163 ASN B CA  1 
ATOM   2241 C C   . ASN B 2 163 ? -81.154  -5.634  -28.220  1.00 122.26 ? 163 ASN B C   1 
ATOM   2242 O O   . ASN B 2 163 ? -81.791  -4.606  -27.988  1.00 122.09 ? 163 ASN B O   1 
ATOM   2243 C CB  . ASN B 2 163 ? -83.249  -6.445  -29.324  1.00 121.47 ? 163 ASN B CB  1 
ATOM   2244 C CG  . ASN B 2 163 ? -83.835  -7.234  -30.468  1.00 121.32 ? 163 ASN B CG  1 
ATOM   2245 O OD1 . ASN B 2 163 ? -83.837  -8.461  -30.445  1.00 121.52 ? 163 ASN B OD1 1 
ATOM   2246 N ND2 . ASN B 2 163 ? -84.342  -6.533  -31.479  1.00 120.91 ? 163 ASN B ND2 1 
ATOM   2247 N N   . PHE B 2 164 ? -79.938  -5.842  -27.719  1.00 123.26 ? 164 PHE B N   1 
ATOM   2248 C CA  . PHE B 2 164 ? -79.317  -4.828  -26.867  1.00 124.28 ? 164 PHE B CA  1 
ATOM   2249 C C   . PHE B 2 164 ? -78.322  -3.939  -27.601  1.00 125.34 ? 164 PHE B C   1 
ATOM   2250 O O   . PHE B 2 164 ? -77.948  -4.225  -28.734  1.00 125.62 ? 164 PHE B O   1 
ATOM   2251 C CB  . PHE B 2 164 ? -78.681  -5.450  -25.631  1.00 123.96 ? 164 PHE B CB  1 
ATOM   2252 C CG  . PHE B 2 164 ? -77.517  -6.344  -25.916  1.00 123.83 ? 164 PHE B CG  1 
ATOM   2253 C CD1 . PHE B 2 164 ? -76.272  -5.817  -26.244  1.00 124.30 ? 164 PHE B CD1 1 
ATOM   2254 C CD2 . PHE B 2 164 ? -77.646  -7.714  -25.798  1.00 123.76 ? 164 PHE B CD2 1 
ATOM   2255 C CE1 . PHE B 2 164 ? -75.179  -6.652  -26.484  1.00 124.22 ? 164 PHE B CE1 1 
ATOM   2256 C CE2 . PHE B 2 164 ? -76.561  -8.556  -26.028  1.00 123.79 ? 164 PHE B CE2 1 
ATOM   2257 C CZ  . PHE B 2 164 ? -75.328  -8.026  -26.375  1.00 124.09 ? 164 PHE B CZ  1 
ATOM   2258 N N   . TYR B 2 165 ? -77.897  -2.867  -26.932  1.00 126.69 ? 165 TYR B N   1 
ATOM   2259 C CA  . TYR B 2 165 ? -76.973  -1.871  -27.485  1.00 127.98 ? 165 TYR B CA  1 
ATOM   2260 C C   . TYR B 2 165 ? -76.590  -0.861  -26.389  1.00 128.87 ? 165 TYR B C   1 
ATOM   2261 O O   . TYR B 2 165 ? -77.471  -0.351  -25.694  1.00 129.18 ? 165 TYR B O   1 
ATOM   2262 C CB  . TYR B 2 165 ? -77.622  -1.158  -28.680  1.00 127.99 ? 165 TYR B CB  1 
ATOM   2263 C CG  . TYR B 2 165 ? -76.850  0.028   -29.209  1.00 128.57 ? 165 TYR B CG  1 
ATOM   2264 C CD1 . TYR B 2 165 ? -75.670  -0.146  -29.930  1.00 128.98 ? 165 TYR B CD1 1 
ATOM   2265 C CD2 . TYR B 2 165 ? -77.311  1.324   -29.004  1.00 128.56 ? 165 TYR B CD2 1 
ATOM   2266 C CE1 . TYR B 2 165 ? -74.965  0.940   -30.413  1.00 129.17 ? 165 TYR B CE1 1 
ATOM   2267 C CE2 . TYR B 2 165 ? -76.620  2.413   -29.486  1.00 128.65 ? 165 TYR B CE2 1 
ATOM   2268 C CZ  . TYR B 2 165 ? -75.449  2.214   -30.186  1.00 129.30 ? 165 TYR B CZ  1 
ATOM   2269 O OH  . TYR B 2 165 ? -74.756  3.296   -30.665  1.00 130.24 ? 165 TYR B OH  1 
ATOM   2270 N N   . PRO B 2 166 ? -75.286  -0.563  -26.214  1.00 129.67 ? 166 PRO B N   1 
ATOM   2271 C CA  . PRO B 2 166 ? -74.097  -0.992  -26.943  1.00 130.48 ? 166 PRO B CA  1 
ATOM   2272 C C   . PRO B 2 166 ? -73.664  -2.430  -26.650  1.00 131.35 ? 166 PRO B C   1 
ATOM   2273 O O   . PRO B 2 166 ? -74.298  -3.122  -25.846  1.00 131.26 ? 166 PRO B O   1 
ATOM   2274 C CB  . PRO B 2 166 ? -73.011  -0.011  -26.460  1.00 130.38 ? 166 PRO B CB  1 
ATOM   2275 C CG  . PRO B 2 166 ? -73.718  1.042   -25.691  1.00 129.94 ? 166 PRO B CG  1 
ATOM   2276 C CD  . PRO B 2 166 ? -74.926  0.382   -25.145  1.00 129.74 ? 166 PRO B CD  1 
ATOM   2277 N N   . LYS B 2 167 ? -72.578  -2.837  -27.317  1.00 132.40 ? 167 LYS B N   1 
ATOM   2278 C CA  . LYS B 2 167 ? -71.998  -4.187  -27.267  1.00 133.47 ? 167 LYS B CA  1 
ATOM   2279 C C   . LYS B 2 167 ? -71.803  -4.720  -25.850  1.00 133.90 ? 167 LYS B C   1 
ATOM   2280 O O   . LYS B 2 167 ? -72.078  -5.898  -25.578  1.00 134.10 ? 167 LYS B O   1 
ATOM   2281 C CB  . LYS B 2 167 ? -70.648  -4.202  -28.024  1.00 133.67 ? 167 LYS B CB  1 
ATOM   2282 C CG  . LYS B 2 167 ? -69.971  -5.596  -28.238  1.00 134.57 ? 167 LYS B CG  1 
ATOM   2283 C CD  . LYS B 2 167 ? -68.873  -5.930  -27.184  1.00 135.10 ? 167 LYS B CD  1 
ATOM   2284 C CE  . LYS B 2 167 ? -68.133  -7.237  -27.520  1.00 134.87 ? 167 LYS B CE  1 
ATOM   2285 N NZ  . LYS B 2 167 ? -67.166  -7.690  -26.467  1.00 134.38 ? 167 LYS B NZ  1 
ATOM   2286 N N   . ASP B 2 168 ? -71.334  -3.849  -24.960  1.00 134.30 ? 168 ASP B N   1 
ATOM   2287 C CA  . ASP B 2 168 ? -70.847  -4.263  -23.649  1.00 134.79 ? 168 ASP B CA  1 
ATOM   2288 C C   . ASP B 2 168 ? -71.951  -4.726  -22.706  1.00 134.86 ? 168 ASP B C   1 
ATOM   2289 O O   . ASP B 2 168 ? -72.867  -3.970  -22.365  1.00 134.80 ? 168 ASP B O   1 
ATOM   2290 C CB  . ASP B 2 168 ? -70.000  -3.151  -23.040  1.00 134.96 ? 168 ASP B CB  1 
ATOM   2291 C CG  . ASP B 2 168 ? -68.977  -2.617  -24.022  1.00 135.76 ? 168 ASP B CG  1 
ATOM   2292 O OD1 . ASP B 2 168 ? -68.292  -3.448  -24.664  1.00 136.40 ? 168 ASP B OD1 1 
ATOM   2293 O OD2 . ASP B 2 168 ? -68.874  -1.379  -24.171  1.00 136.62 ? 168 ASP B OD2 1 
ATOM   2294 N N   . ILE B 2 169 ? -71.842  -5.995  -22.314  1.00 134.98 ? 169 ILE B N   1 
ATOM   2295 C CA  . ILE B 2 169 ? -72.809  -6.663  -21.450  1.00 135.10 ? 169 ILE B CA  1 
ATOM   2296 C C   . ILE B 2 169 ? -72.118  -7.811  -20.699  1.00 135.12 ? 169 ILE B C   1 
ATOM   2297 O O   . ILE B 2 169 ? -71.645  -8.772  -21.313  1.00 134.96 ? 169 ILE B O   1 
ATOM   2298 C CB  . ILE B 2 169 ? -74.055  -7.156  -22.258  1.00 135.11 ? 169 ILE B CB  1 
ATOM   2299 C CG1 . ILE B 2 169 ? -75.027  -7.931  -21.360  1.00 135.16 ? 169 ILE B CG1 1 
ATOM   2300 C CG2 . ILE B 2 169 ? -73.635  -7.986  -23.475  1.00 135.24 ? 169 ILE B CG2 1 
ATOM   2301 C CD1 . ILE B 2 169 ? -76.346  -8.241  -22.021  1.00 135.12 ? 169 ILE B CD1 1 
ATOM   2302 N N   . ASN B 2 170 ? -72.034  -7.686  -19.374  1.00 135.22 ? 170 ASN B N   1 
ATOM   2303 C CA  . ASN B 2 170 ? -71.449  -8.738  -18.548  1.00 135.36 ? 170 ASN B CA  1 
ATOM   2304 C C   . ASN B 2 170 ? -72.543  -9.658  -18.011  1.00 135.53 ? 170 ASN B C   1 
ATOM   2305 O O   . ASN B 2 170 ? -73.275  -9.317  -17.075  1.00 135.37 ? 170 ASN B O   1 
ATOM   2306 C CB  . ASN B 2 170 ? -70.572  -8.160  -17.424  1.00 135.30 ? 170 ASN B CB  1 
ATOM   2307 C CG  . ASN B 2 170 ? -69.567  -9.175  -16.874  1.00 135.27 ? 170 ASN B CG  1 
ATOM   2308 O OD1 . ASN B 2 170 ? -69.047  -10.023 -17.606  1.00 134.98 ? 170 ASN B OD1 1 
ATOM   2309 N ND2 . ASN B 2 170 ? -69.287  -9.082  -15.577  1.00 134.95 ? 170 ASN B ND2 1 
ATOM   2310 N N   . VAL B 2 171 ? -72.647  -10.825 -18.639  1.00 135.84 ? 171 VAL B N   1 
ATOM   2311 C CA  . VAL B 2 171 ? -73.685  -11.800 -18.327  1.00 136.08 ? 171 VAL B CA  1 
ATOM   2312 C C   . VAL B 2 171 ? -73.161  -12.835 -17.333  1.00 136.42 ? 171 VAL B C   1 
ATOM   2313 O O   . VAL B 2 171 ? -72.180  -13.533 -17.600  1.00 136.31 ? 171 VAL B O   1 
ATOM   2314 C CB  . VAL B 2 171 ? -74.251  -12.466 -19.613  1.00 136.02 ? 171 VAL B CB  1 
ATOM   2315 C CG1 . VAL B 2 171 ? -75.162  -13.633 -19.274  1.00 135.95 ? 171 VAL B CG1 1 
ATOM   2316 C CG2 . VAL B 2 171 ? -74.998  -11.439 -20.465  1.00 135.62 ? 171 VAL B CG2 1 
ATOM   2317 N N   . LYS B 2 172 ? -73.833  -12.912 -16.186  1.00 136.93 ? 172 LYS B N   1 
ATOM   2318 C CA  . LYS B 2 172 ? -73.395  -13.723 -15.053  1.00 137.41 ? 172 LYS B CA  1 
ATOM   2319 C C   . LYS B 2 172 ? -74.400  -14.818 -14.724  1.00 137.80 ? 172 LYS B C   1 
ATOM   2320 O O   . LYS B 2 172 ? -75.564  -14.526 -14.429  1.00 137.79 ? 172 LYS B O   1 
ATOM   2321 C CB  . LYS B 2 172 ? -73.182  -12.829 -13.826  1.00 137.40 ? 172 LYS B CB  1 
ATOM   2322 C CG  . LYS B 2 172 ? -74.185  -11.675 -13.711  1.00 137.42 ? 172 LYS B CG  1 
ATOM   2323 C CD  . LYS B 2 172 ? -74.060  -10.897 -12.401  1.00 137.50 ? 172 LYS B CD  1 
ATOM   2324 C CE  . LYS B 2 172 ? -74.911  -11.506 -11.297  1.00 137.04 ? 172 LYS B CE  1 
ATOM   2325 N NZ  . LYS B 2 172 ? -74.911  -10.664 -10.074  1.00 136.67 ? 172 LYS B NZ  1 
ATOM   2326 N N   . TRP B 2 173 ? -73.941  -16.071 -14.779  1.00 138.28 ? 173 TRP B N   1 
ATOM   2327 C CA  . TRP B 2 173 ? -74.767  -17.238 -14.430  1.00 138.92 ? 173 TRP B CA  1 
ATOM   2328 C C   . TRP B 2 173 ? -74.844  -17.461 -12.908  1.00 139.20 ? 173 TRP B C   1 
ATOM   2329 O O   . TRP B 2 173 ? -73.861  -17.242 -12.196  1.00 139.26 ? 173 TRP B O   1 
ATOM   2330 C CB  . TRP B 2 173 ? -74.218  -18.509 -15.088  1.00 139.03 ? 173 TRP B CB  1 
ATOM   2331 C CG  . TRP B 2 173 ? -74.461  -18.661 -16.581  1.00 139.77 ? 173 TRP B CG  1 
ATOM   2332 C CD1 . TRP B 2 173 ? -73.620  -18.283 -17.591  1.00 139.94 ? 173 TRP B CD1 1 
ATOM   2333 C CD2 . TRP B 2 173 ? -75.599  -19.273 -17.218  1.00 140.35 ? 173 TRP B CD2 1 
ATOM   2334 N NE1 . TRP B 2 173 ? -74.168  -18.603 -18.812  1.00 139.94 ? 173 TRP B NE1 1 
ATOM   2335 C CE2 . TRP B 2 173 ? -75.380  -19.209 -18.615  1.00 140.20 ? 173 TRP B CE2 1 
ATOM   2336 C CE3 . TRP B 2 173 ? -76.787  -19.854 -16.745  1.00 140.20 ? 173 TRP B CE3 1 
ATOM   2337 C CZ2 . TRP B 2 173 ? -76.307  -19.707 -19.544  1.00 140.12 ? 173 TRP B CZ2 1 
ATOM   2338 C CZ3 . TRP B 2 173 ? -77.707  -20.352 -17.672  1.00 139.77 ? 173 TRP B CZ3 1 
ATOM   2339 C CH2 . TRP B 2 173 ? -77.459  -20.273 -19.053  1.00 139.75 ? 173 TRP B CH2 1 
ATOM   2340 N N   . LYS B 2 174 ? -76.010  -17.902 -12.424  1.00 139.59 ? 174 LYS B N   1 
ATOM   2341 C CA  . LYS B 2 174 ? -76.226  -18.215 -10.998  1.00 139.75 ? 174 LYS B CA  1 
ATOM   2342 C C   . LYS B 2 174 ? -76.827  -19.603 -10.809  1.00 139.86 ? 174 LYS B C   1 
ATOM   2343 O O   . LYS B 2 174 ? -77.863  -19.935 -11.397  1.00 139.72 ? 174 LYS B O   1 
ATOM   2344 C CB  . LYS B 2 174 ? -77.148  -17.189 -10.314  1.00 139.80 ? 174 LYS B CB  1 
ATOM   2345 C CG  . LYS B 2 174 ? -76.616  -15.756 -10.220  1.00 139.91 ? 174 LYS B CG  1 
ATOM   2346 C CD  . LYS B 2 174 ? -77.316  -14.980 -9.110   1.00 139.57 ? 174 LYS B CD  1 
ATOM   2347 C CE  . LYS B 2 174 ? -76.839  -13.542 -9.056   1.00 139.25 ? 174 LYS B CE  1 
ATOM   2348 N NZ  . LYS B 2 174 ? -77.136  -12.905 -7.743   1.00 139.39 ? 174 LYS B NZ  1 
ATOM   2349 N N   . ILE B 2 175 ? -76.169  -20.411 -9.986   1.00 140.16 ? 175 ILE B N   1 
ATOM   2350 C CA  . ILE B 2 175 ? -76.764  -21.661 -9.526   1.00 140.50 ? 175 ILE B CA  1 
ATOM   2351 C C   . ILE B 2 175 ? -77.354  -21.382 -8.138   1.00 140.78 ? 175 ILE B C   1 
ATOM   2352 O O   . ILE B 2 175 ? -76.620  -21.325 -7.139   1.00 140.67 ? 175 ILE B O   1 
ATOM   2353 C CB  . ILE B 2 175 ? -75.757  -22.853 -9.493   1.00 140.46 ? 175 ILE B CB  1 
ATOM   2354 C CG1 . ILE B 2 175 ? -74.634  -22.686 -10.532  1.00 140.46 ? 175 ILE B CG1 1 
ATOM   2355 C CG2 . ILE B 2 175 ? -76.493  -24.170 -9.676   1.00 139.87 ? 175 ILE B CG2 1 
ATOM   2356 C CD1 . ILE B 2 175 ? -75.073  -22.791 -11.994  1.00 140.29 ? 175 ILE B CD1 1 
ATOM   2357 N N   . ASP B 2 176 ? -78.681  -21.200 -8.109   1.00 141.04 ? 176 ASP B N   1 
ATOM   2358 C CA  . ASP B 2 176 ? -79.466  -20.725 -6.942   1.00 141.15 ? 176 ASP B CA  1 
ATOM   2359 C C   . ASP B 2 176 ? -78.950  -19.450 -6.251   1.00 141.29 ? 176 ASP B C   1 
ATOM   2360 O O   . ASP B 2 176 ? -79.731  -18.714 -5.635   1.00 141.38 ? 176 ASP B O   1 
ATOM   2361 C CB  . ASP B 2 176 ? -79.805  -21.850 -5.923   1.00 141.16 ? 176 ASP B CB  1 
ATOM   2362 C CG  . ASP B 2 176 ? -78.752  -22.972 -5.861   1.00 141.06 ? 176 ASP B CG  1 
ATOM   2363 O OD1 . ASP B 2 176 ? -79.076  -24.117 -6.248   1.00 140.31 ? 176 ASP B OD1 1 
ATOM   2364 O OD2 . ASP B 2 176 ? -77.611  -22.721 -5.410   1.00 141.05 ? 176 ASP B OD2 1 
ATOM   2365 N N   . GLY B 2 177 ? -77.648  -19.191 -6.391   1.00 141.30 ? 177 GLY B N   1 
ATOM   2366 C CA  . GLY B 2 177 ? -76.958  -18.060 -5.764   1.00 141.29 ? 177 GLY B CA  1 
ATOM   2367 C C   . GLY B 2 177 ? -75.446  -18.249 -5.806   1.00 141.34 ? 177 GLY B C   1 
ATOM   2368 O O   . GLY B 2 177 ? -74.693  -17.274 -5.929   1.00 141.24 ? 177 GLY B O   1 
ATOM   2369 N N   . SER B 2 178 ? -75.014  -19.511 -5.696   1.00 141.32 ? 178 SER B N   1 
ATOM   2370 C CA  . SER B 2 178 ? -73.604  -19.907 -5.827   1.00 141.08 ? 178 SER B CA  1 
ATOM   2371 C C   . SER B 2 178 ? -73.183  -19.837 -7.292   1.00 140.98 ? 178 SER B C   1 
ATOM   2372 O O   . SER B 2 178 ? -73.787  -20.486 -8.154   1.00 141.12 ? 178 SER B O   1 
ATOM   2373 C CB  . SER B 2 178 ? -73.390  -21.327 -5.294   1.00 141.00 ? 178 SER B CB  1 
ATOM   2374 O OG  . SER B 2 178 ? -73.870  -21.454 -3.971   1.00 140.79 ? 178 SER B OG  1 
ATOM   2375 N N   . GLU B 2 179 ? -72.140  -19.063 -7.574   1.00 140.64 ? 179 GLU B N   1 
ATOM   2376 C CA  . GLU B 2 179 ? -71.814  -18.717 -8.956   1.00 140.32 ? 179 GLU B CA  1 
ATOM   2377 C C   . GLU B 2 179 ? -70.491  -19.296 -9.475   1.00 139.82 ? 179 GLU B C   1 
ATOM   2378 O O   . GLU B 2 179 ? -69.425  -18.719 -9.251   1.00 139.80 ? 179 GLU B O   1 
ATOM   2379 C CB  . GLU B 2 179 ? -71.880  -17.191 -9.142   1.00 140.55 ? 179 GLU B CB  1 
ATOM   2380 C CG  . GLU B 2 179 ? -73.286  -16.608 -8.887   1.00 141.23 ? 179 GLU B CG  1 
ATOM   2381 C CD  . GLU B 2 179 ? -73.371  -15.088 -9.032   1.00 142.03 ? 179 GLU B CD  1 
ATOM   2382 O OE1 . GLU B 2 179 ? -74.121  -14.467 -8.243   1.00 141.96 ? 179 GLU B OE1 1 
ATOM   2383 O OE2 . GLU B 2 179 ? -72.702  -14.517 -9.928   1.00 142.13 ? 179 GLU B OE2 1 
ATOM   2384 N N   . ARG B 2 180 ? -70.583  -20.430 -10.174  1.00 139.26 ? 180 ARG B N   1 
ATOM   2385 C CA  . ARG B 2 180 ? -69.439  -21.050 -10.883  1.00 138.75 ? 180 ARG B CA  1 
ATOM   2386 C C   . ARG B 2 180 ? -69.324  -20.598 -12.358  1.00 138.36 ? 180 ARG B C   1 
ATOM   2387 O O   . ARG B 2 180 ? -70.291  -20.083 -12.933  1.00 138.28 ? 180 ARG B O   1 
ATOM   2388 C CB  . ARG B 2 180 ? -69.501  -22.584 -10.787  1.00 138.75 ? 180 ARG B CB  1 
ATOM   2389 C CG  . ARG B 2 180 ? -70.901  -23.206 -10.988  1.00 138.64 ? 180 ARG B CG  1 
ATOM   2390 C CD  . ARG B 2 180 ? -71.296  -23.393 -12.463  1.00 137.37 ? 180 ARG B CD  1 
ATOM   2391 N NE  . ARG B 2 180 ? -70.247  -24.024 -13.265  1.00 136.95 ? 180 ARG B NE  1 
ATOM   2392 C CZ  . ARG B 2 180 ? -69.838  -25.287 -13.137  1.00 136.93 ? 180 ARG B CZ  1 
ATOM   2393 N NH1 . ARG B 2 180 ? -70.368  -26.091 -12.218  1.00 136.76 ? 180 ARG B NH1 1 
ATOM   2394 N NH2 . ARG B 2 180 ? -68.881  -25.749 -13.929  1.00 136.40 ? 180 ARG B NH2 1 
ATOM   2395 N N   . GLN B 2 181 ? -68.154  -20.800 -12.971  1.00 137.69 ? 181 GLN B N   1 
ATOM   2396 C CA  . GLN B 2 181 ? -67.887  -20.207 -14.289  1.00 136.96 ? 181 GLN B CA  1 
ATOM   2397 C C   . GLN B 2 181 ? -67.323  -21.148 -15.369  1.00 136.30 ? 181 GLN B C   1 
ATOM   2398 O O   . GLN B 2 181 ? -67.736  -21.063 -16.528  1.00 136.41 ? 181 GLN B O   1 
ATOM   2399 C CB  . GLN B 2 181 ? -67.000  -18.967 -14.143  1.00 137.02 ? 181 GLN B CB  1 
ATOM   2400 C CG  . GLN B 2 181 ? -67.565  -17.710 -14.811  1.00 137.83 ? 181 GLN B CG  1 
ATOM   2401 C CD  . GLN B 2 181 ? -67.544  -17.757 -16.344  1.00 139.08 ? 181 GLN B CD  1 
ATOM   2402 O OE1 . GLN B 2 181 ? -66.646  -18.346 -16.955  1.00 139.32 ? 181 GLN B OE1 1 
ATOM   2403 N NE2 . GLN B 2 181 ? -68.535  -17.116 -16.969  1.00 139.25 ? 181 GLN B NE2 1 
ATOM   2404 N N   . ASN B 2 182 ? -66.391  -22.029 -15.000  1.00 135.40 ? 182 ASN B N   1 
ATOM   2405 C CA  . ASN B 2 182 ? -65.748  -22.957 -15.959  1.00 134.44 ? 182 ASN B CA  1 
ATOM   2406 C C   . ASN B 2 182 ? -66.711  -23.717 -16.903  1.00 133.52 ? 182 ASN B C   1 
ATOM   2407 O O   . ASN B 2 182 ? -67.347  -24.699 -16.513  1.00 133.40 ? 182 ASN B O   1 
ATOM   2408 C CB  . ASN B 2 182 ? -64.787  -23.925 -15.233  1.00 134.57 ? 182 ASN B CB  1 
ATOM   2409 C CG  . ASN B 2 182 ? -65.461  -24.701 -14.085  1.00 134.98 ? 182 ASN B CG  1 
ATOM   2410 O OD1 . ASN B 2 182 ? -66.626  -24.464 -13.742  1.00 135.07 ? 182 ASN B OD1 1 
ATOM   2411 N ND2 . ASN B 2 182 ? -64.717  -25.634 -13.490  1.00 135.10 ? 182 ASN B ND2 1 
ATOM   2412 N N   . GLY B 2 183 ? -66.816  -23.244 -18.144  1.00 132.47 ? 183 GLY B N   1 
ATOM   2413 C CA  . GLY B 2 183 ? -67.686  -23.862 -19.149  1.00 131.01 ? 183 GLY B CA  1 
ATOM   2414 C C   . GLY B 2 183 ? -68.882  -23.005 -19.514  1.00 129.88 ? 183 GLY B C   1 
ATOM   2415 O O   . GLY B 2 183 ? -70.013  -23.476 -19.482  1.00 129.90 ? 183 GLY B O   1 
ATOM   2416 N N   . VAL B 2 184 ? -68.621  -21.750 -19.869  1.00 128.82 ? 184 VAL B N   1 
ATOM   2417 C CA  . VAL B 2 184 ? -69.662  -20.758 -20.166  1.00 127.75 ? 184 VAL B CA  1 
ATOM   2418 C C   . VAL B 2 184 ? -69.276  -19.920 -21.398  1.00 127.02 ? 184 VAL B C   1 
ATOM   2419 O O   . VAL B 2 184 ? -68.660  -18.855 -21.275  1.00 126.91 ? 184 VAL B O   1 
ATOM   2420 C CB  . VAL B 2 184 ? -69.939  -19.848 -18.926  1.00 127.84 ? 184 VAL B CB  1 
ATOM   2421 C CG1 . VAL B 2 184 ? -70.588  -18.523 -19.328  1.00 127.73 ? 184 VAL B CG1 1 
ATOM   2422 C CG2 . VAL B 2 184 ? -70.795  -20.578 -17.897  1.00 127.42 ? 184 VAL B CG2 1 
ATOM   2423 N N   . LEU B 2 185 ? -69.643  -20.410 -22.584  1.00 126.03 ? 185 LEU B N   1 
ATOM   2424 C CA  . LEU B 2 185 ? -69.167  -19.838 -23.860  1.00 124.90 ? 185 LEU B CA  1 
ATOM   2425 C C   . LEU B 2 185 ? -70.216  -19.024 -24.635  1.00 124.09 ? 185 LEU B C   1 
ATOM   2426 O O   . LEU B 2 185 ? -71.283  -19.534 -24.984  1.00 123.94 ? 185 LEU B O   1 
ATOM   2427 C CB  . LEU B 2 185 ? -68.580  -20.940 -24.748  1.00 124.77 ? 185 LEU B CB  1 
ATOM   2428 C CG  . LEU B 2 185 ? -67.137  -21.425 -24.553  1.00 124.58 ? 185 LEU B CG  1 
ATOM   2429 C CD1 . LEU B 2 185 ? -66.508  -21.109 -23.186  1.00 124.04 ? 185 LEU B CD1 1 
ATOM   2430 C CD2 . LEU B 2 185 ? -67.083  -22.920 -24.841  1.00 124.56 ? 185 LEU B CD2 1 
ATOM   2431 N N   . ASN B 2 186 ? -69.873  -17.770 -24.923  1.00 123.06 ? 186 ASN B N   1 
ATOM   2432 C CA  . ASN B 2 186 ? -70.803  -16.787 -25.482  1.00 122.11 ? 186 ASN B CA  1 
ATOM   2433 C C   . ASN B 2 186 ? -70.708  -16.599 -26.997  1.00 121.38 ? 186 ASN B C   1 
ATOM   2434 O O   . ASN B 2 186 ? -69.906  -17.256 -27.665  1.00 121.30 ? 186 ASN B O   1 
ATOM   2435 C CB  . ASN B 2 186 ? -70.578  -15.435 -24.801  1.00 122.16 ? 186 ASN B CB  1 
ATOM   2436 C CG  . ASN B 2 186 ? -70.780  -15.491 -23.295  1.00 122.38 ? 186 ASN B CG  1 
ATOM   2437 O OD1 . ASN B 2 186 ? -70.845  -16.567 -22.692  1.00 122.80 ? 186 ASN B OD1 1 
ATOM   2438 N ND2 . ASN B 2 186 ? -70.873  -14.321 -22.677  1.00 122.25 ? 186 ASN B ND2 1 
ATOM   2439 N N   . SER B 2 187 ? -71.562  -15.722 -27.528  1.00 120.41 ? 187 SER B N   1 
ATOM   2440 C CA  . SER B 2 187 ? -71.377  -15.136 -28.861  1.00 119.51 ? 187 SER B CA  1 
ATOM   2441 C C   . SER B 2 187 ? -72.333  -13.993 -29.186  1.00 118.81 ? 187 SER B C   1 
ATOM   2442 O O   . SER B 2 187 ? -73.558  -14.142 -29.115  1.00 118.67 ? 187 SER B O   1 
ATOM   2443 C CB  . SER B 2 187 ? -71.439  -16.168 -29.983  1.00 119.67 ? 187 SER B CB  1 
ATOM   2444 O OG  . SER B 2 187 ? -71.046  -15.552 -31.201  1.00 119.61 ? 187 SER B OG  1 
ATOM   2445 N N   . TRP B 2 188 ? -71.744  -12.863 -29.567  1.00 117.91 ? 188 TRP B N   1 
ATOM   2446 C CA  . TRP B 2 188 ? -72.482  -11.676 -29.962  1.00 116.98 ? 188 TRP B CA  1 
ATOM   2447 C C   . TRP B 2 188 ? -72.713  -11.778 -31.459  1.00 116.51 ? 188 TRP B C   1 
ATOM   2448 O O   . TRP B 2 188 ? -71.772  -12.063 -32.202  1.00 116.51 ? 188 TRP B O   1 
ATOM   2449 C CB  . TRP B 2 188 ? -71.659  -10.407 -29.671  1.00 116.82 ? 188 TRP B CB  1 
ATOM   2450 C CG  . TRP B 2 188 ? -71.296  -10.142 -28.217  1.00 115.91 ? 188 TRP B CG  1 
ATOM   2451 C CD1 . TRP B 2 188 ? -71.681  -9.063  -27.463  1.00 114.87 ? 188 TRP B CD1 1 
ATOM   2452 C CD2 . TRP B 2 188 ? -70.456  -10.950 -27.360  1.00 115.44 ? 188 TRP B CD2 1 
ATOM   2453 N NE1 . TRP B 2 188 ? -71.147  -9.154  -26.197  1.00 114.92 ? 188 TRP B NE1 1 
ATOM   2454 C CE2 . TRP B 2 188 ? -70.394  -10.300 -26.104  1.00 115.23 ? 188 TRP B CE2 1 
ATOM   2455 C CE3 . TRP B 2 188 ? -69.763  -12.166 -27.528  1.00 114.63 ? 188 TRP B CE3 1 
ATOM   2456 C CZ2 . TRP B 2 188 ? -69.660  -10.826 -25.019  1.00 114.63 ? 188 TRP B CZ2 1 
ATOM   2457 C CZ3 . TRP B 2 188 ? -69.039  -12.691 -26.446  1.00 113.91 ? 188 TRP B CZ3 1 
ATOM   2458 C CH2 . TRP B 2 188 ? -68.993  -12.016 -25.212  1.00 114.00 ? 188 TRP B CH2 1 
ATOM   2459 N N   . THR B 2 189 ? -73.947  -11.566 -31.915  1.00 115.86 ? 189 THR B N   1 
ATOM   2460 C CA  . THR B 2 189 ? -74.149  -11.370 -33.345  1.00 115.33 ? 189 THR B CA  1 
ATOM   2461 C C   . THR B 2 189 ? -73.403  -10.093 -33.706  1.00 115.22 ? 189 THR B C   1 
ATOM   2462 O O   . THR B 2 189 ? -73.236  -9.205  -32.875  1.00 115.17 ? 189 THR B O   1 
ATOM   2463 C CB  . THR B 2 189 ? -75.652  -11.267 -33.811  1.00 115.23 ? 189 THR B CB  1 
ATOM   2464 O OG1 . THR B 2 189 ? -76.231  -10.019 -33.413  1.00 114.59 ? 189 THR B OG1 1 
ATOM   2465 C CG2 . THR B 2 189 ? -76.495  -12.424 -33.302  1.00 114.99 ? 189 THR B CG2 1 
ATOM   2466 N N   . ASP B 2 190 ? -72.908  -10.028 -34.931  1.00 115.14 ? 190 ASP B N   1 
ATOM   2467 C CA  . ASP B 2 190 ? -72.430  -8.773  -35.465  1.00 114.88 ? 190 ASP B CA  1 
ATOM   2468 C C   . ASP B 2 190 ? -73.689  -7.929  -35.665  1.00 114.42 ? 190 ASP B C   1 
ATOM   2469 O O   . ASP B 2 190 ? -74.676  -8.401  -36.233  1.00 114.33 ? 190 ASP B O   1 
ATOM   2470 C CB  . ASP B 2 190 ? -71.635  -8.998  -36.766  1.00 115.10 ? 190 ASP B CB  1 
ATOM   2471 C CG  . ASP B 2 190 ? -70.339  -9.809  -36.539  1.00 115.54 ? 190 ASP B CG  1 
ATOM   2472 O OD1 . ASP B 2 190 ? -69.226  -9.230  -36.637  1.00 115.88 ? 190 ASP B OD1 1 
ATOM   2473 O OD2 . ASP B 2 190 ? -70.433  -11.025 -36.247  1.00 115.64 ? 190 ASP B OD2 1 
ATOM   2474 N N   . GLN B 2 191 ? -73.655  -6.714  -35.124  1.00 113.90 ? 191 GLN B N   1 
ATOM   2475 C CA  . GLN B 2 191 ? -74.760  -5.735  -35.149  1.00 113.40 ? 191 GLN B CA  1 
ATOM   2476 C C   . GLN B 2 191 ? -75.845  -5.939  -36.240  1.00 113.04 ? 191 GLN B C   1 
ATOM   2477 O O   . GLN B 2 191 ? -75.530  -6.103  -37.418  1.00 112.93 ? 191 GLN B O   1 
ATOM   2478 C CB  . GLN B 2 191 ? -74.151  -4.326  -35.236  1.00 113.36 ? 191 GLN B CB  1 
ATOM   2479 C CG  . GLN B 2 191 ? -75.048  -3.174  -34.825  1.00 112.77 ? 191 GLN B CG  1 
ATOM   2480 C CD  . GLN B 2 191 ? -74.396  -1.834  -35.091  1.00 111.77 ? 191 GLN B CD  1 
ATOM   2481 O OE1 . GLN B 2 191 ? -73.205  -1.658  -34.836  1.00 111.72 ? 191 GLN B OE1 1 
ATOM   2482 N NE2 . GLN B 2 191 ? -75.170  -0.883  -35.611  1.00 110.49 ? 191 GLN B NE2 1 
ATOM   2483 N N   . ASP B 2 192 ? -77.112  -5.925  -35.820  1.00 112.68 ? 192 ASP B N   1 
ATOM   2484 C CA  . ASP B 2 192 ? -78.285  -6.036  -36.703  1.00 112.43 ? 192 ASP B CA  1 
ATOM   2485 C C   . ASP B 2 192 ? -78.263  -4.945  -37.772  1.00 112.55 ? 192 ASP B C   1 
ATOM   2486 O O   . ASP B 2 192 ? -77.658  -3.898  -37.569  1.00 112.50 ? 192 ASP B O   1 
ATOM   2487 C CB  . ASP B 2 192 ? -79.555  -5.913  -35.855  1.00 112.23 ? 192 ASP B CB  1 
ATOM   2488 C CG  . ASP B 2 192 ? -80.825  -6.249  -36.617  1.00 111.65 ? 192 ASP B CG  1 
ATOM   2489 O OD1 . ASP B 2 192 ? -81.131  -5.606  -37.643  1.00 110.72 ? 192 ASP B OD1 1 
ATOM   2490 O OD2 . ASP B 2 192 ? -81.548  -7.148  -36.158  1.00 111.42 ? 192 ASP B OD2 1 
ATOM   2491 N N   . SER B 2 193 ? -78.918  -5.184  -38.906  1.00 112.73 ? 193 SER B N   1 
ATOM   2492 C CA  . SER B 2 193 ? -78.915  -4.208  -40.005  1.00 113.05 ? 193 SER B CA  1 
ATOM   2493 C C   . SER B 2 193 ? -80.219  -3.410  -40.131  1.00 113.07 ? 193 SER B C   1 
ATOM   2494 O O   . SER B 2 193 ? -80.213  -2.260  -40.570  1.00 112.73 ? 193 SER B O   1 
ATOM   2495 C CB  . SER B 2 193 ? -78.594  -4.895  -41.330  1.00 113.12 ? 193 SER B CB  1 
ATOM   2496 O OG  . SER B 2 193 ? -79.743  -5.554  -41.832  1.00 113.47 ? 193 SER B OG  1 
ATOM   2497 N N   . LYS B 2 194 ? -81.333  -4.035  -39.766  1.00 113.38 ? 194 LYS B N   1 
ATOM   2498 C CA  . LYS B 2 194 ? -82.625  -3.360  -39.758  1.00 113.72 ? 194 LYS B CA  1 
ATOM   2499 C C   . LYS B 2 194 ? -82.742  -2.497  -38.508  1.00 113.84 ? 194 LYS B C   1 
ATOM   2500 O O   . LYS B 2 194 ? -82.942  -1.283  -38.593  1.00 114.06 ? 194 LYS B O   1 
ATOM   2501 C CB  . LYS B 2 194 ? -83.761  -4.378  -39.800  1.00 113.76 ? 194 LYS B CB  1 
ATOM   2502 C CG  . LYS B 2 194 ? -84.925  -3.961  -40.670  1.00 114.12 ? 194 LYS B CG  1 
ATOM   2503 C CD  . LYS B 2 194 ? -85.811  -5.156  -40.970  1.00 114.87 ? 194 LYS B CD  1 
ATOM   2504 C CE  . LYS B 2 194 ? -86.846  -4.814  -42.022  1.00 115.67 ? 194 LYS B CE  1 
ATOM   2505 N NZ  . LYS B 2 194 ? -88.067  -5.666  -41.892  1.00 116.21 ? 194 LYS B NZ  1 
ATOM   2506 N N   . ASP B 2 195 ? -82.595  -3.139  -37.354  1.00 113.72 ? 195 ASP B N   1 
ATOM   2507 C CA  . ASP B 2 195 ? -82.701  -2.481  -36.061  1.00 113.61 ? 195 ASP B CA  1 
ATOM   2508 C C   . ASP B 2 195 ? -81.354  -1.949  -35.569  1.00 113.48 ? 195 ASP B C   1 
ATOM   2509 O O   . ASP B 2 195 ? -81.309  -1.098  -34.688  1.00 113.65 ? 195 ASP B O   1 
ATOM   2510 C CB  . ASP B 2 195 ? -83.348  -3.443  -35.052  1.00 113.83 ? 195 ASP B CB  1 
ATOM   2511 C CG  . ASP B 2 195 ? -82.478  -3.705  -33.837  1.00 113.96 ? 195 ASP B CG  1 
ATOM   2512 O OD1 . ASP B 2 195 ? -81.729  -4.705  -33.837  1.00 114.40 ? 195 ASP B OD1 1 
ATOM   2513 O OD2 . ASP B 2 195 ? -82.536  -2.907  -32.885  1.00 113.89 ? 195 ASP B OD2 1 
ATOM   2514 N N   . SER B 2 196 ? -80.267  -2.463  -36.134  1.00 113.28 ? 196 SER B N   1 
ATOM   2515 C CA  . SER B 2 196 ? -78.919  -1.951  -35.873  1.00 113.24 ? 196 SER B CA  1 
ATOM   2516 C C   . SER B 2 196 ? -78.448  -2.073  -34.428  1.00 113.15 ? 196 SER B C   1 
ATOM   2517 O O   . SER B 2 196 ? -77.780  -1.179  -33.904  1.00 113.10 ? 196 SER B O   1 
ATOM   2518 C CB  . SER B 2 196 ? -78.783  -0.507  -36.368  1.00 113.19 ? 196 SER B CB  1 
ATOM   2519 O OG  . SER B 2 196 ? -79.185  -0.419  -37.721  1.00 113.67 ? 196 SER B OG  1 
ATOM   2520 N N   . THR B 2 197 ? -78.779  -3.193  -33.795  1.00 113.25 ? 197 THR B N   1 
ATOM   2521 C CA  . THR B 2 197 ? -78.366  -3.440  -32.413  1.00 113.63 ? 197 THR B CA  1 
ATOM   2522 C C   . THR B 2 197 ? -77.904  -4.880  -32.192  1.00 113.58 ? 197 THR B C   1 
ATOM   2523 O O   . THR B 2 197 ? -78.549  -5.814  -32.671  1.00 113.70 ? 197 THR B O   1 
ATOM   2524 C CB  . THR B 2 197 ? -79.522  -3.170  -31.426  1.00 113.82 ? 197 THR B CB  1 
ATOM   2525 O OG1 . THR B 2 197 ? -80.556  -4.140  -31.633  1.00 113.92 ? 197 THR B OG1 1 
ATOM   2526 C CG2 . THR B 2 197 ? -80.085  -1.731  -31.569  1.00 114.09 ? 197 THR B CG2 1 
ATOM   2527 N N   . TYR B 2 198 ? -76.819  -5.051  -31.437  1.00 113.54 ? 198 TYR B N   1 
ATOM   2528 C CA  . TYR B 2 198 ? -76.257  -6.371  -31.123  1.00 113.98 ? 198 TYR B CA  1 
ATOM   2529 C C   . TYR B 2 198 ? -77.262  -7.385  -30.559  1.00 114.06 ? 198 TYR B C   1 
ATOM   2530 O O   . TYR B 2 198 ? -78.438  -7.077  -30.363  1.00 114.28 ? 198 TYR B O   1 
ATOM   2531 C CB  . TYR B 2 198 ? -75.121  -6.238  -30.111  1.00 114.17 ? 198 TYR B CB  1 
ATOM   2532 C CG  . TYR B 2 198 ? -73.947  -5.377  -30.530  1.00 115.75 ? 198 TYR B CG  1 
ATOM   2533 C CD1 . TYR B 2 198 ? -72.764  -5.955  -30.999  1.00 116.30 ? 198 TYR B CD1 1 
ATOM   2534 C CD2 . TYR B 2 198 ? -74.000  -3.981  -30.412  1.00 117.14 ? 198 TYR B CD2 1 
ATOM   2535 C CE1 . TYR B 2 198 ? -71.677  -5.169  -31.367  1.00 116.69 ? 198 TYR B CE1 1 
ATOM   2536 C CE2 . TYR B 2 198 ? -72.916  -3.187  -30.779  1.00 117.49 ? 198 TYR B CE2 1 
ATOM   2537 C CZ  . TYR B 2 198 ? -71.763  -3.789  -31.257  1.00 117.52 ? 198 TYR B CZ  1 
ATOM   2538 O OH  . TYR B 2 198 ? -70.696  -3.002  -31.616  1.00 118.39 ? 198 TYR B OH  1 
ATOM   2539 N N   . SER B 2 199 ? -76.776  -8.604  -30.325  1.00 114.11 ? 199 SER B N   1 
ATOM   2540 C CA  . SER B 2 199 ? -77.471  -9.648  -29.563  1.00 114.26 ? 199 SER B CA  1 
ATOM   2541 C C   . SER B 2 199 ? -76.381  -10.459 -28.872  1.00 114.76 ? 199 SER B C   1 
ATOM   2542 O O   . SER B 2 199 ? -75.212  -10.085 -28.947  1.00 115.07 ? 199 SER B O   1 
ATOM   2543 C CB  . SER B 2 199 ? -78.295  -10.547 -30.478  1.00 113.97 ? 199 SER B CB  1 
ATOM   2544 O OG  . SER B 2 199 ? -79.176  -9.786  -31.273  1.00 113.41 ? 199 SER B OG  1 
ATOM   2545 N N   . MET B 2 200 ? -76.739  -11.552 -28.205  1.00 115.24 ? 200 MET B N   1 
ATOM   2546 C CA  . MET B 2 200 ? -75.740  -12.406 -27.551  1.00 115.94 ? 200 MET B CA  1 
ATOM   2547 C C   . MET B 2 200 ? -76.355  -13.731 -27.131  1.00 116.67 ? 200 MET B C   1 
ATOM   2548 O O   . MET B 2 200 ? -77.577  -13.855 -27.120  1.00 117.02 ? 200 MET B O   1 
ATOM   2549 C CB  . MET B 2 200 ? -75.160  -11.716 -26.318  1.00 115.81 ? 200 MET B CB  1 
ATOM   2550 C CG  . MET B 2 200 ? -73.684  -11.979 -26.120  1.00 115.84 ? 200 MET B CG  1 
ATOM   2551 S SD  . MET B 2 200 ? -73.172  -12.239 -24.409  1.00 115.46 ? 200 MET B SD  1 
ATOM   2552 C CE  . MET B 2 200 ? -73.848  -13.868 -24.114  1.00 115.04 ? 200 MET B CE  1 
ATOM   2553 N N   . SER B 2 201 ? -75.522  -14.716 -26.787  1.00 117.44 ? 201 SER B N   1 
ATOM   2554 C CA  . SER B 2 201 ? -76.013  -16.010 -26.282  1.00 118.17 ? 201 SER B CA  1 
ATOM   2555 C C   . SER B 2 201 ? -74.954  -16.790 -25.505  1.00 118.73 ? 201 SER B C   1 
ATOM   2556 O O   . SER B 2 201 ? -73.992  -17.296 -26.089  1.00 118.72 ? 201 SER B O   1 
ATOM   2557 C CB  . SER B 2 201 ? -76.572  -16.879 -27.416  1.00 118.03 ? 201 SER B CB  1 
ATOM   2558 O OG  . SER B 2 201 ? -75.530  -17.463 -28.180  1.00 118.31 ? 201 SER B OG  1 
ATOM   2559 N N   . SER B 2 202 ? -75.148  -16.887 -24.190  1.00 119.51 ? 202 SER B N   1 
ATOM   2560 C CA  . SER B 2 202 ? -74.256  -17.651 -23.322  1.00 120.27 ? 202 SER B CA  1 
ATOM   2561 C C   . SER B 2 202 ? -74.749  -19.074 -23.093  1.00 120.90 ? 202 SER B C   1 
ATOM   2562 O O   . SER B 2 202 ? -75.939  -19.307 -22.893  1.00 121.10 ? 202 SER B O   1 
ATOM   2563 C CB  . SER B 2 202 ? -74.084  -16.961 -21.978  1.00 120.14 ? 202 SER B CB  1 
ATOM   2564 O OG  . SER B 2 202 ? -73.291  -17.765 -21.127  1.00 120.34 ? 202 SER B OG  1 
ATOM   2565 N N   . THR B 2 203 ? -73.815  -20.016 -23.099  1.00 121.76 ? 203 THR B N   1 
ATOM   2566 C CA  . THR B 2 203 ? -74.136  -21.427 -22.959  1.00 122.70 ? 203 THR B CA  1 
ATOM   2567 C C   . THR B 2 203 ? -73.338  -22.050 -21.823  1.00 123.39 ? 203 THR B C   1 
ATOM   2568 O O   . THR B 2 203 ? -72.109  -22.157 -21.875  1.00 123.49 ? 203 THR B O   1 
ATOM   2569 C CB  . THR B 2 203 ? -73.869  -22.203 -24.273  1.00 122.73 ? 203 THR B CB  1 
ATOM   2570 O OG1 . THR B 2 203 ? -74.730  -21.710 -25.304  1.00 122.93 ? 203 THR B OG1 1 
ATOM   2571 C CG2 . THR B 2 203 ? -74.108  -23.705 -24.094  1.00 122.81 ? 203 THR B CG2 1 
ATOM   2572 N N   . LEU B 2 204 ? -74.059  -22.459 -20.794  1.00 124.32 ? 204 LEU B N   1 
ATOM   2573 C CA  . LEU B 2 204 ? -73.482  -23.222 -19.715  1.00 125.28 ? 204 LEU B CA  1 
ATOM   2574 C C   . LEU B 2 204 ? -73.625  -24.703 -20.049  1.00 125.85 ? 204 LEU B C   1 
ATOM   2575 O O   . LEU B 2 204 ? -74.735  -25.202 -20.260  1.00 125.97 ? 204 LEU B O   1 
ATOM   2576 C CB  . LEU B 2 204 ? -74.190  -22.887 -18.412  1.00 125.31 ? 204 LEU B CB  1 
ATOM   2577 C CG  . LEU B 2 204 ? -73.328  -23.083 -17.176  1.00 125.93 ? 204 LEU B CG  1 
ATOM   2578 C CD1 . LEU B 2 204 ? -73.827  -22.149 -16.091  1.00 126.40 ? 204 LEU B CD1 1 
ATOM   2579 C CD2 . LEU B 2 204 ? -73.291  -24.557 -16.714  1.00 126.07 ? 204 LEU B CD2 1 
ATOM   2580 N N   . THR B 2 205 ? -72.500  -25.404 -20.090  1.00 126.62 ? 205 THR B N   1 
ATOM   2581 C CA  . THR B 2 205 ? -72.487  -26.757 -20.621  1.00 127.50 ? 205 THR B CA  1 
ATOM   2582 C C   . THR B 2 205 ? -71.874  -27.774 -19.649  1.00 128.04 ? 205 THR B C   1 
ATOM   2583 O O   . THR B 2 205 ? -70.654  -27.859 -19.508  1.00 128.13 ? 205 THR B O   1 
ATOM   2584 C CB  . THR B 2 205 ? -71.841  -26.790 -22.043  1.00 127.54 ? 205 THR B CB  1 
ATOM   2585 O OG1 . THR B 2 205 ? -71.660  -28.146 -22.473  1.00 127.86 ? 205 THR B OG1 1 
ATOM   2586 C CG2 . THR B 2 205 ? -70.500  -26.034 -22.074  1.00 127.58 ? 205 THR B CG2 1 
ATOM   2587 N N   . LEU B 2 206 ? -72.749  -28.537 -18.987  1.00 128.83 ? 206 LEU B N   1 
ATOM   2588 C CA  . LEU B 2 206 ? -72.367  -29.523 -17.964  1.00 129.70 ? 206 LEU B CA  1 
ATOM   2589 C C   . LEU B 2 206 ? -72.269  -30.957 -18.484  1.00 130.33 ? 206 LEU B C   1 
ATOM   2590 O O   . LEU B 2 206 ? -72.351  -31.203 -19.694  1.00 130.42 ? 206 LEU B O   1 
ATOM   2591 C CB  . LEU B 2 206 ? -73.370  -29.492 -16.804  1.00 129.58 ? 206 LEU B CB  1 
ATOM   2592 C CG  . LEU B 2 206 ? -73.097  -28.496 -15.678  1.00 130.04 ? 206 LEU B CG  1 
ATOM   2593 C CD1 . LEU B 2 206 ? -74.392  -28.075 -14.990  1.00 130.08 ? 206 LEU B CD1 1 
ATOM   2594 C CD2 . LEU B 2 206 ? -72.092  -29.060 -14.670  1.00 130.13 ? 206 LEU B CD2 1 
ATOM   2595 N N   . THR B 2 207 ? -72.077  -31.897 -17.555  1.00 131.04 ? 207 THR B N   1 
ATOM   2596 C CA  . THR B 2 207 ? -72.275  -33.324 -17.849  1.00 131.57 ? 207 THR B CA  1 
ATOM   2597 C C   . THR B 2 207 ? -73.755  -33.679 -17.570  1.00 131.83 ? 207 THR B C   1 
ATOM   2598 O O   . THR B 2 207 ? -74.464  -32.907 -16.904  1.00 131.93 ? 207 THR B O   1 
ATOM   2599 C CB  . THR B 2 207 ? -71.276  -34.266 -17.069  1.00 131.51 ? 207 THR B CB  1 
ATOM   2600 O OG1 . THR B 2 207 ? -71.768  -34.546 -15.753  1.00 131.60 ? 207 THR B OG1 1 
ATOM   2601 C CG2 . THR B 2 207 ? -69.862  -33.661 -16.982  1.00 131.16 ? 207 THR B CG2 1 
ATOM   2602 N N   . LYS B 2 208 ? -74.217  -34.817 -18.093  1.00 131.96 ? 208 LYS B N   1 
ATOM   2603 C CA  . LYS B 2 208 ? -75.589  -35.303 -17.865  1.00 132.20 ? 208 LYS B CA  1 
ATOM   2604 C C   . LYS B 2 208 ? -75.993  -35.313 -16.383  1.00 132.35 ? 208 LYS B C   1 
ATOM   2605 O O   . LYS B 2 208 ? -77.094  -34.875 -16.027  1.00 132.07 ? 208 LYS B O   1 
ATOM   2606 C CB  . LYS B 2 208 ? -75.744  -36.714 -18.450  1.00 132.21 ? 208 LYS B CB  1 
ATOM   2607 C CG  . LYS B 2 208 ? -77.112  -37.371 -18.250  1.00 132.16 ? 208 LYS B CG  1 
ATOM   2608 C CD  . LYS B 2 208 ? -77.046  -38.857 -18.588  1.00 131.84 ? 208 LYS B CD  1 
ATOM   2609 C CE  . LYS B 2 208 ? -78.412  -39.521 -18.535  1.00 131.64 ? 208 LYS B CE  1 
ATOM   2610 N NZ  . LYS B 2 208 ? -78.344  -40.905 -19.086  1.00 131.36 ? 208 LYS B NZ  1 
ATOM   2611 N N   . ASP B 2 209 ? -75.074  -35.803 -15.544  1.00 132.73 ? 209 ASP B N   1 
ATOM   2612 C CA  . ASP B 2 209 ? -75.317  -36.100 -14.124  1.00 133.02 ? 209 ASP B CA  1 
ATOM   2613 C C   . ASP B 2 209 ? -75.038  -34.928 -13.178  1.00 133.15 ? 209 ASP B C   1 
ATOM   2614 O O   . ASP B 2 209 ? -75.753  -34.735 -12.194  1.00 133.12 ? 209 ASP B O   1 
ATOM   2615 C CB  . ASP B 2 209 ? -74.501  -37.332 -13.693  1.00 133.03 ? 209 ASP B CB  1 
ATOM   2616 C CG  . ASP B 2 209 ? -74.799  -38.573 -14.544  1.00 132.98 ? 209 ASP B CG  1 
ATOM   2617 O OD1 . ASP B 2 209 ? -75.205  -39.609 -13.970  1.00 133.05 ? 209 ASP B OD1 1 
ATOM   2618 O OD2 . ASP B 2 209 ? -74.626  -38.519 -15.782  1.00 132.47 ? 209 ASP B OD2 1 
ATOM   2619 N N   . GLU B 2 210 ? -74.001  -34.153 -13.481  1.00 133.44 ? 210 GLU B N   1 
ATOM   2620 C CA  . GLU B 2 210 ? -73.675  -32.940 -12.726  1.00 133.99 ? 210 GLU B CA  1 
ATOM   2621 C C   . GLU B 2 210 ? -74.764  -31.842 -12.762  1.00 134.22 ? 210 GLU B C   1 
ATOM   2622 O O   . GLU B 2 210 ? -74.704  -30.893 -11.974  1.00 134.25 ? 210 GLU B O   1 
ATOM   2623 C CB  . GLU B 2 210 ? -72.353  -32.340 -13.227  1.00 134.12 ? 210 GLU B CB  1 
ATOM   2624 C CG  . GLU B 2 210 ? -71.080  -33.075 -12.813  1.00 134.70 ? 210 GLU B CG  1 
ATOM   2625 C CD  . GLU B 2 210 ? -69.819  -32.527 -13.499  1.00 135.42 ? 210 GLU B CD  1 
ATOM   2626 O OE1 . GLU B 2 210 ? -69.924  -31.570 -14.299  1.00 135.93 ? 210 GLU B OE1 1 
ATOM   2627 O OE2 . GLU B 2 210 ? -68.717  -33.062 -13.241  1.00 135.39 ? 210 GLU B OE2 1 
ATOM   2628 N N   . TYR B 2 211 ? -75.735  -31.959 -13.672  1.00 134.47 ? 211 TYR B N   1 
ATOM   2629 C CA  . TYR B 2 211 ? -76.763  -30.913 -13.873  1.00 134.66 ? 211 TYR B CA  1 
ATOM   2630 C C   . TYR B 2 211 ? -77.786  -30.842 -12.737  1.00 134.80 ? 211 TYR B C   1 
ATOM   2631 O O   . TYR B 2 211 ? -78.239  -29.756 -12.380  1.00 134.73 ? 211 TYR B O   1 
ATOM   2632 C CB  . TYR B 2 211 ? -77.442  -31.055 -15.262  1.00 134.77 ? 211 TYR B CB  1 
ATOM   2633 C CG  . TYR B 2 211 ? -78.815  -30.383 -15.452  1.00 134.43 ? 211 TYR B CG  1 
ATOM   2634 C CD1 . TYR B 2 211 ? -78.964  -28.991 -15.415  1.00 133.61 ? 211 TYR B CD1 1 
ATOM   2635 C CD2 . TYR B 2 211 ? -79.958  -31.155 -15.709  1.00 134.24 ? 211 TYR B CD2 1 
ATOM   2636 C CE1 . TYR B 2 211 ? -80.220  -28.393 -15.599  1.00 133.20 ? 211 TYR B CE1 1 
ATOM   2637 C CE2 . TYR B 2 211 ? -81.214  -30.565 -15.896  1.00 133.50 ? 211 TYR B CE2 1 
ATOM   2638 C CZ  . TYR B 2 211 ? -81.338  -29.189 -15.836  1.00 133.25 ? 211 TYR B CZ  1 
ATOM   2639 O OH  . TYR B 2 211 ? -82.580  -28.617 -16.012  1.00 132.58 ? 211 TYR B OH  1 
ATOM   2640 N N   . GLU B 2 212 ? -78.127  -31.993 -12.162  1.00 135.05 ? 212 GLU B N   1 
ATOM   2641 C CA  . GLU B 2 212 ? -79.115  -32.064 -11.079  1.00 135.28 ? 212 GLU B CA  1 
ATOM   2642 C C   . GLU B 2 212 ? -78.508  -31.853 -9.683   1.00 135.39 ? 212 GLU B C   1 
ATOM   2643 O O   . GLU B 2 212 ? -79.168  -32.093 -8.670   1.00 135.32 ? 212 GLU B O   1 
ATOM   2644 C CB  . GLU B 2 212 ? -79.873  -33.384 -11.160  1.00 135.27 ? 212 GLU B CB  1 
ATOM   2645 C CG  . GLU B 2 212 ? -80.592  -33.560 -12.482  1.00 135.35 ? 212 GLU B CG  1 
ATOM   2646 C CD  . GLU B 2 212 ? -80.346  -34.913 -13.109  1.00 136.02 ? 212 GLU B CD  1 
ATOM   2647 O OE1 . GLU B 2 212 ? -79.196  -35.402 -13.054  1.00 136.37 ? 212 GLU B OE1 1 
ATOM   2648 O OE2 . GLU B 2 212 ? -81.303  -35.485 -13.672  1.00 136.39 ? 212 GLU B OE2 1 
ATOM   2649 N N   . ARG B 2 213 ? -77.255  -31.387 -9.660   1.00 135.61 ? 213 ARG B N   1 
ATOM   2650 C CA  . ARG B 2 213 ? -76.514  -31.019 -8.445   1.00 135.76 ? 213 ARG B CA  1 
ATOM   2651 C C   . ARG B 2 213 ? -77.253  -29.976 -7.604   1.00 135.89 ? 213 ARG B C   1 
ATOM   2652 O O   . ARG B 2 213 ? -77.297  -30.082 -6.380   1.00 135.94 ? 213 ARG B O   1 
ATOM   2653 C CB  . ARG B 2 213 ? -75.117  -30.492 -8.823   1.00 135.81 ? 213 ARG B CB  1 
ATOM   2654 C CG  . ARG B 2 213 ? -74.133  -30.320 -7.663   1.00 135.55 ? 213 ARG B CG  1 
ATOM   2655 C CD  . ARG B 2 213 ? -72.926  -29.487 -8.084   1.00 134.90 ? 213 ARG B CD  1 
ATOM   2656 N NE  . ARG B 2 213 ? -71.794  -30.283 -8.570   1.00 134.12 ? 213 ARG B NE  1 
ATOM   2657 C CZ  . ARG B 2 213 ? -71.436  -30.419 -9.848   1.00 133.38 ? 213 ARG B CZ  1 
ATOM   2658 N NH1 . ARG B 2 213 ? -72.123  -29.828 -10.815  1.00 132.89 ? 213 ARG B NH1 1 
ATOM   2659 N NH2 . ARG B 2 213 ? -70.379  -31.158 -10.158  1.00 133.33 ? 213 ARG B NH2 1 
ATOM   2660 N N   . HIS B 2 214 ? -77.814  -28.968 -8.270   1.00 136.08 ? 214 HIS B N   1 
ATOM   2661 C CA  . HIS B 2 214 ? -78.654  -27.959 -7.624   1.00 136.29 ? 214 HIS B CA  1 
ATOM   2662 C C   . HIS B 2 214 ? -80.063  -27.980 -8.228   1.00 136.22 ? 214 HIS B C   1 
ATOM   2663 O O   . HIS B 2 214 ? -80.426  -28.904 -8.971   1.00 136.20 ? 214 HIS B O   1 
ATOM   2664 C CB  . HIS B 2 214 ? -78.054  -26.560 -7.793   1.00 136.52 ? 214 HIS B CB  1 
ATOM   2665 C CG  . HIS B 2 214 ? -76.706  -26.380 -7.160   1.00 137.12 ? 214 HIS B CG  1 
ATOM   2666 N ND1 . HIS B 2 214 ? -76.432  -25.352 -6.282   1.00 137.64 ? 214 HIS B ND1 1 
ATOM   2667 C CD2 . HIS B 2 214 ? -75.547  -27.070 -7.303   1.00 137.30 ? 214 HIS B CD2 1 
ATOM   2668 C CE1 . HIS B 2 214 ? -75.169  -25.426 -5.900   1.00 137.93 ? 214 HIS B CE1 1 
ATOM   2669 N NE2 . HIS B 2 214 ? -74.610  -26.461 -6.503   1.00 137.81 ? 214 HIS B NE2 1 
ATOM   2670 N N   . ASN B 2 215 ? -80.849  -26.955 -7.912   1.00 136.12 ? 215 ASN B N   1 
ATOM   2671 C CA  . ASN B 2 215 ? -82.211  -26.848 -8.427   1.00 136.06 ? 215 ASN B CA  1 
ATOM   2672 C C   . ASN B 2 215 ? -82.453  -25.562 -9.221   1.00 135.92 ? 215 ASN B C   1 
ATOM   2673 O O   . ASN B 2 215 ? -82.771  -25.610 -10.415  1.00 136.08 ? 215 ASN B O   1 
ATOM   2674 C CB  . ASN B 2 215 ? -83.235  -26.979 -7.294   1.00 136.08 ? 215 ASN B CB  1 
ATOM   2675 C CG  . ASN B 2 215 ? -84.657  -27.112 -7.807   1.00 136.15 ? 215 ASN B CG  1 
ATOM   2676 O OD1 . ASN B 2 215 ? -84.980  -28.060 -8.531   1.00 136.14 ? 215 ASN B OD1 1 
ATOM   2677 N ND2 . ASN B 2 215 ? -85.517  -26.164 -7.431   1.00 135.70 ? 215 ASN B ND2 1 
ATOM   2678 N N   . SER B 2 216 ? -82.304  -24.417 -8.561   1.00 135.48 ? 216 SER B N   1 
ATOM   2679 C CA  . SER B 2 216 ? -82.522  -23.138 -9.222   1.00 135.08 ? 216 SER B CA  1 
ATOM   2680 C C   . SER B 2 216 ? -81.327  -22.750 -10.090  1.00 134.63 ? 216 SER B C   1 
ATOM   2681 O O   . SER B 2 216 ? -80.169  -22.940 -9.703   1.00 134.65 ? 216 SER B O   1 
ATOM   2682 C CB  . SER B 2 216 ? -82.833  -22.038 -8.206   1.00 135.22 ? 216 SER B CB  1 
ATOM   2683 O OG  . SER B 2 216 ? -83.412  -20.910 -8.844   1.00 135.56 ? 216 SER B OG  1 
ATOM   2684 N N   . TYR B 2 217 ? -81.635  -22.227 -11.274  1.00 133.98 ? 217 TYR B N   1 
ATOM   2685 C CA  . TYR B 2 217 ? -80.650  -21.684 -12.197  1.00 133.19 ? 217 TYR B CA  1 
ATOM   2686 C C   . TYR B 2 217 ? -81.122  -20.334 -12.712  1.00 132.65 ? 217 TYR B C   1 
ATOM   2687 O O   . TYR B 2 217 ? -82.323  -20.094 -12.847  1.00 132.58 ? 217 TYR B O   1 
ATOM   2688 C CB  . TYR B 2 217 ? -80.504  -22.596 -13.405  1.00 133.25 ? 217 TYR B CB  1 
ATOM   2689 C CG  . TYR B 2 217 ? -79.820  -23.914 -13.172  1.00 133.18 ? 217 TYR B CG  1 
ATOM   2690 C CD1 . TYR B 2 217 ? -78.440  -23.982 -12.988  1.00 133.48 ? 217 TYR B CD1 1 
ATOM   2691 C CD2 . TYR B 2 217 ? -80.544  -25.103 -13.193  1.00 133.07 ? 217 TYR B CD2 1 
ATOM   2692 C CE1 . TYR B 2 217 ? -77.800  -25.204 -12.802  1.00 133.71 ? 217 TYR B CE1 1 
ATOM   2693 C CE2 . TYR B 2 217 ? -79.917  -26.327 -13.006  1.00 133.31 ? 217 TYR B CE2 1 
ATOM   2694 C CZ  . TYR B 2 217 ? -78.546  -26.372 -12.812  1.00 133.53 ? 217 TYR B CZ  1 
ATOM   2695 O OH  . TYR B 2 217 ? -77.917  -27.582 -12.626  1.00 133.32 ? 217 TYR B OH  1 
ATOM   2696 N N   . THR B 2 218 ? -80.173  -19.460 -13.022  1.00 132.00 ? 218 THR B N   1 
ATOM   2697 C CA  . THR B 2 218 ? -80.488  -18.196 -13.698  1.00 131.46 ? 218 THR B CA  1 
ATOM   2698 C C   . THR B 2 218 ? -79.265  -17.582 -14.402  1.00 130.85 ? 218 THR B C   1 
ATOM   2699 O O   . THR B 2 218 ? -78.147  -18.097 -14.310  1.00 130.72 ? 218 THR B O   1 
ATOM   2700 C CB  . THR B 2 218 ? -81.203  -17.173 -12.744  1.00 131.50 ? 218 THR B CB  1 
ATOM   2701 O OG1 . THR B 2 218 ? -81.235  -15.872 -13.346  1.00 131.75 ? 218 THR B OG1 1 
ATOM   2702 C CG2 . THR B 2 218 ? -80.542  -17.107 -11.368  1.00 131.60 ? 218 THR B CG2 1 
ATOM   2703 N N   . CYS B 2 219 ? -79.498  -16.509 -15.145  1.00 130.04 ? 219 CYS B N   1 
ATOM   2704 C CA  . CYS B 2 219 ? -78.408  -15.700 -15.659  1.00 129.34 ? 219 CYS B CA  1 
ATOM   2705 C C   . CYS B 2 219 ? -78.799  -14.236 -15.572  1.00 129.39 ? 219 CYS B C   1 
ATOM   2706 O O   . CYS B 2 219 ? -79.988  -13.896 -15.591  1.00 129.24 ? 219 CYS B O   1 
ATOM   2707 C CB  . CYS B 2 219 ? -77.988  -16.120 -17.086  1.00 129.08 ? 219 CYS B CB  1 
ATOM   2708 S SG  . CYS B 2 219 ? -79.106  -15.732 -18.507  1.00 127.44 ? 219 CYS B SG  1 
ATOM   2709 N N   . GLU B 2 220 ? -77.799  -13.374 -15.446  1.00 129.43 ? 220 GLU B N   1 
ATOM   2710 C CA  . GLU B 2 220 ? -78.053  -11.949 -15.375  1.00 129.69 ? 220 GLU B CA  1 
ATOM   2711 C C   . GLU B 2 220 ? -77.202  -11.158 -16.343  1.00 129.67 ? 220 GLU B C   1 
ATOM   2712 O O   . GLU B 2 220 ? -76.053  -11.503 -16.599  1.00 129.46 ? 220 GLU B O   1 
ATOM   2713 C CB  . GLU B 2 220 ? -77.818  -11.424 -13.958  1.00 129.95 ? 220 GLU B CB  1 
ATOM   2714 C CG  . GLU B 2 220 ? -78.897  -11.779 -12.955  1.00 130.38 ? 220 GLU B CG  1 
ATOM   2715 C CD  . GLU B 2 220 ? -78.888  -10.880 -11.728  1.00 131.04 ? 220 GLU B CD  1 
ATOM   2716 O OE1 . GLU B 2 220 ? -77.993  -10.012 -11.606  1.00 130.81 ? 220 GLU B OE1 1 
ATOM   2717 O OE2 . GLU B 2 220 ? -79.784  -11.052 -10.876  1.00 131.73 ? 220 GLU B OE2 1 
ATOM   2718 N N   . ALA B 2 221 ? -77.789  -10.092 -16.871  1.00 129.93 ? 221 ALA B N   1 
ATOM   2719 C CA  . ALA B 2 221 ? -77.052  -9.073  -17.600  1.00 130.51 ? 221 ALA B CA  1 
ATOM   2720 C C   . ALA B 2 221 ? -76.509  -8.032  -16.615  1.00 130.89 ? 221 ALA B C   1 
ATOM   2721 O O   . ALA B 2 221 ? -76.662  -8.187  -15.399  1.00 131.12 ? 221 ALA B O   1 
ATOM   2722 C CB  . ALA B 2 221 ? -77.958  -8.411  -18.613  1.00 130.58 ? 221 ALA B CB  1 
ATOM   2723 N N   . THR B 2 222 ? -75.863  -6.992  -17.146  1.00 131.14 ? 222 THR B N   1 
ATOM   2724 C CA  . THR B 2 222 ? -75.435  -5.815  -16.371  1.00 131.28 ? 222 THR B CA  1 
ATOM   2725 C C   . THR B 2 222 ? -75.353  -4.606  -17.305  1.00 131.25 ? 222 THR B C   1 
ATOM   2726 O O   . THR B 2 222 ? -75.040  -3.489  -16.883  1.00 131.15 ? 222 THR B O   1 
ATOM   2727 C CB  . THR B 2 222 ? -74.082  -6.039  -15.617  1.00 131.38 ? 222 THR B CB  1 
ATOM   2728 O OG1 . THR B 2 222 ? -73.293  -7.016  -16.306  1.00 131.55 ? 222 THR B OG1 1 
ATOM   2729 C CG2 . THR B 2 222 ? -74.319  -6.529  -14.188  1.00 131.34 ? 222 THR B CG2 1 
ATOM   2730 N N   . HIS B 2 223 ? -75.664  -4.868  -18.575  1.00 131.31 ? 223 HIS B N   1 
ATOM   2731 C CA  . HIS B 2 223 ? -75.664  -3.893  -19.670  1.00 131.53 ? 223 HIS B CA  1 
ATOM   2732 C C   . HIS B 2 223 ? -76.063  -2.463  -19.285  1.00 131.85 ? 223 HIS B C   1 
ATOM   2733 O O   . HIS B 2 223 ? -77.097  -2.221  -18.661  1.00 131.77 ? 223 HIS B O   1 
ATOM   2734 C CB  . HIS B 2 223 ? -76.539  -4.413  -20.812  1.00 131.38 ? 223 HIS B CB  1 
ATOM   2735 C CG  . HIS B 2 223 ? -76.548  -3.534  -22.022  1.00 131.02 ? 223 HIS B CG  1 
ATOM   2736 N ND1 . HIS B 2 223 ? -77.449  -2.503  -22.186  1.00 130.60 ? 223 HIS B ND1 1 
ATOM   2737 C CD2 . HIS B 2 223 ? -75.773  -3.537  -23.132  1.00 130.61 ? 223 HIS B CD2 1 
ATOM   2738 C CE1 . HIS B 2 223 ? -77.222  -1.906  -23.341  1.00 130.20 ? 223 HIS B CE1 1 
ATOM   2739 N NE2 . HIS B 2 223 ? -76.212  -2.514  -23.935  1.00 130.06 ? 223 HIS B NE2 1 
ATOM   2740 N N   . LYS B 2 224 ? -75.230  -1.522  -19.713  1.00 132.36 ? 224 LYS B N   1 
ATOM   2741 C CA  . LYS B 2 224 ? -75.248  -0.152  -19.224  1.00 132.81 ? 224 LYS B CA  1 
ATOM   2742 C C   . LYS B 2 224 ? -76.371  0.723   -19.796  1.00 133.10 ? 224 LYS B C   1 
ATOM   2743 O O   . LYS B 2 224 ? -76.114  1.838   -20.255  1.00 133.15 ? 224 LYS B O   1 
ATOM   2744 C CB  . LYS B 2 224 ? -73.876  0.500   -19.476  1.00 132.85 ? 224 LYS B CB  1 
ATOM   2745 C CG  . LYS B 2 224 ? -73.439  1.476   -18.398  1.00 132.97 ? 224 LYS B CG  1 
ATOM   2746 C CD  . LYS B 2 224 ? -72.441  2.488   -18.932  1.00 133.11 ? 224 LYS B CD  1 
ATOM   2747 C CE  . LYS B 2 224 ? -72.234  3.630   -17.935  1.00 133.41 ? 224 LYS B CE  1 
ATOM   2748 N NZ  . LYS B 2 224 ? -73.470  4.440   -17.679  1.00 133.00 ? 224 LYS B NZ  1 
ATOM   2749 N N   . THR B 2 225 ? -77.605  0.223   -19.784  1.00 133.53 ? 225 THR B N   1 
ATOM   2750 C CA  . THR B 2 225 ? -78.774  1.110   -19.918  1.00 134.15 ? 225 THR B CA  1 
ATOM   2751 C C   . THR B 2 225 ? -79.128  1.612   -18.522  1.00 134.55 ? 225 THR B C   1 
ATOM   2752 O O   . THR B 2 225 ? -79.485  2.782   -18.331  1.00 134.65 ? 225 THR B O   1 
ATOM   2753 C CB  . THR B 2 225 ? -79.991  0.442   -20.585  1.00 134.08 ? 225 THR B CB  1 
ATOM   2754 O OG1 . THR B 2 225 ? -79.705  -0.939  -20.852  1.00 134.49 ? 225 THR B OG1 1 
ATOM   2755 C CG2 . THR B 2 225 ? -80.316  1.149   -21.885  1.00 133.91 ? 225 THR B CG2 1 
ATOM   2756 N N   . SER B 2 226 ? -79.050  0.682   -17.568  1.00 134.93 ? 226 SER B N   1 
ATOM   2757 C CA  . SER B 2 226 ? -78.775  0.956   -16.156  1.00 135.23 ? 226 SER B CA  1 
ATOM   2758 C C   . SER B 2 226 ? -78.203  -0.332  -15.564  1.00 135.39 ? 226 SER B C   1 
ATOM   2759 O O   . SER B 2 226 ? -78.722  -1.425  -15.817  1.00 135.50 ? 226 SER B O   1 
ATOM   2760 C CB  . SER B 2 226 ? -80.011  1.426   -15.379  1.00 135.24 ? 226 SER B CB  1 
ATOM   2761 O OG  . SER B 2 226 ? -79.626  2.057   -14.160  1.00 135.12 ? 226 SER B OG  1 
ATOM   2762 N N   . THR B 2 227 ? -77.125  -0.204  -14.794  1.00 135.55 ? 227 THR B N   1 
ATOM   2763 C CA  . THR B 2 227 ? -76.426  -1.370  -14.244  1.00 135.70 ? 227 THR B CA  1 
ATOM   2764 C C   . THR B 2 227 ? -77.216  -2.025  -13.087  1.00 135.46 ? 227 THR B C   1 
ATOM   2765 O O   . THR B 2 227 ? -76.678  -2.369  -12.023  1.00 135.22 ? 227 THR B O   1 
ATOM   2766 C CB  . THR B 2 227 ? -74.931  -1.055  -13.911  1.00 135.93 ? 227 THR B CB  1 
ATOM   2767 O OG1 . THR B 2 227 ? -74.839  0.138   -13.120  1.00 136.26 ? 227 THR B OG1 1 
ATOM   2768 C CG2 . THR B 2 227 ? -74.131  -0.852  -15.203  1.00 135.96 ? 227 THR B CG2 1 
ATOM   2769 N N   . SER B 2 228 ? -78.513  -2.173  -13.349  1.00 135.26 ? 228 SER B N   1 
ATOM   2770 C CA  . SER B 2 228 ? -79.451  -2.910  -12.522  1.00 135.11 ? 228 SER B CA  1 
ATOM   2771 C C   . SER B 2 228 ? -79.631  -4.284  -13.191  1.00 134.79 ? 228 SER B C   1 
ATOM   2772 O O   . SER B 2 228 ? -80.453  -4.428  -14.104  1.00 134.63 ? 228 SER B O   1 
ATOM   2773 C CB  . SER B 2 228 ? -80.793  -2.163  -12.457  1.00 135.33 ? 228 SER B CB  1 
ATOM   2774 O OG  . SER B 2 228 ? -80.640  -0.768  -12.692  1.00 135.45 ? 228 SER B OG  1 
ATOM   2775 N N   . PRO B 2 229 ? -78.854  -5.292  -12.742  1.00 134.54 ? 229 PRO B N   1 
ATOM   2776 C CA  . PRO B 2 229 ? -78.638  -6.555  -13.471  1.00 134.32 ? 229 PRO B CA  1 
ATOM   2777 C C   . PRO B 2 229 ? -79.886  -7.390  -13.786  1.00 134.11 ? 229 PRO B C   1 
ATOM   2778 O O   . PRO B 2 229 ? -80.309  -8.196  -12.957  1.00 134.15 ? 229 PRO B O   1 
ATOM   2779 C CB  . PRO B 2 229 ? -77.670  -7.324  -12.561  1.00 134.21 ? 229 PRO B CB  1 
ATOM   2780 C CG  . PRO B 2 229 ? -76.993  -6.269  -11.754  1.00 134.54 ? 229 PRO B CG  1 
ATOM   2781 C CD  . PRO B 2 229 ? -78.057  -5.245  -11.501  1.00 134.54 ? 229 PRO B CD  1 
ATOM   2782 N N   . ILE B 2 230 ? -80.432  -7.206  -14.998  1.00 133.96 ? 230 ILE B N   1 
ATOM   2783 C CA  . ILE B 2 230 ? -81.615  -7.936  -15.513  1.00 133.58 ? 230 ILE B CA  1 
ATOM   2784 C C   . ILE B 2 230 ? -81.489  -9.459  -15.344  1.00 133.65 ? 230 ILE B C   1 
ATOM   2785 O O   . ILE B 2 230 ? -80.604  -10.091 -15.926  1.00 133.77 ? 230 ILE B O   1 
ATOM   2786 C CB  . ILE B 2 230 ? -81.915  -7.587  -17.009  1.00 133.34 ? 230 ILE B CB  1 
ATOM   2787 C CG1 . ILE B 2 230 ? -82.142  -6.086  -17.181  1.00 133.13 ? 230 ILE B CG1 1 
ATOM   2788 C CG2 . ILE B 2 230 ? -83.131  -8.348  -17.516  1.00 132.79 ? 230 ILE B CG2 1 
ATOM   2789 C CD1 . ILE B 2 230 ? -81.898  -5.581  -18.586  1.00 132.96 ? 230 ILE B CD1 1 
ATOM   2790 N N   . VAL B 2 231 ? -82.392  -10.027 -14.546  1.00 133.58 ? 231 VAL B N   1 
ATOM   2791 C CA  . VAL B 2 231 ? -82.356  -11.443 -14.164  1.00 133.45 ? 231 VAL B CA  1 
ATOM   2792 C C   . VAL B 2 231 ? -83.524  -12.256 -14.773  1.00 133.39 ? 231 VAL B C   1 
ATOM   2793 O O   . VAL B 2 231 ? -84.655  -11.761 -14.879  1.00 133.53 ? 231 VAL B O   1 
ATOM   2794 C CB  . VAL B 2 231 ? -82.295  -11.580 -12.602  1.00 133.44 ? 231 VAL B CB  1 
ATOM   2795 C CG1 . VAL B 2 231 ? -83.464  -10.843 -11.915  1.00 133.50 ? 231 VAL B CG1 1 
ATOM   2796 C CG2 . VAL B 2 231 ? -82.194  -13.035 -12.154  1.00 133.37 ? 231 VAL B CG2 1 
ATOM   2797 N N   . LYS B 2 232 ? -83.237  -13.488 -15.191  1.00 133.08 ? 232 LYS B N   1 
ATOM   2798 C CA  . LYS B 2 232 ? -84.272  -14.398 -15.682  1.00 132.80 ? 232 LYS B CA  1 
ATOM   2799 C C   . LYS B 2 232 ? -83.905  -15.823 -15.290  1.00 132.83 ? 232 LYS B C   1 
ATOM   2800 O O   . LYS B 2 232 ? -82.802  -16.294 -15.595  1.00 132.72 ? 232 LYS B O   1 
ATOM   2801 C CB  . LYS B 2 232 ? -84.438  -14.264 -17.195  1.00 132.72 ? 232 LYS B CB  1 
ATOM   2802 C CG  . LYS B 2 232 ? -85.857  -14.459 -17.704  1.00 132.21 ? 232 LYS B CG  1 
ATOM   2803 C CD  . LYS B 2 232 ? -86.128  -15.910 -18.061  1.00 131.05 ? 232 LYS B CD  1 
ATOM   2804 C CE  . LYS B 2 232 ? -87.383  -16.041 -18.901  1.00 130.56 ? 232 LYS B CE  1 
ATOM   2805 N NZ  . LYS B 2 232 ? -87.839  -17.452 -18.979  1.00 129.94 ? 232 LYS B NZ  1 
ATOM   2806 N N   . SER B 2 233 ? -84.843  -16.502 -14.628  1.00 132.84 ? 233 SER B N   1 
ATOM   2807 C CA  . SER B 2 233 ? -84.553  -17.737 -13.892  1.00 132.79 ? 233 SER B CA  1 
ATOM   2808 C C   . SER B 2 233 ? -85.497  -18.905 -14.199  1.00 132.71 ? 233 SER B C   1 
ATOM   2809 O O   . SER B 2 233 ? -86.571  -18.715 -14.765  1.00 132.65 ? 233 SER B O   1 
ATOM   2810 C CB  . SER B 2 233 ? -84.589  -17.433 -12.390  1.00 132.82 ? 233 SER B CB  1 
ATOM   2811 O OG  . SER B 2 233 ? -83.744  -18.300 -11.657  1.00 132.97 ? 233 SER B OG  1 
ATOM   2812 N N   . PHE B 2 234 ? -85.066  -20.111 -13.836  1.00 132.78 ? 234 PHE B N   1 
ATOM   2813 C CA  . PHE B 2 234 ? -85.944  -21.281 -13.747  1.00 133.10 ? 234 PHE B CA  1 
ATOM   2814 C C   . PHE B 2 234 ? -85.376  -22.259 -12.714  1.00 133.35 ? 234 PHE B C   1 
ATOM   2815 O O   . PHE B 2 234 ? -84.275  -22.041 -12.209  1.00 133.37 ? 234 PHE B O   1 
ATOM   2816 C CB  . PHE B 2 234 ? -86.163  -21.939 -15.123  1.00 133.11 ? 234 PHE B CB  1 
ATOM   2817 C CG  . PHE B 2 234 ? -85.160  -23.015 -15.478  1.00 133.25 ? 234 PHE B CG  1 
ATOM   2818 C CD1 . PHE B 2 234 ? -85.499  -24.366 -15.368  1.00 133.23 ? 234 PHE B CD1 1 
ATOM   2819 C CD2 . PHE B 2 234 ? -83.892  -22.683 -15.955  1.00 133.48 ? 234 PHE B CD2 1 
ATOM   2820 C CE1 . PHE B 2 234 ? -84.577  -25.370 -15.703  1.00 133.24 ? 234 PHE B CE1 1 
ATOM   2821 C CE2 . PHE B 2 234 ? -82.963  -23.682 -16.297  1.00 133.19 ? 234 PHE B CE2 1 
ATOM   2822 C CZ  . PHE B 2 234 ? -83.307  -25.024 -16.166  1.00 133.01 ? 234 PHE B CZ  1 
ATOM   2823 N N   . ASN B 2 235 ? -86.124  -23.314 -12.382  1.00 133.67 ? 235 ASN B N   1 
ATOM   2824 C CA  . ASN B 2 235 ? -85.629  -24.340 -11.446  1.00 133.81 ? 235 ASN B CA  1 
ATOM   2825 C C   . ASN B 2 235 ? -85.855  -25.783 -11.880  1.00 134.00 ? 235 ASN B C   1 
ATOM   2826 O O   . ASN B 2 235 ? -86.957  -26.170 -12.255  1.00 133.80 ? 235 ASN B O   1 
ATOM   2827 C CB  . ASN B 2 235 ? -86.142  -24.108 -10.019  1.00 133.77 ? 235 ASN B CB  1 
ATOM   2828 C CG  . ASN B 2 235 ? -87.623  -23.800 -9.971   1.00 133.70 ? 235 ASN B CG  1 
ATOM   2829 O OD1 . ASN B 2 235 ? -88.465  -24.659 -10.240  1.00 133.29 ? 235 ASN B OD1 1 
ATOM   2830 N ND2 . ASN B 2 235 ? -87.949  -22.564 -9.617   1.00 133.62 ? 235 ASN B ND2 1 
ATOM   2831 N N   . ARG B 2 236 ? -84.777  -26.556 -11.795  1.00 134.57 ? 236 ARG B N   1 
ATOM   2832 C CA  . ARG B 2 236 ? -84.672  -27.942 -12.265  1.00 135.33 ? 236 ARG B CA  1 
ATOM   2833 C C   . ARG B 2 236 ? -85.936  -28.795 -12.113  1.00 135.65 ? 236 ARG B C   1 
ATOM   2834 O O   . ARG B 2 236 ? -86.785  -28.809 -13.000  1.00 135.52 ? 236 ARG B O   1 
ATOM   2835 C CB  . ARG B 2 236 ? -83.508  -28.628 -11.534  1.00 135.50 ? 236 ARG B CB  1 
ATOM   2836 C CG  . ARG B 2 236 ? -82.699  -29.587 -12.378  1.00 136.09 ? 236 ARG B CG  1 
ATOM   2837 C CD  . ARG B 2 236 ? -82.532  -30.922 -11.683  1.00 137.17 ? 236 ARG B CD  1 
ATOM   2838 N NE  . ARG B 2 236 ? -83.733  -31.744 -11.832  1.00 138.55 ? 236 ARG B NE  1 
ATOM   2839 C CZ  . ARG B 2 236 ? -84.092  -32.370 -12.954  1.00 139.50 ? 236 ARG B CZ  1 
ATOM   2840 N NH1 . ARG B 2 236 ? -83.348  -32.285 -14.051  1.00 139.96 ? 236 ARG B NH1 1 
ATOM   2841 N NH2 . ARG B 2 236 ? -85.211  -33.083 -12.987  1.00 140.00 ? 236 ARG B NH2 1 
ATOM   2842 N N   . ASN B 2 237 ? -86.023  -29.500 -10.979  1.00 136.33 ? 237 ASN B N   1 
ATOM   2843 C CA  . ASN B 2 237 ? -87.085  -30.478 -10.634  1.00 136.79 ? 237 ASN B CA  1 
ATOM   2844 C C   . ASN B 2 237 ? -88.063  -30.957 -11.732  1.00 136.91 ? 237 ASN B C   1 
ATOM   2845 O O   . ASN B 2 237 ? -88.020  -32.131 -12.144  1.00 136.78 ? 237 ASN B O   1 
ATOM   2846 C CB  . ASN B 2 237 ? -87.845  -30.039 -9.365   1.00 136.87 ? 237 ASN B CB  1 
ATOM   2847 C CG  . ASN B 2 237 ? -88.212  -28.558 -9.374   1.00 137.38 ? 237 ASN B CG  1 
ATOM   2848 O OD1 . ASN B 2 237 ? -87.780  -27.803 -8.500   1.00 137.78 ? 237 ASN B OD1 1 
ATOM   2849 N ND2 . ASN B 2 237 ? -89.014  -28.137 -10.358  1.00 137.58 ? 237 ASN B ND2 1 
ATOM   2850 N N   . GLU B 2 238 ? -88.941  -30.060 -12.187  1.00 136.99 ? 238 GLU B N   1 
ATOM   2851 C CA  . GLU B 2 238 ? -89.928  -30.403 -13.208  1.00 137.04 ? 238 GLU B CA  1 
ATOM   2852 C C   . GLU B 2 238 ? -89.258  -30.798 -14.534  1.00 137.20 ? 238 GLU B C   1 
ATOM   2853 O O   . GLU B 2 238 ? -89.606  -31.819 -15.144  1.00 137.33 ? 238 GLU B O   1 
ATOM   2854 C CB  . GLU B 2 238 ? -90.944  -29.264 -13.408  1.00 136.76 ? 238 GLU B CB  1 
ATOM   2855 C CG  . GLU B 2 238 ? -92.138  -29.648 -14.302  1.00 136.18 ? 238 GLU B CG  1 
ATOM   2856 C CD  . GLU B 2 238 ? -92.709  -31.046 -14.003  1.00 135.06 ? 238 GLU B CD  1 
ATOM   2857 O OE1 . GLU B 2 238 ? -92.617  -31.931 -14.884  1.00 134.29 ? 238 GLU B OE1 1 
ATOM   2858 O OE2 . GLU B 2 238 ? -93.244  -31.260 -12.892  1.00 134.33 ? 238 GLU B OE2 1 
ATOM   2859 N N   . CYS B 2 239 ? -88.279  -29.998 -14.948  1.00 137.19 ? 239 CYS B N   1 
ATOM   2860 C CA  . CYS B 2 239 ? -87.661  -30.134 -16.260  1.00 137.12 ? 239 CYS B CA  1 
ATOM   2861 C C   . CYS B 2 239 ? -86.170  -30.487 -16.169  1.00 137.28 ? 239 CYS B C   1 
ATOM   2862 O O   . CYS B 2 239 ? -85.323  -30.027 -16.944  1.00 137.39 ? 239 CYS B O   1 
ATOM   2863 C CB  . CYS B 2 239 ? -87.930  -28.866 -17.085  1.00 136.84 ? 239 CYS B CB  1 
ATOM   2864 S SG  . CYS B 2 239 ? -89.620  -28.860 -17.788  1.00 136.76 ? 239 CYS B SG  1 
ATOM   2865 O OXT . CYS B 2 239 ? -85.782  -31.273 -15.300  1.00 137.31 ? 239 CYS B OXT 1 
ATOM   2866 N N   . GLU C 3 1   ? -84.723  -12.575 -61.244  1.00 102.69 ? 1   GLU C N   1 
ATOM   2867 C CA  . GLU C 3 1   ? -84.451  -12.454 -62.703  1.00 102.80 ? 1   GLU C CA  1 
ATOM   2868 C C   . GLU C 3 1   ? -83.246  -13.302 -63.105  1.00 102.29 ? 1   GLU C C   1 
ATOM   2869 O O   . GLU C 3 1   ? -83.379  -14.253 -63.883  1.00 102.61 ? 1   GLU C O   1 
ATOM   2870 C CB  . GLU C 3 1   ? -84.236  -10.987 -63.109  1.00 103.09 ? 1   GLU C CB  1 
ATOM   2871 C CG  . GLU C 3 1   ? -83.798  -10.811 -64.578  1.00 105.16 ? 1   GLU C CG  1 
ATOM   2872 C CD  . GLU C 3 1   ? -84.477  -9.625  -65.268  1.00 107.72 ? 1   GLU C CD  1 
ATOM   2873 O OE1 . GLU C 3 1   ? -84.144  -8.462  -64.932  1.00 108.67 ? 1   GLU C OE1 1 
ATOM   2874 O OE2 . GLU C 3 1   ? -85.342  -9.858  -66.151  1.00 107.69 ? 1   GLU C OE2 1 
ATOM   2875 N N   . VAL C 3 2   ? -82.084  -12.939 -62.561  1.00 101.41 ? 2   VAL C N   1 
ATOM   2876 C CA  . VAL C 3 2   ? -80.801  -13.590 -62.843  1.00 100.18 ? 2   VAL C CA  1 
ATOM   2877 C C   . VAL C 3 2   ? -80.274  -14.263 -61.579  1.00 99.16  ? 2   VAL C C   1 
ATOM   2878 O O   . VAL C 3 2   ? -80.134  -13.627 -60.541  1.00 98.82  ? 2   VAL C O   1 
ATOM   2879 C CB  . VAL C 3 2   ? -79.772  -12.568 -63.399  1.00 100.29 ? 2   VAL C CB  1 
ATOM   2880 C CG1 . VAL C 3 2   ? -80.057  -11.176 -62.848  1.00 100.42 ? 2   VAL C CG1 1 
ATOM   2881 C CG2 . VAL C 3 2   ? -78.335  -12.994 -63.106  1.00 100.03 ? 2   VAL C CG2 1 
ATOM   2882 N N   . GLN C 3 3   ? -79.992  -15.556 -61.674  1.00 98.18  ? 3   GLN C N   1 
ATOM   2883 C CA  . GLN C 3 3   ? -79.548  -16.314 -60.514  1.00 97.27  ? 3   GLN C CA  1 
ATOM   2884 C C   . GLN C 3 3   ? -78.268  -17.123 -60.716  1.00 96.62  ? 3   GLN C C   1 
ATOM   2885 O O   . GLN C 3 3   ? -77.916  -17.513 -61.828  1.00 96.34  ? 3   GLN C O   1 
ATOM   2886 C CB  . GLN C 3 3   ? -80.658  -17.238 -60.023  1.00 97.39  ? 3   GLN C CB  1 
ATOM   2887 C CG  . GLN C 3 3   ? -81.321  -16.826 -58.721  1.00 97.18  ? 3   GLN C CG  1 
ATOM   2888 C CD  . GLN C 3 3   ? -81.918  -18.020 -57.986  1.00 97.17  ? 3   GLN C CD  1 
ATOM   2889 O OE1 . GLN C 3 3   ? -82.598  -18.872 -58.580  1.00 97.20  ? 3   GLN C OE1 1 
ATOM   2890 N NE2 . GLN C 3 3   ? -81.654  -18.095 -56.686  1.00 97.08  ? 3   GLN C NE2 1 
ATOM   2891 N N   . LEU C 3 4   ? -77.587  -17.350 -59.596  1.00 96.06  ? 4   LEU C N   1 
ATOM   2892 C CA  . LEU C 3 4   ? -76.437  -18.239 -59.491  1.00 95.35  ? 4   LEU C CA  1 
ATOM   2893 C C   . LEU C 3 4   ? -76.507  -18.978 -58.151  1.00 95.22  ? 4   LEU C C   1 
ATOM   2894 O O   . LEU C 3 4   ? -76.721  -18.369 -57.091  1.00 94.83  ? 4   LEU C O   1 
ATOM   2895 C CB  . LEU C 3 4   ? -75.125  -17.456 -59.591  1.00 95.13  ? 4   LEU C CB  1 
ATOM   2896 C CG  . LEU C 3 4   ? -74.819  -16.730 -60.892  1.00 93.57  ? 4   LEU C CG  1 
ATOM   2897 C CD1 . LEU C 3 4   ? -73.594  -15.857 -60.758  1.00 91.38  ? 4   LEU C CD1 1 
ATOM   2898 C CD2 . LEU C 3 4   ? -74.612  -17.783 -61.934  1.00 94.01  ? 4   LEU C CD2 1 
ATOM   2899 N N   . VAL C 3 5   ? -76.349  -20.294 -58.219  1.00 95.03  ? 5   VAL C N   1 
ATOM   2900 C CA  . VAL C 3 5   ? -76.301  -21.138 -57.039  1.00 95.21  ? 5   VAL C CA  1 
ATOM   2901 C C   . VAL C 3 5   ? -75.176  -22.127 -57.212  1.00 95.23  ? 5   VAL C C   1 
ATOM   2902 O O   . VAL C 3 5   ? -75.322  -23.141 -57.900  1.00 95.45  ? 5   VAL C O   1 
ATOM   2903 C CB  . VAL C 3 5   ? -77.609  -21.909 -56.808  1.00 95.12  ? 5   VAL C CB  1 
ATOM   2904 C CG1 . VAL C 3 5   ? -78.488  -21.182 -55.813  1.00 95.59  ? 5   VAL C CG1 1 
ATOM   2905 C CG2 . VAL C 3 5   ? -78.349  -22.157 -58.131  1.00 95.62  ? 5   VAL C CG2 1 
ATOM   2906 N N   . GLU C 3 6   ? -74.036  -21.808 -56.616  1.00 95.16  ? 6   GLU C N   1 
ATOM   2907 C CA  . GLU C 3 6   ? -72.907  -22.720 -56.632  1.00 94.95  ? 6   GLU C CA  1 
ATOM   2908 C C   . GLU C 3 6   ? -73.154  -23.733 -55.542  1.00 94.54  ? 6   GLU C C   1 
ATOM   2909 O O   . GLU C 3 6   ? -73.978  -23.495 -54.660  1.00 94.46  ? 6   GLU C O   1 
ATOM   2910 C CB  . GLU C 3 6   ? -71.564  -21.989 -56.441  1.00 95.22  ? 6   GLU C CB  1 
ATOM   2911 C CG  . GLU C 3 6   ? -71.397  -21.238 -55.121  1.00 95.54  ? 6   GLU C CG  1 
ATOM   2912 C CD  . GLU C 3 6   ? -72.001  -19.851 -55.152  1.00 96.01  ? 6   GLU C CD  1 
ATOM   2913 O OE1 . GLU C 3 6   ? -73.084  -19.666 -54.558  1.00 95.65  ? 6   GLU C OE1 1 
ATOM   2914 O OE2 . GLU C 3 6   ? -71.394  -18.952 -55.774  1.00 96.72  ? 6   GLU C OE2 1 
ATOM   2915 N N   . SER C 3 7   ? -72.461  -24.864 -55.615  1.00 94.23  ? 7   SER C N   1 
ATOM   2916 C CA  . SER C 3 7   ? -72.646  -25.918 -54.637  1.00 94.21  ? 7   SER C CA  1 
ATOM   2917 C C   . SER C 3 7   ? -71.733  -27.115 -54.861  1.00 93.90  ? 7   SER C C   1 
ATOM   2918 O O   . SER C 3 7   ? -71.021  -27.194 -55.857  1.00 93.57  ? 7   SER C O   1 
ATOM   2919 C CB  . SER C 3 7   ? -74.112  -26.353 -54.623  1.00 94.34  ? 7   SER C CB  1 
ATOM   2920 O OG  . SER C 3 7   ? -74.655  -26.265 -55.935  1.00 95.41  ? 7   SER C OG  1 
ATOM   2921 N N   . GLY C 3 8   ? -71.765  -28.030 -53.898  1.00 94.00  ? 8   GLY C N   1 
ATOM   2922 C CA  . GLY C 3 8   ? -71.050  -29.291 -53.969  1.00 94.49  ? 8   GLY C CA  1 
ATOM   2923 C C   . GLY C 3 8   ? -69.643  -29.275 -53.379  1.00 94.78  ? 8   GLY C C   1 
ATOM   2924 O O   . GLY C 3 8   ? -68.665  -29.554 -54.089  1.00 95.12  ? 8   GLY C O   1 
ATOM   2925 N N   . GLY C 3 9   ? -69.520  -28.978 -52.085  1.00 94.45  ? 9   GLY C N   1 
ATOM   2926 C CA  . GLY C 3 9   ? -68.209  -29.009 -51.464  1.00 94.02  ? 9   GLY C CA  1 
ATOM   2927 C C   . GLY C 3 9   ? -68.244  -28.736 -49.990  1.00 93.94  ? 9   GLY C C   1 
ATOM   2928 O O   . GLY C 3 9   ? -68.799  -27.738 -49.556  1.00 94.19  ? 9   GLY C O   1 
ATOM   2929 N N   . GLY C 3 10  ? -67.646  -29.634 -49.220  1.00 93.86  ? 10  GLY C N   1 
ATOM   2930 C CA  . GLY C 3 10  ? -67.472  -29.432 -47.787  1.00 93.77  ? 10  GLY C CA  1 
ATOM   2931 C C   . GLY C 3 10  ? -66.021  -29.588 -47.365  1.00 93.69  ? 10  GLY C C   1 
ATOM   2932 O O   . GLY C 3 10  ? -65.184  -28.715 -47.649  1.00 93.73  ? 10  GLY C O   1 
ATOM   2933 N N   . LEU C 3 11  ? -65.716  -30.696 -46.685  1.00 93.38  ? 11  LEU C N   1 
ATOM   2934 C CA  . LEU C 3 11  ? -64.362  -30.926 -46.176  1.00 92.99  ? 11  LEU C CA  1 
ATOM   2935 C C   . LEU C 3 11  ? -63.555  -31.828 -47.113  1.00 92.63  ? 11  LEU C C   1 
ATOM   2936 O O   . LEU C 3 11  ? -64.103  -32.735 -47.732  1.00 92.66  ? 11  LEU C O   1 
ATOM   2937 C CB  . LEU C 3 11  ? -64.387  -31.467 -44.741  1.00 92.81  ? 11  LEU C CB  1 
ATOM   2938 C CG  . LEU C 3 11  ? -63.087  -32.060 -44.184  1.00 93.09  ? 11  LEU C CG  1 
ATOM   2939 C CD1 . LEU C 3 11  ? -62.096  -30.995 -43.723  1.00 93.03  ? 11  LEU C CD1 1 
ATOM   2940 C CD2 . LEU C 3 11  ? -63.389  -33.035 -43.053  1.00 93.86  ? 11  LEU C CD2 1 
ATOM   2941 N N   . VAL C 3 12  ? -62.259  -31.540 -47.227  1.00 92.20  ? 12  VAL C N   1 
ATOM   2942 C CA  . VAL C 3 12  ? -61.347  -32.303 -48.071  1.00 91.72  ? 12  VAL C CA  1 
ATOM   2943 C C   . VAL C 3 12  ? -59.953  -32.271 -47.476  1.00 91.32  ? 12  VAL C C   1 
ATOM   2944 O O   . VAL C 3 12  ? -59.520  -31.250 -46.931  1.00 91.07  ? 12  VAL C O   1 
ATOM   2945 C CB  . VAL C 3 12  ? -61.300  -31.765 -49.506  1.00 91.72  ? 12  VAL C CB  1 
ATOM   2946 C CG1 . VAL C 3 12  ? -60.648  -30.395 -49.539  1.00 91.87  ? 12  VAL C CG1 1 
ATOM   2947 C CG2 . VAL C 3 12  ? -60.550  -32.729 -50.405  1.00 92.14  ? 12  VAL C CG2 1 
ATOM   2948 N N   . LYS C 3 13  ? -59.259  -33.397 -47.579  1.00 90.96  ? 13  LYS C N   1 
ATOM   2949 C CA  . LYS C 3 13  ? -57.956  -33.516 -46.950  1.00 90.92  ? 13  LYS C CA  1 
ATOM   2950 C C   . LYS C 3 13  ? -56.892  -32.800 -47.785  1.00 90.46  ? 13  LYS C C   1 
ATOM   2951 O O   . LYS C 3 13  ? -57.078  -32.646 -48.997  1.00 90.39  ? 13  LYS C O   1 
ATOM   2952 C CB  . LYS C 3 13  ? -57.591  -34.994 -46.643  1.00 91.29  ? 13  LYS C CB  1 
ATOM   2953 C CG  . LYS C 3 13  ? -57.974  -36.070 -47.685  1.00 91.42  ? 13  LYS C CG  1 
ATOM   2954 C CD  . LYS C 3 13  ? -57.238  -37.389 -47.385  1.00 91.73  ? 13  LYS C CD  1 
ATOM   2955 C CE  . LYS C 3 13  ? -57.319  -38.383 -48.560  1.00 93.32  ? 13  LYS C CE  1 
ATOM   2956 N NZ  . LYS C 3 13  ? -56.673  -39.741 -48.326  1.00 93.66  ? 13  LYS C NZ  1 
ATOM   2957 N N   . PRO C 3 14  ? -55.806  -32.313 -47.134  1.00 89.92  ? 14  PRO C N   1 
ATOM   2958 C CA  . PRO C 3 14  ? -54.622  -31.825 -47.832  1.00 89.62  ? 14  PRO C CA  1 
ATOM   2959 C C   . PRO C 3 14  ? -54.230  -32.692 -49.019  1.00 89.47  ? 14  PRO C C   1 
ATOM   2960 O O   . PRO C 3 14  ? -54.456  -33.903 -49.003  1.00 89.70  ? 14  PRO C O   1 
ATOM   2961 C CB  . PRO C 3 14  ? -53.555  -31.877 -46.747  1.00 89.31  ? 14  PRO C CB  1 
ATOM   2962 C CG  . PRO C 3 14  ? -54.299  -31.489 -45.528  1.00 89.57  ? 14  PRO C CG  1 
ATOM   2963 C CD  . PRO C 3 14  ? -55.747  -31.935 -45.712  1.00 89.82  ? 14  PRO C CD  1 
ATOM   2964 N N   . GLY C 3 15  ? -53.676  -32.067 -50.054  1.00 89.28  ? 15  GLY C N   1 
ATOM   2965 C CA  . GLY C 3 15  ? -53.379  -32.759 -51.309  1.00 88.95  ? 15  GLY C CA  1 
ATOM   2966 C C   . GLY C 3 15  ? -54.630  -33.219 -52.044  1.00 88.56  ? 15  GLY C C   1 
ATOM   2967 O O   . GLY C 3 15  ? -54.551  -33.695 -53.179  1.00 88.51  ? 15  GLY C O   1 
ATOM   2968 N N   . GLY C 3 16  ? -55.783  -33.050 -51.401  1.00 88.23  ? 16  GLY C N   1 
ATOM   2969 C CA  . GLY C 3 16  ? -57.052  -33.565 -51.907  1.00 88.23  ? 16  GLY C CA  1 
ATOM   2970 C C   . GLY C 3 16  ? -57.603  -32.985 -53.202  1.00 88.09  ? 16  GLY C C   1 
ATOM   2971 O O   . GLY C 3 16  ? -56.936  -32.223 -53.911  1.00 88.03  ? 16  GLY C O   1 
ATOM   2972 N N   . SER C 3 17  ? -58.836  -33.371 -53.511  1.00 87.86  ? 17  SER C N   1 
ATOM   2973 C CA  . SER C 3 17  ? -59.505  -32.924 -54.722  1.00 87.89  ? 17  SER C CA  1 
ATOM   2974 C C   . SER C 3 17  ? -61.009  -32.816 -54.490  1.00 87.73  ? 17  SER C C   1 
ATOM   2975 O O   . SER C 3 17  ? -61.514  -33.328 -53.486  1.00 87.78  ? 17  SER C O   1 
ATOM   2976 C CB  . SER C 3 17  ? -59.159  -33.839 -55.899  1.00 87.99  ? 17  SER C CB  1 
ATOM   2977 O OG  . SER C 3 17  ? -57.755  -33.785 -56.156  1.00 88.35  ? 17  SER C OG  1 
ATOM   2978 N N   . LEU C 3 18  ? -61.707  -32.129 -55.400  1.00 87.44  ? 18  LEU C N   1 
ATOM   2979 C CA  . LEU C 3 18  ? -63.136  -31.786 -55.237  1.00 87.07  ? 18  LEU C CA  1 
ATOM   2980 C C   . LEU C 3 18  ? -63.561  -30.684 -56.207  1.00 86.76  ? 18  LEU C C   1 
ATOM   2981 O O   . LEU C 3 18  ? -62.856  -29.687 -56.371  1.00 86.77  ? 18  LEU C O   1 
ATOM   2982 C CB  . LEU C 3 18  ? -63.455  -31.382 -53.783  1.00 87.04  ? 18  LEU C CB  1 
ATOM   2983 C CG  . LEU C 3 18  ? -64.545  -30.358 -53.454  1.00 86.89  ? 18  LEU C CG  1 
ATOM   2984 C CD1 . LEU C 3 18  ? -65.928  -30.944 -53.637  1.00 86.82  ? 18  LEU C CD1 1 
ATOM   2985 C CD2 . LEU C 3 18  ? -64.361  -29.848 -52.036  1.00 86.23  ? 18  LEU C CD2 1 
ATOM   2986 N N   . LYS C 3 19  ? -64.734  -30.872 -56.813  1.00 86.39  ? 19  LYS C N   1 
ATOM   2987 C CA  . LYS C 3 19  ? -65.220  -30.042 -57.917  1.00 86.03  ? 19  LYS C CA  1 
ATOM   2988 C C   . LYS C 3 19  ? -66.580  -29.382 -57.617  1.00 86.01  ? 19  LYS C C   1 
ATOM   2989 O O   . LYS C 3 19  ? -67.542  -30.058 -57.228  1.00 86.02  ? 19  LYS C O   1 
ATOM   2990 C CB  . LYS C 3 19  ? -65.293  -30.902 -59.180  1.00 85.92  ? 19  LYS C CB  1 
ATOM   2991 C CG  . LYS C 3 19  ? -66.101  -30.329 -60.313  1.00 85.41  ? 19  LYS C CG  1 
ATOM   2992 C CD  . LYS C 3 19  ? -65.803  -31.034 -61.615  1.00 84.23  ? 19  LYS C CD  1 
ATOM   2993 C CE  . LYS C 3 19  ? -66.667  -30.457 -62.699  1.00 84.14  ? 19  LYS C CE  1 
ATOM   2994 N NZ  . LYS C 3 19  ? -65.922  -30.300 -63.965  1.00 84.64  ? 19  LYS C NZ  1 
ATOM   2995 N N   . LEU C 3 20  ? -66.653  -28.063 -57.801  1.00 85.83  ? 20  LEU C N   1 
ATOM   2996 C CA  . LEU C 3 20  ? -67.863  -27.297 -57.483  1.00 85.58  ? 20  LEU C CA  1 
ATOM   2997 C C   . LEU C 3 20  ? -68.479  -26.791 -58.757  1.00 86.01  ? 20  LEU C C   1 
ATOM   2998 O O   . LEU C 3 20  ? -67.780  -26.498 -59.724  1.00 86.27  ? 20  LEU C O   1 
ATOM   2999 C CB  . LEU C 3 20  ? -67.550  -26.104 -56.581  1.00 85.05  ? 20  LEU C CB  1 
ATOM   3000 C CG  . LEU C 3 20  ? -66.320  -26.200 -55.683  1.00 84.15  ? 20  LEU C CG  1 
ATOM   3001 C CD1 . LEU C 3 20  ? -65.901  -24.828 -55.246  1.00 83.84  ? 20  LEU C CD1 1 
ATOM   3002 C CD2 . LEU C 3 20  ? -66.581  -27.077 -54.490  1.00 83.70  ? 20  LEU C CD2 1 
ATOM   3003 N N   . SER C 3 21  ? -69.794  -26.675 -58.758  1.00 86.53  ? 21  SER C N   1 
ATOM   3004 C CA  . SER C 3 21  ? -70.498  -26.228 -59.942  1.00 87.11  ? 21  SER C CA  1 
ATOM   3005 C C   . SER C 3 21  ? -71.435  -25.116 -59.593  1.00 87.29  ? 21  SER C C   1 
ATOM   3006 O O   . SER C 3 21  ? -72.194  -25.210 -58.645  1.00 87.59  ? 21  SER C O   1 
ATOM   3007 C CB  . SER C 3 21  ? -71.279  -27.375 -60.570  1.00 87.22  ? 21  SER C CB  1 
ATOM   3008 O OG  . SER C 3 21  ? -71.674  -28.312 -59.584  1.00 88.34  ? 21  SER C OG  1 
ATOM   3009 N N   . CYS C 3 22  ? -71.365  -24.050 -60.362  1.00 87.81  ? 22  CYS C N   1 
ATOM   3010 C CA  . CYS C 3 22  ? -72.276  -22.952 -60.209  1.00 88.47  ? 22  CYS C CA  1 
ATOM   3011 C C   . CYS C 3 22  ? -73.421  -23.222 -61.153  1.00 89.18  ? 22  CYS C C   1 
ATOM   3012 O O   . CYS C 3 22  ? -73.234  -23.217 -62.372  1.00 89.22  ? 22  CYS C O   1 
ATOM   3013 C CB  . CYS C 3 22  ? -71.575  -21.667 -60.602  1.00 88.39  ? 22  CYS C CB  1 
ATOM   3014 S SG  . CYS C 3 22  ? -72.559  -20.177 -60.458  1.00 88.57  ? 22  CYS C SG  1 
ATOM   3015 N N   . ALA C 3 23  ? -74.601  -23.486 -60.601  1.00 90.06  ? 23  ALA C N   1 
ATOM   3016 C CA  . ALA C 3 23  ? -75.776  -23.714 -61.435  1.00 91.00  ? 23  ALA C CA  1 
ATOM   3017 C C   . ALA C 3 23  ? -76.316  -22.348 -61.857  1.00 91.60  ? 23  ALA C C   1 
ATOM   3018 O O   . ALA C 3 23  ? -76.845  -21.609 -61.029  1.00 92.10  ? 23  ALA C O   1 
ATOM   3019 C CB  . ALA C 3 23  ? -76.823  -24.539 -60.675  1.00 90.85  ? 23  ALA C CB  1 
ATOM   3020 N N   . ALA C 3 24  ? -76.140  -21.981 -63.122  1.00 92.12  ? 24  ALA C N   1 
ATOM   3021 C CA  . ALA C 3 24  ? -76.534  -20.642 -63.557  1.00 93.02  ? 24  ALA C CA  1 
ATOM   3022 C C   . ALA C 3 24  ? -77.952  -20.633 -64.105  1.00 93.77  ? 24  ALA C C   1 
ATOM   3023 O O   . ALA C 3 24  ? -78.320  -21.534 -64.858  1.00 94.26  ? 24  ALA C O   1 
ATOM   3024 C CB  . ALA C 3 24  ? -75.584  -20.127 -64.589  1.00 92.88  ? 24  ALA C CB  1 
ATOM   3025 N N   . SER C 3 25  ? -78.745  -19.619 -63.753  1.00 94.43  ? 25  SER C N   1 
ATOM   3026 C CA  . SER C 3 25  ? -80.133  -19.580 -64.216  1.00 95.03  ? 25  SER C CA  1 
ATOM   3027 C C   . SER C 3 25  ? -80.828  -18.207 -64.241  1.00 95.40  ? 25  SER C C   1 
ATOM   3028 O O   . SER C 3 25  ? -81.222  -17.652 -63.199  1.00 95.31  ? 25  SER C O   1 
ATOM   3029 C CB  . SER C 3 25  ? -80.979  -20.571 -63.413  1.00 95.13  ? 25  SER C CB  1 
ATOM   3030 O OG  . SER C 3 25  ? -81.948  -21.197 -64.239  1.00 95.95  ? 25  SER C OG  1 
ATOM   3031 N N   . GLY C 3 26  ? -81.009  -17.685 -65.452  1.00 95.74  ? 26  GLY C N   1 
ATOM   3032 C CA  . GLY C 3 26  ? -81.886  -16.535 -65.658  1.00 95.92  ? 26  GLY C CA  1 
ATOM   3033 C C   . GLY C 3 26  ? -81.246  -15.387 -66.404  1.00 95.95  ? 26  GLY C C   1 
ATOM   3034 O O   . GLY C 3 26  ? -81.631  -14.226 -66.216  1.00 96.11  ? 26  GLY C O   1 
ATOM   3035 N N   . PHE C 3 27  ? -80.260  -15.715 -67.235  1.00 95.85  ? 27  PHE C N   1 
ATOM   3036 C CA  . PHE C 3 27  ? -79.621  -14.754 -68.132  1.00 96.03  ? 27  PHE C CA  1 
ATOM   3037 C C   . PHE C 3 27  ? -78.990  -15.514 -69.296  1.00 96.06  ? 27  PHE C C   1 
ATOM   3038 O O   . PHE C 3 27  ? -78.762  -16.724 -69.208  1.00 95.69  ? 27  PHE C O   1 
ATOM   3039 C CB  . PHE C 3 27  ? -78.580  -13.872 -67.395  1.00 96.19  ? 27  PHE C CB  1 
ATOM   3040 C CG  . PHE C 3 27  ? -77.379  -14.632 -66.874  1.00 96.49  ? 27  PHE C CG  1 
ATOM   3041 C CD1 . PHE C 3 27  ? -76.204  -14.707 -67.626  1.00 96.14  ? 27  PHE C CD1 1 
ATOM   3042 C CD2 . PHE C 3 27  ? -77.427  -15.285 -65.638  1.00 96.81  ? 27  PHE C CD2 1 
ATOM   3043 C CE1 . PHE C 3 27  ? -75.104  -15.420 -67.159  1.00 95.97  ? 27  PHE C CE1 1 
ATOM   3044 C CE2 . PHE C 3 27  ? -76.327  -16.006 -65.163  1.00 96.18  ? 27  PHE C CE2 1 
ATOM   3045 C CZ  . PHE C 3 27  ? -75.164  -16.069 -65.921  1.00 95.89  ? 27  PHE C CZ  1 
ATOM   3046 N N   . ALA C 3 28  ? -78.718  -14.800 -70.384  1.00 96.35  ? 28  ALA C N   1 
ATOM   3047 C CA  . ALA C 3 28  ? -78.066  -15.381 -71.558  1.00 96.53  ? 28  ALA C CA  1 
ATOM   3048 C C   . ALA C 3 28  ? -76.689  -15.958 -71.206  1.00 96.57  ? 28  ALA C C   1 
ATOM   3049 O O   . ALA C 3 28  ? -75.648  -15.346 -71.488  1.00 96.49  ? 28  ALA C O   1 
ATOM   3050 C CB  . ALA C 3 28  ? -77.948  -14.336 -72.660  1.00 96.67  ? 28  ALA C CB  1 
ATOM   3051 N N   . PHE C 3 29  ? -76.690  -17.140 -70.594  1.00 96.42  ? 29  PHE C N   1 
ATOM   3052 C CA  . PHE C 3 29  ? -75.456  -17.715 -70.086  1.00 96.46  ? 29  PHE C CA  1 
ATOM   3053 C C   . PHE C 3 29  ? -74.276  -17.652 -71.075  1.00 96.02  ? 29  PHE C C   1 
ATOM   3054 O O   . PHE C 3 29  ? -73.266  -17.020 -70.775  1.00 96.05  ? 29  PHE C O   1 
ATOM   3055 C CB  . PHE C 3 29  ? -75.665  -19.144 -69.573  1.00 96.77  ? 29  PHE C CB  1 
ATOM   3056 C CG  . PHE C 3 29  ? -74.455  -19.711 -68.862  1.00 97.82  ? 29  PHE C CG  1 
ATOM   3057 C CD1 . PHE C 3 29  ? -74.281  -19.514 -67.490  1.00 97.84  ? 29  PHE C CD1 1 
ATOM   3058 C CD2 . PHE C 3 29  ? -73.480  -20.431 -69.569  1.00 98.06  ? 29  PHE C CD2 1 
ATOM   3059 C CE1 . PHE C 3 29  ? -73.156  -20.031 -66.829  1.00 97.81  ? 29  PHE C CE1 1 
ATOM   3060 C CE2 . PHE C 3 29  ? -72.359  -20.950 -68.916  1.00 98.16  ? 29  PHE C CE2 1 
ATOM   3061 C CZ  . PHE C 3 29  ? -72.198  -20.752 -67.542  1.00 98.04  ? 29  PHE C CZ  1 
ATOM   3062 N N   . SER C 3 30  ? -74.416  -18.267 -72.249  1.00 95.41  ? 30  SER C N   1 
ATOM   3063 C CA  . SER C 3 30  ? -73.269  -18.477 -73.153  1.00 94.96  ? 30  SER C CA  1 
ATOM   3064 C C   . SER C 3 30  ? -72.609  -17.191 -73.667  1.00 94.22  ? 30  SER C C   1 
ATOM   3065 O O   . SER C 3 30  ? -71.557  -17.228 -74.303  1.00 93.65  ? 30  SER C O   1 
ATOM   3066 C CB  . SER C 3 30  ? -73.639  -19.423 -74.313  1.00 95.33  ? 30  SER C CB  1 
ATOM   3067 O OG  . SER C 3 30  ? -73.981  -18.728 -75.507  1.00 96.12  ? 30  SER C OG  1 
ATOM   3068 N N   . SER C 3 31  ? -73.223  -16.064 -73.349  1.00 93.80  ? 31  SER C N   1 
ATOM   3069 C CA  . SER C 3 31  ? -72.740  -14.754 -73.764  1.00 93.75  ? 31  SER C CA  1 
ATOM   3070 C C   . SER C 3 31  ? -71.833  -14.011 -72.732  1.00 93.54  ? 31  SER C C   1 
ATOM   3071 O O   . SER C 3 31  ? -70.958  -13.204 -73.114  1.00 93.64  ? 31  SER C O   1 
ATOM   3072 C CB  . SER C 3 31  ? -73.952  -13.903 -74.085  1.00 94.01  ? 31  SER C CB  1 
ATOM   3073 O OG  . SER C 3 31  ? -74.945  -14.106 -73.090  1.00 94.26  ? 31  SER C OG  1 
ATOM   3074 N N   . TYR C 3 32  ? -72.045  -14.261 -71.440  1.00 92.50  ? 32  TYR C N   1 
ATOM   3075 C CA  . TYR C 3 32  ? -71.199  -13.653 -70.421  1.00 91.70  ? 32  TYR C CA  1 
ATOM   3076 C C   . TYR C 3 32  ? -69.910  -14.453 -70.159  1.00 90.31  ? 32  TYR C C   1 
ATOM   3077 O O   . TYR C 3 32  ? -69.771  -15.584 -70.613  1.00 89.86  ? 32  TYR C O   1 
ATOM   3078 C CB  . TYR C 3 32  ? -72.011  -13.411 -69.135  1.00 92.42  ? 32  TYR C CB  1 
ATOM   3079 C CG  . TYR C 3 32  ? -72.883  -12.151 -69.194  1.00 95.00  ? 32  TYR C CG  1 
ATOM   3080 C CD1 . TYR C 3 32  ? -74.072  -12.132 -69.935  1.00 96.70  ? 32  TYR C CD1 1 
ATOM   3081 C CD2 . TYR C 3 32  ? -72.509  -10.970 -68.520  1.00 96.53  ? 32  TYR C CD2 1 
ATOM   3082 C CE1 . TYR C 3 32  ? -74.869  -10.977 -70.005  1.00 97.13  ? 32  TYR C CE1 1 
ATOM   3083 C CE2 . TYR C 3 32  ? -73.302  -9.807  -68.589  1.00 96.82  ? 32  TYR C CE2 1 
ATOM   3084 C CZ  . TYR C 3 32  ? -74.480  -9.830  -69.332  1.00 97.43  ? 32  TYR C CZ  1 
ATOM   3085 O OH  . TYR C 3 32  ? -75.282  -8.719  -69.418  1.00 98.62  ? 32  TYR C OH  1 
ATOM   3086 N N   . ASP C 3 33  ? -68.956  -13.841 -69.457  1.00 88.94  ? 33  ASP C N   1 
ATOM   3087 C CA  . ASP C 3 33  ? -67.811  -14.565 -68.898  1.00 87.36  ? 33  ASP C CA  1 
ATOM   3088 C C   . ASP C 3 33  ? -68.104  -14.991 -67.467  1.00 86.12  ? 33  ASP C C   1 
ATOM   3089 O O   . ASP C 3 33  ? -69.055  -14.525 -66.843  1.00 85.71  ? 33  ASP C O   1 
ATOM   3090 C CB  . ASP C 3 33  ? -66.560  -13.699 -68.911  1.00 87.46  ? 33  ASP C CB  1 
ATOM   3091 C CG  . ASP C 3 33  ? -65.976  -13.546 -70.288  1.00 88.15  ? 33  ASP C CG  1 
ATOM   3092 O OD1 . ASP C 3 33  ? -66.744  -13.676 -71.259  1.00 90.31  ? 33  ASP C OD1 1 
ATOM   3093 O OD2 . ASP C 3 33  ? -64.760  -13.284 -70.408  1.00 87.43  ? 33  ASP C OD2 1 
ATOM   3094 N N   . MET C 3 34  ? -67.286  -15.882 -66.937  1.00 84.66  ? 34  MET C N   1 
ATOM   3095 C CA  . MET C 3 34  ? -67.521  -16.329 -65.585  1.00 83.48  ? 34  MET C CA  1 
ATOM   3096 C C   . MET C 3 34  ? -66.245  -16.364 -64.759  1.00 82.26  ? 34  MET C C   1 
ATOM   3097 O O   . MET C 3 34  ? -65.144  -16.596 -65.303  1.00 81.98  ? 34  MET C O   1 
ATOM   3098 C CB  . MET C 3 34  ? -68.225  -17.686 -65.592  1.00 84.00  ? 34  MET C CB  1 
ATOM   3099 C CG  . MET C 3 34  ? -69.645  -17.658 -66.174  1.00 85.03  ? 34  MET C CG  1 
ATOM   3100 S SD  . MET C 3 34  ? -70.731  -16.372 -65.488  1.00 87.06  ? 34  MET C SD  1 
ATOM   3101 C CE  . MET C 3 34  ? -71.308  -17.164 -63.978  1.00 85.85  ? 34  MET C CE  1 
ATOM   3102 N N   . SER C 3 35  ? -66.415  -16.123 -63.451  1.00 80.50  ? 35  SER C N   1 
ATOM   3103 C CA  . SER C 3 35  ? -65.311  -16.015 -62.495  1.00 78.86  ? 35  SER C CA  1 
ATOM   3104 C C   . SER C 3 35  ? -65.643  -16.741 -61.222  1.00 77.56  ? 35  SER C C   1 
ATOM   3105 O O   . SER C 3 35  ? -66.807  -17.005 -60.949  1.00 77.07  ? 35  SER C O   1 
ATOM   3106 C CB  . SER C 3 35  ? -65.069  -14.564 -62.140  1.00 79.11  ? 35  SER C CB  1 
ATOM   3107 O OG  . SER C 3 35  ? -66.170  -14.078 -61.397  1.00 79.30  ? 35  SER C OG  1 
ATOM   3108 N N   . TRP C 3 36  ? -64.613  -17.019 -60.431  1.00 76.34  ? 36  TRP C N   1 
ATOM   3109 C CA  . TRP C 3 36  ? -64.749  -17.806 -59.214  1.00 75.56  ? 36  TRP C CA  1 
ATOM   3110 C C   . TRP C 3 36  ? -64.005  -17.144 -58.108  1.00 74.70  ? 36  TRP C C   1 
ATOM   3111 O O   . TRP C 3 36  ? -62.794  -17.271 -58.047  1.00 74.79  ? 36  TRP C O   1 
ATOM   3112 C CB  . TRP C 3 36  ? -64.113  -19.173 -59.396  1.00 75.76  ? 36  TRP C CB  1 
ATOM   3113 C CG  . TRP C 3 36  ? -65.051  -20.224 -59.827  1.00 76.90  ? 36  TRP C CG  1 
ATOM   3114 C CD1 . TRP C 3 36  ? -65.089  -20.838 -61.040  1.00 77.16  ? 36  TRP C CD1 1 
ATOM   3115 C CD2 . TRP C 3 36  ? -66.094  -20.802 -59.048  1.00 77.81  ? 36  TRP C CD2 1 
ATOM   3116 N NE1 . TRP C 3 36  ? -66.087  -21.771 -61.062  1.00 77.90  ? 36  TRP C NE1 1 
ATOM   3117 C CE2 . TRP C 3 36  ? -66.724  -21.765 -59.851  1.00 78.26  ? 36  TRP C CE2 1 
ATOM   3118 C CE3 . TRP C 3 36  ? -66.557  -20.598 -57.746  1.00 79.39  ? 36  TRP C CE3 1 
ATOM   3119 C CZ2 . TRP C 3 36  ? -67.801  -22.523 -59.401  1.00 80.03  ? 36  TRP C CZ2 1 
ATOM   3120 C CZ3 . TRP C 3 36  ? -67.630  -21.358 -57.289  1.00 80.43  ? 36  TRP C CZ3 1 
ATOM   3121 C CH2 . TRP C 3 36  ? -68.241  -22.306 -58.117  1.00 80.89  ? 36  TRP C CH2 1 
ATOM   3122 N N   . VAL C 3 37  ? -64.713  -16.465 -57.219  1.00 73.83  ? 37  VAL C N   1 
ATOM   3123 C CA  . VAL C 3 37  ? -64.068  -15.765 -56.120  1.00 73.20  ? 37  VAL C CA  1 
ATOM   3124 C C   . VAL C 3 37  ? -64.287  -16.549 -54.830  1.00 72.97  ? 37  VAL C C   1 
ATOM   3125 O O   . VAL C 3 37  ? -65.379  -17.068 -54.595  1.00 72.50  ? 37  VAL C O   1 
ATOM   3126 C CB  . VAL C 3 37  ? -64.598  -14.316 -55.992  1.00 73.22  ? 37  VAL C CB  1 
ATOM   3127 C CG1 . VAL C 3 37  ? -63.773  -13.518 -55.006  1.00 73.10  ? 37  VAL C CG1 1 
ATOM   3128 C CG2 . VAL C 3 37  ? -64.573  -13.616 -57.340  1.00 73.12  ? 37  VAL C CG2 1 
ATOM   3129 N N   . ARG C 3 38  ? -63.231  -16.658 -54.021  1.00 72.80  ? 38  ARG C N   1 
ATOM   3130 C CA  . ARG C 3 38  ? -63.327  -17.241 -52.678  1.00 72.79  ? 38  ARG C CA  1 
ATOM   3131 C C   . ARG C 3 38  ? -63.118  -16.165 -51.629  1.00 73.23  ? 38  ARG C C   1 
ATOM   3132 O O   . ARG C 3 38  ? -62.568  -15.094 -51.920  1.00 73.40  ? 38  ARG C O   1 
ATOM   3133 C CB  . ARG C 3 38  ? -62.293  -18.340 -52.475  1.00 72.55  ? 38  ARG C CB  1 
ATOM   3134 C CG  . ARG C 3 38  ? -60.865  -17.831 -52.373  1.00 72.56  ? 38  ARG C CG  1 
ATOM   3135 C CD  . ARG C 3 38  ? -59.837  -18.942 -52.427  1.00 71.98  ? 38  ARG C CD  1 
ATOM   3136 N NE  . ARG C 3 38  ? -58.486  -18.406 -52.568  1.00 71.71  ? 38  ARG C NE  1 
ATOM   3137 C CZ  . ARG C 3 38  ? -57.385  -19.141 -52.721  1.00 72.59  ? 38  ARG C CZ  1 
ATOM   3138 N NH1 . ARG C 3 38  ? -57.433  -20.475 -52.754  1.00 71.77  ? 38  ARG C NH1 1 
ATOM   3139 N NH2 . ARG C 3 38  ? -56.216  -18.531 -52.849  1.00 73.35  ? 38  ARG C NH2 1 
ATOM   3140 N N   . GLN C 3 39  ? -63.546  -16.446 -50.407  1.00 73.70  ? 39  GLN C N   1 
ATOM   3141 C CA  . GLN C 3 39  ? -63.326  -15.512 -49.314  1.00 74.51  ? 39  GLN C CA  1 
ATOM   3142 C C   . GLN C 3 39  ? -62.753  -16.248 -48.138  1.00 74.83  ? 39  GLN C C   1 
ATOM   3143 O O   . GLN C 3 39  ? -63.374  -17.172 -47.629  1.00 74.83  ? 39  GLN C O   1 
ATOM   3144 C CB  . GLN C 3 39  ? -64.619  -14.815 -48.907  1.00 74.68  ? 39  GLN C CB  1 
ATOM   3145 C CG  . GLN C 3 39  ? -64.426  -13.730 -47.846  1.00 75.46  ? 39  GLN C CG  1 
ATOM   3146 C CD  . GLN C 3 39  ? -65.657  -12.852 -47.649  1.00 76.47  ? 39  GLN C CD  1 
ATOM   3147 O OE1 . GLN C 3 39  ? -66.759  -13.182 -48.101  1.00 76.12  ? 39  GLN C OE1 1 
ATOM   3148 N NE2 . GLN C 3 39  ? -65.472  -11.729 -46.961  1.00 76.23  ? 39  GLN C NE2 1 
ATOM   3149 N N   . THR C 3 40  ? -61.569  -15.834 -47.702  1.00 75.40  ? 40  THR C N   1 
ATOM   3150 C CA  . THR C 3 40  ? -60.854  -16.562 -46.663  1.00 76.14  ? 40  THR C CA  1 
ATOM   3151 C C   . THR C 3 40  ? -61.544  -16.431 -45.316  1.00 76.72  ? 40  THR C C   1 
ATOM   3152 O O   . THR C 3 40  ? -62.493  -15.646 -45.178  1.00 76.78  ? 40  THR C O   1 
ATOM   3153 C CB  . THR C 3 40  ? -59.430  -16.065 -46.482  1.00 76.12  ? 40  THR C CB  1 
ATOM   3154 O OG1 . THR C 3 40  ? -59.425  -15.019 -45.501  1.00 76.57  ? 40  THR C OG1 1 
ATOM   3155 C CG2 . THR C 3 40  ? -58.854  -15.580 -47.801  1.00 76.28  ? 40  THR C CG2 1 
ATOM   3156 N N   . PRO C 3 41  ? -61.076  -17.217 -44.320  1.00 77.29  ? 41  PRO C N   1 
ATOM   3157 C CA  . PRO C 3 41  ? -61.549  -17.103 -42.941  1.00 77.51  ? 41  PRO C CA  1 
ATOM   3158 C C   . PRO C 3 41  ? -61.248  -15.761 -42.303  1.00 77.79  ? 41  PRO C C   1 
ATOM   3159 O O   . PRO C 3 41  ? -61.966  -15.361 -41.392  1.00 77.73  ? 41  PRO C O   1 
ATOM   3160 C CB  . PRO C 3 41  ? -60.807  -18.230 -42.237  1.00 77.43  ? 41  PRO C CB  1 
ATOM   3161 C CG  . PRO C 3 41  ? -60.710  -19.291 -43.315  1.00 77.24  ? 41  PRO C CG  1 
ATOM   3162 C CD  . PRO C 3 41  ? -60.328  -18.477 -44.519  1.00 77.41  ? 41  PRO C CD  1 
ATOM   3163 N N   . GLU C 3 42  ? -60.234  -15.057 -42.804  1.00 78.26  ? 42  GLU C N   1 
ATOM   3164 C CA  . GLU C 3 42  ? -59.954  -13.697 -42.355  1.00 79.09  ? 42  GLU C CA  1 
ATOM   3165 C C   . GLU C 3 42  ? -60.979  -12.722 -42.917  1.00 79.49  ? 42  GLU C C   1 
ATOM   3166 O O   . GLU C 3 42  ? -60.967  -11.556 -42.546  1.00 79.96  ? 42  GLU C O   1 
ATOM   3167 C CB  . GLU C 3 42  ? -58.557  -13.234 -42.773  1.00 79.14  ? 42  GLU C CB  1 
ATOM   3168 C CG  . GLU C 3 42  ? -57.417  -14.124 -42.357  1.00 80.69  ? 42  GLU C CG  1 
ATOM   3169 C CD  . GLU C 3 42  ? -57.589  -15.546 -42.854  1.00 83.29  ? 42  GLU C CD  1 
ATOM   3170 O OE1 . GLU C 3 42  ? -57.164  -15.860 -43.992  1.00 84.13  ? 42  GLU C OE1 1 
ATOM   3171 O OE2 . GLU C 3 42  ? -58.160  -16.354 -42.093  1.00 85.04  ? 42  GLU C OE2 1 
ATOM   3172 N N   . LYS C 3 43  ? -61.867  -13.198 -43.792  1.00 79.88  ? 43  LYS C N   1 
ATOM   3173 C CA  . LYS C 3 43  ? -62.864  -12.355 -44.481  1.00 80.55  ? 43  LYS C CA  1 
ATOM   3174 C C   . LYS C 3 43  ? -62.262  -11.696 -45.714  1.00 80.56  ? 43  LYS C C   1 
ATOM   3175 O O   . LYS C 3 43  ? -62.923  -10.929 -46.413  1.00 80.11  ? 43  LYS C O   1 
ATOM   3176 C CB  . LYS C 3 43  ? -63.485  -11.303 -43.547  1.00 80.93  ? 43  LYS C CB  1 
ATOM   3177 C CG  . LYS C 3 43  ? -64.597  -11.820 -42.635  1.00 82.71  ? 43  LYS C CG  1 
ATOM   3178 C CD  . LYS C 3 43  ? -64.066  -12.607 -41.436  1.00 85.56  ? 43  LYS C CD  1 
ATOM   3179 C CE  . LYS C 3 43  ? -65.200  -13.341 -40.704  1.00 88.12  ? 43  LYS C CE  1 
ATOM   3180 N NZ  . LYS C 3 43  ? -66.100  -12.427 -39.894  1.00 89.71  ? 43  LYS C NZ  1 
ATOM   3181 N N   . ARG C 3 44  ? -60.991  -12.027 -45.953  1.00 81.05  ? 44  ARG C N   1 
ATOM   3182 C CA  . ARG C 3 44  ? -60.183  -11.615 -47.115  1.00 81.38  ? 44  ARG C CA  1 
ATOM   3183 C C   . ARG C 3 44  ? -60.831  -12.044 -48.451  1.00 80.48  ? 44  ARG C C   1 
ATOM   3184 O O   . ARG C 3 44  ? -61.597  -13.006 -48.479  1.00 80.56  ? 44  ARG C O   1 
ATOM   3185 C CB  . ARG C 3 44  ? -58.778  -12.221 -46.936  1.00 81.75  ? 44  ARG C CB  1 
ATOM   3186 C CG  . ARG C 3 44  ? -57.691  -11.645 -47.789  1.00 85.63  ? 44  ARG C CG  1 
ATOM   3187 C CD  . ARG C 3 44  ? -57.427  -10.194 -47.415  1.00 93.05  ? 44  ARG C CD  1 
ATOM   3188 N NE  . ARG C 3 44  ? -57.288  -9.343  -48.607  1.00 97.98  ? 44  ARG C NE  1 
ATOM   3189 C CZ  . ARG C 3 44  ? -58.301  -8.851  -49.333  1.00 100.32 ? 44  ARG C CZ  1 
ATOM   3190 N NH1 . ARG C 3 44  ? -59.575  -9.100  -49.011  1.00 101.14 ? 44  ARG C NH1 1 
ATOM   3191 N NH2 . ARG C 3 44  ? -58.039  -8.090  -50.392  1.00 101.27 ? 44  ARG C NH2 1 
ATOM   3192 N N   . LEU C 3 45  ? -60.549  -11.337 -49.546  1.00 79.52  ? 45  LEU C N   1 
ATOM   3193 C CA  . LEU C 3 45  ? -61.203  -11.649 -50.842  1.00 78.96  ? 45  LEU C CA  1 
ATOM   3194 C C   . LEU C 3 45  ? -60.273  -11.920 -52.032  1.00 78.39  ? 45  LEU C C   1 
ATOM   3195 O O   . LEU C 3 45  ? -59.758  -10.986 -52.647  1.00 78.39  ? 45  LEU C O   1 
ATOM   3196 C CB  . LEU C 3 45  ? -62.225  -10.568 -51.227  1.00 78.86  ? 45  LEU C CB  1 
ATOM   3197 C CG  . LEU C 3 45  ? -63.682  -10.826 -50.835  1.00 79.17  ? 45  LEU C CG  1 
ATOM   3198 C CD1 . LEU C 3 45  ? -64.617  -9.707  -51.305  1.00 78.10  ? 45  LEU C CD1 1 
ATOM   3199 C CD2 . LEU C 3 45  ? -64.143  -12.176 -51.372  1.00 79.61  ? 45  LEU C CD2 1 
ATOM   3200 N N   . GLU C 3 46  ? -60.079  -13.185 -52.381  1.00 77.65  ? 46  GLU C N   1 
ATOM   3201 C CA  . GLU C 3 46  ? -59.191  -13.500 -53.493  1.00 77.33  ? 46  GLU C CA  1 
ATOM   3202 C C   . GLU C 3 46  ? -59.954  -13.992 -54.720  1.00 76.96  ? 46  GLU C C   1 
ATOM   3203 O O   . GLU C 3 46  ? -60.889  -14.820 -54.614  1.00 76.66  ? 46  GLU C O   1 
ATOM   3204 C CB  . GLU C 3 46  ? -58.132  -14.513 -53.082  1.00 77.50  ? 46  GLU C CB  1 
ATOM   3205 C CG  . GLU C 3 46  ? -57.312  -14.118 -51.857  1.00 79.47  ? 46  GLU C CG  1 
ATOM   3206 C CD  . GLU C 3 46  ? -56.474  -15.280 -51.318  1.00 83.07  ? 46  GLU C CD  1 
ATOM   3207 O OE1 . GLU C 3 46  ? -55.768  -15.937 -52.122  1.00 85.17  ? 46  GLU C OE1 1 
ATOM   3208 O OE2 . GLU C 3 46  ? -56.518  -15.546 -50.091  1.00 84.17  ? 46  GLU C OE2 1 
ATOM   3209 N N   . TRP C 3 47  ? -59.566  -13.456 -55.881  1.00 76.38  ? 47  TRP C N   1 
ATOM   3210 C CA  . TRP C 3 47  ? -60.114  -13.896 -57.161  1.00 75.74  ? 47  TRP C CA  1 
ATOM   3211 C C   . TRP C 3 47  ? -59.348  -15.144 -57.495  1.00 75.87  ? 47  TRP C C   1 
ATOM   3212 O O   . TRP C 3 47  ? -58.150  -15.230 -57.187  1.00 76.34  ? 47  TRP C O   1 
ATOM   3213 C CB  . TRP C 3 47  ? -59.881  -12.859 -58.241  1.00 75.40  ? 47  TRP C CB  1 
ATOM   3214 C CG  . TRP C 3 47  ? -59.739  -13.458 -59.603  1.00 75.14  ? 47  TRP C CG  1 
ATOM   3215 C CD1 . TRP C 3 47  ? -60.722  -14.055 -60.341  1.00 75.43  ? 47  TRP C CD1 1 
ATOM   3216 C CD2 . TRP C 3 47  ? -58.543  -13.523 -60.403  1.00 74.92  ? 47  TRP C CD2 1 
ATOM   3217 N NE1 . TRP C 3 47  ? -60.218  -14.487 -61.551  1.00 75.70  ? 47  TRP C NE1 1 
ATOM   3218 C CE2 . TRP C 3 47  ? -58.884  -14.174 -61.616  1.00 75.48  ? 47  TRP C CE2 1 
ATOM   3219 C CE3 . TRP C 3 47  ? -57.222  -13.103 -60.212  1.00 73.79  ? 47  TRP C CE3 1 
ATOM   3220 C CZ2 . TRP C 3 47  ? -57.945  -14.416 -62.633  1.00 75.06  ? 47  TRP C CZ2 1 
ATOM   3221 C CZ3 . TRP C 3 47  ? -56.293  -13.338 -61.225  1.00 73.98  ? 47  TRP C CZ3 1 
ATOM   3222 C CH2 . TRP C 3 47  ? -56.659  -13.989 -62.420  1.00 74.31  ? 47  TRP C CH2 1 
ATOM   3223 N N   . VAL C 3 48  ? -60.014  -16.102 -58.133  1.00 75.34  ? 48  VAL C N   1 
ATOM   3224 C CA  . VAL C 3 48  ? -59.471  -17.445 -58.234  1.00 74.83  ? 48  VAL C CA  1 
ATOM   3225 C C   . VAL C 3 48  ? -59.364  -17.997 -59.657  1.00 75.01  ? 48  VAL C C   1 
ATOM   3226 O O   . VAL C 3 48  ? -58.384  -18.659 -59.995  1.00 75.44  ? 48  VAL C O   1 
ATOM   3227 C CB  . VAL C 3 48  ? -60.243  -18.373 -57.297  1.00 74.61  ? 48  VAL C CB  1 
ATOM   3228 C CG1 . VAL C 3 48  ? -60.488  -19.738 -57.912  1.00 74.44  ? 48  VAL C CG1 1 
ATOM   3229 C CG2 . VAL C 3 48  ? -59.523  -18.464 -55.969  1.00 74.27  ? 48  VAL C CG2 1 
ATOM   3230 N N   . ALA C 3 49  ? -60.354  -17.725 -60.493  1.00 74.93  ? 49  ALA C N   1 
ATOM   3231 C CA  . ALA C 3 49  ? -60.329  -18.208 -61.859  1.00 74.81  ? 49  ALA C CA  1 
ATOM   3232 C C   . ALA C 3 49  ? -61.254  -17.377 -62.714  1.00 75.26  ? 49  ALA C C   1 
ATOM   3233 O O   . ALA C 3 49  ? -62.187  -16.726 -62.223  1.00 74.98  ? 49  ALA C O   1 
ATOM   3234 C CB  . ALA C 3 49  ? -60.743  -19.643 -61.905  1.00 74.59  ? 49  ALA C CB  1 
ATOM   3235 N N   . TYR C 3 50  ? -60.994  -17.408 -64.009  1.00 76.04  ? 50  TYR C N   1 
ATOM   3236 C CA  . TYR C 3 50  ? -61.794  -16.659 -64.957  1.00 76.75  ? 50  TYR C CA  1 
ATOM   3237 C C   . TYR C 3 50  ? -61.849  -17.430 -66.238  1.00 77.45  ? 50  TYR C C   1 
ATOM   3238 O O   . TYR C 3 50  ? -60.807  -17.719 -66.828  1.00 77.52  ? 50  TYR C O   1 
ATOM   3239 C CB  . TYR C 3 50  ? -61.139  -15.318 -65.238  1.00 76.62  ? 50  TYR C CB  1 
ATOM   3240 C CG  . TYR C 3 50  ? -61.997  -14.357 -66.003  1.00 75.57  ? 50  TYR C CG  1 
ATOM   3241 C CD1 . TYR C 3 50  ? -62.774  -13.416 -65.330  1.00 75.58  ? 50  TYR C CD1 1 
ATOM   3242 C CD2 . TYR C 3 50  ? -62.009  -14.361 -67.386  1.00 74.22  ? 50  TYR C CD2 1 
ATOM   3243 C CE1 . TYR C 3 50  ? -63.553  -12.505 -66.008  1.00 75.88  ? 50  TYR C CE1 1 
ATOM   3244 C CE2 . TYR C 3 50  ? -62.779  -13.454 -68.087  1.00 75.59  ? 50  TYR C CE2 1 
ATOM   3245 C CZ  . TYR C 3 50  ? -63.560  -12.523 -67.394  1.00 76.59  ? 50  TYR C CZ  1 
ATOM   3246 O OH  . TYR C 3 50  ? -64.350  -11.608 -68.076  1.00 76.55  ? 50  TYR C OH  1 
ATOM   3247 N N   . ILE C 3 51  ? -63.056  -17.771 -66.665  1.00 78.21  ? 51  ILE C N   1 
ATOM   3248 C CA  . ILE C 3 51  ? -63.226  -18.375 -67.978  1.00 79.00  ? 51  ILE C CA  1 
ATOM   3249 C C   . ILE C 3 51  ? -63.929  -17.388 -68.916  1.00 79.67  ? 51  ILE C C   1 
ATOM   3250 O O   . ILE C 3 51  ? -64.825  -16.633 -68.490  1.00 80.01  ? 51  ILE C O   1 
ATOM   3251 C CB  . ILE C 3 51  ? -63.961  -19.742 -67.906  1.00 78.77  ? 51  ILE C CB  1 
ATOM   3252 C CG1 . ILE C 3 51  ? -63.933  -20.433 -69.272  1.00 78.32  ? 51  ILE C CG1 1 
ATOM   3253 C CG2 . ILE C 3 51  ? -65.377  -19.572 -67.357  1.00 78.63  ? 51  ILE C CG2 1 
ATOM   3254 C CD1 . ILE C 3 51  ? -64.431  -21.853 -69.253  1.00 78.93  ? 51  ILE C CD1 1 
ATOM   3255 N N   . SER C 3 52  ? -63.508  -17.393 -70.179  1.00 79.98  ? 52  SER C N   1 
ATOM   3256 C CA  . SER C 3 52  ? -64.135  -16.585 -71.219  1.00 80.53  ? 52  SER C CA  1 
ATOM   3257 C C   . SER C 3 52  ? -65.469  -17.148 -71.694  1.00 80.82  ? 52  SER C C   1 
ATOM   3258 O O   . SER C 3 52  ? -65.696  -18.361 -71.666  1.00 80.76  ? 52  SER C O   1 
ATOM   3259 C CB  . SER C 3 52  ? -63.202  -16.503 -72.408  1.00 80.78  ? 52  SER C CB  1 
ATOM   3260 O OG  . SER C 3 52  ? -62.784  -17.802 -72.786  1.00 81.72  ? 52  SER C OG  1 
ATOM   3261 N N   . SER C 3 53  ? -66.331  -16.245 -72.157  1.00 81.47  ? 53  SER C N   1 
ATOM   3262 C CA  . SER C 3 53  ? -67.693  -16.555 -72.662  1.00 81.99  ? 53  SER C CA  1 
ATOM   3263 C C   . SER C 3 53  ? -67.843  -17.927 -73.335  1.00 81.89  ? 53  SER C C   1 
ATOM   3264 O O   . SER C 3 53  ? -68.741  -18.705 -72.977  1.00 81.54  ? 53  SER C O   1 
ATOM   3265 C CB  . SER C 3 53  ? -68.198  -15.428 -73.608  1.00 82.25  ? 53  SER C CB  1 
ATOM   3266 O OG  . SER C 3 53  ? -69.425  -15.758 -74.256  1.00 82.00  ? 53  SER C OG  1 
ATOM   3267 N N   . GLY C 3 54  ? -66.966  -18.193 -74.306  1.00 81.89  ? 54  GLY C N   1 
ATOM   3268 C CA  . GLY C 3 54  ? -66.990  -19.431 -75.067  1.00 81.95  ? 54  GLY C CA  1 
ATOM   3269 C C   . GLY C 3 54  ? -65.885  -20.388 -74.655  1.00 82.01  ? 54  GLY C C   1 
ATOM   3270 O O   . GLY C 3 54  ? -65.203  -20.942 -75.508  1.00 82.57  ? 54  GLY C O   1 
ATOM   3271 N N   . GLY C 3 55  ? -65.690  -20.570 -73.350  1.00 81.70  ? 55  GLY C N   1 
ATOM   3272 C CA  . GLY C 3 55  ? -64.719  -21.533 -72.825  1.00 81.17  ? 55  GLY C CA  1 
ATOM   3273 C C   . GLY C 3 55  ? -63.325  -21.458 -73.410  1.00 80.83  ? 55  GLY C C   1 
ATOM   3274 O O   . GLY C 3 55  ? -62.474  -22.278 -73.101  1.00 80.55  ? 55  GLY C O   1 
ATOM   3275 N N   . GLY C 3 56  ? -63.102  -20.452 -74.243  1.00 81.03  ? 56  GLY C N   1 
ATOM   3276 C CA  . GLY C 3 56  ? -61.881  -20.310 -75.024  1.00 81.34  ? 56  GLY C CA  1 
ATOM   3277 C C   . GLY C 3 56  ? -60.653  -20.173 -74.160  1.00 81.28  ? 56  GLY C C   1 
ATOM   3278 O O   . GLY C 3 56  ? -59.875  -21.121 -74.029  1.00 81.78  ? 56  GLY C O   1 
ATOM   3279 N N   . SER C 3 57  ? -60.490  -18.994 -73.571  1.00 81.04  ? 57  SER C N   1 
ATOM   3280 C CA  . SER C 3 57  ? -59.403  -18.729 -72.627  1.00 80.96  ? 57  SER C CA  1 
ATOM   3281 C C   . SER C 3 57  ? -59.825  -18.884 -71.138  1.00 80.77  ? 57  SER C C   1 
ATOM   3282 O O   . SER C 3 57  ? -61.007  -18.684 -70.773  1.00 80.97  ? 57  SER C O   1 
ATOM   3283 C CB  . SER C 3 57  ? -58.841  -17.334 -72.891  1.00 81.04  ? 57  SER C CB  1 
ATOM   3284 O OG  . SER C 3 57  ? -59.885  -16.452 -73.277  1.00 80.61  ? 57  SER C OG  1 
ATOM   3285 N N   . THR C 3 58  ? -58.868  -19.277 -70.294  1.00 79.86  ? 58  THR C N   1 
ATOM   3286 C CA  . THR C 3 58  ? -59.076  -19.258 -68.848  1.00 79.07  ? 58  THR C CA  1 
ATOM   3287 C C   . THR C 3 58  ? -57.927  -18.488 -68.246  1.00 79.08  ? 58  THR C C   1 
ATOM   3288 O O   . THR C 3 58  ? -56.876  -18.413 -68.869  1.00 79.62  ? 58  THR C O   1 
ATOM   3289 C CB  . THR C 3 58  ? -59.115  -20.664 -68.227  1.00 78.77  ? 58  THR C CB  1 
ATOM   3290 O OG1 . THR C 3 58  ? -57.877  -21.347 -68.479  1.00 77.77  ? 58  THR C OG1 1 
ATOM   3291 C CG2 . THR C 3 58  ? -60.276  -21.445 -68.785  1.00 78.11  ? 58  THR C CG2 1 
ATOM   3292 N N   . TYR C 3 59  ? -58.112  -17.917 -67.051  1.00 78.62  ? 59  TYR C N   1 
ATOM   3293 C CA  . TYR C 3 59  ? -56.999  -17.259 -66.331  1.00 78.00  ? 59  TYR C CA  1 
ATOM   3294 C C   . TYR C 3 59  ? -56.993  -17.556 -64.827  1.00 77.10  ? 59  TYR C C   1 
ATOM   3295 O O   . TYR C 3 59  ? -58.040  -17.798 -64.225  1.00 77.08  ? 59  TYR C O   1 
ATOM   3296 C CB  . TYR C 3 59  ? -57.013  -15.749 -66.567  1.00 78.26  ? 59  TYR C CB  1 
ATOM   3297 C CG  . TYR C 3 59  ? -57.420  -15.320 -67.956  1.00 78.90  ? 59  TYR C CG  1 
ATOM   3298 C CD1 . TYR C 3 59  ? -56.468  -15.018 -68.925  1.00 80.78  ? 59  TYR C CD1 1 
ATOM   3299 C CD2 . TYR C 3 59  ? -58.758  -15.201 -68.297  1.00 80.74  ? 59  TYR C CD2 1 
ATOM   3300 C CE1 . TYR C 3 59  ? -56.844  -14.608 -70.225  1.00 82.35  ? 59  TYR C CE1 1 
ATOM   3301 C CE2 . TYR C 3 59  ? -59.150  -14.794 -69.584  1.00 82.62  ? 59  TYR C CE2 1 
ATOM   3302 C CZ  . TYR C 3 59  ? -58.193  -14.500 -70.544  1.00 82.66  ? 59  TYR C CZ  1 
ATOM   3303 O OH  . TYR C 3 59  ? -58.601  -14.091 -71.802  1.00 82.73  ? 59  TYR C OH  1 
ATOM   3304 N N   . TYR C 3 60  ? -55.814  -17.553 -64.222  1.00 76.05  ? 60  TYR C N   1 
ATOM   3305 C CA  . TYR C 3 60  ? -55.732  -17.809 -62.789  1.00 75.54  ? 60  TYR C CA  1 
ATOM   3306 C C   . TYR C 3 60  ? -54.641  -17.019 -62.119  1.00 75.55  ? 60  TYR C C   1 
ATOM   3307 O O   . TYR C 3 60  ? -53.594  -16.780 -62.704  1.00 76.10  ? 60  TYR C O   1 
ATOM   3308 C CB  . TYR C 3 60  ? -55.448  -19.275 -62.490  1.00 75.10  ? 60  TYR C CB  1 
ATOM   3309 C CG  . TYR C 3 60  ? -56.288  -20.263 -63.241  1.00 74.02  ? 60  TYR C CG  1 
ATOM   3310 C CD1 . TYR C 3 60  ? -57.479  -20.734 -62.716  1.00 72.93  ? 60  TYR C CD1 1 
ATOM   3311 C CD2 . TYR C 3 60  ? -55.864  -20.762 -64.459  1.00 73.06  ? 60  TYR C CD2 1 
ATOM   3312 C CE1 . TYR C 3 60  ? -58.228  -21.664 -63.403  1.00 72.97  ? 60  TYR C CE1 1 
ATOM   3313 C CE2 . TYR C 3 60  ? -56.600  -21.678 -65.150  1.00 72.85  ? 60  TYR C CE2 1 
ATOM   3314 C CZ  . TYR C 3 60  ? -57.782  -22.125 -64.630  1.00 73.04  ? 60  TYR C CZ  1 
ATOM   3315 O OH  . TYR C 3 60  ? -58.510  -23.037 -65.356  1.00 73.92  ? 60  TYR C OH  1 
ATOM   3316 N N   . PRO C 3 61  ? -54.863  -16.633 -60.866  1.00 75.28  ? 61  PRO C N   1 
ATOM   3317 C CA  . PRO C 3 61  ? -53.766  -16.162 -60.077  1.00 75.48  ? 61  PRO C CA  1 
ATOM   3318 C C   . PRO C 3 61  ? -52.728  -17.261 -60.016  1.00 76.04  ? 61  PRO C C   1 
ATOM   3319 O O   . PRO C 3 61  ? -53.094  -18.452 -60.051  1.00 76.23  ? 61  PRO C O   1 
ATOM   3320 C CB  . PRO C 3 61  ? -54.396  -16.014 -58.698  1.00 75.55  ? 61  PRO C CB  1 
ATOM   3321 C CG  . PRO C 3 61  ? -55.594  -16.899 -58.730  1.00 75.08  ? 61  PRO C CG  1 
ATOM   3322 C CD  . PRO C 3 61  ? -56.098  -16.698 -60.082  1.00 75.24  ? 61  PRO C CD  1 
ATOM   3323 N N   . ASP C 3 62  ? -51.455  -16.880 -59.922  1.00 76.28  ? 62  ASP C N   1 
ATOM   3324 C CA  . ASP C 3 62  ? -50.388  -17.857 -59.716  1.00 76.78  ? 62  ASP C CA  1 
ATOM   3325 C C   . ASP C 3 62  ? -50.593  -18.781 -58.504  1.00 76.81  ? 62  ASP C C   1 
ATOM   3326 O O   . ASP C 3 62  ? -50.016  -19.879 -58.467  1.00 77.44  ? 62  ASP C O   1 
ATOM   3327 C CB  . ASP C 3 62  ? -49.048  -17.158 -59.583  1.00 77.11  ? 62  ASP C CB  1 
ATOM   3328 C CG  . ASP C 3 62  ? -48.455  -16.777 -60.917  1.00 79.38  ? 62  ASP C CG  1 
ATOM   3329 O OD1 . ASP C 3 62  ? -47.372  -16.133 -60.907  1.00 81.47  ? 62  ASP C OD1 1 
ATOM   3330 O OD2 . ASP C 3 62  ? -49.058  -17.118 -61.972  1.00 81.59  ? 62  ASP C OD2 1 
ATOM   3331 N N   . THR C 3 63  ? -51.405  -18.347 -57.532  1.00 76.20  ? 63  THR C N   1 
ATOM   3332 C CA  . THR C 3 63  ? -51.637  -19.112 -56.309  1.00 75.38  ? 63  THR C CA  1 
ATOM   3333 C C   . THR C 3 63  ? -52.511  -20.331 -56.500  1.00 74.95  ? 63  THR C C   1 
ATOM   3334 O O   . THR C 3 63  ? -52.495  -21.228 -55.662  1.00 75.02  ? 63  THR C O   1 
ATOM   3335 C CB  . THR C 3 63  ? -52.232  -18.268 -55.191  1.00 75.38  ? 63  THR C CB  1 
ATOM   3336 O OG1 . THR C 3 63  ? -53.274  -17.451 -55.717  1.00 75.17  ? 63  THR C OG1 1 
ATOM   3337 C CG2 . THR C 3 63  ? -51.155  -17.392 -54.555  1.00 76.33  ? 63  THR C CG2 1 
ATOM   3338 N N   . VAL C 3 64  ? -53.275  -20.390 -57.581  1.00 74.49  ? 64  VAL C N   1 
ATOM   3339 C CA  . VAL C 3 64  ? -53.908  -21.669 -57.921  1.00 74.51  ? 64  VAL C CA  1 
ATOM   3340 C C   . VAL C 3 64  ? -53.566  -22.170 -59.327  1.00 74.57  ? 64  VAL C C   1 
ATOM   3341 O O   . VAL C 3 64  ? -53.967  -23.271 -59.712  1.00 74.50  ? 64  VAL C O   1 
ATOM   3342 C CB  . VAL C 3 64  ? -55.464  -21.740 -57.623  1.00 74.35  ? 64  VAL C CB  1 
ATOM   3343 C CG1 . VAL C 3 64  ? -55.724  -21.702 -56.149  1.00 74.69  ? 64  VAL C CG1 1 
ATOM   3344 C CG2 . VAL C 3 64  ? -56.263  -20.647 -58.319  1.00 74.05  ? 64  VAL C CG2 1 
ATOM   3345 N N   . LYS C 3 65  ? -52.824  -21.377 -60.094  1.00 74.62  ? 65  LYS C N   1 
ATOM   3346 C CA  . LYS C 3 65  ? -52.490  -21.805 -61.446  1.00 74.97  ? 65  LYS C CA  1 
ATOM   3347 C C   . LYS C 3 65  ? -51.815  -23.147 -61.337  1.00 75.22  ? 65  LYS C C   1 
ATOM   3348 O O   . LYS C 3 65  ? -50.856  -23.313 -60.580  1.00 75.10  ? 65  LYS C O   1 
ATOM   3349 C CB  . LYS C 3 65  ? -51.571  -20.814 -62.153  1.00 75.08  ? 65  LYS C CB  1 
ATOM   3350 C CG  . LYS C 3 65  ? -51.494  -20.984 -63.665  1.00 74.47  ? 65  LYS C CG  1 
ATOM   3351 C CD  . LYS C 3 65  ? -50.172  -20.440 -64.230  1.00 75.59  ? 65  LYS C CD  1 
ATOM   3352 C CE  . LYS C 3 65  ? -50.110  -18.911 -64.321  1.00 75.24  ? 65  LYS C CE  1 
ATOM   3353 N NZ  . LYS C 3 65  ? -51.034  -18.391 -65.348  1.00 76.09  ? 65  LYS C NZ  1 
ATOM   3354 N N   . GLY C 3 66  ? -52.352  -24.106 -62.075  1.00 75.79  ? 66  GLY C N   1 
ATOM   3355 C CA  . GLY C 3 66  ? -51.849  -25.475 -62.060  1.00 76.49  ? 66  GLY C CA  1 
ATOM   3356 C C   . GLY C 3 66  ? -52.751  -26.429 -61.304  1.00 76.96  ? 66  GLY C C   1 
ATOM   3357 O O   . GLY C 3 66  ? -52.967  -27.552 -61.748  1.00 77.05  ? 66  GLY C O   1 
ATOM   3358 N N   . ARG C 3 67  ? -53.289  -25.974 -60.171  1.00 77.37  ? 67  ARG C N   1 
ATOM   3359 C CA  . ARG C 3 67  ? -54.067  -26.823 -59.272  1.00 77.57  ? 67  ARG C CA  1 
ATOM   3360 C C   . ARG C 3 67  ? -55.559  -26.670 -59.483  1.00 77.88  ? 67  ARG C C   1 
ATOM   3361 O O   . ARG C 3 67  ? -56.334  -27.433 -58.923  1.00 77.90  ? 67  ARG C O   1 
ATOM   3362 C CB  . ARG C 3 67  ? -53.727  -26.519 -57.806  1.00 77.50  ? 67  ARG C CB  1 
ATOM   3363 C CG  . ARG C 3 67  ? -52.219  -26.352 -57.492  1.00 78.18  ? 67  ARG C CG  1 
ATOM   3364 C CD  . ARG C 3 67  ? -51.904  -26.549 -55.999  1.00 79.23  ? 67  ARG C CD  1 
ATOM   3365 N NE  . ARG C 3 67  ? -53.007  -26.075 -55.167  1.00 80.53  ? 67  ARG C NE  1 
ATOM   3366 C CZ  . ARG C 3 67  ? -53.124  -24.825 -54.738  1.00 81.03  ? 67  ARG C CZ  1 
ATOM   3367 N NH1 . ARG C 3 67  ? -52.186  -23.933 -55.047  1.00 82.29  ? 67  ARG C NH1 1 
ATOM   3368 N NH2 . ARG C 3 67  ? -54.165  -24.471 -53.998  1.00 79.26  ? 67  ARG C NH2 1 
ATOM   3369 N N   . PHE C 3 68  ? -55.959  -25.689 -60.289  1.00 78.77  ? 68  PHE C N   1 
ATOM   3370 C CA  . PHE C 3 68  ? -57.378  -25.291 -60.428  1.00 79.63  ? 68  PHE C CA  1 
ATOM   3371 C C   . PHE C 3 68  ? -57.849  -25.117 -61.895  1.00 80.00  ? 68  PHE C C   1 
ATOM   3372 O O   . PHE C 3 68  ? -57.059  -24.727 -62.759  1.00 80.26  ? 68  PHE C O   1 
ATOM   3373 C CB  . PHE C 3 68  ? -57.619  -24.013 -59.627  1.00 79.66  ? 68  PHE C CB  1 
ATOM   3374 C CG  . PHE C 3 68  ? -57.814  -24.237 -58.150  1.00 79.98  ? 68  PHE C CG  1 
ATOM   3375 C CD1 . PHE C 3 68  ? -57.181  -25.270 -57.489  1.00 80.83  ? 68  PHE C CD1 1 
ATOM   3376 C CD2 . PHE C 3 68  ? -58.621  -23.384 -57.415  1.00 80.92  ? 68  PHE C CD2 1 
ATOM   3377 C CE1 . PHE C 3 68  ? -57.364  -25.466 -56.115  1.00 82.15  ? 68  PHE C CE1 1 
ATOM   3378 C CE2 . PHE C 3 68  ? -58.807  -23.566 -56.043  1.00 81.12  ? 68  PHE C CE2 1 
ATOM   3379 C CZ  . PHE C 3 68  ? -58.177  -24.608 -55.394  1.00 81.18  ? 68  PHE C CZ  1 
ATOM   3380 N N   . THR C 3 69  ? -59.123  -25.405 -62.175  1.00 80.46  ? 69  THR C N   1 
ATOM   3381 C CA  . THR C 3 69  ? -59.577  -25.558 -63.577  1.00 81.24  ? 69  THR C CA  1 
ATOM   3382 C C   . THR C 3 69  ? -61.016  -25.068 -63.886  1.00 81.88  ? 69  THR C C   1 
ATOM   3383 O O   . THR C 3 69  ? -62.010  -25.775 -63.649  1.00 82.11  ? 69  THR C O   1 
ATOM   3384 C CB  . THR C 3 69  ? -59.423  -27.026 -64.047  1.00 81.25  ? 69  THR C CB  1 
ATOM   3385 O OG1 . THR C 3 69  ? -58.403  -27.684 -63.277  1.00 81.57  ? 69  THR C OG1 1 
ATOM   3386 C CG2 . THR C 3 69  ? -59.081  -27.090 -65.525  1.00 80.57  ? 69  THR C CG2 1 
ATOM   3387 N N   . ILE C 3 70  ? -61.122  -23.868 -64.439  1.00 82.30  ? 70  ILE C N   1 
ATOM   3388 C CA  . ILE C 3 70  ? -62.417  -23.248 -64.595  1.00 83.19  ? 70  ILE C CA  1 
ATOM   3389 C C   . ILE C 3 70  ? -63.094  -23.662 -65.902  1.00 84.15  ? 70  ILE C C   1 
ATOM   3390 O O   . ILE C 3 70  ? -62.968  -22.999 -66.920  1.00 84.66  ? 70  ILE C O   1 
ATOM   3391 C CB  . ILE C 3 70  ? -62.342  -21.698 -64.401  1.00 83.13  ? 70  ILE C CB  1 
ATOM   3392 C CG1 . ILE C 3 70  ? -63.729  -21.063 -64.552  1.00 83.97  ? 70  ILE C CG1 1 
ATOM   3393 C CG2 . ILE C 3 70  ? -61.325  -21.050 -65.338  1.00 82.57  ? 70  ILE C CG2 1 
ATOM   3394 C CD1 . ILE C 3 70  ? -63.892  -19.709 -63.897  1.00 84.10  ? 70  ILE C CD1 1 
ATOM   3395 N N   . SER C 3 71  ? -63.815  -24.772 -65.879  1.00 85.28  ? 71  SER C N   1 
ATOM   3396 C CA  . SER C 3 71  ? -64.573  -25.185 -67.064  1.00 86.24  ? 71  SER C CA  1 
ATOM   3397 C C   . SER C 3 71  ? -66.019  -24.684 -67.002  1.00 87.15  ? 71  SER C C   1 
ATOM   3398 O O   . SER C 3 71  ? -66.489  -24.245 -65.938  1.00 86.98  ? 71  SER C O   1 
ATOM   3399 C CB  . SER C 3 71  ? -64.541  -26.703 -67.217  1.00 86.04  ? 71  SER C CB  1 
ATOM   3400 O OG  . SER C 3 71  ? -65.071  -27.340 -66.066  1.00 85.95  ? 71  SER C OG  1 
ATOM   3401 N N   . ARG C 3 72  ? -66.702  -24.727 -68.150  1.00 88.24  ? 72  ARG C N   1 
ATOM   3402 C CA  . ARG C 3 72  ? -68.144  -24.434 -68.231  1.00 89.32  ? 72  ARG C CA  1 
ATOM   3403 C C   . ARG C 3 72  ? -68.832  -25.354 -69.229  1.00 90.35  ? 72  ARG C C   1 
ATOM   3404 O O   . ARG C 3 72  ? -68.190  -25.920 -70.115  1.00 90.91  ? 72  ARG C O   1 
ATOM   3405 C CB  . ARG C 3 72  ? -68.415  -22.972 -68.605  1.00 88.90  ? 72  ARG C CB  1 
ATOM   3406 C CG  . ARG C 3 72  ? -68.291  -22.670 -70.088  1.00 88.45  ? 72  ARG C CG  1 
ATOM   3407 C CD  . ARG C 3 72  ? -68.102  -21.178 -70.342  1.00 88.66  ? 72  ARG C CD  1 
ATOM   3408 N NE  . ARG C 3 72  ? -69.333  -20.402 -70.190  1.00 88.12  ? 72  ARG C NE  1 
ATOM   3409 C CZ  . ARG C 3 72  ? -69.390  -19.073 -70.114  1.00 87.46  ? 72  ARG C CZ  1 
ATOM   3410 N NH1 . ARG C 3 72  ? -68.283  -18.342 -70.165  1.00 86.67  ? 72  ARG C NH1 1 
ATOM   3411 N NH2 . ARG C 3 72  ? -70.565  -18.473 -69.979  1.00 87.07  ? 72  ARG C NH2 1 
ATOM   3412 N N   . ASP C 3 73  ? -70.143  -25.488 -69.078  1.00 91.27  ? 73  ASP C N   1 
ATOM   3413 C CA  . ASP C 3 73  ? -70.947  -26.282 -69.979  1.00 92.06  ? 73  ASP C CA  1 
ATOM   3414 C C   . ASP C 3 73  ? -72.270  -25.555 -70.164  1.00 92.30  ? 73  ASP C C   1 
ATOM   3415 O O   . ASP C 3 73  ? -73.184  -25.668 -69.341  1.00 92.31  ? 73  ASP C O   1 
ATOM   3416 C CB  . ASP C 3 73  ? -71.147  -27.693 -69.405  1.00 92.47  ? 73  ASP C CB  1 
ATOM   3417 C CG  . ASP C 3 73  ? -72.180  -28.504 -70.178  1.00 93.81  ? 73  ASP C CG  1 
ATOM   3418 O OD1 . ASP C 3 73  ? -72.051  -28.562 -71.430  1.00 94.86  ? 73  ASP C OD1 1 
ATOM   3419 O OD2 . ASP C 3 73  ? -73.111  -29.071 -69.531  1.00 93.88  ? 73  ASP C OD2 1 
ATOM   3420 N N   . ASN C 3 74  ? -72.353  -24.779 -71.238  1.00 92.77  ? 74  ASN C N   1 
ATOM   3421 C CA  . ASN C 3 74  ? -73.558  -23.995 -71.555  1.00 93.31  ? 74  ASN C CA  1 
ATOM   3422 C C   . ASN C 3 74  ? -74.639  -24.895 -72.177  1.00 93.78  ? 74  ASN C C   1 
ATOM   3423 O O   . ASN C 3 74  ? -75.652  -24.416 -72.716  1.00 93.85  ? 74  ASN C O   1 
ATOM   3424 C CB  . ASN C 3 74  ? -73.213  -22.834 -72.499  1.00 93.06  ? 74  ASN C CB  1 
ATOM   3425 C CG  . ASN C 3 74  ? -71.722  -22.671 -72.692  1.00 92.40  ? 74  ASN C CG  1 
ATOM   3426 O OD1 . ASN C 3 74  ? -70.972  -23.647 -72.634  1.00 91.99  ? 74  ASN C OD1 1 
ATOM   3427 N ND2 . ASN C 3 74  ? -71.280  -21.443 -72.921  1.00 91.58  ? 74  ASN C ND2 1 
ATOM   3428 N N   . ALA C 3 75  ? -74.394  -26.202 -72.130  1.00 93.96  ? 75  ALA C N   1 
ATOM   3429 C CA  . ALA C 3 75  ? -75.419  -27.162 -72.436  1.00 94.39  ? 75  ALA C CA  1 
ATOM   3430 C C   . ALA C 3 75  ? -76.281  -27.232 -71.182  1.00 94.84  ? 75  ALA C C   1 
ATOM   3431 O O   . ALA C 3 75  ? -77.473  -26.897 -71.203  1.00 95.11  ? 75  ALA C O   1 
ATOM   3432 C CB  . ALA C 3 75  ? -74.807  -28.506 -72.765  1.00 94.37  ? 75  ALA C CB  1 
ATOM   3433 N N   . LYS C 3 76  ? -75.666  -27.617 -70.072  1.00 95.09  ? 76  LYS C N   1 
ATOM   3434 C CA  . LYS C 3 76  ? -76.403  -27.680 -68.825  1.00 95.41  ? 76  LYS C CA  1 
ATOM   3435 C C   . LYS C 3 76  ? -76.223  -26.449 -67.940  1.00 94.94  ? 76  LYS C C   1 
ATOM   3436 O O   . LYS C 3 76  ? -76.447  -26.498 -66.730  1.00 95.07  ? 76  LYS C O   1 
ATOM   3437 C CB  . LYS C 3 76  ? -76.124  -29.003 -68.102  1.00 95.78  ? 76  LYS C CB  1 
ATOM   3438 C CG  . LYS C 3 76  ? -77.309  -30.009 -68.189  1.00 98.22  ? 76  LYS C CG  1 
ATOM   3439 C CD  . LYS C 3 76  ? -78.086  -29.999 -69.554  1.00 100.20 ? 76  LYS C CD  1 
ATOM   3440 C CE  . LYS C 3 76  ? -79.557  -30.468 -69.405  1.00 100.03 ? 76  LYS C CE  1 
ATOM   3441 N NZ  . LYS C 3 76  ? -80.481  -29.364 -68.983  1.00 99.23  ? 76  LYS C NZ  1 
ATOM   3442 N N   . ASN C 3 77  ? -75.834  -25.339 -68.567  1.00 94.37  ? 77  ASN C N   1 
ATOM   3443 C CA  . ASN C 3 77  ? -75.823  -24.025 -67.926  1.00 93.98  ? 77  ASN C CA  1 
ATOM   3444 C C   . ASN C 3 77  ? -74.958  -23.865 -66.671  1.00 93.54  ? 77  ASN C C   1 
ATOM   3445 O O   . ASN C 3 77  ? -74.994  -22.831 -65.990  1.00 93.35  ? 77  ASN C O   1 
ATOM   3446 C CB  . ASN C 3 77  ? -77.255  -23.568 -67.647  1.00 94.03  ? 77  ASN C CB  1 
ATOM   3447 C CG  . ASN C 3 77  ? -77.652  -22.372 -68.485  1.00 94.84  ? 77  ASN C CG  1 
ATOM   3448 O OD1 . ASN C 3 77  ? -77.209  -22.201 -69.636  1.00 95.35  ? 77  ASN C OD1 1 
ATOM   3449 N ND2 . ASN C 3 77  ? -78.484  -21.520 -67.906  1.00 95.71  ? 77  ASN C ND2 1 
ATOM   3450 N N   . THR C 3 78  ? -74.169  -24.890 -66.382  1.00 93.14  ? 78  THR C N   1 
ATOM   3451 C CA  . THR C 3 78  ? -73.315  -24.892 -65.199  1.00 92.58  ? 78  THR C CA  1 
ATOM   3452 C C   . THR C 3 78  ? -71.931  -24.256 -65.487  1.00 92.21  ? 78  THR C C   1 
ATOM   3453 O O   . THR C 3 78  ? -71.414  -24.314 -66.617  1.00 92.24  ? 78  THR C O   1 
ATOM   3454 C CB  . THR C 3 78  ? -73.143  -26.338 -64.607  1.00 92.58  ? 78  THR C CB  1 
ATOM   3455 O OG1 . THR C 3 78  ? -72.322  -27.112 -65.483  1.00 92.40  ? 78  THR C OG1 1 
ATOM   3456 C CG2 . THR C 3 78  ? -74.507  -27.059 -64.399  1.00 91.56  ? 78  THR C CG2 1 
ATOM   3457 N N   . LEU C 3 79  ? -71.366  -23.620 -64.464  1.00 91.36  ? 79  LEU C N   1 
ATOM   3458 C CA  . LEU C 3 79  ? -69.955  -23.258 -64.452  1.00 90.61  ? 79  LEU C CA  1 
ATOM   3459 C C   . LEU C 3 79  ? -69.288  -24.282 -63.553  1.00 90.33  ? 79  LEU C C   1 
ATOM   3460 O O   . LEU C 3 79  ? -69.948  -24.871 -62.704  1.00 90.59  ? 79  LEU C O   1 
ATOM   3461 C CB  . LEU C 3 79  ? -69.763  -21.840 -63.907  1.00 90.33  ? 79  LEU C CB  1 
ATOM   3462 C CG  . LEU C 3 79  ? -68.366  -21.336 -63.540  1.00 89.67  ? 79  LEU C CG  1 
ATOM   3463 C CD1 . LEU C 3 79  ? -67.446  -21.247 -64.733  1.00 88.81  ? 79  LEU C CD1 1 
ATOM   3464 C CD2 . LEU C 3 79  ? -68.483  -19.997 -62.871  1.00 89.99  ? 79  LEU C CD2 1 
ATOM   3465 N N   . TYR C 3 80  ? -67.998  -24.522 -63.735  1.00 89.84  ? 80  TYR C N   1 
ATOM   3466 C CA  . TYR C 3 80  ? -67.325  -25.471 -62.864  1.00 89.53  ? 80  TYR C CA  1 
ATOM   3467 C C   . TYR C 3 80  ? -65.999  -24.965 -62.338  1.00 89.21  ? 80  TYR C C   1 
ATOM   3468 O O   . TYR C 3 80  ? -65.245  -24.304 -63.058  1.00 89.43  ? 80  TYR C O   1 
ATOM   3469 C CB  . TYR C 3 80  ? -67.066  -26.787 -63.591  1.00 89.71  ? 80  TYR C CB  1 
ATOM   3470 C CG  . TYR C 3 80  ? -68.286  -27.508 -64.078  1.00 89.92  ? 80  TYR C CG  1 
ATOM   3471 C CD1 . TYR C 3 80  ? -69.201  -28.056 -63.180  1.00 89.62  ? 80  TYR C CD1 1 
ATOM   3472 C CD2 . TYR C 3 80  ? -68.511  -27.670 -65.441  1.00 90.59  ? 80  TYR C CD2 1 
ATOM   3473 C CE1 . TYR C 3 80  ? -70.318  -28.726 -63.624  1.00 90.20  ? 80  TYR C CE1 1 
ATOM   3474 C CE2 . TYR C 3 80  ? -69.623  -28.344 -65.901  1.00 91.22  ? 80  TYR C CE2 1 
ATOM   3475 C CZ  . TYR C 3 80  ? -70.521  -28.872 -64.985  1.00 91.32  ? 80  TYR C CZ  1 
ATOM   3476 O OH  . TYR C 3 80  ? -71.627  -29.548 -65.438  1.00 92.94  ? 80  TYR C OH  1 
ATOM   3477 N N   . LEU C 3 81  ? -65.708  -25.297 -61.088  1.00 88.48  ? 81  LEU C N   1 
ATOM   3478 C CA  . LEU C 3 81  ? -64.350  -25.199 -60.616  1.00 87.98  ? 81  LEU C CA  1 
ATOM   3479 C C   . LEU C 3 81  ? -63.870  -26.556 -60.113  1.00 87.73  ? 81  LEU C C   1 
ATOM   3480 O O   . LEU C 3 81  ? -64.429  -27.124 -59.169  1.00 87.31  ? 81  LEU C O   1 
ATOM   3481 C CB  . LEU C 3 81  ? -64.185  -24.103 -59.558  1.00 87.92  ? 81  LEU C CB  1 
ATOM   3482 C CG  . LEU C 3 81  ? -62.712  -23.685 -59.395  1.00 87.85  ? 81  LEU C CG  1 
ATOM   3483 C CD1 . LEU C 3 81  ? -62.248  -22.751 -60.514  1.00 87.18  ? 81  LEU C CD1 1 
ATOM   3484 C CD2 . LEU C 3 81  ? -62.448  -23.059 -58.044  1.00 87.55  ? 81  LEU C CD2 1 
ATOM   3485 N N   . GLN C 3 82  ? -62.834  -27.072 -60.768  1.00 87.54  ? 82  GLN C N   1 
ATOM   3486 C CA  . GLN C 3 82  ? -62.251  -28.346 -60.380  1.00 87.61  ? 82  GLN C CA  1 
ATOM   3487 C C   . GLN C 3 82  ? -60.953  -28.124 -59.625  1.00 87.06  ? 82  GLN C C   1 
ATOM   3488 O O   . GLN C 3 82  ? -59.926  -27.818 -60.239  1.00 87.09  ? 82  GLN C O   1 
ATOM   3489 C CB  . GLN C 3 82  ? -61.997  -29.222 -61.612  1.00 88.07  ? 82  GLN C CB  1 
ATOM   3490 C CG  . GLN C 3 82  ? -62.335  -30.717 -61.416  1.00 89.83  ? 82  GLN C CG  1 
ATOM   3491 C CD  . GLN C 3 82  ? -61.556  -31.370 -60.282  1.00 92.22  ? 82  GLN C CD  1 
ATOM   3492 O OE1 . GLN C 3 82  ? -60.402  -31.779 -60.462  1.00 93.65  ? 82  GLN C OE1 1 
ATOM   3493 N NE2 . GLN C 3 82  ? -62.185  -31.479 -59.107  1.00 92.46  ? 82  GLN C NE2 1 
ATOM   3494 N N   . MET C 3 83  ? -61.015  -28.279 -58.299  1.00 86.41  ? 83  MET C N   1 
ATOM   3495 C CA  . MET C 3 83  ? -59.869  -28.071 -57.396  1.00 85.64  ? 83  MET C CA  1 
ATOM   3496 C C   . MET C 3 83  ? -59.085  -29.356 -57.272  1.00 84.81  ? 83  MET C C   1 
ATOM   3497 O O   . MET C 3 83  ? -59.687  -30.406 -57.086  1.00 85.09  ? 83  MET C O   1 
ATOM   3498 C CB  . MET C 3 83  ? -60.348  -27.644 -55.995  1.00 85.81  ? 83  MET C CB  1 
ATOM   3499 C CG  . MET C 3 83  ? -61.127  -26.317 -55.954  1.00 86.75  ? 83  MET C CG  1 
ATOM   3500 S SD  . MET C 3 83  ? -61.922  -25.913 -54.369  1.00 88.45  ? 83  MET C SD  1 
ATOM   3501 C CE  . MET C 3 83  ? -60.597  -25.148 -53.472  1.00 88.66  ? 83  MET C CE  1 
ATOM   3502 N N   . SER C 3 84  ? -57.759  -29.284 -57.380  1.00 83.85  ? 84  SER C N   1 
ATOM   3503 C CA  . SER C 3 84  ? -56.899  -30.439 -57.100  1.00 83.12  ? 84  SER C CA  1 
ATOM   3504 C C   . SER C 3 84  ? -55.931  -30.106 -55.967  1.00 82.72  ? 84  SER C C   1 
ATOM   3505 O O   . SER C 3 84  ? -56.309  -29.381 -55.070  1.00 82.72  ? 84  SER C O   1 
ATOM   3506 C CB  . SER C 3 84  ? -56.173  -30.910 -58.357  1.00 83.15  ? 84  SER C CB  1 
ATOM   3507 O OG  . SER C 3 84  ? -55.019  -30.128 -58.598  1.00 83.45  ? 84  SER C OG  1 
ATOM   3508 N N   . SER C 3 85  ? -54.698  -30.617 -56.024  1.00 82.60  ? 85  SER C N   1 
ATOM   3509 C CA  . SER C 3 85  ? -53.677  -30.545 -54.934  1.00 82.50  ? 85  SER C CA  1 
ATOM   3510 C C   . SER C 3 85  ? -53.979  -29.592 -53.777  1.00 82.44  ? 85  SER C C   1 
ATOM   3511 O O   . SER C 3 85  ? -53.273  -28.601 -53.585  1.00 82.79  ? 85  SER C O   1 
ATOM   3512 C CB  . SER C 3 85  ? -52.292  -30.210 -55.501  1.00 82.27  ? 85  SER C CB  1 
ATOM   3513 O OG  . SER C 3 85  ? -52.066  -30.883 -56.725  1.00 82.99  ? 85  SER C OG  1 
ATOM   3514 N N   . LEU C 3 86  ? -54.997  -29.912 -52.985  1.00 82.17  ? 86  LEU C N   1 
ATOM   3515 C CA  . LEU C 3 86  ? -55.606  -28.914 -52.118  1.00 81.90  ? 86  LEU C CA  1 
ATOM   3516 C C   . LEU C 3 86  ? -54.777  -28.494 -50.926  1.00 81.85  ? 86  LEU C C   1 
ATOM   3517 O O   . LEU C 3 86  ? -54.576  -29.274 -50.014  1.00 81.94  ? 86  LEU C O   1 
ATOM   3518 C CB  . LEU C 3 86  ? -57.021  -29.330 -51.705  1.00 81.76  ? 86  LEU C CB  1 
ATOM   3519 C CG  . LEU C 3 86  ? -58.099  -28.652 -52.558  1.00 81.15  ? 86  LEU C CG  1 
ATOM   3520 C CD1 . LEU C 3 86  ? -59.101  -29.648 -53.100  1.00 81.50  ? 86  LEU C CD1 1 
ATOM   3521 C CD2 . LEU C 3 86  ? -58.788  -27.572 -51.779  1.00 79.78  ? 86  LEU C CD2 1 
ATOM   3522 N N   . LYS C 3 87  ? -54.305  -27.250 -50.964  1.00 81.94  ? 87  LYS C N   1 
ATOM   3523 C CA  . LYS C 3 87  ? -53.688  -26.594 -49.816  1.00 82.28  ? 87  LYS C CA  1 
ATOM   3524 C C   . LYS C 3 87  ? -54.737  -26.181 -48.792  1.00 82.56  ? 87  LYS C C   1 
ATOM   3525 O O   . LYS C 3 87  ? -55.853  -25.787 -49.155  1.00 82.60  ? 87  LYS C O   1 
ATOM   3526 C CB  . LYS C 3 87  ? -52.930  -25.335 -50.244  1.00 82.19  ? 87  LYS C CB  1 
ATOM   3527 C CG  . LYS C 3 87  ? -52.013  -25.515 -51.431  1.00 81.97  ? 87  LYS C CG  1 
ATOM   3528 C CD  . LYS C 3 87  ? -50.867  -24.532 -51.394  1.00 80.45  ? 87  LYS C CD  1 
ATOM   3529 C CE  . LYS C 3 87  ? -49.905  -24.838 -52.497  1.00 80.47  ? 87  LYS C CE  1 
ATOM   3530 N NZ  . LYS C 3 87  ? -48.568  -24.456 -52.013  1.00 82.52  ? 87  LYS C NZ  1 
ATOM   3531 N N   . SER C 3 88  ? -54.352  -26.240 -47.520  1.00 82.69  ? 88  SER C N   1 
ATOM   3532 C CA  . SER C 3 88  ? -55.170  -25.754 -46.414  1.00 83.10  ? 88  SER C CA  1 
ATOM   3533 C C   . SER C 3 88  ? -55.286  -24.224 -46.392  1.00 82.95  ? 88  SER C C   1 
ATOM   3534 O O   . SER C 3 88  ? -55.962  -23.658 -45.529  1.00 82.77  ? 88  SER C O   1 
ATOM   3535 C CB  . SER C 3 88  ? -54.521  -26.190 -45.131  1.00 83.35  ? 88  SER C CB  1 
ATOM   3536 O OG  . SER C 3 88  ? -53.235  -25.593 -45.084  1.00 85.45  ? 88  SER C OG  1 
ATOM   3537 N N   . GLU C 3 89  ? -54.576  -23.567 -47.310  1.00 82.91  ? 89  GLU C N   1 
ATOM   3538 C CA  . GLU C 3 89  ? -54.817  -22.164 -47.640  1.00 82.85  ? 89  GLU C CA  1 
ATOM   3539 C C   . GLU C 3 89  ? -56.139  -22.016 -48.405  1.00 82.21  ? 89  GLU C C   1 
ATOM   3540 O O   . GLU C 3 89  ? -56.844  -21.027 -48.238  1.00 82.05  ? 89  GLU C O   1 
ATOM   3541 C CB  . GLU C 3 89  ? -53.673  -21.595 -48.484  1.00 83.02  ? 89  GLU C CB  1 
ATOM   3542 C CG  . GLU C 3 89  ? -52.388  -21.285 -47.712  1.00 86.06  ? 89  GLU C CG  1 
ATOM   3543 C CD  . GLU C 3 89  ? -51.463  -22.495 -47.542  1.00 90.09  ? 89  GLU C CD  1 
ATOM   3544 O OE1 . GLU C 3 89  ? -51.161  -23.172 -48.560  1.00 91.27  ? 89  GLU C OE1 1 
ATOM   3545 O OE2 . GLU C 3 89  ? -51.023  -22.754 -46.389  1.00 91.24  ? 89  GLU C OE2 1 
ATOM   3546 N N   . ASP C 3 90  ? -56.474  -23.011 -49.230  1.00 81.59  ? 90  ASP C N   1 
ATOM   3547 C CA  . ASP C 3 90  ? -57.650  -22.962 -50.108  1.00 81.10  ? 90  ASP C CA  1 
ATOM   3548 C C   . ASP C 3 90  ? -58.959  -22.880 -49.336  1.00 80.61  ? 90  ASP C C   1 
ATOM   3549 O O   . ASP C 3 90  ? -60.017  -22.510 -49.879  1.00 80.51  ? 90  ASP C O   1 
ATOM   3550 C CB  . ASP C 3 90  ? -57.677  -24.189 -51.000  1.00 81.11  ? 90  ASP C CB  1 
ATOM   3551 C CG  . ASP C 3 90  ? -56.550  -24.209 -51.987  1.00 82.75  ? 90  ASP C CG  1 
ATOM   3552 O OD1 . ASP C 3 90  ? -55.938  -23.141 -52.250  1.00 84.89  ? 90  ASP C OD1 1 
ATOM   3553 O OD2 . ASP C 3 90  ? -56.278  -25.303 -52.522  1.00 84.80  ? 90  ASP C OD2 1 
ATOM   3554 N N   . THR C 3 91  ? -58.869  -23.270 -48.071  1.00 79.80  ? 91  THR C N   1 
ATOM   3555 C CA  . THR C 3 91  ? -59.934  -23.150 -47.102  1.00 78.84  ? 91  THR C CA  1 
ATOM   3556 C C   . THR C 3 91  ? -60.608  -21.770 -47.174  1.00 78.59  ? 91  THR C C   1 
ATOM   3557 O O   . THR C 3 91  ? -60.061  -20.782 -46.658  1.00 78.78  ? 91  THR C O   1 
ATOM   3558 C CB  . THR C 3 91  ? -59.317  -23.320 -45.724  1.00 78.68  ? 91  THR C CB  1 
ATOM   3559 O OG1 . THR C 3 91  ? -58.416  -24.439 -45.747  1.00 78.50  ? 91  THR C OG1 1 
ATOM   3560 C CG2 . THR C 3 91  ? -60.386  -23.495 -44.681  1.00 78.30  ? 91  THR C CG2 1 
ATOM   3561 N N   . ALA C 3 92  ? -61.776  -21.696 -47.820  1.00 77.57  ? 92  ALA C N   1 
ATOM   3562 C CA  . ALA C 3 92  ? -62.531  -20.449 -47.897  1.00 76.81  ? 92  ALA C CA  1 
ATOM   3563 C C   . ALA C 3 92  ? -63.946  -20.704 -48.372  1.00 76.81  ? 92  ALA C C   1 
ATOM   3564 O O   . ALA C 3 92  ? -64.288  -21.835 -48.692  1.00 77.02  ? 92  ALA C O   1 
ATOM   3565 C CB  . ALA C 3 92  ? -61.852  -19.502 -48.824  1.00 76.66  ? 92  ALA C CB  1 
ATOM   3566 N N   . MET C 3 93  ? -64.764  -19.649 -48.413  1.00 76.69  ? 93  MET C N   1 
ATOM   3567 C CA  . MET C 3 93  ? -66.097  -19.671 -49.024  1.00 76.41  ? 93  MET C CA  1 
ATOM   3568 C C   . MET C 3 93  ? -65.924  -19.386 -50.498  1.00 76.51  ? 93  MET C C   1 
ATOM   3569 O O   . MET C 3 93  ? -65.119  -18.531 -50.850  1.00 76.70  ? 93  MET C O   1 
ATOM   3570 C CB  . MET C 3 93  ? -66.947  -18.567 -48.424  1.00 76.30  ? 93  MET C CB  1 
ATOM   3571 C CG  . MET C 3 93  ? -68.294  -18.387 -49.079  1.00 77.01  ? 93  MET C CG  1 
ATOM   3572 S SD  . MET C 3 93  ? -69.375  -19.772 -48.696  1.00 79.37  ? 93  MET C SD  1 
ATOM   3573 C CE  . MET C 3 93  ? -69.515  -19.634 -46.910  1.00 79.16  ? 93  MET C CE  1 
ATOM   3574 N N   . TYR C 3 94  ? -66.682  -20.065 -51.357  1.00 76.64  ? 94  TYR C N   1 
ATOM   3575 C CA  . TYR C 3 94  ? -66.447  -19.991 -52.808  1.00 76.96  ? 94  TYR C CA  1 
ATOM   3576 C C   . TYR C 3 94  ? -67.556  -19.376 -53.678  1.00 77.63  ? 94  TYR C C   1 
ATOM   3577 O O   . TYR C 3 94  ? -68.473  -20.074 -54.085  1.00 77.89  ? 94  TYR C O   1 
ATOM   3578 C CB  . TYR C 3 94  ? -66.032  -21.365 -53.338  1.00 76.47  ? 94  TYR C CB  1 
ATOM   3579 C CG  . TYR C 3 94  ? -64.553  -21.584 -53.217  1.00 75.41  ? 94  TYR C CG  1 
ATOM   3580 C CD1 . TYR C 3 94  ? -63.983  -21.934 -52.001  1.00 75.14  ? 94  TYR C CD1 1 
ATOM   3581 C CD2 . TYR C 3 94  ? -63.714  -21.406 -54.310  1.00 74.07  ? 94  TYR C CD2 1 
ATOM   3582 C CE1 . TYR C 3 94  ? -62.599  -22.117 -51.877  1.00 75.36  ? 94  TYR C CE1 1 
ATOM   3583 C CE2 . TYR C 3 94  ? -62.336  -21.587 -54.201  1.00 74.20  ? 94  TYR C CE2 1 
ATOM   3584 C CZ  . TYR C 3 94  ? -61.782  -21.941 -52.981  1.00 74.70  ? 94  TYR C CZ  1 
ATOM   3585 O OH  . TYR C 3 94  ? -60.419  -22.119 -52.857  1.00 74.22  ? 94  TYR C OH  1 
ATOM   3586 N N   . TYR C 3 95  ? -67.452  -18.089 -54.000  1.00 78.52  ? 95  TYR C N   1 
ATOM   3587 C CA  . TYR C 3 95  ? -68.493  -17.417 -54.791  1.00 79.57  ? 95  TYR C CA  1 
ATOM   3588 C C   . TYR C 3 95  ? -68.266  -17.581 -56.277  1.00 80.38  ? 95  TYR C C   1 
ATOM   3589 O O   . TYR C 3 95  ? -67.126  -17.681 -56.731  1.00 80.52  ? 95  TYR C O   1 
ATOM   3590 C CB  . TYR C 3 95  ? -68.586  -15.925 -54.461  1.00 79.56  ? 95  TYR C CB  1 
ATOM   3591 C CG  . TYR C 3 95  ? -68.813  -15.658 -53.007  1.00 79.56  ? 95  TYR C CG  1 
ATOM   3592 C CD1 . TYR C 3 95  ? -67.737  -15.549 -52.139  1.00 79.49  ? 95  TYR C CD1 1 
ATOM   3593 C CD2 . TYR C 3 95  ? -70.102  -15.534 -52.492  1.00 79.29  ? 95  TYR C CD2 1 
ATOM   3594 C CE1 . TYR C 3 95  ? -67.927  -15.325 -50.802  1.00 80.23  ? 95  TYR C CE1 1 
ATOM   3595 C CE2 . TYR C 3 95  ? -70.305  -15.298 -51.149  1.00 79.89  ? 95  TYR C CE2 1 
ATOM   3596 C CZ  . TYR C 3 95  ? -69.205  -15.201 -50.308  1.00 80.54  ? 95  TYR C CZ  1 
ATOM   3597 O OH  . TYR C 3 95  ? -69.358  -14.985 -48.958  1.00 81.83  ? 95  TYR C OH  1 
ATOM   3598 N N   . CYS C 3 96  ? -69.371  -17.594 -57.015  1.00 81.30  ? 96  CYS C N   1 
ATOM   3599 C CA  . CYS C 3 96  ? -69.376  -17.684 -58.454  1.00 82.67  ? 96  CYS C CA  1 
ATOM   3600 C C   . CYS C 3 96  ? -69.912  -16.357 -58.939  1.00 82.80  ? 96  CYS C C   1 
ATOM   3601 O O   . CYS C 3 96  ? -71.030  -15.987 -58.618  1.00 82.90  ? 96  CYS C O   1 
ATOM   3602 C CB  . CYS C 3 96  ? -70.277  -18.849 -58.881  1.00 83.14  ? 96  CYS C CB  1 
ATOM   3603 S SG  . CYS C 3 96  ? -71.109  -18.743 -60.528  1.00 87.48  ? 96  CYS C SG  1 
ATOM   3604 N N   . ALA C 3 97  ? -69.111  -15.626 -59.702  1.00 83.58  ? 97  ALA C N   1 
ATOM   3605 C CA  . ALA C 3 97  ? -69.475  -14.258 -60.076  1.00 84.43  ? 97  ALA C CA  1 
ATOM   3606 C C   . ALA C 3 97  ? -69.632  -13.995 -61.588  1.00 85.25  ? 97  ALA C C   1 
ATOM   3607 O O   . ALA C 3 97  ? -69.192  -14.788 -62.432  1.00 85.71  ? 97  ALA C O   1 
ATOM   3608 C CB  . ALA C 3 97  ? -68.503  -13.270 -59.451  1.00 84.06  ? 97  ALA C CB  1 
ATOM   3609 N N   . ARG C 3 98  ? -70.258  -12.863 -61.908  1.00 85.91  ? 98  ARG C N   1 
ATOM   3610 C CA  . ARG C 3 98  ? -70.563  -12.485 -63.275  1.00 86.49  ? 98  ARG C CA  1 
ATOM   3611 C C   . ARG C 3 98  ? -70.022  -11.101 -63.605  1.00 86.76  ? 98  ARG C C   1 
ATOM   3612 O O   . ARG C 3 98  ? -70.362  -10.137 -62.917  1.00 87.41  ? 98  ARG C O   1 
ATOM   3613 C CB  . ARG C 3 98  ? -72.062  -12.445 -63.451  1.00 86.60  ? 98  ARG C CB  1 
ATOM   3614 C CG  . ARG C 3 98  ? -72.466  -12.289 -64.877  1.00 88.61  ? 98  ARG C CG  1 
ATOM   3615 C CD  . ARG C 3 98  ? -73.926  -12.472 -64.987  1.00 92.28  ? 98  ARG C CD  1 
ATOM   3616 N NE  . ARG C 3 98  ? -74.596  -11.190 -64.987  1.00 95.71  ? 98  ARG C NE  1 
ATOM   3617 C CZ  . ARG C 3 98  ? -75.334  -10.755 -65.999  1.00 98.49  ? 98  ARG C CZ  1 
ATOM   3618 N NH1 . ARG C 3 98  ? -75.497  -11.529 -67.073  1.00 98.77  ? 98  ARG C NH1 1 
ATOM   3619 N NH2 . ARG C 3 98  ? -75.926  -9.564  -65.924  1.00 99.70  ? 98  ARG C NH2 1 
ATOM   3620 N N   . PRO C 3 99  ? -69.173  -10.999 -64.643  1.00 86.63  ? 99  PRO C N   1 
ATOM   3621 C CA  . PRO C 3 99  ? -68.683  -9.719  -65.157  1.00 86.60  ? 99  PRO C CA  1 
ATOM   3622 C C   . PRO C 3 99  ? -69.178  -9.352  -66.569  1.00 86.79  ? 99  PRO C C   1 
ATOM   3623 O O   . PRO C 3 99  ? -69.701  -10.214 -67.270  1.00 86.79  ? 99  PRO C O   1 
ATOM   3624 C CB  . PRO C 3 99  ? -67.162  -9.921  -65.152  1.00 86.82  ? 99  PRO C CB  1 
ATOM   3625 C CG  . PRO C 3 99  ? -66.925  -11.431 -64.994  1.00 86.37  ? 99  PRO C CG  1 
ATOM   3626 C CD  . PRO C 3 99  ? -68.262  -12.098 -64.995  1.00 86.58  ? 99  PRO C CD  1 
ATOM   3627 N N   . ASP C 3 100 ? -68.976  -8.094  -66.983  1.00 87.09  ? 100 ASP C N   1 
ATOM   3628 C CA  . ASP C 3 100 ? -69.530  -7.540  -68.247  1.00 87.77  ? 100 ASP C CA  1 
ATOM   3629 C C   . ASP C 3 100 ? -68.543  -7.506  -69.433  1.00 87.59  ? 100 ASP C C   1 
ATOM   3630 O O   . ASP C 3 100 ? -68.755  -6.819  -70.453  1.00 87.29  ? 100 ASP C O   1 
ATOM   3631 C CB  . ASP C 3 100 ? -70.108  -6.142  -68.003  1.00 87.96  ? 100 ASP C CB  1 
ATOM   3632 C CG  . ASP C 3 100 ? -71.031  -6.093  -66.787  1.00 90.69  ? 100 ASP C CG  1 
ATOM   3633 O OD1 . ASP C 3 100 ? -71.750  -5.075  -66.618  1.00 94.23  ? 100 ASP C OD1 1 
ATOM   3634 O OD2 . ASP C 3 100 ? -71.041  -7.064  -65.983  1.00 92.44  ? 100 ASP C OD2 1 
ATOM   3635 N N   . ALA C 3 105 ? -65.997  -6.781  -63.524  1.00 90.55  ? 105 ALA C N   1 
ATOM   3636 C CA  . ALA C 3 105 ? -66.964  -6.087  -62.663  1.00 90.85  ? 105 ALA C CA  1 
ATOM   3637 C C   . ALA C 3 105 ? -68.131  -6.996  -62.298  1.00 91.00  ? 105 ALA C C   1 
ATOM   3638 O O   . ALA C 3 105 ? -69.187  -6.966  -62.929  1.00 91.04  ? 105 ALA C O   1 
ATOM   3639 C CB  . ALA C 3 105 ? -67.466  -4.805  -63.316  1.00 90.92  ? 105 ALA C CB  1 
ATOM   3640 N N   . MET C 3 106 ? -67.911  -7.796  -61.258  1.00 91.36  ? 106 MET C N   1 
ATOM   3641 C CA  . MET C 3 106 ? -68.829  -8.828  -60.780  1.00 91.17  ? 106 MET C CA  1 
ATOM   3642 C C   . MET C 3 106 ? -70.179  -8.239  -60.394  1.00 90.98  ? 106 MET C C   1 
ATOM   3643 O O   . MET C 3 106 ? -70.304  -7.595  -59.354  1.00 90.85  ? 106 MET C O   1 
ATOM   3644 C CB  . MET C 3 106 ? -68.219  -9.507  -59.557  1.00 91.36  ? 106 MET C CB  1 
ATOM   3645 C CG  . MET C 3 106 ? -66.704  -9.575  -59.530  1.00 91.96  ? 106 MET C CG  1 
ATOM   3646 S SD  . MET C 3 106 ? -66.124  -11.180 -60.096  1.00 94.84  ? 106 MET C SD  1 
ATOM   3647 C CE  . MET C 3 106 ? -64.338  -10.947 -60.081  1.00 93.51  ? 106 MET C CE  1 
ATOM   3648 N N   . ASP C 3 107 ? -71.193  -8.460  -61.216  1.00 90.80  ? 107 ASP C N   1 
ATOM   3649 C CA  . ASP C 3 107 ? -72.444  -7.761  -60.995  1.00 91.22  ? 107 ASP C CA  1 
ATOM   3650 C C   . ASP C 3 107 ? -73.560  -8.604  -60.397  1.00 91.32  ? 107 ASP C C   1 
ATOM   3651 O O   . ASP C 3 107 ? -74.470  -8.046  -59.773  1.00 91.52  ? 107 ASP C O   1 
ATOM   3652 C CB  . ASP C 3 107 ? -72.905  -7.010  -62.253  1.00 91.60  ? 107 ASP C CB  1 
ATOM   3653 C CG  . ASP C 3 107 ? -73.306  -7.929  -63.385  1.00 92.32  ? 107 ASP C CG  1 
ATOM   3654 O OD1 . ASP C 3 107 ? -72.919  -9.117  -63.369  1.00 93.99  ? 107 ASP C OD1 1 
ATOM   3655 O OD2 . ASP C 3 107 ? -74.013  -7.452  -64.300  1.00 93.10  ? 107 ASP C OD2 1 
ATOM   3656 N N   . TYR C 3 108 ? -73.498  -9.929  -60.595  1.00 91.22  ? 108 TYR C N   1 
ATOM   3657 C CA  . TYR C 3 108 ? -74.378  -10.883 -59.880  1.00 90.91  ? 108 TYR C CA  1 
ATOM   3658 C C   . TYR C 3 108 ? -73.570  -12.004 -59.231  1.00 90.49  ? 108 TYR C C   1 
ATOM   3659 O O   . TYR C 3 108 ? -72.991  -12.849 -59.920  1.00 90.81  ? 108 TYR C O   1 
ATOM   3660 C CB  . TYR C 3 108 ? -75.499  -11.432 -60.776  1.00 90.95  ? 108 TYR C CB  1 
ATOM   3661 C CG  . TYR C 3 108 ? -76.486  -10.358 -61.144  1.00 92.34  ? 108 TYR C CG  1 
ATOM   3662 C CD1 . TYR C 3 108 ? -77.193  -9.683  -60.149  1.00 93.63  ? 108 TYR C CD1 1 
ATOM   3663 C CD2 . TYR C 3 108 ? -76.684  -9.976  -62.478  1.00 93.45  ? 108 TYR C CD2 1 
ATOM   3664 C CE1 . TYR C 3 108 ? -78.086  -8.665  -60.466  1.00 94.61  ? 108 TYR C CE1 1 
ATOM   3665 C CE2 . TYR C 3 108 ? -77.580  -8.954  -62.811  1.00 93.97  ? 108 TYR C CE2 1 
ATOM   3666 C CZ  . TYR C 3 108 ? -78.280  -8.304  -61.791  1.00 94.60  ? 108 TYR C CZ  1 
ATOM   3667 O OH  . TYR C 3 108 ? -79.172  -7.290  -62.065  1.00 94.81  ? 108 TYR C OH  1 
ATOM   3668 N N   . TRP C 3 109 ? -73.520  -11.989 -57.901  1.00 89.63  ? 109 TRP C N   1 
ATOM   3669 C CA  . TRP C 3 109 ? -72.707  -12.930 -57.139  1.00 88.51  ? 109 TRP C CA  1 
ATOM   3670 C C   . TRP C 3 109 ? -73.562  -14.055 -56.618  1.00 88.16  ? 109 TRP C C   1 
ATOM   3671 O O   . TRP C 3 109 ? -74.761  -13.885 -56.415  1.00 88.31  ? 109 TRP C O   1 
ATOM   3672 C CB  . TRP C 3 109 ? -72.101  -12.218 -55.952  1.00 88.42  ? 109 TRP C CB  1 
ATOM   3673 C CG  . TRP C 3 109 ? -71.018  -11.260 -56.285  1.00 87.36  ? 109 TRP C CG  1 
ATOM   3674 C CD1 . TRP C 3 109 ? -71.120  -10.109 -57.017  1.00 85.55  ? 109 TRP C CD1 1 
ATOM   3675 C CD2 . TRP C 3 109 ? -69.665  -11.347 -55.855  1.00 86.31  ? 109 TRP C CD2 1 
ATOM   3676 N NE1 . TRP C 3 109 ? -69.905  -9.490  -57.077  1.00 84.93  ? 109 TRP C NE1 1 
ATOM   3677 C CE2 . TRP C 3 109 ? -68.993  -10.231 -56.373  1.00 85.64  ? 109 TRP C CE2 1 
ATOM   3678 C CE3 . TRP C 3 109 ? -68.952  -12.274 -55.083  1.00 86.26  ? 109 TRP C CE3 1 
ATOM   3679 C CZ2 . TRP C 3 109 ? -67.638  -10.013 -56.150  1.00 86.78  ? 109 TRP C CZ2 1 
ATOM   3680 C CZ3 . TRP C 3 109 ? -67.612  -12.064 -54.861  1.00 86.35  ? 109 TRP C CZ3 1 
ATOM   3681 C CH2 . TRP C 3 109 ? -66.964  -10.941 -55.391  1.00 87.37  ? 109 TRP C CH2 1 
ATOM   3682 N N   . GLY C 3 110 ? -72.945  -15.199 -56.370  1.00 87.70  ? 110 GLY C N   1 
ATOM   3683 C CA  . GLY C 3 110 ? -73.682  -16.353 -55.890  1.00 87.41  ? 110 GLY C CA  1 
ATOM   3684 C C   . GLY C 3 110 ? -74.063  -16.222 -54.431  1.00 87.43  ? 110 GLY C C   1 
ATOM   3685 O O   . GLY C 3 110 ? -74.744  -15.267 -54.024  1.00 87.35  ? 110 GLY C O   1 
ATOM   3686 N N   . GLN C 3 111 ? -73.605  -17.183 -53.638  1.00 87.29  ? 111 GLN C N   1 
ATOM   3687 C CA  . GLN C 3 111 ? -74.003  -17.299 -52.246  1.00 87.31  ? 111 GLN C CA  1 
ATOM   3688 C C   . GLN C 3 111 ? -72.942  -18.080 -51.500  1.00 86.83  ? 111 GLN C C   1 
ATOM   3689 O O   . GLN C 3 111 ? -72.885  -18.051 -50.269  1.00 86.93  ? 111 GLN C O   1 
ATOM   3690 C CB  . GLN C 3 111 ? -75.344  -18.026 -52.145  1.00 87.56  ? 111 GLN C CB  1 
ATOM   3691 C CG  . GLN C 3 111 ? -75.237  -19.533 -52.447  1.00 89.41  ? 111 GLN C CG  1 
ATOM   3692 C CD  . GLN C 3 111 ? -76.555  -20.182 -52.819  1.00 91.43  ? 111 GLN C CD  1 
ATOM   3693 O OE1 . GLN C 3 111 ? -77.563  -19.498 -53.045  1.00 93.21  ? 111 GLN C OE1 1 
ATOM   3694 N NE2 . GLN C 3 111 ? -76.556  -21.514 -52.892  1.00 91.19  ? 111 GLN C NE2 1 
ATOM   3695 N N   . GLY C 3 112 ? -72.122  -18.800 -52.258  1.00 86.38  ? 112 GLY C N   1 
ATOM   3696 C CA  . GLY C 3 112 ? -71.015  -19.562 -51.701  1.00 85.93  ? 112 GLY C CA  1 
ATOM   3697 C C   . GLY C 3 112 ? -71.255  -21.044 -51.467  1.00 85.56  ? 112 GLY C C   1 
ATOM   3698 O O   . GLY C 3 112 ? -72.361  -21.481 -51.162  1.00 85.67  ? 112 GLY C O   1 
ATOM   3699 N N   . THR C 3 113 ? -70.203  -21.820 -51.667  1.00 85.07  ? 113 THR C N   1 
ATOM   3700 C CA  . THR C 3 113 ? -70.085  -23.109 -51.050  1.00 84.81  ? 113 THR C CA  1 
ATOM   3701 C C   . THR C 3 113 ? -68.859  -22.917 -50.205  1.00 84.86  ? 113 THR C C   1 
ATOM   3702 O O   . THR C 3 113 ? -67.815  -22.505 -50.720  1.00 85.19  ? 113 THR C O   1 
ATOM   3703 C CB  . THR C 3 113 ? -69.760  -24.190 -52.046  1.00 84.67  ? 113 THR C CB  1 
ATOM   3704 O OG1 . THR C 3 113 ? -70.257  -23.808 -53.325  1.00 84.76  ? 113 THR C OG1 1 
ATOM   3705 C CG2 . THR C 3 113 ? -70.374  -25.518 -51.609  1.00 84.95  ? 113 THR C CG2 1 
ATOM   3706 N N   . SER C 3 114 ? -68.984  -23.169 -48.909  1.00 84.56  ? 114 SER C N   1 
ATOM   3707 C CA  . SER C 3 114 ? -67.827  -23.205 -48.051  1.00 84.44  ? 114 SER C CA  1 
ATOM   3708 C C   . SER C 3 114 ? -67.010  -24.447 -48.394  1.00 84.41  ? 114 SER C C   1 
ATOM   3709 O O   . SER C 3 114 ? -67.564  -25.512 -48.639  1.00 84.40  ? 114 SER C O   1 
ATOM   3710 C CB  . SER C 3 114 ? -68.273  -23.244 -46.601  1.00 84.45  ? 114 SER C CB  1 
ATOM   3711 O OG  . SER C 3 114 ? -67.274  -23.814 -45.773  1.00 85.24  ? 114 SER C OG  1 
ATOM   3712 N N   . VAL C 3 115 ? -65.694  -24.302 -48.444  1.00 84.58  ? 115 VAL C N   1 
ATOM   3713 C CA  . VAL C 3 115 ? -64.805  -25.444 -48.632  1.00 85.11  ? 115 VAL C CA  1 
ATOM   3714 C C   . VAL C 3 115 ? -63.692  -25.353 -47.596  1.00 85.72  ? 115 VAL C C   1 
ATOM   3715 O O   . VAL C 3 115 ? -62.949  -24.360 -47.562  1.00 85.90  ? 115 VAL C O   1 
ATOM   3716 C CB  . VAL C 3 115 ? -64.179  -25.485 -50.057  1.00 85.01  ? 115 VAL C CB  1 
ATOM   3717 C CG1 . VAL C 3 115 ? -63.261  -26.693 -50.223  1.00 84.57  ? 115 VAL C CG1 1 
ATOM   3718 C CG2 . VAL C 3 115 ? -65.248  -25.481 -51.125  1.00 84.68  ? 115 VAL C CG2 1 
ATOM   3719 N N   . THR C 3 116 ? -63.581  -26.364 -46.735  1.00 86.28  ? 116 THR C N   1 
ATOM   3720 C CA  . THR C 3 116 ? -62.446  -26.391 -45.802  1.00 86.69  ? 116 THR C CA  1 
ATOM   3721 C C   . THR C 3 116 ? -61.499  -27.563 -45.988  1.00 87.32  ? 116 THR C C   1 
ATOM   3722 O O   . THR C 3 116 ? -61.889  -28.642 -46.422  1.00 87.27  ? 116 THR C O   1 
ATOM   3723 C CB  . THR C 3 116 ? -62.793  -26.147 -44.300  1.00 86.39  ? 116 THR C CB  1 
ATOM   3724 O OG1 . THR C 3 116 ? -61.942  -26.965 -43.488  1.00 85.01  ? 116 THR C OG1 1 
ATOM   3725 C CG2 . THR C 3 116 ? -64.265  -26.412 -43.987  1.00 86.35  ? 116 THR C CG2 1 
ATOM   3726 N N   . VAL C 3 117 ? -60.238  -27.293 -45.682  1.00 88.12  ? 117 VAL C N   1 
ATOM   3727 C CA  . VAL C 3 117 ? -59.153  -28.206 -45.920  1.00 89.09  ? 117 VAL C CA  1 
ATOM   3728 C C   . VAL C 3 117 ? -58.396  -28.327 -44.613  1.00 89.93  ? 117 VAL C C   1 
ATOM   3729 O O   . VAL C 3 117 ? -57.895  -27.335 -44.060  1.00 90.04  ? 117 VAL C O   1 
ATOM   3730 C CB  . VAL C 3 117 ? -58.240  -27.712 -47.035  1.00 88.98  ? 117 VAL C CB  1 
ATOM   3731 C CG1 . VAL C 3 117 ? -57.134  -28.724 -47.310  1.00 89.63  ? 117 VAL C CG1 1 
ATOM   3732 C CG2 . VAL C 3 117 ? -59.042  -27.490 -48.279  1.00 88.97  ? 117 VAL C CG2 1 
ATOM   3733 N N   . SER C 3 118 ? -58.321  -29.573 -44.149  1.00 90.88  ? 118 SER C N   1 
ATOM   3734 C CA  . SER C 3 118 ? -58.001  -29.933 -42.773  1.00 91.26  ? 118 SER C CA  1 
ATOM   3735 C C   . SER C 3 118 ? -57.873  -31.458 -42.786  1.00 91.66  ? 118 SER C C   1 
ATOM   3736 O O   . SER C 3 118 ? -58.174  -32.100 -43.805  1.00 91.85  ? 118 SER C O   1 
ATOM   3737 C CB  . SER C 3 118 ? -59.163  -29.518 -41.855  1.00 91.10  ? 118 SER C CB  1 
ATOM   3738 O OG  . SER C 3 118 ? -58.710  -29.086 -40.590  1.00 90.65  ? 118 SER C OG  1 
ATOM   3739 N N   . SER C 3 119 ? -57.448  -32.042 -41.669  1.00 91.92  ? 119 SER C N   1 
ATOM   3740 C CA  . SER C 3 119 ? -57.408  -33.507 -41.558  1.00 92.12  ? 119 SER C CA  1 
ATOM   3741 C C   . SER C 3 119 ? -58.343  -34.041 -40.466  1.00 91.70  ? 119 SER C C   1 
ATOM   3742 O O   . SER C 3 119 ? -59.430  -34.542 -40.749  1.00 91.10  ? 119 SER C O   1 
ATOM   3743 C CB  . SER C 3 119 ? -55.974  -33.975 -41.313  1.00 92.46  ? 119 SER C CB  1 
ATOM   3744 O OG  . SER C 3 119 ? -55.056  -33.165 -42.036  1.00 93.24  ? 119 SER C OG  1 
ATOM   3745 N N   . LYS C 3 121 ? -61.721  -34.680 -40.400  1.00 117.76 ? 121 LYS C N   1 
ATOM   3746 C CA  . LYS C 3 121 ? -62.502  -35.389 -39.393  1.00 117.98 ? 121 LYS C CA  1 
ATOM   3747 C C   . LYS C 3 121 ? -63.904  -34.787 -39.231  1.00 117.99 ? 121 LYS C C   1 
ATOM   3748 O O   . LYS C 3 121 ? -64.193  -34.047 -38.273  1.00 117.85 ? 121 LYS C O   1 
ATOM   3749 C CB  . LYS C 3 121 ? -61.752  -35.464 -38.052  1.00 118.10 ? 121 LYS C CB  1 
ATOM   3750 C CG  . LYS C 3 121 ? -61.505  -34.119 -37.332  1.00 118.61 ? 121 LYS C CG  1 
ATOM   3751 C CD  . LYS C 3 121 ? -60.408  -33.263 -37.991  1.00 118.27 ? 121 LYS C CD  1 
ATOM   3752 C CE  . LYS C 3 121 ? -59.740  -32.332 -36.986  1.00 118.12 ? 121 LYS C CE  1 
ATOM   3753 N NZ  . LYS C 3 121 ? -59.208  -33.053 -35.787  1.00 117.52 ? 121 LYS C NZ  1 
ATOM   3754 N N   . THR C 3 122 ? -64.766  -35.121 -40.191  1.00 117.97 ? 122 THR C N   1 
ATOM   3755 C CA  . THR C 3 122 ? -66.161  -34.674 -40.216  1.00 117.80 ? 122 THR C CA  1 
ATOM   3756 C C   . THR C 3 122 ? -66.956  -35.184 -39.011  1.00 117.86 ? 122 THR C C   1 
ATOM   3757 O O   . THR C 3 122 ? -66.706  -36.277 -38.507  1.00 118.08 ? 122 THR C O   1 
ATOM   3758 C CB  . THR C 3 122 ? -66.839  -35.128 -41.515  1.00 117.67 ? 122 THR C CB  1 
ATOM   3759 O OG1 . THR C 3 122 ? -66.143  -34.559 -42.624  1.00 117.65 ? 122 THR C OG1 1 
ATOM   3760 C CG2 . THR C 3 122 ? -68.267  -34.676 -41.569  1.00 117.51 ? 122 THR C CG2 1 
ATOM   3761 N N   . THR C 3 123 ? -67.909  -34.381 -38.553  1.00 117.82 ? 123 THR C N   1 
ATOM   3762 C CA  . THR C 3 123 ? -68.731  -34.728 -37.403  1.00 117.65 ? 123 THR C CA  1 
ATOM   3763 C C   . THR C 3 123 ? -70.133  -34.130 -37.568  1.00 117.69 ? 123 THR C C   1 
ATOM   3764 O O   . THR C 3 123 ? -70.314  -32.910 -37.487  1.00 117.65 ? 123 THR C O   1 
ATOM   3765 C CB  . THR C 3 123 ? -68.086  -34.206 -36.099  1.00 117.69 ? 123 THR C CB  1 
ATOM   3766 O OG1 . THR C 3 123 ? -66.659  -34.367 -36.158  1.00 117.36 ? 123 THR C OG1 1 
ATOM   3767 C CG2 . THR C 3 123 ? -68.649  -34.934 -34.885  1.00 117.78 ? 123 THR C CG2 1 
ATOM   3768 N N   . ALA C 3 124 ? -71.119  -34.991 -37.814  1.00 117.65 ? 124 ALA C N   1 
ATOM   3769 C CA  . ALA C 3 124 ? -72.513  -34.565 -37.925  1.00 117.73 ? 124 ALA C CA  1 
ATOM   3770 C C   . ALA C 3 124 ? -72.946  -33.758 -36.695  1.00 117.89 ? 124 ALA C C   1 
ATOM   3771 O O   . ALA C 3 124 ? -72.616  -34.118 -35.573  1.00 117.99 ? 124 ALA C O   1 
ATOM   3772 C CB  . ALA C 3 124 ? -73.405  -35.766 -38.104  1.00 117.72 ? 124 ALA C CB  1 
ATOM   3773 N N   . PRO C 3 125 ? -73.686  -32.658 -36.898  1.00 118.15 ? 125 PRO C N   1 
ATOM   3774 C CA  . PRO C 3 125 ? -74.055  -31.843 -35.744  1.00 118.22 ? 125 PRO C CA  1 
ATOM   3775 C C   . PRO C 3 125 ? -75.254  -32.401 -34.983  1.00 118.20 ? 125 PRO C C   1 
ATOM   3776 O O   . PRO C 3 125 ? -76.212  -32.888 -35.595  1.00 118.24 ? 125 PRO C O   1 
ATOM   3777 C CB  . PRO C 3 125 ? -74.406  -30.488 -36.368  1.00 118.19 ? 125 PRO C CB  1 
ATOM   3778 C CG  . PRO C 3 125 ? -74.871  -30.806 -37.748  1.00 118.41 ? 125 PRO C CG  1 
ATOM   3779 C CD  . PRO C 3 125 ? -74.287  -32.152 -38.146  1.00 118.37 ? 125 PRO C CD  1 
ATOM   3780 N N   . SER C 3 126 ? -75.183  -32.331 -33.656  1.00 118.15 ? 126 SER C N   1 
ATOM   3781 C CA  . SER C 3 126 ? -76.298  -32.708 -32.796  1.00 118.05 ? 126 SER C CA  1 
ATOM   3782 C C   . SER C 3 126 ? -77.237  -31.506 -32.684  1.00 117.82 ? 126 SER C C   1 
ATOM   3783 O O   . SER C 3 126 ? -76.776  -30.382 -32.475  1.00 117.80 ? 126 SER C O   1 
ATOM   3784 C CB  . SER C 3 126 ? -75.779  -33.133 -31.421  1.00 118.19 ? 126 SER C CB  1 
ATOM   3785 O OG  . SER C 3 126 ? -74.729  -34.089 -31.530  1.00 118.61 ? 126 SER C OG  1 
ATOM   3786 N N   . VAL C 3 127 ? -78.540  -31.741 -32.853  1.00 117.48 ? 127 VAL C N   1 
ATOM   3787 C CA  . VAL C 3 127 ? -79.542  -30.665 -32.901  1.00 117.21 ? 127 VAL C CA  1 
ATOM   3788 C C   . VAL C 3 127 ? -80.645  -30.876 -31.874  1.00 117.13 ? 127 VAL C C   1 
ATOM   3789 O O   . VAL C 3 127 ? -81.483  -31.767 -32.017  1.00 117.10 ? 127 VAL C O   1 
ATOM   3790 C CB  . VAL C 3 127 ? -80.202  -30.541 -34.300  1.00 117.22 ? 127 VAL C CB  1 
ATOM   3791 C CG1 . VAL C 3 127 ? -81.293  -29.467 -34.303  1.00 117.03 ? 127 VAL C CG1 1 
ATOM   3792 C CG2 . VAL C 3 127 ? -79.166  -30.250 -35.372  1.00 117.52 ? 127 VAL C CG2 1 
ATOM   3793 N N   . TYR C 3 128 ? -80.653  -30.038 -30.848  1.00 117.06 ? 128 TYR C N   1 
ATOM   3794 C CA  . TYR C 3 128 ? -81.656  -30.140 -29.802  1.00 117.02 ? 128 TYR C CA  1 
ATOM   3795 C C   . TYR C 3 128 ? -82.575  -28.922 -29.852  1.00 116.62 ? 128 TYR C C   1 
ATOM   3796 O O   . TYR C 3 128 ? -82.089  -27.799 -30.005  1.00 116.38 ? 128 TYR C O   1 
ATOM   3797 C CB  . TYR C 3 128 ? -80.987  -30.245 -28.426  1.00 117.42 ? 128 TYR C CB  1 
ATOM   3798 C CG  . TYR C 3 128 ? -79.684  -31.020 -28.390  1.00 118.20 ? 128 TYR C CG  1 
ATOM   3799 C CD1 . TYR C 3 128 ? -79.674  -32.420 -28.425  1.00 119.05 ? 128 TYR C CD1 1 
ATOM   3800 C CD2 . TYR C 3 128 ? -78.459  -30.350 -28.307  1.00 118.83 ? 128 TYR C CD2 1 
ATOM   3801 C CE1 . TYR C 3 128 ? -78.467  -33.136 -28.394  1.00 120.28 ? 128 TYR C CE1 1 
ATOM   3802 C CE2 . TYR C 3 128 ? -77.248  -31.049 -28.275  1.00 119.93 ? 128 TYR C CE2 1 
ATOM   3803 C CZ  . TYR C 3 128 ? -77.255  -32.442 -28.319  1.00 120.66 ? 128 TYR C CZ  1 
ATOM   3804 O OH  . TYR C 3 128 ? -76.055  -33.133 -28.282  1.00 120.91 ? 128 TYR C OH  1 
ATOM   3805 N N   . PRO C 3 129 ? -83.902  -29.137 -29.727  1.00 116.43 ? 129 PRO C N   1 
ATOM   3806 C CA  . PRO C 3 129 ? -84.833  -28.009 -29.727  1.00 116.43 ? 129 PRO C CA  1 
ATOM   3807 C C   . PRO C 3 129 ? -84.891  -27.338 -28.361  1.00 116.48 ? 129 PRO C C   1 
ATOM   3808 O O   . PRO C 3 129 ? -84.816  -28.012 -27.345  1.00 116.38 ? 129 PRO C O   1 
ATOM   3809 C CB  . PRO C 3 129 ? -86.179  -28.656 -30.076  1.00 116.35 ? 129 PRO C CB  1 
ATOM   3810 C CG  . PRO C 3 129 ? -86.063  -30.076 -29.642  1.00 116.21 ? 129 PRO C CG  1 
ATOM   3811 C CD  . PRO C 3 129 ? -84.596  -30.428 -29.540  1.00 116.45 ? 129 PRO C CD  1 
ATOM   3812 N N   . LEU C 3 130 ? -85.019  -26.019 -28.340  1.00 116.85 ? 130 LEU C N   1 
ATOM   3813 C CA  . LEU C 3 130 ? -85.074  -25.288 -27.079  1.00 117.47 ? 130 LEU C CA  1 
ATOM   3814 C C   . LEU C 3 130 ? -86.478  -24.751 -26.769  1.00 118.18 ? 130 LEU C C   1 
ATOM   3815 O O   . LEU C 3 130 ? -86.865  -23.675 -27.243  1.00 118.17 ? 130 LEU C O   1 
ATOM   3816 C CB  . LEU C 3 130 ? -84.058  -24.143 -27.087  1.00 117.32 ? 130 LEU C CB  1 
ATOM   3817 C CG  . LEU C 3 130 ? -82.604  -24.252 -26.611  1.00 117.06 ? 130 LEU C CG  1 
ATOM   3818 C CD1 . LEU C 3 130 ? -82.050  -25.668 -26.626  1.00 116.94 ? 130 LEU C CD1 1 
ATOM   3819 C CD2 . LEU C 3 130 ? -81.730  -23.311 -27.442  1.00 116.81 ? 130 LEU C CD2 1 
ATOM   3820 N N   . ALA C 3 131 ? -87.235  -25.507 -25.975  1.00 118.96 ? 131 ALA C N   1 
ATOM   3821 C CA  . ALA C 3 131 ? -88.549  -25.072 -25.509  1.00 119.89 ? 131 ALA C CA  1 
ATOM   3822 C C   . ALA C 3 131 ? -88.409  -24.171 -24.269  1.00 120.75 ? 131 ALA C C   1 
ATOM   3823 O O   . ALA C 3 131 ? -87.537  -24.429 -23.426  1.00 120.95 ? 131 ALA C O   1 
ATOM   3824 C CB  . ALA C 3 131 ? -89.388  -26.272 -25.196  1.00 119.67 ? 131 ALA C CB  1 
ATOM   3825 N N   . PRO C 3 132 ? -89.264  -23.125 -24.138  1.00 121.49 ? 132 PRO C N   1 
ATOM   3826 C CA  . PRO C 3 132 ? -89.098  -22.199 -23.011  1.00 122.40 ? 132 PRO C CA  1 
ATOM   3827 C C   . PRO C 3 132 ? -89.419  -22.822 -21.635  1.00 123.54 ? 132 PRO C C   1 
ATOM   3828 O O   . PRO C 3 132 ? -89.740  -24.009 -21.554  1.00 123.63 ? 132 PRO C O   1 
ATOM   3829 C CB  . PRO C 3 132 ? -90.057  -21.046 -23.349  1.00 122.17 ? 132 PRO C CB  1 
ATOM   3830 C CG  . PRO C 3 132 ? -91.048  -21.606 -24.259  1.00 121.57 ? 132 PRO C CG  1 
ATOM   3831 C CD  . PRO C 3 132 ? -90.432  -22.775 -24.969  1.00 121.42 ? 132 PRO C CD  1 
ATOM   3832 N N   . VAL C 3 133 ? -89.292  -22.034 -20.567  1.00 124.75 ? 133 VAL C N   1 
ATOM   3833 C CA  . VAL C 3 133 ? -89.660  -22.457 -19.204  1.00 125.89 ? 133 VAL C CA  1 
ATOM   3834 C C   . VAL C 3 133 ? -90.939  -23.312 -19.176  1.00 126.76 ? 133 VAL C C   1 
ATOM   3835 O O   . VAL C 3 133 ? -91.971  -22.864 -19.688  1.00 126.78 ? 133 VAL C O   1 
ATOM   3836 C CB  . VAL C 3 133 ? -89.846  -21.218 -18.277  1.00 125.91 ? 133 VAL C CB  1 
ATOM   3837 C CG1 . VAL C 3 133 ? -88.500  -20.648 -17.873  1.00 125.94 ? 133 VAL C CG1 1 
ATOM   3838 C CG2 . VAL C 3 133 ? -90.713  -20.130 -18.951  1.00 125.65 ? 133 VAL C CG2 1 
ATOM   3839 N N   . CYS C 3 134 ? -90.888  -24.522 -18.597  1.00 127.90 ? 134 CYS C N   1 
ATOM   3840 C CA  . CYS C 3 134 ? -92.100  -25.395 -18.561  1.00 129.25 ? 134 CYS C CA  1 
ATOM   3841 C C   . CYS C 3 134 ? -93.272  -24.839 -17.754  1.00 129.40 ? 134 CYS C C   1 
ATOM   3842 O O   . CYS C 3 134 ? -94.372  -25.409 -17.770  1.00 129.28 ? 134 CYS C O   1 
ATOM   3843 C CB  . CYS C 3 134 ? -91.836  -26.875 -18.199  1.00 129.53 ? 134 CYS C CB  1 
ATOM   3844 S SG  . CYS C 3 134 ? -90.644  -27.319 -16.899  1.00 132.39 ? 134 CYS C SG  1 
ATOM   3845 N N   . GLY C 3 135 ? -93.019  -23.726 -17.064  1.00 129.84 ? 135 GLY C N   1 
ATOM   3846 C CA  . GLY C 3 135 ? -94.061  -22.931 -16.427  1.00 130.27 ? 135 GLY C CA  1 
ATOM   3847 C C   . GLY C 3 135 ? -94.980  -22.341 -17.480  1.00 130.56 ? 135 GLY C C   1 
ATOM   3848 O O   . GLY C 3 135 ? -94.522  -21.912 -18.547  1.00 130.66 ? 135 GLY C O   1 
ATOM   3849 N N   . ASP C 3 136 ? -96.278  -22.330 -17.174  1.00 130.66 ? 136 ASP C N   1 
ATOM   3850 C CA  . ASP C 3 136 ? -97.314  -21.871 -18.101  1.00 130.63 ? 136 ASP C CA  1 
ATOM   3851 C C   . ASP C 3 136 ? -97.294  -20.348 -18.233  1.00 130.47 ? 136 ASP C C   1 
ATOM   3852 O O   . ASP C 3 136 ? -97.846  -19.787 -19.194  1.00 130.40 ? 136 ASP C O   1 
ATOM   3853 C CB  . ASP C 3 136 ? -98.682  -22.384 -17.645  1.00 130.71 ? 136 ASP C CB  1 
ATOM   3854 C CG  . ASP C 3 136 ? -98.686  -23.898 -17.406  1.00 131.41 ? 136 ASP C CG  1 
ATOM   3855 O OD1 . ASP C 3 136 ? -99.148  -24.343 -16.328  1.00 131.95 ? 136 ASP C OD1 1 
ATOM   3856 O OD2 . ASP C 3 136 ? -98.209  -24.646 -18.292  1.00 131.79 ? 136 ASP C OD2 1 
ATOM   3857 N N   . THR C 3 137 ? -96.634  -19.709 -17.259  1.00 130.17 ? 137 THR C N   1 
ATOM   3858 C CA  . THR C 3 137 ? -96.339  -18.262 -17.227  1.00 129.73 ? 137 THR C CA  1 
ATOM   3859 C C   . THR C 3 137 ? -96.236  -17.605 -18.607  1.00 129.14 ? 137 THR C C   1 
ATOM   3860 O O   . THR C 3 137 ? -95.148  -17.524 -19.203  1.00 129.15 ? 137 THR C O   1 
ATOM   3861 C CB  . THR C 3 137 ? -95.038  -17.965 -16.428  1.00 129.83 ? 137 THR C CB  1 
ATOM   3862 O OG1 . THR C 3 137 ? -94.021  -18.915 -16.786  1.00 129.92 ? 137 THR C OG1 1 
ATOM   3863 C CG2 . THR C 3 137 ? -95.299  -18.027 -14.914  1.00 130.31 ? 137 THR C CG2 1 
ATOM   3864 N N   . THR C 3 138 ? -97.383  -17.147 -19.107  1.00 128.19 ? 138 THR C N   1 
ATOM   3865 C CA  . THR C 3 138 ? -97.429  -16.470 -20.397  1.00 127.05 ? 138 THR C CA  1 
ATOM   3866 C C   . THR C 3 138 ? -96.953  -15.013 -20.263  1.00 126.14 ? 138 THR C C   1 
ATOM   3867 O O   . THR C 3 138 ? -97.415  -14.264 -19.396  1.00 125.97 ? 138 THR C O   1 
ATOM   3868 C CB  . THR C 3 138 ? -98.823  -16.619 -21.100  1.00 127.06 ? 138 THR C CB  1 
ATOM   3869 O OG1 . THR C 3 138 ? -98.738  -16.154 -22.454  1.00 126.58 ? 138 THR C OG1 1 
ATOM   3870 C CG2 . THR C 3 138 ? -99.945  -15.875 -20.345  1.00 127.06 ? 138 THR C CG2 1 
ATOM   3871 N N   . GLY C 3 139 ? -95.968  -14.659 -21.086  1.00 125.02 ? 139 GLY C N   1 
ATOM   3872 C CA  . GLY C 3 139 ? -95.522  -13.279 -21.246  1.00 123.53 ? 139 GLY C CA  1 
ATOM   3873 C C   . GLY C 3 139 ? -96.328  -12.669 -22.376  1.00 122.38 ? 139 GLY C C   1 
ATOM   3874 O O   . GLY C 3 139 ? -97.558  -12.607 -22.292  1.00 122.38 ? 139 GLY C O   1 
ATOM   3875 N N   . SER C 3 140 ? -95.650  -12.251 -23.445  1.00 121.06 ? 140 SER C N   1 
ATOM   3876 C CA  . SER C 3 140 ? -96.335  -11.661 -24.599  1.00 119.84 ? 140 SER C CA  1 
ATOM   3877 C C   . SER C 3 140 ? -95.681  -12.046 -25.932  1.00 118.90 ? 140 SER C C   1 
ATOM   3878 O O   . SER C 3 140 ? -96.353  -12.514 -26.859  1.00 118.55 ? 140 SER C O   1 
ATOM   3879 C CB  . SER C 3 140 ? -96.396  -10.134 -24.444  1.00 119.95 ? 140 SER C CB  1 
ATOM   3880 O OG  . SER C 3 140 ? -97.316  -9.563  -25.355  1.00 119.76 ? 140 SER C OG  1 
ATOM   3881 N N   . SER C 3 141 ? -94.371  -11.816 -26.010  1.00 117.72 ? 141 SER C N   1 
ATOM   3882 C CA  . SER C 3 141 ? -93.556  -12.124 -27.179  1.00 116.33 ? 141 SER C CA  1 
ATOM   3883 C C   . SER C 3 141 ? -92.695  -13.316 -26.842  1.00 115.47 ? 141 SER C C   1 
ATOM   3884 O O   . SER C 3 141 ? -91.572  -13.162 -26.330  1.00 115.47 ? 141 SER C O   1 
ATOM   3885 C CB  . SER C 3 141 ? -92.649  -10.948 -27.530  1.00 116.33 ? 141 SER C CB  1 
ATOM   3886 O OG  . SER C 3 141 ? -93.377  -9.909  -28.145  1.00 116.46 ? 141 SER C OG  1 
ATOM   3887 N N   . VAL C 3 142 ? -93.233  -14.501 -27.129  1.00 114.09 ? 142 VAL C N   1 
ATOM   3888 C CA  . VAL C 3 142 ? -92.580  -15.776 -26.828  1.00 112.59 ? 142 VAL C CA  1 
ATOM   3889 C C   . VAL C 3 142 ? -91.370  -16.024 -27.715  1.00 111.26 ? 142 VAL C C   1 
ATOM   3890 O O   . VAL C 3 142 ? -91.478  -15.980 -28.936  1.00 111.18 ? 142 VAL C O   1 
ATOM   3891 C CB  . VAL C 3 142 ? -93.551  -16.938 -27.018  1.00 112.68 ? 142 VAL C CB  1 
ATOM   3892 C CG1 . VAL C 3 142 ? -92.968  -18.218 -26.418  1.00 112.82 ? 142 VAL C CG1 1 
ATOM   3893 C CG2 . VAL C 3 142 ? -94.887  -16.596 -26.384  1.00 113.03 ? 142 VAL C CG2 1 
ATOM   3894 N N   . THR C 3 143 ? -90.218  -16.270 -27.102  1.00 109.69 ? 143 THR C N   1 
ATOM   3895 C CA  . THR C 3 143 ? -89.035  -16.632 -27.872  1.00 108.42 ? 143 THR C CA  1 
ATOM   3896 C C   . THR C 3 143 ? -88.683  -18.106 -27.614  1.00 107.75 ? 143 THR C C   1 
ATOM   3897 O O   . THR C 3 143 ? -88.703  -18.567 -26.472  1.00 107.75 ? 143 THR C O   1 
ATOM   3898 C CB  . THR C 3 143 ? -87.801  -15.661 -27.666  1.00 108.23 ? 143 THR C CB  1 
ATOM   3899 O OG1 . THR C 3 143 ? -86.860  -16.230 -26.753  1.00 108.00 ? 143 THR C OG1 1 
ATOM   3900 C CG2 . THR C 3 143 ? -88.221  -14.259 -27.192  1.00 107.57 ? 143 THR C CG2 1 
ATOM   3901 N N   . LEU C 3 144 ? -88.414  -18.843 -28.691  1.00 106.65 ? 144 LEU C N   1 
ATOM   3902 C CA  . LEU C 3 144 ? -87.993  -20.230 -28.599  1.00 105.42 ? 144 LEU C CA  1 
ATOM   3903 C C   . LEU C 3 144 ? -86.598  -20.301 -29.180  1.00 105.09 ? 144 LEU C C   1 
ATOM   3904 O O   . LEU C 3 144 ? -86.119  -19.338 -29.781  1.00 104.96 ? 144 LEU C O   1 
ATOM   3905 C CB  . LEU C 3 144 ? -88.924  -21.165 -29.379  1.00 105.16 ? 144 LEU C CB  1 
ATOM   3906 C CG  . LEU C 3 144 ? -90.194  -20.706 -30.102  1.00 104.34 ? 144 LEU C CG  1 
ATOM   3907 C CD1 . LEU C 3 144 ? -90.758  -21.867 -30.886  1.00 104.14 ? 144 LEU C CD1 1 
ATOM   3908 C CD2 . LEU C 3 144 ? -91.246  -20.150 -29.177  1.00 103.83 ? 144 LEU C CD2 1 
ATOM   3909 N N   . GLY C 3 145 ? -85.947  -21.443 -29.008  1.00 104.74 ? 145 GLY C N   1 
ATOM   3910 C CA  . GLY C 3 145 ? -84.595  -21.619 -29.511  1.00 104.29 ? 145 GLY C CA  1 
ATOM   3911 C C   . GLY C 3 145 ? -84.340  -22.930 -30.235  1.00 104.05 ? 145 GLY C C   1 
ATOM   3912 O O   . GLY C 3 145 ? -85.187  -23.837 -30.262  1.00 103.80 ? 145 GLY C O   1 
ATOM   3913 N N   . CYS C 3 146 ? -83.155  -23.005 -30.835  1.00 103.82 ? 146 CYS C N   1 
ATOM   3914 C CA  . CYS C 3 146 ? -82.628  -24.224 -31.430  1.00 103.46 ? 146 CYS C CA  1 
ATOM   3915 C C   . CYS C 3 146 ? -81.141  -24.282 -31.097  1.00 103.35 ? 146 CYS C C   1 
ATOM   3916 O O   . CYS C 3 146 ? -80.442  -23.271 -31.240  1.00 103.38 ? 146 CYS C O   1 
ATOM   3917 C CB  . CYS C 3 146 ? -82.842  -24.219 -32.941  1.00 103.21 ? 146 CYS C CB  1 
ATOM   3918 S SG  . CYS C 3 146 ? -82.280  -25.716 -33.730  1.00 103.10 ? 146 CYS C SG  1 
ATOM   3919 N N   . LEU C 3 147 ? -80.662  -25.440 -30.635  1.00 103.15 ? 147 LEU C N   1 
ATOM   3920 C CA  . LEU C 3 147 ? -79.245  -25.574 -30.271  1.00 103.22 ? 147 LEU C CA  1 
ATOM   3921 C C   . LEU C 3 147 ? -78.509  -26.652 -31.050  1.00 103.25 ? 147 LEU C C   1 
ATOM   3922 O O   . LEU C 3 147 ? -78.991  -27.784 -31.165  1.00 103.28 ? 147 LEU C O   1 
ATOM   3923 C CB  . LEU C 3 147 ? -79.053  -25.807 -28.774  1.00 103.20 ? 147 LEU C CB  1 
ATOM   3924 C CG  . LEU C 3 147 ? -77.626  -25.465 -28.330  1.00 103.15 ? 147 LEU C CG  1 
ATOM   3925 C CD1 . LEU C 3 147 ? -77.523  -24.003 -27.864  1.00 102.73 ? 147 LEU C CD1 1 
ATOM   3926 C CD2 . LEU C 3 147 ? -77.133  -26.436 -27.258  1.00 103.29 ? 147 LEU C CD2 1 
ATOM   3927 N N   . VAL C 3 148 ? -77.323  -26.281 -31.545  1.00 103.19 ? 148 VAL C N   1 
ATOM   3928 C CA  . VAL C 3 148 ? -76.525  -27.098 -32.473  1.00 103.10 ? 148 VAL C CA  1 
ATOM   3929 C C   . VAL C 3 148 ? -75.084  -27.277 -31.963  1.00 102.85 ? 148 VAL C C   1 
ATOM   3930 O O   . VAL C 3 148 ? -74.334  -26.318 -31.789  1.00 102.61 ? 148 VAL C O   1 
ATOM   3931 C CB  . VAL C 3 148 ? -76.554  -26.506 -33.919  1.00 103.23 ? 148 VAL C CB  1 
ATOM   3932 C CG1 . VAL C 3 148 ? -75.730  -27.360 -34.884  1.00 103.43 ? 148 VAL C CG1 1 
ATOM   3933 C CG2 . VAL C 3 148 ? -78.000  -26.369 -34.422  1.00 103.00 ? 148 VAL C CG2 1 
ATOM   3934 N N   . LYS C 3 149 ? -74.700  -28.525 -31.743  1.00 102.83 ? 149 LYS C N   1 
ATOM   3935 C CA  . LYS C 3 149 ? -73.559  -28.797 -30.890  1.00 103.04 ? 149 LYS C CA  1 
ATOM   3936 C C   . LYS C 3 149 ? -72.726  -29.985 -31.368  1.00 103.19 ? 149 LYS C C   1 
ATOM   3937 O O   . LYS C 3 149 ? -73.271  -30.988 -31.867  1.00 102.98 ? 149 LYS C O   1 
ATOM   3938 C CB  . LYS C 3 149 ? -74.057  -29.034 -29.452  1.00 103.13 ? 149 LYS C CB  1 
ATOM   3939 C CG  . LYS C 3 149 ? -72.981  -29.214 -28.400  1.00 102.64 ? 149 LYS C CG  1 
ATOM   3940 C CD  . LYS C 3 149 ? -73.430  -30.174 -27.318  1.00 102.06 ? 149 LYS C CD  1 
ATOM   3941 C CE  . LYS C 3 149 ? -72.320  -30.361 -26.312  1.00 102.83 ? 149 LYS C CE  1 
ATOM   3942 N NZ  . LYS C 3 149 ? -71.659  -29.057 -25.971  1.00 102.91 ? 149 LYS C NZ  1 
ATOM   3943 N N   . GLY C 3 150 ? -71.407  -29.852 -31.190  1.00 103.21 ? 150 GLY C N   1 
ATOM   3944 C CA  . GLY C 3 150 ? -70.452  -30.916 -31.469  1.00 103.15 ? 150 GLY C CA  1 
ATOM   3945 C C   . GLY C 3 150 ? -70.410  -31.276 -32.941  1.00 103.26 ? 150 GLY C C   1 
ATOM   3946 O O   . GLY C 3 150 ? -70.806  -32.387 -33.331  1.00 103.41 ? 150 GLY C O   1 
ATOM   3947 N N   . TYR C 3 151 ? -69.950  -30.331 -33.765  1.00 103.03 ? 151 TYR C N   1 
ATOM   3948 C CA  . TYR C 3 151 ? -69.791  -30.593 -35.198  1.00 102.51 ? 151 TYR C CA  1 
ATOM   3949 C C   . TYR C 3 151 ? -68.486  -30.082 -35.782  1.00 101.90 ? 151 TYR C C   1 
ATOM   3950 O O   . TYR C 3 151 ? -67.823  -29.215 -35.204  1.00 101.72 ? 151 TYR C O   1 
ATOM   3951 C CB  . TYR C 3 151 ? -70.986  -30.078 -36.015  1.00 102.57 ? 151 TYR C CB  1 
ATOM   3952 C CG  . TYR C 3 151 ? -71.112  -28.572 -36.134  1.00 102.87 ? 151 TYR C CG  1 
ATOM   3953 C CD1 . TYR C 3 151 ? -70.253  -27.842 -36.947  1.00 103.12 ? 151 TYR C CD1 1 
ATOM   3954 C CD2 . TYR C 3 151 ? -72.121  -27.885 -35.465  1.00 102.96 ? 151 TYR C CD2 1 
ATOM   3955 C CE1 . TYR C 3 151 ? -70.381  -26.471 -37.067  1.00 103.30 ? 151 TYR C CE1 1 
ATOM   3956 C CE2 . TYR C 3 151 ? -72.256  -26.511 -35.581  1.00 102.74 ? 151 TYR C CE2 1 
ATOM   3957 C CZ  . TYR C 3 151 ? -71.383  -25.813 -36.382  1.00 102.96 ? 151 TYR C CZ  1 
ATOM   3958 O OH  . TYR C 3 151 ? -71.511  -24.453 -36.507  1.00 103.26 ? 151 TYR C OH  1 
ATOM   3959 N N   . PHE C 3 152 ? -68.144  -30.645 -36.937  1.00 101.12 ? 152 PHE C N   1 
ATOM   3960 C CA  . PHE C 3 152 ? -67.054  -30.170 -37.765  1.00 100.54 ? 152 PHE C CA  1 
ATOM   3961 C C   . PHE C 3 152 ? -67.373  -30.485 -39.220  1.00 100.17 ? 152 PHE C C   1 
ATOM   3962 O O   . PHE C 3 152 ? -67.922  -31.545 -39.516  1.00 100.32 ? 152 PHE C O   1 
ATOM   3963 C CB  . PHE C 3 152 ? -65.737  -30.832 -37.370  1.00 100.43 ? 152 PHE C CB  1 
ATOM   3964 C CG  . PHE C 3 152 ? -64.515  -30.082 -37.838  1.00 100.07 ? 152 PHE C CG  1 
ATOM   3965 C CD1 . PHE C 3 152 ? -63.740  -30.572 -38.886  1.00 99.53  ? 152 PHE C CD1 1 
ATOM   3966 C CD2 . PHE C 3 152 ? -64.132  -28.887 -37.222  1.00 99.46  ? 152 PHE C CD2 1 
ATOM   3967 C CE1 . PHE C 3 152 ? -62.593  -29.889 -39.311  1.00 99.24  ? 152 PHE C CE1 1 
ATOM   3968 C CE2 . PHE C 3 152 ? -62.994  -28.196 -37.644  1.00 99.00  ? 152 PHE C CE2 1 
ATOM   3969 C CZ  . PHE C 3 152 ? -62.223  -28.698 -38.689  1.00 98.85  ? 152 PHE C CZ  1 
ATOM   3970 N N   . PRO C 3 153 ? -67.054  -29.555 -40.133  1.00 99.62  ? 153 PRO C N   1 
ATOM   3971 C CA  . PRO C 3 153 ? -66.575  -28.215 -39.838  1.00 99.16  ? 153 PRO C CA  1 
ATOM   3972 C C   . PRO C 3 153 ? -67.681  -27.191 -40.023  1.00 98.65  ? 153 PRO C C   1 
ATOM   3973 O O   . PRO C 3 153 ? -68.825  -27.568 -40.298  1.00 98.67  ? 153 PRO C O   1 
ATOM   3974 C CB  . PRO C 3 153 ? -65.481  -27.999 -40.895  1.00 99.16  ? 153 PRO C CB  1 
ATOM   3975 C CG  . PRO C 3 153 ? -65.548  -29.216 -41.830  1.00 99.41  ? 153 PRO C CG  1 
ATOM   3976 C CD  . PRO C 3 153 ? -66.849  -29.881 -41.549  1.00 99.58  ? 153 PRO C CD  1 
ATOM   3977 N N   . GLU C 3 154 ? -67.338  -25.914 -39.860  1.00 97.94  ? 154 GLU C N   1 
ATOM   3978 C CA  . GLU C 3 154 ? -68.178  -24.820 -40.322  1.00 97.28  ? 154 GLU C CA  1 
ATOM   3979 C C   . GLU C 3 154 ? -68.400  -24.997 -41.825  1.00 96.66  ? 154 GLU C C   1 
ATOM   3980 O O   . GLU C 3 154 ? -67.558  -25.584 -42.510  1.00 96.91  ? 154 GLU C O   1 
ATOM   3981 C CB  . GLU C 3 154 ? -67.481  -23.489 -40.057  1.00 97.41  ? 154 GLU C CB  1 
ATOM   3982 C CG  . GLU C 3 154 ? -67.450  -23.069 -38.597  1.00 98.49  ? 154 GLU C CG  1 
ATOM   3983 C CD  . GLU C 3 154 ? -68.509  -22.015 -38.245  1.00 99.88  ? 154 GLU C CD  1 
ATOM   3984 O OE1 . GLU C 3 154 ? -69.727  -22.254 -38.494  1.00 99.49  ? 154 GLU C OE1 1 
ATOM   3985 O OE2 . GLU C 3 154 ? -68.107  -20.950 -37.704  1.00 99.75  ? 154 GLU C OE2 1 
ATOM   3986 N N   . PRO C 3 155 ? -69.530  -24.512 -42.351  1.00 96.03  ? 155 PRO C N   1 
ATOM   3987 C CA  . PRO C 3 155 ? -70.626  -23.863 -41.661  1.00 95.92  ? 155 PRO C CA  1 
ATOM   3988 C C   . PRO C 3 155 ? -71.736  -24.860 -41.374  1.00 95.85  ? 155 PRO C C   1 
ATOM   3989 O O   . PRO C 3 155 ? -71.610  -26.039 -41.727  1.00 96.36  ? 155 PRO C O   1 
ATOM   3990 C CB  . PRO C 3 155 ? -71.113  -22.852 -42.701  1.00 95.96  ? 155 PRO C CB  1 
ATOM   3991 C CG  . PRO C 3 155 ? -70.779  -23.480 -44.039  1.00 95.45  ? 155 PRO C CG  1 
ATOM   3992 C CD  . PRO C 3 155 ? -69.759  -24.552 -43.806  1.00 95.76  ? 155 PRO C CD  1 
ATOM   3993 N N   . VAL C 3 156 ? -72.802  -24.403 -40.728  1.00 95.22  ? 156 VAL C N   1 
ATOM   3994 C CA  . VAL C 3 156 ? -74.079  -25.106 -40.803  1.00 94.73  ? 156 VAL C CA  1 
ATOM   3995 C C   . VAL C 3 156 ? -75.076  -24.170 -41.473  1.00 94.38  ? 156 VAL C C   1 
ATOM   3996 O O   . VAL C 3 156 ? -74.719  -23.047 -41.825  1.00 94.39  ? 156 VAL C O   1 
ATOM   3997 C CB  . VAL C 3 156 ? -74.587  -25.605 -39.430  1.00 94.70  ? 156 VAL C CB  1 
ATOM   3998 C CG1 . VAL C 3 156 ? -74.175  -27.035 -39.221  1.00 94.99  ? 156 VAL C CG1 1 
ATOM   3999 C CG2 . VAL C 3 156 ? -74.072  -24.739 -38.299  1.00 94.99  ? 156 VAL C CG2 1 
ATOM   4000 N N   . THR C 3 157 ? -76.303  -24.635 -41.688  1.00 94.08  ? 157 THR C N   1 
ATOM   4001 C CA  . THR C 3 157 ? -77.366  -23.786 -42.224  1.00 93.68  ? 157 THR C CA  1 
ATOM   4002 C C   . THR C 3 157 ? -78.673  -23.979 -41.446  1.00 93.86  ? 157 THR C C   1 
ATOM   4003 O O   . THR C 3 157 ? -79.421  -24.948 -41.666  1.00 93.94  ? 157 THR C O   1 
ATOM   4004 C CB  . THR C 3 157 ? -77.533  -23.952 -43.753  1.00 93.46  ? 157 THR C CB  1 
ATOM   4005 O OG1 . THR C 3 157 ? -76.548  -23.152 -44.409  1.00 92.66  ? 157 THR C OG1 1 
ATOM   4006 C CG2 . THR C 3 157 ? -78.906  -23.488 -44.222  1.00 93.63  ? 157 THR C CG2 1 
ATOM   4007 N N   . LEU C 3 158 ? -78.919  -23.044 -40.525  1.00 93.68  ? 158 LEU C N   1 
ATOM   4008 C CA  . LEU C 3 158 ? -80.070  -23.104 -39.636  1.00 93.40  ? 158 LEU C CA  1 
ATOM   4009 C C   . LEU C 3 158 ? -81.204  -22.243 -40.179  1.00 93.31  ? 158 LEU C C   1 
ATOM   4010 O O   . LEU C 3 158 ? -81.040  -21.039 -40.372  1.00 93.34  ? 158 LEU C O   1 
ATOM   4011 C CB  . LEU C 3 158 ? -79.665  -22.644 -38.235  1.00 93.44  ? 158 LEU C CB  1 
ATOM   4012 C CG  . LEU C 3 158 ? -80.378  -23.210 -37.006  1.00 93.00  ? 158 LEU C CG  1 
ATOM   4013 C CD1 . LEU C 3 158 ? -79.557  -22.890 -35.769  1.00 92.21  ? 158 LEU C CD1 1 
ATOM   4014 C CD2 . LEU C 3 158 ? -81.788  -22.661 -36.875  1.00 93.44  ? 158 LEU C CD2 1 
ATOM   4015 N N   . THR C 3 159 ? -82.347  -22.876 -40.424  1.00 93.16  ? 159 THR C N   1 
ATOM   4016 C CA  . THR C 3 159 ? -83.535  -22.197 -40.954  1.00 93.09  ? 159 THR C CA  1 
ATOM   4017 C C   . THR C 3 159 ? -84.751  -22.451 -40.065  1.00 93.08  ? 159 THR C C   1 
ATOM   4018 O O   . THR C 3 159 ? -85.051  -23.599 -39.718  1.00 93.25  ? 159 THR C O   1 
ATOM   4019 C CB  . THR C 3 159 ? -83.843  -22.601 -42.447  1.00 93.03  ? 159 THR C CB  1 
ATOM   4020 O OG1 . THR C 3 159 ? -85.216  -22.347 -42.767  1.00 92.28  ? 159 THR C OG1 1 
ATOM   4021 C CG2 . THR C 3 159 ? -83.564  -24.072 -42.695  1.00 93.32  ? 159 THR C CG2 1 
ATOM   4022 N N   . TRP C 3 160 ? -85.441  -21.377 -39.694  1.00 92.78  ? 160 TRP C N   1 
ATOM   4023 C CA  . TRP C 3 160 ? -86.706  -21.501 -38.986  1.00 92.48  ? 160 TRP C CA  1 
ATOM   4024 C C   . TRP C 3 160 ? -87.856  -21.670 -39.967  1.00 93.18  ? 160 TRP C C   1 
ATOM   4025 O O   . TRP C 3 160 ? -88.040  -20.837 -40.870  1.00 93.21  ? 160 TRP C O   1 
ATOM   4026 C CB  . TRP C 3 160 ? -86.919  -20.309 -38.067  1.00 91.70  ? 160 TRP C CB  1 
ATOM   4027 C CG  . TRP C 3 160 ? -85.957  -20.337 -36.952  1.00 89.68  ? 160 TRP C CG  1 
ATOM   4028 C CD1 . TRP C 3 160 ? -84.779  -19.675 -36.874  1.00 88.09  ? 160 TRP C CD1 1 
ATOM   4029 C CD2 . TRP C 3 160 ? -86.062  -21.113 -35.761  1.00 88.09  ? 160 TRP C CD2 1 
ATOM   4030 N NE1 . TRP C 3 160 ? -84.147  -19.964 -35.695  1.00 86.87  ? 160 TRP C NE1 1 
ATOM   4031 C CE2 . TRP C 3 160 ? -84.914  -20.854 -34.994  1.00 86.91  ? 160 TRP C CE2 1 
ATOM   4032 C CE3 . TRP C 3 160 ? -87.030  -21.991 -35.258  1.00 87.39  ? 160 TRP C CE3 1 
ATOM   4033 C CZ2 . TRP C 3 160 ? -84.702  -21.439 -33.756  1.00 86.10  ? 160 TRP C CZ2 1 
ATOM   4034 C CZ3 . TRP C 3 160 ? -86.822  -22.563 -34.037  1.00 86.43  ? 160 TRP C CZ3 1 
ATOM   4035 C CH2 . TRP C 3 160 ? -85.663  -22.291 -33.296  1.00 86.17  ? 160 TRP C CH2 1 
ATOM   4036 N N   . ASN C 3 161 ? -88.603  -22.765 -39.789  1.00 93.85  ? 161 ASN C N   1 
ATOM   4037 C CA  . ASN C 3 161 ? -89.750  -23.114 -40.638  1.00 94.78  ? 161 ASN C CA  1 
ATOM   4038 C C   . ASN C 3 161 ? -89.520  -22.972 -42.140  1.00 95.51  ? 161 ASN C C   1 
ATOM   4039 O O   . ASN C 3 161 ? -90.186  -22.154 -42.793  1.00 95.62  ? 161 ASN C O   1 
ATOM   4040 C CB  . ASN C 3 161 ? -90.998  -22.319 -40.242  1.00 94.62  ? 161 ASN C CB  1 
ATOM   4041 C CG  . ASN C 3 161 ? -91.909  -23.086 -39.316  1.00 95.02  ? 161 ASN C CG  1 
ATOM   4042 O OD1 . ASN C 3 161 ? -93.009  -22.630 -39.020  1.00 94.97  ? 161 ASN C OD1 1 
ATOM   4043 N ND2 . ASN C 3 161 ? -91.468  -24.263 -38.861  1.00 95.12  ? 161 ASN C ND2 1 
ATOM   4044 N N   . SER C 3 162 ? -88.580  -23.763 -42.669  1.00 96.21  ? 162 SER C N   1 
ATOM   4045 C CA  . SER C 3 162 ? -88.281  -23.826 -44.107  1.00 96.92  ? 162 SER C CA  1 
ATOM   4046 C C   . SER C 3 162 ? -88.040  -22.453 -44.733  1.00 97.43  ? 162 SER C C   1 
ATOM   4047 O O   . SER C 3 162 ? -88.467  -22.195 -45.866  1.00 97.59  ? 162 SER C O   1 
ATOM   4048 C CB  . SER C 3 162 ? -89.399  -24.556 -44.856  1.00 96.84  ? 162 SER C CB  1 
ATOM   4049 O OG  . SER C 3 162 ? -89.663  -25.809 -44.253  1.00 97.87  ? 162 SER C OG  1 
ATOM   4050 N N   . GLY C 3 163 ? -87.363  -21.581 -43.983  1.00 97.96  ? 163 GLY C N   1 
ATOM   4051 C CA  . GLY C 3 163 ? -87.051  -20.226 -44.423  1.00 98.40  ? 163 GLY C CA  1 
ATOM   4052 C C   . GLY C 3 163 ? -88.180  -19.230 -44.229  1.00 98.93  ? 163 GLY C C   1 
ATOM   4053 O O   . GLY C 3 163 ? -87.975  -18.019 -44.388  1.00 99.12  ? 163 GLY C O   1 
ATOM   4054 N N   . SER C 3 164 ? -89.367  -19.733 -43.889  1.00 99.28  ? 164 SER C N   1 
ATOM   4055 C CA  . SER C 3 164 ? -90.560  -18.891 -43.754  1.00 99.68  ? 164 SER C CA  1 
ATOM   4056 C C   . SER C 3 164 ? -90.532  -18.010 -42.504  1.00 99.93  ? 164 SER C C   1 
ATOM   4057 O O   . SER C 3 164 ? -90.992  -16.862 -42.542  1.00 100.05 ? 164 SER C O   1 
ATOM   4058 C CB  . SER C 3 164 ? -91.824  -19.737 -43.789  1.00 99.57  ? 164 SER C CB  1 
ATOM   4059 O OG  . SER C 3 164 ? -91.885  -20.457 -45.001  1.00 99.71  ? 164 SER C OG  1 
ATOM   4060 N N   . LEU C 3 165 ? -89.995  -18.547 -41.406  1.00 100.03 ? 165 LEU C N   1 
ATOM   4061 C CA  . LEU C 3 165 ? -89.718  -17.734 -40.224  1.00 100.01 ? 165 LEU C CA  1 
ATOM   4062 C C   . LEU C 3 165 ? -88.324  -17.131 -40.410  1.00 100.54 ? 165 LEU C C   1 
ATOM   4063 O O   . LEU C 3 165 ? -87.301  -17.760 -40.137  1.00 100.45 ? 165 LEU C O   1 
ATOM   4064 C CB  . LEU C 3 165 ? -89.853  -18.546 -38.927  1.00 99.52  ? 165 LEU C CB  1 
ATOM   4065 C CG  . LEU C 3 165 ? -90.801  -17.983 -37.864  1.00 98.24  ? 165 LEU C CG  1 
ATOM   4066 C CD1 . LEU C 3 165 ? -92.218  -17.860 -38.398  1.00 97.81  ? 165 LEU C CD1 1 
ATOM   4067 C CD2 . LEU C 3 165 ? -90.807  -18.844 -36.631  1.00 97.26  ? 165 LEU C CD2 1 
ATOM   4068 N N   . SER C 3 166 ? -88.307  -15.914 -40.936  1.00 101.26 ? 166 SER C N   1 
ATOM   4069 C CA  . SER C 3 166 ? -87.064  -15.236 -41.256  1.00 102.00 ? 166 SER C CA  1 
ATOM   4070 C C   . SER C 3 166 ? -86.981  -13.900 -40.545  1.00 102.21 ? 166 SER C C   1 
ATOM   4071 O O   . SER C 3 166 ? -85.882  -13.454 -40.203  1.00 102.43 ? 166 SER C O   1 
ATOM   4072 C CB  . SER C 3 166 ? -86.922  -15.036 -42.773  1.00 102.22 ? 166 SER C CB  1 
ATOM   4073 O OG  . SER C 3 166 ? -88.058  -14.394 -43.327  1.00 103.01 ? 166 SER C OG  1 
ATOM   4074 N N   . SER C 3 167 ? -88.137  -13.266 -40.327  1.00 102.33 ? 167 SER C N   1 
ATOM   4075 C CA  . SER C 3 167 ? -88.184  -11.976 -39.627  1.00 102.40 ? 167 SER C CA  1 
ATOM   4076 C C   . SER C 3 167 ? -88.316  -12.098 -38.101  1.00 102.25 ? 167 SER C C   1 
ATOM   4077 O O   . SER C 3 167 ? -89.399  -12.395 -37.577  1.00 102.30 ? 167 SER C O   1 
ATOM   4078 C CB  . SER C 3 167 ? -89.291  -11.084 -40.183  1.00 102.55 ? 167 SER C CB  1 
ATOM   4079 O OG  . SER C 3 167 ? -89.320  -9.854  -39.482  1.00 102.76 ? 167 SER C OG  1 
ATOM   4080 N N   . GLY C 3 168 ? -87.202  -11.860 -37.407  1.00 101.92 ? 168 GLY C N   1 
ATOM   4081 C CA  . GLY C 3 168 ? -87.159  -11.875 -35.953  1.00 101.27 ? 168 GLY C CA  1 
ATOM   4082 C C   . GLY C 3 168 ? -86.414  -13.068 -35.403  1.00 100.87 ? 168 GLY C C   1 
ATOM   4083 O O   . GLY C 3 168 ? -86.960  -13.821 -34.607  1.00 100.75 ? 168 GLY C O   1 
ATOM   4084 N N   . VAL C 3 169 ? -85.158  -13.225 -35.803  1.00 100.70 ? 169 VAL C N   1 
ATOM   4085 C CA  . VAL C 3 169 ? -84.361  -14.386 -35.400  1.00 100.99 ? 169 VAL C CA  1 
ATOM   4086 C C   . VAL C 3 169 ? -82.859  -14.070 -35.308  1.00 101.15 ? 169 VAL C C   1 
ATOM   4087 O O   . VAL C 3 169 ? -82.339  -13.346 -36.143  1.00 101.18 ? 169 VAL C O   1 
ATOM   4088 C CB  . VAL C 3 169 ? -84.645  -15.604 -36.349  1.00 101.08 ? 169 VAL C CB  1 
ATOM   4089 C CG1 . VAL C 3 169 ? -84.949  -15.140 -37.776  1.00 101.33 ? 169 VAL C CG1 1 
ATOM   4090 C CG2 . VAL C 3 169 ? -83.515  -16.635 -36.335  1.00 100.74 ? 169 VAL C CG2 1 
ATOM   4091 N N   . HIS C 3 170 ? -82.174  -14.603 -34.293  1.00 101.54 ? 170 HIS C N   1 
ATOM   4092 C CA  . HIS C 3 170 ? -80.719  -14.420 -34.144  1.00 102.10 ? 170 HIS C CA  1 
ATOM   4093 C C   . HIS C 3 170 ? -79.946  -15.742 -34.140  1.00 102.66 ? 170 HIS C C   1 
ATOM   4094 O O   . HIS C 3 170 ? -80.311  -16.672 -33.417  1.00 102.84 ? 170 HIS C O   1 
ATOM   4095 C CB  . HIS C 3 170 ? -80.394  -13.625 -32.877  1.00 101.84 ? 170 HIS C CB  1 
ATOM   4096 C CG  . HIS C 3 170 ? -81.025  -12.272 -32.843  1.00 102.02 ? 170 HIS C CG  1 
ATOM   4097 N ND1 . HIS C 3 170 ? -81.905  -11.887 -31.854  1.00 102.24 ? 170 HIS C ND1 1 
ATOM   4098 C CD2 . HIS C 3 170 ? -80.928  -11.221 -33.691  1.00 101.96 ? 170 HIS C CD2 1 
ATOM   4099 C CE1 . HIS C 3 170 ? -82.317  -10.654 -32.090  1.00 101.69 ? 170 HIS C CE1 1 
ATOM   4100 N NE2 . HIS C 3 170 ? -81.740  -10.227 -33.199  1.00 101.86 ? 170 HIS C NE2 1 
ATOM   4101 N N   . THR C 3 171 ? -78.877  -15.817 -34.935  1.00 103.18 ? 171 THR C N   1 
ATOM   4102 C CA  . THR C 3 171 ? -78.076  -17.042 -35.038  1.00 103.76 ? 171 THR C CA  1 
ATOM   4103 C C   . THR C 3 171 ? -76.594  -16.813 -34.767  1.00 103.99 ? 171 THR C C   1 
ATOM   4104 O O   . THR C 3 171 ? -75.843  -16.363 -35.633  1.00 104.21 ? 171 THR C O   1 
ATOM   4105 C CB  . THR C 3 171 ? -78.243  -17.719 -36.402  1.00 103.89 ? 171 THR C CB  1 
ATOM   4106 O OG1 . THR C 3 171 ? -79.636  -17.796 -36.735  1.00 104.41 ? 171 THR C OG1 1 
ATOM   4107 C CG2 . THR C 3 171 ? -77.651  -19.124 -36.359  1.00 104.25 ? 171 THR C CG2 1 
ATOM   4108 N N   . PHE C 3 172 ? -76.177  -17.192 -33.571  1.00 104.37 ? 172 PHE C N   1 
ATOM   4109 C CA  . PHE C 3 172 ? -74.923  -16.733 -32.979  1.00 104.81 ? 172 PHE C CA  1 
ATOM   4110 C C   . PHE C 3 172 ? -73.692  -17.514 -33.439  1.00 104.85 ? 172 PHE C C   1 
ATOM   4111 O O   . PHE C 3 172 ? -73.712  -18.736 -33.467  1.00 104.98 ? 172 PHE C O   1 
ATOM   4112 C CB  . PHE C 3 172 ? -75.076  -16.731 -31.454  1.00 104.94 ? 172 PHE C CB  1 
ATOM   4113 C CG  . PHE C 3 172 ? -76.391  -16.154 -30.999  1.00 105.81 ? 172 PHE C CG  1 
ATOM   4114 C CD1 . PHE C 3 172 ? -77.541  -16.943 -30.969  1.00 106.56 ? 172 PHE C CD1 1 
ATOM   4115 C CD2 . PHE C 3 172 ? -76.492  -14.812 -30.653  1.00 106.53 ? 172 PHE C CD2 1 
ATOM   4116 C CE1 . PHE C 3 172 ? -78.761  -16.413 -30.584  1.00 106.92 ? 172 PHE C CE1 1 
ATOM   4117 C CE2 . PHE C 3 172 ? -77.715  -14.269 -30.263  1.00 107.11 ? 172 PHE C CE2 1 
ATOM   4118 C CZ  . PHE C 3 172 ? -78.850  -15.074 -30.224  1.00 107.34 ? 172 PHE C CZ  1 
ATOM   4119 N N   . PRO C 3 173 ? -72.624  -16.793 -33.819  1.00 105.01 ? 173 PRO C N   1 
ATOM   4120 C CA  . PRO C 3 173 ? -71.362  -17.325 -34.344  1.00 105.19 ? 173 PRO C CA  1 
ATOM   4121 C C   . PRO C 3 173 ? -70.832  -18.543 -33.601  1.00 105.32 ? 173 PRO C C   1 
ATOM   4122 O O   . PRO C 3 173 ? -70.418  -18.416 -32.459  1.00 105.36 ? 173 PRO C O   1 
ATOM   4123 C CB  . PRO C 3 173 ? -70.394  -16.158 -34.141  1.00 105.24 ? 173 PRO C CB  1 
ATOM   4124 C CG  . PRO C 3 173 ? -71.249  -14.928 -34.223  1.00 105.22 ? 173 PRO C CG  1 
ATOM   4125 C CD  . PRO C 3 173 ? -72.665  -15.319 -33.885  1.00 105.05 ? 173 PRO C CD  1 
ATOM   4126 N N   . ALA C 3 174 ? -70.828  -19.705 -34.250  1.00 105.71 ? 174 ALA C N   1 
ATOM   4127 C CA  . ALA C 3 174 ? -70.327  -20.942 -33.637  1.00 106.35 ? 174 ALA C CA  1 
ATOM   4128 C C   . ALA C 3 174 ? -68.960  -20.736 -33.002  1.00 106.88 ? 174 ALA C C   1 
ATOM   4129 O O   . ALA C 3 174 ? -68.142  -20.000 -33.543  1.00 107.10 ? 174 ALA C O   1 
ATOM   4130 C CB  . ALA C 3 174 ? -70.255  -22.050 -34.667  1.00 106.25 ? 174 ALA C CB  1 
ATOM   4131 N N   . VAL C 3 175 ? -68.710  -21.375 -31.859  1.00 107.67 ? 175 VAL C N   1 
ATOM   4132 C CA  . VAL C 3 175 ? -67.405  -21.244 -31.196  1.00 108.36 ? 175 VAL C CA  1 
ATOM   4133 C C   . VAL C 3 175 ? -66.562  -22.518 -31.285  1.00 108.97 ? 175 VAL C C   1 
ATOM   4134 O O   . VAL C 3 175 ? -67.050  -23.591 -31.673  1.00 108.94 ? 175 VAL C O   1 
ATOM   4135 C CB  . VAL C 3 175 ? -67.504  -20.790 -29.718  1.00 108.32 ? 175 VAL C CB  1 
ATOM   4136 C CG1 . VAL C 3 175 ? -66.160  -20.227 -29.265  1.00 108.53 ? 175 VAL C CG1 1 
ATOM   4137 C CG2 . VAL C 3 175 ? -68.606  -19.753 -29.525  1.00 108.12 ? 175 VAL C CG2 1 
ATOM   4138 N N   . LEU C 3 176 ? -65.298  -22.380 -30.891  1.00 109.65 ? 176 LEU C N   1 
ATOM   4139 C CA  . LEU C 3 176 ? -64.272  -23.383 -31.150  1.00 110.34 ? 176 LEU C CA  1 
ATOM   4140 C C   . LEU C 3 176 ? -63.769  -24.089 -29.887  1.00 110.61 ? 176 LEU C C   1 
ATOM   4141 O O   . LEU C 3 176 ? -62.558  -24.256 -29.708  1.00 110.86 ? 176 LEU C O   1 
ATOM   4142 C CB  . LEU C 3 176 ? -63.105  -22.747 -31.941  1.00 110.28 ? 176 LEU C CB  1 
ATOM   4143 C CG  . LEU C 3 176 ? -62.623  -21.353 -31.492  1.00 110.58 ? 176 LEU C CG  1 
ATOM   4144 C CD1 . LEU C 3 176 ? -61.298  -21.418 -30.726  1.00 110.17 ? 176 LEU C CD1 1 
ATOM   4145 C CD2 . LEU C 3 176 ? -62.508  -20.391 -32.679  1.00 110.60 ? 176 LEU C CD2 1 
ATOM   4146 N N   . GLN C 3 177 ? -64.685  -24.511 -29.014  1.00 110.81 ? 177 GLN C N   1 
ATOM   4147 C CA  . GLN C 3 177 ? -64.289  -25.410 -27.922  1.00 111.23 ? 177 GLN C CA  1 
ATOM   4148 C C   . GLN C 3 177 ? -63.783  -26.725 -28.510  1.00 111.16 ? 177 GLN C C   1 
ATOM   4149 O O   . GLN C 3 177 ? -64.365  -27.243 -29.470  1.00 111.01 ? 177 GLN C O   1 
ATOM   4150 C CB  . GLN C 3 177 ? -65.400  -25.642 -26.871  1.00 111.42 ? 177 GLN C CB  1 
ATOM   4151 C CG  . GLN C 3 177 ? -66.863  -25.645 -27.364  1.00 112.48 ? 177 GLN C CG  1 
ATOM   4152 C CD  . GLN C 3 177 ? -67.289  -26.909 -28.135  1.00 114.08 ? 177 GLN C CD  1 
ATOM   4153 O OE1 . GLN C 3 177 ? -68.331  -26.909 -28.800  1.00 114.75 ? 177 GLN C OE1 1 
ATOM   4154 N NE2 . GLN C 3 177 ? -66.495  -27.982 -28.045  1.00 113.95 ? 177 GLN C NE2 1 
ATOM   4155 N N   . SER C 3 178 ? -62.690  -27.239 -27.942  1.00 111.23 ? 178 SER C N   1 
ATOM   4156 C CA  . SER C 3 178 ? -62.019  -28.454 -28.432  1.00 111.42 ? 178 SER C CA  1 
ATOM   4157 C C   . SER C 3 178 ? -61.587  -28.328 -29.898  1.00 111.33 ? 178 SER C C   1 
ATOM   4158 O O   . SER C 3 178 ? -60.554  -27.718 -30.209  1.00 111.39 ? 178 SER C O   1 
ATOM   4159 C CB  . SER C 3 178 ? -62.916  -29.694 -28.252  1.00 111.51 ? 178 SER C CB  1 
ATOM   4160 O OG  . SER C 3 178 ? -62.787  -30.255 -26.957  1.00 112.19 ? 178 SER C OG  1 
ATOM   4161 N N   . ASP C 3 179 ? -62.392  -28.945 -30.769  1.00 111.09 ? 179 ASP C N   1 
ATOM   4162 C CA  . ASP C 3 179 ? -62.304  -28.871 -32.232  1.00 110.73 ? 179 ASP C CA  1 
ATOM   4163 C C   . ASP C 3 179 ? -63.650  -29.340 -32.764  1.00 110.18 ? 179 ASP C C   1 
ATOM   4164 O O   . ASP C 3 179 ? -63.751  -30.066 -33.763  1.00 109.69 ? 179 ASP C O   1 
ATOM   4165 C CB  . ASP C 3 179 ? -61.156  -29.720 -32.792  1.00 111.13 ? 179 ASP C CB  1 
ATOM   4166 C CG  . ASP C 3 179 ? -60.623  -30.729 -31.786  1.00 112.02 ? 179 ASP C CG  1 
ATOM   4167 O OD1 . ASP C 3 179 ? -59.442  -30.566 -31.397  1.00 112.54 ? 179 ASP C OD1 1 
ATOM   4168 O OD2 . ASP C 3 179 ? -61.382  -31.650 -31.374  1.00 112.52 ? 179 ASP C OD2 1 
ATOM   4169 N N   . LEU C 3 180 ? -64.679  -28.922 -32.031  1.00 109.92 ? 180 LEU C N   1 
ATOM   4170 C CA  . LEU C 3 180 ? -66.082  -29.055 -32.415  1.00 109.54 ? 180 LEU C CA  1 
ATOM   4171 C C   . LEU C 3 180 ? -66.748  -27.680 -32.265  1.00 109.20 ? 180 LEU C C   1 
ATOM   4172 O O   . LEU C 3 180 ? -66.492  -26.948 -31.298  1.00 109.17 ? 180 LEU C O   1 
ATOM   4173 C CB  . LEU C 3 180 ? -66.798  -30.106 -31.549  1.00 109.55 ? 180 LEU C CB  1 
ATOM   4174 C CG  . LEU C 3 180 ? -66.547  -31.620 -31.707  1.00 109.04 ? 180 LEU C CG  1 
ATOM   4175 C CD1 . LEU C 3 180 ? -66.801  -32.097 -33.142  1.00 108.47 ? 180 LEU C CD1 1 
ATOM   4176 C CD2 . LEU C 3 180 ? -65.158  -32.063 -31.195  1.00 108.51 ? 180 LEU C CD2 1 
ATOM   4177 N N   . TYR C 3 181 ? -67.575  -27.312 -33.234  1.00 108.58 ? 181 TYR C N   1 
ATOM   4178 C CA  . TYR C 3 181 ? -68.180  -25.997 -33.201  1.00 108.16 ? 181 TYR C CA  1 
ATOM   4179 C C   . TYR C 3 181 ? -69.522  -26.140 -32.552  1.00 107.51 ? 181 TYR C C   1 
ATOM   4180 O O   . TYR C 3 181 ? -70.147  -27.188 -32.679  1.00 107.65 ? 181 TYR C O   1 
ATOM   4181 C CB  . TYR C 3 181 ? -68.297  -25.412 -34.609  1.00 108.48 ? 181 TYR C CB  1 
ATOM   4182 C CG  . TYR C 3 181 ? -66.970  -24.948 -35.181  1.00 108.96 ? 181 TYR C CG  1 
ATOM   4183 C CD1 . TYR C 3 181 ? -66.600  -23.607 -35.123  1.00 109.52 ? 181 TYR C CD1 1 
ATOM   4184 C CD2 . TYR C 3 181 ? -66.076  -25.856 -35.763  1.00 109.10 ? 181 TYR C CD2 1 
ATOM   4185 C CE1 . TYR C 3 181 ? -65.380  -23.175 -35.637  1.00 110.25 ? 181 TYR C CE1 1 
ATOM   4186 C CE2 . TYR C 3 181 ? -64.856  -25.440 -36.276  1.00 109.37 ? 181 TYR C CE2 1 
ATOM   4187 C CZ  . TYR C 3 181 ? -64.515  -24.096 -36.215  1.00 110.08 ? 181 TYR C CZ  1 
ATOM   4188 O OH  . TYR C 3 181 ? -63.309  -23.668 -36.724  1.00 109.68 ? 181 TYR C OH  1 
ATOM   4189 N N   . THR C 3 182 ? -69.954  -25.108 -31.835  1.00 106.62 ? 182 THR C N   1 
ATOM   4190 C CA  . THR C 3 182 ? -71.266  -25.150 -31.190  1.00 105.94 ? 182 THR C CA  1 
ATOM   4191 C C   . THR C 3 182 ? -72.002  -23.798 -31.277  1.00 105.34 ? 182 THR C C   1 
ATOM   4192 O O   . THR C 3 182 ? -71.444  -22.747 -30.936  1.00 105.40 ? 182 THR C O   1 
ATOM   4193 C CB  . THR C 3 182 ? -71.169  -25.732 -29.742  1.00 106.14 ? 182 THR C CB  1 
ATOM   4194 O OG1 . THR C 3 182 ? -70.783  -27.116 -29.813  1.00 105.27 ? 182 THR C OG1 1 
ATOM   4195 C CG2 . THR C 3 182 ? -72.504  -25.612 -28.976  1.00 106.10 ? 182 THR C CG2 1 
ATOM   4196 N N   . LEU C 3 183 ? -73.260  -23.854 -31.725  1.00 104.26 ? 183 LEU C N   1 
ATOM   4197 C CA  . LEU C 3 183 ? -74.009  -22.676 -32.171  1.00 103.34 ? 183 LEU C CA  1 
ATOM   4198 C C   . LEU C 3 183 ? -75.503  -22.687 -31.794  1.00 102.81 ? 183 LEU C C   1 
ATOM   4199 O O   . LEU C 3 183 ? -76.188  -23.706 -31.915  1.00 102.75 ? 183 LEU C O   1 
ATOM   4200 C CB  . LEU C 3 183 ? -73.831  -22.538 -33.685  1.00 103.38 ? 183 LEU C CB  1 
ATOM   4201 C CG  . LEU C 3 183 ? -74.700  -21.655 -34.578  1.00 103.45 ? 183 LEU C CG  1 
ATOM   4202 C CD1 . LEU C 3 183 ? -73.856  -21.176 -35.747  1.00 103.65 ? 183 LEU C CD1 1 
ATOM   4203 C CD2 . LEU C 3 183 ? -75.954  -22.388 -35.070  1.00 103.40 ? 183 LEU C CD2 1 
ATOM   4204 N N   . SER C 3 184 ? -76.001  -21.526 -31.377  1.00 102.06 ? 184 SER C N   1 
ATOM   4205 C CA  . SER C 3 184 ? -77.349  -21.375 -30.816  1.00 101.22 ? 184 SER C CA  1 
ATOM   4206 C C   . SER C 3 184 ? -78.259  -20.617 -31.771  1.00 100.64 ? 184 SER C C   1 
ATOM   4207 O O   . SER C 3 184 ? -77.755  -19.940 -32.662  1.00 100.82 ? 184 SER C O   1 
ATOM   4208 C CB  . SER C 3 184 ? -77.243  -20.595 -29.513  1.00 101.24 ? 184 SER C CB  1 
ATOM   4209 O OG  . SER C 3 184 ? -76.472  -19.423 -29.710  1.00 100.79 ? 184 SER C OG  1 
ATOM   4210 N N   . SER C 3 185 ? -79.581  -20.717 -31.588  1.00 99.81  ? 185 SER C N   1 
ATOM   4211 C CA  . SER C 3 185 ? -80.532  -19.949 -32.420  1.00 99.31  ? 185 SER C CA  1 
ATOM   4212 C C   . SER C 3 185 ? -81.828  -19.473 -31.744  1.00 98.98  ? 185 SER C C   1 
ATOM   4213 O O   . SER C 3 185 ? -82.709  -20.272 -31.425  1.00 99.03  ? 185 SER C O   1 
ATOM   4214 C CB  . SER C 3 185 ? -80.882  -20.710 -33.699  1.00 99.33  ? 185 SER C CB  1 
ATOM   4215 O OG  . SER C 3 185 ? -81.494  -19.843 -34.645  1.00 99.11  ? 185 SER C OG  1 
ATOM   4216 N N   . SER C 3 186 ? -81.950  -18.164 -31.555  1.00 98.43  ? 186 SER C N   1 
ATOM   4217 C CA  . SER C 3 186 ? -83.155  -17.602 -30.966  1.00 98.02  ? 186 SER C CA  1 
ATOM   4218 C C   . SER C 3 186 ? -84.071  -17.146 -32.075  1.00 97.60  ? 186 SER C C   1 
ATOM   4219 O O   . SER C 3 186 ? -83.611  -16.713 -33.119  1.00 97.54  ? 186 SER C O   1 
ATOM   4220 C CB  . SER C 3 186 ? -82.829  -16.409 -30.058  1.00 98.18  ? 186 SER C CB  1 
ATOM   4221 O OG  . SER C 3 186 ? -83.163  -15.167 -30.675  1.00 98.43  ? 186 SER C OG  1 
ATOM   4222 N N   . VAL C 3 187 ? -85.370  -17.240 -31.830  1.00 97.32  ? 187 VAL C N   1 
ATOM   4223 C CA  . VAL C 3 187 ? -86.387  -16.676 -32.712  1.00 96.96  ? 187 VAL C CA  1 
ATOM   4224 C C   . VAL C 3 187 ? -87.555  -16.224 -31.833  1.00 96.94  ? 187 VAL C C   1 
ATOM   4225 O O   . VAL C 3 187 ? -88.161  -17.044 -31.142  1.00 96.83  ? 187 VAL C O   1 
ATOM   4226 C CB  . VAL C 3 187 ? -86.843  -17.698 -33.802  1.00 96.76  ? 187 VAL C CB  1 
ATOM   4227 C CG1 . VAL C 3 187 ? -87.340  -18.987 -33.173  1.00 96.84  ? 187 VAL C CG1 1 
ATOM   4228 C CG2 . VAL C 3 187 ? -87.913  -17.113 -34.691  1.00 96.15  ? 187 VAL C CG2 1 
ATOM   4229 N N   . THR C 3 188 ? -87.843  -14.921 -31.829  1.00 96.79  ? 188 THR C N   1 
ATOM   4230 C CA  . THR C 3 188 ? -88.973  -14.386 -31.063  1.00 96.76  ? 188 THR C CA  1 
ATOM   4231 C C   . THR C 3 188 ? -90.243  -14.665 -31.854  1.00 96.52  ? 188 THR C C   1 
ATOM   4232 O O   . THR C 3 188 ? -90.169  -15.038 -33.023  1.00 96.69  ? 188 THR C O   1 
ATOM   4233 C CB  . THR C 3 188 ? -88.812  -12.853 -30.786  1.00 96.90  ? 188 THR C CB  1 
ATOM   4234 O OG1 . THR C 3 188 ? -87.554  -12.608 -30.141  1.00 98.01  ? 188 THR C OG1 1 
ATOM   4235 C CG2 . THR C 3 188 ? -89.922  -12.312 -29.882  1.00 96.73  ? 188 THR C CG2 1 
ATOM   4236 N N   . VAL C 3 189 ? -91.402  -14.525 -31.217  1.00 96.23  ? 189 VAL C N   1 
ATOM   4237 C CA  . VAL C 3 189 ? -92.661  -14.394 -31.959  1.00 95.94  ? 189 VAL C CA  1 
ATOM   4238 C C   . VAL C 3 189 ? -93.896  -14.288 -31.040  1.00 95.62  ? 189 VAL C C   1 
ATOM   4239 O O   . VAL C 3 189 ? -93.897  -14.817 -29.928  1.00 95.63  ? 189 VAL C O   1 
ATOM   4240 C CB  . VAL C 3 189 ? -92.780  -15.461 -33.115  1.00 95.92  ? 189 VAL C CB  1 
ATOM   4241 C CG1 . VAL C 3 189 ? -93.303  -16.807 -32.619  1.00 95.73  ? 189 VAL C CG1 1 
ATOM   4242 C CG2 . VAL C 3 189 ? -93.584  -14.896 -34.302  1.00 96.40  ? 189 VAL C CG2 1 
ATOM   4243 N N   . THR C 3 190 ? -94.916  -13.572 -31.509  1.00 95.25  ? 190 THR C N   1 
ATOM   4244 C CA  . THR C 3 190 ? -96.173  -13.388 -30.791  1.00 95.43  ? 190 THR C CA  1 
ATOM   4245 C C   . THR C 3 190 ? -96.700  -14.672 -30.184  1.00 95.58  ? 190 THR C C   1 
ATOM   4246 O O   . THR C 3 190 ? -96.617  -15.737 -30.800  1.00 95.74  ? 190 THR C O   1 
ATOM   4247 C CB  . THR C 3 190 ? -97.261  -12.916 -31.728  1.00 95.41  ? 190 THR C CB  1 
ATOM   4248 O OG1 . THR C 3 190 ? -96.666  -12.177 -32.795  1.00 96.23  ? 190 THR C OG1 1 
ATOM   4249 C CG2 . THR C 3 190 ? -98.275  -12.052 -30.984  1.00 95.90  ? 190 THR C CG2 1 
ATOM   4250 N N   . SER C 3 191 ? -97.264  -14.555 -28.980  1.00 95.63  ? 191 SER C N   1 
ATOM   4251 C CA  . SER C 3 191 ? -97.831  -15.690 -28.261  1.00 95.28  ? 191 SER C CA  1 
ATOM   4252 C C   . SER C 3 191 ? -99.012  -16.227 -29.029  1.00 94.78  ? 191 SER C C   1 
ATOM   4253 O O   . SER C 3 191 ? -99.382  -17.389 -28.874  1.00 94.88  ? 191 SER C O   1 
ATOM   4254 C CB  . SER C 3 191 ? -98.273  -15.287 -26.854  1.00 95.44  ? 191 SER C CB  1 
ATOM   4255 O OG  . SER C 3 191 ? -99.544  -14.653 -26.888  1.00 96.57  ? 191 SER C OG  1 
ATOM   4256 N N   . SER C 3 192 ? -99.607  -15.374 -29.852  1.00 94.28  ? 192 SER C N   1 
ATOM   4257 C CA  . SER C 3 192 ? -100.678 -15.814 -30.712  1.00 94.33  ? 192 SER C CA  1 
ATOM   4258 C C   . SER C 3 192 ? -100.167 -16.820 -31.739  1.00 94.21  ? 192 SER C C   1 
ATOM   4259 O O   . SER C 3 192 ? -100.800 -17.868 -31.973  1.00 94.10  ? 192 SER C O   1 
ATOM   4260 C CB  . SER C 3 192 ? -101.374 -14.627 -31.375  1.00 94.54  ? 192 SER C CB  1 
ATOM   4261 O OG  . SER C 3 192 ? -102.669 -14.433 -30.815  1.00 94.79  ? 192 SER C OG  1 
ATOM   4262 N N   . THR C 3 193 ? -99.005  -16.514 -32.319  1.00 94.07  ? 193 THR C N   1 
ATOM   4263 C CA  . THR C 3 193 ? -98.425  -17.371 -33.361  1.00 93.64  ? 193 THR C CA  1 
ATOM   4264 C C   . THR C 3 193 ? -97.782  -18.675 -32.846  1.00 93.69  ? 193 THR C C   1 
ATOM   4265 O O   . THR C 3 193 ? -97.769  -19.652 -33.579  1.00 93.62  ? 193 THR C O   1 
ATOM   4266 C CB  . THR C 3 193 ? -97.468  -16.616 -34.357  1.00 93.45  ? 193 THR C CB  1 
ATOM   4267 O OG1 . THR C 3 193 ? -96.121  -16.660 -33.878  1.00 92.51  ? 193 THR C OG1 1 
ATOM   4268 C CG2 . THR C 3 193 ? -97.922  -15.158 -34.624  1.00 92.82  ? 193 THR C CG2 1 
ATOM   4269 N N   . TRP C 3 194 ? -97.263  -18.726 -31.616  1.00 93.82  ? 194 TRP C N   1 
ATOM   4270 C CA  . TRP C 3 194 ? -96.782  -20.036 -31.144  1.00 94.23  ? 194 TRP C CA  1 
ATOM   4271 C C   . TRP C 3 194 ? -97.895  -20.962 -30.657  1.00 94.64  ? 194 TRP C C   1 
ATOM   4272 O O   . TRP C 3 194 ? -99.006  -20.872 -31.179  1.00 95.03  ? 194 TRP C O   1 
ATOM   4273 C CB  . TRP C 3 194 ? -95.569  -20.024 -30.197  1.00 94.28  ? 194 TRP C CB  1 
ATOM   4274 C CG  . TRP C 3 194 ? -94.948  -21.444 -30.076  1.00 93.68  ? 194 TRP C CG  1 
ATOM   4275 C CD1 . TRP C 3 194 ? -94.661  -22.294 -31.103  1.00 92.40  ? 194 TRP C CD1 1 
ATOM   4276 C CD2 . TRP C 3 194 ? -94.581  -22.146 -28.871  1.00 93.73  ? 194 TRP C CD2 1 
ATOM   4277 N NE1 . TRP C 3 194 ? -94.132  -23.466 -30.626  1.00 92.25  ? 194 TRP C NE1 1 
ATOM   4278 C CE2 . TRP C 3 194 ? -94.066  -23.404 -29.262  1.00 92.92  ? 194 TRP C CE2 1 
ATOM   4279 C CE3 . TRP C 3 194 ? -94.623  -21.828 -27.502  1.00 93.86  ? 194 TRP C CE3 1 
ATOM   4280 C CZ2 . TRP C 3 194 ? -93.599  -24.348 -28.338  1.00 93.02  ? 194 TRP C CZ2 1 
ATOM   4281 C CZ3 . TRP C 3 194 ? -94.157  -22.775 -26.580  1.00 93.43  ? 194 TRP C CZ3 1 
ATOM   4282 C CH2 . TRP C 3 194 ? -93.655  -24.017 -27.007  1.00 92.96  ? 194 TRP C CH2 1 
ATOM   4283 N N   . PRO C 3 195 ? -97.628  -21.772 -29.606  1.00 94.78  ? 195 PRO C N   1 
ATOM   4284 C CA  . PRO C 3 195 ? -98.010  -23.199 -29.501  1.00 94.98  ? 195 PRO C CA  1 
ATOM   4285 C C   . PRO C 3 195 ? -99.006  -23.690 -30.560  1.00 95.45  ? 195 PRO C C   1 
ATOM   4286 O O   . PRO C 3 195 ? -98.720  -24.658 -31.254  1.00 95.39  ? 195 PRO C O   1 
ATOM   4287 C CB  . PRO C 3 195 ? -98.595  -23.318 -28.093  1.00 94.76  ? 195 PRO C CB  1 
ATOM   4288 C CG  . PRO C 3 195 ? -98.719  -21.906 -27.601  1.00 95.07  ? 195 PRO C CG  1 
ATOM   4289 C CD  . PRO C 3 195 ? -97.659  -21.131 -28.284  1.00 94.48  ? 195 PRO C CD  1 
ATOM   4290 N N   . SER C 3 196 ? -100.154 -23.018 -30.670  1.00 96.23  ? 196 SER C N   1 
ATOM   4291 C CA  . SER C 3 196 ? -101.160 -23.270 -31.709  1.00 96.87  ? 196 SER C CA  1 
ATOM   4292 C C   . SER C 3 196 ? -100.520 -23.577 -33.047  1.00 97.35  ? 196 SER C C   1 
ATOM   4293 O O   . SER C 3 196 ? -100.590 -24.703 -33.536  1.00 97.82  ? 196 SER C O   1 
ATOM   4294 C CB  . SER C 3 196 ? -102.127 -22.079 -31.841  1.00 96.90  ? 196 SER C CB  1 
ATOM   4295 O OG  . SER C 3 196 ? -101.460 -20.822 -31.877  1.00 97.02  ? 196 SER C OG  1 
ATOM   4296 N N   . GLN C 3 197 ? -99.877  -22.569 -33.614  1.00 97.85  ? 197 GLN C N   1 
ATOM   4297 C CA  . GLN C 3 197 ? -99.214  -22.673 -34.902  1.00 98.41  ? 197 GLN C CA  1 
ATOM   4298 C C   . GLN C 3 197 ? -97.841  -23.298 -34.677  1.00 98.31  ? 197 GLN C C   1 
ATOM   4299 O O   . GLN C 3 197 ? -97.178  -22.973 -33.708  1.00 98.38  ? 197 GLN C O   1 
ATOM   4300 C CB  . GLN C 3 197 ? -99.160  -21.266 -35.521  1.00 98.70  ? 197 GLN C CB  1 
ATOM   4301 C CG  . GLN C 3 197 ? -98.156  -20.993 -36.633  1.00 99.72  ? 197 GLN C CG  1 
ATOM   4302 C CD  . GLN C 3 197 ? -98.590  -19.809 -37.493  1.00 100.96 ? 197 GLN C CD  1 
ATOM   4303 O OE1 . GLN C 3 197 ? -99.656  -19.846 -38.113  1.00 102.01 ? 197 GLN C OE1 1 
ATOM   4304 N NE2 . GLN C 3 197 ? -97.768  -18.759 -37.539  1.00 100.58 ? 197 GLN C NE2 1 
ATOM   4305 N N   . SER C 3 198 ? -97.444  -24.224 -35.543  1.00 98.60  ? 198 SER C N   1 
ATOM   4306 C CA  . SER C 3 198 ? -96.165  -24.933 -35.397  1.00 99.10  ? 198 SER C CA  1 
ATOM   4307 C C   . SER C 3 198 ? -94.985  -24.069 -35.807  1.00 99.30  ? 198 SER C C   1 
ATOM   4308 O O   . SER C 3 198 ? -95.116  -23.204 -36.680  1.00 99.43  ? 198 SER C O   1 
ATOM   4309 C CB  . SER C 3 198 ? -96.149  -26.224 -36.227  1.00 99.35  ? 198 SER C CB  1 
ATOM   4310 O OG  . SER C 3 198 ? -94.827  -26.574 -36.643  1.00 99.50  ? 198 SER C OG  1 
ATOM   4311 N N   . ILE C 3 199 ? -93.838  -24.333 -35.178  1.00 99.27  ? 199 ILE C N   1 
ATOM   4312 C CA  . ILE C 3 199 ? -92.573  -23.655 -35.467  1.00 99.16  ? 199 ILE C CA  1 
ATOM   4313 C C   . ILE C 3 199 ? -91.456  -24.671 -35.295  1.00 99.26  ? 199 ILE C C   1 
ATOM   4314 O O   . ILE C 3 199 ? -91.251  -25.194 -34.198  1.00 99.32  ? 199 ILE C O   1 
ATOM   4315 C CB  . ILE C 3 199 ? -92.334  -22.451 -34.509  1.00 99.06  ? 199 ILE C CB  1 
ATOM   4316 C CG1 . ILE C 3 199 ? -93.271  -21.291 -34.854  1.00 98.50  ? 199 ILE C CG1 1 
ATOM   4317 C CG2 . ILE C 3 199 ? -90.862  -21.990 -34.545  1.00 99.24  ? 199 ILE C CG2 1 
ATOM   4318 C CD1 . ILE C 3 199 ? -93.737  -20.499 -33.671  1.00 97.63  ? 199 ILE C CD1 1 
ATOM   4319 N N   . THR C 3 200 ? -90.739  -24.964 -36.373  1.00 99.40  ? 200 THR C N   1 
ATOM   4320 C CA  . THR C 3 200 ? -89.654  -25.939 -36.291  1.00 99.58  ? 200 THR C CA  1 
ATOM   4321 C C   . THR C 3 200 ? -88.324  -25.359 -36.757  1.00 99.69  ? 200 THR C C   1 
ATOM   4322 O O   . THR C 3 200 ? -88.280  -24.465 -37.619  1.00 99.68  ? 200 THR C O   1 
ATOM   4323 C CB  . THR C 3 200 ? -89.940  -27.232 -37.090  1.00 99.45  ? 200 THR C CB  1 
ATOM   4324 O OG1 . THR C 3 200 ? -89.288  -27.160 -38.361  1.00 99.54  ? 200 THR C OG1 1 
ATOM   4325 C CG2 . THR C 3 200 ? -91.437  -27.440 -37.294  1.00 100.00 ? 200 THR C CG2 1 
ATOM   4326 N N   . CYS C 3 201 ? -87.256  -25.895 -36.165  1.00 99.67  ? 201 CYS C N   1 
ATOM   4327 C CA  . CYS C 3 201 ? -85.877  -25.582 -36.506  1.00 99.73  ? 201 CYS C CA  1 
ATOM   4328 C C   . CYS C 3 201 ? -85.375  -26.584 -37.559  1.00 99.26  ? 201 CYS C C   1 
ATOM   4329 O O   . CYS C 3 201 ? -85.407  -27.793 -37.325  1.00 99.31  ? 201 CYS C O   1 
ATOM   4330 C CB  . CYS C 3 201 ? -85.009  -25.638 -35.231  1.00 99.83  ? 201 CYS C CB  1 
ATOM   4331 S SG  . CYS C 3 201 ? -83.221  -25.765 -35.540  1.00 102.18 ? 201 CYS C SG  1 
ATOM   4332 N N   . ASN C 3 202 ? -84.940  -26.086 -38.719  1.00 98.79  ? 202 ASN C N   1 
ATOM   4333 C CA  . ASN C 3 202 ? -84.246  -26.919 -39.712  1.00 98.46  ? 202 ASN C CA  1 
ATOM   4334 C C   . ASN C 3 202 ? -82.741  -26.632 -39.723  1.00 98.26  ? 202 ASN C C   1 
ATOM   4335 O O   . ASN C 3 202 ? -82.328  -25.482 -39.864  1.00 98.17  ? 202 ASN C O   1 
ATOM   4336 C CB  . ASN C 3 202 ? -84.780  -26.703 -41.136  1.00 98.55  ? 202 ASN C CB  1 
ATOM   4337 C CG  . ASN C 3 202 ? -86.257  -26.356 -41.192  1.00 98.51  ? 202 ASN C CG  1 
ATOM   4338 O OD1 . ASN C 3 202 ? -87.118  -27.198 -40.946  1.00 98.65  ? 202 ASN C OD1 1 
ATOM   4339 N ND2 . ASN C 3 202 ? -86.555  -25.120 -41.577  1.00 98.26  ? 202 ASN C ND2 1 
ATOM   4340 N N   . VAL C 3 203 ? -81.923  -27.672 -39.593  1.00 98.03  ? 203 VAL C N   1 
ATOM   4341 C CA  . VAL C 3 203 ? -80.467  -27.505 -39.610  1.00 98.05  ? 203 VAL C CA  1 
ATOM   4342 C C   . VAL C 3 203 ? -79.838  -28.307 -40.739  1.00 98.14  ? 203 VAL C C   1 
ATOM   4343 O O   . VAL C 3 203 ? -80.123  -29.497 -40.893  1.00 98.50  ? 203 VAL C O   1 
ATOM   4344 C CB  . VAL C 3 203 ? -79.819  -27.926 -38.267  1.00 98.10  ? 203 VAL C CB  1 
ATOM   4345 C CG1 . VAL C 3 203 ? -78.283  -27.852 -38.340  1.00 97.64  ? 203 VAL C CG1 1 
ATOM   4346 C CG2 . VAL C 3 203 ? -80.349  -27.064 -37.119  1.00 98.28  ? 203 VAL C CG2 1 
ATOM   4347 N N   . ALA C 3 204 ? -78.973  -27.661 -41.518  1.00 97.98  ? 204 ALA C N   1 
ATOM   4348 C CA  . ALA C 3 204 ? -78.283  -28.340 -42.607  1.00 97.84  ? 204 ALA C CA  1 
ATOM   4349 C C   . ALA C 3 204 ? -76.768  -28.288 -42.474  1.00 97.80  ? 204 ALA C C   1 
ATOM   4350 O O   . ALA C 3 204 ? -76.149  -27.237 -42.613  1.00 97.58  ? 204 ALA C O   1 
ATOM   4351 C CB  . ALA C 3 204 ? -78.717  -27.779 -43.943  1.00 98.18  ? 204 ALA C CB  1 
ATOM   4352 N N   . HIS C 3 205 ? -76.177  -29.436 -42.189  1.00 97.99  ? 205 HIS C N   1 
ATOM   4353 C CA  . HIS C 3 205 ? -74.741  -29.579 -42.262  1.00 98.23  ? 205 HIS C CA  1 
ATOM   4354 C C   . HIS C 3 205 ? -74.435  -30.078 -43.668  1.00 98.57  ? 205 HIS C C   1 
ATOM   4355 O O   . HIS C 3 205 ? -74.850  -31.185 -44.041  1.00 98.40  ? 205 HIS C O   1 
ATOM   4356 C CB  . HIS C 3 205 ? -74.259  -30.577 -41.221  1.00 98.20  ? 205 HIS C CB  1 
ATOM   4357 C CG  . HIS C 3 205 ? -72.812  -30.442 -40.875  1.00 97.77  ? 205 HIS C CG  1 
ATOM   4358 N ND1 . HIS C 3 205 ? -71.829  -31.178 -41.495  1.00 97.11  ? 205 HIS C ND1 1 
ATOM   4359 C CD2 . HIS C 3 205 ? -72.181  -29.666 -39.961  1.00 97.80  ? 205 HIS C CD2 1 
ATOM   4360 C CE1 . HIS C 3 205 ? -70.654  -30.861 -40.981  1.00 97.89  ? 205 HIS C CE1 1 
ATOM   4361 N NE2 . HIS C 3 205 ? -70.839  -29.944 -40.049  1.00 97.85  ? 205 HIS C NE2 1 
ATOM   4362 N N   . PRO C 3 206 ? -73.744  -29.245 -44.472  1.00 98.88  ? 206 PRO C N   1 
ATOM   4363 C CA  . PRO C 3 206 ? -73.427  -29.606 -45.855  1.00 98.98  ? 206 PRO C CA  1 
ATOM   4364 C C   . PRO C 3 206 ? -72.174  -30.457 -45.892  1.00 99.22  ? 206 PRO C C   1 
ATOM   4365 O O   . PRO C 3 206 ? -72.138  -31.488 -46.571  1.00 99.24  ? 206 PRO C O   1 
ATOM   4366 C CB  . PRO C 3 206 ? -73.158  -28.255 -46.511  1.00 98.85  ? 206 PRO C CB  1 
ATOM   4367 C CG  . PRO C 3 206 ? -72.614  -27.405 -45.400  1.00 98.77  ? 206 PRO C CG  1 
ATOM   4368 C CD  . PRO C 3 206 ? -73.220  -27.910 -44.112  1.00 98.80  ? 206 PRO C CD  1 
ATOM   4369 N N   . ALA C 3 207 ? -71.166  -30.024 -45.136  1.00 99.52  ? 207 ALA C N   1 
ATOM   4370 C CA  . ALA C 3 207 ? -69.878  -30.695 -45.057  1.00 99.79  ? 207 ALA C CA  1 
ATOM   4371 C C   . ALA C 3 207 ? -69.958  -32.128 -44.494  1.00 99.86  ? 207 ALA C C   1 
ATOM   4372 O O   . ALA C 3 207 ? -68.919  -32.772 -44.309  1.00 99.74  ? 207 ALA C O   1 
ATOM   4373 C CB  . ALA C 3 207 ? -68.886  -29.829 -44.267  1.00 99.70  ? 207 ALA C CB  1 
ATOM   4374 N N   . SER C 3 208 ? -71.189  -32.610 -44.246  1.00 100.15 ? 208 SER C N   1 
ATOM   4375 C CA  . SER C 3 208 ? -71.465  -34.006 -43.819  1.00 100.40 ? 208 SER C CA  1 
ATOM   4376 C C   . SER C 3 208 ? -72.748  -34.645 -44.384  1.00 100.53 ? 208 SER C C   1 
ATOM   4377 O O   . SER C 3 208 ? -72.993  -35.826 -44.165  1.00 100.31 ? 208 SER C O   1 
ATOM   4378 C CB  . SER C 3 208 ? -71.461  -34.138 -42.281  1.00 100.38 ? 208 SER C CB  1 
ATOM   4379 O OG  . SER C 3 208 ? -72.657  -33.674 -41.676  1.00 100.26 ? 208 SER C OG  1 
ATOM   4380 N N   . SER C 3 209 ? -73.550  -33.871 -45.110  1.00 101.12 ? 209 SER C N   1 
ATOM   4381 C CA  . SER C 3 209 ? -74.914  -34.269 -45.485  1.00 101.90 ? 209 SER C CA  1 
ATOM   4382 C C   . SER C 3 209 ? -75.732  -34.623 -44.245  1.00 102.73 ? 209 SER C C   1 
ATOM   4383 O O   . SER C 3 209 ? -75.660  -35.750 -43.743  1.00 103.22 ? 209 SER C O   1 
ATOM   4384 C CB  . SER C 3 209 ? -74.905  -35.436 -46.458  1.00 101.45 ? 209 SER C CB  1 
ATOM   4385 O OG  . SER C 3 209 ? -73.827  -35.289 -47.342  1.00 101.51 ? 209 SER C OG  1 
ATOM   4386 N N   . THR C 3 210 ? -76.491  -33.648 -43.746  1.00 103.31 ? 210 THR C N   1 
ATOM   4387 C CA  . THR C 3 210 ? -77.314  -33.817 -42.558  1.00 103.76 ? 210 THR C CA  1 
ATOM   4388 C C   . THR C 3 210 ? -78.511  -32.875 -42.669  1.00 104.46 ? 210 THR C C   1 
ATOM   4389 O O   . THR C 3 210 ? -78.354  -31.650 -42.645  1.00 104.83 ? 210 THR C O   1 
ATOM   4390 C CB  . THR C 3 210 ? -76.512  -33.484 -41.287  1.00 103.68 ? 210 THR C CB  1 
ATOM   4391 O OG1 . THR C 3 210 ? -75.219  -34.096 -41.356  1.00 103.11 ? 210 THR C OG1 1 
ATOM   4392 C CG2 . THR C 3 210 ? -77.230  -33.965 -40.041  1.00 103.94 ? 210 THR C CG2 1 
ATOM   4393 N N   . LYS C 3 211 ? -79.705  -33.438 -42.819  1.00 104.98 ? 211 LYS C N   1 
ATOM   4394 C CA  . LYS C 3 211 ? -80.917  -32.621 -42.881  1.00 105.43 ? 211 LYS C CA  1 
ATOM   4395 C C   . LYS C 3 211 ? -81.785  -32.834 -41.636  1.00 105.57 ? 211 LYS C C   1 
ATOM   4396 O O   . LYS C 3 211 ? -82.949  -33.256 -41.733  1.00 105.81 ? 211 LYS C O   1 
ATOM   4397 C CB  . LYS C 3 211 ? -81.709  -32.885 -44.171  1.00 105.50 ? 211 LYS C CB  1 
ATOM   4398 C CG  . LYS C 3 211 ? -81.260  -32.058 -45.387  1.00 105.96 ? 211 LYS C CG  1 
ATOM   4399 C CD  . LYS C 3 211 ? -82.284  -32.140 -46.541  1.00 106.79 ? 211 LYS C CD  1 
ATOM   4400 C CE  . LYS C 3 211 ? -82.314  -33.534 -47.197  1.00 106.82 ? 211 LYS C CE  1 
ATOM   4401 N NZ  . LYS C 3 211 ? -83.703  -34.020 -47.453  1.00 106.61 ? 211 LYS C NZ  1 
ATOM   4402 N N   . VAL C 3 212 ? -81.209  -32.529 -40.474  1.00 105.46 ? 212 VAL C N   1 
ATOM   4403 C CA  . VAL C 3 212 ? -81.891  -32.700 -39.196  1.00 105.63 ? 212 VAL C CA  1 
ATOM   4404 C C   . VAL C 3 212 ? -83.009  -31.675 -38.990  1.00 105.65 ? 212 VAL C C   1 
ATOM   4405 O O   . VAL C 3 212 ? -82.777  -30.470 -39.051  1.00 105.43 ? 212 VAL C O   1 
ATOM   4406 C CB  . VAL C 3 212 ? -80.896  -32.636 -38.014  1.00 105.82 ? 212 VAL C CB  1 
ATOM   4407 C CG1 . VAL C 3 212 ? -81.631  -32.736 -36.696  1.00 105.76 ? 212 VAL C CG1 1 
ATOM   4408 C CG2 . VAL C 3 212 ? -79.855  -33.752 -38.115  1.00 106.08 ? 212 VAL C CG2 1 
ATOM   4409 N N   . ASP C 3 213 ? -84.217  -32.181 -38.756  1.00 105.98 ? 213 ASP C N   1 
ATOM   4410 C CA  . ASP C 3 213 ? -85.395  -31.364 -38.462  1.00 106.44 ? 213 ASP C CA  1 
ATOM   4411 C C   . ASP C 3 213 ? -85.768  -31.526 -37.006  1.00 106.65 ? 213 ASP C C   1 
ATOM   4412 O O   . ASP C 3 213 ? -85.864  -32.654 -36.520  1.00 107.08 ? 213 ASP C O   1 
ATOM   4413 C CB  . ASP C 3 213 ? -86.591  -31.837 -39.291  1.00 106.57 ? 213 ASP C CB  1 
ATOM   4414 C CG  . ASP C 3 213 ? -86.772  -31.057 -40.570  1.00 106.92 ? 213 ASP C CG  1 
ATOM   4415 O OD1 . ASP C 3 213 ? -85.776  -30.522 -41.106  1.00 107.97 ? 213 ASP C OD1 1 
ATOM   4416 O OD2 . ASP C 3 213 ? -87.922  -30.996 -41.049  1.00 106.85 ? 213 ASP C OD2 1 
ATOM   4417 N N   . LYS C 3 214 ? -86.008  -30.414 -36.318  1.00 106.70 ? 214 LYS C N   1 
ATOM   4418 C CA  . LYS C 3 214 ? -86.405  -30.440 -34.914  1.00 106.84 ? 214 LYS C CA  1 
ATOM   4419 C C   . LYS C 3 214 ? -87.603  -29.548 -34.705  1.00 107.32 ? 214 LYS C C   1 
ATOM   4420 O O   . LYS C 3 214 ? -87.488  -28.334 -34.838  1.00 107.58 ? 214 LYS C O   1 
ATOM   4421 C CB  . LYS C 3 214 ? -85.250  -29.964 -34.029  1.00 106.70 ? 214 LYS C CB  1 
ATOM   4422 C CG  . LYS C 3 214 ? -84.576  -31.054 -33.215  1.00 106.38 ? 214 LYS C CG  1 
ATOM   4423 C CD  . LYS C 3 214 ? -84.194  -32.250 -34.061  1.00 105.67 ? 214 LYS C CD  1 
ATOM   4424 C CE  . LYS C 3 214 ? -84.532  -33.567 -33.382  1.00 105.11 ? 214 LYS C CE  1 
ATOM   4425 N NZ  . LYS C 3 214 ? -83.353  -34.122 -32.670  1.00 105.29 ? 214 LYS C NZ  1 
ATOM   4426 N N   . LYS C 3 215 ? -88.755  -30.141 -34.398  1.00 108.01 ? 215 LYS C N   1 
ATOM   4427 C CA  . LYS C 3 215 ? -89.974  -29.358 -34.111  1.00 108.59 ? 215 LYS C CA  1 
ATOM   4428 C C   . LYS C 3 215 ? -89.991  -28.930 -32.642  1.00 109.27 ? 215 LYS C C   1 
ATOM   4429 O O   . LYS C 3 215 ? -89.745  -29.756 -31.760  1.00 109.64 ? 215 LYS C O   1 
ATOM   4430 C CB  . LYS C 3 215 ? -91.241  -30.152 -34.453  1.00 108.25 ? 215 LYS C CB  1 
ATOM   4431 C CG  . LYS C 3 215 ? -92.511  -29.321 -34.410  1.00 107.08 ? 215 LYS C CG  1 
ATOM   4432 C CD  . LYS C 3 215 ? -93.784  -30.167 -34.362  1.00 105.46 ? 215 LYS C CD  1 
ATOM   4433 C CE  . LYS C 3 215 ? -95.026  -29.300 -34.599  1.00 104.24 ? 215 LYS C CE  1 
ATOM   4434 N NZ  . LYS C 3 215 ? -96.203  -29.661 -33.762  1.00 102.35 ? 215 LYS C NZ  1 
ATOM   4435 N N   . ILE C 3 216 ? -90.265  -27.650 -32.377  1.00 109.97 ? 216 ILE C N   1 
ATOM   4436 C CA  . ILE C 3 216 ? -90.234  -27.137 -31.000  1.00 110.58 ? 216 ILE C CA  1 
ATOM   4437 C C   . ILE C 3 216 ? -91.530  -27.444 -30.275  1.00 111.19 ? 216 ILE C C   1 
ATOM   4438 O O   . ILE C 3 216 ? -92.576  -26.844 -30.547  1.00 111.09 ? 216 ILE C O   1 
ATOM   4439 C CB  . ILE C 3 216 ? -89.893  -25.626 -30.899  1.00 110.52 ? 216 ILE C CB  1 
ATOM   4440 C CG1 . ILE C 3 216 ? -88.421  -25.392 -31.224  1.00 110.36 ? 216 ILE C CG1 1 
ATOM   4441 C CG2 . ILE C 3 216 ? -90.180  -25.091 -29.492  1.00 110.34 ? 216 ILE C CG2 1 
ATOM   4442 C CD1 . ILE C 3 216 ? -88.155  -25.208 -32.685  1.00 110.86 ? 216 ILE C CD1 1 
ATOM   4443 N N   . GLU C 3 217 ? -91.426  -28.402 -29.356  1.00 112.02 ? 217 GLU C N   1 
ATOM   4444 C CA  . GLU C 3 217 ? -92.532  -28.854 -28.536  1.00 112.76 ? 217 GLU C CA  1 
ATOM   4445 C C   . GLU C 3 217 ? -92.511  -28.143 -27.202  1.00 113.64 ? 217 GLU C C   1 
ATOM   4446 O O   . GLU C 3 217 ? -91.436  -27.857 -26.685  1.00 113.83 ? 217 GLU C O   1 
ATOM   4447 C CB  . GLU C 3 217 ? -92.434  -30.358 -28.299  1.00 112.48 ? 217 GLU C CB  1 
ATOM   4448 C CG  . GLU C 3 217 ? -92.778  -31.188 -29.514  1.00 112.18 ? 217 GLU C CG  1 
ATOM   4449 C CD  . GLU C 3 217 ? -94.097  -30.780 -30.144  1.00 111.93 ? 217 GLU C CD  1 
ATOM   4450 O OE1 . GLU C 3 217 ? -95.065  -30.503 -29.402  1.00 112.29 ? 217 GLU C OE1 1 
ATOM   4451 O OE2 . GLU C 3 217 ? -94.168  -30.739 -31.387  1.00 111.75 ? 217 GLU C OE2 1 
ATOM   4452 N N   . PRO C 3 218 ? -93.700  -27.837 -26.646  1.00 114.47 ? 218 PRO C N   1 
ATOM   4453 C CA  . PRO C 3 218 ? -93.803  -27.429 -25.247  1.00 115.15 ? 218 PRO C CA  1 
ATOM   4454 C C   . PRO C 3 218 ? -93.269  -28.517 -24.304  1.00 115.98 ? 218 PRO C C   1 
ATOM   4455 O O   . PRO C 3 218 ? -92.472  -29.360 -24.721  1.00 115.97 ? 218 PRO C O   1 
ATOM   4456 C CB  . PRO C 3 218 ? -95.305  -27.220 -25.066  1.00 115.22 ? 218 PRO C CB  1 
ATOM   4457 C CG  . PRO C 3 218 ? -95.777  -26.802 -26.422  1.00 114.80 ? 218 PRO C CG  1 
ATOM   4458 C CD  . PRO C 3 218 ? -94.972  -27.636 -27.369  1.00 114.46 ? 218 PRO C CD  1 
ATOM   4459 N N   . ARG C 3 219 ? -93.686  -28.512 -23.043  1.00 117.11 ? 219 ARG C N   1 
ATOM   4460 C CA  . ARG C 3 219 ? -93.047  -29.404 -22.077  1.00 118.50 ? 219 ARG C CA  1 
ATOM   4461 C C   . ARG C 3 219 ? -93.999  -30.187 -21.179  1.00 118.80 ? 219 ARG C C   1 
ATOM   4462 O O   . ARG C 3 219 ? -94.319  -29.753 -20.070  1.00 118.86 ? 219 ARG C O   1 
ATOM   4463 C CB  . ARG C 3 219 ? -92.021  -28.635 -21.242  1.00 118.94 ? 219 ARG C CB  1 
ATOM   4464 C CG  . ARG C 3 219 ? -91.020  -27.827 -22.074  1.00 120.97 ? 219 ARG C CG  1 
ATOM   4465 C CD  . ARG C 3 219 ? -91.441  -26.351 -22.276  1.00 124.23 ? 219 ARG C CD  1 
ATOM   4466 N NE  . ARG C 3 219 ? -92.882  -26.131 -22.456  1.00 126.04 ? 219 ARG C NE  1 
ATOM   4467 C CZ  . ARG C 3 219 ? -93.450  -24.938 -22.637  1.00 127.46 ? 219 ARG C CZ  1 
ATOM   4468 N NH1 . ARG C 3 219 ? -92.703  -23.838 -22.672  1.00 128.04 ? 219 ARG C NH1 1 
ATOM   4469 N NH2 . ARG C 3 219 ? -94.769  -24.839 -22.780  1.00 127.74 ? 219 ARG C NH2 1 
ATOM   4470 N N   . GLY C 3 220 ? -94.435  -31.344 -21.681  1.00 119.37 ? 220 GLY C N   1 
ATOM   4471 C CA  . GLY C 3 220 ? -95.226  -32.315 -20.920  1.00 119.99 ? 220 GLY C CA  1 
ATOM   4472 C C   . GLY C 3 220 ? -94.339  -33.217 -20.062  1.00 120.46 ? 220 GLY C C   1 
ATOM   4473 O O   . GLY C 3 220 ? -93.119  -33.306 -20.292  1.00 120.42 ? 220 GLY C O   1 
ATOM   4474 N N   . PRO C 3 221 ? -94.936  -33.882 -19.051  1.00 120.63 ? 221 PRO C N   1 
ATOM   4475 C CA  . PRO C 3 221 ? -94.148  -34.726 -18.158  1.00 120.67 ? 221 PRO C CA  1 
ATOM   4476 C C   . PRO C 3 221 ? -94.282  -36.218 -18.479  1.00 120.76 ? 221 PRO C C   1 
ATOM   4477 O O   . PRO C 3 221 ? -93.935  -36.653 -19.581  1.00 120.83 ? 221 PRO C O   1 
ATOM   4478 C CB  . PRO C 3 221 ? -94.744  -34.411 -16.777  1.00 120.69 ? 221 PRO C CB  1 
ATOM   4479 C CG  . PRO C 3 221 ? -96.135  -33.800 -17.053  1.00 120.58 ? 221 PRO C CG  1 
ATOM   4480 C CD  . PRO C 3 221 ? -96.314  -33.716 -18.551  1.00 120.61 ? 221 PRO C CD  1 
ATOM   4481 N N   . GLN D 1 10  ? -125.985 -35.080 -152.385 1.00 132.02 ? 10  GLN D N   1 
ATOM   4482 C CA  . GLN D 1 10  ? -125.635 -33.689 -151.973 1.00 131.93 ? 10  GLN D CA  1 
ATOM   4483 C C   . GLN D 1 10  ? -126.759 -32.707 -152.334 1.00 131.97 ? 10  GLN D C   1 
ATOM   4484 O O   . GLN D 1 10  ? -126.524 -31.580 -152.793 1.00 131.83 ? 10  GLN D O   1 
ATOM   4485 C CB  . GLN D 1 10  ? -124.288 -33.256 -152.571 1.00 131.84 ? 10  GLN D CB  1 
ATOM   4486 C CG  . GLN D 1 10  ? -123.066 -33.764 -151.807 1.00 131.36 ? 10  GLN D CG  1 
ATOM   4487 C CD  . GLN D 1 10  ? -122.123 -32.641 -151.409 1.00 130.96 ? 10  GLN D CD  1 
ATOM   4488 O OE1 . GLN D 1 10  ? -122.507 -31.471 -151.403 1.00 130.90 ? 10  GLN D OE1 1 
ATOM   4489 N NE2 . GLN D 1 10  ? -120.889 -32.992 -151.058 1.00 130.48 ? 10  GLN D NE2 1 
ATOM   4490 N N   . GLY D 1 11  ? -127.987 -33.158 -152.107 1.00 131.97 ? 11  GLY D N   1 
ATOM   4491 C CA  . GLY D 1 11  ? -129.177 -32.371 -152.374 1.00 131.99 ? 11  GLY D CA  1 
ATOM   4492 C C   . GLY D 1 11  ? -130.371 -33.189 -151.948 1.00 132.09 ? 11  GLY D C   1 
ATOM   4493 O O   . GLY D 1 11  ? -130.219 -34.357 -151.586 1.00 131.75 ? 11  GLY D O   1 
ATOM   4494 N N   . ARG D 1 12  ? -131.549 -32.567 -152.024 1.00 132.47 ? 12  ARG D N   1 
ATOM   4495 C CA  . ARG D 1 12  ? -132.846 -33.095 -151.528 1.00 132.93 ? 12  ARG D CA  1 
ATOM   4496 C C   . ARG D 1 12  ? -132.854 -34.396 -150.696 1.00 133.19 ? 12  ARG D C   1 
ATOM   4497 O O   . ARG D 1 12  ? -133.249 -34.381 -149.526 1.00 133.41 ? 12  ARG D O   1 
ATOM   4498 C CB  . ARG D 1 12  ? -133.885 -33.187 -152.658 1.00 132.94 ? 12  ARG D CB  1 
ATOM   4499 C CG  . ARG D 1 12  ? -134.394 -31.846 -153.206 1.00 132.89 ? 12  ARG D CG  1 
ATOM   4500 C CD  . ARG D 1 12  ? -135.775 -32.002 -153.863 1.00 132.75 ? 12  ARG D CD  1 
ATOM   4501 N NE  . ARG D 1 12  ? -136.059 -33.390 -154.244 1.00 131.78 ? 12  ARG D NE  1 
ATOM   4502 C CZ  . ARG D 1 12  ? -137.216 -33.827 -154.734 1.00 131.18 ? 12  ARG D CZ  1 
ATOM   4503 N NH1 . ARG D 1 12  ? -138.230 -32.996 -154.930 1.00 130.71 ? 12  ARG D NH1 1 
ATOM   4504 N NH2 . ARG D 1 12  ? -137.356 -35.108 -155.032 1.00 131.33 ? 12  ARG D NH2 1 
ATOM   4505 N N   . GLY D 1 13  ? -132.449 -35.512 -151.301 1.00 133.28 ? 13  GLY D N   1 
ATOM   4506 C CA  . GLY D 1 13  ? -132.406 -36.794 -150.602 1.00 133.22 ? 13  GLY D CA  1 
ATOM   4507 C C   . GLY D 1 13  ? -131.373 -36.851 -149.493 1.00 133.34 ? 13  GLY D C   1 
ATOM   4508 O O   . GLY D 1 13  ? -131.703 -37.183 -148.355 1.00 133.29 ? 13  GLY D O   1 
ATOM   4509 N N   . ALA D 1 14  ? -130.126 -36.513 -149.827 1.00 133.49 ? 14  ALA D N   1 
ATOM   4510 C CA  . ALA D 1 14  ? -129.017 -36.472 -148.863 1.00 133.57 ? 14  ALA D CA  1 
ATOM   4511 C C   . ALA D 1 14  ? -129.406 -35.734 -147.573 1.00 133.64 ? 14  ALA D C   1 
ATOM   4512 O O   . ALA D 1 14  ? -128.841 -35.976 -146.503 1.00 133.62 ? 14  ALA D O   1 
ATOM   4513 C CB  . ALA D 1 14  ? -127.773 -35.835 -149.508 1.00 133.46 ? 14  ALA D CB  1 
ATOM   4514 N N   . TRP D 1 15  ? -130.390 -34.845 -147.698 1.00 133.74 ? 15  TRP D N   1 
ATOM   4515 C CA  . TRP D 1 15  ? -130.916 -34.079 -146.581 1.00 133.78 ? 15  TRP D CA  1 
ATOM   4516 C C   . TRP D 1 15  ? -132.244 -34.643 -146.068 1.00 133.98 ? 15  TRP D C   1 
ATOM   4517 O O   . TRP D 1 15  ? -132.440 -34.721 -144.859 1.00 134.00 ? 15  TRP D O   1 
ATOM   4518 C CB  . TRP D 1 15  ? -131.083 -32.609 -146.977 1.00 133.68 ? 15  TRP D CB  1 
ATOM   4519 C CG  . TRP D 1 15  ? -129.797 -31.860 -147.170 1.00 132.95 ? 15  TRP D CG  1 
ATOM   4520 C CD1 . TRP D 1 15  ? -129.128 -31.674 -148.343 1.00 132.89 ? 15  TRP D CD1 1 
ATOM   4521 C CD2 . TRP D 1 15  ? -129.039 -31.179 -146.164 1.00 132.31 ? 15  TRP D CD2 1 
ATOM   4522 N NE1 . TRP D 1 15  ? -127.991 -30.928 -148.131 1.00 132.51 ? 15  TRP D NE1 1 
ATOM   4523 C CE2 . TRP D 1 15  ? -127.913 -30.608 -146.802 1.00 132.22 ? 15  TRP D CE2 1 
ATOM   4524 C CE3 . TRP D 1 15  ? -129.195 -31.003 -144.784 1.00 132.26 ? 15  TRP D CE3 1 
ATOM   4525 C CZ2 . TRP D 1 15  ? -126.945 -29.870 -146.108 1.00 131.95 ? 15  TRP D CZ2 1 
ATOM   4526 C CZ3 . TRP D 1 15  ? -128.234 -30.266 -144.093 1.00 132.69 ? 15  TRP D CZ3 1 
ATOM   4527 C CH2 . TRP D 1 15  ? -127.121 -29.708 -144.761 1.00 132.21 ? 15  TRP D CH2 1 
ATOM   4528 N N   . LEU D 1 16  ? -133.142 -35.024 -146.981 1.00 134.22 ? 16  LEU D N   1 
ATOM   4529 C CA  . LEU D 1 16  ? -134.458 -35.600 -146.630 1.00 134.61 ? 16  LEU D CA  1 
ATOM   4530 C C   . LEU D 1 16  ? -134.382 -36.986 -145.975 1.00 134.99 ? 16  LEU D C   1 
ATOM   4531 O O   . LEU D 1 16  ? -135.297 -37.397 -145.249 1.00 134.81 ? 16  LEU D O   1 
ATOM   4532 C CB  . LEU D 1 16  ? -135.370 -35.660 -147.860 1.00 134.48 ? 16  LEU D CB  1 
ATOM   4533 C CG  . LEU D 1 16  ? -136.522 -34.661 -147.950 1.00 134.20 ? 16  LEU D CG  1 
ATOM   4534 C CD1 . LEU D 1 16  ? -136.682 -34.170 -149.375 1.00 133.83 ? 16  LEU D CD1 1 
ATOM   4535 C CD2 . LEU D 1 16  ? -137.822 -35.273 -147.426 1.00 133.41 ? 16  LEU D CD2 1 
ATOM   4536 N N   . LEU D 1 17  ? -133.296 -37.702 -146.265 1.00 135.55 ? 17  LEU D N   1 
ATOM   4537 C CA  . LEU D 1 17  ? -132.947 -38.944 -145.596 1.00 136.10 ? 17  LEU D CA  1 
ATOM   4538 C C   . LEU D 1 17  ? -132.795 -38.611 -144.124 1.00 136.56 ? 17  LEU D C   1 
ATOM   4539 O O   . LEU D 1 17  ? -133.324 -39.308 -143.261 1.00 136.52 ? 17  LEU D O   1 
ATOM   4540 C CB  . LEU D 1 17  ? -131.619 -39.462 -146.158 1.00 136.08 ? 17  LEU D CB  1 
ATOM   4541 C CG  . LEU D 1 17  ? -131.146 -40.905 -145.973 1.00 136.15 ? 17  LEU D CG  1 
ATOM   4542 C CD1 . LEU D 1 17  ? -131.885 -41.858 -146.907 1.00 136.00 ? 17  LEU D CD1 1 
ATOM   4543 C CD2 . LEU D 1 17  ? -129.638 -40.997 -146.198 1.00 135.88 ? 17  LEU D CD2 1 
ATOM   4544 N N   . MET D 1 18  ? -132.088 -37.511 -143.869 1.00 137.30 ? 18  MET D N   1 
ATOM   4545 C CA  . MET D 1 18  ? -131.828 -37.001 -142.526 1.00 138.15 ? 18  MET D CA  1 
ATOM   4546 C C   . MET D 1 18  ? -133.080 -36.499 -141.807 1.00 138.60 ? 18  MET D C   1 
ATOM   4547 O O   . MET D 1 18  ? -133.539 -37.144 -140.870 1.00 138.64 ? 18  MET D O   1 
ATOM   4548 C CB  . MET D 1 18  ? -130.738 -35.926 -142.566 1.00 138.19 ? 18  MET D CB  1 
ATOM   4549 C CG  . MET D 1 18  ? -129.332 -36.486 -142.530 1.00 138.89 ? 18  MET D CG  1 
ATOM   4550 S SD  . MET D 1 18  ? -129.125 -38.065 -143.391 1.00 140.58 ? 18  MET D SD  1 
ATOM   4551 C CE  . MET D 1 18  ? -127.952 -38.874 -142.288 1.00 140.16 ? 18  MET D CE  1 
ATOM   4552 N N   . ALA D 1 19  ? -133.634 -35.367 -142.244 1.00 139.26 ? 19  ALA D N   1 
ATOM   4553 C CA  . ALA D 1 19  ? -134.855 -34.807 -141.650 1.00 139.85 ? 19  ALA D CA  1 
ATOM   4554 C C   . ALA D 1 19  ? -135.846 -35.904 -141.287 1.00 140.42 ? 19  ALA D C   1 
ATOM   4555 O O   . ALA D 1 19  ? -136.577 -35.791 -140.298 1.00 140.53 ? 19  ALA D O   1 
ATOM   4556 C CB  . ALA D 1 19  ? -135.500 -33.812 -142.593 1.00 139.82 ? 19  ALA D CB  1 
ATOM   4557 N N   . PHE D 1 20  ? -135.850 -36.964 -142.095 1.00 141.21 ? 20  PHE D N   1 
ATOM   4558 C CA  . PHE D 1 20  ? -136.674 -38.142 -141.846 1.00 141.99 ? 20  PHE D CA  1 
ATOM   4559 C C   . PHE D 1 20  ? -136.150 -39.029 -140.701 1.00 142.20 ? 20  PHE D C   1 
ATOM   4560 O O   . PHE D 1 20  ? -136.942 -39.483 -139.874 1.00 142.28 ? 20  PHE D O   1 
ATOM   4561 C CB  . PHE D 1 20  ? -136.863 -38.961 -143.133 1.00 142.15 ? 20  PHE D CB  1 
ATOM   4562 C CG  . PHE D 1 20  ? -137.560 -40.275 -142.915 1.00 142.89 ? 20  PHE D CG  1 
ATOM   4563 C CD1 . PHE D 1 20  ? -138.948 -40.322 -142.750 1.00 143.30 ? 20  PHE D CD1 1 
ATOM   4564 C CD2 . PHE D 1 20  ? -136.825 -41.468 -142.856 1.00 143.15 ? 20  PHE D CD2 1 
ATOM   4565 C CE1 . PHE D 1 20  ? -139.597 -41.540 -142.533 1.00 143.56 ? 20  PHE D CE1 1 
ATOM   4566 C CE2 . PHE D 1 20  ? -137.460 -42.694 -142.639 1.00 143.05 ? 20  PHE D CE2 1 
ATOM   4567 C CZ  . PHE D 1 20  ? -138.848 -42.731 -142.478 1.00 143.53 ? 20  PHE D CZ  1 
ATOM   4568 N N   . THR D 1 21  ? -134.839 -39.280 -140.658 1.00 142.48 ? 21  THR D N   1 
ATOM   4569 C CA  . THR D 1 21  ? -134.265 -40.159 -139.628 1.00 142.84 ? 21  THR D CA  1 
ATOM   4570 C C   . THR D 1 21  ? -134.412 -39.639 -138.195 1.00 143.18 ? 21  THR D C   1 
ATOM   4571 O O   . THR D 1 21  ? -134.571 -40.430 -137.262 1.00 143.28 ? 21  THR D O   1 
ATOM   4572 C CB  . THR D 1 21  ? -132.783 -40.572 -139.899 1.00 142.81 ? 21  THR D CB  1 
ATOM   4573 O OG1 . THR D 1 21  ? -132.227 -41.153 -138.715 1.00 143.01 ? 21  THR D OG1 1 
ATOM   4574 C CG2 . THR D 1 21  ? -131.922 -39.397 -140.274 1.00 142.70 ? 21  THR D CG2 1 
ATOM   4575 N N   . ALA D 1 22  ? -134.358 -38.317 -138.028 1.00 143.50 ? 22  ALA D N   1 
ATOM   4576 C CA  . ALA D 1 22  ? -134.529 -37.694 -136.715 1.00 143.81 ? 22  ALA D CA  1 
ATOM   4577 C C   . ALA D 1 22  ? -135.996 -37.688 -136.271 1.00 144.16 ? 22  ALA D C   1 
ATOM   4578 O O   . ALA D 1 22  ? -136.286 -37.776 -135.076 1.00 144.13 ? 22  ALA D O   1 
ATOM   4579 C CB  . ALA D 1 22  ? -133.944 -36.291 -136.699 1.00 143.67 ? 22  ALA D CB  1 
ATOM   4580 N N   . LEU D 1 23  ? -136.918 -37.585 -137.229 1.00 144.66 ? 23  LEU D N   1 
ATOM   4581 C CA  . LEU D 1 23  ? -138.340 -37.795 -136.935 1.00 145.24 ? 23  LEU D CA  1 
ATOM   4582 C C   . LEU D 1 23  ? -138.669 -39.273 -136.745 1.00 145.49 ? 23  LEU D C   1 
ATOM   4583 O O   . LEU D 1 23  ? -139.623 -39.612 -136.045 1.00 145.38 ? 23  LEU D O   1 
ATOM   4584 C CB  . LEU D 1 23  ? -139.252 -37.169 -137.999 1.00 145.34 ? 23  LEU D CB  1 
ATOM   4585 C CG  . LEU D 1 23  ? -140.074 -35.942 -137.567 1.00 145.82 ? 23  LEU D CG  1 
ATOM   4586 C CD1 . LEU D 1 23  ? -140.914 -35.423 -138.723 1.00 146.16 ? 23  LEU D CD1 1 
ATOM   4587 C CD2 . LEU D 1 23  ? -140.974 -36.226 -136.358 1.00 145.94 ? 23  LEU D CD2 1 
ATOM   4588 N N   . ALA D 1 24  ? -137.875 -40.138 -137.381 1.00 145.99 ? 24  ALA D N   1 
ATOM   4589 C CA  . ALA D 1 24  ? -137.903 -41.579 -137.126 1.00 146.39 ? 24  ALA D CA  1 
ATOM   4590 C C   . ALA D 1 24  ? -137.385 -41.851 -135.716 1.00 146.72 ? 24  ALA D C   1 
ATOM   4591 O O   . ALA D 1 24  ? -137.729 -42.862 -135.103 1.00 146.91 ? 24  ALA D O   1 
ATOM   4592 C CB  . ALA D 1 24  ? -137.073 -42.335 -138.167 1.00 146.16 ? 24  ALA D CB  1 
ATOM   4593 N N   . LEU D 1 25  ? -136.562 -40.933 -135.212 1.00 147.08 ? 25  LEU D N   1 
ATOM   4594 C CA  . LEU D 1 25  ? -136.063 -40.982 -133.843 1.00 147.47 ? 25  LEU D CA  1 
ATOM   4595 C C   . LEU D 1 25  ? -137.066 -40.400 -132.847 1.00 147.76 ? 25  LEU D C   1 
ATOM   4596 O O   . LEU D 1 25  ? -137.265 -40.955 -131.767 1.00 147.77 ? 25  LEU D O   1 
ATOM   4597 C CB  . LEU D 1 25  ? -134.738 -40.226 -133.735 1.00 147.49 ? 25  LEU D CB  1 
ATOM   4598 C CG  . LEU D 1 25  ? -133.439 -40.928 -134.133 1.00 147.52 ? 25  LEU D CG  1 
ATOM   4599 C CD1 . LEU D 1 25  ? -132.427 -39.908 -134.632 1.00 147.62 ? 25  LEU D CD1 1 
ATOM   4600 C CD2 . LEU D 1 25  ? -132.870 -41.729 -132.965 1.00 147.37 ? 25  LEU D CD2 1 
ATOM   4601 N N   . GLU D 1 26  ? -137.691 -39.283 -133.206 1.00 148.17 ? 26  GLU D N   1 
ATOM   4602 C CA  . GLU D 1 26  ? -138.661 -38.644 -132.322 1.00 148.60 ? 26  GLU D CA  1 
ATOM   4603 C C   . GLU D 1 26  ? -140.036 -39.301 -132.397 1.00 149.21 ? 26  GLU D C   1 
ATOM   4604 O O   . GLU D 1 26  ? -140.939 -38.956 -131.629 1.00 149.17 ? 26  GLU D O   1 
ATOM   4605 C CB  . GLU D 1 26  ? -138.731 -37.146 -132.590 1.00 148.46 ? 26  GLU D CB  1 
ATOM   4606 C CG  . GLU D 1 26  ? -137.402 -36.457 -132.345 1.00 147.98 ? 26  GLU D CG  1 
ATOM   4607 C CD  . GLU D 1 26  ? -137.541 -34.994 -132.014 1.00 147.42 ? 26  GLU D CD  1 
ATOM   4608 O OE1 . GLU D 1 26  ? -138.063 -34.235 -132.853 1.00 147.59 ? 26  GLU D OE1 1 
ATOM   4609 O OE2 . GLU D 1 26  ? -137.111 -34.600 -130.915 1.00 146.64 ? 26  GLU D OE2 1 
ATOM   4610 N N   . LEU D 1 27  ? -140.173 -40.244 -133.333 1.00 150.02 ? 27  LEU D N   1 
ATOM   4611 C CA  . LEU D 1 27  ? -141.291 -41.190 -133.376 1.00 150.78 ? 27  LEU D CA  1 
ATOM   4612 C C   . LEU D 1 27  ? -141.072 -42.286 -132.340 1.00 151.35 ? 27  LEU D C   1 
ATOM   4613 O O   . LEU D 1 27  ? -141.955 -42.569 -131.529 1.00 151.32 ? 27  LEU D O   1 
ATOM   4614 C CB  . LEU D 1 27  ? -141.428 -41.817 -134.770 1.00 150.67 ? 27  LEU D CB  1 
ATOM   4615 C CG  . LEU D 1 27  ? -142.563 -41.359 -135.690 1.00 150.73 ? 27  LEU D CG  1 
ATOM   4616 C CD1 . LEU D 1 27  ? -142.164 -41.508 -137.150 1.00 150.86 ? 27  LEU D CD1 1 
ATOM   4617 C CD2 . LEU D 1 27  ? -143.850 -42.136 -135.408 1.00 150.61 ? 27  LEU D CD2 1 
ATOM   4618 N N   . THR D 1 28  ? -139.884 -42.895 -132.383 1.00 152.24 ? 28  THR D N   1 
ATOM   4619 C CA  . THR D 1 28  ? -139.438 -43.880 -131.385 1.00 153.04 ? 28  THR D CA  1 
ATOM   4620 C C   . THR D 1 28  ? -139.488 -43.280 -129.971 1.00 153.67 ? 28  THR D C   1 
ATOM   4621 O O   . THR D 1 28  ? -139.653 -44.005 -128.984 1.00 153.74 ? 28  THR D O   1 
ATOM   4622 C CB  . THR D 1 28  ? -137.988 -44.388 -131.674 1.00 152.94 ? 28  THR D CB  1 
ATOM   4623 O OG1 . THR D 1 28  ? -137.787 -44.544 -133.086 1.00 152.74 ? 28  THR D OG1 1 
ATOM   4624 C CG2 . THR D 1 28  ? -137.723 -45.722 -130.980 1.00 152.83 ? 28  THR D CG2 1 
ATOM   4625 N N   . ALA D 1 29  ? -139.344 -41.955 -129.895 1.00 154.42 ? 29  ALA D N   1 
ATOM   4626 C CA  . ALA D 1 29  ? -139.422 -41.210 -128.639 1.00 155.07 ? 29  ALA D CA  1 
ATOM   4627 C C   . ALA D 1 29  ? -140.861 -41.107 -128.130 1.00 155.54 ? 29  ALA D C   1 
ATOM   4628 O O   . ALA D 1 29  ? -141.166 -41.572 -127.026 1.00 155.65 ? 29  ALA D O   1 
ATOM   4629 C CB  . ALA D 1 29  ? -138.810 -39.825 -128.806 1.00 155.01 ? 29  ALA D CB  1 
ATOM   4630 N N   . LEU D 1 30  ? -141.739 -40.508 -128.937 1.00 156.08 ? 30  LEU D N   1 
ATOM   4631 C CA  . LEU D 1 30  ? -143.161 -40.373 -128.593 1.00 156.54 ? 30  LEU D CA  1 
ATOM   4632 C C   . LEU D 1 30  ? -143.847 -41.723 -128.337 1.00 157.03 ? 30  LEU D C   1 
ATOM   4633 O O   . LEU D 1 30  ? -144.857 -41.787 -127.627 1.00 157.02 ? 30  LEU D O   1 
ATOM   4634 C CB  . LEU D 1 30  ? -143.901 -39.561 -129.662 1.00 156.31 ? 30  LEU D CB  1 
ATOM   4635 C CG  . LEU D 1 30  ? -143.976 -38.066 -129.352 1.00 155.87 ? 30  LEU D CG  1 
ATOM   4636 C CD1 . LEU D 1 30  ? -143.518 -37.232 -130.527 1.00 155.40 ? 30  LEU D CD1 1 
ATOM   4637 C CD2 . LEU D 1 30  ? -145.380 -37.679 -128.909 1.00 155.37 ? 30  LEU D CD2 1 
ATOM   4638 N N   . TRP D 1 31  ? -143.278 -42.788 -128.908 1.00 157.66 ? 31  TRP D N   1 
ATOM   4639 C CA  . TRP D 1 31  ? -143.742 -44.162 -128.686 1.00 158.29 ? 31  TRP D CA  1 
ATOM   4640 C C   . TRP D 1 31  ? -143.624 -44.525 -127.209 1.00 158.30 ? 31  TRP D C   1 
ATOM   4641 O O   . TRP D 1 31  ? -144.587 -45.002 -126.601 1.00 158.39 ? 31  TRP D O   1 
ATOM   4642 C CB  . TRP D 1 31  ? -142.944 -45.153 -129.553 1.00 158.55 ? 31  TRP D CB  1 
ATOM   4643 C CG  . TRP D 1 31  ? -143.591 -46.510 -129.689 1.00 159.84 ? 31  TRP D CG  1 
ATOM   4644 C CD1 . TRP D 1 31  ? -144.814 -46.782 -130.240 1.00 160.53 ? 31  TRP D CD1 1 
ATOM   4645 C CD2 . TRP D 1 31  ? -143.043 -47.778 -129.285 1.00 161.27 ? 31  TRP D CD2 1 
ATOM   4646 N NE1 . TRP D 1 31  ? -145.070 -48.134 -130.190 1.00 161.16 ? 31  TRP D NE1 1 
ATOM   4647 C CE2 . TRP D 1 31  ? -144.000 -48.771 -129.614 1.00 161.62 ? 31  TRP D CE2 1 
ATOM   4648 C CE3 . TRP D 1 31  ? -141.839 -48.174 -128.680 1.00 161.58 ? 31  TRP D CE3 1 
ATOM   4649 C CZ2 . TRP D 1 31  ? -143.792 -50.139 -129.352 1.00 161.66 ? 31  TRP D CZ2 1 
ATOM   4650 C CZ3 . TRP D 1 31  ? -141.631 -49.537 -128.422 1.00 161.63 ? 31  TRP D CZ3 1 
ATOM   4651 C CH2 . TRP D 1 31  ? -142.605 -50.499 -128.758 1.00 161.68 ? 31  TRP D CH2 1 
ATOM   4652 N N   . PHE D 1 32  ? -142.444 -44.270 -126.640 1.00 158.35 ? 32  PHE D N   1 
ATOM   4653 C CA  . PHE D 1 32  ? -142.168 -44.544 -125.228 1.00 158.30 ? 32  PHE D CA  1 
ATOM   4654 C C   . PHE D 1 32  ? -142.693 -43.454 -124.296 1.00 157.95 ? 32  PHE D C   1 
ATOM   4655 O O   . PHE D 1 32  ? -142.685 -43.622 -123.080 1.00 157.93 ? 32  PHE D O   1 
ATOM   4656 C CB  . PHE D 1 32  ? -140.670 -44.795 -124.997 1.00 158.48 ? 32  PHE D CB  1 
ATOM   4657 C CG  . PHE D 1 32  ? -140.195 -46.143 -125.488 1.00 159.33 ? 32  PHE D CG  1 
ATOM   4658 C CD1 . PHE D 1 32  ? -139.348 -46.240 -126.589 1.00 159.86 ? 32  PHE D CD1 1 
ATOM   4659 C CD2 . PHE D 1 32  ? -140.603 -47.319 -124.852 1.00 160.15 ? 32  PHE D CD2 1 
ATOM   4660 C CE1 . PHE D 1 32  ? -138.909 -47.491 -127.051 1.00 160.34 ? 32  PHE D CE1 1 
ATOM   4661 C CE2 . PHE D 1 32  ? -140.171 -48.573 -125.303 1.00 160.31 ? 32  PHE D CE2 1 
ATOM   4662 C CZ  . PHE D 1 32  ? -139.319 -48.657 -126.402 1.00 160.32 ? 32  PHE D CZ  1 
ATOM   4663 N N   . GLN D 1 33  ? -143.145 -42.342 -124.872 1.00 157.61 ? 33  GLN D N   1 
ATOM   4664 C CA  . GLN D 1 33  ? -143.859 -41.312 -124.119 1.00 157.27 ? 33  GLN D CA  1 
ATOM   4665 C C   . GLN D 1 33  ? -145.271 -41.795 -123.790 1.00 157.15 ? 33  GLN D C   1 
ATOM   4666 O O   . GLN D 1 33  ? -145.762 -41.568 -122.678 1.00 157.04 ? 33  GLN D O   1 
ATOM   4667 C CB  . GLN D 1 33  ? -143.912 -39.998 -124.912 1.00 157.23 ? 33  GLN D CB  1 
ATOM   4668 C CG  . GLN D 1 33  ? -144.642 -38.834 -124.215 1.00 157.03 ? 33  GLN D CG  1 
ATOM   4669 C CD  . GLN D 1 33  ? -144.759 -37.592 -125.094 1.00 156.86 ? 33  GLN D CD  1 
ATOM   4670 O OE1 . GLN D 1 33  ? -145.817 -36.964 -125.172 1.00 156.38 ? 33  GLN D OE1 1 
ATOM   4671 N NE2 . GLN D 1 33  ? -143.670 -37.236 -125.764 1.00 157.12 ? 33  GLN D NE2 1 
ATOM   4672 N N   . HIS D 1 34  ? -145.905 -42.474 -124.753 1.00 156.96 ? 34  HIS D N   1 
ATOM   4673 C CA  . HIS D 1 34  ? -147.317 -42.853 -124.638 1.00 156.77 ? 34  HIS D CA  1 
ATOM   4674 C C   . HIS D 1 34  ? -147.641 -44.346 -124.706 1.00 156.72 ? 34  HIS D C   1 
ATOM   4675 O O   . HIS D 1 34  ? -148.168 -44.901 -123.740 1.00 156.73 ? 34  HIS D O   1 
ATOM   4676 C CB  . HIS D 1 34  ? -148.177 -42.079 -125.644 1.00 156.63 ? 34  HIS D CB  1 
ATOM   4677 C CG  . HIS D 1 34  ? -148.553 -40.709 -125.178 1.00 156.39 ? 34  HIS D CG  1 
ATOM   4678 N ND1 . HIS D 1 34  ? -147.996 -39.565 -125.706 1.00 156.40 ? 34  HIS D ND1 1 
ATOM   4679 C CD2 . HIS D 1 34  ? -149.419 -40.298 -124.220 1.00 156.36 ? 34  HIS D CD2 1 
ATOM   4680 C CE1 . HIS D 1 34  ? -148.506 -38.508 -125.098 1.00 156.30 ? 34  HIS D CE1 1 
ATOM   4681 N NE2 . HIS D 1 34  ? -149.373 -38.926 -124.193 1.00 156.30 ? 34  HIS D NE2 1 
ATOM   4682 N N   . VAL D 1 35  ? -147.340 -44.987 -125.835 1.00 156.70 ? 35  VAL D N   1 
ATOM   4683 C CA  . VAL D 1 35  ? -147.852 -46.345 -126.110 1.00 156.71 ? 35  VAL D CA  1 
ATOM   4684 C C   . VAL D 1 35  ? -147.434 -47.396 -125.066 1.00 156.71 ? 35  VAL D C   1 
ATOM   4685 O O   . VAL D 1 35  ? -148.160 -48.371 -124.830 1.00 156.69 ? 35  VAL D O   1 
ATOM   4686 C CB  . VAL D 1 35  ? -147.498 -46.852 -127.549 1.00 156.75 ? 35  VAL D CB  1 
ATOM   4687 C CG1 . VAL D 1 35  ? -147.434 -45.693 -128.552 1.00 156.48 ? 35  VAL D CG1 1 
ATOM   4688 C CG2 . VAL D 1 35  ? -146.208 -47.663 -127.539 1.00 156.51 ? 35  VAL D CG2 1 
ATOM   4689 N N   . MET D 1 36  ? -146.265 -47.186 -124.457 1.00 156.61 ? 36  MET D N   1 
ATOM   4690 C CA  . MET D 1 36  ? -145.729 -48.078 -123.425 1.00 156.37 ? 36  MET D CA  1 
ATOM   4691 C C   . MET D 1 36  ? -146.112 -47.616 -122.011 1.00 156.10 ? 36  MET D C   1 
ATOM   4692 O O   . MET D 1 36  ? -146.605 -48.414 -121.200 1.00 156.12 ? 36  MET D O   1 
ATOM   4693 C CB  . MET D 1 36  ? -144.209 -48.209 -123.570 1.00 156.37 ? 36  MET D CB  1 
ATOM   4694 C CG  . MET D 1 36  ? -143.755 -49.236 -124.598 1.00 156.57 ? 36  MET D CG  1 
ATOM   4695 S SD  . MET D 1 36  ? -143.838 -50.935 -123.980 1.00 157.15 ? 36  MET D SD  1 
ATOM   4696 C CE  . MET D 1 36  ? -145.519 -51.420 -124.397 1.00 156.96 ? 36  MET D CE  1 
ATOM   4697 N N   . LEU D 1 37  ? -145.890 -46.324 -121.745 1.00 155.61 ? 37  LEU D N   1 
ATOM   4698 C CA  . LEU D 1 37  ? -146.250 -45.653 -120.484 1.00 155.01 ? 37  LEU D CA  1 
ATOM   4699 C C   . LEU D 1 37  ? -145.667 -46.347 -119.235 1.00 154.58 ? 37  LEU D C   1 
ATOM   4700 O O   . LEU D 1 37  ? -146.372 -47.142 -118.605 1.00 154.64 ? 37  LEU D O   1 
ATOM   4701 C CB  . LEU D 1 37  ? -147.784 -45.468 -120.379 1.00 155.02 ? 37  LEU D CB  1 
ATOM   4702 C CG  . LEU D 1 37  ? -148.376 -44.308 -119.560 1.00 154.83 ? 37  LEU D CG  1 
ATOM   4703 C CD1 . LEU D 1 37  ? -149.682 -43.827 -120.180 1.00 154.38 ? 37  LEU D CD1 1 
ATOM   4704 C CD2 . LEU D 1 37  ? -148.581 -44.675 -118.088 1.00 154.65 ? 37  LEU D CD2 1 
ATOM   4705 N N   . LEU D 1 38  ? -144.405 -46.090 -118.856 1.00 153.92 ? 38  LEU D N   1 
ATOM   4706 C CA  . LEU D 1 38  ? -143.405 -45.214 -119.516 1.00 153.26 ? 38  LEU D CA  1 
ATOM   4707 C C   . LEU D 1 38  ? -143.736 -43.707 -119.602 1.00 152.91 ? 38  LEU D C   1 
ATOM   4708 O O   . LEU D 1 38  ? -144.412 -43.252 -120.530 1.00 153.05 ? 38  LEU D O   1 
ATOM   4709 C CB  . LEU D 1 38  ? -142.919 -45.806 -120.851 1.00 153.23 ? 38  LEU D CB  1 
ATOM   4710 C CG  . LEU D 1 38  ? -141.633 -46.630 -120.741 1.00 153.15 ? 38  LEU D CG  1 
ATOM   4711 C CD1 . LEU D 1 38  ? -141.708 -47.938 -121.512 1.00 153.00 ? 38  LEU D CD1 1 
ATOM   4712 C CD2 . LEU D 1 38  ? -140.425 -45.806 -121.174 1.00 153.09 ? 38  LEU D CD2 1 
ATOM   4713 N N   . LYS D 1 39  ? -143.212 -42.944 -118.641 1.00 152.31 ? 39  LYS D N   1 
ATOM   4714 C CA  . LYS D 1 39  ? -143.622 -41.546 -118.426 1.00 151.76 ? 39  LYS D CA  1 
ATOM   4715 C C   . LYS D 1 39  ? -142.523 -40.453 -118.503 1.00 151.38 ? 39  LYS D C   1 
ATOM   4716 O O   . LYS D 1 39  ? -142.827 -39.277 -118.280 1.00 151.23 ? 39  LYS D O   1 
ATOM   4717 C CB  . LYS D 1 39  ? -144.341 -41.446 -117.070 1.00 151.76 ? 39  LYS D CB  1 
ATOM   4718 C CG  . LYS D 1 39  ? -145.501 -40.467 -117.036 1.00 151.42 ? 39  LYS D CG  1 
ATOM   4719 C CD  . LYS D 1 39  ? -146.449 -40.780 -115.892 1.00 150.73 ? 39  LYS D CD  1 
ATOM   4720 C CE  . LYS D 1 39  ? -147.894 -40.554 -116.307 1.00 149.91 ? 39  LYS D CE  1 
ATOM   4721 N NZ  . LYS D 1 39  ? -148.330 -41.539 -117.335 1.00 148.80 ? 39  LYS D NZ  1 
ATOM   4722 N N   . PRO D 1 40  ? -141.263 -40.823 -118.840 1.00 151.05 ? 40  PRO D N   1 
ATOM   4723 C CA  . PRO D 1 40  ? -140.106 -39.927 -118.601 1.00 150.70 ? 40  PRO D CA  1 
ATOM   4724 C C   . PRO D 1 40  ? -140.165 -38.546 -119.256 1.00 150.23 ? 40  PRO D C   1 
ATOM   4725 O O   . PRO D 1 40  ? -140.857 -38.361 -120.260 1.00 150.23 ? 40  PRO D O   1 
ATOM   4726 C CB  . PRO D 1 40  ? -138.921 -40.712 -119.183 1.00 150.81 ? 40  PRO D CB  1 
ATOM   4727 C CG  . PRO D 1 40  ? -139.527 -41.639 -120.173 1.00 151.12 ? 40  PRO D CG  1 
ATOM   4728 C CD  . PRO D 1 40  ? -140.854 -42.029 -119.587 1.00 151.06 ? 40  PRO D CD  1 
ATOM   4729 N N   . SER D 1 41  ? -139.426 -37.596 -118.678 1.00 149.66 ? 41  SER D N   1 
ATOM   4730 C CA  . SER D 1 41  ? -139.313 -36.229 -119.215 1.00 148.99 ? 41  SER D CA  1 
ATOM   4731 C C   . SER D 1 41  ? -138.087 -35.420 -118.723 1.00 148.50 ? 41  SER D C   1 
ATOM   4732 O O   . SER D 1 41  ? -137.427 -34.758 -119.533 1.00 148.37 ? 41  SER D O   1 
ATOM   4733 C CB  . SER D 1 41  ? -140.620 -35.442 -119.020 1.00 149.07 ? 41  SER D CB  1 
ATOM   4734 O OG  . SER D 1 41  ? -141.309 -35.828 -117.843 1.00 148.63 ? 41  SER D OG  1 
ATOM   4735 N N   . VAL D 1 42  ? -137.802 -35.475 -117.416 1.00 147.78 ? 42  VAL D N   1 
ATOM   4736 C CA  . VAL D 1 42  ? -136.657 -34.779 -116.775 1.00 147.10 ? 42  VAL D CA  1 
ATOM   4737 C C   . VAL D 1 42  ? -136.244 -33.465 -117.488 1.00 146.64 ? 42  VAL D C   1 
ATOM   4738 O O   . VAL D 1 42  ? -137.082 -32.572 -117.717 1.00 146.25 ? 42  VAL D O   1 
ATOM   4739 C CB  . VAL D 1 42  ? -135.403 -35.725 -116.605 1.00 147.13 ? 42  VAL D CB  1 
ATOM   4740 C CG1 . VAL D 1 42  ? -134.571 -35.319 -115.375 1.00 147.16 ? 42  VAL D CG1 1 
ATOM   4741 C CG2 . VAL D 1 42  ? -135.808 -37.197 -116.515 1.00 146.79 ? 42  VAL D CG2 1 
ATOM   4742 N N   . LEU D 1 43  ? -134.943 -33.364 -117.793 1.00 146.09 ? 43  LEU D N   1 
ATOM   4743 C CA  . LEU D 1 43  ? -134.386 -32.417 -118.765 1.00 145.33 ? 43  LEU D CA  1 
ATOM   4744 C C   . LEU D 1 43  ? -134.919 -32.770 -120.153 1.00 144.87 ? 43  LEU D C   1 
ATOM   4745 O O   . LEU D 1 43  ? -135.509 -31.927 -120.825 1.00 144.76 ? 43  LEU D O   1 
ATOM   4746 C CB  . LEU D 1 43  ? -132.848 -32.524 -118.813 1.00 145.22 ? 43  LEU D CB  1 
ATOM   4747 C CG  . LEU D 1 43  ? -131.843 -31.853 -117.869 1.00 144.88 ? 43  LEU D CG  1 
ATOM   4748 C CD1 . LEU D 1 43  ? -130.560 -32.660 -117.826 1.00 144.60 ? 43  LEU D CD1 1 
ATOM   4749 C CD2 . LEU D 1 43  ? -131.535 -30.428 -118.291 1.00 144.70 ? 43  LEU D CD2 1 
ATOM   4750 N N   . CYS D 1 44  ? -134.739 -34.040 -120.530 1.00 144.24 ? 44  CYS D N   1 
ATOM   4751 C CA  . CYS D 1 44  ? -134.785 -34.536 -121.913 1.00 143.64 ? 44  CYS D CA  1 
ATOM   4752 C C   . CYS D 1 44  ? -135.852 -33.969 -122.868 1.00 143.18 ? 44  CYS D C   1 
ATOM   4753 O O   . CYS D 1 44  ? -135.676 -34.041 -124.084 1.00 143.17 ? 44  CYS D O   1 
ATOM   4754 C CB  . CYS D 1 44  ? -134.794 -36.062 -121.927 1.00 143.59 ? 44  CYS D CB  1 
ATOM   4755 S SG  . CYS D 1 44  ? -136.248 -36.776 -121.179 1.00 144.22 ? 44  CYS D SG  1 
ATOM   4756 N N   . ILE D 1 45  ? -136.951 -33.430 -122.339 1.00 142.50 ? 45  ILE D N   1 
ATOM   4757 C CA  . ILE D 1 45  ? -137.881 -32.653 -123.174 1.00 141.73 ? 45  ILE D CA  1 
ATOM   4758 C C   . ILE D 1 45  ? -137.164 -31.437 -123.768 1.00 141.02 ? 45  ILE D C   1 
ATOM   4759 O O   . ILE D 1 45  ? -137.508 -30.990 -124.857 1.00 141.05 ? 45  ILE D O   1 
ATOM   4760 C CB  . ILE D 1 45  ? -139.201 -32.240 -122.437 1.00 141.86 ? 45  ILE D CB  1 
ATOM   4761 C CG1 . ILE D 1 45  ? -138.939 -31.750 -121.003 1.00 142.32 ? 45  ILE D CG1 1 
ATOM   4762 C CG2 . ILE D 1 45  ? -140.196 -33.396 -122.421 1.00 141.75 ? 45  ILE D CG2 1 
ATOM   4763 C CD1 . ILE D 1 45  ? -138.731 -30.239 -120.857 1.00 142.98 ? 45  ILE D CD1 1 
ATOM   4764 N N   . TYR D 1 46  ? -136.173 -30.921 -123.034 1.00 140.23 ? 46  TYR D N   1 
ATOM   4765 C CA  . TYR D 1 46  ? -135.200 -29.932 -123.527 1.00 139.51 ? 46  TYR D CA  1 
ATOM   4766 C C   . TYR D 1 46  ? -134.384 -30.524 -124.680 1.00 138.66 ? 46  TYR D C   1 
ATOM   4767 O O   . TYR D 1 46  ? -134.036 -29.817 -125.634 1.00 138.45 ? 46  TYR D O   1 
ATOM   4768 C CB  . TYR D 1 46  ? -134.220 -29.530 -122.402 1.00 139.91 ? 46  TYR D CB  1 
ATOM   4769 C CG  . TYR D 1 46  ? -134.475 -28.213 -121.671 1.00 140.24 ? 46  TYR D CG  1 
ATOM   4770 C CD1 . TYR D 1 46  ? -135.374 -28.141 -120.597 1.00 140.20 ? 46  TYR D CD1 1 
ATOM   4771 C CD2 . TYR D 1 46  ? -133.774 -27.053 -122.027 1.00 140.36 ? 46  TYR D CD2 1 
ATOM   4772 C CE1 . TYR D 1 46  ? -135.590 -26.941 -119.920 1.00 140.14 ? 46  TYR D CE1 1 
ATOM   4773 C CE2 . TYR D 1 46  ? -133.982 -25.849 -121.355 1.00 140.42 ? 46  TYR D CE2 1 
ATOM   4774 C CZ  . TYR D 1 46  ? -134.888 -25.802 -120.304 1.00 140.40 ? 46  TYR D CZ  1 
ATOM   4775 O OH  . TYR D 1 46  ? -135.094 -24.617 -119.638 1.00 140.48 ? 46  TYR D OH  1 
ATOM   4776 N N   . GLU D 1 47  ? -134.071 -31.817 -124.561 1.00 137.60 ? 47  GLU D N   1 
ATOM   4777 C CA  . GLU D 1 47  ? -133.299 -32.557 -125.562 1.00 136.65 ? 47  GLU D CA  1 
ATOM   4778 C C   . GLU D 1 47  ? -134.165 -32.990 -126.744 1.00 135.81 ? 47  GLU D C   1 
ATOM   4779 O O   . GLU D 1 47  ? -133.644 -33.256 -127.830 1.00 135.70 ? 47  GLU D O   1 
ATOM   4780 C CB  . GLU D 1 47  ? -132.627 -33.774 -124.928 1.00 136.75 ? 47  GLU D CB  1 
ATOM   4781 C CG  . GLU D 1 47  ? -131.720 -33.430 -123.755 1.00 137.33 ? 47  GLU D CG  1 
ATOM   4782 C CD  . GLU D 1 47  ? -131.244 -34.650 -122.977 1.00 138.02 ? 47  GLU D CD  1 
ATOM   4783 O OE1 . GLU D 1 47  ? -131.756 -35.770 -123.202 1.00 138.19 ? 47  GLU D OE1 1 
ATOM   4784 O OE2 . GLU D 1 47  ? -130.346 -34.481 -122.130 1.00 138.29 ? 47  GLU D OE2 1 
ATOM   4785 N N   . ARG D 1 48  ? -135.479 -33.070 -126.520 1.00 134.76 ? 48  ARG D N   1 
ATOM   4786 C CA  . ARG D 1 48  ? -136.453 -33.264 -127.595 1.00 133.66 ? 48  ARG D CA  1 
ATOM   4787 C C   . ARG D 1 48  ? -136.402 -32.068 -128.524 1.00 132.57 ? 48  ARG D C   1 
ATOM   4788 O O   . ARG D 1 48  ? -136.223 -32.213 -129.733 1.00 132.64 ? 48  ARG D O   1 
ATOM   4789 C CB  . ARG D 1 48  ? -137.869 -33.386 -127.040 1.00 133.89 ? 48  ARG D CB  1 
ATOM   4790 C CG  . ARG D 1 48  ? -138.236 -34.741 -126.487 1.00 134.92 ? 48  ARG D CG  1 
ATOM   4791 C CD  . ARG D 1 48  ? -139.611 -35.150 -127.017 1.00 137.16 ? 48  ARG D CD  1 
ATOM   4792 N NE  . ARG D 1 48  ? -140.386 -36.012 -126.119 1.00 139.12 ? 48  ARG D NE  1 
ATOM   4793 C CZ  . ARG D 1 48  ? -140.016 -37.228 -125.713 1.00 140.50 ? 48  ARG D CZ  1 
ATOM   4794 N NH1 . ARG D 1 48  ? -138.848 -37.746 -126.086 1.00 141.56 ? 48  ARG D NH1 1 
ATOM   4795 N NH2 . ARG D 1 48  ? -140.812 -37.923 -124.910 1.00 140.66 ? 48  ARG D NH2 1 
ATOM   4796 N N   . VAL D 1 49  ? -136.549 -30.886 -127.934 1.00 131.18 ? 49  VAL D N   1 
ATOM   4797 C CA  . VAL D 1 49  ? -136.457 -29.614 -128.643 1.00 129.87 ? 49  VAL D CA  1 
ATOM   4798 C C   . VAL D 1 49  ? -135.038 -29.372 -129.216 1.00 129.30 ? 49  VAL D C   1 
ATOM   4799 O O   . VAL D 1 49  ? -134.821 -28.448 -129.990 1.00 129.03 ? 49  VAL D O   1 
ATOM   4800 C CB  . VAL D 1 49  ? -136.993 -28.455 -127.748 1.00 129.69 ? 49  VAL D CB  1 
ATOM   4801 C CG1 . VAL D 1 49  ? -137.005 -27.126 -128.485 1.00 129.24 ? 49  VAL D CG1 1 
ATOM   4802 C CG2 . VAL D 1 49  ? -138.398 -28.789 -127.266 1.00 128.82 ? 49  VAL D CG2 1 
ATOM   4803 N N   . ALA D 1 50  ? -134.085 -30.226 -128.860 1.00 128.78 ? 50  ALA D N   1 
ATOM   4804 C CA  . ALA D 1 50  ? -132.787 -30.238 -129.535 1.00 128.50 ? 50  ALA D CA  1 
ATOM   4805 C C   . ALA D 1 50  ? -132.706 -31.349 -130.590 1.00 128.27 ? 50  ALA D C   1 
ATOM   4806 O O   . ALA D 1 50  ? -131.612 -31.736 -131.016 1.00 128.23 ? 50  ALA D O   1 
ATOM   4807 C CB  . ALA D 1 50  ? -131.648 -30.354 -128.530 1.00 128.58 ? 50  ALA D CB  1 
ATOM   4808 N N   . LEU D 1 51  ? -133.870 -31.865 -130.987 1.00 127.93 ? 51  LEU D N   1 
ATOM   4809 C CA  . LEU D 1 51  ? -133.998 -32.763 -132.140 1.00 127.63 ? 51  LEU D CA  1 
ATOM   4810 C C   . LEU D 1 51  ? -135.008 -32.235 -133.162 1.00 127.40 ? 51  LEU D C   1 
ATOM   4811 O O   . LEU D 1 51  ? -134.775 -32.336 -134.373 1.00 127.37 ? 51  LEU D O   1 
ATOM   4812 C CB  . LEU D 1 51  ? -134.352 -34.191 -131.723 1.00 127.59 ? 51  LEU D CB  1 
ATOM   4813 C CG  . LEU D 1 51  ? -133.270 -35.277 -131.689 1.00 127.64 ? 51  LEU D CG  1 
ATOM   4814 C CD1 . LEU D 1 51  ? -133.929 -36.617 -131.940 1.00 127.91 ? 51  LEU D CD1 1 
ATOM   4815 C CD2 . LEU D 1 51  ? -132.165 -35.065 -132.711 1.00 127.26 ? 51  LEU D CD2 1 
ATOM   4816 N N   . PHE D 1 52  ? -136.124 -31.678 -132.679 1.00 127.00 ? 52  PHE D N   1 
ATOM   4817 C CA  . PHE D 1 52  ? -136.988 -30.839 -133.521 1.00 126.62 ? 52  PHE D CA  1 
ATOM   4818 C C   . PHE D 1 52  ? -136.121 -29.706 -134.081 1.00 126.42 ? 52  PHE D C   1 
ATOM   4819 O O   . PHE D 1 52  ? -136.557 -28.901 -134.904 1.00 126.34 ? 52  PHE D O   1 
ATOM   4820 C CB  . PHE D 1 52  ? -138.188 -30.297 -132.729 1.00 126.45 ? 52  PHE D CB  1 
ATOM   4821 C CG  . PHE D 1 52  ? -139.116 -31.375 -132.222 1.00 126.52 ? 52  PHE D CG  1 
ATOM   4822 C CD1 . PHE D 1 52  ? -140.156 -31.849 -133.012 1.00 126.76 ? 52  PHE D CD1 1 
ATOM   4823 C CD2 . PHE D 1 52  ? -138.945 -31.927 -130.958 1.00 126.38 ? 52  PHE D CD2 1 
ATOM   4824 C CE1 . PHE D 1 52  ? -141.009 -32.857 -132.546 1.00 126.18 ? 52  PHE D CE1 1 
ATOM   4825 C CE2 . PHE D 1 52  ? -139.795 -32.929 -130.486 1.00 125.79 ? 52  PHE D CE2 1 
ATOM   4826 C CZ  . PHE D 1 52  ? -140.824 -33.394 -131.281 1.00 125.62 ? 52  PHE D CZ  1 
ATOM   4827 N N   . GLY D 1 53  ? -134.878 -29.685 -133.608 1.00 126.20 ? 53  GLY D N   1 
ATOM   4828 C CA  . GLY D 1 53  ? -133.852 -28.787 -134.073 1.00 125.93 ? 53  GLY D CA  1 
ATOM   4829 C C   . GLY D 1 53  ? -133.042 -29.423 -135.177 1.00 125.85 ? 53  GLY D C   1 
ATOM   4830 O O   . GLY D 1 53  ? -132.448 -28.722 -135.988 1.00 126.09 ? 53  GLY D O   1 
ATOM   4831 N N   . VAL D 1 54  ? -132.987 -30.748 -135.212 1.00 125.69 ? 54  VAL D N   1 
ATOM   4832 C CA  . VAL D 1 54  ? -132.425 -31.415 -136.388 1.00 125.55 ? 54  VAL D CA  1 
ATOM   4833 C C   . VAL D 1 54  ? -133.569 -31.779 -137.350 1.00 125.45 ? 54  VAL D C   1 
ATOM   4834 O O   . VAL D 1 54  ? -133.359 -32.439 -138.378 1.00 125.33 ? 54  VAL D O   1 
ATOM   4835 C CB  . VAL D 1 54  ? -131.486 -32.607 -136.053 1.00 125.55 ? 54  VAL D CB  1 
ATOM   4836 C CG1 . VAL D 1 54  ? -130.507 -32.833 -137.199 1.00 125.50 ? 54  VAL D CG1 1 
ATOM   4837 C CG2 . VAL D 1 54  ? -130.699 -32.333 -134.789 1.00 125.33 ? 54  VAL D CG2 1 
ATOM   4838 N N   . LEU D 1 55  ? -134.780 -31.339 -137.002 1.00 125.26 ? 55  LEU D N   1 
ATOM   4839 C CA  . LEU D 1 55  ? -135.840 -31.212 -137.994 1.00 125.25 ? 55  LEU D CA  1 
ATOM   4840 C C   . LEU D 1 55  ? -135.451 -30.083 -138.942 1.00 125.04 ? 55  LEU D C   1 
ATOM   4841 O O   . LEU D 1 55  ? -134.909 -30.338 -140.022 1.00 125.21 ? 55  LEU D O   1 
ATOM   4842 C CB  . LEU D 1 55  ? -137.207 -30.913 -137.363 1.00 125.35 ? 55  LEU D CB  1 
ATOM   4843 C CG  . LEU D 1 55  ? -138.326 -31.963 -137.424 1.00 125.71 ? 55  LEU D CG  1 
ATOM   4844 C CD1 . LEU D 1 55  ? -139.701 -31.273 -137.567 1.00 125.00 ? 55  LEU D CD1 1 
ATOM   4845 C CD2 . LEU D 1 55  ? -138.099 -32.977 -138.549 1.00 125.72 ? 55  LEU D CD2 1 
ATOM   4846 N N   . GLY D 1 56  ? -135.704 -28.842 -138.521 1.00 124.53 ? 56  GLY D N   1 
ATOM   4847 C CA  . GLY D 1 56  ? -135.325 -27.666 -139.289 1.00 123.76 ? 56  GLY D CA  1 
ATOM   4848 C C   . GLY D 1 56  ? -134.025 -27.907 -140.022 1.00 123.34 ? 56  GLY D C   1 
ATOM   4849 O O   . GLY D 1 56  ? -134.006 -27.975 -141.239 1.00 123.14 ? 56  GLY D O   1 
ATOM   4850 N N   . ALA D 1 57  ? -132.951 -28.081 -139.259 1.00 123.23 ? 57  ALA D N   1 
ATOM   4851 C CA  . ALA D 1 57  ? -131.585 -28.253 -139.775 1.00 123.18 ? 57  ALA D CA  1 
ATOM   4852 C C   . ALA D 1 57  ? -131.483 -28.915 -141.147 1.00 123.07 ? 57  ALA D C   1 
ATOM   4853 O O   . ALA D 1 57  ? -131.129 -28.258 -142.128 1.00 123.04 ? 57  ALA D O   1 
ATOM   4854 C CB  . ALA D 1 57  ? -130.754 -29.020 -138.769 1.00 123.26 ? 57  ALA D CB  1 
ATOM   4855 N N   . ALA D 1 58  ? -131.782 -30.217 -141.192 1.00 122.96 ? 58  ALA D N   1 
ATOM   4856 C CA  . ALA D 1 58  ? -131.721 -31.017 -142.415 1.00 122.76 ? 58  ALA D CA  1 
ATOM   4857 C C   . ALA D 1 58  ? -132.906 -30.711 -143.313 1.00 122.70 ? 58  ALA D C   1 
ATOM   4858 O O   . ALA D 1 58  ? -132.769 -30.691 -144.532 1.00 122.83 ? 58  ALA D O   1 
ATOM   4859 C CB  . ALA D 1 58  ? -131.692 -32.495 -142.088 1.00 122.68 ? 58  ALA D CB  1 
ATOM   4860 N N   . LEU D 1 59  ? -134.063 -30.471 -142.696 1.00 122.43 ? 59  LEU D N   1 
ATOM   4861 C CA  . LEU D 1 59  ? -135.303 -30.171 -143.406 1.00 122.02 ? 59  LEU D CA  1 
ATOM   4862 C C   . LEU D 1 59  ? -135.259 -28.785 -144.065 1.00 121.90 ? 59  LEU D C   1 
ATOM   4863 O O   . LEU D 1 59  ? -136.047 -28.500 -144.964 1.00 122.10 ? 59  LEU D O   1 
ATOM   4864 C CB  . LEU D 1 59  ? -136.480 -30.283 -142.442 1.00 121.90 ? 59  LEU D CB  1 
ATOM   4865 C CG  . LEU D 1 59  ? -137.838 -30.699 -142.990 1.00 122.04 ? 59  LEU D CG  1 
ATOM   4866 C CD1 . LEU D 1 59  ? -138.532 -31.625 -142.009 1.00 121.39 ? 59  LEU D CD1 1 
ATOM   4867 C CD2 . LEU D 1 59  ? -138.697 -29.469 -143.296 1.00 122.43 ? 59  LEU D CD2 1 
ATOM   4868 N N   . ILE D 1 60  ? -134.347 -27.928 -143.604 1.00 121.54 ? 60  ILE D N   1 
ATOM   4869 C CA  . ILE D 1 60  ? -134.017 -26.687 -144.296 1.00 120.97 ? 60  ILE D CA  1 
ATOM   4870 C C   . ILE D 1 60  ? -133.001 -27.017 -145.375 1.00 121.06 ? 60  ILE D C   1 
ATOM   4871 O O   . ILE D 1 60  ? -133.141 -26.588 -146.520 1.00 121.23 ? 60  ILE D O   1 
ATOM   4872 C CB  . ILE D 1 60  ? -133.476 -25.618 -143.332 1.00 120.77 ? 60  ILE D CB  1 
ATOM   4873 C CG1 . ILE D 1 60  ? -134.645 -24.861 -142.687 1.00 120.41 ? 60  ILE D CG1 1 
ATOM   4874 C CG2 . ILE D 1 60  ? -132.540 -24.657 -144.054 1.00 120.66 ? 60  ILE D CG2 1 
ATOM   4875 C CD1 . ILE D 1 60  ? -134.270 -23.976 -141.497 1.00 119.26 ? 60  ILE D CD1 1 
ATOM   4876 N N   . GLY D 1 61  ? -131.995 -27.810 -145.015 1.00 121.08 ? 61  GLY D N   1 
ATOM   4877 C CA  . GLY D 1 61  ? -131.019 -28.303 -145.988 1.00 121.28 ? 61  GLY D CA  1 
ATOM   4878 C C   . GLY D 1 61  ? -131.671 -29.107 -147.095 1.00 121.37 ? 61  GLY D C   1 
ATOM   4879 O O   . GLY D 1 61  ? -131.109 -29.260 -148.182 1.00 121.30 ? 61  GLY D O   1 
ATOM   4880 N N   . ALA D 1 62  ? -132.863 -29.624 -146.801 1.00 121.47 ? 62  ALA D N   1 
ATOM   4881 C CA  . ALA D 1 62  ? -133.696 -30.290 -147.786 1.00 121.43 ? 62  ALA D CA  1 
ATOM   4882 C C   . ALA D 1 62  ? -134.467 -29.246 -148.591 1.00 121.49 ? 62  ALA D C   1 
ATOM   4883 O O   . ALA D 1 62  ? -134.207 -29.057 -149.782 1.00 121.52 ? 62  ALA D O   1 
ATOM   4884 C CB  . ALA D 1 62  ? -134.645 -31.289 -147.109 1.00 121.26 ? 62  ALA D CB  1 
ATOM   4885 N N   . ILE D 1 63  ? -135.386 -28.546 -147.931 1.00 121.51 ? 63  ILE D N   1 
ATOM   4886 C CA  . ILE D 1 63  ? -136.304 -27.639 -148.624 1.00 121.71 ? 63  ILE D CA  1 
ATOM   4887 C C   . ILE D 1 63  ? -135.554 -26.579 -149.433 1.00 121.68 ? 63  ILE D C   1 
ATOM   4888 O O   . ILE D 1 63  ? -135.114 -25.560 -148.900 1.00 121.63 ? 63  ILE D O   1 
ATOM   4889 C CB  . ILE D 1 63  ? -137.428 -27.076 -147.668 1.00 121.85 ? 63  ILE D CB  1 
ATOM   4890 C CG1 . ILE D 1 63  ? -138.646 -28.034 -147.623 1.00 122.10 ? 63  ILE D CG1 1 
ATOM   4891 C CG2 . ILE D 1 63  ? -137.904 -25.668 -148.091 1.00 121.46 ? 63  ILE D CG2 1 
ATOM   4892 C CD1 . ILE D 1 63  ? -138.363 -29.529 -147.274 1.00 120.74 ? 63  ILE D CD1 1 
ATOM   4893 N N   . ALA D 1 64  ? -135.411 -26.873 -150.727 1.00 121.68 ? 64  ALA D N   1 
ATOM   4894 C CA  . ALA D 1 64  ? -134.689 -26.044 -151.699 1.00 121.94 ? 64  ALA D CA  1 
ATOM   4895 C C   . ALA D 1 64  ? -133.153 -26.043 -151.500 1.00 122.18 ? 64  ALA D C   1 
ATOM   4896 O O   . ALA D 1 64  ? -132.567 -24.986 -151.253 1.00 122.19 ? 64  ALA D O   1 
ATOM   4897 C CB  . ALA D 1 64  ? -135.272 -24.608 -151.749 1.00 121.72 ? 64  ALA D CB  1 
ATOM   4898 N N   . PRO D 1 65  ? -132.498 -27.221 -151.674 1.00 122.45 ? 65  PRO D N   1 
ATOM   4899 C CA  . PRO D 1 65  ? -131.114 -27.548 -151.291 1.00 122.68 ? 65  PRO D CA  1 
ATOM   4900 C C   . PRO D 1 65  ? -130.094 -26.422 -151.035 1.00 122.93 ? 65  PRO D C   1 
ATOM   4901 O O   . PRO D 1 65  ? -129.432 -26.492 -150.000 1.00 123.20 ? 65  PRO D O   1 
ATOM   4902 C CB  . PRO D 1 65  ? -130.676 -28.526 -152.374 1.00 122.59 ? 65  PRO D CB  1 
ATOM   4903 C CG  . PRO D 1 65  ? -131.905 -29.309 -152.611 1.00 122.91 ? 65  PRO D CG  1 
ATOM   4904 C CD  . PRO D 1 65  ? -133.086 -28.350 -152.421 1.00 122.69 ? 65  PRO D CD  1 
ATOM   4905 N N   . LYS D 1 66  ? -129.870 -25.443 -151.920 1.00 123.08 ? 66  LYS D N   1 
ATOM   4906 C CA  . LYS D 1 66  ? -130.016 -25.497 -153.374 1.00 123.18 ? 66  LYS D CA  1 
ATOM   4907 C C   . LYS D 1 66  ? -128.655 -25.061 -153.912 1.00 122.88 ? 66  LYS D C   1 
ATOM   4908 O O   . LYS D 1 66  ? -128.113 -25.683 -154.831 1.00 122.68 ? 66  LYS D O   1 
ATOM   4909 C CB  . LYS D 1 66  ? -131.118 -24.564 -153.891 1.00 123.39 ? 66  LYS D CB  1 
ATOM   4910 C CG  . LYS D 1 66  ? -132.312 -25.311 -154.504 1.00 123.68 ? 66  LYS D CG  1 
ATOM   4911 C CD  . LYS D 1 66  ? -133.350 -24.376 -155.136 1.00 123.75 ? 66  LYS D CD  1 
ATOM   4912 C CE  . LYS D 1 66  ? -134.716 -25.062 -155.317 1.00 123.48 ? 66  LYS D CE  1 
ATOM   4913 N NZ  . LYS D 1 66  ? -134.669 -26.430 -155.934 1.00 122.80 ? 66  LYS D NZ  1 
ATOM   4914 N N   . THR D 1 67  ? -128.112 -23.999 -153.315 1.00 122.46 ? 67  THR D N   1 
ATOM   4915 C CA  . THR D 1 67  ? -126.691 -23.648 -153.452 1.00 122.19 ? 67  THR D CA  1 
ATOM   4916 C C   . THR D 1 67  ? -126.176 -22.798 -152.274 1.00 121.79 ? 67  THR D C   1 
ATOM   4917 O O   . THR D 1 67  ? -125.023 -22.965 -151.858 1.00 121.89 ? 67  THR D O   1 
ATOM   4918 C CB  . THR D 1 67  ? -126.353 -23.001 -154.833 1.00 122.33 ? 67  THR D CB  1 
ATOM   4919 O OG1 . THR D 1 67  ? -126.391 -24.012 -155.848 1.00 122.68 ? 67  THR D OG1 1 
ATOM   4920 C CG2 . THR D 1 67  ? -124.961 -22.339 -154.840 1.00 122.05 ? 67  THR D CG2 1 
ATOM   4921 N N   . PRO D 1 68  ? -127.017 -21.890 -151.735 1.00 121.22 ? 68  PRO D N   1 
ATOM   4922 C CA  . PRO D 1 68  ? -126.515 -21.143 -150.590 1.00 120.84 ? 68  PRO D CA  1 
ATOM   4923 C C   . PRO D 1 68  ? -127.218 -21.451 -149.243 1.00 120.54 ? 68  PRO D C   1 
ATOM   4924 O O   . PRO D 1 68  ? -126.607 -21.298 -148.186 1.00 120.67 ? 68  PRO D O   1 
ATOM   4925 C CB  . PRO D 1 68  ? -126.722 -19.688 -151.026 1.00 120.75 ? 68  PRO D CB  1 
ATOM   4926 C CG  . PRO D 1 68  ? -127.831 -19.751 -152.113 1.00 121.03 ? 68  PRO D CG  1 
ATOM   4927 C CD  . PRO D 1 68  ? -128.172 -21.206 -152.340 1.00 121.15 ? 68  PRO D CD  1 
ATOM   4928 N N   . LEU D 1 69  ? -128.471 -21.895 -149.285 1.00 120.09 ? 69  LEU D N   1 
ATOM   4929 C CA  . LEU D 1 69  ? -129.200 -22.336 -148.095 1.00 119.78 ? 69  LEU D CA  1 
ATOM   4930 C C   . LEU D 1 69  ? -128.682 -23.694 -147.583 1.00 120.00 ? 69  LEU D C   1 
ATOM   4931 O O   . LEU D 1 69  ? -129.259 -24.301 -146.673 1.00 119.79 ? 69  LEU D O   1 
ATOM   4932 C CB  . LEU D 1 69  ? -130.681 -22.424 -148.434 1.00 119.58 ? 69  LEU D CB  1 
ATOM   4933 C CG  . LEU D 1 69  ? -131.680 -22.835 -147.369 1.00 118.87 ? 69  LEU D CG  1 
ATOM   4934 C CD1 . LEU D 1 69  ? -132.466 -21.641 -146.903 1.00 118.36 ? 69  LEU D CD1 1 
ATOM   4935 C CD2 . LEU D 1 69  ? -132.592 -23.856 -147.980 1.00 118.09 ? 69  LEU D CD2 1 
ATOM   4936 N N   . ARG D 1 70  ? -127.597 -24.164 -148.198 1.00 120.29 ? 70  ARG D N   1 
ATOM   4937 C CA  . ARG D 1 70  ? -126.862 -25.342 -147.746 1.00 120.61 ? 70  ARG D CA  1 
ATOM   4938 C C   . ARG D 1 70  ? -126.181 -24.988 -146.437 1.00 120.65 ? 70  ARG D C   1 
ATOM   4939 O O   . ARG D 1 70  ? -126.174 -25.792 -145.506 1.00 120.85 ? 70  ARG D O   1 
ATOM   4940 C CB  . ARG D 1 70  ? -125.803 -25.771 -148.774 1.00 120.63 ? 70  ARG D CB  1 
ATOM   4941 C CG  . ARG D 1 70  ? -126.279 -25.731 -150.220 1.00 121.95 ? 70  ARG D CG  1 
ATOM   4942 C CD  . ARG D 1 70  ? -125.506 -26.677 -151.135 1.00 123.63 ? 70  ARG D CD  1 
ATOM   4943 N NE  . ARG D 1 70  ? -126.224 -26.967 -152.389 1.00 124.98 ? 70  ARG D NE  1 
ATOM   4944 C CZ  . ARG D 1 70  ? -127.311 -27.743 -152.502 1.00 125.55 ? 70  ARG D CZ  1 
ATOM   4945 N NH1 . ARG D 1 70  ? -127.863 -28.318 -151.439 1.00 125.46 ? 70  ARG D NH1 1 
ATOM   4946 N NH2 . ARG D 1 70  ? -127.858 -27.945 -153.693 1.00 125.63 ? 70  ARG D NH2 1 
ATOM   4947 N N   . TYR D 1 71  ? -125.623 -23.774 -146.384 1.00 120.55 ? 71  TYR D N   1 
ATOM   4948 C CA  . TYR D 1 71  ? -124.947 -23.232 -145.207 1.00 120.45 ? 71  TYR D CA  1 
ATOM   4949 C C   . TYR D 1 71  ? -125.880 -23.166 -143.998 1.00 120.17 ? 71  TYR D C   1 
ATOM   4950 O O   . TYR D 1 71  ? -125.640 -23.834 -142.994 1.00 120.36 ? 71  TYR D O   1 
ATOM   4951 C CB  . TYR D 1 71  ? -124.427 -21.828 -145.497 1.00 120.65 ? 71  TYR D CB  1 
ATOM   4952 C CG  . TYR D 1 71  ? -123.239 -21.713 -146.435 1.00 121.82 ? 71  TYR D CG  1 
ATOM   4953 C CD1 . TYR D 1 71  ? -122.214 -20.793 -146.165 1.00 122.93 ? 71  TYR D CD1 1 
ATOM   4954 C CD2 . TYR D 1 71  ? -123.141 -22.490 -147.596 1.00 122.19 ? 71  TYR D CD2 1 
ATOM   4955 C CE1 . TYR D 1 71  ? -121.122 -20.651 -147.017 1.00 123.27 ? 71  TYR D CE1 1 
ATOM   4956 C CE2 . TYR D 1 71  ? -122.050 -22.359 -148.456 1.00 122.88 ? 71  TYR D CE2 1 
ATOM   4957 C CZ  . TYR D 1 71  ? -121.046 -21.436 -148.160 1.00 123.61 ? 71  TYR D CZ  1 
ATOM   4958 O OH  . TYR D 1 71  ? -119.965 -21.290 -149.001 1.00 124.28 ? 71  TYR D OH  1 
ATOM   4959 N N   . VAL D 1 72  ? -126.939 -22.359 -144.105 1.00 119.75 ? 72  VAL D N   1 
ATOM   4960 C CA  . VAL D 1 72  ? -127.956 -22.196 -143.047 1.00 119.13 ? 72  VAL D CA  1 
ATOM   4961 C C   . VAL D 1 72  ? -128.376 -23.536 -142.454 1.00 118.81 ? 72  VAL D C   1 
ATOM   4962 O O   . VAL D 1 72  ? -128.535 -23.669 -141.247 1.00 118.70 ? 72  VAL D O   1 
ATOM   4963 C CB  . VAL D 1 72  ? -129.210 -21.415 -143.567 1.00 119.16 ? 72  VAL D CB  1 
ATOM   4964 C CG1 . VAL D 1 72  ? -130.433 -21.624 -142.666 1.00 118.90 ? 72  VAL D CG1 1 
ATOM   4965 C CG2 . VAL D 1 72  ? -128.900 -19.939 -143.694 1.00 118.59 ? 72  VAL D CG2 1 
ATOM   4966 N N   . ALA D 1 73  ? -128.536 -24.523 -143.327 1.00 118.55 ? 73  ALA D N   1 
ATOM   4967 C CA  . ALA D 1 73  ? -128.915 -25.875 -142.945 1.00 118.30 ? 73  ALA D CA  1 
ATOM   4968 C C   . ALA D 1 73  ? -127.878 -26.561 -142.067 1.00 118.03 ? 73  ALA D C   1 
ATOM   4969 O O   . ALA D 1 73  ? -128.239 -27.278 -141.136 1.00 117.81 ? 73  ALA D O   1 
ATOM   4970 C CB  . ALA D 1 73  ? -129.145 -26.691 -144.183 1.00 118.44 ? 73  ALA D CB  1 
ATOM   4971 N N   . MET D 1 74  ? -126.602 -26.333 -142.386 1.00 117.81 ? 74  MET D N   1 
ATOM   4972 C CA  . MET D 1 74  ? -125.468 -26.997 -141.738 1.00 117.86 ? 74  MET D CA  1 
ATOM   4973 C C   . MET D 1 74  ? -125.230 -26.486 -140.333 1.00 117.32 ? 74  MET D C   1 
ATOM   4974 O O   . MET D 1 74  ? -124.872 -27.253 -139.441 1.00 117.42 ? 74  MET D O   1 
ATOM   4975 C CB  . MET D 1 74  ? -124.175 -26.800 -142.542 1.00 118.24 ? 74  MET D CB  1 
ATOM   4976 C CG  . MET D 1 74  ? -124.090 -27.561 -143.871 1.00 120.04 ? 74  MET D CG  1 
ATOM   4977 S SD  . MET D 1 74  ? -122.436 -27.511 -144.625 1.00 123.58 ? 74  MET D SD  1 
ATOM   4978 C CE  . MET D 1 74  ? -122.280 -25.779 -145.108 1.00 122.81 ? 74  MET D CE  1 
ATOM   4979 N N   . VAL D 1 75  ? -125.399 -25.183 -140.150 1.00 116.75 ? 75  VAL D N   1 
ATOM   4980 C CA  . VAL D 1 75  ? -125.172 -24.560 -138.857 1.00 116.25 ? 75  VAL D CA  1 
ATOM   4981 C C   . VAL D 1 75  ? -126.283 -24.957 -137.875 1.00 115.97 ? 75  VAL D C   1 
ATOM   4982 O O   . VAL D 1 75  ? -126.013 -25.643 -136.891 1.00 116.13 ? 75  VAL D O   1 
ATOM   4983 C CB  . VAL D 1 75  ? -124.943 -23.010 -138.980 1.00 116.27 ? 75  VAL D CB  1 
ATOM   4984 C CG1 . VAL D 1 75  ? -125.889 -22.398 -139.982 1.00 116.16 ? 75  VAL D CG1 1 
ATOM   4985 C CG2 . VAL D 1 75  ? -125.037 -22.298 -137.620 1.00 116.18 ? 75  VAL D CG2 1 
ATOM   4986 N N   . ILE D 1 76  ? -127.527 -24.585 -138.157 1.00 115.44 ? 76  ILE D N   1 
ATOM   4987 C CA  . ILE D 1 76  ? -128.633 -24.946 -137.275 1.00 115.10 ? 76  ILE D CA  1 
ATOM   4988 C C   . ILE D 1 76  ? -128.818 -26.477 -137.202 1.00 115.00 ? 76  ILE D C   1 
ATOM   4989 O O   . ILE D 1 76  ? -129.835 -26.978 -136.729 1.00 115.00 ? 76  ILE D O   1 
ATOM   4990 C CB  . ILE D 1 76  ? -129.932 -24.161 -137.637 1.00 115.05 ? 76  ILE D CB  1 
ATOM   4991 C CG1 . ILE D 1 76  ? -130.886 -24.109 -136.434 1.00 115.44 ? 76  ILE D CG1 1 
ATOM   4992 C CG2 . ILE D 1 76  ? -130.601 -24.731 -138.891 1.00 115.03 ? 76  ILE D CG2 1 
ATOM   4993 C CD1 . ILE D 1 76  ? -131.616 -22.780 -136.229 1.00 115.24 ? 76  ILE D CD1 1 
ATOM   4994 N N   . TRP D 1 77  ? -127.792 -27.194 -137.662 1.00 114.97 ? 77  TRP D N   1 
ATOM   4995 C CA  . TRP D 1 77  ? -127.663 -28.657 -137.608 1.00 114.91 ? 77  TRP D CA  1 
ATOM   4996 C C   . TRP D 1 77  ? -126.526 -28.929 -136.642 1.00 114.09 ? 77  TRP D C   1 
ATOM   4997 O O   . TRP D 1 77  ? -126.722 -29.548 -135.599 1.00 113.75 ? 77  TRP D O   1 
ATOM   4998 C CB  . TRP D 1 77  ? -127.373 -29.159 -139.029 1.00 115.40 ? 77  TRP D CB  1 
ATOM   4999 C CG  . TRP D 1 77  ? -126.773 -30.532 -139.275 1.00 117.50 ? 77  TRP D CG  1 
ATOM   5000 C CD1 . TRP D 1 77  ? -125.461 -30.902 -139.130 1.00 118.82 ? 77  TRP D CD1 1 
ATOM   5001 C CD2 . TRP D 1 77  ? -127.444 -31.670 -139.846 1.00 119.71 ? 77  TRP D CD2 1 
ATOM   5002 N NE1 . TRP D 1 77  ? -125.284 -32.214 -139.526 1.00 119.27 ? 77  TRP D NE1 1 
ATOM   5003 C CE2 . TRP D 1 77  ? -126.484 -32.707 -139.970 1.00 120.10 ? 77  TRP D CE2 1 
ATOM   5004 C CE3 . TRP D 1 77  ? -128.770 -31.924 -140.242 1.00 120.24 ? 77  TRP D CE3 1 
ATOM   5005 C CZ2 . TRP D 1 77  ? -126.811 -33.977 -140.468 1.00 120.83 ? 77  TRP D CZ2 1 
ATOM   5006 C CZ3 . TRP D 1 77  ? -129.093 -33.193 -140.738 1.00 120.41 ? 77  TRP D CZ3 1 
ATOM   5007 C CH2 . TRP D 1 77  ? -128.118 -34.197 -140.845 1.00 120.73 ? 77  TRP D CH2 1 
ATOM   5008 N N   . LEU D 1 78  ? -125.348 -28.419 -136.990 1.00 113.46 ? 78  LEU D N   1 
ATOM   5009 C CA  . LEU D 1 78  ? -124.226 -28.294 -136.070 1.00 113.08 ? 78  LEU D CA  1 
ATOM   5010 C C   . LEU D 1 78  ? -124.669 -27.949 -134.646 1.00 112.83 ? 78  LEU D C   1 
ATOM   5011 O O   . LEU D 1 78  ? -124.207 -28.559 -133.675 1.00 112.99 ? 78  LEU D O   1 
ATOM   5012 C CB  . LEU D 1 78  ? -123.286 -27.195 -136.561 1.00 112.94 ? 78  LEU D CB  1 
ATOM   5013 C CG  . LEU D 1 78  ? -122.005 -27.596 -137.266 1.00 112.93 ? 78  LEU D CG  1 
ATOM   5014 C CD1 . LEU D 1 78  ? -121.781 -26.669 -138.430 1.00 113.39 ? 78  LEU D CD1 1 
ATOM   5015 C CD2 . LEU D 1 78  ? -120.845 -27.535 -136.288 1.00 112.50 ? 78  LEU D CD2 1 
ATOM   5016 N N   . TYR D 1 79  ? -125.563 -26.969 -134.531 1.00 112.10 ? 79  TYR D N   1 
ATOM   5017 C CA  . TYR D 1 79  ? -125.979 -26.456 -133.240 1.00 111.29 ? 79  TYR D CA  1 
ATOM   5018 C C   . TYR D 1 79  ? -126.852 -27.469 -132.548 1.00 110.95 ? 79  TYR D C   1 
ATOM   5019 O O   . TYR D 1 79  ? -126.446 -28.053 -131.558 1.00 111.02 ? 79  TYR D O   1 
ATOM   5020 C CB  . TYR D 1 79  ? -126.721 -25.141 -133.415 1.00 111.32 ? 79  TYR D CB  1 
ATOM   5021 C CG  . TYR D 1 79  ? -127.231 -24.493 -132.143 1.00 110.47 ? 79  TYR D CG  1 
ATOM   5022 C CD1 . TYR D 1 79  ? -126.401 -23.688 -131.364 1.00 109.54 ? 79  TYR D CD1 1 
ATOM   5023 C CD2 . TYR D 1 79  ? -128.559 -24.644 -131.748 1.00 109.40 ? 79  TYR D CD2 1 
ATOM   5024 C CE1 . TYR D 1 79  ? -126.877 -23.079 -130.220 1.00 108.67 ? 79  TYR D CE1 1 
ATOM   5025 C CE2 . TYR D 1 79  ? -129.039 -24.037 -130.603 1.00 108.55 ? 79  TYR D CE2 1 
ATOM   5026 C CZ  . TYR D 1 79  ? -128.195 -23.255 -129.847 1.00 108.49 ? 79  TYR D CZ  1 
ATOM   5027 O OH  . TYR D 1 79  ? -128.671 -22.654 -128.709 1.00 108.74 ? 79  TYR D OH  1 
ATOM   5028 N N   . SER D 1 80  ? -128.043 -27.704 -133.072 1.00 110.57 ? 80  SER D N   1 
ATOM   5029 C CA  . SER D 1 80  ? -128.953 -28.638 -132.421 1.00 110.52 ? 80  SER D CA  1 
ATOM   5030 C C   . SER D 1 80  ? -128.233 -29.913 -131.964 1.00 110.42 ? 80  SER D C   1 
ATOM   5031 O O   . SER D 1 80  ? -128.543 -30.469 -130.900 1.00 110.31 ? 80  SER D O   1 
ATOM   5032 C CB  . SER D 1 80  ? -130.123 -28.969 -133.342 1.00 110.58 ? 80  SER D CB  1 
ATOM   5033 O OG  . SER D 1 80  ? -130.939 -27.831 -133.521 1.00 110.27 ? 80  SER D OG  1 
ATOM   5034 N N   . ALA D 1 81  ? -127.268 -30.351 -132.771 1.00 110.20 ? 81  ALA D N   1 
ATOM   5035 C CA  . ALA D 1 81  ? -126.437 -31.503 -132.447 1.00 110.08 ? 81  ALA D CA  1 
ATOM   5036 C C   . ALA D 1 81  ? -125.584 -31.209 -131.220 1.00 109.89 ? 81  ALA D C   1 
ATOM   5037 O O   . ALA D 1 81  ? -125.642 -31.930 -130.225 1.00 109.82 ? 81  ALA D O   1 
ATOM   5038 C CB  . ALA D 1 81  ? -125.554 -31.882 -133.642 1.00 110.15 ? 81  ALA D CB  1 
ATOM   5039 N N   . PHE D 1 82  ? -124.802 -30.138 -131.303 1.00 109.74 ? 82  PHE D N   1 
ATOM   5040 C CA  . PHE D 1 82  ? -123.952 -29.682 -130.203 1.00 109.67 ? 82  PHE D CA  1 
ATOM   5041 C C   . PHE D 1 82  ? -124.735 -29.477 -128.907 1.00 109.81 ? 82  PHE D C   1 
ATOM   5042 O O   . PHE D 1 82  ? -124.292 -29.898 -127.841 1.00 109.92 ? 82  PHE D O   1 
ATOM   5043 C CB  . PHE D 1 82  ? -123.260 -28.387 -130.611 1.00 109.53 ? 82  PHE D CB  1 
ATOM   5044 C CG  . PHE D 1 82  ? -122.407 -27.779 -129.549 1.00 108.18 ? 82  PHE D CG  1 
ATOM   5045 C CD1 . PHE D 1 82  ? -122.977 -27.095 -128.494 1.00 106.90 ? 82  PHE D CD1 1 
ATOM   5046 C CD2 . PHE D 1 82  ? -121.027 -27.847 -129.644 1.00 107.58 ? 82  PHE D CD2 1 
ATOM   5047 C CE1 . PHE D 1 82  ? -122.189 -26.514 -127.535 1.00 107.69 ? 82  PHE D CE1 1 
ATOM   5048 C CE2 . PHE D 1 82  ? -120.230 -27.266 -128.693 1.00 107.89 ? 82  PHE D CE2 1 
ATOM   5049 C CZ  . PHE D 1 82  ? -120.809 -26.598 -127.630 1.00 108.17 ? 82  PHE D CZ  1 
ATOM   5050 N N   . ARG D 1 83  ? -125.893 -28.830 -129.001 1.00 109.87 ? 83  ARG D N   1 
ATOM   5051 C CA  . ARG D 1 83  ? -126.747 -28.673 -127.838 1.00 110.03 ? 83  ARG D CA  1 
ATOM   5052 C C   . ARG D 1 83  ? -127.199 -30.033 -127.360 1.00 110.31 ? 83  ARG D C   1 
ATOM   5053 O O   . ARG D 1 83  ? -127.227 -30.290 -126.162 1.00 110.54 ? 83  ARG D O   1 
ATOM   5054 C CB  . ARG D 1 83  ? -127.943 -27.762 -128.119 1.00 109.77 ? 83  ARG D CB  1 
ATOM   5055 C CG  . ARG D 1 83  ? -127.580 -26.285 -128.244 1.00 109.77 ? 83  ARG D CG  1 
ATOM   5056 C CD  . ARG D 1 83  ? -126.897 -25.697 -126.990 1.00 110.68 ? 83  ARG D CD  1 
ATOM   5057 N NE  . ARG D 1 83  ? -127.843 -25.394 -125.916 1.00 111.67 ? 83  ARG D NE  1 
ATOM   5058 C CZ  . ARG D 1 83  ? -127.944 -26.061 -124.765 1.00 112.24 ? 83  ARG D CZ  1 
ATOM   5059 N NH1 . ARG D 1 83  ? -127.146 -27.083 -124.487 1.00 112.26 ? 83  ARG D NH1 1 
ATOM   5060 N NH2 . ARG D 1 83  ? -128.856 -25.695 -123.877 1.00 112.76 ? 83  ARG D NH2 1 
ATOM   5061 N N   . GLY D 1 84  ? -127.515 -30.914 -128.301 1.00 110.67 ? 84  GLY D N   1 
ATOM   5062 C CA  . GLY D 1 84  ? -127.955 -32.261 -127.964 1.00 111.10 ? 84  GLY D CA  1 
ATOM   5063 C C   . GLY D 1 84  ? -126.942 -33.005 -127.123 1.00 111.34 ? 84  GLY D C   1 
ATOM   5064 O O   . GLY D 1 84  ? -127.256 -33.432 -126.013 1.00 111.29 ? 84  GLY D O   1 
ATOM   5065 N N   . VAL D 1 85  ? -125.728 -33.140 -127.656 1.00 111.70 ? 85  VAL D N   1 
ATOM   5066 C CA  . VAL D 1 85  ? -124.621 -33.814 -126.976 1.00 112.21 ? 85  VAL D CA  1 
ATOM   5067 C C   . VAL D 1 85  ? -124.530 -33.403 -125.511 1.00 112.44 ? 85  VAL D C   1 
ATOM   5068 O O   . VAL D 1 85  ? -124.744 -34.229 -124.630 1.00 112.52 ? 85  VAL D O   1 
ATOM   5069 C CB  . VAL D 1 85  ? -123.262 -33.557 -127.698 1.00 112.33 ? 85  VAL D CB  1 
ATOM   5070 C CG1 . VAL D 1 85  ? -122.062 -33.681 -126.743 1.00 112.05 ? 85  VAL D CG1 1 
ATOM   5071 C CG2 . VAL D 1 85  ? -123.102 -34.504 -128.874 1.00 113.02 ? 85  VAL D CG2 1 
ATOM   5072 N N   . GLN D 1 86  ? -124.252 -32.122 -125.270 1.00 112.63 ? 86  GLN D N   1 
ATOM   5073 C CA  . GLN D 1 86  ? -123.953 -31.612 -123.929 1.00 112.76 ? 86  GLN D CA  1 
ATOM   5074 C C   . GLN D 1 86  ? -125.095 -31.758 -122.901 1.00 113.27 ? 86  GLN D C   1 
ATOM   5075 O O   . GLN D 1 86  ? -124.854 -32.159 -121.751 1.00 113.38 ? 86  GLN D O   1 
ATOM   5076 C CB  . GLN D 1 86  ? -123.451 -30.165 -124.007 1.00 112.42 ? 86  GLN D CB  1 
ATOM   5077 C CG  . GLN D 1 86  ? -124.407 -29.177 -124.643 1.00 111.44 ? 86  GLN D CG  1 
ATOM   5078 C CD  . GLN D 1 86  ? -123.771 -27.828 -124.861 1.00 111.09 ? 86  GLN D CD  1 
ATOM   5079 O OE1 . GLN D 1 86  ? -124.455 -26.813 -124.986 1.00 111.27 ? 86  GLN D OE1 1 
ATOM   5080 N NE2 . GLN D 1 86  ? -122.449 -27.805 -124.904 1.00 111.31 ? 86  GLN D NE2 1 
ATOM   5081 N N   . LEU D 1 87  ? -126.323 -31.435 -123.309 1.00 113.66 ? 87  LEU D N   1 
ATOM   5082 C CA  . LEU D 1 87  ? -127.482 -31.671 -122.465 1.00 114.07 ? 87  LEU D CA  1 
ATOM   5083 C C   . LEU D 1 87  ? -127.520 -33.154 -122.131 1.00 114.38 ? 87  LEU D C   1 
ATOM   5084 O O   . LEU D 1 87  ? -127.417 -33.529 -120.962 1.00 114.50 ? 87  LEU D O   1 
ATOM   5085 C CB  . LEU D 1 87  ? -128.782 -31.263 -123.163 1.00 114.19 ? 87  LEU D CB  1 
ATOM   5086 C CG  . LEU D 1 87  ? -129.127 -29.814 -123.522 1.00 114.52 ? 87  LEU D CG  1 
ATOM   5087 C CD1 . LEU D 1 87  ? -130.494 -29.811 -124.187 1.00 114.97 ? 87  LEU D CD1 1 
ATOM   5088 C CD2 . LEU D 1 87  ? -129.119 -28.861 -122.327 1.00 114.67 ? 87  LEU D CD2 1 
ATOM   5089 N N   . THR D 1 88  ? -127.629 -33.987 -123.167 1.00 114.64 ? 88  THR D N   1 
ATOM   5090 C CA  . THR D 1 88  ? -127.658 -35.443 -123.011 1.00 115.05 ? 88  THR D CA  1 
ATOM   5091 C C   . THR D 1 88  ? -126.446 -35.995 -122.258 1.00 115.21 ? 88  THR D C   1 
ATOM   5092 O O   . THR D 1 88  ? -126.540 -37.023 -121.587 1.00 115.14 ? 88  THR D O   1 
ATOM   5093 C CB  . THR D 1 88  ? -127.787 -36.172 -124.373 1.00 115.19 ? 88  THR D CB  1 
ATOM   5094 O OG1 . THR D 1 88  ? -126.786 -35.694 -125.286 1.00 115.54 ? 88  THR D OG1 1 
ATOM   5095 C CG2 . THR D 1 88  ? -129.166 -35.965 -124.976 1.00 114.97 ? 88  THR D CG2 1 
ATOM   5096 N N   . TYR D 1 89  ? -125.317 -35.306 -122.377 1.00 115.62 ? 89  TYR D N   1 
ATOM   5097 C CA  . TYR D 1 89  ? -124.088 -35.710 -121.714 1.00 116.13 ? 89  TYR D CA  1 
ATOM   5098 C C   . TYR D 1 89  ? -124.239 -35.590 -120.215 1.00 116.81 ? 89  TYR D C   1 
ATOM   5099 O O   . TYR D 1 89  ? -124.153 -36.578 -119.493 1.00 116.76 ? 89  TYR D O   1 
ATOM   5100 C CB  . TYR D 1 89  ? -122.910 -34.853 -122.192 1.00 115.96 ? 89  TYR D CB  1 
ATOM   5101 C CG  . TYR D 1 89  ? -121.665 -35.049 -121.381 1.00 114.99 ? 89  TYR D CG  1 
ATOM   5102 C CD1 . TYR D 1 89  ? -121.338 -34.159 -120.363 1.00 114.50 ? 89  TYR D CD1 1 
ATOM   5103 C CD2 . TYR D 1 89  ? -120.825 -36.133 -121.615 1.00 113.63 ? 89  TYR D CD2 1 
ATOM   5104 C CE1 . TYR D 1 89  ? -120.210 -34.335 -119.600 1.00 114.64 ? 89  TYR D CE1 1 
ATOM   5105 C CE2 . TYR D 1 89  ? -119.691 -36.318 -120.860 1.00 113.95 ? 89  TYR D CE2 1 
ATOM   5106 C CZ  . TYR D 1 89  ? -119.389 -35.414 -119.849 1.00 114.76 ? 89  TYR D CZ  1 
ATOM   5107 O OH  . TYR D 1 89  ? -118.258 -35.576 -119.084 1.00 115.96 ? 89  TYR D OH  1 
ATOM   5108 N N   . GLU D 1 90  ? -124.471 -34.368 -119.753 1.00 117.72 ? 90  GLU D N   1 
ATOM   5109 C CA  . GLU D 1 90  ? -124.564 -34.110 -118.331 1.00 118.69 ? 90  GLU D CA  1 
ATOM   5110 C C   . GLU D 1 90  ? -125.779 -34.797 -117.715 1.00 119.12 ? 90  GLU D C   1 
ATOM   5111 O O   . GLU D 1 90  ? -125.809 -35.052 -116.514 1.00 119.35 ? 90  GLU D O   1 
ATOM   5112 C CB  . GLU D 1 90  ? -124.561 -32.609 -118.051 1.00 118.85 ? 90  GLU D CB  1 
ATOM   5113 C CG  . GLU D 1 90  ? -125.807 -31.868 -118.472 1.00 119.55 ? 90  GLU D CG  1 
ATOM   5114 C CD  . GLU D 1 90  ? -126.213 -30.825 -117.443 1.00 121.50 ? 90  GLU D CD  1 
ATOM   5115 O OE1 . GLU D 1 90  ? -125.343 -30.037 -116.987 1.00 121.46 ? 90  GLU D OE1 1 
ATOM   5116 O OE2 . GLU D 1 90  ? -127.412 -30.804 -117.082 1.00 122.78 ? 90  GLU D OE2 1 
ATOM   5117 N N   . HIS D 1 91  ? -126.766 -35.105 -118.551 1.00 119.79 ? 91  HIS D N   1 
ATOM   5118 C CA  . HIS D 1 91  ? -127.886 -35.955 -118.164 1.00 120.38 ? 91  HIS D CA  1 
ATOM   5119 C C   . HIS D 1 91  ? -127.373 -37.347 -117.812 1.00 121.04 ? 91  HIS D C   1 
ATOM   5120 O O   . HIS D 1 91  ? -127.855 -37.979 -116.871 1.00 120.95 ? 91  HIS D O   1 
ATOM   5121 C CB  . HIS D 1 91  ? -128.889 -36.054 -119.310 1.00 120.19 ? 91  HIS D CB  1 
ATOM   5122 C CG  . HIS D 1 91  ? -130.211 -36.618 -118.906 1.00 119.87 ? 91  HIS D CG  1 
ATOM   5123 N ND1 . HIS D 1 91  ? -131.375 -35.886 -118.958 1.00 120.18 ? 91  HIS D ND1 1 
ATOM   5124 C CD2 . HIS D 1 91  ? -130.555 -37.839 -118.436 1.00 120.05 ? 91  HIS D CD2 1 
ATOM   5125 C CE1 . HIS D 1 91  ? -132.382 -36.633 -118.543 1.00 120.65 ? 91  HIS D CE1 1 
ATOM   5126 N NE2 . HIS D 1 91  ? -131.912 -37.823 -118.219 1.00 120.36 ? 91  HIS D NE2 1 
ATOM   5127 N N   . THR D 1 92  ? -126.392 -37.815 -118.580 1.00 122.07 ? 92  THR D N   1 
ATOM   5128 C CA  . THR D 1 92  ? -125.753 -39.102 -118.321 1.00 123.00 ? 92  THR D CA  1 
ATOM   5129 C C   . THR D 1 92  ? -124.925 -39.002 -117.032 1.00 123.61 ? 92  THR D C   1 
ATOM   5130 O O   . THR D 1 92  ? -124.970 -39.920 -116.201 1.00 123.77 ? 92  THR D O   1 
ATOM   5131 C CB  . THR D 1 92  ? -124.902 -39.601 -119.535 1.00 122.99 ? 92  THR D CB  1 
ATOM   5132 O OG1 . THR D 1 92  ? -125.608 -39.357 -120.759 1.00 122.95 ? 92  THR D OG1 1 
ATOM   5133 C CG2 . THR D 1 92  ? -124.615 -41.095 -119.425 1.00 122.89 ? 92  THR D CG2 1 
ATOM   5134 N N   . MET D 1 93  ? -124.207 -37.883 -116.858 1.00 124.25 ? 93  MET D N   1 
ATOM   5135 C CA  . MET D 1 93  ? -123.505 -37.588 -115.596 1.00 124.89 ? 93  MET D CA  1 
ATOM   5136 C C   . MET D 1 93  ? -124.455 -37.739 -114.419 1.00 125.25 ? 93  MET D C   1 
ATOM   5137 O O   . MET D 1 93  ? -124.126 -38.391 -113.433 1.00 125.35 ? 93  MET D O   1 
ATOM   5138 C CB  . MET D 1 93  ? -122.908 -36.175 -115.577 1.00 124.85 ? 93  MET D CB  1 
ATOM   5139 C CG  . MET D 1 93  ? -121.700 -35.939 -116.494 1.00 125.50 ? 93  MET D CG  1 
ATOM   5140 S SD  . MET D 1 93  ? -120.433 -37.236 -116.505 1.00 125.58 ? 93  MET D SD  1 
ATOM   5141 C CE  . MET D 1 93  ? -118.960 -36.280 -116.121 1.00 124.99 ? 93  MET D CE  1 
ATOM   5142 N N   . LEU D 1 94  ? -125.645 -37.155 -114.550 1.00 125.83 ? 94  LEU D N   1 
ATOM   5143 C CA  . LEU D 1 94  ? -126.670 -37.184 -113.508 1.00 126.38 ? 94  LEU D CA  1 
ATOM   5144 C C   . LEU D 1 94  ? -127.206 -38.584 -113.262 1.00 126.86 ? 94  LEU D C   1 
ATOM   5145 O O   . LEU D 1 94  ? -127.756 -38.865 -112.202 1.00 126.90 ? 94  LEU D O   1 
ATOM   5146 C CB  . LEU D 1 94  ? -127.819 -36.259 -113.889 1.00 126.28 ? 94  LEU D CB  1 
ATOM   5147 C CG  . LEU D 1 94  ? -128.529 -35.489 -112.777 1.00 126.45 ? 94  LEU D CG  1 
ATOM   5148 C CD1 . LEU D 1 94  ? -129.061 -34.181 -113.345 1.00 126.81 ? 94  LEU D CD1 1 
ATOM   5149 C CD2 . LEU D 1 94  ? -129.650 -36.293 -112.121 1.00 126.67 ? 94  LEU D CD2 1 
ATOM   5150 N N   . GLN D 1 95  ? -127.049 -39.457 -114.246 1.00 127.66 ? 95  GLN D N   1 
ATOM   5151 C CA  . GLN D 1 95  ? -127.507 -40.828 -114.114 1.00 128.56 ? 95  GLN D CA  1 
ATOM   5152 C C   . GLN D 1 95  ? -126.443 -41.740 -113.530 1.00 129.05 ? 95  GLN D C   1 
ATOM   5153 O O   . GLN D 1 95  ? -126.768 -42.681 -112.814 1.00 128.97 ? 95  GLN D O   1 
ATOM   5154 C CB  . GLN D 1 95  ? -128.012 -41.357 -115.460 1.00 128.58 ? 95  GLN D CB  1 
ATOM   5155 C CG  . GLN D 1 95  ? -129.545 -41.481 -115.567 1.00 129.19 ? 95  GLN D CG  1 
ATOM   5156 C CD  . GLN D 1 95  ? -130.330 -40.268 -115.037 1.00 130.06 ? 95  GLN D CD  1 
ATOM   5157 O OE1 . GLN D 1 95  ? -129.855 -39.129 -115.072 1.00 130.53 ? 95  GLN D OE1 1 
ATOM   5158 N NE2 . GLN D 1 95  ? -131.548 -40.519 -114.557 1.00 130.04 ? 95  GLN D NE2 1 
ATOM   5159 N N   . LEU D 1 96  ? -125.178 -41.451 -113.826 1.00 129.89 ? 96  LEU D N   1 
ATOM   5160 C CA  . LEU D 1 96  ? -124.075 -42.327 -113.419 1.00 130.82 ? 96  LEU D CA  1 
ATOM   5161 C C   . LEU D 1 96  ? -123.302 -41.833 -112.200 1.00 131.41 ? 96  LEU D C   1 
ATOM   5162 O O   . LEU D 1 96  ? -122.587 -42.598 -111.558 1.00 131.32 ? 96  LEU D O   1 
ATOM   5163 C CB  . LEU D 1 96  ? -123.118 -42.613 -114.596 1.00 130.76 ? 96  LEU D CB  1 
ATOM   5164 C CG  . LEU D 1 96  ? -123.509 -43.692 -115.625 1.00 130.71 ? 96  LEU D CG  1 
ATOM   5165 C CD1 . LEU D 1 96  ? -122.554 -43.684 -116.814 1.00 130.56 ? 96  LEU D CD1 1 
ATOM   5166 C CD2 . LEU D 1 96  ? -123.584 -45.100 -115.014 1.00 130.28 ? 96  LEU D CD2 1 
ATOM   5167 N N   . TYR D 1 97  ? -123.446 -40.553 -111.884 1.00 132.47 ? 97  TYR D N   1 
ATOM   5168 C CA  . TYR D 1 97  ? -122.726 -39.959 -110.759 1.00 133.53 ? 97  TYR D CA  1 
ATOM   5169 C C   . TYR D 1 97  ? -123.581 -38.899 -110.061 1.00 134.40 ? 97  TYR D C   1 
ATOM   5170 O O   . TYR D 1 97  ? -123.152 -37.750 -109.931 1.00 134.44 ? 97  TYR D O   1 
ATOM   5171 C CB  . TYR D 1 97  ? -121.400 -39.337 -111.234 1.00 133.43 ? 97  TYR D CB  1 
ATOM   5172 C CG  . TYR D 1 97  ? -120.500 -40.289 -111.979 1.00 133.12 ? 97  TYR D CG  1 
ATOM   5173 C CD1 . TYR D 1 97  ? -120.515 -40.352 -113.368 1.00 132.67 ? 97  TYR D CD1 1 
ATOM   5174 C CD2 . TYR D 1 97  ? -119.644 -41.138 -111.291 1.00 133.16 ? 97  TYR D CD2 1 
ATOM   5175 C CE1 . TYR D 1 97  ? -119.693 -41.238 -114.052 1.00 132.76 ? 97  TYR D CE1 1 
ATOM   5176 C CE2 . TYR D 1 97  ? -118.815 -42.023 -111.965 1.00 133.02 ? 97  TYR D CE2 1 
ATOM   5177 C CZ  . TYR D 1 97  ? -118.843 -42.069 -113.342 1.00 132.62 ? 97  TYR D CZ  1 
ATOM   5178 O OH  . TYR D 1 97  ? -118.018 -42.950 -113.995 1.00 132.00 ? 97  TYR D OH  1 
ATOM   5179 N N   . PRO D 1 98  ? -124.787 -39.277 -109.594 1.00 135.33 ? 98  PRO D N   1 
ATOM   5180 C CA  . PRO D 1 98  ? -125.657 -38.241 -109.043 1.00 136.31 ? 98  PRO D CA  1 
ATOM   5181 C C   . PRO D 1 98  ? -124.998 -37.528 -107.862 1.00 137.45 ? 98  PRO D C   1 
ATOM   5182 O O   . PRO D 1 98  ? -124.235 -38.141 -107.116 1.00 137.57 ? 98  PRO D O   1 
ATOM   5183 C CB  . PRO D 1 98  ? -126.901 -39.019 -108.600 1.00 136.20 ? 98  PRO D CB  1 
ATOM   5184 C CG  . PRO D 1 98  ? -126.441 -40.415 -108.413 1.00 135.60 ? 98  PRO D CG  1 
ATOM   5185 C CD  . PRO D 1 98  ? -125.341 -40.628 -109.401 1.00 135.36 ? 98  PRO D CD  1 
ATOM   5186 N N   . SER D 1 99  ? -125.274 -36.237 -107.718 1.00 138.80 ? 99  SER D N   1 
ATOM   5187 C CA  . SER D 1 99  ? -124.715 -35.440 -106.636 1.00 140.24 ? 99  SER D CA  1 
ATOM   5188 C C   . SER D 1 99  ? -125.139 -36.011 -105.285 1.00 141.50 ? 99  SER D C   1 
ATOM   5189 O O   . SER D 1 99  ? -126.068 -36.820 -105.221 1.00 141.55 ? 99  SER D O   1 
ATOM   5190 C CB  . SER D 1 99  ? -125.203 -33.998 -106.752 1.00 140.22 ? 99  SER D CB  1 
ATOM   5191 O OG  . SER D 1 99  ? -126.536 -33.871 -106.282 1.00 140.35 ? 99  SER D OG  1 
ATOM   5192 N N   . PRO D 1 100 ? -124.472 -35.585 -104.195 1.00 142.79 ? 100 PRO D N   1 
ATOM   5193 C CA  . PRO D 1 100 ? -124.938 -35.950 -102.864 1.00 143.93 ? 100 PRO D CA  1 
ATOM   5194 C C   . PRO D 1 100 ? -126.283 -35.317 -102.527 1.00 145.23 ? 100 PRO D C   1 
ATOM   5195 O O   . PRO D 1 100 ? -126.750 -35.444 -101.400 1.00 145.38 ? 100 PRO D O   1 
ATOM   5196 C CB  . PRO D 1 100 ? -123.853 -35.375 -101.946 1.00 143.79 ? 100 PRO D CB  1 
ATOM   5197 C CG  . PRO D 1 100 ? -122.658 -35.276 -102.795 1.00 143.27 ? 100 PRO D CG  1 
ATOM   5198 C CD  . PRO D 1 100 ? -123.183 -34.877 -104.131 1.00 142.88 ? 100 PRO D CD  1 
ATOM   5199 N N   . PHE D 1 101 ? -126.905 -34.663 -103.505 1.00 146.83 ? 101 PHE D N   1 
ATOM   5200 C CA  . PHE D 1 101 ? -128.099 -33.863 -103.255 1.00 148.45 ? 101 PHE D CA  1 
ATOM   5201 C C   . PHE D 1 101 ? -129.340 -34.319 -104.029 1.00 149.92 ? 101 PHE D C   1 
ATOM   5202 O O   . PHE D 1 101 ? -130.374 -34.621 -103.417 1.00 150.16 ? 101 PHE D O   1 
ATOM   5203 C CB  . PHE D 1 101 ? -127.787 -32.388 -103.511 1.00 148.11 ? 101 PHE D CB  1 
ATOM   5204 C CG  . PHE D 1 101 ? -126.524 -31.919 -102.841 1.00 147.57 ? 101 PHE D CG  1 
ATOM   5205 C CD1 . PHE D 1 101 ? -125.403 -31.594 -103.588 1.00 147.05 ? 101 PHE D CD1 1 
ATOM   5206 C CD2 . PHE D 1 101 ? -126.448 -31.832 -101.457 1.00 146.88 ? 101 PHE D CD2 1 
ATOM   5207 C CE1 . PHE D 1 101 ? -124.229 -31.170 -102.968 1.00 146.44 ? 101 PHE D CE1 1 
ATOM   5208 C CE2 . PHE D 1 101 ? -125.282 -31.411 -100.833 1.00 146.47 ? 101 PHE D CE2 1 
ATOM   5209 C CZ  . PHE D 1 101 ? -124.171 -31.078 -101.591 1.00 146.27 ? 101 PHE D CZ  1 
ATOM   5210 N N   . ALA D 1 102 ? -129.221 -34.383 -105.360 1.00 151.66 ? 102 ALA D N   1 
ATOM   5211 C CA  . ALA D 1 102 ? -130.336 -34.692 -106.283 1.00 153.29 ? 102 ALA D CA  1 
ATOM   5212 C C   . ALA D 1 102 ? -131.402 -33.583 -106.336 1.00 154.49 ? 102 ALA D C   1 
ATOM   5213 O O   . ALA D 1 102 ? -131.496 -32.753 -105.427 1.00 154.54 ? 102 ALA D O   1 
ATOM   5214 C CB  . ALA D 1 102 ? -130.966 -36.073 -105.978 1.00 153.08 ? 102 ALA D CB  1 
ATOM   5215 N N   . THR D 1 103 ? -132.186 -33.562 -107.415 1.00 156.17 ? 103 THR D N   1 
ATOM   5216 C CA  . THR D 1 103 ? -133.222 -32.541 -107.597 1.00 157.88 ? 103 THR D CA  1 
ATOM   5217 C C   . THR D 1 103 ? -134.480 -33.099 -108.274 1.00 159.16 ? 103 THR D C   1 
ATOM   5218 O O   . THR D 1 103 ? -135.547 -33.146 -107.648 1.00 159.16 ? 103 THR D O   1 
ATOM   5219 C CB  . THR D 1 103 ? -132.687 -31.303 -108.376 1.00 157.85 ? 103 THR D CB  1 
ATOM   5220 O OG1 . THR D 1 103 ? -131.381 -30.952 -107.894 1.00 157.80 ? 103 THR D OG1 1 
ATOM   5221 C CG2 . THR D 1 103 ? -133.630 -30.103 -108.214 1.00 157.85 ? 103 THR D CG2 1 
ATOM   5222 N N   . CYS D 1 104 ? -134.338 -33.513 -109.540 1.00 160.87 ? 104 CYS D N   1 
ATOM   5223 C CA  . CYS D 1 104 ? -135.435 -34.076 -110.357 1.00 162.58 ? 104 CYS D CA  1 
ATOM   5224 C C   . CYS D 1 104 ? -136.610 -33.087 -110.535 1.00 162.92 ? 104 CYS D C   1 
ATOM   5225 O O   . CYS D 1 104 ? -137.783 -33.454 -110.386 1.00 163.06 ? 104 CYS D O   1 
ATOM   5226 C CB  . CYS D 1 104 ? -135.895 -35.434 -109.779 1.00 163.05 ? 104 CYS D CB  1 
ATOM   5227 S SG  . CYS D 1 104 ? -137.255 -36.286 -110.651 1.00 165.99 ? 104 CYS D SG  1 
ATOM   5228 N N   . ASP D 1 105 ? -136.282 -31.836 -110.867 1.00 163.43 ? 105 ASP D N   1 
ATOM   5229 C CA  . ASP D 1 105 ? -137.272 -30.742 -110.929 1.00 163.83 ? 105 ASP D CA  1 
ATOM   5230 C C   . ASP D 1 105 ? -138.168 -30.747 -112.181 1.00 164.30 ? 105 ASP D C   1 
ATOM   5231 O O   . ASP D 1 105 ? -138.039 -31.623 -113.042 1.00 164.33 ? 105 ASP D O   1 
ATOM   5232 C CB  . ASP D 1 105 ? -136.595 -29.371 -110.745 1.00 163.69 ? 105 ASP D CB  1 
ATOM   5233 C CG  . ASP D 1 105 ? -135.438 -29.144 -111.707 1.00 163.19 ? 105 ASP D CG  1 
ATOM   5234 O OD1 . ASP D 1 105 ? -135.444 -28.109 -112.409 1.00 162.18 ? 105 ASP D OD1 1 
ATOM   5235 O OD2 . ASP D 1 105 ? -134.519 -29.990 -111.752 1.00 162.73 ? 105 ASP D OD2 1 
ATOM   5236 N N   . PHE D 1 106 ? -139.082 -29.772 -112.253 1.00 164.87 ? 106 PHE D N   1 
ATOM   5237 C CA  . PHE D 1 106 ? -140.050 -29.627 -113.363 1.00 165.43 ? 106 PHE D CA  1 
ATOM   5238 C C   . PHE D 1 106 ? -140.129 -28.159 -113.844 1.00 165.74 ? 106 PHE D C   1 
ATOM   5239 O O   . PHE D 1 106 ? -139.781 -27.250 -113.076 1.00 165.86 ? 106 PHE D O   1 
ATOM   5240 C CB  . PHE D 1 106 ? -141.450 -30.109 -112.932 1.00 165.39 ? 106 PHE D CB  1 
ATOM   5241 C CG  . PHE D 1 106 ? -141.454 -31.435 -112.213 1.00 165.53 ? 106 PHE D CG  1 
ATOM   5242 C CD1 . PHE D 1 106 ? -141.367 -31.490 -110.820 1.00 165.76 ? 106 PHE D CD1 1 
ATOM   5243 C CD2 . PHE D 1 106 ? -141.549 -32.628 -112.924 1.00 165.65 ? 106 PHE D CD2 1 
ATOM   5244 C CE1 . PHE D 1 106 ? -141.365 -32.718 -110.146 1.00 165.88 ? 106 PHE D CE1 1 
ATOM   5245 C CE2 . PHE D 1 106 ? -141.551 -33.860 -112.262 1.00 165.80 ? 106 PHE D CE2 1 
ATOM   5246 C CZ  . PHE D 1 106 ? -141.458 -33.904 -110.870 1.00 165.84 ? 106 PHE D CZ  1 
ATOM   5247 N N   . MET D 1 107 ? -140.559 -27.948 -115.104 1.00 166.03 ? 107 MET D N   1 
ATOM   5248 C CA  . MET D 1 107 ? -140.896 -26.612 -115.692 1.00 166.27 ? 107 MET D CA  1 
ATOM   5249 C C   . MET D 1 107 ? -140.517 -26.400 -117.183 1.00 166.20 ? 107 MET D C   1 
ATOM   5250 O O   . MET D 1 107 ? -140.234 -27.362 -117.910 1.00 166.10 ? 107 MET D O   1 
ATOM   5251 C CB  . MET D 1 107 ? -140.421 -25.423 -114.816 1.00 166.46 ? 107 MET D CB  1 
ATOM   5252 C CG  . MET D 1 107 ? -138.941 -25.007 -114.958 1.00 167.02 ? 107 MET D CG  1 
ATOM   5253 S SD  . MET D 1 107 ? -138.534 -23.549 -113.960 1.00 168.35 ? 107 MET D SD  1 
ATOM   5254 C CE  . MET D 1 107 ? -136.858 -23.205 -114.503 1.00 168.09 ? 107 MET D CE  1 
ATOM   5255 N N   . VAL D 1 108 ? -140.544 -25.132 -117.615 1.00 166.15 ? 108 VAL D N   1 
ATOM   5256 C CA  . VAL D 1 108 ? -140.167 -24.715 -118.974 1.00 166.10 ? 108 VAL D CA  1 
ATOM   5257 C C   . VAL D 1 108 ? -138.711 -25.073 -119.293 1.00 166.14 ? 108 VAL D C   1 
ATOM   5258 O O   . VAL D 1 108 ? -137.776 -24.369 -118.899 1.00 166.17 ? 108 VAL D O   1 
ATOM   5259 C CB  . VAL D 1 108 ? -140.431 -23.181 -119.244 1.00 166.09 ? 108 VAL D CB  1 
ATOM   5260 C CG1 . VAL D 1 108 ? -141.901 -22.916 -119.577 1.00 165.95 ? 108 VAL D CG1 1 
ATOM   5261 C CG2 . VAL D 1 108 ? -139.967 -22.305 -118.080 1.00 165.95 ? 108 VAL D CG2 1 
ATOM   5262 N N   . LEU D 1 114 ? -140.708 -15.990 -126.076 1.00 182.86 ? 114 LEU D N   1 
ATOM   5263 C CA  . LEU D 1 114 ? -141.695 -17.003 -126.437 1.00 182.93 ? 114 LEU D CA  1 
ATOM   5264 C C   . LEU D 1 114 ? -142.258 -17.744 -125.215 1.00 183.12 ? 114 LEU D C   1 
ATOM   5265 O O   . LEU D 1 114 ? -141.555 -17.933 -124.214 1.00 183.14 ? 114 LEU D O   1 
ATOM   5266 C CB  . LEU D 1 114 ? -141.093 -18.008 -127.434 1.00 182.79 ? 114 LEU D CB  1 
ATOM   5267 C CG  . LEU D 1 114 ? -141.862 -19.300 -127.758 1.00 182.46 ? 114 LEU D CG  1 
ATOM   5268 C CD1 . LEU D 1 114 ? -142.983 -19.065 -128.766 1.00 182.28 ? 114 LEU D CD1 1 
ATOM   5269 C CD2 . LEU D 1 114 ? -140.930 -20.394 -128.245 1.00 181.94 ? 114 LEU D CD2 1 
ATOM   5270 N N   . PRO D 1 115 ? -143.545 -18.133 -125.287 1.00 183.24 ? 115 PRO D N   1 
ATOM   5271 C CA  . PRO D 1 115 ? -144.120 -19.162 -124.418 1.00 183.29 ? 115 PRO D CA  1 
ATOM   5272 C C   . PRO D 1 115 ? -143.709 -20.589 -124.849 1.00 183.26 ? 115 PRO D C   1 
ATOM   5273 O O   . PRO D 1 115 ? -143.928 -20.976 -126.001 1.00 183.23 ? 115 PRO D O   1 
ATOM   5274 C CB  . PRO D 1 115 ? -145.631 -18.952 -124.590 1.00 183.32 ? 115 PRO D CB  1 
ATOM   5275 C CG  . PRO D 1 115 ? -145.777 -17.551 -125.091 1.00 183.29 ? 115 PRO D CG  1 
ATOM   5276 C CD  . PRO D 1 115 ? -144.595 -17.357 -125.975 1.00 183.21 ? 115 PRO D CD  1 
ATOM   5277 N N   . LEU D 1 116 ? -143.122 -21.350 -123.921 1.00 183.22 ? 116 LEU D N   1 
ATOM   5278 C CA  . LEU D 1 116 ? -142.591 -22.702 -124.192 1.00 183.13 ? 116 LEU D CA  1 
ATOM   5279 C C   . LEU D 1 116 ? -143.636 -23.821 -124.041 1.00 183.11 ? 116 LEU D C   1 
ATOM   5280 O O   . LEU D 1 116 ? -144.137 -24.346 -125.040 1.00 183.02 ? 116 LEU D O   1 
ATOM   5281 C CB  . LEU D 1 116 ? -141.334 -22.963 -123.327 1.00 183.13 ? 116 LEU D CB  1 
ATOM   5282 C CG  . LEU D 1 116 ? -140.699 -24.324 -122.962 1.00 182.75 ? 116 LEU D CG  1 
ATOM   5283 C CD1 . LEU D 1 116 ? -140.839 -25.430 -124.012 1.00 182.19 ? 116 LEU D CD1 1 
ATOM   5284 C CD2 . LEU D 1 116 ? -139.233 -24.100 -122.638 1.00 182.46 ? 116 LEU D CD2 1 
ATOM   5285 N N   . ASP D 1 117 ? -143.938 -24.186 -122.793 1.00 183.10 ? 117 ASP D N   1 
ATOM   5286 C CA  . ASP D 1 117 ? -145.004 -25.134 -122.458 1.00 183.09 ? 117 ASP D CA  1 
ATOM   5287 C C   . ASP D 1 117 ? -146.322 -24.795 -123.142 1.00 183.03 ? 117 ASP D C   1 
ATOM   5288 O O   . ASP D 1 117 ? -147.164 -25.669 -123.371 1.00 183.01 ? 117 ASP D O   1 
ATOM   5289 C CB  . ASP D 1 117 ? -145.256 -25.092 -120.950 1.00 183.11 ? 117 ASP D CB  1 
ATOM   5290 C CG  . ASP D 1 117 ? -144.679 -26.279 -120.222 1.00 183.35 ? 117 ASP D CG  1 
ATOM   5291 O OD1 . ASP D 1 117 ? -144.958 -27.429 -120.625 1.00 183.52 ? 117 ASP D OD1 1 
ATOM   5292 O OD2 . ASP D 1 117 ? -143.968 -26.059 -119.221 1.00 183.77 ? 117 ASP D OD2 1 
ATOM   5293 N N   . LYS D 1 118 ? -146.467 -23.515 -123.475 1.00 182.93 ? 118 LYS D N   1 
ATOM   5294 C CA  . LYS D 1 118 ? -147.762 -22.874 -123.670 1.00 182.75 ? 118 LYS D CA  1 
ATOM   5295 C C   . LYS D 1 118 ? -148.442 -23.162 -125.007 1.00 182.56 ? 118 LYS D C   1 
ATOM   5296 O O   . LYS D 1 118 ? -149.599 -23.585 -125.020 1.00 182.59 ? 118 LYS D O   1 
ATOM   5297 C CB  . LYS D 1 118 ? -147.654 -21.362 -123.402 1.00 182.79 ? 118 LYS D CB  1 
ATOM   5298 C CG  . LYS D 1 118 ? -147.247 -20.992 -121.956 1.00 183.00 ? 118 LYS D CG  1 
ATOM   5299 C CD  . LYS D 1 118 ? -145.738 -21.157 -121.708 1.00 183.39 ? 118 LYS D CD  1 
ATOM   5300 C CE  . LYS D 1 118 ? -145.406 -21.504 -120.258 1.00 183.50 ? 118 LYS D CE  1 
ATOM   5301 N NZ  . LYS D 1 118 ? -145.370 -20.314 -119.364 1.00 183.82 ? 118 LYS D NZ  1 
ATOM   5302 N N   . TRP D 1 119 ? -147.740 -22.955 -126.121 1.00 182.27 ? 119 TRP D N   1 
ATOM   5303 C CA  . TRP D 1 119 ? -148.376 -23.113 -127.433 1.00 182.01 ? 119 TRP D CA  1 
ATOM   5304 C C   . TRP D 1 119 ? -148.450 -24.561 -127.959 1.00 181.81 ? 119 TRP D C   1 
ATOM   5305 O O   . TRP D 1 119 ? -148.942 -24.781 -129.064 1.00 181.91 ? 119 TRP D O   1 
ATOM   5306 C CB  . TRP D 1 119 ? -147.788 -22.148 -128.477 1.00 182.00 ? 119 TRP D CB  1 
ATOM   5307 C CG  . TRP D 1 119 ? -148.846 -21.585 -129.412 1.00 182.30 ? 119 TRP D CG  1 
ATOM   5308 C CD1 . TRP D 1 119 ? -149.213 -22.084 -130.632 1.00 182.37 ? 119 TRP D CD1 1 
ATOM   5309 C CD2 . TRP D 1 119 ? -149.683 -20.432 -129.186 1.00 182.61 ? 119 TRP D CD2 1 
ATOM   5310 N NE1 . TRP D 1 119 ? -150.215 -21.317 -131.181 1.00 182.40 ? 119 TRP D NE1 1 
ATOM   5311 C CE2 . TRP D 1 119 ? -150.523 -20.297 -130.318 1.00 182.59 ? 119 TRP D CE2 1 
ATOM   5312 C CE3 . TRP D 1 119 ? -149.801 -19.500 -128.141 1.00 182.56 ? 119 TRP D CE3 1 
ATOM   5313 C CZ2 . TRP D 1 119 ? -151.471 -19.265 -130.434 1.00 182.51 ? 119 TRP D CZ2 1 
ATOM   5314 C CZ3 . TRP D 1 119 ? -150.746 -18.472 -128.260 1.00 182.36 ? 119 TRP D CZ3 1 
ATOM   5315 C CH2 . TRP D 1 119 ? -151.566 -18.367 -129.399 1.00 182.35 ? 119 TRP D CH2 1 
ATOM   5316 N N   . VAL D 1 120 ? -147.976 -25.533 -127.171 1.00 181.55 ? 120 VAL D N   1 
ATOM   5317 C CA  . VAL D 1 120 ? -148.184 -26.972 -127.455 1.00 181.22 ? 120 VAL D CA  1 
ATOM   5318 C C   . VAL D 1 120 ? -148.458 -27.783 -126.171 1.00 181.02 ? 120 VAL D C   1 
ATOM   5319 O O   . VAL D 1 120 ? -147.684 -27.708 -125.212 1.00 180.98 ? 120 VAL D O   1 
ATOM   5320 C CB  . VAL D 1 120 ? -147.007 -27.617 -128.253 1.00 181.23 ? 120 VAL D CB  1 
ATOM   5321 C CG1 . VAL D 1 120 ? -147.130 -29.141 -128.277 1.00 181.13 ? 120 VAL D CG1 1 
ATOM   5322 C CG2 . VAL D 1 120 ? -146.945 -27.086 -129.680 1.00 181.21 ? 120 VAL D CG2 1 
ATOM   5323 N N   . PRO D 1 121 ? -149.570 -28.552 -126.151 1.00 180.78 ? 121 PRO D N   1 
ATOM   5324 C CA  . PRO D 1 121 ? -149.943 -29.380 -124.995 1.00 180.47 ? 121 PRO D CA  1 
ATOM   5325 C C   . PRO D 1 121 ? -149.240 -30.745 -124.911 1.00 180.13 ? 121 PRO D C   1 
ATOM   5326 O O   . PRO D 1 121 ? -148.195 -30.856 -124.265 1.00 179.99 ? 121 PRO D O   1 
ATOM   5327 C CB  . PRO D 1 121 ? -151.467 -29.557 -125.160 1.00 180.49 ? 121 PRO D CB  1 
ATOM   5328 C CG  . PRO D 1 121 ? -151.878 -28.627 -126.285 1.00 180.58 ? 121 PRO D CG  1 
ATOM   5329 C CD  . PRO D 1 121 ? -150.663 -28.493 -127.139 1.00 180.78 ? 121 PRO D CD  1 
ATOM   5330 N N   . GLN D 1 122 ? -149.816 -31.757 -125.562 1.00 179.77 ? 122 GLN D N   1 
ATOM   5331 C CA  . GLN D 1 122 ? -149.419 -33.163 -125.400 1.00 179.48 ? 122 GLN D CA  1 
ATOM   5332 C C   . GLN D 1 122 ? -147.902 -33.405 -125.335 1.00 179.19 ? 122 GLN D C   1 
ATOM   5333 O O   . GLN D 1 122 ? -147.404 -33.929 -124.340 1.00 179.15 ? 122 GLN D O   1 
ATOM   5334 C CB  . GLN D 1 122 ? -150.082 -34.042 -126.479 1.00 179.54 ? 122 GLN D CB  1 
ATOM   5335 C CG  . GLN D 1 122 ? -150.084 -35.558 -126.181 1.00 179.83 ? 122 GLN D CG  1 
ATOM   5336 C CD  . GLN D 1 122 ? -150.882 -36.397 -127.197 1.00 180.15 ? 122 GLN D CD  1 
ATOM   5337 O OE1 . GLN D 1 122 ? -151.984 -36.023 -127.608 1.00 180.14 ? 122 GLN D OE1 1 
ATOM   5338 N NE2 . GLN D 1 122 ? -150.327 -37.545 -127.586 1.00 180.04 ? 122 GLN D NE2 1 
ATOM   5339 N N   . VAL D 1 123 ? -147.174 -33.012 -126.378 1.00 178.85 ? 123 VAL D N   1 
ATOM   5340 C CA  . VAL D 1 123 ? -145.735 -33.284 -126.442 1.00 178.53 ? 123 VAL D CA  1 
ATOM   5341 C C   . VAL D 1 123 ? -144.889 -32.157 -125.827 1.00 178.32 ? 123 VAL D C   1 
ATOM   5342 O O   . VAL D 1 123 ? -143.674 -32.306 -125.670 1.00 178.30 ? 123 VAL D O   1 
ATOM   5343 C CB  . VAL D 1 123 ? -145.271 -33.637 -127.889 1.00 178.56 ? 123 VAL D CB  1 
ATOM   5344 C CG1 . VAL D 1 123 ? -145.112 -32.381 -128.740 1.00 178.62 ? 123 VAL D CG1 1 
ATOM   5345 C CG2 . VAL D 1 123 ? -143.978 -34.452 -127.872 1.00 178.38 ? 123 VAL D CG2 1 
ATOM   5346 N N   . PHE D 1 124 ? -145.529 -31.038 -125.483 1.00 178.00 ? 124 PHE D N   1 
ATOM   5347 C CA  . PHE D 1 124 ? -144.851 -29.968 -124.740 1.00 177.62 ? 124 PHE D CA  1 
ATOM   5348 C C   . PHE D 1 124 ? -145.344 -29.875 -123.295 1.00 177.55 ? 124 PHE D C   1 
ATOM   5349 O O   . PHE D 1 124 ? -146.075 -28.947 -122.921 1.00 177.52 ? 124 PHE D O   1 
ATOM   5350 C CB  . PHE D 1 124 ? -144.947 -28.624 -125.465 1.00 177.47 ? 124 PHE D CB  1 
ATOM   5351 C CG  . PHE D 1 124 ? -143.843 -28.390 -126.454 1.00 176.86 ? 124 PHE D CG  1 
ATOM   5352 C CD1 . PHE D 1 124 ? -143.521 -29.354 -127.406 1.00 176.31 ? 124 PHE D CD1 1 
ATOM   5353 C CD2 . PHE D 1 124 ? -143.128 -27.203 -126.439 1.00 176.28 ? 124 PHE D CD2 1 
ATOM   5354 C CE1 . PHE D 1 124 ? -142.501 -29.145 -128.320 1.00 175.84 ? 124 PHE D CE1 1 
ATOM   5355 C CE2 . PHE D 1 124 ? -142.109 -26.984 -127.351 1.00 175.97 ? 124 PHE D CE2 1 
ATOM   5356 C CZ  . PHE D 1 124 ? -141.796 -27.960 -128.295 1.00 175.87 ? 124 PHE D CZ  1 
ATOM   5357 N N   . VAL D 1 125 ? -144.930 -30.876 -122.514 1.00 177.39 ? 125 VAL D N   1 
ATOM   5358 C CA  . VAL D 1 125 ? -145.223 -31.021 -121.079 1.00 177.12 ? 125 VAL D CA  1 
ATOM   5359 C C   . VAL D 1 125 ? -144.307 -32.115 -120.480 1.00 176.89 ? 125 VAL D C   1 
ATOM   5360 O O   . VAL D 1 125 ? -143.917 -33.061 -121.171 1.00 176.78 ? 125 VAL D O   1 
ATOM   5361 C CB  . VAL D 1 125 ? -146.742 -31.313 -120.808 1.00 177.17 ? 125 VAL D CB  1 
ATOM   5362 C CG1 . VAL D 1 125 ? -147.146 -32.714 -121.284 1.00 177.14 ? 125 VAL D CG1 1 
ATOM   5363 C CG2 . VAL D 1 125 ? -147.102 -31.095 -119.331 1.00 176.94 ? 125 VAL D CG2 1 
ATOM   5364 N N   . ALA D 1 126 ? -143.959 -31.966 -119.203 1.00 176.64 ? 126 ALA D N   1 
ATOM   5365 C CA  . ALA D 1 126 ? -143.035 -32.877 -118.526 1.00 176.33 ? 126 ALA D CA  1 
ATOM   5366 C C   . ALA D 1 126 ? -143.624 -33.449 -117.229 1.00 176.14 ? 126 ALA D C   1 
ATOM   5367 O O   . ALA D 1 126 ? -144.149 -32.702 -116.401 1.00 176.20 ? 126 ALA D O   1 
ATOM   5368 C CB  . ALA D 1 126 ? -141.713 -32.163 -118.245 1.00 176.24 ? 126 ALA D CB  1 
ATOM   5369 N N   . SER D 1 127 ? -143.547 -34.771 -117.061 1.00 175.83 ? 127 SER D N   1 
ATOM   5370 C CA  . SER D 1 127 ? -143.971 -35.420 -115.810 1.00 175.59 ? 127 SER D CA  1 
ATOM   5371 C C   . SER D 1 127 ? -143.155 -36.678 -115.457 1.00 175.39 ? 127 SER D C   1 
ATOM   5372 O O   . SER D 1 127 ? -143.318 -37.736 -116.076 1.00 175.28 ? 127 SER D O   1 
ATOM   5373 C CB  . SER D 1 127 ? -145.483 -35.708 -115.811 1.00 175.55 ? 127 SER D CB  1 
ATOM   5374 O OG  . SER D 1 127 ? -145.829 -36.673 -116.785 1.00 175.56 ? 127 SER D OG  1 
ATOM   5375 N N   . GLY D 1 128 ? -142.281 -36.541 -114.454 1.00 175.13 ? 128 GLY D N   1 
ATOM   5376 C CA  . GLY D 1 128 ? -141.431 -37.635 -113.969 1.00 174.72 ? 128 GLY D CA  1 
ATOM   5377 C C   . GLY D 1 128 ? -141.258 -37.601 -112.460 1.00 174.48 ? 128 GLY D C   1 
ATOM   5378 O O   . GLY D 1 128 ? -140.559 -36.735 -111.930 1.00 174.46 ? 128 GLY D O   1 
ATOM   5379 N N   . ASP D 1 129 ? -141.886 -38.564 -111.781 1.00 174.23 ? 129 ASP D N   1 
ATOM   5380 C CA  . ASP D 1 129 ? -141.989 -38.599 -110.312 1.00 173.87 ? 129 ASP D CA  1 
ATOM   5381 C C   . ASP D 1 129 ? -140.667 -38.812 -109.563 1.00 173.64 ? 129 ASP D C   1 
ATOM   5382 O O   . ASP D 1 129 ? -140.429 -38.176 -108.529 1.00 173.70 ? 129 ASP D O   1 
ATOM   5383 C CB  . ASP D 1 129 ? -143.024 -39.652 -109.867 1.00 173.89 ? 129 ASP D CB  1 
ATOM   5384 C CG  . ASP D 1 129 ? -142.570 -41.095 -110.129 1.00 173.83 ? 129 ASP D CG  1 
ATOM   5385 O OD1 . ASP D 1 129 ? -142.661 -41.923 -109.196 1.00 173.58 ? 129 ASP D OD1 1 
ATOM   5386 O OD2 . ASP D 1 129 ? -142.128 -41.406 -111.258 1.00 173.83 ? 129 ASP D OD2 1 
ATOM   5387 N N   . CYS D 1 130 ? -139.830 -39.706 -110.092 1.00 173.27 ? 130 CYS D N   1 
ATOM   5388 C CA  . CYS D 1 130 ? -138.554 -40.112 -109.478 1.00 172.78 ? 130 CYS D CA  1 
ATOM   5389 C C   . CYS D 1 130 ? -138.687 -41.109 -108.307 1.00 173.03 ? 130 CYS D C   1 
ATOM   5390 O O   . CYS D 1 130 ? -138.318 -40.812 -107.163 1.00 173.05 ? 130 CYS D O   1 
ATOM   5391 C CB  . CYS D 1 130 ? -137.675 -38.898 -109.126 1.00 172.38 ? 130 CYS D CB  1 
ATOM   5392 S SG  . CYS D 1 130 ? -136.762 -38.260 -110.550 1.00 170.52 ? 130 CYS D SG  1 
ATOM   5393 N N   . ALA D 1 131 ? -139.236 -42.284 -108.623 1.00 173.17 ? 131 ALA D N   1 
ATOM   5394 C CA  . ALA D 1 131 ? -139.171 -43.469 -107.767 1.00 173.26 ? 131 ALA D CA  1 
ATOM   5395 C C   . ALA D 1 131 ? -138.376 -44.503 -108.561 1.00 173.37 ? 131 ALA D C   1 
ATOM   5396 O O   . ALA D 1 131 ? -138.943 -45.366 -109.238 1.00 173.35 ? 131 ALA D O   1 
ATOM   5397 C CB  . ALA D 1 131 ? -140.567 -43.980 -107.437 1.00 173.20 ? 131 ALA D CB  1 
ATOM   5398 N N   . GLU D 1 132 ? -137.053 -44.394 -108.464 1.00 173.55 ? 132 GLU D N   1 
ATOM   5399 C CA  . GLU D 1 132 ? -136.127 -44.948 -109.461 1.00 173.68 ? 132 GLU D CA  1 
ATOM   5400 C C   . GLU D 1 132 ? -135.870 -46.468 -109.386 1.00 173.71 ? 132 GLU D C   1 
ATOM   5401 O O   . GLU D 1 132 ? -135.144 -46.951 -108.510 1.00 173.82 ? 132 GLU D O   1 
ATOM   5402 C CB  . GLU D 1 132 ? -134.803 -44.163 -109.433 1.00 173.68 ? 132 GLU D CB  1 
ATOM   5403 C CG  . GLU D 1 132 ? -134.331 -43.643 -110.799 1.00 173.48 ? 132 GLU D CG  1 
ATOM   5404 C CD  . GLU D 1 132 ? -134.888 -42.262 -111.167 1.00 172.85 ? 132 GLU D CD  1 
ATOM   5405 O OE1 . GLU D 1 132 ? -135.964 -41.879 -110.657 1.00 172.46 ? 132 GLU D OE1 1 
ATOM   5406 O OE2 . GLU D 1 132 ? -134.243 -41.556 -111.978 1.00 172.46 ? 132 GLU D OE2 1 
ATOM   5407 N N   . ARG D 1 133 ? -136.484 -47.195 -110.323 1.00 173.56 ? 133 ARG D N   1 
ATOM   5408 C CA  . ARG D 1 133 ? -136.259 -48.632 -110.545 1.00 173.33 ? 133 ARG D CA  1 
ATOM   5409 C C   . ARG D 1 133 ? -136.342 -48.911 -112.054 1.00 173.22 ? 133 ARG D C   1 
ATOM   5410 O O   . ARG D 1 133 ? -137.328 -48.541 -112.696 1.00 173.25 ? 133 ARG D O   1 
ATOM   5411 C CB  . ARG D 1 133 ? -137.255 -49.498 -109.744 1.00 173.33 ? 133 ARG D CB  1 
ATOM   5412 C CG  . ARG D 1 133 ? -138.485 -48.778 -109.137 1.00 173.16 ? 133 ARG D CG  1 
ATOM   5413 C CD  . ARG D 1 133 ? -139.506 -48.294 -110.179 1.00 173.20 ? 133 ARG D CD  1 
ATOM   5414 N NE  . ARG D 1 133 ? -139.850 -49.324 -111.158 1.00 173.39 ? 133 ARG D NE  1 
ATOM   5415 C CZ  . ARG D 1 133 ? -140.819 -50.223 -111.006 1.00 173.48 ? 133 ARG D CZ  1 
ATOM   5416 N NH1 . ARG D 1 133 ? -141.567 -50.232 -109.910 1.00 173.54 ? 133 ARG D NH1 1 
ATOM   5417 N NH2 . ARG D 1 133 ? -141.042 -51.119 -111.957 1.00 173.59 ? 133 ARG D NH2 1 
ATOM   5418 N N   . GLN D 1 134 ? -135.313 -49.552 -112.618 1.00 173.03 ? 134 GLN D N   1 
ATOM   5419 C CA  . GLN D 1 134 ? -135.113 -49.529 -114.084 1.00 172.83 ? 134 GLN D CA  1 
ATOM   5420 C C   . GLN D 1 134 ? -134.872 -50.846 -114.857 1.00 172.64 ? 134 GLN D C   1 
ATOM   5421 O O   . GLN D 1 134 ? -134.352 -51.834 -114.320 1.00 172.55 ? 134 GLN D O   1 
ATOM   5422 C CB  . GLN D 1 134 ? -133.999 -48.528 -114.445 1.00 172.86 ? 134 GLN D CB  1 
ATOM   5423 C CG  . GLN D 1 134 ? -134.493 -47.183 -114.991 1.00 172.67 ? 134 GLN D CG  1 
ATOM   5424 C CD  . GLN D 1 134 ? -134.832 -46.171 -113.905 1.00 172.27 ? 134 GLN D CD  1 
ATOM   5425 O OE1 . GLN D 1 134 ? -134.040 -45.930 -112.992 1.00 172.15 ? 134 GLN D OE1 1 
ATOM   5426 N NE2 . GLN D 1 134 ? -136.007 -45.560 -114.014 1.00 171.90 ? 134 GLN D NE2 1 
ATOM   5427 N N   . TRP D 1 135 ? -135.273 -50.817 -116.133 1.00 172.36 ? 135 TRP D N   1 
ATOM   5428 C CA  . TRP D 1 135 ? -134.851 -51.786 -117.158 1.00 172.01 ? 135 TRP D CA  1 
ATOM   5429 C C   . TRP D 1 135 ? -134.615 -51.112 -118.531 1.00 171.42 ? 135 TRP D C   1 
ATOM   5430 O O   . TRP D 1 135 ? -135.563 -50.710 -119.218 1.00 171.28 ? 135 TRP D O   1 
ATOM   5431 C CB  . TRP D 1 135 ? -135.795 -53.011 -117.247 1.00 172.25 ? 135 TRP D CB  1 
ATOM   5432 C CG  . TRP D 1 135 ? -137.293 -52.738 -117.423 1.00 172.96 ? 135 TRP D CG  1 
ATOM   5433 C CD1 . TRP D 1 135 ? -138.137 -52.149 -116.515 1.00 173.21 ? 135 TRP D CD1 1 
ATOM   5434 C CD2 . TRP D 1 135 ? -138.114 -53.099 -118.554 1.00 173.60 ? 135 TRP D CD2 1 
ATOM   5435 N NE1 . TRP D 1 135 ? -139.418 -52.099 -117.021 1.00 173.44 ? 135 TRP D NE1 1 
ATOM   5436 C CE2 . TRP D 1 135 ? -139.434 -52.674 -118.266 1.00 173.54 ? 135 TRP D CE2 1 
ATOM   5437 C CE3 . TRP D 1 135 ? -137.860 -53.728 -119.787 1.00 173.79 ? 135 TRP D CE3 1 
ATOM   5438 C CZ2 . TRP D 1 135 ? -140.500 -52.857 -119.166 1.00 173.39 ? 135 TRP D CZ2 1 
ATOM   5439 C CZ3 . TRP D 1 135 ? -138.925 -53.911 -120.683 1.00 173.54 ? 135 TRP D CZ3 1 
ATOM   5440 C CH2 . TRP D 1 135 ? -140.225 -53.476 -120.364 1.00 173.38 ? 135 TRP D CH2 1 
ATOM   5441 N N   . ASP D 1 136 ? -133.338 -50.983 -118.899 1.00 170.73 ? 136 ASP D N   1 
ATOM   5442 C CA  . ASP D 1 136 ? -132.915 -50.322 -120.142 1.00 170.06 ? 136 ASP D CA  1 
ATOM   5443 C C   . ASP D 1 136 ? -132.261 -51.308 -121.110 1.00 169.68 ? 136 ASP D C   1 
ATOM   5444 O O   . ASP D 1 136 ? -131.456 -52.142 -120.697 1.00 169.53 ? 136 ASP D O   1 
ATOM   5445 C CB  . ASP D 1 136 ? -131.936 -49.181 -119.838 1.00 169.95 ? 136 ASP D CB  1 
ATOM   5446 C CG  . ASP D 1 136 ? -132.531 -48.112 -118.928 1.00 169.52 ? 136 ASP D CG  1 
ATOM   5447 O OD1 . ASP D 1 136 ? -132.466 -46.919 -119.294 1.00 168.86 ? 136 ASP D OD1 1 
ATOM   5448 O OD2 . ASP D 1 136 ? -133.056 -48.459 -117.848 1.00 168.81 ? 136 ASP D OD2 1 
ATOM   5449 N N   . PHE D 1 137 ? -132.606 -51.201 -122.393 1.00 169.29 ? 137 PHE D N   1 
ATOM   5450 C CA  . PHE D 1 137 ? -132.092 -52.113 -123.424 1.00 168.99 ? 137 PHE D CA  1 
ATOM   5451 C C   . PHE D 1 137 ? -130.566 -52.023 -123.581 1.00 168.66 ? 137 PHE D C   1 
ATOM   5452 O O   . PHE D 1 137 ? -129.974 -50.949 -123.403 1.00 168.52 ? 137 PHE D O   1 
ATOM   5453 C CB  . PHE D 1 137 ? -132.814 -51.907 -124.769 1.00 169.11 ? 137 PHE D CB  1 
ATOM   5454 C CG  . PHE D 1 137 ? -134.007 -52.830 -124.988 1.00 169.31 ? 137 PHE D CG  1 
ATOM   5455 C CD1 . PHE D 1 137 ? -133.965 -53.825 -125.969 1.00 169.27 ? 137 PHE D CD1 1 
ATOM   5456 C CD2 . PHE D 1 137 ? -135.174 -52.693 -124.229 1.00 169.21 ? 137 PHE D CD2 1 
ATOM   5457 C CE1 . PHE D 1 137 ? -135.058 -54.674 -126.182 1.00 169.00 ? 137 PHE D CE1 1 
ATOM   5458 C CE2 . PHE D 1 137 ? -136.270 -53.539 -124.438 1.00 168.91 ? 137 PHE D CE2 1 
ATOM   5459 C CZ  . PHE D 1 137 ? -136.210 -54.530 -125.415 1.00 168.79 ? 137 PHE D CZ  1 
ATOM   5460 N N   . LEU D 1 138 ? -129.961 -53.167 -123.922 1.00 168.29 ? 138 LEU D N   1 
ATOM   5461 C CA  . LEU D 1 138 ? -128.509 -53.441 -123.785 1.00 167.80 ? 138 LEU D CA  1 
ATOM   5462 C C   . LEU D 1 138 ? -127.899 -53.004 -122.428 1.00 167.47 ? 138 LEU D C   1 
ATOM   5463 O O   . LEU D 1 138 ? -126.707 -52.676 -122.347 1.00 167.55 ? 138 LEU D O   1 
ATOM   5464 C CB  . LEU D 1 138 ? -127.696 -52.925 -124.996 1.00 167.72 ? 138 LEU D CB  1 
ATOM   5465 C CG  . LEU D 1 138 ? -126.176 -53.200 -125.056 1.00 167.43 ? 138 LEU D CG  1 
ATOM   5466 C CD1 . LEU D 1 138 ? -125.798 -54.675 -124.832 1.00 167.04 ? 138 LEU D CD1 1 
ATOM   5467 C CD2 . LEU D 1 138 ? -125.577 -52.689 -126.354 1.00 167.18 ? 138 LEU D CD2 1 
ATOM   5468 N N   . GLY D 1 139 ? -128.723 -53.020 -121.372 1.00 166.88 ? 139 GLY D N   1 
ATOM   5469 C CA  . GLY D 1 139 ? -128.313 -52.601 -120.023 1.00 165.95 ? 139 GLY D CA  1 
ATOM   5470 C C   . GLY D 1 139 ? -127.824 -51.163 -119.930 1.00 165.37 ? 139 GLY D C   1 
ATOM   5471 O O   . GLY D 1 139 ? -127.369 -50.722 -118.869 1.00 165.27 ? 139 GLY D O   1 
ATOM   5472 N N   . LEU D 1 140 ? -127.916 -50.440 -121.051 1.00 164.78 ? 140 LEU D N   1 
ATOM   5473 C CA  . LEU D 1 140 ? -127.432 -49.060 -121.161 1.00 163.99 ? 140 LEU D CA  1 
ATOM   5474 C C   . LEU D 1 140 ? -128.579 -48.066 -121.128 1.00 163.53 ? 140 LEU D C   1 
ATOM   5475 O O   . LEU D 1 140 ? -129.622 -48.281 -121.754 1.00 163.32 ? 140 LEU D O   1 
ATOM   5476 C CB  . LEU D 1 140 ? -126.609 -48.850 -122.441 1.00 163.94 ? 140 LEU D CB  1 
ATOM   5477 C CG  . LEU D 1 140 ? -125.071 -48.727 -122.258 1.00 163.58 ? 140 LEU D CG  1 
ATOM   5478 C CD1 . LEU D 1 140 ? -124.378 -50.097 -122.409 1.00 163.25 ? 140 LEU D CD1 1 
ATOM   5479 C CD2 . LEU D 1 140 ? -124.511 -47.724 -123.257 1.00 163.10 ? 140 LEU D CD2 1 
ATOM   5480 N N   . GLU D 1 141 ? -128.351 -46.978 -120.392 1.00 163.00 ? 141 GLU D N   1 
ATOM   5481 C CA  . GLU D 1 141 ? -129.329 -45.911 -120.182 1.00 162.52 ? 141 GLU D CA  1 
ATOM   5482 C C   . GLU D 1 141 ? -129.681 -45.229 -121.499 1.00 162.00 ? 141 GLU D C   1 
ATOM   5483 O O   . GLU D 1 141 ? -128.800 -44.965 -122.320 1.00 161.98 ? 141 GLU D O   1 
ATOM   5484 C CB  . GLU D 1 141 ? -128.776 -44.874 -119.194 1.00 162.65 ? 141 GLU D CB  1 
ATOM   5485 C CG  . GLU D 1 141 ? -128.551 -45.377 -117.765 1.00 162.97 ? 141 GLU D CG  1 
ATOM   5486 C CD  . GLU D 1 141 ? -129.809 -45.320 -116.906 1.00 163.81 ? 141 GLU D CD  1 
ATOM   5487 O OE1 . GLU D 1 141 ? -130.605 -44.366 -117.066 1.00 163.89 ? 141 GLU D OE1 1 
ATOM   5488 O OE2 . GLU D 1 141 ? -130.000 -46.227 -116.064 1.00 164.24 ? 141 GLU D OE2 1 
ATOM   5489 N N   . MET D 1 142 ? -130.969 -44.946 -121.695 1.00 161.25 ? 142 MET D N   1 
ATOM   5490 C CA  . MET D 1 142 ? -131.448 -44.335 -122.946 1.00 160.51 ? 142 MET D CA  1 
ATOM   5491 C C   . MET D 1 142 ? -130.873 -42.939 -123.229 1.00 159.55 ? 142 MET D C   1 
ATOM   5492 O O   . MET D 1 142 ? -130.560 -42.626 -124.381 1.00 159.58 ? 142 MET D O   1 
ATOM   5493 C CB  . MET D 1 142 ? -132.984 -44.353 -123.036 1.00 160.68 ? 142 MET D CB  1 
ATOM   5494 C CG  . MET D 1 142 ? -133.579 -45.525 -123.853 1.00 161.58 ? 142 MET D CG  1 
ATOM   5495 S SD  . MET D 1 142 ? -133.692 -47.156 -123.042 1.00 163.49 ? 142 MET D SD  1 
ATOM   5496 C CE  . MET D 1 142 ? -132.196 -47.980 -123.590 1.00 162.89 ? 142 MET D CE  1 
ATOM   5497 N N   . PRO D 1 143 ? -130.712 -42.100 -122.188 1.00 158.59 ? 143 PRO D N   1 
ATOM   5498 C CA  . PRO D 1 143 ? -130.060 -40.821 -122.449 1.00 157.80 ? 143 PRO D CA  1 
ATOM   5499 C C   . PRO D 1 143 ? -128.550 -40.997 -122.591 1.00 156.92 ? 143 PRO D C   1 
ATOM   5500 O O   . PRO D 1 143 ? -127.823 -40.015 -122.775 1.00 156.89 ? 143 PRO D O   1 
ATOM   5501 C CB  . PRO D 1 143 ? -130.385 -40.010 -121.199 1.00 157.92 ? 143 PRO D CB  1 
ATOM   5502 C CG  . PRO D 1 143 ? -130.500 -41.032 -120.125 1.00 158.24 ? 143 PRO D CG  1 
ATOM   5503 C CD  . PRO D 1 143 ? -131.093 -42.243 -120.769 1.00 158.52 ? 143 PRO D CD  1 
ATOM   5504 N N   . GLN D 1 144 ? -128.101 -42.247 -122.495 1.00 155.77 ? 144 GLN D N   1 
ATOM   5505 C CA  . GLN D 1 144 ? -126.704 -42.609 -122.690 1.00 154.68 ? 144 GLN D CA  1 
ATOM   5506 C C   . GLN D 1 144 ? -126.515 -43.151 -124.109 1.00 153.67 ? 144 GLN D C   1 
ATOM   5507 O O   . GLN D 1 144 ? -125.430 -43.040 -124.688 1.00 153.58 ? 144 GLN D O   1 
ATOM   5508 C CB  . GLN D 1 144 ? -126.279 -43.638 -121.644 1.00 154.78 ? 144 GLN D CB  1 
ATOM   5509 C CG  . GLN D 1 144 ? -124.785 -43.827 -121.502 1.00 155.37 ? 144 GLN D CG  1 
ATOM   5510 C CD  . GLN D 1 144 ? -124.436 -44.968 -120.571 1.00 156.28 ? 144 GLN D CD  1 
ATOM   5511 O OE1 . GLN D 1 144 ? -125.196 -45.931 -120.436 1.00 156.64 ? 144 GLN D OE1 1 
ATOM   5512 N NE2 . GLN D 1 144 ? -123.277 -44.871 -119.925 1.00 156.76 ? 144 GLN D NE2 1 
ATOM   5513 N N   . TRP D 1 145 ? -127.576 -43.740 -124.660 1.00 152.42 ? 145 TRP D N   1 
ATOM   5514 C CA  . TRP D 1 145 ? -127.648 -44.005 -126.095 1.00 151.20 ? 145 TRP D CA  1 
ATOM   5515 C C   . TRP D 1 145 ? -127.634 -42.657 -126.838 1.00 150.41 ? 145 TRP D C   1 
ATOM   5516 O O   . TRP D 1 145 ? -126.744 -42.399 -127.658 1.00 150.32 ? 145 TRP D O   1 
ATOM   5517 C CB  . TRP D 1 145 ? -128.932 -44.772 -126.462 1.00 151.20 ? 145 TRP D CB  1 
ATOM   5518 C CG  . TRP D 1 145 ? -128.909 -46.300 -126.365 1.00 150.56 ? 145 TRP D CG  1 
ATOM   5519 C CD1 . TRP D 1 145 ? -129.880 -47.088 -125.814 1.00 149.69 ? 145 TRP D CD1 1 
ATOM   5520 C CD2 . TRP D 1 145 ? -127.903 -47.201 -126.867 1.00 150.12 ? 145 TRP D CD2 1 
ATOM   5521 N NE1 . TRP D 1 145 ? -129.539 -48.413 -125.922 1.00 149.62 ? 145 TRP D NE1 1 
ATOM   5522 C CE2 . TRP D 1 145 ? -128.333 -48.515 -126.564 1.00 149.76 ? 145 TRP D CE2 1 
ATOM   5523 C CE3 . TRP D 1 145 ? -126.677 -47.026 -127.531 1.00 149.92 ? 145 TRP D CE3 1 
ATOM   5524 C CZ2 . TRP D 1 145 ? -127.582 -49.651 -126.902 1.00 149.35 ? 145 TRP D CZ2 1 
ATOM   5525 C CZ3 . TRP D 1 145 ? -125.930 -48.159 -127.868 1.00 149.51 ? 145 TRP D CZ3 1 
ATOM   5526 C CH2 . TRP D 1 145 ? -126.389 -49.452 -127.552 1.00 149.19 ? 145 TRP D CH2 1 
ATOM   5527 N N   . LEU D 1 146 ? -128.618 -41.806 -126.526 1.00 149.19 ? 146 LEU D N   1 
ATOM   5528 C CA  . LEU D 1 146 ? -128.793 -40.488 -127.152 1.00 147.95 ? 146 LEU D CA  1 
ATOM   5529 C C   . LEU D 1 146 ? -127.519 -39.670 -127.187 1.00 147.08 ? 146 LEU D C   1 
ATOM   5530 O O   . LEU D 1 146 ? -127.122 -39.207 -128.247 1.00 146.83 ? 146 LEU D O   1 
ATOM   5531 C CB  . LEU D 1 146 ? -129.902 -39.695 -126.452 1.00 147.99 ? 146 LEU D CB  1 
ATOM   5532 C CG  . LEU D 1 146 ? -131.361 -39.821 -126.920 1.00 148.07 ? 146 LEU D CG  1 
ATOM   5533 C CD1 . LEU D 1 146 ? -131.673 -38.834 -128.042 1.00 147.72 ? 146 LEU D CD1 1 
ATOM   5534 C CD2 . LEU D 1 146 ? -131.763 -41.259 -127.313 1.00 148.13 ? 146 LEU D CD2 1 
ATOM   5535 N N   . LEU D 1 147 ? -126.882 -39.509 -126.027 1.00 146.26 ? 147 LEU D N   1 
ATOM   5536 C CA  . LEU D 1 147 ? -125.590 -38.823 -125.915 1.00 145.57 ? 147 LEU D CA  1 
ATOM   5537 C C   . LEU D 1 147 ? -124.571 -39.366 -126.914 1.00 145.12 ? 147 LEU D C   1 
ATOM   5538 O O   . LEU D 1 147 ? -123.656 -38.653 -127.331 1.00 145.15 ? 147 LEU D O   1 
ATOM   5539 C CB  . LEU D 1 147 ? -125.047 -38.906 -124.476 1.00 145.54 ? 147 LEU D CB  1 
ATOM   5540 C CG  . LEU D 1 147 ? -123.641 -38.425 -124.054 1.00 145.39 ? 147 LEU D CG  1 
ATOM   5541 C CD1 . LEU D 1 147 ? -122.610 -39.534 -124.179 1.00 145.56 ? 147 LEU D CD1 1 
ATOM   5542 C CD2 . LEU D 1 147 ? -123.165 -37.188 -124.814 1.00 145.27 ? 147 LEU D CD2 1 
ATOM   5543 N N   . GLY D 1 148 ? -124.733 -40.627 -127.296 1.00 144.44 ? 148 GLY D N   1 
ATOM   5544 C CA  . GLY D 1 148 ? -123.893 -41.208 -128.323 1.00 143.63 ? 148 GLY D CA  1 
ATOM   5545 C C   . GLY D 1 148 ? -124.218 -40.607 -129.673 1.00 143.05 ? 148 GLY D C   1 
ATOM   5546 O O   . GLY D 1 148 ? -123.372 -39.959 -130.295 1.00 142.96 ? 148 GLY D O   1 
ATOM   5547 N N   . ILE D 1 149 ? -125.465 -40.792 -130.105 1.00 142.41 ? 149 ILE D N   1 
ATOM   5548 C CA  . ILE D 1 149 ? -125.858 -40.505 -131.493 1.00 141.64 ? 149 ILE D CA  1 
ATOM   5549 C C   . ILE D 1 149 ? -125.929 -39.013 -131.857 1.00 141.23 ? 149 ILE D C   1 
ATOM   5550 O O   . ILE D 1 149 ? -125.951 -38.651 -133.034 1.00 141.16 ? 149 ILE D O   1 
ATOM   5551 C CB  . ILE D 1 149 ? -127.126 -41.317 -131.926 1.00 141.59 ? 149 ILE D CB  1 
ATOM   5552 C CG1 . ILE D 1 149 ? -128.373 -40.929 -131.116 1.00 141.00 ? 149 ILE D CG1 1 
ATOM   5553 C CG2 . ILE D 1 149 ? -126.839 -42.826 -131.855 1.00 141.40 ? 149 ILE D CG2 1 
ATOM   5554 C CD1 . ILE D 1 149 ? -129.387 -40.107 -131.897 1.00 140.03 ? 149 ILE D CD1 1 
ATOM   5555 N N   . PHE D 1 150 ? -125.937 -38.156 -130.841 1.00 140.64 ? 150 PHE D N   1 
ATOM   5556 C CA  . PHE D 1 150 ? -125.772 -36.728 -131.046 1.00 140.14 ? 150 PHE D CA  1 
ATOM   5557 C C   . PHE D 1 150 ? -124.338 -36.402 -131.489 1.00 139.85 ? 150 PHE D C   1 
ATOM   5558 O O   . PHE D 1 150 ? -124.116 -35.380 -132.134 1.00 139.70 ? 150 PHE D O   1 
ATOM   5559 C CB  . PHE D 1 150 ? -126.119 -35.954 -129.771 1.00 140.25 ? 150 PHE D CB  1 
ATOM   5560 C CG  . PHE D 1 150 ? -127.575 -35.558 -129.650 1.00 140.18 ? 150 PHE D CG  1 
ATOM   5561 C CD1 . PHE D 1 150 ? -128.397 -36.150 -128.693 1.00 140.35 ? 150 PHE D CD1 1 
ATOM   5562 C CD2 . PHE D 1 150 ? -128.116 -34.562 -130.462 1.00 140.33 ? 150 PHE D CD2 1 
ATOM   5563 C CE1 . PHE D 1 150 ? -129.740 -35.773 -128.561 1.00 140.04 ? 150 PHE D CE1 1 
ATOM   5564 C CE2 . PHE D 1 150 ? -129.461 -34.178 -130.336 1.00 140.14 ? 150 PHE D CE2 1 
ATOM   5565 C CZ  . PHE D 1 150 ? -130.269 -34.787 -129.384 1.00 139.90 ? 150 PHE D CZ  1 
ATOM   5566 N N   . ILE D 1 151 ? -123.372 -37.255 -131.135 1.00 139.57 ? 151 ILE D N   1 
ATOM   5567 C CA  . ILE D 1 151 ? -121.990 -37.109 -131.636 1.00 139.48 ? 151 ILE D CA  1 
ATOM   5568 C C   . ILE D 1 151 ? -121.889 -37.585 -133.093 1.00 139.35 ? 151 ILE D C   1 
ATOM   5569 O O   . ILE D 1 151 ? -121.118 -37.034 -133.888 1.00 139.28 ? 151 ILE D O   1 
ATOM   5570 C CB  . ILE D 1 151 ? -120.932 -37.890 -130.801 1.00 139.52 ? 151 ILE D CB  1 
ATOM   5571 C CG1 . ILE D 1 151 ? -121.306 -37.952 -129.319 1.00 139.51 ? 151 ILE D CG1 1 
ATOM   5572 C CG2 . ILE D 1 151 ? -119.532 -37.279 -130.996 1.00 139.38 ? 151 ILE D CG2 1 
ATOM   5573 C CD1 . ILE D 1 151 ? -120.693 -39.134 -128.590 1.00 139.34 ? 151 ILE D CD1 1 
ATOM   5574 N N   . ALA D 1 152 ? -122.667 -38.617 -133.424 1.00 139.06 ? 152 ALA D N   1 
ATOM   5575 C CA  . ALA D 1 152 ? -122.780 -39.117 -134.798 1.00 138.73 ? 152 ALA D CA  1 
ATOM   5576 C C   . ALA D 1 152 ? -123.851 -38.336 -135.594 1.00 138.41 ? 152 ALA D C   1 
ATOM   5577 O O   . ALA D 1 152 ? -124.484 -38.851 -136.530 1.00 138.50 ? 152 ALA D O   1 
ATOM   5578 C CB  . ALA D 1 152 ? -123.062 -40.619 -134.794 1.00 138.77 ? 152 ALA D CB  1 
ATOM   5579 N N   . TYR D 1 153 ? -124.034 -37.083 -135.189 1.00 137.71 ? 153 TYR D N   1 
ATOM   5580 C CA  . TYR D 1 153 ? -124.903 -36.127 -135.843 1.00 136.96 ? 153 TYR D CA  1 
ATOM   5581 C C   . TYR D 1 153 ? -124.151 -34.810 -135.808 1.00 136.52 ? 153 TYR D C   1 
ATOM   5582 O O   . TYR D 1 153 ? -124.367 -33.943 -136.648 1.00 136.70 ? 153 TYR D O   1 
ATOM   5583 C CB  . TYR D 1 153 ? -126.220 -35.996 -135.079 1.00 136.96 ? 153 TYR D CB  1 
ATOM   5584 C CG  . TYR D 1 153 ? -127.431 -36.686 -135.689 1.00 136.59 ? 153 TYR D CG  1 
ATOM   5585 C CD1 . TYR D 1 153 ? -127.318 -37.560 -136.775 1.00 136.73 ? 153 TYR D CD1 1 
ATOM   5586 C CD2 . TYR D 1 153 ? -128.697 -36.475 -135.148 1.00 136.27 ? 153 TYR D CD2 1 
ATOM   5587 C CE1 . TYR D 1 153 ? -128.452 -38.191 -137.315 1.00 136.96 ? 153 TYR D CE1 1 
ATOM   5588 C CE2 . TYR D 1 153 ? -129.827 -37.094 -135.669 1.00 136.29 ? 153 TYR D CE2 1 
ATOM   5589 C CZ  . TYR D 1 153 ? -129.708 -37.946 -136.747 1.00 136.63 ? 153 TYR D CZ  1 
ATOM   5590 O OH  . TYR D 1 153 ? -130.852 -38.542 -137.241 1.00 136.20 ? 153 TYR D OH  1 
ATOM   5591 N N   . LEU D 1 154 ? -123.271 -34.671 -134.819 1.00 135.88 ? 154 LEU D N   1 
ATOM   5592 C CA  . LEU D 1 154 ? -122.350 -33.541 -134.740 1.00 135.28 ? 154 LEU D CA  1 
ATOM   5593 C C   . LEU D 1 154 ? -121.060 -33.822 -135.526 1.00 134.92 ? 154 LEU D C   1 
ATOM   5594 O O   . LEU D 1 154 ? -120.297 -32.899 -135.826 1.00 134.85 ? 154 LEU D O   1 
ATOM   5595 C CB  . LEU D 1 154 ? -122.051 -33.174 -133.276 1.00 135.32 ? 154 LEU D CB  1 
ATOM   5596 C CG  . LEU D 1 154 ? -121.258 -31.906 -132.919 1.00 134.90 ? 154 LEU D CG  1 
ATOM   5597 C CD1 . LEU D 1 154 ? -121.919 -30.641 -133.437 1.00 134.50 ? 154 LEU D CD1 1 
ATOM   5598 C CD2 . LEU D 1 154 ? -121.064 -31.815 -131.419 1.00 134.33 ? 154 LEU D CD2 1 
ATOM   5599 N N   . ILE D 1 155 ? -120.812 -35.086 -135.866 1.00 134.35 ? 155 ILE D N   1 
ATOM   5600 C CA  . ILE D 1 155 ? -119.753 -35.374 -136.835 1.00 133.92 ? 155 ILE D CA  1 
ATOM   5601 C C   . ILE D 1 155 ? -120.317 -35.417 -138.265 1.00 133.56 ? 155 ILE D C   1 
ATOM   5602 O O   . ILE D 1 155 ? -119.724 -34.853 -139.188 1.00 133.39 ? 155 ILE D O   1 
ATOM   5603 C CB  . ILE D 1 155 ? -118.854 -36.596 -136.460 1.00 133.98 ? 155 ILE D CB  1 
ATOM   5604 C CG1 . ILE D 1 155 ? -119.679 -37.863 -136.192 1.00 133.94 ? 155 ILE D CG1 1 
ATOM   5605 C CG2 . ILE D 1 155 ? -117.946 -36.235 -135.283 1.00 133.79 ? 155 ILE D CG2 1 
ATOM   5606 C CD1 . ILE D 1 155 ? -118.852 -39.148 -136.113 1.00 133.52 ? 155 ILE D CD1 1 
ATOM   5607 N N   . VAL D 1 156 ? -121.479 -36.054 -138.430 1.00 133.15 ? 156 VAL D N   1 
ATOM   5608 C CA  . VAL D 1 156 ? -122.241 -36.004 -139.692 1.00 132.67 ? 156 VAL D CA  1 
ATOM   5609 C C   . VAL D 1 156 ? -122.646 -34.542 -139.970 1.00 132.35 ? 156 VAL D C   1 
ATOM   5610 O O   . VAL D 1 156 ? -123.566 -34.249 -140.734 1.00 132.38 ? 156 VAL D O   1 
ATOM   5611 C CB  . VAL D 1 156 ? -123.464 -36.996 -139.680 1.00 132.77 ? 156 VAL D CB  1 
ATOM   5612 C CG1 . VAL D 1 156 ? -124.282 -36.922 -140.979 1.00 132.37 ? 156 VAL D CG1 1 
ATOM   5613 C CG2 . VAL D 1 156 ? -122.993 -38.433 -139.434 1.00 132.41 ? 156 VAL D CG2 1 
ATOM   5614 N N   . ALA D 1 157 ? -121.941 -33.634 -139.308 1.00 131.84 ? 157 ALA D N   1 
ATOM   5615 C CA  . ALA D 1 157 ? -121.956 -32.235 -139.644 1.00 131.59 ? 157 ALA D CA  1 
ATOM   5616 C C   . ALA D 1 157 ? -120.556 -31.905 -140.126 1.00 131.55 ? 157 ALA D C   1 
ATOM   5617 O O   . ALA D 1 157 ? -120.253 -32.054 -141.310 1.00 131.49 ? 157 ALA D O   1 
ATOM   5618 C CB  . ALA D 1 157 ? -122.314 -31.404 -138.436 1.00 131.54 ? 157 ALA D CB  1 
ATOM   5619 N N   . VAL D 1 158 ? -119.699 -31.493 -139.195 1.00 131.43 ? 158 VAL D N   1 
ATOM   5620 C CA  . VAL D 1 158 ? -118.341 -31.072 -139.512 1.00 131.38 ? 158 VAL D CA  1 
ATOM   5621 C C   . VAL D 1 158 ? -117.592 -32.199 -140.218 1.00 131.54 ? 158 VAL D C   1 
ATOM   5622 O O   . VAL D 1 158 ? -117.209 -32.060 -141.389 1.00 131.47 ? 158 VAL D O   1 
ATOM   5623 C CB  . VAL D 1 158 ? -117.555 -30.659 -138.245 1.00 131.25 ? 158 VAL D CB  1 
ATOM   5624 C CG1 . VAL D 1 158 ? -116.365 -29.784 -138.616 1.00 131.22 ? 158 VAL D CG1 1 
ATOM   5625 C CG2 . VAL D 1 158 ? -118.448 -29.929 -137.277 1.00 131.16 ? 158 VAL D CG2 1 
ATOM   5626 N N   . LEU D 1 159 ? -117.426 -33.320 -139.505 1.00 131.64 ? 159 LEU D N   1 
ATOM   5627 C CA  . LEU D 1 159 ? -116.589 -34.452 -139.950 1.00 131.52 ? 159 LEU D CA  1 
ATOM   5628 C C   . LEU D 1 159 ? -117.130 -35.120 -141.217 1.00 131.23 ? 159 LEU D C   1 
ATOM   5629 O O   . LEU D 1 159 ? -116.535 -36.074 -141.728 1.00 131.17 ? 159 LEU D O   1 
ATOM   5630 C CB  . LEU D 1 159 ? -116.397 -35.479 -138.820 1.00 131.62 ? 159 LEU D CB  1 
ATOM   5631 C CG  . LEU D 1 159 ? -115.044 -36.202 -138.684 1.00 131.87 ? 159 LEU D CG  1 
ATOM   5632 C CD1 . LEU D 1 159 ? -114.793 -36.577 -137.218 1.00 132.02 ? 159 LEU D CD1 1 
ATOM   5633 C CD2 . LEU D 1 159 ? -114.886 -37.429 -139.610 1.00 131.24 ? 159 LEU D CD2 1 
ATOM   5634 N N   . VAL D 1 160 ? -118.269 -34.625 -141.700 1.00 130.82 ? 160 VAL D N   1 
ATOM   5635 C CA  . VAL D 1 160 ? -118.671 -34.850 -143.085 1.00 130.40 ? 160 VAL D CA  1 
ATOM   5636 C C   . VAL D 1 160 ? -118.970 -33.494 -143.736 1.00 129.97 ? 160 VAL D C   1 
ATOM   5637 O O   . VAL D 1 160 ? -118.047 -32.821 -144.194 1.00 129.95 ? 160 VAL D O   1 
ATOM   5638 C CB  . VAL D 1 160 ? -119.857 -35.860 -143.253 1.00 130.55 ? 160 VAL D CB  1 
ATOM   5639 C CG1 . VAL D 1 160 ? -120.019 -36.259 -144.737 1.00 130.28 ? 160 VAL D CG1 1 
ATOM   5640 C CG2 . VAL D 1 160 ? -119.657 -37.108 -142.385 1.00 130.34 ? 160 VAL D CG2 1 
ATOM   5641 N N   . VAL D 1 161 ? -120.240 -33.079 -143.716 1.00 129.32 ? 161 VAL D N   1 
ATOM   5642 C CA  . VAL D 1 161 ? -120.742 -31.970 -144.541 1.00 128.60 ? 161 VAL D CA  1 
ATOM   5643 C C   . VAL D 1 161 ? -119.722 -30.857 -144.822 1.00 128.30 ? 161 VAL D C   1 
ATOM   5644 O O   . VAL D 1 161 ? -119.559 -30.445 -145.969 1.00 128.33 ? 161 VAL D O   1 
ATOM   5645 C CB  . VAL D 1 161 ? -122.063 -31.396 -143.997 1.00 128.47 ? 161 VAL D CB  1 
ATOM   5646 C CG1 . VAL D 1 161 ? -122.872 -30.813 -145.130 1.00 128.29 ? 161 VAL D CG1 1 
ATOM   5647 C CG2 . VAL D 1 161 ? -122.873 -32.488 -143.340 1.00 128.33 ? 161 VAL D CG2 1 
ATOM   5648 N N   . ILE D 1 162 ? -119.022 -30.393 -143.793 1.00 127.82 ? 162 ILE D N   1 
ATOM   5649 C CA  . ILE D 1 162 ? -117.984 -29.380 -143.983 1.00 127.40 ? 162 ILE D CA  1 
ATOM   5650 C C   . ILE D 1 162 ? -116.598 -30.021 -144.085 1.00 127.24 ? 162 ILE D C   1 
ATOM   5651 O O   . ILE D 1 162 ? -116.154 -30.384 -145.177 1.00 126.79 ? 162 ILE D O   1 
ATOM   5652 C CB  . ILE D 1 162 ? -118.031 -28.319 -142.868 1.00 127.32 ? 162 ILE D CB  1 
ATOM   5653 C CG1 . ILE D 1 162 ? -119.444 -27.755 -142.775 1.00 127.44 ? 162 ILE D CG1 1 
ATOM   5654 C CG2 . ILE D 1 162 ? -117.045 -27.183 -143.134 1.00 126.75 ? 162 ILE D CG2 1 
ATOM   5655 C CD1 . ILE D 1 162 ? -120.018 -27.786 -141.382 1.00 127.95 ? 162 ILE D CD1 1 
ATOM   5656 N N   . ASP E 2 21  ? -132.310 -36.034 -91.457  1.00 97.42  ? 21  ASP E N   1 
ATOM   5657 C CA  . ASP E 2 21  ? -131.158 -36.470 -92.310  1.00 97.76  ? 21  ASP E CA  1 
ATOM   5658 C C   . ASP E 2 21  ? -130.847 -37.955 -92.144  1.00 97.69  ? 21  ASP E C   1 
ATOM   5659 O O   . ASP E 2 21  ? -131.697 -38.734 -91.715  1.00 97.89  ? 21  ASP E O   1 
ATOM   5660 C CB  . ASP E 2 21  ? -129.912 -35.648 -91.969  1.00 97.73  ? 21  ASP E CB  1 
ATOM   5661 C CG  . ASP E 2 21  ? -130.110 -34.166 -92.203  1.00 98.10  ? 21  ASP E CG  1 
ATOM   5662 O OD1 . ASP E 2 21  ? -131.272 -33.684 -92.170  1.00 97.46  ? 21  ASP E OD1 1 
ATOM   5663 O OD2 . ASP E 2 21  ? -129.088 -33.481 -92.420  1.00 98.90  ? 21  ASP E OD2 1 
ATOM   5664 N N   . ILE E 2 22  ? -129.624 -38.345 -92.488  1.00 97.48  ? 22  ILE E N   1 
ATOM   5665 C CA  . ILE E 2 22  ? -129.151 -39.691 -92.194  1.00 97.11  ? 22  ILE E CA  1 
ATOM   5666 C C   . ILE E 2 22  ? -128.216 -39.657 -90.974  1.00 96.92  ? 22  ILE E C   1 
ATOM   5667 O O   . ILE E 2 22  ? -127.426 -38.717 -90.813  1.00 96.79  ? 22  ILE E O   1 
ATOM   5668 C CB  . ILE E 2 22  ? -128.439 -40.326 -93.415  1.00 97.01  ? 22  ILE E CB  1 
ATOM   5669 C CG1 . ILE E 2 22  ? -129.341 -40.284 -94.644  1.00 96.89  ? 22  ILE E CG1 1 
ATOM   5670 C CG2 . ILE E 2 22  ? -128.074 -41.772 -93.136  1.00 97.66  ? 22  ILE E CG2 1 
ATOM   5671 C CD1 . ILE E 2 22  ? -128.880 -41.182 -95.776  1.00 97.03  ? 22  ILE E CD1 1 
ATOM   5672 N N   . VAL E 2 23  ? -128.326 -40.671 -90.112  1.00 96.64  ? 23  VAL E N   1 
ATOM   5673 C CA  . VAL E 2 23  ? -127.352 -40.877 -89.025  1.00 96.29  ? 23  VAL E CA  1 
ATOM   5674 C C   . VAL E 2 23  ? -126.343 -42.003 -89.287  1.00 96.01  ? 23  VAL E C   1 
ATOM   5675 O O   . VAL E 2 23  ? -126.702 -43.152 -89.530  1.00 95.70  ? 23  VAL E O   1 
ATOM   5676 C CB  . VAL E 2 23  ? -128.011 -41.051 -87.631  1.00 96.24  ? 23  VAL E CB  1 
ATOM   5677 C CG1 . VAL E 2 23  ? -128.423 -39.694 -87.072  1.00 96.28  ? 23  VAL E CG1 1 
ATOM   5678 C CG2 . VAL E 2 23  ? -129.200 -41.996 -87.690  1.00 96.24  ? 23  VAL E CG2 1 
ATOM   5679 N N   . MET E 2 24  ? -125.071 -41.633 -89.253  1.00 95.92  ? 24  MET E N   1 
ATOM   5680 C CA  . MET E 2 24  ? -123.988 -42.576 -89.391  1.00 96.04  ? 24  MET E CA  1 
ATOM   5681 C C   . MET E 2 24  ? -123.493 -42.898 -87.999  1.00 96.28  ? 24  MET E C   1 
ATOM   5682 O O   . MET E 2 24  ? -123.284 -41.986 -87.193  1.00 96.69  ? 24  MET E O   1 
ATOM   5683 C CB  . MET E 2 24  ? -122.856 -41.961 -90.219  1.00 95.96  ? 24  MET E CB  1 
ATOM   5684 C CG  . MET E 2 24  ? -123.256 -41.583 -91.642  1.00 96.14  ? 24  MET E CG  1 
ATOM   5685 S SD  . MET E 2 24  ? -124.110 -42.916 -92.526  1.00 96.57  ? 24  MET E SD  1 
ATOM   5686 C CE  . MET E 2 24  ? -122.758 -44.031 -92.893  1.00 95.03  ? 24  MET E CE  1 
ATOM   5687 N N   . SER E 2 25  ? -123.306 -44.182 -87.699  1.00 96.32  ? 25  SER E N   1 
ATOM   5688 C CA  . SER E 2 25  ? -122.790 -44.570 -86.386  1.00 96.26  ? 25  SER E CA  1 
ATOM   5689 C C   . SER E 2 25  ? -121.681 -45.619 -86.431  1.00 96.59  ? 25  SER E C   1 
ATOM   5690 O O   . SER E 2 25  ? -121.908 -46.770 -86.800  1.00 96.45  ? 25  SER E O   1 
ATOM   5691 C CB  . SER E 2 25  ? -123.928 -44.980 -85.446  1.00 95.98  ? 25  SER E CB  1 
ATOM   5692 O OG  . SER E 2 25  ? -124.905 -45.743 -86.119  1.00 95.20  ? 25  SER E OG  1 
ATOM   5693 N N   . GLN E 2 26  ? -120.482 -45.196 -86.041  1.00 97.25  ? 26  GLN E N   1 
ATOM   5694 C CA  . GLN E 2 26  ? -119.332 -46.087 -85.935  1.00 98.11  ? 26  GLN E CA  1 
ATOM   5695 C C   . GLN E 2 26  ? -119.191 -46.809 -84.606  1.00 98.75  ? 26  GLN E C   1 
ATOM   5696 O O   . GLN E 2 26  ? -119.491 -46.265 -83.538  1.00 98.75  ? 26  GLN E O   1 
ATOM   5697 C CB  . GLN E 2 26  ? -118.048 -45.333 -86.197  1.00 97.93  ? 26  GLN E CB  1 
ATOM   5698 C CG  . GLN E 2 26  ? -117.719 -45.279 -87.632  1.00 98.46  ? 26  GLN E CG  1 
ATOM   5699 C CD  . GLN E 2 26  ? -116.710 -44.222 -87.922  1.00 99.24  ? 26  GLN E CD  1 
ATOM   5700 O OE1 . GLN E 2 26  ? -115.540 -44.528 -88.122  1.00 100.30 ? 26  GLN E OE1 1 
ATOM   5701 N NE2 . GLN E 2 26  ? -117.144 -42.960 -87.940  1.00 98.59  ? 26  GLN E NE2 1 
ATOM   5702 N N   . SER E 2 27  ? -118.706 -48.041 -84.714  1.00 99.67  ? 27  SER E N   1 
ATOM   5703 C CA  . SER E 2 27  ? -118.410 -48.918 -83.591  1.00 100.46 ? 27  SER E CA  1 
ATOM   5704 C C   . SER E 2 27  ? -117.087 -49.636 -83.885  1.00 101.30 ? 27  SER E C   1 
ATOM   5705 O O   . SER E 2 27  ? -116.862 -50.107 -85.005  1.00 101.75 ? 27  SER E O   1 
ATOM   5706 C CB  . SER E 2 27  ? -119.538 -49.935 -83.407  1.00 100.34 ? 27  SER E CB  1 
ATOM   5707 O OG  . SER E 2 27  ? -120.008 -50.407 -84.665  1.00 99.77  ? 27  SER E OG  1 
ATOM   5708 N N   . PRO E 2 28  ? -116.192 -49.719 -82.895  1.00 101.85 ? 28  PRO E N   1 
ATOM   5709 C CA  . PRO E 2 28  ? -116.301 -49.221 -81.536  1.00 102.25 ? 28  PRO E CA  1 
ATOM   5710 C C   . PRO E 2 28  ? -115.906 -47.754 -81.493  1.00 102.79 ? 28  PRO E C   1 
ATOM   5711 O O   . PRO E 2 28  ? -115.625 -47.172 -82.544  1.00 102.89 ? 28  PRO E O   1 
ATOM   5712 C CB  . PRO E 2 28  ? -115.253 -50.052 -80.806  1.00 102.43 ? 28  PRO E CB  1 
ATOM   5713 C CG  . PRO E 2 28  ? -114.178 -50.259 -81.832  1.00 102.06 ? 28  PRO E CG  1 
ATOM   5714 C CD  . PRO E 2 28  ? -114.887 -50.363 -83.149  1.00 101.79 ? 28  PRO E CD  1 
ATOM   5715 N N   . SER E 2 29  ? -115.878 -47.169 -80.295  1.00 103.38 ? 29  SER E N   1 
ATOM   5716 C CA  . SER E 2 29  ? -115.334 -45.827 -80.112  1.00 104.13 ? 29  SER E CA  1 
ATOM   5717 C C   . SER E 2 29  ? -113.853 -45.807 -80.413  1.00 104.63 ? 29  SER E C   1 
ATOM   5718 O O   . SER E 2 29  ? -113.350 -44.892 -81.078  1.00 104.66 ? 29  SER E O   1 
ATOM   5719 C CB  . SER E 2 29  ? -115.555 -45.349 -78.693  1.00 103.98 ? 29  SER E CB  1 
ATOM   5720 O OG  . SER E 2 29  ? -116.766 -44.632 -78.621  1.00 104.76 ? 29  SER E OG  1 
ATOM   5721 N N   . SER E 2 30  ? -113.168 -46.833 -79.917  1.00 105.21 ? 30  SER E N   1 
ATOM   5722 C CA  . SER E 2 30  ? -111.740 -46.971 -80.116  1.00 105.97 ? 30  SER E CA  1 
ATOM   5723 C C   . SER E 2 30  ? -111.256 -48.409 -80.005  1.00 106.61 ? 30  SER E C   1 
ATOM   5724 O O   . SER E 2 30  ? -111.975 -49.303 -79.549  1.00 106.57 ? 30  SER E O   1 
ATOM   5725 C CB  . SER E 2 30  ? -110.972 -46.063 -79.149  1.00 105.87 ? 30  SER E CB  1 
ATOM   5726 O OG  . SER E 2 30  ? -111.839 -45.486 -78.186  1.00 105.97 ? 30  SER E OG  1 
ATOM   5727 N N   . LEU E 2 31  ? -110.018 -48.610 -80.436  1.00 107.53 ? 31  LEU E N   1 
ATOM   5728 C CA  . LEU E 2 31  ? -109.370 -49.895 -80.355  1.00 108.51 ? 31  LEU E CA  1 
ATOM   5729 C C   . LEU E 2 31  ? -107.867 -49.755 -80.419  1.00 109.00 ? 31  LEU E C   1 
ATOM   5730 O O   . LEU E 2 31  ? -107.318 -49.257 -81.405  1.00 109.01 ? 31  LEU E O   1 
ATOM   5731 C CB  . LEU E 2 31  ? -109.839 -50.794 -81.492  1.00 108.82 ? 31  LEU E CB  1 
ATOM   5732 C CG  . LEU E 2 31  ? -110.814 -51.896 -81.093  1.00 109.58 ? 31  LEU E CG  1 
ATOM   5733 C CD1 . LEU E 2 31  ? -111.004 -52.849 -82.290  1.00 110.14 ? 31  LEU E CD1 1 
ATOM   5734 C CD2 . LEU E 2 31  ? -110.321 -52.632 -79.823  1.00 109.06 ? 31  LEU E CD2 1 
ATOM   5735 N N   . ALA E 2 32  ? -107.205 -50.191 -79.355  1.00 109.71 ? 32  ALA E N   1 
ATOM   5736 C CA  . ALA E 2 32  ? -105.758 -50.305 -79.366  1.00 110.39 ? 32  ALA E CA  1 
ATOM   5737 C C   . ALA E 2 32  ? -105.411 -51.617 -80.035  1.00 110.86 ? 32  ALA E C   1 
ATOM   5738 O O   . ALA E 2 32  ? -106.111 -52.625 -79.845  1.00 110.86 ? 32  ALA E O   1 
ATOM   5739 C CB  . ALA E 2 32  ? -105.188 -50.251 -77.957  1.00 110.53 ? 32  ALA E CB  1 
ATOM   5740 N N   . VAL E 2 33  ? -104.341 -51.602 -80.828  1.00 111.45 ? 33  VAL E N   1 
ATOM   5741 C CA  . VAL E 2 33  ? -103.933 -52.806 -81.556  1.00 111.87 ? 33  VAL E CA  1 
ATOM   5742 C C   . VAL E 2 33  ? -102.400 -52.945 -81.745  1.00 112.00 ? 33  VAL E C   1 
ATOM   5743 O O   . VAL E 2 33  ? -101.637 -51.991 -81.515  1.00 111.71 ? 33  VAL E O   1 
ATOM   5744 C CB  . VAL E 2 33  ? -104.763 -52.974 -82.882  1.00 111.91 ? 33  VAL E CB  1 
ATOM   5745 C CG1 . VAL E 2 33  ? -104.189 -52.120 -84.041  1.00 111.68 ? 33  VAL E CG1 1 
ATOM   5746 C CG2 . VAL E 2 33  ? -104.921 -54.459 -83.247  1.00 111.86 ? 33  VAL E CG2 1 
ATOM   5747 N N   . SER E 2 34  ? -101.982 -54.150 -82.142  1.00 112.26 ? 34  SER E N   1 
ATOM   5748 C CA  . SER E 2 34  ? -100.574 -54.529 -82.243  1.00 112.51 ? 34  SER E CA  1 
ATOM   5749 C C   . SER E 2 34  ? -100.081 -54.523 -83.688  1.00 112.39 ? 34  SER E C   1 
ATOM   5750 O O   . SER E 2 34  ? -100.727 -55.081 -84.580  1.00 112.15 ? 34  SER E O   1 
ATOM   5751 C CB  . SER E 2 34  ? -100.362 -55.909 -81.612  1.00 112.60 ? 34  SER E CB  1 
ATOM   5752 O OG  . SER E 2 34  ? -101.073 -56.016 -80.387  1.00 113.14 ? 34  SER E OG  1 
ATOM   5753 N N   . ALA E 2 35  ? -98.919  -53.910 -83.890  1.00 112.49 ? 35  ALA E N   1 
ATOM   5754 C CA  . ALA E 2 35  ? -98.396  -53.626 -85.221  1.00 112.80 ? 35  ALA E CA  1 
ATOM   5755 C C   . ALA E 2 35  ? -98.120  -54.868 -86.076  1.00 113.00 ? 35  ALA E C   1 
ATOM   5756 O O   . ALA E 2 35  ? -97.258  -55.690 -85.747  1.00 113.02 ? 35  ALA E O   1 
ATOM   5757 C CB  . ALA E 2 35  ? -97.149  -52.754 -85.115  1.00 112.93 ? 35  ALA E CB  1 
ATOM   5758 N N   . GLY E 2 36  ? -98.860  -54.984 -87.178  1.00 113.27 ? 36  GLY E N   1 
ATOM   5759 C CA  . GLY E 2 36  ? -98.692  -56.083 -88.131  1.00 113.39 ? 36  GLY E CA  1 
ATOM   5760 C C   . GLY E 2 36  ? -99.916  -56.972 -88.243  1.00 113.50 ? 36  GLY E C   1 
ATOM   5761 O O   . GLY E 2 36  ? -99.971  -57.842 -89.105  1.00 113.66 ? 36  GLY E O   1 
ATOM   5762 N N   . GLU E 2 37  ? -100.895 -56.746 -87.369  1.00 113.54 ? 37  GLU E N   1 
ATOM   5763 C CA  . GLU E 2 37  ? -102.150 -57.501 -87.344  1.00 113.57 ? 37  GLU E CA  1 
ATOM   5764 C C   . GLU E 2 37  ? -103.176 -57.055 -88.397  1.00 113.49 ? 37  GLU E C   1 
ATOM   5765 O O   . GLU E 2 37  ? -102.832 -56.368 -89.361  1.00 113.56 ? 37  GLU E O   1 
ATOM   5766 C CB  . GLU E 2 37  ? -102.788 -57.350 -85.974  1.00 113.69 ? 37  GLU E CB  1 
ATOM   5767 C CG  . GLU E 2 37  ? -102.172 -58.189 -84.907  1.00 114.29 ? 37  GLU E CG  1 
ATOM   5768 C CD  . GLU E 2 37  ? -103.010 -58.179 -83.656  1.00 115.13 ? 37  GLU E CD  1 
ATOM   5769 O OE1 . GLU E 2 37  ? -103.605 -59.237 -83.338  1.00 114.76 ? 37  GLU E OE1 1 
ATOM   5770 O OE2 . GLU E 2 37  ? -103.087 -57.107 -83.012  1.00 115.29 ? 37  GLU E OE2 1 
ATOM   5771 N N   . LYS E 2 38  ? -104.440 -57.441 -88.190  1.00 113.25 ? 38  LYS E N   1 
ATOM   5772 C CA  . LYS E 2 38  ? -105.539 -57.050 -89.080  1.00 112.92 ? 38  LYS E CA  1 
ATOM   5773 C C   . LYS E 2 38  ? -106.826 -56.668 -88.343  1.00 112.35 ? 38  LYS E C   1 
ATOM   5774 O O   . LYS E 2 38  ? -107.689 -57.531 -88.100  1.00 112.27 ? 38  LYS E O   1 
ATOM   5775 C CB  . LYS E 2 38  ? -105.825 -58.141 -90.120  1.00 113.31 ? 38  LYS E CB  1 
ATOM   5776 C CG  . LYS E 2 38  ? -106.657 -57.679 -91.321  1.00 114.41 ? 38  LYS E CG  1 
ATOM   5777 C CD  . LYS E 2 38  ? -106.512 -58.641 -92.500  1.00 116.92 ? 38  LYS E CD  1 
ATOM   5778 C CE  . LYS E 2 38  ? -107.158 -58.080 -93.771  1.00 118.50 ? 38  LYS E CE  1 
ATOM   5779 N NZ  . LYS E 2 38  ? -107.282 -59.111 -94.861  1.00 119.12 ? 38  LYS E NZ  1 
ATOM   5780 N N   . VAL E 2 39  ? -106.936 -55.369 -88.015  1.00 111.62 ? 39  VAL E N   1 
ATOM   5781 C CA  . VAL E 2 39  ? -108.155 -54.737 -87.440  1.00 110.57 ? 39  VAL E CA  1 
ATOM   5782 C C   . VAL E 2 39  ? -109.261 -54.501 -88.462  1.00 109.76 ? 39  VAL E C   1 
ATOM   5783 O O   . VAL E 2 39  ? -109.000 -54.431 -89.663  1.00 109.72 ? 39  VAL E O   1 
ATOM   5784 C CB  . VAL E 2 39  ? -107.881 -53.346 -86.768  1.00 110.56 ? 39  VAL E CB  1 
ATOM   5785 C CG1 . VAL E 2 39  ? -108.194 -53.378 -85.260  1.00 110.60 ? 39  VAL E CG1 1 
ATOM   5786 C CG2 . VAL E 2 39  ? -106.474 -52.822 -87.076  1.00 110.20 ? 39  VAL E CG2 1 
ATOM   5787 N N   . THR E 2 40  ? -110.493 -54.377 -87.974  1.00 108.70 ? 40  THR E N   1 
ATOM   5788 C CA  . THR E 2 40  ? -111.617 -53.951 -88.798  1.00 107.84 ? 40  THR E CA  1 
ATOM   5789 C C   . THR E 2 40  ? -112.552 -53.087 -87.968  1.00 107.26 ? 40  THR E C   1 
ATOM   5790 O O   . THR E 2 40  ? -113.093 -53.567 -86.980  1.00 107.37 ? 40  THR E O   1 
ATOM   5791 C CB  . THR E 2 40  ? -112.424 -55.151 -89.375  1.00 107.83 ? 40  THR E CB  1 
ATOM   5792 O OG1 . THR E 2 40  ? -113.384 -55.612 -88.414  1.00 107.65 ? 40  THR E OG1 1 
ATOM   5793 C CG2 . THR E 2 40  ? -111.512 -56.303 -89.770  1.00 107.90 ? 40  THR E CG2 1 
ATOM   5794 N N   . MET E 2 41  ? -112.738 -51.821 -88.338  1.00 106.65 ? 41  MET E N   1 
ATOM   5795 C CA  . MET E 2 41  ? -113.804 -51.035 -87.700  1.00 106.22 ? 41  MET E CA  1 
ATOM   5796 C C   . MET E 2 41  ? -115.083 -51.111 -88.497  1.00 105.97 ? 41  MET E C   1 
ATOM   5797 O O   . MET E 2 41  ? -115.069 -51.532 -89.649  1.00 105.95 ? 41  MET E O   1 
ATOM   5798 C CB  . MET E 2 41  ? -113.431 -49.573 -87.393  1.00 106.19 ? 41  MET E CB  1 
ATOM   5799 C CG  . MET E 2 41  ? -112.915 -48.726 -88.526  1.00 105.50 ? 41  MET E CG  1 
ATOM   5800 S SD  . MET E 2 41  ? -111.223 -48.213 -88.192  1.00 104.82 ? 41  MET E SD  1 
ATOM   5801 C CE  . MET E 2 41  ? -110.293 -49.458 -89.091  1.00 104.22 ? 41  MET E CE  1 
ATOM   5802 N N   . SER E 2 42  ? -116.185 -50.713 -87.871  1.00 105.81 ? 42  SER E N   1 
ATOM   5803 C CA  . SER E 2 42  ? -117.490 -50.804 -88.499  1.00 105.87 ? 42  SER E CA  1 
ATOM   5804 C C   . SER E 2 42  ? -118.222 -49.470 -88.609  1.00 105.90 ? 42  SER E C   1 
ATOM   5805 O O   . SER E 2 42  ? -118.113 -48.597 -87.743  1.00 105.85 ? 42  SER E O   1 
ATOM   5806 C CB  . SER E 2 42  ? -118.369 -51.816 -87.779  1.00 105.84 ? 42  SER E CB  1 
ATOM   5807 O OG  . SER E 2 42  ? -119.701 -51.706 -88.239  1.00 106.16 ? 42  SER E OG  1 
ATOM   5808 N N   . CYS E 2 43  ? -118.975 -49.345 -89.695  1.00 105.97 ? 43  CYS E N   1 
ATOM   5809 C CA  . CYS E 2 43  ? -119.752 -48.161 -89.983  1.00 105.95 ? 43  CYS E CA  1 
ATOM   5810 C C   . CYS E 2 43  ? -121.146 -48.573 -90.411  1.00 106.47 ? 43  CYS E C   1 
ATOM   5811 O O   . CYS E 2 43  ? -121.324 -49.426 -91.274  1.00 106.28 ? 43  CYS E O   1 
ATOM   5812 C CB  . CYS E 2 43  ? -119.084 -47.348 -91.082  1.00 105.56 ? 43  CYS E CB  1 
ATOM   5813 S SG  . CYS E 2 43  ? -120.003 -45.901 -91.593  1.00 104.29 ? 43  CYS E SG  1 
ATOM   5814 N N   . LYS E 2 44  ? -122.138 -47.966 -89.782  1.00 107.33 ? 44  LYS E N   1 
ATOM   5815 C CA  . LYS E 2 44  ? -123.517 -48.229 -90.128  1.00 108.25 ? 44  LYS E CA  1 
ATOM   5816 C C   . LYS E 2 44  ? -124.277 -46.935 -90.391  1.00 108.77 ? 44  LYS E C   1 
ATOM   5817 O O   . LYS E 2 44  ? -123.803 -45.848 -90.064  1.00 108.83 ? 44  LYS E O   1 
ATOM   5818 C CB  . LYS E 2 44  ? -124.181 -49.104 -89.066  1.00 108.25 ? 44  LYS E CB  1 
ATOM   5819 C CG  . LYS E 2 44  ? -123.826 -50.591 -89.242  1.00 109.02 ? 44  LYS E CG  1 
ATOM   5820 C CD  . LYS E 2 44  ? -124.569 -51.513 -88.265  1.00 110.62 ? 44  LYS E CD  1 
ATOM   5821 C CE  . LYS E 2 44  ? -126.102 -51.385 -88.346  1.00 111.03 ? 44  LYS E CE  1 
ATOM   5822 N NZ  . LYS E 2 44  ? -126.674 -51.973 -89.593  1.00 111.51 ? 44  LYS E NZ  1 
ATOM   5823 N N   . SER E 2 45  ? -125.443 -47.066 -91.010  1.00 109.50 ? 45  SER E N   1 
ATOM   5824 C CA  . SER E 2 45  ? -126.175 -45.928 -91.532  1.00 110.38 ? 45  SER E CA  1 
ATOM   5825 C C   . SER E 2 45  ? -127.640 -46.179 -91.318  1.00 111.04 ? 45  SER E C   1 
ATOM   5826 O O   . SER E 2 45  ? -128.087 -47.320 -91.433  1.00 111.14 ? 45  SER E O   1 
ATOM   5827 C CB  . SER E 2 45  ? -125.924 -45.824 -93.021  1.00 110.35 ? 45  SER E CB  1 
ATOM   5828 O OG  . SER E 2 45  ? -126.093 -47.098 -93.612  1.00 110.64 ? 45  SER E OG  1 
ATOM   5829 N N   . SER E 2 46  ? -128.390 -45.119 -91.022  1.00 111.97 ? 46  SER E N   1 
ATOM   5830 C CA  . SER E 2 46  ? -129.818 -45.253 -90.726  1.00 112.93 ? 46  SER E CA  1 
ATOM   5831 C C   . SER E 2 46  ? -130.569 -45.664 -91.977  1.00 113.73 ? 46  SER E C   1 
ATOM   5832 O O   . SER E 2 46  ? -131.448 -46.526 -91.940  1.00 113.81 ? 46  SER E O   1 
ATOM   5833 C CB  . SER E 2 46  ? -130.394 -43.950 -90.175  1.00 112.78 ? 46  SER E CB  1 
ATOM   5834 O OG  . SER E 2 46  ? -130.576 -42.992 -91.199  1.00 112.62 ? 46  SER E OG  1 
ATOM   5835 N N   . GLN E 2 47  ? -130.196 -45.035 -93.085  1.00 114.87 ? 47  GLN E N   1 
ATOM   5836 C CA  . GLN E 2 47  ? -130.789 -45.307 -94.385  1.00 115.77 ? 47  GLN E CA  1 
ATOM   5837 C C   . GLN E 2 47  ? -129.853 -46.132 -95.238  1.00 116.10 ? 47  GLN E C   1 
ATOM   5838 O O   . GLN E 2 47  ? -128.631 -46.068 -95.070  1.00 115.94 ? 47  GLN E O   1 
ATOM   5839 C CB  . GLN E 2 47  ? -131.067 -44.004 -95.115  1.00 115.86 ? 47  GLN E CB  1 
ATOM   5840 C CG  . GLN E 2 47  ? -132.397 -43.394 -94.818  1.00 116.39 ? 47  GLN E CG  1 
ATOM   5841 C CD  . GLN E 2 47  ? -132.713 -42.299 -95.795  1.00 118.12 ? 47  GLN E CD  1 
ATOM   5842 O OE1 . GLN E 2 47  ? -132.089 -42.194 -96.867  1.00 118.37 ? 47  GLN E OE1 1 
ATOM   5843 N NE2 . GLN E 2 47  ? -133.685 -41.464 -95.441  1.00 119.15 ? 47  GLN E NE2 1 
ATOM   5844 N N   . SER E 2 48  ? -130.435 -46.897 -96.157  1.00 116.55 ? 48  SER E N   1 
ATOM   5845 C CA  . SER E 2 48  ? -129.650 -47.646 -97.107  1.00 117.09 ? 48  SER E CA  1 
ATOM   5846 C C   . SER E 2 48  ? -129.006 -46.684 -98.081  1.00 117.42 ? 48  SER E C   1 
ATOM   5847 O O   . SER E 2 48  ? -129.617 -45.700 -98.489  1.00 117.50 ? 48  SER E O   1 
ATOM   5848 C CB  . SER E 2 48  ? -130.507 -48.651 -97.845  1.00 117.10 ? 48  SER E CB  1 
ATOM   5849 O OG  . SER E 2 48  ? -129.671 -49.548 -98.545  1.00 117.81 ? 48  SER E OG  1 
ATOM   5850 N N   . LEU E 2 49  ? -127.762 -46.968 -98.433  1.00 117.95 ? 49  LEU E N   1 
ATOM   5851 C CA  . LEU E 2 49  ? -126.983 -46.070 -99.261  1.00 118.63 ? 49  LEU E CA  1 
ATOM   5852 C C   . LEU E 2 49  ? -126.808 -46.635 -100.672 1.00 119.60 ? 49  LEU E C   1 
ATOM   5853 O O   . LEU E 2 49  ? -125.958 -46.156 -101.437 1.00 119.88 ? 49  LEU E O   1 
ATOM   5854 C CB  . LEU E 2 49  ? -125.627 -45.800 -98.600  1.00 118.30 ? 49  LEU E CB  1 
ATOM   5855 C CG  . LEU E 2 49  ? -125.442 -44.686 -97.561  1.00 117.75 ? 49  LEU E CG  1 
ATOM   5856 C CD1 . LEU E 2 49  ? -126.739 -44.222 -96.896  1.00 117.56 ? 49  LEU E CD1 1 
ATOM   5857 C CD2 . LEU E 2 49  ? -124.420 -45.105 -96.515  1.00 116.48 ? 49  LEU E CD2 1 
ATOM   5858 N N   . LEU E 2 50  ? -127.602 -47.657 -101.005 1.00 120.53 ? 50  LEU E N   1 
ATOM   5859 C CA  . LEU E 2 50  ? -127.612 -48.249 -102.351 1.00 121.49 ? 50  LEU E CA  1 
ATOM   5860 C C   . LEU E 2 50  ? -128.359 -47.390 -103.374 1.00 122.39 ? 50  LEU E C   1 
ATOM   5861 O O   . LEU E 2 50  ? -129.172 -46.537 -103.006 1.00 122.58 ? 50  LEU E O   1 
ATOM   5862 C CB  . LEU E 2 50  ? -128.221 -49.658 -102.327 1.00 121.31 ? 50  LEU E CB  1 
ATOM   5863 C CG  . LEU E 2 50  ? -127.265 -50.854 -102.402 1.00 121.14 ? 50  LEU E CG  1 
ATOM   5864 C CD1 . LEU E 2 50  ? -128.025 -52.164 -102.218 1.00 120.32 ? 50  LEU E CD1 1 
ATOM   5865 C CD2 . LEU E 2 50  ? -126.471 -50.861 -103.711 1.00 120.63 ? 50  LEU E CD2 1 
ATOM   5866 N N   . ASN E 2 51  ? -128.081 -47.625 -104.656 1.00 123.45 ? 51  ASN E N   1 
ATOM   5867 C CA  . ASN E 2 51  ? -128.787 -46.951 -105.745 1.00 124.49 ? 51  ASN E CA  1 
ATOM   5868 C C   . ASN E 2 51  ? -129.199 -47.941 -106.833 1.00 125.29 ? 51  ASN E C   1 
ATOM   5869 O O   . ASN E 2 51  ? -128.329 -48.593 -107.420 1.00 125.63 ? 51  ASN E O   1 
ATOM   5870 C CB  . ASN E 2 51  ? -127.900 -45.859 -106.345 1.00 124.40 ? 51  ASN E CB  1 
ATOM   5871 C CG  . ASN E 2 51  ? -128.691 -44.820 -107.126 1.00 124.59 ? 51  ASN E CG  1 
ATOM   5872 O OD1 . ASN E 2 51  ? -128.109 -44.002 -107.846 1.00 124.66 ? 51  ASN E OD1 1 
ATOM   5873 N ND2 . ASN E 2 51  ? -130.018 -44.839 -106.983 1.00 124.30 ? 51  ASN E ND2 1 
ATOM   5874 N N   . SER E 2 52  ? -130.508 -48.046 -107.104 1.00 126.21 ? 52  SER E N   1 
ATOM   5875 C CA  . SER E 2 52  ? -131.062 -48.980 -108.117 1.00 126.92 ? 52  SER E CA  1 
ATOM   5876 C C   . SER E 2 52  ? -130.153 -49.156 -109.333 1.00 127.65 ? 52  SER E C   1 
ATOM   5877 O O   . SER E 2 52  ? -129.940 -50.271 -109.809 1.00 127.73 ? 52  SER E O   1 
ATOM   5878 C CB  . SER E 2 52  ? -132.451 -48.529 -108.582 1.00 126.82 ? 52  SER E CB  1 
ATOM   5879 O OG  . SER E 2 52  ? -132.374 -47.492 -109.553 1.00 126.29 ? 52  SER E OG  1 
ATOM   5880 N N   . ARG E 2 53  ? -129.636 -48.030 -109.818 1.00 128.64 ? 53  ARG E N   1 
ATOM   5881 C CA  . ARG E 2 53  ? -128.620 -47.971 -110.862 1.00 129.59 ? 53  ARG E CA  1 
ATOM   5882 C C   . ARG E 2 53  ? -127.494 -47.026 -110.406 1.00 130.21 ? 53  ARG E C   1 
ATOM   5883 O O   . ARG E 2 53  ? -127.768 -45.979 -109.824 1.00 130.53 ? 53  ARG E O   1 
ATOM   5884 C CB  . ARG E 2 53  ? -129.237 -47.432 -112.159 1.00 129.72 ? 53  ARG E CB  1 
ATOM   5885 C CG  . ARG E 2 53  ? -130.015 -46.110 -111.986 1.00 130.11 ? 53  ARG E CG  1 
ATOM   5886 C CD  . ARG E 2 53  ? -129.701 -45.131 -113.102 1.00 130.91 ? 53  ARG E CD  1 
ATOM   5887 N NE  . ARG E 2 53  ? -129.454 -43.779 -112.597 1.00 132.12 ? 53  ARG E NE  1 
ATOM   5888 C CZ  . ARG E 2 53  ? -130.389 -42.848 -112.416 1.00 132.83 ? 53  ARG E CZ  1 
ATOM   5889 N NH1 . ARG E 2 53  ? -131.661 -43.106 -112.701 1.00 133.65 ? 53  ARG E NH1 1 
ATOM   5890 N NH2 . ARG E 2 53  ? -130.047 -41.650 -111.955 1.00 132.72 ? 53  ARG E NH2 1 
ATOM   5891 N N   . THR E 2 54  ? -126.232 -47.411 -110.572 1.00 130.84 ? 54  THR E N   1 
ATOM   5892 C CA  . THR E 2 54  ? -125.817 -48.795 -110.704 1.00 131.46 ? 54  THR E CA  1 
ATOM   5893 C C   . THR E 2 54  ? -125.523 -49.133 -109.253 1.00 131.45 ? 54  THR E C   1 
ATOM   5894 O O   . THR E 2 54  ? -125.477 -48.212 -108.423 1.00 131.46 ? 54  THR E O   1 
ATOM   5895 C CB  . THR E 2 54  ? -124.510 -48.926 -111.549 1.00 131.77 ? 54  THR E CB  1 
ATOM   5896 O OG1 . THR E 2 54  ? -124.501 -47.954 -112.612 1.00 132.24 ? 54  THR E OG1 1 
ATOM   5897 C CG2 . THR E 2 54  ? -124.354 -50.348 -112.133 1.00 131.66 ? 54  THR E CG2 1 
ATOM   5898 N N   . ARG E 2 55  ? -125.342 -50.415 -108.927 1.00 131.40 ? 55  ARG E N   1 
ATOM   5899 C CA  . ARG E 2 55  ? -124.873 -50.772 -107.588 1.00 131.48 ? 55  ARG E CA  1 
ATOM   5900 C C   . ARG E 2 55  ? -123.719 -49.846 -107.204 1.00 131.08 ? 55  ARG E C   1 
ATOM   5901 O O   . ARG E 2 55  ? -122.575 -50.024 -107.643 1.00 131.36 ? 55  ARG E O   1 
ATOM   5902 C CB  . ARG E 2 55  ? -124.449 -52.243 -107.488 1.00 131.83 ? 55  ARG E CB  1 
ATOM   5903 C CG  . ARG E 2 55  ? -125.312 -53.103 -106.550 1.00 132.94 ? 55  ARG E CG  1 
ATOM   5904 C CD  . ARG E 2 55  ? -124.943 -54.584 -106.637 1.00 134.59 ? 55  ARG E CD  1 
ATOM   5905 N NE  . ARG E 2 55  ? -124.695 -54.984 -108.026 1.00 136.81 ? 55  ARG E NE  1 
ATOM   5906 C CZ  . ARG E 2 55  ? -124.799 -56.223 -108.511 1.00 137.92 ? 55  ARG E CZ  1 
ATOM   5907 N NH1 . ARG E 2 55  ? -125.163 -57.238 -107.731 1.00 138.46 ? 55  ARG E NH1 1 
ATOM   5908 N NH2 . ARG E 2 55  ? -124.543 -56.446 -109.797 1.00 138.40 ? 55  ARG E NH2 1 
ATOM   5909 N N   . LYS E 2 56  ? -124.060 -48.822 -106.426 1.00 130.28 ? 56  LYS E N   1 
ATOM   5910 C CA  . LYS E 2 56  ? -123.109 -47.856 -105.892 1.00 129.25 ? 56  LYS E CA  1 
ATOM   5911 C C   . LYS E 2 56  ? -123.601 -47.492 -104.493 1.00 128.58 ? 56  LYS E C   1 
ATOM   5912 O O   . LYS E 2 56  ? -124.807 -47.561 -104.200 1.00 128.74 ? 56  LYS E O   1 
ATOM   5913 C CB  . LYS E 2 56  ? -123.004 -46.620 -106.791 1.00 129.33 ? 56  LYS E CB  1 
ATOM   5914 C CG  . LYS E 2 56  ? -122.169 -46.799 -108.057 1.00 129.13 ? 56  LYS E CG  1 
ATOM   5915 C CD  . LYS E 2 56  ? -120.668 -46.765 -107.767 1.00 128.31 ? 56  LYS E CD  1 
ATOM   5916 C CE  . LYS E 2 56  ? -119.872 -46.449 -109.025 1.00 127.91 ? 56  LYS E CE  1 
ATOM   5917 N NZ  . LYS E 2 56  ? -120.149 -47.425 -110.121 1.00 127.96 ? 56  LYS E NZ  1 
ATOM   5918 N N   . ASN E 2 57  ? -122.666 -47.084 -103.643 1.00 127.29 ? 57  ASN E N   1 
ATOM   5919 C CA  . ASN E 2 57  ? -122.838 -47.152 -102.213 1.00 125.93 ? 57  ASN E CA  1 
ATOM   5920 C C   . ASN E 2 57  ? -121.601 -46.455 -101.699 1.00 125.02 ? 57  ASN E C   1 
ATOM   5921 O O   . ASN E 2 57  ? -120.787 -47.131 -101.092 1.00 125.31 ? 57  ASN E O   1 
ATOM   5922 C CB  . ASN E 2 57  ? -122.708 -48.635 -101.843 1.00 126.07 ? 57  ASN E CB  1 
ATOM   5923 C CG  . ASN E 2 57  ? -123.778 -49.119 -100.902 1.00 126.22 ? 57  ASN E CG  1 
ATOM   5924 O OD1 . ASN E 2 57  ? -123.847 -50.307 -100.589 1.00 125.84 ? 57  ASN E OD1 1 
ATOM   5925 N ND2 . ASN E 2 57  ? -124.620 -48.217 -100.450 1.00 127.35 ? 57  ASN E ND2 1 
ATOM   5926 N N   . TYR E 2 58  ? -121.396 -45.145 -101.850 1.00 123.66 ? 58  TYR E N   1 
ATOM   5927 C CA  . TYR E 2 58  ? -122.274 -43.987 -101.575 1.00 122.32 ? 58  TYR E CA  1 
ATOM   5928 C C   . TYR E 2 58  ? -122.028 -43.604 -100.128 1.00 121.12 ? 58  TYR E C   1 
ATOM   5929 O O   . TYR E 2 58  ? -122.898 -43.131 -99.393  1.00 121.15 ? 58  TYR E O   1 
ATOM   5930 C CB  . TYR E 2 58  ? -123.728 -44.057 -102.058 1.00 122.43 ? 58  TYR E CB  1 
ATOM   5931 C CG  . TYR E 2 58  ? -123.736 -43.675 -103.515 1.00 123.05 ? 58  TYR E CG  1 
ATOM   5932 C CD1 . TYR E 2 58  ? -124.680 -44.180 -104.403 1.00 123.17 ? 58  TYR E CD1 1 
ATOM   5933 C CD2 . TYR E 2 58  ? -122.716 -42.848 -104.019 1.00 123.52 ? 58  TYR E CD2 1 
ATOM   5934 C CE1 . TYR E 2 58  ? -124.627 -43.843 -105.752 1.00 124.08 ? 58  TYR E CE1 1 
ATOM   5935 C CE2 . TYR E 2 58  ? -122.648 -42.512 -105.345 1.00 124.11 ? 58  TYR E CE2 1 
ATOM   5936 C CZ  . TYR E 2 58  ? -123.598 -43.008 -106.217 1.00 124.87 ? 58  TYR E CZ  1 
ATOM   5937 O OH  . TYR E 2 58  ? -123.509 -42.653 -107.550 1.00 125.94 ? 58  TYR E OH  1 
ATOM   5938 N N   . LEU E 2 59  ? -120.755 -43.807 -99.795  1.00 119.37 ? 59  LEU E N   1 
ATOM   5939 C CA  . LEU E 2 59  ? -120.181 -43.698 -98.483  1.00 117.73 ? 59  LEU E CA  1 
ATOM   5940 C C   . LEU E 2 59  ? -118.675 -43.702 -98.694  1.00 116.67 ? 59  LEU E C   1 
ATOM   5941 O O   . LEU E 2 59  ? -118.159 -44.440 -99.541  1.00 116.67 ? 59  LEU E O   1 
ATOM   5942 C CB  . LEU E 2 59  ? -120.587 -44.896 -97.622  1.00 117.76 ? 59  LEU E CB  1 
ATOM   5943 C CG  . LEU E 2 59  ? -119.854 -45.140 -96.296  1.00 117.71 ? 59  LEU E CG  1 
ATOM   5944 C CD1 . LEU E 2 59  ? -120.824 -45.560 -95.233  1.00 117.80 ? 59  LEU E CD1 1 
ATOM   5945 C CD2 . LEU E 2 59  ? -118.740 -46.168 -96.432  1.00 117.98 ? 59  LEU E CD2 1 
ATOM   5946 N N   . ALA E 2 60  ? -117.978 -42.890 -97.907  1.00 115.10 ? 60  ALA E N   1 
ATOM   5947 C CA  . ALA E 2 60  ? -116.530 -42.795 -97.966  1.00 113.45 ? 60  ALA E CA  1 
ATOM   5948 C C   . ALA E 2 60  ? -115.873 -43.256 -96.662  1.00 112.39 ? 60  ALA E C   1 
ATOM   5949 O O   . ALA E 2 60  ? -116.552 -43.694 -95.741  1.00 112.35 ? 60  ALA E O   1 
ATOM   5950 C CB  . ALA E 2 60  ? -116.128 -41.374 -98.293  1.00 113.40 ? 60  ALA E CB  1 
ATOM   5951 N N   . TRP E 2 61  ? -114.545 -43.168 -96.618  1.00 111.06 ? 61  TRP E N   1 
ATOM   5952 C CA  . TRP E 2 61  ? -113.732 -43.400 -95.429  1.00 109.51 ? 61  TRP E CA  1 
ATOM   5953 C C   . TRP E 2 61  ? -112.608 -42.377 -95.418  1.00 109.35 ? 61  TRP E C   1 
ATOM   5954 O O   . TRP E 2 61  ? -111.865 -42.253 -96.388  1.00 109.49 ? 61  TRP E O   1 
ATOM   5955 C CB  . TRP E 2 61  ? -113.129 -44.791 -95.465  1.00 108.92 ? 61  TRP E CB  1 
ATOM   5956 C CG  . TRP E 2 61  ? -114.078 -45.842 -95.078  1.00 107.10 ? 61  TRP E CG  1 
ATOM   5957 C CD1 . TRP E 2 61  ? -114.709 -46.713 -95.906  1.00 105.84 ? 61  TRP E CD1 1 
ATOM   5958 C CD2 . TRP E 2 61  ? -114.520 -46.151 -93.751  1.00 105.48 ? 61  TRP E CD2 1 
ATOM   5959 N NE1 . TRP E 2 61  ? -115.519 -47.552 -95.179  1.00 105.17 ? 61  TRP E NE1 1 
ATOM   5960 C CE2 . TRP E 2 61  ? -115.420 -47.226 -93.853  1.00 104.58 ? 61  TRP E CE2 1 
ATOM   5961 C CE3 . TRP E 2 61  ? -114.245 -45.619 -92.487  1.00 104.65 ? 61  TRP E CE3 1 
ATOM   5962 C CZ2 . TRP E 2 61  ? -116.043 -47.780 -92.744  1.00 103.52 ? 61  TRP E CZ2 1 
ATOM   5963 C CZ3 . TRP E 2 61  ? -114.867 -46.164 -91.391  1.00 103.52 ? 61  TRP E CZ3 1 
ATOM   5964 C CH2 . TRP E 2 61  ? -115.753 -47.235 -91.526  1.00 103.57 ? 61  TRP E CH2 1 
ATOM   5965 N N   . TYR E 2 62  ? -112.490 -41.633 -94.329  1.00 108.94 ? 62  TYR E N   1 
ATOM   5966 C CA  . TYR E 2 62  ? -111.442 -40.631 -94.199  1.00 108.54 ? 62  TYR E CA  1 
ATOM   5967 C C   . TYR E 2 62  ? -110.638 -40.937 -92.943  1.00 108.45 ? 62  TYR E C   1 
ATOM   5968 O O   . TYR E 2 62  ? -111.209 -41.280 -91.910  1.00 108.34 ? 62  TYR E O   1 
ATOM   5969 C CB  . TYR E 2 62  ? -112.047 -39.227 -94.080  1.00 108.46 ? 62  TYR E CB  1 
ATOM   5970 C CG  . TYR E 2 62  ? -112.791 -38.704 -95.294  1.00 108.30 ? 62  TYR E CG  1 
ATOM   5971 C CD1 . TYR E 2 62  ? -113.963 -39.312 -95.743  1.00 108.31 ? 62  TYR E CD1 1 
ATOM   5972 C CD2 . TYR E 2 62  ? -112.346 -37.563 -95.962  1.00 108.34 ? 62  TYR E CD2 1 
ATOM   5973 C CE1 . TYR E 2 62  ? -114.653 -38.817 -96.849  1.00 108.91 ? 62  TYR E CE1 1 
ATOM   5974 C CE2 . TYR E 2 62  ? -113.028 -37.055 -97.070  1.00 108.50 ? 62  TYR E CE2 1 
ATOM   5975 C CZ  . TYR E 2 62  ? -114.183 -37.686 -97.511  1.00 109.30 ? 62  TYR E CZ  1 
ATOM   5976 O OH  . TYR E 2 62  ? -114.864 -37.188 -98.611  1.00 109.61 ? 62  TYR E OH  1 
ATOM   5977 N N   . GLN E 2 63  ? -109.316 -40.816 -93.019  1.00 108.51 ? 63  GLN E N   1 
ATOM   5978 C CA  . GLN E 2 63  ? -108.490 -40.942 -91.815  1.00 108.66 ? 63  GLN E CA  1 
ATOM   5979 C C   . GLN E 2 63  ? -107.873 -39.609 -91.381  1.00 108.32 ? 63  GLN E C   1 
ATOM   5980 O O   . GLN E 2 63  ? -107.304 -38.884 -92.202  1.00 108.49 ? 63  GLN E O   1 
ATOM   5981 C CB  . GLN E 2 63  ? -107.438 -42.066 -91.953  1.00 108.98 ? 63  GLN E CB  1 
ATOM   5982 C CG  . GLN E 2 63  ? -106.084 -41.710 -92.603  1.00 110.03 ? 63  GLN E CG  1 
ATOM   5983 C CD  . GLN E 2 63  ? -104.890 -42.522 -92.037  1.00 111.21 ? 63  GLN E CD  1 
ATOM   5984 O OE1 . GLN E 2 63  ? -103.789 -42.488 -92.592  1.00 112.63 ? 63  GLN E OE1 1 
ATOM   5985 N NE2 . GLN E 2 63  ? -105.111 -43.239 -90.937  1.00 110.63 ? 63  GLN E NE2 1 
ATOM   5986 N N   . GLN E 2 64  ? -108.014 -39.282 -90.097  1.00 107.88 ? 64  GLN E N   1 
ATOM   5987 C CA  . GLN E 2 64  ? -107.469 -38.038 -89.548  1.00 107.55 ? 64  GLN E CA  1 
ATOM   5988 C C   . GLN E 2 64  ? -106.470 -38.281 -88.405  1.00 107.63 ? 64  GLN E C   1 
ATOM   5989 O O   . GLN E 2 64  ? -106.824 -38.732 -87.304  1.00 107.46 ? 64  GLN E O   1 
ATOM   5990 C CB  . GLN E 2 64  ? -108.587 -37.067 -89.120  1.00 107.52 ? 64  GLN E CB  1 
ATOM   5991 C CG  . GLN E 2 64  ? -108.100 -35.658 -88.717  1.00 106.65 ? 64  GLN E CG  1 
ATOM   5992 C CD  . GLN E 2 64  ? -109.193 -34.769 -88.130  1.00 105.11 ? 64  GLN E CD  1 
ATOM   5993 O OE1 . GLN E 2 64  ? -110.040 -35.217 -87.363  1.00 104.57 ? 64  GLN E OE1 1 
ATOM   5994 N NE2 . GLN E 2 64  ? -109.163 -33.498 -88.483  1.00 104.76 ? 64  GLN E NE2 1 
ATOM   5995 N N   . LYS E 2 65  ? -105.212 -37.981 -88.704  1.00 107.66 ? 65  LYS E N   1 
ATOM   5996 C CA  . LYS E 2 65  ? -104.133 -37.999 -87.736  1.00 107.57 ? 65  LYS E CA  1 
ATOM   5997 C C   . LYS E 2 65  ? -104.140 -36.673 -86.965  1.00 107.76 ? 65  LYS E C   1 
ATOM   5998 O O   . LYS E 2 65  ? -104.549 -35.645 -87.508  1.00 107.49 ? 65  LYS E O   1 
ATOM   5999 C CB  . LYS E 2 65  ? -102.803 -38.190 -88.468  1.00 107.48 ? 65  LYS E CB  1 
ATOM   6000 C CG  . LYS E 2 65  ? -102.681 -39.516 -89.199  1.00 107.05 ? 65  LYS E CG  1 
ATOM   6001 C CD  . LYS E 2 65  ? -101.346 -39.645 -89.908  1.00 106.73 ? 65  LYS E CD  1 
ATOM   6002 C CE  . LYS E 2 65  ? -100.943 -41.110 -90.034  1.00 106.53 ? 65  LYS E CE  1 
ATOM   6003 N NZ  . LYS E 2 65  ? -99.687  -41.281 -90.815  1.00 106.26 ? 65  LYS E NZ  1 
ATOM   6004 N N   . PRO E 2 66  ? -103.684 -36.690 -85.695  1.00 108.17 ? 66  PRO E N   1 
ATOM   6005 C CA  . PRO E 2 66  ? -103.660 -35.475 -84.863  1.00 108.39 ? 66  PRO E CA  1 
ATOM   6006 C C   . PRO E 2 66  ? -103.050 -34.273 -85.575  1.00 108.62 ? 66  PRO E C   1 
ATOM   6007 O O   . PRO E 2 66  ? -102.193 -34.436 -86.444  1.00 108.41 ? 66  PRO E O   1 
ATOM   6008 C CB  . PRO E 2 66  ? -102.778 -35.873 -83.668  1.00 108.35 ? 66  PRO E CB  1 
ATOM   6009 C CG  . PRO E 2 66  ? -102.142 -37.212 -84.046  1.00 108.33 ? 66  PRO E CG  1 
ATOM   6010 C CD  . PRO E 2 66  ? -103.127 -37.851 -84.973  1.00 108.29 ? 66  PRO E CD  1 
ATOM   6011 N N   . GLY E 2 67  ? -103.510 -33.081 -85.210  1.00 109.11 ? 67  GLY E N   1 
ATOM   6012 C CA  . GLY E 2 67  ? -103.007 -31.828 -85.778  1.00 109.99 ? 67  GLY E CA  1 
ATOM   6013 C C   . GLY E 2 67  ? -103.048 -31.736 -87.300  1.00 110.71 ? 67  GLY E C   1 
ATOM   6014 O O   . GLY E 2 67  ? -102.059 -31.320 -87.913  1.00 110.69 ? 67  GLY E O   1 
ATOM   6015 N N   . GLN E 2 68  ? -104.193 -32.108 -87.896  1.00 111.26 ? 68  GLN E N   1 
ATOM   6016 C CA  . GLN E 2 68  ? -104.385 -32.194 -89.366  1.00 111.58 ? 68  GLN E CA  1 
ATOM   6017 C C   . GLN E 2 68  ? -105.848 -32.308 -89.815  1.00 111.48 ? 68  GLN E C   1 
ATOM   6018 O O   . GLN E 2 68  ? -106.743 -32.537 -89.004  1.00 111.76 ? 68  GLN E O   1 
ATOM   6019 C CB  . GLN E 2 68  ? -103.648 -33.408 -89.924  1.00 111.69 ? 68  GLN E CB  1 
ATOM   6020 C CG  . GLN E 2 68  ? -102.359 -33.085 -90.637  1.00 113.28 ? 68  GLN E CG  1 
ATOM   6021 C CD  . GLN E 2 68  ? -101.417 -34.277 -90.680  1.00 115.29 ? 68  GLN E CD  1 
ATOM   6022 O OE1 . GLN E 2 68  ? -101.031 -34.819 -89.638  1.00 116.46 ? 68  GLN E OE1 1 
ATOM   6023 N NE2 . GLN E 2 68  ? -101.038 -34.690 -91.888  1.00 115.47 ? 68  GLN E NE2 1 
ATOM   6024 N N   . SER E 2 69  ? -106.069 -32.161 -91.123  1.00 111.24 ? 69  SER E N   1 
ATOM   6025 C CA  . SER E 2 69  ? -107.342 -32.495 -91.763  1.00 110.84 ? 69  SER E CA  1 
ATOM   6026 C C   . SER E 2 69  ? -107.426 -34.010 -91.943  1.00 110.80 ? 69  SER E C   1 
ATOM   6027 O O   . SER E 2 69  ? -106.482 -34.728 -91.601  1.00 110.93 ? 69  SER E O   1 
ATOM   6028 C CB  . SER E 2 69  ? -107.428 -31.840 -93.141  1.00 110.68 ? 69  SER E CB  1 
ATOM   6029 O OG  . SER E 2 69  ? -107.276 -30.440 -93.063  1.00 110.68 ? 69  SER E OG  1 
ATOM   6030 N N   . PRO E 2 70  ? -108.562 -34.509 -92.463  1.00 110.61 ? 70  PRO E N   1 
ATOM   6031 C CA  . PRO E 2 70  ? -108.638 -35.897 -92.927  1.00 110.50 ? 70  PRO E CA  1 
ATOM   6032 C C   . PRO E 2 70  ? -108.081 -36.069 -94.338  1.00 110.49 ? 70  PRO E C   1 
ATOM   6033 O O   . PRO E 2 70  ? -107.801 -35.082 -95.009  1.00 110.50 ? 70  PRO E O   1 
ATOM   6034 C CB  . PRO E 2 70  ? -110.144 -36.182 -92.936  1.00 110.40 ? 70  PRO E CB  1 
ATOM   6035 C CG  . PRO E 2 70  ? -110.757 -35.109 -92.113  1.00 110.55 ? 70  PRO E CG  1 
ATOM   6036 C CD  . PRO E 2 70  ? -109.898 -33.917 -92.307  1.00 110.56 ? 70  PRO E CD  1 
ATOM   6037 N N   . LYS E 2 71  ? -107.912 -37.316 -94.770  1.00 110.69 ? 71  LYS E N   1 
ATOM   6038 C CA  . LYS E 2 71  ? -107.596 -37.635 -96.163  1.00 111.25 ? 71  LYS E CA  1 
ATOM   6039 C C   . LYS E 2 71  ? -108.583 -38.699 -96.630  1.00 111.46 ? 71  LYS E C   1 
ATOM   6040 O O   . LYS E 2 71  ? -108.859 -39.638 -95.883  1.00 111.82 ? 71  LYS E O   1 
ATOM   6041 C CB  . LYS E 2 71  ? -106.188 -38.219 -96.303  1.00 111.35 ? 71  LYS E CB  1 
ATOM   6042 C CG  . LYS E 2 71  ? -105.138 -37.742 -95.290  1.00 112.35 ? 71  LYS E CG  1 
ATOM   6043 C CD  . LYS E 2 71  ? -103.781 -38.466 -95.476  1.00 113.47 ? 71  LYS E CD  1 
ATOM   6044 C CE  . LYS E 2 71  ? -103.064 -38.053 -96.784  1.00 113.89 ? 71  LYS E CE  1 
ATOM   6045 N NZ  . LYS E 2 71  ? -101.840 -38.856 -97.079  1.00 113.30 ? 71  LYS E NZ  1 
ATOM   6046 N N   . LEU E 2 72  ? -109.115 -38.569 -97.848  1.00 111.56 ? 72  LEU E N   1 
ATOM   6047 C CA  . LEU E 2 72  ? -110.007 -39.603 -98.397  1.00 111.59 ? 72  LEU E CA  1 
ATOM   6048 C C   . LEU E 2 72  ? -109.244 -40.922 -98.591  1.00 112.02 ? 72  LEU E C   1 
ATOM   6049 O O   . LEU E 2 72  ? -108.251 -40.991 -99.315  1.00 112.23 ? 72  LEU E O   1 
ATOM   6050 C CB  . LEU E 2 72  ? -110.681 -39.141 -99.702  1.00 111.32 ? 72  LEU E CB  1 
ATOM   6051 C CG  . LEU E 2 72  ? -111.465 -40.143 -100.570 1.00 110.39 ? 72  LEU E CG  1 
ATOM   6052 C CD1 . LEU E 2 72  ? -112.745 -40.575 -99.921  1.00 109.49 ? 72  LEU E CD1 1 
ATOM   6053 C CD2 . LEU E 2 72  ? -111.760 -39.561 -101.931 1.00 109.79 ? 72  LEU E CD2 1 
ATOM   6054 N N   . LEU E 2 73  ? -109.705 -41.964 -97.919  1.00 112.37 ? 73  LEU E N   1 
ATOM   6055 C CA  . LEU E 2 73  ? -109.041 -43.244 -97.983  1.00 112.85 ? 73  LEU E CA  1 
ATOM   6056 C C   . LEU E 2 73  ? -109.755 -44.098 -99.000  1.00 113.21 ? 73  LEU E C   1 
ATOM   6057 O O   . LEU E 2 73  ? -109.135 -44.673 -99.892  1.00 113.50 ? 73  LEU E O   1 
ATOM   6058 C CB  . LEU E 2 73  ? -109.102 -43.921 -96.624  1.00 113.02 ? 73  LEU E CB  1 
ATOM   6059 C CG  . LEU E 2 73  ? -107.985 -44.891 -96.268  1.00 113.41 ? 73  LEU E CG  1 
ATOM   6060 C CD1 . LEU E 2 73  ? -106.875 -44.142 -95.532  1.00 114.12 ? 73  LEU E CD1 1 
ATOM   6061 C CD2 . LEU E 2 73  ? -108.546 -45.998 -95.406  1.00 113.57 ? 73  LEU E CD2 1 
ATOM   6062 N N   . ILE E 2 74  ? -111.071 -44.179 -98.863  1.00 113.47 ? 74  ILE E N   1 
ATOM   6063 C CA  . ILE E 2 74  ? -111.873 -44.963 -99.776  1.00 114.04 ? 74  ILE E CA  1 
ATOM   6064 C C   . ILE E 2 74  ? -113.147 -44.203 -100.116 1.00 114.61 ? 74  ILE E C   1 
ATOM   6065 O O   . ILE E 2 74  ? -113.764 -43.618 -99.238  1.00 114.81 ? 74  ILE E O   1 
ATOM   6066 C CB  . ILE E 2 74  ? -112.185 -46.346 -99.172  1.00 113.98 ? 74  ILE E CB  1 
ATOM   6067 C CG1 . ILE E 2 74  ? -111.003 -47.286 -99.409  1.00 114.41 ? 74  ILE E CG1 1 
ATOM   6068 C CG2 . ILE E 2 74  ? -113.438 -46.936 -99.776  1.00 113.42 ? 74  ILE E CG2 1 
ATOM   6069 C CD1 . ILE E 2 74  ? -111.054 -48.588 -98.625  1.00 115.00 ? 74  ILE E CD1 1 
ATOM   6070 N N   . TYR E 2 75  ? -113.516 -44.191 -101.396 1.00 115.29 ? 75  TYR E N   1 
ATOM   6071 C CA  . TYR E 2 75  ? -114.807 -43.661 -101.826 1.00 115.69 ? 75  TYR E CA  1 
ATOM   6072 C C   . TYR E 2 75  ? -115.679 -44.757 -102.427 1.00 116.20 ? 75  TYR E C   1 
ATOM   6073 O O   . TYR E 2 75  ? -115.180 -45.814 -102.834 1.00 116.10 ? 75  TYR E O   1 
ATOM   6074 C CB  . TYR E 2 75  ? -114.646 -42.490 -102.796 1.00 115.53 ? 75  TYR E CB  1 
ATOM   6075 C CG  . TYR E 2 75  ? -113.759 -42.732 -104.000 1.00 115.69 ? 75  TYR E CG  1 
ATOM   6076 C CD1 . TYR E 2 75  ? -112.406 -42.411 -103.958 1.00 116.49 ? 75  TYR E CD1 1 
ATOM   6077 C CD2 . TYR E 2 75  ? -114.277 -43.237 -105.197 1.00 115.70 ? 75  TYR E CD2 1 
ATOM   6078 C CE1 . TYR E 2 75  ? -111.574 -42.608 -105.065 1.00 116.63 ? 75  TYR E CE1 1 
ATOM   6079 C CE2 . TYR E 2 75  ? -113.452 -43.433 -106.319 1.00 115.90 ? 75  TYR E CE2 1 
ATOM   6080 C CZ  . TYR E 2 75  ? -112.097 -43.118 -106.236 1.00 116.11 ? 75  TYR E CZ  1 
ATOM   6081 O OH  . TYR E 2 75  ? -111.253 -43.299 -107.308 1.00 115.69 ? 75  TYR E OH  1 
ATOM   6082 N N   . TRP E 2 76  ? -116.984 -44.495 -102.467 1.00 116.94 ? 76  TRP E N   1 
ATOM   6083 C CA  . TRP E 2 76  ? -117.979 -45.470 -102.914 1.00 117.69 ? 76  TRP E CA  1 
ATOM   6084 C C   . TRP E 2 76  ? -117.821 -46.786 -102.152 1.00 117.94 ? 76  TRP E C   1 
ATOM   6085 O O   . TRP E 2 76  ? -118.126 -47.866 -102.685 1.00 117.86 ? 76  TRP E O   1 
ATOM   6086 C CB  . TRP E 2 76  ? -117.875 -45.724 -104.428 1.00 117.99 ? 76  TRP E CB  1 
ATOM   6087 C CG  . TRP E 2 76  ? -118.360 -44.609 -105.364 1.00 118.91 ? 76  TRP E CG  1 
ATOM   6088 C CD1 . TRP E 2 76  ? -119.387 -43.721 -105.153 1.00 119.49 ? 76  TRP E CD1 1 
ATOM   6089 C CD2 . TRP E 2 76  ? -117.858 -44.329 -106.677 1.00 119.54 ? 76  TRP E CD2 1 
ATOM   6090 N NE1 . TRP E 2 76  ? -119.528 -42.892 -106.241 1.00 119.64 ? 76  TRP E NE1 1 
ATOM   6091 C CE2 . TRP E 2 76  ? -118.604 -43.246 -107.189 1.00 119.90 ? 76  TRP E CE2 1 
ATOM   6092 C CE3 . TRP E 2 76  ? -116.838 -44.880 -107.463 1.00 119.98 ? 76  TRP E CE3 1 
ATOM   6093 C CZ2 . TRP E 2 76  ? -118.362 -42.706 -108.451 1.00 120.33 ? 76  TRP E CZ2 1 
ATOM   6094 C CZ3 . TRP E 2 76  ? -116.601 -44.346 -108.713 1.00 120.56 ? 76  TRP E CZ3 1 
ATOM   6095 C CH2 . TRP E 2 76  ? -117.361 -43.270 -109.198 1.00 120.51 ? 76  TRP E CH2 1 
ATOM   6096 N N   . ALA E 2 77  ? -117.338 -46.672 -100.909 1.00 118.37 ? 77  ALA E N   1 
ATOM   6097 C CA  . ALA E 2 77  ? -117.050 -47.800 -99.993  1.00 118.99 ? 77  ALA E CA  1 
ATOM   6098 C C   . ALA E 2 77  ? -115.945 -48.774 -100.430 1.00 119.47 ? 77  ALA E C   1 
ATOM   6099 O O   . ALA E 2 77  ? -115.144 -49.209 -99.597  1.00 119.39 ? 77  ALA E O   1 
ATOM   6100 C CB  . ALA E 2 77  ? -118.322 -48.566 -99.623  1.00 118.96 ? 77  ALA E CB  1 
ATOM   6101 N N   . SER E 2 78  ? -115.916 -49.118 -101.721 1.00 120.10 ? 78  SER E N   1 
ATOM   6102 C CA  . SER E 2 78  ? -114.913 -50.029 -102.278 1.00 120.25 ? 78  SER E CA  1 
ATOM   6103 C C   . SER E 2 78  ? -113.703 -49.292 -102.815 1.00 120.49 ? 78  SER E C   1 
ATOM   6104 O O   . SER E 2 78  ? -112.687 -49.214 -102.139 1.00 120.73 ? 78  SER E O   1 
ATOM   6105 C CB  . SER E 2 78  ? -115.510 -50.913 -103.370 1.00 120.21 ? 78  SER E CB  1 
ATOM   6106 O OG  . SER E 2 78  ? -116.156 -52.033 -102.803 1.00 120.36 ? 78  SER E OG  1 
ATOM   6107 N N   . THR E 2 79  ? -113.814 -48.732 -104.014 1.00 120.85 ? 79  THR E N   1 
ATOM   6108 C CA  . THR E 2 79  ? -112.633 -48.250 -104.728 1.00 121.35 ? 79  THR E CA  1 
ATOM   6109 C C   . THR E 2 79  ? -111.705 -47.435 -103.831 1.00 121.73 ? 79  THR E C   1 
ATOM   6110 O O   . THR E 2 79  ? -112.130 -46.480 -103.184 1.00 121.57 ? 79  THR E O   1 
ATOM   6111 C CB  . THR E 2 79  ? -112.980 -47.438 -105.999 1.00 121.30 ? 79  THR E CB  1 
ATOM   6112 O OG1 . THR E 2 79  ? -112.877 -46.041 -105.716 1.00 121.34 ? 79  THR E OG1 1 
ATOM   6113 C CG2 . THR E 2 79  ? -114.384 -47.772 -106.530 1.00 121.26 ? 79  THR E CG2 1 
ATOM   6114 N N   . ARG E 2 80  ? -110.439 -47.838 -103.795 1.00 122.48 ? 80  ARG E N   1 
ATOM   6115 C CA  . ARG E 2 80  ? -109.405 -47.113 -103.069 1.00 123.45 ? 80  ARG E CA  1 
ATOM   6116 C C   . ARG E 2 80  ? -109.205 -45.708 -103.618 1.00 123.77 ? 80  ARG E C   1 
ATOM   6117 O O   . ARG E 2 80  ? -109.831 -45.313 -104.597 1.00 123.82 ? 80  ARG E O   1 
ATOM   6118 C CB  . ARG E 2 80  ? -108.079 -47.862 -103.163 1.00 123.64 ? 80  ARG E CB  1 
ATOM   6119 C CG  . ARG E 2 80  ? -108.028 -49.142 -102.386 1.00 124.68 ? 80  ARG E CG  1 
ATOM   6120 C CD  . ARG E 2 80  ? -106.610 -49.399 -101.909 1.00 126.59 ? 80  ARG E CD  1 
ATOM   6121 N NE  . ARG E 2 80  ? -106.430 -50.791 -101.502 1.00 128.82 ? 80  ARG E NE  1 
ATOM   6122 C CZ  . ARG E 2 80  ? -106.158 -51.795 -102.339 1.00 129.71 ? 80  ARG E CZ  1 
ATOM   6123 N NH1 . ARG E 2 80  ? -106.017 -51.564 -103.645 1.00 129.75 ? 80  ARG E NH1 1 
ATOM   6124 N NH2 . ARG E 2 80  ? -106.024 -53.033 -101.867 1.00 129.50 ? 80  ARG E NH2 1 
ATOM   6125 N N   . GLU E 2 81  ? -108.312 -44.960 -102.988 1.00 124.34 ? 81  GLU E N   1 
ATOM   6126 C CA  . GLU E 2 81  ? -107.953 -43.645 -103.486 1.00 125.12 ? 81  GLU E CA  1 
ATOM   6127 C C   . GLU E 2 81  ? -106.558 -43.684 -104.120 1.00 125.80 ? 81  GLU E C   1 
ATOM   6128 O O   . GLU E 2 81  ? -105.794 -44.628 -103.894 1.00 125.79 ? 81  GLU E O   1 
ATOM   6129 C CB  . GLU E 2 81  ? -108.026 -42.622 -102.359 1.00 124.91 ? 81  GLU E CB  1 
ATOM   6130 C CG  . GLU E 2 81  ? -108.774 -41.372 -102.733 1.00 124.82 ? 81  GLU E CG  1 
ATOM   6131 C CD  . GLU E 2 81  ? -107.940 -40.406 -103.535 1.00 125.34 ? 81  GLU E CD  1 
ATOM   6132 O OE1 . GLU E 2 81  ? -106.764 -40.206 -103.173 1.00 126.05 ? 81  GLU E OE1 1 
ATOM   6133 O OE2 . GLU E 2 81  ? -108.458 -39.841 -104.523 1.00 125.69 ? 81  GLU E OE2 1 
ATOM   6134 N N   . SER E 2 82  ? -106.241 -42.669 -104.928 1.00 126.64 ? 82  SER E N   1 
ATOM   6135 C CA  . SER E 2 82  ? -104.950 -42.594 -105.633 1.00 127.36 ? 82  SER E CA  1 
ATOM   6136 C C   . SER E 2 82  ? -103.783 -42.406 -104.661 1.00 127.85 ? 82  SER E C   1 
ATOM   6137 O O   . SER E 2 82  ? -103.544 -41.295 -104.154 1.00 127.94 ? 82  SER E O   1 
ATOM   6138 C CB  . SER E 2 82  ? -104.952 -41.489 -106.709 1.00 127.42 ? 82  SER E CB  1 
ATOM   6139 O OG  . SER E 2 82  ? -105.458 -41.952 -107.960 1.00 127.19 ? 82  SER E OG  1 
ATOM   6140 N N   . GLY E 2 83  ? -103.073 -43.509 -104.410 1.00 128.22 ? 83  GLY E N   1 
ATOM   6141 C CA  . GLY E 2 83  ? -101.940 -43.539 -103.480 1.00 128.63 ? 83  GLY E CA  1 
ATOM   6142 C C   . GLY E 2 83  ? -102.302 -44.125 -102.126 1.00 128.89 ? 83  GLY E C   1 
ATOM   6143 O O   . GLY E 2 83  ? -101.729 -43.748 -101.098 1.00 129.07 ? 83  GLY E O   1 
ATOM   6144 N N   . VAL E 2 84  ? -103.259 -45.049 -102.127 1.00 129.00 ? 84  VAL E N   1 
ATOM   6145 C CA  . VAL E 2 84  ? -103.716 -45.685 -100.893 1.00 129.13 ? 84  VAL E CA  1 
ATOM   6146 C C   . VAL E 2 84  ? -103.401 -47.187 -100.878 1.00 128.94 ? 84  VAL E C   1 
ATOM   6147 O O   . VAL E 2 84  ? -103.911 -47.945 -101.715 1.00 129.19 ? 84  VAL E O   1 
ATOM   6148 C CB  . VAL E 2 84  ? -105.222 -45.419 -100.634 1.00 129.31 ? 84  VAL E CB  1 
ATOM   6149 C CG1 . VAL E 2 84  ? -105.784 -46.379 -99.563  1.00 129.52 ? 84  VAL E CG1 1 
ATOM   6150 C CG2 . VAL E 2 84  ? -105.445 -43.944 -100.256 1.00 129.27 ? 84  VAL E CG2 1 
ATOM   6151 N N   . PRO E 2 85  ? -102.552 -47.610 -99.922  1.00 128.55 ? 85  PRO E N   1 
ATOM   6152 C CA  . PRO E 2 85  ? -102.067 -48.981 -99.717  1.00 128.04 ? 85  PRO E CA  1 
ATOM   6153 C C   . PRO E 2 85  ? -103.096 -50.111 -99.895  1.00 127.40 ? 85  PRO E C   1 
ATOM   6154 O O   . PRO E 2 85  ? -104.306 -49.898 -99.764  1.00 127.15 ? 85  PRO E O   1 
ATOM   6155 C CB  . PRO E 2 85  ? -101.571 -48.944 -98.272  1.00 128.20 ? 85  PRO E CB  1 
ATOM   6156 C CG  . PRO E 2 85  ? -101.067 -47.540 -98.097  1.00 128.38 ? 85  PRO E CG  1 
ATOM   6157 C CD  . PRO E 2 85  ? -101.915 -46.660 -98.984  1.00 128.46 ? 85  PRO E CD  1 
ATOM   6158 N N   . ASP E 2 86  ? -102.580 -51.301 -100.191 1.00 126.80 ? 86  ASP E N   1 
ATOM   6159 C CA  . ASP E 2 86  ? -103.381 -52.507 -100.383 1.00 126.23 ? 86  ASP E CA  1 
ATOM   6160 C C   . ASP E 2 86  ? -104.121 -52.900 -99.128  1.00 125.81 ? 86  ASP E C   1 
ATOM   6161 O O   . ASP E 2 86  ? -105.280 -53.307 -99.190  1.00 125.76 ? 86  ASP E O   1 
ATOM   6162 C CB  . ASP E 2 86  ? -102.494 -53.678 -100.820 1.00 126.31 ? 86  ASP E CB  1 
ATOM   6163 C CG  . ASP E 2 86  ? -102.462 -53.853 -102.325 1.00 126.50 ? 86  ASP E CG  1 
ATOM   6164 O OD1 . ASP E 2 86  ? -103.487 -54.305 -102.880 1.00 126.94 ? 86  ASP E OD1 1 
ATOM   6165 O OD2 . ASP E 2 86  ? -101.421 -53.544 -102.955 1.00 126.21 ? 86  ASP E OD2 1 
ATOM   6166 N N   . ARG E 2 87  ? -103.427 -52.768 -98.000  1.00 125.24 ? 87  ARG E N   1 
ATOM   6167 C CA  . ARG E 2 87  ? -103.905 -53.193 -96.681  1.00 124.62 ? 87  ARG E CA  1 
ATOM   6168 C C   . ARG E 2 87  ? -105.359 -52.812 -96.356  1.00 124.09 ? 87  ARG E C   1 
ATOM   6169 O O   . ARG E 2 87  ? -106.145 -53.694 -95.986  1.00 123.96 ? 87  ARG E O   1 
ATOM   6170 C CB  . ARG E 2 87  ? -102.935 -52.703 -95.604  1.00 124.68 ? 87  ARG E CB  1 
ATOM   6171 C CG  . ARG E 2 87  ? -102.267 -51.397 -95.963  1.00 124.76 ? 87  ARG E CG  1 
ATOM   6172 C CD  . ARG E 2 87  ? -100.807 -51.378 -95.561  1.00 125.74 ? 87  ARG E CD  1 
ATOM   6173 N NE  . ARG E 2 87  ? -100.386 -50.014 -95.257  1.00 126.63 ? 87  ARG E NE  1 
ATOM   6174 C CZ  . ARG E 2 87  ? -100.510 -49.441 -94.061  1.00 126.71 ? 87  ARG E CZ  1 
ATOM   6175 N NH1 . ARG E 2 87  ? -101.024 -50.124 -93.043  1.00 126.41 ? 87  ARG E NH1 1 
ATOM   6176 N NH2 . ARG E 2 87  ? -100.114 -48.186 -93.881  1.00 126.68 ? 87  ARG E NH2 1 
ATOM   6177 N N   . PHE E 2 88  ? -105.704 -51.523 -96.506  1.00 123.35 ? 88  PHE E N   1 
ATOM   6178 C CA  . PHE E 2 88  ? -107.090 -51.037 -96.351  1.00 122.55 ? 88  PHE E CA  1 
ATOM   6179 C C   . PHE E 2 88  ? -107.993 -51.641 -97.422  1.00 122.10 ? 88  PHE E C   1 
ATOM   6180 O O   . PHE E 2 88  ? -107.578 -51.818 -98.570  1.00 122.15 ? 88  PHE E O   1 
ATOM   6181 C CB  . PHE E 2 88  ? -107.188 -49.514 -96.442  1.00 122.36 ? 88  PHE E CB  1 
ATOM   6182 C CG  . PHE E 2 88  ? -106.199 -48.778 -95.592  1.00 122.84 ? 88  PHE E CG  1 
ATOM   6183 C CD1 . PHE E 2 88  ? -105.073 -48.189 -96.168  1.00 123.61 ? 88  PHE E CD1 1 
ATOM   6184 C CD2 . PHE E 2 88  ? -106.397 -48.643 -94.219  1.00 122.87 ? 88  PHE E CD2 1 
ATOM   6185 C CE1 . PHE E 2 88  ? -104.142 -47.483 -95.378  1.00 123.95 ? 88  PHE E CE1 1 
ATOM   6186 C CE2 . PHE E 2 88  ? -105.471 -47.938 -93.417  1.00 122.98 ? 88  PHE E CE2 1 
ATOM   6187 C CZ  . PHE E 2 88  ? -104.343 -47.360 -93.996  1.00 123.19 ? 88  PHE E CZ  1 
ATOM   6188 N N   . THR E 2 89  ? -109.227 -51.959 -97.045  1.00 121.44 ? 89  THR E N   1 
ATOM   6189 C CA  . THR E 2 89  ? -110.164 -52.604 -97.958  1.00 120.79 ? 89  THR E CA  1 
ATOM   6190 C C   . THR E 2 89  ? -111.582 -52.455 -97.432  1.00 120.41 ? 89  THR E C   1 
ATOM   6191 O O   . THR E 2 89  ? -112.060 -53.298 -96.670  1.00 120.53 ? 89  THR E O   1 
ATOM   6192 C CB  . THR E 2 89  ? -109.874 -54.120 -98.114  1.00 120.72 ? 89  THR E CB  1 
ATOM   6193 O OG1 . THR E 2 89  ? -108.509 -54.403 -97.779  1.00 120.45 ? 89  THR E OG1 1 
ATOM   6194 C CG2 . THR E 2 89  ? -110.164 -54.577 -99.533  1.00 120.80 ? 89  THR E CG2 1 
ATOM   6195 N N   . GLY E 2 90  ? -112.255 -51.381 -97.832  1.00 119.77 ? 90  GLY E N   1 
ATOM   6196 C CA  . GLY E 2 90  ? -113.644 -51.162 -97.436  1.00 118.85 ? 90  GLY E CA  1 
ATOM   6197 C C   . GLY E 2 90  ? -114.537 -52.261 -97.973  1.00 118.23 ? 90  GLY E C   1 
ATOM   6198 O O   . GLY E 2 90  ? -114.239 -52.870 -98.999  1.00 118.47 ? 90  GLY E O   1 
ATOM   6199 N N   . SER E 2 91  ? -115.625 -52.529 -97.268  1.00 117.52 ? 91  SER E N   1 
ATOM   6200 C CA  . SER E 2 91  ? -116.572 -53.556 -97.676  1.00 116.99 ? 91  SER E CA  1 
ATOM   6201 C C   . SER E 2 91  ? -117.937 -53.231 -97.098  1.00 116.57 ? 91  SER E C   1 
ATOM   6202 O O   . SER E 2 91  ? -118.081 -52.279 -96.330  1.00 116.76 ? 91  SER E O   1 
ATOM   6203 C CB  . SER E 2 91  ? -116.103 -54.939 -97.203  1.00 117.09 ? 91  SER E CB  1 
ATOM   6204 O OG  . SER E 2 91  ? -115.934 -54.983 -95.792  1.00 117.34 ? 91  SER E OG  1 
ATOM   6205 N N   . GLY E 2 92  ? -118.942 -54.015 -97.460  1.00 115.94 ? 92  GLY E N   1 
ATOM   6206 C CA  . GLY E 2 92  ? -120.262 -53.836 -96.882  1.00 115.29 ? 92  GLY E CA  1 
ATOM   6207 C C   . GLY E 2 92  ? -121.212 -53.236 -97.880  1.00 114.88 ? 92  GLY E C   1 
ATOM   6208 O O   . GLY E 2 92  ? -120.780 -52.711 -98.902  1.00 114.71 ? 92  GLY E O   1 
ATOM   6209 N N   . SER E 2 93  ? -122.506 -53.308 -97.579  1.00 114.73 ? 93  SER E N   1 
ATOM   6210 C CA  . SER E 2 93  ? -123.531 -52.950 -98.558  1.00 114.73 ? 93  SER E CA  1 
ATOM   6211 C C   . SER E 2 93  ? -124.868 -52.489 -97.970  1.00 114.50 ? 93  SER E C   1 
ATOM   6212 O O   . SER E 2 93  ? -125.536 -53.222 -97.228  1.00 114.47 ? 93  SER E O   1 
ATOM   6213 C CB  . SER E 2 93  ? -123.758 -54.112 -99.536  1.00 114.82 ? 93  SER E CB  1 
ATOM   6214 O OG  . SER E 2 93  ? -124.563 -53.711 -100.634 1.00 115.38 ? 93  SER E OG  1 
ATOM   6215 N N   . GLY E 2 94  ? -125.252 -51.269 -98.336  1.00 114.28 ? 94  GLY E N   1 
ATOM   6216 C CA  . GLY E 2 94  ? -126.559 -50.729 -97.995  1.00 114.21 ? 94  GLY E CA  1 
ATOM   6217 C C   . GLY E 2 94  ? -126.573 -50.019 -96.661  1.00 114.09 ? 94  GLY E C   1 
ATOM   6218 O O   . GLY E 2 94  ? -126.627 -48.790 -96.609  1.00 114.12 ? 94  GLY E O   1 
ATOM   6219 N N   . THR E 2 95  ? -126.513 -50.806 -95.588  1.00 113.95 ? 95  THR E N   1 
ATOM   6220 C CA  . THR E 2 95  ? -126.571 -50.295 -94.215  1.00 113.57 ? 95  THR E CA  1 
ATOM   6221 C C   . THR E 2 95  ? -125.524 -50.943 -93.296  1.00 113.33 ? 95  THR E C   1 
ATOM   6222 O O   . THR E 2 95  ? -125.744 -51.047 -92.096  1.00 112.98 ? 95  THR E O   1 
ATOM   6223 C CB  . THR E 2 95  ? -127.988 -50.490 -93.619  1.00 113.58 ? 95  THR E CB  1 
ATOM   6224 O OG1 . THR E 2 95  ? -128.575 -51.675 -94.168  1.00 113.55 ? 95  THR E OG1 1 
ATOM   6225 C CG2 . THR E 2 95  ? -128.884 -49.316 -93.955  1.00 113.41 ? 95  THR E CG2 1 
ATOM   6226 N N   . ASP E 2 96  ? -124.383 -51.346 -93.864  1.00 113.39 ? 96  ASP E N   1 
ATOM   6227 C CA  . ASP E 2 96  ? -123.365 -52.137 -93.151  1.00 113.57 ? 96  ASP E CA  1 
ATOM   6228 C C   . ASP E 2 96  ? -121.960 -52.057 -93.738  1.00 113.36 ? 96  ASP E C   1 
ATOM   6229 O O   . ASP E 2 96  ? -121.497 -53.008 -94.364  1.00 113.28 ? 96  ASP E O   1 
ATOM   6230 C CB  . ASP E 2 96  ? -123.768 -53.610 -93.137  1.00 113.86 ? 96  ASP E CB  1 
ATOM   6231 C CG  . ASP E 2 96  ? -124.156 -54.093 -91.768  1.00 114.85 ? 96  ASP E CG  1 
ATOM   6232 O OD1 . ASP E 2 96  ? -124.969 -53.415 -91.099  1.00 115.60 ? 96  ASP E OD1 1 
ATOM   6233 O OD2 . ASP E 2 96  ? -123.649 -55.167 -91.370  1.00 115.85 ? 96  ASP E OD2 1 
ATOM   6234 N N   . PHE E 2 97  ? -121.265 -50.952 -93.498  1.00 113.25 ? 97  PHE E N   1 
ATOM   6235 C CA  . PHE E 2 97  ? -119.948 -50.721 -94.113  1.00 113.02 ? 97  PHE E CA  1 
ATOM   6236 C C   . PHE E 2 97  ? -118.777 -50.980 -93.146  1.00 113.24 ? 97  PHE E C   1 
ATOM   6237 O O   . PHE E 2 97  ? -118.855 -50.672 -91.954  1.00 113.20 ? 97  PHE E O   1 
ATOM   6238 C CB  . PHE E 2 97  ? -119.893 -49.318 -94.738  1.00 112.62 ? 97  PHE E CB  1 
ATOM   6239 C CG  . PHE E 2 97  ? -121.048 -49.028 -95.644  1.00 110.99 ? 97  PHE E CG  1 
ATOM   6240 C CD1 . PHE E 2 97  ? -122.320 -48.825 -95.126  1.00 109.88 ? 97  PHE E CD1 1 
ATOM   6241 C CD2 . PHE E 2 97  ? -120.874 -48.987 -97.013  1.00 110.26 ? 97  PHE E CD2 1 
ATOM   6242 C CE1 . PHE E 2 97  ? -123.400 -48.573 -95.956  1.00 109.48 ? 97  PHE E CE1 1 
ATOM   6243 C CE2 . PHE E 2 97  ? -121.947 -48.736 -97.857  1.00 109.78 ? 97  PHE E CE2 1 
ATOM   6244 C CZ  . PHE E 2 97  ? -123.215 -48.527 -97.321  1.00 109.68 ? 97  PHE E CZ  1 
ATOM   6245 N N   . THR E 2 98  ? -117.693 -51.547 -93.665  1.00 113.32 ? 98  THR E N   1 
ATOM   6246 C CA  . THR E 2 98  ? -116.648 -52.067 -92.801  1.00 113.69 ? 98  THR E CA  1 
ATOM   6247 C C   . THR E 2 98  ? -115.241 -51.910 -93.348  1.00 113.75 ? 98  THR E C   1 
ATOM   6248 O O   . THR E 2 98  ? -114.793 -52.706 -94.171  1.00 113.97 ? 98  THR E O   1 
ATOM   6249 C CB  . THR E 2 98  ? -116.915 -53.544 -92.487  1.00 113.86 ? 98  THR E CB  1 
ATOM   6250 O OG1 . THR E 2 98  ? -118.134 -53.648 -91.729  1.00 114.68 ? 98  THR E OG1 1 
ATOM   6251 C CG2 . THR E 2 98  ? -115.751 -54.158 -91.699  1.00 114.19 ? 98  THR E CG2 1 
ATOM   6252 N N   . LEU E 2 99  ? -114.549 -50.882 -92.869  1.00 113.94 ? 99  LEU E N   1 
ATOM   6253 C CA  . LEU E 2 99  ? -113.156 -50.639 -93.221  1.00 114.04 ? 99  LEU E CA  1 
ATOM   6254 C C   . LEU E 2 99  ? -112.282 -51.611 -92.454  1.00 114.28 ? 99  LEU E C   1 
ATOM   6255 O O   . LEU E 2 99  ? -112.580 -51.918 -91.303  1.00 114.24 ? 99  LEU E O   1 
ATOM   6256 C CB  . LEU E 2 99  ? -112.778 -49.212 -92.856  1.00 113.93 ? 99  LEU E CB  1 
ATOM   6257 C CG  . LEU E 2 99  ? -111.331 -48.776 -93.047  1.00 113.89 ? 99  LEU E CG  1 
ATOM   6258 C CD1 . LEU E 2 99  ? -111.031 -48.591 -94.519  1.00 113.70 ? 99  LEU E CD1 1 
ATOM   6259 C CD2 . LEU E 2 99  ? -111.079 -47.494 -92.274  1.00 113.83 ? 99  LEU E CD2 1 
ATOM   6260 N N   . THR E 2 100 ? -111.218 -52.097 -93.097  1.00 114.68 ? 100 THR E N   1 
ATOM   6261 C CA  . THR E 2 100 ? -110.323 -53.091 -92.495  1.00 115.24 ? 100 THR E CA  1 
ATOM   6262 C C   . THR E 2 100 ? -108.862 -52.915 -92.893  1.00 115.89 ? 100 THR E C   1 
ATOM   6263 O O   . THR E 2 100 ? -108.568 -52.785 -94.067  1.00 115.87 ? 100 THR E O   1 
ATOM   6264 C CB  . THR E 2 100 ? -110.785 -54.569 -92.761  1.00 115.10 ? 100 THR E CB  1 
ATOM   6265 O OG1 . THR E 2 100 ? -109.674 -55.356 -93.205  1.00 115.01 ? 100 THR E OG1 1 
ATOM   6266 C CG2 . THR E 2 100 ? -111.888 -54.655 -93.801  1.00 114.70 ? 100 THR E CG2 1 
ATOM   6267 N N   . ILE E 2 101 ? -107.964 -52.916 -91.904  1.00 117.13 ? 101 ILE E N   1 
ATOM   6268 C CA  . ILE E 2 101 ? -106.502 -52.823 -92.120  1.00 118.52 ? 101 ILE E CA  1 
ATOM   6269 C C   . ILE E 2 101 ? -105.773 -54.102 -91.706  1.00 119.56 ? 101 ILE E C   1 
ATOM   6270 O O   . ILE E 2 101 ? -106.051 -54.649 -90.637  1.00 119.79 ? 101 ILE E O   1 
ATOM   6271 C CB  . ILE E 2 101 ? -105.827 -51.711 -91.249  1.00 118.38 ? 101 ILE E CB  1 
ATOM   6272 C CG1 . ILE E 2 101 ? -106.664 -50.435 -91.183  1.00 118.79 ? 101 ILE E CG1 1 
ATOM   6273 C CG2 . ILE E 2 101 ? -104.402 -51.426 -91.732  1.00 118.18 ? 101 ILE E CG2 1 
ATOM   6274 C CD1 . ILE E 2 101 ? -106.078 -49.368 -90.267  1.00 118.97 ? 101 ILE E CD1 1 
ATOM   6275 N N   . SER E 2 102 ? -104.833 -54.563 -92.533  1.00 120.64 ? 102 SER E N   1 
ATOM   6276 C CA  . SER E 2 102 ? -103.773 -55.476 -92.069  1.00 121.53 ? 102 SER E CA  1 
ATOM   6277 C C   . SER E 2 102 ? -102.430 -54.739 -92.097  1.00 122.18 ? 102 SER E C   1 
ATOM   6278 O O   . SER E 2 102 ? -102.383 -53.560 -92.481  1.00 122.25 ? 102 SER E O   1 
ATOM   6279 C CB  . SER E 2 102 ? -103.721 -56.786 -92.871  1.00 121.39 ? 102 SER E CB  1 
ATOM   6280 O OG  . SER E 2 102 ? -104.335 -56.649 -94.140  1.00 121.88 ? 102 SER E OG  1 
ATOM   6281 N N   . SER E 2 103 ? -101.355 -55.423 -91.680  1.00 122.93 ? 103 SER E N   1 
ATOM   6282 C CA  . SER E 2 103 ? -99.988  -54.842 -91.595  1.00 123.48 ? 103 SER E CA  1 
ATOM   6283 C C   . SER E 2 103 ? -99.933  -53.528 -90.800  1.00 123.77 ? 103 SER E C   1 
ATOM   6284 O O   . SER E 2 103 ? -98.981  -52.744 -90.913  1.00 123.73 ? 103 SER E O   1 
ATOM   6285 C CB  . SER E 2 103 ? -99.362  -54.661 -92.996  1.00 123.51 ? 103 SER E CB  1 
ATOM   6286 O OG  . SER E 2 103 ? -98.355  -55.627 -93.258  1.00 123.54 ? 103 SER E OG  1 
ATOM   6287 N N   . VAL E 2 104 ? -100.974 -53.306 -90.008  1.00 124.11 ? 104 VAL E N   1 
ATOM   6288 C CA  . VAL E 2 104 ? -101.123 -52.119 -89.193  1.00 124.66 ? 104 VAL E CA  1 
ATOM   6289 C C   . VAL E 2 104 ? -99.789  -51.410 -88.978  1.00 124.84 ? 104 VAL E C   1 
ATOM   6290 O O   . VAL E 2 104 ? -98.975  -51.839 -88.157  1.00 125.01 ? 104 VAL E O   1 
ATOM   6291 C CB  . VAL E 2 104 ? -101.737 -52.490 -87.822  1.00 124.84 ? 104 VAL E CB  1 
ATOM   6292 C CG1 . VAL E 2 104 ? -102.188 -51.235 -87.067  1.00 125.18 ? 104 VAL E CG1 1 
ATOM   6293 C CG2 . VAL E 2 104 ? -102.909 -53.455 -88.004  1.00 124.94 ? 104 VAL E CG2 1 
ATOM   6294 N N   . GLN E 2 105 ? -99.559  -50.338 -89.727  1.00 125.04 ? 105 GLN E N   1 
ATOM   6295 C CA  . GLN E 2 105 ? -98.376  -49.506 -89.505  1.00 125.44 ? 105 GLN E CA  1 
ATOM   6296 C C   . GLN E 2 105 ? -98.456  -48.741 -88.175  1.00 125.33 ? 105 GLN E C   1 
ATOM   6297 O O   . GLN E 2 105 ? -99.501  -48.714 -87.521  1.00 125.19 ? 105 GLN E O   1 
ATOM   6298 C CB  . GLN E 2 105 ? -98.128  -48.545 -90.685  1.00 125.64 ? 105 GLN E CB  1 
ATOM   6299 C CG  . GLN E 2 105 ? -97.545  -49.209 -91.938  1.00 126.90 ? 105 GLN E CG  1 
ATOM   6300 C CD  . GLN E 2 105 ? -96.307  -50.053 -91.643  1.00 129.34 ? 105 GLN E CD  1 
ATOM   6301 O OE1 . GLN E 2 105 ? -96.359  -51.290 -91.687  1.00 130.18 ? 105 GLN E OE1 1 
ATOM   6302 N NE2 . GLN E 2 105 ? -95.191  -49.386 -91.321  1.00 130.10 ? 105 GLN E NE2 1 
ATOM   6303 N N   . ALA E 2 106 ? -97.334  -48.152 -87.767  1.00 125.41 ? 106 ALA E N   1 
ATOM   6304 C CA  . ALA E 2 106 ? -97.294  -47.282 -86.596  1.00 125.31 ? 106 ALA E CA  1 
ATOM   6305 C C   . ALA E 2 106 ? -97.847  -45.927 -87.006  1.00 125.30 ? 106 ALA E C   1 
ATOM   6306 O O   . ALA E 2 106 ? -98.465  -45.224 -86.201  1.00 125.36 ? 106 ALA E O   1 
ATOM   6307 C CB  . ALA E 2 106 ? -95.874  -47.149 -86.074  1.00 125.33 ? 106 ALA E CB  1 
ATOM   6308 N N   . GLU E 2 107 ? -97.623  -45.586 -88.277  1.00 125.24 ? 107 GLU E N   1 
ATOM   6309 C CA  . GLU E 2 107 ? -98.212  -44.403 -88.917  1.00 125.07 ? 107 GLU E CA  1 
ATOM   6310 C C   . GLU E 2 107 ? -99.586  -44.754 -89.528  1.00 124.20 ? 107 GLU E C   1 
ATOM   6311 O O   . GLU E 2 107 ? -99.892  -44.423 -90.679  1.00 124.03 ? 107 GLU E O   1 
ATOM   6312 C CB  . GLU E 2 107 ? -97.255  -43.816 -89.971  1.00 125.49 ? 107 GLU E CB  1 
ATOM   6313 C CG  . GLU E 2 107 ? -95.765  -43.727 -89.544  1.00 127.15 ? 107 GLU E CG  1 
ATOM   6314 C CD  . GLU E 2 107 ? -94.881  -44.858 -90.124  1.00 129.05 ? 107 GLU E CD  1 
ATOM   6315 O OE1 . GLU E 2 107 ? -95.150  -46.055 -89.835  1.00 129.35 ? 107 GLU E OE1 1 
ATOM   6316 O OE2 . GLU E 2 107 ? -93.906  -44.538 -90.860  1.00 129.04 ? 107 GLU E OE2 1 
ATOM   6317 N N   . ASP E 2 108 ? -100.384 -45.457 -88.731  1.00 123.16 ? 108 ASP E N   1 
ATOM   6318 C CA  . ASP E 2 108 ? -101.761 -45.783 -89.037  1.00 122.17 ? 108 ASP E CA  1 
ATOM   6319 C C   . ASP E 2 108 ? -102.608 -45.437 -87.835  1.00 121.51 ? 108 ASP E C   1 
ATOM   6320 O O   . ASP E 2 108 ? -103.810 -45.727 -87.801  1.00 121.28 ? 108 ASP E O   1 
ATOM   6321 C CB  . ASP E 2 108 ? -101.901 -47.261 -89.348  1.00 122.13 ? 108 ASP E CB  1 
ATOM   6322 C CG  . ASP E 2 108 ? -101.752 -47.557 -90.815  1.00 123.04 ? 108 ASP E CG  1 
ATOM   6323 O OD1 . ASP E 2 108 ? -101.528 -46.613 -91.612  1.00 123.22 ? 108 ASP E OD1 1 
ATOM   6324 O OD2 . ASP E 2 108 ? -101.873 -48.748 -91.175  1.00 124.47 ? 108 ASP E OD2 1 
ATOM   6325 N N   . LEU E 2 109 ? -101.962 -44.831 -86.838  1.00 120.71 ? 109 LEU E N   1 
ATOM   6326 C CA  . LEU E 2 109 ? -102.673 -44.288 -85.693  1.00 119.94 ? 109 LEU E CA  1 
ATOM   6327 C C   . LEU E 2 109 ? -103.384 -43.035 -86.191  1.00 118.93 ? 109 LEU E C   1 
ATOM   6328 O O   . LEU E 2 109 ? -102.754 -42.146 -86.781  1.00 118.96 ? 109 LEU E O   1 
ATOM   6329 C CB  . LEU E 2 109 ? -101.724 -43.975 -84.514  1.00 120.35 ? 109 LEU E CB  1 
ATOM   6330 C CG  . LEU E 2 109 ? -102.232 -44.059 -83.047  1.00 120.79 ? 109 LEU E CG  1 
ATOM   6331 C CD1 . LEU E 2 109 ? -101.093 -43.915 -82.014  1.00 120.60 ? 109 LEU E CD1 1 
ATOM   6332 C CD2 . LEU E 2 109 ? -103.372 -43.067 -82.726  1.00 121.09 ? 109 LEU E CD2 1 
ATOM   6333 N N   . ALA E 2 110 ? -104.699 -43.008 -85.972  1.00 117.52 ? 110 ALA E N   1 
ATOM   6334 C CA  . ALA E 2 110 ? -105.596 -41.953 -86.447  1.00 116.15 ? 110 ALA E CA  1 
ATOM   6335 C C   . ALA E 2 110 ? -107.036 -42.257 -86.024  1.00 115.00 ? 110 ALA E C   1 
ATOM   6336 O O   . ALA E 2 110 ? -107.328 -43.346 -85.501  1.00 115.08 ? 110 ALA E O   1 
ATOM   6337 C CB  . ALA E 2 110 ? -105.517 -41.826 -87.972  1.00 116.32 ? 110 ALA E CB  1 
ATOM   6338 N N   . VAL E 2 111 ? -107.933 -41.295 -86.237  1.00 113.10 ? 111 VAL E N   1 
ATOM   6339 C CA  . VAL E 2 111 ? -109.356 -41.566 -86.090  1.00 111.19 ? 111 VAL E CA  1 
ATOM   6340 C C   . VAL E 2 111 ? -109.919 -41.805 -87.487  1.00 109.96 ? 111 VAL E C   1 
ATOM   6341 O O   . VAL E 2 111 ? -109.710 -41.006 -88.401  1.00 109.86 ? 111 VAL E O   1 
ATOM   6342 C CB  . VAL E 2 111 ? -110.113 -40.445 -85.338  1.00 111.12 ? 111 VAL E CB  1 
ATOM   6343 C CG1 . VAL E 2 111 ? -111.502 -40.919 -84.929  1.00 110.70 ? 111 VAL E CG1 1 
ATOM   6344 C CG2 . VAL E 2 111 ? -109.352 -40.045 -84.100  1.00 111.02 ? 111 VAL E CG2 1 
ATOM   6345 N N   . TYR E 2 112 ? -110.598 -42.934 -87.652  1.00 108.25 ? 112 TYR E N   1 
ATOM   6346 C CA  . TYR E 2 112 ? -111.198 -43.269 -88.926  1.00 106.47 ? 112 TYR E CA  1 
ATOM   6347 C C   . TYR E 2 112 ? -112.667 -42.937 -88.854  1.00 105.30 ? 112 TYR E C   1 
ATOM   6348 O O   . TYR E 2 112 ? -113.370 -43.417 -87.969  1.00 104.98 ? 112 TYR E O   1 
ATOM   6349 C CB  . TYR E 2 112 ? -110.958 -44.739 -89.280  1.00 106.53 ? 112 TYR E CB  1 
ATOM   6350 C CG  . TYR E 2 112 ? -109.484 -45.076 -89.454  1.00 106.27 ? 112 TYR E CG  1 
ATOM   6351 C CD1 . TYR E 2 112 ? -108.888 -45.067 -90.713  1.00 105.48 ? 112 TYR E CD1 1 
ATOM   6352 C CD2 . TYR E 2 112 ? -108.681 -45.390 -88.354  1.00 106.06 ? 112 TYR E CD2 1 
ATOM   6353 C CE1 . TYR E 2 112 ? -107.535 -45.371 -90.871  1.00 104.86 ? 112 TYR E CE1 1 
ATOM   6354 C CE2 . TYR E 2 112 ? -107.330 -45.691 -88.507  1.00 105.31 ? 112 TYR E CE2 1 
ATOM   6355 C CZ  . TYR E 2 112 ? -106.768 -45.680 -89.764  1.00 104.53 ? 112 TYR E CZ  1 
ATOM   6356 O OH  . TYR E 2 112 ? -105.437 -45.976 -89.910  1.00 103.95 ? 112 TYR E OH  1 
ATOM   6357 N N   . TYR E 2 113 ? -113.089 -42.070 -89.773  1.00 103.98 ? 113 TYR E N   1 
ATOM   6358 C CA  . TYR E 2 113 ? -114.466 -41.613 -89.925  1.00 102.69 ? 113 TYR E CA  1 
ATOM   6359 C C   . TYR E 2 113 ? -115.102 -42.274 -91.147  1.00 101.98 ? 113 TYR E C   1 
ATOM   6360 O O   . TYR E 2 113 ? -114.401 -42.794 -92.012  1.00 101.85 ? 113 TYR E O   1 
ATOM   6361 C CB  . TYR E 2 113 ? -114.477 -40.103 -90.159  1.00 102.64 ? 113 TYR E CB  1 
ATOM   6362 C CG  . TYR E 2 113 ? -114.083 -39.239 -88.979  1.00 102.32 ? 113 TYR E CG  1 
ATOM   6363 C CD1 . TYR E 2 113 ? -112.763 -38.841 -88.787  1.00 101.82 ? 113 TYR E CD1 1 
ATOM   6364 C CD2 . TYR E 2 113 ? -115.044 -38.789 -88.077  1.00 102.32 ? 113 TYR E CD2 1 
ATOM   6365 C CE1 . TYR E 2 113 ? -112.410 -38.039 -87.713  1.00 101.83 ? 113 TYR E CE1 1 
ATOM   6366 C CE2 . TYR E 2 113 ? -114.706 -37.988 -87.006  1.00 101.93 ? 113 TYR E CE2 1 
ATOM   6367 C CZ  . TYR E 2 113 ? -113.391 -37.618 -86.826  1.00 102.07 ? 113 TYR E CZ  1 
ATOM   6368 O OH  . TYR E 2 113 ? -113.065 -36.823 -85.751  1.00 102.30 ? 113 TYR E OH  1 
ATOM   6369 N N   . CYS E 2 114 ? -116.429 -42.242 -91.229  1.00 101.11 ? 114 CYS E N   1 
ATOM   6370 C CA  . CYS E 2 114 ? -117.119 -42.624 -92.459  1.00 100.23 ? 114 CYS E CA  1 
ATOM   6371 C C   . CYS E 2 114 ? -118.167 -41.583 -92.822  1.00 99.29  ? 114 CYS E C   1 
ATOM   6372 O O   . CYS E 2 114 ? -118.887 -41.094 -91.950  1.00 99.04  ? 114 CYS E O   1 
ATOM   6373 C CB  . CYS E 2 114 ? -117.720 -44.032 -92.372  1.00 100.46 ? 114 CYS E CB  1 
ATOM   6374 S SG  . CYS E 2 114 ? -118.860 -44.310 -91.009  1.00 101.94 ? 114 CYS E SG  1 
ATOM   6375 N N   . LYS E 2 115 ? -118.212 -41.242 -94.112  1.00 98.31  ? 115 LYS E N   1 
ATOM   6376 C CA  . LYS E 2 115 ? -119.102 -40.217 -94.669  1.00 97.38  ? 115 LYS E CA  1 
ATOM   6377 C C   . LYS E 2 115 ? -120.015 -40.843 -95.705  1.00 96.94  ? 115 LYS E C   1 
ATOM   6378 O O   . LYS E 2 115 ? -119.536 -41.430 -96.668  1.00 96.89  ? 115 LYS E O   1 
ATOM   6379 C CB  . LYS E 2 115 ? -118.290 -39.107 -95.362  1.00 97.24  ? 115 LYS E CB  1 
ATOM   6380 C CG  . LYS E 2 115 ? -119.077 -38.317 -96.432  1.00 96.88  ? 115 LYS E CG  1 
ATOM   6381 C CD  . LYS E 2 115 ? -118.387 -38.307 -97.824  1.00 96.46  ? 115 LYS E CD  1 
ATOM   6382 C CE  . LYS E 2 115 ? -117.694 -36.981 -98.105  1.00 95.67  ? 115 LYS E CE  1 
ATOM   6383 N NZ  . LYS E 2 115 ? -118.449 -35.870 -97.459  1.00 96.46  ? 115 LYS E NZ  1 
ATOM   6384 N N   . GLN E 2 116 ? -121.324 -40.708 -95.522  1.00 96.46  ? 116 GLN E N   1 
ATOM   6385 C CA  . GLN E 2 116 ? -122.252 -41.000 -96.604  1.00 96.15  ? 116 GLN E CA  1 
ATOM   6386 C C   . GLN E 2 116 ? -122.524 -39.730 -97.377  1.00 95.85  ? 116 GLN E C   1 
ATOM   6387 O O   . GLN E 2 116 ? -122.541 -38.630 -96.810  1.00 95.74  ? 116 GLN E O   1 
ATOM   6388 C CB  . GLN E 2 116 ? -123.560 -41.610 -96.100  1.00 96.33  ? 116 GLN E CB  1 
ATOM   6389 C CG  . GLN E 2 116 ? -124.471 -40.673 -95.313  1.00 97.06  ? 116 GLN E CG  1 
ATOM   6390 C CD  . GLN E 2 116 ? -125.283 -39.756 -96.199  1.00 97.87  ? 116 GLN E CD  1 
ATOM   6391 O OE1 . GLN E 2 116 ? -125.212 -38.530 -96.065  1.00 98.78  ? 116 GLN E OE1 1 
ATOM   6392 N NE2 . GLN E 2 116 ? -126.044 -40.337 -97.124  1.00 97.29  ? 116 GLN E NE2 1 
ATOM   6393 N N   . SER E 2 117 ? -122.732 -39.882 -98.679  1.00 95.55  ? 117 SER E N   1 
ATOM   6394 C CA  . SER E 2 117 ? -123.120 -38.755 -99.504  1.00 95.04  ? 117 SER E CA  1 
ATOM   6395 C C   . SER E 2 117 ? -124.355 -39.062 -100.345 1.00 94.72  ? 117 SER E C   1 
ATOM   6396 O O   . SER E 2 117 ? -124.755 -38.246 -101.167 1.00 94.71  ? 117 SER E O   1 
ATOM   6397 C CB  . SER E 2 117 ? -121.960 -38.307 -100.369 1.00 94.73  ? 117 SER E CB  1 
ATOM   6398 O OG  . SER E 2 117 ? -121.677 -39.307 -101.307 1.00 95.56  ? 117 SER E OG  1 
ATOM   6399 N N   . TYR E 2 118 ? -124.969 -40.225 -100.122 1.00 94.50  ? 118 TYR E N   1 
ATOM   6400 C CA  . TYR E 2 118 ? -126.219 -40.577 -100.800 1.00 94.39  ? 118 TYR E CA  1 
ATOM   6401 C C   . TYR E 2 118 ? -127.179 -39.411 -100.758 1.00 93.98  ? 118 TYR E C   1 
ATOM   6402 O O   . TYR E 2 118 ? -127.751 -39.040 -101.773 1.00 94.13  ? 118 TYR E O   1 
ATOM   6403 C CB  . TYR E 2 118 ? -126.885 -41.776 -100.145 1.00 94.66  ? 118 TYR E CB  1 
ATOM   6404 C CG  . TYR E 2 118 ? -128.233 -42.129 -100.733 1.00 95.99  ? 118 TYR E CG  1 
ATOM   6405 C CD1 . TYR E 2 118 ? -128.336 -43.093 -101.738 1.00 98.22  ? 118 TYR E CD1 1 
ATOM   6406 C CD2 . TYR E 2 118 ? -129.411 -41.516 -100.280 1.00 97.34  ? 118 TYR E CD2 1 
ATOM   6407 C CE1 . TYR E 2 118 ? -129.581 -43.443 -102.296 1.00 99.55  ? 118 TYR E CE1 1 
ATOM   6408 C CE2 . TYR E 2 118 ? -130.663 -41.850 -100.827 1.00 99.15  ? 118 TYR E CE2 1 
ATOM   6409 C CZ  . TYR E 2 118 ? -130.738 -42.820 -101.840 1.00 100.05 ? 118 TYR E CZ  1 
ATOM   6410 O OH  . TYR E 2 118 ? -131.948 -43.184 -102.405 1.00 100.10 ? 118 TYR E OH  1 
ATOM   6411 N N   . ASN E 2 119 ? -127.358 -38.849 -99.570  1.00 93.49  ? 119 ASN E N   1 
ATOM   6412 C CA  . ASN E 2 119 ? -128.231 -37.714 -99.381  1.00 93.12  ? 119 ASN E CA  1 
ATOM   6413 C C   . ASN E 2 119 ? -127.541 -36.775 -98.436  1.00 92.74  ? 119 ASN E C   1 
ATOM   6414 O O   . ASN E 2 119 ? -127.292 -37.115 -97.293  1.00 92.57  ? 119 ASN E O   1 
ATOM   6415 C CB  . ASN E 2 119 ? -129.587 -38.155 -98.823  1.00 93.26  ? 119 ASN E CB  1 
ATOM   6416 C CG  . ASN E 2 119 ? -130.564 -36.998 -98.654  1.00 93.96  ? 119 ASN E CG  1 
ATOM   6417 O OD1 . ASN E 2 119 ? -130.159 -35.846 -98.448  1.00 94.93  ? 119 ASN E OD1 1 
ATOM   6418 N ND2 . ASN E 2 119 ? -131.865 -37.303 -98.728  1.00 93.97  ? 119 ASN E ND2 1 
ATOM   6419 N N   . LEU E 2 120 ? -127.230 -35.589 -98.935  1.00 92.78  ? 120 LEU E N   1 
ATOM   6420 C CA  . LEU E 2 120 ? -126.412 -34.611 -98.219  1.00 92.87  ? 120 LEU E CA  1 
ATOM   6421 C C   . LEU E 2 120 ? -125.019 -35.155 -97.827  1.00 93.21  ? 120 LEU E C   1 
ATOM   6422 O O   . LEU E 2 120 ? -124.513 -36.084 -98.451  1.00 93.33  ? 120 LEU E O   1 
ATOM   6423 C CB  . LEU E 2 120 ? -127.182 -34.039 -97.025  1.00 92.48  ? 120 LEU E CB  1 
ATOM   6424 C CG  . LEU E 2 120 ? -128.398 -33.201 -97.394  1.00 91.48  ? 120 LEU E CG  1 
ATOM   6425 C CD1 . LEU E 2 120 ? -129.046 -32.666 -96.157  1.00 91.52  ? 120 LEU E CD1 1 
ATOM   6426 C CD2 . LEU E 2 120 ? -127.987 -32.057 -98.275  1.00 91.38  ? 120 LEU E CD2 1 
ATOM   6427 N N   . TYR E 2 121 ? -124.400 -34.556 -96.816  1.00 93.46  ? 121 TYR E N   1 
ATOM   6428 C CA  . TYR E 2 121 ? -123.129 -35.030 -96.290  1.00 93.69  ? 121 TYR E CA  1 
ATOM   6429 C C   . TYR E 2 121 ? -123.241 -35.205 -94.776  1.00 93.67  ? 121 TYR E C   1 
ATOM   6430 O O   . TYR E 2 121 ? -123.378 -34.219 -94.046  1.00 94.09  ? 121 TYR E O   1 
ATOM   6431 C CB  . TYR E 2 121 ? -122.041 -33.998 -96.573  1.00 93.87  ? 121 TYR E CB  1 
ATOM   6432 C CG  . TYR E 2 121 ? -121.409 -34.031 -97.944  1.00 94.49  ? 121 TYR E CG  1 
ATOM   6433 C CD1 . TYR E 2 121 ? -120.916 -32.867 -98.530  1.00 94.14  ? 121 TYR E CD1 1 
ATOM   6434 C CD2 . TYR E 2 121 ? -121.278 -35.225 -98.646  1.00 95.84  ? 121 TYR E CD2 1 
ATOM   6435 C CE1 . TYR E 2 121 ? -120.314 -32.893 -99.780  1.00 94.34  ? 121 TYR E CE1 1 
ATOM   6436 C CE2 . TYR E 2 121 ? -120.676 -35.255 -99.900  1.00 95.99  ? 121 TYR E CE2 1 
ATOM   6437 C CZ  . TYR E 2 121 ? -120.200 -34.091 -100.455 1.00 95.15  ? 121 TYR E CZ  1 
ATOM   6438 O OH  . TYR E 2 121 ? -119.616 -34.150 -101.694 1.00 96.20  ? 121 TYR E OH  1 
ATOM   6439 N N   . THR E 2 122 ? -123.179 -36.438 -94.290  1.00 93.32  ? 122 THR E N   1 
ATOM   6440 C CA  . THR E 2 122 ? -123.233 -36.660 -92.852  1.00 93.09  ? 122 THR E CA  1 
ATOM   6441 C C   . THR E 2 122 ? -122.148 -37.638 -92.389  1.00 93.45  ? 122 THR E C   1 
ATOM   6442 O O   . THR E 2 122 ? -122.054 -38.743 -92.905  1.00 93.44  ? 122 THR E O   1 
ATOM   6443 C CB  . THR E 2 122 ? -124.620 -37.166 -92.440  1.00 93.00  ? 122 THR E CB  1 
ATOM   6444 O OG1 . THR E 2 122 ? -124.849 -38.463 -93.002  1.00 92.82  ? 122 THR E OG1 1 
ATOM   6445 C CG2 . THR E 2 122 ? -125.716 -36.209 -92.913  1.00 92.75  ? 122 THR E CG2 1 
ATOM   6446 N N   . PHE E 2 123 ? -121.336 -37.243 -91.412  1.00 94.06  ? 123 PHE E N   1 
ATOM   6447 C CA  . PHE E 2 123 ? -120.235 -38.103 -90.932  1.00 94.93  ? 123 PHE E CA  1 
ATOM   6448 C C   . PHE E 2 123 ? -120.561 -39.129 -89.827  1.00 95.72  ? 123 PHE E C   1 
ATOM   6449 O O   . PHE E 2 123 ? -121.588 -39.039 -89.144  1.00 95.78  ? 123 PHE E O   1 
ATOM   6450 C CB  . PHE E 2 123 ? -119.080 -37.247 -90.436  1.00 94.78  ? 123 PHE E CB  1 
ATOM   6451 C CG  . PHE E 2 123 ? -118.403 -36.467 -91.507  1.00 94.87  ? 123 PHE E CG  1 
ATOM   6452 C CD1 . PHE E 2 123 ? -118.498 -35.083 -91.533  1.00 94.73  ? 123 PHE E CD1 1 
ATOM   6453 C CD2 . PHE E 2 123 ? -117.660 -37.109 -92.490  1.00 94.66  ? 123 PHE E CD2 1 
ATOM   6454 C CE1 . PHE E 2 123 ? -117.863 -34.353 -92.516  1.00 94.11  ? 123 PHE E CE1 1 
ATOM   6455 C CE2 . PHE E 2 123 ? -117.021 -36.383 -93.479  1.00 93.84  ? 123 PHE E CE2 1 
ATOM   6456 C CZ  . PHE E 2 123 ? -117.120 -35.001 -93.488  1.00 93.89  ? 123 PHE E CZ  1 
ATOM   6457 N N   . GLY E 2 124 ? -119.657 -40.098 -89.655  1.00 96.54  ? 124 GLY E N   1 
ATOM   6458 C CA  . GLY E 2 124 ? -119.717 -41.044 -88.537  1.00 97.23  ? 124 GLY E CA  1 
ATOM   6459 C C   . GLY E 2 124 ? -119.123 -40.426 -87.287  1.00 97.66  ? 124 GLY E C   1 
ATOM   6460 O O   . GLY E 2 124 ? -118.685 -39.273 -87.312  1.00 97.48  ? 124 GLY E O   1 
ATOM   6461 N N   . GLY E 2 125 ? -119.117 -41.184 -86.193  1.00 98.25  ? 125 GLY E N   1 
ATOM   6462 C CA  . GLY E 2 125 ? -118.509 -40.724 -84.938  1.00 99.16  ? 125 GLY E CA  1 
ATOM   6463 C C   . GLY E 2 125 ? -116.993 -40.827 -84.948  1.00 99.82  ? 125 GLY E C   1 
ATOM   6464 O O   . GLY E 2 125 ? -116.283 -39.894 -84.589  1.00 99.44  ? 125 GLY E O   1 
ATOM   6465 N N   . GLY E 2 126 ? -116.503 -41.978 -85.380  1.00 100.87 ? 126 GLY E N   1 
ATOM   6466 C CA  . GLY E 2 126 ? -115.083 -42.248 -85.432  1.00 102.07 ? 126 GLY E CA  1 
ATOM   6467 C C   . GLY E 2 126 ? -114.786 -43.571 -84.761  1.00 103.08 ? 126 GLY E C   1 
ATOM   6468 O O   . GLY E 2 126 ? -115.565 -44.051 -83.930  1.00 103.14 ? 126 GLY E O   1 
ATOM   6469 N N   . THR E 2 127 ? -113.669 -44.172 -85.153  1.00 104.03 ? 127 THR E N   1 
ATOM   6470 C CA  . THR E 2 127 ? -113.066 -45.255 -84.399  1.00 105.03 ? 127 THR E CA  1 
ATOM   6471 C C   . THR E 2 127 ? -111.618 -44.834 -84.214  1.00 105.79 ? 127 THR E C   1 
ATOM   6472 O O   . THR E 2 127 ? -110.877 -44.732 -85.193  1.00 105.97 ? 127 THR E O   1 
ATOM   6473 C CB  . THR E 2 127 ? -113.126 -46.587 -85.160  1.00 104.97 ? 127 THR E CB  1 
ATOM   6474 O OG1 . THR E 2 127 ? -114.451 -46.812 -85.658  1.00 105.57 ? 127 THR E OG1 1 
ATOM   6475 C CG2 . THR E 2 127 ? -112.750 -47.720 -84.243  1.00 105.26 ? 127 THR E CG2 1 
ATOM   6476 N N   . LYS E 2 128 ? -111.223 -44.549 -82.975  1.00 106.78 ? 128 LYS E N   1 
ATOM   6477 C CA  . LYS E 2 128 ? -109.847 -44.131 -82.691  1.00 107.94 ? 128 LYS E CA  1 
ATOM   6478 C C   . LYS E 2 128 ? -108.989 -45.378 -82.684  1.00 108.56 ? 128 LYS E C   1 
ATOM   6479 O O   . LYS E 2 128 ? -109.394 -46.401 -82.124  1.00 108.82 ? 128 LYS E O   1 
ATOM   6480 C CB  . LYS E 2 128 ? -109.758 -43.443 -81.326  1.00 108.16 ? 128 LYS E CB  1 
ATOM   6481 C CG  . LYS E 2 128 ? -108.650 -42.373 -81.179  1.00 109.15 ? 128 LYS E CG  1 
ATOM   6482 C CD  . LYS E 2 128 ? -108.166 -42.149 -79.703  1.00 110.68 ? 128 LYS E CD  1 
ATOM   6483 C CE  . LYS E 2 128 ? -109.290 -42.085 -78.622  1.00 110.92 ? 128 LYS E CE  1 
ATOM   6484 N NZ  . LYS E 2 128 ? -109.949 -40.751 -78.454  1.00 110.86 ? 128 LYS E NZ  1 
ATOM   6485 N N   . LEU E 2 129 ? -107.813 -45.317 -83.298  1.00 109.27 ? 129 LEU E N   1 
ATOM   6486 C CA  . LEU E 2 129 ? -106.986 -46.517 -83.387  1.00 110.11 ? 129 LEU E CA  1 
ATOM   6487 C C   . LEU E 2 129 ? -105.639 -46.390 -82.672  1.00 110.99 ? 129 LEU E C   1 
ATOM   6488 O O   . LEU E 2 129 ? -104.631 -46.031 -83.278  1.00 111.38 ? 129 LEU E O   1 
ATOM   6489 C CB  . LEU E 2 129 ? -106.800 -46.937 -84.845  1.00 109.91 ? 129 LEU E CB  1 
ATOM   6490 C CG  . LEU E 2 129 ? -106.486 -48.409 -85.088  1.00 109.71 ? 129 LEU E CG  1 
ATOM   6491 C CD1 . LEU E 2 129 ? -107.662 -49.294 -84.688  1.00 110.07 ? 129 LEU E CD1 1 
ATOM   6492 C CD2 . LEU E 2 129 ? -106.132 -48.614 -86.541  1.00 109.34 ? 129 LEU E CD2 1 
ATOM   6493 N N   . GLU E 2 130 ? -105.628 -46.715 -81.382  1.00 111.81 ? 130 GLU E N   1 
ATOM   6494 C CA  . GLU E 2 130 ? -104.419 -46.635 -80.559  1.00 112.48 ? 130 GLU E CA  1 
ATOM   6495 C C   . GLU E 2 130 ? -103.465 -47.858 -80.659  1.00 113.11 ? 130 GLU E C   1 
ATOM   6496 O O   . GLU E 2 130 ? -103.846 -48.941 -81.122  1.00 113.02 ? 130 GLU E O   1 
ATOM   6497 C CB  . GLU E 2 130 ? -104.790 -46.298 -79.102  1.00 112.47 ? 130 GLU E CB  1 
ATOM   6498 C CG  . GLU E 2 130 ? -106.300 -46.311 -78.778  1.00 112.44 ? 130 GLU E CG  1 
ATOM   6499 C CD  . GLU E 2 130 ? -106.741 -45.149 -77.863  1.00 112.93 ? 130 GLU E CD  1 
ATOM   6500 O OE1 . GLU E 2 130 ? -106.106 -44.064 -77.888  1.00 112.96 ? 130 GLU E OE1 1 
ATOM   6501 O OE2 . GLU E 2 130 ? -107.739 -45.315 -77.125  1.00 112.36 ? 130 GLU E OE2 1 
ATOM   6502 N N   . ILE E 2 131 ? -102.220 -47.666 -80.228  1.00 113.82 ? 131 ILE E N   1 
ATOM   6503 C CA  . ILE E 2 131 ? -101.180 -48.704 -80.315  1.00 114.57 ? 131 ILE E CA  1 
ATOM   6504 C C   . ILE E 2 131 ? -100.805 -49.300 -78.945  1.00 114.68 ? 131 ILE E C   1 
ATOM   6505 O O   . ILE E 2 131 ? -100.499 -48.561 -78.004  1.00 114.62 ? 131 ILE E O   1 
ATOM   6506 C CB  . ILE E 2 131 ? -99.894  -48.145 -81.011  1.00 114.78 ? 131 ILE E CB  1 
ATOM   6507 C CG1 . ILE E 2 131 ? -100.248 -47.584 -82.404  1.00 116.08 ? 131 ILE E CG1 1 
ATOM   6508 C CG2 . ILE E 2 131 ? -98.776  -49.211 -81.070  1.00 114.48 ? 131 ILE E CG2 1 
ATOM   6509 C CD1 . ILE E 2 131 ? -99.114  -46.822 -83.122  1.00 117.78 ? 131 ILE E CD1 1 
ATOM   6510 N N   . LYS E 2 132 ? -100.824 -50.633 -78.847  1.00 114.78 ? 132 LYS E N   1 
ATOM   6511 C CA  . LYS E 2 132 ? -100.308 -51.338 -77.665  1.00 114.73 ? 132 LYS E CA  1 
ATOM   6512 C C   . LYS E 2 132 ? -98.787  -51.154 -77.558  1.00 114.92 ? 132 LYS E C   1 
ATOM   6513 O O   . LYS E 2 132 ? -98.166  -51.513 -76.546  1.00 115.13 ? 132 LYS E O   1 
ATOM   6514 C CB  . LYS E 2 132 ? -100.629 -52.840 -77.697  1.00 114.59 ? 132 LYS E CB  1 
ATOM   6515 C CG  . LYS E 2 132 ? -101.954 -53.230 -78.299  1.00 114.08 ? 132 LYS E CG  1 
ATOM   6516 C CD  . LYS E 2 132 ? -102.551 -54.386 -77.547  1.00 113.61 ? 132 LYS E CD  1 
ATOM   6517 C CE  . LYS E 2 132 ? -103.509 -53.862 -76.486  1.00 114.34 ? 132 LYS E CE  1 
ATOM   6518 N NZ  . LYS E 2 132 ? -103.551 -54.679 -75.230  1.00 114.52 ? 132 LYS E NZ  1 
ATOM   6519 N N   . ALA E 2 134 ? -98.113  -52.624 -74.460  1.00 117.22 ? 134 ALA E N   1 
ATOM   6520 C CA  . ALA E 2 134 ? -97.627  -53.340 -73.280  1.00 117.64 ? 134 ALA E CA  1 
ATOM   6521 C C   . ALA E 2 134 ? -97.724  -52.474 -72.016  1.00 117.70 ? 134 ALA E C   1 
ATOM   6522 O O   . ALA E 2 134 ? -97.316  -51.296 -72.019  1.00 117.96 ? 134 ALA E O   1 
ATOM   6523 C CB  . ALA E 2 134 ? -96.198  -53.829 -73.494  1.00 117.58 ? 134 ALA E CB  1 
ATOM   6524 N N   . ASP E 2 135 ? -98.251  -53.073 -70.945  1.00 117.44 ? 135 ASP E N   1 
ATOM   6525 C CA  . ASP E 2 135 ? -98.727  -52.345 -69.758  1.00 117.29 ? 135 ASP E CA  1 
ATOM   6526 C C   . ASP E 2 135 ? -97.659  -51.543 -69.017  1.00 117.00 ? 135 ASP E C   1 
ATOM   6527 O O   . ASP E 2 135 ? -96.476  -51.592 -69.357  1.00 117.03 ? 135 ASP E O   1 
ATOM   6528 C CB  . ASP E 2 135 ? -99.413  -53.307 -68.768  1.00 117.48 ? 135 ASP E CB  1 
ATOM   6529 C CG  . ASP E 2 135 ? -100.624 -54.011 -69.365  1.00 118.26 ? 135 ASP E CG  1 
ATOM   6530 O OD1 . ASP E 2 135 ? -101.664 -54.103 -68.668  1.00 118.32 ? 135 ASP E OD1 1 
ATOM   6531 O OD2 . ASP E 2 135 ? -100.535 -54.476 -70.529  1.00 119.70 ? 135 ASP E OD2 1 
ATOM   6532 N N   . ALA E 2 136 ? -98.109  -50.806 -67.999  1.00 116.65 ? 136 ALA E N   1 
ATOM   6533 C CA  . ALA E 2 136 ? -97.253  -50.068 -67.056  1.00 116.12 ? 136 ALA E CA  1 
ATOM   6534 C C   . ALA E 2 136 ? -98.098  -49.503 -65.900  1.00 115.76 ? 136 ALA E C   1 
ATOM   6535 O O   . ALA E 2 136 ? -99.319  -49.357 -66.030  1.00 115.96 ? 136 ALA E O   1 
ATOM   6536 C CB  . ALA E 2 136 ? -96.501  -48.943 -67.761  1.00 116.01 ? 136 ALA E CB  1 
ATOM   6537 N N   . ALA E 2 137 ? -97.451  -49.196 -64.775  1.00 114.96 ? 137 ALA E N   1 
ATOM   6538 C CA  . ALA E 2 137 ? -98.123  -48.548 -63.647  1.00 114.06 ? 137 ALA E CA  1 
ATOM   6539 C C   . ALA E 2 137 ? -97.900  -47.019 -63.634  1.00 113.41 ? 137 ALA E C   1 
ATOM   6540 O O   . ALA E 2 137 ? -96.843  -46.530 -64.052  1.00 113.28 ? 137 ALA E O   1 
ATOM   6541 C CB  . ALA E 2 137 ? -97.688  -49.184 -62.334  1.00 114.09 ? 137 ALA E CB  1 
ATOM   6542 N N   . PRO E 2 138 ? -98.902  -46.260 -63.160  1.00 112.73 ? 138 PRO E N   1 
ATOM   6543 C CA  . PRO E 2 138 ? -98.812  -44.804 -63.205  1.00 112.28 ? 138 PRO E CA  1 
ATOM   6544 C C   . PRO E 2 138 ? -97.889  -44.212 -62.151  1.00 111.85 ? 138 PRO E C   1 
ATOM   6545 O O   . PRO E 2 138 ? -97.954  -44.584 -60.978  1.00 111.89 ? 138 PRO E O   1 
ATOM   6546 C CB  . PRO E 2 138 ? -100.256 -44.348 -62.963  1.00 112.37 ? 138 PRO E CB  1 
ATOM   6547 C CG  . PRO E 2 138 ? -100.890 -45.466 -62.220  1.00 112.66 ? 138 PRO E CG  1 
ATOM   6548 C CD  . PRO E 2 138 ? -100.202 -46.728 -62.643  1.00 112.78 ? 138 PRO E CD  1 
ATOM   6549 N N   . THR E 2 139 ? -97.047  -43.283 -62.589  1.00 111.42 ? 139 THR E N   1 
ATOM   6550 C CA  . THR E 2 139 ? -96.162  -42.531 -61.712  1.00 110.95 ? 139 THR E CA  1 
ATOM   6551 C C   . THR E 2 139 ? -96.905  -41.308 -61.188  1.00 110.72 ? 139 THR E C   1 
ATOM   6552 O O   . THR E 2 139 ? -96.913  -40.236 -61.812  1.00 110.49 ? 139 THR E O   1 
ATOM   6553 C CB  . THR E 2 139 ? -94.891  -42.090 -62.457  1.00 111.04 ? 139 THR E CB  1 
ATOM   6554 O OG1 . THR E 2 139 ? -94.447  -43.145 -63.322  1.00 110.92 ? 139 THR E OG1 1 
ATOM   6555 C CG2 . THR E 2 139 ? -93.781  -41.720 -61.471  1.00 111.20 ? 139 THR E CG2 1 
ATOM   6556 N N   . VAL E 2 140 ? -97.535  -41.482 -60.035  1.00 110.54 ? 140 VAL E N   1 
ATOM   6557 C CA  . VAL E 2 140 ? -98.346  -40.431 -59.442  1.00 110.47 ? 140 VAL E CA  1 
ATOM   6558 C C   . VAL E 2 140 ? -97.562  -39.576 -58.441  1.00 110.49 ? 140 VAL E C   1 
ATOM   6559 O O   . VAL E 2 140 ? -96.761  -40.077 -57.652  1.00 110.31 ? 140 VAL E O   1 
ATOM   6560 C CB  . VAL E 2 140 ? -99.690  -40.983 -58.861  1.00 110.49 ? 140 VAL E CB  1 
ATOM   6561 C CG1 . VAL E 2 140 ? -99.590  -42.468 -58.516  1.00 110.34 ? 140 VAL E CG1 1 
ATOM   6562 C CG2 . VAL E 2 140 ? -100.183 -40.153 -57.675  1.00 110.74 ? 140 VAL E CG2 1 
ATOM   6563 N N   . SER E 2 141 ? -97.790  -38.273 -58.509  1.00 110.73 ? 141 SER E N   1 
ATOM   6564 C CA  . SER E 2 141 ? -97.121  -37.334 -57.637  1.00 111.10 ? 141 SER E CA  1 
ATOM   6565 C C   . SER E 2 141 ? -98.070  -36.199 -57.318  1.00 111.37 ? 141 SER E C   1 
ATOM   6566 O O   . SER E 2 141 ? -98.627  -35.594 -58.225  1.00 111.28 ? 141 SER E O   1 
ATOM   6567 C CB  . SER E 2 141 ? -95.851  -36.801 -58.302  1.00 111.13 ? 141 SER E CB  1 
ATOM   6568 O OG  . SER E 2 141 ? -96.136  -36.216 -59.562  1.00 111.07 ? 141 SER E OG  1 
ATOM   6569 N N   . ILE E 2 142 ? -98.243  -35.927 -56.025  1.00 111.96 ? 142 ILE E N   1 
ATOM   6570 C CA  . ILE E 2 142 ? -99.146  -34.881 -55.522  1.00 112.48 ? 142 ILE E CA  1 
ATOM   6571 C C   . ILE E 2 142 ? -98.400  -33.573 -55.242  1.00 112.85 ? 142 ILE E C   1 
ATOM   6572 O O   . ILE E 2 142 ? -97.198  -33.582 -54.969  1.00 112.60 ? 142 ILE E O   1 
ATOM   6573 C CB  . ILE E 2 142 ? -99.961  -35.383 -54.279  1.00 112.47 ? 142 ILE E CB  1 
ATOM   6574 C CG1 . ILE E 2 142 ? -101.117 -34.427 -53.921  1.00 112.18 ? 142 ILE E CG1 1 
ATOM   6575 C CG2 . ILE E 2 142 ? -99.028  -35.699 -53.088  1.00 112.82 ? 142 ILE E CG2 1 
ATOM   6576 C CD1 . ILE E 2 142 ? -102.239 -35.084 -53.091  1.00 111.39 ? 142 ILE E CD1 1 
ATOM   6577 N N   . PHE E 2 143 ? -99.121  -32.457 -55.340  1.00 113.60 ? 143 PHE E N   1 
ATOM   6578 C CA  . PHE E 2 143 ? -98.529  -31.126 -55.280  1.00 114.56 ? 143 PHE E CA  1 
ATOM   6579 C C   . PHE E 2 143 ? -99.487  -30.157 -54.611  1.00 114.92 ? 143 PHE E C   1 
ATOM   6580 O O   . PHE E 2 143 ? -100.578 -29.933 -55.126  1.00 114.96 ? 143 PHE E O   1 
ATOM   6581 C CB  . PHE E 2 143 ? -98.218  -30.609 -56.690  1.00 114.73 ? 143 PHE E CB  1 
ATOM   6582 C CG  . PHE E 2 143 ? -97.049  -31.285 -57.352  1.00 116.01 ? 143 PHE E CG  1 
ATOM   6583 C CD1 . PHE E 2 143 ? -97.152  -32.591 -57.840  1.00 117.24 ? 143 PHE E CD1 1 
ATOM   6584 C CD2 . PHE E 2 143 ? -95.846  -30.609 -57.517  1.00 117.03 ? 143 PHE E CD2 1 
ATOM   6585 C CE1 . PHE E 2 143 ? -96.063  -33.223 -58.459  1.00 117.65 ? 143 PHE E CE1 1 
ATOM   6586 C CE2 . PHE E 2 143 ? -94.751  -31.230 -58.140  1.00 117.74 ? 143 PHE E CE2 1 
ATOM   6587 C CZ  . PHE E 2 143 ? -94.864  -32.540 -58.613  1.00 117.84 ? 143 PHE E CZ  1 
ATOM   6588 N N   . PRO E 2 144 ? -99.079  -29.579 -53.463  1.00 115.52 ? 144 PRO E N   1 
ATOM   6589 C CA  . PRO E 2 144 ? -99.810  -28.559 -52.684  1.00 115.88 ? 144 PRO E CA  1 
ATOM   6590 C C   . PRO E 2 144 ? -99.990  -27.218 -53.404  1.00 116.26 ? 144 PRO E C   1 
ATOM   6591 O O   . PRO E 2 144 ? -99.269  -26.935 -54.360  1.00 116.25 ? 144 PRO E O   1 
ATOM   6592 C CB  . PRO E 2 144 ? -98.931  -28.369 -51.443  1.00 115.88 ? 144 PRO E CB  1 
ATOM   6593 C CG  . PRO E 2 144 ? -97.600  -28.891 -51.820  1.00 115.95 ? 144 PRO E CG  1 
ATOM   6594 C CD  . PRO E 2 144 ? -97.861  -30.017 -52.762  1.00 115.61 ? 144 PRO E CD  1 
ATOM   6595 N N   . PRO E 2 145 ? -100.944 -26.389 -52.943  1.00 116.82 ? 145 PRO E N   1 
ATOM   6596 C CA  . PRO E 2 145 ? -101.221 -25.125 -53.618  1.00 117.61 ? 145 PRO E CA  1 
ATOM   6597 C C   . PRO E 2 145 ? -100.066 -24.152 -53.454  1.00 118.47 ? 145 PRO E C   1 
ATOM   6598 O O   . PRO E 2 145 ? -99.712  -23.777 -52.331  1.00 118.43 ? 145 PRO E O   1 
ATOM   6599 C CB  . PRO E 2 145 ? -102.475 -24.592 -52.906  1.00 117.46 ? 145 PRO E CB  1 
ATOM   6600 C CG  . PRO E 2 145 ? -102.950 -25.682 -52.047  1.00 117.30 ? 145 PRO E CG  1 
ATOM   6601 C CD  . PRO E 2 145 ? -101.781 -26.555 -51.749  1.00 116.78 ? 145 PRO E CD  1 
ATOM   6602 N N   . SER E 2 146 ? -99.500  -23.749 -54.584  1.00 119.49 ? 146 SER E N   1 
ATOM   6603 C CA  . SER E 2 146 ? -98.288  -22.945 -54.606  1.00 120.65 ? 146 SER E CA  1 
ATOM   6604 C C   . SER E 2 146 ? -98.312  -21.715 -53.703  1.00 121.33 ? 146 SER E C   1 
ATOM   6605 O O   . SER E 2 146 ? -99.332  -21.001 -53.599  1.00 121.15 ? 146 SER E O   1 
ATOM   6606 C CB  . SER E 2 146 ? -97.957  -22.523 -56.036  1.00 120.72 ? 146 SER E CB  1 
ATOM   6607 O OG  . SER E 2 146 ? -98.975  -21.697 -56.567  1.00 121.53 ? 146 SER E OG  1 
ATOM   6608 N N   . SER E 2 147 ? -97.154  -21.513 -53.066  1.00 122.24 ? 147 SER E N   1 
ATOM   6609 C CA  . SER E 2 147 ? -96.796  -20.341 -52.262  1.00 123.12 ? 147 SER E CA  1 
ATOM   6610 C C   . SER E 2 147 ? -97.644  -19.087 -52.526  1.00 123.83 ? 147 SER E C   1 
ATOM   6611 O O   . SER E 2 147 ? -98.266  -18.538 -51.604  1.00 123.87 ? 147 SER E O   1 
ATOM   6612 C CB  . SER E 2 147 ? -95.300  -20.044 -52.465  1.00 122.95 ? 147 SER E CB  1 
ATOM   6613 O OG  . SER E 2 147 ? -94.921  -18.787 -51.935  1.00 123.21 ? 147 SER E OG  1 
ATOM   6614 N N   . GLU E 2 148 ? -97.680  -18.653 -53.783  1.00 124.60 ? 148 GLU E N   1 
ATOM   6615 C CA  . GLU E 2 148 ? -98.327  -17.394 -54.122  1.00 125.30 ? 148 GLU E CA  1 
ATOM   6616 C C   . GLU E 2 148 ? -99.827  -17.506 -54.383  1.00 125.58 ? 148 GLU E C   1 
ATOM   6617 O O   . GLU E 2 148 ? -100.586 -16.599 -54.030  1.00 125.63 ? 148 GLU E O   1 
ATOM   6618 C CB  . GLU E 2 148 ? -97.605  -16.699 -55.278  1.00 125.39 ? 148 GLU E CB  1 
ATOM   6619 C CG  . GLU E 2 148 ? -97.309  -17.561 -56.484  1.00 125.84 ? 148 GLU E CG  1 
ATOM   6620 C CD  . GLU E 2 148 ? -96.507  -16.799 -57.518  1.00 127.10 ? 148 GLU E CD  1 
ATOM   6621 O OE1 . GLU E 2 148 ? -97.116  -16.299 -58.491  1.00 127.62 ? 148 GLU E OE1 1 
ATOM   6622 O OE2 . GLU E 2 148 ? -95.272  -16.672 -57.341  1.00 127.33 ? 148 GLU E OE2 1 
ATOM   6623 N N   . GLN E 2 149 ? -100.261 -18.613 -54.977  1.00 125.94 ? 149 GLN E N   1 
ATOM   6624 C CA  . GLN E 2 149 ? -101.679 -18.782 -55.284  1.00 126.44 ? 149 GLN E CA  1 
ATOM   6625 C C   . GLN E 2 149 ? -102.536 -18.435 -54.070  1.00 126.71 ? 149 GLN E C   1 
ATOM   6626 O O   . GLN E 2 149 ? -103.577 -17.765 -54.188  1.00 126.63 ? 149 GLN E O   1 
ATOM   6627 C CB  . GLN E 2 149 ? -101.975 -20.210 -55.745  1.00 126.50 ? 149 GLN E CB  1 
ATOM   6628 C CG  . GLN E 2 149 ? -103.450 -20.450 -56.074  1.00 126.45 ? 149 GLN E CG  1 
ATOM   6629 C CD  . GLN E 2 149 ? -103.692 -21.690 -56.909  1.00 126.51 ? 149 GLN E CD  1 
ATOM   6630 O OE1 . GLN E 2 149 ? -104.794 -21.890 -57.411  1.00 127.03 ? 149 GLN E OE1 1 
ATOM   6631 N NE2 . GLN E 2 149 ? -102.667 -22.524 -57.073  1.00 126.20 ? 149 GLN E NE2 1 
ATOM   6632 N N   . LEU E 2 150 ? -102.065 -18.894 -52.912  1.00 126.88 ? 150 LEU E N   1 
ATOM   6633 C CA  . LEU E 2 150 ? -102.753 -18.724 -51.637  1.00 127.12 ? 150 LEU E CA  1 
ATOM   6634 C C   . LEU E 2 150 ? -103.081 -17.261 -51.330  1.00 127.29 ? 150 LEU E C   1 
ATOM   6635 O O   . LEU E 2 150 ? -104.262 -16.898 -51.189  1.00 127.44 ? 150 LEU E O   1 
ATOM   6636 C CB  . LEU E 2 150 ? -101.922 -19.349 -50.516  1.00 127.09 ? 150 LEU E CB  1 
ATOM   6637 C CG  . LEU E 2 150 ? -101.807 -20.869 -50.627  1.00 127.10 ? 150 LEU E CG  1 
ATOM   6638 C CD1 . LEU E 2 150 ? -100.557 -21.402 -49.935  1.00 126.57 ? 150 LEU E CD1 1 
ATOM   6639 C CD2 . LEU E 2 150 ? -103.073 -21.514 -50.078  1.00 127.57 ? 150 LEU E CD2 1 
ATOM   6640 N N   . THR E 2 151 ? -102.036 -16.430 -51.252  1.00 127.14 ? 151 THR E N   1 
ATOM   6641 C CA  . THR E 2 151 ? -102.180 -14.987 -51.006  1.00 126.82 ? 151 THR E CA  1 
ATOM   6642 C C   . THR E 2 151 ? -103.215 -14.338 -51.932  1.00 126.42 ? 151 THR E C   1 
ATOM   6643 O O   . THR E 2 151 ? -103.829 -13.328 -51.581  1.00 126.16 ? 151 THR E O   1 
ATOM   6644 C CB  . THR E 2 151 ? -100.810 -14.233 -51.082  1.00 126.97 ? 151 THR E CB  1 
ATOM   6645 O OG1 . THR E 2 151 ? -99.852  -15.017 -51.811  1.00 126.87 ? 151 THR E OG1 1 
ATOM   6646 C CG2 . THR E 2 151 ? -100.265 -13.952 -49.672  1.00 126.85 ? 151 THR E CG2 1 
ATOM   6647 N N   . SER E 2 152 ? -103.425 -14.956 -53.093  1.00 126.13 ? 152 SER E N   1 
ATOM   6648 C CA  . SER E 2 152 ? -104.367 -14.460 -54.100  1.00 125.99 ? 152 SER E CA  1 
ATOM   6649 C C   . SER E 2 152 ? -105.840 -14.734 -53.765  1.00 125.51 ? 152 SER E C   1 
ATOM   6650 O O   . SER E 2 152 ? -106.739 -14.225 -54.443  1.00 125.39 ? 152 SER E O   1 
ATOM   6651 C CB  . SER E 2 152 ? -104.018 -15.032 -55.475  1.00 126.12 ? 152 SER E CB  1 
ATOM   6652 O OG  . SER E 2 152 ? -102.612 -14.984 -55.689  1.00 126.81 ? 152 SER E OG  1 
ATOM   6653 N N   . GLY E 2 153 ? -106.076 -15.529 -52.720  1.00 124.91 ? 153 GLY E N   1 
ATOM   6654 C CA  . GLY E 2 153 ? -107.431 -15.833 -52.253  1.00 123.92 ? 153 GLY E CA  1 
ATOM   6655 C C   . GLY E 2 153 ? -107.948 -17.176 -52.740  1.00 123.20 ? 153 GLY E C   1 
ATOM   6656 O O   . GLY E 2 153 ? -109.071 -17.585 -52.400  1.00 123.10 ? 153 GLY E O   1 
ATOM   6657 N N   . GLY E 2 154 ? -107.126 -17.857 -53.539  1.00 122.35 ? 154 GLY E N   1 
ATOM   6658 C CA  . GLY E 2 154 ? -107.472 -19.164 -54.093  1.00 121.20 ? 154 GLY E CA  1 
ATOM   6659 C C   . GLY E 2 154 ? -106.405 -20.193 -53.775  1.00 120.34 ? 154 GLY E C   1 
ATOM   6660 O O   . GLY E 2 154 ? -105.312 -19.833 -53.332  1.00 120.33 ? 154 GLY E O   1 
ATOM   6661 N N   . ALA E 2 155 ? -106.729 -21.470 -53.995  1.00 119.33 ? 155 ALA E N   1 
ATOM   6662 C CA  . ALA E 2 155 ? -105.815 -22.586 -53.713  1.00 118.28 ? 155 ALA E CA  1 
ATOM   6663 C C   . ALA E 2 155 ? -106.163 -23.855 -54.501  1.00 117.43 ? 155 ALA E C   1 
ATOM   6664 O O   . ALA E 2 155 ? -107.259 -24.404 -54.364  1.00 117.32 ? 155 ALA E O   1 
ATOM   6665 C CB  . ALA E 2 155 ? -105.787 -22.885 -52.212  1.00 118.49 ? 155 ALA E CB  1 
ATOM   6666 N N   . SER E 2 156 ? -105.218 -24.328 -55.309  1.00 116.22 ? 156 SER E N   1 
ATOM   6667 C CA  . SER E 2 156 ? -105.428 -25.523 -56.124  1.00 114.92 ? 156 SER E CA  1 
ATOM   6668 C C   . SER E 2 156 ? -104.379 -26.582 -55.846  1.00 113.95 ? 156 SER E C   1 
ATOM   6669 O O   . SER E 2 156 ? -103.188 -26.334 -56.013  1.00 113.87 ? 156 SER E O   1 
ATOM   6670 C CB  . SER E 2 156 ? -105.407 -25.173 -57.612  1.00 114.91 ? 156 SER E CB  1 
ATOM   6671 O OG  . SER E 2 156 ? -106.383 -24.197 -57.911  1.00 114.86 ? 156 SER E OG  1 
ATOM   6672 N N   . VAL E 2 157 ? -104.836 -27.758 -55.425  1.00 112.73 ? 157 VAL E N   1 
ATOM   6673 C CA  . VAL E 2 157 ? -103.973 -28.917 -55.227  1.00 111.63 ? 157 VAL E CA  1 
ATOM   6674 C C   . VAL E 2 157 ? -103.983 -29.750 -56.495  1.00 110.96 ? 157 VAL E C   1 
ATOM   6675 O O   . VAL E 2 157 ? -105.046 -30.116 -56.967  1.00 110.95 ? 157 VAL E O   1 
ATOM   6676 C CB  . VAL E 2 157 ? -104.485 -29.799 -54.071  1.00 111.60 ? 157 VAL E CB  1 
ATOM   6677 C CG1 . VAL E 2 157 ? -103.500 -30.911 -53.766  1.00 111.22 ? 157 VAL E CG1 1 
ATOM   6678 C CG2 . VAL E 2 157 ? -104.744 -28.964 -52.831  1.00 111.49 ? 157 VAL E CG2 1 
ATOM   6679 N N   . VAL E 2 158 ? -102.819 -30.055 -57.055  1.00 110.28 ? 158 VAL E N   1 
ATOM   6680 C CA  . VAL E 2 158 ? -102.780 -30.916 -58.240  1.00 110.00 ? 158 VAL E CA  1 
ATOM   6681 C C   . VAL E 2 158 ? -102.058 -32.234 -57.975  1.00 109.68 ? 158 VAL E C   1 
ATOM   6682 O O   . VAL E 2 158 ? -101.336 -32.368 -56.987  1.00 109.73 ? 158 VAL E O   1 
ATOM   6683 C CB  . VAL E 2 158 ? -102.125 -30.227 -59.470  1.00 110.04 ? 158 VAL E CB  1 
ATOM   6684 C CG1 . VAL E 2 158 ? -102.774 -28.898 -59.772  1.00 110.23 ? 158 VAL E CG1 1 
ATOM   6685 C CG2 . VAL E 2 158 ? -100.641 -30.046 -59.259  1.00 110.54 ? 158 VAL E CG2 1 
ATOM   6686 N N   . CYS E 2 159 ? -102.264 -33.206 -58.857  1.00 109.30 ? 159 CYS E N   1 
ATOM   6687 C CA  . CYS E 2 159 ? -101.415 -34.383 -58.872  1.00 109.15 ? 159 CYS E CA  1 
ATOM   6688 C C   . CYS E 2 159 ? -101.408 -35.078 -60.222  1.00 108.50 ? 159 CYS E C   1 
ATOM   6689 O O   . CYS E 2 159 ? -102.456 -35.322 -60.804  1.00 108.24 ? 159 CYS E O   1 
ATOM   6690 C CB  . CYS E 2 159 ? -101.720 -35.336 -57.704  1.00 109.48 ? 159 CYS E CB  1 
ATOM   6691 S SG  . CYS E 2 159 ? -103.102 -36.447 -57.844  1.00 110.93 ? 159 CYS E SG  1 
ATOM   6692 N N   . PHE E 2 160 ? -100.203 -35.368 -60.704  1.00 107.98 ? 160 PHE E N   1 
ATOM   6693 C CA  . PHE E 2 160 ? -99.990  -35.894 -62.042  1.00 107.73 ? 160 PHE E CA  1 
ATOM   6694 C C   . PHE E 2 160 ? -99.841  -37.407 -62.068  1.00 107.63 ? 160 PHE E C   1 
ATOM   6695 O O   . PHE E 2 160 ? -98.862  -37.958 -61.556  1.00 107.74 ? 160 PHE E O   1 
ATOM   6696 C CB  . PHE E 2 160 ? -98.763  -35.241 -62.686  1.00 107.63 ? 160 PHE E CB  1 
ATOM   6697 C CG  . PHE E 2 160 ? -98.818  -33.748 -62.707  1.00 107.75 ? 160 PHE E CG  1 
ATOM   6698 C CD1 . PHE E 2 160 ? -99.807  -33.084 -63.415  1.00 108.06 ? 160 PHE E CD1 1 
ATOM   6699 C CD2 . PHE E 2 160 ? -97.882  -33.001 -62.021  1.00 108.32 ? 160 PHE E CD2 1 
ATOM   6700 C CE1 . PHE E 2 160 ? -99.870  -31.697 -63.439  1.00 108.01 ? 160 PHE E CE1 1 
ATOM   6701 C CE2 . PHE E 2 160 ? -97.935  -31.609 -62.040  1.00 108.63 ? 160 PHE E CE2 1 
ATOM   6702 C CZ  . PHE E 2 160 ? -98.936  -30.958 -62.751  1.00 108.31 ? 160 PHE E CZ  1 
ATOM   6703 N N   . LEU E 2 161 ? -100.818 -38.066 -62.685  1.00 107.39 ? 161 LEU E N   1 
ATOM   6704 C CA  . LEU E 2 161 ? -100.828 -39.519 -62.847  1.00 107.27 ? 161 LEU E CA  1 
ATOM   6705 C C   . LEU E 2 161 ? -100.186 -39.880 -64.196  1.00 107.34 ? 161 LEU E C   1 
ATOM   6706 O O   . LEU E 2 161 ? -100.872 -40.004 -65.206  1.00 107.66 ? 161 LEU E O   1 
ATOM   6707 C CB  . LEU E 2 161 ? -102.271 -40.034 -62.779  1.00 107.00 ? 161 LEU E CB  1 
ATOM   6708 C CG  . LEU E 2 161 ? -103.185 -39.790 -61.568  1.00 106.27 ? 161 LEU E CG  1 
ATOM   6709 C CD1 . LEU E 2 161 ? -103.434 -41.086 -60.828  1.00 106.37 ? 161 LEU E CD1 1 
ATOM   6710 C CD2 . LEU E 2 161 ? -102.724 -38.694 -60.607  1.00 105.14 ? 161 LEU E CD2 1 
ATOM   6711 N N   . ASN E 2 162 ? -98.870  -40.048 -64.213  1.00 107.16 ? 162 ASN E N   1 
ATOM   6712 C CA  . ASN E 2 162 ? -98.144  -40.078 -65.475  1.00 106.89 ? 162 ASN E CA  1 
ATOM   6713 C C   . ASN E 2 162 ? -97.715  -41.461 -65.940  1.00 106.54 ? 162 ASN E C   1 
ATOM   6714 O O   . ASN E 2 162 ? -97.493  -42.350 -65.136  1.00 106.44 ? 162 ASN E O   1 
ATOM   6715 C CB  . ASN E 2 162 ? -96.945  -39.114 -65.423  1.00 107.08 ? 162 ASN E CB  1 
ATOM   6716 C CG  . ASN E 2 162 ? -97.351  -37.678 -65.049  1.00 107.52 ? 162 ASN E CG  1 
ATOM   6717 O OD1 . ASN E 2 162 ? -98.464  -37.228 -65.343  1.00 107.28 ? 162 ASN E OD1 1 
ATOM   6718 N ND2 . ASN E 2 162 ? -96.441  -36.959 -64.400  1.00 107.93 ? 162 ASN E ND2 1 
ATOM   6719 N N   . ASN E 2 163 ? -97.635  -41.623 -67.256  1.00 106.39 ? 163 ASN E N   1 
ATOM   6720 C CA  . ASN E 2 163 ? -97.064  -42.801 -67.903  1.00 106.35 ? 163 ASN E CA  1 
ATOM   6721 C C   . ASN E 2 163 ? -97.622  -44.135 -67.467  1.00 106.37 ? 163 ASN E C   1 
ATOM   6722 O O   . ASN E 2 163 ? -96.989  -44.868 -66.705  1.00 106.33 ? 163 ASN E O   1 
ATOM   6723 C CB  . ASN E 2 163 ? -95.551  -42.781 -67.790  1.00 106.43 ? 163 ASN E CB  1 
ATOM   6724 C CG  . ASN E 2 163 ? -94.946  -41.609 -68.519  1.00 107.41 ? 163 ASN E CG  1 
ATOM   6725 O OD1 . ASN E 2 163 ? -95.355  -40.456 -68.325  1.00 108.53 ? 163 ASN E OD1 1 
ATOM   6726 N ND2 . ASN E 2 163 ? -93.974  -41.889 -69.379  1.00 107.92 ? 163 ASN E ND2 1 
ATOM   6727 N N   . PHE E 2 164 ? -98.812  -44.443 -67.982  1.00 106.58 ? 164 PHE E N   1 
ATOM   6728 C CA  . PHE E 2 164 ? -99.519  -45.695 -67.683  1.00 106.48 ? 164 PHE E CA  1 
ATOM   6729 C C   . PHE E 2 164 ? -100.326 -46.232 -68.860  1.00 106.79 ? 164 PHE E C   1 
ATOM   6730 O O   . PHE E 2 164 ? -100.827 -45.478 -69.689  1.00 106.87 ? 164 PHE E O   1 
ATOM   6731 C CB  . PHE E 2 164 ? -100.441 -45.515 -66.483  1.00 106.14 ? 164 PHE E CB  1 
ATOM   6732 C CG  . PHE E 2 164 ? -101.518 -44.489 -66.685  1.00 104.95 ? 164 PHE E CG  1 
ATOM   6733 C CD1 . PHE E 2 164 ? -102.838 -44.882 -66.827  1.00 104.23 ? 164 PHE E CD1 1 
ATOM   6734 C CD2 . PHE E 2 164 ? -101.220 -43.135 -66.701  1.00 103.92 ? 164 PHE E CD2 1 
ATOM   6735 C CE1 . PHE E 2 164 ? -103.836 -43.947 -66.995  1.00 103.76 ? 164 PHE E CE1 1 
ATOM   6736 C CE2 . PHE E 2 164 ? -102.215 -42.197 -66.877  1.00 103.83 ? 164 PHE E CE2 1 
ATOM   6737 C CZ  . PHE E 2 164 ? -103.522 -42.599 -67.019  1.00 103.72 ? 164 PHE E CZ  1 
ATOM   6738 N N   . TYR E 2 165 ? -100.447 -47.547 -68.920  1.00 107.11 ? 165 TYR E N   1 
ATOM   6739 C CA  . TYR E 2 165 ? -101.263 -48.180 -69.922  1.00 107.80 ? 165 TYR E CA  1 
ATOM   6740 C C   . TYR E 2 165 ? -101.875 -49.437 -69.317  1.00 107.62 ? 165 TYR E C   1 
ATOM   6741 O O   . TYR E 2 165 ? -101.163 -50.194 -68.666  1.00 107.76 ? 165 TYR E O   1 
ATOM   6742 C CB  . TYR E 2 165 ? -100.428 -48.548 -71.153  1.00 108.35 ? 165 TYR E CB  1 
ATOM   6743 C CG  . TYR E 2 165 ? -101.284 -49.261 -72.174  1.00 110.78 ? 165 TYR E CG  1 
ATOM   6744 C CD1 . TYR E 2 165 ? -101.864 -48.556 -73.228  1.00 112.49 ? 165 TYR E CD1 1 
ATOM   6745 C CD2 . TYR E 2 165 ? -101.576 -50.631 -72.045  1.00 112.20 ? 165 TYR E CD2 1 
ATOM   6746 C CE1 . TYR E 2 165 ? -102.691 -49.190 -74.146  1.00 114.07 ? 165 TYR E CE1 1 
ATOM   6747 C CE2 . TYR E 2 165 ? -102.399 -51.274 -72.949  1.00 113.76 ? 165 TYR E CE2 1 
ATOM   6748 C CZ  . TYR E 2 165 ? -102.955 -50.546 -74.004  1.00 115.03 ? 165 TYR E CZ  1 
ATOM   6749 O OH  . TYR E 2 165 ? -103.775 -51.163 -74.928  1.00 116.75 ? 165 TYR E OH  1 
ATOM   6750 N N   . PRO E 2 166 ? -103.181 -49.699 -69.549  1.00 107.55 ? 166 PRO E N   1 
ATOM   6751 C CA  . PRO E 2 166 ? -104.255 -49.060 -70.335  1.00 107.66 ? 166 PRO E CA  1 
ATOM   6752 C C   . PRO E 2 166 ? -104.821 -47.760 -69.753  1.00 107.89 ? 166 PRO E C   1 
ATOM   6753 O O   . PRO E 2 166 ? -104.693 -47.516 -68.563  1.00 108.20 ? 166 PRO E O   1 
ATOM   6754 C CB  . PRO E 2 166 ? -105.353 -50.126 -70.337  1.00 107.60 ? 166 PRO E CB  1 
ATOM   6755 C CG  . PRO E 2 166 ? -104.665 -51.389 -69.957  1.00 107.58 ? 166 PRO E CG  1 
ATOM   6756 C CD  . PRO E 2 166 ? -103.636 -50.983 -68.995  1.00 107.33 ? 166 PRO E CD  1 
ATOM   6757 N N   . LYS E 2 167 ? -105.467 -46.948 -70.587  1.00 108.14 ? 167 LYS E N   1 
ATOM   6758 C CA  . LYS E 2 167 ? -105.953 -45.626 -70.174  1.00 108.49 ? 167 LYS E CA  1 
ATOM   6759 C C   . LYS E 2 167 ? -106.808 -45.650 -68.901  1.00 108.70 ? 167 LYS E C   1 
ATOM   6760 O O   . LYS E 2 167 ? -106.670 -44.775 -68.044  1.00 108.73 ? 167 LYS E O   1 
ATOM   6761 C CB  . LYS E 2 167 ? -106.696 -44.927 -71.335  1.00 108.53 ? 167 LYS E CB  1 
ATOM   6762 C CG  . LYS E 2 167 ? -107.194 -43.489 -71.051  1.00 108.93 ? 167 LYS E CG  1 
ATOM   6763 C CD  . LYS E 2 167 ? -108.630 -43.489 -70.481  1.00 109.47 ? 167 LYS E CD  1 
ATOM   6764 C CE  . LYS E 2 167 ? -109.134 -42.090 -70.148  1.00 109.28 ? 167 LYS E CE  1 
ATOM   6765 N NZ  . LYS E 2 167 ? -110.600 -42.071 -69.839  1.00 108.74 ? 167 LYS E NZ  1 
ATOM   6766 N N   . ASP E 2 168 ? -107.671 -46.657 -68.782  1.00 108.90 ? 168 ASP E N   1 
ATOM   6767 C CA  . ASP E 2 168 ? -108.683 -46.718 -67.723  1.00 109.22 ? 168 ASP E CA  1 
ATOM   6768 C C   . ASP E 2 168 ? -108.092 -46.601 -66.335  1.00 109.04 ? 168 ASP E C   1 
ATOM   6769 O O   . ASP E 2 168 ? -107.675 -47.596 -65.743  1.00 109.06 ? 168 ASP E O   1 
ATOM   6770 C CB  . ASP E 2 168 ? -109.456 -48.022 -67.817  1.00 109.50 ? 168 ASP E CB  1 
ATOM   6771 C CG  . ASP E 2 168 ? -109.440 -48.588 -69.206  1.00 110.81 ? 168 ASP E CG  1 
ATOM   6772 O OD1 . ASP E 2 168 ? -110.517 -48.573 -69.842  1.00 112.51 ? 168 ASP E OD1 1 
ATOM   6773 O OD2 . ASP E 2 168 ? -108.348 -49.016 -69.665  1.00 111.52 ? 168 ASP E OD2 1 
ATOM   6774 N N   . ILE E 2 169 ? -108.048 -45.375 -65.832  1.00 108.84 ? 169 ILE E N   1 
ATOM   6775 C CA  . ILE E 2 169 ? -107.583 -45.128 -64.485  1.00 108.90 ? 169 ILE E CA  1 
ATOM   6776 C C   . ILE E 2 169 ? -108.746 -44.585 -63.678  1.00 108.91 ? 169 ILE E C   1 
ATOM   6777 O O   . ILE E 2 169 ? -109.808 -44.289 -64.227  1.00 108.96 ? 169 ILE E O   1 
ATOM   6778 C CB  . ILE E 2 169 ? -106.358 -44.169 -64.450  1.00 108.99 ? 169 ILE E CB  1 
ATOM   6779 C CG1 . ILE E 2 169 ? -105.477 -44.460 -63.223  1.00 108.89 ? 169 ILE E CG1 1 
ATOM   6780 C CG2 . ILE E 2 169 ? -106.796 -42.692 -64.534  1.00 109.13 ? 169 ILE E CG2 1 
ATOM   6781 C CD1 . ILE E 2 169 ? -104.069 -43.902 -63.321  1.00 108.66 ? 169 ILE E CD1 1 
ATOM   6782 N N   . ASN E 2 170 ? -108.539 -44.466 -62.374  1.00 108.91 ? 170 ASN E N   1 
ATOM   6783 C CA  . ASN E 2 170 ? -109.563 -43.984 -61.489  1.00 108.85 ? 170 ASN E CA  1 
ATOM   6784 C C   . ASN E 2 170 ? -108.918 -43.284 -60.294  1.00 108.61 ? 170 ASN E C   1 
ATOM   6785 O O   . ASN E 2 170 ? -108.251 -43.915 -59.482  1.00 108.85 ? 170 ASN E O   1 
ATOM   6786 C CB  . ASN E 2 170 ? -110.440 -45.165 -61.063  1.00 108.91 ? 170 ASN E CB  1 
ATOM   6787 C CG  . ASN E 2 170 ? -111.717 -44.731 -60.391  1.00 109.95 ? 170 ASN E CG  1 
ATOM   6788 O OD1 . ASN E 2 170 ? -112.136 -43.572 -60.502  1.00 111.32 ? 170 ASN E OD1 1 
ATOM   6789 N ND2 . ASN E 2 170 ? -112.353 -45.664 -59.685  1.00 110.28 ? 170 ASN E ND2 1 
ATOM   6790 N N   . VAL E 2 171 ? -109.087 -41.971 -60.203  1.00 108.31 ? 171 VAL E N   1 
ATOM   6791 C CA  . VAL E 2 171 ? -108.564 -41.220 -59.061  1.00 107.90 ? 171 VAL E CA  1 
ATOM   6792 C C   . VAL E 2 171 ? -109.642 -41.070 -58.001  1.00 107.84 ? 171 VAL E C   1 
ATOM   6793 O O   . VAL E 2 171 ? -110.831 -41.052 -58.309  1.00 108.00 ? 171 VAL E O   1 
ATOM   6794 C CB  . VAL E 2 171 ? -108.057 -39.824 -59.463  1.00 107.85 ? 171 VAL E CB  1 
ATOM   6795 C CG1 . VAL E 2 171 ? -107.012 -39.332 -58.466  1.00 107.35 ? 171 VAL E CG1 1 
ATOM   6796 C CG2 . VAL E 2 171 ? -107.477 -39.858 -60.855  1.00 107.73 ? 171 VAL E CG2 1 
ATOM   6797 N N   . LYS E 2 172 ? -109.220 -40.966 -56.750  1.00 107.68 ? 172 LYS E N   1 
ATOM   6798 C CA  . LYS E 2 172 ? -110.150 -40.829 -55.636  1.00 107.75 ? 172 LYS E CA  1 
ATOM   6799 C C   . LYS E 2 172 ? -109.520 -39.989 -54.527  1.00 107.25 ? 172 LYS E C   1 
ATOM   6800 O O   . LYS E 2 172 ? -108.744 -40.493 -53.718  1.00 107.28 ? 172 LYS E O   1 
ATOM   6801 C CB  . LYS E 2 172 ? -110.635 -42.210 -55.124  1.00 108.22 ? 172 LYS E CB  1 
ATOM   6802 C CG  . LYS E 2 172 ? -109.701 -43.422 -55.445  1.00 109.77 ? 172 LYS E CG  1 
ATOM   6803 C CD  . LYS E 2 172 ? -110.172 -44.776 -54.857  1.00 110.59 ? 172 LYS E CD  1 
ATOM   6804 C CE  . LYS E 2 172 ? -110.025 -44.832 -53.323  1.00 111.21 ? 172 LYS E CE  1 
ATOM   6805 N NZ  . LYS E 2 172 ? -109.513 -46.152 -52.809  1.00 111.59 ? 172 LYS E NZ  1 
ATOM   6806 N N   . TRP E 2 173 ? -109.854 -38.700 -54.517  1.00 106.74 ? 173 TRP E N   1 
ATOM   6807 C CA  . TRP E 2 173 ? -109.302 -37.740 -53.562  1.00 106.28 ? 173 TRP E CA  1 
ATOM   6808 C C   . TRP E 2 173 ? -109.811 -37.924 -52.132  1.00 106.02 ? 173 TRP E C   1 
ATOM   6809 O O   . TRP E 2 173 ? -110.938 -38.376 -51.907  1.00 105.94 ? 173 TRP E O   1 
ATOM   6810 C CB  . TRP E 2 173 ? -109.612 -36.315 -54.019  1.00 106.39 ? 173 TRP E CB  1 
ATOM   6811 C CG  . TRP E 2 173 ? -108.688 -35.805 -55.062  1.00 106.63 ? 173 TRP E CG  1 
ATOM   6812 C CD1 . TRP E 2 173 ? -108.790 -35.996 -56.406  1.00 106.84 ? 173 TRP E CD1 1 
ATOM   6813 C CD2 . TRP E 2 173 ? -107.516 -35.006 -54.858  1.00 107.04 ? 173 TRP E CD2 1 
ATOM   6814 N NE1 . TRP E 2 173 ? -107.755 -35.366 -57.057  1.00 106.97 ? 173 TRP E NE1 1 
ATOM   6815 C CE2 . TRP E 2 173 ? -106.955 -34.755 -56.130  1.00 106.77 ? 173 TRP E CE2 1 
ATOM   6816 C CE3 . TRP E 2 173 ? -106.884 -34.479 -53.723  1.00 106.87 ? 173 TRP E CE3 1 
ATOM   6817 C CZ2 . TRP E 2 173 ? -105.796 -34.006 -56.302  1.00 106.46 ? 173 TRP E CZ2 1 
ATOM   6818 C CZ3 . TRP E 2 173 ? -105.732 -33.731 -53.897  1.00 106.73 ? 173 TRP E CZ3 1 
ATOM   6819 C CH2 . TRP E 2 173 ? -105.199 -33.504 -55.178  1.00 106.71 ? 173 TRP E CH2 1 
ATOM   6820 N N   . LYS E 2 174 ? -108.967 -37.563 -51.167  1.00 105.61 ? 174 LYS E N   1 
ATOM   6821 C CA  . LYS E 2 174 ? -109.351 -37.564 -49.763  1.00 105.02 ? 174 LYS E CA  1 
ATOM   6822 C C   . LYS E 2 174 ? -108.785 -36.335 -49.055  1.00 105.09 ? 174 LYS E C   1 
ATOM   6823 O O   . LYS E 2 174 ? -107.611 -35.993 -49.233  1.00 104.64 ? 174 LYS E O   1 
ATOM   6824 C CB  . LYS E 2 174 ? -108.880 -38.844 -49.061  1.00 104.91 ? 174 LYS E CB  1 
ATOM   6825 C CG  . LYS E 2 174 ? -109.324 -40.157 -49.716  1.00 103.85 ? 174 LYS E CG  1 
ATOM   6826 C CD  . LYS E 2 174 ? -108.896 -41.377 -48.908  1.00 102.26 ? 174 LYS E CD  1 
ATOM   6827 C CE  . LYS E 2 174 ? -109.267 -42.650 -49.632  1.00 101.48 ? 174 LYS E CE  1 
ATOM   6828 N NZ  . LYS E 2 174 ? -108.958 -43.888 -48.872  1.00 101.82 ? 174 LYS E NZ  1 
ATOM   6829 N N   . ILE E 2 175 ? -109.654 -35.663 -48.291  1.00 105.50 ? 175 ILE E N   1 
ATOM   6830 C CA  . ILE E 2 175 ? -109.271 -34.662 -47.287  1.00 105.91 ? 175 ILE E CA  1 
ATOM   6831 C C   . ILE E 2 175 ? -109.310 -35.380 -45.937  1.00 106.58 ? 175 ILE E C   1 
ATOM   6832 O O   . ILE E 2 175 ? -110.395 -35.659 -45.410  1.00 106.51 ? 175 ILE E O   1 
ATOM   6833 C CB  . ILE E 2 175 ? -110.248 -33.473 -47.209  1.00 105.55 ? 175 ILE E CB  1 
ATOM   6834 C CG1 . ILE E 2 175 ? -110.925 -33.177 -48.550  1.00 105.50 ? 175 ILE E CG1 1 
ATOM   6835 C CG2 . ILE E 2 175 ? -109.534 -32.264 -46.690  1.00 105.96 ? 175 ILE E CG2 1 
ATOM   6836 C CD1 . ILE E 2 175 ? -110.198 -32.207 -49.476  1.00 104.31 ? 175 ILE E CD1 1 
ATOM   6837 N N   . ASP E 2 176 ? -108.124 -35.654 -45.387  1.00 107.47 ? 176 ASP E N   1 
ATOM   6838 C CA  . ASP E 2 176 ? -107.928 -36.630 -44.302  1.00 108.41 ? 176 ASP E CA  1 
ATOM   6839 C C   . ASP E 2 176 ? -109.048 -37.682 -44.155  1.00 109.34 ? 176 ASP E C   1 
ATOM   6840 O O   . ASP E 2 176 ? -110.074 -37.456 -43.489  1.00 109.05 ? 176 ASP E O   1 
ATOM   6841 C CB  . ASP E 2 176 ? -107.562 -35.954 -42.964  1.00 108.36 ? 176 ASP E CB  1 
ATOM   6842 C CG  . ASP E 2 176 ? -108.291 -34.632 -42.739  1.00 107.96 ? 176 ASP E CG  1 
ATOM   6843 O OD1 . ASP E 2 176 ? -107.613 -33.584 -42.604  1.00 106.24 ? 176 ASP E OD1 1 
ATOM   6844 O OD2 . ASP E 2 176 ? -109.539 -34.645 -42.686  1.00 107.40 ? 176 ASP E OD2 1 
ATOM   6845 N N   . GLY E 2 177 ? -108.835 -38.818 -44.825  1.00 110.44 ? 177 GLY E N   1 
ATOM   6846 C CA  . GLY E 2 177 ? -109.673 -40.004 -44.684  1.00 111.88 ? 177 GLY E CA  1 
ATOM   6847 C C   . GLY E 2 177 ? -110.999 -39.911 -45.404  1.00 113.01 ? 177 GLY E C   1 
ATOM   6848 O O   . GLY E 2 177 ? -111.387 -40.843 -46.111  1.00 113.42 ? 177 GLY E O   1 
ATOM   6849 N N   . SER E 2 178 ? -111.705 -38.798 -45.213  1.00 113.95 ? 178 SER E N   1 
ATOM   6850 C CA  . SER E 2 178 ? -112.982 -38.561 -45.891  1.00 114.81 ? 178 SER E CA  1 
ATOM   6851 C C   . SER E 2 178 ? -112.712 -38.179 -47.336  1.00 114.96 ? 178 SER E C   1 
ATOM   6852 O O   . SER E 2 178 ? -111.828 -37.369 -47.612  1.00 114.93 ? 178 SER E O   1 
ATOM   6853 C CB  . SER E 2 178 ? -113.782 -37.456 -45.190  1.00 115.12 ? 178 SER E CB  1 
ATOM   6854 O OG  . SER E 2 178 ? -114.078 -37.794 -43.839  1.00 116.24 ? 178 SER E OG  1 
ATOM   6855 N N   . GLU E 2 179 ? -113.482 -38.763 -48.249  1.00 115.40 ? 179 GLU E N   1 
ATOM   6856 C CA  . GLU E 2 179 ? -113.189 -38.691 -49.679  1.00 115.96 ? 179 GLU E CA  1 
ATOM   6857 C C   . GLU E 2 179 ? -114.233 -37.902 -50.426  1.00 115.41 ? 179 GLU E C   1 
ATOM   6858 O O   . GLU E 2 179 ? -115.104 -38.504 -51.046  1.00 115.35 ? 179 GLU E O   1 
ATOM   6859 C CB  . GLU E 2 179 ? -113.157 -40.098 -50.290  1.00 116.45 ? 179 GLU E CB  1 
ATOM   6860 C CG  . GLU E 2 179 ? -112.676 -41.201 -49.339  1.00 119.85 ? 179 GLU E CG  1 
ATOM   6861 C CD  . GLU E 2 179 ? -112.605 -42.594 -49.984  1.00 123.76 ? 179 GLU E CD  1 
ATOM   6862 O OE1 . GLU E 2 179 ? -112.872 -43.586 -49.251  1.00 124.18 ? 179 GLU E OE1 1 
ATOM   6863 O OE2 . GLU E 2 179 ? -112.271 -42.696 -51.202  1.00 125.46 ? 179 GLU E OE2 1 
ATOM   6864 N N   . ARG E 2 180 ? -114.155 -36.572 -50.384  1.00 115.01 ? 180 ARG E N   1 
ATOM   6865 C CA  . ARG E 2 180 ? -115.085 -35.736 -51.171  1.00 114.56 ? 180 ARG E CA  1 
ATOM   6866 C C   . ARG E 2 180 ? -114.749 -35.727 -52.678  1.00 114.25 ? 180 ARG E C   1 
ATOM   6867 O O   . ARG E 2 180 ? -113.570 -35.831 -53.073  1.00 114.33 ? 180 ARG E O   1 
ATOM   6868 C CB  . ARG E 2 180 ? -115.215 -34.307 -50.604  1.00 114.54 ? 180 ARG E CB  1 
ATOM   6869 C CG  . ARG E 2 180 ? -113.908 -33.546 -50.415  1.00 113.45 ? 180 ARG E CG  1 
ATOM   6870 C CD  . ARG E 2 180 ? -113.449 -32.807 -51.663  1.00 111.22 ? 180 ARG E CD  1 
ATOM   6871 N NE  . ARG E 2 180 ? -114.407 -31.809 -52.138  1.00 110.70 ? 180 ARG E NE  1 
ATOM   6872 C CZ  . ARG E 2 180 ? -114.644 -30.635 -51.554  1.00 110.85 ? 180 ARG E CZ  1 
ATOM   6873 N NH1 . ARG E 2 180 ? -114.013 -30.296 -50.439  1.00 111.24 ? 180 ARG E NH1 1 
ATOM   6874 N NH2 . ARG E 2 180 ? -115.526 -29.792 -52.079  1.00 110.89 ? 180 ARG E NH2 1 
ATOM   6875 N N   . GLN E 2 181 ? -115.788 -35.612 -53.507  1.00 113.27 ? 181 GLN E N   1 
ATOM   6876 C CA  . GLN E 2 181 ? -115.607 -35.715 -54.940  1.00 112.55 ? 181 GLN E CA  1 
ATOM   6877 C C   . GLN E 2 181 ? -115.641 -34.341 -55.564  1.00 111.34 ? 181 GLN E C   1 
ATOM   6878 O O   . GLN E 2 181 ? -114.681 -33.935 -56.204  1.00 111.58 ? 181 GLN E O   1 
ATOM   6879 C CB  . GLN E 2 181 ? -116.668 -36.629 -55.576  1.00 113.12 ? 181 GLN E CB  1 
ATOM   6880 C CG  . GLN E 2 181 ? -116.178 -37.448 -56.806  1.00 115.72 ? 181 GLN E CG  1 
ATOM   6881 C CD  . GLN E 2 181 ? -116.127 -36.649 -58.133  1.00 119.10 ? 181 GLN E CD  1 
ATOM   6882 O OE1 . GLN E 2 181 ? -117.164 -36.212 -58.661  1.00 120.00 ? 181 GLN E OE1 1 
ATOM   6883 N NE2 . GLN E 2 181 ? -114.917 -36.488 -58.684  1.00 119.73 ? 181 GLN E NE2 1 
ATOM   6884 N N   . ASN E 2 182 ? -116.737 -33.618 -55.368  1.00 109.87 ? 182 ASN E N   1 
ATOM   6885 C CA  . ASN E 2 182 ? -116.971 -32.379 -56.112  1.00 108.50 ? 182 ASN E CA  1 
ATOM   6886 C C   . ASN E 2 182 ? -115.916 -31.302 -55.882  1.00 107.79 ? 182 ASN E C   1 
ATOM   6887 O O   . ASN E 2 182 ? -115.334 -31.199 -54.805  1.00 107.70 ? 182 ASN E O   1 
ATOM   6888 C CB  . ASN E 2 182 ? -118.374 -31.842 -55.856  1.00 108.31 ? 182 ASN E CB  1 
ATOM   6889 C CG  . ASN E 2 182 ? -118.774 -31.944 -54.421  1.00 107.44 ? 182 ASN E CG  1 
ATOM   6890 O OD1 . ASN E 2 182 ? -118.174 -32.687 -53.649  1.00 108.12 ? 182 ASN E OD1 1 
ATOM   6891 N ND2 . ASN E 2 182 ? -119.800 -31.205 -54.047  1.00 106.47 ? 182 ASN E ND2 1 
ATOM   6892 N N   . GLY E 2 183 ? -115.668 -30.512 -56.921  1.00 106.88 ? 183 GLY E N   1 
ATOM   6893 C CA  . GLY E 2 183 ? -114.591 -29.543 -56.904  1.00 105.61 ? 183 GLY E CA  1 
ATOM   6894 C C   . GLY E 2 183 ? -113.367 -30.045 -57.638  1.00 104.80 ? 183 GLY E C   1 
ATOM   6895 O O   . GLY E 2 183 ? -112.443 -29.268 -57.884  1.00 104.49 ? 183 GLY E O   1 
ATOM   6896 N N   . VAL E 2 184 ? -113.359 -31.336 -57.988  1.00 104.23 ? 184 VAL E N   1 
ATOM   6897 C CA  . VAL E 2 184 ? -112.228 -31.952 -58.706  1.00 103.88 ? 184 VAL E CA  1 
ATOM   6898 C C   . VAL E 2 184 ? -112.355 -31.823 -60.223  1.00 104.06 ? 184 VAL E C   1 
ATOM   6899 O O   . VAL E 2 184 ? -113.444 -31.978 -60.783  1.00 104.31 ? 184 VAL E O   1 
ATOM   6900 C CB  . VAL E 2 184 ? -112.002 -33.432 -58.316  1.00 103.42 ? 184 VAL E CB  1 
ATOM   6901 C CG1 . VAL E 2 184 ? -110.934 -34.062 -59.183  1.00 102.76 ? 184 VAL E CG1 1 
ATOM   6902 C CG2 . VAL E 2 184 ? -111.562 -33.520 -56.885  1.00 103.67 ? 184 VAL E CG2 1 
ATOM   6903 N N   . LEU E 2 185 ? -111.231 -31.528 -60.872  1.00 103.96 ? 185 LEU E N   1 
ATOM   6904 C CA  . LEU E 2 185 ? -111.151 -31.437 -62.320  1.00 103.99 ? 185 LEU E CA  1 
ATOM   6905 C C   . LEU E 2 185 ? -110.099 -32.415 -62.838  1.00 104.44 ? 185 LEU E C   1 
ATOM   6906 O O   . LEU E 2 185 ? -109.004 -32.498 -62.273  1.00 104.78 ? 185 LEU E O   1 
ATOM   6907 C CB  . LEU E 2 185 ? -110.774 -30.011 -62.725  1.00 103.66 ? 185 LEU E CB  1 
ATOM   6908 C CG  . LEU E 2 185 ? -111.823 -28.992 -63.180  1.00 103.27 ? 185 LEU E CG  1 
ATOM   6909 C CD1 . LEU E 2 185 ? -112.808 -28.562 -62.096  1.00 102.52 ? 185 LEU E CD1 1 
ATOM   6910 C CD2 . LEU E 2 185 ? -111.087 -27.789 -63.714  1.00 103.94 ? 185 LEU E CD2 1 
ATOM   6911 N N   . ASN E 2 186 ? -110.418 -33.158 -63.903  1.00 104.72 ? 186 ASN E N   1 
ATOM   6912 C CA  . ASN E 2 186 ? -109.421 -34.041 -64.537  1.00 104.78 ? 186 ASN E CA  1 
ATOM   6913 C C   . ASN E 2 186 ? -109.110 -33.702 -65.988  1.00 104.90 ? 186 ASN E C   1 
ATOM   6914 O O   . ASN E 2 186 ? -109.778 -32.870 -66.598  1.00 104.58 ? 186 ASN E O   1 
ATOM   6915 C CB  . ASN E 2 186 ? -109.802 -35.507 -64.404  1.00 104.70 ? 186 ASN E CB  1 
ATOM   6916 C CG  . ASN E 2 186 ? -110.278 -35.851 -63.023  1.00 104.87 ? 186 ASN E CG  1 
ATOM   6917 O OD1 . ASN E 2 186 ? -111.456 -35.687 -62.704  1.00 105.40 ? 186 ASN E OD1 1 
ATOM   6918 N ND2 . ASN E 2 186 ? -109.368 -36.329 -62.187  1.00 104.97 ? 186 ASN E ND2 1 
ATOM   6919 N N   . SER E 2 187 ? -108.075 -34.348 -66.518  1.00 105.44 ? 187 SER E N   1 
ATOM   6920 C CA  . SER E 2 187 ? -107.561 -34.060 -67.853  1.00 106.08 ? 187 SER E CA  1 
ATOM   6921 C C   . SER E 2 187 ? -106.623 -35.169 -68.352  1.00 106.64 ? 187 SER E C   1 
ATOM   6922 O O   . SER E 2 187 ? -105.666 -35.551 -67.668  1.00 106.64 ? 187 SER E O   1 
ATOM   6923 C CB  . SER E 2 187 ? -106.847 -32.710 -67.865  1.00 105.84 ? 187 SER E CB  1 
ATOM   6924 O OG  . SER E 2 187 ? -106.911 -32.124 -69.147  1.00 106.12 ? 187 SER E OG  1 
ATOM   6925 N N   . TRP E 2 188 ? -106.900 -35.664 -69.557  1.00 107.29 ? 188 TRP E N   1 
ATOM   6926 C CA  . TRP E 2 188 ? -106.197 -36.811 -70.100  1.00 107.89 ? 188 TRP E CA  1 
ATOM   6927 C C   . TRP E 2 188 ? -105.463 -36.518 -71.383  1.00 108.39 ? 188 TRP E C   1 
ATOM   6928 O O   . TRP E 2 188 ? -106.002 -35.895 -72.284  1.00 108.16 ? 188 TRP E O   1 
ATOM   6929 C CB  . TRP E 2 188 ? -107.182 -37.922 -70.370  1.00 107.84 ? 188 TRP E CB  1 
ATOM   6930 C CG  . TRP E 2 188 ? -107.719 -38.502 -69.145  1.00 108.39 ? 188 TRP E CG  1 
ATOM   6931 C CD1 . TRP E 2 188 ? -107.252 -39.602 -68.490  1.00 108.86 ? 188 TRP E CD1 1 
ATOM   6932 C CD2 . TRP E 2 188 ? -108.842 -38.031 -68.400  1.00 109.12 ? 188 TRP E CD2 1 
ATOM   6933 N NE1 . TRP E 2 188 ? -108.019 -39.852 -67.377  1.00 109.12 ? 188 TRP E NE1 1 
ATOM   6934 C CE2 . TRP E 2 188 ? -109.005 -38.904 -67.299  1.00 109.42 ? 188 TRP E CE2 1 
ATOM   6935 C CE3 . TRP E 2 188 ? -109.738 -36.960 -68.560  1.00 109.38 ? 188 TRP E CE3 1 
ATOM   6936 C CZ2 . TRP E 2 188 ? -110.023 -38.738 -66.356  1.00 109.91 ? 188 TRP E CZ2 1 
ATOM   6937 C CZ3 . TRP E 2 188 ? -110.751 -36.792 -67.626  1.00 109.48 ? 188 TRP E CZ3 1 
ATOM   6938 C CH2 . TRP E 2 188 ? -110.887 -37.680 -66.538  1.00 110.39 ? 188 TRP E CH2 1 
ATOM   6939 N N   . THR E 2 189 ? -104.227 -36.993 -71.460  1.00 109.49 ? 189 THR E N   1 
ATOM   6940 C CA  . THR E 2 189 ? -103.458 -36.909 -72.689  1.00 110.52 ? 189 THR E CA  1 
ATOM   6941 C C   . THR E 2 189 ? -103.818 -38.077 -73.602  1.00 111.44 ? 189 THR E C   1 
ATOM   6942 O O   . THR E 2 189 ? -104.409 -39.072 -73.167  1.00 111.48 ? 189 THR E O   1 
ATOM   6943 C CB  . THR E 2 189 ? -101.911 -36.925 -72.441  1.00 110.41 ? 189 THR E CB  1 
ATOM   6944 O OG1 . THR E 2 189 ? -101.562 -37.999 -71.557  1.00 109.94 ? 189 THR E OG1 1 
ATOM   6945 C CG2 . THR E 2 189 ? -101.419 -35.597 -71.877  1.00 110.11 ? 189 THR E CG2 1 
ATOM   6946 N N   . ASP E 2 190 ? -103.465 -37.924 -74.874  1.00 112.50 ? 190 ASP E N   1 
ATOM   6947 C CA  . ASP E 2 190 ? -103.401 -39.027 -75.813  1.00 113.46 ? 190 ASP E CA  1 
ATOM   6948 C C   . ASP E 2 190 ? -102.079 -39.755 -75.643  1.00 114.01 ? 190 ASP E C   1 
ATOM   6949 O O   . ASP E 2 190 ? -101.087 -39.195 -75.164  1.00 113.99 ? 190 ASP E O   1 
ATOM   6950 C CB  . ASP E 2 190 ? -103.472 -38.496 -77.238  1.00 113.69 ? 190 ASP E CB  1 
ATOM   6951 C CG  . ASP E 2 190 ? -104.587 -37.497 -77.432  1.00 114.70 ? 190 ASP E CG  1 
ATOM   6952 O OD1 . ASP E 2 190 ? -105.762 -37.926 -77.504  1.00 115.84 ? 190 ASP E OD1 1 
ATOM   6953 O OD2 . ASP E 2 190 ? -104.285 -36.284 -77.519  1.00 115.66 ? 190 ASP E OD2 1 
ATOM   6954 N N   . GLN E 2 191 ? -102.077 -41.012 -76.052  1.00 114.84 ? 191 GLN E N   1 
ATOM   6955 C CA  . GLN E 2 191 ? -100.872 -41.816 -76.158  1.00 115.83 ? 191 GLN E CA  1 
ATOM   6956 C C   . GLN E 2 191 ? -99.602  -41.026 -76.451  1.00 116.36 ? 191 GLN E C   1 
ATOM   6957 O O   . GLN E 2 191 ? -99.617  -40.066 -77.223  1.00 116.17 ? 191 GLN E O   1 
ATOM   6958 C CB  . GLN E 2 191 ? -101.080 -42.813 -77.274  1.00 115.75 ? 191 GLN E CB  1 
ATOM   6959 C CG  . GLN E 2 191 ? -100.303 -44.053 -77.106  1.00 116.58 ? 191 GLN E CG  1 
ATOM   6960 C CD  . GLN E 2 191 ? -101.122 -45.250 -77.482  1.00 117.95 ? 191 GLN E CD  1 
ATOM   6961 O OE1 . GLN E 2 191 ? -102.209 -45.471 -76.939  1.00 117.98 ? 191 GLN E OE1 1 
ATOM   6962 N NE2 . GLN E 2 191 ? -100.617 -46.034 -78.426  1.00 118.67 ? 191 GLN E NE2 1 
ATOM   6963 N N   . ASP E 2 192 ? -98.498  -41.446 -75.841  1.00 117.42 ? 192 ASP E N   1 
ATOM   6964 C CA  . ASP E 2 192 ? -97.213  -40.804 -76.096  1.00 118.50 ? 192 ASP E CA  1 
ATOM   6965 C C   . ASP E 2 192 ? -96.683  -41.275 -77.439  1.00 119.25 ? 192 ASP E C   1 
ATOM   6966 O O   . ASP E 2 192 ? -96.991  -42.393 -77.870  1.00 119.47 ? 192 ASP E O   1 
ATOM   6967 C CB  . ASP E 2 192 ? -96.203  -41.094 -74.987  1.00 118.33 ? 192 ASP E CB  1 
ATOM   6968 C CG  . ASP E 2 192 ? -95.233  -39.937 -74.761  1.00 118.64 ? 192 ASP E CG  1 
ATOM   6969 O OD1 . ASP E 2 192 ? -94.007  -40.181 -74.701  1.00 118.81 ? 192 ASP E OD1 1 
ATOM   6970 O OD2 . ASP E 2 192 ? -95.695  -38.778 -74.643  1.00 118.36 ? 192 ASP E OD2 1 
ATOM   6971 N N   . SER E 2 193 ? -95.914  -40.413 -78.108  1.00 120.04 ? 193 SER E N   1 
ATOM   6972 C CA  . SER E 2 193 ? -95.365  -40.733 -79.433  1.00 120.64 ? 193 SER E CA  1 
ATOM   6973 C C   . SER E 2 193 ? -94.167  -41.682 -79.332  1.00 120.92 ? 193 SER E C   1 
ATOM   6974 O O   . SER E 2 193 ? -93.959  -42.540 -80.196  1.00 120.93 ? 193 SER E O   1 
ATOM   6975 C CB  . SER E 2 193 ? -94.987  -39.460 -80.194  1.00 120.57 ? 193 SER E CB  1 
ATOM   6976 O OG  . SER E 2 193 ? -93.891  -38.813 -79.578  1.00 120.90 ? 193 SER E OG  1 
ATOM   6977 N N   . LYS E 2 194 ? -93.392  -41.524 -78.265  1.00 121.34 ? 194 LYS E N   1 
ATOM   6978 C CA  . LYS E 2 194 ? -92.229  -42.373 -78.008  1.00 121.74 ? 194 LYS E CA  1 
ATOM   6979 C C   . LYS E 2 194 ? -92.586  -43.421 -76.943  1.00 121.46 ? 194 LYS E C   1 
ATOM   6980 O O   . LYS E 2 194 ? -92.511  -44.632 -77.182  1.00 121.48 ? 194 LYS E O   1 
ATOM   6981 C CB  . LYS E 2 194 ? -91.037  -41.499 -77.561  1.00 122.02 ? 194 LYS E CB  1 
ATOM   6982 C CG  . LYS E 2 194 ? -89.648  -41.966 -78.036  1.00 122.67 ? 194 LYS E CG  1 
ATOM   6983 C CD  . LYS E 2 194 ? -88.630  -40.816 -77.962  1.00 123.30 ? 194 LYS E CD  1 
ATOM   6984 C CE  . LYS E 2 194 ? -87.192  -41.294 -78.193  1.00 123.58 ? 194 LYS E CE  1 
ATOM   6985 N NZ  . LYS E 2 194 ? -86.177  -40.238 -77.850  1.00 123.34 ? 194 LYS E NZ  1 
ATOM   6986 N N   . ASP E 2 195 ? -92.999  -42.928 -75.779  1.00 121.10 ? 195 ASP E N   1 
ATOM   6987 C CA  . ASP E 2 195 ? -93.348  -43.754 -74.631  1.00 120.76 ? 195 ASP E CA  1 
ATOM   6988 C C   . ASP E 2 195 ? -94.677  -44.525 -74.836  1.00 120.03 ? 195 ASP E C   1 
ATOM   6989 O O   . ASP E 2 195 ? -94.930  -45.541 -74.175  1.00 119.63 ? 195 ASP E O   1 
ATOM   6990 C CB  . ASP E 2 195 ? -93.313  -42.871 -73.365  1.00 121.08 ? 195 ASP E CB  1 
ATOM   6991 C CG  . ASP E 2 195 ? -94.533  -43.044 -72.474  1.00 122.43 ? 195 ASP E CG  1 
ATOM   6992 O OD1 . ASP E 2 195 ? -95.426  -42.159 -72.489  1.00 123.12 ? 195 ASP E OD1 1 
ATOM   6993 O OD2 . ASP E 2 195 ? -94.596  -44.065 -71.750  1.00 124.09 ? 195 ASP E OD2 1 
ATOM   6994 N N   . SER E 2 196 ? -95.498  -44.046 -75.771  1.00 119.23 ? 196 SER E N   1 
ATOM   6995 C CA  . SER E 2 196 ? -96.731  -44.734 -76.204  1.00 118.45 ? 196 SER E CA  1 
ATOM   6996 C C   . SER E 2 196 ? -97.716  -45.055 -75.079  1.00 117.73 ? 196 SER E C   1 
ATOM   6997 O O   . SER E 2 196 ? -98.459  -46.039 -75.152  1.00 117.47 ? 196 SER E O   1 
ATOM   6998 C CB  . SER E 2 196 ? -96.405  -45.989 -77.029  1.00 118.46 ? 196 SER E CB  1 
ATOM   6999 O OG  . SER E 2 196 ? -95.491  -45.682 -78.071  1.00 118.54 ? 196 SER E OG  1 
ATOM   7000 N N   . THR E 2 197 ? -97.721  -44.212 -74.049  1.00 116.93 ? 197 THR E N   1 
ATOM   7001 C CA  . THR E 2 197 ? -98.635  -44.376 -72.914  1.00 116.20 ? 197 THR E CA  1 
ATOM   7002 C C   . THR E 2 197 ? -99.307  -43.056 -72.509  1.00 115.22 ? 197 THR E C   1 
ATOM   7003 O O   . THR E 2 197 ? -99.001  -41.993 -73.055  1.00 115.27 ? 197 THR E O   1 
ATOM   7004 C CB  . THR E 2 197 ? -97.945  -45.030 -71.657  1.00 116.46 ? 197 THR E CB  1 
ATOM   7005 O OG1 . THR E 2 197 ? -97.082  -44.080 -71.011  1.00 116.68 ? 197 THR E OG1 1 
ATOM   7006 C CG2 . THR E 2 197 ? -97.168  -46.315 -72.015  1.00 116.53 ? 197 THR E CG2 1 
ATOM   7007 N N   . TYR E 2 198 ? -100.208 -43.142 -71.533  1.00 113.90 ? 198 TYR E N   1 
ATOM   7008 C CA  . TYR E 2 198 ? -101.009 -42.008 -71.112  1.00 112.59 ? 198 TYR E CA  1 
ATOM   7009 C C   . TYR E 2 198 ? -100.536 -41.399 -69.809  1.00 111.79 ? 198 TYR E C   1 
ATOM   7010 O O   . TYR E 2 198 ? -99.819  -42.022 -69.037  1.00 111.57 ? 198 TYR E O   1 
ATOM   7011 C CB  . TYR E 2 198 ? -102.475 -42.417 -70.976  1.00 112.56 ? 198 TYR E CB  1 
ATOM   7012 C CG  . TYR E 2 198 ? -102.966 -43.271 -72.114  1.00 112.21 ? 198 TYR E CG  1 
ATOM   7013 C CD1 . TYR E 2 198 ? -103.137 -42.741 -73.393  1.00 112.41 ? 198 TYR E CD1 1 
ATOM   7014 C CD2 . TYR E 2 198 ? -103.252 -44.611 -71.915  1.00 111.97 ? 198 TYR E CD2 1 
ATOM   7015 C CE1 . TYR E 2 198 ? -103.583 -43.533 -74.446  1.00 112.59 ? 198 TYR E CE1 1 
ATOM   7016 C CE2 . TYR E 2 198 ? -103.703 -45.410 -72.952  1.00 112.42 ? 198 TYR E CE2 1 
ATOM   7017 C CZ  . TYR E 2 198 ? -103.866 -44.872 -74.214  1.00 112.76 ? 198 TYR E CZ  1 
ATOM   7018 O OH  . TYR E 2 198 ? -104.308 -45.688 -75.235  1.00 113.09 ? 198 TYR E OH  1 
ATOM   7019 N N   . SER E 2 199 ? -100.955 -40.157 -69.600  1.00 110.99 ? 199 SER E N   1 
ATOM   7020 C CA  . SER E 2 199 ? -100.753 -39.417 -68.364  1.00 110.06 ? 199 SER E CA  1 
ATOM   7021 C C   . SER E 2 199 ? -101.995 -38.571 -68.121  1.00 109.27 ? 199 SER E C   1 
ATOM   7022 O O   . SER E 2 199 ? -102.586 -38.025 -69.050  1.00 109.17 ? 199 SER E O   1 
ATOM   7023 C CB  . SER E 2 199 ? -99.514  -38.523 -68.449  1.00 110.15 ? 199 SER E CB  1 
ATOM   7024 O OG  . SER E 2 199 ? -98.336  -39.296 -68.605  1.00 110.24 ? 199 SER E OG  1 
ATOM   7025 N N   . MET E 2 200 ? -102.389 -38.462 -66.866  1.00 108.31 ? 200 MET E N   1 
ATOM   7026 C CA  . MET E 2 200 ? -103.569 -37.713 -66.521  1.00 107.59 ? 200 MET E CA  1 
ATOM   7027 C C   . MET E 2 200 ? -103.274 -36.815 -65.330  1.00 107.18 ? 200 MET E C   1 
ATOM   7028 O O   . MET E 2 200 ? -102.595 -37.227 -64.395  1.00 107.14 ? 200 MET E O   1 
ATOM   7029 C CB  . MET E 2 200 ? -104.684 -38.685 -66.176  1.00 107.58 ? 200 MET E CB  1 
ATOM   7030 C CG  . MET E 2 200 ? -105.992 -38.024 -65.806  1.00 107.46 ? 200 MET E CG  1 
ATOM   7031 S SD  . MET E 2 200 ? -106.792 -38.900 -64.464  1.00 106.18 ? 200 MET E SD  1 
ATOM   7032 C CE  . MET E 2 200 ? -105.874 -38.162 -63.130  1.00 106.36 ? 200 MET E CE  1 
ATOM   7033 N N   . SER E 2 201 ? -103.770 -35.586 -65.362  1.00 106.53 ? 201 SER E N   1 
ATOM   7034 C CA  . SER E 2 201 ? -103.679 -34.740 -64.186  1.00 106.09 ? 201 SER E CA  1 
ATOM   7035 C C   . SER E 2 201 ? -105.041 -34.593 -63.510  1.00 105.96 ? 201 SER E C   1 
ATOM   7036 O O   . SER E 2 201 ? -106.076 -34.802 -64.136  1.00 105.89 ? 201 SER E O   1 
ATOM   7037 C CB  . SER E 2 201 ? -103.053 -33.387 -64.520  1.00 105.99 ? 201 SER E CB  1 
ATOM   7038 O OG  . SER E 2 201 ? -103.897 -32.588 -65.317  1.00 105.93 ? 201 SER E OG  1 
ATOM   7039 N N   . SER E 2 202 ? -105.026 -34.276 -62.219  1.00 105.96 ? 202 SER E N   1 
ATOM   7040 C CA  . SER E 2 202 ? -106.247 -34.134 -61.432  1.00 106.02 ? 202 SER E CA  1 
ATOM   7041 C C   . SER E 2 202 ? -106.068 -33.018 -60.427  1.00 106.33 ? 202 SER E C   1 
ATOM   7042 O O   . SER E 2 202 ? -105.047 -32.958 -59.748  1.00 106.66 ? 202 SER E O   1 
ATOM   7043 C CB  . SER E 2 202 ? -106.574 -35.424 -60.690  1.00 105.78 ? 202 SER E CB  1 
ATOM   7044 O OG  . SER E 2 202 ? -107.860 -35.345 -60.107  1.00 105.30 ? 202 SER E OG  1 
ATOM   7045 N N   . THR E 2 203 ? -107.069 -32.151 -60.322  1.00 106.51 ? 203 THR E N   1 
ATOM   7046 C CA  . THR E 2 203 ? -106.951 -30.942 -59.531  1.00 106.78 ? 203 THR E CA  1 
ATOM   7047 C C   . THR E 2 203 ? -108.174 -30.661 -58.675  1.00 107.14 ? 203 THR E C   1 
ATOM   7048 O O   . THR E 2 203 ? -109.189 -30.150 -59.153  1.00 107.07 ? 203 THR E O   1 
ATOM   7049 C CB  . THR E 2 203 ? -106.672 -29.723 -60.431  1.00 106.87 ? 203 THR E CB  1 
ATOM   7050 O OG1 . THR E 2 203 ? -105.434 -29.916 -61.127  1.00 106.94 ? 203 THR E OG1 1 
ATOM   7051 C CG2 . THR E 2 203 ? -106.621 -28.415 -59.609  1.00 106.96 ? 203 THR E CG2 1 
ATOM   7052 N N   . LEU E 2 204 ? -108.064 -30.994 -57.398  1.00 107.75 ? 204 LEU E N   1 
ATOM   7053 C CA  . LEU E 2 204 ? -109.026 -30.541 -56.412  1.00 108.36 ? 204 LEU E CA  1 
ATOM   7054 C C   . LEU E 2 204 ? -108.725 -29.086 -56.096  1.00 108.86 ? 204 LEU E C   1 
ATOM   7055 O O   . LEU E 2 204 ? -107.625 -28.757 -55.648  1.00 109.04 ? 204 LEU E O   1 
ATOM   7056 C CB  . LEU E 2 204 ? -108.925 -31.377 -55.144  1.00 108.36 ? 204 LEU E CB  1 
ATOM   7057 C CG  . LEU E 2 204 ? -110.051 -31.244 -54.123  1.00 108.44 ? 204 LEU E CG  1 
ATOM   7058 C CD1 . LEU E 2 204 ? -109.992 -32.425 -53.166  1.00 109.46 ? 204 LEU E CD1 1 
ATOM   7059 C CD2 . LEU E 2 204 ? -109.979 -29.930 -53.367  1.00 107.73 ? 204 LEU E CD2 1 
ATOM   7060 N N   . THR E 2 205 ? -109.708 -28.222 -56.318  1.00 109.52 ? 205 THR E N   1 
ATOM   7061 C CA  . THR E 2 205 ? -109.515 -26.794 -56.128  1.00 109.98 ? 205 THR E CA  1 
ATOM   7062 C C   . THR E 2 205 ? -110.459 -26.187 -55.070  1.00 110.28 ? 205 THR E C   1 
ATOM   7063 O O   . THR E 2 205 ? -111.662 -26.455 -55.054  1.00 109.89 ? 205 THR E O   1 
ATOM   7064 C CB  . THR E 2 205 ? -109.548 -26.055 -57.487  1.00 110.06 ? 205 THR E CB  1 
ATOM   7065 O OG1 . THR E 2 205 ? -108.791 -24.844 -57.395  1.00 110.39 ? 205 THR E OG1 1 
ATOM   7066 C CG2 . THR E 2 205 ? -110.983 -25.761 -57.952  1.00 110.35 ? 205 THR E CG2 1 
ATOM   7067 N N   . LEU E 2 206 ? -109.875 -25.383 -54.179  1.00 111.13 ? 206 LEU E N   1 
ATOM   7068 C CA  . LEU E 2 206 ? -110.576 -24.786 -53.033  1.00 111.79 ? 206 LEU E CA  1 
ATOM   7069 C C   . LEU E 2 206 ? -110.238 -23.318 -52.768  1.00 112.47 ? 206 LEU E C   1 
ATOM   7070 O O   . LEU E 2 206 ? -109.118 -22.853 -53.009  1.00 112.22 ? 206 LEU E O   1 
ATOM   7071 C CB  . LEU E 2 206 ? -110.238 -25.546 -51.749  1.00 111.58 ? 206 LEU E CB  1 
ATOM   7072 C CG  . LEU E 2 206 ? -110.735 -26.960 -51.507  1.00 110.94 ? 206 LEU E CG  1 
ATOM   7073 C CD1 . LEU E 2 206 ? -110.057 -27.488 -50.257  1.00 109.77 ? 206 LEU E CD1 1 
ATOM   7074 C CD2 . LEU E 2 206 ? -112.250 -26.990 -51.381  1.00 110.79 ? 206 LEU E CD2 1 
ATOM   7075 N N   . THR E 2 207 ? -111.218 -22.606 -52.227  1.00 113.54 ? 207 THR E N   1 
ATOM   7076 C CA  . THR E 2 207 ? -110.966 -21.318 -51.606  1.00 114.62 ? 207 THR E CA  1 
ATOM   7077 C C   . THR E 2 207 ? -110.034 -21.549 -50.408  1.00 115.60 ? 207 THR E C   1 
ATOM   7078 O O   . THR E 2 207 ? -110.327 -22.371 -49.530  1.00 115.51 ? 207 THR E O   1 
ATOM   7079 C CB  . THR E 2 207 ? -112.287 -20.636 -51.147  1.00 114.51 ? 207 THR E CB  1 
ATOM   7080 O OG1 . THR E 2 207 ? -112.403 -20.665 -49.715  1.00 114.35 ? 207 THR E OG1 1 
ATOM   7081 C CG2 . THR E 2 207 ? -113.487 -21.325 -51.769  1.00 113.94 ? 207 THR E CG2 1 
ATOM   7082 N N   . LYS E 2 208 ? -108.905 -20.840 -50.411  1.00 116.90 ? 208 LYS E N   1 
ATOM   7083 C CA  . LYS E 2 208 ? -107.941 -20.803 -49.295  1.00 118.13 ? 208 LYS E CA  1 
ATOM   7084 C C   . LYS E 2 208 ? -108.605 -21.057 -47.947  1.00 118.98 ? 208 LYS E C   1 
ATOM   7085 O O   . LYS E 2 208 ? -108.243 -22.008 -47.255  1.00 119.35 ? 208 LYS E O   1 
ATOM   7086 C CB  . LYS E 2 208 ? -107.218 -19.449 -49.272  1.00 118.24 ? 208 LYS E CB  1 
ATOM   7087 C CG  . LYS E 2 208 ? -106.123 -19.278 -48.229  1.00 117.98 ? 208 LYS E CG  1 
ATOM   7088 C CD  . LYS E 2 208 ? -105.695 -17.818 -48.215  1.00 117.95 ? 208 LYS E CD  1 
ATOM   7089 C CE  . LYS E 2 208 ? -104.476 -17.580 -47.351  1.00 117.76 ? 208 LYS E CE  1 
ATOM   7090 N NZ  . LYS E 2 208 ? -104.088 -16.146 -47.418  1.00 117.32 ? 208 LYS E NZ  1 
ATOM   7091 N N   . ASP E 2 209 ? -109.573 -20.209 -47.583  1.00 119.80 ? 209 ASP E N   1 
ATOM   7092 C CA  . ASP E 2 209 ? -110.380 -20.394 -46.368  1.00 120.49 ? 209 ASP E CA  1 
ATOM   7093 C C   . ASP E 2 209 ? -110.659 -21.869 -46.092  1.00 120.86 ? 209 ASP E C   1 
ATOM   7094 O O   . ASP E 2 209 ? -110.342 -22.386 -45.019  1.00 120.83 ? 209 ASP E O   1 
ATOM   7095 C CB  . ASP E 2 209 ? -111.706 -19.637 -46.485  1.00 120.52 ? 209 ASP E CB  1 
ATOM   7096 C CG  . ASP E 2 209 ? -111.552 -18.152 -46.257  1.00 120.91 ? 209 ASP E CG  1 
ATOM   7097 O OD1 . ASP E 2 209 ? -110.459 -17.721 -45.815  1.00 121.01 ? 209 ASP E OD1 1 
ATOM   7098 O OD2 . ASP E 2 209 ? -112.537 -17.420 -46.513  1.00 121.04 ? 209 ASP E OD2 1 
ATOM   7099 N N   . GLU E 2 210 ? -111.229 -22.540 -47.085  1.00 121.27 ? 210 GLU E N   1 
ATOM   7100 C CA  . GLU E 2 210 ? -111.566 -23.939 -46.959  1.00 121.88 ? 210 GLU E CA  1 
ATOM   7101 C C   . GLU E 2 210 ? -110.352 -24.838 -47.100  1.00 121.80 ? 210 GLU E C   1 
ATOM   7102 O O   . GLU E 2 210 ? -110.375 -25.989 -46.661  1.00 122.07 ? 210 GLU E O   1 
ATOM   7103 C CB  . GLU E 2 210 ? -112.646 -24.304 -47.960  1.00 121.99 ? 210 GLU E CB  1 
ATOM   7104 C CG  . GLU E 2 210 ? -113.962 -23.673 -47.582  1.00 124.27 ? 210 GLU E CG  1 
ATOM   7105 C CD  . GLU E 2 210 ? -115.145 -24.321 -48.260  1.00 127.65 ? 210 GLU E CD  1 
ATOM   7106 O OE1 . GLU E 2 210 ? -115.278 -24.169 -49.502  1.00 129.76 ? 210 GLU E OE1 1 
ATOM   7107 O OE2 . GLU E 2 210 ? -115.951 -24.966 -47.545  1.00 128.23 ? 210 GLU E OE2 1 
ATOM   7108 N N   . TYR E 2 211 ? -109.284 -24.321 -47.696  1.00 121.66 ? 211 TYR E N   1 
ATOM   7109 C CA  . TYR E 2 211 ? -108.069 -25.105 -47.795  1.00 121.56 ? 211 TYR E CA  1 
ATOM   7110 C C   . TYR E 2 211 ? -107.581 -25.456 -46.404  1.00 121.81 ? 211 TYR E C   1 
ATOM   7111 O O   . TYR E 2 211 ? -107.221 -26.602 -46.149  1.00 121.71 ? 211 TYR E O   1 
ATOM   7112 C CB  . TYR E 2 211 ? -106.976 -24.374 -48.578  1.00 121.39 ? 211 TYR E CB  1 
ATOM   7113 C CG  . TYR E 2 211 ? -105.675 -25.130 -48.587  1.00 120.56 ? 211 TYR E CG  1 
ATOM   7114 C CD1 . TYR E 2 211 ? -105.605 -26.423 -49.101  1.00 119.82 ? 211 TYR E CD1 1 
ATOM   7115 C CD2 . TYR E 2 211 ? -104.522 -24.566 -48.069  1.00 119.91 ? 211 TYR E CD2 1 
ATOM   7116 C CE1 . TYR E 2 211 ? -104.424 -27.128 -49.102  1.00 118.92 ? 211 TYR E CE1 1 
ATOM   7117 C CE2 . TYR E 2 211 ? -103.329 -25.268 -48.071  1.00 119.63 ? 211 TYR E CE2 1 
ATOM   7118 C CZ  . TYR E 2 211 ? -103.292 -26.548 -48.583  1.00 119.13 ? 211 TYR E CZ  1 
ATOM   7119 O OH  . TYR E 2 211 ? -102.112 -27.243 -48.581  1.00 119.51 ? 211 TYR E OH  1 
ATOM   7120 N N   . GLU E 2 212 ? -107.599 -24.467 -45.510  1.00 122.35 ? 212 GLU E N   1 
ATOM   7121 C CA  . GLU E 2 212 ? -107.091 -24.633 -44.142  1.00 122.86 ? 212 GLU E CA  1 
ATOM   7122 C C   . GLU E 2 212 ? -108.100 -25.251 -43.169  1.00 123.12 ? 212 GLU E C   1 
ATOM   7123 O O   . GLU E 2 212 ? -107.770 -25.482 -42.002  1.00 123.36 ? 212 GLU E O   1 
ATOM   7124 C CB  . GLU E 2 212 ? -106.556 -23.309 -43.577  1.00 122.77 ? 212 GLU E CB  1 
ATOM   7125 C CG  . GLU E 2 212 ? -105.126 -22.955 -44.001  1.00 122.99 ? 212 GLU E CG  1 
ATOM   7126 C CD  . GLU E 2 212 ? -105.055 -21.799 -45.004  1.00 123.26 ? 212 GLU E CD  1 
ATOM   7127 O OE1 . GLU E 2 212 ? -106.044 -21.574 -45.731  1.00 123.70 ? 212 GLU E OE1 1 
ATOM   7128 O OE2 . GLU E 2 212 ? -104.008 -21.110 -45.065  1.00 122.55 ? 212 GLU E OE2 1 
ATOM   7129 N N   . ARG E 2 213 ? -109.318 -25.522 -43.638  1.00 123.26 ? 213 ARG E N   1 
ATOM   7130 C CA  . ARG E 2 213 ? -110.279 -26.276 -42.840  1.00 123.26 ? 213 ARG E CA  1 
ATOM   7131 C C   . ARG E 2 213 ? -109.604 -27.555 -42.351  1.00 122.77 ? 213 ARG E C   1 
ATOM   7132 O O   . ARG E 2 213 ? -109.736 -27.908 -41.185  1.00 122.61 ? 213 ARG E O   1 
ATOM   7133 C CB  . ARG E 2 213 ? -111.545 -26.608 -43.647  1.00 123.79 ? 213 ARG E CB  1 
ATOM   7134 C CG  . ARG E 2 213 ? -112.482 -27.619 -42.968  1.00 125.11 ? 213 ARG E CG  1 
ATOM   7135 C CD  . ARG E 2 213 ? -113.587 -28.124 -43.885  1.00 125.94 ? 213 ARG E CD  1 
ATOM   7136 N NE  . ARG E 2 213 ? -114.680 -27.162 -43.975  1.00 126.43 ? 213 ARG E NE  1 
ATOM   7137 C CZ  . ARG E 2 213 ? -114.850 -26.329 -44.997  1.00 127.31 ? 213 ARG E CZ  1 
ATOM   7138 N NH1 . ARG E 2 213 ? -114.003 -26.351 -46.023  1.00 127.01 ? 213 ARG E NH1 1 
ATOM   7139 N NH2 . ARG E 2 213 ? -115.875 -25.481 -44.998  1.00 127.84 ? 213 ARG E NH2 1 
ATOM   7140 N N   . HIS E 2 214 ? -108.856 -28.216 -43.235  1.00 122.35 ? 214 HIS E N   1 
ATOM   7141 C CA  . HIS E 2 214 ? -108.232 -29.493 -42.909  1.00 122.11 ? 214 HIS E CA  1 
ATOM   7142 C C   . HIS E 2 214 ? -106.713 -29.533 -43.018  1.00 121.24 ? 214 HIS E C   1 
ATOM   7143 O O   . HIS E 2 214 ? -106.074 -28.512 -43.250  1.00 121.06 ? 214 HIS E O   1 
ATOM   7144 C CB  . HIS E 2 214 ? -108.848 -30.590 -43.765  1.00 122.67 ? 214 HIS E CB  1 
ATOM   7145 C CG  . HIS E 2 214 ? -110.247 -30.945 -43.368  1.00 124.56 ? 214 HIS E CG  1 
ATOM   7146 N ND1 . HIS E 2 214 ? -110.541 -31.640 -42.210  1.00 126.32 ? 214 HIS E ND1 1 
ATOM   7147 C CD2 . HIS E 2 214 ? -111.433 -30.705 -43.977  1.00 125.24 ? 214 HIS E CD2 1 
ATOM   7148 C CE1 . HIS E 2 214 ? -111.849 -31.806 -42.120  1.00 126.68 ? 214 HIS E CE1 1 
ATOM   7149 N NE2 . HIS E 2 214 ? -112.413 -31.252 -43.181  1.00 126.46 ? 214 HIS E NE2 1 
ATOM   7150 N N   . ASN E 2 215 ? -106.151 -30.727 -42.844  1.00 120.48 ? 215 ASN E N   1 
ATOM   7151 C CA  . ASN E 2 215 ? -104.707 -30.921 -42.850  1.00 119.96 ? 215 ASN E CA  1 
ATOM   7152 C C   . ASN E 2 215 ? -104.235 -31.902 -43.919  1.00 119.28 ? 215 ASN E C   1 
ATOM   7153 O O   . ASN E 2 215 ? -103.377 -31.572 -44.736  1.00 119.28 ? 215 ASN E O   1 
ATOM   7154 C CB  . ASN E 2 215 ? -104.221 -31.362 -41.456  1.00 120.29 ? 215 ASN E CB  1 
ATOM   7155 C CG  . ASN E 2 215 ? -102.788 -31.910 -41.460  1.00 121.10 ? 215 ASN E CG  1 
ATOM   7156 O OD1 . ASN E 2 215 ? -101.861 -31.292 -42.000  1.00 122.49 ? 215 ASN E OD1 1 
ATOM   7157 N ND2 . ASN E 2 215 ? -102.604 -33.076 -40.842  1.00 121.74 ? 215 ASN E ND2 1 
ATOM   7158 N N   . SER E 2 216 ? -104.790 -33.105 -43.913  1.00 118.34 ? 216 SER E N   1 
ATOM   7159 C CA  . SER E 2 216 ? -104.264 -34.162 -44.759  1.00 117.50 ? 216 SER E CA  1 
ATOM   7160 C C   . SER E 2 216 ? -104.952 -34.199 -46.109  1.00 116.46 ? 216 SER E C   1 
ATOM   7161 O O   . SER E 2 216 ? -106.174 -34.233 -46.179  1.00 116.45 ? 216 SER E O   1 
ATOM   7162 C CB  . SER E 2 216 ? -104.396 -35.507 -44.051  1.00 117.85 ? 216 SER E CB  1 
ATOM   7163 O OG  . SER E 2 216 ? -103.668 -36.516 -44.725  1.00 119.04 ? 216 SER E OG  1 
ATOM   7164 N N   . TYR E 2 217 ? -104.157 -34.183 -47.173  1.00 115.28 ? 217 TYR E N   1 
ATOM   7165 C CA  . TYR E 2 217 ? -104.672 -34.315 -48.535  1.00 114.27 ? 217 TYR E CA  1 
ATOM   7166 C C   . TYR E 2 217 ? -103.978 -35.472 -49.252  1.00 114.00 ? 217 TYR E C   1 
ATOM   7167 O O   . TYR E 2 217 ? -102.776 -35.683 -49.076  1.00 113.97 ? 217 TYR E O   1 
ATOM   7168 C CB  . TYR E 2 217 ? -104.457 -33.023 -49.337  1.00 114.03 ? 217 TYR E CB  1 
ATOM   7169 C CG  . TYR E 2 217 ? -105.260 -31.823 -48.890  1.00 112.45 ? 217 TYR E CG  1 
ATOM   7170 C CD1 . TYR E 2 217 ? -106.636 -31.788 -49.031  1.00 111.51 ? 217 TYR E CD1 1 
ATOM   7171 C CD2 . TYR E 2 217 ? -104.636 -30.708 -48.358  1.00 111.54 ? 217 TYR E CD2 1 
ATOM   7172 C CE1 . TYR E 2 217 ? -107.369 -30.682 -48.632  1.00 110.88 ? 217 TYR E CE1 1 
ATOM   7173 C CE2 . TYR E 2 217 ? -105.365 -29.601 -47.951  1.00 110.59 ? 217 TYR E CE2 1 
ATOM   7174 C CZ  . TYR E 2 217 ? -106.731 -29.594 -48.094  1.00 110.28 ? 217 TYR E CZ  1 
ATOM   7175 O OH  . TYR E 2 217 ? -107.472 -28.504 -47.700  1.00 109.72 ? 217 TYR E OH  1 
ATOM   7176 N N   . THR E 2 218 ? -104.728 -36.203 -50.078  1.00 113.48 ? 218 THR E N   1 
ATOM   7177 C CA  . THR E 2 218 ? -104.196 -37.396 -50.758  1.00 112.72 ? 218 THR E CA  1 
ATOM   7178 C C   . THR E 2 218 ? -104.946 -37.775 -52.051  1.00 112.22 ? 218 THR E C   1 
ATOM   7179 O O   . THR E 2 218 ? -106.167 -37.634 -52.130  1.00 112.21 ? 218 THR E O   1 
ATOM   7180 C CB  . THR E 2 218 ? -104.123 -38.610 -49.781  1.00 112.63 ? 218 THR E CB  1 
ATOM   7181 O OG1 . THR E 2 218 ? -104.005 -39.824 -50.523  1.00 112.83 ? 218 THR E OG1 1 
ATOM   7182 C CG2 . THR E 2 218 ? -105.344 -38.678 -48.855  1.00 112.10 ? 218 THR E CG2 1 
ATOM   7183 N N   . CYS E 2 219 ? -104.205 -38.247 -53.055  1.00 111.50 ? 219 CYS E N   1 
ATOM   7184 C CA  . CYS E 2 219 ? -104.804 -38.753 -54.298  1.00 110.88 ? 219 CYS E CA  1 
ATOM   7185 C C   . CYS E 2 219 ? -104.363 -40.182 -54.621  1.00 110.22 ? 219 CYS E C   1 
ATOM   7186 O O   . CYS E 2 219 ? -103.234 -40.564 -54.364  1.00 109.80 ? 219 CYS E O   1 
ATOM   7187 C CB  . CYS E 2 219 ? -104.575 -37.789 -55.482  1.00 110.96 ? 219 CYS E CB  1 
ATOM   7188 S SG  . CYS E 2 219 ? -102.896 -37.710 -56.238  1.00 111.96 ? 219 CYS E SG  1 
ATOM   7189 N N   . GLU E 2 220 ? -105.271 -40.973 -55.178  1.00 110.05 ? 220 GLU E N   1 
ATOM   7190 C CA  . GLU E 2 220 ? -105.010 -42.396 -55.372  1.00 110.06 ? 220 GLU E CA  1 
ATOM   7191 C C   . GLU E 2 220 ? -105.398 -42.900 -56.748  1.00 110.13 ? 220 GLU E C   1 
ATOM   7192 O O   . GLU E 2 220 ? -106.583 -42.962 -57.077  1.00 110.30 ? 220 GLU E O   1 
ATOM   7193 C CB  . GLU E 2 220 ? -105.774 -43.227 -54.343  1.00 109.97 ? 220 GLU E CB  1 
ATOM   7194 C CG  . GLU E 2 220 ? -106.410 -42.419 -53.239  1.00 109.95 ? 220 GLU E CG  1 
ATOM   7195 C CD  . GLU E 2 220 ? -106.582 -43.209 -51.965  1.00 110.43 ? 220 GLU E CD  1 
ATOM   7196 O OE1 . GLU E 2 220 ? -106.893 -44.423 -52.033  1.00 110.94 ? 220 GLU E OE1 1 
ATOM   7197 O OE2 . GLU E 2 220 ? -106.403 -42.604 -50.887  1.00 109.98 ? 220 GLU E OE2 1 
ATOM   7198 N N   . ALA E 2 221 ? -104.401 -43.285 -57.540  1.00 110.10 ? 221 ALA E N   1 
ATOM   7199 C CA  . ALA E 2 221 ? -104.634 -44.072 -58.743  1.00 110.32 ? 221 ALA E CA  1 
ATOM   7200 C C   . ALA E 2 221 ? -105.302 -45.389 -58.351  1.00 110.57 ? 221 ALA E C   1 
ATOM   7201 O O   . ALA E 2 221 ? -105.328 -45.732 -57.180  1.00 110.93 ? 221 ALA E O   1 
ATOM   7202 C CB  . ALA E 2 221 ? -103.330 -44.349 -59.414  1.00 110.43 ? 221 ALA E CB  1 
ATOM   7203 N N   . THR E 2 222 ? -105.867 -46.109 -59.314  1.00 110.77 ? 222 THR E N   1 
ATOM   7204 C CA  . THR E 2 222 ? -106.399 -47.452 -59.066  1.00 111.18 ? 222 THR E CA  1 
ATOM   7205 C C   . THR E 2 222 ? -106.390 -48.192 -60.393  1.00 111.37 ? 222 THR E C   1 
ATOM   7206 O O   . THR E 2 222 ? -107.329 -48.926 -60.740  1.00 111.66 ? 222 THR E O   1 
ATOM   7207 C CB  . THR E 2 222 ? -107.832 -47.460 -58.496  1.00 111.24 ? 222 THR E CB  1 
ATOM   7208 O OG1 . THR E 2 222 ? -108.643 -46.574 -59.274  1.00 112.64 ? 222 THR E OG1 1 
ATOM   7209 C CG2 . THR E 2 222 ? -107.876 -47.058 -57.013  1.00 110.60 ? 222 THR E CG2 1 
ATOM   7210 N N   . HIS E 2 223 ? -105.302 -47.976 -61.123  1.00 111.35 ? 223 HIS E N   1 
ATOM   7211 C CA  . HIS E 2 223 ? -104.995 -48.650 -62.377  1.00 111.27 ? 223 HIS E CA  1 
ATOM   7212 C C   . HIS E 2 223 ? -105.055 -50.189 -62.357  1.00 111.29 ? 223 HIS E C   1 
ATOM   7213 O O   . HIS E 2 223 ? -104.907 -50.832 -61.316  1.00 111.09 ? 223 HIS E O   1 
ATOM   7214 C CB  . HIS E 2 223 ? -103.613 -48.192 -62.821  1.00 111.17 ? 223 HIS E CB  1 
ATOM   7215 C CG  . HIS E 2 223 ? -103.397 -48.276 -64.293  1.00 110.96 ? 223 HIS E CG  1 
ATOM   7216 N ND1 . HIS E 2 223 ? -102.173 -48.589 -64.845  1.00 110.78 ? 223 HIS E ND1 1 
ATOM   7217 C CD2 . HIS E 2 223 ? -104.246 -48.097 -65.331  1.00 110.13 ? 223 HIS E CD2 1 
ATOM   7218 C CE1 . HIS E 2 223 ? -102.276 -48.589 -66.160  1.00 110.44 ? 223 HIS E CE1 1 
ATOM   7219 N NE2 . HIS E 2 223 ? -103.523 -48.296 -66.480  1.00 110.66 ? 223 HIS E NE2 1 
ATOM   7220 N N   . LYS E 2 224 ? -105.270 -50.769 -63.532  1.00 111.51 ? 224 LYS E N   1 
ATOM   7221 C CA  . LYS E 2 224 ? -105.334 -52.210 -63.675  1.00 111.96 ? 224 LYS E CA  1 
ATOM   7222 C C   . LYS E 2 224 ? -103.928 -52.797 -63.808  1.00 112.39 ? 224 LYS E C   1 
ATOM   7223 O O   . LYS E 2 224 ? -103.639 -53.490 -64.785  1.00 112.50 ? 224 LYS E O   1 
ATOM   7224 C CB  . LYS E 2 224 ? -106.166 -52.574 -64.913  1.00 112.01 ? 224 LYS E CB  1 
ATOM   7225 C CG  . LYS E 2 224 ? -106.750 -53.999 -64.917  1.00 111.74 ? 224 LYS E CG  1 
ATOM   7226 C CD  . LYS E 2 224 ? -106.509 -54.707 -66.259  1.00 110.54 ? 224 LYS E CD  1 
ATOM   7227 C CE  . LYS E 2 224 ? -107.279 -56.024 -66.363  1.00 110.31 ? 224 LYS E CE  1 
ATOM   7228 N NZ  . LYS E 2 224 ? -106.839 -57.072 -65.389  1.00 110.01 ? 224 LYS E NZ  1 
ATOM   7229 N N   . THR E 2 225 ? -103.047 -52.505 -62.852  1.00 112.92 ? 225 THR E N   1 
ATOM   7230 C CA  . THR E 2 225 ? -101.713 -53.129 -62.817  1.00 113.43 ? 225 THR E CA  1 
ATOM   7231 C C   . THR E 2 225 ? -101.570 -53.902 -61.535  1.00 113.97 ? 225 THR E C   1 
ATOM   7232 O O   . THR E 2 225 ? -101.334 -55.113 -61.550  1.00 114.27 ? 225 THR E O   1 
ATOM   7233 C CB  . THR E 2 225 ? -100.547 -52.123 -62.857  1.00 113.34 ? 225 THR E CB  1 
ATOM   7234 O OG1 . THR E 2 225 ? -100.787 -51.068 -61.919  1.00 113.37 ? 225 THR E OG1 1 
ATOM   7235 C CG2 . THR E 2 225 ? -100.346 -51.561 -64.256  1.00 113.30 ? 225 THR E CG2 1 
ATOM   7236 N N   . SER E 2 226 ? -101.689 -53.180 -60.424  1.00 114.43 ? 226 SER E N   1 
ATOM   7237 C CA  . SER E 2 226 ? -101.755 -53.790 -59.105  1.00 114.95 ? 226 SER E CA  1 
ATOM   7238 C C   . SER E 2 226 ? -103.031 -53.306 -58.440  1.00 114.98 ? 226 SER E C   1 
ATOM   7239 O O   . SER E 2 226 ? -103.142 -52.118 -58.120  1.00 115.06 ? 226 SER E O   1 
ATOM   7240 C CB  . SER E 2 226 ? -100.530 -53.400 -58.265  1.00 115.07 ? 226 SER E CB  1 
ATOM   7241 O OG  . SER E 2 226 ? -100.350 -54.297 -57.176  1.00 115.35 ? 226 SER E OG  1 
ATOM   7242 N N   . THR E 2 227 ? -104.002 -54.202 -58.247  1.00 114.96 ? 227 THR E N   1 
ATOM   7243 C CA  . THR E 2 227 ? -105.237 -53.788 -57.582  1.00 115.07 ? 227 THR E CA  1 
ATOM   7244 C C   . THR E 2 227 ? -104.961 -53.511 -56.104  1.00 115.02 ? 227 THR E C   1 
ATOM   7245 O O   . THR E 2 227 ? -105.307 -54.286 -55.215  1.00 114.88 ? 227 THR E O   1 
ATOM   7246 C CB  . THR E 2 227 ? -106.479 -54.711 -57.843  1.00 115.16 ? 227 THR E CB  1 
ATOM   7247 O OG1 . THR E 2 227 ? -106.167 -56.076 -57.547  1.00 115.15 ? 227 THR E OG1 1 
ATOM   7248 C CG2 . THR E 2 227 ? -106.975 -54.577 -59.297  1.00 114.88 ? 227 THR E CG2 1 
ATOM   7249 N N   . SER E 2 228 ? -104.275 -52.390 -55.908  1.00 115.21 ? 228 SER E N   1 
ATOM   7250 C CA  . SER E 2 228 ? -103.951 -51.779 -54.629  1.00 115.53 ? 228 SER E CA  1 
ATOM   7251 C C   . SER E 2 228 ? -103.651 -50.316 -54.964  1.00 115.61 ? 228 SER E C   1 
ATOM   7252 O O   . SER E 2 228 ? -102.637 -50.023 -55.607  1.00 115.56 ? 228 SER E O   1 
ATOM   7253 C CB  . SER E 2 228 ? -102.721 -52.430 -53.973  1.00 115.58 ? 228 SER E CB  1 
ATOM   7254 O OG  . SER E 2 228 ? -103.083 -53.342 -52.952  1.00 115.32 ? 228 SER E OG  1 
ATOM   7255 N N   . PRO E 2 229 ? -104.546 -49.400 -54.564  1.00 115.72 ? 229 PRO E N   1 
ATOM   7256 C CA  . PRO E 2 229 ? -104.373 -47.979 -54.820  1.00 116.08 ? 229 PRO E CA  1 
ATOM   7257 C C   . PRO E 2 229 ? -102.950 -47.486 -54.595  1.00 116.46 ? 229 PRO E C   1 
ATOM   7258 O O   . PRO E 2 229 ? -102.311 -47.903 -53.633  1.00 116.61 ? 229 PRO E O   1 
ATOM   7259 C CB  . PRO E 2 229 ? -105.308 -47.342 -53.795  1.00 115.99 ? 229 PRO E CB  1 
ATOM   7260 C CG  . PRO E 2 229 ? -106.442 -48.312 -53.709  1.00 115.91 ? 229 PRO E CG  1 
ATOM   7261 C CD  . PRO E 2 229 ? -105.859 -49.684 -53.957  1.00 115.70 ? 229 PRO E CD  1 
ATOM   7262 N N   . ILE E 2 230 ? -102.452 -46.636 -55.493  1.00 116.96 ? 230 ILE E N   1 
ATOM   7263 C CA  . ILE E 2 230 ? -101.236 -45.868 -55.219  1.00 117.65 ? 230 ILE E CA  1 
ATOM   7264 C C   . ILE E 2 230 ? -101.632 -44.550 -54.540  1.00 118.20 ? 230 ILE E C   1 
ATOM   7265 O O   . ILE E 2 230 ? -101.874 -43.525 -55.193  1.00 118.27 ? 230 ILE E O   1 
ATOM   7266 C CB  . ILE E 2 230 ? -100.329 -45.604 -56.474  1.00 117.62 ? 230 ILE E CB  1 
ATOM   7267 C CG1 . ILE E 2 230 ? -99.839  -46.908 -57.109  1.00 117.66 ? 230 ILE E CG1 1 
ATOM   7268 C CG2 . ILE E 2 230 ? -99.108  -44.748 -56.092  1.00 117.57 ? 230 ILE E CG2 1 
ATOM   7269 C CD1 . ILE E 2 230 ? -99.193  -46.724 -58.490  1.00 117.12 ? 230 ILE E CD1 1 
ATOM   7270 N N   . VAL E 2 231 ? -101.724 -44.611 -53.217  1.00 118.83 ? 231 VAL E N   1 
ATOM   7271 C CA  . VAL E 2 231 ? -101.863 -43.430 -52.386  1.00 119.31 ? 231 VAL E CA  1 
ATOM   7272 C C   . VAL E 2 231 ? -100.539 -42.674 -52.387  1.00 119.70 ? 231 VAL E C   1 
ATOM   7273 O O   . VAL E 2 231 ? -99.467  -43.258 -52.543  1.00 119.65 ? 231 VAL E O   1 
ATOM   7274 C CB  . VAL E 2 231 ? -102.280 -43.808 -50.946  1.00 119.35 ? 231 VAL E CB  1 
ATOM   7275 C CG1 . VAL E 2 231 ? -101.380 -44.927 -50.384  1.00 119.45 ? 231 VAL E CG1 1 
ATOM   7276 C CG2 . VAL E 2 231 ? -102.293 -42.577 -50.024  1.00 119.55 ? 231 VAL E CG2 1 
ATOM   7277 N N   . LYS E 2 232 ? -100.633 -41.366 -52.226  1.00 120.29 ? 232 LYS E N   1 
ATOM   7278 C CA  . LYS E 2 232 ? -99.484  -40.501 -52.237  1.00 121.11 ? 232 LYS E CA  1 
ATOM   7279 C C   . LYS E 2 232 ? -100.007 -39.198 -51.663  1.00 121.81 ? 232 LYS E C   1 
ATOM   7280 O O   . LYS E 2 232 ? -100.648 -38.404 -52.352  1.00 121.89 ? 232 LYS E O   1 
ATOM   7281 C CB  . LYS E 2 232 ? -98.961  -40.341 -53.669  1.00 121.04 ? 232 LYS E CB  1 
ATOM   7282 C CG  . LYS E 2 232 ? -97.484  -40.012 -53.793  1.00 121.27 ? 232 LYS E CG  1 
ATOM   7283 C CD  . LYS E 2 232 ? -97.297  -38.522 -53.859  1.00 122.31 ? 232 LYS E CD  1 
ATOM   7284 C CE  . LYS E 2 232 ? -95.887  -38.132 -54.226  1.00 123.72 ? 232 LYS E CE  1 
ATOM   7285 N NZ  . LYS E 2 232 ? -95.754  -36.633 -54.306  1.00 124.53 ? 232 LYS E NZ  1 
ATOM   7286 N N   . SER E 2 233 ? -99.751  -39.001 -50.377  1.00 122.79 ? 233 SER E N   1 
ATOM   7287 C CA  . SER E 2 233 ? -100.395 -37.943 -49.614  1.00 123.75 ? 233 SER E CA  1 
ATOM   7288 C C   . SER E 2 233 ? -99.430  -36.885 -49.068  1.00 124.39 ? 233 SER E C   1 
ATOM   7289 O O   . SER E 2 233 ? -98.272  -37.177 -48.766  1.00 124.56 ? 233 SER E O   1 
ATOM   7290 C CB  . SER E 2 233 ? -101.170 -38.573 -48.458  1.00 123.76 ? 233 SER E CB  1 
ATOM   7291 O OG  . SER E 2 233 ? -101.929 -37.603 -47.767  1.00 123.93 ? 233 SER E OG  1 
ATOM   7292 N N   . PHE E 2 234 ? -99.932  -35.659 -48.940  1.00 125.13 ? 234 PHE E N   1 
ATOM   7293 C CA  . PHE E 2 234 ? -99.232  -34.586 -48.240  1.00 125.90 ? 234 PHE E CA  1 
ATOM   7294 C C   . PHE E 2 234 ? -100.211 -33.932 -47.247  1.00 126.60 ? 234 PHE E C   1 
ATOM   7295 O O   . PHE E 2 234 ? -101.428 -33.999 -47.440  1.00 126.77 ? 234 PHE E O   1 
ATOM   7296 C CB  . PHE E 2 234 ? -98.693  -33.563 -49.243  1.00 125.71 ? 234 PHE E CB  1 
ATOM   7297 C CG  . PHE E 2 234 ? -99.687  -32.503 -49.614  1.00 125.90 ? 234 PHE E CG  1 
ATOM   7298 C CD1 . PHE E 2 234 ? -99.589  -31.221 -49.075  1.00 126.00 ? 234 PHE E CD1 1 
ATOM   7299 C CD2 . PHE E 2 234 ? -100.737 -32.786 -50.478  1.00 125.85 ? 234 PHE E CD2 1 
ATOM   7300 C CE1 . PHE E 2 234 ? -100.514 -30.241 -49.395  1.00 125.20 ? 234 PHE E CE1 1 
ATOM   7301 C CE2 . PHE E 2 234 ? -101.663 -31.808 -50.806  1.00 125.74 ? 234 PHE E CE2 1 
ATOM   7302 C CZ  . PHE E 2 234 ? -101.552 -30.535 -50.261  1.00 125.43 ? 234 PHE E CZ  1 
ATOM   7303 N N   . ASN E 2 235 ? -99.695  -33.305 -46.191  1.00 127.38 ? 235 ASN E N   1 
ATOM   7304 C CA  . ASN E 2 235 ? -100.564 -32.702 -45.174  1.00 128.08 ? 235 ASN E CA  1 
ATOM   7305 C C   . ASN E 2 235 ? -100.091 -31.348 -44.696  1.00 128.45 ? 235 ASN E C   1 
ATOM   7306 O O   . ASN E 2 235 ? -98.906  -31.143 -44.465  1.00 128.33 ? 235 ASN E O   1 
ATOM   7307 C CB  . ASN E 2 235 ? -100.815 -33.653 -43.999  1.00 128.23 ? 235 ASN E CB  1 
ATOM   7308 C CG  . ASN E 2 235 ? -99.591  -34.460 -43.624  1.00 129.19 ? 235 ASN E CG  1 
ATOM   7309 O OD1 . ASN E 2 235 ? -98.560  -33.900 -43.243  1.00 131.01 ? 235 ASN E OD1 1 
ATOM   7310 N ND2 . ASN E 2 235 ? -99.696  -35.788 -43.725  1.00 128.95 ? 235 ASN E ND2 1 
ATOM   7311 N N   . ARG E 2 236 ? -101.057 -30.449 -44.528  1.00 129.39 ? 236 ARG E N   1 
ATOM   7312 C CA  . ARG E 2 236 ? -100.848 -28.995 -44.438  1.00 130.43 ? 236 ARG E CA  1 
ATOM   7313 C C   . ARG E 2 236 ? -99.637  -28.480 -43.644  1.00 131.42 ? 236 ARG E C   1 
ATOM   7314 O O   . ARG E 2 236 ? -98.667  -28.029 -44.253  1.00 131.43 ? 236 ARG E O   1 
ATOM   7315 C CB  . ARG E 2 236 ? -102.132 -28.292 -43.984  1.00 130.14 ? 236 ARG E CB  1 
ATOM   7316 C CG  . ARG E 2 236 ? -102.927 -27.659 -45.113  1.00 129.96 ? 236 ARG E CG  1 
ATOM   7317 C CD  . ARG E 2 236 ? -103.674 -26.426 -44.629  1.00 130.66 ? 236 ARG E CD  1 
ATOM   7318 N NE  . ARG E 2 236 ? -102.845 -25.622 -43.729  1.00 132.19 ? 236 ARG E NE  1 
ATOM   7319 C CZ  . ARG E 2 236 ? -102.003 -24.657 -44.105  1.00 132.96 ? 236 ARG E CZ  1 
ATOM   7320 N NH1 . ARG E 2 236 ? -101.868 -24.325 -45.384  1.00 133.20 ? 236 ARG E NH1 1 
ATOM   7321 N NH2 . ARG E 2 236 ? -101.292 -24.011 -43.190  1.00 133.26 ? 236 ARG E NH2 1 
ATOM   7322 N N   . ASN E 2 237 ? -99.706  -28.560 -42.309  1.00 132.76 ? 237 ASN E N   1 
ATOM   7323 C CA  . ASN E 2 237 ? -98.722  -27.964 -41.362  1.00 133.92 ? 237 ASN E CA  1 
ATOM   7324 C C   . ASN E 2 237 ? -97.660  -27.006 -41.923  1.00 135.02 ? 237 ASN E C   1 
ATOM   7325 O O   . ASN E 2 237 ? -97.783  -25.779 -41.787  1.00 134.96 ? 237 ASN E O   1 
ATOM   7326 C CB  . ASN E 2 237 ? -98.076  -29.030 -40.438  1.00 133.64 ? 237 ASN E CB  1 
ATOM   7327 C CG  . ASN E 2 237 ? -97.533  -30.255 -41.194  1.00 133.03 ? 237 ASN E CG  1 
ATOM   7328 O OD1 . ASN E 2 237 ? -98.059  -31.357 -41.048  1.00 132.59 ? 237 ASN E OD1 1 
ATOM   7329 N ND2 . ASN E 2 237 ? -96.471  -30.068 -41.975  1.00 131.49 ? 237 ASN E ND2 1 
ATOM   7330 N N   . GLU E 2 238 ? -96.637  -27.584 -42.558  1.00 136.42 ? 238 GLU E N   1 
ATOM   7331 C CA  . GLU E 2 238 ? -95.471  -26.862 -43.073  1.00 137.82 ? 238 GLU E CA  1 
ATOM   7332 C C   . GLU E 2 238 ? -95.792  -25.928 -44.264  1.00 138.57 ? 238 GLU E C   1 
ATOM   7333 O O   . GLU E 2 238 ? -95.100  -24.911 -44.465  1.00 138.77 ? 238 GLU E O   1 
ATOM   7334 C CB  . GLU E 2 238 ? -94.344  -27.864 -43.420  1.00 137.88 ? 238 GLU E CB  1 
ATOM   7335 C CG  . GLU E 2 238 ? -92.927  -27.272 -43.592  1.00 138.62 ? 238 GLU E CG  1 
ATOM   7336 C CD  . GLU E 2 238 ? -92.429  -26.488 -42.366  1.00 139.23 ? 238 GLU E CD  1 
ATOM   7337 O OE1 . GLU E 2 238 ? -92.984  -25.400 -42.074  1.00 139.07 ? 238 GLU E OE1 1 
ATOM   7338 O OE2 . GLU E 2 238 ? -91.466  -26.953 -41.708  1.00 139.07 ? 238 GLU E OE2 1 
ATOM   7339 N N   . CYS E 2 239 ? -96.840  -26.274 -45.028  1.00 139.33 ? 239 CYS E N   1 
ATOM   7340 C CA  . CYS E 2 239 ? -97.290  -25.500 -46.209  1.00 139.91 ? 239 CYS E CA  1 
ATOM   7341 C C   . CYS E 2 239 ? -98.726  -24.972 -46.071  1.00 140.01 ? 239 CYS E C   1 
ATOM   7342 O O   . CYS E 2 239 ? -99.663  -25.558 -46.625  1.00 140.12 ? 239 CYS E O   1 
ATOM   7343 C CB  . CYS E 2 239 ? -97.180  -26.338 -47.492  1.00 139.87 ? 239 CYS E CB  1 
ATOM   7344 S SG  . CYS E 2 239 ? -95.540  -27.048 -47.816  1.00 141.11 ? 239 CYS E SG  1 
ATOM   7345 O OXT . CYS E 2 239 ? -98.991  -23.953 -45.419  1.00 140.07 ? 239 CYS E OXT 1 
ATOM   7346 N N   . GLU F 3 1   ? -98.629  -30.138 -104.222 1.00 122.41 ? 1   GLU F N   1 
ATOM   7347 C CA  . GLU F 3 1   ? -99.138  -29.607 -105.513 1.00 122.61 ? 1   GLU F CA  1 
ATOM   7348 C C   . GLU F 3 1   ? -100.469 -28.837 -105.346 1.00 122.75 ? 1   GLU F C   1 
ATOM   7349 O O   . GLU F 3 1   ? -100.469 -27.601 -105.280 1.00 122.81 ? 1   GLU F O   1 
ATOM   7350 C CB  . GLU F 3 1   ? -99.256  -30.753 -106.526 1.00 122.69 ? 1   GLU F CB  1 
ATOM   7351 C CG  . GLU F 3 1   ? -99.522  -30.339 -107.979 1.00 122.81 ? 1   GLU F CG  1 
ATOM   7352 C CD  . GLU F 3 1   ? -101.004 -30.319 -108.344 1.00 122.49 ? 1   GLU F CD  1 
ATOM   7353 O OE1 . GLU F 3 1   ? -101.700 -31.344 -108.149 1.00 121.53 ? 1   GLU F OE1 1 
ATOM   7354 O OE2 . GLU F 3 1   ? -101.464 -29.268 -108.838 1.00 122.59 ? 1   GLU F OE2 1 
ATOM   7355 N N   . VAL F 3 2   ? -101.586 -29.570 -105.266 1.00 122.78 ? 2   VAL F N   1 
ATOM   7356 C CA  . VAL F 3 2   ? -102.942 -28.983 -105.262 1.00 122.60 ? 2   VAL F CA  1 
ATOM   7357 C C   . VAL F 3 2   ? -103.349 -28.511 -103.859 1.00 122.55 ? 2   VAL F C   1 
ATOM   7358 O O   . VAL F 3 2   ? -103.397 -29.311 -102.927 1.00 122.67 ? 2   VAL F O   1 
ATOM   7359 C CB  . VAL F 3 2   ? -103.990 -29.963 -105.902 1.00 122.49 ? 2   VAL F CB  1 
ATOM   7360 C CG1 . VAL F 3 2   ? -103.712 -31.398 -105.506 1.00 122.12 ? 2   VAL F CG1 1 
ATOM   7361 C CG2 . VAL F 3 2   ? -105.420 -29.566 -105.563 1.00 122.53 ? 2   VAL F CG2 1 
ATOM   7362 N N   . GLN F 3 3   ? -103.642 -27.218 -103.713 1.00 122.48 ? 3   GLN F N   1 
ATOM   7363 C CA  . GLN F 3 3   ? -103.738 -26.617 -102.374 1.00 122.61 ? 3   GLN F CA  1 
ATOM   7364 C C   . GLN F 3 3   ? -104.848 -25.602 -102.050 1.00 122.61 ? 3   GLN F C   1 
ATOM   7365 O O   . GLN F 3 3   ? -105.199 -24.746 -102.867 1.00 122.68 ? 3   GLN F O   1 
ATOM   7366 C CB  . GLN F 3 3   ? -102.390 -26.031 -101.974 1.00 122.60 ? 3   GLN F CB  1 
ATOM   7367 C CG  . GLN F 3 3   ? -101.547 -26.996 -101.182 1.00 122.83 ? 3   GLN F CG  1 
ATOM   7368 C CD  . GLN F 3 3   ? -100.509 -26.287 -100.355 1.00 123.35 ? 3   GLN F CD  1 
ATOM   7369 O OE1 . GLN F 3 3   ? -100.712 -25.144 -99.924  1.00 123.08 ? 3   GLN F OE1 1 
ATOM   7370 N NE2 . GLN F 3 3   ? -99.378  -26.955 -100.127 1.00 123.44 ? 3   GLN F NE2 1 
ATOM   7371 N N   . LEU F 3 4   ? -105.360 -25.708 -100.818 1.00 122.47 ? 4   LEU F N   1 
ATOM   7372 C CA  . LEU F 3 4   ? -106.323 -24.764 -100.231 1.00 122.11 ? 4   LEU F CA  1 
ATOM   7373 C C   . LEU F 3 4   ? -105.762 -24.172 -98.928  1.00 121.89 ? 4   LEU F C   1 
ATOM   7374 O O   . LEU F 3 4   ? -105.123 -24.869 -98.132  1.00 121.79 ? 4   LEU F O   1 
ATOM   7375 C CB  . LEU F 3 4   ? -107.652 -25.461 -99.934  1.00 122.02 ? 4   LEU F CB  1 
ATOM   7376 C CG  . LEU F 3 4   ? -108.265 -26.417 -100.956 1.00 121.83 ? 4   LEU F CG  1 
ATOM   7377 C CD1 . LEU F 3 4   ? -108.746 -27.671 -100.255 1.00 122.04 ? 4   LEU F CD1 1 
ATOM   7378 C CD2 . LEU F 3 4   ? -109.395 -25.760 -101.727 1.00 121.53 ? 4   LEU F CD2 1 
ATOM   7379 N N   . VAL F 3 5   ? -106.000 -22.886 -98.707  1.00 121.58 ? 5   VAL F N   1 
ATOM   7380 C CA  . VAL F 3 5   ? -105.486 -22.228 -97.515  1.00 121.46 ? 5   VAL F CA  1 
ATOM   7381 C C   . VAL F 3 5   ? -106.588 -21.383 -96.897  1.00 121.34 ? 5   VAL F C   1 
ATOM   7382 O O   . VAL F 3 5   ? -106.689 -20.178 -97.173  1.00 121.36 ? 5   VAL F O   1 
ATOM   7383 C CB  . VAL F 3 5   ? -104.259 -21.321 -97.819  1.00 121.59 ? 5   VAL F CB  1 
ATOM   7384 C CG1 . VAL F 3 5   ? -103.523 -20.972 -96.524  1.00 121.85 ? 5   VAL F CG1 1 
ATOM   7385 C CG2 . VAL F 3 5   ? -103.302 -21.973 -98.826  1.00 121.53 ? 5   VAL F CG2 1 
ATOM   7386 N N   . GLU F 3 6   ? -107.424 -22.018 -96.076  1.00 121.05 ? 6   GLU F N   1 
ATOM   7387 C CA  . GLU F 3 6   ? -108.502 -21.305 -95.384  1.00 120.71 ? 6   GLU F CA  1 
ATOM   7388 C C   . GLU F 3 6   ? -107.954 -20.514 -94.196  1.00 120.40 ? 6   GLU F C   1 
ATOM   7389 O O   . GLU F 3 6   ? -106.978 -20.934 -93.568  1.00 120.47 ? 6   GLU F O   1 
ATOM   7390 C CB  . GLU F 3 6   ? -109.643 -22.241 -94.967  1.00 120.67 ? 6   GLU F CB  1 
ATOM   7391 C CG  . GLU F 3 6   ? -109.249 -23.376 -94.025  1.00 120.92 ? 6   GLU F CG  1 
ATOM   7392 C CD  . GLU F 3 6   ? -109.134 -24.732 -94.713  1.00 121.17 ? 6   GLU F CD  1 
ATOM   7393 O OE1 . GLU F 3 6   ? -108.997 -25.750 -94.001  1.00 120.98 ? 6   GLU F OE1 1 
ATOM   7394 O OE2 . GLU F 3 6   ? -109.193 -24.793 -95.959  1.00 120.85 ? 6   GLU F OE2 1 
ATOM   7395 N N   . SER F 3 7   ? -108.571 -19.365 -93.908  1.00 119.91 ? 7   SER F N   1 
ATOM   7396 C CA  . SER F 3 7   ? -108.035 -18.427 -92.912  1.00 119.39 ? 7   SER F CA  1 
ATOM   7397 C C   . SER F 3 7   ? -108.983 -17.292 -92.517  1.00 118.98 ? 7   SER F C   1 
ATOM   7398 O O   . SER F 3 7   ? -110.081 -17.158 -93.063  1.00 118.73 ? 7   SER F O   1 
ATOM   7399 C CB  . SER F 3 7   ? -106.681 -17.857 -93.375  1.00 119.52 ? 7   SER F CB  1 
ATOM   7400 O OG  . SER F 3 7   ? -106.608 -17.742 -94.788  1.00 119.25 ? 7   SER F OG  1 
ATOM   7401 N N   . GLY F 3 8   ? -108.531 -16.484 -91.559  1.00 118.56 ? 8   GLY F N   1 
ATOM   7402 C CA  . GLY F 3 8   ? -109.302 -15.366 -91.035  1.00 118.32 ? 8   GLY F CA  1 
ATOM   7403 C C   . GLY F 3 8   ? -110.482 -15.801 -90.184  1.00 118.05 ? 8   GLY F C   1 
ATOM   7404 O O   . GLY F 3 8   ? -111.568 -16.020 -90.710  1.00 117.92 ? 8   GLY F O   1 
ATOM   7405 N N   . GLY F 3 9   ? -110.264 -15.915 -88.870  1.00 117.99 ? 9   GLY F N   1 
ATOM   7406 C CA  . GLY F 3 9   ? -111.308 -16.312 -87.908  1.00 117.68 ? 9   GLY F CA  1 
ATOM   7407 C C   . GLY F 3 9   ? -110.818 -16.521 -86.482  1.00 117.53 ? 9   GLY F C   1 
ATOM   7408 O O   . GLY F 3 9   ? -109.700 -16.999 -86.259  1.00 117.65 ? 9   GLY F O   1 
ATOM   7409 N N   . GLY F 3 10  ? -111.663 -16.172 -85.515  1.00 117.39 ? 10  GLY F N   1 
ATOM   7410 C CA  . GLY F 3 10  ? -111.329 -16.272 -84.083  1.00 117.46 ? 10  GLY F CA  1 
ATOM   7411 C C   . GLY F 3 10  ? -112.538 -15.919 -83.227  1.00 117.56 ? 10  GLY F C   1 
ATOM   7412 O O   . GLY F 3 10  ? -113.676 -16.129 -83.656  1.00 117.83 ? 10  GLY F O   1 
ATOM   7413 N N   . LEU F 3 11  ? -112.309 -15.369 -82.032  1.00 117.33 ? 11  LEU F N   1 
ATOM   7414 C CA  . LEU F 3 11  ? -113.406 -14.998 -81.119  1.00 117.05 ? 11  LEU F CA  1 
ATOM   7415 C C   . LEU F 3 11  ? -114.482 -14.108 -81.750  1.00 116.79 ? 11  LEU F C   1 
ATOM   7416 O O   . LEU F 3 11  ? -114.203 -13.285 -82.623  1.00 116.62 ? 11  LEU F O   1 
ATOM   7417 C CB  . LEU F 3 11  ? -112.862 -14.314 -79.860  1.00 117.23 ? 11  LEU F CB  1 
ATOM   7418 C CG  . LEU F 3 11  ? -113.870 -13.525 -79.002  1.00 117.95 ? 11  LEU F CG  1 
ATOM   7419 C CD1 . LEU F 3 11  ? -114.613 -14.428 -78.015  1.00 118.31 ? 11  LEU F CD1 1 
ATOM   7420 C CD2 . LEU F 3 11  ? -113.217 -12.346 -78.274  1.00 119.01 ? 11  LEU F CD2 1 
ATOM   7421 N N   . VAL F 3 12  ? -115.717 -14.293 -81.286  1.00 116.65 ? 12  VAL F N   1 
ATOM   7422 C CA  . VAL F 3 12  ? -116.843 -13.408 -81.615  1.00 116.36 ? 12  VAL F CA  1 
ATOM   7423 C C   . VAL F 3 12  ? -117.922 -13.486 -80.523  1.00 115.90 ? 12  VAL F C   1 
ATOM   7424 O O   . VAL F 3 12  ? -117.963 -14.442 -79.751  1.00 116.05 ? 12  VAL F O   1 
ATOM   7425 C CB  . VAL F 3 12  ? -117.447 -13.739 -83.012  1.00 116.42 ? 12  VAL F CB  1 
ATOM   7426 C CG1 . VAL F 3 12  ? -118.217 -15.061 -82.979  1.00 116.71 ? 12  VAL F CG1 1 
ATOM   7427 C CG2 . VAL F 3 12  ? -118.336 -12.607 -83.507  1.00 116.65 ? 12  VAL F CG2 1 
ATOM   7428 N N   . LYS F 3 13  ? -118.774 -12.470 -80.455  1.00 115.29 ? 13  LYS F N   1 
ATOM   7429 C CA  . LYS F 3 13  ? -119.957 -12.509 -79.610  1.00 114.74 ? 13  LYS F CA  1 
ATOM   7430 C C   . LYS F 3 13  ? -121.089 -13.231 -80.336  1.00 114.26 ? 13  LYS F C   1 
ATOM   7431 O O   . LYS F 3 13  ? -121.222 -13.104 -81.553  1.00 113.99 ? 13  LYS F O   1 
ATOM   7432 C CB  . LYS F 3 13  ? -120.384 -11.086 -79.230  1.00 114.93 ? 13  LYS F CB  1 
ATOM   7433 C CG  . LYS F 3 13  ? -121.897 -10.838 -79.221  1.00 115.07 ? 13  LYS F CG  1 
ATOM   7434 C CD  . LYS F 3 13  ? -122.225 -9.545  -79.953  1.00 115.36 ? 13  LYS F CD  1 
ATOM   7435 C CE  . LYS F 3 13  ? -123.479 -9.680  -80.812  1.00 115.36 ? 13  LYS F CE  1 
ATOM   7436 N NZ  . LYS F 3 13  ? -123.470 -8.737  -81.974  1.00 115.08 ? 13  LYS F NZ  1 
ATOM   7437 N N   . PRO F 3 14  ? -121.892 -14.008 -79.587  1.00 114.01 ? 14  PRO F N   1 
ATOM   7438 C CA  . PRO F 3 14  ? -123.155 -14.573 -80.051  1.00 113.81 ? 14  PRO F CA  1 
ATOM   7439 C C   . PRO F 3 14  ? -124.036 -13.510 -80.671  1.00 113.63 ? 14  PRO F C   1 
ATOM   7440 O O   . PRO F 3 14  ? -124.662 -12.729 -79.955  1.00 113.51 ? 14  PRO F O   1 
ATOM   7441 C CB  . PRO F 3 14  ? -123.792 -15.087 -78.764  1.00 113.80 ? 14  PRO F CB  1 
ATOM   7442 C CG  . PRO F 3 14  ? -122.624 -15.507 -77.940  1.00 114.18 ? 14  PRO F CG  1 
ATOM   7443 C CD  . PRO F 3 14  ? -121.511 -14.541 -78.266  1.00 114.08 ? 14  PRO F CD  1 
ATOM   7444 N N   . GLY F 3 15  ? -124.063 -13.494 -82.002  1.00 113.65 ? 15  GLY F N   1 
ATOM   7445 C CA  . GLY F 3 15  ? -124.813 -12.508 -82.785  1.00 113.42 ? 15  GLY F CA  1 
ATOM   7446 C C   . GLY F 3 15  ? -123.949 -11.860 -83.854  1.00 113.29 ? 15  GLY F C   1 
ATOM   7447 O O   . GLY F 3 15  ? -124.460 -11.415 -84.883  1.00 113.09 ? 15  GLY F O   1 
ATOM   7448 N N   . GLY F 3 16  ? -122.638 -11.828 -83.603  1.00 113.25 ? 16  GLY F N   1 
ATOM   7449 C CA  . GLY F 3 16  ? -121.660 -11.174 -84.478  1.00 113.24 ? 16  GLY F CA  1 
ATOM   7450 C C   . GLY F 3 16  ? -121.480 -11.831 -85.836  1.00 113.23 ? 16  GLY F C   1 
ATOM   7451 O O   . GLY F 3 16  ? -122.315 -12.642 -86.254  1.00 113.35 ? 16  GLY F O   1 
ATOM   7452 N N   . SER F 3 17  ? -120.394 -11.475 -86.529  1.00 112.99 ? 17  SER F N   1 
ATOM   7453 C CA  . SER F 3 17  ? -120.147 -11.971 -87.888  1.00 112.88 ? 17  SER F CA  1 
ATOM   7454 C C   . SER F 3 17  ? -118.686 -12.239 -88.173  1.00 112.79 ? 17  SER F C   1 
ATOM   7455 O O   . SER F 3 17  ? -117.830 -11.825 -87.409  1.00 112.65 ? 17  SER F O   1 
ATOM   7456 C CB  . SER F 3 17  ? -120.726 -11.025 -88.942  1.00 112.93 ? 17  SER F CB  1 
ATOM   7457 O OG  . SER F 3 17  ? -122.073 -11.364 -89.216  1.00 112.88 ? 17  SER F OG  1 
ATOM   7458 N N   . LEU F 3 18  ? -118.421 -12.921 -89.290  1.00 112.95 ? 18  LEU F N   1 
ATOM   7459 C CA  . LEU F 3 18  ? -117.079 -13.383 -89.667  1.00 113.12 ? 18  LEU F CA  1 
ATOM   7460 C C   . LEU F 3 18  ? -117.049 -13.912 -91.113  1.00 113.39 ? 18  LEU F C   1 
ATOM   7461 O O   . LEU F 3 18  ? -117.765 -14.870 -91.454  1.00 113.57 ? 18  LEU F O   1 
ATOM   7462 C CB  . LEU F 3 18  ? -116.617 -14.482 -88.708  1.00 112.97 ? 18  LEU F CB  1 
ATOM   7463 C CG  . LEU F 3 18  ? -115.166 -14.943 -88.783  1.00 112.79 ? 18  LEU F CG  1 
ATOM   7464 C CD1 . LEU F 3 18  ? -114.227 -13.919 -88.154  1.00 112.68 ? 18  LEU F CD1 1 
ATOM   7465 C CD2 . LEU F 3 18  ? -115.054 -16.275 -88.082  1.00 112.80 ? 18  LEU F CD2 1 
ATOM   7466 N N   . LYS F 3 19  ? -116.218 -13.302 -91.959  1.00 113.45 ? 19  LYS F N   1 
ATOM   7467 C CA  . LYS F 3 19  ? -116.194 -13.672 -93.375  1.00 113.46 ? 19  LYS F CA  1 
ATOM   7468 C C   . LYS F 3 19  ? -115.012 -14.562 -93.712  1.00 113.24 ? 19  LYS F C   1 
ATOM   7469 O O   . LYS F 3 19  ? -114.010 -14.108 -94.258  1.00 112.84 ? 19  LYS F O   1 
ATOM   7470 C CB  . LYS F 3 19  ? -116.252 -12.447 -94.298  1.00 113.66 ? 19  LYS F CB  1 
ATOM   7471 C CG  . LYS F 3 19  ? -116.782 -12.802 -95.681  1.00 114.51 ? 19  LYS F CG  1 
ATOM   7472 C CD  . LYS F 3 19  ? -116.757 -11.661 -96.684  1.00 115.51 ? 19  LYS F CD  1 
ATOM   7473 C CE  . LYS F 3 19  ? -117.071 -12.223 -98.079  1.00 116.17 ? 19  LYS F CE  1 
ATOM   7474 N NZ  . LYS F 3 19  ? -116.480 -11.437 -99.199  1.00 116.61 ? 19  LYS F NZ  1 
ATOM   7475 N N   . LEU F 3 20  ? -115.163 -15.840 -93.381  1.00 113.54 ? 20  LEU F N   1 
ATOM   7476 C CA  . LEU F 3 20  ? -114.127 -16.850 -93.591  1.00 113.78 ? 20  LEU F CA  1 
ATOM   7477 C C   . LEU F 3 20  ? -113.808 -17.073 -95.063  1.00 114.29 ? 20  LEU F C   1 
ATOM   7478 O O   . LEU F 3 20  ? -114.691 -16.958 -95.921  1.00 114.57 ? 20  LEU F O   1 
ATOM   7479 C CB  . LEU F 3 20  ? -114.518 -18.163 -92.915  1.00 113.39 ? 20  LEU F CB  1 
ATOM   7480 C CG  . LEU F 3 20  ? -113.943 -18.250 -91.507  1.00 112.60 ? 20  LEU F CG  1 
ATOM   7481 C CD1 . LEU F 3 20  ? -114.871 -18.986 -90.594  1.00 112.29 ? 20  LEU F CD1 1 
ATOM   7482 C CD2 . LEU F 3 20  ? -112.586 -18.911 -91.545  1.00 112.30 ? 20  LEU F CD2 1 
ATOM   7483 N N   . SER F 3 21  ? -112.539 -17.393 -95.336  1.00 114.61 ? 21  SER F N   1 
ATOM   7484 C CA  . SER F 3 21  ? -112.008 -17.473 -96.700  1.00 114.66 ? 21  SER F CA  1 
ATOM   7485 C C   . SER F 3 21  ? -110.965 -18.582 -96.874  1.00 114.68 ? 21  SER F C   1 
ATOM   7486 O O   . SER F 3 21  ? -110.262 -18.938 -95.934  1.00 114.50 ? 21  SER F O   1 
ATOM   7487 C CB  . SER F 3 21  ? -111.425 -16.115 -97.113  1.00 114.78 ? 21  SER F CB  1 
ATOM   7488 O OG  . SER F 3 21  ? -110.836 -15.445 -96.003  1.00 114.71 ? 21  SER F OG  1 
ATOM   7489 N N   . CYS F 3 22  ? -110.878 -19.102 -98.096  1.00 114.97 ? 22  CYS F N   1 
ATOM   7490 C CA  . CYS F 3 22  ? -110.012 -20.227 -98.448  1.00 115.29 ? 22  CYS F CA  1 
ATOM   7491 C C   . CYS F 3 22  ? -109.334 -20.001 -99.806  1.00 115.62 ? 22  CYS F C   1 
ATOM   7492 O O   . CYS F 3 22  ? -110.017 -19.946 -100.836 1.00 115.58 ? 22  CYS F O   1 
ATOM   7493 C CB  . CYS F 3 22  ? -110.843 -21.512 -98.482  1.00 115.17 ? 22  CYS F CB  1 
ATOM   7494 S SG  . CYS F 3 22  ? -110.149 -22.866 -99.466  1.00 115.34 ? 22  CYS F SG  1 
ATOM   7495 N N   . ALA F 3 23  ? -108.001 -19.877 -99.808  1.00 116.05 ? 23  ALA F N   1 
ATOM   7496 C CA  . ALA F 3 23  ? -107.228 -19.643 -101.047 1.00 116.29 ? 23  ALA F CA  1 
ATOM   7497 C C   . ALA F 3 23  ? -106.854 -20.943 -101.761 1.00 116.39 ? 23  ALA F C   1 
ATOM   7498 O O   . ALA F 3 23  ? -106.134 -21.780 -101.226 1.00 116.40 ? 23  ALA F O   1 
ATOM   7499 C CB  . ALA F 3 23  ? -105.981 -18.800 -100.767 1.00 116.17 ? 23  ALA F CB  1 
ATOM   7500 N N   . ALA F 3 24  ? -107.355 -21.107 -102.974 1.00 116.69 ? 24  ALA F N   1 
ATOM   7501 C CA  . ALA F 3 24  ? -107.106 -22.324 -103.729 1.00 117.16 ? 24  ALA F CA  1 
ATOM   7502 C C   . ALA F 3 24  ? -105.916 -22.132 -104.659 1.00 117.55 ? 24  ALA F C   1 
ATOM   7503 O O   . ALA F 3 24  ? -105.974 -21.344 -105.611 1.00 117.69 ? 24  ALA F O   1 
ATOM   7504 C CB  . ALA F 3 24  ? -108.338 -22.713 -104.512 1.00 117.25 ? 24  ALA F CB  1 
ATOM   7505 N N   . SER F 3 25  ? -104.838 -22.857 -104.389 1.00 117.76 ? 25  SER F N   1 
ATOM   7506 C CA  . SER F 3 25  ? -103.595 -22.627 -105.098 1.00 117.97 ? 25  SER F CA  1 
ATOM   7507 C C   . SER F 3 25  ? -102.990 -23.911 -105.667 1.00 118.03 ? 25  SER F C   1 
ATOM   7508 O O   . SER F 3 25  ? -102.137 -24.546 -105.028 1.00 118.07 ? 25  SER F O   1 
ATOM   7509 C CB  . SER F 3 25  ? -102.609 -21.913 -104.171 1.00 118.07 ? 25  SER F CB  1 
ATOM   7510 O OG  . SER F 3 25  ? -101.647 -21.175 -104.910 1.00 119.00 ? 25  SER F OG  1 
ATOM   7511 N N   . GLY F 3 26  ? -103.440 -24.287 -106.865 1.00 118.05 ? 26  GLY F N   1 
ATOM   7512 C CA  . GLY F 3 26  ? -102.844 -25.403 -107.604 1.00 118.12 ? 26  GLY F CA  1 
ATOM   7513 C C   . GLY F 3 26  ? -103.800 -26.271 -108.400 1.00 118.18 ? 26  GLY F C   1 
ATOM   7514 O O   . GLY F 3 26  ? -103.415 -27.325 -108.903 1.00 117.97 ? 26  GLY F O   1 
ATOM   7515 N N   . PHE F 3 27  ? -105.052 -25.842 -108.515 1.00 118.47 ? 27  PHE F N   1 
ATOM   7516 C CA  . PHE F 3 27  ? -106.033 -26.601 -109.295 1.00 118.77 ? 27  PHE F CA  1 
ATOM   7517 C C   . PHE F 3 27  ? -106.954 -25.688 -110.124 1.00 118.75 ? 27  PHE F C   1 
ATOM   7518 O O   . PHE F 3 27  ? -107.048 -24.478 -109.857 1.00 118.46 ? 27  PHE F O   1 
ATOM   7519 C CB  . PHE F 3 27  ? -106.807 -27.611 -108.402 1.00 119.12 ? 27  PHE F CB  1 
ATOM   7520 C CG  . PHE F 3 27  ? -107.959 -27.014 -107.621 1.00 119.17 ? 27  PHE F CG  1 
ATOM   7521 C CD1 . PHE F 3 27  ? -109.276 -27.270 -108.001 1.00 119.31 ? 27  PHE F CD1 1 
ATOM   7522 C CD2 . PHE F 3 27  ? -107.728 -26.208 -106.510 1.00 119.12 ? 27  PHE F CD2 1 
ATOM   7523 C CE1 . PHE F 3 27  ? -110.339 -26.722 -107.299 1.00 119.56 ? 27  PHE F CE1 1 
ATOM   7524 C CE2 . PHE F 3 27  ? -108.788 -25.658 -105.802 1.00 119.19 ? 27  PHE F CE2 1 
ATOM   7525 C CZ  . PHE F 3 27  ? -110.095 -25.911 -106.194 1.00 119.32 ? 27  PHE F CZ  1 
ATOM   7526 N N   . ALA F 3 28  ? -107.614 -26.279 -111.127 1.00 118.86 ? 28  ALA F N   1 
ATOM   7527 C CA  . ALA F 3 28  ? -108.430 -25.537 -112.108 1.00 119.04 ? 28  ALA F CA  1 
ATOM   7528 C C   . ALA F 3 28  ? -109.704 -24.900 -111.528 1.00 119.15 ? 28  ALA F C   1 
ATOM   7529 O O   . ALA F 3 28  ? -110.668 -24.634 -112.261 1.00 118.91 ? 28  ALA F O   1 
ATOM   7530 C CB  . ALA F 3 28  ? -108.759 -26.422 -113.304 1.00 118.96 ? 28  ALA F CB  1 
ATOM   7531 N N   . PHE F 3 29  ? -109.675 -24.674 -110.209 1.00 119.24 ? 29  PHE F N   1 
ATOM   7532 C CA  . PHE F 3 29  ? -110.696 -23.955 -109.439 1.00 119.19 ? 29  PHE F CA  1 
ATOM   7533 C C   . PHE F 3 29  ? -112.099 -24.081 -110.027 1.00 119.31 ? 29  PHE F C   1 
ATOM   7534 O O   . PHE F 3 29  ? -112.851 -24.996 -109.668 1.00 119.41 ? 29  PHE F O   1 
ATOM   7535 C CB  . PHE F 3 29  ? -110.289 -22.487 -109.265 1.00 119.08 ? 29  PHE F CB  1 
ATOM   7536 C CG  . PHE F 3 29  ? -111.064 -21.764 -108.206 1.00 118.90 ? 29  PHE F CG  1 
ATOM   7537 C CD1 . PHE F 3 29  ? -110.803 -21.996 -106.857 1.00 119.15 ? 29  PHE F CD1 1 
ATOM   7538 C CD2 . PHE F 3 29  ? -112.047 -20.848 -108.552 1.00 118.47 ? 29  PHE F CD2 1 
ATOM   7539 C CE1 . PHE F 3 29  ? -111.515 -21.329 -105.862 1.00 119.11 ? 29  PHE F CE1 1 
ATOM   7540 C CE2 . PHE F 3 29  ? -112.764 -20.177 -107.572 1.00 118.90 ? 29  PHE F CE2 1 
ATOM   7541 C CZ  . PHE F 3 29  ? -112.499 -20.417 -106.221 1.00 119.15 ? 29  PHE F CZ  1 
ATOM   7542 N N   . SER F 3 30  ? -112.429 -23.168 -110.941 1.00 119.33 ? 30  SER F N   1 
ATOM   7543 C CA  . SER F 3 30  ? -113.692 -23.189 -111.686 1.00 119.24 ? 30  SER F CA  1 
ATOM   7544 C C   . SER F 3 30  ? -114.057 -24.594 -112.166 1.00 119.04 ? 30  SER F C   1 
ATOM   7545 O O   . SER F 3 30  ? -115.216 -24.873 -112.467 1.00 118.91 ? 30  SER F O   1 
ATOM   7546 C CB  . SER F 3 30  ? -113.637 -22.196 -112.853 1.00 119.23 ? 30  SER F CB  1 
ATOM   7547 O OG  . SER F 3 30  ? -112.316 -21.697 -113.038 1.00 119.22 ? 30  SER F OG  1 
ATOM   7548 N N   . SER F 3 31  ? -113.050 -25.463 -112.208 1.00 118.92 ? 31  SER F N   1 
ATOM   7549 C CA  . SER F 3 31  ? -113.209 -26.878 -112.511 1.00 119.17 ? 31  SER F CA  1 
ATOM   7550 C C   . SER F 3 31  ? -114.366 -27.541 -111.757 1.00 119.22 ? 31  SER F C   1 
ATOM   7551 O O   . SER F 3 31  ? -115.392 -27.869 -112.364 1.00 119.43 ? 31  SER F O   1 
ATOM   7552 C CB  . SER F 3 31  ? -111.903 -27.622 -112.210 1.00 119.30 ? 31  SER F CB  1 
ATOM   7553 O OG  . SER F 3 31  ? -111.396 -27.265 -110.930 1.00 119.32 ? 31  SER F OG  1 
ATOM   7554 N N   . TYR F 3 32  ? -114.194 -27.729 -110.445 1.00 119.04 ? 32  TYR F N   1 
ATOM   7555 C CA  . TYR F 3 32  ? -115.153 -28.473 -109.614 1.00 118.64 ? 32  TYR F CA  1 
ATOM   7556 C C   . TYR F 3 32  ? -115.994 -27.563 -108.711 1.00 118.04 ? 32  TYR F C   1 
ATOM   7557 O O   . TYR F 3 32  ? -115.776 -26.342 -108.640 1.00 117.84 ? 32  TYR F O   1 
ATOM   7558 C CB  . TYR F 3 32  ? -114.434 -29.491 -108.714 1.00 118.97 ? 32  TYR F CB  1 
ATOM   7559 C CG  . TYR F 3 32  ? -113.398 -30.380 -109.373 1.00 119.94 ? 32  TYR F CG  1 
ATOM   7560 C CD1 . TYR F 3 32  ? -112.033 -30.057 -109.326 1.00 120.65 ? 32  TYR F CD1 1 
ATOM   7561 C CD2 . TYR F 3 32  ? -113.775 -31.567 -110.002 1.00 121.00 ? 32  TYR F CD2 1 
ATOM   7562 C CE1 . TYR F 3 32  ? -111.076 -30.887 -109.917 1.00 121.09 ? 32  TYR F CE1 1 
ATOM   7563 C CE2 . TYR F 3 32  ? -112.830 -32.397 -110.598 1.00 121.52 ? 32  TYR F CE2 1 
ATOM   7564 C CZ  . TYR F 3 32  ? -111.489 -32.054 -110.550 1.00 121.54 ? 32  TYR F CZ  1 
ATOM   7565 O OH  . TYR F 3 32  ? -110.578 -32.890 -111.144 1.00 121.85 ? 32  TYR F OH  1 
ATOM   7566 N N   . ASP F 3 33  ? -116.942 -28.189 -108.013 1.00 117.20 ? 33  ASP F N   1 
ATOM   7567 C CA  . ASP F 3 33  ? -117.750 -27.528 -106.994 1.00 116.39 ? 33  ASP F CA  1 
ATOM   7568 C C   . ASP F 3 33  ? -116.886 -27.317 -105.745 1.00 115.76 ? 33  ASP F C   1 
ATOM   7569 O O   . ASP F 3 33  ? -115.728 -27.737 -105.711 1.00 115.67 ? 33  ASP F O   1 
ATOM   7570 C CB  . ASP F 3 33  ? -118.980 -28.382 -106.638 1.00 116.48 ? 33  ASP F CB  1 
ATOM   7571 C CG  . ASP F 3 33  ? -119.801 -28.842 -107.867 1.00 116.83 ? 33  ASP F CG  1 
ATOM   7572 O OD1 . ASP F 3 33  ? -119.919 -28.098 -108.869 1.00 117.54 ? 33  ASP F OD1 1 
ATOM   7573 O OD2 . ASP F 3 33  ? -120.366 -29.961 -107.810 1.00 116.07 ? 33  ASP F OD2 1 
ATOM   7574 N N   . MET F 3 34  ? -117.446 -26.675 -104.719 1.00 114.99 ? 34  MET F N   1 
ATOM   7575 C CA  . MET F 3 34  ? -116.735 -26.469 -103.438 1.00 114.27 ? 34  MET F CA  1 
ATOM   7576 C C   . MET F 3 34  ? -117.601 -26.666 -102.171 1.00 113.35 ? 34  MET F C   1 
ATOM   7577 O O   . MET F 3 34  ? -118.826 -26.841 -102.265 1.00 113.32 ? 34  MET F O   1 
ATOM   7578 C CB  . MET F 3 34  ? -116.063 -25.092 -103.403 1.00 114.47 ? 34  MET F CB  1 
ATOM   7579 C CG  . MET F 3 34  ? -114.848 -24.965 -104.289 1.00 115.35 ? 34  MET F CG  1 
ATOM   7580 S SD  . MET F 3 34  ? -113.603 -26.192 -103.879 1.00 118.05 ? 34  MET F SD  1 
ATOM   7581 C CE  . MET F 3 34  ? -113.123 -25.670 -102.222 1.00 117.01 ? 34  MET F CE  1 
ATOM   7582 N N   . SER F 3 35  ? -116.956 -26.631 -100.996 1.00 111.85 ? 35  SER F N   1 
ATOM   7583 C CA  . SER F 3 35  ? -117.639 -26.865 -99.724  1.00 110.14 ? 35  SER F CA  1 
ATOM   7584 C C   . SER F 3 35  ? -116.759 -26.588 -98.518  1.00 109.27 ? 35  SER F C   1 
ATOM   7585 O O   . SER F 3 35  ? -115.526 -26.651 -98.605  1.00 109.06 ? 35  SER F O   1 
ATOM   7586 C CB  . SER F 3 35  ? -118.115 -28.315 -99.636  1.00 110.14 ? 35  SER F CB  1 
ATOM   7587 O OG  . SER F 3 35  ? -117.065 -29.172 -99.229  1.00 109.46 ? 35  SER F OG  1 
ATOM   7588 N N   . TRP F 3 36  ? -117.418 -26.307 -97.393  1.00 108.04 ? 36  TRP F N   1 
ATOM   7589 C CA  . TRP F 3 36  ? -116.779 -26.259 -96.081  1.00 106.63 ? 36  TRP F CA  1 
ATOM   7590 C C   . TRP F 3 36  ? -117.301 -27.369 -95.199  1.00 105.45 ? 36  TRP F C   1 
ATOM   7591 O O   . TRP F 3 36  ? -118.501 -27.616 -95.137  1.00 105.19 ? 36  TRP F O   1 
ATOM   7592 C CB  . TRP F 3 36  ? -117.100 -24.958 -95.367  1.00 106.83 ? 36  TRP F CB  1 
ATOM   7593 C CG  . TRP F 3 36  ? -116.654 -23.747 -96.056  1.00 107.35 ? 36  TRP F CG  1 
ATOM   7594 C CD1 . TRP F 3 36  ? -117.316 -23.076 -97.032  1.00 107.73 ? 36  TRP F CD1 1 
ATOM   7595 C CD2 . TRP F 3 36  ? -115.449 -23.021 -95.809  1.00 108.29 ? 36  TRP F CD2 1 
ATOM   7596 N NE1 . TRP F 3 36  ? -116.594 -21.976 -97.423  1.00 108.41 ? 36  TRP F NE1 1 
ATOM   7597 C CE2 . TRP F 3 36  ? -115.441 -21.917 -96.686  1.00 108.51 ? 36  TRP F CE2 1 
ATOM   7598 C CE3 . TRP F 3 36  ? -114.369 -23.199 -94.934  1.00 109.00 ? 36  TRP F CE3 1 
ATOM   7599 C CZ2 . TRP F 3 36  ? -114.397 -20.988 -96.715  1.00 109.14 ? 36  TRP F CZ2 1 
ATOM   7600 C CZ3 . TRP F 3 36  ? -113.323 -22.269 -94.963  1.00 109.35 ? 36  TRP F CZ3 1 
ATOM   7601 C CH2 . TRP F 3 36  ? -113.348 -21.181 -95.849  1.00 109.31 ? 36  TRP F CH2 1 
ATOM   7602 N N   . VAL F 3 37  ? -116.394 -28.023 -94.496  1.00 104.24 ? 37  VAL F N   1 
ATOM   7603 C CA  . VAL F 3 37  ? -116.783 -28.875 -93.390  1.00 103.13 ? 37  VAL F CA  1 
ATOM   7604 C C   . VAL F 3 37  ? -116.186 -28.281 -92.125  1.00 102.43 ? 37  VAL F C   1 
ATOM   7605 O O   . VAL F 3 37  ? -115.096 -27.709 -92.155  1.00 102.52 ? 37  VAL F O   1 
ATOM   7606 C CB  . VAL F 3 37  ? -116.288 -30.310 -93.553  1.00 103.03 ? 37  VAL F CB  1 
ATOM   7607 C CG1 . VAL F 3 37  ? -117.250 -31.234 -92.892  1.00 102.83 ? 37  VAL F CG1 1 
ATOM   7608 C CG2 . VAL F 3 37  ? -116.190 -30.681 -95.007  1.00 103.47 ? 37  VAL F CG2 1 
ATOM   7609 N N   . ARG F 3 38  ? -116.903 -28.388 -91.016  1.00 101.41 ? 38  ARG F N   1 
ATOM   7610 C CA  . ARG F 3 38  ? -116.365 -27.917 -89.751  1.00 100.44 ? 38  ARG F CA  1 
ATOM   7611 C C   . ARG F 3 38  ? -116.243 -29.080 -88.790  1.00 100.42 ? 38  ARG F C   1 
ATOM   7612 O O   . ARG F 3 38  ? -116.804 -30.157 -89.027  1.00 100.46 ? 38  ARG F O   1 
ATOM   7613 C CB  . ARG F 3 38  ? -117.219 -26.792 -89.155  1.00 100.13 ? 38  ARG F CB  1 
ATOM   7614 C CG  . ARG F 3 38  ? -118.559 -27.232 -88.613  1.00 98.63  ? 38  ARG F CG  1 
ATOM   7615 C CD  . ARG F 3 38  ? -119.384 -26.059 -88.126  1.00 96.41  ? 38  ARG F CD  1 
ATOM   7616 N NE  . ARG F 3 38  ? -120.739 -26.490 -87.776  1.00 95.38  ? 38  ARG F NE  1 
ATOM   7617 C CZ  . ARG F 3 38  ? -121.778 -25.680 -87.579  1.00 94.57  ? 38  ARG F CZ  1 
ATOM   7618 N NH1 . ARG F 3 38  ? -121.648 -24.361 -87.701  1.00 94.70  ? 38  ARG F NH1 1 
ATOM   7619 N NH2 . ARG F 3 38  ? -122.957 -26.198 -87.263  1.00 93.24  ? 38  ARG F NH2 1 
ATOM   7620 N N   . GLN F 3 39  ? -115.496 -28.858 -87.711  1.00 100.16 ? 39  GLN F N   1 
ATOM   7621 C CA  . GLN F 3 39  ? -115.268 -29.876 -86.700  1.00 99.77  ? 39  GLN F CA  1 
ATOM   7622 C C   . GLN F 3 39  ? -115.181 -29.216 -85.356  1.00 99.48  ? 39  GLN F C   1 
ATOM   7623 O O   . GLN F 3 39  ? -114.381 -28.302 -85.154  1.00 99.31  ? 39  GLN F O   1 
ATOM   7624 C CB  . GLN F 3 39  ? -113.977 -30.635 -86.977  1.00 99.90  ? 39  GLN F CB  1 
ATOM   7625 C CG  . GLN F 3 39  ? -113.628 -31.650 -85.923  1.00 100.14 ? 39  GLN F CG  1 
ATOM   7626 C CD  . GLN F 3 39  ? -112.589 -32.644 -86.400  1.00 101.13 ? 39  GLN F CD  1 
ATOM   7627 O OE1 . GLN F 3 39  ? -111.516 -32.267 -86.876  1.00 101.88 ? 39  GLN F OE1 1 
ATOM   7628 N NE2 . GLN F 3 39  ? -112.900 -33.928 -86.265  1.00 100.99 ? 39  GLN F NE2 1 
ATOM   7629 N N   . THR F 3 40  ? -116.012 -29.696 -84.441  1.00 99.36  ? 40  THR F N   1 
ATOM   7630 C CA  . THR F 3 40  ? -116.076 -29.170 -83.078  1.00 99.19  ? 40  THR F CA  1 
ATOM   7631 C C   . THR F 3 40  ? -114.832 -29.511 -82.236  1.00 99.24  ? 40  THR F C   1 
ATOM   7632 O O   . THR F 3 40  ? -113.958 -30.270 -82.686  1.00 99.18  ? 40  THR F O   1 
ATOM   7633 C CB  . THR F 3 40  ? -117.343 -29.670 -82.369  1.00 99.07  ? 40  THR F CB  1 
ATOM   7634 O OG1 . THR F 3 40  ? -117.693 -30.956 -82.890  1.00 98.52  ? 40  THR F OG1 1 
ATOM   7635 C CG2 . THR F 3 40  ? -118.499 -28.690 -82.584  1.00 98.81  ? 40  THR F CG2 1 
ATOM   7636 N N   . PRO F 3 41  ? -114.734 -28.929 -81.021  1.00 99.21  ? 41  PRO F N   1 
ATOM   7637 C CA  . PRO F 3 41  ? -113.680 -29.336 -80.096  1.00 99.34  ? 41  PRO F CA  1 
ATOM   7638 C C   . PRO F 3 41  ? -113.768 -30.829 -79.771  1.00 99.45  ? 41  PRO F C   1 
ATOM   7639 O O   . PRO F 3 41  ? -112.740 -31.484 -79.571  1.00 99.41  ? 41  PRO F O   1 
ATOM   7640 C CB  . PRO F 3 41  ? -113.979 -28.503 -78.849  1.00 99.33  ? 41  PRO F CB  1 
ATOM   7641 C CG  . PRO F 3 41  ? -114.655 -27.305 -79.364  1.00 99.10  ? 41  PRO F CG  1 
ATOM   7642 C CD  . PRO F 3 41  ? -115.501 -27.785 -80.493  1.00 99.05  ? 41  PRO F CD  1 
ATOM   7643 N N   . GLU F 3 42  ? -114.996 -31.350 -79.749  1.00 99.51  ? 42  GLU F N   1 
ATOM   7644 C CA  . GLU F 3 42  ? -115.269 -32.764 -79.496  1.00 99.56  ? 42  GLU F CA  1 
ATOM   7645 C C   . GLU F 3 42  ? -114.967 -33.636 -80.716  1.00 99.50  ? 42  GLU F C   1 
ATOM   7646 O O   . GLU F 3 42  ? -115.247 -34.833 -80.717  1.00 99.50  ? 42  GLU F O   1 
ATOM   7647 C CB  . GLU F 3 42  ? -116.718 -32.952 -79.044  1.00 99.49  ? 42  GLU F CB  1 
ATOM   7648 C CG  . GLU F 3 42  ? -117.068 -32.171 -77.785  1.00 100.59 ? 42  GLU F CG  1 
ATOM   7649 C CD  . GLU F 3 42  ? -117.224 -30.675 -78.044  1.00 102.31 ? 42  GLU F CD  1 
ATOM   7650 O OE1 . GLU F 3 42  ? -117.913 -30.319 -79.021  1.00 103.77 ? 42  GLU F OE1 1 
ATOM   7651 O OE2 . GLU F 3 42  ? -116.664 -29.854 -77.282  1.00 102.62 ? 42  GLU F OE2 1 
ATOM   7652 N N   . LYS F 3 43  ? -114.387 -33.027 -81.747  1.00 99.50  ? 43  LYS F N   1 
ATOM   7653 C CA  . LYS F 3 43  ? -113.973 -33.731 -82.961  1.00 99.59  ? 43  LYS F CA  1 
ATOM   7654 C C   . LYS F 3 43  ? -115.142 -34.347 -83.754  1.00 99.78  ? 43  LYS F C   1 
ATOM   7655 O O   . LYS F 3 43  ? -114.961 -35.248 -84.577  1.00 99.64  ? 43  LYS F O   1 
ATOM   7656 C CB  . LYS F 3 43  ? -112.843 -34.720 -82.653  1.00 99.52  ? 43  LYS F CB  1 
ATOM   7657 C CG  . LYS F 3 43  ? -111.606 -34.036 -82.052  1.00 99.77  ? 43  LYS F CG  1 
ATOM   7658 C CD  . LYS F 3 43  ? -110.868 -33.139 -83.075  1.00 99.56  ? 43  LYS F CD  1 
ATOM   7659 C CE  . LYS F 3 43  ? -110.067 -32.006 -82.416  1.00 99.12  ? 43  LYS F CE  1 
ATOM   7660 N NZ  . LYS F 3 43  ? -110.952 -30.911 -81.901  1.00 98.71  ? 43  LYS F NZ  1 
ATOM   7661 N N   . ARG F 3 44  ? -116.342 -33.836 -83.492  1.00 100.04 ? 44  ARG F N   1 
ATOM   7662 C CA  . ARG F 3 44  ? -117.499 -34.067 -84.337  1.00 100.28 ? 44  ARG F CA  1 
ATOM   7663 C C   . ARG F 3 44  ? -117.303 -33.269 -85.628  1.00 99.90  ? 44  ARG F C   1 
ATOM   7664 O O   . ARG F 3 44  ? -116.936 -32.084 -85.583  1.00 99.59  ? 44  ARG F O   1 
ATOM   7665 C CB  . ARG F 3 44  ? -118.767 -33.593 -83.616  1.00 100.73 ? 44  ARG F CB  1 
ATOM   7666 C CG  . ARG F 3 44  ? -120.095 -33.961 -84.290  1.00 102.91 ? 44  ARG F CG  1 
ATOM   7667 C CD  . ARG F 3 44  ? -120.644 -35.277 -83.731  1.00 106.70 ? 44  ARG F CD  1 
ATOM   7668 N NE  . ARG F 3 44  ? -121.117 -36.183 -84.781  1.00 108.96 ? 44  ARG F NE  1 
ATOM   7669 C CZ  . ARG F 3 44  ? -120.338 -36.768 -85.697  1.00 110.47 ? 44  ARG F CZ  1 
ATOM   7670 N NH1 . ARG F 3 44  ? -119.024 -36.543 -85.733  1.00 110.87 ? 44  ARG F NH1 1 
ATOM   7671 N NH2 . ARG F 3 44  ? -120.878 -37.582 -86.598  1.00 111.23 ? 44  ARG F NH2 1 
ATOM   7672 N N   . LEU F 3 45  ? -117.530 -33.932 -86.766  1.00 99.56  ? 45  LEU F N   1 
ATOM   7673 C CA  . LEU F 3 45  ? -117.497 -33.286 -88.088  1.00 99.05  ? 45  LEU F CA  1 
ATOM   7674 C C   . LEU F 3 45  ? -118.889 -32.863 -88.534  1.00 99.08  ? 45  LEU F C   1 
ATOM   7675 O O   . LEU F 3 45  ? -119.893 -33.423 -88.085  1.00 99.04  ? 45  LEU F O   1 
ATOM   7676 C CB  . LEU F 3 45  ? -116.887 -34.208 -89.139  1.00 98.64  ? 45  LEU F CB  1 
ATOM   7677 C CG  . LEU F 3 45  ? -115.371 -34.256 -89.298  1.00 98.26  ? 45  LEU F CG  1 
ATOM   7678 C CD1 . LEU F 3 45  ? -114.976 -35.366 -90.264  1.00 97.06  ? 45  LEU F CD1 1 
ATOM   7679 C CD2 . LEU F 3 45  ? -114.806 -32.904 -89.736  1.00 97.06  ? 45  LEU F CD2 1 
ATOM   7680 N N   . GLU F 3 46  ? -118.942 -31.876 -89.424  1.00 99.10  ? 46  GLU F N   1 
ATOM   7681 C CA  . GLU F 3 46  ? -120.205 -31.276 -89.833  1.00 99.14  ? 46  GLU F CA  1 
ATOM   7682 C C   . GLU F 3 46  ? -120.162 -30.611 -91.202  1.00 99.25  ? 46  GLU F C   1 
ATOM   7683 O O   . GLU F 3 46  ? -119.444 -29.617 -91.385  1.00 99.21  ? 46  GLU F O   1 
ATOM   7684 C CB  . GLU F 3 46  ? -120.616 -30.237 -88.810  1.00 98.87  ? 46  GLU F CB  1 
ATOM   7685 C CG  . GLU F 3 46  ? -121.725 -30.676 -87.930  1.00 99.78  ? 46  GLU F CG  1 
ATOM   7686 C CD  . GLU F 3 46  ? -122.500 -29.495 -87.406  1.00 102.30 ? 46  GLU F CD  1 
ATOM   7687 O OE1 . GLU F 3 46  ? -123.708 -29.376 -87.727  1.00 103.23 ? 46  GLU F OE1 1 
ATOM   7688 O OE2 . GLU F 3 46  ? -121.894 -28.665 -86.689  1.00 103.29 ? 46  GLU F OE2 1 
ATOM   7689 N N   . TRP F 3 47  ? -120.937 -31.139 -92.157  1.00 99.31  ? 47  TRP F N   1 
ATOM   7690 C CA  . TRP F 3 47  ? -121.078 -30.466 -93.452  1.00 99.37  ? 47  TRP F CA  1 
ATOM   7691 C C   . TRP F 3 47  ? -121.928 -29.203 -93.371  1.00 99.65  ? 47  TRP F C   1 
ATOM   7692 O O   . TRP F 3 47  ? -123.124 -29.257 -93.119  1.00 99.64  ? 47  TRP F O   1 
ATOM   7693 C CB  . TRP F 3 47  ? -121.633 -31.365 -94.548  1.00 99.00  ? 47  TRP F CB  1 
ATOM   7694 C CG  . TRP F 3 47  ? -122.049 -30.535 -95.739  1.00 98.19  ? 47  TRP F CG  1 
ATOM   7695 C CD1 . TRP F 3 47  ? -121.228 -29.848 -96.595  1.00 97.15  ? 47  TRP F CD1 1 
ATOM   7696 C CD2 . TRP F 3 47  ? -123.384 -30.265 -96.166  1.00 97.53  ? 47  TRP F CD2 1 
ATOM   7697 N NE1 . TRP F 3 47  ? -121.974 -29.188 -97.539  1.00 96.29  ? 47  TRP F NE1 1 
ATOM   7698 C CE2 . TRP F 3 47  ? -123.301 -29.426 -97.298  1.00 97.08  ? 47  TRP F CE2 1 
ATOM   7699 C CE3 . TRP F 3 47  ? -124.649 -30.664 -95.710  1.00 97.46  ? 47  TRP F CE3 1 
ATOM   7700 C CZ2 . TRP F 3 47  ? -124.432 -28.981 -97.979  1.00 97.23  ? 47  TRP F CZ2 1 
ATOM   7701 C CZ3 . TRP F 3 47  ? -125.773 -30.221 -96.386  1.00 96.64  ? 47  TRP F CZ3 1 
ATOM   7702 C CH2 . TRP F 3 47  ? -125.658 -29.390 -97.510  1.00 96.96  ? 47  TRP F CH2 1 
ATOM   7703 N N   . VAL F 3 48  ? -121.296 -28.079 -93.663  1.00 100.12 ? 48  VAL F N   1 
ATOM   7704 C CA  . VAL F 3 48  ? -121.875 -26.781 -93.424  1.00 100.68 ? 48  VAL F CA  1 
ATOM   7705 C C   . VAL F 3 48  ? -122.321 -26.043 -94.691  1.00 101.45 ? 48  VAL F C   1 
ATOM   7706 O O   . VAL F 3 48  ? -123.371 -25.402 -94.706  1.00 101.53 ? 48  VAL F O   1 
ATOM   7707 C CB  . VAL F 3 48  ? -120.880 -25.954 -92.616  1.00 100.43 ? 48  VAL F CB  1 
ATOM   7708 C CG1 . VAL F 3 48  ? -121.146 -24.464 -92.739  1.00 100.58 ? 48  VAL F CG1 1 
ATOM   7709 C CG2 . VAL F 3 48  ? -120.945 -26.392 -91.193  1.00 100.12 ? 48  VAL F CG2 1 
ATOM   7710 N N   . ALA F 3 49  ? -121.530 -26.131 -95.753  1.00 102.41 ? 49  ALA F N   1 
ATOM   7711 C CA  . ALA F 3 49  ? -121.787 -25.340 -96.945  1.00 103.29 ? 49  ALA F CA  1 
ATOM   7712 C C   . ALA F 3 49  ? -121.357 -26.088 -98.188  1.00 104.10 ? 49  ALA F C   1 
ATOM   7713 O O   . ALA F 3 49  ? -120.497 -26.970 -98.111  1.00 104.16 ? 49  ALA F O   1 
ATOM   7714 C CB  . ALA F 3 49  ? -121.047 -24.034 -96.850  1.00 103.33 ? 49  ALA F CB  1 
ATOM   7715 N N   . TYR F 3 50  ? -121.958 -25.733 -99.328  1.00 105.00 ? 50  TYR F N   1 
ATOM   7716 C CA  . TYR F 3 50  ? -121.598 -26.316 -100.630 1.00 105.75 ? 50  TYR F CA  1 
ATOM   7717 C C   . TYR F 3 50  ? -121.960 -25.409 -101.794 1.00 106.24 ? 50  TYR F C   1 
ATOM   7718 O O   . TYR F 3 50  ? -123.139 -25.257 -102.120 1.00 106.33 ? 50  TYR F O   1 
ATOM   7719 C CB  . TYR F 3 50  ? -122.283 -27.670 -100.840 1.00 105.78 ? 50  TYR F CB  1 
ATOM   7720 C CG  . TYR F 3 50  ? -121.787 -28.435 -102.052 1.00 106.07 ? 50  TYR F CG  1 
ATOM   7721 C CD1 . TYR F 3 50  ? -120.784 -29.392 -101.918 1.00 106.90 ? 50  TYR F CD1 1 
ATOM   7722 C CD2 . TYR F 3 50  ? -122.318 -28.214 -103.325 1.00 105.69 ? 50  TYR F CD2 1 
ATOM   7723 C CE1 . TYR F 3 50  ? -120.315 -30.110 -103.007 1.00 106.80 ? 50  TYR F CE1 1 
ATOM   7724 C CE2 . TYR F 3 50  ? -121.851 -28.927 -104.428 1.00 105.82 ? 50  TYR F CE2 1 
ATOM   7725 C CZ  . TYR F 3 50  ? -120.849 -29.879 -104.254 1.00 106.67 ? 50  TYR F CZ  1 
ATOM   7726 O OH  . TYR F 3 50  ? -120.357 -30.612 -105.312 1.00 107.11 ? 50  TYR F OH  1 
ATOM   7727 N N   . ILE F 3 51  ? -120.939 -24.840 -102.432 1.00 106.90 ? 51  ILE F N   1 
ATOM   7728 C CA  . ILE F 3 51  ? -121.109 -24.023 -103.640 1.00 107.52 ? 51  ILE F CA  1 
ATOM   7729 C C   . ILE F 3 51  ? -120.904 -24.871 -104.904 1.00 107.89 ? 51  ILE F C   1 
ATOM   7730 O O   . ILE F 3 51  ? -120.069 -25.777 -104.918 1.00 108.02 ? 51  ILE F O   1 
ATOM   7731 C CB  . ILE F 3 51  ? -120.154 -22.788 -103.618 1.00 107.52 ? 51  ILE F CB  1 
ATOM   7732 C CG1 . ILE F 3 51  ? -120.586 -21.727 -104.636 1.00 108.16 ? 51  ILE F CG1 1 
ATOM   7733 C CG2 . ILE F 3 51  ? -118.707 -23.199 -103.823 1.00 107.11 ? 51  ILE F CG2 1 
ATOM   7734 C CD1 . ILE F 3 51  ? -120.150 -20.302 -104.282 1.00 108.42 ? 51  ILE F CD1 1 
ATOM   7735 N N   . SER F 3 52  ? -121.666 -24.585 -105.958 1.00 108.41 ? 52  SER F N   1 
ATOM   7736 C CA  . SER F 3 52  ? -121.527 -25.318 -107.228 1.00 109.02 ? 52  SER F CA  1 
ATOM   7737 C C   . SER F 3 52  ? -120.186 -25.056 -107.943 1.00 109.32 ? 52  SER F C   1 
ATOM   7738 O O   . SER F 3 52  ? -119.262 -24.469 -107.360 1.00 109.50 ? 52  SER F O   1 
ATOM   7739 C CB  . SER F 3 52  ? -122.709 -25.021 -108.157 1.00 108.98 ? 52  SER F CB  1 
ATOM   7740 O OG  . SER F 3 52  ? -122.890 -23.627 -108.308 1.00 109.32 ? 52  SER F OG  1 
ATOM   7741 N N   . SER F 3 53  ? -120.081 -25.512 -109.194 1.00 109.56 ? 53  SER F N   1 
ATOM   7742 C CA  . SER F 3 53  ? -118.894 -25.272 -110.022 1.00 109.74 ? 53  SER F CA  1 
ATOM   7743 C C   . SER F 3 53  ? -118.665 -23.761 -110.199 1.00 110.17 ? 53  SER F C   1 
ATOM   7744 O O   . SER F 3 53  ? -117.695 -23.194 -109.674 1.00 110.13 ? 53  SER F O   1 
ATOM   7745 C CB  . SER F 3 53  ? -119.050 -25.969 -111.374 1.00 109.47 ? 53  SER F CB  1 
ATOM   7746 O OG  . SER F 3 53  ? -117.850 -25.904 -112.110 1.00 109.12 ? 53  SER F OG  1 
ATOM   7747 N N   . GLY F 3 54  ? -119.580 -23.114 -110.920 1.00 110.47 ? 54  GLY F N   1 
ATOM   7748 C CA  . GLY F 3 54  ? -119.602 -21.659 -111.015 1.00 110.71 ? 54  GLY F CA  1 
ATOM   7749 C C   . GLY F 3 54  ? -120.779 -21.095 -110.235 1.00 110.82 ? 54  GLY F C   1 
ATOM   7750 O O   . GLY F 3 54  ? -121.827 -20.778 -110.819 1.00 110.84 ? 54  GLY F O   1 
ATOM   7751 N N   . GLY F 3 55  ? -120.602 -20.993 -108.914 1.00 110.73 ? 55  GLY F N   1 
ATOM   7752 C CA  . GLY F 3 55  ? -121.615 -20.472 -107.979 1.00 110.40 ? 55  GLY F CA  1 
ATOM   7753 C C   . GLY F 3 55  ? -123.058 -20.347 -108.448 1.00 110.09 ? 55  GLY F C   1 
ATOM   7754 O O   . GLY F 3 55  ? -123.755 -19.413 -108.048 1.00 110.10 ? 55  GLY F O   1 
ATOM   7755 N N   . GLY F 3 56  ? -123.499 -21.285 -109.291 1.00 109.77 ? 56  GLY F N   1 
ATOM   7756 C CA  . GLY F 3 56  ? -124.868 -21.322 -109.810 1.00 109.17 ? 56  GLY F CA  1 
ATOM   7757 C C   . GLY F 3 56  ? -125.864 -21.394 -108.670 1.00 108.69 ? 56  GLY F C   1 
ATOM   7758 O O   . GLY F 3 56  ? -126.579 -20.421 -108.393 1.00 108.60 ? 56  GLY F O   1 
ATOM   7759 N N   . SER F 3 57  ? -125.900 -22.544 -108.002 1.00 108.04 ? 57  SER F N   1 
ATOM   7760 C CA  . SER F 3 57  ? -126.671 -22.689 -106.773 1.00 107.58 ? 57  SER F CA  1 
ATOM   7761 C C   . SER F 3 57  ? -125.788 -23.143 -105.592 1.00 106.93 ? 57  SER F C   1 
ATOM   7762 O O   . SER F 3 57  ? -124.641 -23.576 -105.784 1.00 106.76 ? 57  SER F O   1 
ATOM   7763 C CB  . SER F 3 57  ? -127.851 -23.633 -106.990 1.00 107.62 ? 57  SER F CB  1 
ATOM   7764 O OG  . SER F 3 57  ? -127.385 -24.889 -107.436 1.00 108.31 ? 57  SER F OG  1 
ATOM   7765 N N   . THR F 3 58  ? -126.327 -23.013 -104.377 1.00 106.01 ? 58  THR F N   1 
ATOM   7766 C CA  . THR F 3 58  ? -125.606 -23.362 -103.150 1.00 105.11 ? 58  THR F CA  1 
ATOM   7767 C C   . THR F 3 58  ? -126.380 -24.390 -102.327 1.00 104.31 ? 58  THR F C   1 
ATOM   7768 O O   . THR F 3 58  ? -127.545 -24.657 -102.625 1.00 104.23 ? 58  THR F O   1 
ATOM   7769 C CB  . THR F 3 58  ? -125.300 -22.115 -102.281 1.00 105.30 ? 58  THR F CB  1 
ATOM   7770 O OG1 . THR F 3 58  ? -126.520 -21.434 -101.954 1.00 105.34 ? 58  THR F OG1 1 
ATOM   7771 C CG2 . THR F 3 58  ? -124.342 -21.165 -103.012 1.00 105.19 ? 58  THR F CG2 1 
ATOM   7772 N N   . TYR F 3 59  ? -125.724 -24.966 -101.310 1.00 103.36 ? 59  TYR F N   1 
ATOM   7773 C CA  . TYR F 3 59  ? -126.306 -26.030 -100.462 1.00 102.45 ? 59  TYR F CA  1 
ATOM   7774 C C   . TYR F 3 59  ? -125.920 -25.966 -98.969  1.00 101.87 ? 59  TYR F C   1 
ATOM   7775 O O   . TYR F 3 59  ? -124.754 -25.721 -98.626  1.00 101.78 ? 59  TYR F O   1 
ATOM   7776 C CB  . TYR F 3 59  ? -125.957 -27.407 -101.028 1.00 102.34 ? 59  TYR F CB  1 
ATOM   7777 C CG  . TYR F 3 59  ? -126.507 -27.644 -102.408 1.00 101.85 ? 59  TYR F CG  1 
ATOM   7778 C CD1 . TYR F 3 59  ? -127.761 -28.217 -102.589 1.00 101.48 ? 59  TYR F CD1 1 
ATOM   7779 C CD2 . TYR F 3 59  ? -125.780 -27.277 -103.533 1.00 102.04 ? 59  TYR F CD2 1 
ATOM   7780 C CE1 . TYR F 3 59  ? -128.272 -28.430 -103.863 1.00 101.81 ? 59  TYR F CE1 1 
ATOM   7781 C CE2 . TYR F 3 59  ? -126.285 -27.474 -104.813 1.00 102.23 ? 59  TYR F CE2 1 
ATOM   7782 C CZ  . TYR F 3 59  ? -127.527 -28.056 -104.974 1.00 102.04 ? 59  TYR F CZ  1 
ATOM   7783 O OH  . TYR F 3 59  ? -128.014 -28.257 -106.248 1.00 101.67 ? 59  TYR F OH  1 
ATOM   7784 N N   . TYR F 3 60  ? -126.904 -26.193 -98.095  1.00 101.08 ? 60  TYR F N   1 
ATOM   7785 C CA  . TYR F 3 60  ? -126.712 -26.078 -96.637  1.00 100.71 ? 60  TYR F CA  1 
ATOM   7786 C C   . TYR F 3 60  ? -127.459 -27.176 -95.851  1.00 100.44 ? 60  TYR F C   1 
ATOM   7787 O O   . TYR F 3 60  ? -128.445 -27.731 -96.349  1.00 100.59 ? 60  TYR F O   1 
ATOM   7788 C CB  . TYR F 3 60  ? -127.153 -24.688 -96.126  1.00 100.55 ? 60  TYR F CB  1 
ATOM   7789 C CG  . TYR F 3 60  ? -126.573 -23.509 -96.888  1.00 100.11 ? 60  TYR F CG  1 
ATOM   7790 C CD1 . TYR F 3 60  ? -125.343 -22.934 -96.516  1.00 99.06  ? 60  TYR F CD1 1 
ATOM   7791 C CD2 . TYR F 3 60  ? -127.255 -22.962 -97.979  1.00 99.33  ? 60  TYR F CD2 1 
ATOM   7792 C CE1 . TYR F 3 60  ? -124.807 -21.843 -97.216  1.00 98.09  ? 60  TYR F CE1 1 
ATOM   7793 C CE2 . TYR F 3 60  ? -126.721 -21.881 -98.692  1.00 99.22  ? 60  TYR F CE2 1 
ATOM   7794 C CZ  . TYR F 3 60  ? -125.502 -21.324 -98.307  1.00 98.45  ? 60  TYR F CZ  1 
ATOM   7795 O OH  . TYR F 3 60  ? -125.005 -20.253 -99.019  1.00 97.21  ? 60  TYR F OH  1 
ATOM   7796 N N   . PRO F 3 61  ? -126.983 -27.509 -94.629  1.00 99.96  ? 61  PRO F N   1 
ATOM   7797 C CA  . PRO F 3 61  ? -127.850 -28.247 -93.729  1.00 99.70  ? 61  PRO F CA  1 
ATOM   7798 C C   . PRO F 3 61  ? -128.786 -27.227 -93.108  1.00 99.65  ? 61  PRO F C   1 
ATOM   7799 O O   . PRO F 3 61  ? -128.439 -26.038 -93.038  1.00 99.67  ? 61  PRO F O   1 
ATOM   7800 C CB  . PRO F 3 61  ? -126.883 -28.777 -92.679  1.00 99.61  ? 61  PRO F CB  1 
ATOM   7801 C CG  . PRO F 3 61  ? -125.828 -27.767 -92.627  1.00 99.45  ? 61  PRO F CG  1 
ATOM   7802 C CD  . PRO F 3 61  ? -125.647 -27.313 -94.042  1.00 99.89  ? 61  PRO F CD  1 
ATOM   7803 N N   . ASP F 3 62  ? -129.960 -27.665 -92.670  1.00 99.49  ? 62  ASP F N   1 
ATOM   7804 C CA  . ASP F 3 62  ? -130.927 -26.727 -92.121  1.00 99.44  ? 62  ASP F CA  1 
ATOM   7805 C C   . ASP F 3 62  ? -130.303 -25.878 -91.036  1.00 99.02  ? 62  ASP F C   1 
ATOM   7806 O O   . ASP F 3 62  ? -130.553 -24.692 -90.967  1.00 98.81  ? 62  ASP F O   1 
ATOM   7807 C CB  . ASP F 3 62  ? -132.156 -27.453 -91.588  1.00 99.87  ? 62  ASP F CB  1 
ATOM   7808 C CG  . ASP F 3 62  ? -133.284 -27.530 -92.610  1.00 101.38 ? 62  ASP F CG  1 
ATOM   7809 O OD1 . ASP F 3 62  ? -134.413 -27.903 -92.210  1.00 103.07 ? 62  ASP F OD1 1 
ATOM   7810 O OD2 . ASP F 3 62  ? -133.055 -27.216 -93.804  1.00 102.73 ? 62  ASP F OD2 1 
ATOM   7811 N N   . THR F 3 63  ? -129.451 -26.499 -90.226  1.00 98.99  ? 63  THR F N   1 
ATOM   7812 C CA  . THR F 3 63  ? -128.797 -25.856 -89.076  1.00 98.86  ? 63  THR F CA  1 
ATOM   7813 C C   . THR F 3 63  ? -128.157 -24.476 -89.331  1.00 98.66  ? 63  THR F C   1 
ATOM   7814 O O   . THR F 3 63  ? -128.178 -23.614 -88.452  1.00 98.56  ? 63  THR F O   1 
ATOM   7815 C CB  . THR F 3 63  ? -127.780 -26.829 -88.380  1.00 98.83  ? 63  THR F CB  1 
ATOM   7816 O OG1 . THR F 3 63  ? -127.298 -26.240 -87.171  1.00 99.11  ? 63  THR F OG1 1 
ATOM   7817 C CG2 . THR F 3 63  ? -126.586 -27.170 -89.278  1.00 98.79  ? 63  THR F CG2 1 
ATOM   7818 N N   . VAL F 3 64  ? -127.602 -24.269 -90.524  1.00 98.46  ? 64  VAL F N   1 
ATOM   7819 C CA  . VAL F 3 64  ? -126.945 -23.000 -90.858  1.00 98.27  ? 64  VAL F CA  1 
ATOM   7820 C C   . VAL F 3 64  ? -127.758 -22.164 -91.874  1.00 98.52  ? 64  VAL F C   1 
ATOM   7821 O O   . VAL F 3 64  ? -127.571 -20.941 -91.978  1.00 98.26  ? 64  VAL F O   1 
ATOM   7822 C CB  . VAL F 3 64  ? -125.455 -23.204 -91.321  1.00 97.98  ? 64  VAL F CB  1 
ATOM   7823 C CG1 . VAL F 3 64  ? -124.667 -23.968 -90.290  1.00 97.07  ? 64  VAL F CG1 1 
ATOM   7824 C CG2 . VAL F 3 64  ? -125.382 -23.935 -92.637  1.00 98.21  ? 64  VAL F CG2 1 
ATOM   7825 N N   . LYS F 3 65  ? -128.668 -22.839 -92.590  1.00 98.81  ? 65  LYS F N   1 
ATOM   7826 C CA  . LYS F 3 65  ? -129.472 -22.249 -93.672  1.00 99.19  ? 65  LYS F CA  1 
ATOM   7827 C C   . LYS F 3 65  ? -130.130 -20.907 -93.327  1.00 99.74  ? 65  LYS F C   1 
ATOM   7828 O O   . LYS F 3 65  ? -131.170 -20.850 -92.669  1.00 99.30  ? 65  LYS F O   1 
ATOM   7829 C CB  . LYS F 3 65  ? -130.525 -23.242 -94.156  1.00 98.93  ? 65  LYS F CB  1 
ATOM   7830 C CG  . LYS F 3 65  ? -131.146 -22.872 -95.490  1.00 99.14  ? 65  LYS F CG  1 
ATOM   7831 C CD  . LYS F 3 65  ? -132.418 -23.683 -95.831  1.00 99.01  ? 65  LYS F CD  1 
ATOM   7832 C CE  . LYS F 3 65  ? -132.170 -25.187 -96.077  1.00 97.96  ? 65  LYS F CE  1 
ATOM   7833 N NZ  . LYS F 3 65  ? -131.184 -25.496 -97.147  1.00 96.60  ? 65  LYS F NZ  1 
ATOM   7834 N N   . GLY F 3 66  ? -129.502 -19.832 -93.789  1.00 100.67 ? 66  GLY F N   1 
ATOM   7835 C CA  . GLY F 3 66  ? -130.006 -18.493 -93.563  1.00 101.86 ? 66  GLY F CA  1 
ATOM   7836 C C   . GLY F 3 66  ? -129.303 -17.827 -92.406  1.00 102.93 ? 66  GLY F C   1 
ATOM   7837 O O   . GLY F 3 66  ? -129.886 -16.999 -91.723  1.00 103.10 ? 66  GLY F O   1 
ATOM   7838 N N   . ARG F 3 67  ? -128.056 -18.209 -92.162  1.00 104.00 ? 67  ARG F N   1 
ATOM   7839 C CA  . ARG F 3 67  ? -127.202 -17.509 -91.196  1.00 105.25 ? 67  ARG F CA  1 
ATOM   7840 C C   . ARG F 3 67  ? -125.762 -17.600 -91.698  1.00 106.32 ? 67  ARG F C   1 
ATOM   7841 O O   . ARG F 3 67  ? -124.819 -17.023 -91.123  1.00 106.16 ? 67  ARG F O   1 
ATOM   7842 C CB  . ARG F 3 67  ? -127.289 -18.136 -89.808  1.00 105.15 ? 67  ARG F CB  1 
ATOM   7843 C CG  . ARG F 3 67  ? -128.537 -18.942 -89.494  1.00 104.82 ? 67  ARG F CG  1 
ATOM   7844 C CD  . ARG F 3 67  ? -128.613 -19.211 -88.005  1.00 104.53 ? 67  ARG F CD  1 
ATOM   7845 N NE  . ARG F 3 67  ? -127.290 -19.274 -87.383  1.00 104.06 ? 67  ARG F NE  1 
ATOM   7846 C CZ  . ARG F 3 67  ? -126.517 -20.356 -87.344  1.00 103.75 ? 67  ARG F CZ  1 
ATOM   7847 N NH1 . ARG F 3 67  ? -126.918 -21.494 -87.894  1.00 103.32 ? 67  ARG F NH1 1 
ATOM   7848 N NH2 . ARG F 3 67  ? -125.338 -20.294 -86.751  1.00 102.82 ? 67  ARG F NH2 1 
ATOM   7849 N N   . PHE F 3 68  ? -125.631 -18.360 -92.784  1.00 107.61 ? 68  PHE F N   1 
ATOM   7850 C CA  . PHE F 3 68  ? -124.374 -18.691 -93.427  1.00 108.63 ? 68  PHE F CA  1 
ATOM   7851 C C   . PHE F 3 68  ? -124.585 -18.555 -94.920  1.00 109.66 ? 68  PHE F C   1 
ATOM   7852 O O   . PHE F 3 68  ? -125.649 -18.920 -95.441  1.00 109.84 ? 68  PHE F O   1 
ATOM   7853 C CB  . PHE F 3 68  ? -124.021 -20.153 -93.144  1.00 108.50 ? 68  PHE F CB  1 
ATOM   7854 C CG  . PHE F 3 68  ? -123.216 -20.369 -91.899  1.00 107.67 ? 68  PHE F CG  1 
ATOM   7855 C CD1 . PHE F 3 68  ? -123.638 -19.868 -90.675  1.00 106.83 ? 68  PHE F CD1 1 
ATOM   7856 C CD2 . PHE F 3 68  ? -122.045 -21.109 -91.954  1.00 106.91 ? 68  PHE F CD2 1 
ATOM   7857 C CE1 . PHE F 3 68  ? -122.895 -20.078 -89.535  1.00 107.19 ? 68  PHE F CE1 1 
ATOM   7858 C CE2 . PHE F 3 68  ? -121.296 -21.331 -90.817  1.00 107.11 ? 68  PHE F CE2 1 
ATOM   7859 C CZ  . PHE F 3 68  ? -121.719 -20.819 -89.600  1.00 107.09 ? 68  PHE F CZ  1 
ATOM   7860 N N   . THR F 3 69  ? -123.575 -18.031 -95.605  1.00 110.96 ? 69  THR F N   1 
ATOM   7861 C CA  . THR F 3 69  ? -123.565 -18.015 -97.067  1.00 112.18 ? 69  THR F CA  1 
ATOM   7862 C C   . THR F 3 69  ? -122.178 -18.333 -97.629  1.00 113.02 ? 69  THR F C   1 
ATOM   7863 O O   . THR F 3 69  ? -121.150 -17.934 -97.075  1.00 112.73 ? 69  THR F O   1 
ATOM   7864 C CB  . THR F 3 69  ? -124.187 -16.712 -97.680  1.00 112.20 ? 69  THR F CB  1 
ATOM   7865 O OG1 . THR F 3 69  ? -124.102 -15.618 -96.751  1.00 112.40 ? 69  THR F OG1 1 
ATOM   7866 C CG2 . THR F 3 69  ? -125.654 -16.940 -98.025  1.00 112.30 ? 69  THR F CG2 1 
ATOM   7867 N N   . ILE F 3 70  ? -122.173 -19.080 -98.725  1.00 114.63 ? 70  ILE F N   1 
ATOM   7868 C CA  . ILE F 3 70  ? -120.935 -19.494 -99.392  1.00 116.25 ? 70  ILE F CA  1 
ATOM   7869 C C   . ILE F 3 70  ? -120.746 -18.776 -100.742 1.00 117.47 ? 70  ILE F C   1 
ATOM   7870 O O   . ILE F 3 70  ? -121.566 -18.908 -101.670 1.00 117.65 ? 70  ILE F O   1 
ATOM   7871 C CB  . ILE F 3 70  ? -120.826 -21.055 -99.531  1.00 116.10 ? 70  ILE F CB  1 
ATOM   7872 C CG1 . ILE F 3 70  ? -119.405 -21.460 -99.942  1.00 116.62 ? 70  ILE F CG1 1 
ATOM   7873 C CG2 . ILE F 3 70  ? -121.908 -21.631 -100.472 1.00 115.56 ? 70  ILE F CG2 1 
ATOM   7874 C CD1 . ILE F 3 70  ? -119.136 -22.968 -99.934  1.00 117.82 ? 70  ILE F CD1 1 
ATOM   7875 N N   . SER F 3 71  ? -119.663 -18.012 -100.837 1.00 118.80 ? 71  SER F N   1 
ATOM   7876 C CA  . SER F 3 71  ? -119.397 -17.225 -102.032 1.00 120.16 ? 71  SER F CA  1 
ATOM   7877 C C   . SER F 3 71  ? -118.024 -17.527 -102.618 1.00 120.85 ? 71  SER F C   1 
ATOM   7878 O O   . SER F 3 71  ? -117.050 -17.682 -101.880 1.00 120.89 ? 71  SER F O   1 
ATOM   7879 C CB  . SER F 3 71  ? -119.533 -15.729 -101.724 1.00 120.39 ? 71  SER F CB  1 
ATOM   7880 O OG  . SER F 3 71  ? -118.585 -15.305 -100.756 1.00 120.97 ? 71  SER F OG  1 
ATOM   7881 N N   . ARG F 3 72  ? -117.961 -17.628 -103.945 1.00 121.76 ? 72  ARG F N   1 
ATOM   7882 C CA  . ARG F 3 72  ? -116.688 -17.788 -104.645 1.00 122.67 ? 72  ARG F CA  1 
ATOM   7883 C C   . ARG F 3 72  ? -116.536 -16.769 -105.772 1.00 123.38 ? 72  ARG F C   1 
ATOM   7884 O O   . ARG F 3 72  ? -117.525 -16.270 -106.324 1.00 123.43 ? 72  ARG F O   1 
ATOM   7885 C CB  . ARG F 3 72  ? -116.489 -19.228 -105.157 1.00 122.49 ? 72  ARG F CB  1 
ATOM   7886 C CG  . ARG F 3 72  ? -117.238 -19.582 -106.439 1.00 122.62 ? 72  ARG F CG  1 
ATOM   7887 C CD  . ARG F 3 72  ? -117.199 -21.080 -106.724 1.00 122.88 ? 72  ARG F CD  1 
ATOM   7888 N NE  . ARG F 3 72  ? -115.837 -21.569 -106.942 1.00 123.20 ? 72  ARG F NE  1 
ATOM   7889 C CZ  . ARG F 3 72  ? -115.529 -22.811 -107.314 1.00 123.50 ? 72  ARG F CZ  1 
ATOM   7890 N NH1 . ARG F 3 72  ? -116.484 -23.714 -107.514 1.00 123.73 ? 72  ARG F NH1 1 
ATOM   7891 N NH2 . ARG F 3 72  ? -114.258 -23.153 -107.486 1.00 123.25 ? 72  ARG F NH2 1 
ATOM   7892 N N   . ASP F 3 73  ? -115.278 -16.459 -106.076 1.00 124.33 ? 73  ASP F N   1 
ATOM   7893 C CA  . ASP F 3 73  ? -114.892 -15.650 -107.231 1.00 125.02 ? 73  ASP F CA  1 
ATOM   7894 C C   . ASP F 3 73  ? -114.066 -16.541 -108.184 1.00 125.55 ? 73  ASP F C   1 
ATOM   7895 O O   . ASP F 3 73  ? -112.830 -16.625 -108.062 1.00 125.65 ? 73  ASP F O   1 
ATOM   7896 C CB  . ASP F 3 73  ? -114.123 -14.404 -106.751 1.00 124.84 ? 73  ASP F CB  1 
ATOM   7897 C CG  . ASP F 3 73  ? -113.355 -13.708 -107.857 1.00 124.61 ? 73  ASP F CG  1 
ATOM   7898 O OD1 . ASP F 3 73  ? -113.875 -13.585 -108.989 1.00 124.92 ? 73  ASP F OD1 1 
ATOM   7899 O OD2 . ASP F 3 73  ? -112.225 -13.269 -107.574 1.00 123.62 ? 73  ASP F OD2 1 
ATOM   7900 N N   . ASN F 3 74  ? -114.770 -17.213 -109.107 1.00 126.01 ? 74  ASN F N   1 
ATOM   7901 C CA  . ASN F 3 74  ? -114.183 -18.180 -110.050 1.00 126.73 ? 74  ASN F CA  1 
ATOM   7902 C C   . ASN F 3 74  ? -112.872 -17.706 -110.679 1.00 127.01 ? 74  ASN F C   1 
ATOM   7903 O O   . ASN F 3 74  ? -112.099 -18.512 -111.207 1.00 127.24 ? 74  ASN F O   1 
ATOM   7904 C CB  . ASN F 3 74  ? -115.193 -18.562 -111.150 1.00 127.03 ? 74  ASN F CB  1 
ATOM   7905 C CG  . ASN F 3 74  ? -115.991 -19.846 -110.826 1.00 128.26 ? 74  ASN F CG  1 
ATOM   7906 O OD1 . ASN F 3 74  ? -116.337 -20.116 -109.671 1.00 129.54 ? 74  ASN F OD1 1 
ATOM   7907 N ND2 . ASN F 3 74  ? -116.301 -20.628 -111.863 1.00 128.81 ? 74  ASN F ND2 1 
ATOM   7908 N N   . ALA F 3 75  ? -112.639 -16.393 -110.613 1.00 127.25 ? 75  ALA F N   1 
ATOM   7909 C CA  . ALA F 3 75  ? -111.406 -15.767 -111.087 1.00 127.20 ? 75  ALA F CA  1 
ATOM   7910 C C   . ALA F 3 75  ? -110.265 -15.886 -110.067 1.00 127.19 ? 75  ALA F C   1 
ATOM   7911 O O   . ALA F 3 75  ? -109.339 -16.680 -110.256 1.00 127.15 ? 75  ALA F O   1 
ATOM   7912 C CB  . ALA F 3 75  ? -111.658 -14.301 -111.460 1.00 127.04 ? 75  ALA F CB  1 
ATOM   7913 N N   . LYS F 3 76  ? -110.343 -15.125 -108.977 1.00 127.19 ? 76  LYS F N   1 
ATOM   7914 C CA  . LYS F 3 76  ? -109.189 -14.968 -108.072 1.00 127.28 ? 76  LYS F CA  1 
ATOM   7915 C C   . LYS F 3 76  ? -108.901 -16.189 -107.170 1.00 127.16 ? 76  LYS F C   1 
ATOM   7916 O O   . LYS F 3 76  ? -108.153 -16.102 -106.179 1.00 127.03 ? 76  LYS F O   1 
ATOM   7917 C CB  . LYS F 3 76  ? -109.273 -13.641 -107.281 1.00 127.33 ? 76  LYS F CB  1 
ATOM   7918 C CG  . LYS F 3 76  ? -108.826 -12.372 -108.059 1.00 126.97 ? 76  LYS F CG  1 
ATOM   7919 C CD  . LYS F 3 76  ? -109.709 -12.072 -109.286 1.00 126.83 ? 76  LYS F CD  1 
ATOM   7920 C CE  . LYS F 3 76  ? -109.565 -10.640 -109.791 1.00 126.30 ? 76  LYS F CE  1 
ATOM   7921 N NZ  . LYS F 3 76  ? -108.312 -10.417 -110.555 1.00 125.81 ? 76  LYS F NZ  1 
ATOM   7922 N N   . ASN F 3 77  ? -109.490 -17.323 -107.558 1.00 127.01 ? 77  ASN F N   1 
ATOM   7923 C CA  . ASN F 3 77  ? -109.243 -18.642 -106.949 1.00 126.77 ? 77  ASN F CA  1 
ATOM   7924 C C   . ASN F 3 77  ? -109.455 -18.731 -105.426 1.00 126.48 ? 77  ASN F C   1 
ATOM   7925 O O   . ASN F 3 77  ? -108.717 -19.418 -104.708 1.00 126.35 ? 77  ASN F O   1 
ATOM   7926 C CB  . ASN F 3 77  ? -107.876 -19.196 -107.389 1.00 126.66 ? 77  ASN F CB  1 
ATOM   7927 C CG  . ASN F 3 77  ? -107.883 -19.693 -108.831 1.00 126.47 ? 77  ASN F CG  1 
ATOM   7928 O OD1 . ASN F 3 77  ? -108.847 -19.492 -109.575 1.00 126.17 ? 77  ASN F OD1 1 
ATOM   7929 N ND2 . ASN F 3 77  ? -106.804 -20.353 -109.227 1.00 126.22 ? 77  ASN F ND2 1 
ATOM   7930 N N   . THR F 3 78  ? -110.490 -18.038 -104.958 1.00 126.11 ? 78  THR F N   1 
ATOM   7931 C CA  . THR F 3 78  ? -110.813 -17.985 -103.535 1.00 125.78 ? 78  THR F CA  1 
ATOM   7932 C C   . THR F 3 78  ? -112.254 -18.420 -103.252 1.00 125.28 ? 78  THR F C   1 
ATOM   7933 O O   . THR F 3 78  ? -113.180 -18.099 -104.011 1.00 125.24 ? 78  THR F O   1 
ATOM   7934 C CB  . THR F 3 78  ? -110.563 -16.568 -102.928 1.00 125.85 ? 78  THR F CB  1 
ATOM   7935 O OG1 . THR F 3 78  ? -111.132 -15.573 -103.784 1.00 126.07 ? 78  THR F OG1 1 
ATOM   7936 C CG2 . THR F 3 78  ? -109.069 -16.283 -102.762 1.00 125.98 ? 78  THR F CG2 1 
ATOM   7937 N N   . LEU F 3 79  ? -112.412 -19.168 -102.158 1.00 124.52 ? 79  LEU F N   1 
ATOM   7938 C CA  . LEU F 3 79  ? -113.710 -19.547 -101.608 1.00 123.59 ? 79  LEU F CA  1 
ATOM   7939 C C   . LEU F 3 79  ? -113.979 -18.735 -100.342 1.00 122.94 ? 79  LEU F C   1 
ATOM   7940 O O   . LEU F 3 79  ? -113.051 -18.369 -99.617  1.00 122.81 ? 79  LEU F O   1 
ATOM   7941 C CB  . LEU F 3 79  ? -113.731 -21.044 -101.286 1.00 123.62 ? 79  LEU F CB  1 
ATOM   7942 C CG  . LEU F 3 79  ? -115.099 -21.700 -101.068 1.00 123.94 ? 79  LEU F CG  1 
ATOM   7943 C CD1 . LEU F 3 79  ? -115.994 -21.564 -102.295 1.00 123.75 ? 79  LEU F CD1 1 
ATOM   7944 C CD2 . LEU F 3 79  ? -114.949 -23.160 -100.676 1.00 124.19 ? 79  LEU F CD2 1 
ATOM   7945 N N   . TYR F 3 80  ? -115.245 -18.439 -100.075 1.00 122.18 ? 80  TYR F N   1 
ATOM   7946 C CA  . TYR F 3 80  ? -115.591 -17.695 -98.866  1.00 121.58 ? 80  TYR F CA  1 
ATOM   7947 C C   . TYR F 3 80  ? -116.768 -18.320 -98.128  1.00 120.58 ? 80  TYR F C   1 
ATOM   7948 O O   . TYR F 3 80  ? -117.693 -18.857 -98.756  1.00 120.39 ? 80  TYR F O   1 
ATOM   7949 C CB  . TYR F 3 80  ? -115.900 -16.215 -99.175  1.00 122.07 ? 80  TYR F CB  1 
ATOM   7950 C CG  . TYR F 3 80  ? -114.972 -15.563 -100.183 1.00 123.30 ? 80  TYR F CG  1 
ATOM   7951 C CD1 . TYR F 3 80  ? -113.673 -15.182 -99.816  1.00 124.33 ? 80  TYR F CD1 1 
ATOM   7952 C CD2 . TYR F 3 80  ? -115.391 -15.328 -101.505 1.00 123.45 ? 80  TYR F CD2 1 
ATOM   7953 C CE1 . TYR F 3 80  ? -112.807 -14.594 -100.739 1.00 124.52 ? 80  TYR F CE1 1 
ATOM   7954 C CE2 . TYR F 3 80  ? -114.535 -14.741 -102.435 1.00 123.87 ? 80  TYR F CE2 1 
ATOM   7955 C CZ  . TYR F 3 80  ? -113.246 -14.374 -102.040 1.00 124.40 ? 80  TYR F CZ  1 
ATOM   7956 O OH  . TYR F 3 80  ? -112.386 -13.789 -102.936 1.00 124.49 ? 80  TYR F OH  1 
ATOM   7957 N N   . LEU F 3 81  ? -116.711 -18.252 -96.796  1.00 119.24 ? 81  LEU F N   1 
ATOM   7958 C CA  . LEU F 3 81  ? -117.861 -18.537 -95.945  1.00 117.97 ? 81  LEU F CA  1 
ATOM   7959 C C   . LEU F 3 81  ? -118.223 -17.289 -95.142  1.00 117.00 ? 81  LEU F C   1 
ATOM   7960 O O   . LEU F 3 81  ? -117.437 -16.801 -94.328  1.00 116.84 ? 81  LEU F O   1 
ATOM   7961 C CB  . LEU F 3 81  ? -117.606 -19.752 -95.033  1.00 118.00 ? 81  LEU F CB  1 
ATOM   7962 C CG  . LEU F 3 81  ? -118.790 -20.386 -94.274  1.00 117.65 ? 81  LEU F CG  1 
ATOM   7963 C CD1 . LEU F 3 81  ? -120.018 -20.586 -95.151  1.00 117.29 ? 81  LEU F CD1 1 
ATOM   7964 C CD2 . LEU F 3 81  ? -118.394 -21.702 -93.635  1.00 117.24 ? 81  LEU F CD2 1 
ATOM   7965 N N   . GLN F 3 82  ? -119.414 -16.765 -95.395  1.00 115.77 ? 82  GLN F N   1 
ATOM   7966 C CA  . GLN F 3 82  ? -119.868 -15.572 -94.709  1.00 114.69 ? 82  GLN F CA  1 
ATOM   7967 C C   . GLN F 3 82  ? -120.804 -15.979 -93.589  1.00 113.94 ? 82  GLN F C   1 
ATOM   7968 O O   . GLN F 3 82  ? -121.918 -16.452 -93.843  1.00 113.91 ? 82  GLN F O   1 
ATOM   7969 C CB  . GLN F 3 82  ? -120.605 -14.650 -95.677  1.00 114.80 ? 82  GLN F CB  1 
ATOM   7970 C CG  . GLN F 3 82  ? -120.167 -13.191 -95.651  1.00 114.51 ? 82  GLN F CG  1 
ATOM   7971 C CD  . GLN F 3 82  ? -120.003 -12.599 -94.257  1.00 114.09 ? 82  GLN F CD  1 
ATOM   7972 O OE1 . GLN F 3 82  ? -120.300 -13.229 -93.248  1.00 113.39 ? 82  GLN F OE1 1 
ATOM   7973 N NE2 . GLN F 3 82  ? -119.519 -11.368 -94.208  1.00 115.01 ? 82  GLN F NE2 1 
ATOM   7974 N N   . MET F 3 83  ? -120.358 -15.774 -92.351  1.00 112.84 ? 83  MET F N   1 
ATOM   7975 C CA  . MET F 3 83  ? -121.112 -16.221 -91.174  1.00 111.84 ? 83  MET F CA  1 
ATOM   7976 C C   . MET F 3 83  ? -121.726 -15.092 -90.361  1.00 110.95 ? 83  MET F C   1 
ATOM   7977 O O   . MET F 3 83  ? -121.069 -14.109 -90.049  1.00 110.76 ? 83  MET F O   1 
ATOM   7978 C CB  . MET F 3 83  ? -120.219 -17.077 -90.289  1.00 112.00 ? 83  MET F CB  1 
ATOM   7979 C CG  . MET F 3 83  ? -119.872 -18.399 -90.921  1.00 112.36 ? 83  MET F CG  1 
ATOM   7980 S SD  . MET F 3 83  ? -118.362 -19.154 -90.316  1.00 113.44 ? 83  MET F SD  1 
ATOM   7981 C CE  . MET F 3 83  ? -118.634 -19.238 -88.547  1.00 113.04 ? 83  MET F CE  1 
ATOM   7982 N N   . SER F 3 84  ? -122.992 -15.243 -90.010  1.00 110.06 ? 84  SER F N   1 
ATOM   7983 C CA  . SER F 3 84  ? -123.708 -14.166 -89.341  1.00 109.50 ? 84  SER F CA  1 
ATOM   7984 C C   . SER F 3 84  ? -124.819 -14.689 -88.443  1.00 108.95 ? 84  SER F C   1 
ATOM   7985 O O   . SER F 3 84  ? -125.189 -15.863 -88.535  1.00 109.06 ? 84  SER F O   1 
ATOM   7986 C CB  . SER F 3 84  ? -124.262 -13.199 -90.378  1.00 109.59 ? 84  SER F CB  1 
ATOM   7987 O OG  . SER F 3 84  ? -124.461 -13.872 -91.606  1.00 110.14 ? 84  SER F OG  1 
ATOM   7988 N N   . SER F 3 85  ? -125.353 -13.812 -87.589  1.00 108.10 ? 85  SER F N   1 
ATOM   7989 C CA  . SER F 3 85  ? -126.238 -14.213 -86.491  1.00 107.39 ? 85  SER F CA  1 
ATOM   7990 C C   . SER F 3 85  ? -125.679 -15.499 -85.907  1.00 106.60 ? 85  SER F C   1 
ATOM   7991 O O   . SER F 3 85  ? -126.283 -16.569 -85.996  1.00 106.42 ? 85  SER F O   1 
ATOM   7992 C CB  . SER F 3 85  ? -127.702 -14.364 -86.942  1.00 107.59 ? 85  SER F CB  1 
ATOM   7993 O OG  . SER F 3 85  ? -127.869 -15.415 -87.883  1.00 108.24 ? 85  SER F OG  1 
ATOM   7994 N N   . LEU F 3 86  ? -124.489 -15.366 -85.336  1.00 105.89 ? 86  LEU F N   1 
ATOM   7995 C CA  . LEU F 3 86  ? -123.681 -16.508 -84.944  1.00 105.14 ? 86  LEU F CA  1 
ATOM   7996 C C   . LEU F 3 86  ? -124.140 -17.172 -83.649  1.00 104.91 ? 86  LEU F C   1 
ATOM   7997 O O   . LEU F 3 86  ? -124.397 -16.512 -82.642  1.00 104.60 ? 86  LEU F O   1 
ATOM   7998 C CB  . LEU F 3 86  ? -122.198 -16.120 -84.875  1.00 104.87 ? 86  LEU F CB  1 
ATOM   7999 C CG  . LEU F 3 86  ? -121.487 -15.979 -86.221  1.00 103.66 ? 86  LEU F CG  1 
ATOM   8000 C CD1 . LEU F 3 86  ? -120.090 -15.415 -86.053  1.00 103.35 ? 86  LEU F CD1 1 
ATOM   8001 C CD2 . LEU F 3 86  ? -121.424 -17.312 -86.911  1.00 102.59 ? 86  LEU F CD2 1 
ATOM   8002 N N   . LYS F 3 87  ? -124.258 -18.493 -83.717  1.00 104.68 ? 87  LYS F N   1 
ATOM   8003 C CA  . LYS F 3 87  ? -124.540 -19.316 -82.563  1.00 104.55 ? 87  LYS F CA  1 
ATOM   8004 C C   . LYS F 3 87  ? -123.223 -19.834 -81.975  1.00 104.76 ? 87  LYS F C   1 
ATOM   8005 O O   . LYS F 3 87  ? -122.225 -20.002 -82.698  1.00 104.90 ? 87  LYS F O   1 
ATOM   8006 C CB  . LYS F 3 87  ? -125.454 -20.477 -82.962  1.00 104.42 ? 87  LYS F CB  1 
ATOM   8007 C CG  . LYS F 3 87  ? -126.912 -20.076 -83.179  1.00 104.33 ? 87  LYS F CG  1 
ATOM   8008 C CD  . LYS F 3 87  ? -127.764 -21.217 -83.743  1.00 104.13 ? 87  LYS F CD  1 
ATOM   8009 C CE  . LYS F 3 87  ? -129.239 -20.825 -83.817  1.00 104.19 ? 87  LYS F CE  1 
ATOM   8010 N NZ  . LYS F 3 87  ? -129.946 -21.309 -85.049  1.00 104.00 ? 87  LYS F NZ  1 
ATOM   8011 N N   . SER F 3 88  ? -123.230 -20.062 -80.657  1.00 104.69 ? 88  SER F N   1 
ATOM   8012 C CA  . SER F 3 88  ? -122.133 -20.702 -79.922  1.00 104.23 ? 88  SER F CA  1 
ATOM   8013 C C   . SER F 3 88  ? -121.729 -22.015 -80.575  1.00 104.14 ? 88  SER F C   1 
ATOM   8014 O O   . SER F 3 88  ? -120.549 -22.364 -80.587  1.00 103.74 ? 88  SER F O   1 
ATOM   8015 C CB  . SER F 3 88  ? -122.590 -20.996 -78.500  1.00 104.25 ? 88  SER F CB  1 
ATOM   8016 O OG  . SER F 3 88  ? -123.704 -21.883 -78.516  1.00 104.21 ? 88  SER F OG  1 
ATOM   8017 N N   . GLU F 3 89  ? -122.735 -22.726 -81.101  1.00 104.16 ? 89  GLU F N   1 
ATOM   8018 C CA  . GLU F 3 89  ? -122.572 -23.997 -81.817  1.00 104.30 ? 89  GLU F CA  1 
ATOM   8019 C C   . GLU F 3 89  ? -121.572 -23.924 -82.977  1.00 104.15 ? 89  GLU F C   1 
ATOM   8020 O O   . GLU F 3 89  ? -120.870 -24.895 -83.274  1.00 104.07 ? 89  GLU F O   1 
ATOM   8021 C CB  . GLU F 3 89  ? -123.911 -24.479 -82.387  1.00 104.32 ? 89  GLU F CB  1 
ATOM   8022 C CG  . GLU F 3 89  ? -125.153 -24.216 -81.552  1.00 105.17 ? 89  GLU F CG  1 
ATOM   8023 C CD  . GLU F 3 89  ? -126.404 -24.903 -82.138  1.00 107.01 ? 89  GLU F CD  1 
ATOM   8024 O OE1 . GLU F 3 89  ? -126.544 -24.995 -83.386  1.00 105.91 ? 89  GLU F OE1 1 
ATOM   8025 O OE2 . GLU F 3 89  ? -127.257 -25.355 -81.338  1.00 108.55 ? 89  GLU F OE2 1 
ATOM   8026 N N   . ASP F 3 90  ? -121.518 -22.774 -83.637  1.00 104.03 ? 90  ASP F N   1 
ATOM   8027 C CA  . ASP F 3 90  ? -120.690 -22.624 -84.821  1.00 104.14 ? 90  ASP F CA  1 
ATOM   8028 C C   . ASP F 3 90  ? -119.190 -22.608 -84.505  1.00 103.99 ? 90  ASP F C   1 
ATOM   8029 O O   . ASP F 3 90  ? -118.362 -22.647 -85.413  1.00 104.35 ? 90  ASP F O   1 
ATOM   8030 C CB  . ASP F 3 90  ? -121.134 -21.405 -85.625  1.00 104.25 ? 90  ASP F CB  1 
ATOM   8031 C CG  . ASP F 3 90  ? -122.603 -21.483 -86.027  1.00 105.45 ? 90  ASP F CG  1 
ATOM   8032 O OD1 . ASP F 3 90  ? -122.996 -22.454 -86.715  1.00 105.64 ? 90  ASP F OD1 1 
ATOM   8033 O OD2 . ASP F 3 90  ? -123.376 -20.573 -85.643  1.00 106.79 ? 90  ASP F OD2 1 
ATOM   8034 N N   . THR F 3 91  ? -118.846 -22.560 -83.218  1.00 103.58 ? 91  THR F N   1 
ATOM   8035 C CA  . THR F 3 91  ? -117.475 -22.783 -82.763  1.00 102.78 ? 91  THR F CA  1 
ATOM   8036 C C   . THR F 3 91  ? -116.986 -24.085 -83.367  1.00 102.63 ? 91  THR F C   1 
ATOM   8037 O O   . THR F 3 91  ? -117.694 -25.095 -83.340  1.00 102.40 ? 91  THR F O   1 
ATOM   8038 C CB  . THR F 3 91  ? -117.413 -22.875 -81.227  1.00 102.67 ? 91  THR F CB  1 
ATOM   8039 O OG1 . THR F 3 91  ? -117.873 -21.641 -80.660  1.00 102.33 ? 91  THR F OG1 1 
ATOM   8040 C CG2 . THR F 3 91  ? -115.995 -23.198 -80.734  1.00 101.77 ? 91  THR F CG2 1 
ATOM   8041 N N   . ALA F 3 92  ? -115.787 -24.040 -83.935  1.00 102.56 ? 92  ALA F N   1 
ATOM   8042 C CA  . ALA F 3 92  ? -115.178 -25.186 -84.590  1.00 102.79 ? 92  ALA F CA  1 
ATOM   8043 C C   . ALA F 3 92  ? -113.983 -24.737 -85.397  1.00 103.05 ? 92  ALA F C   1 
ATOM   8044 O O   . ALA F 3 92  ? -113.847 -23.554 -85.713  1.00 103.07 ? 92  ALA F O   1 
ATOM   8045 C CB  . ALA F 3 92  ? -116.174 -25.869 -85.506  1.00 102.78 ? 92  ALA F CB  1 
ATOM   8046 N N   . MET F 3 93  ? -113.112 -25.690 -85.717  1.00 103.36 ? 93  MET F N   1 
ATOM   8047 C CA  . MET F 3 93  ? -112.090 -25.490 -86.730  1.00 103.70 ? 93  MET F CA  1 
ATOM   8048 C C   . MET F 3 93  ? -112.781 -25.779 -88.071  1.00 104.09 ? 93  MET F C   1 
ATOM   8049 O O   . MET F 3 93  ? -113.487 -26.780 -88.206  1.00 104.11 ? 93  MET F O   1 
ATOM   8050 C CB  . MET F 3 93  ? -110.905 -26.417 -86.465  1.00 103.45 ? 93  MET F CB  1 
ATOM   8051 C CG  . MET F 3 93  ? -109.913 -26.530 -87.598  1.00 103.86 ? 93  MET F CG  1 
ATOM   8052 S SD  . MET F 3 93  ? -108.533 -25.378 -87.548  1.00 104.94 ? 93  MET F SD  1 
ATOM   8053 C CE  . MET F 3 93  ? -107.254 -26.308 -86.681  1.00 104.58 ? 93  MET F CE  1 
ATOM   8054 N N   . TYR F 3 94  ? -112.608 -24.879 -89.040  1.00 104.61 ? 94  TYR F N   1 
ATOM   8055 C CA  . TYR F 3 94  ? -113.384 -24.902 -90.288  1.00 105.06 ? 94  TYR F CA  1 
ATOM   8056 C C   . TYR F 3 94  ? -112.532 -25.276 -91.481  1.00 106.25 ? 94  TYR F C   1 
ATOM   8057 O O   . TYR F 3 94  ? -111.661 -24.501 -91.870  1.00 106.64 ? 94  TYR F O   1 
ATOM   8058 C CB  . TYR F 3 94  ? -113.997 -23.526 -90.547  1.00 104.28 ? 94  TYR F CB  1 
ATOM   8059 C CG  . TYR F 3 94  ? -115.302 -23.287 -89.842  1.00 102.02 ? 94  TYR F CG  1 
ATOM   8060 C CD1 . TYR F 3 94  ? -115.339 -22.831 -88.528  1.00 99.69  ? 94  TYR F CD1 1 
ATOM   8061 C CD2 . TYR F 3 94  ? -116.503 -23.510 -90.493  1.00 100.08 ? 94  TYR F CD2 1 
ATOM   8062 C CE1 . TYR F 3 94  ? -116.541 -22.607 -87.885  1.00 98.14  ? 94  TYR F CE1 1 
ATOM   8063 C CE2 . TYR F 3 94  ? -117.708 -23.295 -89.857  1.00 98.85  ? 94  TYR F CE2 1 
ATOM   8064 C CZ  . TYR F 3 94  ? -117.725 -22.844 -88.555  1.00 97.83  ? 94  TYR F CZ  1 
ATOM   8065 O OH  . TYR F 3 94  ? -118.941 -22.629 -87.945  1.00 96.69  ? 94  TYR F OH  1 
ATOM   8066 N N   . TYR F 3 95  ? -112.795 -26.440 -92.074  1.00 107.49 ? 95  TYR F N   1 
ATOM   8067 C CA  . TYR F 3 95  ? -111.977 -26.955 -93.184  1.00 108.83 ? 95  TYR F CA  1 
ATOM   8068 C C   . TYR F 3 95  ? -112.598 -26.726 -94.566  1.00 109.73 ? 95  TYR F C   1 
ATOM   8069 O O   . TYR F 3 95  ? -113.683 -27.244 -94.866  1.00 110.18 ? 95  TYR F O   1 
ATOM   8070 C CB  . TYR F 3 95  ? -111.688 -28.454 -93.009  1.00 108.81 ? 95  TYR F CB  1 
ATOM   8071 C CG  . TYR F 3 95  ? -110.979 -28.823 -91.723  1.00 109.38 ? 95  TYR F CG  1 
ATOM   8072 C CD1 . TYR F 3 95  ? -111.696 -29.035 -90.545  1.00 109.56 ? 95  TYR F CD1 1 
ATOM   8073 C CD2 . TYR F 3 95  ? -109.593 -28.980 -91.686  1.00 109.95 ? 95  TYR F CD2 1 
ATOM   8074 C CE1 . TYR F 3 95  ? -111.051 -29.384 -89.364  1.00 109.91 ? 95  TYR F CE1 1 
ATOM   8075 C CE2 . TYR F 3 95  ? -108.933 -29.333 -90.502  1.00 109.80 ? 95  TYR F CE2 1 
ATOM   8076 C CZ  . TYR F 3 95  ? -109.670 -29.531 -89.349  1.00 109.98 ? 95  TYR F CZ  1 
ATOM   8077 O OH  . TYR F 3 95  ? -109.040 -29.869 -88.173  1.00 110.45 ? 95  TYR F OH  1 
ATOM   8078 N N   . CYS F 3 96  ? -111.902 -25.957 -95.404  1.00 110.55 ? 96  CYS F N   1 
ATOM   8079 C CA  . CYS F 3 96  ? -112.242 -25.843 -96.816  1.00 111.47 ? 96  CYS F CA  1 
ATOM   8080 C C   . CYS F 3 96  ? -111.757 -27.115 -97.493  1.00 111.62 ? 96  CYS F C   1 
ATOM   8081 O O   . CYS F 3 96  ? -110.561 -27.422 -97.490  1.00 111.53 ? 96  CYS F O   1 
ATOM   8082 C CB  . CYS F 3 96  ? -111.596 -24.589 -97.415  1.00 111.80 ? 96  CYS F CB  1 
ATOM   8083 S SG  . CYS F 3 96  ? -111.497 -24.391 -99.257  1.00 114.51 ? 96  CYS F SG  1 
ATOM   8084 N N   . ALA F 3 97  ? -112.703 -27.878 -98.028  1.00 111.98 ? 97  ALA F N   1 
ATOM   8085 C CA  . ALA F 3 97  ? -112.390 -29.129 -98.706  1.00 112.33 ? 97  ALA F CA  1 
ATOM   8086 C C   . ALA F 3 97  ? -113.028 -29.160 -100.090 1.00 112.63 ? 97  ALA F C   1 
ATOM   8087 O O   . ALA F 3 97  ? -113.922 -28.363 -100.390 1.00 112.73 ? 97  ALA F O   1 
ATOM   8088 C CB  . ALA F 3 97  ? -112.845 -30.306 -97.877  1.00 112.24 ? 97  ALA F CB  1 
ATOM   8089 N N   . ARG F 3 98  ? -112.565 -30.083 -100.927 1.00 113.01 ? 98  ARG F N   1 
ATOM   8090 C CA  . ARG F 3 98  ? -112.929 -30.089 -102.335 1.00 113.41 ? 98  ARG F CA  1 
ATOM   8091 C C   . ARG F 3 98  ? -113.399 -31.458 -102.785 1.00 113.69 ? 98  ARG F C   1 
ATOM   8092 O O   . ARG F 3 98  ? -112.659 -32.441 -102.682 1.00 113.61 ? 98  ARG F O   1 
ATOM   8093 C CB  . ARG F 3 98  ? -111.742 -29.638 -103.193 1.00 113.50 ? 98  ARG F CB  1 
ATOM   8094 C CG  . ARG F 3 98  ? -112.083 -29.425 -104.663 1.00 113.31 ? 98  ARG F CG  1 
ATOM   8095 C CD  . ARG F 3 98  ? -110.852 -29.500 -105.546 1.00 112.82 ? 98  ARG F CD  1 
ATOM   8096 N NE  . ARG F 3 98  ? -110.221 -30.816 -105.509 1.00 112.05 ? 98  ARG F NE  1 
ATOM   8097 C CZ  . ARG F 3 98  ? -109.242 -31.203 -106.319 1.00 111.63 ? 98  ARG F CZ  1 
ATOM   8098 N NH1 . ARG F 3 98  ? -108.768 -30.375 -107.250 1.00 110.71 ? 98  ARG F NH1 1 
ATOM   8099 N NH2 . ARG F 3 98  ? -108.742 -32.426 -106.190 1.00 111.09 ? 98  ARG F NH2 1 
ATOM   8100 N N   . PRO F 3 99  ? -114.625 -31.517 -103.315 1.00 114.03 ? 99  PRO F N   1 
ATOM   8101 C CA  . PRO F 3 99  ? -115.239 -32.768 -103.750 1.00 114.65 ? 99  PRO F CA  1 
ATOM   8102 C C   . PRO F 3 99  ? -114.539 -33.320 -104.980 1.00 115.37 ? 99  PRO F C   1 
ATOM   8103 O O   . PRO F 3 99  ? -114.140 -32.557 -105.850 1.00 115.59 ? 99  PRO F O   1 
ATOM   8104 C CB  . PRO F 3 99  ? -116.674 -32.357 -104.105 1.00 114.62 ? 99  PRO F CB  1 
ATOM   8105 C CG  . PRO F 3 99  ? -116.811 -30.911 -103.674 1.00 114.34 ? 99  PRO F CG  1 
ATOM   8106 C CD  . PRO F 3 99  ? -115.450 -30.344 -103.640 1.00 113.74 ? 99  PRO F CD  1 
ATOM   8107 N N   . ASP F 3 100 ? -114.388 -34.636 -105.054 1.00 116.31 ? 100 ASP F N   1 
ATOM   8108 C CA  . ASP F 3 100 ? -113.773 -35.264 -106.224 1.00 117.19 ? 100 ASP F CA  1 
ATOM   8109 C C   . ASP F 3 100 ? -114.720 -35.202 -107.422 1.00 117.71 ? 100 ASP F C   1 
ATOM   8110 O O   . ASP F 3 100 ? -115.940 -35.287 -107.277 1.00 117.38 ? 100 ASP F O   1 
ATOM   8111 C CB  . ASP F 3 100 ? -113.383 -36.721 -105.923 1.00 117.32 ? 100 ASP F CB  1 
ATOM   8112 C CG  . ASP F 3 100 ? -111.967 -37.078 -106.396 1.00 117.51 ? 100 ASP F CG  1 
ATOM   8113 O OD1 . ASP F 3 100 ? -111.382 -36.337 -107.222 1.00 117.16 ? 100 ASP F OD1 1 
ATOM   8114 O OD2 . ASP F 3 100 ? -111.439 -38.117 -105.931 1.00 117.78 ? 100 ASP F OD2 1 
ATOM   8115 N N   . TYR F 3 101 ? -114.126 -35.021 -108.596 1.00 118.76 ? 101 TYR F N   1 
ATOM   8116 C CA  . TYR F 3 101 ? -114.802 -35.085 -109.902 1.00 119.90 ? 101 TYR F CA  1 
ATOM   8117 C C   . TYR F 3 101 ? -116.212 -35.718 -109.902 1.00 120.20 ? 101 TYR F C   1 
ATOM   8118 O O   . TYR F 3 101 ? -117.206 -35.038 -110.173 1.00 120.24 ? 101 TYR F O   1 
ATOM   8119 C CB  . TYR F 3 101 ? -113.875 -35.788 -110.923 1.00 120.16 ? 101 TYR F CB  1 
ATOM   8120 C CG  . TYR F 3 101 ? -113.554 -37.250 -110.591 1.00 121.41 ? 101 TYR F CG  1 
ATOM   8121 C CD1 . TYR F 3 101 ? -113.448 -38.211 -111.597 1.00 122.01 ? 101 TYR F CD1 1 
ATOM   8122 C CD2 . TYR F 3 101 ? -113.382 -37.669 -109.266 1.00 122.02 ? 101 TYR F CD2 1 
ATOM   8123 C CE1 . TYR F 3 101 ? -113.169 -39.545 -111.287 1.00 122.87 ? 101 TYR F CE1 1 
ATOM   8124 C CE2 . TYR F 3 101 ? -113.111 -38.987 -108.948 1.00 122.64 ? 101 TYR F CE2 1 
ATOM   8125 C CZ  . TYR F 3 101 ? -113.004 -39.922 -109.955 1.00 123.16 ? 101 TYR F CZ  1 
ATOM   8126 O OH  . TYR F 3 101 ? -112.733 -41.233 -109.619 1.00 123.87 ? 101 TYR F OH  1 
ATOM   8127 N N   . ARG F 3 102 ? -116.284 -37.006 -109.572 1.00 120.52 ? 102 ARG F N   1 
ATOM   8128 C CA  . ARG F 3 102 ? -117.485 -37.809 -109.756 1.00 120.96 ? 102 ARG F CA  1 
ATOM   8129 C C   . ARG F 3 102 ? -117.930 -38.433 -108.451 1.00 121.02 ? 102 ARG F C   1 
ATOM   8130 O O   . ARG F 3 102 ? -119.121 -38.607 -108.214 1.00 121.18 ? 102 ARG F O   1 
ATOM   8131 C CB  . ARG F 3 102 ? -117.192 -38.948 -110.714 1.00 121.13 ? 102 ARG F CB  1 
ATOM   8132 C CG  . ARG F 3 102 ? -117.066 -38.588 -112.169 1.00 122.54 ? 102 ARG F CG  1 
ATOM   8133 C CD  . ARG F 3 102 ? -116.289 -39.698 -112.854 1.00 124.82 ? 102 ARG F CD  1 
ATOM   8134 N NE  . ARG F 3 102 ? -116.596 -39.850 -114.271 1.00 126.47 ? 102 ARG F NE  1 
ATOM   8135 C CZ  . ARG F 3 102 ? -116.070 -40.796 -115.043 1.00 127.71 ? 102 ARG F CZ  1 
ATOM   8136 N NH1 . ARG F 3 102 ? -115.213 -41.675 -114.526 1.00 128.10 ? 102 ARG F NH1 1 
ATOM   8137 N NH2 . ARG F 3 102 ? -116.404 -40.869 -116.331 1.00 128.16 ? 102 ARG F NH2 1 
ATOM   8138 N N   . SER F 3 103 ? -116.954 -38.803 -107.627 1.00 121.04 ? 103 SER F N   1 
ATOM   8139 C CA  . SER F 3 103 ? -117.194 -39.419 -106.328 1.00 120.98 ? 103 SER F CA  1 
ATOM   8140 C C   . SER F 3 103 ? -117.770 -38.418 -105.333 1.00 120.96 ? 103 SER F C   1 
ATOM   8141 O O   . SER F 3 103 ? -118.458 -38.798 -104.382 1.00 120.96 ? 103 SER F O   1 
ATOM   8142 C CB  . SER F 3 103 ? -115.879 -39.948 -105.776 1.00 120.97 ? 103 SER F CB  1 
ATOM   8143 O OG  . SER F 3 103 ? -115.193 -40.687 -106.765 1.00 121.57 ? 103 SER F OG  1 
ATOM   8144 N N   . TYR F 3 104 ? -117.470 -37.138 -105.555 1.00 120.90 ? 104 TYR F N   1 
ATOM   8145 C CA  . TYR F 3 104 ? -117.818 -36.063 -104.626 1.00 120.57 ? 104 TYR F CA  1 
ATOM   8146 C C   . TYR F 3 104 ? -117.127 -36.248 -103.283 1.00 120.20 ? 104 TYR F C   1 
ATOM   8147 O O   . TYR F 3 104 ? -117.183 -35.381 -102.409 1.00 120.31 ? 104 TYR F O   1 
ATOM   8148 C CB  . TYR F 3 104 ? -119.330 -35.950 -104.471 1.00 120.58 ? 104 TYR F CB  1 
ATOM   8149 C CG  . TYR F 3 104 ? -119.985 -35.351 -105.688 1.00 120.94 ? 104 TYR F CG  1 
ATOM   8150 C CD1 . TYR F 3 104 ? -120.546 -36.162 -106.679 1.00 120.66 ? 104 TYR F CD1 1 
ATOM   8151 C CD2 . TYR F 3 104 ? -120.041 -33.964 -105.853 1.00 121.36 ? 104 TYR F CD2 1 
ATOM   8152 C CE1 . TYR F 3 104 ? -121.156 -35.606 -107.798 1.00 121.09 ? 104 TYR F CE1 1 
ATOM   8153 C CE2 . TYR F 3 104 ? -120.647 -33.398 -106.967 1.00 121.48 ? 104 TYR F CE2 1 
ATOM   8154 C CZ  . TYR F 3 104 ? -121.200 -34.221 -107.934 1.00 121.50 ? 104 TYR F CZ  1 
ATOM   8155 O OH  . TYR F 3 104 ? -121.786 -33.642 -109.035 1.00 121.94 ? 104 TYR F OH  1 
ATOM   8156 N N   . ALA F 3 105 ? -116.468 -37.392 -103.146 1.00 119.58 ? 105 ALA F N   1 
ATOM   8157 C CA  . ALA F 3 105 ? -115.607 -37.669 -102.026 1.00 119.16 ? 105 ALA F CA  1 
ATOM   8158 C C   . ALA F 3 105 ? -114.572 -36.566 -101.938 1.00 118.78 ? 105 ALA F C   1 
ATOM   8159 O O   . ALA F 3 105 ? -113.776 -36.389 -102.852 1.00 118.81 ? 105 ALA F O   1 
ATOM   8160 C CB  . ALA F 3 105 ? -114.939 -38.981 -102.243 1.00 119.41 ? 105 ALA F CB  1 
ATOM   8161 N N   . MET F 3 106 ? -114.595 -35.817 -100.844 1.00 118.33 ? 106 MET F N   1 
ATOM   8162 C CA  . MET F 3 106 ? -113.705 -34.674 -100.686 1.00 118.01 ? 106 MET F CA  1 
ATOM   8163 C C   . MET F 3 106 ? -112.244 -35.107 -100.685 1.00 117.79 ? 106 MET F C   1 
ATOM   8164 O O   . MET F 3 106 ? -111.686 -35.434 -99.634  1.00 117.87 ? 106 MET F O   1 
ATOM   8165 C CB  . MET F 3 106 ? -114.045 -33.910 -99.410  1.00 118.01 ? 106 MET F CB  1 
ATOM   8166 C CG  . MET F 3 106 ? -115.391 -33.220 -99.449  1.00 117.90 ? 106 MET F CG  1 
ATOM   8167 S SD  . MET F 3 106 ? -116.112 -33.144 -97.804  1.00 117.96 ? 106 MET F SD  1 
ATOM   8168 C CE  . MET F 3 106 ? -117.488 -32.042 -98.089  1.00 118.11 ? 106 MET F CE  1 
ATOM   8169 N N   . ASP F 3 107 ? -111.629 -35.112 -101.868 1.00 117.46 ? 107 ASP F N   1 
ATOM   8170 C CA  . ASP F 3 107 ? -110.276 -35.654 -102.008 1.00 117.15 ? 107 ASP F CA  1 
ATOM   8171 C C   . ASP F 3 107 ? -109.151 -34.676 -101.666 1.00 116.56 ? 107 ASP F C   1 
ATOM   8172 O O   . ASP F 3 107 ? -108.038 -35.101 -101.373 1.00 116.40 ? 107 ASP F O   1 
ATOM   8173 C CB  . ASP F 3 107 ? -110.057 -36.414 -103.349 1.00 117.46 ? 107 ASP F CB  1 
ATOM   8174 C CG  . ASP F 3 107 ? -110.014 -35.502 -104.590 1.00 118.49 ? 107 ASP F CG  1 
ATOM   8175 O OD1 . ASP F 3 107 ? -110.830 -34.557 -104.695 1.00 120.28 ? 107 ASP F OD1 1 
ATOM   8176 O OD2 . ASP F 3 107 ? -109.185 -35.773 -105.499 1.00 118.62 ? 107 ASP F OD2 1 
ATOM   8177 N N   . TYR F 3 108 ? -109.434 -33.379 -101.662 1.00 116.09 ? 108 TYR F N   1 
ATOM   8178 C CA  . TYR F 3 108 ? -108.418 -32.438 -101.201 1.00 115.98 ? 108 TYR F CA  1 
ATOM   8179 C C   . TYR F 3 108 ? -108.884 -31.433 -100.168 1.00 115.72 ? 108 TYR F C   1 
ATOM   8180 O O   . TYR F 3 108 ? -109.851 -30.699 -100.381 1.00 115.81 ? 108 TYR F O   1 
ATOM   8181 C CB  . TYR F 3 108 ? -107.678 -31.769 -102.356 1.00 116.15 ? 108 TYR F CB  1 
ATOM   8182 C CG  . TYR F 3 108 ? -106.486 -32.580 -102.774 1.00 116.55 ? 108 TYR F CG  1 
ATOM   8183 C CD1 . TYR F 3 108 ? -105.324 -32.600 -101.993 1.00 116.49 ? 108 TYR F CD1 1 
ATOM   8184 C CD2 . TYR F 3 108 ? -106.528 -33.362 -103.929 1.00 117.10 ? 108 TYR F CD2 1 
ATOM   8185 C CE1 . TYR F 3 108 ? -104.228 -33.365 -102.364 1.00 117.15 ? 108 TYR F CE1 1 
ATOM   8186 C CE2 . TYR F 3 108 ? -105.438 -34.137 -104.312 1.00 117.56 ? 108 TYR F CE2 1 
ATOM   8187 C CZ  . TYR F 3 108 ? -104.294 -34.135 -103.526 1.00 117.65 ? 108 TYR F CZ  1 
ATOM   8188 O OH  . TYR F 3 108 ? -103.223 -34.904 -103.915 1.00 118.02 ? 108 TYR F OH  1 
ATOM   8189 N N   . TRP F 3 109 ? -108.156 -31.410 -99.054  1.00 115.25 ? 109 TRP F N   1 
ATOM   8190 C CA  . TRP F 3 109 ? -108.577 -30.714 -97.848  1.00 114.83 ? 109 TRP F CA  1 
ATOM   8191 C C   . TRP F 3 109 ? -107.644 -29.560 -97.485  1.00 115.04 ? 109 TRP F C   1 
ATOM   8192 O O   . TRP F 3 109 ? -106.460 -29.563 -97.842  1.00 114.95 ? 109 TRP F O   1 
ATOM   8193 C CB  . TRP F 3 109 ? -108.636 -31.704 -96.675  1.00 114.57 ? 109 TRP F CB  1 
ATOM   8194 C CG  . TRP F 3 109 ? -109.812 -32.645 -96.678  1.00 112.77 ? 109 TRP F CG  1 
ATOM   8195 C CD1 . TRP F 3 109 ? -109.999 -33.725 -97.492  1.00 111.31 ? 109 TRP F CD1 1 
ATOM   8196 C CD2 . TRP F 3 109 ? -110.944 -32.602 -95.802  1.00 111.75 ? 109 TRP F CD2 1 
ATOM   8197 N NE1 . TRP F 3 109 ? -111.185 -34.346 -97.191  1.00 110.71 ? 109 TRP F NE1 1 
ATOM   8198 C CE2 . TRP F 3 109 ? -111.786 -33.680 -96.154  1.00 111.35 ? 109 TRP F CE2 1 
ATOM   8199 C CE3 . TRP F 3 109 ? -111.336 -31.750 -94.755  1.00 111.89 ? 109 TRP F CE3 1 
ATOM   8200 C CZ2 . TRP F 3 109 ? -113.003 -33.935 -95.493  1.00 111.27 ? 109 TRP F CZ2 1 
ATOM   8201 C CZ3 . TRP F 3 109 ? -112.551 -32.007 -94.093  1.00 111.42 ? 109 TRP F CZ3 1 
ATOM   8202 C CH2 . TRP F 3 109 ? -113.366 -33.091 -94.469  1.00 110.67 ? 109 TRP F CH2 1 
ATOM   8203 N N   . GLY F 3 110 ? -108.191 -28.586 -96.756  1.00 115.12 ? 110 GLY F N   1 
ATOM   8204 C CA  . GLY F 3 110 ? -107.413 -27.470 -96.224  1.00 114.99 ? 110 GLY F CA  1 
ATOM   8205 C C   . GLY F 3 110 ? -106.748 -27.791 -94.899  1.00 114.95 ? 110 GLY F C   1 
ATOM   8206 O O   . GLY F 3 110 ? -106.264 -28.900 -94.693  1.00 115.00 ? 110 GLY F O   1 
ATOM   8207 N N   . GLN F 3 111 ? -106.720 -26.815 -94.000  1.00 114.93 ? 111 GLN F N   1 
ATOM   8208 C CA  . GLN F 3 111 ? -106.028 -26.969 -92.726  1.00 115.01 ? 111 GLN F CA  1 
ATOM   8209 C C   . GLN F 3 111 ? -106.825 -26.362 -91.562  1.00 114.89 ? 111 GLN F C   1 
ATOM   8210 O O   . GLN F 3 111 ? -106.549 -26.638 -90.390  1.00 115.00 ? 111 GLN F O   1 
ATOM   8211 C CB  . GLN F 3 111 ? -104.595 -26.411 -92.823  1.00 115.10 ? 111 GLN F CB  1 
ATOM   8212 C CG  . GLN F 3 111 ? -104.428 -24.891 -92.604  1.00 116.16 ? 111 GLN F CG  1 
ATOM   8213 C CD  . GLN F 3 111 ? -105.372 -24.023 -93.439  1.00 117.13 ? 111 GLN F CD  1 
ATOM   8214 O OE1 . GLN F 3 111 ? -105.300 -23.988 -94.674  1.00 117.62 ? 111 GLN F OE1 1 
ATOM   8215 N NE2 . GLN F 3 111 ? -106.252 -23.305 -92.756  1.00 116.77 ? 111 GLN F NE2 1 
ATOM   8216 N N   . GLY F 3 112 ? -107.814 -25.537 -91.891  1.00 114.64 ? 112 GLY F N   1 
ATOM   8217 C CA  . GLY F 3 112 ? -108.783 -25.069 -90.905  1.00 114.69 ? 112 GLY F CA  1 
ATOM   8218 C C   . GLY F 3 112 ? -108.533 -23.701 -90.305  1.00 114.61 ? 112 GLY F C   1 
ATOM   8219 O O   . GLY F 3 112 ? -107.451 -23.135 -90.463  1.00 114.85 ? 112 GLY F O   1 
ATOM   8220 N N   . THR F 3 113 ? -109.538 -23.178 -89.603  1.00 114.30 ? 113 THR F N   1 
ATOM   8221 C CA  . THR F 3 113 ? -109.427 -21.883 -88.944  1.00 114.20 ? 113 THR F CA  1 
ATOM   8222 C C   . THR F 3 113 ? -110.204 -21.859 -87.641  1.00 114.30 ? 113 THR F C   1 
ATOM   8223 O O   . THR F 3 113 ? -111.409 -22.115 -87.636  1.00 114.52 ? 113 THR F O   1 
ATOM   8224 C CB  . THR F 3 113 ? -110.001 -20.779 -89.809  1.00 114.22 ? 113 THR F CB  1 
ATOM   8225 O OG1 . THR F 3 113 ? -109.663 -21.014 -91.183  1.00 114.26 ? 113 THR F OG1 1 
ATOM   8226 C CG2 . THR F 3 113 ? -109.475 -19.426 -89.347  1.00 114.27 ? 113 THR F CG2 1 
ATOM   8227 N N   . SER F 3 114 ? -109.521 -21.530 -86.545  1.00 114.26 ? 114 SER F N   1 
ATOM   8228 C CA  . SER F 3 114 ? -110.149 -21.475 -85.220  1.00 114.14 ? 114 SER F CA  1 
ATOM   8229 C C   . SER F 3 114 ? -111.303 -20.486 -85.204  1.00 114.11 ? 114 SER F C   1 
ATOM   8230 O O   . SER F 3 114 ? -111.199 -19.390 -85.757  1.00 114.31 ? 114 SER F O   1 
ATOM   8231 C CB  . SER F 3 114 ? -109.128 -21.100 -84.136  1.00 114.14 ? 114 SER F CB  1 
ATOM   8232 O OG  . SER F 3 114 ? -109.768 -20.768 -82.907  1.00 114.17 ? 114 SER F OG  1 
ATOM   8233 N N   . VAL F 3 115 ? -112.408 -20.900 -84.593  1.00 113.86 ? 115 VAL F N   1 
ATOM   8234 C CA  . VAL F 3 115 ? -113.544 -20.024 -84.337  1.00 113.66 ? 115 VAL F CA  1 
ATOM   8235 C C   . VAL F 3 115 ? -114.056 -20.361 -82.949  1.00 113.58 ? 115 VAL F C   1 
ATOM   8236 O O   . VAL F 3 115 ? -113.941 -21.503 -82.492  1.00 113.56 ? 115 VAL F O   1 
ATOM   8237 C CB  . VAL F 3 115 ? -114.695 -20.204 -85.382  1.00 113.77 ? 115 VAL F CB  1 
ATOM   8238 C CG1 . VAL F 3 115 ? -115.916 -19.343 -85.032  1.00 113.34 ? 115 VAL F CG1 1 
ATOM   8239 C CG2 . VAL F 3 115 ? -114.224 -19.877 -86.791  1.00 113.91 ? 115 VAL F CG2 1 
ATOM   8240 N N   . THR F 3 116 ? -114.597 -19.351 -82.280  1.00 113.47 ? 116 THR F N   1 
ATOM   8241 C CA  . THR F 3 116 ? -115.275 -19.514 -81.000  1.00 113.38 ? 116 THR F CA  1 
ATOM   8242 C C   . THR F 3 116 ? -116.214 -18.337 -80.736  1.00 113.32 ? 116 THR F C   1 
ATOM   8243 O O   . THR F 3 116 ? -115.974 -17.208 -81.163  1.00 112.98 ? 116 THR F O   1 
ATOM   8244 C CB  . THR F 3 116 ? -114.285 -19.803 -79.804  1.00 113.44 ? 116 THR F CB  1 
ATOM   8245 O OG1 . THR F 3 116 ? -114.906 -19.471 -78.554  1.00 113.24 ? 116 THR F OG1 1 
ATOM   8246 C CG2 . THR F 3 116 ? -112.953 -19.039 -79.945  1.00 113.79 ? 116 THR F CG2 1 
ATOM   8247 N N   . VAL F 3 117 ? -117.305 -18.621 -80.048  1.00 113.59 ? 117 VAL F N   1 
ATOM   8248 C CA  . VAL F 3 117 ? -118.335 -17.631 -79.834  1.00 114.12 ? 117 VAL F CA  1 
ATOM   8249 C C   . VAL F 3 117 ? -118.539 -17.478 -78.326  1.00 114.46 ? 117 VAL F C   1 
ATOM   8250 O O   . VAL F 3 117 ? -119.483 -18.023 -77.753  1.00 114.60 ? 117 VAL F O   1 
ATOM   8251 C CB  . VAL F 3 117 ? -119.646 -18.032 -80.561  1.00 114.14 ? 117 VAL F CB  1 
ATOM   8252 C CG1 . VAL F 3 117 ? -120.553 -16.849 -80.712  1.00 114.09 ? 117 VAL F CG1 1 
ATOM   8253 C CG2 . VAL F 3 117 ? -119.347 -18.605 -81.936  1.00 114.26 ? 117 VAL F CG2 1 
ATOM   8254 N N   . SER F 3 118 ? -117.640 -16.728 -77.692  1.00 114.91 ? 118 SER F N   1 
ATOM   8255 C CA  . SER F 3 118 ? -117.573 -16.641 -76.221  1.00 115.36 ? 118 SER F CA  1 
ATOM   8256 C C   . SER F 3 118 ? -118.002 -15.268 -75.650  1.00 115.41 ? 118 SER F C   1 
ATOM   8257 O O   . SER F 3 118 ? -117.203 -14.312 -75.598  1.00 115.58 ? 118 SER F O   1 
ATOM   8258 C CB  . SER F 3 118 ? -116.155 -17.022 -75.743  1.00 115.54 ? 118 SER F CB  1 
ATOM   8259 O OG  . SER F 3 118 ? -116.106 -17.409 -74.374  1.00 115.44 ? 118 SER F OG  1 
ATOM   8260 N N   . SER F 3 119 ? -119.262 -15.184 -75.221  1.00 115.18 ? 119 SER F N   1 
ATOM   8261 C CA  . SER F 3 119 ? -119.789 -13.964 -74.623  1.00 115.01 ? 119 SER F CA  1 
ATOM   8262 C C   . SER F 3 119 ? -119.281 -13.803 -73.190  1.00 115.03 ? 119 SER F C   1 
ATOM   8263 O O   . SER F 3 119 ? -118.164 -13.335 -72.966  1.00 114.83 ? 119 SER F O   1 
ATOM   8264 C CB  . SER F 3 119 ? -121.323 -13.948 -74.666  1.00 115.00 ? 119 SER F CB  1 
ATOM   8265 O OG  . SER F 3 119 ? -121.883 -15.008 -73.907  1.00 114.42 ? 119 SER F OG  1 
ATOM   8266 N N   . LYS F 3 121 ? -113.323 -11.736 -74.838  1.00 118.14 ? 121 LYS F N   1 
ATOM   8267 C CA  . LYS F 3 121 ? -112.736 -11.307 -73.561  1.00 118.13 ? 121 LYS F CA  1 
ATOM   8268 C C   . LYS F 3 121 ? -111.376 -11.945 -73.258  1.00 118.15 ? 121 LYS F C   1 
ATOM   8269 O O   . LYS F 3 121 ? -111.250 -12.805 -72.374  1.00 117.87 ? 121 LYS F O   1 
ATOM   8270 C CB  . LYS F 3 121 ? -113.718 -11.500 -72.383  1.00 118.15 ? 121 LYS F CB  1 
ATOM   8271 C CG  . LYS F 3 121 ? -114.098 -12.945 -72.053  1.00 117.47 ? 121 LYS F CG  1 
ATOM   8272 C CD  . LYS F 3 121 ? -114.922 -13.586 -73.162  1.00 116.86 ? 121 LYS F CD  1 
ATOM   8273 C CE  . LYS F 3 121 ? -115.434 -14.931 -72.734  1.00 116.71 ? 121 LYS F CE  1 
ATOM   8274 N NZ  . LYS F 3 121 ? -116.487 -14.796 -71.689  1.00 117.06 ? 121 LYS F NZ  1 
ATOM   8275 N N   . THR F 3 122 ? -110.367 -11.515 -74.012  1.00 118.28 ? 122 THR F N   1 
ATOM   8276 C CA  . THR F 3 122 ? -108.969 -11.803 -73.706  1.00 118.51 ? 122 THR F CA  1 
ATOM   8277 C C   . THR F 3 122 ? -108.810 -11.814 -72.181  1.00 118.58 ? 122 THR F C   1 
ATOM   8278 O O   . THR F 3 122 ? -109.248 -10.872 -71.518  1.00 118.99 ? 122 THR F O   1 
ATOM   8279 C CB  . THR F 3 122 ? -108.032 -10.717 -74.372  1.00 118.69 ? 122 THR F CB  1 
ATOM   8280 O OG1 . THR F 3 122 ? -107.760 -11.064 -75.743  1.00 118.61 ? 122 THR F OG1 1 
ATOM   8281 C CG2 . THR F 3 122 ? -106.700 -10.525 -73.605  1.00 118.49 ? 122 THR F CG2 1 
ATOM   8282 N N   . THR F 3 123 ? -108.242 -12.887 -71.623  1.00 118.47 ? 123 THR F N   1 
ATOM   8283 C CA  . THR F 3 123 ? -107.862 -12.922 -70.186  1.00 118.11 ? 123 THR F CA  1 
ATOM   8284 C C   . THR F 3 123 ? -106.541 -13.689 -69.920  1.00 118.06 ? 123 THR F C   1 
ATOM   8285 O O   . THR F 3 123 ? -106.200 -14.636 -70.640  1.00 118.07 ? 123 THR F O   1 
ATOM   8286 C CB  . THR F 3 123 ? -109.018 -13.412 -69.287  1.00 117.92 ? 123 THR F CB  1 
ATOM   8287 O OG1 . THR F 3 123 ? -110.197 -12.655 -69.578  1.00 117.57 ? 123 THR F OG1 1 
ATOM   8288 C CG2 . THR F 3 123 ? -108.681 -13.212 -67.830  1.00 118.06 ? 123 THR F CG2 1 
ATOM   8289 N N   . ALA F 3 124 ? -105.806 -13.268 -68.890  1.00 117.87 ? 124 ALA F N   1 
ATOM   8290 C CA  . ALA F 3 124 ? -104.417 -13.703 -68.690  1.00 117.73 ? 124 ALA F CA  1 
ATOM   8291 C C   . ALA F 3 124 ? -104.245 -14.847 -67.683  1.00 117.63 ? 124 ALA F C   1 
ATOM   8292 O O   . ALA F 3 124 ? -105.062 -14.991 -66.770  1.00 117.31 ? 124 ALA F O   1 
ATOM   8293 C CB  . ALA F 3 124 ? -103.542 -12.511 -68.309  1.00 117.84 ? 124 ALA F CB  1 
ATOM   8294 N N   . PRO F 3 125 ? -103.170 -15.658 -67.850  1.00 117.74 ? 125 PRO F N   1 
ATOM   8295 C CA  . PRO F 3 125 ? -102.916 -16.885 -67.090  1.00 117.83 ? 125 PRO F CA  1 
ATOM   8296 C C   . PRO F 3 125 ? -101.785 -16.780 -66.055  1.00 118.00 ? 125 PRO F C   1 
ATOM   8297 O O   . PRO F 3 125 ? -100.607 -16.696 -66.418  1.00 118.08 ? 125 PRO F O   1 
ATOM   8298 C CB  . PRO F 3 125 ? -102.495 -17.858 -68.183  1.00 117.56 ? 125 PRO F CB  1 
ATOM   8299 C CG  . PRO F 3 125 ? -101.738 -16.987 -69.164  1.00 117.88 ? 125 PRO F CG  1 
ATOM   8300 C CD  . PRO F 3 125 ? -102.190 -15.536 -68.947  1.00 117.87 ? 125 PRO F CD  1 
ATOM   8301 N N   . SER F 3 126 ? -102.154 -16.804 -64.778  1.00 118.05 ? 126 SER F N   1 
ATOM   8302 C CA  . SER F 3 126 ? -101.197 -16.808 -63.685  1.00 117.85 ? 126 SER F CA  1 
ATOM   8303 C C   . SER F 3 126 ? -100.545 -18.176 -63.676  1.00 117.90 ? 126 SER F C   1 
ATOM   8304 O O   . SER F 3 126 ? -101.213 -19.177 -63.434  1.00 117.85 ? 126 SER F O   1 
ATOM   8305 C CB  . SER F 3 126 ? -101.941 -16.577 -62.376  1.00 117.83 ? 126 SER F CB  1 
ATOM   8306 O OG  . SER F 3 126 ? -103.233 -16.047 -62.637  1.00 117.54 ? 126 SER F OG  1 
ATOM   8307 N N   . VAL F 3 127 ? -99.255  -18.235 -63.977  1.00 118.18 ? 127 VAL F N   1 
ATOM   8308 C CA  . VAL F 3 127 ? -98.567  -19.527 -63.994  1.00 118.78 ? 127 VAL F CA  1 
ATOM   8309 C C   . VAL F 3 127 ? -97.951  -19.839 -62.623  1.00 119.29 ? 127 VAL F C   1 
ATOM   8310 O O   . VAL F 3 127 ? -96.789  -19.504 -62.346  1.00 119.43 ? 127 VAL F O   1 
ATOM   8311 C CB  . VAL F 3 127 ? -97.529  -19.663 -65.151  1.00 118.77 ? 127 VAL F CB  1 
ATOM   8312 C CG1 . VAL F 3 127 ? -96.917  -21.076 -65.180  1.00 118.38 ? 127 VAL F CG1 1 
ATOM   8313 C CG2 . VAL F 3 127 ? -98.178  -19.351 -66.493  1.00 118.90 ? 127 VAL F CG2 1 
ATOM   8314 N N   . TYR F 3 128 ? -98.752  -20.473 -61.767  1.00 119.71 ? 128 TYR F N   1 
ATOM   8315 C CA  . TYR F 3 128 ? -98.313  -20.850 -60.432  1.00 119.95 ? 128 TYR F CA  1 
ATOM   8316 C C   . TYR F 3 128 ? -97.283  -21.963 -60.535  1.00 120.63 ? 128 TYR F C   1 
ATOM   8317 O O   . TYR F 3 128 ? -97.482  -22.919 -61.287  1.00 120.68 ? 128 TYR F O   1 
ATOM   8318 C CB  . TYR F 3 128 ? -99.498  -21.299 -59.585  1.00 119.61 ? 128 TYR F CB  1 
ATOM   8319 C CG  . TYR F 3 128 ? -100.586 -20.263 -59.430  1.00 118.86 ? 128 TYR F CG  1 
ATOM   8320 C CD1 . TYR F 3 128 ? -100.291 -18.962 -59.039  1.00 118.22 ? 128 TYR F CD1 1 
ATOM   8321 C CD2 . TYR F 3 128 ? -101.917 -20.592 -59.651  1.00 118.70 ? 128 TYR F CD2 1 
ATOM   8322 C CE1 . TYR F 3 128 ? -101.293 -18.009 -58.887  1.00 118.20 ? 128 TYR F CE1 1 
ATOM   8323 C CE2 . TYR F 3 128 ? -102.930 -19.644 -59.500  1.00 118.73 ? 128 TYR F CE2 1 
ATOM   8324 C CZ  . TYR F 3 128 ? -102.610 -18.356 -59.116  1.00 118.25 ? 128 TYR F CZ  1 
ATOM   8325 O OH  . TYR F 3 128 ? -103.608 -17.416 -58.966  1.00 118.21 ? 128 TYR F OH  1 
ATOM   8326 N N   . PRO F 3 129 ? -96.164  -21.834 -59.800  1.00 121.38 ? 129 PRO F N   1 
ATOM   8327 C CA  . PRO F 3 129 ? -95.151  -22.886 -59.874  1.00 122.03 ? 129 PRO F CA  1 
ATOM   8328 C C   . PRO F 3 129 ? -95.603  -24.098 -59.060  1.00 122.57 ? 129 PRO F C   1 
ATOM   8329 O O   . PRO F 3 129 ? -96.420  -23.942 -58.158  1.00 122.74 ? 129 PRO F O   1 
ATOM   8330 C CB  . PRO F 3 129 ? -93.908  -22.226 -59.255  1.00 122.05 ? 129 PRO F CB  1 
ATOM   8331 C CG  . PRO F 3 129 ? -94.445  -21.165 -58.327  1.00 121.77 ? 129 PRO F CG  1 
ATOM   8332 C CD  . PRO F 3 129 ? -95.839  -20.803 -58.792  1.00 121.50 ? 129 PRO F CD  1 
ATOM   8333 N N   . LEU F 3 130 ? -95.105  -25.288 -59.386  1.00 123.16 ? 130 LEU F N   1 
ATOM   8334 C CA  . LEU F 3 130 ? -95.443  -26.495 -58.628  1.00 123.78 ? 130 LEU F CA  1 
ATOM   8335 C C   . LEU F 3 130 ? -94.204  -27.258 -58.140  1.00 124.37 ? 130 LEU F C   1 
ATOM   8336 O O   . LEU F 3 130 ? -93.619  -28.056 -58.878  1.00 124.42 ? 130 LEU F O   1 
ATOM   8337 C CB  . LEU F 3 130 ? -96.360  -27.406 -59.451  1.00 123.60 ? 130 LEU F CB  1 
ATOM   8338 C CG  . LEU F 3 130 ? -97.892  -27.351 -59.357  1.00 123.50 ? 130 LEU F CG  1 
ATOM   8339 C CD1 . LEU F 3 130 ? -98.488  -25.980 -59.075  1.00 122.61 ? 130 LEU F CD1 1 
ATOM   8340 C CD2 . LEU F 3 130 ? -98.467  -27.896 -60.647  1.00 124.07 ? 130 LEU F CD2 1 
ATOM   8341 N N   . ALA F 3 131 ? -93.813  -26.999 -56.893  1.00 125.22 ? 131 ALA F N   1 
ATOM   8342 C CA  . ALA F 3 131 ? -92.677  -27.676 -56.259  1.00 126.19 ? 131 ALA F CA  1 
ATOM   8343 C C   . ALA F 3 131 ? -93.144  -28.831 -55.375  1.00 126.89 ? 131 ALA F C   1 
ATOM   8344 O O   . ALA F 3 131 ? -94.158  -28.702 -54.683  1.00 126.77 ? 131 ALA F O   1 
ATOM   8345 C CB  . ALA F 3 131 ? -91.856  -26.684 -55.452  1.00 126.35 ? 131 ALA F CB  1 
ATOM   8346 N N   . PRO F 3 132 ? -92.395  -29.955 -55.375  1.00 127.77 ? 132 PRO F N   1 
ATOM   8347 C CA  . PRO F 3 132 ? -92.896  -31.203 -54.787  1.00 128.74 ? 132 PRO F CA  1 
ATOM   8348 C C   . PRO F 3 132 ? -93.162  -31.180 -53.266  1.00 129.77 ? 132 PRO F C   1 
ATOM   8349 O O   . PRO F 3 132 ? -93.498  -30.130 -52.700  1.00 129.71 ? 132 PRO F O   1 
ATOM   8350 C CB  . PRO F 3 132 ? -91.807  -32.237 -55.149  1.00 128.58 ? 132 PRO F CB  1 
ATOM   8351 C CG  . PRO F 3 132 ? -90.968  -31.591 -56.179  1.00 128.05 ? 132 PRO F CG  1 
ATOM   8352 C CD  . PRO F 3 132 ? -91.026  -30.126 -55.892  1.00 127.75 ? 132 PRO F CD  1 
ATOM   8353 N N   . VAL F 3 133 ? -93.005  -32.341 -52.633  1.00 130.90 ? 133 VAL F N   1 
ATOM   8354 C CA  . VAL F 3 133 ? -93.487  -32.586 -51.274  1.00 132.12 ? 133 VAL F CA  1 
ATOM   8355 C C   . VAL F 3 133 ? -92.970  -31.644 -50.176  1.00 133.03 ? 133 VAL F C   1 
ATOM   8356 O O   . VAL F 3 133 ? -91.763  -31.551 -49.915  1.00 133.07 ? 133 VAL F O   1 
ATOM   8357 C CB  . VAL F 3 133 ? -93.285  -34.067 -50.867  1.00 132.14 ? 133 VAL F CB  1 
ATOM   8358 C CG1 . VAL F 3 133 ? -94.332  -34.947 -51.540  1.00 132.18 ? 133 VAL F CG1 1 
ATOM   8359 C CG2 . VAL F 3 133 ? -91.871  -34.540 -51.211  1.00 132.23 ? 133 VAL F CG2 1 
ATOM   8360 N N   . CYS F 3 134 ? -93.932  -30.946 -49.566  1.00 134.14 ? 134 CYS F N   1 
ATOM   8361 C CA  . CYS F 3 134 ? -93.774  -30.045 -48.409  1.00 135.27 ? 134 CYS F CA  1 
ATOM   8362 C C   . CYS F 3 134 ? -92.582  -30.380 -47.486  1.00 135.21 ? 134 CYS F C   1 
ATOM   8363 O O   . CYS F 3 134 ? -91.729  -29.522 -47.191  1.00 135.14 ? 134 CYS F O   1 
ATOM   8364 C CB  . CYS F 3 134 ? -95.096  -30.060 -47.619  1.00 135.65 ? 134 CYS F CB  1 
ATOM   8365 S SG  . CYS F 3 134 ? -95.422  -28.641 -46.532  1.00 138.78 ? 134 CYS F SG  1 
ATOM   8366 N N   . GLY F 3 135 ? -92.568  -31.629 -47.020  1.00 135.24 ? 135 GLY F N   1 
ATOM   8367 C CA  . GLY F 3 135 ? -91.407  -32.249 -46.400  1.00 135.12 ? 135 GLY F CA  1 
ATOM   8368 C C   . GLY F 3 135 ? -90.890  -33.316 -47.349  1.00 135.00 ? 135 GLY F C   1 
ATOM   8369 O O   . GLY F 3 135 ? -91.623  -34.226 -47.737  1.00 134.95 ? 135 GLY F O   1 
ATOM   8370 N N   . ASP F 3 136 ? -89.622  -33.197 -47.723  1.00 135.00 ? 136 ASP F N   1 
ATOM   8371 C CA  . ASP F 3 136 ? -88.991  -34.082 -48.708  1.00 135.07 ? 136 ASP F CA  1 
ATOM   8372 C C   . ASP F 3 136 ? -89.064  -35.574 -48.340  1.00 135.04 ? 136 ASP F C   1 
ATOM   8373 O O   . ASP F 3 136 ? -89.223  -35.924 -47.170  1.00 135.08 ? 136 ASP F O   1 
ATOM   8374 C CB  . ASP F 3 136 ? -87.527  -33.660 -48.920  1.00 135.03 ? 136 ASP F CB  1 
ATOM   8375 C CG  . ASP F 3 136 ? -87.367  -32.155 -49.139  1.00 134.71 ? 136 ASP F CG  1 
ATOM   8376 O OD1 . ASP F 3 136 ? -88.213  -31.367 -48.654  1.00 133.76 ? 136 ASP F OD1 1 
ATOM   8377 O OD2 . ASP F 3 136 ? -86.379  -31.762 -49.795  1.00 134.69 ? 136 ASP F OD2 1 
ATOM   8378 N N   . THR F 3 137 ? -88.978  -36.438 -49.355  1.00 135.01 ? 137 THR F N   1 
ATOM   8379 C CA  . THR F 3 137 ? -88.818  -37.897 -49.173  1.00 135.01 ? 137 THR F CA  1 
ATOM   8380 C C   . THR F 3 137 ? -88.134  -38.522 -50.413  1.00 134.91 ? 137 THR F C   1 
ATOM   8381 O O   . THR F 3 137 ? -88.363  -39.700 -50.740  1.00 134.77 ? 137 THR F O   1 
ATOM   8382 C CB  . THR F 3 137 ? -90.171  -38.625 -48.855  1.00 135.05 ? 137 THR F CB  1 
ATOM   8383 O OG1 . THR F 3 137 ? -91.010  -37.775 -48.061  1.00 135.43 ? 137 THR F OG1 1 
ATOM   8384 C CG2 . THR F 3 137 ? -89.934  -39.953 -48.106  1.00 134.73 ? 137 THR F CG2 1 
ATOM   8385 N N   . THR F 3 138 ? -87.278  -37.723 -51.066  1.00 134.66 ? 138 THR F N   1 
ATOM   8386 C CA  . THR F 3 138 ? -86.670  -38.042 -52.377  1.00 134.29 ? 138 THR F CA  1 
ATOM   8387 C C   . THR F 3 138 ? -86.389  -39.545 -52.629  1.00 134.09 ? 138 THR F C   1 
ATOM   8388 O O   . THR F 3 138 ? -85.312  -40.074 -52.314  1.00 133.96 ? 138 THR F O   1 
ATOM   8389 C CB  . THR F 3 138 ? -85.463  -37.088 -52.718  1.00 134.24 ? 138 THR F CB  1 
ATOM   8390 O OG1 . THR F 3 138 ? -84.877  -37.456 -53.975  1.00 134.38 ? 138 THR F OG1 1 
ATOM   8391 C CG2 . THR F 3 138 ? -84.397  -37.083 -51.615  1.00 134.11 ? 138 THR F CG2 1 
ATOM   8392 N N   . GLY F 3 139 ? -87.404  -40.202 -53.202  1.00 133.83 ? 139 GLY F N   1 
ATOM   8393 C CA  . GLY F 3 139 ? -87.454  -41.650 -53.424  1.00 133.31 ? 139 GLY F CA  1 
ATOM   8394 C C   . GLY F 3 139 ? -86.396  -42.190 -54.365  1.00 133.02 ? 139 GLY F C   1 
ATOM   8395 O O   . GLY F 3 139 ? -85.611  -43.052 -53.968  1.00 133.11 ? 139 GLY F O   1 
ATOM   8396 N N   . SER F 3 140 ? -86.378  -41.699 -55.610  1.00 132.58 ? 140 SER F N   1 
ATOM   8397 C CA  . SER F 3 140 ? -85.340  -42.082 -56.586  1.00 132.11 ? 140 SER F CA  1 
ATOM   8398 C C   . SER F 3 140 ? -85.197  -41.119 -57.778  1.00 131.81 ? 140 SER F C   1 
ATOM   8399 O O   . SER F 3 140 ? -84.084  -40.753 -58.155  1.00 131.54 ? 140 SER F O   1 
ATOM   8400 C CB  . SER F 3 140 ? -85.551  -43.516 -57.078  1.00 132.08 ? 140 SER F CB  1 
ATOM   8401 O OG  . SER F 3 140 ? -84.309  -44.185 -57.210  1.00 132.00 ? 140 SER F OG  1 
ATOM   8402 N N   . SER F 3 141 ? -86.320  -40.727 -58.372  1.00 131.65 ? 141 SER F N   1 
ATOM   8403 C CA  . SER F 3 141 ? -86.308  -39.777 -59.490  1.00 131.41 ? 141 SER F CA  1 
ATOM   8404 C C   . SER F 3 141 ? -87.321  -38.636 -59.310  1.00 131.08 ? 141 SER F C   1 
ATOM   8405 O O   . SER F 3 141 ? -88.483  -38.863 -58.951  1.00 131.22 ? 141 SER F O   1 
ATOM   8406 C CB  . SER F 3 141 ? -86.517  -40.504 -60.819  1.00 131.41 ? 141 SER F CB  1 
ATOM   8407 O OG  . SER F 3 141 ? -85.436  -41.383 -61.068  1.00 131.54 ? 141 SER F OG  1 
ATOM   8408 N N   . VAL F 3 142 ? -86.861  -37.415 -59.570  1.00 130.41 ? 142 VAL F N   1 
ATOM   8409 C CA  . VAL F 3 142 ? -87.625  -36.197 -59.294  1.00 129.76 ? 142 VAL F CA  1 
ATOM   8410 C C   . VAL F 3 142 ? -88.662  -35.891 -60.378  1.00 129.35 ? 142 VAL F C   1 
ATOM   8411 O O   . VAL F 3 142 ? -88.354  -35.965 -61.565  1.00 129.37 ? 142 VAL F O   1 
ATOM   8412 C CB  . VAL F 3 142 ? -86.652  -34.997 -59.099  1.00 129.85 ? 142 VAL F CB  1 
ATOM   8413 C CG1 . VAL F 3 142 ? -87.309  -33.655 -59.420  1.00 129.38 ? 142 VAL F CG1 1 
ATOM   8414 C CG2 . VAL F 3 142 ? -86.059  -35.011 -57.683  1.00 130.06 ? 142 VAL F CG2 1 
ATOM   8415 N N   . THR F 3 143 ? -89.886  -35.555 -59.964  1.00 128.79 ? 143 THR F N   1 
ATOM   8416 C CA  . THR F 3 143 ? -90.940  -35.103 -60.894  1.00 128.17 ? 143 THR F CA  1 
ATOM   8417 C C   . THR F 3 143 ? -91.567  -33.761 -60.472  1.00 127.54 ? 143 THR F C   1 
ATOM   8418 O O   . THR F 3 143 ? -91.877  -33.558 -59.298  1.00 127.52 ? 143 THR F O   1 
ATOM   8419 C CB  . THR F 3 143 ? -92.024  -36.195 -61.153  1.00 128.22 ? 143 THR F CB  1 
ATOM   8420 O OG1 . THR F 3 143 ? -93.294  -35.574 -61.392  1.00 128.55 ? 143 THR F OG1 1 
ATOM   8421 C CG2 . THR F 3 143 ? -92.138  -37.166 -59.976  1.00 128.17 ? 143 THR F CG2 1 
ATOM   8422 N N   . LEU F 3 144 ? -91.741  -32.857 -61.438  1.00 126.71 ? 144 LEU F N   1 
ATOM   8423 C CA  . LEU F 3 144 ? -92.131  -31.472 -61.156  1.00 125.97 ? 144 LEU F CA  1 
ATOM   8424 C C   . LEU F 3 144 ? -93.240  -30.977 -62.068  1.00 125.51 ? 144 LEU F C   1 
ATOM   8425 O O   . LEU F 3 144 ? -93.433  -31.502 -63.160  1.00 125.44 ? 144 LEU F O   1 
ATOM   8426 C CB  . LEU F 3 144 ? -90.933  -30.532 -61.322  1.00 126.12 ? 144 LEU F CB  1 
ATOM   8427 C CG  . LEU F 3 144 ? -89.526  -30.933 -60.868  1.00 125.85 ? 144 LEU F CG  1 
ATOM   8428 C CD1 . LEU F 3 144 ? -88.505  -29.931 -61.374  1.00 125.27 ? 144 LEU F CD1 1 
ATOM   8429 C CD2 . LEU F 3 144 ? -89.462  -31.040 -59.367  1.00 125.79 ? 144 LEU F CD2 1 
ATOM   8430 N N   . GLY F 3 145 ? -93.932  -29.930 -61.630  1.00 125.06 ? 145 GLY F N   1 
ATOM   8431 C CA  . GLY F 3 145 ? -95.064  -29.382 -62.368  1.00 124.58 ? 145 GLY F CA  1 
ATOM   8432 C C   . GLY F 3 145 ? -95.011  -27.890 -62.661  1.00 124.30 ? 145 GLY F C   1 
ATOM   8433 O O   . GLY F 3 145 ? -94.037  -27.212 -62.326  1.00 124.11 ? 145 GLY F O   1 
ATOM   8434 N N   . CYS F 3 146 ? -96.085  -27.397 -63.286  1.00 124.09 ? 146 CYS F N   1 
ATOM   8435 C CA  . CYS F 3 146 ? -96.224  -26.011 -63.752  1.00 123.88 ? 146 CYS F CA  1 
ATOM   8436 C C   . CYS F 3 146 ? -97.715  -25.764 -64.006  1.00 123.44 ? 146 CYS F C   1 
ATOM   8437 O O   . CYS F 3 146 ? -98.285  -26.407 -64.879  1.00 123.36 ? 146 CYS F O   1 
ATOM   8438 C CB  . CYS F 3 146 ? -95.448  -25.844 -65.059  1.00 123.96 ? 146 CYS F CB  1 
ATOM   8439 S SG  . CYS F 3 146 ? -94.861  -24.188 -65.455  1.00 124.85 ? 146 CYS F SG  1 
ATOM   8440 N N   . LEU F 3 147 ? -98.349  -24.863 -63.250  1.00 123.04 ? 147 LEU F N   1 
ATOM   8441 C CA  . LEU F 3 147 ? -99.812  -24.682 -63.336  1.00 122.84 ? 147 LEU F CA  1 
ATOM   8442 C C   . LEU F 3 147 ? -100.216 -23.367 -63.971  1.00 122.89 ? 147 LEU F C   1 
ATOM   8443 O O   . LEU F 3 147 ? -99.630  -22.336 -63.667  1.00 123.10 ? 147 LEU F O   1 
ATOM   8444 C CB  . LEU F 3 147 ? -100.483 -24.793 -61.962  1.00 122.71 ? 147 LEU F CB  1 
ATOM   8445 C CG  . LEU F 3 147 ? -102.003 -24.558 -61.958  1.00 122.44 ? 147 LEU F CG  1 
ATOM   8446 C CD1 . LEU F 3 147 ? -102.772 -25.836 -62.265  1.00 122.27 ? 147 LEU F CD1 1 
ATOM   8447 C CD2 . LEU F 3 147 ? -102.479 -23.960 -60.649  1.00 122.47 ? 147 LEU F CD2 1 
ATOM   8448 N N   . VAL F 3 148 ? -101.240 -23.413 -64.826  1.00 122.78 ? 148 VAL F N   1 
ATOM   8449 C CA  . VAL F 3 148 ? -101.718 -22.245 -65.574  1.00 122.72 ? 148 VAL F CA  1 
ATOM   8450 C C   . VAL F 3 148 ? -103.248 -22.173 -65.526  1.00 122.86 ? 148 VAL F C   1 
ATOM   8451 O O   . VAL F 3 148 ? -103.937 -22.881 -66.266  1.00 123.03 ? 148 VAL F O   1 
ATOM   8452 C CB  . VAL F 3 148 ? -101.262 -22.293 -67.057  1.00 122.59 ? 148 VAL F CB  1 
ATOM   8453 C CG1 . VAL F 3 148 ? -101.601 -21.004 -67.759  1.00 122.66 ? 148 VAL F CG1 1 
ATOM   8454 C CG2 . VAL F 3 148 ? -99.769  -22.581 -67.179  1.00 122.50 ? 148 VAL F CG2 1 
ATOM   8455 N N   . LYS F 3 149 ? -103.782 -21.310 -64.670  1.00 122.90 ? 149 LYS F N   1 
ATOM   8456 C CA  . LYS F 3 149 ? -105.219 -21.315 -64.403  1.00 123.06 ? 149 LYS F CA  1 
ATOM   8457 C C   . LYS F 3 149 ? -105.882 -19.999 -64.835  1.00 123.32 ? 149 LYS F C   1 
ATOM   8458 O O   . LYS F 3 149 ? -105.188 -19.047 -65.199  1.00 123.20 ? 149 LYS F O   1 
ATOM   8459 C CB  . LYS F 3 149 ? -105.461 -21.628 -62.914  1.00 123.13 ? 149 LYS F CB  1 
ATOM   8460 C CG  . LYS F 3 149 ? -106.845 -22.176 -62.542  1.00 122.38 ? 149 LYS F CG  1 
ATOM   8461 C CD  . LYS F 3 149 ? -106.857 -22.735 -61.117  1.00 120.97 ? 149 LYS F CD  1 
ATOM   8462 C CE  . LYS F 3 149 ? -108.280 -22.925 -60.582  1.00 120.83 ? 149 LYS F CE  1 
ATOM   8463 N NZ  . LYS F 3 149 ? -109.015 -24.114 -61.125  1.00 120.59 ? 149 LYS F NZ  1 
ATOM   8464 N N   . GLY F 3 150 ? -107.220 -19.988 -64.821  1.00 123.63 ? 150 GLY F N   1 
ATOM   8465 C CA  . GLY F 3 150 ? -108.070 -18.818 -65.100  1.00 124.15 ? 150 GLY F CA  1 
ATOM   8466 C C   . GLY F 3 150 ? -107.772 -17.927 -66.299  1.00 124.61 ? 150 GLY F C   1 
ATOM   8467 O O   . GLY F 3 150 ? -107.423 -16.761 -66.109  1.00 124.66 ? 150 GLY F O   1 
ATOM   8468 N N   . TYR F 3 151 ? -107.941 -18.443 -67.525  1.00 125.09 ? 151 TYR F N   1 
ATOM   8469 C CA  . TYR F 3 151 ? -107.571 -17.681 -68.750  1.00 125.45 ? 151 TYR F CA  1 
ATOM   8470 C C   . TYR F 3 151 ? -108.515 -17.738 -69.967  1.00 125.86 ? 151 TYR F C   1 
ATOM   8471 O O   . TYR F 3 151 ? -109.515 -18.454 -69.956  1.00 126.14 ? 151 TYR F O   1 
ATOM   8472 C CB  . TYR F 3 151 ? -106.131 -17.992 -69.180  1.00 125.24 ? 151 TYR F CB  1 
ATOM   8473 C CG  . TYR F 3 151 ? -105.871 -19.379 -69.732  1.00 124.62 ? 151 TYR F CG  1 
ATOM   8474 C CD1 . TYR F 3 151 ? -105.732 -19.581 -71.105  1.00 124.08 ? 151 TYR F CD1 1 
ATOM   8475 C CD2 . TYR F 3 151 ? -105.711 -20.481 -68.879  1.00 124.05 ? 151 TYR F CD2 1 
ATOM   8476 C CE1 . TYR F 3 151 ? -105.465 -20.847 -71.625  1.00 124.04 ? 151 TYR F CE1 1 
ATOM   8477 C CE2 . TYR F 3 151 ? -105.442 -21.757 -69.388  1.00 123.71 ? 151 TYR F CE2 1 
ATOM   8478 C CZ  . TYR F 3 151 ? -105.320 -21.929 -70.764  1.00 123.71 ? 151 TYR F CZ  1 
ATOM   8479 O OH  . TYR F 3 151 ? -105.056 -23.172 -71.289  1.00 122.46 ? 151 TYR F OH  1 
ATOM   8480 N N   . PHE F 3 152 ? -108.185 -16.972 -71.008  1.00 126.27 ? 152 PHE F N   1 
ATOM   8481 C CA  . PHE F 3 152 ? -108.961 -16.955 -72.258  1.00 126.67 ? 152 PHE F CA  1 
ATOM   8482 C C   . PHE F 3 152 ? -108.284 -16.179 -73.415  1.00 126.64 ? 152 PHE F C   1 
ATOM   8483 O O   . PHE F 3 152 ? -107.663 -15.134 -73.194  1.00 126.46 ? 152 PHE F O   1 
ATOM   8484 C CB  . PHE F 3 152 ? -110.378 -16.405 -72.015  1.00 126.82 ? 152 PHE F CB  1 
ATOM   8485 C CG  . PHE F 3 152 ? -111.262 -16.457 -73.229  1.00 127.64 ? 152 PHE F CG  1 
ATOM   8486 C CD1 . PHE F 3 152 ? -111.323 -15.380 -74.111  1.00 128.49 ? 152 PHE F CD1 1 
ATOM   8487 C CD2 . PHE F 3 152 ? -112.026 -17.583 -73.498  1.00 128.19 ? 152 PHE F CD2 1 
ATOM   8488 C CE1 . PHE F 3 152 ? -112.131 -15.425 -75.240  1.00 128.69 ? 152 PHE F CE1 1 
ATOM   8489 C CE2 . PHE F 3 152 ? -112.840 -17.634 -74.623  1.00 128.44 ? 152 PHE F CE2 1 
ATOM   8490 C CZ  . PHE F 3 152 ? -112.890 -16.553 -75.496  1.00 128.51 ? 152 PHE F CZ  1 
ATOM   8491 N N   . PRO F 3 153 ? -108.380 -16.709 -74.651  1.00 126.65 ? 153 PRO F N   1 
ATOM   8492 C CA  . PRO F 3 153 ? -108.783 -18.075 -74.964  1.00 126.65 ? 153 PRO F CA  1 
ATOM   8493 C C   . PRO F 3 153 ? -107.584 -18.938 -75.374  1.00 126.66 ? 153 PRO F C   1 
ATOM   8494 O O   . PRO F 3 153 ? -106.420 -18.562 -75.156  1.00 126.61 ? 153 PRO F O   1 
ATOM   8495 C CB  . PRO F 3 153 ? -109.727 -17.891 -76.156  1.00 126.50 ? 153 PRO F CB  1 
ATOM   8496 C CG  . PRO F 3 153 ? -109.281 -16.610 -76.813  1.00 126.66 ? 153 PRO F CG  1 
ATOM   8497 C CD  . PRO F 3 153 ? -108.359 -15.873 -75.864  1.00 126.72 ? 153 PRO F CD  1 
ATOM   8498 N N   . GLU F 3 154 ? -107.880 -20.090 -75.964  1.00 126.47 ? 154 GLU F N   1 
ATOM   8499 C CA  . GLU F 3 154 ? -106.858 -20.949 -76.515  1.00 126.28 ? 154 GLU F CA  1 
ATOM   8500 C C   . GLU F 3 154 ? -106.090 -20.162 -77.565  1.00 126.18 ? 154 GLU F C   1 
ATOM   8501 O O   . GLU F 3 154 ? -106.660 -19.282 -78.213  1.00 126.15 ? 154 GLU F O   1 
ATOM   8502 C CB  . GLU F 3 154 ? -107.502 -22.182 -77.142  1.00 126.35 ? 154 GLU F CB  1 
ATOM   8503 C CG  . GLU F 3 154 ? -108.437 -22.935 -76.204  1.00 126.44 ? 154 GLU F CG  1 
ATOM   8504 C CD  . GLU F 3 154 ? -107.732 -23.993 -75.384  1.00 126.60 ? 154 GLU F CD  1 
ATOM   8505 O OE1 . GLU F 3 154 ? -106.608 -23.734 -74.902  1.00 126.51 ? 154 GLU F OE1 1 
ATOM   8506 O OE2 . GLU F 3 154 ? -108.313 -25.089 -75.223  1.00 126.65 ? 154 GLU F OE2 1 
ATOM   8507 N N   . PRO F 3 155 ? -104.786 -20.453 -77.714  1.00 126.11 ? 155 PRO F N   1 
ATOM   8508 C CA  . PRO F 3 155 ? -104.087 -21.385 -76.855  1.00 126.08 ? 155 PRO F CA  1 
ATOM   8509 C C   . PRO F 3 155 ? -103.255 -20.638 -75.826  1.00 126.14 ? 155 PRO F C   1 
ATOM   8510 O O   . PRO F 3 155 ? -103.612 -19.524 -75.430  1.00 126.11 ? 155 PRO F O   1 
ATOM   8511 C CB  . PRO F 3 155 ? -103.179 -22.143 -77.839  1.00 125.99 ? 155 PRO F CB  1 
ATOM   8512 C CG  . PRO F 3 155 ? -103.149 -21.307 -79.107  1.00 125.84 ? 155 PRO F CG  1 
ATOM   8513 C CD  . PRO F 3 155 ? -103.939 -20.058 -78.849  1.00 126.07 ? 155 PRO F CD  1 
ATOM   8514 N N   . VAL F 3 156 ? -102.183 -21.292 -75.384  1.00 126.28 ? 156 VAL F N   1 
ATOM   8515 C CA  . VAL F 3 156 ? -101.083 -20.723 -74.602  1.00 126.36 ? 156 VAL F CA  1 
ATOM   8516 C C   . VAL F 3 156 ? -99.936  -21.700 -74.822  1.00 126.43 ? 156 VAL F C   1 
ATOM   8517 O O   . VAL F 3 156 ? -100.175 -22.891 -75.039  1.00 126.38 ? 156 VAL F O   1 
ATOM   8518 C CB  . VAL F 3 156 ? -101.384 -20.604 -73.063  1.00 126.44 ? 156 VAL F CB  1 
ATOM   8519 C CG1 . VAL F 3 156 ? -102.274 -19.406 -72.753  1.00 126.31 ? 156 VAL F CG1 1 
ATOM   8520 C CG2 . VAL F 3 156 ? -101.989 -21.893 -72.482  1.00 126.38 ? 156 VAL F CG2 1 
ATOM   8521 N N   . THR F 3 157 ? -98.698  -21.220 -74.788  1.00 126.60 ? 157 THR F N   1 
ATOM   8522 C CA  . THR F 3 157 ? -97.563  -22.136 -74.933  1.00 126.70 ? 157 THR F CA  1 
ATOM   8523 C C   . THR F 3 157 ? -96.713  -22.231 -73.664  1.00 127.00 ? 157 THR F C   1 
ATOM   8524 O O   . THR F 3 157 ? -96.038  -21.272 -73.266  1.00 127.21 ? 157 THR F O   1 
ATOM   8525 C CB  . THR F 3 157 ? -96.687  -21.823 -76.168  1.00 126.50 ? 157 THR F CB  1 
ATOM   8526 O OG1 . THR F 3 157 ? -97.525  -21.698 -77.320  1.00 126.28 ? 157 THR F OG1 1 
ATOM   8527 C CG2 . THR F 3 157 ? -95.681  -22.944 -76.408  1.00 126.18 ? 157 THR F CG2 1 
ATOM   8528 N N   . LEU F 3 158 ? -96.784  -23.403 -73.036  1.00 127.00 ? 158 LEU F N   1 
ATOM   8529 C CA  . LEU F 3 158 ? -95.916  -23.770 -71.930  1.00 126.90 ? 158 LEU F CA  1 
ATOM   8530 C C   . LEU F 3 158 ? -94.723  -24.531 -72.498  1.00 126.82 ? 158 LEU F C   1 
ATOM   8531 O O   . LEU F 3 158 ? -94.868  -25.308 -73.454  1.00 126.92 ? 158 LEU F O   1 
ATOM   8532 C CB  . LEU F 3 158 ? -96.677  -24.671 -70.953  1.00 126.93 ? 158 LEU F CB  1 
ATOM   8533 C CG  . LEU F 3 158 ? -96.125  -25.014 -69.560  1.00 127.08 ? 158 LEU F CG  1 
ATOM   8534 C CD1 . LEU F 3 158 ? -97.281  -25.453 -68.672  1.00 127.33 ? 158 LEU F CD1 1 
ATOM   8535 C CD2 . LEU F 3 158 ? -94.999  -26.067 -69.555  1.00 126.37 ? 158 LEU F CD2 1 
ATOM   8536 N N   . THR F 3 159 ? -93.549  -24.298 -71.915  1.00 126.54 ? 159 THR F N   1 
ATOM   8537 C CA  . THR F 3 159 ? -92.389  -25.162 -72.146  1.00 126.02 ? 159 THR F CA  1 
ATOM   8538 C C   . THR F 3 159 ? -91.477  -25.210 -70.919  1.00 125.83 ? 159 THR F C   1 
ATOM   8539 O O   . THR F 3 159 ? -91.620  -24.392 -70.006  1.00 125.56 ? 159 THR F O   1 
ATOM   8540 C CB  . THR F 3 159 ? -91.614  -24.796 -73.444  1.00 125.91 ? 159 THR F CB  1 
ATOM   8541 O OG1 . THR F 3 159 ? -90.393  -25.548 -73.493  1.00 125.64 ? 159 THR F OG1 1 
ATOM   8542 C CG2 . THR F 3 159 ? -91.330  -23.291 -73.536  1.00 125.40 ? 159 THR F CG2 1 
ATOM   8543 N N   . TRP F 3 160 ? -90.572  -26.191 -70.892  1.00 125.75 ? 160 TRP F N   1 
ATOM   8544 C CA  . TRP F 3 160 ? -89.545  -26.287 -69.845  1.00 125.72 ? 160 TRP F CA  1 
ATOM   8545 C C   . TRP F 3 160 ? -88.160  -26.017 -70.441  1.00 125.38 ? 160 TRP F C   1 
ATOM   8546 O O   . TRP F 3 160 ? -87.779  -26.617 -71.451  1.00 125.27 ? 160 TRP F O   1 
ATOM   8547 C CB  . TRP F 3 160 ? -89.561  -27.646 -69.125  1.00 125.78 ? 160 TRP F CB  1 
ATOM   8548 C CG  . TRP F 3 160 ? -90.892  -28.086 -68.526  1.00 126.46 ? 160 TRP F CG  1 
ATOM   8549 C CD1 . TRP F 3 160 ? -92.044  -28.384 -69.207  1.00 127.33 ? 160 TRP F CD1 1 
ATOM   8550 C CD2 . TRP F 3 160 ? -91.179  -28.326 -67.139  1.00 126.86 ? 160 TRP F CD2 1 
ATOM   8551 N NE1 . TRP F 3 160 ? -93.030  -28.776 -68.329  1.00 127.60 ? 160 TRP F NE1 1 
ATOM   8552 C CE2 . TRP F 3 160 ? -92.526  -28.751 -67.056  1.00 127.27 ? 160 TRP F CE2 1 
ATOM   8553 C CE3 . TRP F 3 160 ? -90.434  -28.213 -65.958  1.00 127.10 ? 160 TRP F CE3 1 
ATOM   8554 C CZ2 . TRP F 3 160 ? -93.140  -29.065 -65.838  1.00 127.48 ? 160 TRP F CZ2 1 
ATOM   8555 C CZ3 . TRP F 3 160 ? -91.049  -28.528 -64.743  1.00 127.02 ? 160 TRP F CZ3 1 
ATOM   8556 C CH2 . TRP F 3 160 ? -92.385  -28.946 -64.696  1.00 127.31 ? 160 TRP F CH2 1 
ATOM   8557 N N   . ASN F 3 161 ? -87.430  -25.105 -69.798  1.00 125.05 ? 161 ASN F N   1 
ATOM   8558 C CA  . ASN F 3 161 ? -86.120  -24.621 -70.250  1.00 124.77 ? 161 ASN F CA  1 
ATOM   8559 C C   . ASN F 3 161 ? -86.083  -24.031 -71.669  1.00 124.39 ? 161 ASN F C   1 
ATOM   8560 O O   . ASN F 3 161 ? -85.214  -24.362 -72.478  1.00 124.11 ? 161 ASN F O   1 
ATOM   8561 C CB  . ASN F 3 161 ? -85.026  -25.677 -70.027  1.00 124.94 ? 161 ASN F CB  1 
ATOM   8562 C CG  . ASN F 3 161 ? -84.559  -25.740 -68.580  1.00 125.18 ? 161 ASN F CG  1 
ATOM   8563 O OD1 . ASN F 3 161 ? -84.037  -26.762 -68.131  1.00 125.40 ? 161 ASN F OD1 1 
ATOM   8564 N ND2 . ASN F 3 161 ? -84.742  -24.644 -67.842  1.00 125.32 ? 161 ASN F ND2 1 
ATOM   8565 N N   . SER F 3 162 ? -87.034  -23.138 -71.938  1.00 124.10 ? 162 SER F N   1 
ATOM   8566 C CA  . SER F 3 162 ? -87.174  -22.434 -73.221  1.00 123.83 ? 162 SER F CA  1 
ATOM   8567 C C   . SER F 3 162 ? -87.478  -23.394 -74.375  1.00 123.66 ? 162 SER F C   1 
ATOM   8568 O O   . SER F 3 162 ? -88.092  -23.006 -75.378  1.00 123.75 ? 162 SER F O   1 
ATOM   8569 C CB  . SER F 3 162 ? -85.950  -21.548 -73.511  1.00 123.85 ? 162 SER F CB  1 
ATOM   8570 O OG  . SER F 3 162 ? -85.898  -20.433 -72.632  1.00 123.32 ? 162 SER F OG  1 
ATOM   8571 N N   . GLY F 3 163 ? -87.063  -24.648 -74.196  1.00 123.26 ? 163 GLY F N   1 
ATOM   8572 C CA  . GLY F 3 163 ? -87.293  -25.742 -75.140  1.00 122.70 ? 163 GLY F CA  1 
ATOM   8573 C C   . GLY F 3 163 ? -86.286  -26.847 -74.876  1.00 122.34 ? 163 GLY F C   1 
ATOM   8574 O O   . GLY F 3 163 ? -86.453  -27.975 -75.336  1.00 122.24 ? 163 GLY F O   1 
ATOM   8575 N N   . SER F 3 164 ? -85.251  -26.508 -74.103  1.00 121.99 ? 164 SER F N   1 
ATOM   8576 C CA  . SER F 3 164 ? -84.086  -27.368 -73.865  1.00 121.49 ? 164 SER F CA  1 
ATOM   8577 C C   . SER F 3 164 ? -84.411  -28.638 -73.095  1.00 121.07 ? 164 SER F C   1 
ATOM   8578 O O   . SER F 3 164 ? -83.651  -29.608 -73.136  1.00 121.25 ? 164 SER F O   1 
ATOM   8579 C CB  . SER F 3 164 ? -82.995  -26.591 -73.122  1.00 121.59 ? 164 SER F CB  1 
ATOM   8580 O OG  . SER F 3 164 ? -82.672  -25.381 -73.789  1.00 121.70 ? 164 SER F OG  1 
ATOM   8581 N N   . LEU F 3 165 ? -85.529  -28.621 -72.384  1.00 120.46 ? 165 LEU F N   1 
ATOM   8582 C CA  . LEU F 3 165 ? -86.010  -29.807 -71.704  1.00 119.93 ? 165 LEU F CA  1 
ATOM   8583 C C   . LEU F 3 165 ? -87.339  -30.219 -72.333  1.00 119.50 ? 165 LEU F C   1 
ATOM   8584 O O   . LEU F 3 165 ? -88.275  -29.418 -72.407  1.00 119.55 ? 165 LEU F O   1 
ATOM   8585 C CB  . LEU F 3 165 ? -86.141  -29.536 -70.201  1.00 120.05 ? 165 LEU F CB  1 
ATOM   8586 C CG  . LEU F 3 165 ? -86.047  -30.703 -69.207  1.00 119.95 ? 165 LEU F CG  1 
ATOM   8587 C CD1 . LEU F 3 165 ? -84.746  -31.510 -69.362  1.00 120.32 ? 165 LEU F CD1 1 
ATOM   8588 C CD2 . LEU F 3 165 ? -86.191  -30.180 -67.785  1.00 119.29 ? 165 LEU F CD2 1 
ATOM   8589 N N   . SER F 3 166 ? -87.407  -31.461 -72.803  1.00 118.93 ? 166 SER F N   1 
ATOM   8590 C CA  . SER F 3 166 ? -88.549  -31.927 -73.581  1.00 118.53 ? 166 SER F CA  1 
ATOM   8591 C C   . SER F 3 166 ? -88.880  -33.390 -73.312  1.00 118.19 ? 166 SER F C   1 
ATOM   8592 O O   . SER F 3 166 ? -89.964  -33.703 -72.823  1.00 118.16 ? 166 SER F O   1 
ATOM   8593 C CB  . SER F 3 166 ? -88.276  -31.724 -75.074  1.00 118.71 ? 166 SER F CB  1 
ATOM   8594 O OG  . SER F 3 166 ? -86.991  -32.221 -75.430  1.00 118.79 ? 166 SER F OG  1 
ATOM   8595 N N   . SER F 3 167 ? -87.932  -34.264 -73.646  1.00 117.79 ? 167 SER F N   1 
ATOM   8596 C CA  . SER F 3 167 ? -88.032  -35.720 -73.487  1.00 117.50 ? 167 SER F CA  1 
ATOM   8597 C C   . SER F 3 167 ? -88.817  -36.174 -72.237  1.00 117.24 ? 167 SER F C   1 
ATOM   8598 O O   . SER F 3 167 ? -88.239  -36.393 -71.172  1.00 117.26 ? 167 SER F O   1 
ATOM   8599 C CB  . SER F 3 167 ? -86.610  -36.318 -73.510  1.00 117.53 ? 167 SER F CB  1 
ATOM   8600 O OG  . SER F 3 167 ? -86.585  -37.695 -73.170  1.00 117.57 ? 167 SER F OG  1 
ATOM   8601 N N   . GLY F 3 168 ? -90.136  -36.306 -72.372  1.00 116.87 ? 168 GLY F N   1 
ATOM   8602 C CA  . GLY F 3 168 ? -90.983  -36.709 -71.244  1.00 116.40 ? 168 GLY F CA  1 
ATOM   8603 C C   . GLY F 3 168 ? -91.704  -35.577 -70.518  1.00 116.04 ? 168 GLY F C   1 
ATOM   8604 O O   . GLY F 3 168 ? -91.862  -35.619 -69.291  1.00 116.04 ? 168 GLY F O   1 
ATOM   8605 N N   . VAL F 3 169 ? -92.129  -34.564 -71.275  1.00 115.47 ? 169 VAL F N   1 
ATOM   8606 C CA  . VAL F 3 169 ? -93.034  -33.518 -70.779  1.00 114.97 ? 169 VAL F CA  1 
ATOM   8607 C C   . VAL F 3 169 ? -94.498  -33.962 -70.960  1.00 114.48 ? 169 VAL F C   1 
ATOM   8608 O O   . VAL F 3 169 ? -94.793  -34.838 -71.788  1.00 114.50 ? 169 VAL F O   1 
ATOM   8609 C CB  . VAL F 3 169 ? -92.800  -32.158 -71.503  1.00 115.09 ? 169 VAL F CB  1 
ATOM   8610 C CG1 . VAL F 3 169 ? -93.129  -32.264 -73.005  1.00 115.70 ? 169 VAL F CG1 1 
ATOM   8611 C CG2 . VAL F 3 169 ? -93.616  -31.032 -70.861  1.00 114.75 ? 169 VAL F CG2 1 
ATOM   8612 N N   . HIS F 3 170 ? -95.409  -33.367 -70.188  1.00 113.57 ? 170 HIS F N   1 
ATOM   8613 C CA  . HIS F 3 170 ? -96.831  -33.665 -70.326  1.00 112.58 ? 170 HIS F CA  1 
ATOM   8614 C C   . HIS F 3 170 ? -97.695  -32.422 -70.123  1.00 111.96 ? 170 HIS F C   1 
ATOM   8615 O O   . HIS F 3 170 ? -97.818  -31.929 -69.010  1.00 111.88 ? 170 HIS F O   1 
ATOM   8616 C CB  . HIS F 3 170 ? -97.249  -34.785 -69.359  1.00 112.42 ? 170 HIS F CB  1 
ATOM   8617 C CG  . HIS F 3 170 ? -96.481  -36.057 -69.539  1.00 111.78 ? 170 HIS F CG  1 
ATOM   8618 N ND1 . HIS F 3 170 ? -95.314  -36.323 -68.857  1.00 111.78 ? 170 HIS F ND1 1 
ATOM   8619 C CD2 . HIS F 3 170 ? -96.703  -37.129 -70.335  1.00 111.36 ? 170 HIS F CD2 1 
ATOM   8620 C CE1 . HIS F 3 170 ? -94.855  -37.508 -69.217  1.00 111.29 ? 170 HIS F CE1 1 
ATOM   8621 N NE2 . HIS F 3 170 ? -95.680  -38.019 -70.112  1.00 110.99 ? 170 HIS F NE2 1 
ATOM   8622 N N   . THR F 3 171 ? -98.291  -31.924 -71.202  1.00 111.17 ? 171 THR F N   1 
ATOM   8623 C CA  . THR F 3 171 ? -99.231  -30.803 -71.111  1.00 110.58 ? 171 THR F CA  1 
ATOM   8624 C C   . THR F 3 171 ? -100.677 -31.242 -71.369  1.00 110.34 ? 171 THR F C   1 
ATOM   8625 O O   . THR F 3 171 ? -101.057 -31.627 -72.482  1.00 110.24 ? 171 THR F O   1 
ATOM   8626 C CB  . THR F 3 171 ? -98.832  -29.660 -72.045  1.00 110.54 ? 171 THR F CB  1 
ATOM   8627 O OG1 . THR F 3 171 ? -97.440  -29.391 -71.870  1.00 110.86 ? 171 THR F OG1 1 
ATOM   8628 C CG2 . THR F 3 171 ? -99.631  -28.405 -71.746  1.00 109.72 ? 171 THR F CG2 1 
ATOM   8629 N N   . PHE F 3 172 ? -101.478 -31.176 -70.316  1.00 110.00 ? 172 PHE F N   1 
ATOM   8630 C CA  . PHE F 3 172 ? -102.807 -31.760 -70.327  1.00 109.66 ? 172 PHE F CA  1 
ATOM   8631 C C   . PHE F 3 172 ? -103.799 -30.804 -70.961  1.00 109.47 ? 172 PHE F C   1 
ATOM   8632 O O   . PHE F 3 172 ? -103.719 -29.600 -70.730  1.00 109.64 ? 172 PHE F O   1 
ATOM   8633 C CB  . PHE F 3 172 ? -103.212 -32.145 -68.901  1.00 109.68 ? 172 PHE F CB  1 
ATOM   8634 C CG  . PHE F 3 172 ? -102.269 -33.127 -68.260  1.00 109.70 ? 172 PHE F CG  1 
ATOM   8635 C CD1 . PHE F 3 172 ? -101.236 -32.688 -67.448  1.00 109.38 ? 172 PHE F CD1 1 
ATOM   8636 C CD2 . PHE F 3 172 ? -102.396 -34.494 -68.498  1.00 109.60 ? 172 PHE F CD2 1 
ATOM   8637 C CE1 . PHE F 3 172 ? -100.358 -33.594 -66.881  1.00 109.73 ? 172 PHE F CE1 1 
ATOM   8638 C CE2 . PHE F 3 172 ? -101.517 -35.397 -67.935  1.00 109.07 ? 172 PHE F CE2 1 
ATOM   8639 C CZ  . PHE F 3 172 ? -100.503 -34.953 -67.125  1.00 109.35 ? 172 PHE F CZ  1 
ATOM   8640 N N   . PRO F 3 173 ? -104.728 -31.334 -71.780  1.00 109.20 ? 173 PRO F N   1 
ATOM   8641 C CA  . PRO F 3 173 ? -105.716 -30.513 -72.474  1.00 108.98 ? 173 PRO F CA  1 
ATOM   8642 C C   . PRO F 3 173 ? -106.379 -29.529 -71.530  1.00 108.88 ? 173 PRO F C   1 
ATOM   8643 O O   . PRO F 3 173 ? -106.788 -29.906 -70.435  1.00 108.87 ? 173 PRO F O   1 
ATOM   8644 C CB  . PRO F 3 173 ? -106.739 -31.538 -72.957  1.00 108.91 ? 173 PRO F CB  1 
ATOM   8645 C CG  . PRO F 3 173 ? -105.968 -32.765 -73.149  1.00 108.97 ? 173 PRO F CG  1 
ATOM   8646 C CD  . PRO F 3 173 ? -104.897 -32.764 -72.093  1.00 109.24 ? 173 PRO F CD  1 
ATOM   8647 N N   . ALA F 3 174 ? -106.473 -28.274 -71.947  1.00 108.97 ? 174 ALA F N   1 
ATOM   8648 C CA  . ALA F 3 174 ? -107.079 -27.242 -71.109  1.00 109.15 ? 174 ALA F CA  1 
ATOM   8649 C C   . ALA F 3 174 ? -108.522 -27.563 -70.752  1.00 109.17 ? 174 ALA F C   1 
ATOM   8650 O O   . ALA F 3 174 ? -109.150 -28.415 -71.377  1.00 109.01 ? 174 ALA F O   1 
ATOM   8651 C CB  . ALA F 3 174 ? -106.982 -25.879 -71.770  1.00 109.36 ? 174 ALA F CB  1 
ATOM   8652 N N   . VAL F 3 175 ? -109.037 -26.878 -69.738  1.00 109.43 ? 175 VAL F N   1 
ATOM   8653 C CA  . VAL F 3 175 ? -110.338 -27.206 -69.179  1.00 109.78 ? 175 VAL F CA  1 
ATOM   8654 C C   . VAL F 3 175 ? -111.094 -25.944 -68.800  1.00 110.12 ? 175 VAL F C   1 
ATOM   8655 O O   . VAL F 3 175 ? -110.503 -24.988 -68.297  1.00 110.38 ? 175 VAL F O   1 
ATOM   8656 C CB  . VAL F 3 175 ? -110.185 -28.068 -67.922  1.00 109.73 ? 175 VAL F CB  1 
ATOM   8657 C CG1 . VAL F 3 175 ? -111.549 -28.483 -67.410  1.00 109.85 ? 175 VAL F CG1 1 
ATOM   8658 C CG2 . VAL F 3 175 ? -109.306 -29.293 -68.200  1.00 109.51 ? 175 VAL F CG2 1 
ATOM   8659 N N   . LEU F 3 176 ? -112.405 -25.955 -69.000  1.00 110.43 ? 176 LEU F N   1 
ATOM   8660 C CA  . LEU F 3 176 ? -113.189 -24.745 -68.798  1.00 110.99 ? 176 LEU F CA  1 
ATOM   8661 C C   . LEU F 3 176 ? -113.903 -24.605 -67.450  1.00 111.30 ? 176 LEU F C   1 
ATOM   8662 O O   . LEU F 3 176 ? -115.031 -25.076 -67.276  1.00 111.32 ? 176 LEU F O   1 
ATOM   8663 C CB  . LEU F 3 176 ? -114.167 -24.525 -69.956  1.00 111.09 ? 176 LEU F CB  1 
ATOM   8664 C CG  . LEU F 3 176 ? -113.563 -23.864 -71.198  1.00 111.25 ? 176 LEU F CG  1 
ATOM   8665 C CD1 . LEU F 3 176 ? -113.558 -24.798 -72.407  1.00 110.76 ? 176 LEU F CD1 1 
ATOM   8666 C CD2 . LEU F 3 176 ? -114.358 -22.615 -71.498  1.00 112.07 ? 176 LEU F CD2 1 
ATOM   8667 N N   . GLN F 3 177 ? -113.233 -23.945 -66.505  1.00 111.78 ? 177 GLN F N   1 
ATOM   8668 C CA  . GLN F 3 177 ? -113.892 -23.472 -65.278  1.00 112.10 ? 177 GLN F CA  1 
ATOM   8669 C C   . GLN F 3 177 ? -114.639 -22.163 -65.558  1.00 112.46 ? 177 GLN F C   1 
ATOM   8670 O O   . GLN F 3 177 ? -114.037 -21.098 -65.786  1.00 112.11 ? 177 GLN F O   1 
ATOM   8671 C CB  . GLN F 3 177 ? -112.938 -23.381 -64.060  1.00 111.98 ? 177 GLN F CB  1 
ATOM   8672 C CG  . GLN F 3 177 ? -111.437 -23.196 -64.360  1.00 111.42 ? 177 GLN F CG  1 
ATOM   8673 C CD  . GLN F 3 177 ? -110.874 -21.828 -63.962  1.00 110.55 ? 177 GLN F CD  1 
ATOM   8674 O OE1 . GLN F 3 177 ? -109.661 -21.674 -63.782  1.00 109.62 ? 177 GLN F OE1 1 
ATOM   8675 N NE2 . GLN F 3 177 ? -111.750 -20.834 -63.827  1.00 109.83 ? 177 GLN F NE2 1 
ATOM   8676 N N   . SER F 3 178 ? -115.965 -22.276 -65.552  1.00 113.07 ? 178 SER F N   1 
ATOM   8677 C CA  . SER F 3 178 ? -116.849 -21.226 -66.047  1.00 113.84 ? 178 SER F CA  1 
ATOM   8678 C C   . SER F 3 178 ? -116.334 -20.668 -67.386  1.00 114.44 ? 178 SER F C   1 
ATOM   8679 O O   . SER F 3 178 ? -116.097 -21.435 -68.343  1.00 114.84 ? 178 SER F O   1 
ATOM   8680 C CB  . SER F 3 178 ? -117.077 -20.128 -64.994  1.00 113.76 ? 178 SER F CB  1 
ATOM   8681 O OG  . SER F 3 178 ? -118.156 -20.466 -64.134  1.00 113.46 ? 178 SER F OG  1 
ATOM   8682 N N   . ASP F 3 179 ? -116.159 -19.350 -67.458  1.00 114.58 ? 179 ASP F N   1 
ATOM   8683 C CA  . ASP F 3 179 ? -115.705 -18.729 -68.690  1.00 114.51 ? 179 ASP F CA  1 
ATOM   8684 C C   . ASP F 3 179 ? -114.214 -18.562 -68.668  1.00 114.15 ? 179 ASP F C   1 
ATOM   8685 O O   . ASP F 3 179 ? -113.680 -17.656 -69.305  1.00 114.27 ? 179 ASP F O   1 
ATOM   8686 C CB  . ASP F 3 179 ? -116.410 -17.399 -68.925  1.00 114.76 ? 179 ASP F CB  1 
ATOM   8687 C CG  . ASP F 3 179 ? -117.854 -17.585 -69.337  1.00 115.96 ? 179 ASP F CG  1 
ATOM   8688 O OD1 . ASP F 3 179 ? -118.158 -18.619 -69.979  1.00 116.94 ? 179 ASP F OD1 1 
ATOM   8689 O OD2 . ASP F 3 179 ? -118.685 -16.705 -69.021  1.00 117.71 ? 179 ASP F OD2 1 
ATOM   8690 N N   . LEU F 3 180 ? -113.546 -19.434 -67.922  1.00 113.66 ? 180 LEU F N   1 
ATOM   8691 C CA  . LEU F 3 180 ? -112.098 -19.451 -67.916  1.00 113.46 ? 180 LEU F CA  1 
ATOM   8692 C C   . LEU F 3 180 ? -111.579 -20.844 -68.178  1.00 113.36 ? 180 LEU F C   1 
ATOM   8693 O O   . LEU F 3 180 ? -112.338 -21.810 -68.153  1.00 113.29 ? 180 LEU F O   1 
ATOM   8694 C CB  . LEU F 3 180 ? -111.533 -18.900 -66.607  1.00 113.39 ? 180 LEU F CB  1 
ATOM   8695 C CG  . LEU F 3 180 ? -111.467 -17.383 -66.386  1.00 113.37 ? 180 LEU F CG  1 
ATOM   8696 C CD1 . LEU F 3 180 ? -110.763 -16.661 -67.532  1.00 112.30 ? 180 LEU F CD1 1 
ATOM   8697 C CD2 . LEU F 3 180 ? -112.862 -16.769 -66.111  1.00 113.64 ? 180 LEU F CD2 1 
ATOM   8698 N N   . TYR F 3 181 ? -110.276 -20.919 -68.431  1.00 113.28 ? 181 TYR F N   1 
ATOM   8699 C CA  . TYR F 3 181 ? -109.594 -22.141 -68.824  1.00 113.24 ? 181 TYR F CA  1 
ATOM   8700 C C   . TYR F 3 181 ? -108.620 -22.563 -67.746  1.00 113.05 ? 181 TYR F C   1 
ATOM   8701 O O   . TYR F 3 181 ? -108.412 -21.826 -66.791  1.00 113.30 ? 181 TYR F O   1 
ATOM   8702 C CB  . TYR F 3 181 ? -108.849 -21.911 -70.135  1.00 113.36 ? 181 TYR F CB  1 
ATOM   8703 C CG  . TYR F 3 181 ? -109.703 -22.114 -71.351  1.00 113.82 ? 181 TYR F CG  1 
ATOM   8704 C CD1 . TYR F 3 181 ? -109.588 -23.276 -72.113  1.00 114.33 ? 181 TYR F CD1 1 
ATOM   8705 C CD2 . TYR F 3 181 ? -110.641 -21.156 -71.732  1.00 114.23 ? 181 TYR F CD2 1 
ATOM   8706 C CE1 . TYR F 3 181 ? -110.373 -23.477 -73.231  1.00 114.86 ? 181 TYR F CE1 1 
ATOM   8707 C CE2 . TYR F 3 181 ? -111.435 -21.346 -72.847  1.00 115.03 ? 181 TYR F CE2 1 
ATOM   8708 C CZ  . TYR F 3 181 ? -111.293 -22.507 -73.593  1.00 115.29 ? 181 TYR F CZ  1 
ATOM   8709 O OH  . TYR F 3 181 ? -112.077 -22.698 -74.699  1.00 115.89 ? 181 TYR F OH  1 
ATOM   8710 N N   . THR F 3 182 ? -108.028 -23.747 -67.892  1.00 112.75 ? 182 THR F N   1 
ATOM   8711 C CA  . THR F 3 182 ? -107.072 -24.249 -66.911  1.00 112.44 ? 182 THR F CA  1 
ATOM   8712 C C   . THR F 3 182 ? -106.183 -25.311 -67.513  1.00 112.24 ? 182 THR F C   1 
ATOM   8713 O O   . THR F 3 182 ? -106.669 -26.191 -68.216  1.00 112.32 ? 182 THR F O   1 
ATOM   8714 C CB  . THR F 3 182 ? -107.785 -24.894 -65.723  1.00 112.58 ? 182 THR F CB  1 
ATOM   8715 O OG1 . THR F 3 182 ? -109.056 -24.264 -65.517  1.00 112.65 ? 182 THR F OG1 1 
ATOM   8716 C CG2 . THR F 3 182 ? -106.923 -24.789 -64.467  1.00 112.50 ? 182 THR F CG2 1 
ATOM   8717 N N   . LEU F 3 183 ? -104.891 -25.250 -67.195  1.00 112.05 ? 183 LEU F N   1 
ATOM   8718 C CA  . LEU F 3 183 ? -103.893 -26.191 -67.717  1.00 111.88 ? 183 LEU F CA  1 
ATOM   8719 C C   . LEU F 3 183 ? -102.725 -26.434 -66.740  1.00 111.98 ? 183 LEU F C   1 
ATOM   8720 O O   . LEU F 3 183 ? -102.576 -25.734 -65.734  1.00 111.89 ? 183 LEU F O   1 
ATOM   8721 C CB  . LEU F 3 183 ? -103.387 -25.676 -69.068  1.00 111.77 ? 183 LEU F CB  1 
ATOM   8722 C CG  . LEU F 3 183 ? -102.297 -26.350 -69.900  1.00 111.63 ? 183 LEU F CG  1 
ATOM   8723 C CD1 . LEU F 3 183 ? -102.605 -26.142 -71.374  1.00 111.78 ? 183 LEU F CD1 1 
ATOM   8724 C CD2 . LEU F 3 183 ? -100.904 -25.817 -69.550  1.00 111.20 ? 183 LEU F CD2 1 
ATOM   8725 N N   . SER F 3 184 ? -101.914 -27.445 -67.041  1.00 112.18 ? 184 SER F N   1 
ATOM   8726 C CA  . SER F 3 184 ? -100.698 -27.743 -66.292  1.00 112.45 ? 184 SER F CA  1 
ATOM   8727 C C   . SER F 3 184 ? -99.831  -28.726 -67.067  1.00 112.82 ? 184 SER F C   1 
ATOM   8728 O O   . SER F 3 184 ? -100.351 -29.588 -67.776  1.00 112.99 ? 184 SER F O   1 
ATOM   8729 C CB  . SER F 3 184 ? -101.036 -28.336 -64.926  1.00 112.27 ? 184 SER F CB  1 
ATOM   8730 O OG  . SER F 3 184 ? -101.727 -29.561 -65.073  1.00 112.43 ? 184 SER F OG  1 
ATOM   8731 N N   . SER F 3 185 ? -98.513  -28.603 -66.928  1.00 113.33 ? 185 SER F N   1 
ATOM   8732 C CA  . SER F 3 185 ? -97.592  -29.593 -67.488  1.00 113.83 ? 185 SER F CA  1 
ATOM   8733 C C   . SER F 3 185 ? -96.678  -30.244 -66.451  1.00 114.19 ? 185 SER F C   1 
ATOM   8734 O O   . SER F 3 185 ? -96.338  -29.653 -65.431  1.00 114.22 ? 185 SER F O   1 
ATOM   8735 C CB  . SER F 3 185 ? -96.756  -29.005 -68.622  1.00 113.76 ? 185 SER F CB  1 
ATOM   8736 O OG  . SER F 3 185 ? -96.004  -30.027 -69.258  1.00 114.06 ? 185 SER F OG  1 
ATOM   8737 N N   . SER F 3 186 ? -96.279  -31.473 -66.732  1.00 114.75 ? 186 SER F N   1 
ATOM   8738 C CA  . SER F 3 186 ? -95.432  -32.213 -65.821  1.00 115.39 ? 186 SER F CA  1 
ATOM   8739 C C   . SER F 3 186 ? -94.138  -32.651 -66.506  1.00 115.72 ? 186 SER F C   1 
ATOM   8740 O O   . SER F 3 186 ? -94.106  -32.816 -67.727  1.00 115.73 ? 186 SER F O   1 
ATOM   8741 C CB  . SER F 3 186 ? -96.199  -33.412 -65.234  1.00 115.50 ? 186 SER F CB  1 
ATOM   8742 O OG  . SER F 3 186 ? -96.890  -34.149 -66.232  1.00 115.42 ? 186 SER F OG  1 
ATOM   8743 N N   . VAL F 3 187 ? -93.078  -32.819 -65.713  1.00 116.11 ? 187 VAL F N   1 
ATOM   8744 C CA  . VAL F 3 187 ? -91.790  -33.291 -66.212  1.00 116.45 ? 187 VAL F CA  1 
ATOM   8745 C C   . VAL F 3 187 ? -91.053  -34.118 -65.151  1.00 116.96 ? 187 VAL F C   1 
ATOM   8746 O O   . VAL F 3 187 ? -91.168  -33.858 -63.957  1.00 116.80 ? 187 VAL F O   1 
ATOM   8747 C CB  . VAL F 3 187 ? -90.922  -32.124 -66.724  1.00 116.26 ? 187 VAL F CB  1 
ATOM   8748 C CG1 . VAL F 3 187 ? -89.767  -31.854 -65.778  1.00 116.16 ? 187 VAL F CG1 1 
ATOM   8749 C CG2 . VAL F 3 187 ? -90.411  -32.426 -68.127  1.00 116.07 ? 187 VAL F CG2 1 
ATOM   8750 N N   . THR F 3 188 ? -90.292  -35.108 -65.612  1.00 117.90 ? 188 THR F N   1 
ATOM   8751 C CA  . THR F 3 188 ? -89.692  -36.127 -64.745  1.00 118.83 ? 188 THR F CA  1 
ATOM   8752 C C   . THR F 3 188 ? -88.166  -36.294 -64.967  1.00 119.75 ? 188 THR F C   1 
ATOM   8753 O O   . THR F 3 188 ? -87.721  -36.943 -65.922  1.00 119.83 ? 188 THR F O   1 
ATOM   8754 C CB  . THR F 3 188 ? -90.417  -37.478 -64.918  1.00 118.54 ? 188 THR F CB  1 
ATOM   8755 O OG1 . THR F 3 188 ? -91.785  -37.242 -65.256  1.00 118.55 ? 188 THR F OG1 1 
ATOM   8756 C CG2 . THR F 3 188 ? -90.367  -38.277 -63.642  1.00 118.68 ? 188 THR F CG2 1 
ATOM   8757 N N   . VAL F 3 189 ? -87.388  -35.716 -64.048  1.00 120.75 ? 189 VAL F N   1 
ATOM   8758 C CA  . VAL F 3 189 ? -85.926  -35.596 -64.131  1.00 121.49 ? 189 VAL F CA  1 
ATOM   8759 C C   . VAL F 3 189 ? -85.235  -36.618 -63.216  1.00 122.11 ? 189 VAL F C   1 
ATOM   8760 O O   . VAL F 3 189 ? -85.863  -37.168 -62.305  1.00 122.18 ? 189 VAL F O   1 
ATOM   8761 C CB  . VAL F 3 189 ? -85.485  -34.159 -63.699  1.00 121.46 ? 189 VAL F CB  1 
ATOM   8762 C CG1 . VAL F 3 189 ? -84.103  -33.825 -64.211  1.00 121.78 ? 189 VAL F CG1 1 
ATOM   8763 C CG2 . VAL F 3 189 ? -86.471  -33.112 -64.198  1.00 121.50 ? 189 VAL F CG2 1 
ATOM   8764 N N   . THR F 3 190 ? -83.947  -36.874 -63.463  1.00 122.99 ? 190 THR F N   1 
ATOM   8765 C CA  . THR F 3 190 ? -83.102  -37.643 -62.534  1.00 123.75 ? 190 THR F CA  1 
ATOM   8766 C C   . THR F 3 190 ? -82.940  -36.839 -61.253  1.00 124.12 ? 190 THR F C   1 
ATOM   8767 O O   . THR F 3 190 ? -82.617  -35.650 -61.305  1.00 124.28 ? 190 THR F O   1 
ATOM   8768 C CB  . THR F 3 190 ? -81.677  -37.914 -63.111  1.00 123.79 ? 190 THR F CB  1 
ATOM   8769 O OG1 . THR F 3 190 ? -81.769  -38.646 -64.340  1.00 124.23 ? 190 THR F OG1 1 
ATOM   8770 C CG2 . THR F 3 190 ? -80.813  -38.705 -62.125  1.00 123.85 ? 190 THR F CG2 1 
ATOM   8771 N N   . SER F 3 191 ? -83.166  -37.486 -60.111  1.00 124.66 ? 191 SER F N   1 
ATOM   8772 C CA  . SER F 3 191 ? -82.926  -36.865 -58.806  1.00 125.22 ? 191 SER F CA  1 
ATOM   8773 C C   . SER F 3 191 ? -81.697  -35.942 -58.831  1.00 125.60 ? 191 SER F C   1 
ATOM   8774 O O   . SER F 3 191 ? -81.733  -34.826 -58.288  1.00 125.62 ? 191 SER F O   1 
ATOM   8775 C CB  . SER F 3 191 ? -82.775  -37.939 -57.721  1.00 125.20 ? 191 SER F CB  1 
ATOM   8776 O OG  . SER F 3 191 ? -81.853  -38.943 -58.119  1.00 125.04 ? 191 SER F OG  1 
ATOM   8777 N N   . SER F 3 192 ? -80.639  -36.411 -59.500  1.00 125.96 ? 192 SER F N   1 
ATOM   8778 C CA  . SER F 3 192 ? -79.362  -35.704 -59.611  1.00 126.44 ? 192 SER F CA  1 
ATOM   8779 C C   . SER F 3 192 ? -79.456  -34.338 -60.297  1.00 126.82 ? 192 SER F C   1 
ATOM   8780 O O   . SER F 3 192 ? -78.881  -33.353 -59.820  1.00 126.80 ? 192 SER F O   1 
ATOM   8781 C CB  . SER F 3 192 ? -78.347  -36.577 -60.352  1.00 126.35 ? 192 SER F CB  1 
ATOM   8782 O OG  . SER F 3 192 ? -78.173  -37.822 -59.698  1.00 126.52 ? 192 SER F OG  1 
ATOM   8783 N N   . THR F 3 193 ? -80.179  -34.288 -61.413  1.00 127.33 ? 193 THR F N   1 
ATOM   8784 C CA  . THR F 3 193 ? -80.217  -33.083 -62.244  1.00 127.69 ? 193 THR F CA  1 
ATOM   8785 C C   . THR F 3 193 ? -81.094  -31.935 -61.731  1.00 128.05 ? 193 THR F C   1 
ATOM   8786 O O   . THR F 3 193 ? -80.766  -30.775 -61.979  1.00 128.10 ? 193 THR F O   1 
ATOM   8787 C CB  . THR F 3 193 ? -80.478  -33.377 -63.748  1.00 127.65 ? 193 THR F CB  1 
ATOM   8788 O OG1 . THR F 3 193 ? -81.163  -34.628 -63.904  1.00 127.13 ? 193 THR F OG1 1 
ATOM   8789 C CG2 . THR F 3 193 ? -79.156  -33.431 -64.498  1.00 127.87 ? 193 THR F CG2 1 
ATOM   8790 N N   . TRP F 3 194 ? -82.190  -32.215 -61.027  1.00 128.43 ? 194 TRP F N   1 
ATOM   8791 C CA  . TRP F 3 194 ? -82.803  -31.105 -60.304  1.00 128.93 ? 194 TRP F CA  1 
ATOM   8792 C C   . TRP F 3 194 ? -82.150  -30.967 -58.943  1.00 129.05 ? 194 TRP F C   1 
ATOM   8793 O O   . TRP F 3 194 ? -80.963  -31.276 -58.820  1.00 129.13 ? 194 TRP F O   1 
ATOM   8794 C CB  . TRP F 3 194 ? -84.339  -31.102 -60.248  1.00 129.20 ? 194 TRP F CB  1 
ATOM   8795 C CG  . TRP F 3 194 ? -84.907  -29.659 -60.200  1.00 129.89 ? 194 TRP F CG  1 
ATOM   8796 C CD1 . TRP F 3 194 ? -84.655  -28.656 -61.097  1.00 130.58 ? 194 TRP F CD1 1 
ATOM   8797 C CD2 . TRP F 3 194 ? -85.800  -29.091 -59.219  1.00 130.28 ? 194 TRP F CD2 1 
ATOM   8798 N NE1 . TRP F 3 194 ? -85.328  -27.508 -60.747  1.00 130.92 ? 194 TRP F NE1 1 
ATOM   8799 C CE2 . TRP F 3 194 ? -86.042  -27.743 -59.603  1.00 130.88 ? 194 TRP F CE2 1 
ATOM   8800 C CE3 . TRP F 3 194 ? -86.420  -29.587 -58.064  1.00 130.02 ? 194 TRP F CE3 1 
ATOM   8801 C CZ2 . TRP F 3 194 ? -86.884  -26.884 -58.873  1.00 131.10 ? 194 TRP F CZ2 1 
ATOM   8802 C CZ3 . TRP F 3 194 ? -87.254  -28.733 -57.333  1.00 130.82 ? 194 TRP F CZ3 1 
ATOM   8803 C CH2 . TRP F 3 194 ? -87.478  -27.393 -57.745  1.00 131.25 ? 194 TRP F CH2 1 
ATOM   8804 N N   . PRO F 3 195 ? -82.930  -30.626 -57.898  1.00 129.16 ? 195 PRO F N   1 
ATOM   8805 C CA  . PRO F 3 195 ? -82.432  -29.670 -56.932  1.00 129.13 ? 195 PRO F CA  1 
ATOM   8806 C C   . PRO F 3 195 ? -81.269  -28.853 -57.517  1.00 129.24 ? 195 PRO F C   1 
ATOM   8807 O O   . PRO F 3 195 ? -81.488  -27.712 -57.937  1.00 129.41 ? 195 PRO F O   1 
ATOM   8808 C CB  . PRO F 3 195 ? -82.023  -30.563 -55.762  1.00 129.06 ? 195 PRO F CB  1 
ATOM   8809 C CG  . PRO F 3 195 ? -82.977  -31.783 -55.879  1.00 129.10 ? 195 PRO F CG  1 
ATOM   8810 C CD  . PRO F 3 195 ? -83.705  -31.667 -57.204  1.00 129.21 ? 195 PRO F CD  1 
ATOM   8811 N N   . SER F 3 196 ? -80.076  -29.454 -57.580  1.00 129.18 ? 196 SER F N   1 
ATOM   8812 C CA  . SER F 3 196 ? -78.866  -28.853 -58.171  1.00 129.06 ? 196 SER F CA  1 
ATOM   8813 C C   . SER F 3 196 ? -79.110  -27.882 -59.347  1.00 129.01 ? 196 SER F C   1 
ATOM   8814 O O   . SER F 3 196 ? -79.231  -26.661 -59.139  1.00 128.99 ? 196 SER F O   1 
ATOM   8815 C CB  . SER F 3 196 ? -77.868  -29.956 -58.570  1.00 129.07 ? 196 SER F CB  1 
ATOM   8816 O OG  . SER F 3 196 ? -78.411  -30.841 -59.536  1.00 128.73 ? 196 SER F OG  1 
ATOM   8817 N N   . GLN F 3 197 ? -79.168  -28.428 -60.564  1.00 128.85 ? 197 GLN F N   1 
ATOM   8818 C CA  . GLN F 3 197 ? -79.434  -27.643 -61.776  1.00 128.66 ? 197 GLN F CA  1 
ATOM   8819 C C   . GLN F 3 197 ? -80.908  -27.252 -61.889  1.00 128.53 ? 197 GLN F C   1 
ATOM   8820 O O   . GLN F 3 197 ? -81.799  -28.078 -61.684  1.00 128.56 ? 197 GLN F O   1 
ATOM   8821 C CB  . GLN F 3 197 ? -79.001  -28.413 -63.019  1.00 128.54 ? 197 GLN F CB  1 
ATOM   8822 C CG  . GLN F 3 197 ? -79.413  -27.767 -64.320  1.00 128.29 ? 197 GLN F CG  1 
ATOM   8823 C CD  . GLN F 3 197 ? -79.384  -28.732 -65.483  1.00 128.79 ? 197 GLN F CD  1 
ATOM   8824 O OE1 . GLN F 3 197 ? -79.605  -28.334 -66.629  1.00 128.95 ? 197 GLN F OE1 1 
ATOM   8825 N NE2 . GLN F 3 197 ? -79.115  -30.012 -65.202  1.00 128.47 ? 197 GLN F NE2 1 
ATOM   8826 N N   . SER F 3 198 ? -81.138  -25.989 -62.237  1.00 128.22 ? 198 SER F N   1 
ATOM   8827 C CA  . SER F 3 198 ? -82.465  -25.382 -62.271  1.00 127.94 ? 198 SER F CA  1 
ATOM   8828 C C   . SER F 3 198 ? -83.270  -25.691 -63.542  1.00 127.97 ? 198 SER F C   1 
ATOM   8829 O O   . SER F 3 198 ? -82.706  -26.080 -64.572  1.00 128.00 ? 198 SER F O   1 
ATOM   8830 C CB  . SER F 3 198 ? -82.300  -23.879 -62.133  1.00 127.83 ? 198 SER F CB  1 
ATOM   8831 O OG  . SER F 3 198 ? -81.032  -23.495 -62.628  1.00 127.56 ? 198 SER F OG  1 
ATOM   8832 N N   . ILE F 3 199 ? -84.594  -25.527 -63.449  1.00 127.75 ? 199 ILE F N   1 
ATOM   8833 C CA  . ILE F 3 199 ? -85.498  -25.619 -64.599  1.00 127.27 ? 199 ILE F CA  1 
ATOM   8834 C C   . ILE F 3 199 ? -86.529  -24.498 -64.535  1.00 127.22 ? 199 ILE F C   1 
ATOM   8835 O O   . ILE F 3 199 ? -87.461  -24.548 -63.732  1.00 127.17 ? 199 ILE F O   1 
ATOM   8836 C CB  . ILE F 3 199 ? -86.256  -26.955 -64.661  1.00 127.10 ? 199 ILE F CB  1 
ATOM   8837 C CG1 . ILE F 3 199 ? -85.313  -28.141 -64.470  1.00 126.93 ? 199 ILE F CG1 1 
ATOM   8838 C CG2 . ILE F 3 199 ? -86.990  -27.066 -65.992  1.00 127.32 ? 199 ILE F CG2 1 
ATOM   8839 C CD1 . ILE F 3 199 ? -86.007  -29.418 -64.052  1.00 126.68 ? 199 ILE F CD1 1 
ATOM   8840 N N   . THR F 3 200 ? -86.349  -23.491 -65.383  1.00 127.23 ? 200 THR F N   1 
ATOM   8841 C CA  . THR F 3 200 ? -87.278  -22.364 -65.481  1.00 127.36 ? 200 THR F CA  1 
ATOM   8842 C C   . THR F 3 200 ? -88.436  -22.686 -66.422  1.00 127.40 ? 200 THR F C   1 
ATOM   8843 O O   . THR F 3 200 ? -88.220  -23.008 -67.593  1.00 127.65 ? 200 THR F O   1 
ATOM   8844 C CB  . THR F 3 200 ? -86.573  -21.088 -65.971  1.00 127.37 ? 200 THR F CB  1 
ATOM   8845 O OG1 . THR F 3 200 ? -85.355  -21.449 -66.638  1.00 127.69 ? 200 THR F OG1 1 
ATOM   8846 C CG2 . THR F 3 200 ? -86.250  -20.169 -64.807  1.00 127.31 ? 200 THR F CG2 1 
ATOM   8847 N N   . CYS F 3 201 ? -89.661  -22.585 -65.907  1.00 127.32 ? 201 CYS F N   1 
ATOM   8848 C CA  . CYS F 3 201 ? -90.864  -22.998 -66.638  1.00 127.15 ? 201 CYS F CA  1 
ATOM   8849 C C   . CYS F 3 201 ? -91.445  -21.871 -67.487  1.00 127.26 ? 201 CYS F C   1 
ATOM   8850 O O   . CYS F 3 201 ? -92.151  -20.992 -66.982  1.00 127.24 ? 201 CYS F O   1 
ATOM   8851 C CB  . CYS F 3 201 ? -91.922  -23.548 -65.681  1.00 127.03 ? 201 CYS F CB  1 
ATOM   8852 S SG  . CYS F 3 201 ? -93.154  -24.575 -66.485  1.00 126.14 ? 201 CYS F SG  1 
ATOM   8853 N N   . ASN F 3 202 ? -91.160  -21.942 -68.787  1.00 127.33 ? 202 ASN F N   1 
ATOM   8854 C CA  . ASN F 3 202 ? -91.401  -20.849 -69.727  1.00 127.34 ? 202 ASN F CA  1 
ATOM   8855 C C   . ASN F 3 202 ? -92.773  -20.909 -70.368  1.00 127.65 ? 202 ASN F C   1 
ATOM   8856 O O   . ASN F 3 202 ? -93.044  -21.773 -71.207  1.00 127.53 ? 202 ASN F O   1 
ATOM   8857 C CB  . ASN F 3 202 ? -90.331  -20.847 -70.821  1.00 127.14 ? 202 ASN F CB  1 
ATOM   8858 C CG  . ASN F 3 202 ? -89.185  -21.775 -70.512  1.00 126.02 ? 202 ASN F CG  1 
ATOM   8859 O OD1 . ASN F 3 202 ? -88.113  -21.343 -70.112  1.00 125.34 ? 202 ASN F OD1 1 
ATOM   8860 N ND2 . ASN F 3 202 ? -89.409  -23.061 -70.692  1.00 124.67 ? 202 ASN F ND2 1 
ATOM   8861 N N   . VAL F 3 203 ? -93.636  -19.979 -69.976  1.00 128.12 ? 203 VAL F N   1 
ATOM   8862 C CA  . VAL F 3 203 ? -95.006  -19.970 -70.477  1.00 128.71 ? 203 VAL F CA  1 
ATOM   8863 C C   . VAL F 3 203 ? -95.370  -18.624 -71.100  1.00 128.92 ? 203 VAL F C   1 
ATOM   8864 O O   . VAL F 3 203 ? -94.913  -17.576 -70.637  1.00 128.88 ? 203 VAL F O   1 
ATOM   8865 C CB  . VAL F 3 203 ? -96.038  -20.359 -69.382  1.00 128.77 ? 203 VAL F CB  1 
ATOM   8866 C CG1 . VAL F 3 203 ? -97.375  -20.760 -70.016  1.00 128.70 ? 203 VAL F CG1 1 
ATOM   8867 C CG2 . VAL F 3 203 ? -95.505  -21.500 -68.510  1.00 128.85 ? 203 VAL F CG2 1 
ATOM   8868 N N   . ALA F 3 204 ? -96.188  -18.680 -72.155  1.00 129.22 ? 204 ALA F N   1 
ATOM   8869 C CA  . ALA F 3 204 ? -96.658  -17.493 -72.866  1.00 129.55 ? 204 ALA F CA  1 
ATOM   8870 C C   . ALA F 3 204 ? -98.119  -17.614 -73.321  1.00 129.77 ? 204 ALA F C   1 
ATOM   8871 O O   . ALA F 3 204 ? -98.562  -18.687 -73.746  1.00 129.71 ? 204 ALA F O   1 
ATOM   8872 C CB  . ALA F 3 204 ? -95.749  -17.196 -74.055  1.00 129.46 ? 204 ALA F CB  1 
ATOM   8873 N N   . HIS F 3 205 ? -98.857  -16.509 -73.217  1.00 130.01 ? 205 HIS F N   1 
ATOM   8874 C CA  . HIS F 3 205 ? -100.223 -16.417 -73.733  1.00 130.39 ? 205 HIS F CA  1 
ATOM   8875 C C   . HIS F 3 205 ? -100.204 -15.480 -74.931  1.00 130.71 ? 205 HIS F C   1 
ATOM   8876 O O   . HIS F 3 205 ? -99.681  -14.379 -74.818  1.00 130.94 ? 205 HIS F O   1 
ATOM   8877 C CB  . HIS F 3 205 ? -101.147 -15.838 -72.660  1.00 130.41 ? 205 HIS F CB  1 
ATOM   8878 C CG  . HIS F 3 205 ? -102.609 -15.898 -72.999  1.00 130.48 ? 205 HIS F CG  1 
ATOM   8879 N ND1 . HIS F 3 205 ? -103.118 -15.490 -74.214  1.00 130.77 ? 205 HIS F ND1 1 
ATOM   8880 C CD2 . HIS F 3 205 ? -103.676 -16.281 -72.258  1.00 130.45 ? 205 HIS F CD2 1 
ATOM   8881 C CE1 . HIS F 3 205 ? -104.430 -15.645 -74.215  1.00 130.87 ? 205 HIS F CE1 1 
ATOM   8882 N NE2 . HIS F 3 205 ? -104.795 -16.118 -73.038  1.00 130.66 ? 205 HIS F NE2 1 
ATOM   8883 N N   . PRO F 3 206 ? -100.771 -15.901 -76.080  1.00 130.93 ? 206 PRO F N   1 
ATOM   8884 C CA  . PRO F 3 206 ? -100.784 -15.005 -77.235  1.00 131.01 ? 206 PRO F CA  1 
ATOM   8885 C C   . PRO F 3 206 ? -101.723 -13.817 -77.038  1.00 131.18 ? 206 PRO F C   1 
ATOM   8886 O O   . PRO F 3 206 ? -101.274 -12.673 -77.110  1.00 131.34 ? 206 PRO F O   1 
ATOM   8887 C CB  . PRO F 3 206 ? -101.266 -15.901 -78.378  1.00 131.02 ? 206 PRO F CB  1 
ATOM   8888 C CG  . PRO F 3 206 ? -102.030 -16.986 -77.723  1.00 131.04 ? 206 PRO F CG  1 
ATOM   8889 C CD  . PRO F 3 206 ? -101.356 -17.216 -76.400  1.00 131.09 ? 206 PRO F CD  1 
ATOM   8890 N N   . ALA F 3 207 ? -102.998 -14.080 -76.764  1.00 131.27 ? 207 ALA F N   1 
ATOM   8891 C CA  . ALA F 3 207 ? -103.987 -13.012 -76.654  1.00 131.62 ? 207 ALA F CA  1 
ATOM   8892 C C   . ALA F 3 207 ? -103.722 -12.022 -75.512  1.00 131.95 ? 207 ALA F C   1 
ATOM   8893 O O   . ALA F 3 207 ? -104.348 -10.961 -75.455  1.00 132.04 ? 207 ALA F O   1 
ATOM   8894 C CB  . ALA F 3 207 ? -105.383 -13.585 -76.561  1.00 131.55 ? 207 ALA F CB  1 
ATOM   8895 N N   . SER F 3 208 ? -102.795 -12.360 -74.615  1.00 132.39 ? 208 SER F N   1 
ATOM   8896 C CA  . SER F 3 208 ? -102.364 -11.432 -73.559  1.00 132.91 ? 208 SER F CA  1 
ATOM   8897 C C   . SER F 3 208 ? -100.976 -10.870 -73.862  1.00 133.15 ? 208 SER F C   1 
ATOM   8898 O O   . SER F 3 208 ? -100.764 -9.654  -73.815  1.00 133.17 ? 208 SER F O   1 
ATOM   8899 C CB  . SER F 3 208 ? -102.385 -12.096 -72.169  1.00 133.00 ? 208 SER F CB  1 
ATOM   8900 O OG  . SER F 3 208 ? -101.108 -12.595 -71.784  1.00 132.97 ? 208 SER F OG  1 
ATOM   8901 N N   . SER F 3 209 ? -100.050 -11.779 -74.166  1.00 133.47 ? 209 SER F N   1 
ATOM   8902 C CA  . SER F 3 209 ? -98.651  -11.475 -74.511  1.00 133.80 ? 209 SER F CA  1 
ATOM   8903 C C   . SER F 3 209 ? -97.747  -11.348 -73.276  1.00 133.89 ? 209 SER F C   1 
ATOM   8904 O O   . SER F 3 209 ? -97.261  -10.263 -72.958  1.00 134.00 ? 209 SER F O   1 
ATOM   8905 C CB  . SER F 3 209 ? -98.539  -10.258 -75.452  1.00 133.83 ? 209 SER F CB  1 
ATOM   8906 O OG  . SER F 3 209 ? -99.367  -10.416 -76.599  1.00 133.86 ? 209 SER F OG  1 
ATOM   8907 N N   . THR F 3 210 ? -97.523  -12.467 -72.589  1.00 134.05 ? 210 THR F N   1 
ATOM   8908 C CA  . THR F 3 210 ? -96.658  -12.477 -71.403  1.00 134.31 ? 210 THR F CA  1 
ATOM   8909 C C   . THR F 3 210 ? -95.636  -13.616 -71.385  1.00 134.33 ? 210 THR F C   1 
ATOM   8910 O O   . THR F 3 210 ? -96.000  -14.789 -71.480  1.00 134.33 ? 210 THR F O   1 
ATOM   8911 C CB  . THR F 3 210 ? -97.468  -12.480 -70.080  1.00 134.42 ? 210 THR F CB  1 
ATOM   8912 O OG1 . THR F 3 210 ? -98.704  -13.192 -70.266  1.00 135.00 ? 210 THR F OG1 1 
ATOM   8913 C CG2 . THR F 3 210 ? -97.748  -11.045 -69.619  1.00 134.04 ? 210 THR F CG2 1 
ATOM   8914 N N   . LYS F 3 211 ? -94.360  -13.241 -71.263  1.00 134.38 ? 211 LYS F N   1 
ATOM   8915 C CA  . LYS F 3 211 ? -93.240  -14.180 -71.115  1.00 134.32 ? 211 LYS F CA  1 
ATOM   8916 C C   . LYS F 3 211 ? -92.829  -14.327 -69.636  1.00 134.55 ? 211 LYS F C   1 
ATOM   8917 O O   . LYS F 3 211 ? -91.831  -13.747 -69.178  1.00 134.59 ? 211 LYS F O   1 
ATOM   8918 C CB  . LYS F 3 211 ? -92.039  -13.746 -71.971  1.00 134.13 ? 211 LYS F CB  1 
ATOM   8919 C CG  . LYS F 3 211 ? -92.248  -13.847 -73.483  1.00 133.39 ? 211 LYS F CG  1 
ATOM   8920 C CD  . LYS F 3 211 ? -90.980  -13.461 -74.263  1.00 132.32 ? 211 LYS F CD  1 
ATOM   8921 C CE  . LYS F 3 211 ? -90.786  -11.940 -74.382  1.00 130.81 ? 211 LYS F CE  1 
ATOM   8922 N NZ  . LYS F 3 211 ? -89.422  -11.572 -74.866  1.00 128.94 ? 211 LYS F NZ  1 
ATOM   8923 N N   . VAL F 3 212 ? -93.615  -15.106 -68.898  1.00 134.66 ? 212 VAL F N   1 
ATOM   8924 C CA  . VAL F 3 212 ? -93.360  -15.363 -67.486  1.00 134.74 ? 212 VAL F CA  1 
ATOM   8925 C C   . VAL F 3 212 ? -92.743  -16.759 -67.364  1.00 134.95 ? 212 VAL F C   1 
ATOM   8926 O O   . VAL F 3 212 ? -93.351  -17.746 -67.809  1.00 135.08 ? 212 VAL F O   1 
ATOM   8927 C CB  . VAL F 3 212 ? -94.657  -15.279 -66.668  1.00 134.63 ? 212 VAL F CB  1 
ATOM   8928 C CG1 . VAL F 3 212 ? -94.494  -14.256 -65.578  1.00 134.78 ? 212 VAL F CG1 1 
ATOM   8929 C CG2 . VAL F 3 212 ? -95.823  -14.875 -67.556  1.00 134.28 ? 212 VAL F CG2 1 
ATOM   8930 N N   . ASP F 3 213 ? -91.537  -16.836 -66.789  1.00 134.92 ? 213 ASP F N   1 
ATOM   8931 C CA  . ASP F 3 213 ? -90.731  -18.076 -66.823  1.00 134.85 ? 213 ASP F CA  1 
ATOM   8932 C C   . ASP F 3 213 ? -90.199  -18.530 -65.450  1.00 134.69 ? 213 ASP F C   1 
ATOM   8933 O O   . ASP F 3 213 ? -89.063  -18.213 -65.086  1.00 134.70 ? 213 ASP F O   1 
ATOM   8934 C CB  . ASP F 3 213 ? -89.561  -17.934 -67.817  1.00 134.92 ? 213 ASP F CB  1 
ATOM   8935 C CG  . ASP F 3 213 ? -89.983  -17.347 -69.174  1.00 135.04 ? 213 ASP F CG  1 
ATOM   8936 O OD1 . ASP F 3 213 ? -91.042  -17.744 -69.724  1.00 134.27 ? 213 ASP F OD1 1 
ATOM   8937 O OD2 . ASP F 3 213 ? -89.227  -16.492 -69.698  1.00 135.43 ? 213 ASP F OD2 1 
ATOM   8938 N N   . LYS F 3 214 ? -91.006  -19.311 -64.726  1.00 134.45 ? 214 LYS F N   1 
ATOM   8939 C CA  . LYS F 3 214 ? -90.762  -19.633 -63.304  1.00 134.13 ? 214 LYS F CA  1 
ATOM   8940 C C   . LYS F 3 214 ? -89.784  -20.781 -63.027  1.00 134.24 ? 214 LYS F C   1 
ATOM   8941 O O   . LYS F 3 214 ? -89.342  -21.457 -63.941  1.00 134.16 ? 214 LYS F O   1 
ATOM   8942 C CB  . LYS F 3 214 ? -92.092  -19.889 -62.597  1.00 133.81 ? 214 LYS F CB  1 
ATOM   8943 C CG  . LYS F 3 214 ? -92.861  -18.629 -62.322  1.00 133.22 ? 214 LYS F CG  1 
ATOM   8944 C CD  . LYS F 3 214 ? -93.271  -17.940 -63.612  1.00 132.68 ? 214 LYS F CD  1 
ATOM   8945 C CE  . LYS F 3 214 ? -93.142  -16.438 -63.493  1.00 132.47 ? 214 LYS F CE  1 
ATOM   8946 N NZ  . LYS F 3 214 ? -94.243  -15.830 -62.689  1.00 132.41 ? 214 LYS F NZ  1 
ATOM   8947 N N   . LYS F 3 215 ? -89.448  -20.987 -61.754  1.00 134.41 ? 215 LYS F N   1 
ATOM   8948 C CA  . LYS F 3 215 ? -88.538  -22.063 -61.339  1.00 134.59 ? 215 LYS F CA  1 
ATOM   8949 C C   . LYS F 3 215 ? -88.865  -22.559 -59.923  1.00 134.57 ? 215 LYS F C   1 
ATOM   8950 O O   . LYS F 3 215 ? -89.865  -22.152 -59.318  1.00 134.45 ? 215 LYS F O   1 
ATOM   8951 C CB  . LYS F 3 215 ? -87.079  -21.591 -61.433  1.00 134.69 ? 215 LYS F CB  1 
ATOM   8952 C CG  . LYS F 3 215 ? -86.027  -22.535 -60.841  1.00 135.30 ? 215 LYS F CG  1 
ATOM   8953 C CD  . LYS F 3 215 ? -84.704  -21.787 -60.612  1.00 136.18 ? 215 LYS F CD  1 
ATOM   8954 C CE  . LYS F 3 215 ? -83.864  -22.427 -59.496  1.00 136.39 ? 215 LYS F CE  1 
ATOM   8955 N NZ  . LYS F 3 215 ? -82.569  -21.718 -59.244  1.00 135.88 ? 215 LYS F NZ  1 
HETATM 8956 C C1  . UQ1 G 4 .   ? -53.949  -1.126  -89.758  1.00 169.48 ? 177 UQ1 A C1  1 
HETATM 8957 O O1  . UQ1 G 4 .   ? -53.350  -0.690  -90.763  1.00 169.99 ? 177 UQ1 A O1  1 
HETATM 8958 C C2  . UQ1 G 4 .   ? -53.273  -1.015  -88.441  1.00 169.35 ? 177 UQ1 A C2  1 
HETATM 8959 O O2  . UQ1 G 4 .   ? -52.028  -0.450  -88.360  1.00 169.26 ? 177 UQ1 A O2  1 
HETATM 8960 C CM2 . UQ1 G 4 .   ? -50.865  -1.249  -88.572  1.00 169.08 ? 177 UQ1 A CM2 1 
HETATM 8961 C C3  . UQ1 G 4 .   ? -53.941  -1.519  -87.217  1.00 169.40 ? 177 UQ1 A C3  1 
HETATM 8962 O O3  . UQ1 G 4 .   ? -53.300  -1.406  -86.013  1.00 169.57 ? 177 UQ1 A O3  1 
HETATM 8963 C CM3 . UQ1 G 4 .   ? -52.610  -2.513  -85.439  1.00 169.85 ? 177 UQ1 A CM3 1 
HETATM 8964 C C4  . UQ1 G 4 .   ? -55.295  -2.135  -87.308  1.00 169.31 ? 177 UQ1 A C4  1 
HETATM 8965 O O4  . UQ1 G 4 .   ? -55.854  -2.569  -86.277  1.00 169.20 ? 177 UQ1 A O4  1 
HETATM 8966 C C5  . UQ1 G 4 .   ? -55.977  -2.248  -88.629  1.00 169.25 ? 177 UQ1 A C5  1 
HETATM 8967 C CM5 . UQ1 G 4 .   ? -57.342  -2.881  -88.689  1.00 169.22 ? 177 UQ1 A CM5 1 
HETATM 8968 C C6  . UQ1 G 4 .   ? -55.309  -1.741  -89.870  1.00 169.37 ? 177 UQ1 A C6  1 
HETATM 8969 C C7  . UQ1 G 4 .   ? -55.998  -1.859  -91.223  1.00 169.09 ? 177 UQ1 A C7  1 
HETATM 8970 C C8  . UQ1 G 4 .   ? -56.275  -0.491  -91.821  1.00 168.71 ? 177 UQ1 A C8  1 
HETATM 8971 C C9  . UQ1 G 4 .   ? -56.766  -0.297  -93.057  1.00 168.17 ? 177 UQ1 A C9  1 
HETATM 8972 C C10 . UQ1 G 4 .   ? -57.001  1.102   -93.552  1.00 167.64 ? 177 UQ1 A C10 1 
HETATM 8973 C C11 . UQ1 G 4 .   ? -57.080  -1.465  -93.946  1.00 168.41 ? 177 UQ1 A C11 1 
HETATM 8974 C C1  . UQ1 H 4 .   ? -137.101 -42.012 -124.039 1.00 268.54 ? 177 UQ1 D C1  1 
HETATM 8975 O O1  . UQ1 H 4 .   ? -138.009 -42.233 -124.871 1.00 268.62 ? 177 UQ1 D O1  1 
HETATM 8976 C C2  . UQ1 H 4 .   ? -136.935 -42.948 -122.894 1.00 268.56 ? 177 UQ1 D C2  1 
HETATM 8977 O O2  . UQ1 H 4 .   ? -137.769 -44.030 -122.775 1.00 268.53 ? 177 UQ1 D O2  1 
HETATM 8978 C CM2 . UQ1 H 4 .   ? -137.379 -45.282 -123.340 1.00 268.30 ? 177 UQ1 D CM2 1 
HETATM 8979 C C3  . UQ1 H 4 .   ? -135.866 -42.710 -121.886 1.00 268.59 ? 177 UQ1 D C3  1 
HETATM 8980 O O3  . UQ1 H 4 .   ? -135.705 -43.574 -120.831 1.00 268.78 ? 177 UQ1 D O3  1 
HETATM 8981 C CM3 . UQ1 H 4 .   ? -136.175 -43.254 -119.520 1.00 268.63 ? 177 UQ1 D CM3 1 
HETATM 8982 C C4  . UQ1 H 4 .   ? -134.961 -41.539 -122.034 1.00 268.50 ? 177 UQ1 D C4  1 
HETATM 8983 O O4  . UQ1 H 4 .   ? -134.063 -41.343 -121.190 1.00 268.56 ? 177 UQ1 D O4  1 
HETATM 8984 C C5  . UQ1 H 4 .   ? -135.122 -40.600 -123.176 1.00 268.44 ? 177 UQ1 D C5  1 
HETATM 8985 C CM5 . UQ1 H 4 .   ? -134.187 -39.421 -123.292 1.00 268.44 ? 177 UQ1 D CM5 1 
HETATM 8986 C C6  . UQ1 H 4 .   ? -136.194 -40.834 -124.188 1.00 268.49 ? 177 UQ1 D C6  1 
HETATM 8987 C C7  . UQ1 H 4 .   ? -136.362 -39.876 -125.354 1.00 268.47 ? 177 UQ1 D C7  1 
HETATM 8988 C C8  . UQ1 H 4 .   ? -135.851 -40.485 -126.644 1.00 268.32 ? 177 UQ1 D C8  1 
HETATM 8989 C C9  . UQ1 H 4 .   ? -135.459 -39.760 -127.712 1.00 268.09 ? 177 UQ1 D C9  1 
HETATM 8990 C C10 . UQ1 H 4 .   ? -134.977 -40.478 -128.938 1.00 267.98 ? 177 UQ1 D C10 1 
HETATM 8991 C C11 . UQ1 H 4 .   ? -135.492 -38.257 -127.715 1.00 267.86 ? 177 UQ1 D C11 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LEU 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   PHE 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   ALA 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  TRP 31  31  31  TRP TRP A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  HIS 34  34  34  HIS HIS A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  TYR 46  46  46  TYR TYR A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 ?   ?   ?   A . n 
A 1 110 PHE 110 110 ?   ?   ?   A . n 
A 1 111 PRO 111 111 ?   ?   ?   A . n 
A 1 112 GLU 112 112 ?   ?   ?   A . n 
A 1 113 TRP 113 113 ?   ?   ?   A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 CYS 130 130 130 CYS CYS A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 GLN 134 134 134 GLN GLN A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLN 144 144 144 GLN GLN A . n 
A 1 145 TRP 145 145 145 TRP TRP A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 SER 163 163 ?   ?   ?   A . n 
A 1 164 GLN 164 164 ?   ?   ?   A . n 
A 1 165 PRO 165 165 ?   ?   ?   A . n 
A 1 166 PHE 166 166 ?   ?   ?   A . n 
A 1 167 LYS 167 167 ?   ?   ?   A . n 
A 1 168 ALA 168 168 ?   ?   ?   A . n 
A 1 169 LYS 169 169 ?   ?   ?   A . n 
A 1 170 LYS 170 170 ?   ?   ?   A . n 
A 1 171 ARG 171 171 ?   ?   ?   A . n 
A 1 172 ASP 172 172 ?   ?   ?   A . n 
A 1 173 LEU 173 173 ?   ?   ?   A . n 
A 1 174 PHE 174 174 ?   ?   ?   A . n 
A 1 175 GLY 175 175 ?   ?   ?   A . n 
A 1 176 ARG 176 176 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ASP 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   GLN 4   4   ?   ?   ?   B . n 
B 2 5   ALA 5   5   ?   ?   ?   B . n 
B 2 6   GLN 6   6   ?   ?   ?   B . n 
B 2 7   VAL 7   7   ?   ?   ?   B . n 
B 2 8   LEU 8   8   ?   ?   ?   B . n 
B 2 9   ILE 9   9   ?   ?   ?   B . n 
B 2 10  LEU 10  10  ?   ?   ?   B . n 
B 2 11  LEU 11  11  ?   ?   ?   B . n 
B 2 12  LEU 12  12  ?   ?   ?   B . n 
B 2 13  LEU 13  13  ?   ?   ?   B . n 
B 2 14  TRP 14  14  ?   ?   ?   B . n 
B 2 15  VAL 15  15  ?   ?   ?   B . n 
B 2 16  SER 16  16  ?   ?   ?   B . n 
B 2 17  GLY 17  17  ?   ?   ?   B . n 
B 2 18  THR 18  18  ?   ?   ?   B . n 
B 2 19  CYS 19  19  ?   ?   ?   B . n 
B 2 20  GLY 20  20  ?   ?   ?   B . n 
B 2 21  ASP 21  21  21  ASP ASP B . n 
B 2 22  ILE 22  22  22  ILE ILE B . n 
B 2 23  VAL 23  23  23  VAL VAL B . n 
B 2 24  MET 24  24  24  MET MET B . n 
B 2 25  SER 25  25  25  SER SER B . n 
B 2 26  GLN 26  26  26  GLN GLN B . n 
B 2 27  SER 27  27  27  SER SER B . n 
B 2 28  PRO 28  28  28  PRO PRO B . n 
B 2 29  SER 29  29  29  SER SER B . n 
B 2 30  SER 30  30  30  SER SER B . n 
B 2 31  LEU 31  31  31  LEU LEU B . n 
B 2 32  ALA 32  32  32  ALA ALA B . n 
B 2 33  VAL 33  33  33  VAL VAL B . n 
B 2 34  SER 34  34  34  SER SER B . n 
B 2 35  ALA 35  35  35  ALA ALA B . n 
B 2 36  GLY 36  36  36  GLY GLY B . n 
B 2 37  GLU 37  37  37  GLU GLU B . n 
B 2 38  LYS 38  38  38  LYS LYS B . n 
B 2 39  VAL 39  39  39  VAL VAL B . n 
B 2 40  THR 40  40  40  THR THR B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  SER 42  42  42  SER SER B . n 
B 2 43  CYS 43  43  43  CYS CYS B . n 
B 2 44  LYS 44  44  44  LYS LYS B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  SER 46  46  46  SER SER B . n 
B 2 47  GLN 47  47  47  GLN GLN B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LEU 49  49  49  LEU LEU B . n 
B 2 50  LEU 50  50  50  LEU LEU B . n 
B 2 51  ASN 51  51  51  ASN ASN B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  ARG 53  53  53  ARG ARG B . n 
B 2 54  THR 54  54  54  THR THR B . n 
B 2 55  ARG 55  55  55  ARG ARG B . n 
B 2 56  LYS 56  56  56  LYS LYS B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  TYR 58  58  58  TYR TYR B . n 
B 2 59  LEU 59  59  59  LEU LEU B . n 
B 2 60  ALA 60  60  60  ALA ALA B . n 
B 2 61  TRP 61  61  61  TRP TRP B . n 
B 2 62  TYR 62  62  62  TYR TYR B . n 
B 2 63  GLN 63  63  63  GLN GLN B . n 
B 2 64  GLN 64  64  64  GLN GLN B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  PRO 66  66  66  PRO PRO B . n 
B 2 67  GLY 67  67  67  GLY GLY B . n 
B 2 68  GLN 68  68  68  GLN GLN B . n 
B 2 69  SER 69  69  69  SER SER B . n 
B 2 70  PRO 70  70  70  PRO PRO B . n 
B 2 71  LYS 71  71  71  LYS LYS B . n 
B 2 72  LEU 72  72  72  LEU LEU B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  ILE 74  74  74  ILE ILE B . n 
B 2 75  TYR 75  75  75  TYR TYR B . n 
B 2 76  TRP 76  76  76  TRP TRP B . n 
B 2 77  ALA 77  77  77  ALA ALA B . n 
B 2 78  SER 78  78  78  SER SER B . n 
B 2 79  THR 79  79  79  THR THR B . n 
B 2 80  ARG 80  80  80  ARG ARG B . n 
B 2 81  GLU 81  81  81  GLU GLU B . n 
B 2 82  SER 82  82  82  SER SER B . n 
B 2 83  GLY 83  83  83  GLY GLY B . n 
B 2 84  VAL 84  84  84  VAL VAL B . n 
B 2 85  PRO 85  85  85  PRO PRO B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  ARG 87  87  87  ARG ARG B . n 
B 2 88  PHE 88  88  88  PHE PHE B . n 
B 2 89  THR 89  89  89  THR THR B . n 
B 2 90  GLY 90  90  90  GLY GLY B . n 
B 2 91  SER 91  91  91  SER SER B . n 
B 2 92  GLY 92  92  92  GLY GLY B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  GLY 94  94  94  GLY GLY B . n 
B 2 95  THR 95  95  95  THR THR B . n 
B 2 96  ASP 96  96  96  ASP ASP B . n 
B 2 97  PHE 97  97  97  PHE PHE B . n 
B 2 98  THR 98  98  98  THR THR B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 THR 100 100 100 THR THR B . n 
B 2 101 ILE 101 101 101 ILE ILE B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 SER 103 103 103 SER SER B . n 
B 2 104 VAL 104 104 104 VAL VAL B . n 
B 2 105 GLN 105 105 105 GLN GLN B . n 
B 2 106 ALA 106 106 106 ALA ALA B . n 
B 2 107 GLU 107 107 107 GLU GLU B . n 
B 2 108 ASP 108 108 108 ASP ASP B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ALA 110 110 110 ALA ALA B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 TYR 112 112 112 TYR TYR B . n 
B 2 113 TYR 113 113 113 TYR TYR B . n 
B 2 114 CYS 114 114 114 CYS CYS B . n 
B 2 115 LYS 115 115 115 LYS LYS B . n 
B 2 116 GLN 116 116 116 GLN GLN B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 TYR 118 118 118 TYR TYR B . n 
B 2 119 ASN 119 119 119 ASN ASN B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 TYR 121 121 121 TYR TYR B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 PHE 123 123 123 PHE PHE B . n 
B 2 124 GLY 124 124 124 GLY GLY B . n 
B 2 125 GLY 125 125 125 GLY GLY B . n 
B 2 126 GLY 126 126 126 GLY GLY B . n 
B 2 127 THR 127 127 127 THR THR B . n 
B 2 128 LYS 128 128 128 LYS LYS B . n 
B 2 129 LEU 129 129 129 LEU LEU B . n 
B 2 130 GLU 130 130 130 GLU GLU B . n 
B 2 131 ILE 131 131 131 ILE ILE B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 ARG 133 133 ?   ?   ?   B . n 
B 2 134 ALA 134 134 134 ALA ALA B . n 
B 2 135 ASP 135 135 135 ASP ASP B . n 
B 2 136 ALA 136 136 136 ALA ALA B . n 
B 2 137 ALA 137 137 137 ALA ALA B . n 
B 2 138 PRO 138 138 138 PRO PRO B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 VAL 140 140 140 VAL VAL B . n 
B 2 141 SER 141 141 141 SER SER B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 PHE 143 143 143 PHE PHE B . n 
B 2 144 PRO 144 144 144 PRO PRO B . n 
B 2 145 PRO 145 145 145 PRO PRO B . n 
B 2 146 SER 146 146 146 SER SER B . n 
B 2 147 SER 147 147 147 SER SER B . n 
B 2 148 GLU 148 148 148 GLU GLU B . n 
B 2 149 GLN 149 149 149 GLN GLN B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 THR 151 151 151 THR THR B . n 
B 2 152 SER 152 152 152 SER SER B . n 
B 2 153 GLY 153 153 153 GLY GLY B . n 
B 2 154 GLY 154 154 154 GLY GLY B . n 
B 2 155 ALA 155 155 155 ALA ALA B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 VAL 157 157 157 VAL VAL B . n 
B 2 158 VAL 158 158 158 VAL VAL B . n 
B 2 159 CYS 159 159 159 CYS CYS B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 LEU 161 161 161 LEU LEU B . n 
B 2 162 ASN 162 162 162 ASN ASN B . n 
B 2 163 ASN 163 163 163 ASN ASN B . n 
B 2 164 PHE 164 164 164 PHE PHE B . n 
B 2 165 TYR 165 165 165 TYR TYR B . n 
B 2 166 PRO 166 166 166 PRO PRO B . n 
B 2 167 LYS 167 167 167 LYS LYS B . n 
B 2 168 ASP 168 168 168 ASP ASP B . n 
B 2 169 ILE 169 169 169 ILE ILE B . n 
B 2 170 ASN 170 170 170 ASN ASN B . n 
B 2 171 VAL 171 171 171 VAL VAL B . n 
B 2 172 LYS 172 172 172 LYS LYS B . n 
B 2 173 TRP 173 173 173 TRP TRP B . n 
B 2 174 LYS 174 174 174 LYS LYS B . n 
B 2 175 ILE 175 175 175 ILE ILE B . n 
B 2 176 ASP 176 176 176 ASP ASP B . n 
B 2 177 GLY 177 177 177 GLY GLY B . n 
B 2 178 SER 178 178 178 SER SER B . n 
B 2 179 GLU 179 179 179 GLU GLU B . n 
B 2 180 ARG 180 180 180 ARG ARG B . n 
B 2 181 GLN 181 181 181 GLN GLN B . n 
B 2 182 ASN 182 182 182 ASN ASN B . n 
B 2 183 GLY 183 183 183 GLY GLY B . n 
B 2 184 VAL 184 184 184 VAL VAL B . n 
B 2 185 LEU 185 185 185 LEU LEU B . n 
B 2 186 ASN 186 186 186 ASN ASN B . n 
B 2 187 SER 187 187 187 SER SER B . n 
B 2 188 TRP 188 188 188 TRP TRP B . n 
B 2 189 THR 189 189 189 THR THR B . n 
B 2 190 ASP 190 190 190 ASP ASP B . n 
B 2 191 GLN 191 191 191 GLN GLN B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 SER 193 193 193 SER SER B . n 
B 2 194 LYS 194 194 194 LYS LYS B . n 
B 2 195 ASP 195 195 195 ASP ASP B . n 
B 2 196 SER 196 196 196 SER SER B . n 
B 2 197 THR 197 197 197 THR THR B . n 
B 2 198 TYR 198 198 198 TYR TYR B . n 
B 2 199 SER 199 199 199 SER SER B . n 
B 2 200 MET 200 200 200 MET MET B . n 
B 2 201 SER 201 201 201 SER SER B . n 
B 2 202 SER 202 202 202 SER SER B . n 
B 2 203 THR 203 203 203 THR THR B . n 
B 2 204 LEU 204 204 204 LEU LEU B . n 
B 2 205 THR 205 205 205 THR THR B . n 
B 2 206 LEU 206 206 206 LEU LEU B . n 
B 2 207 THR 207 207 207 THR THR B . n 
B 2 208 LYS 208 208 208 LYS LYS B . n 
B 2 209 ASP 209 209 209 ASP ASP B . n 
B 2 210 GLU 210 210 210 GLU GLU B . n 
B 2 211 TYR 211 211 211 TYR TYR B . n 
B 2 212 GLU 212 212 212 GLU GLU B . n 
B 2 213 ARG 213 213 213 ARG ARG B . n 
B 2 214 HIS 214 214 214 HIS HIS B . n 
B 2 215 ASN 215 215 215 ASN ASN B . n 
B 2 216 SER 216 216 216 SER SER B . n 
B 2 217 TYR 217 217 217 TYR TYR B . n 
B 2 218 THR 218 218 218 THR THR B . n 
B 2 219 CYS 219 219 219 CYS CYS B . n 
B 2 220 GLU 220 220 220 GLU GLU B . n 
B 2 221 ALA 221 221 221 ALA ALA B . n 
B 2 222 THR 222 222 222 THR THR B . n 
B 2 223 HIS 223 223 223 HIS HIS B . n 
B 2 224 LYS 224 224 224 LYS LYS B . n 
B 2 225 THR 225 225 225 THR THR B . n 
B 2 226 SER 226 226 226 SER SER B . n 
B 2 227 THR 227 227 227 THR THR B . n 
B 2 228 SER 228 228 228 SER SER B . n 
B 2 229 PRO 229 229 229 PRO PRO B . n 
B 2 230 ILE 230 230 230 ILE ILE B . n 
B 2 231 VAL 231 231 231 VAL VAL B . n 
B 2 232 LYS 232 232 232 LYS LYS B . n 
B 2 233 SER 233 233 233 SER SER B . n 
B 2 234 PHE 234 234 234 PHE PHE B . n 
B 2 235 ASN 235 235 235 ASN ASN B . n 
B 2 236 ARG 236 236 236 ARG ARG B . n 
B 2 237 ASN 237 237 237 ASN ASN B . n 
B 2 238 GLU 238 238 238 GLU GLU B . n 
B 2 239 CYS 239 239 239 CYS CYS B . n 
C 3 1   GLU 1   1   1   GLU GLU C . n 
C 3 2   VAL 2   2   2   VAL VAL C . n 
C 3 3   GLN 3   3   3   GLN GLN C . n 
C 3 4   LEU 4   4   4   LEU LEU C . n 
C 3 5   VAL 5   5   5   VAL VAL C . n 
C 3 6   GLU 6   6   6   GLU GLU C . n 
C 3 7   SER 7   7   7   SER SER C . n 
C 3 8   GLY 8   8   8   GLY GLY C . n 
C 3 9   GLY 9   9   9   GLY GLY C . n 
C 3 10  GLY 10  10  10  GLY GLY C . n 
C 3 11  LEU 11  11  11  LEU LEU C . n 
C 3 12  VAL 12  12  12  VAL VAL C . n 
C 3 13  LYS 13  13  13  LYS LYS C . n 
C 3 14  PRO 14  14  14  PRO PRO C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  GLY 16  16  16  GLY GLY C . n 
C 3 17  SER 17  17  17  SER SER C . n 
C 3 18  LEU 18  18  18  LEU LEU C . n 
C 3 19  LYS 19  19  19  LYS LYS C . n 
C 3 20  LEU 20  20  20  LEU LEU C . n 
C 3 21  SER 21  21  21  SER SER C . n 
C 3 22  CYS 22  22  22  CYS CYS C . n 
C 3 23  ALA 23  23  23  ALA ALA C . n 
C 3 24  ALA 24  24  24  ALA ALA C . n 
C 3 25  SER 25  25  25  SER SER C . n 
C 3 26  GLY 26  26  26  GLY GLY C . n 
C 3 27  PHE 27  27  27  PHE PHE C . n 
C 3 28  ALA 28  28  28  ALA ALA C . n 
C 3 29  PHE 29  29  29  PHE PHE C . n 
C 3 30  SER 30  30  30  SER SER C . n 
C 3 31  SER 31  31  31  SER SER C . n 
C 3 32  TYR 32  32  32  TYR TYR C . n 
C 3 33  ASP 33  33  33  ASP ASP C . n 
C 3 34  MET 34  34  34  MET MET C . n 
C 3 35  SER 35  35  35  SER SER C . n 
C 3 36  TRP 36  36  36  TRP TRP C . n 
C 3 37  VAL 37  37  37  VAL VAL C . n 
C 3 38  ARG 38  38  38  ARG ARG C . n 
C 3 39  GLN 39  39  39  GLN GLN C . n 
C 3 40  THR 40  40  40  THR THR C . n 
C 3 41  PRO 41  41  41  PRO PRO C . n 
C 3 42  GLU 42  42  42  GLU GLU C . n 
C 3 43  LYS 43  43  43  LYS LYS C . n 
C 3 44  ARG 44  44  44  ARG ARG C . n 
C 3 45  LEU 45  45  45  LEU LEU C . n 
C 3 46  GLU 46  46  46  GLU GLU C . n 
C 3 47  TRP 47  47  47  TRP TRP C . n 
C 3 48  VAL 48  48  48  VAL VAL C . n 
C 3 49  ALA 49  49  49  ALA ALA C . n 
C 3 50  TYR 50  50  50  TYR TYR C . n 
C 3 51  ILE 51  51  51  ILE ILE C . n 
C 3 52  SER 52  52  52  SER SER C . n 
C 3 53  SER 53  53  53  SER SER C . n 
C 3 54  GLY 54  54  54  GLY GLY C . n 
C 3 55  GLY 55  55  55  GLY GLY C . n 
C 3 56  GLY 56  56  56  GLY GLY C . n 
C 3 57  SER 57  57  57  SER SER C . n 
C 3 58  THR 58  58  58  THR THR C . n 
C 3 59  TYR 59  59  59  TYR TYR C . n 
C 3 60  TYR 60  60  60  TYR TYR C . n 
C 3 61  PRO 61  61  61  PRO PRO C . n 
C 3 62  ASP 62  62  62  ASP ASP C . n 
C 3 63  THR 63  63  63  THR THR C . n 
C 3 64  VAL 64  64  64  VAL VAL C . n 
C 3 65  LYS 65  65  65  LYS LYS C . n 
C 3 66  GLY 66  66  66  GLY GLY C . n 
C 3 67  ARG 67  67  67  ARG ARG C . n 
C 3 68  PHE 68  68  68  PHE PHE C . n 
C 3 69  THR 69  69  69  THR THR C . n 
C 3 70  ILE 70  70  70  ILE ILE C . n 
C 3 71  SER 71  71  71  SER SER C . n 
C 3 72  ARG 72  72  72  ARG ARG C . n 
C 3 73  ASP 73  73  73  ASP ASP C . n 
C 3 74  ASN 74  74  74  ASN ASN C . n 
C 3 75  ALA 75  75  75  ALA ALA C . n 
C 3 76  LYS 76  76  76  LYS LYS C . n 
C 3 77  ASN 77  77  77  ASN ASN C . n 
C 3 78  THR 78  78  78  THR THR C . n 
C 3 79  LEU 79  79  79  LEU LEU C . n 
C 3 80  TYR 80  80  80  TYR TYR C . n 
C 3 81  LEU 81  81  81  LEU LEU C . n 
C 3 82  GLN 82  82  82  GLN GLN C . n 
C 3 83  MET 83  83  83  MET MET C . n 
C 3 84  SER 84  84  84  SER SER C . n 
C 3 85  SER 85  85  85  SER SER C . n 
C 3 86  LEU 86  86  86  LEU LEU C . n 
C 3 87  LYS 87  87  87  LYS LYS C . n 
C 3 88  SER 88  88  88  SER SER C . n 
C 3 89  GLU 89  89  89  GLU GLU C . n 
C 3 90  ASP 90  90  90  ASP ASP C . n 
C 3 91  THR 91  91  91  THR THR C . n 
C 3 92  ALA 92  92  92  ALA ALA C . n 
C 3 93  MET 93  93  93  MET MET C . n 
C 3 94  TYR 94  94  94  TYR TYR C . n 
C 3 95  TYR 95  95  95  TYR TYR C . n 
C 3 96  CYS 96  96  96  CYS CYS C . n 
C 3 97  ALA 97  97  97  ALA ALA C . n 
C 3 98  ARG 98  98  98  ARG ARG C . n 
C 3 99  PRO 99  99  99  PRO PRO C . n 
C 3 100 ASP 100 100 100 ASP ASP C . n 
C 3 101 TYR 101 101 ?   ?   ?   C . n 
C 3 102 ARG 102 102 ?   ?   ?   C . n 
C 3 103 SER 103 103 ?   ?   ?   C . n 
C 3 104 TYR 104 104 ?   ?   ?   C . n 
C 3 105 ALA 105 105 105 ALA ALA C . n 
C 3 106 MET 106 106 106 MET MET C . n 
C 3 107 ASP 107 107 107 ASP ASP C . n 
C 3 108 TYR 108 108 108 TYR TYR C . n 
C 3 109 TRP 109 109 109 TRP TRP C . n 
C 3 110 GLY 110 110 110 GLY GLY C . n 
C 3 111 GLN 111 111 111 GLN GLN C . n 
C 3 112 GLY 112 112 112 GLY GLY C . n 
C 3 113 THR 113 113 113 THR THR C . n 
C 3 114 SER 114 114 114 SER SER C . n 
C 3 115 VAL 115 115 115 VAL VAL C . n 
C 3 116 THR 116 116 116 THR THR C . n 
C 3 117 VAL 117 117 117 VAL VAL C . n 
C 3 118 SER 118 118 118 SER SER C . n 
C 3 119 SER 119 119 119 SER SER C . n 
C 3 120 ALA 120 120 ?   ?   ?   C . n 
C 3 121 LYS 121 121 121 LYS LYS C . n 
C 3 122 THR 122 122 122 THR THR C . n 
C 3 123 THR 123 123 123 THR THR C . n 
C 3 124 ALA 124 124 124 ALA ALA C . n 
C 3 125 PRO 125 125 125 PRO PRO C . n 
C 3 126 SER 126 126 126 SER SER C . n 
C 3 127 VAL 127 127 127 VAL VAL C . n 
C 3 128 TYR 128 128 128 TYR TYR C . n 
C 3 129 PRO 129 129 129 PRO PRO C . n 
C 3 130 LEU 130 130 130 LEU LEU C . n 
C 3 131 ALA 131 131 131 ALA ALA C . n 
C 3 132 PRO 132 132 132 PRO PRO C . n 
C 3 133 VAL 133 133 133 VAL VAL C . n 
C 3 134 CYS 134 134 134 CYS CYS C . n 
C 3 135 GLY 135 135 135 GLY GLY C . n 
C 3 136 ASP 136 136 136 ASP ASP C . n 
C 3 137 THR 137 137 137 THR THR C . n 
C 3 138 THR 138 138 138 THR THR C . n 
C 3 139 GLY 139 139 139 GLY GLY C . n 
C 3 140 SER 140 140 140 SER SER C . n 
C 3 141 SER 141 141 141 SER SER C . n 
C 3 142 VAL 142 142 142 VAL VAL C . n 
C 3 143 THR 143 143 143 THR THR C . n 
C 3 144 LEU 144 144 144 LEU LEU C . n 
C 3 145 GLY 145 145 145 GLY GLY C . n 
C 3 146 CYS 146 146 146 CYS CYS C . n 
C 3 147 LEU 147 147 147 LEU LEU C . n 
C 3 148 VAL 148 148 148 VAL VAL C . n 
C 3 149 LYS 149 149 149 LYS LYS C . n 
C 3 150 GLY 150 150 150 GLY GLY C . n 
C 3 151 TYR 151 151 151 TYR TYR C . n 
C 3 152 PHE 152 152 152 PHE PHE C . n 
C 3 153 PRO 153 153 153 PRO PRO C . n 
C 3 154 GLU 154 154 154 GLU GLU C . n 
C 3 155 PRO 155 155 155 PRO PRO C . n 
C 3 156 VAL 156 156 156 VAL VAL C . n 
C 3 157 THR 157 157 157 THR THR C . n 
C 3 158 LEU 158 158 158 LEU LEU C . n 
C 3 159 THR 159 159 159 THR THR C . n 
C 3 160 TRP 160 160 160 TRP TRP C . n 
C 3 161 ASN 161 161 161 ASN ASN C . n 
C 3 162 SER 162 162 162 SER SER C . n 
C 3 163 GLY 163 163 163 GLY GLY C . n 
C 3 164 SER 164 164 164 SER SER C . n 
C 3 165 LEU 165 165 165 LEU LEU C . n 
C 3 166 SER 166 166 166 SER SER C . n 
C 3 167 SER 167 167 167 SER SER C . n 
C 3 168 GLY 168 168 168 GLY GLY C . n 
C 3 169 VAL 169 169 169 VAL VAL C . n 
C 3 170 HIS 170 170 170 HIS HIS C . n 
C 3 171 THR 171 171 171 THR THR C . n 
C 3 172 PHE 172 172 172 PHE PHE C . n 
C 3 173 PRO 173 173 173 PRO PRO C . n 
C 3 174 ALA 174 174 174 ALA ALA C . n 
C 3 175 VAL 175 175 175 VAL VAL C . n 
C 3 176 LEU 176 176 176 LEU LEU C . n 
C 3 177 GLN 177 177 177 GLN GLN C . n 
C 3 178 SER 178 178 178 SER SER C . n 
C 3 179 ASP 179 179 179 ASP ASP C . n 
C 3 180 LEU 180 180 180 LEU LEU C . n 
C 3 181 TYR 181 181 181 TYR TYR C . n 
C 3 182 THR 182 182 182 THR THR C . n 
C 3 183 LEU 183 183 183 LEU LEU C . n 
C 3 184 SER 184 184 184 SER SER C . n 
C 3 185 SER 185 185 185 SER SER C . n 
C 3 186 SER 186 186 186 SER SER C . n 
C 3 187 VAL 187 187 187 VAL VAL C . n 
C 3 188 THR 188 188 188 THR THR C . n 
C 3 189 VAL 189 189 189 VAL VAL C . n 
C 3 190 THR 190 190 190 THR THR C . n 
C 3 191 SER 191 191 191 SER SER C . n 
C 3 192 SER 192 192 192 SER SER C . n 
C 3 193 THR 193 193 193 THR THR C . n 
C 3 194 TRP 194 194 194 TRP TRP C . n 
C 3 195 PRO 195 195 195 PRO PRO C . n 
C 3 196 SER 196 196 196 SER SER C . n 
C 3 197 GLN 197 197 197 GLN GLN C . n 
C 3 198 SER 198 198 198 SER SER C . n 
C 3 199 ILE 199 199 199 ILE ILE C . n 
C 3 200 THR 200 200 200 THR THR C . n 
C 3 201 CYS 201 201 201 CYS CYS C . n 
C 3 202 ASN 202 202 202 ASN ASN C . n 
C 3 203 VAL 203 203 203 VAL VAL C . n 
C 3 204 ALA 204 204 204 ALA ALA C . n 
C 3 205 HIS 205 205 205 HIS HIS C . n 
C 3 206 PRO 206 206 206 PRO PRO C . n 
C 3 207 ALA 207 207 207 ALA ALA C . n 
C 3 208 SER 208 208 208 SER SER C . n 
C 3 209 SER 209 209 209 SER SER C . n 
C 3 210 THR 210 210 210 THR THR C . n 
C 3 211 LYS 211 211 211 LYS LYS C . n 
C 3 212 VAL 212 212 212 VAL VAL C . n 
C 3 213 ASP 213 213 213 ASP ASP C . n 
C 3 214 LYS 214 214 214 LYS LYS C . n 
C 3 215 LYS 215 215 215 LYS LYS C . n 
C 3 216 ILE 216 216 216 ILE ILE C . n 
C 3 217 GLU 217 217 217 GLU GLU C . n 
C 3 218 PRO 218 218 218 PRO PRO C . n 
C 3 219 ARG 219 219 219 ARG ARG C . n 
C 3 220 GLY 220 220 220 GLY GLY C . n 
C 3 221 PRO 221 221 221 PRO PRO C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   LEU 2   2   ?   ?   ?   D . n 
D 1 3   ARG 3   3   ?   ?   ?   D . n 
D 1 4   PHE 4   4   ?   ?   ?   D . n 
D 1 5   LEU 5   5   ?   ?   ?   D . n 
D 1 6   ASN 6   6   ?   ?   ?   D . n 
D 1 7   GLN 7   7   ?   ?   ?   D . n 
D 1 8   ALA 8   8   ?   ?   ?   D . n 
D 1 9   SER 9   9   ?   ?   ?   D . n 
D 1 10  GLN 10  10  10  GLN GLN D . n 
D 1 11  GLY 11  11  11  GLY GLY D . n 
D 1 12  ARG 12  12  12  ARG ARG D . n 
D 1 13  GLY 13  13  13  GLY GLY D . n 
D 1 14  ALA 14  14  14  ALA ALA D . n 
D 1 15  TRP 15  15  15  TRP TRP D . n 
D 1 16  LEU 16  16  16  LEU LEU D . n 
D 1 17  LEU 17  17  17  LEU LEU D . n 
D 1 18  MET 18  18  18  MET MET D . n 
D 1 19  ALA 19  19  19  ALA ALA D . n 
D 1 20  PHE 20  20  20  PHE PHE D . n 
D 1 21  THR 21  21  21  THR THR D . n 
D 1 22  ALA 22  22  22  ALA ALA D . n 
D 1 23  LEU 23  23  23  LEU LEU D . n 
D 1 24  ALA 24  24  24  ALA ALA D . n 
D 1 25  LEU 25  25  25  LEU LEU D . n 
D 1 26  GLU 26  26  26  GLU GLU D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  THR 28  28  28  THR THR D . n 
D 1 29  ALA 29  29  29  ALA ALA D . n 
D 1 30  LEU 30  30  30  LEU LEU D . n 
D 1 31  TRP 31  31  31  TRP TRP D . n 
D 1 32  PHE 32  32  32  PHE PHE D . n 
D 1 33  GLN 33  33  33  GLN GLN D . n 
D 1 34  HIS 34  34  34  HIS HIS D . n 
D 1 35  VAL 35  35  35  VAL VAL D . n 
D 1 36  MET 36  36  36  MET MET D . n 
D 1 37  LEU 37  37  37  LEU LEU D . n 
D 1 38  LEU 38  38  38  LEU LEU D . n 
D 1 39  LYS 39  39  39  LYS LYS D . n 
D 1 40  PRO 40  40  40  PRO PRO D . n 
D 1 41  SER 41  41  41  SER SER D . n 
D 1 42  VAL 42  42  42  VAL VAL D . n 
D 1 43  LEU 43  43  43  LEU LEU D . n 
D 1 44  CYS 44  44  44  CYS CYS D . n 
D 1 45  ILE 45  45  45  ILE ILE D . n 
D 1 46  TYR 46  46  46  TYR TYR D . n 
D 1 47  GLU 47  47  47  GLU GLU D . n 
D 1 48  ARG 48  48  48  ARG ARG D . n 
D 1 49  VAL 49  49  49  VAL VAL D . n 
D 1 50  ALA 50  50  50  ALA ALA D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  PHE 52  52  52  PHE PHE D . n 
D 1 53  GLY 53  53  53  GLY GLY D . n 
D 1 54  VAL 54  54  54  VAL VAL D . n 
D 1 55  LEU 55  55  55  LEU LEU D . n 
D 1 56  GLY 56  56  56  GLY GLY D . n 
D 1 57  ALA 57  57  57  ALA ALA D . n 
D 1 58  ALA 58  58  58  ALA ALA D . n 
D 1 59  LEU 59  59  59  LEU LEU D . n 
D 1 60  ILE 60  60  60  ILE ILE D . n 
D 1 61  GLY 61  61  61  GLY GLY D . n 
D 1 62  ALA 62  62  62  ALA ALA D . n 
D 1 63  ILE 63  63  63  ILE ILE D . n 
D 1 64  ALA 64  64  64  ALA ALA D . n 
D 1 65  PRO 65  65  65  PRO PRO D . n 
D 1 66  LYS 66  66  66  LYS LYS D . n 
D 1 67  THR 67  67  67  THR THR D . n 
D 1 68  PRO 68  68  68  PRO PRO D . n 
D 1 69  LEU 69  69  69  LEU LEU D . n 
D 1 70  ARG 70  70  70  ARG ARG D . n 
D 1 71  TYR 71  71  71  TYR TYR D . n 
D 1 72  VAL 72  72  72  VAL VAL D . n 
D 1 73  ALA 73  73  73  ALA ALA D . n 
D 1 74  MET 74  74  74  MET MET D . n 
D 1 75  VAL 75  75  75  VAL VAL D . n 
D 1 76  ILE 76  76  76  ILE ILE D . n 
D 1 77  TRP 77  77  77  TRP TRP D . n 
D 1 78  LEU 78  78  78  LEU LEU D . n 
D 1 79  TYR 79  79  79  TYR TYR D . n 
D 1 80  SER 80  80  80  SER SER D . n 
D 1 81  ALA 81  81  81  ALA ALA D . n 
D 1 82  PHE 82  82  82  PHE PHE D . n 
D 1 83  ARG 83  83  83  ARG ARG D . n 
D 1 84  GLY 84  84  84  GLY GLY D . n 
D 1 85  VAL 85  85  85  VAL VAL D . n 
D 1 86  GLN 86  86  86  GLN GLN D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  THR 88  88  88  THR THR D . n 
D 1 89  TYR 89  89  89  TYR TYR D . n 
D 1 90  GLU 90  90  90  GLU GLU D . n 
D 1 91  HIS 91  91  91  HIS HIS D . n 
D 1 92  THR 92  92  92  THR THR D . n 
D 1 93  MET 93  93  93  MET MET D . n 
D 1 94  LEU 94  94  94  LEU LEU D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  LEU 96  96  96  LEU LEU D . n 
D 1 97  TYR 97  97  97  TYR TYR D . n 
D 1 98  PRO 98  98  98  PRO PRO D . n 
D 1 99  SER 99  99  99  SER SER D . n 
D 1 100 PRO 100 100 100 PRO PRO D . n 
D 1 101 PHE 101 101 101 PHE PHE D . n 
D 1 102 ALA 102 102 102 ALA ALA D . n 
D 1 103 THR 103 103 103 THR THR D . n 
D 1 104 CYS 104 104 104 CYS CYS D . n 
D 1 105 ASP 105 105 105 ASP ASP D . n 
D 1 106 PHE 106 106 106 PHE PHE D . n 
D 1 107 MET 107 107 107 MET MET D . n 
D 1 108 VAL 108 108 108 VAL VAL D . n 
D 1 109 ARG 109 109 ?   ?   ?   D . n 
D 1 110 PHE 110 110 ?   ?   ?   D . n 
D 1 111 PRO 111 111 ?   ?   ?   D . n 
D 1 112 GLU 112 112 ?   ?   ?   D . n 
D 1 113 TRP 113 113 ?   ?   ?   D . n 
D 1 114 LEU 114 114 114 LEU LEU D . n 
D 1 115 PRO 115 115 115 PRO PRO D . n 
D 1 116 LEU 116 116 116 LEU LEU D . n 
D 1 117 ASP 117 117 117 ASP ASP D . n 
D 1 118 LYS 118 118 118 LYS LYS D . n 
D 1 119 TRP 119 119 119 TRP TRP D . n 
D 1 120 VAL 120 120 120 VAL VAL D . n 
D 1 121 PRO 121 121 121 PRO PRO D . n 
D 1 122 GLN 122 122 122 GLN GLN D . n 
D 1 123 VAL 123 123 123 VAL VAL D . n 
D 1 124 PHE 124 124 124 PHE PHE D . n 
D 1 125 VAL 125 125 125 VAL VAL D . n 
D 1 126 ALA 126 126 126 ALA ALA D . n 
D 1 127 SER 127 127 127 SER SER D . n 
D 1 128 GLY 128 128 128 GLY GLY D . n 
D 1 129 ASP 129 129 129 ASP ASP D . n 
D 1 130 CYS 130 130 130 CYS CYS D . n 
D 1 131 ALA 131 131 131 ALA ALA D . n 
D 1 132 GLU 132 132 132 GLU GLU D . n 
D 1 133 ARG 133 133 133 ARG ARG D . n 
D 1 134 GLN 134 134 134 GLN GLN D . n 
D 1 135 TRP 135 135 135 TRP TRP D . n 
D 1 136 ASP 136 136 136 ASP ASP D . n 
D 1 137 PHE 137 137 137 PHE PHE D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 GLY 139 139 139 GLY GLY D . n 
D 1 140 LEU 140 140 140 LEU LEU D . n 
D 1 141 GLU 141 141 141 GLU GLU D . n 
D 1 142 MET 142 142 142 MET MET D . n 
D 1 143 PRO 143 143 143 PRO PRO D . n 
D 1 144 GLN 144 144 144 GLN GLN D . n 
D 1 145 TRP 145 145 145 TRP TRP D . n 
D 1 146 LEU 146 146 146 LEU LEU D . n 
D 1 147 LEU 147 147 147 LEU LEU D . n 
D 1 148 GLY 148 148 148 GLY GLY D . n 
D 1 149 ILE 149 149 149 ILE ILE D . n 
D 1 150 PHE 150 150 150 PHE PHE D . n 
D 1 151 ILE 151 151 151 ILE ILE D . n 
D 1 152 ALA 152 152 152 ALA ALA D . n 
D 1 153 TYR 153 153 153 TYR TYR D . n 
D 1 154 LEU 154 154 154 LEU LEU D . n 
D 1 155 ILE 155 155 155 ILE ILE D . n 
D 1 156 VAL 156 156 156 VAL VAL D . n 
D 1 157 ALA 157 157 157 ALA ALA D . n 
D 1 158 VAL 158 158 158 VAL VAL D . n 
D 1 159 LEU 159 159 159 LEU LEU D . n 
D 1 160 VAL 160 160 160 VAL VAL D . n 
D 1 161 VAL 161 161 161 VAL VAL D . n 
D 1 162 ILE 162 162 162 ILE ILE D . n 
D 1 163 SER 163 163 ?   ?   ?   D . n 
D 1 164 GLN 164 164 ?   ?   ?   D . n 
D 1 165 PRO 165 165 ?   ?   ?   D . n 
D 1 166 PHE 166 166 ?   ?   ?   D . n 
D 1 167 LYS 167 167 ?   ?   ?   D . n 
D 1 168 ALA 168 168 ?   ?   ?   D . n 
D 1 169 LYS 169 169 ?   ?   ?   D . n 
D 1 170 LYS 170 170 ?   ?   ?   D . n 
D 1 171 ARG 171 171 ?   ?   ?   D . n 
D 1 172 ASP 172 172 ?   ?   ?   D . n 
D 1 173 LEU 173 173 ?   ?   ?   D . n 
D 1 174 PHE 174 174 ?   ?   ?   D . n 
D 1 175 GLY 175 175 ?   ?   ?   D . n 
D 1 176 ARG 176 176 ?   ?   ?   D . n 
E 2 1   MET 1   1   ?   ?   ?   E . n 
E 2 2   ASP 2   2   ?   ?   ?   E . n 
E 2 3   SER 3   3   ?   ?   ?   E . n 
E 2 4   GLN 4   4   ?   ?   ?   E . n 
E 2 5   ALA 5   5   ?   ?   ?   E . n 
E 2 6   GLN 6   6   ?   ?   ?   E . n 
E 2 7   VAL 7   7   ?   ?   ?   E . n 
E 2 8   LEU 8   8   ?   ?   ?   E . n 
E 2 9   ILE 9   9   ?   ?   ?   E . n 
E 2 10  LEU 10  10  ?   ?   ?   E . n 
E 2 11  LEU 11  11  ?   ?   ?   E . n 
E 2 12  LEU 12  12  ?   ?   ?   E . n 
E 2 13  LEU 13  13  ?   ?   ?   E . n 
E 2 14  TRP 14  14  ?   ?   ?   E . n 
E 2 15  VAL 15  15  ?   ?   ?   E . n 
E 2 16  SER 16  16  ?   ?   ?   E . n 
E 2 17  GLY 17  17  ?   ?   ?   E . n 
E 2 18  THR 18  18  ?   ?   ?   E . n 
E 2 19  CYS 19  19  ?   ?   ?   E . n 
E 2 20  GLY 20  20  ?   ?   ?   E . n 
E 2 21  ASP 21  21  21  ASP ASP E . n 
E 2 22  ILE 22  22  22  ILE ILE E . n 
E 2 23  VAL 23  23  23  VAL VAL E . n 
E 2 24  MET 24  24  24  MET MET E . n 
E 2 25  SER 25  25  25  SER SER E . n 
E 2 26  GLN 26  26  26  GLN GLN E . n 
E 2 27  SER 27  27  27  SER SER E . n 
E 2 28  PRO 28  28  28  PRO PRO E . n 
E 2 29  SER 29  29  29  SER SER E . n 
E 2 30  SER 30  30  30  SER SER E . n 
E 2 31  LEU 31  31  31  LEU LEU E . n 
E 2 32  ALA 32  32  32  ALA ALA E . n 
E 2 33  VAL 33  33  33  VAL VAL E . n 
E 2 34  SER 34  34  34  SER SER E . n 
E 2 35  ALA 35  35  35  ALA ALA E . n 
E 2 36  GLY 36  36  36  GLY GLY E . n 
E 2 37  GLU 37  37  37  GLU GLU E . n 
E 2 38  LYS 38  38  38  LYS LYS E . n 
E 2 39  VAL 39  39  39  VAL VAL E . n 
E 2 40  THR 40  40  40  THR THR E . n 
E 2 41  MET 41  41  41  MET MET E . n 
E 2 42  SER 42  42  42  SER SER E . n 
E 2 43  CYS 43  43  43  CYS CYS E . n 
E 2 44  LYS 44  44  44  LYS LYS E . n 
E 2 45  SER 45  45  45  SER SER E . n 
E 2 46  SER 46  46  46  SER SER E . n 
E 2 47  GLN 47  47  47  GLN GLN E . n 
E 2 48  SER 48  48  48  SER SER E . n 
E 2 49  LEU 49  49  49  LEU LEU E . n 
E 2 50  LEU 50  50  50  LEU LEU E . n 
E 2 51  ASN 51  51  51  ASN ASN E . n 
E 2 52  SER 52  52  52  SER SER E . n 
E 2 53  ARG 53  53  53  ARG ARG E . n 
E 2 54  THR 54  54  54  THR THR E . n 
E 2 55  ARG 55  55  55  ARG ARG E . n 
E 2 56  LYS 56  56  56  LYS LYS E . n 
E 2 57  ASN 57  57  57  ASN ASN E . n 
E 2 58  TYR 58  58  58  TYR TYR E . n 
E 2 59  LEU 59  59  59  LEU LEU E . n 
E 2 60  ALA 60  60  60  ALA ALA E . n 
E 2 61  TRP 61  61  61  TRP TRP E . n 
E 2 62  TYR 62  62  62  TYR TYR E . n 
E 2 63  GLN 63  63  63  GLN GLN E . n 
E 2 64  GLN 64  64  64  GLN GLN E . n 
E 2 65  LYS 65  65  65  LYS LYS E . n 
E 2 66  PRO 66  66  66  PRO PRO E . n 
E 2 67  GLY 67  67  67  GLY GLY E . n 
E 2 68  GLN 68  68  68  GLN GLN E . n 
E 2 69  SER 69  69  69  SER SER E . n 
E 2 70  PRO 70  70  70  PRO PRO E . n 
E 2 71  LYS 71  71  71  LYS LYS E . n 
E 2 72  LEU 72  72  72  LEU LEU E . n 
E 2 73  LEU 73  73  73  LEU LEU E . n 
E 2 74  ILE 74  74  74  ILE ILE E . n 
E 2 75  TYR 75  75  75  TYR TYR E . n 
E 2 76  TRP 76  76  76  TRP TRP E . n 
E 2 77  ALA 77  77  77  ALA ALA E . n 
E 2 78  SER 78  78  78  SER SER E . n 
E 2 79  THR 79  79  79  THR THR E . n 
E 2 80  ARG 80  80  80  ARG ARG E . n 
E 2 81  GLU 81  81  81  GLU GLU E . n 
E 2 82  SER 82  82  82  SER SER E . n 
E 2 83  GLY 83  83  83  GLY GLY E . n 
E 2 84  VAL 84  84  84  VAL VAL E . n 
E 2 85  PRO 85  85  85  PRO PRO E . n 
E 2 86  ASP 86  86  86  ASP ASP E . n 
E 2 87  ARG 87  87  87  ARG ARG E . n 
E 2 88  PHE 88  88  88  PHE PHE E . n 
E 2 89  THR 89  89  89  THR THR E . n 
E 2 90  GLY 90  90  90  GLY GLY E . n 
E 2 91  SER 91  91  91  SER SER E . n 
E 2 92  GLY 92  92  92  GLY GLY E . n 
E 2 93  SER 93  93  93  SER SER E . n 
E 2 94  GLY 94  94  94  GLY GLY E . n 
E 2 95  THR 95  95  95  THR THR E . n 
E 2 96  ASP 96  96  96  ASP ASP E . n 
E 2 97  PHE 97  97  97  PHE PHE E . n 
E 2 98  THR 98  98  98  THR THR E . n 
E 2 99  LEU 99  99  99  LEU LEU E . n 
E 2 100 THR 100 100 100 THR THR E . n 
E 2 101 ILE 101 101 101 ILE ILE E . n 
E 2 102 SER 102 102 102 SER SER E . n 
E 2 103 SER 103 103 103 SER SER E . n 
E 2 104 VAL 104 104 104 VAL VAL E . n 
E 2 105 GLN 105 105 105 GLN GLN E . n 
E 2 106 ALA 106 106 106 ALA ALA E . n 
E 2 107 GLU 107 107 107 GLU GLU E . n 
E 2 108 ASP 108 108 108 ASP ASP E . n 
E 2 109 LEU 109 109 109 LEU LEU E . n 
E 2 110 ALA 110 110 110 ALA ALA E . n 
E 2 111 VAL 111 111 111 VAL VAL E . n 
E 2 112 TYR 112 112 112 TYR TYR E . n 
E 2 113 TYR 113 113 113 TYR TYR E . n 
E 2 114 CYS 114 114 114 CYS CYS E . n 
E 2 115 LYS 115 115 115 LYS LYS E . n 
E 2 116 GLN 116 116 116 GLN GLN E . n 
E 2 117 SER 117 117 117 SER SER E . n 
E 2 118 TYR 118 118 118 TYR TYR E . n 
E 2 119 ASN 119 119 119 ASN ASN E . n 
E 2 120 LEU 120 120 120 LEU LEU E . n 
E 2 121 TYR 121 121 121 TYR TYR E . n 
E 2 122 THR 122 122 122 THR THR E . n 
E 2 123 PHE 123 123 123 PHE PHE E . n 
E 2 124 GLY 124 124 124 GLY GLY E . n 
E 2 125 GLY 125 125 125 GLY GLY E . n 
E 2 126 GLY 126 126 126 GLY GLY E . n 
E 2 127 THR 127 127 127 THR THR E . n 
E 2 128 LYS 128 128 128 LYS LYS E . n 
E 2 129 LEU 129 129 129 LEU LEU E . n 
E 2 130 GLU 130 130 130 GLU GLU E . n 
E 2 131 ILE 131 131 131 ILE ILE E . n 
E 2 132 LYS 132 132 132 LYS LYS E . n 
E 2 133 ARG 133 133 ?   ?   ?   E . n 
E 2 134 ALA 134 134 134 ALA ALA E . n 
E 2 135 ASP 135 135 135 ASP ASP E . n 
E 2 136 ALA 136 136 136 ALA ALA E . n 
E 2 137 ALA 137 137 137 ALA ALA E . n 
E 2 138 PRO 138 138 138 PRO PRO E . n 
E 2 139 THR 139 139 139 THR THR E . n 
E 2 140 VAL 140 140 140 VAL VAL E . n 
E 2 141 SER 141 141 141 SER SER E . n 
E 2 142 ILE 142 142 142 ILE ILE E . n 
E 2 143 PHE 143 143 143 PHE PHE E . n 
E 2 144 PRO 144 144 144 PRO PRO E . n 
E 2 145 PRO 145 145 145 PRO PRO E . n 
E 2 146 SER 146 146 146 SER SER E . n 
E 2 147 SER 147 147 147 SER SER E . n 
E 2 148 GLU 148 148 148 GLU GLU E . n 
E 2 149 GLN 149 149 149 GLN GLN E . n 
E 2 150 LEU 150 150 150 LEU LEU E . n 
E 2 151 THR 151 151 151 THR THR E . n 
E 2 152 SER 152 152 152 SER SER E . n 
E 2 153 GLY 153 153 153 GLY GLY E . n 
E 2 154 GLY 154 154 154 GLY GLY E . n 
E 2 155 ALA 155 155 155 ALA ALA E . n 
E 2 156 SER 156 156 156 SER SER E . n 
E 2 157 VAL 157 157 157 VAL VAL E . n 
E 2 158 VAL 158 158 158 VAL VAL E . n 
E 2 159 CYS 159 159 159 CYS CYS E . n 
E 2 160 PHE 160 160 160 PHE PHE E . n 
E 2 161 LEU 161 161 161 LEU LEU E . n 
E 2 162 ASN 162 162 162 ASN ASN E . n 
E 2 163 ASN 163 163 163 ASN ASN E . n 
E 2 164 PHE 164 164 164 PHE PHE E . n 
E 2 165 TYR 165 165 165 TYR TYR E . n 
E 2 166 PRO 166 166 166 PRO PRO E . n 
E 2 167 LYS 167 167 167 LYS LYS E . n 
E 2 168 ASP 168 168 168 ASP ASP E . n 
E 2 169 ILE 169 169 169 ILE ILE E . n 
E 2 170 ASN 170 170 170 ASN ASN E . n 
E 2 171 VAL 171 171 171 VAL VAL E . n 
E 2 172 LYS 172 172 172 LYS LYS E . n 
E 2 173 TRP 173 173 173 TRP TRP E . n 
E 2 174 LYS 174 174 174 LYS LYS E . n 
E 2 175 ILE 175 175 175 ILE ILE E . n 
E 2 176 ASP 176 176 176 ASP ASP E . n 
E 2 177 GLY 177 177 177 GLY GLY E . n 
E 2 178 SER 178 178 178 SER SER E . n 
E 2 179 GLU 179 179 179 GLU GLU E . n 
E 2 180 ARG 180 180 180 ARG ARG E . n 
E 2 181 GLN 181 181 181 GLN GLN E . n 
E 2 182 ASN 182 182 182 ASN ASN E . n 
E 2 183 GLY 183 183 183 GLY GLY E . n 
E 2 184 VAL 184 184 184 VAL VAL E . n 
E 2 185 LEU 185 185 185 LEU LEU E . n 
E 2 186 ASN 186 186 186 ASN ASN E . n 
E 2 187 SER 187 187 187 SER SER E . n 
E 2 188 TRP 188 188 188 TRP TRP E . n 
E 2 189 THR 189 189 189 THR THR E . n 
E 2 190 ASP 190 190 190 ASP ASP E . n 
E 2 191 GLN 191 191 191 GLN GLN E . n 
E 2 192 ASP 192 192 192 ASP ASP E . n 
E 2 193 SER 193 193 193 SER SER E . n 
E 2 194 LYS 194 194 194 LYS LYS E . n 
E 2 195 ASP 195 195 195 ASP ASP E . n 
E 2 196 SER 196 196 196 SER SER E . n 
E 2 197 THR 197 197 197 THR THR E . n 
E 2 198 TYR 198 198 198 TYR TYR E . n 
E 2 199 SER 199 199 199 SER SER E . n 
E 2 200 MET 200 200 200 MET MET E . n 
E 2 201 SER 201 201 201 SER SER E . n 
E 2 202 SER 202 202 202 SER SER E . n 
E 2 203 THR 203 203 203 THR THR E . n 
E 2 204 LEU 204 204 204 LEU LEU E . n 
E 2 205 THR 205 205 205 THR THR E . n 
E 2 206 LEU 206 206 206 LEU LEU E . n 
E 2 207 THR 207 207 207 THR THR E . n 
E 2 208 LYS 208 208 208 LYS LYS E . n 
E 2 209 ASP 209 209 209 ASP ASP E . n 
E 2 210 GLU 210 210 210 GLU GLU E . n 
E 2 211 TYR 211 211 211 TYR TYR E . n 
E 2 212 GLU 212 212 212 GLU GLU E . n 
E 2 213 ARG 213 213 213 ARG ARG E . n 
E 2 214 HIS 214 214 214 HIS HIS E . n 
E 2 215 ASN 215 215 215 ASN ASN E . n 
E 2 216 SER 216 216 216 SER SER E . n 
E 2 217 TYR 217 217 217 TYR TYR E . n 
E 2 218 THR 218 218 218 THR THR E . n 
E 2 219 CYS 219 219 219 CYS CYS E . n 
E 2 220 GLU 220 220 220 GLU GLU E . n 
E 2 221 ALA 221 221 221 ALA ALA E . n 
E 2 222 THR 222 222 222 THR THR E . n 
E 2 223 HIS 223 223 223 HIS HIS E . n 
E 2 224 LYS 224 224 224 LYS LYS E . n 
E 2 225 THR 225 225 225 THR THR E . n 
E 2 226 SER 226 226 226 SER SER E . n 
E 2 227 THR 227 227 227 THR THR E . n 
E 2 228 SER 228 228 228 SER SER E . n 
E 2 229 PRO 229 229 229 PRO PRO E . n 
E 2 230 ILE 230 230 230 ILE ILE E . n 
E 2 231 VAL 231 231 231 VAL VAL E . n 
E 2 232 LYS 232 232 232 LYS LYS E . n 
E 2 233 SER 233 233 233 SER SER E . n 
E 2 234 PHE 234 234 234 PHE PHE E . n 
E 2 235 ASN 235 235 235 ASN ASN E . n 
E 2 236 ARG 236 236 236 ARG ARG E . n 
E 2 237 ASN 237 237 237 ASN ASN E . n 
E 2 238 GLU 238 238 238 GLU GLU E . n 
E 2 239 CYS 239 239 239 CYS CYS E . n 
F 3 1   GLU 1   1   1   GLU GLU F . n 
F 3 2   VAL 2   2   2   VAL VAL F . n 
F 3 3   GLN 3   3   3   GLN GLN F . n 
F 3 4   LEU 4   4   4   LEU LEU F . n 
F 3 5   VAL 5   5   5   VAL VAL F . n 
F 3 6   GLU 6   6   6   GLU GLU F . n 
F 3 7   SER 7   7   7   SER SER F . n 
F 3 8   GLY 8   8   8   GLY GLY F . n 
F 3 9   GLY 9   9   9   GLY GLY F . n 
F 3 10  GLY 10  10  10  GLY GLY F . n 
F 3 11  LEU 11  11  11  LEU LEU F . n 
F 3 12  VAL 12  12  12  VAL VAL F . n 
F 3 13  LYS 13  13  13  LYS LYS F . n 
F 3 14  PRO 14  14  14  PRO PRO F . n 
F 3 15  GLY 15  15  15  GLY GLY F . n 
F 3 16  GLY 16  16  16  GLY GLY F . n 
F 3 17  SER 17  17  17  SER SER F . n 
F 3 18  LEU 18  18  18  LEU LEU F . n 
F 3 19  LYS 19  19  19  LYS LYS F . n 
F 3 20  LEU 20  20  20  LEU LEU F . n 
F 3 21  SER 21  21  21  SER SER F . n 
F 3 22  CYS 22  22  22  CYS CYS F . n 
F 3 23  ALA 23  23  23  ALA ALA F . n 
F 3 24  ALA 24  24  24  ALA ALA F . n 
F 3 25  SER 25  25  25  SER SER F . n 
F 3 26  GLY 26  26  26  GLY GLY F . n 
F 3 27  PHE 27  27  27  PHE PHE F . n 
F 3 28  ALA 28  28  28  ALA ALA F . n 
F 3 29  PHE 29  29  29  PHE PHE F . n 
F 3 30  SER 30  30  30  SER SER F . n 
F 3 31  SER 31  31  31  SER SER F . n 
F 3 32  TYR 32  32  32  TYR TYR F . n 
F 3 33  ASP 33  33  33  ASP ASP F . n 
F 3 34  MET 34  34  34  MET MET F . n 
F 3 35  SER 35  35  35  SER SER F . n 
F 3 36  TRP 36  36  36  TRP TRP F . n 
F 3 37  VAL 37  37  37  VAL VAL F . n 
F 3 38  ARG 38  38  38  ARG ARG F . n 
F 3 39  GLN 39  39  39  GLN GLN F . n 
F 3 40  THR 40  40  40  THR THR F . n 
F 3 41  PRO 41  41  41  PRO PRO F . n 
F 3 42  GLU 42  42  42  GLU GLU F . n 
F 3 43  LYS 43  43  43  LYS LYS F . n 
F 3 44  ARG 44  44  44  ARG ARG F . n 
F 3 45  LEU 45  45  45  LEU LEU F . n 
F 3 46  GLU 46  46  46  GLU GLU F . n 
F 3 47  TRP 47  47  47  TRP TRP F . n 
F 3 48  VAL 48  48  48  VAL VAL F . n 
F 3 49  ALA 49  49  49  ALA ALA F . n 
F 3 50  TYR 50  50  50  TYR TYR F . n 
F 3 51  ILE 51  51  51  ILE ILE F . n 
F 3 52  SER 52  52  52  SER SER F . n 
F 3 53  SER 53  53  53  SER SER F . n 
F 3 54  GLY 54  54  54  GLY GLY F . n 
F 3 55  GLY 55  55  55  GLY GLY F . n 
F 3 56  GLY 56  56  56  GLY GLY F . n 
F 3 57  SER 57  57  57  SER SER F . n 
F 3 58  THR 58  58  58  THR THR F . n 
F 3 59  TYR 59  59  59  TYR TYR F . n 
F 3 60  TYR 60  60  60  TYR TYR F . n 
F 3 61  PRO 61  61  61  PRO PRO F . n 
F 3 62  ASP 62  62  62  ASP ASP F . n 
F 3 63  THR 63  63  63  THR THR F . n 
F 3 64  VAL 64  64  64  VAL VAL F . n 
F 3 65  LYS 65  65  65  LYS LYS F . n 
F 3 66  GLY 66  66  66  GLY GLY F . n 
F 3 67  ARG 67  67  67  ARG ARG F . n 
F 3 68  PHE 68  68  68  PHE PHE F . n 
F 3 69  THR 69  69  69  THR THR F . n 
F 3 70  ILE 70  70  70  ILE ILE F . n 
F 3 71  SER 71  71  71  SER SER F . n 
F 3 72  ARG 72  72  72  ARG ARG F . n 
F 3 73  ASP 73  73  73  ASP ASP F . n 
F 3 74  ASN 74  74  74  ASN ASN F . n 
F 3 75  ALA 75  75  75  ALA ALA F . n 
F 3 76  LYS 76  76  76  LYS LYS F . n 
F 3 77  ASN 77  77  77  ASN ASN F . n 
F 3 78  THR 78  78  78  THR THR F . n 
F 3 79  LEU 79  79  79  LEU LEU F . n 
F 3 80  TYR 80  80  80  TYR TYR F . n 
F 3 81  LEU 81  81  81  LEU LEU F . n 
F 3 82  GLN 82  82  82  GLN GLN F . n 
F 3 83  MET 83  83  83  MET MET F . n 
F 3 84  SER 84  84  84  SER SER F . n 
F 3 85  SER 85  85  85  SER SER F . n 
F 3 86  LEU 86  86  86  LEU LEU F . n 
F 3 87  LYS 87  87  87  LYS LYS F . n 
F 3 88  SER 88  88  88  SER SER F . n 
F 3 89  GLU 89  89  89  GLU GLU F . n 
F 3 90  ASP 90  90  90  ASP ASP F . n 
F 3 91  THR 91  91  91  THR THR F . n 
F 3 92  ALA 92  92  92  ALA ALA F . n 
F 3 93  MET 93  93  93  MET MET F . n 
F 3 94  TYR 94  94  94  TYR TYR F . n 
F 3 95  TYR 95  95  95  TYR TYR F . n 
F 3 96  CYS 96  96  96  CYS CYS F . n 
F 3 97  ALA 97  97  97  ALA ALA F . n 
F 3 98  ARG 98  98  98  ARG ARG F . n 
F 3 99  PRO 99  99  99  PRO PRO F . n 
F 3 100 ASP 100 100 100 ASP ASP F . n 
F 3 101 TYR 101 101 101 TYR TYR F . n 
F 3 102 ARG 102 102 102 ARG ARG F . n 
F 3 103 SER 103 103 103 SER SER F . n 
F 3 104 TYR 104 104 104 TYR TYR F . n 
F 3 105 ALA 105 105 105 ALA ALA F . n 
F 3 106 MET 106 106 106 MET MET F . n 
F 3 107 ASP 107 107 107 ASP ASP F . n 
F 3 108 TYR 108 108 108 TYR TYR F . n 
F 3 109 TRP 109 109 109 TRP TRP F . n 
F 3 110 GLY 110 110 110 GLY GLY F . n 
F 3 111 GLN 111 111 111 GLN GLN F . n 
F 3 112 GLY 112 112 112 GLY GLY F . n 
F 3 113 THR 113 113 113 THR THR F . n 
F 3 114 SER 114 114 114 SER SER F . n 
F 3 115 VAL 115 115 115 VAL VAL F . n 
F 3 116 THR 116 116 116 THR THR F . n 
F 3 117 VAL 117 117 117 VAL VAL F . n 
F 3 118 SER 118 118 118 SER SER F . n 
F 3 119 SER 119 119 119 SER SER F . n 
F 3 120 ALA 120 120 ?   ?   ?   F . n 
F 3 121 LYS 121 121 121 LYS LYS F . n 
F 3 122 THR 122 122 122 THR THR F . n 
F 3 123 THR 123 123 123 THR THR F . n 
F 3 124 ALA 124 124 124 ALA ALA F . n 
F 3 125 PRO 125 125 125 PRO PRO F . n 
F 3 126 SER 126 126 126 SER SER F . n 
F 3 127 VAL 127 127 127 VAL VAL F . n 
F 3 128 TYR 128 128 128 TYR TYR F . n 
F 3 129 PRO 129 129 129 PRO PRO F . n 
F 3 130 LEU 130 130 130 LEU LEU F . n 
F 3 131 ALA 131 131 131 ALA ALA F . n 
F 3 132 PRO 132 132 132 PRO PRO F . n 
F 3 133 VAL 133 133 133 VAL VAL F . n 
F 3 134 CYS 134 134 134 CYS CYS F . n 
F 3 135 GLY 135 135 135 GLY GLY F . n 
F 3 136 ASP 136 136 136 ASP ASP F . n 
F 3 137 THR 137 137 137 THR THR F . n 
F 3 138 THR 138 138 138 THR THR F . n 
F 3 139 GLY 139 139 139 GLY GLY F . n 
F 3 140 SER 140 140 140 SER SER F . n 
F 3 141 SER 141 141 141 SER SER F . n 
F 3 142 VAL 142 142 142 VAL VAL F . n 
F 3 143 THR 143 143 143 THR THR F . n 
F 3 144 LEU 144 144 144 LEU LEU F . n 
F 3 145 GLY 145 145 145 GLY GLY F . n 
F 3 146 CYS 146 146 146 CYS CYS F . n 
F 3 147 LEU 147 147 147 LEU LEU F . n 
F 3 148 VAL 148 148 148 VAL VAL F . n 
F 3 149 LYS 149 149 149 LYS LYS F . n 
F 3 150 GLY 150 150 150 GLY GLY F . n 
F 3 151 TYR 151 151 151 TYR TYR F . n 
F 3 152 PHE 152 152 152 PHE PHE F . n 
F 3 153 PRO 153 153 153 PRO PRO F . n 
F 3 154 GLU 154 154 154 GLU GLU F . n 
F 3 155 PRO 155 155 155 PRO PRO F . n 
F 3 156 VAL 156 156 156 VAL VAL F . n 
F 3 157 THR 157 157 157 THR THR F . n 
F 3 158 LEU 158 158 158 LEU LEU F . n 
F 3 159 THR 159 159 159 THR THR F . n 
F 3 160 TRP 160 160 160 TRP TRP F . n 
F 3 161 ASN 161 161 161 ASN ASN F . n 
F 3 162 SER 162 162 162 SER SER F . n 
F 3 163 GLY 163 163 163 GLY GLY F . n 
F 3 164 SER 164 164 164 SER SER F . n 
F 3 165 LEU 165 165 165 LEU LEU F . n 
F 3 166 SER 166 166 166 SER SER F . n 
F 3 167 SER 167 167 167 SER SER F . n 
F 3 168 GLY 168 168 168 GLY GLY F . n 
F 3 169 VAL 169 169 169 VAL VAL F . n 
F 3 170 HIS 170 170 170 HIS HIS F . n 
F 3 171 THR 171 171 171 THR THR F . n 
F 3 172 PHE 172 172 172 PHE PHE F . n 
F 3 173 PRO 173 173 173 PRO PRO F . n 
F 3 174 ALA 174 174 174 ALA ALA F . n 
F 3 175 VAL 175 175 175 VAL VAL F . n 
F 3 176 LEU 176 176 176 LEU LEU F . n 
F 3 177 GLN 177 177 177 GLN GLN F . n 
F 3 178 SER 178 178 178 SER SER F . n 
F 3 179 ASP 179 179 179 ASP ASP F . n 
F 3 180 LEU 180 180 180 LEU LEU F . n 
F 3 181 TYR 181 181 181 TYR TYR F . n 
F 3 182 THR 182 182 182 THR THR F . n 
F 3 183 LEU 183 183 183 LEU LEU F . n 
F 3 184 SER 184 184 184 SER SER F . n 
F 3 185 SER 185 185 185 SER SER F . n 
F 3 186 SER 186 186 186 SER SER F . n 
F 3 187 VAL 187 187 187 VAL VAL F . n 
F 3 188 THR 188 188 188 THR THR F . n 
F 3 189 VAL 189 189 189 VAL VAL F . n 
F 3 190 THR 190 190 190 THR THR F . n 
F 3 191 SER 191 191 191 SER SER F . n 
F 3 192 SER 192 192 192 SER SER F . n 
F 3 193 THR 193 193 193 THR THR F . n 
F 3 194 TRP 194 194 194 TRP TRP F . n 
F 3 195 PRO 195 195 195 PRO PRO F . n 
F 3 196 SER 196 196 196 SER SER F . n 
F 3 197 GLN 197 197 197 GLN GLN F . n 
F 3 198 SER 198 198 198 SER SER F . n 
F 3 199 ILE 199 199 199 ILE ILE F . n 
F 3 200 THR 200 200 200 THR THR F . n 
F 3 201 CYS 201 201 201 CYS CYS F . n 
F 3 202 ASN 202 202 202 ASN ASN F . n 
F 3 203 VAL 203 203 203 VAL VAL F . n 
F 3 204 ALA 204 204 204 ALA ALA F . n 
F 3 205 HIS 205 205 205 HIS HIS F . n 
F 3 206 PRO 206 206 206 PRO PRO F . n 
F 3 207 ALA 207 207 207 ALA ALA F . n 
F 3 208 SER 208 208 208 SER SER F . n 
F 3 209 SER 209 209 209 SER SER F . n 
F 3 210 THR 210 210 210 THR THR F . n 
F 3 211 LYS 211 211 211 LYS LYS F . n 
F 3 212 VAL 212 212 212 VAL VAL F . n 
F 3 213 ASP 213 213 213 ASP ASP F . n 
F 3 214 LYS 214 214 214 LYS LYS F . n 
F 3 215 LYS 215 215 215 LYS LYS F . n 
F 3 216 ILE 216 216 ?   ?   ?   F . n 
F 3 217 GLU 217 217 ?   ?   ?   F . n 
F 3 218 PRO 218 218 ?   ?   ?   F . n 
F 3 219 ARG 219 219 ?   ?   ?   F . n 
F 3 220 GLY 220 220 ?   ?   ?   F . n 
F 3 221 PRO 221 221 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 UQ1 1 177 1 UQ1 UQ1 A . 
H 4 UQ1 1 177 1 UQ1 UQ1 D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G 
2 1 D,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-04-14 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2         
2 3 'Structure model' struct_ref_seq_dif 
3 3 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_struct_ref_seq_dif.details'         
4 3 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 3 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 3 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC     refinement        5.5.0044 ? 1 
MACSCIENCE 'data collection' .        ? 2 
HKL-2000   'data reduction'  .        ? 3 
HKL-2000   'data scaling'    .        ? 4 
PHASER     phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ B LYS 44 ? ? OD1 B ASP 96 ? ? 1.85 
2 1 O  C ALA 28 ? ? OG  C SER 31 ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA C CYS 134 ? ? CB C CYS 134 ? ? SG C CYS 134 ? ? 120.85 114.20 6.65   1.10 N 
2 1 C  C TRP 194 ? ? N  C PRO 195 ? ? CD C PRO 195 ? ? 115.68 128.40 -12.72 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ALA A 14  ? ? -56.01  7.63    
2   1 TRP A 15  ? ? -126.46 -59.68  
3   1 ALA A 24  ? ? -78.77  27.97   
4   1 LEU A 25  ? ? -150.08 -56.34  
5   1 VAL A 35  ? ? -99.26  -61.86  
6   1 LEU A 37  ? ? -25.90  100.17  
7   1 LEU A 38  ? ? 55.04   77.85   
8   1 PRO A 40  ? ? -36.59  165.12  
9   1 SER A 41  ? ? -138.44 -62.15  
10  1 VAL A 42  ? ? 55.92   -126.82 
11  1 LEU A 55  ? ? -42.55  -77.13  
12  1 ALA A 62  ? ? -88.12  -89.65  
13  1 ALA A 64  ? ? 49.23   74.01   
14  1 PRO A 65  ? ? -31.92  -78.57  
15  1 LYS A 66  ? ? -126.73 -54.96  
16  1 THR A 67  ? ? -166.12 -24.18  
17  1 TYR A 79  ? ? -61.48  -71.34  
18  1 LEU A 94  ? ? -62.17  12.03   
19  1 LEU A 96  ? ? -66.29  9.05    
20  1 TYR A 97  ? ? 177.45  73.40   
21  1 PRO A 100 ? ? -34.05  -18.86  
22  1 ALA A 102 ? ? 55.39   -155.17 
23  1 THR A 103 ? ? -175.15 -60.25  
24  1 CYS A 104 ? ? 76.63   60.98   
25  1 PHE A 106 ? ? -142.63 -106.75 
26  1 MET A 107 ? ? 48.32   -166.70 
27  1 LEU A 116 ? ? -68.88  -75.65  
28  1 TRP A 119 ? ? -61.45  9.43    
29  1 VAL A 123 ? ? -143.19 -6.30   
30  1 SER A 127 ? ? -114.13 65.06   
31  1 CYS A 130 ? ? 61.16   85.32   
32  1 TRP A 135 ? ? -92.38  43.52   
33  1 LEU A 138 ? ? 77.33   33.07   
34  1 TRP A 145 ? ? -58.59  -74.35  
35  1 LEU A 146 ? ? -35.70  -36.37  
36  1 VAL A 156 ? ? -70.09  -91.63  
37  1 ALA A 157 ? ? -7.49   -71.73  
38  1 VAL A 158 ? ? -73.87  -79.75  
39  1 VAL A 161 ? ? -134.22 -80.37  
40  1 ALA B 35  ? ? -55.06  93.34   
41  1 THR B 54  ? ? 62.23   126.28  
42  1 ARG B 55  ? ? -54.72  101.82  
43  1 LEU B 73  ? ? -128.35 -51.99  
44  1 TRP B 76  ? ? 55.54   -44.45  
45  1 ALA B 77  ? ? 158.96  -35.34  
46  1 SER B 82  ? ? -25.14  101.79  
47  1 ASP B 86  ? ? -38.16  -26.94  
48  1 SER B 93  ? ? 175.61  135.05  
49  1 VAL B 104 ? ? -53.71  100.92  
50  1 LEU B 120 ? ? 63.56   -170.25 
51  1 THR B 139 ? ? -115.68 76.32   
52  1 SER B 141 ? ? -169.13 115.57  
53  1 PRO B 145 ? ? -46.82  162.38  
54  1 SER B 147 ? ? -24.92  -59.51  
55  1 LEU B 161 ? ? -119.82 74.37   
56  1 TYR B 165 ? ? -174.10 131.66  
57  1 ASP B 176 ? ? 50.10   -25.01  
58  1 GLN B 181 ? ? -131.18 -41.05  
59  1 ASN B 182 ? ? -47.72  101.05  
60  1 SER B 187 ? ? -170.47 125.63  
61  1 GLN B 191 ? ? -20.32  129.87  
62  1 TYR B 198 ? ? -51.60  177.20  
63  1 HIS B 214 ? ? -119.38 -167.85 
64  1 ASN B 215 ? ? -121.76 -61.52  
65  1 THR B 222 ? ? -153.47 -0.50   
66  1 HIS B 223 ? ? -33.42  130.46  
67  1 LYS B 224 ? ? -77.26  48.54   
68  1 THR B 227 ? ? -73.91  45.33   
69  1 PRO B 229 ? ? -59.02  95.11   
70  1 ARG B 236 ? ? -35.41  -92.41  
71  1 ASN B 237 ? ? 11.88   -69.50  
72  1 LEU C 18  ? ? 163.74  136.54  
73  1 ALA C 28  ? ? -59.32  77.79   
74  1 LYS C 43  ? ? 83.80   1.76    
75  1 ASN C 77  ? ? 59.17   8.17    
76  1 SER C 84  ? ? -120.27 -144.29 
77  1 SER C 85  ? ? -12.01  67.74   
78  1 THR C 91  ? ? -44.76  100.98  
79  1 MET C 106 ? ? -58.93  106.01  
80  1 GLN C 111 ? ? -157.26 -18.34  
81  1 PRO C 132 ? ? -68.47  -179.84 
82  1 VAL C 133 ? ? -38.70  124.96  
83  1 THR C 137 ? ? -27.22  88.58   
84  1 SER C 140 ? ? -143.67 -52.56  
85  1 SER C 178 ? ? 57.45   -101.37 
86  1 ASP C 179 ? ? -162.11 38.52   
87  1 VAL C 189 ? ? 178.13  149.39  
88  1 TRP C 194 ? ? -79.37  -144.29 
89  1 PRO C 195 ? ? -11.90  -54.94  
90  1 ALA C 207 ? ? -62.23  4.82    
91  1 SER C 208 ? ? -143.36 -5.29   
92  1 SER C 209 ? ? 55.46   95.45   
93  1 LYS C 211 ? ? -111.43 59.98   
94  1 PRO C 218 ? ? -59.38  -157.80 
95  1 ARG D 12  ? ? 7.89    -63.94  
96  1 MET D 18  ? ? -66.90  -70.89  
97  1 ALA D 19  ? ? -38.69  -33.41  
98  1 HIS D 34  ? ? -120.85 -62.34  
99  1 LEU D 37  ? ? 54.71   82.95   
100 1 LEU D 38  ? ? 63.30   96.02   
101 1 SER D 41  ? ? -160.34 -44.38  
102 1 VAL D 42  ? ? 29.63   -128.33 
103 1 CYS D 44  ? ? -39.82  -22.83  
104 1 PHE D 52  ? ? -56.29  -5.08   
105 1 LEU D 55  ? ? -68.22  -81.25  
106 1 ALA D 57  ? ? -29.84  -70.63  
107 1 ILE D 63  ? ? -56.94  96.91   
108 1 ALA D 64  ? ? 70.69   64.19   
109 1 PRO D 65  ? ? -19.67  -52.29  
110 1 THR D 67  ? ? -156.06 -36.25  
111 1 ILE D 76  ? ? -63.09  15.32   
112 1 TYR D 97  ? ? -144.85 56.73   
113 1 PRO D 100 ? ? -66.62  7.10    
114 1 ALA D 102 ? ? 68.12   159.06  
115 1 THR D 103 ? ? -143.62 -65.67  
116 1 MET D 107 ? ? 143.06  -165.75 
117 1 LEU D 116 ? ? -87.11  -77.19  
118 1 PRO D 121 ? ? -82.36  -87.25  
119 1 PHE D 124 ? ? -108.77 72.19   
120 1 CYS D 130 ? ? 77.83   61.65   
121 1 LEU D 138 ? ? 45.15   29.36   
122 1 VAL D 156 ? ? -61.95  18.86   
123 1 ALA D 157 ? ? -114.20 -90.64  
124 1 VAL D 160 ? ? -126.61 -93.70  
125 1 GLU E 37  ? ? -79.60  -162.35 
126 1 ARG E 55  ? ? -44.84  98.65   
127 1 ASN E 57  ? ? -174.28 68.97   
128 1 TYR E 58  ? ? 88.56   34.54   
129 1 PRO E 66  ? ? -48.16  150.21  
130 1 ALA E 77  ? ? 64.19   -41.23  
131 1 SER E 78  ? ? -92.14  -79.50  
132 1 PRO E 85  ? ? -40.62  156.43  
133 1 THR E 89  ? ? -162.35 90.30   
134 1 ASP E 96  ? ? -157.92 76.34   
135 1 SER E 103 ? ? 52.32   18.31   
136 1 VAL E 104 ? ? -19.42  101.18  
137 1 GLU E 107 ? ? -88.37  46.10   
138 1 ALA E 110 ? ? 179.40  171.52  
139 1 LEU E 120 ? ? 57.52   -157.45 
140 1 SER E 147 ? ? -19.30  -56.18  
141 1 ASN E 163 ? ? 53.00   77.41   
142 1 ASP E 168 ? ? -55.18  93.04   
143 1 ASP E 176 ? ? 20.79   92.67   
144 1 GLU E 179 ? ? -113.51 79.94   
145 1 GLN E 191 ? ? -29.15  142.41  
146 1 LYS E 208 ? ? -27.89  -59.23  
147 1 ASN E 215 ? ? -121.38 -54.81  
148 1 THR E 222 ? ? -155.51 40.91   
149 1 LYS E 232 ? ? -165.54 98.79   
150 1 ARG E 236 ? ? -40.11  -73.63  
151 1 ASN E 237 ? ? 9.77    -77.28  
152 1 PRO F 14  ? ? -50.47  102.01  
153 1 LYS F 19  ? ? -102.07 79.19   
154 1 ALA F 28  ? ? -67.98  23.08   
155 1 PHE F 29  ? ? 29.86   -88.29  
156 1 SER F 30  ? ? -43.12  -19.37  
157 1 SER F 31  ? ? -45.96  -71.45  
158 1 SER F 52  ? ? -67.37  -169.51 
159 1 LYS F 65  ? ? -47.69  100.01  
160 1 ARG F 67  ? ? -147.54 -5.23   
161 1 ASN F 74  ? ? -43.83  -18.58  
162 1 ALA F 75  ? ? -80.86  -72.87  
163 1 SER F 85  ? ? 39.70   64.94   
164 1 ALA F 92  ? ? 167.06  160.82  
165 1 TYR F 101 ? ? -14.40  -64.43  
166 1 TYR F 104 ? ? 62.54   -6.84   
167 1 MET F 106 ? ? -62.59  91.51   
168 1 THR F 122 ? ? -34.84  127.22  
169 1 PRO F 132 ? ? -64.02  -149.98 
170 1 CYS F 134 ? ? -26.89  -54.96  
171 1 THR F 137 ? ? -154.62 30.50   
172 1 THR F 138 ? ? -33.09  89.93   
173 1 SER F 140 ? ? -161.39 -46.07  
174 1 CYS F 146 ? ? -162.96 115.41  
175 1 PHE F 152 ? ? -170.55 140.33  
176 1 PRO F 153 ? ? -105.00 -165.22 
177 1 PRO F 155 ? ? -101.73 -152.70 
178 1 SER F 162 ? ? 63.66   -25.24  
179 1 SER F 166 ? ? -145.07 -62.97  
180 1 SER F 167 ? ? -35.02  87.77   
181 1 SER F 178 ? ? 44.71   -126.09 
182 1 TRP F 194 ? ? -86.73  -142.80 
183 1 PRO F 195 ? ? 19.01   -77.25  
184 1 SER F 196 ? ? -31.56  -87.97  
185 1 SER F 209 ? ? 85.98   68.19   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 TRP C 194 ? ? PRO C 195 ? ? -136.66 
2 1 ASN E 57  ? ? TYR E 58  ? ? 49.02   
3 1 TRP F 194 ? ? PRO F 195 ? ? -138.66 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A LEU 2   ? A LEU 2   
3   1 Y 1 A ARG 3   ? A ARG 3   
4   1 Y 1 A PHE 4   ? A PHE 4   
5   1 Y 1 A LEU 5   ? A LEU 5   
6   1 Y 1 A ASN 6   ? A ASN 6   
7   1 Y 1 A GLN 7   ? A GLN 7   
8   1 Y 1 A ALA 8   ? A ALA 8   
9   1 Y 1 A SER 9   ? A SER 9   
10  1 Y 1 A ARG 109 ? A ARG 109 
11  1 Y 1 A PHE 110 ? A PHE 110 
12  1 Y 1 A PRO 111 ? A PRO 111 
13  1 Y 1 A GLU 112 ? A GLU 112 
14  1 Y 1 A TRP 113 ? A TRP 113 
15  1 Y 1 A SER 163 ? A SER 163 
16  1 Y 1 A GLN 164 ? A GLN 164 
17  1 Y 1 A PRO 165 ? A PRO 165 
18  1 Y 1 A PHE 166 ? A PHE 166 
19  1 Y 1 A LYS 167 ? A LYS 167 
20  1 Y 1 A ALA 168 ? A ALA 168 
21  1 Y 1 A LYS 169 ? A LYS 169 
22  1 Y 1 A LYS 170 ? A LYS 170 
23  1 Y 1 A ARG 171 ? A ARG 171 
24  1 Y 1 A ASP 172 ? A ASP 172 
25  1 Y 1 A LEU 173 ? A LEU 173 
26  1 Y 1 A PHE 174 ? A PHE 174 
27  1 Y 1 A GLY 175 ? A GLY 175 
28  1 Y 1 A ARG 176 ? A ARG 176 
29  1 Y 1 B MET 1   ? B MET 1   
30  1 Y 1 B ASP 2   ? B ASP 2   
31  1 Y 1 B SER 3   ? B SER 3   
32  1 Y 1 B GLN 4   ? B GLN 4   
33  1 Y 1 B ALA 5   ? B ALA 5   
34  1 Y 1 B GLN 6   ? B GLN 6   
35  1 Y 1 B VAL 7   ? B VAL 7   
36  1 Y 1 B LEU 8   ? B LEU 8   
37  1 Y 1 B ILE 9   ? B ILE 9   
38  1 Y 1 B LEU 10  ? B LEU 10  
39  1 Y 1 B LEU 11  ? B LEU 11  
40  1 Y 1 B LEU 12  ? B LEU 12  
41  1 Y 1 B LEU 13  ? B LEU 13  
42  1 Y 1 B TRP 14  ? B TRP 14  
43  1 Y 1 B VAL 15  ? B VAL 15  
44  1 Y 1 B SER 16  ? B SER 16  
45  1 Y 1 B GLY 17  ? B GLY 17  
46  1 Y 1 B THR 18  ? B THR 18  
47  1 Y 1 B CYS 19  ? B CYS 19  
48  1 Y 1 B GLY 20  ? B GLY 20  
49  1 Y 1 B ARG 133 ? B ARG 133 
50  1 Y 1 C TYR 101 ? C TYR 101 
51  1 Y 1 C ARG 102 ? C ARG 102 
52  1 Y 1 C SER 103 ? C SER 103 
53  1 Y 1 C TYR 104 ? C TYR 104 
54  1 Y 1 C ALA 120 ? C ALA 120 
55  1 Y 1 D MET 1   ? D MET 1   
56  1 Y 1 D LEU 2   ? D LEU 2   
57  1 Y 1 D ARG 3   ? D ARG 3   
58  1 Y 1 D PHE 4   ? D PHE 4   
59  1 Y 1 D LEU 5   ? D LEU 5   
60  1 Y 1 D ASN 6   ? D ASN 6   
61  1 Y 1 D GLN 7   ? D GLN 7   
62  1 Y 1 D ALA 8   ? D ALA 8   
63  1 Y 1 D SER 9   ? D SER 9   
64  1 Y 1 D ARG 109 ? D ARG 109 
65  1 Y 1 D PHE 110 ? D PHE 110 
66  1 Y 1 D PRO 111 ? D PRO 111 
67  1 Y 1 D GLU 112 ? D GLU 112 
68  1 Y 1 D TRP 113 ? D TRP 113 
69  1 Y 1 D SER 163 ? D SER 163 
70  1 Y 1 D GLN 164 ? D GLN 164 
71  1 Y 1 D PRO 165 ? D PRO 165 
72  1 Y 1 D PHE 166 ? D PHE 166 
73  1 Y 1 D LYS 167 ? D LYS 167 
74  1 Y 1 D ALA 168 ? D ALA 168 
75  1 Y 1 D LYS 169 ? D LYS 169 
76  1 Y 1 D LYS 170 ? D LYS 170 
77  1 Y 1 D ARG 171 ? D ARG 171 
78  1 Y 1 D ASP 172 ? D ASP 172 
79  1 Y 1 D LEU 173 ? D LEU 173 
80  1 Y 1 D PHE 174 ? D PHE 174 
81  1 Y 1 D GLY 175 ? D GLY 175 
82  1 Y 1 D ARG 176 ? D ARG 176 
83  1 Y 1 E MET 1   ? E MET 1   
84  1 Y 1 E ASP 2   ? E ASP 2   
85  1 Y 1 E SER 3   ? E SER 3   
86  1 Y 1 E GLN 4   ? E GLN 4   
87  1 Y 1 E ALA 5   ? E ALA 5   
88  1 Y 1 E GLN 6   ? E GLN 6   
89  1 Y 1 E VAL 7   ? E VAL 7   
90  1 Y 1 E LEU 8   ? E LEU 8   
91  1 Y 1 E ILE 9   ? E ILE 9   
92  1 Y 1 E LEU 10  ? E LEU 10  
93  1 Y 1 E LEU 11  ? E LEU 11  
94  1 Y 1 E LEU 12  ? E LEU 12  
95  1 Y 1 E LEU 13  ? E LEU 13  
96  1 Y 1 E TRP 14  ? E TRP 14  
97  1 Y 1 E VAL 15  ? E VAL 15  
98  1 Y 1 E SER 16  ? E SER 16  
99  1 Y 1 E GLY 17  ? E GLY 17  
100 1 Y 1 E THR 18  ? E THR 18  
101 1 Y 1 E CYS 19  ? E CYS 19  
102 1 Y 1 E GLY 20  ? E GLY 20  
103 1 Y 1 E ARG 133 ? E ARG 133 
104 1 Y 1 F ALA 120 ? F ALA 120 
105 1 Y 1 F ILE 216 ? F ILE 216 
106 1 Y 1 F GLU 217 ? F GLU 217 
107 1 Y 1 F PRO 218 ? F PRO 218 
108 1 Y 1 F ARG 219 ? F ARG 219 
109 1 Y 1 F GLY 220 ? F GLY 220 
110 1 Y 1 F PRO 221 ? F PRO 221 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        UBIQUINONE-1 
_pdbx_entity_nonpoly.comp_id     UQ1 
#